BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c25628_g6_i1 len=474 path=[20398:0-473]

Length=474
                                                                      Score     E

ref|XP_009788755.1|  PREDICTED: cytochrome P450 76A2-like               148   7e-39   
ref|XP_009589554.1|  PREDICTED: cytochrome P450 76A2-like               147   1e-38   
ref|XP_006341182.1|  PREDICTED: cytochrome P450 76A2-like               143   3e-37   
gb|KDP43104.1|  hypothetical protein JCGZ_27053                         136   3e-37   
ref|XP_004246901.1|  PREDICTED: cytochrome P450 76A2-like               142   7e-37   
ref|XP_011094547.1|  PREDICTED: cytochrome P450 76A2-like               140   4e-36   
gb|KDP27487.1|  hypothetical protein JCGZ_20022                         140   6e-36   
ref|XP_002528645.1|  cytochrome P450, putative                          137   4e-35   Ricinus communis
ref|XP_002528652.1|  conserved hypothetical protein                     131   6e-35   Ricinus communis
dbj|BAC53891.1|  cytochrome P450                                        135   2e-34   Petunia x hybrida [garden petunia]
ref|XP_009785656.1|  PREDICTED: cytochrome P450 76A1-like isoform X1    134   5e-34   
ref|XP_002277746.1|  PREDICTED: cytochrome P450 76A1                    134   5e-34   Vitis vinifera
ref|XP_009785657.1|  PREDICTED: cytochrome P450 76A1-like isoform X2    134   5e-34   
ref|XP_004246574.1|  PREDICTED: LOW QUALITY PROTEIN: cytochrome P...    134   8e-34   
ref|XP_006482364.1|  PREDICTED: cytochrome P450 76A2-like               133   1e-33   
gb|KDO61008.1|  hypothetical protein CISIN_1g036305mg                   133   1e-33   
ref|XP_006430324.1|  hypothetical protein CICLE_v10013315mg             133   2e-33   
sp|P37121.1|C76A1_SOLME  RecName: Full=Cytochrome P450 76A1; AltN...    132   4e-33   Solanum melongena [aubergine]
ref|XP_004494132.1|  PREDICTED: cytochrome P450 76A2-like               132   4e-33   
ref|XP_010112510.1|  Cytochrome P450 76A2                               131   9e-33   
ref|XP_009786696.1|  PREDICTED: cytochrome P450 76A1-like               130   1e-32   
ref|XP_009613392.1|  PREDICTED: cytochrome P450 76A2-like               130   1e-32   
ref|XP_006341183.1|  PREDICTED: cytochrome P450 76A1-like               130   1e-32   
ref|XP_002309107.1|  hypothetical protein POPTR_0006s09580g             130   2e-32   Populus trichocarpa [western balsam poplar]
gb|AIW00679.1|  flavonoid 3',5'-hydroxylase                             129   3e-32   
ref|XP_002277595.2|  PREDICTED: cytochrome P450 76A1-like               127   5e-32   Vitis vinifera
ref|XP_004249462.1|  PREDICTED: cytochrome P450 76A2-like               129   5e-32   
ref|XP_004249632.1|  PREDICTED: cytochrome P450 76A2-like               128   7e-32   
ref|XP_006339109.1|  PREDICTED: cytochrome P450 76A2-like               128   7e-32   
ref|XP_009616474.1|  PREDICTED: cytochrome P450 76A1-like               128   8e-32   
ref|XP_004305369.1|  PREDICTED: cytochrome P450 76A2-like               128   9e-32   
ref|XP_009602679.1|  PREDICTED: cytochrome P450 76A2-like               127   1e-31   
gb|KDP43097.1|  hypothetical protein JCGZ_27046                         127   1e-31   
ref|XP_010687564.1|  PREDICTED: cytochrome P450 76C4-like isoform X2    123   2e-31   
ref|XP_010687563.1|  PREDICTED: cytochrome P450 76C4-like isoform X1    124   2e-31   
ref|XP_006339110.1|  PREDICTED: cytochrome P450 76A2-like               127   2e-31   
emb|CBI30225.3|  unnamed protein product                                130   2e-31   
ref|XP_010042416.1|  PREDICTED: cytochrome P450 76A1-like               122   2e-31   
emb|CBI30232.3|  unnamed protein product                                127   2e-31   
ref|XP_011019179.1|  PREDICTED: cytochrome P450 76A2-like               127   2e-31   
emb|CAN76784.1|  hypothetical protein VITISV_028823                     127   3e-31   Vitis vinifera
ref|XP_007204461.1|  hypothetical protein PRUPE_ppa023213mg             126   3e-31   
ref|XP_002283772.1|  PREDICTED: cytochrome P450 76A1                    126   3e-31   Vitis vinifera
ref|XP_004303043.1|  PREDICTED: cytochrome P450 76A2-like               126   3e-31   
gb|KCW84349.1|  hypothetical protein EUGRSUZ_B01199                     124   3e-31   
ref|XP_010036736.1|  PREDICTED: cytochrome P450 76A1-like               126   4e-31   
ref|XP_003520677.1|  PREDICTED: cytochrome P450 76A2-like               126   4e-31   
gb|KHN18720.1|  Cytochrome P450 76A2                                    126   4e-31   
ref|XP_004249463.1|  PREDICTED: cytochrome P450 76A2-like               126   5e-31   
gb|AGT03776.1|  CYP76 hydroxylase                                       125   1e-30   
ref|XP_009757934.1|  PREDICTED: cytochrome P450 76A2-like               125   1e-30   
gb|KCW84345.1|  hypothetical protein EUGRSUZ_B01194                     117   1e-30   
gb|KEH43603.1|  cytochrome P450 family protein                          124   2e-30   
gb|KCW74001.1|  hypothetical protein EUGRSUZ_E02618                     124   2e-30   
ref|XP_002528647.1|  cytochrome P450, putative                          124   2e-30   Ricinus communis
ref|XP_010683910.1|  PREDICTED: cytochrome P450 76A2-like               124   2e-30   
ref|XP_006339111.1|  PREDICTED: cytochrome P450 76A2-like               124   2e-30   
gb|KCW84358.1|  hypothetical protein EUGRSUZ_B012101                    122   3e-30   
ref|XP_010057042.1|  PREDICTED: cytochrome P450 76A2-like               124   3e-30   
ref|XP_010056841.1|  PREDICTED: cytochrome P450 76A1-like               124   3e-30   
gb|KCW84351.1|  hypothetical protein EUGRSUZ_B01202                     121   4e-30   
ref|XP_007027589.1|  Cytochrome P450 76A2                               124   4e-30   
gb|KCW84354.1|  hypothetical protein EUGRSUZ_B01206                     123   4e-30   
ref|XP_006339108.1|  PREDICTED: cytochrome P450 76A2-like               123   5e-30   
gb|KEH24104.1|  cytochrome P450 family protein                          123   5e-30   
ref|XP_002528649.1|  cytochrome P450, putative                          123   6e-30   Ricinus communis
gb|KCW84356.1|  hypothetical protein EUGRSUZ_B01208                     122   6e-30   
ref|XP_010042682.1|  PREDICTED: cytochrome P450 76A2-like               118   6e-30   
emb|CBI30227.3|  unnamed protein product                                120   7e-30   
ref|XP_010676979.1|  PREDICTED: geraniol 8-hydroxylase-like             122   8e-30   
ref|XP_008241318.1|  PREDICTED: cytochrome P450 76A2-like               122   9e-30   
ref|XP_010036221.1|  PREDICTED: cytochrome P450 76A1-like               122   1e-29   
gb|EYU29599.1|  hypothetical protein MIMGU_mgv1a026574mg                121   2e-29   
ref|XP_010045880.1|  PREDICTED: cytochrome P450 76A1-like               121   2e-29   
gb|KCW84348.1|  hypothetical protein EUGRSUZ_B01197                     120   2e-29   
emb|CAN77400.1|  hypothetical protein VITISV_015278                     121   2e-29   Vitis vinifera
ref|XP_007040049.1|  Cytochrome P450, putative                          121   3e-29   
gb|KEH43874.1|  cytochrome P450 family protein                          120   4e-29   
gb|KDP20523.1|  hypothetical protein JCGZ_05069                         120   4e-29   
ref|XP_002277661.2|  PREDICTED: cytochrome P450 76A1-like               120   4e-29   Vitis vinifera
ref|XP_006451465.1|  hypothetical protein CICLE_v10008099mg             120   4e-29   
gb|KDO57775.1|  hypothetical protein CISIN_1g011069mg                   120   5e-29   
ref|XP_006451469.1|  hypothetical protein CICLE_v10008095mg             120   5e-29   
emb|CAN77399.1|  hypothetical protein VITISV_015277                     120   5e-29   Vitis vinifera
emb|CBI34790.3|  unnamed protein product                                119   6e-29   
ref|XP_006853500.1|  hypothetical protein AMTR_s00032p00217210          115   6e-29   
ref|XP_010036187.1|  PREDICTED: cytochrome P450 76A1-like               120   9e-29   
emb|CDP10329.1|  unnamed protein product                                119   9e-29   
ref|XP_002277725.1|  PREDICTED: cytochrome P450 76A1                    119   9e-29   Vitis vinifera
gb|KCW74002.1|  hypothetical protein EUGRSUZ_E02619                     119   1e-28   
gb|KDO43350.1|  hypothetical protein CISIN_1g039984mg                   112   1e-28   
ref|NP_001268152.1|  ripening-related P-450 enzyme-like                 119   1e-28   
ref|XP_010057043.1|  PREDICTED: cytochrome P450 76A1-like               119   1e-28   
ref|XP_010658029.1|  PREDICTED: ripening-related P-450 enzyme-lik...    119   1e-28   
ref|XP_006423671.1|  hypothetical protein CICLE_v10028269mg             119   1e-28   
ref|XP_009763141.1|  PREDICTED: geraniol 8-hydroxylase-like             119   2e-28   
ref|XP_006853505.1|  hypothetical protein AMTR_s00032p00218900          115   2e-28   
ref|XP_010053380.1|  PREDICTED: geraniol 8-hydroxylase-like             119   2e-28   
ref|XP_006339107.1|  PREDICTED: cytochrome P450 76A2-like               119   2e-28   
ref|XP_006494410.1|  PREDICTED: geraniol 8-hydroxylase-like             118   2e-28   
gb|KCW84347.1|  hypothetical protein EUGRSUZ_B011961                    117   2e-28   
ref|XP_010036165.1|  PREDICTED: cytochrome P450 76A1-like               119   2e-28   
gb|KCW77657.1|  hypothetical protein EUGRSUZ_D01955                     118   2e-28   
ref|XP_002509653.1|  cytochrome P450, putative                          118   2e-28   Ricinus communis
ref|XP_010053379.1|  PREDICTED: geraniol 8-hydroxylase-like             118   3e-28   
ref|XP_006494407.1|  PREDICTED: geraniol 8-hydroxylase-like             118   3e-28   
gb|AJD25180.1|  cytochrome P450 CYP76A36                                118   3e-28   
emb|CAN79423.1|  hypothetical protein VITISV_011260                     117   4e-28   Vitis vinifera
gb|KHG25715.1|  7-ethoxycoumarin O-deethylase                           117   4e-28   
ref|XP_002276053.1|  PREDICTED: geraniol 8-hydroxylase-like             117   5e-28   Vitis vinifera
ref|XP_010093536.1|  Cytochrome P450 76C4                               117   5e-28   
gb|KDO53972.1|  hypothetical protein CISIN_1g024901mg                   115   5e-28   
ref|XP_002299579.2|  hypothetical protein POPTR_0001s08320g             117   6e-28   Populus trichocarpa [western balsam poplar]
ref|XP_010036177.1|  PREDICTED: cytochrome P450 76A1-like               117   6e-28   
ref|XP_010036151.1|  PREDICTED: cytochrome P450 76A1-like               117   7e-28   
ref|XP_002528653.1|  cytochrome P450, putative                          117   9e-28   Ricinus communis
gb|KDO36667.1|  hypothetical protein CISIN_1g011040mg                   117   1e-27   
ref|XP_006840610.1|  hypothetical protein AMTR_s00084p00062680          112   1e-27   
ref|XP_006423653.1|  hypothetical protein CICLE_v10028270mg             116   1e-27   
ref|XP_002301305.2|  cytochrome P450 family protein                     116   1e-27   Populus trichocarpa [western balsam poplar]
ref|XP_006487694.1|  PREDICTED: geraniol 8-hydroxylase-like             116   1e-27   
emb|CBI30226.3|  unnamed protein product                                118   1e-27   
sp|P37122.1|C76A2_SOLME  RecName: Full=Cytochrome P450 76A2; AltN...    116   1e-27   Solanum melongena [aubergine]
ref|XP_003631427.1|  PREDICTED: geraniol 8-hydroxylase-like             116   1e-27   
ref|XP_010045882.1|  PREDICTED: cytochrome P450 76A2-like               114   1e-27   
ref|XP_007209932.1|  hypothetical protein PRUPE_ppa004606mg             116   2e-27   
ref|XP_006423676.1|  hypothetical protein CICLE_v10030057mg             116   2e-27   
gb|KCW72821.1|  hypothetical protein EUGRSUZ_E01263                     115   2e-27   
emb|CAN83490.1|  hypothetical protein VITISV_001325                     115   2e-27   Vitis vinifera
ref|XP_002270541.1|  PREDICTED: geraniol 8-hydroxylase                  115   2e-27   Vitis vinifera
ref|XP_011033851.1|  PREDICTED: geraniol 8-hydroxylase-like isofo...    115   2e-27   
ref|XP_006423711.1|  hypothetical protein CICLE_v10028239mg             115   2e-27   
emb|CBI38804.3|  unnamed protein product                                109   2e-27   
ref|XP_006487469.1|  PREDICTED: geraniol 8-hydroxylase-like             115   3e-27   
ref|XP_007162842.1|  hypothetical protein PHAVU_001G185500g             115   3e-27   
ref|XP_004232063.1|  PREDICTED: geraniol 8-hydroxylase-like             115   3e-27   
ref|XP_011029123.1|  PREDICTED: geraniol 8-hydroxylase-like             115   3e-27   
ref|XP_011033850.1|  PREDICTED: geraniol 8-hydroxylase-like isofo...    115   3e-27   
ref|XP_006853508.1|  hypothetical protein AMTR_s00032p00219670          115   3e-27   
ref|XP_010056209.1|  PREDICTED: geraniol 8-hydroxylase-like             115   3e-27   
gb|KDP43102.1|  hypothetical protein JCGZ_27051                         115   3e-27   
gb|KDP43052.1|  hypothetical protein JCGZ_25238                         113   4e-27   
dbj|BAC53892.1|  cytochrome P450                                        115   4e-27   Petunia x hybrida [garden petunia]
emb|CBI30230.3|  unnamed protein product                                115   5e-27   
ref|XP_006853497.1|  hypothetical protein AMTR_s00032p00215290          115   5e-27   
ref|XP_002283777.2|  PREDICTED: cytochrome P450 76A1                    115   5e-27   Vitis vinifera
gb|KHG21745.1|  Cytochrome P450 protein                                 115   5e-27   
ref|XP_006388387.1|  hypothetical protein POPTR_0201s00200g             114   6e-27   
ref|XP_006423677.1|  hypothetical protein CICLE_v10028488mg             114   6e-27   
ref|XP_010053039.1|  PREDICTED: geraniol 8-hydroxylase-like             114   6e-27   
ref|XP_006423661.1|  hypothetical protein CICLE_v10028273mg             114   6e-27   
gb|KDO41057.1|  hypothetical protein CISIN_1g043641mg                   114   7e-27   
ref|XP_002301306.2|  hypothetical protein POPTR_0002s15150g             114   7e-27   Populus trichocarpa [western balsam poplar]
emb|CDP17802.1|  unnamed protein product                                114   7e-27   
ref|XP_010058414.1|  PREDICTED: geraniol 8-hydroxylase-like             114   7e-27   
ref|XP_006477330.1|  PREDICTED: geraniol 8-hydroxylase-like             114   8e-27   
ref|XP_006423672.1|  hypothetical protein CICLE_v10028278mg             114   1e-26   
ref|XP_006423660.1|  hypothetical protein CICLE_v10030225mg             114   1e-26   
gb|AGX93052.1|  geraniol 10-hydroxylase-like protein                    114   1e-26   
gb|KCW45004.1|  hypothetical protein EUGRSUZ_L01403                     112   1e-26   
ref|XP_002322452.2|  hypothetical protein POPTR_0015s13590g             114   1e-26   Populus trichocarpa [western balsam poplar]
emb|CAN66326.1|  hypothetical protein VITISV_000490                     106   1e-26   Vitis vinifera
ref|XP_002301307.2|  cytochrome P450 family protein                     113   1e-26   Populus trichocarpa [western balsam poplar]
ref|XP_002528654.1|  cytochrome P450, putative                          114   1e-26   Ricinus communis
gb|KHN00774.1|  Cytochrome P450 76C4                                    110   2e-26   
ref|XP_011017515.1|  PREDICTED: geraniol 8-hydroxylase-like             113   2e-26   
ref|XP_006487449.1|  PREDICTED: geraniol 8-hydroxylase-like             113   2e-26   
ref|XP_010040684.1|  PREDICTED: geraniol 8-hydroxylase-like             112   2e-26   
ref|XP_006477329.1|  PREDICTED: geraniol 8-hydroxylase-like             113   2e-26   
ref|XP_003589660.1|  Cytochrome P450 monooxygenase                      113   2e-26   
ref|XP_006487435.1|  PREDICTED: geraniol 8-hydroxylase-like             113   2e-26   
ref|XP_006360234.1|  PREDICTED: geraniol 8-hydroxylase-like             113   2e-26   
gb|KCW77280.1|  hypothetical protein EUGRSUZ_D01639                     109   2e-26   
ref|XP_002276094.1|  PREDICTED: geraniol 8-hydroxylase                  113   2e-26   Vitis vinifera
gb|AHX24364.1|  CYP76A26-like protein                                   113   2e-26   
ref|XP_010105779.1|  Cytochrome P450 76C4                               114   2e-26   
ref|XP_006423622.1|  hypothetical protein CICLE_v10028275mg             113   2e-26   
ref|XP_006494536.1|  PREDICTED: geraniol 8-hydroxylase-like             113   2e-26   
ref|XP_006423678.1|  hypothetical protein CICLE_v10028268mg             113   2e-26   
gb|EYU36335.1|  hypothetical protein MIMGU_mgv1a004314mg                113   2e-26   
ref|XP_009774708.1|  PREDICTED: cytochrome P450 76A2-like               113   2e-26   
ref|XP_006477331.1|  PREDICTED: geraniol 8-hydroxylase-like             113   2e-26   
ref|XP_006423673.1|  hypothetical protein CICLE_v10028257mg             113   3e-26   
ref|XP_007143610.1|  hypothetical protein PHAVU_007G086200g             113   3e-26   
gb|ACI90295.1|  cytochrome P450 monoxygenase                            109   3e-26   Picrorhiza kurrooa
ref|XP_004496721.1|  PREDICTED: geraniol 8-hydroxylase-like             113   3e-26   
emb|CDP17803.1|  unnamed protein product                                112   3e-26   
gb|KCW77276.1|  hypothetical protein EUGRSUZ_D01633                     112   3e-26   
ref|XP_002271652.1|  PREDICTED: geraniol 8-hydroxylase                  112   3e-26   Vitis vinifera
ref|XP_002276576.1|  PREDICTED: geraniol 8-hydroxylase                  112   3e-26   Vitis vinifera
ref|XP_006419188.1|  hypothetical protein CICLE_v10030448mg             112   3e-26   
emb|CAN75686.1|  hypothetical protein VITISV_010578                     112   4e-26   Vitis vinifera
gb|EPS67290.1|  hypothetical protein M569_07486                         112   4e-26   
ref|XP_006494538.1|  PREDICTED: geraniol 8-hydroxylase-like             114   4e-26   
gb|KCW47877.1|  hypothetical protein EUGRSUZ_K01623                     112   4e-26   
ref|XP_004233427.1|  PREDICTED: geraniol 8-hydroxylase-like             112   4e-26   
gb|EYU38602.1|  hypothetical protein MIMGU_mgv1a006828mg                111   5e-26   
emb|CDP02457.1|  unnamed protein product                                110   5e-26   
ref|XP_002301302.2|  hypothetical protein POPTR_0002s15110g             111   5e-26   Populus trichocarpa [western balsam poplar]
ref|XP_011041604.1|  PREDICTED: probable (S)-N-methylcoclaurine 3...    112   5e-26   
ref|XP_010038949.1|  PREDICTED: geraniol 8-hydroxylase-like             109   5e-26   
ref|XP_010687566.1|  PREDICTED: geraniol 8-hydroxylase-like             112   5e-26   
ref|XP_006440463.1|  hypothetical protein CICLE_v10019651mg             112   5e-26   
ref|XP_010038981.1|  PREDICTED: cytochrome P450 76A1-like               112   5e-26   
ref|XP_011017516.1|  PREDICTED: geraniol 8-hydroxylase-like             112   6e-26   
ref|XP_010053037.1|  PREDICTED: geraniol 8-hydroxylase-like             112   6e-26   
emb|CBI30229.3|  unnamed protein product                                112   6e-26   
ref|XP_010277464.1|  PREDICTED: geraniol 8-hydroxylase-like             112   6e-26   
ref|XP_006440464.1|  hypothetical protein CICLE_v10019826mg             112   6e-26   
ref|XP_006338232.1|  PREDICTED: geraniol 8-hydroxylase-like             112   6e-26   
ref|XP_010036342.1|  PREDICTED: cytochrome P450 76A1-like               112   6e-26   
gb|AGX93055.1|  geraniol 10-hydroxylase-like protein                    112   6e-26   
ref|XP_002267565.2|  PREDICTED: cytochrome P450 76A2-like               112   7e-26   Vitis vinifera
emb|CAN72997.1|  hypothetical protein VITISV_043956                     104   7e-26   Vitis vinifera
ref|XP_010050611.1|  PREDICTED: geraniol 8-hydroxylase-like             111   7e-26   
emb|CDP17825.1|  unnamed protein product                                111   8e-26   
gb|KHG23791.1|  Cytochrome P450 protein                                 108   8e-26   
ref|XP_009793557.1|  PREDICTED: geraniol 8-hydroxylase-like             111   9e-26   
ref|XP_010667628.1|  PREDICTED: geraniol 8-hydroxylase-like             108   9e-26   
ref|XP_010103208.1|  Cytochrome P450 76C1                               111   9e-26   
ref|XP_006495031.1|  PREDICTED: geraniol 8-hydroxylase-like             111   9e-26   
gb|KCW84353.1|  hypothetical protein EUGRSUZ_B01205                     110   1e-25   
ref|XP_011013817.1|  PREDICTED: geraniol 8-hydroxylase-like             111   1e-25   
ref|XP_006487472.1|  PREDICTED: geraniol 8-hydroxylase-like isofo...    110   1e-25   
gb|KEH43873.1|  cytochrome P450 family protein                          111   1e-25   
gb|KDO61006.1|  hypothetical protein CISIN_1g0379901mg                  107   1e-25   
emb|CAN81641.1|  hypothetical protein VITISV_036425                     110   1e-25   Vitis vinifera
gb|AIO11760.1|  cytochrome p450                                         111   1e-25   
ref|XP_006423714.1|  hypothetical protein CICLE_v10028277mg             111   1e-25   
ref|XP_006341260.1|  PREDICTED: cytochrome P450 76A2-like               111   1e-25   
ref|XP_006487471.1|  PREDICTED: geraniol 8-hydroxylase-like isofo...    111   1e-25   
ref|XP_010661703.1|  PREDICTED: cytochrome P450 76C4-like               110   1e-25   
emb|CBI38806.3|  unnamed protein product                                113   1e-25   
ref|XP_007201998.1|  hypothetical protein PRUPE_ppa022979mg             111   1e-25   
ref|XP_009116769.1|  PREDICTED: cytochrome P450 76C3                    111   1e-25   
ref|XP_006494719.1|  PREDICTED: geraniol 8-hydroxylase-like             110   1e-25   
ref|XP_006360237.1|  PREDICTED: geraniol 8-hydroxylase-like             110   1e-25   
ref|XP_011069673.1|  PREDICTED: ferruginol synthase-like                111   2e-25   
ref|XP_010661589.1|  PREDICTED: geraniol 8-hydroxylase-like             110   2e-25   
ref|XP_003557080.2|  PREDICTED: geraniol 8-hydroxylase-like             110   2e-25   
ref|XP_010045881.1|  PREDICTED: cytochrome P450 76A1-like               110   2e-25   
ref|XP_011074592.1|  PREDICTED: ferruginol synthase-like                110   2e-25   
gb|EPS66524.1|  hypothetical protein M569_08252                         110   2e-25   
gb|AHX24367.1|  CYP76A26-like protein                                   110   2e-25   
ref|XP_010105781.1|  7-ethoxycoumarin O-deethylase                      110   2e-25   
ref|XP_004147600.1|  PREDICTED: geraniol 8-hydroxylase-like             110   2e-25   
emb|CDP18467.1|  unnamed protein product                                110   2e-25   
ref|XP_003521519.1|  PREDICTED: geraniol 8-hydroxylase-like             110   2e-25   
gb|ACU20890.1|  unknown                                                 110   2e-25   Glycine max [soybeans]
ref|XP_011091126.1|  PREDICTED: geraniol 8-hydroxylase-like             110   2e-25   
ref|XP_009613834.1|  PREDICTED: geraniol 8-hydroxylase-like             110   2e-25   
gb|AHX24366.1|  CYP76A26-like protein                                   110   2e-25   
gb|KHN02716.1|  Cytochrome P450 76C1                                    109   3e-25   
ref|XP_010691514.1|  PREDICTED: geraniol 8-hydroxylase-like             110   3e-25   
gb|KHG26828.1|  Cytochrome P450 protein                                 110   3e-25   
ref|XP_004496400.1|  PREDICTED: geraniol 8-hydroxylase-like             110   3e-25   
ref|XP_010691516.1|  PREDICTED: geraniol 8-hydroxylase-like             110   3e-25   
ref|XP_004246575.1|  PREDICTED: cytochrome P450 76A1-like               110   3e-25   
ref|XP_010105780.1|  Cytochrome P450 76C2                               109   3e-25   
ref|XP_003556053.1|  PREDICTED: geraniol 8-hydroxylase-like             110   3e-25   
gb|EYU29984.1|  hypothetical protein MIMGU_mgv1a026778mg                109   3e-25   
ref|XP_010054741.1|  PREDICTED: geraniol 8-hydroxylase-like             107   4e-25   
ref|XP_008241321.1|  PREDICTED: cytochrome P450 76A1                    110   4e-25   
ref|XP_009626046.1|  PREDICTED: cytochrome P450 76A1                    110   4e-25   
gb|AHX24368.1|  CYP76A26-like protein                                   110   4e-25   
ref|XP_004166926.1|  PREDICTED: geraniol 8-hydroxylase-like             109   4e-25   
ref|XP_010661590.1|  PREDICTED: geraniol 8-hydroxylase-like             105   4e-25   
gb|KGN50170.1|  hypothetical protein Csa_5G157290                       109   4e-25   
gb|AHX24365.1|  CYP76A26-like protein                                   109   4e-25   
ref|XP_010050589.1|  PREDICTED: geraniol 8-hydroxylase-like             109   4e-25   
ref|XP_002318834.2|  hypothetical protein POPTR_0012s13620g             109   4e-25   Populus trichocarpa [western balsam poplar]
gb|KHG13567.1|  Cytochrome P450 protein                                 108   4e-25   
ref|XP_011069674.1|  PREDICTED: ferruginol synthase-like                109   5e-25   
gb|ADE75682.1|  unknown                                                 108   5e-25   
ref|XP_010692297.1|  PREDICTED: geraniol 8-hydroxylase-like isofo...    109   5e-25   
ref|XP_009372317.1|  PREDICTED: geraniol 8-hydroxylase-like             109   5e-25   
ref|XP_006358811.1|  PREDICTED: geraniol 8-hydroxylase-like             109   6e-25   
gb|AGX93054.1|  geraniol 10-hydroxylase-like protein                    109   6e-25   
gb|ABC68413.1|  cytochrome P450 monooxygenase CYP76E3                   108   6e-25   Glycine max [soybeans]
ref|XP_006487474.1|  PREDICTED: geraniol 8-hydroxylase-like             108   7e-25   
emb|CDY52338.1|  BnaA09g38870D                                          108   7e-25   
emb|CBI38803.3|  unnamed protein product                                111   8e-25   
ref|XP_004233425.1|  PREDICTED: geraniol 8-hydroxylase-like             108   8e-25   
ref|XP_007027586.1|  Cytochrome P450                                    111   8e-25   
gb|KDO47864.1|  hypothetical protein CISIN_1g043423mg                   108   8e-25   
ref|XP_006423715.1|  hypothetical protein CICLE_v10028276mg             108   8e-25   
gb|AFG47442.1|  hypothetical protein 0_17014_01                         102   8e-25   
emb|CDP02458.1|  unnamed protein product                                108   8e-25   
emb|CBI33813.3|  unnamed protein product                                109   9e-25   
dbj|BAJ97899.1|  predicted protein                                      108   9e-25   
ref|XP_007034575.1|  Cytochrome P450, putative                          109   9e-25   
ref|XP_002276121.1|  PREDICTED: geraniol 8-hydroxylase-like isofo...    108   9e-25   
ref|XP_006423657.1|  hypothetical protein CICLE_v10030181mg             108   9e-25   
emb|CDX71765.1|  BnaC08g31090D                                          108   9e-25   
ref|XP_008241319.1|  PREDICTED: cytochrome P450 76A2-like               108   9e-25   
ref|XP_006358837.1|  PREDICTED: geraniol 8-hydroxylase-like             108   1e-24   
gb|AJD25179.1|  cytochrome P450 CYP76A35                                108   1e-24   
ref|XP_003528904.1|  PREDICTED: geraniol 8-hydroxylase-like             108   1e-24   
dbj|BAK03294.1|  predicted protein                                      108   1e-24   
emb|CDP20725.1|  unnamed protein product                                104   1e-24   
ref|XP_006439139.1|  hypothetical protein CICLE_v10033708mg             108   1e-24   
ref|XP_009362819.1|  PREDICTED: geraniol 8-hydroxylase-like             108   1e-24   
gb|KCW84355.1|  hypothetical protein EUGRSUZ_B01207                     107   1e-24   
gb|KHG03596.1|  Cytochrome P450 protein                                 108   1e-24   
ref|XP_008392536.1|  PREDICTED: cytochrome P450 76A1                    108   1e-24   
ref|XP_010691517.1|  PREDICTED: geraniol 8-hydroxylase-like             108   1e-24   
ref|XP_010661587.1|  PREDICTED: geraniol 8-hydroxylase-like isofo...    108   1e-24   
ref|XP_009763140.1|  PREDICTED: geraniol 8-hydroxylase-like isofo...    108   1e-24   
emb|CBI33786.3|  unnamed protein product                                107   2e-24   
ref|XP_009763139.1|  PREDICTED: geraniol 8-hydroxylase-like isofo...    108   2e-24   
gb|KHN15752.1|  Cytochrome P450 76C4                                    107   2e-24   
ref|XP_010412744.1|  PREDICTED: cytochrome P450 76A1-like               108   2e-24   
emb|CDP04799.1|  unnamed protein product                                109   2e-24   
gb|EMS63597.1|  Cytochrome P450 76C2                                    106   2e-24   
ref|XP_011099226.1|  PREDICTED: geraniol 8-hydroxylase-like             107   2e-24   
ref|XP_004232060.1|  PREDICTED: geraniol 8-hydroxylase-like             108   2e-24   
emb|CDP15345.1|  unnamed protein product                                107   2e-24   
gb|AEX12353.1|  hypothetical protein 0_9308_02                          102   2e-24   
sp|D1MI46.1|C76BA_SWEMU  RecName: Full=Geraniol 8-hydroxylase; Al...    107   2e-24   
emb|CDP07751.1|  unnamed protein product                                107   2e-24   
gb|AEX12355.1|  hypothetical protein 0_9308_02                          102   2e-24   
ref|XP_009603940.1|  PREDICTED: cytochrome P450 76A2-like               108   2e-24   
ref|XP_010069286.1|  PREDICTED: geraniol 8-hydroxylase-like             107   2e-24   
gb|AEX12356.1|  hypothetical protein 0_9308_02                          102   2e-24   
gb|AFG61947.1|  hypothetical protein 2_9900_01                          102   3e-24   
gb|AEX12364.1|  hypothetical protein 0_9308_02                          102   3e-24   
ref|XP_006431818.1|  hypothetical protein CICLE_v10003307mg             102   3e-24   
emb|CBI23267.3|  unnamed protein product                                109   3e-24   
gb|KDP29429.1|  hypothetical protein JCGZ_18350                         107   3e-24   
gb|KDP34508.1|  hypothetical protein JCGZ_11058                         106   3e-24   
gb|AJD20226.1|  putative N-methylcoclaurine 3-hydroxylase               107   3e-24   
emb|CDP20559.1|  unnamed protein product                                107   3e-24   
gb|AHX24370.1|  CYP76A26                                                107   3e-24   
ref|XP_004310208.1|  PREDICTED: geraniol 8-hydroxylase-like             107   3e-24   
ref|XP_008437176.1|  PREDICTED: geraniol 8-hydroxylase-like             107   3e-24   
gb|AHK60833.1|  iridoid oxidase                                         107   3e-24   
ref|XP_010662807.1|  PREDICTED: geraniol 8-hydroxylase                  107   3e-24   
dbj|BAP90522.1|  geraniol 10-hydroxylase                                107   3e-24   
gb|AEX12370.1|  hypothetical protein 0_9308_02                          101   3e-24   
ref|XP_010692294.1|  PREDICTED: geraniol 8-hydroxylase-like             107   4e-24   
ref|XP_008390127.1|  PREDICTED: geraniol 8-hydroxylase-like             107   4e-24   
ref|XP_011069677.1|  PREDICTED: ferruginol synthase-like                107   4e-24   
ref|XP_003610828.1|  Cytochrome P450 monooxygenase                      107   4e-24   
ref|XP_006338756.1|  PREDICTED: geraniol 8-hydroxylase-like             107   4e-24   
ref|XP_010504051.1|  PREDICTED: cytochrome P450 76A1-like               107   4e-24   
ref|XP_002303546.2|  hypothetical protein POPTR_0003s11810g             107   4e-24   
ref|XP_010057720.1|  PREDICTED: geraniol 8-hydroxylase-like             106   4e-24   
ref|XP_009350795.1|  PREDICTED: cytochrome P450 76A2-like               107   4e-24   
ref|XP_006360238.1|  PREDICTED: geraniol 8-hydroxylase-like             107   4e-24   
ref|XP_009334561.1|  PREDICTED: cytochrome P450 76A2-like               107   4e-24   
emb|CBI38805.3|  unnamed protein product                                107   4e-24   
ref|XP_006853516.1|  hypothetical protein AMTR_s00032p00222110          106   4e-24   
emb|CDP16259.1|  unnamed protein product                                105   4e-24   
gb|ABD97100.1|  cytochrome P450 monooxygenase CYP76X3                   105   4e-24   
ref|XP_009793679.1|  PREDICTED: cytochrome P450 76A1                    107   4e-24   
gb|AGX93051.1|  geraniol 10-hydroxylase-like protein                    107   4e-24   
gb|KDP29244.1|  hypothetical protein JCGZ_16633                         107   5e-24   
ref|XP_006360236.1|  PREDICTED: geraniol 8-hydroxylase-like             106   5e-24   
ref|XP_010691493.1|  PREDICTED: geraniol 8-hydroxylase-like             107   5e-24   
ref|XP_007040051.1|  Cytochrome P450, putative                          107   5e-24   
ref|XP_011030061.1|  PREDICTED: probable (S)-N-methylcoclaurine 3...    107   5e-24   
ref|XP_006482365.1|  PREDICTED: cytochrome P450 76A2-like               107   5e-24   
emb|CBI33787.3|  unnamed protein product                                106   5e-24   
ref|XP_011030059.1|  PREDICTED: probable (S)-N-methylcoclaurine 3...    107   5e-24   
ref|XP_011030058.1|  PREDICTED: probable (S)-N-methylcoclaurine 3...    107   5e-24   
ref|XP_008392600.1|  PREDICTED: cytochrome P450 76A2-like               107   5e-24   
ref|XP_004248012.1|  PREDICTED: geraniol 8-hydroxylase-like             106   5e-24   
ref|XP_010059476.1|  PREDICTED: geraniol 8-hydroxylase-like             105   6e-24   
ref|XP_004310057.1|  PREDICTED: geraniol 8-hydroxylase-like             106   6e-24   
gb|AHX24369.1|  CYP76A26-like protein                                   106   6e-24   
emb|CDP11103.1|  unnamed protein product                                106   6e-24   
gb|EMS49735.1|  Cytochrome P450 76C4                                    106   6e-24   
gb|AEX12368.1|  hypothetical protein 0_9308_02                          100   6e-24   
gb|AAS92624.1|  cytochrome P450                                         106   6e-24   
ref|XP_010692296.1|  PREDICTED: geraniol 8-hydroxylase-like isofo...    106   6e-24   
ref|XP_004496849.1|  PREDICTED: geraniol 8-hydroxylase-like             106   7e-24   
gb|AGX93053.1|  geraniol 10-hydroxylase-like protein                    106   7e-24   
gb|KCW45005.1|  hypothetical protein EUGRSUZ_L01405                     106   7e-24   
gb|KCW74940.1|  hypothetical protein EUGRSUZ_E03685                     106   7e-24   
ref|XP_006293048.1|  hypothetical protein CARUB_v10019335mg             106   8e-24   
ref|XP_004233426.2|  PREDICTED: geraniol 8-hydroxylase-like             106   8e-24   
ref|XP_010053375.1|  PREDICTED: geraniol 8-hydroxylase-like             106   8e-24   
ref|XP_007203742.1|  hypothetical protein PRUPE_ppa018268mg             106   8e-24   
ref|XP_002276561.1|  PREDICTED: geraniol 8-hydroxylase                  106   8e-24   
ref|XP_010248141.1|  PREDICTED: probable (S)-N-methylcoclaurine 3...    103   9e-24   
ref|XP_004310205.1|  PREDICTED: geraniol 8-hydroxylase-like             107   9e-24   
ref|XP_010040683.1|  PREDICTED: geraniol 8-hydroxylase-like             106   9e-24   
ref|XP_011094434.1|  PREDICTED: cytochrome P450 76A1-like               106   9e-24   
ref|XP_010648037.1|  PREDICTED: geraniol 8-hydroxylase-like             105   9e-24   
ref|XP_003610827.1|  Cytochrome P450                                    105   1e-23   
ref|XP_002513347.1|  (S)-N-methylcoclaurine 3'-hydroxylase isozym...    105   1e-23   
ref|NP_001061284.2|  Os08g0226300                                       106   1e-23   
gb|EAZ41927.1|  hypothetical protein OsJ_26473                          106   1e-23   
ref|XP_009372318.1|  PREDICTED: geraniol 8-hydroxylase-like             105   1e-23   
gb|ADJ68324.1|  geraniol 10-hydroxylase                                 105   1e-23   
ref|XP_003610835.1|  Cytochrome P450                                    105   1e-23   
ref|XP_010518177.1|  PREDICTED: cytochrome P450 76C1-like               105   1e-23   
sp|Q8VWZ7.1|C76B6_CATRO  RecName: Full=Geraniol 8-hydroxylase; Al...    105   1e-23   
ref|XP_003631468.1|  PREDICTED: geraniol 8-hydroxylase                  105   1e-23   
ref|XP_006857462.1|  hypothetical protein AMTR_s00067p00183120          101   1e-23   
gb|AGX93050.1|  geraniol 10-hydroxylase-like protein                    105   1e-23   
gb|KCW74933.1|  hypothetical protein EUGRSUZ_E03678                     105   1e-23   
gb|AES93793.2|  cytochrome P450 family 71 protein                       105   1e-23   
gb|KCW89351.1|  hypothetical protein EUGRSUZ_A01647                     105   1e-23   
gb|AJD25184.1|  cytochrome P450 CYP76G16                                105   1e-23   
gb|KDP27489.1|  hypothetical protein JCGZ_20024                         105   1e-23   
ref|XP_010057715.1|  PREDICTED: geraniol 8-hydroxylase-like             105   1e-23   
ref|XP_002970157.1|  hypothetical protein SELMODRAFT_93320              100   1e-23   
ref|XP_010512836.1|  PREDICTED: cytochrome P450 76C4-like               101   1e-23   
gb|KDP34506.1|  hypothetical protein JCGZ_11056                         103   2e-23   
ref|XP_009781673.1|  PREDICTED: geraniol 8-hydroxylase-like             103   2e-23   
ref|XP_009609252.1|  PREDICTED: probable (S)-N-methylcoclaurine 3...    105   2e-23   
gb|KCW74938.1|  hypothetical protein EUGRSUZ_E036841                    103   2e-23   
ref|XP_002528644.1|  cytochrome P450, putative                          105   2e-23   
ref|NP_174633.1|  cytochrome P450, family 76, subfamily C, polype...    105   2e-23   
ref|XP_002318835.2|  hypothetical protein POPTR_0012s13630g             105   2e-23   
gb|AEX12354.1|  hypothetical protein 0_9308_02                        99.8    2e-23   
ref|XP_008361842.1|  PREDICTED: geraniol 8-hydroxylase-like             102   2e-23   
ref|XP_010506516.1|  PREDICTED: cytochrome P450 76C1-like               105   2e-23   
ref|XP_006293280.1|  hypothetical protein CARUB_v10019616mg             102   2e-23   
ref|NP_174634.1|  cytochrome P450, family 76, subfamily C, polype...    103   2e-23   
ref|XP_004310207.1|  PREDICTED: geraniol 8-hydroxylase-like             104   2e-23   
gb|AHF22835.1|  drimenol oxidase 1                                      105   2e-23   
ref|XP_006481913.1|  PREDICTED: cytochrome P450 76A2-like               105   2e-23   
ref|XP_002283415.2|  PREDICTED: probable (S)-N-methylcoclaurine 3...    105   2e-23   
gb|KDO61009.1|  hypothetical protein CISIN_1g010359mg                   105   2e-23   
ref|XP_002274562.1|  PREDICTED: probable (S)-N-methylcoclaurine 3...    105   2e-23   
ref|XP_006430323.1|  hypothetical protein CICLE_v10011511mg             105   2e-23   
ref|XP_006360240.1|  PREDICTED: geraniol 8-hydroxylase-like             105   2e-23   
gb|EMT10761.1|  Cytochrome P450 76C2                                    103   2e-23   
gb|KDP26153.1|  hypothetical protein JCGZ_22834                         105   2e-23   
ref|XP_010431310.1|  PREDICTED: cytochrome P450 76A1-like               105   2e-23   
emb|CBI38801.3|  unnamed protein product                              99.0    2e-23   
emb|CAN62647.1|  hypothetical protein VITISV_013219                     105   2e-23   
ref|XP_011100232.1|  PREDICTED: cytochrome P450 76A2-like               105   2e-23   
emb|CAB86901.1|  cytochrome P450-like protein                           105   3e-23   
ref|NP_190865.2|  cytochrome P450, family 76, subfamily G, polype...    105   3e-23   
emb|CAN81642.1|  hypothetical protein VITISV_036426                     103   3e-23   
emb|CDP04819.1|  unnamed protein product                                103   3e-23   
dbj|BAC42682.1|  putative cytochrome P450                               105   3e-23   
ref|NP_001190075.1|  cytochrome P450, family 76, subfamily G, pol...    105   3e-23   
ref|XP_010676619.1|  PREDICTED: geraniol 8-hydroxylase-like             105   3e-23   
ref|XP_010057714.1|  PREDICTED: geraniol 8-hydroxylase-like             104   3e-23   
ref|XP_009777857.1|  PREDICTED: geraniol 8-hydroxylase-like             104   3e-23   
emb|CBI34715.3|  unnamed protein product                                106   3e-23   
ref|XP_007142620.1|  hypothetical protein PHAVU_007G003100g             104   3e-23   
ref|XP_006360235.1|  PREDICTED: geraniol 8-hydroxylase-like             104   3e-23   
gb|KHG16052.1|  Cytochrome P450 protein                                 104   3e-23   
ref|XP_010057717.1|  PREDICTED: geraniol 8-hydroxylase-like             103   3e-23   
gb|ABK24553.1|  unknown                                                 104   4e-23   
ref|XP_009596429.1|  PREDICTED: geraniol 8-hydroxylase-like             104   4e-23   
emb|CBI24532.3|  unnamed protein product                                101   4e-23   
ref|XP_006338229.1|  PREDICTED: geraniol 8-hydroxylase-like             104   4e-23   
ref|XP_008389819.1|  PREDICTED: geraniol 8-hydroxylase-like             104   4e-23   
ref|XP_008389841.1|  PREDICTED: geraniol 8-hydroxylase-like             104   4e-23   
gb|KHN37270.1|  Cytochrome P450 76A2                                    104   4e-23   
ref|XP_004953280.1|  PREDICTED: cytochrome P450 76C2-like               101   4e-23   
gb|KDP24880.1|  hypothetical protein JCGZ_25133                         104   4e-23   
gb|EYU38601.1|  hypothetical protein MIMGU_mgv1a004436mg                104   4e-23   
ref|XP_010508150.1|  PREDICTED: cytochrome P450 76C1 isoform X1         104   4e-23   
ref|XP_009787971.1|  PREDICTED: geraniol 8-hydroxylase-like             103   4e-23   
ref|XP_009780149.1|  PREDICTED: geraniol 8-hydroxylase-like             103   5e-23   
ref|XP_004514899.1|  PREDICTED: geraniol 8-hydroxylase-like             104   5e-23   
ref|XP_003607445.1|  Cytochrome P450                                    103   5e-23   
ref|XP_003535793.1|  PREDICTED: cytochrome P450 76A2-like               104   5e-23   
ref|XP_006431815.1|  hypothetical protein CICLE_v10003440mg             102   5e-23   
ref|XP_010037099.1|  PREDICTED: cytochrome P450 76A1-like               104   5e-23   
ref|XP_010558964.1|  PREDICTED: LOW QUALITY PROTEIN: cytochrome P...    104   5e-23   
ref|XP_011070820.1|  PREDICTED: flavonoid 3'-monooxygenase-like         104   5e-23   
gb|AAF97287.1|AC010164_9  Putative cytochrome P450                      103   6e-23   
emb|CDY27374.1|  BnaC04g50310D                                          103   6e-23   
ref|XP_010037101.1|  PREDICTED: cytochrome P450 76A1-like               103   6e-23   
gb|KDP34505.1|  hypothetical protein JCGZ_11055                         102   6e-23   
ref|XP_002528643.1|  cytochrome P450, putative                          104   6e-23   
ref|XP_002318833.1|  hypothetical protein POPTR_0012s13580g             103   6e-23   
gb|KCW48743.1|  hypothetical protein EUGRSUZ_K02382                     103   6e-23   
ref|XP_010654031.1|  PREDICTED: cytochrome P450 76A1                    103   6e-23   
gb|EYU25445.1|  hypothetical protein MIMGU_mgv1a018354mg                103   6e-23   
ref|XP_009630529.1|  PREDICTED: geraniol 8-hydroxylase-like             103   6e-23   
ref|XP_002283461.2|  PREDICTED: probable (S)-N-methylcoclaurine 3...    104   6e-23   
ref|XP_006403743.1|  hypothetical protein EUTSA_v10010318mg             103   7e-23   
gb|KDP34502.1|  hypothetical protein JCGZ_11052                         103   7e-23   
ref|XP_002509713.1|  (S)-N-methylcoclaurine 3'-hydroxylase isozym...    103   7e-23   
ref|XP_010528787.1|  PREDICTED: cytochrome P450 76C4-like isoform X2    103   7e-23   
ref|XP_003536316.1|  PREDICTED: geraniol 8-hydroxylase-like             103   7e-23   
gb|KCW75046.1|  hypothetical protein EUGRSUZ_E03823                     102   7e-23   
ref|XP_004147601.1|  PREDICTED: geraniol 8-hydroxylase-like             103   7e-23   
ref|XP_004166924.1|  PREDICTED: geraniol 8-hydroxylase-like             103   7e-23   
ref|XP_010528786.1|  PREDICTED: cytochrome P450 76C4-like isoform X1    103   7e-23   
ref|XP_010692468.1|  PREDICTED: geraniol 8-hydroxylase-like             102   7e-23   
ref|XP_009372315.1|  PREDICTED: geraniol 8-hydroxylase-like             103   7e-23   
ref|XP_002978324.1|  hypothetical protein SELMODRAFT_108642           99.0    7e-23   
ref|XP_004245646.1|  PREDICTED: probable (S)-N-methylcoclaurine 3...    103   7e-23   
gb|KFK37346.1|  hypothetical protein AALP_AA4G244600                    103   8e-23   
ref|XP_010250222.1|  PREDICTED: geraniol 8-hydroxylase-like             103   8e-23   
ref|XP_009762539.1|  PREDICTED: geraniol 8-hydroxylase-like             102   8e-23   
ref|XP_004232059.1|  PREDICTED: geraniol 8-hydroxylase                  103   9e-23   
ref|XP_010692298.1|  PREDICTED: geraniol 8-hydroxylase-like             103   9e-23   
ref|XP_011094433.1|  PREDICTED: cytochrome P450 76A1-like               103   9e-23   
ref|XP_009791755.1|  PREDICTED: LOW QUALITY PROTEIN: geraniol 8-h...    102   9e-23   



>ref|XP_009788755.1| PREDICTED: cytochrome P450 76A2-like [Nicotiana sylvestris]
Length=505

 Score =   148 bits (373),  Expect = 7e-39, Method: Compositional matrix adjust.
 Identities = 68/86 (79%), Positives = 75/86 (87%), Gaps = 0/86 (0%)
 Frame = -2

Query  473  KPERFLGSNIDFKGQNFEFLPFGAGRRMCAGLPLGNRMLHFVLGSLLHTFDWELEGNVSS  294
            KPERFL S IDFKGQ FEFLPFGAGRRMC GLPLGNRMLH VLGSLLH FDWEL  NV+ 
Sbjct  418  KPERFLNSKIDFKGQCFEFLPFGAGRRMCVGLPLGNRMLHVVLGSLLHEFDWELPENVTP  477

Query  293  ESLDMAERMGITVRKFEPLKAIPRRV  216
            +S+DM ERMG+TVRKF+PLKA+PR+ 
Sbjct  478  KSMDMKERMGMTVRKFQPLKAVPRKT  503



>ref|XP_009589554.1| PREDICTED: cytochrome P450 76A2-like [Nicotiana tomentosiformis]
Length=506

 Score =   147 bits (371),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 67/88 (76%), Positives = 75/88 (85%), Gaps = 0/88 (0%)
 Frame = -2

Query  473  KPERFLGSNIDFKGQNFEFLPFGAGRRMCAGLPLGNRMLHFVLGSLLHTFDWELEGNVSS  294
            KPERFL S IDFKGQ FEFLPFGAGRRMC GLPLGNRMLH VLGSLLH FDWEL   ++ 
Sbjct  419  KPERFLNSKIDFKGQCFEFLPFGAGRRMCVGLPLGNRMLHLVLGSLLHEFDWELPETITP  478

Query  293  ESLDMAERMGITVRKFEPLKAIPRRVVA  210
            +S+DM ERMG+TVRKF+PLKA+PR+  A
Sbjct  479  KSMDMKERMGMTVRKFQPLKAVPRKTSA  506



>ref|XP_006341182.1| PREDICTED: cytochrome P450 76A2-like [Solanum tuberosum]
Length=507

 Score =   143 bits (361),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 65/86 (76%), Positives = 72/86 (84%), Gaps = 0/86 (0%)
 Frame = -2

Query  473  KPERFLGSNIDFKGQNFEFLPFGAGRRMCAGLPLGNRMLHFVLGSLLHTFDWELEGNVSS  294
            KPERFL S  DFKGQ +EFLPFGAGRRMC GLPLGNRMLHFVLGSLLH FDWEL  NV+ 
Sbjct  420  KPERFLNSKTDFKGQCYEFLPFGAGRRMCVGLPLGNRMLHFVLGSLLHEFDWELPSNVTP  479

Query  293  ESLDMAERMGITVRKFEPLKAIPRRV  216
            +S+DM ERMG+TVRKF PL A+P + 
Sbjct  480  KSMDMKERMGMTVRKFNPLTAVPTKT  505



>gb|KDP43104.1| hypothetical protein JCGZ_27053 [Jatropha curcas]
Length=168

 Score =   136 bits (343),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 56/85 (66%), Positives = 75/85 (88%), Gaps = 0/85 (0%)
 Frame = -2

Query  473  KPERFLGSNIDFKGQNFEFLPFGAGRRMCAGLPLGNRMLHFVLGSLLHTFDWELEGNVSS  294
            KPERF+GSNID++GQNFE LPFGAGRR+C G+P+ +R++HF + SLLH FDWEL+ N ++
Sbjct  79   KPERFIGSNIDYRGQNFELLPFGAGRRICVGIPMAHRVVHFAVASLLHCFDWELDSNSAA  138

Query  293  ESLDMAERMGITVRKFEPLKAIPRR  219
            E+LD+ ERMGITVRK +P+KAIP++
Sbjct  139  ENLDVKERMGITVRKLKPVKAIPKK  163



>ref|XP_004246901.1| PREDICTED: cytochrome P450 76A2-like [Solanum lycopersicum]
Length=507

 Score =   142 bits (359),  Expect = 7e-37, Method: Compositional matrix adjust.
 Identities = 65/86 (76%), Positives = 71/86 (83%), Gaps = 0/86 (0%)
 Frame = -2

Query  473  KPERFLGSNIDFKGQNFEFLPFGAGRRMCAGLPLGNRMLHFVLGSLLHTFDWELEGNVSS  294
            KPERFL S  DFKGQ +EFLPFGAGRRMC GLPLGNRMLHFVLGSLLH FDWEL  NV+ 
Sbjct  420  KPERFLNSKTDFKGQCYEFLPFGAGRRMCVGLPLGNRMLHFVLGSLLHEFDWELPSNVTP  479

Query  293  ESLDMAERMGITVRKFEPLKAIPRRV  216
             S+DM ERMG+TVRKF PL A+P + 
Sbjct  480  VSMDMKERMGMTVRKFNPLTAVPTKT  505



>ref|XP_011094547.1| PREDICTED: cytochrome P450 76A2-like [Sesamum indicum]
Length=504

 Score =   140 bits (353),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 60/85 (71%), Positives = 78/85 (92%), Gaps = 0/85 (0%)
 Frame = -2

Query  473  KPERFLGSNIDFKGQNFEFLPFGAGRRMCAGLPLGNRMLHFVLGSLLHTFDWELEGNVSS  294
            KPERFLG+N+D+KGQ+FE +PFGAGRRMCAGL LG+RM+HFVLGSL+H F+WELE +V+ 
Sbjct  412  KPERFLGTNVDYKGQSFELIPFGAGRRMCAGLALGHRMIHFVLGSLVHEFEWELESSVTP  471

Query  293  ESLDMAERMGITVRKFEPLKAIPRR  219
            +++DM+ERMGITV K +PLKA+PR+
Sbjct  472  DAVDMSERMGITVGKLKPLKAVPRK  496



>gb|KDP27487.1| hypothetical protein JCGZ_20022 [Jatropha curcas]
Length=505

 Score =   140 bits (352),  Expect = 6e-36, Method: Compositional matrix adjust.
 Identities = 60/86 (70%), Positives = 76/86 (88%), Gaps = 0/86 (0%)
 Frame = -2

Query  473  KPERFLGSNIDFKGQNFEFLPFGAGRRMCAGLPLGNRMLHFVLGSLLHTFDWELEGNVSS  294
            KPERF+GSN+D+KGQN+EF+PFGAGRRMCAG+ LG+R+LH +LGSLLH FDWELE NV+ 
Sbjct  416  KPERFIGSNVDYKGQNYEFIPFGAGRRMCAGVTLGHRVLHLILGSLLHHFDWELEANVNP  475

Query  293  ESLDMAERMGITVRKFEPLKAIPRRV  216
            E +DM +R+GIT+RK EPL A+P+ V
Sbjct  476  EKVDMRDRLGITMRKLEPLIAVPKTV  501



>ref|XP_002528645.1| cytochrome P450, putative [Ricinus communis]
 gb|EEF33748.1| cytochrome P450, putative [Ricinus communis]
Length=502

 Score =   137 bits (345),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 57/87 (66%), Positives = 76/87 (87%), Gaps = 0/87 (0%)
 Frame = -2

Query  473  KPERFLGSNIDFKGQNFEFLPFGAGRRMCAGLPLGNRMLHFVLGSLLHTFDWELEGNVSS  294
            KPERF+GSN+D+KGQ++EF+PFGAGRRMCAG+ L +R+LH  LGSLLH FDWELE NV+ 
Sbjct  416  KPERFMGSNVDYKGQHYEFIPFGAGRRMCAGVSLAHRILHLTLGSLLHHFDWELEANVTP  475

Query  293  ESLDMAERMGITVRKFEPLKAIPRRVV  213
            ++LDM +R+G+T+RK EPL A+P++ V
Sbjct  476  DTLDMRDRLGVTMRKLEPLLAVPKKCV  502



>ref|XP_002528652.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF33755.1| conserved hypothetical protein [Ricinus communis]
Length=187

 Score =   131 bits (330),  Expect = 6e-35, Method: Compositional matrix adjust.
 Identities = 56/87 (64%), Positives = 72/87 (83%), Gaps = 0/87 (0%)
 Frame = -2

Query  473  KPERFLGSNIDFKGQNFEFLPFGAGRRMCAGLPLGNRMLHFVLGSLLHTFDWELEGNVSS  294
            KPERFL SNID+KGQNFE LPFG+GRR+C G+PL +R+LH  L SLLH FDWEL  N + 
Sbjct  99   KPERFLDSNIDYKGQNFELLPFGSGRRICVGIPLAHRILHPALASLLHCFDWELGSNSTP  158

Query  293  ESLDMAERMGITVRKFEPLKAIPRRVV  213
            E++DM ER+GI+VRK  P+KAIP++++
Sbjct  159  ETIDMKERLGISVRKLVPMKAIPKKIL  185



>dbj|BAC53891.1| cytochrome P450 [Petunia x hybrida]
Length=507

 Score =   135 bits (340),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 59/84 (70%), Positives = 72/84 (86%), Gaps = 0/84 (0%)
 Frame = -2

Query  470  PERFLGSNIDFKGQNFEFLPFGAGRRMCAGLPLGNRMLHFVLGSLLHTFDWELEGNVSSE  291
            PERF+GS IDFKG N+E +PFGAGRRMC G+PLG+RM+HFVLG+LLH F+WEL  N+SS+
Sbjct  420  PERFIGSKIDFKGLNYELIPFGAGRRMCVGVPLGHRMVHFVLGTLLHEFNWELPHNMSSK  479

Query  290  SLDMAERMGITVRKFEPLKAIPRR  219
            S+DM ER+G TVRK EPLK IP +
Sbjct  480  SIDMTERLGTTVRKLEPLKVIPNK  503



>ref|XP_009785656.1| PREDICTED: cytochrome P450 76A1-like isoform X1 [Nicotiana sylvestris]
Length=517

 Score =   134 bits (338),  Expect = 5e-34, Method: Compositional matrix adjust.
 Identities = 59/86 (69%), Positives = 71/86 (83%), Gaps = 0/86 (0%)
 Frame = -2

Query  473  KPERFLGSNIDFKGQNFEFLPFGAGRRMCAGLPLGNRMLHFVLGSLLHTFDWELEGNVSS  294
            KPERFLGSN+D KGQN+E +PFGAGRRMC GL LG+RM+HF  GSLLH F+WEL GNV+ 
Sbjct  432  KPERFLGSNVDVKGQNYELIPFGAGRRMCVGLSLGHRMMHFAFGSLLHEFNWELPGNVTP  491

Query  293  ESLDMAERMGITVRKFEPLKAIPRRV  216
            +S++M E MGIT RK +PLK IP+R 
Sbjct  492  KSMNMDESMGITARKKQPLKVIPKRA  517



>ref|XP_002277746.1| PREDICTED: cytochrome P450 76A1 [Vitis vinifera]
Length=509

 Score =   134 bits (338),  Expect = 5e-34, Method: Compositional matrix adjust.
 Identities = 58/84 (69%), Positives = 72/84 (86%), Gaps = 0/84 (0%)
 Frame = -2

Query  473  KPERFLGSNIDFKGQNFEFLPFGAGRRMCAGLPLGNRMLHFVLGSLLHTFDWELEGNVSS  294
            KPERF+ SN+D+KGQNFEF+PFGAGRR+C G+PL  R+LHFVLGSLLH FDW+LE NV+ 
Sbjct  420  KPERFVDSNMDYKGQNFEFIPFGAGRRICVGIPLAYRVLHFVLGSLLHHFDWQLERNVTP  479

Query  293  ESLDMAERMGITVRKFEPLKAIPR  222
            E++DM ER GI + KF PLKA+P+
Sbjct  480  ETMDMKERRGIVICKFHPLKAVPK  503



>ref|XP_009785657.1| PREDICTED: cytochrome P450 76A1-like isoform X2 [Nicotiana sylvestris]
Length=508

 Score =   134 bits (338),  Expect = 5e-34, Method: Compositional matrix adjust.
 Identities = 59/86 (69%), Positives = 71/86 (83%), Gaps = 0/86 (0%)
 Frame = -2

Query  473  KPERFLGSNIDFKGQNFEFLPFGAGRRMCAGLPLGNRMLHFVLGSLLHTFDWELEGNVSS  294
            KPERFLGSN+D KGQN+E +PFGAGRRMC GL LG+RM+HF  GSLLH F+WEL GNV+ 
Sbjct  423  KPERFLGSNVDVKGQNYELIPFGAGRRMCVGLSLGHRMMHFAFGSLLHEFNWELPGNVTP  482

Query  293  ESLDMAERMGITVRKFEPLKAIPRRV  216
            +S++M E MGIT RK +PLK IP+R 
Sbjct  483  KSMNMDESMGITARKKQPLKVIPKRA  508



>ref|XP_004246574.1| PREDICTED: LOW QUALITY PROTEIN: cytochrome P450 76A1-like [Solanum 
lycopersicum]
Length=512

 Score =   134 bits (336),  Expect = 8e-34, Method: Compositional matrix adjust.
 Identities = 61/86 (71%), Positives = 70/86 (81%), Gaps = 0/86 (0%)
 Frame = -2

Query  473  KPERFLGSNIDFKGQNFEFLPFGAGRRMCAGLPLGNRMLHFVLGSLLHTFDWELEGNVSS  294
            KPERFL S +D KGQN E +PFGAGRRMCAGLPLG+RM+HF  GSLLH FDWEL  NVS 
Sbjct  427  KPERFLESKVDVKGQNHELIPFGAGRRMCAGLPLGHRMMHFAFGSLLHEFDWELPNNVSP  486

Query  293  ESLDMAERMGITVRKFEPLKAIPRRV  216
            +S++M E MGIT RK +PLK IP+RV
Sbjct  487  KSINMEESMGITARKKQPLKVIPKRV  512



>ref|XP_006482364.1| PREDICTED: cytochrome P450 76A2-like [Citrus sinensis]
Length=500

 Score =   133 bits (334),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 59/85 (69%), Positives = 71/85 (84%), Gaps = 3/85 (4%)
 Frame = -2

Query  473  KPERFLGSNIDFKGQNFEFLPFGAGRRMCAGLPLGNRMLHFVLGSLLHTFDWELEGNVSS  294
            KPERFLGS +D+KGQN+E +PFGAGRRMCAG+PL +RMLH +LGSLLH FDWEL+     
Sbjct  417  KPERFLGSTVDYKGQNYELIPFGAGRRMCAGVPLAHRMLHLILGSLLHQFDWELD---CK  473

Query  293  ESLDMAERMGITVRKFEPLKAIPRR  219
            E +DM +RMGITVRK EPL A+P+R
Sbjct  474  EKIDMNDRMGITVRKAEPLIAVPKR  498



>gb|KDO61008.1| hypothetical protein CISIN_1g036305mg [Citrus sinensis]
Length=515

 Score =   133 bits (334),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 59/85 (69%), Positives = 71/85 (84%), Gaps = 3/85 (4%)
 Frame = -2

Query  473  KPERFLGSNIDFKGQNFEFLPFGAGRRMCAGLPLGNRMLHFVLGSLLHTFDWELEGNVSS  294
            KPERFLGS +D+KGQN+E +PFGAGRRMCAG+PL +RMLH +LGSLLH FDWEL+     
Sbjct  432  KPERFLGSTVDYKGQNYELIPFGAGRRMCAGVPLAHRMLHLILGSLLHQFDWELD---CK  488

Query  293  ESLDMAERMGITVRKFEPLKAIPRR  219
            E +DM +RMGITVRK EPL A+P+R
Sbjct  489  EEIDMNDRMGITVRKAEPLIAVPKR  513



>ref|XP_006430324.1| hypothetical protein CICLE_v10013315mg [Citrus clementina]
 gb|ESR43564.1| hypothetical protein CICLE_v10013315mg [Citrus clementina]
Length=515

 Score =   133 bits (334),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 59/85 (69%), Positives = 71/85 (84%), Gaps = 3/85 (4%)
 Frame = -2

Query  473  KPERFLGSNIDFKGQNFEFLPFGAGRRMCAGLPLGNRMLHFVLGSLLHTFDWELEGNVSS  294
            KPERFLGS +D+KGQN+E +PFGAGRRMCAG+PL +RMLH +LGSLLH FDWEL+     
Sbjct  432  KPERFLGSTVDYKGQNYELIPFGAGRRMCAGVPLAHRMLHLILGSLLHQFDWELD---CK  488

Query  293  ESLDMAERMGITVRKFEPLKAIPRR  219
            E +DM +RMGITVRK EPL A+P+R
Sbjct  489  EEIDMNDRMGITVRKAEPLIAVPKR  513



>sp|P37121.1|C76A1_SOLME RecName: Full=Cytochrome P450 76A1; AltName: Full=CYPLXXVIA1; 
AltName: Full=Cytochrome P-450EG8, partial [Solanum melongena]
 emb|CAA50649.1| unnamed protein product [Solanum melongena]
Length=467

 Score =   132 bits (331),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 58/86 (67%), Positives = 69/86 (80%), Gaps = 0/86 (0%)
 Frame = -2

Query  473  KPERFLGSNIDFKGQNFEFLPFGAGRRMCAGLPLGNRMLHFVLGSLLHTFDWELEGNVSS  294
            KPERFL S +D KGQN+E +PFGAGRRMC GLPLG+RM+HF  GSLLH FDWEL  NVS 
Sbjct  382  KPERFLESKVDVKGQNYELIPFGAGRRMCVGLPLGHRMMHFTFGSLLHEFDWELPHNVSP  441

Query  293  ESLDMAERMGITVRKFEPLKAIPRRV  216
            +S++M E MGIT RK +PLK IP++ 
Sbjct  442  KSINMEESMGITARKKQPLKVIPKKA  467



>ref|XP_004494132.1| PREDICTED: cytochrome P450 76A2-like [Cicer arietinum]
Length=511

 Score =   132 bits (331),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 58/92 (63%), Positives = 75/92 (82%), Gaps = 4/92 (4%)
 Frame = -2

Query  473  KPERFLGSNI----DFKGQNFEFLPFGAGRRMCAGLPLGNRMLHFVLGSLLHTFDWELEG  306
            KPERF G NI    D+KGQN+E +PFGAGRRMCAG+PL +R+LH VLGSLLH FDWEL+ 
Sbjct  420  KPERFYGCNINNKIDYKGQNYELIPFGAGRRMCAGVPLAHRVLHLVLGSLLHRFDWELDS  479

Query  305  NVSSESLDMAERMGITVRKFEPLKAIPRRVVA  210
            NV+  ++DM +R+GIT+RKF+PL A+P+ V +
Sbjct  480  NVTPSTIDMKDRLGITMRKFQPLLAVPKLVAS  511



>ref|XP_010112510.1| Cytochrome P450 76A2 [Morus notabilis]
 gb|EXC33898.1| Cytochrome P450 76A2 [Morus notabilis]
Length=509

 Score =   131 bits (329),  Expect = 9e-33, Method: Compositional matrix adjust.
 Identities = 59/90 (66%), Positives = 75/90 (83%), Gaps = 3/90 (3%)
 Frame = -2

Query  473  KPERFL---GSNIDFKGQNFEFLPFGAGRRMCAGLPLGNRMLHFVLGSLLHTFDWELEGN  303
            KPERF+    S+ D+KGQ+FEF+PFGAGRRMCAG+PL +R+LH VLGSLLH FDWEL+ +
Sbjct  420  KPERFMVGPNSSTDYKGQHFEFIPFGAGRRMCAGVPLAHRVLHLVLGSLLHHFDWELDAS  479

Query  302  VSSESLDMAERMGITVRKFEPLKAIPRRVV  213
            V  E++DM +R+GITVRKFEPL AIP + +
Sbjct  480  VDVETMDMKDRLGITVRKFEPLLAIPTKCI  509



>ref|XP_009786696.1| PREDICTED: cytochrome P450 76A1-like [Nicotiana sylvestris]
Length=508

 Score =   130 bits (328),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 57/86 (66%), Positives = 69/86 (80%), Gaps = 0/86 (0%)
 Frame = -2

Query  473  KPERFLGSNIDFKGQNFEFLPFGAGRRMCAGLPLGNRMLHFVLGSLLHTFDWELEGNVSS  294
            KPERFLGSN+D KGQN+E +PFGAGRRMC GL LG+RM+HF  GSLLH F+WEL  NV+ 
Sbjct  423  KPERFLGSNVDVKGQNYELIPFGAGRRMCVGLSLGHRMMHFAFGSLLHEFNWELPDNVTP  482

Query  293  ESLDMAERMGITVRKFEPLKAIPRRV  216
            +S++M E MG+T RK +PLK IP R 
Sbjct  483  KSMNMDESMGVTARKKQPLKVIPNRA  508



>ref|XP_009613392.1| PREDICTED: cytochrome P450 76A2-like [Nicotiana tomentosiformis]
Length=453

 Score =   130 bits (327),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 60/95 (63%), Positives = 73/95 (77%), Gaps = 2/95 (2%)
 Frame = -2

Query  473  KPERFLGSNIDFKGQNFEFLPFGAGRRMCAGLPLGNRMLHFVLGSLLHTFDWELEGNVSS  294
            +PERFL S IDFKGQ +EF+PFGAGR+MC GLPL NR+LH  LGSLL  FDWEL  N++ 
Sbjct  359  RPERFLCSKIDFKGQCYEFIPFGAGRKMCVGLPLANRILHLALGSLLQEFDWELPENITP  418

Query  293  ESLDMAERMGITVRKFEPLKAIP--RRVVA*QKLE  195
             S+DM E++GITVRK +PLKA+P  RR     KL+
Sbjct  419  NSMDMTEKIGITVRKVQPLKAVPIKRRTSYSHKLQ  453



>ref|XP_006341183.1| PREDICTED: cytochrome P450 76A1-like [Solanum tuberosum]
Length=513

 Score =   130 bits (327),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 59/86 (69%), Positives = 68/86 (79%), Gaps = 0/86 (0%)
 Frame = -2

Query  473  KPERFLGSNIDFKGQNFEFLPFGAGRRMCAGLPLGNRMLHFVLGSLLHTFDWELEGNVSS  294
            KPERFL S +D KGQN E +PFGAGRRMC GLPLG+RM+HF  GSLLH FDWEL  NVS 
Sbjct  428  KPERFLESKVDVKGQNHELIPFGAGRRMCVGLPLGHRMMHFAFGSLLHEFDWELPHNVSP  487

Query  293  ESLDMAERMGITVRKFEPLKAIPRRV  216
            +S++M E MGIT RK +PLK IP+R 
Sbjct  488  KSINMEESMGITTRKKQPLKVIPKRA  513



>ref|XP_002309107.1| hypothetical protein POPTR_0006s09580g [Populus trichocarpa]
 gb|EEE92630.1| hypothetical protein POPTR_0006s09580g [Populus trichocarpa]
Length=508

 Score =   130 bits (326),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 55/84 (65%), Positives = 70/84 (83%), Gaps = 0/84 (0%)
 Frame = -2

Query  470  PERFLGSNIDFKGQNFEFLPFGAGRRMCAGLPLGNRMLHFVLGSLLHTFDWELEGNVSSE  291
            PERF+G  +D++GQ+ EF+PFGAGRRMCAG+PL +R+LH +LGSLLH FDWE E NV+  
Sbjct  421  PERFIGKRVDYRGQDLEFIPFGAGRRMCAGVPLAHRVLHLILGSLLHHFDWEFEANVNPA  480

Query  290  SLDMAERMGITVRKFEPLKAIPRR  219
            S+D  +RMGITVRK EPL A+P+R
Sbjct  481  SVDKKDRMGITVRKSEPLMAVPKR  504



>gb|AIW00679.1| flavonoid 3',5'-hydroxylase, partial [Paeonia lactiflora]
Length=503

 Score =   129 bits (325),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 55/87 (63%), Positives = 72/87 (83%), Gaps = 0/87 (0%)
 Frame = -2

Query  473  KPERFLGSNIDFKGQNFEFLPFGAGRRMCAGLPLGNRMLHFVLGSLLHTFDWELEGNVSS  294
            KPERFL S +D+KGQNFEFLPFG+GRR+C G+ L +R++H  L SLLHTFDWEL  N++ 
Sbjct  416  KPERFLDSKVDYKGQNFEFLPFGSGRRICVGMVLADRVVHLALASLLHTFDWELPNNITQ  475

Query  293  ESLDMAERMGITVRKFEPLKAIPRRVV  213
            E+LD+ E+MGIT+RK  PLKAIP++ +
Sbjct  476  ETLDVNEKMGITLRKLVPLKAIPKKRI  502



>ref|XP_002277595.2| PREDICTED: cytochrome P450 76A1-like [Vitis vinifera]
Length=332

 Score =   127 bits (319),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 54/88 (61%), Positives = 75/88 (85%), Gaps = 1/88 (1%)
 Frame = -2

Query  473  KPERFLGSN-IDFKGQNFEFLPFGAGRRMCAGLPLGNRMLHFVLGSLLHTFDWELEGNVS  297
            KPERFL S  I++KGQNFE +PFGAGRR+CAG+PL +R+LH VLG+LLH FDW+L+GNV+
Sbjct  245  KPERFLDSKKIEYKGQNFELIPFGAGRRICAGIPLAHRVLHLVLGTLLHHFDWQLKGNVT  304

Query  296  SESLDMAERMGITVRKFEPLKAIPRRVV  213
             E++DM E+ G+ +RK +PLKA+P+++ 
Sbjct  305  PETMDMKEKWGLVMRKSQPLKAVPKKLT  332



>ref|XP_004249462.1| PREDICTED: cytochrome P450 76A2-like [Solanum lycopersicum]
Length=499

 Score =   129 bits (323),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 57/86 (66%), Positives = 70/86 (81%), Gaps = 0/86 (0%)
 Frame = -2

Query  473  KPERFLGSNIDFKGQNFEFLPFGAGRRMCAGLPLGNRMLHFVLGSLLHTFDWELEGNVSS  294
            KPERFLGS +D KGQ++E +PFGAGRRMC GLPLG+RM+HF LGSLLH FDWEL   VS 
Sbjct  414  KPERFLGSKLDVKGQHYELIPFGAGRRMCVGLPLGHRMMHFALGSLLHEFDWELPDGVSP  473

Query  293  ESLDMAERMGITVRKFEPLKAIPRRV  216
            +S++M E MG+T RK + LK IP++V
Sbjct  474  KSINMDESMGVTARKRDSLKVIPKKV  499



>ref|XP_004249632.1| PREDICTED: cytochrome P450 76A2-like [Solanum lycopersicum]
Length=507

 Score =   128 bits (322),  Expect = 7e-32, Method: Compositional matrix adjust.
 Identities = 56/84 (67%), Positives = 72/84 (86%), Gaps = 0/84 (0%)
 Frame = -2

Query  473  KPERFLGSNIDFKGQNFEFLPFGAGRRMCAGLPLGNRMLHFVLGSLLHTFDWELEGNVSS  294
            KPERFL  NI+++GQNFEF+PFGAGRR+CAG+PL +RMLH VLG+LL  FDWE++ +V  
Sbjct  418  KPERFLDLNIEYRGQNFEFIPFGAGRRICAGIPLAHRMLHLVLGALLSEFDWEIDVSVLD  477

Query  293  ESLDMAERMGITVRKFEPLKAIPR  222
            E+LD  +RMG+TVRK +PLKAIP+
Sbjct  478  EALDTRDRMGVTVRKLKPLKAIPK  501



>ref|XP_006339109.1| PREDICTED: cytochrome P450 76A2-like [Solanum tuberosum]
Length=505

 Score =   128 bits (322),  Expect = 7e-32, Method: Compositional matrix adjust.
 Identities = 57/86 (66%), Positives = 69/86 (80%), Gaps = 0/86 (0%)
 Frame = -2

Query  473  KPERFLGSNIDFKGQNFEFLPFGAGRRMCAGLPLGNRMLHFVLGSLLHTFDWELEGNVSS  294
            KPERFLGS ID KGQN+E +PFGAGRRMC GLPLG+RM+HF LGSLLH F+WEL   VS 
Sbjct  420  KPERFLGSKIDVKGQNYELIPFGAGRRMCVGLPLGHRMMHFALGSLLHEFEWELPDGVSP  479

Query  293  ESLDMAERMGITVRKFEPLKAIPRRV  216
            +S++M E MG+T RK + LK IP++ 
Sbjct  480  KSINMDESMGVTARKRDSLKVIPKKA  505



>ref|XP_009616474.1| PREDICTED: cytochrome P450 76A1-like [Nicotiana tomentosiformis]
Length=508

 Score =   128 bits (321),  Expect = 8e-32, Method: Compositional matrix adjust.
 Identities = 56/86 (65%), Positives = 69/86 (80%), Gaps = 0/86 (0%)
 Frame = -2

Query  473  KPERFLGSNIDFKGQNFEFLPFGAGRRMCAGLPLGNRMLHFVLGSLLHTFDWELEGNVSS  294
            KPERFLGS +D KGQ++E +PFGAGRRMC GL LG+RM+HF  GSLLH F+WEL  NVS 
Sbjct  423  KPERFLGSKVDVKGQHYELIPFGAGRRMCVGLSLGHRMMHFAFGSLLHEFNWELPNNVSP  482

Query  293  ESLDMAERMGITVRKFEPLKAIPRRV  216
            + ++M ERMG+T RK +PLK IP+R 
Sbjct  483  KYINMDERMGLTARKKQPLKVIPKRA  508



>ref|XP_004305369.1| PREDICTED: cytochrome P450 76A2-like [Fragaria vesca subsp. vesca]
Length=517

 Score =   128 bits (321),  Expect = 9e-32, Method: Compositional matrix adjust.
 Identities = 52/87 (60%), Positives = 73/87 (84%), Gaps = 0/87 (0%)
 Frame = -2

Query  473  KPERFLGSNIDFKGQNFEFLPFGAGRRMCAGLPLGNRMLHFVLGSLLHTFDWELEGNVSS  294
            KPERF+GS +D+KGQ++E +PFGAGRRMCAG+PLG++MLH  LGSLLH FDW L  NV+ 
Sbjct  425  KPERFIGSKVDYKGQHYELIPFGAGRRMCAGVPLGHKMLHLTLGSLLHQFDWALGRNVTK  484

Query  293  ESLDMAERMGITVRKFEPLKAIPRRVV  213
            +++D  +R+GIT+RK++PL A+P + +
Sbjct  485  DTMDWNDRLGITMRKYQPLLAVPTKCL  511



>ref|XP_009602679.1| PREDICTED: cytochrome P450 76A2-like [Nicotiana tomentosiformis]
Length=507

 Score =   127 bits (320),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 57/86 (66%), Positives = 68/86 (79%), Gaps = 0/86 (0%)
 Frame = -2

Query  473  KPERFLGSNIDFKGQNFEFLPFGAGRRMCAGLPLGNRMLHFVLGSLLHTFDWELEGNVSS  294
            KPERFLGS ID KGQN+E +PFGAGRRMC GLPLG+RM+HF LGSLLH FDWEL   VS 
Sbjct  422  KPERFLGSKIDVKGQNYELMPFGAGRRMCVGLPLGHRMMHFALGSLLHEFDWELPDGVSP  481

Query  293  ESLDMAERMGITVRKFEPLKAIPRRV  216
            +S++M E +G+T RK   LK IP++ 
Sbjct  482  KSINMDESLGVTARKRHSLKVIPKKA  507



>gb|KDP43097.1| hypothetical protein JCGZ_27046 [Jatropha curcas]
Length=493

 Score =   127 bits (320),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 54/85 (64%), Positives = 70/85 (82%), Gaps = 0/85 (0%)
 Frame = -2

Query  473  KPERFLGSNIDFKGQNFEFLPFGAGRRMCAGLPLGNRMLHFVLGSLLHTFDWELEGNVSS  294
            KPERF+GSNID+ GQNFE LPFG+GRR+C G+PL +R++HF L SLLH FDW+L+   +S
Sbjct  404  KPERFIGSNIDYNGQNFELLPFGSGRRICVGIPLAHRIVHFALASLLHCFDWKLDIYSAS  463

Query  293  ESLDMAERMGITVRKFEPLKAIPRR  219
            ++LDM ERMG T RK +PLKAI ++
Sbjct  464  DTLDMKERMGFTARKLKPLKAIAKK  488



>ref|XP_010687564.1| PREDICTED: cytochrome P450 76C4-like isoform X2 [Beta vulgaris 
subsp. vulgaris]
Length=221

 Score =   123 bits (309),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 54/82 (66%), Positives = 67/82 (82%), Gaps = 0/82 (0%)
 Frame = -2

Query  470  PERFLGSNIDFKGQNFEFLPFGAGRRMCAGLPLGNRMLHFVLGSLLHTFDWELEGNVSSE  291
            PERFLGSNID KG++FE +PFGAGRR+C GLPL NRM+H +LGSL+H FDW+LEG +  E
Sbjct  137  PERFLGSNIDVKGRDFELIPFGAGRRICPGLPLANRMIHLMLGSLIHGFDWKLEGGIVPE  196

Query  290  SLDMAERMGITVRKFEPLKAIP  225
             +DM E+ GIT+ K +PL AIP
Sbjct  197  KMDMEEKYGITLEKAQPLCAIP  218



>ref|XP_010687563.1| PREDICTED: cytochrome P450 76C4-like isoform X1 [Beta vulgaris 
subsp. vulgaris]
Length=241

 Score =   124 bits (310),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 54/82 (66%), Positives = 67/82 (82%), Gaps = 0/82 (0%)
 Frame = -2

Query  470  PERFLGSNIDFKGQNFEFLPFGAGRRMCAGLPLGNRMLHFVLGSLLHTFDWELEGNVSSE  291
            PERFLGSNID KG++FE +PFGAGRR+C GLPL NRM+H +LGSL+H FDW+LEG +  E
Sbjct  157  PERFLGSNIDVKGRDFELIPFGAGRRICPGLPLANRMIHLMLGSLIHGFDWKLEGGIVPE  216

Query  290  SLDMAERMGITVRKFEPLKAIP  225
             +DM E+ GIT+ K +PL AIP
Sbjct  217  KMDMEEKYGITLEKAQPLCAIP  238



>ref|XP_006339110.1| PREDICTED: cytochrome P450 76A2-like [Solanum tuberosum]
Length=541

 Score =   127 bits (320),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 57/87 (66%), Positives = 69/87 (79%), Gaps = 0/87 (0%)
 Frame = -2

Query  473  KPERFLGSNIDFKGQNFEFLPFGAGRRMCAGLPLGNRMLHFVLGSLLHTFDWELEGNVSS  294
            KPERFLGS ID KGQ++E +PFGAGRRMC GLPLG+RM+HF LGSLLH FDWEL   VS 
Sbjct  421  KPERFLGSKIDVKGQHYELIPFGAGRRMCVGLPLGHRMMHFALGSLLHEFDWELPNGVSP  480

Query  293  ESLDMAERMGITVRKFEPLKAIPRRVV  213
            +S++M E MG T RK + LK IP++ +
Sbjct  481  KSINMDESMGATARKRDSLKVIPKKAL  507



>emb|CBI30225.3| unnamed protein product [Vitis vinifera]
Length=1065

 Score =   130 bits (326),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 57/81 (70%), Positives = 69/81 (85%), Gaps = 0/81 (0%)
 Frame = -2

Query  473   KPERFLGSNIDFKGQNFEFLPFGAGRRMCAGLPLGNRMLHFVLGSLLHTFDWELEGNVSS  294
             KPERF+ SN+D+KGQNFEF+PFGAGRR+C G+PL  R+LHFVLGSLLH FDW+LE NV+ 
Sbjct  950   KPERFVDSNMDYKGQNFEFIPFGAGRRICVGIPLAYRVLHFVLGSLLHHFDWQLERNVTP  1009

Query  293   ESLDMAERMGITVRKFEPLKA  231
             E++DM ER GI + KF PLKA
Sbjct  1010  ETMDMKERRGIVICKFHPLKA  1030


 Score =   104 bits (260),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 47/83 (57%), Positives = 64/83 (77%), Gaps = 1/83 (1%)
 Frame = -2

Query  470  PERFLGSN-IDFKGQNFEFLPFGAGRRMCAGLPLGNRMLHFVLGSLLHTFDWELEGNVSS  294
            PERFL  N +D+KG +FEF+PFG+GRRMC  +PL +R+L   LGSLLH+F+W L   ++ 
Sbjct  439  PERFLEPNMVDYKGHHFEFIPFGSGRRMCPAVPLASRVLPLALGSLLHSFNWVLPDGLNP  498

Query  293  ESLDMAERMGITVRKFEPLKAIP  225
            + +DM ERMGIT+RK  PL+A+P
Sbjct  499  KEMDMTERMGITLRKSVPLRAMP  521



>ref|XP_010042416.1| PREDICTED: cytochrome P450 76A1-like [Eucalyptus grandis]
Length=186

 Score =   122 bits (306),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 54/85 (64%), Positives = 66/85 (78%), Gaps = 0/85 (0%)
 Frame = -2

Query  473  KPERFLGSNIDFKGQNFEFLPFGAGRRMCAGLPLGNRMLHFVLGSLLHTFDWELEGNVSS  294
            KPERFLGS ID+KGQNFE +PFG+GRRMC GL L +R+LH  L  LL+ FDWEL   ++ 
Sbjct  99   KPERFLGSKIDYKGQNFELIPFGSGRRMCVGLSLADRVLHLGLAKLLYHFDWELGDGLTP  158

Query  293  ESLDMAERMGITVRKFEPLKAIPRR  219
            E+LDM ER+GI VRK  PLK IP++
Sbjct  159  ETLDMTERVGIAVRKLHPLKVIPKK  183



>emb|CBI30232.3| unnamed protein product [Vitis vinifera]
Length=446

 Score =   127 bits (318),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 54/87 (62%), Positives = 72/87 (83%), Gaps = 0/87 (0%)
 Frame = -2

Query  473  KPERFLGSNIDFKGQNFEFLPFGAGRRMCAGLPLGNRMLHFVLGSLLHTFDWELEGNVSS  294
            KP RFLGS+ID+KGQNFE +PFG+GRRMC G+P  ++++ FVL SLLH FDWEL  N++ 
Sbjct  340  KPRRFLGSDIDYKGQNFELIPFGSGRRMCIGMPFAHKVVPFVLASLLHCFDWELGSNLTP  399

Query  293  ESLDMAERMGITVRKFEPLKAIPRRVV  213
            E++DM ER+G+T+RK  PLKAIPR+ +
Sbjct  400  ETIDMNERVGLTLRKLVPLKAIPRKRI  426



>ref|XP_011019179.1| PREDICTED: cytochrome P450 76A2-like [Populus euphratica]
Length=508

 Score =   127 bits (318),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 53/84 (63%), Positives = 69/84 (82%), Gaps = 0/84 (0%)
 Frame = -2

Query  470  PERFLGSNIDFKGQNFEFLPFGAGRRMCAGLPLGNRMLHFVLGSLLHTFDWELEGNVSSE  291
            PERF+G  +D++GQ+ EF+PFGAGRRMCAG+PL  R+LH +LGSLLH FDWE E +V+  
Sbjct  421  PERFIGKEVDYRGQDLEFIPFGAGRRMCAGVPLARRVLHLILGSLLHHFDWEFEAHVNPA  480

Query  290  SLDMAERMGITVRKFEPLKAIPRR  219
            S+D  +RMG+TVRK EPL A+P+R
Sbjct  481  SVDKKDRMGVTVRKSEPLIAVPKR  504



>emb|CAN76784.1| hypothetical protein VITISV_028823 [Vitis vinifera]
Length=511

 Score =   127 bits (318),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 54/88 (61%), Positives = 72/88 (82%), Gaps = 0/88 (0%)
 Frame = -2

Query  473  KPERFLGSNIDFKGQNFEFLPFGAGRRMCAGLPLGNRMLHFVLGSLLHTFDWELEGNVSS  294
            KP RFLGS+ID+KGQNFE +PFG+GRRMC G+P  ++++ FVL SLLH FDWEL  N++ 
Sbjct  421  KPRRFLGSDIDYKGQNFELIPFGSGRRMCIGMPFAHKVVPFVLASLLHCFDWELGSNLTP  480

Query  293  ESLDMAERMGITVRKFEPLKAIPRRVVA  210
            E++DM ER+G+T+RK  PLKAIPR+ + 
Sbjct  481  ETIDMNERVGLTLRKLVPLKAIPRKRIV  508



>ref|XP_007204461.1| hypothetical protein PRUPE_ppa023213mg [Prunus persica]
 gb|EMJ05660.1| hypothetical protein PRUPE_ppa023213mg [Prunus persica]
Length=462

 Score =   126 bits (317),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 52/88 (59%), Positives = 72/88 (82%), Gaps = 0/88 (0%)
 Frame = -2

Query  473  KPERFLGSNIDFKGQNFEFLPFGAGRRMCAGLPLGNRMLHFVLGSLLHTFDWELEGNVSS  294
            KPERF+GS ID+KGQ++E +PFGAGRRMCAG+PL +RMLH  LG LLH FDW L+GNV+ 
Sbjct  375  KPERFIGSKIDYKGQHYELIPFGAGRRMCAGVPLAHRMLHLTLGILLHQFDWSLDGNVTR  434

Query  293  ESLDMAERMGITVRKFEPLKAIPRRVVA  210
            +++D  +R+GI++RK  PL A+P++ + 
Sbjct  435  DTMDWKDRLGISIRKSVPLLAVPKKCLV  462



>ref|XP_002283772.1| PREDICTED: cytochrome P450 76A1 [Vitis vinifera]
 ref|XP_010654032.1| PREDICTED: cytochrome P450 76A1 [Vitis vinifera]
Length=511

 Score =   126 bits (317),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 54/88 (61%), Positives = 72/88 (82%), Gaps = 0/88 (0%)
 Frame = -2

Query  473  KPERFLGSNIDFKGQNFEFLPFGAGRRMCAGLPLGNRMLHFVLGSLLHTFDWELEGNVSS  294
            KP RFLGS+ID+KGQNFE +PFG+GRRMC G+P  ++++ FVL SLLH FDWEL  N++ 
Sbjct  421  KPRRFLGSDIDYKGQNFELIPFGSGRRMCIGMPFAHKVVPFVLASLLHCFDWELGSNLTP  480

Query  293  ESLDMAERMGITVRKFEPLKAIPRRVVA  210
            E++DM ER+G+T+RK  PLKAIPR+ + 
Sbjct  481  ETIDMNERVGLTLRKLVPLKAIPRKRIV  508



>ref|XP_004303043.1| PREDICTED: cytochrome P450 76A2-like [Fragaria vesca subsp. vesca]
Length=512

 Score =   126 bits (317),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 56/87 (64%), Positives = 71/87 (82%), Gaps = 0/87 (0%)
 Frame = -2

Query  473  KPERFLGSNIDFKGQNFEFLPFGAGRRMCAGLPLGNRMLHFVLGSLLHTFDWELEGNVSS  294
            KPERF+GS ID+KGQ++E +PFGAGRRMCAG+PLG+RMLH  LGSLLH FDW L  NVS 
Sbjct  425  KPERFIGSKIDYKGQHYELIPFGAGRRMCAGVPLGHRMLHLTLGSLLHQFDWALGRNVSK  484

Query  293  ESLDMAERMGITVRKFEPLKAIPRRVV  213
            ES++  + +GIT+RK EPL A+P + +
Sbjct  485  ESMNWNDNLGITMRKSEPLLAVPTKCL  511



>gb|KCW84349.1| hypothetical protein EUGRSUZ_B01199 [Eucalyptus grandis]
Length=285

 Score =   124 bits (311),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 55/85 (65%), Positives = 68/85 (80%), Gaps = 0/85 (0%)
 Frame = -2

Query  473  KPERFLGSNIDFKGQNFEFLPFGAGRRMCAGLPLGNRMLHFVLGSLLHTFDWELEGNVSS  294
            KPERFLGS ID+KGQNFE +PFG+GRRMC GL L +R+LH  L  LL+ FDWEL   ++S
Sbjct  198  KPERFLGSKIDYKGQNFELIPFGSGRRMCVGLSLADRVLHLGLAKLLYHFDWELSDGLTS  257

Query  293  ESLDMAERMGITVRKFEPLKAIPRR  219
            E+LDM ER+GIT+RK  PLK IP++
Sbjct  258  ETLDMRERVGITLRKLHPLKVIPKK  282



>ref|XP_010036736.1| PREDICTED: cytochrome P450 76A1-like [Eucalyptus grandis]
 gb|KCW48374.1| hypothetical protein EUGRSUZ_K02083 [Eucalyptus grandis]
Length=510

 Score =   126 bits (317),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 52/84 (62%), Positives = 70/84 (83%), Gaps = 0/84 (0%)
 Frame = -2

Query  473  KPERFLGSNIDFKGQNFEFLPFGAGRRMCAGLPLGNRMLHFVLGSLLHTFDWELEGNVSS  294
            KPERF+GS +D+KGQ+FEF+PFGAGRRMCAG+PL +R+LH   GSLLH FDWE  G    
Sbjct  423  KPERFIGSKLDYKGQHFEFIPFGAGRRMCAGVPLAHRVLHLAFGSLLHEFDWEFNGRKDP  482

Query  293  ESLDMAERMGITVRKFEPLKAIPR  222
            +++DM +R+G+T+RK+EPL A+P+
Sbjct  483  KTIDMRDRLGVTMRKYEPLLAVPK  506



>ref|XP_003520677.1| PREDICTED: cytochrome P450 76A2-like [Glycine max]
Length=516

 Score =   126 bits (317),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 55/89 (62%), Positives = 76/89 (85%), Gaps = 1/89 (1%)
 Frame = -2

Query  473  KPERFL-GSNIDFKGQNFEFLPFGAGRRMCAGLPLGNRMLHFVLGSLLHTFDWELEGNVS  297
            KPERF   +NID+KG +FEF+PFGAGRRMCAG+PL +R+LH VLGSLLH FDWEL+ +V+
Sbjct  426  KPERFSENNNIDYKGHHFEFIPFGAGRRMCAGVPLAHRVLHLVLGSLLHRFDWELDCHVT  485

Query  296  SESLDMAERMGITVRKFEPLKAIPRRVVA  210
              ++DM +++GIT+RKF+PL A+P+ +V+
Sbjct  486  PSTMDMRDKLGITMRKFQPLLAVPKLIVS  514



>gb|KHN18720.1| Cytochrome P450 76A2 [Glycine soja]
Length=516

 Score =   126 bits (317),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 55/89 (62%), Positives = 76/89 (85%), Gaps = 1/89 (1%)
 Frame = -2

Query  473  KPERFL-GSNIDFKGQNFEFLPFGAGRRMCAGLPLGNRMLHFVLGSLLHTFDWELEGNVS  297
            KPERF   +NID+KG +FEF+PFGAGRRMCAG+PL +R+LH VLGSLLH FDWEL+ +V+
Sbjct  426  KPERFSENNNIDYKGHHFEFIPFGAGRRMCAGVPLAHRVLHLVLGSLLHRFDWELDCHVT  485

Query  296  SESLDMAERMGITVRKFEPLKAIPRRVVA  210
              ++DM +++GIT+RKF+PL A+P+ +V+
Sbjct  486  PSTMDMRDKLGITMRKFQPLLAVPKLIVS  514



>ref|XP_004249463.1| PREDICTED: cytochrome P450 76A2-like [Solanum lycopersicum]
Length=518

 Score =   126 bits (316),  Expect = 5e-31, Method: Compositional matrix adjust.
 Identities = 56/86 (65%), Positives = 69/86 (80%), Gaps = 0/86 (0%)
 Frame = -2

Query  473  KPERFLGSNIDFKGQNFEFLPFGAGRRMCAGLPLGNRMLHFVLGSLLHTFDWELEGNVSS  294
            KPERFLGS ID KGQ++E +PFGAGRRMC GLPLG+RM+HF LGSLLH F+WEL   VS 
Sbjct  417  KPERFLGSKIDVKGQHYELIPFGAGRRMCVGLPLGHRMMHFALGSLLHEFEWELPDGVSP  476

Query  293  ESLDMAERMGITVRKFEPLKAIPRRV  216
            +S++M E MG+T RK + LK IP++ 
Sbjct  477  KSINMDESMGVTARKRDSLKVIPKKA  502



>gb|AGT03776.1| CYP76 hydroxylase [Withania somnifera]
Length=515

 Score =   125 bits (314),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 56/86 (65%), Positives = 69/86 (80%), Gaps = 0/86 (0%)
 Frame = -2

Query  473  KPERFLGSNIDFKGQNFEFLPFGAGRRMCAGLPLGNRMLHFVLGSLLHTFDWELEGNVSS  294
            KPERFLGS +D KGQ++E +PFGAGRRMC GLPLG+RM+HF LGSLLH F+WEL   VS 
Sbjct  423  KPERFLGSKVDMKGQHYELIPFGAGRRMCVGLPLGHRMMHFALGSLLHEFEWELPDGVSP  482

Query  293  ESLDMAERMGITVRKFEPLKAIPRRV  216
            +S++M   MGIT RK E LK IP+++
Sbjct  483  KSINMDVSMGITARKQESLKVIPKKL  508



>ref|XP_009757934.1| PREDICTED: cytochrome P450 76A2-like [Nicotiana sylvestris]
Length=506

 Score =   125 bits (313),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 56/85 (66%), Positives = 67/85 (79%), Gaps = 0/85 (0%)
 Frame = -2

Query  473  KPERFLGSNIDFKGQNFEFLPFGAGRRMCAGLPLGNRMLHFVLGSLLHTFDWELEGNVSS  294
            KPERFL SNID KGQ++E +PFGAGRRMC GLPLG+RM+HF LGSLLH FDWEL   VS 
Sbjct  421  KPERFLSSNIDVKGQHYELMPFGAGRRMCVGLPLGHRMMHFALGSLLHEFDWELPDGVSP  480

Query  293  ESLDMAERMGITVRKFEPLKAIPRR  219
            +S++M E  G+T RK   LK IP++
Sbjct  481  KSINMDESFGVTARKRHSLKVIPKK  505



>gb|KCW84345.1| hypothetical protein EUGRSUZ_B01194, partial [Eucalyptus grandis]
Length=103

 Score =   117 bits (294),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 52/85 (61%), Positives = 65/85 (76%), Gaps = 0/85 (0%)
 Frame = -2

Query  473  KPERFLGSNIDFKGQNFEFLPFGAGRRMCAGLPLGNRMLHFVLGSLLHTFDWELEGNVSS  294
            KPERFLGS ID+KGQNF+ +PFG+GRRMC GL L +R+LH  L  LL+ FDWEL   ++ 
Sbjct  16   KPERFLGSKIDYKGQNFDLIPFGSGRRMCVGLSLADRVLHLGLAKLLYHFDWELSDGLTP  75

Query  293  ESLDMAERMGITVRKFEPLKAIPRR  219
            E+LDM ER GI +RK  PLK IP++
Sbjct  76   ETLDMRERAGIALRKLHPLKVIPKK  100



>gb|KEH43603.1| cytochrome P450 family protein [Medicago truncatula]
Length=498

 Score =   124 bits (312),  Expect = 2e-30, Method: Composition-based stats.
 Identities = 53/87 (61%), Positives = 70/87 (80%), Gaps = 0/87 (0%)
 Frame = -2

Query  473  KPERFLGSNIDFKGQNFEFLPFGAGRRMCAGLPLGNRMLHFVLGSLLHTFDWELEGNVSS  294
            +PERFL SN+DFKG++FE+LPFGAGRR+C G+PL NRM+  +L  LLH+F+WEL   VS 
Sbjct  411  QPERFLNSNVDFKGRDFEYLPFGAGRRICPGIPLANRMIILMLAVLLHSFEWELPKGVSP  470

Query  293  ESLDMAERMGITVRKFEPLKAIPRRVV  213
            E+LDM+E+ GIT++K  PL A+P  VV
Sbjct  471  ETLDMSEQYGITLKKLIPLSAVPISVV  497



>gb|KCW74001.1| hypothetical protein EUGRSUZ_E02618 [Eucalyptus grandis]
Length=458

 Score =   124 bits (311),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 51/88 (58%), Positives = 70/88 (80%), Gaps = 0/88 (0%)
 Frame = -2

Query  473  KPERFLGSNIDFKGQNFEFLPFGAGRRMCAGLPLGNRMLHFVLGSLLHTFDWELEGNVSS  294
            KPERF+GS +D+KGQ++EF+PFGAGRRMCAGL L +R+LH  LGSLLH FDWE +G +  
Sbjct  371  KPERFIGSKLDYKGQHYEFIPFGAGRRMCAGLSLAHRVLHLALGSLLHEFDWEFDGRIDP  430

Query  293  ESLDMAERMGITVRKFEPLKAIPRRVVA  210
            +++DM +R+G+  RK+ PL  +P+R  A
Sbjct  431  KTIDMRDRVGLATRKYVPLLVVPKRRAA  458



>ref|XP_002528647.1| cytochrome P450, putative [Ricinus communis]
 gb|EEF33750.1| cytochrome P450, putative [Ricinus communis]
Length=512

 Score =   124 bits (312),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 52/85 (61%), Positives = 70/85 (82%), Gaps = 0/85 (0%)
 Frame = -2

Query  473  KPERFLGSNIDFKGQNFEFLPFGAGRRMCAGLPLGNRMLHFVLGSLLHTFDWELEGNVSS  294
            KPERFLGSNID+KGQ+F+ +PFG+GRR+C G+ LG R++H  L SL+H FDWE+  N +S
Sbjct  422  KPERFLGSNIDYKGQDFQLIPFGSGRRICVGMLLGQRVIHLGLASLIHYFDWEMGSNSNS  481

Query  293  ESLDMAERMGITVRKFEPLKAIPRR  219
            E++DM ER GITVRK +PLK +P++
Sbjct  482  ETIDMNERTGITVRKLDPLKLVPKK  506



>ref|XP_010683910.1| PREDICTED: cytochrome P450 76A2-like [Beta vulgaris subsp. vulgaris]
Length=511

 Score =   124 bits (311),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 50/84 (60%), Positives = 70/84 (83%), Gaps = 0/84 (0%)
 Frame = -2

Query  470  PERFLGSNIDFKGQNFEFLPFGAGRRMCAGLPLGNRMLHFVLGSLLHTFDWELEGNVSSE  291
            PERFLGS  D+KGQ++E +PFGAGRRMCAG+PL ++ML+ +LG+LLH FDWELE +++ E
Sbjct  425  PERFLGSETDYKGQHYELIPFGAGRRMCAGVPLSHKMLNLILGALLHNFDWELESHITPE  484

Query  290  SLDMAERMGITVRKFEPLKAIPRR  219
            ++D  +R+G+T +K  PLK IPR+
Sbjct  485  TIDWEDRIGLTAKKLTPLKVIPRK  508



>ref|XP_006339111.1| PREDICTED: cytochrome P450 76A2-like [Solanum tuberosum]
Length=506

 Score =   124 bits (311),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 55/86 (64%), Positives = 68/86 (79%), Gaps = 0/86 (0%)
 Frame = -2

Query  473  KPERFLGSNIDFKGQNFEFLPFGAGRRMCAGLPLGNRMLHFVLGSLLHTFDWELEGNVSS  294
            KPERFLGS +D KGQ++E +PFGAGRRMC GLPLG+RM+ F LGSLLH FDWEL   VS 
Sbjct  421  KPERFLGSKLDVKGQHYELIPFGAGRRMCVGLPLGHRMMQFALGSLLHEFDWELPDGVSP  480

Query  293  ESLDMAERMGITVRKFEPLKAIPRRV  216
            +S++M E MG+T RK + LK IP++ 
Sbjct  481  KSINMDESMGVTARKRDSLKVIPKKA  506



>gb|KCW84358.1| hypothetical protein EUGRSUZ_B012101, partial [Eucalyptus grandis]
Length=301

 Score =   122 bits (305),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 54/85 (64%), Positives = 69/85 (81%), Gaps = 0/85 (0%)
 Frame = -2

Query  473  KPERFLGSNIDFKGQNFEFLPFGAGRRMCAGLPLGNRMLHFVLGSLLHTFDWELEGNVSS  294
            KPERFLGSN DFKGQNFE +PFG+GRRMC GL L +R+LH  L +LL+ F+WEL G ++ 
Sbjct  214  KPERFLGSNTDFKGQNFELIPFGSGRRMCIGLSLAHRVLHLGLATLLYHFNWELGGGLTP  273

Query  293  ESLDMAERMGITVRKFEPLKAIPRR  219
            E+LDM ER+GIT+RK  PLK +P++
Sbjct  274  ETLDMRERIGITLRKLHPLKVVPKK  298



>ref|XP_010057042.1| PREDICTED: cytochrome P450 76A2-like [Eucalyptus grandis]
Length=511

 Score =   124 bits (310),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 51/88 (58%), Positives = 70/88 (80%), Gaps = 0/88 (0%)
 Frame = -2

Query  473  KPERFLGSNIDFKGQNFEFLPFGAGRRMCAGLPLGNRMLHFVLGSLLHTFDWELEGNVSS  294
            KPERF+GS +D+KGQ++EF+PFGAGRRMCAGL L +R+LH  LGSLLH FDWE +G +  
Sbjct  424  KPERFIGSKLDYKGQHYEFIPFGAGRRMCAGLSLAHRVLHLALGSLLHEFDWEFDGRIDP  483

Query  293  ESLDMAERMGITVRKFEPLKAIPRRVVA  210
            +++DM +R+G+  RK+ PL  +P+R  A
Sbjct  484  KTIDMRDRVGLATRKYVPLLVVPKRRAA  511



>ref|XP_010056841.1| PREDICTED: cytochrome P450 76A1-like [Eucalyptus grandis]
 gb|KCW73724.1| hypothetical protein EUGRSUZ_E02332 [Eucalyptus grandis]
Length=511

 Score =   124 bits (310),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 51/88 (58%), Positives = 70/88 (80%), Gaps = 0/88 (0%)
 Frame = -2

Query  473  KPERFLGSNIDFKGQNFEFLPFGAGRRMCAGLPLGNRMLHFVLGSLLHTFDWELEGNVSS  294
            KPERF+GS +D+KGQ++EF+PFGAGRRMCAGL L +R+LH  LGSLLH FDWE +G +  
Sbjct  424  KPERFIGSKLDYKGQHYEFIPFGAGRRMCAGLSLAHRVLHLALGSLLHEFDWEFDGRIDP  483

Query  293  ESLDMAERMGITVRKFEPLKAIPRRVVA  210
            +++DM +R+G+  RK+ PL  +P+R  A
Sbjct  484  KTIDMRDRVGLATRKYVPLLVVPKRRAA  511



>gb|KCW84351.1| hypothetical protein EUGRSUZ_B01202 [Eucalyptus grandis]
Length=293

 Score =   121 bits (304),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 54/85 (64%), Positives = 67/85 (79%), Gaps = 0/85 (0%)
 Frame = -2

Query  473  KPERFLGSNIDFKGQNFEFLPFGAGRRMCAGLPLGNRMLHFVLGSLLHTFDWELEGNVSS  294
            KPERFLGS ID+KGQNFE +PFG+GRRMC GL L +R+LH  L  LL+ FDWEL   ++ 
Sbjct  206  KPERFLGSKIDYKGQNFELIPFGSGRRMCVGLSLADRVLHLGLAKLLYHFDWELGDGLTP  265

Query  293  ESLDMAERMGITVRKFEPLKAIPRR  219
            E+LDM ER+GIT+RK  PLK IP++
Sbjct  266  ETLDMRERVGITLRKLHPLKVIPKK  290



>ref|XP_007027589.1| Cytochrome P450 76A2 [Theobroma cacao]
 gb|EOY08091.1| Cytochrome P450 76A2 [Theobroma cacao]
Length=598

 Score =   124 bits (312),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 52/85 (61%), Positives = 71/85 (84%), Gaps = 0/85 (0%)
 Frame = -2

Query  473  KPERFLGSNIDFKGQNFEFLPFGAGRRMCAGLPLGNRMLHFVLGSLLHTFDWELEGNVSS  294
            KPERF+GS I++KG ++E +PFGAGRRMCAG+ L +R+L  VLGSLLH FDWEL GNV+ 
Sbjct  509  KPERFIGSKIEYKGHHYELIPFGAGRRMCAGVALADRVLRLVLGSLLHHFDWELGGNVTK  568

Query  293  ESLDMAERMGITVRKFEPLKAIPRR  219
            E++DM + +G+T+RK EPL A+P++
Sbjct  569  ETIDMKDNLGVTMRKLEPLLAVPKK  593



>gb|KCW84354.1| hypothetical protein EUGRSUZ_B01206 [Eucalyptus grandis]
Length=498

 Score =   123 bits (309),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 54/85 (64%), Positives = 68/85 (80%), Gaps = 0/85 (0%)
 Frame = -2

Query  473  KPERFLGSNIDFKGQNFEFLPFGAGRRMCAGLPLGNRMLHFVLGSLLHTFDWELEGNVSS  294
            KPERFLGS ID+KGQNFE +PFG+GRRMC GL L +R+LH  L  LL+ FDWEL  +++ 
Sbjct  411  KPERFLGSKIDYKGQNFELIPFGSGRRMCVGLSLADRVLHLGLAKLLYHFDWELSDDLTP  470

Query  293  ESLDMAERMGITVRKFEPLKAIPRR  219
            E+LDM ER+GIT+RK  PLK IP++
Sbjct  471  ETLDMRERVGITLRKLHPLKVIPKK  495



>ref|XP_006339108.1| PREDICTED: cytochrome P450 76A2-like [Solanum tuberosum]
Length=506

 Score =   123 bits (309),  Expect = 5e-30, Method: Compositional matrix adjust.
 Identities = 55/86 (64%), Positives = 68/86 (79%), Gaps = 0/86 (0%)
 Frame = -2

Query  473  KPERFLGSNIDFKGQNFEFLPFGAGRRMCAGLPLGNRMLHFVLGSLLHTFDWELEGNVSS  294
            KPERFLGS +D KGQ++E +PFGAGRRMC GLPLG+RM+HF LGSLLH F+WEL   VS 
Sbjct  421  KPERFLGSKLDVKGQHYELIPFGAGRRMCVGLPLGHRMMHFALGSLLHEFEWELPDGVSP  480

Query  293  ESLDMAERMGITVRKFEPLKAIPRRV  216
            +S++M E MG T RK + LK IP++ 
Sbjct  481  KSINMDESMGATARKRDSLKVIPKKA  506



>gb|KEH24104.1| cytochrome P450 family protein [Medicago truncatula]
Length=519

 Score =   123 bits (309),  Expect = 5e-30, Method: Compositional matrix adjust.
 Identities = 54/88 (61%), Positives = 73/88 (83%), Gaps = 2/88 (2%)
 Frame = -2

Query  473  KPERFLGSN--IDFKGQNFEFLPFGAGRRMCAGLPLGNRMLHFVLGSLLHTFDWELEGNV  300
            KPERF   N   D++GQ++EF+PFGAGRRMCAG+PL +R+LH VLGSLLH FDWEL+ N+
Sbjct  430  KPERFCDINNKSDYRGQHYEFIPFGAGRRMCAGIPLAHRILHLVLGSLLHRFDWELDCNI  489

Query  299  SSESLDMAERMGITVRKFEPLKAIPRRV  216
            +  ++DM +R+GIT+RKF+PL A+P+ V
Sbjct  490  TPLTMDMKDRLGITMRKFQPLLAVPKLV  517



>ref|XP_002528649.1| cytochrome P450, putative [Ricinus communis]
 gb|EEF33752.1| cytochrome P450, putative [Ricinus communis]
Length=524

 Score =   123 bits (309),  Expect = 6e-30, Method: Compositional matrix adjust.
 Identities = 53/85 (62%), Positives = 69/85 (81%), Gaps = 0/85 (0%)
 Frame = -2

Query  473  KPERFLGSNIDFKGQNFEFLPFGAGRRMCAGLPLGNRMLHFVLGSLLHTFDWELEGNVSS  294
            KPERFL S+ID++G+NFE+LPFG+GRR+CAG+ L  R+LH  L SLLH FDWEL  N + 
Sbjct  436  KPERFLESDIDYRGKNFEYLPFGSGRRICAGILLAQRVLHLGLASLLHCFDWELSSNYTP  495

Query  293  ESLDMAERMGITVRKFEPLKAIPRR  219
            +S+DM E+MG+ VRK  PLKAIP++
Sbjct  496  DSIDMKEKMGMAVRKLVPLKAIPKK  520



>gb|KCW84356.1| hypothetical protein EUGRSUZ_B01208 [Eucalyptus grandis]
Length=441

 Score =   122 bits (307),  Expect = 6e-30, Method: Compositional matrix adjust.
 Identities = 56/88 (64%), Positives = 68/88 (77%), Gaps = 0/88 (0%)
 Frame = -2

Query  473  KPERFLGSNIDFKGQNFEFLPFGAGRRMCAGLPLGNRMLHFVLGSLLHTFDWELEGNVSS  294
            KPERFLGS ID+KGQNFE +PFG+GRRMC GL L +R+LH  L  LL+ FDWEL   ++ 
Sbjct  354  KPERFLGSKIDYKGQNFELIPFGSGRRMCVGLSLADRVLHLGLAKLLYHFDWELGDGLTP  413

Query  293  ESLDMAERMGITVRKFEPLKAIPRRVVA  210
            E+LDM ER+GITVRK  PLK IP++  A
Sbjct  414  ETLDMRERVGITVRKLHPLKVIPKKRSA  441



>ref|XP_010042682.1| PREDICTED: cytochrome P450 76A2-like [Eucalyptus grandis]
Length=186

 Score =   118 bits (296),  Expect = 6e-30, Method: Compositional matrix adjust.
 Identities = 51/85 (60%), Positives = 67/85 (79%), Gaps = 0/85 (0%)
 Frame = -2

Query  473  KPERFLGSNIDFKGQNFEFLPFGAGRRMCAGLPLGNRMLHFVLGSLLHTFDWELEGNVSS  294
            KPERF+GS ID+KGQNFE +PFG+GRR+C GL L +R+LH  L +LL+ FDWEL    + 
Sbjct  99   KPERFMGSKIDYKGQNFELIPFGSGRRICVGLSLADRVLHLGLATLLYHFDWELGDGSTP  158

Query  293  ESLDMAERMGITVRKFEPLKAIPRR  219
            ++LDM ER+GIT+RK  PLK IP++
Sbjct  159  KTLDMKERVGITLRKLNPLKVIPKK  183



>emb|CBI30227.3| unnamed protein product [Vitis vinifera]
Length=266

 Score =   120 bits (300),  Expect = 7e-30, Method: Compositional matrix adjust.
 Identities = 51/86 (59%), Positives = 72/86 (84%), Gaps = 1/86 (1%)
 Frame = -2

Query  473  KPERFLGSN-IDFKGQNFEFLPFGAGRRMCAGLPLGNRMLHFVLGSLLHTFDWELEGNVS  297
            KPERFL  N ID+KGQ+FE +PFGAGRRMCAG+PL +RM+H VLGSL++ FDW+L+ +++
Sbjct  169  KPERFLDLNHIDYKGQHFELIPFGAGRRMCAGVPLAHRMVHLVLGSLVYHFDWQLDSSIT  228

Query  296  SESLDMAERMGITVRKFEPLKAIPRR  219
             E++DM E + + +RK EPLKA+P++
Sbjct  229  LETMDMRENLAMVMRKLEPLKALPKK  254



>ref|XP_010676979.1| PREDICTED: geraniol 8-hydroxylase-like [Beta vulgaris subsp. 
vulgaris]
Length=500

 Score =   122 bits (307),  Expect = 8e-30, Method: Compositional matrix adjust.
 Identities = 55/83 (66%), Positives = 67/83 (81%), Gaps = 0/83 (0%)
 Frame = -2

Query  473  KPERFLGSNIDFKGQNFEFLPFGAGRRMCAGLPLGNRMLHFVLGSLLHTFDWELEGNVSS  294
            +PERFLGS IDFKG +FE +PFGAGRRMC GLPL  RMLH VLGSL+H FDW+LE  VS+
Sbjct  415  EPERFLGSEIDFKGHDFELIPFGAGRRMCLGLPLAIRMLHLVLGSLIHRFDWKLEAGVSA  474

Query  293  ESLDMAERMGITVRKFEPLKAIP  225
             ++DM ER GIT+ K + L+A+P
Sbjct  475  ANMDMEERYGITLAKAKTLRAVP  497



>ref|XP_008241318.1| PREDICTED: cytochrome P450 76A2-like [Prunus mume]
Length=509

 Score =   122 bits (307),  Expect = 9e-30, Method: Compositional matrix adjust.
 Identities = 50/88 (57%), Positives = 71/88 (81%), Gaps = 0/88 (0%)
 Frame = -2

Query  473  KPERFLGSNIDFKGQNFEFLPFGAGRRMCAGLPLGNRMLHFVLGSLLHTFDWELEGNVSS  294
            KPERF+GS ID+KGQ++E +PFGAGRRMCAG+PL +RMLH  LG LLH FDW L+GNV+ 
Sbjct  422  KPERFIGSKIDYKGQHYELIPFGAGRRMCAGVPLAHRMLHLTLGMLLHQFDWSLDGNVTR  481

Query  293  ESLDMAERMGITVRKFEPLKAIPRRVVA  210
            +++D  +++G ++RK  PL A+P++ + 
Sbjct  482  DTMDWKDKLGASMRKSVPLLAVPKKCLV  509



>ref|XP_010036221.1| PREDICTED: cytochrome P450 76A1-like [Eucalyptus grandis]
Length=506

 Score =   122 bits (306),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 54/85 (64%), Positives = 69/85 (81%), Gaps = 0/85 (0%)
 Frame = -2

Query  473  KPERFLGSNIDFKGQNFEFLPFGAGRRMCAGLPLGNRMLHFVLGSLLHTFDWELEGNVSS  294
            KPERFLGSN DFKGQNFE +PFG+GRRMC GL L +R+LH  L +LL+ F+WEL G ++ 
Sbjct  419  KPERFLGSNTDFKGQNFELIPFGSGRRMCIGLSLAHRVLHLGLATLLYHFNWELGGGLTP  478

Query  293  ESLDMAERMGITVRKFEPLKAIPRR  219
            E+LDM ER+GIT+RK  PLK +P++
Sbjct  479  ETLDMRERIGITLRKLHPLKVVPKK  503



>gb|EYU29599.1| hypothetical protein MIMGU_mgv1a026574mg [Erythranthe guttata]
Length=500

 Score =   121 bits (304),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 55/85 (65%), Positives = 67/85 (79%), Gaps = 0/85 (0%)
 Frame = -2

Query  473  KPERFLGSNIDFKGQNFEFLPFGAGRRMCAGLPLGNRMLHFVLGSLLHTFDWELEGNVSS  294
            KPERFLGS IDFKG +FE +PFGAGRR+CAG+PL +RMLH VLG+LLH FDW ++     
Sbjct  413  KPERFLGSKIDFKGHHFELIPFGAGRRICAGIPLAHRMLHLVLGTLLHEFDWRVDEIERK  472

Query  293  ESLDMAERMGITVRKFEPLKAIPRR  219
              +D  ER+G+TVRK  PLKAIP+R
Sbjct  473  GMIDTRERIGVTVRKLVPLKAIPQR  497



>ref|XP_010045880.1| PREDICTED: cytochrome P450 76A1-like, partial [Eucalyptus grandis]
Length=475

 Score =   121 bits (304),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 54/85 (64%), Positives = 67/85 (79%), Gaps = 0/85 (0%)
 Frame = -2

Query  473  KPERFLGSNIDFKGQNFEFLPFGAGRRMCAGLPLGNRMLHFVLGSLLHTFDWELEGNVSS  294
            KPERFLGS ID+KGQNFE +PFG+GRRMC GL L +R+LH  L  LL+ FDWEL   ++ 
Sbjct  388  KPERFLGSKIDYKGQNFELIPFGSGRRMCVGLSLADRVLHLGLAKLLYHFDWELGDGLTP  447

Query  293  ESLDMAERMGITVRKFEPLKAIPRR  219
            E+LDM ER+GIT+RK  PLK IP++
Sbjct  448  ETLDMRERVGITLRKLHPLKVIPKK  472



>gb|KCW84348.1| hypothetical protein EUGRSUZ_B01197 [Eucalyptus grandis]
Length=318

 Score =   120 bits (300),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 53/85 (62%), Positives = 66/85 (78%), Gaps = 0/85 (0%)
 Frame = -2

Query  473  KPERFLGSNIDFKGQNFEFLPFGAGRRMCAGLPLGNRMLHFVLGSLLHTFDWELEGNVSS  294
            KPERFLGS ID+KGQNFE +PFG+GRRMC GL L +R+LH  L  LL+ FDWEL   ++S
Sbjct  231  KPERFLGSKIDYKGQNFELIPFGSGRRMCVGLSLADRVLHLGLAKLLYHFDWELSDGLTS  290

Query  293  ESLDMAERMGITVRKFEPLKAIPRR  219
            E+LDM ER+GI +RK   LK IP++
Sbjct  291  ETLDMRERVGIALRKLHSLKVIPKK  315



>emb|CAN77400.1| hypothetical protein VITISV_015278 [Vitis vinifera]
Length=456

 Score =   121 bits (303),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 52/87 (60%), Positives = 73/87 (84%), Gaps = 1/87 (1%)
 Frame = -2

Query  473  KPERFLGSN-IDFKGQNFEFLPFGAGRRMCAGLPLGNRMLHFVLGSLLHTFDWELEGNVS  297
            KPERFL  N ID+KGQ+FE +PFGAGRRMCAG+PL +RM+H VLGSL++ FDW+L+ +++
Sbjct  368  KPERFLDLNHIDYKGQHFELIPFGAGRRMCAGVPLAHRMVHLVLGSLVYHFDWQLDSSIT  427

Query  296  SESLDMAERMGITVRKFEPLKAIPRRV  216
             E++DM E + + +RK EPLKA+P++V
Sbjct  428  LETMDMRENLAMVMRKLEPLKALPKKV  454



>ref|XP_007040049.1| Cytochrome P450, putative [Theobroma cacao]
 gb|EOY24550.1| Cytochrome P450, putative [Theobroma cacao]
Length=500

 Score =   121 bits (303),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 52/85 (61%), Positives = 70/85 (82%), Gaps = 0/85 (0%)
 Frame = -2

Query  470  PERFLGSNIDFKGQNFEFLPFGAGRRMCAGLPLGNRMLHFVLGSLLHTFDWELEGNVSSE  291
            PERF+GS+ID KG++F  +PFGAGRR+C GLPL NRMLH +LGSL+H+FDW+LEG +S E
Sbjct  416  PERFMGSDIDVKGRDFGLIPFGAGRRICPGLPLANRMLHLMLGSLIHSFDWKLEGGISPE  475

Query  290  SLDMAERMGITVRKFEPLKAIPRRV  216
             ++M E+ G+T++  EPL+AIP  V
Sbjct  476  DMNMEEKFGLTLQLAEPLRAIPTPV  500



>gb|KEH43874.1| cytochrome P450 family protein [Medicago truncatula]
Length=500

 Score =   120 bits (302),  Expect = 4e-29, Method: Composition-based stats.
 Identities = 50/85 (59%), Positives = 70/85 (82%), Gaps = 0/85 (0%)
 Frame = -2

Query  470  PERFLGSNIDFKGQNFEFLPFGAGRRMCAGLPLGNRMLHFVLGSLLHTFDWELEGNVSSE  291
            PERFLGS+ID KG+NFE +PFGAGRR+C GL L NRML  +LGSL+++FDW+LEG++  E
Sbjct  414  PERFLGSDIDVKGRNFELVPFGAGRRICPGLQLANRMLLLMLGSLVNSFDWKLEGDMKPE  473

Query  290  SLDMAERMGITVRKFEPLKAIPRRV  216
             +DM ++ GIT++K +PL+ +P R+
Sbjct  474  DMDMNDKFGITLQKAQPLRVVPVRI  498



>gb|KDP20523.1| hypothetical protein JCGZ_05069 [Jatropha curcas]
Length=513

 Score =   120 bits (302),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 51/86 (59%), Positives = 68/86 (79%), Gaps = 0/86 (0%)
 Frame = -2

Query  473  KPERFLGSNIDFKGQNFEFLPFGAGRRMCAGLPLGNRMLHFVLGSLLHTFDWELEGNVSS  294
            KPERF+ SNID++GQNFE LPFGAGRR+C G+P+ +R+LH V+ SLLH FDWE+    + 
Sbjct  425  KPERFIDSNIDYRGQNFELLPFGAGRRICPGIPMAHRVLHHVVASLLHCFDWEVGSGSTP  484

Query  293  ESLDMAERMGITVRKFEPLKAIPRRV  216
             ++DM E MGITVRK  PL+A P+++
Sbjct  485  RTIDMKEGMGITVRKLIPLRATPKKI  510



>ref|XP_002277661.2| PREDICTED: cytochrome P450 76A1-like [Vitis vinifera]
Length=518

 Score =   120 bits (302),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 52/87 (60%), Positives = 73/87 (84%), Gaps = 1/87 (1%)
 Frame = -2

Query  473  KPERFLGSN-IDFKGQNFEFLPFGAGRRMCAGLPLGNRMLHFVLGSLLHTFDWELEGNVS  297
            KPERFL  N ID+KGQ+FE +PFGAGRRMCAG+PL +RM+H VLGSL++ FDW+L+ +++
Sbjct  430  KPERFLDLNHIDYKGQHFELIPFGAGRRMCAGVPLAHRMVHLVLGSLVYHFDWQLDSSIT  489

Query  296  SESLDMAERMGITVRKFEPLKAIPRRV  216
             E++DM E + + +RK EPLKA+P++V
Sbjct  490  LETMDMRENLAMVMRKLEPLKALPKKV  516



>ref|XP_006451465.1| hypothetical protein CICLE_v10008099mg [Citrus clementina]
 ref|XP_006451466.1| hypothetical protein CICLE_v10008099mg [Citrus clementina]
 ref|XP_006451467.1| hypothetical protein CICLE_v10008099mg [Citrus clementina]
 ref|XP_006451468.1| hypothetical protein CICLE_v10008099mg [Citrus clementina]
 ref|XP_006475423.1| PREDICTED: geraniol 8-hydroxylase-like isoform X1 [Citrus sinensis]
 ref|XP_006475424.1| PREDICTED: geraniol 8-hydroxylase-like isoform X2 [Citrus sinensis]
 ref|XP_006475425.1| PREDICTED: geraniol 8-hydroxylase-like isoform X3 [Citrus sinensis]
 gb|ESR64705.1| hypothetical protein CICLE_v10008099mg [Citrus clementina]
 gb|ESR64706.1| hypothetical protein CICLE_v10008099mg [Citrus clementina]
 gb|ESR64707.1| hypothetical protein CICLE_v10008099mg [Citrus clementina]
 gb|ESR64708.1| hypothetical protein CICLE_v10008099mg [Citrus clementina]
 gb|KDO57774.1| hypothetical protein CISIN_1g011093mg [Citrus sinensis]
Length=494

 Score =   120 bits (302),  Expect = 4e-29, Method: Composition-based stats.
 Identities = 49/83 (59%), Positives = 69/83 (83%), Gaps = 0/83 (0%)
 Frame = -2

Query  473  KPERFLGSNIDFKGQNFEFLPFGAGRRMCAGLPLGNRMLHFVLGSLLHTFDWELEGNVSS  294
            KPERFLGS++D KG+NFE +PFGAGRR+C GLPL  RML+ +LGSL+ +FDW+L+  V+S
Sbjct  409  KPERFLGSDVDVKGRNFELIPFGAGRRICPGLPLAIRMLYLMLGSLIKSFDWKLDNEVTS  468

Query  293  ESLDMAERMGITVRKFEPLKAIP  225
             ++DM E+ GIT++K +PL+ +P
Sbjct  469  GNIDMEEKFGITLQKAQPLRVVP  491



>gb|KDO57775.1| hypothetical protein CISIN_1g011069mg [Citrus sinensis]
Length=494

 Score =   120 bits (301),  Expect = 5e-29, Method: Compositional matrix adjust.
 Identities = 50/83 (60%), Positives = 69/83 (83%), Gaps = 0/83 (0%)
 Frame = -2

Query  473  KPERFLGSNIDFKGQNFEFLPFGAGRRMCAGLPLGNRMLHFVLGSLLHTFDWELEGNVSS  294
            KPERFLG ++D KG+NFE +PFGAGRR+C GLPL  RMLH +LGSL+ +FDW+LE  V++
Sbjct  409  KPERFLGLDVDVKGRNFELIPFGAGRRICPGLPLAIRMLHLMLGSLIKSFDWKLESKVTT  468

Query  293  ESLDMAERMGITVRKFEPLKAIP  225
            E++DM E+ GIT++K +PL+ +P
Sbjct  469  ENMDMEEKFGITLQKAQPLRVVP  491



>ref|XP_006451469.1| hypothetical protein CICLE_v10008095mg [Citrus clementina]
 ref|XP_006475422.1| PREDICTED: geraniol 8-hydroxylase-like [Citrus sinensis]
 gb|ESR64709.1| hypothetical protein CICLE_v10008095mg [Citrus clementina]
Length=494

 Score =   120 bits (301),  Expect = 5e-29, Method: Compositional matrix adjust.
 Identities = 50/86 (58%), Positives = 70/86 (81%), Gaps = 0/86 (0%)
 Frame = -2

Query  473  KPERFLGSNIDFKGQNFEFLPFGAGRRMCAGLPLGNRMLHFVLGSLLHTFDWELEGNVSS  294
            KPERFLG ++D KG+NFE +PFGAGRR+C GLPL  RMLH +LGSL+ +FDW+LE  V++
Sbjct  409  KPERFLGLDVDVKGRNFELIPFGAGRRICPGLPLAIRMLHLMLGSLIKSFDWKLESKVTT  468

Query  293  ESLDMAERMGITVRKFEPLKAIPRRV  216
            E++DM E+ GIT++K +PL+ +P  +
Sbjct  469  ENMDMEEKFGITLQKAQPLRVVPDAI  494



>emb|CAN77399.1| hypothetical protein VITISV_015277 [Vitis vinifera]
Length=508

 Score =   120 bits (301),  Expect = 5e-29, Method: Compositional matrix adjust.
 Identities = 51/87 (59%), Positives = 73/87 (84%), Gaps = 1/87 (1%)
 Frame = -2

Query  473  KPERFLGSN-IDFKGQNFEFLPFGAGRRMCAGLPLGNRMLHFVLGSLLHTFDWELEGNVS  297
            KPERFL  N ID+KGQ+F+ +PFGAGRRMCAG+PL +RM+H VLGSL++ FDW+L+ +++
Sbjct  420  KPERFLDLNHIDYKGQHFZLIPFGAGRRMCAGVPLAHRMVHLVLGSLVYHFDWQLDSSIT  479

Query  296  SESLDMAERMGITVRKFEPLKAIPRRV  216
             E++DM E + + +RK EPLKA+P++V
Sbjct  480  LETMDMRENLAMVMRKLEPLKALPKKV  506



>emb|CBI34790.3| unnamed protein product [Vitis vinifera]
Length=373

 Score =   119 bits (298),  Expect = 6e-29, Method: Compositional matrix adjust.
 Identities = 50/85 (59%), Positives = 70/85 (82%), Gaps = 0/85 (0%)
 Frame = -2

Query  470  PERFLGSNIDFKGQNFEFLPFGAGRRMCAGLPLGNRMLHFVLGSLLHTFDWELEGNVSSE  291
            PERFLG ++D KGQNFE +PFGAGRR+C GLPL  RM+H +L SL+H++DW+LE  V+ E
Sbjct  289  PERFLGLDMDVKGQNFELIPFGAGRRICPGLPLAIRMVHLMLASLIHSYDWKLEDGVTPE  348

Query  290  SLDMAERMGITVRKFEPLKAIPRRV  216
            +++M ER GI+++K +PL+A+P RV
Sbjct  349  NMNMEERYGISLQKAQPLQALPVRV  373



>ref|XP_006853500.1| hypothetical protein AMTR_s00032p00217210 [Amborella trichopoda]
 gb|ERN14967.1| hypothetical protein AMTR_s00032p00217210 [Amborella trichopoda]
Length=162

 Score =   115 bits (287),  Expect = 6e-29, Method: Compositional matrix adjust.
 Identities = 47/82 (57%), Positives = 65/82 (79%), Gaps = 0/82 (0%)
 Frame = -2

Query  470  PERFLGSNIDFKGQNFEFLPFGAGRRMCAGLPLGNRMLHFVLGSLLHTFDWELEGNVSSE  291
            PERFLG N+D+KG++F+F+PFGAG + C GLPLG RM+H +L SLLH FDWEL G + +E
Sbjct  72   PERFLGCNVDYKGKDFQFIPFGAGWKTCPGLPLGVRMVHLMLASLLHYFDWELSGGLKAE  131

Query  290  SLDMAERMGITVRKFEPLKAIP  225
             +DM ++ G+T++   PL+AIP
Sbjct  132  EMDMRDKFGVTLQTLVPLRAIP  153



>ref|XP_010036187.1| PREDICTED: cytochrome P450 76A1-like [Eucalyptus grandis]
Length=506

 Score =   120 bits (300),  Expect = 9e-29, Method: Compositional matrix adjust.
 Identities = 53/85 (62%), Positives = 66/85 (78%), Gaps = 0/85 (0%)
 Frame = -2

Query  473  KPERFLGSNIDFKGQNFEFLPFGAGRRMCAGLPLGNRMLHFVLGSLLHTFDWELEGNVSS  294
            KPERFLGS ID+KGQNFE +PFG+GRRMC GL L +R+LH  L  LL+ FDWEL   ++S
Sbjct  419  KPERFLGSKIDYKGQNFELIPFGSGRRMCVGLSLADRVLHLGLAKLLYHFDWELSDGLTS  478

Query  293  ESLDMAERMGITVRKFEPLKAIPRR  219
            E+LDM ER+GI +RK   LK IP++
Sbjct  479  ETLDMRERVGIALRKLHSLKVIPKK  503



>emb|CDP10329.1| unnamed protein product [Coffea canephora]
Length=470

 Score =   119 bits (299),  Expect = 9e-29, Method: Compositional matrix adjust.
 Identities = 49/87 (56%), Positives = 65/87 (75%), Gaps = 0/87 (0%)
 Frame = -2

Query  470  PERFLGSNIDFKGQNFEFLPFGAGRRMCAGLPLGNRMLHFVLGSLLHTFDWELEGNVSSE  291
            PERFL S ID KGQ+FE LPFG GRRMC G+PL +R +H  + SL+H FDW++EG +  E
Sbjct  384  PERFLDSEIDVKGQHFELLPFGTGRRMCLGMPLADRFIHLTVASLIHNFDWKIEGGIKPE  443

Query  290  SLDMAERMGITVRKFEPLKAIPRRVVA  210
             +DM+E++G+T++K  PLKAIP R   
Sbjct  444  DVDMSEKLGVTMQKALPLKAIPTRTTV  470



>ref|XP_002277725.1| PREDICTED: cytochrome P450 76A1 [Vitis vinifera]
Length=508

 Score =   119 bits (299),  Expect = 9e-29, Method: Compositional matrix adjust.
 Identities = 51/87 (59%), Positives = 73/87 (84%), Gaps = 1/87 (1%)
 Frame = -2

Query  473  KPERFLGSN-IDFKGQNFEFLPFGAGRRMCAGLPLGNRMLHFVLGSLLHTFDWELEGNVS  297
            KPERFL  N ID+KGQ+F+ +PFGAGRRMCAG+PL +RM+H VLGSL++ FDW+L+ +++
Sbjct  420  KPERFLDLNHIDYKGQHFQLIPFGAGRRMCAGVPLAHRMVHLVLGSLVYHFDWQLDSSIT  479

Query  296  SESLDMAERMGITVRKFEPLKAIPRRV  216
             E++DM E + + +RK EPLKA+P++V
Sbjct  480  LETMDMRENLAMVMRKLEPLKALPKKV  506



>gb|KCW74002.1| hypothetical protein EUGRSUZ_E02619, partial [Eucalyptus grandis]
Length=482

 Score =   119 bits (299),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 50/88 (57%), Positives = 69/88 (78%), Gaps = 0/88 (0%)
 Frame = -2

Query  473  KPERFLGSNIDFKGQNFEFLPFGAGRRMCAGLPLGNRMLHFVLGSLLHTFDWELEGNVSS  294
            KPERF+GS +D+KGQ++EF+PFGAGRRM AGL L +R+LH  LGSLLH FDWE +G +  
Sbjct  395  KPERFIGSKLDYKGQHYEFIPFGAGRRMYAGLSLAHRVLHLALGSLLHEFDWEFDGRIDP  454

Query  293  ESLDMAERMGITVRKFEPLKAIPRRVVA  210
            +++DM +R+G+  RK+ PL  +P+R  A
Sbjct  455  KTIDMRDRVGLATRKYVPLLVVPKRRAA  482



>gb|KDO43350.1| hypothetical protein CISIN_1g039984mg, partial [Citrus sinensis]
Length=93

 Score =   112 bits (280),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 51/82 (62%), Positives = 67/82 (82%), Gaps = 4/82 (5%)
 Frame = -2

Query  470  PERFLGSNIDFKGQNFEFLPFGAGRRMCAGLPLGNRMLHFVLGSLLHTFDWELEGNVSSE  291
            PERFL SN+DFKGQNFE +PFGAGRR+C GLPL  RML+ +LGSL+++FDW+LE     E
Sbjct  13   PERFLRSNVDFKGQNFELIPFGAGRRICPGLPLAIRMLYLMLGSLINSFDWKLE----DE  68

Query  290  SLDMAERMGITVRKFEPLKAIP  225
            ++DM E+ GIT+ K +PL+A+P
Sbjct  69   NMDMEEKFGITIMKAQPLRAVP  90



>ref|NP_001268152.1| ripening-related P-450 enzyme-like [Vitis vinifera]
 emb|CAB85635.1| putative ripening-related P-450 enzyme [Vitis vinifera]
Length=499

 Score =   119 bits (298),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 50/85 (59%), Positives = 70/85 (82%), Gaps = 0/85 (0%)
 Frame = -2

Query  470  PERFLGSNIDFKGQNFEFLPFGAGRRMCAGLPLGNRMLHFVLGSLLHTFDWELEGNVSSE  291
            PERFLG ++D KGQNFE +PFGAGRR+C GLPL  RM+H +L SL+H++DW+LE  V+ E
Sbjct  415  PERFLGLDMDVKGQNFELIPFGAGRRICPGLPLAIRMVHLMLASLIHSYDWKLEDGVTPE  474

Query  290  SLDMAERMGITVRKFEPLKAIPRRV  216
            +++M ER GI+++K +PL+A+P RV
Sbjct  475  NMNMEERYGISLQKAQPLQALPVRV  499



>ref|XP_010057043.1| PREDICTED: cytochrome P450 76A1-like [Eucalyptus grandis]
Length=511

 Score =   119 bits (299),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 50/88 (57%), Positives = 69/88 (78%), Gaps = 0/88 (0%)
 Frame = -2

Query  473  KPERFLGSNIDFKGQNFEFLPFGAGRRMCAGLPLGNRMLHFVLGSLLHTFDWELEGNVSS  294
            KPERF+GS +D+KGQ++EF+PFGAGRRM AGL L +R+LH  LGSLLH FDWE +G +  
Sbjct  424  KPERFIGSKLDYKGQHYEFIPFGAGRRMYAGLSLAHRVLHLALGSLLHEFDWEFDGRIDP  483

Query  293  ESLDMAERMGITVRKFEPLKAIPRRVVA  210
            +++DM +R+G+  RK+ PL  +P+R  A
Sbjct  484  KTIDMRDRVGLATRKYVPLLVVPKRRAA  511



>ref|XP_010658029.1| PREDICTED: ripening-related P-450 enzyme-like isoform X1 [Vitis 
vinifera]
 ref|XP_010658036.1| PREDICTED: ripening-related P-450 enzyme-like isoform X1 [Vitis 
vinifera]
Length=499

 Score =   119 bits (298),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 50/85 (59%), Positives = 70/85 (82%), Gaps = 0/85 (0%)
 Frame = -2

Query  470  PERFLGSNIDFKGQNFEFLPFGAGRRMCAGLPLGNRMLHFVLGSLLHTFDWELEGNVSSE  291
            PERFLG ++D KGQNFE +PFGAGRR+C GLPL  RM+H +L SL+H++DW+LE  V+ E
Sbjct  415  PERFLGLDMDVKGQNFELIPFGAGRRICPGLPLAIRMVHLMLASLIHSYDWKLEDGVTPE  474

Query  290  SLDMAERMGITVRKFEPLKAIPRRV  216
            +++M ER GI+++K +PL+A+P RV
Sbjct  475  NMNMEERYGISLQKAQPLQALPVRV  499



>ref|XP_006423671.1| hypothetical protein CICLE_v10028269mg [Citrus clementina]
 gb|ESR36911.1| hypothetical protein CICLE_v10028269mg [Citrus clementina]
Length=495

 Score =   119 bits (298),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 53/83 (64%), Positives = 70/83 (84%), Gaps = 4/83 (5%)
 Frame = -2

Query  473  KPERFLGSNIDFKGQNFEFLPFGAGRRMCAGLPLGNRMLHFVLGSLLHTFDWELEGNVSS  294
            KPERFLGS++DFKGQNFE +PFGAGRR+C GLPL  RML+ +LGSL+++FDW+LE     
Sbjct  414  KPERFLGSDVDFKGQNFELIPFGAGRRICPGLPLAIRMLYLMLGSLINSFDWKLE----D  469

Query  293  ESLDMAERMGITVRKFEPLKAIP  225
            ESLDM E+ G+T++K +PL+A+P
Sbjct  470  ESLDMKEKFGLTIQKAKPLRAVP  492



>ref|XP_009763141.1| PREDICTED: geraniol 8-hydroxylase-like [Nicotiana sylvestris]
Length=498

 Score =   119 bits (297),  Expect = 2e-28, Method: Composition-based stats.
 Identities = 48/83 (58%), Positives = 66/83 (80%), Gaps = 0/83 (0%)
 Frame = -2

Query  473  KPERFLGSNIDFKGQNFEFLPFGAGRRMCAGLPLGNRMLHFVLGSLLHTFDWELEGNVSS  294
            KPERF GS +D +GQ+FEF+PFGAGRR+C GLPL NR +  +LGSLL++FDW+ EG+++ 
Sbjct  413  KPERFWGSKVDVRGQDFEFIPFGAGRRICPGLPLANRTVPVMLGSLLNSFDWKAEGDIAP  472

Query  293  ESLDMAERMGITVRKFEPLKAIP  225
              LD+ ER GIT+ +  PL+A+P
Sbjct  473  ADLDVEERFGITLARARPLRAVP  495



>ref|XP_006853505.1| hypothetical protein AMTR_s00032p00218900 [Amborella trichopoda]
 gb|ERN14972.1| hypothetical protein AMTR_s00032p00218900 [Amborella trichopoda]
Length=208

 Score =   115 bits (287),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 47/84 (56%), Positives = 68/84 (81%), Gaps = 0/84 (0%)
 Frame = -2

Query  470  PERFLGSNIDFKGQNFEFLPFGAGRRMCAGLPLGNRMLHFVLGSLLHTFDWELEGNVSSE  291
            PERF+GSNI++KG++F+++PFGAGRR+C GLPLG RM+  VL SLLH+FDWEL   +  E
Sbjct  117  PERFVGSNINYKGRDFQYIPFGAGRRICPGLPLGVRMVQIVLASLLHSFDWELPDGLKPE  176

Query  290  SLDMAERMGITVRKFEPLKAIPRR  219
             +DM ++ G+T++K  PL+A+P +
Sbjct  177  EMDMRDKFGVTLQKAVPLEAVPVK  200



>ref|XP_010053380.1| PREDICTED: geraniol 8-hydroxylase-like [Eucalyptus grandis]
 gb|KCW77658.1| hypothetical protein EUGRSUZ_D01956 [Eucalyptus grandis]
Length=498

 Score =   119 bits (297),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 52/83 (63%), Positives = 67/83 (81%), Gaps = 0/83 (0%)
 Frame = -2

Query  470  PERFLGSNIDFKGQNFEFLPFGAGRRMCAGLPLGNRMLHFVLGSLLHTFDWELEGNVSSE  291
            PERFLGS ID KGQ+FE  PFGAGRR+C GLPL  RMLH++LGSL+++F+WELEG V  E
Sbjct  414  PERFLGSEIDVKGQDFELTPFGAGRRICPGLPLALRMLHWMLGSLINSFNWELEGKVKPE  473

Query  290  SLDMAERMGITVRKFEPLKAIPR  222
             L M E+ GIT+++ +PL+ IP+
Sbjct  474  DLSMEEKFGITLQRAQPLRVIPK  496



>ref|XP_006339107.1| PREDICTED: cytochrome P450 76A2-like [Solanum tuberosum]
Length=506

 Score =   119 bits (297),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 53/83 (64%), Positives = 65/83 (78%), Gaps = 0/83 (0%)
 Frame = -2

Query  473  KPERFLGSNIDFKGQNFEFLPFGAGRRMCAGLPLGNRMLHFVLGSLLHTFDWELEGNVSS  294
            KPERF+GS ID KGQ++  +PFGAGRRMC GLPLG+RM+ F LGSLLH FDWEL   V+ 
Sbjct  421  KPERFVGSKIDVKGQHYGLIPFGAGRRMCVGLPLGHRMMQFALGSLLHQFDWELPDGVTP  480

Query  293  ESLDMAERMGITVRKFEPLKAIP  225
            +S++M E MG+T RK + LK IP
Sbjct  481  KSINMDESMGVTARKRDSLKVIP  503



>ref|XP_006494410.1| PREDICTED: geraniol 8-hydroxylase-like [Citrus sinensis]
Length=488

 Score =   118 bits (296),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 52/83 (63%), Positives = 70/83 (84%), Gaps = 4/83 (5%)
 Frame = -2

Query  473  KPERFLGSNIDFKGQNFEFLPFGAGRRMCAGLPLGNRMLHFVLGSLLHTFDWELEGNVSS  294
            KPERFLGS++DFKGQNFE +PFGAGRR+C GLPL  RML+ +LGSL+++FDW+LE     
Sbjct  407  KPERFLGSDVDFKGQNFELIPFGAGRRICPGLPLAIRMLYLMLGSLINSFDWKLE----D  462

Query  293  ESLDMAERMGITVRKFEPLKAIP  225
            ES+DM E+ G+T++K +PL+A+P
Sbjct  463  ESMDMKEKFGLTIQKAKPLRAVP  485



>gb|KCW84347.1| hypothetical protein EUGRSUZ_B011961, partial [Eucalyptus grandis]
Length=337

 Score =   117 bits (293),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 51/85 (60%), Positives = 67/85 (79%), Gaps = 0/85 (0%)
 Frame = -2

Query  473  KPERFLGSNIDFKGQNFEFLPFGAGRRMCAGLPLGNRMLHFVLGSLLHTFDWELEGNVSS  294
            KPERF+GS ID+KGQNFE +PFG+GRR+C GL L +R+LH  L +LL+ FDWEL    + 
Sbjct  250  KPERFVGSKIDYKGQNFELIPFGSGRRICVGLSLADRVLHLGLATLLYHFDWELGDGSTP  309

Query  293  ESLDMAERMGITVRKFEPLKAIPRR  219
            ++LDM ER+GIT+RK  PLK IP++
Sbjct  310  KTLDMKERVGITLRKLHPLKVIPKK  334



>ref|XP_010036165.1| PREDICTED: cytochrome P450 76A1-like [Eucalyptus grandis]
Length=506

 Score =   119 bits (297),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 52/85 (61%), Positives = 65/85 (76%), Gaps = 0/85 (0%)
 Frame = -2

Query  473  KPERFLGSNIDFKGQNFEFLPFGAGRRMCAGLPLGNRMLHFVLGSLLHTFDWELEGNVSS  294
            KPERFLGS ID+KGQNF+ +PFG+GRRMC GL L +R+LH  L  LL+ FDWEL   ++ 
Sbjct  419  KPERFLGSKIDYKGQNFDLIPFGSGRRMCVGLSLADRVLHLGLAKLLYHFDWELSDGLTP  478

Query  293  ESLDMAERMGITVRKFEPLKAIPRR  219
            E+LDM ER GI +RK  PLK IP++
Sbjct  479  ETLDMRERAGIALRKLHPLKVIPKK  503



>gb|KCW77657.1| hypothetical protein EUGRSUZ_D01955 [Eucalyptus grandis]
Length=487

 Score =   118 bits (296),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 52/83 (63%), Positives = 67/83 (81%), Gaps = 0/83 (0%)
 Frame = -2

Query  470  PERFLGSNIDFKGQNFEFLPFGAGRRMCAGLPLGNRMLHFVLGSLLHTFDWELEGNVSSE  291
            PERFLGS ID KGQ+FE  PFGAGRR+C GLPL  RMLH++LGSL+++F+WELEG V  E
Sbjct  403  PERFLGSEIDVKGQDFELAPFGAGRRICPGLPLALRMLHWMLGSLINSFNWELEGKVKPE  462

Query  290  SLDMAERMGITVRKFEPLKAIPR  222
             L M E+ GIT+++ +PL+ IP+
Sbjct  463  DLSMEEKFGITLQRAQPLRVIPK  485



>ref|XP_002509653.1| cytochrome P450, putative [Ricinus communis]
 gb|EEF51040.1| cytochrome P450, putative [Ricinus communis]
Length=501

 Score =   118 bits (296),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 52/86 (60%), Positives = 70/86 (81%), Gaps = 0/86 (0%)
 Frame = -2

Query  473  KPERFLGSNIDFKGQNFEFLPFGAGRRMCAGLPLGNRMLHFVLGSLLHTFDWELEGNVSS  294
            +PERFL SNID +GQ FE +PFGAGRR+C GLPL  RMLH +LGSL+++FDW+LE  V+ 
Sbjct  416  RPERFLESNIDARGQYFELIPFGAGRRICPGLPLAIRMLHLLLGSLIYSFDWKLEDGVTP  475

Query  293  ESLDMAERMGITVRKFEPLKAIPRRV  216
            E++DM +R GI+++K +PL AIP +V
Sbjct  476  ENMDMEDRFGISLQKAKPLIAIPNQV  501



>ref|XP_010053379.1| PREDICTED: geraniol 8-hydroxylase-like [Eucalyptus grandis]
Length=498

 Score =   118 bits (296),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 52/83 (63%), Positives = 67/83 (81%), Gaps = 0/83 (0%)
 Frame = -2

Query  470  PERFLGSNIDFKGQNFEFLPFGAGRRMCAGLPLGNRMLHFVLGSLLHTFDWELEGNVSSE  291
            PERFLGS ID KGQ+FE  PFGAGRR+C GLPL  RMLH++LGSL+++F+WELEG V  E
Sbjct  414  PERFLGSEIDVKGQDFELAPFGAGRRICPGLPLALRMLHWMLGSLINSFNWELEGKVKPE  473

Query  290  SLDMAERMGITVRKFEPLKAIPR  222
             L M E+ GIT+++ +PL+ IP+
Sbjct  474  DLSMEEKFGITLQRAQPLRVIPK  496



>ref|XP_006494407.1| PREDICTED: geraniol 8-hydroxylase-like [Citrus sinensis]
Length=495

 Score =   118 bits (296),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 52/83 (63%), Positives = 70/83 (84%), Gaps = 4/83 (5%)
 Frame = -2

Query  473  KPERFLGSNIDFKGQNFEFLPFGAGRRMCAGLPLGNRMLHFVLGSLLHTFDWELEGNVSS  294
            KPERFLGS++DFKGQNFE +PFGAGRR+C GLPL  RML+ +LGSL+++FDW+LE     
Sbjct  414  KPERFLGSDVDFKGQNFELIPFGAGRRICPGLPLAIRMLYLMLGSLINSFDWKLE----D  469

Query  293  ESLDMAERMGITVRKFEPLKAIP  225
            ES+DM E+ G+T++K +PL+A+P
Sbjct  470  ESMDMKEKFGLTIQKAKPLRAVP  492



>gb|AJD25180.1| cytochrome P450 CYP76A36 [Salvia miltiorrhiza]
Length=513

 Score =   118 bits (296),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 55/88 (63%), Positives = 66/88 (75%), Gaps = 0/88 (0%)
 Frame = -2

Query  473  KPERFLGSNIDFKGQNFEFLPFGAGRRMCAGLPLGNRMLHFVLGSLLHTFDWELEGNVSS  294
            KPERFLGS  D+KGQNFE +PFGAGRR+CAG+PL +RMLH VLG+LLH F+W ++     
Sbjct  426  KPERFLGSGRDYKGQNFELIPFGAGRRICAGIPLAHRMLHLVLGNLLHEFEWGVDEVGRK  485

Query  293  ESLDMAERMGITVRKFEPLKAIPRRVVA  210
              +D  ERMG+TVRK  PL A PRR  A
Sbjct  486  AMMDERERMGVTVRKLVPLMATPRRCSA  513



>emb|CAN79423.1| hypothetical protein VITISV_011260 [Vitis vinifera]
Length=479

 Score =   117 bits (294),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 50/85 (59%), Positives = 68/85 (80%), Gaps = 0/85 (0%)
 Frame = -2

Query  470  PERFLGSNIDFKGQNFEFLPFGAGRRMCAGLPLGNRMLHFVLGSLLHTFDWELEGNVSSE  291
            PERFL  ++D KGQNFE +PFGAGRR+C GLPL  RM+H +L SL+H+ DW+LE  ++ E
Sbjct  395  PERFLELDMDVKGQNFELIPFGAGRRICPGLPLATRMVHLMLASLIHSCDWKLEDGITPE  454

Query  290  SLDMAERMGITVRKFEPLKAIPRRV  216
            +++M +R GIT++K +PLKAIP RV
Sbjct  455  NMNMEDRFGITLQKAQPLKAIPIRV  479



>gb|KHG25715.1| 7-ethoxycoumarin O-deethylase [Gossypium arboreum]
Length=437

 Score =   117 bits (293),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 51/82 (62%), Positives = 67/82 (82%), Gaps = 0/82 (0%)
 Frame = -2

Query  470  PERFLGSNIDFKGQNFEFLPFGAGRRMCAGLPLGNRMLHFVLGSLLHTFDWELEGNVSSE  291
            PERFLGS ID KG++F  +PFGAGRR+C GLPL NRMLH +LGSL+++FDW+LEG +S  
Sbjct  353  PERFLGSEIDVKGRDFGLIPFGAGRRICPGLPLANRMLHLMLGSLINSFDWKLEGGISPN  412

Query  290  SLDMAERMGITVRKFEPLKAIP  225
             ++M E++ ITV+  EPL+AIP
Sbjct  413  EINMEEKLAITVQMAEPLQAIP  434



>ref|XP_002276053.1| PREDICTED: geraniol 8-hydroxylase-like [Vitis vinifera]
Length=496

 Score =   117 bits (294),  Expect = 5e-28, Method: Composition-based stats.
 Identities = 47/85 (55%), Positives = 68/85 (80%), Gaps = 0/85 (0%)
 Frame = -2

Query  470  PERFLGSNIDFKGQNFEFLPFGAGRRMCAGLPLGNRMLHFVLGSLLHTFDWELEGNVSSE  291
            PERFLG +ID KG++FE +PFGAGRR+C GLPL +RM+H +L SLLH++ W+L+  +  E
Sbjct  412  PERFLGCDIDVKGRDFELIPFGAGRRICLGLPLAHRMVHLILASLLHSYAWKLDDGMKPE  471

Query  290  SLDMAERMGITVRKFEPLKAIPRRV  216
             +DM E++G T++K +PL+AIP +V
Sbjct  472  DMDMNEKLGFTLQKAQPLRAIPIKV  496



>ref|XP_010093536.1| Cytochrome P450 76C4 [Morus notabilis]
 gb|EXB54226.1| Cytochrome P450 76C4 [Morus notabilis]
Length=498

 Score =   117 bits (294),  Expect = 5e-28, Method: Compositional matrix adjust.
 Identities = 49/82 (60%), Positives = 69/82 (84%), Gaps = 0/82 (0%)
 Frame = -2

Query  470  PERFLGSNIDFKGQNFEFLPFGAGRRMCAGLPLGNRMLHFVLGSLLHTFDWELEGNVSSE  291
            PERFLGS++D++G++FE++PFGAGRR+C GLPL NRM+  +L SLLH+FDW+L   ++SE
Sbjct  411  PERFLGSSVDYRGRDFEYIPFGAGRRICPGLPLANRMVTLLLASLLHSFDWKLPEGITSE  470

Query  290  SLDMAERMGITVRKFEPLKAIP  225
            +LDM E+ GIT++K  PL A+P
Sbjct  471  NLDMTEQFGITLKKAIPLCAVP  492



>gb|KDO53972.1| hypothetical protein CISIN_1g024901mg [Citrus sinensis]
Length=260

 Score =   115 bits (287),  Expect = 5e-28, Method: Compositional matrix adjust.
 Identities = 51/82 (62%), Positives = 68/82 (83%), Gaps = 4/82 (5%)
 Frame = -2

Query  470  PERFLGSNIDFKGQNFEFLPFGAGRRMCAGLPLGNRMLHFVLGSLLHTFDWELEGNVSSE  291
            PERFLGSN+DFKG+NFE +PFG+GRR+C GLPL  RMLH +LGSL+++FDW+LE     E
Sbjct  180  PERFLGSNLDFKGRNFELIPFGSGRRICPGLPLAIRMLHLMLGSLINSFDWKLE----DE  235

Query  290  SLDMAERMGITVRKFEPLKAIP  225
            ++DM E+ GIT++K +PL+ IP
Sbjct  236  NMDMEEKFGITLQKAQPLRVIP  257



>ref|XP_002299579.2| hypothetical protein POPTR_0001s08320g [Populus trichocarpa]
 gb|EEE84384.2| hypothetical protein POPTR_0001s08320g [Populus trichocarpa]
Length=502

 Score =   117 bits (294),  Expect = 6e-28, Method: Compositional matrix adjust.
 Identities = 51/82 (62%), Positives = 67/82 (82%), Gaps = 0/82 (0%)
 Frame = -2

Query  470  PERFLGSNIDFKGQNFEFLPFGAGRRMCAGLPLGNRMLHFVLGSLLHTFDWELEGNVSSE  291
            PERFLGS+ID +G+NFE +PFGAGRR+C GLPL  RMLH +LGSL+H+FDW+LE  V+ E
Sbjct  418  PERFLGSDIDARGRNFELIPFGAGRRICPGLPLAMRMLHMMLGSLIHSFDWKLENGVTPE  477

Query  290  SLDMAERMGITVRKFEPLKAIP  225
            S+DM ++ GIT+ K   L+A+P
Sbjct  478  SMDMEDKFGITLGKARSLRAVP  499



>ref|XP_010036177.1| PREDICTED: cytochrome P450 76A1-like [Eucalyptus grandis]
Length=507

 Score =   117 bits (293),  Expect = 6e-28, Method: Compositional matrix adjust.
 Identities = 51/86 (59%), Positives = 67/86 (78%), Gaps = 0/86 (0%)
 Frame = -2

Query  473  KPERFLGSNIDFKGQNFEFLPFGAGRRMCAGLPLGNRMLHFVLGSLLHTFDWELEGNVSS  294
            KPERF+GS ID+KGQNFE +PFG+GRR+C GL L +R+LH  L +LL+ FDWEL    + 
Sbjct  420  KPERFVGSKIDYKGQNFELIPFGSGRRICVGLSLADRVLHLGLATLLYHFDWELGDGSTP  479

Query  293  ESLDMAERMGITVRKFEPLKAIPRRV  216
            ++LDM ER+GIT+RK  PLK IP++ 
Sbjct  480  KTLDMKERVGITLRKLHPLKVIPKKC  505



>ref|XP_010036151.1| PREDICTED: cytochrome P450 76A1-like [Eucalyptus grandis]
 gb|KCW84344.1| hypothetical protein EUGRSUZ_B01192 [Eucalyptus grandis]
Length=507

 Score =   117 bits (293),  Expect = 7e-28, Method: Compositional matrix adjust.
 Identities = 50/85 (59%), Positives = 67/85 (79%), Gaps = 0/85 (0%)
 Frame = -2

Query  473  KPERFLGSNIDFKGQNFEFLPFGAGRRMCAGLPLGNRMLHFVLGSLLHTFDWELEGNVSS  294
            KPERF+GS ID+KGQNFE +PFG+GRR+C GL L +R+LH  L +L++ FDWEL    + 
Sbjct  420  KPERFMGSKIDYKGQNFELIPFGSGRRICVGLSLADRVLHLGLATLIYHFDWELGDGSTP  479

Query  293  ESLDMAERMGITVRKFEPLKAIPRR  219
            ++LDM ER+GIT+RK  PLK IP++
Sbjct  480  KTLDMKERVGITLRKLHPLKVIPKK  504



>ref|XP_002528653.1| cytochrome P450, putative [Ricinus communis]
 gb|EEF33756.1| cytochrome P450, putative [Ricinus communis]
Length=515

 Score =   117 bits (293),  Expect = 9e-28, Method: Compositional matrix adjust.
 Identities = 59/87 (68%), Positives = 72/87 (83%), Gaps = 0/87 (0%)
 Frame = -2

Query  473  KPERFLGSNIDFKGQNFEFLPFGAGRRMCAGLPLGNRMLHFVLGSLLHTFDWELEGNVSS  294
            KPERFLGSNID+KGQNFE LPFG+GRR+C G+PL +R+LH  L SLLH FDWEL  N + 
Sbjct  426  KPERFLGSNIDYKGQNFELLPFGSGRRICVGIPLAHRVLHLALASLLHCFDWELGSNSTP  485

Query  293  ESLDMAERMGITVRKFEPLKAIPRRVV  213
            ES+DM ER+GITVRK  P+KAIP++ +
Sbjct  486  ESIDMNERLGITVRKLVPMKAIPKKKI  512



>gb|KDO36667.1| hypothetical protein CISIN_1g011040mg [Citrus sinensis]
Length=495

 Score =   117 bits (292),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 51/82 (62%), Positives = 67/82 (82%), Gaps = 4/82 (5%)
 Frame = -2

Query  470  PERFLGSNIDFKGQNFEFLPFGAGRRMCAGLPLGNRMLHFVLGSLLHTFDWELEGNVSSE  291
            PERFLGS +DFKGQNFE +PFGAGRR+C GLPL  RMLH +LGSL+++FDW+LEG    E
Sbjct  415  PERFLGSKVDFKGQNFELIPFGAGRRICPGLPLAIRMLHLMLGSLINSFDWKLEG----E  470

Query  290  SLDMAERMGITVRKFEPLKAIP  225
            ++DM E+ G+T++K +PL  +P
Sbjct  471  NMDMEEKFGLTIQKAQPLHVVP  492



>ref|XP_006840610.1| hypothetical protein AMTR_s00084p00062680 [Amborella trichopoda]
 gb|ERN02285.1| hypothetical protein AMTR_s00084p00062680 [Amborella trichopoda]
Length=186

 Score =   112 bits (280),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 46/84 (55%), Positives = 66/84 (79%), Gaps = 0/84 (0%)
 Frame = -2

Query  470  PERFLGSNIDFKGQNFEFLPFGAGRRMCAGLPLGNRMLHFVLGSLLHTFDWELEGNVSSE  291
            P+RFLGSN+D++G++F+F+PFGAGRR C GLP G  M+H +L SLLH FDWEL   + +E
Sbjct  101  PKRFLGSNVDYRGKDFQFIPFGAGRRTCPGLPFGVHMVHVMLTSLLHYFDWELPDGLKAE  160

Query  290  SLDMAERMGITVRKFEPLKAIPRR  219
             +DM ++ G+T++K  PL+ IPR+
Sbjct  161  EMDMRDKFGVTLQKLVPLRLIPRQ  184



>ref|XP_006423653.1| hypothetical protein CICLE_v10028270mg [Citrus clementina]
 gb|ESR36893.1| hypothetical protein CICLE_v10028270mg [Citrus clementina]
Length=495

 Score =   116 bits (291),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 51/82 (62%), Positives = 67/82 (82%), Gaps = 4/82 (5%)
 Frame = -2

Query  470  PERFLGSNIDFKGQNFEFLPFGAGRRMCAGLPLGNRMLHFVLGSLLHTFDWELEGNVSSE  291
            PERFLGS +DFKGQNFE +PFGAGRR+C GLPL  RMLH +LGSL+++FDW+LEG    E
Sbjct  415  PERFLGSKVDFKGQNFELIPFGAGRRICPGLPLAIRMLHLMLGSLINSFDWKLEG----E  470

Query  290  SLDMAERMGITVRKFEPLKAIP  225
            ++DM E+ G+T++K +PL  +P
Sbjct  471  NMDMEEKFGLTIQKAQPLHVVP  492



>ref|XP_002301305.2| cytochrome P450 family protein [Populus trichocarpa]
 gb|EEE80578.2| cytochrome P450 family protein [Populus trichocarpa]
Length=500

 Score =   116 bits (291),  Expect = 1e-27, Method: Composition-based stats.
 Identities = 46/85 (54%), Positives = 66/85 (78%), Gaps = 0/85 (0%)
 Frame = -2

Query  473  KPERFLGSNIDFKGQNFEFLPFGAGRRMCAGLPLGNRMLHFVLGSLLHTFDWELEGNVSS  294
            KPERFL    D KG++FE +PFGAGRR+C GLPLG++M+H  L SL+H+FDW++ G+++ 
Sbjct  415  KPERFLECQADVKGRDFELIPFGAGRRICPGLPLGHKMVHLTLASLIHSFDWKIAGDLTP  474

Query  293  ESLDMAERMGITVRKFEPLKAIPRR  219
            E +D +E  G+T+ K EPL+AIP +
Sbjct  475  EDIDTSETFGLTLHKSEPLRAIPMK  499



>ref|XP_006487694.1| PREDICTED: geraniol 8-hydroxylase-like [Citrus sinensis]
Length=495

 Score =   116 bits (291),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 51/82 (62%), Positives = 67/82 (82%), Gaps = 4/82 (5%)
 Frame = -2

Query  470  PERFLGSNIDFKGQNFEFLPFGAGRRMCAGLPLGNRMLHFVLGSLLHTFDWELEGNVSSE  291
            PERFLGS +DFKGQNFE +PFGAGRR+C GLPL  RMLH +LGSL+++FDW+LEG    E
Sbjct  415  PERFLGSKVDFKGQNFELIPFGAGRRICPGLPLAIRMLHLMLGSLINSFDWKLEG----E  470

Query  290  SLDMAERMGITVRKFEPLKAIP  225
            ++DM E+ G+T++K +PL  +P
Sbjct  471  NMDMEEKFGLTIQKAQPLYVVP  492



>emb|CBI30226.3| unnamed protein product [Vitis vinifera]
Length=660

 Score =   118 bits (295),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 50/86 (58%), Positives = 72/86 (84%), Gaps = 1/86 (1%)
 Frame = -2

Query  473  KPERFLGSN-IDFKGQNFEFLPFGAGRRMCAGLPLGNRMLHFVLGSLLHTFDWELEGNVS  297
            KPERFL  N ID+KGQ+F+ +PFGAGRRMCAG+PL +RM+H VLGSL++ FDW+L+ +++
Sbjct  420  KPERFLDLNHIDYKGQHFQLIPFGAGRRMCAGVPLAHRMVHLVLGSLVYHFDWQLDSSIT  479

Query  296  SESLDMAERMGITVRKFEPLKAIPRR  219
             E++DM E + + +RK EPLKA+P++
Sbjct  480  LETMDMRENLAMVMRKLEPLKALPKK  505



>sp|P37122.1|C76A2_SOLME RecName: Full=Cytochrome P450 76A2; AltName: Full=CYPLXXVIA2; 
AltName: Full=Cytochrome P-450EG7 [Solanum melongena]
 emb|CAA50648.1| P450 hydroxylase [Solanum melongena]
Length=505

 Score =   116 bits (291),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 53/86 (62%), Positives = 66/86 (77%), Gaps = 0/86 (0%)
 Frame = -2

Query  473  KPERFLGSNIDFKGQNFEFLPFGAGRRMCAGLPLGNRMLHFVLGSLLHTFDWELEGNVSS  294
            KPERFLGS ID KGQ++  +PFGAGRRMC GLPLG+RM+HF LGSLL  F+WEL   VS 
Sbjct  420  KPERFLGSKIDVKGQHYGLIPFGAGRRMCVGLPLGHRMMHFALGSLLREFEWELPDGVSP  479

Query  293  ESLDMAERMGITVRKFEPLKAIPRRV  216
            +S++M   MG+T RK + LK IP++ 
Sbjct  480  KSINMDGSMGVTARKRDSLKVIPKKA  505



>ref|XP_003631427.1| PREDICTED: geraniol 8-hydroxylase-like [Vitis vinifera]
 ref|XP_010661621.1| PREDICTED: geraniol 8-hydroxylase-like [Vitis vinifera]
 ref|XP_010661624.1| PREDICTED: geraniol 8-hydroxylase-like [Vitis vinifera]
 ref|XP_010661630.1| PREDICTED: geraniol 8-hydroxylase-like [Vitis vinifera]
 ref|XP_010661639.1| PREDICTED: geraniol 8-hydroxylase-like [Vitis vinifera]
Length=499

 Score =   116 bits (291),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 50/85 (59%), Positives = 68/85 (80%), Gaps = 0/85 (0%)
 Frame = -2

Query  470  PERFLGSNIDFKGQNFEFLPFGAGRRMCAGLPLGNRMLHFVLGSLLHTFDWELEGNVSSE  291
            PERFL  ++D KGQNFE +PFGAGRR+C GLPL  RM+H +L SL+H+ DW+LE  ++ E
Sbjct  415  PERFLELDMDVKGQNFELIPFGAGRRICPGLPLATRMVHLMLASLIHSCDWKLEDGMTPE  474

Query  290  SLDMAERMGITVRKFEPLKAIPRRV  216
            +++M +R GIT++K +PLKAIP RV
Sbjct  475  NMNMEDRFGITLQKAQPLKAIPIRV  499



>ref|XP_010045882.1| PREDICTED: cytochrome P450 76A2-like [Eucalyptus grandis]
Length=270

 Score =   114 bits (285),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 49/85 (58%), Positives = 65/85 (76%), Gaps = 0/85 (0%)
 Frame = -2

Query  473  KPERFLGSNIDFKGQNFEFLPFGAGRRMCAGLPLGNRMLHFVLGSLLHTFDWELEGNVSS  294
            KPERF+GS ID+KGQNFE +PFG+GRR+C GL L +R+LH  L +LL+ FDWEL    + 
Sbjct  183  KPERFMGSKIDYKGQNFELIPFGSGRRICVGLSLADRVLHLGLATLLYHFDWELGDGSTP  242

Query  293  ESLDMAERMGITVRKFEPLKAIPRR  219
            ++LDM ER+ I +RK  PLK IP++
Sbjct  243  KTLDMKERVRIILRKLHPLKVIPKK  267



>ref|XP_007209932.1| hypothetical protein PRUPE_ppa004606mg [Prunus persica]
 gb|EMJ11131.1| hypothetical protein PRUPE_ppa004606mg [Prunus persica]
Length=500

 Score =   116 bits (290),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 50/83 (60%), Positives = 67/83 (81%), Gaps = 0/83 (0%)
 Frame = -2

Query  473  KPERFLGSNIDFKGQNFEFLPFGAGRRMCAGLPLGNRMLHFVLGSLLHTFDWELEGNVSS  294
            KPERFLGS ID KG+NFE +PFGAGRR+C GLPL  RMLH +LGSL+H+FDW+LE  V+ 
Sbjct  415  KPERFLGSEIDVKGRNFELIPFGAGRRVCPGLPLAMRMLHLMLGSLIHSFDWKLEDGVTP  474

Query  293  ESLDMAERMGITVRKFEPLKAIP  225
            E+++M ++ GIT+   + L+A+P
Sbjct  475  ENMNMDDKFGITLEMAQSLRAVP  497



>ref|XP_006423676.1| hypothetical protein CICLE_v10030057mg [Citrus clementina]
 gb|ESR36916.1| hypothetical protein CICLE_v10030057mg [Citrus clementina]
Length=475

 Score =   116 bits (290),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 51/82 (62%), Positives = 69/82 (84%), Gaps = 4/82 (5%)
 Frame = -2

Query  473  KPERFLGSNIDFKGQNFEFLPFGAGRRMCAGLPLGNRMLHFVLGSLLHTFDWELEGNVSS  294
            KPERFLGS++DFKGQNFE +PFGAGRR+C GLPL  RML+ +LGSL+++FDW+LE     
Sbjct  394  KPERFLGSDVDFKGQNFELIPFGAGRRICPGLPLAIRMLYLMLGSLINSFDWKLE----D  449

Query  293  ESLDMAERMGITVRKFEPLKAI  228
            ES+DM E+ G+T++K +PL+A+
Sbjct  450  ESMDMKEKFGLTIQKAKPLRAV  471



>gb|KCW72821.1| hypothetical protein EUGRSUZ_E01263 [Eucalyptus grandis]
Length=441

 Score =   115 bits (288),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 49/85 (58%), Positives = 69/85 (81%), Gaps = 0/85 (0%)
 Frame = -2

Query  470  PERFLGSNIDFKGQNFEFLPFGAGRRMCAGLPLGNRMLHFVLGSLLHTFDWELEGNVSSE  291
            PERFLGSN+D+KG++FE++PFGAGRR+C GLPL  RM+H ++ SL+ +F+W+L   ++ E
Sbjct  357  PERFLGSNVDYKGRDFEYIPFGAGRRICPGLPLAIRMVHLMVASLVQSFNWKLPEGMAPE  416

Query  290  SLDMAERMGITVRKFEPLKAIPRRV  216
            SLDM E+ G+T+RK  PL+AIP  V
Sbjct  417  SLDMQEQFGVTLRKAIPLRAIPSLV  441



>emb|CAN83490.1| hypothetical protein VITISV_001325 [Vitis vinifera]
Length=501

 Score =   115 bits (289),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 49/82 (60%), Positives = 66/82 (80%), Gaps = 0/82 (0%)
 Frame = -2

Query  470  PERFLGSNIDFKGQNFEFLPFGAGRRMCAGLPLGNRMLHFVLGSLLHTFDWELEGNVSSE  291
            PERFL SNIDF+GQ+FE+LPFGAG+R+C G+ LG RM+H VL S++H+F W+L   ++ E
Sbjct  412  PERFLSSNIDFRGQDFEYLPFGAGKRICPGISLGLRMVHLVLASIIHSFSWKLPQGITPE  471

Query  290  SLDMAERMGITVRKFEPLKAIP  225
            SLDM E+ G+T++K  PL AIP
Sbjct  472  SLDMKEQFGVTLKKVVPLCAIP  493



>ref|XP_002270541.1| PREDICTED: geraniol 8-hydroxylase [Vitis vinifera]
Length=501

 Score =   115 bits (289),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 49/82 (60%), Positives = 66/82 (80%), Gaps = 0/82 (0%)
 Frame = -2

Query  470  PERFLGSNIDFKGQNFEFLPFGAGRRMCAGLPLGNRMLHFVLGSLLHTFDWELEGNVSSE  291
            PERFL SNIDF+GQ+FE+LPFGAG+R+C G+ LG RM+H VL S++H+F W+L   ++ E
Sbjct  412  PERFLSSNIDFRGQDFEYLPFGAGKRICPGISLGLRMVHLVLASIIHSFSWKLPQGITPE  471

Query  290  SLDMAERMGITVRKFEPLKAIP  225
            SLDM E+ G+T++K  PL AIP
Sbjct  472  SLDMKEQFGVTLKKVVPLCAIP  493



>ref|XP_011033851.1| PREDICTED: geraniol 8-hydroxylase-like isoform X2 [Populus euphratica]
Length=500

 Score =   115 bits (289),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 52/85 (61%), Positives = 68/85 (80%), Gaps = 0/85 (0%)
 Frame = -2

Query  470  PERFLGSNIDFKGQNFEFLPFGAGRRMCAGLPLGNRMLHFVLGSLLHTFDWELEGNVSSE  291
            PERFL S ID +GQNFEF+PFG+GRRMC GLPL  RMLH +LGSL+ +FDW+L   V+ E
Sbjct  416  PERFLDSGIDHRGQNFEFIPFGSGRRMCPGLPLAMRMLHLMLGSLILSFDWKLADGVTPE  475

Query  290  SLDMAERMGITVRKFEPLKAIPRRV  216
            +L+M ++ G+T+ K +PL+AIP RV
Sbjct  476  NLNMDDKFGLTLLKAQPLRAIPIRV  500



>ref|XP_006423711.1| hypothetical protein CICLE_v10028239mg [Citrus clementina]
 gb|ESR36951.1| hypothetical protein CICLE_v10028239mg [Citrus clementina]
Length=506

 Score =   115 bits (289),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 51/82 (62%), Positives = 68/82 (83%), Gaps = 4/82 (5%)
 Frame = -2

Query  470  PERFLGSNIDFKGQNFEFLPFGAGRRMCAGLPLGNRMLHFVLGSLLHTFDWELEGNVSSE  291
            PERFLGSN+DFKG+NFE +PFG+GRR+C GLPL  RMLH +LGSL+++FDW+LE     E
Sbjct  426  PERFLGSNLDFKGRNFELIPFGSGRRICPGLPLAIRMLHLMLGSLINSFDWKLE----DE  481

Query  290  SLDMAERMGITVRKFEPLKAIP  225
            ++DM E+ GIT++K +PL+ IP
Sbjct  482  NMDMEEKFGITLQKAQPLRVIP  503



>emb|CBI38804.3| unnamed protein product [Vitis vinifera]
Length=113

 Score =   109 bits (273),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 46/82 (56%), Positives = 65/82 (79%), Gaps = 0/82 (0%)
 Frame = -2

Query  470  PERFLGSNIDFKGQNFEFLPFGAGRRMCAGLPLGNRMLHFVLGSLLHTFDWELEGNVSSE  291
            PERFL   ID KG++F+ +PFGAGRR+C GL LG+RM+H +L SLLH+FDW+L+  +  E
Sbjct  29   PERFLECEIDVKGRDFQLIPFGAGRRICPGLLLGHRMVHLMLASLLHSFDWKLQDGLKPE  88

Query  290  SLDMAERMGITVRKFEPLKAIP  225
             +DM E+ G+T+RK +PL+A+P
Sbjct  89   DMDMTEKFGLTLRKAQPLQAVP  110



>ref|XP_006487469.1| PREDICTED: geraniol 8-hydroxylase-like [Citrus sinensis]
Length=506

 Score =   115 bits (289),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 51/82 (62%), Positives = 68/82 (83%), Gaps = 4/82 (5%)
 Frame = -2

Query  470  PERFLGSNIDFKGQNFEFLPFGAGRRMCAGLPLGNRMLHFVLGSLLHTFDWELEGNVSSE  291
            PERFLGSN+DFKG+NFE +PFG+GRR+C GLPL  RMLH +LGSL+++FDW+LE     E
Sbjct  426  PERFLGSNLDFKGRNFELIPFGSGRRICPGLPLAIRMLHLMLGSLINSFDWKLE----DE  481

Query  290  SLDMAERMGITVRKFEPLKAIP  225
            ++DM E+ GIT++K +PL+ IP
Sbjct  482  NMDMEEKFGITLQKAQPLRVIP  503



>ref|XP_007162842.1| hypothetical protein PHAVU_001G185500g [Phaseolus vulgaris]
 gb|ESW34836.1| hypothetical protein PHAVU_001G185500g [Phaseolus vulgaris]
Length=515

 Score =   115 bits (289),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 50/85 (59%), Positives = 70/85 (82%), Gaps = 1/85 (1%)
 Frame = -2

Query  473  KPERFLG-SNIDFKGQNFEFLPFGAGRRMCAGLPLGNRMLHFVLGSLLHTFDWELEGNVS  297
            KP+RF+  +NID+KG +F F+PFGAGRRMCAG+PL +R+LH VLGSLLH F WEL+ +V+
Sbjct  419  KPQRFVDCNNIDYKGHHFGFIPFGAGRRMCAGVPLAHRILHLVLGSLLHRFHWELQTHVT  478

Query  296  SESLDMAERMGITVRKFEPLKAIPR  222
              ++DM E++GIT+RK +PL  +P+
Sbjct  479  PSTVDMKEKLGITMRKLQPLLLVPK  503



>ref|XP_004232063.1| PREDICTED: geraniol 8-hydroxylase-like [Solanum lycopersicum]
Length=495

 Score =   115 bits (289),  Expect = 3e-27, Method: Composition-based stats.
 Identities = 46/83 (55%), Positives = 65/83 (78%), Gaps = 0/83 (0%)
 Frame = -2

Query  473  KPERFLGSNIDFKGQNFEFLPFGAGRRMCAGLPLGNRMLHFVLGSLLHTFDWELEGNVSS  294
            KPERF  S +D +GQ+FE +PFGAGRR+C GLPL  R L  +LGSLL++FDW+ EG++++
Sbjct  410  KPERFWSSKMDVRGQDFELIPFGAGRRICPGLPLATRTLSVMLGSLLNSFDWKAEGDIAA  469

Query  293  ESLDMAERMGITVRKFEPLKAIP  225
            E LD+ E+ GIT+ +  PL+A+P
Sbjct  470  EDLDVEEKFGITLARLRPLRAVP  492



>ref|XP_011029123.1| PREDICTED: geraniol 8-hydroxylase-like [Populus euphratica]
Length=501

 Score =   115 bits (289),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 50/82 (61%), Positives = 67/82 (82%), Gaps = 0/82 (0%)
 Frame = -2

Query  470  PERFLGSNIDFKGQNFEFLPFGAGRRMCAGLPLGNRMLHFVLGSLLHTFDWELEGNVSSE  291
            PERFLGS+ID +G+NFE +PFGAGRR+C GLPL  RML  +LGSL+H+FDW+LE  V+ E
Sbjct  418  PERFLGSDIDARGRNFELIPFGAGRRICPGLPLAMRMLPMMLGSLIHSFDWKLENGVTPE  477

Query  290  SLDMAERMGITVRKFEPLKAIP  225
            S+DM ++ GIT+ K + L+A+P
Sbjct  478  SMDMEDKFGITLEKAQSLRAVP  499



>ref|XP_011033850.1| PREDICTED: geraniol 8-hydroxylase-like isoform X1 [Populus euphratica]
Length=519

 Score =   115 bits (289),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 52/85 (61%), Positives = 68/85 (80%), Gaps = 0/85 (0%)
 Frame = -2

Query  470  PERFLGSNIDFKGQNFEFLPFGAGRRMCAGLPLGNRMLHFVLGSLLHTFDWELEGNVSSE  291
            PERFL S ID +GQNFEF+PFG+GRRMC GLPL  RMLH +LGSL+ +FDW+L   V+ E
Sbjct  435  PERFLDSGIDHRGQNFEFIPFGSGRRMCPGLPLAMRMLHLMLGSLILSFDWKLADGVTPE  494

Query  290  SLDMAERMGITVRKFEPLKAIPRRV  216
            +L+M ++ G+T+ K +PL+AIP RV
Sbjct  495  NLNMDDKFGLTLLKAQPLRAIPIRV  519



>ref|XP_006853508.1| hypothetical protein AMTR_s00032p00219670 [Amborella trichopoda]
 gb|ERN14975.1| hypothetical protein AMTR_s00032p00219670 [Amborella trichopoda]
Length=488

 Score =   115 bits (288),  Expect = 3e-27, Method: Composition-based stats.
 Identities = 47/82 (57%), Positives = 66/82 (80%), Gaps = 0/82 (0%)
 Frame = -2

Query  470  PERFLGSNIDFKGQNFEFLPFGAGRRMCAGLPLGNRMLHFVLGSLLHTFDWELEGNVSSE  291
            PERF+GSNIDFKG++F+++PFGAGRR+C GLPLG RM+H +L SLLH+F WEL   +  E
Sbjct  398  PERFVGSNIDFKGRDFQYIPFGAGRRICPGLPLGVRMVHIMLASLLHSFYWELPDGLKPE  457

Query  290  SLDMAERMGITVRKFEPLKAIP  225
             +D+ ++ G+T++K  PL A+P
Sbjct  458  EMDIKDKFGVTLQKAVPLVAVP  479



>ref|XP_010056209.1| PREDICTED: geraniol 8-hydroxylase-like [Eucalyptus grandis]
Length=495

 Score =   115 bits (288),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 49/85 (58%), Positives = 69/85 (81%), Gaps = 0/85 (0%)
 Frame = -2

Query  470  PERFLGSNIDFKGQNFEFLPFGAGRRMCAGLPLGNRMLHFVLGSLLHTFDWELEGNVSSE  291
            PERFLGSN+D+KG++FE++PFGAGRR+C GLPL  RM+H ++ SL+ +F+W+L   ++ E
Sbjct  411  PERFLGSNVDYKGRDFEYIPFGAGRRICPGLPLAIRMVHLMVASLVQSFNWKLPEGMAPE  470

Query  290  SLDMAERMGITVRKFEPLKAIPRRV  216
            SLDM E+ G+T+RK  PL+AIP  V
Sbjct  471  SLDMQEQFGVTLRKAIPLRAIPSLV  495



>gb|KDP43102.1| hypothetical protein JCGZ_27051 [Jatropha curcas]
Length=512

 Score =   115 bits (288),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 48/76 (63%), Positives = 63/76 (83%), Gaps = 0/76 (0%)
 Frame = -2

Query  473  KPERFLGSNIDFKGQNFEFLPFGAGRRMCAGLPLGNRMLHFVLGSLLHTFDWELEGNVSS  294
            KPE+F+GSNID+KGQNFE LPFG+GRR+C G+PL +R++ F L SLLH FDW+L+ + + 
Sbjct  425  KPEKFIGSNIDYKGQNFELLPFGSGRRICVGIPLAHRIVQFALASLLHCFDWKLDSHSAV  484

Query  293  ESLDMAERMGITVRKF  246
            ++LDM ERMG TVRK 
Sbjct  485  DTLDMNERMGFTVRKL  500



>gb|KDP43052.1| hypothetical protein JCGZ_25238 [Jatropha curcas]
Length=289

 Score =   113 bits (283),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 47/82 (57%), Positives = 67/82 (82%), Gaps = 0/82 (0%)
 Frame = -2

Query  470  PERFLGSNIDFKGQNFEFLPFGAGRRMCAGLPLGNRMLHFVLGSLLHTFDWELEGNVSSE  291
            PERFLGS ID +G+NFE +PFGAGRR+C GLPL   ML  +LGSL+++F W+LE  ++S+
Sbjct  203  PERFLGSEIDARGRNFELIPFGAGRRICPGLPLATSMLSLILGSLINSFGWKLEDEITSQ  262

Query  290  SLDMAERMGITVRKFEPLKAIP  225
            ++DM +R G+T++K +PL+AIP
Sbjct  263  TMDMEDRFGVTLQKAQPLRAIP  284



>dbj|BAC53892.1| cytochrome P450 [Petunia x hybrida]
Length=510

 Score =   115 bits (288),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 61/86 (71%), Positives = 70/86 (81%), Gaps = 3/86 (3%)
 Frame = -2

Query  473  KPERFL---GSNIDFKGQNFEFLPFGAGRRMCAGLPLGNRMLHFVLGSLLHTFDWELEGN  303
            KPERFL       DFKGQNFEF+PFGAGRRMCAGLPLGNRM H +LGSLLH FDWEL  N
Sbjct  417  KPERFLNLSSKTTDFKGQNFEFIPFGAGRRMCAGLPLGNRMSHLLLGSLLHAFDWELPSN  476

Query  302  VSSESLDMAERMGITVRKFEPLKAIP  225
            V+ +S+DM ERMG+TVRK +PL+ +P
Sbjct  477  VTPKSMDMKERMGMTVRKLQPLQVVP  502



>emb|CBI30230.3| unnamed protein product [Vitis vinifera]
Length=533

 Score =   115 bits (288),  Expect = 5e-27, Method: Compositional matrix adjust.
 Identities = 56/85 (66%), Positives = 70/85 (82%), Gaps = 0/85 (0%)
 Frame = -2

Query  473  KPERFLGSNIDFKGQNFEFLPFGAGRRMCAGLPLGNRMLHFVLGSLLHTFDWELEGNVSS  294
            KP+RFLGSN+D+KGQNFEF+PFG+GRR+C G+ L N++L   L SLLH FDWEL G V+ 
Sbjct  446  KPDRFLGSNLDYKGQNFEFIPFGSGRRICIGISLANKLLPLALASLLHCFDWELGGGVTP  505

Query  293  ESLDMAERMGITVRKFEPLKAIPRR  219
            E++DM ER+GITVRK  PLK IP+R
Sbjct  506  ETMDMNERVGITVRKLIPLKPIPKR  530


 Score =   113 bits (282),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 49/76 (64%), Positives = 65/76 (86%), Gaps = 1/76 (1%)
 Frame = -2

Query  473  KPERFLGSN-IDFKGQNFEFLPFGAGRRMCAGLPLGNRMLHFVLGSLLHTFDWELEGNVS  297
            KPERFL S  I++KGQNFE +PFGAGRR+CAG+PL +R+LH VLG+LLH FDW+L+GNV+
Sbjct  158  KPERFLDSKKIEYKGQNFELIPFGAGRRICAGIPLAHRVLHLVLGTLLHHFDWQLKGNVT  217

Query  296  SESLDMAERMGITVRK  249
             E++DM E+ G+ +RK
Sbjct  218  PETMDMKEKWGLVMRK  233



>ref|XP_006853497.1| hypothetical protein AMTR_s00032p00215290 [Amborella trichopoda]
 gb|ERN14964.1| hypothetical protein AMTR_s00032p00215290 [Amborella trichopoda]
Length=512

 Score =   115 bits (287),  Expect = 5e-27, Method: Compositional matrix adjust.
 Identities = 47/82 (57%), Positives = 65/82 (79%), Gaps = 0/82 (0%)
 Frame = -2

Query  470  PERFLGSNIDFKGQNFEFLPFGAGRRMCAGLPLGNRMLHFVLGSLLHTFDWELEGNVSSE  291
            PERFLG N+D+KG++F+F+PFGAGRR+C GLPLG RM+H +L SLLH FDW L   + +E
Sbjct  427  PERFLGCNVDYKGKDFQFIPFGAGRRICPGLPLGVRMVHLILASLLHYFDWGLPDGMKAE  486

Query  290  SLDMAERMGITVRKFEPLKAIP  225
             +DM ++ G+T++K  PL+ IP
Sbjct  487  EMDMRDKFGVTLQKLVPLRVIP  508



>ref|XP_002283777.2| PREDICTED: cytochrome P450 76A1 [Vitis vinifera]
Length=512

 Score =   115 bits (287),  Expect = 5e-27, Method: Compositional matrix adjust.
 Identities = 56/85 (66%), Positives = 70/85 (82%), Gaps = 0/85 (0%)
 Frame = -2

Query  473  KPERFLGSNIDFKGQNFEFLPFGAGRRMCAGLPLGNRMLHFVLGSLLHTFDWELEGNVSS  294
            KP+RFLGSN+D+KGQNFEF+PFG+GRR+C G+ L N++L   L SLLH FDWEL G V+ 
Sbjct  425  KPDRFLGSNLDYKGQNFEFIPFGSGRRICIGISLANKLLPLALASLLHCFDWELGGGVTP  484

Query  293  ESLDMAERMGITVRKFEPLKAIPRR  219
            E++DM ER+GITVRK  PLK IP+R
Sbjct  485  ETMDMNERVGITVRKLIPLKPIPKR  509



>gb|KHG21745.1| Cytochrome P450 protein [Gossypium arboreum]
Length=500

 Score =   115 bits (287),  Expect = 5e-27, Method: Compositional matrix adjust.
 Identities = 49/82 (60%), Positives = 68/82 (83%), Gaps = 0/82 (0%)
 Frame = -2

Query  470  PERFLGSNIDFKGQNFEFLPFGAGRRMCAGLPLGNRMLHFVLGSLLHTFDWELEGNVSSE  291
            PERFLGS ID KG++F  +PFGAGRR+C GLPL NRML+ +LGSL+++FDW+LEG +S +
Sbjct  416  PERFLGSEIDVKGRDFGLIPFGAGRRICPGLPLANRMLYLMLGSLINSFDWKLEGGISPK  475

Query  290  SLDMAERMGITVRKFEPLKAIP  225
             ++M E+ G+TV+  EPL+A+P
Sbjct  476  EMNMEEKFGLTVQMAEPLQAVP  497



>ref|XP_006388387.1| hypothetical protein POPTR_0201s00200g [Populus trichocarpa]
 gb|ERP47301.1| hypothetical protein POPTR_0201s00200g [Populus trichocarpa]
Length=496

 Score =   114 bits (286),  Expect = 6e-27, Method: Composition-based stats.
 Identities = 46/85 (54%), Positives = 65/85 (76%), Gaps = 0/85 (0%)
 Frame = -2

Query  473  KPERFLGSNIDFKGQNFEFLPFGAGRRMCAGLPLGNRMLHFVLGSLLHTFDWELEGNVSS  294
            KPERFL    D KG++FE +PFGAGRR+C GLPLG++M+H  L SL+H+FDW++  +++ 
Sbjct  411  KPERFLECQADVKGRDFELIPFGAGRRICPGLPLGHKMVHLALASLIHSFDWKIADDLTP  470

Query  293  ESLDMAERMGITVRKFEPLKAIPRR  219
            E +D +E  GIT+ K EPL+AIP +
Sbjct  471  EDIDTSETFGITLHKSEPLRAIPMK  495



>ref|XP_006423677.1| hypothetical protein CICLE_v10028488mg [Citrus clementina]
 gb|ESR36917.1| hypothetical protein CICLE_v10028488mg [Citrus clementina]
Length=434

 Score =   114 bits (285),  Expect = 6e-27, Method: Compositional matrix adjust.
 Identities = 51/82 (62%), Positives = 67/82 (82%), Gaps = 4/82 (5%)
 Frame = -2

Query  470  PERFLGSNIDFKGQNFEFLPFGAGRRMCAGLPLGNRMLHFVLGSLLHTFDWELEGNVSSE  291
            PERFL SN+DFKGQNFE +PFGAGRR+C GLPL  RML+ +LGSL+++FDW+LE     E
Sbjct  354  PERFLRSNVDFKGQNFELIPFGAGRRICPGLPLAIRMLYLMLGSLINSFDWKLE----DE  409

Query  290  SLDMAERMGITVRKFEPLKAIP  225
            ++DM E+ GIT+ K +PL+A+P
Sbjct  410  NMDMEEKFGITIMKAQPLRAVP  431



>ref|XP_010053039.1| PREDICTED: geraniol 8-hydroxylase-like [Eucalyptus grandis]
 gb|KCW77278.1| hypothetical protein EUGRSUZ_D01636 [Eucalyptus grandis]
Length=506

 Score =   114 bits (286),  Expect = 6e-27, Method: Compositional matrix adjust.
 Identities = 50/85 (59%), Positives = 65/85 (76%), Gaps = 0/85 (0%)
 Frame = -2

Query  470  PERFLGSNIDFKGQNFEFLPFGAGRRMCAGLPLGNRMLHFVLGSLLHTFDWELEGNVSSE  291
            PERFLG  IDFKG++FE +PFG+GRR+C G+PL  RM+H +L SLL +FDW+LE  V+ E
Sbjct  422  PERFLGGEIDFKGRDFELIPFGSGRRICPGMPLAYRMVHLILASLLRSFDWKLEEGVTPE  481

Query  290  SLDMAERMGITVRKFEPLKAIPRRV  216
             +DM E+ GIT++K  PL AIP  V
Sbjct  482  EMDMTEKFGITLQKATPLCAIPMEV  506



>ref|XP_006423661.1| hypothetical protein CICLE_v10028273mg [Citrus clementina]
 gb|ESR36901.1| hypothetical protein CICLE_v10028273mg [Citrus clementina]
Length=495

 Score =   114 bits (286),  Expect = 6e-27, Method: Compositional matrix adjust.
 Identities = 51/82 (62%), Positives = 67/82 (82%), Gaps = 4/82 (5%)
 Frame = -2

Query  470  PERFLGSNIDFKGQNFEFLPFGAGRRMCAGLPLGNRMLHFVLGSLLHTFDWELEGNVSSE  291
            PERFLGSN DFKGQNFE +PFGAGRR+C GLPL  RMLH +LGSL+++FDW+L+ +    
Sbjct  415  PERFLGSNADFKGQNFELIPFGAGRRICPGLPLAIRMLHLMLGSLINSFDWKLDNH----  470

Query  290  SLDMAERMGITVRKFEPLKAIP  225
            ++DM ++ G+TV+K EPL A+P
Sbjct  471  NMDMEDKFGLTVQKAEPLHAVP  492



>gb|KDO41057.1| hypothetical protein CISIN_1g043641mg [Citrus sinensis]
Length=478

 Score =   114 bits (285),  Expect = 7e-27, Method: Composition-based stats.
 Identities = 48/83 (58%), Positives = 66/83 (80%), Gaps = 0/83 (0%)
 Frame = -2

Query  473  KPERFLGSNIDFKGQNFEFLPFGAGRRMCAGLPLGNRMLHFVLGSLLHTFDWELEGNVSS  294
            K ERFLGS++D KG+NFE  PFGAGRR+C GLPL  RML+ +LGSL+ +FDW+L+  V+S
Sbjct  393  KLERFLGSDVDVKGRNFELFPFGAGRRICLGLPLAIRMLYLMLGSLIKSFDWKLDNKVTS  452

Query  293  ESLDMAERMGITVRKFEPLKAIP  225
             ++DM E+ GIT++K +PL  +P
Sbjct  453  GNVDMEEKFGITLQKAQPLHVVP  475



>ref|XP_002301306.2| hypothetical protein POPTR_0002s15150g [Populus trichocarpa]
 gb|EEE80579.2| hypothetical protein POPTR_0002s15150g [Populus trichocarpa]
Length=496

 Score =   114 bits (286),  Expect = 7e-27, Method: Composition-based stats.
 Identities = 46/85 (54%), Positives = 65/85 (76%), Gaps = 0/85 (0%)
 Frame = -2

Query  473  KPERFLGSNIDFKGQNFEFLPFGAGRRMCAGLPLGNRMLHFVLGSLLHTFDWELEGNVSS  294
            KPERFL    D KG++FE +PFGAGRR+C GLPLG++M+H  L SL+H+FDW++  +++ 
Sbjct  411  KPERFLECQADVKGRDFELIPFGAGRRICPGLPLGHKMVHLTLASLIHSFDWKIADDLTP  470

Query  293  ESLDMAERMGITVRKFEPLKAIPRR  219
            E +D +E  GIT+ K EPL+AIP +
Sbjct  471  EDIDTSETFGITLHKSEPLRAIPMK  495



>emb|CDP17802.1| unnamed protein product [Coffea canephora]
Length=500

 Score =   114 bits (286),  Expect = 7e-27, Method: Compositional matrix adjust.
 Identities = 48/86 (56%), Positives = 66/86 (77%), Gaps = 0/86 (0%)
 Frame = -2

Query  473  KPERFLGSNIDFKGQNFEFLPFGAGRRMCAGLPLGNRMLHFVLGSLLHTFDWELEGNVSS  294
            +PERFLGS+ID +GQ+FE +PFGAGRR+C GLPL  RM+H +L S +H  DW+LE  +  
Sbjct  415  EPERFLGSDIDVRGQHFELIPFGAGRRICPGLPLAYRMVHLMLASFIHNIDWKLEDGMKP  474

Query  293  ESLDMAERMGITVRKFEPLKAIPRRV  216
            E +DM E+ G+T++K  PLKAIP ++
Sbjct  475  EDMDMEEKFGLTIQKALPLKAIPVKL  500



>ref|XP_010058414.1| PREDICTED: geraniol 8-hydroxylase-like [Eucalyptus grandis]
 gb|KCW72820.1| hypothetical protein EUGRSUZ_E01262 [Eucalyptus grandis]
Length=438

 Score =   114 bits (284),  Expect = 7e-27, Method: Compositional matrix adjust.
 Identities = 48/85 (56%), Positives = 68/85 (80%), Gaps = 0/85 (0%)
 Frame = -2

Query  470  PERFLGSNIDFKGQNFEFLPFGAGRRMCAGLPLGNRMLHFVLGSLLHTFDWELEGNVSSE  291
            PERFLGSN+D++G++FEF+PFG GRR+C GLPL  RM+H ++ SL+ +F+W+L   ++ E
Sbjct  354  PERFLGSNVDYRGRDFEFIPFGVGRRICPGLPLAVRMVHLMVASLVQSFNWKLPEGMAPE  413

Query  290  SLDMAERMGITVRKFEPLKAIPRRV  216
            SLDM E+ G+T+RK  PL+AIP  V
Sbjct  414  SLDMQEQFGVTLRKAVPLRAIPSLV  438



>ref|XP_006477330.1| PREDICTED: geraniol 8-hydroxylase-like [Citrus sinensis]
Length=499

 Score =   114 bits (285),  Expect = 8e-27, Method: Compositional matrix adjust.
 Identities = 48/82 (59%), Positives = 67/82 (82%), Gaps = 0/82 (0%)
 Frame = -2

Query  470  PERFLGSNIDFKGQNFEFLPFGAGRRMCAGLPLGNRMLHFVLGSLLHTFDWELEGNVSSE  291
            P+RFLGS+ID KGQNFE +PFGAGRR+C GLPL  RML+ +LGSL+++FDW+ E  ++  
Sbjct  415  PKRFLGSDIDVKGQNFELIPFGAGRRICPGLPLAIRMLYLMLGSLINSFDWKFEDGITQH  474

Query  290  SLDMAERMGITVRKFEPLKAIP  225
            ++DM E+ G+T++K +PL AIP
Sbjct  475  NMDMEEKFGLTLQKAQPLHAIP  496



>ref|XP_006423672.1| hypothetical protein CICLE_v10028278mg [Citrus clementina]
 gb|ESR36912.1| hypothetical protein CICLE_v10028278mg [Citrus clementina]
Length=495

 Score =   114 bits (284),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 51/82 (62%), Positives = 67/82 (82%), Gaps = 4/82 (5%)
 Frame = -2

Query  470  PERFLGSNIDFKGQNFEFLPFGAGRRMCAGLPLGNRMLHFVLGSLLHTFDWELEGNVSSE  291
            PERFL SN+DFKGQNFE +PFGAGRR+C GLPL  RML+ +LGSL+++FDW+LE     E
Sbjct  415  PERFLRSNVDFKGQNFELIPFGAGRRICPGLPLAIRMLYLMLGSLINSFDWKLE----DE  470

Query  290  SLDMAERMGITVRKFEPLKAIP  225
            ++DM E+ GIT+ K +PL+A+P
Sbjct  471  NMDMEEKFGITIMKAQPLRAVP  492



>ref|XP_006423660.1| hypothetical protein CICLE_v10030225mg, partial [Citrus clementina]
 gb|ESR36900.1| hypothetical protein CICLE_v10030225mg, partial [Citrus clementina]
Length=483

 Score =   114 bits (284),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 50/82 (61%), Positives = 67/82 (82%), Gaps = 4/82 (5%)
 Frame = -2

Query  470  PERFLGSNIDFKGQNFEFLPFGAGRRMCAGLPLGNRMLHFVLGSLLHTFDWELEGNVSSE  291
            PERFLGS++DFKGQNFE +PFGAGRR+C GLPL  RML+ +LGSL+++FDW+LE     E
Sbjct  403  PERFLGSDVDFKGQNFELIPFGAGRRICPGLPLAIRMLYLMLGSLINSFDWKLE----DE  458

Query  290  SLDMAERMGITVRKFEPLKAIP  225
            + DM E+ G+T++K +PL+ IP
Sbjct  459  NTDMEEKFGLTIKKAQPLRTIP  480



>gb|AGX93052.1| geraniol 10-hydroxylase-like protein [Amsonia hubrichtii]
Length=493

 Score =   114 bits (284),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 49/84 (58%), Positives = 68/84 (81%), Gaps = 0/84 (0%)
 Frame = -2

Query  473  KPERFLGSNIDFKGQNFEFLPFGAGRRMCAGLPLGNRMLHFVLGSLLHTFDWELEGNVSS  294
            KPERFL S +D +G++FE +PFGAGRR+C GLPL  RM+  +LGSLL++FDW+LEG ++ 
Sbjct  408  KPERFLESEVDMRGRDFELIPFGAGRRICPGLPLAIRMVPVMLGSLLNSFDWKLEGGIAP  467

Query  293  ESLDMAERMGITVRKFEPLKAIPR  222
            + LDM E+ GIT++K  PL+A+PR
Sbjct  468  KDLDMEEKFGITLQKAHPLRAVPR  491



>gb|KCW45004.1| hypothetical protein EUGRSUZ_L01403 [Eucalyptus grandis]
Length=305

 Score =   112 bits (280),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 46/81 (57%), Positives = 66/81 (81%), Gaps = 0/81 (0%)
 Frame = -2

Query  470  PERFLGSNIDFKGQNFEFLPFGAGRRMCAGLPLGNRMLHFVLGSLLHTFDWELEGNVSSE  291
            PERFLGS++D +GQ+FE +PFG GRR+C GLPL  RMLH +LGSLL+ F+W LE  V+ E
Sbjct  221  PERFLGSDVDVRGQDFEIIPFGGGRRICPGLPLATRMLHLMLGSLLNAFNWRLEDGVTVE  280

Query  290  SLDMAERMGITVRKFEPLKAI  228
            +++M ++ GITV++ +P+KA+
Sbjct  281  NMNMEDKFGITVQRAQPVKAV  301



>ref|XP_002322452.2| hypothetical protein POPTR_0015s13590g [Populus trichocarpa]
 gb|EEF06579.2| hypothetical protein POPTR_0015s13590g [Populus trichocarpa]
Length=494

 Score =   114 bits (284),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 48/87 (55%), Positives = 66/87 (76%), Gaps = 0/87 (0%)
 Frame = -2

Query  473  KPERFLGSNIDFKGQNFEFLPFGAGRRMCAGLPLGNRMLHFVLGSLLHTFDWELEGNVSS  294
            KPERFLGS++DFKGQ+FEFLPFGAGRR+C GLP+  + +H ++ +LL+ FDW L      
Sbjct  408  KPERFLGSDLDFKGQDFEFLPFGAGRRICPGLPMAAKQVHLIIATLLYYFDWSLPNGEDP  467

Query  293  ESLDMAERMGITVRKFEPLKAIPRRVV  213
              LDM+E+ GIT++K +PL  +PRR +
Sbjct  468  AMLDMSEKFGITLQKEQPLLVVPRRRI  494



>emb|CAN66326.1| hypothetical protein VITISV_000490 [Vitis vinifera]
Length=86

 Score =   106 bits (265),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 45/85 (53%), Positives = 67/85 (79%), Gaps = 0/85 (0%)
 Frame = -2

Query  470  PERFLGSNIDFKGQNFEFLPFGAGRRMCAGLPLGNRMLHFVLGSLLHTFDWELEGNVSSE  291
            PERFLGS++D +GQNFE +PFGAGRR+C GL LG RM+  +L SL+H++DW+LE  ++ E
Sbjct  2    PERFLGSDMDVRGQNFELIPFGAGRRICPGLLLGIRMVQLMLASLIHSYDWKLEDGLTPE  61

Query  290  SLDMAERMGITVRKFEPLKAIPRRV  216
            +++M E+ G T++K +PL+ +P  V
Sbjct  62   NMNMEEKFGFTLQKAQPLRVLPIHV  86



>ref|XP_002301307.2| cytochrome P450 family protein [Populus trichocarpa]
 gb|EEE80580.2| cytochrome P450 family protein [Populus trichocarpa]
Length=496

 Score =   113 bits (283),  Expect = 1e-26, Method: Composition-based stats.
 Identities = 45/85 (53%), Positives = 65/85 (76%), Gaps = 0/85 (0%)
 Frame = -2

Query  473  KPERFLGSNIDFKGQNFEFLPFGAGRRMCAGLPLGNRMLHFVLGSLLHTFDWELEGNVSS  294
            KPERFL    D KG++FE +PFGAGRR+C GLPL ++M+H  L SL+H+FDW++  +++ 
Sbjct  411  KPERFLECQADVKGRDFELIPFGAGRRICPGLPLAHKMVHLTLASLIHSFDWKIADDLTP  470

Query  293  ESLDMAERMGITVRKFEPLKAIPRR  219
            E +DM+E  G+T+ K EPL+AIP +
Sbjct  471  EDIDMSETFGLTLHKSEPLRAIPMK  495



>ref|XP_002528654.1| cytochrome P450, putative [Ricinus communis]
 gb|EEF33757.1| cytochrome P450, putative [Ricinus communis]
Length=514

 Score =   114 bits (284),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 56/87 (64%), Positives = 72/87 (83%), Gaps = 0/87 (0%)
 Frame = -2

Query  473  KPERFLGSNIDFKGQNFEFLPFGAGRRMCAGLPLGNRMLHFVLGSLLHTFDWELEGNVSS  294
            KPERFLGSNID+KGQNF+ LPFG+GRR+C G+PL +R+LH  L SLLH FDWEL  N + 
Sbjct  426  KPERFLGSNIDYKGQNFQLLPFGSGRRICVGIPLAHRVLHLALASLLHCFDWELGSNSTP  485

Query  293  ESLDMAERMGITVRKFEPLKAIPRRVV  213
            E++DM ER+GI+VRK  P+KAIP++ +
Sbjct  486  ETIDMNERLGISVRKLVPMKAIPKKKI  512



>gb|KHN00774.1| Cytochrome P450 76C4 [Glycine soja]
Length=210

 Score =   110 bits (274),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 48/86 (56%), Positives = 66/86 (77%), Gaps = 0/86 (0%)
 Frame = -2

Query  473  KPERFLGSNIDFKGQNFEFLPFGAGRRMCAGLPLGNRMLHFVLGSLLHTFDWELEGNVSS  294
            +PERFL S IDFKG++F +LPFGAGRR+C GL L NRM+  +L + LH+F+WEL   V+ 
Sbjct  125  QPERFLRSKIDFKGRDFMYLPFGAGRRICPGLSLANRMITLMLATFLHSFEWELPQGVTP  184

Query  293  ESLDMAERMGITVRKFEPLKAIPRRV  216
            ++LDM+E+ GIT+++  PL AIP  V
Sbjct  185  QTLDMSEQYGITLKRLSPLCAIPISV  210



>ref|XP_011017515.1| PREDICTED: geraniol 8-hydroxylase-like [Populus euphratica]
 ref|XP_011013816.1| PREDICTED: geraniol 8-hydroxylase-like [Populus euphratica]
Length=496

 Score =   113 bits (283),  Expect = 2e-26, Method: Composition-based stats.
 Identities = 45/85 (53%), Positives = 65/85 (76%), Gaps = 0/85 (0%)
 Frame = -2

Query  473  KPERFLGSNIDFKGQNFEFLPFGAGRRMCAGLPLGNRMLHFVLGSLLHTFDWELEGNVSS  294
            KPERFL    D KG++FE +PFGAGRR+C GLPLG++M+H  L SL+H+FDW++  +++ 
Sbjct  411  KPERFLECQADVKGRDFELIPFGAGRRICPGLPLGHKMVHLTLASLIHSFDWKIADDLTP  470

Query  293  ESLDMAERMGITVRKFEPLKAIPRR  219
            E +D +E  G+T+ K EPL+AIP +
Sbjct  471  EDIDTSETFGLTLHKSEPLRAIPMK  495



>ref|XP_006487449.1| PREDICTED: geraniol 8-hydroxylase-like [Citrus sinensis]
Length=495

 Score =   113 bits (283),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 50/82 (61%), Positives = 67/82 (82%), Gaps = 4/82 (5%)
 Frame = -2

Query  470  PERFLGSNIDFKGQNFEFLPFGAGRRMCAGLPLGNRMLHFVLGSLLHTFDWELEGNVSSE  291
            PERFLGSN DFKGQNFE +PFGAGRR+C GLPL  RMLH +LGSL+++FDW+L+ +    
Sbjct  415  PERFLGSNADFKGQNFELIPFGAGRRICPGLPLAIRMLHLMLGSLINSFDWKLDNH----  470

Query  290  SLDMAERMGITVRKFEPLKAIP  225
            ++DM ++ G+TV+K +PL A+P
Sbjct  471  NMDMEDKFGLTVQKAQPLHAVP  492



>ref|XP_010040684.1| PREDICTED: geraniol 8-hydroxylase-like, partial [Eucalyptus grandis]
Length=342

 Score =   112 bits (280),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 46/81 (57%), Positives = 66/81 (81%), Gaps = 0/81 (0%)
 Frame = -2

Query  470  PERFLGSNIDFKGQNFEFLPFGAGRRMCAGLPLGNRMLHFVLGSLLHTFDWELEGNVSSE  291
            PERFLGS++D +GQ+FE +PFG GRR+C GLPL  RMLH +LGSLL+ F+W LE  V+ E
Sbjct  258  PERFLGSDVDVRGQDFEIIPFGGGRRICPGLPLATRMLHLMLGSLLNAFNWRLEDGVTVE  317

Query  290  SLDMAERMGITVRKFEPLKAI  228
            +++M ++ GITV++ +P+KA+
Sbjct  318  NMNMEDKFGITVQRAQPVKAV  338



>ref|XP_006477329.1| PREDICTED: geraniol 8-hydroxylase-like [Citrus sinensis]
Length=499

 Score =   113 bits (283),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 48/82 (59%), Positives = 66/82 (80%), Gaps = 0/82 (0%)
 Frame = -2

Query  470  PERFLGSNIDFKGQNFEFLPFGAGRRMCAGLPLGNRMLHFVLGSLLHTFDWELEGNVSSE  291
            PERFLGS+ID KG+NFE +PFGAGRR+C GLPL  RML+ +LGSL+++FDW+ E  ++  
Sbjct  415  PERFLGSDIDVKGRNFELIPFGAGRRICPGLPLAIRMLYLMLGSLINSFDWKFEDGITQH  474

Query  290  SLDMAERMGITVRKFEPLKAIP  225
            ++DM E+ G+T+ K +PL AIP
Sbjct  475  NMDMEEKFGLTLNKAQPLHAIP  496



>ref|XP_003589660.1| Cytochrome P450 monooxygenase [Medicago truncatula]
 gb|AES59911.1| cytochrome P450 family protein [Medicago truncatula]
Length=499

 Score =   113 bits (283),  Expect = 2e-26, Method: Composition-based stats.
 Identities = 46/85 (54%), Positives = 67/85 (79%), Gaps = 0/85 (0%)
 Frame = -2

Query  470  PERFLGSNIDFKGQNFEFLPFGAGRRMCAGLPLGNRMLHFVLGSLLHTFDWELEGNVSSE  291
            PERF+GS+ID KG+N+E  PFG GRR+C GL L NRML  +LGSL+++FDWELEG +  E
Sbjct  413  PERFMGSDIDVKGRNYEVAPFGGGRRICPGLQLANRMLMLMLGSLINSFDWELEGGMKPE  472

Query  290  SLDMAERMGITVRKFEPLKAIPRRV  216
             ++M ++ GIT++K +PL+ +P ++
Sbjct  473  DMNMDDKFGITLQKAQPLRIVPLKL  497



>ref|XP_006487435.1| PREDICTED: geraniol 8-hydroxylase-like [Citrus sinensis]
Length=495

 Score =   113 bits (283),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 51/82 (62%), Positives = 67/82 (82%), Gaps = 4/82 (5%)
 Frame = -2

Query  470  PERFLGSNIDFKGQNFEFLPFGAGRRMCAGLPLGNRMLHFVLGSLLHTFDWELEGNVSSE  291
            PERFLGS++DF+GQNFE LPFGAGRR+C GLPL  RML+ +LGSL++ FDW+LE     E
Sbjct  415  PERFLGSDVDFRGQNFELLPFGAGRRVCPGLPLAIRMLYLMLGSLINAFDWKLE----DE  470

Query  290  SLDMAERMGITVRKFEPLKAIP  225
            ++DM E+ G+T++K +PL AIP
Sbjct  471  NMDMEEKSGLTIQKAQPLCAIP  492



>ref|XP_006360234.1| PREDICTED: geraniol 8-hydroxylase-like [Solanum tuberosum]
Length=491

 Score =   113 bits (282),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 52/83 (63%), Positives = 64/83 (77%), Gaps = 0/83 (0%)
 Frame = -2

Query  473  KPERFLGSNIDFKGQNFEFLPFGAGRRMCAGLPLGNRMLHFVLGSLLHTFDWELEGNVSS  294
            KPERFL S ID +GQ+FE LPFG GRR+C GLPL  RM+  VLGSLL+TF+W+L+  ++ 
Sbjct  406  KPERFLESEIDIRGQDFELLPFGVGRRICPGLPLAIRMIPIVLGSLLNTFNWKLQDGITP  465

Query  293  ESLDMAERMGITVRKFEPLKAIP  225
            E LDM ER GIT+ K +PL AIP
Sbjct  466  EDLDMEERFGITLSKAQPLLAIP  488



>gb|KCW77280.1| hypothetical protein EUGRSUZ_D01639 [Eucalyptus grandis]
Length=187

 Score =   109 bits (272),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 47/85 (55%), Positives = 65/85 (76%), Gaps = 0/85 (0%)
 Frame = -2

Query  470  PERFLGSNIDFKGQNFEFLPFGAGRRMCAGLPLGNRMLHFVLGSLLHTFDWELEGNVSSE  291
            PERF+G  IDFKG++FE +PFG+GRR+C G+PL  RM+H +L  LL +FDW+LE  V  +
Sbjct  101  PERFVGREIDFKGRDFELIPFGSGRRICPGMPLAYRMVHSILAFLLRSFDWKLEQGVRPK  160

Query  290  SLDMAERMGITVRKFEPLKAIPRRV  216
             +DM E+ GIT++K  PL+AIP +V
Sbjct  161  EMDMTEKFGITLQKATPLRAIPMKV  185



>ref|XP_002276094.1| PREDICTED: geraniol 8-hydroxylase [Vitis vinifera]
Length=496

 Score =   113 bits (283),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 46/85 (54%), Positives = 67/85 (79%), Gaps = 0/85 (0%)
 Frame = -2

Query  470  PERFLGSNIDFKGQNFEFLPFGAGRRMCAGLPLGNRMLHFVLGSLLHTFDWELEGNVSSE  291
            PERFLG +ID KG++FE +PFGAGRR+C GLPL +RM+H +L SLLH++ W+L+  +   
Sbjct  412  PERFLGCDIDVKGRDFELIPFGAGRRICLGLPLAHRMVHLILASLLHSYAWKLDDGMKPA  471

Query  290  SLDMAERMGITVRKFEPLKAIPRRV  216
             +DM E++G+T+ K +PL+AIP +V
Sbjct  472  DMDMNEKLGLTLHKVQPLRAIPIKV  496



>gb|AHX24364.1| CYP76A26-like protein [Lonicera japonica]
Length=510

 Score =   113 bits (283),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 47/85 (55%), Positives = 67/85 (79%), Gaps = 0/85 (0%)
 Frame = -2

Query  473  KPERFLGSNIDFKGQNFEFLPFGAGRRMCAGLPLGNRMLHFVLGSLLHTFDWELEGNVSS  294
            KPERFL SNI++KGQ+FEF+PFG+GRR+C G PL +R++H  L +L+ +FDWE       
Sbjct  421  KPERFLTSNIEYKGQHFEFIPFGSGRRICIGFPLAHRVVHLALATLVQSFDWEFPAGEGP  480

Query  293  ESLDMAERMGITVRKFEPLKAIPRR  219
            ++LDM ER+G+T+RK  P+KAIP++
Sbjct  481  KTLDMDERLGLTLRKKNPVKAIPKK  505



>ref|XP_010105779.1| Cytochrome P450 76C4 [Morus notabilis]
 gb|EXC06132.1| Cytochrome P450 76C4 [Morus notabilis]
Length=645

 Score =   114 bits (286),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 50/82 (61%), Positives = 66/82 (80%), Gaps = 0/82 (0%)
 Frame = -2

Query  470  PERFLGSNIDFKGQNFEFLPFGAGRRMCAGLPLGNRMLHFVLGSLLHTFDWELEGNVSSE  291
            PERFL  NIDF G +FE +PFGAG+R+C GLPL  RMLH +LGSLLH+FDW+LE  VS E
Sbjct  561  PERFLKLNIDFGGHDFELIPFGAGKRICPGLPLAARMLHLMLGSLLHSFDWKLEDGVSPE  620

Query  290  SLDMAERMGITVRKFEPLKAIP  225
            +L+M ++ GIT++  +PL+A+P
Sbjct  621  TLNMEDKFGITLQMAQPLRALP  642


 Score =   110 bits (276),  Expect = 5e-25, Method: Compositional matrix adjust.
 Identities = 49/87 (56%), Positives = 67/87 (77%), Gaps = 0/87 (0%)
 Frame = -2

Query  470  PERFLGSNIDFKGQNFEFLPFGAGRRMCAGLPLGNRMLHFVLGSLLHTFDWELEGNVSSE  291
            P RFL SNID +GQ+FEF PFGAGRR+C GLPL  R+L  +LGSLLH+FDW LE  V+ E
Sbjct  59   PGRFLDSNIDVRGQDFEFTPFGAGRRLCPGLPLAIRILPLMLGSLLHSFDWMLEDGVTPE  118

Query  290  SLDMAERMGITVRKFEPLKAIPRRVVA  210
            +++M ++ G+T +  +PL+ IPR ++A
Sbjct  119  TINMEDKFGLTFQMAQPLRVIPRIILA  145



>ref|XP_006423622.1| hypothetical protein CICLE_v10028275mg [Citrus clementina]
 gb|ESR36862.1| hypothetical protein CICLE_v10028275mg [Citrus clementina]
 gb|KDO50048.1| hypothetical protein CISIN_1g011032mg [Citrus sinensis]
Length=495

 Score =   113 bits (282),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 50/82 (61%), Positives = 68/82 (83%), Gaps = 4/82 (5%)
 Frame = -2

Query  470  PERFLGSNIDFKGQNFEFLPFGAGRRMCAGLPLGNRMLHFVLGSLLHTFDWELEGNVSSE  291
            PERFLGS++DF+GQNFE +PFGAGRR+C GLPL  RML+ +LGSL+++FDW+LE     E
Sbjct  415  PERFLGSDVDFRGQNFELIPFGAGRRVCPGLPLAIRMLYLMLGSLINSFDWKLE----DE  470

Query  290  SLDMAERMGITVRKFEPLKAIP  225
            ++DM E+ G+T++K +PL AIP
Sbjct  471  NMDMEEKSGLTIQKAQPLCAIP  492



>ref|XP_006494536.1| PREDICTED: geraniol 8-hydroxylase-like [Citrus sinensis]
Length=501

 Score =   113 bits (282),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 50/82 (61%), Positives = 67/82 (82%), Gaps = 4/82 (5%)
 Frame = -2

Query  470  PERFLGSNIDFKGQNFEFLPFGAGRRMCAGLPLGNRMLHFVLGSLLHTFDWELEGNVSSE  291
            PERFLGS++D KG+NFE +PFGAGRR+C GLPL  RMLH +LGSL+++FDW+LE     E
Sbjct  421  PERFLGSDLDVKGRNFELIPFGAGRRICPGLPLAIRMLHIMLGSLINSFDWKLE----DE  476

Query  290  SLDMAERMGITVRKFEPLKAIP  225
             +DM E+ GIT++K +PL+A+P
Sbjct  477  KMDMEEKFGITLQKAQPLRAVP  498



>ref|XP_006423678.1| hypothetical protein CICLE_v10028268mg [Citrus clementina]
 gb|ESR36918.1| hypothetical protein CICLE_v10028268mg [Citrus clementina]
Length=496

 Score =   113 bits (282),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 50/85 (59%), Positives = 68/85 (80%), Gaps = 4/85 (5%)
 Frame = -2

Query  470  PERFLGSNIDFKGQNFEFLPFGAGRRMCAGLPLGNRMLHFVLGSLLHTFDWELEGNVSSE  291
            PERFLGS++D KG+NFE +PFGAGRR+C GLPL  RMLH +LGSL+++FDW+LE     E
Sbjct  416  PERFLGSDLDVKGRNFELIPFGAGRRICPGLPLAIRMLHIMLGSLINSFDWKLE----DE  471

Query  290  SLDMAERMGITVRKFEPLKAIPRRV  216
             +DM E+ GIT++K +PL+A+P  +
Sbjct  472  KMDMEEKFGITLQKAQPLRAVPMAI  496



>gb|EYU36335.1| hypothetical protein MIMGU_mgv1a004314mg [Erythranthe guttata]
Length=533

 Score =   113 bits (283),  Expect = 2e-26, Method: Composition-based stats.
 Identities = 49/86 (57%), Positives = 64/86 (74%), Gaps = 3/86 (3%)
 Frame = -2

Query  473  KPERFLGSNIDFKGQNFEFLPFGAGRRMCAGLPLGNRMLHFVLGSLLHTFDWELEGNVSS  294
            +PERFL S +DFKGQ+FE +PFG+GRRMC GLPL +RMLH  + SL+H FDW+LE  V  
Sbjct  451  EPERFLDSKVDFKGQDFELIPFGSGRRMCPGLPLVDRMLHLTVASLIHNFDWKLEAGV--  508

Query  293  ESLDMAERMGITVRKFEPLKAIPRRV  216
              LD  E+ G+++ K  PL+AIP +V
Sbjct  509  -KLDTEEKFGLSLHKAVPLEAIPTKV  533



>ref|XP_009774708.1| PREDICTED: cytochrome P450 76A2-like [Nicotiana sylvestris]
Length=508

 Score =   113 bits (282),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 58/85 (68%), Positives = 73/85 (86%), Gaps = 0/85 (0%)
 Frame = -2

Query  473  KPERFLGSNIDFKGQNFEFLPFGAGRRMCAGLPLGNRMLHFVLGSLLHTFDWELEGNVSS  294
            KPERFL S I+++GQNFEF+PFGAGRR+CAG+PL +RMLH +LGSLLH FDWE++ +V  
Sbjct  419  KPERFLDSKIEYRGQNFEFIPFGAGRRICAGIPLAHRMLHLLLGSLLHEFDWEIDNSVLD  478

Query  293  ESLDMAERMGITVRKFEPLKAIPRR  219
            E LD  +RMG+TVRK +PLKAIP+R
Sbjct  479  EVLDSQDRMGVTVRKLKPLKAIPKR  503



>ref|XP_006477331.1| PREDICTED: geraniol 8-hydroxylase-like [Citrus sinensis]
Length=499

 Score =   113 bits (282),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 48/82 (59%), Positives = 68/82 (83%), Gaps = 0/82 (0%)
 Frame = -2

Query  470  PERFLGSNIDFKGQNFEFLPFGAGRRMCAGLPLGNRMLHFVLGSLLHTFDWELEGNVSSE  291
            PERFLG ++D KG+NFE +PFGAGRR+C GLPL  RML+ +LGSL+++FDW+LE  V+ E
Sbjct  415  PERFLGLDLDVKGRNFELIPFGAGRRICPGLPLAIRMLYLMLGSLINSFDWKLEDGVTPE  474

Query  290  SLDMAERMGITVRKFEPLKAIP  225
            ++DM E+ G+T++K  PL+A+P
Sbjct  475  TIDMEEKFGLTLQKARPLRALP  496



>ref|XP_006423673.1| hypothetical protein CICLE_v10028257mg [Citrus clementina]
 gb|ESR36913.1| hypothetical protein CICLE_v10028257mg [Citrus clementina]
Length=501

 Score =   113 bits (282),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 50/82 (61%), Positives = 67/82 (82%), Gaps = 4/82 (5%)
 Frame = -2

Query  470  PERFLGSNIDFKGQNFEFLPFGAGRRMCAGLPLGNRMLHFVLGSLLHTFDWELEGNVSSE  291
            PERFLGS++D KG+NFE +PFGAGRR+C GLPL  RMLH +LGSL+++FDW+LE     E
Sbjct  421  PERFLGSDLDVKGRNFELIPFGAGRRICPGLPLAIRMLHIMLGSLINSFDWKLE----DE  476

Query  290  SLDMAERMGITVRKFEPLKAIP  225
             +DM E+ GIT++K +PL+A+P
Sbjct  477  KMDMEEKFGITLQKAQPLRAVP  498



>ref|XP_007143610.1| hypothetical protein PHAVU_007G086200g [Phaseolus vulgaris]
 gb|ESW15604.1| hypothetical protein PHAVU_007G086200g [Phaseolus vulgaris]
Length=495

 Score =   113 bits (282),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 49/83 (59%), Positives = 64/83 (77%), Gaps = 0/83 (0%)
 Frame = -2

Query  473  KPERFLGSNIDFKGQNFEFLPFGAGRRMCAGLPLGNRMLHFVLGSLLHTFDWELEGNVSS  294
            +P+RFL SNIDFKG++FE+LPFG GRR+C GLPL  RM+  +L +LLH+F WEL   V+ 
Sbjct  410  QPQRFLRSNIDFKGRDFEYLPFGGGRRICPGLPLAIRMITLMLAALLHSFQWELPQGVTP  469

Query  293  ESLDMAERMGITVRKFEPLKAIP  225
             +LDM E+ GIT++K  PL AIP
Sbjct  470  HTLDMTEQYGITLKKLSPLSAIP  492



>gb|ACI90295.1| cytochrome P450 monoxygenase, partial [Picrorhiza kurrooa]
Length=206

 Score =   109 bits (272),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 46/85 (54%), Positives = 66/85 (78%), Gaps = 0/85 (0%)
 Frame = -2

Query  473  KPERFLGSNIDFKGQNFEFLPFGAGRRMCAGLPLGNRMLHFVLGSLLHTFDWELEGNVSS  294
            +PERFL S+ID KGQNFE +PFGAGRR+C GLPL + M+H ++ SL+  FDW LE  ++ 
Sbjct  121  EPERFLNSDIDAKGQNFELIPFGAGRRICPGLPLAHAMVHLLVASLIRNFDWRLEPGITP  180

Query  293  ESLDMAERMGITVRKFEPLKAIPRR  219
            E +D+++R G++++K  PLKA+P R
Sbjct  181  EQVDISDRFGLSLQKAMPLKALPVR  205



>ref|XP_004496721.1| PREDICTED: geraniol 8-hydroxylase-like [Cicer arietinum]
Length=500

 Score =   113 bits (282),  Expect = 3e-26, Method: Composition-based stats.
 Identities = 48/85 (56%), Positives = 65/85 (76%), Gaps = 0/85 (0%)
 Frame = -2

Query  470  PERFLGSNIDFKGQNFEFLPFGAGRRMCAGLPLGNRMLHFVLGSLLHTFDWELEGNVSSE  291
            PERFLGS ID KG+NFE  PFGAGRR+C GL L NRML  +LGSL+++FDW LE  +  E
Sbjct  414  PERFLGSQIDVKGRNFELAPFGAGRRICPGLQLANRMLLLMLGSLVNSFDWMLEDGMKPE  473

Query  290  SLDMAERMGITVRKFEPLKAIPRRV  216
             ++M ++ GIT++K +PL+ +P R+
Sbjct  474  DMNMDDKFGITLQKAQPLRVVPVRI  498



>emb|CDP17803.1| unnamed protein product [Coffea canephora]
Length=499

 Score =   112 bits (281),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 49/86 (57%), Positives = 66/86 (77%), Gaps = 0/86 (0%)
 Frame = -2

Query  473  KPERFLGSNIDFKGQNFEFLPFGAGRRMCAGLPLGNRMLHFVLGSLLHTFDWELEGNVSS  294
            +PERFLGS+ID +GQ+FE +P GAGRR+C GLPLG RM+H +L S ++  DW+LE  +  
Sbjct  414  EPERFLGSDIDVRGQHFELIPLGAGRRICPGLPLGYRMVHLMLASFIYNIDWKLEDGMKP  473

Query  293  ESLDMAERMGITVRKFEPLKAIPRRV  216
            E LDM E+ G+TV+K  PLKAIP ++
Sbjct  474  EDLDMEEKFGLTVQKAWPLKAIPVKL  499



>gb|KCW77276.1| hypothetical protein EUGRSUZ_D01633 [Eucalyptus grandis]
Length=431

 Score =   112 bits (280),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 49/85 (58%), Positives = 64/85 (75%), Gaps = 0/85 (0%)
 Frame = -2

Query  470  PERFLGSNIDFKGQNFEFLPFGAGRRMCAGLPLGNRMLHFVLGSLLHTFDWELEGNVSSE  291
            PERFLG  IDFKG++FE +PFG+GRR+C G+PL  RM+H +L SLL +FDW+LE  V+  
Sbjct  347  PERFLGGEIDFKGRDFELIPFGSGRRICPGMPLAYRMVHLILASLLRSFDWKLEEGVTPV  406

Query  290  SLDMAERMGITVRKFEPLKAIPRRV  216
             +DM E+ GIT++K  PL AIP  V
Sbjct  407  EMDMTEKFGITLQKATPLCAIPMEV  431



>ref|XP_002271652.1| PREDICTED: geraniol 8-hydroxylase [Vitis vinifera]
Length=499

 Score =   112 bits (281),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 48/82 (59%), Positives = 64/82 (78%), Gaps = 0/82 (0%)
 Frame = -2

Query  470  PERFLGSNIDFKGQNFEFLPFGAGRRMCAGLPLGNRMLHFVLGSLLHTFDWELEGNVSSE  291
            PERFL  +ID KG++F+ +PFGAGRR+C GL LG RM+H VL SLLH+FDW+LEG +  E
Sbjct  415  PERFLECDIDVKGRDFQLIPFGAGRRICPGLLLGRRMVHLVLASLLHSFDWKLEGGMKPE  474

Query  290  SLDMAERMGITVRKFEPLKAIP  225
             +DM+E  G +VRK +PL+ +P
Sbjct  475  DMDMSETFGFSVRKAQPLRVVP  496



>ref|XP_002276576.1| PREDICTED: geraniol 8-hydroxylase [Vitis vinifera]
Length=499

 Score =   112 bits (281),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 47/84 (56%), Positives = 67/84 (80%), Gaps = 0/84 (0%)
 Frame = -2

Query  470  PERFLGSNIDFKGQNFEFLPFGAGRRMCAGLPLGNRMLHFVLGSLLHTFDWELEGNVSSE  291
            PERFL   ID KG++F+ +PFGAGRR+C GL LG+RM+H +L SLLH+FDW+LE ++  E
Sbjct  415  PERFLECQIDVKGRDFQLIPFGAGRRICPGLLLGHRMVHLMLASLLHSFDWKLEDSMRPE  474

Query  290  SLDMAERMGITVRKFEPLKAIPRR  219
             +DM+E+ G T+RK +PL+A+P +
Sbjct  475  DMDMSEKFGFTLRKAQPLRAVPTK  498



>ref|XP_006419188.1| hypothetical protein CICLE_v10030448mg [Citrus clementina]
 gb|ESR32428.1| hypothetical protein CICLE_v10030448mg [Citrus clementina]
Length=499

 Score =   112 bits (281),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 48/82 (59%), Positives = 65/82 (79%), Gaps = 0/82 (0%)
 Frame = -2

Query  470  PERFLGSNIDFKGQNFEFLPFGAGRRMCAGLPLGNRMLHFVLGSLLHTFDWELEGNVSSE  291
            PERFLGS ID KG+NFE +PFGAGRR+C GLPL  RML+ +LGSL+++FDW+ E  ++  
Sbjct  415  PERFLGSEIDVKGRNFELIPFGAGRRICPGLPLAIRMLYLMLGSLINSFDWKFEDGITQH  474

Query  290  SLDMAERMGITVRKFEPLKAIP  225
            ++DM E+ G+T+ K +PL AIP
Sbjct  475  NMDMEEKFGLTLNKAQPLHAIP  496



>emb|CAN75686.1| hypothetical protein VITISV_010578 [Vitis vinifera]
Length=499

 Score =   112 bits (281),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 48/82 (59%), Positives = 64/82 (78%), Gaps = 0/82 (0%)
 Frame = -2

Query  470  PERFLGSNIDFKGQNFEFLPFGAGRRMCAGLPLGNRMLHFVLGSLLHTFDWELEGNVSSE  291
            PERFL  +ID KG++F+ +PFGAGRR+C GL LG RM+H VL SLLH+FDW+LEG +  E
Sbjct  415  PERFLECDIDVKGRDFQLIPFGAGRRICPGLLLGRRMVHLVLASLLHSFDWKLEGGMKPE  474

Query  290  SLDMAERMGITVRKFEPLKAIP  225
             +DM+E  G +VRK +PL+ +P
Sbjct  475  DMDMSEXFGFSVRKAQPLRVVP  496



>gb|EPS67290.1| hypothetical protein M569_07486, partial [Genlisea aurea]
Length=485

 Score =   112 bits (280),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 50/85 (59%), Positives = 67/85 (79%), Gaps = 2/85 (2%)
 Frame = -2

Query  473  KPERFLGSN--IDFKGQNFEFLPFGAGRRMCAGLPLGNRMLHFVLGSLLHTFDWELEGNV  300
            +PERFL SN  +DFKGQNFE +PFG+GRR+C GLPL +RM+H ++ SLLH FDW+L+  +
Sbjct  399  EPERFLNSNKKMDFKGQNFELIPFGSGRRICPGLPLADRMVHIMVASLLHQFDWKLDAGM  458

Query  299  SSESLDMAERMGITVRKFEPLKAIP  225
            S E +D AE+ G+++ K  PLKAIP
Sbjct  459  SPEMVDRAEKFGLSLTKLVPLKAIP  483



>ref|XP_006494538.1| PREDICTED: geraniol 8-hydroxylase-like [Citrus sinensis]
Length=739

 Score =   114 bits (285),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 51/82 (62%), Positives = 67/82 (82%), Gaps = 4/82 (5%)
 Frame = -2

Query  470  PERFLGSNIDFKGQNFEFLPFGAGRRMCAGLPLGNRMLHFVLGSLLHTFDWELEGNVSSE  291
            PERFL SN+DFKGQNFE +PFGAGRR+C GLPL  RML+ +LGSL+++FDW+LE     E
Sbjct  412  PERFLRSNVDFKGQNFELIPFGAGRRICPGLPLAIRMLYLMLGSLINSFDWKLE----DE  467

Query  290  SLDMAERMGITVRKFEPLKAIP  225
            ++DM E+ GIT+ K +PL+A+P
Sbjct  468  NMDMEEKFGITIMKAQPLRAVP  489


 Score =   114 bits (285),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 51/82 (62%), Positives = 67/82 (82%), Gaps = 4/82 (5%)
 Frame = -2

Query  470  PERFLGSNIDFKGQNFEFLPFGAGRRMCAGLPLGNRMLHFVLGSLLHTFDWELEGNVSSE  291
            PERFL SN+DFKGQNFE +PFGAGRR+C GLPL  RML+ +LGSL+++FDW+LE     E
Sbjct  659  PERFLRSNVDFKGQNFELIPFGAGRRICPGLPLAIRMLYLMLGSLINSFDWKLE----DE  714

Query  290  SLDMAERMGITVRKFEPLKAIP  225
            ++DM E+ GIT+ K +PL+A+P
Sbjct  715  NMDMEEKFGITIMKAQPLRAVP  736



>gb|KCW47877.1| hypothetical protein EUGRSUZ_K01623, partial [Eucalyptus grandis]
Length=514

 Score =   112 bits (281),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 53/84 (63%), Positives = 63/84 (75%), Gaps = 1/84 (1%)
 Frame = -2

Query  473  KPERFLGSNI-DFKGQNFEFLPFGAGRRMCAGLPLGNRMLHFVLGSLLHTFDWELEGNVS  297
            KPERFL  N  D+KG +FEF+PFG+GRRMC  +PL +R+L   LGSLLH FDW L G   
Sbjct  421  KPERFLEPNTADYKGHHFEFIPFGSGRRMCPAVPLASRVLPLALGSLLHAFDWVLAGGTK  480

Query  296  SESLDMAERMGITVRKFEPLKAIP  225
             E +DM+ERMGIT+RK  PLKAIP
Sbjct  481  PEEMDMSERMGITLRKAVPLKAIP  504



>ref|XP_004233427.1| PREDICTED: geraniol 8-hydroxylase-like [Solanum lycopersicum]
Length=491

 Score =   112 bits (280),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 52/83 (63%), Positives = 64/83 (77%), Gaps = 0/83 (0%)
 Frame = -2

Query  473  KPERFLGSNIDFKGQNFEFLPFGAGRRMCAGLPLGNRMLHFVLGSLLHTFDWELEGNVSS  294
            KPERF  S ID +GQ+FE LPFGAGRR+C GLPL  RM+  VLGSLL+TF+W+L+  ++ 
Sbjct  406  KPERFWESEIDIRGQDFELLPFGAGRRICPGLPLAIRMIPIVLGSLLNTFNWKLQDGITP  465

Query  293  ESLDMAERMGITVRKFEPLKAIP  225
            E LDM ER GIT+ K +PL AIP
Sbjct  466  EDLDMEERFGITLAKAQPLLAIP  488



>gb|EYU38602.1| hypothetical protein MIMGU_mgv1a006828mg [Erythranthe guttata]
Length=430

 Score =   111 bits (278),  Expect = 5e-26, Method: Compositional matrix adjust.
 Identities = 49/84 (58%), Positives = 68/84 (81%), Gaps = 1/84 (1%)
 Frame = -2

Query  473  KPERFLGSNIDFKGQNFEFLPFGAGRRMCAGLPLGNRMLHFVLGSLLHTFDWEL-EGNVS  297
            KPERFL S++DFKGQ+FE LPFG+GRR C GL LG+RM+   L +L+H FDW+L +G ++
Sbjct  343  KPERFLDSDVDFKGQHFEMLPFGSGRRSCIGLTLGHRMVSLTLATLVHAFDWKLGDGIIN  402

Query  296  SESLDMAERMGITVRKFEPLKAIP  225
             ESLDM+E++G+T+R+  PLK +P
Sbjct  403  PESLDMSEKVGLTMRRMVPLKLVP  426



>emb|CDP02457.1| unnamed protein product [Coffea canephora]
Length=269

 Score =   110 bits (274),  Expect = 5e-26, Method: Compositional matrix adjust.
 Identities = 48/83 (58%), Positives = 67/83 (81%), Gaps = 0/83 (0%)
 Frame = -2

Query  473  KPERFLGSNIDFKGQNFEFLPFGAGRRMCAGLPLGNRMLHFVLGSLLHTFDWELEGNVSS  294
            KPERFL S +D +G++FE +PFGAGRR+C GLPL  RM+  +LGSLL++FDW+LEG ++ 
Sbjct  184  KPERFLESELDIRGRDFELIPFGAGRRICPGLPLAVRMVPVMLGSLLNSFDWKLEGGIAP  243

Query  293  ESLDMAERMGITVRKFEPLKAIP  225
            + LDM E+ GIT++K  PL+A+P
Sbjct  244  KDLDMEEKFGITLQKALPLRAVP  266



>ref|XP_002301302.2| hypothetical protein POPTR_0002s15110g [Populus trichocarpa]
 gb|EEE80575.2| hypothetical protein POPTR_0002s15110g [Populus trichocarpa]
Length=430

 Score =   111 bits (278),  Expect = 5e-26, Method: Compositional matrix adjust.
 Identities = 45/86 (52%), Positives = 65/86 (76%), Gaps = 0/86 (0%)
 Frame = -2

Query  473  KPERFLGSNIDFKGQNFEFLPFGAGRRMCAGLPLGNRMLHFVLGSLLHTFDWELEGNVSS  294
            KPERFL    D KG++FE +PFGAGRR+C GLPLG++M+H  L SL+H+FDW++  +++ 
Sbjct  345  KPERFLECQADVKGRDFELIPFGAGRRICPGLPLGHKMVHLTLASLIHSFDWKIADDLTP  404

Query  293  ESLDMAERMGITVRKFEPLKAIPRRV  216
            E +D++E  G T+ K EPL+AIP + 
Sbjct  405  EDIDISETFGFTLHKSEPLRAIPMKT  430



>ref|XP_011041604.1| PREDICTED: probable (S)-N-methylcoclaurine 3'-hydroxylase isozyme 
2 [Populus euphratica]
Length=492

 Score =   112 bits (279),  Expect = 5e-26, Method: Compositional matrix adjust.
 Identities = 47/85 (55%), Positives = 65/85 (76%), Gaps = 0/85 (0%)
 Frame = -2

Query  473  KPERFLGSNIDFKGQNFEFLPFGAGRRMCAGLPLGNRMLHFVLGSLLHTFDWELEGNVSS  294
            KPERFLGS++DFKG +FEFLPFGAGRR+C GLP+  + +H ++ +LL+ FDW L      
Sbjct  406  KPERFLGSDLDFKGHDFEFLPFGAGRRICPGLPMAAKQVHLIIATLLYYFDWSLPNGEDP  465

Query  293  ESLDMAERMGITVRKFEPLKAIPRR  219
             +LDM+E+ GIT++K +PL  +PRR
Sbjct  466  ATLDMSEKFGITLQKEQPLLLVPRR  490



>ref|XP_010038949.1| PREDICTED: geraniol 8-hydroxylase-like [Eucalyptus grandis]
Length=261

 Score =   109 bits (273),  Expect = 5e-26, Method: Compositional matrix adjust.
 Identities = 47/85 (55%), Positives = 65/85 (76%), Gaps = 0/85 (0%)
 Frame = -2

Query  470  PERFLGSNIDFKGQNFEFLPFGAGRRMCAGLPLGNRMLHFVLGSLLHTFDWELEGNVSSE  291
            PERF+G  IDFKG++FE +PFG+GRR+C G+PL  RM+H +L  LL +FDW+LE  V  +
Sbjct  175  PERFVGREIDFKGRDFELIPFGSGRRICPGMPLAYRMVHSILAFLLRSFDWKLEQGVRPK  234

Query  290  SLDMAERMGITVRKFEPLKAIPRRV  216
             +DM E+ GIT++K  PL+AIP +V
Sbjct  235  EMDMTEKFGITLQKATPLRAIPMKV  259



>ref|XP_010687566.1| PREDICTED: geraniol 8-hydroxylase-like [Beta vulgaris subsp. 
vulgaris]
Length=501

 Score =   112 bits (280),  Expect = 5e-26, Method: Compositional matrix adjust.
 Identities = 48/83 (58%), Positives = 63/83 (76%), Gaps = 0/83 (0%)
 Frame = -2

Query  473  KPERFLGSNIDFKGQNFEFLPFGAGRRMCAGLPLGNRMLHFVLGSLLHTFDWELEGNVSS  294
            +PERFLG  ID KG +FE +PFGAGRR+C GLPL  RM+H +LGSL+H FDW+L G++  
Sbjct  415  EPERFLGLEIDVKGHDFELIPFGAGRRICPGLPLAIRMIHLMLGSLIHGFDWKLAGDIPP  474

Query  293  ESLDMAERMGITVRKFEPLKAIP  225
            E +DM  + G+T+ K +PL AIP
Sbjct  475  EKMDMESKFGLTLDKAQPLHAIP  497



>ref|XP_006440463.1| hypothetical protein CICLE_v10019651mg [Citrus clementina]
 gb|ESR53703.1| hypothetical protein CICLE_v10019651mg [Citrus clementina]
Length=536

 Score =   112 bits (281),  Expect = 5e-26, Method: Compositional matrix adjust.
 Identities = 48/82 (59%), Positives = 65/82 (79%), Gaps = 0/82 (0%)
 Frame = -2

Query  470  PERFLGSNIDFKGQNFEFLPFGAGRRMCAGLPLGNRMLHFVLGSLLHTFDWELEGNVSSE  291
            PERFLGS ID KG+NFE +PFGAGRR+C GLPL  RML+ +LGSL+++FDW+ E  ++  
Sbjct  452  PERFLGSEIDVKGRNFELIPFGAGRRICPGLPLAIRMLYLMLGSLINSFDWKFEDGITQH  511

Query  290  SLDMAERMGITVRKFEPLKAIP  225
            ++DM E+ G+T+ K +PL AIP
Sbjct  512  NMDMEEKFGLTLNKAQPLHAIP  533



>ref|XP_010038981.1| PREDICTED: cytochrome P450 76A1-like [Eucalyptus grandis]
 gb|KCW48371.1| hypothetical protein EUGRSUZ_K02081 [Eucalyptus grandis]
Length=523

 Score =   112 bits (280),  Expect = 5e-26, Method: Compositional matrix adjust.
 Identities = 53/84 (63%), Positives = 63/84 (75%), Gaps = 1/84 (1%)
 Frame = -2

Query  473  KPERFLGSNI-DFKGQNFEFLPFGAGRRMCAGLPLGNRMLHFVLGSLLHTFDWELEGNVS  297
            KPERFL  N  D+KG +FEF+PFG+GRRMC  +PL +R+L   LGSLLH FDW L G   
Sbjct  421  KPERFLEPNTADYKGHHFEFIPFGSGRRMCPAVPLASRVLPLALGSLLHAFDWVLAGGTK  480

Query  296  SESLDMAERMGITVRKFEPLKAIP  225
             E +DM+ERMGIT+RK  PLKAIP
Sbjct  481  PEEMDMSERMGITLRKAVPLKAIP  504



>ref|XP_011017516.1| PREDICTED: geraniol 8-hydroxylase-like [Populus euphratica]
Length=500

 Score =   112 bits (279),  Expect = 6e-26, Method: Composition-based stats.
 Identities = 45/83 (54%), Positives = 63/83 (76%), Gaps = 0/83 (0%)
 Frame = -2

Query  473  KPERFLGSNIDFKGQNFEFLPFGAGRRMCAGLPLGNRMLHFVLGSLLHTFDWELEGNVSS  294
            KPERFL    D KG+ FE +PFGAGRR C GLPLG++M+H  L SL+H+FDW++  +++ 
Sbjct  415  KPERFLECQADMKGRGFELIPFGAGRRSCPGLPLGHKMVHLTLASLIHSFDWKIADDLTP  474

Query  293  ESLDMAERMGITVRKFEPLKAIP  225
            E +DM+E  G+T+ K +PL+AIP
Sbjct  475  EDIDMSEAFGLTLHKSDPLRAIP  497



>ref|XP_010053037.1| PREDICTED: geraniol 8-hydroxylase-like [Eucalyptus grandis]
Length=501

 Score =   112 bits (279),  Expect = 6e-26, Method: Compositional matrix adjust.
 Identities = 49/85 (58%), Positives = 64/85 (75%), Gaps = 0/85 (0%)
 Frame = -2

Query  470  PERFLGSNIDFKGQNFEFLPFGAGRRMCAGLPLGNRMLHFVLGSLLHTFDWELEGNVSSE  291
            PERFLG  IDFKG++FE +PFG+GRR+C G+PL  RM+H +L SLL +FDW+LE  V+  
Sbjct  417  PERFLGGEIDFKGRDFELIPFGSGRRICPGMPLAYRMVHLILASLLRSFDWKLEEGVTPV  476

Query  290  SLDMAERMGITVRKFEPLKAIPRRV  216
             +DM E+ GIT++K  PL AIP  V
Sbjct  477  EMDMTEKFGITLQKATPLCAIPMEV  501



>emb|CBI30229.3| unnamed protein product [Vitis vinifera]
Length=514

 Score =   112 bits (280),  Expect = 6e-26, Method: Compositional matrix adjust.
 Identities = 54/85 (64%), Positives = 69/85 (81%), Gaps = 0/85 (0%)
 Frame = -2

Query  473  KPERFLGSNIDFKGQNFEFLPFGAGRRMCAGLPLGNRMLHFVLGSLLHTFDWELEGNVSS  294
            KP+RFLGSN+D+KGQNFEF+PFG+GRR+C G+ L N++L   L SLLH FDWEL G V+ 
Sbjct  427  KPDRFLGSNLDYKGQNFEFIPFGSGRRICIGISLANKLLPLALASLLHCFDWELGGGVTP  486

Query  293  ESLDMAERMGITVRKFEPLKAIPRR  219
            E++DM ER+G+ VRK  PLK IP+R
Sbjct  487  ETIDMNERVGMAVRKLIPLKPIPKR  511



>ref|XP_010277464.1| PREDICTED: geraniol 8-hydroxylase-like [Nelumbo nucifera]
Length=504

 Score =   112 bits (279),  Expect = 6e-26, Method: Compositional matrix adjust.
 Identities = 48/85 (56%), Positives = 66/85 (78%), Gaps = 0/85 (0%)
 Frame = -2

Query  470  PERFLGSNIDFKGQNFEFLPFGAGRRMCAGLPLGNRMLHFVLGSLLHTFDWELEGNVSSE  291
            P+RFL S IDFKG++F+ +PFGAGRR+C GLPL  RM+H +L SLLH+FDW+LE   ++E
Sbjct  420  PDRFLNSAIDFKGRDFDLIPFGAGRRICPGLPLAFRMVHSMLASLLHSFDWKLEDGTTTE  479

Query  290  SLDMAERMGITVRKFEPLKAIPRRV  216
             +DM +  G+T++K EPL A+P  V
Sbjct  480  QMDMDDCFGLTLQKAEPLXAVPVHV  504



>ref|XP_006440464.1| hypothetical protein CICLE_v10019826mg [Citrus clementina]
 gb|ESR53704.1| hypothetical protein CICLE_v10019826mg [Citrus clementina]
Length=499

 Score =   112 bits (279),  Expect = 6e-26, Method: Compositional matrix adjust.
 Identities = 47/82 (57%), Positives = 68/82 (83%), Gaps = 0/82 (0%)
 Frame = -2

Query  470  PERFLGSNIDFKGQNFEFLPFGAGRRMCAGLPLGNRMLHFVLGSLLHTFDWELEGNVSSE  291
            PERFLG ++D KG+NFE +PFGAGRR+C GLPL  RML+ +LGSL+++FDW+LE  V+ +
Sbjct  415  PERFLGLDLDVKGRNFELIPFGAGRRICPGLPLAIRMLYLMLGSLINSFDWKLEDGVTPQ  474

Query  290  SLDMAERMGITVRKFEPLKAIP  225
            ++DM E+ G+T++K  PL+A+P
Sbjct  475  TIDMEEKFGLTLQKARPLRALP  496



>ref|XP_006338232.1| PREDICTED: geraniol 8-hydroxylase-like [Solanum tuberosum]
Length=495

 Score =   112 bits (279),  Expect = 6e-26, Method: Composition-based stats.
 Identities = 46/83 (55%), Positives = 64/83 (77%), Gaps = 0/83 (0%)
 Frame = -2

Query  473  KPERFLGSNIDFKGQNFEFLPFGAGRRMCAGLPLGNRMLHFVLGSLLHTFDWELEGNVSS  294
            KPERF  S +D +GQ+FE +PFGAGRR+C GLPL  R L  +LGSLL++FDW+ EG+++ 
Sbjct  410  KPERFWSSKMDVRGQDFELIPFGAGRRICPGLPLAIRTLSVMLGSLLNSFDWKAEGDIAP  469

Query  293  ESLDMAERMGITVRKFEPLKAIP  225
            E LD+ E+ GIT+ +  PL+A+P
Sbjct  470  EDLDVEEKFGITLARSHPLRAVP  492



>ref|XP_010036342.1| PREDICTED: cytochrome P450 76A1-like [Eucalyptus grandis]
Length=523

 Score =   112 bits (280),  Expect = 6e-26, Method: Compositional matrix adjust.
 Identities = 53/84 (63%), Positives = 63/84 (75%), Gaps = 1/84 (1%)
 Frame = -2

Query  473  KPERFLGSNI-DFKGQNFEFLPFGAGRRMCAGLPLGNRMLHFVLGSLLHTFDWELEGNVS  297
            KPERFL  N  D+KG +FEF+PFG+GRRMC  +PL +R+L   LGSLLH FDW L G   
Sbjct  421  KPERFLEPNTADYKGHHFEFIPFGSGRRMCPAVPLASRVLPLALGSLLHAFDWVLAGGTK  480

Query  296  SESLDMAERMGITVRKFEPLKAIP  225
             E +DM+ERMGIT+RK  PLKAIP
Sbjct  481  PEEMDMSERMGITLRKAVPLKAIP  504



>gb|AGX93055.1| geraniol 10-hydroxylase-like protein [Vinca minor]
Length=493

 Score =   112 bits (279),  Expect = 6e-26, Method: Compositional matrix adjust.
 Identities = 48/83 (58%), Positives = 68/83 (82%), Gaps = 0/83 (0%)
 Frame = -2

Query  473  KPERFLGSNIDFKGQNFEFLPFGAGRRMCAGLPLGNRMLHFVLGSLLHTFDWELEGNVSS  294
            KPERFL S +D +G++FE +PFGAGRR+C GLPL NRM+  +LGSLL++F+W+LEG ++ 
Sbjct  408  KPERFLESELDTRGRDFELIPFGAGRRICPGLPLANRMVPVMLGSLLNSFNWKLEGGIAP  467

Query  293  ESLDMAERMGITVRKFEPLKAIP  225
            + LDM E+ GIT++K  PL+A+P
Sbjct  468  KDLDMEEKFGITLQKAHPLRAVP  490



>ref|XP_002267565.2| PREDICTED: cytochrome P450 76A2-like [Vitis vinifera]
Length=512

 Score =   112 bits (279),  Expect = 7e-26, Method: Compositional matrix adjust.
 Identities = 54/85 (64%), Positives = 69/85 (81%), Gaps = 0/85 (0%)
 Frame = -2

Query  473  KPERFLGSNIDFKGQNFEFLPFGAGRRMCAGLPLGNRMLHFVLGSLLHTFDWELEGNVSS  294
            KP+RFLGSN+D+KGQNFEF+PFG+GRR+C G+ L N++L   L SLLH FDWEL G V+ 
Sbjct  425  KPDRFLGSNLDYKGQNFEFIPFGSGRRICIGISLANKLLPLALASLLHCFDWELGGGVTP  484

Query  293  ESLDMAERMGITVRKFEPLKAIPRR  219
            E++DM ER+G+ VRK  PLK IP+R
Sbjct  485  ETIDMNERVGMAVRKLIPLKPIPKR  509



>emb|CAN72997.1| hypothetical protein VITISV_043956 [Vitis vinifera]
Length=82

 Score =   104 bits (260),  Expect = 7e-26, Method: Compositional matrix adjust.
 Identities = 45/85 (53%), Positives = 67/85 (79%), Gaps = 4/85 (5%)
 Frame = -2

Query  470  PERFLGSNIDFKGQNFEFLPFGAGRRMCAGLPLGNRMLHFVLGSLLHTFDWELEGNVSSE  291
            PERFLGS++D +GQNFE +PF AGRR+C G+    RM+H +L SLLH++DW+LE  V+ E
Sbjct  2    PERFLGSDMDVRGQNFELIPFXAGRRICPGI----RMIHLMLASLLHSYDWKLEDGVTPE  57

Query  290  SLDMAERMGITVRKFEPLKAIPRRV  216
            +++M E+ G+T++K +PL+A+P  V
Sbjct  58   NMNMEEKFGVTLQKAQPLRALPTLV  82



>ref|XP_010050611.1| PREDICTED: geraniol 8-hydroxylase-like [Eucalyptus grandis]
 gb|KCW89349.1| hypothetical protein EUGRSUZ_A01643 [Eucalyptus grandis]
Length=498

 Score =   111 bits (278),  Expect = 7e-26, Method: Compositional matrix adjust.
 Identities = 45/81 (56%), Positives = 68/81 (84%), Gaps = 0/81 (0%)
 Frame = -2

Query  470  PERFLGSNIDFKGQNFEFLPFGAGRRMCAGLPLGNRMLHFVLGSLLHTFDWELEGNVSSE  291
            PERFLGS+IDF+G+NFE +PFG GRR+C GLPL  RMLH +LGSL+++F+W+LE  V+ E
Sbjct  414  PERFLGSDIDFRGKNFELVPFGGGRRICPGLPLATRMLHVMLGSLINSFNWKLEDGVTPE  473

Query  290  SLDMAERMGITVRKFEPLKAI  228
            +++M ++ GI++++ +PLK +
Sbjct  474  NMNMEDKFGISMQRAQPLKVV  494



>emb|CDP17825.1| unnamed protein product [Coffea canephora]
Length=471

 Score =   111 bits (277),  Expect = 8e-26, Method: Compositional matrix adjust.
 Identities = 48/87 (55%), Positives = 62/87 (71%), Gaps = 0/87 (0%)
 Frame = -2

Query  470  PERFLGSNIDFKGQNFEFLPFGAGRRMCAGLPLGNRMLHFVLGSLLHTFDWELEGNVSSE  291
            PERF+  NID KG +FE LPFG GRR+C GLPL +RM+H ++ SLLH FDW+LE  +  E
Sbjct  385  PERFMDRNIDAKGNHFELLPFGTGRRICPGLPLAHRMVHIMVASLLHKFDWKLEEEIKPE  444

Query  290  SLDMAERMGITVRKFEPLKAIPRRVVA  210
             LDM+E+  +T+ K  PL+AIP R   
Sbjct  445  QLDMSEKSALTLHKAVPLRAIPVRTTV  471



>gb|KHG23791.1| Cytochrome P450 protein [Gossypium arboreum]
Length=226

 Score =   108 bits (270),  Expect = 8e-26, Method: Compositional matrix adjust.
 Identities = 48/82 (59%), Positives = 62/82 (76%), Gaps = 0/82 (0%)
 Frame = -2

Query  470  PERFLGSNIDFKGQNFEFLPFGAGRRMCAGLPLGNRMLHFVLGSLLHTFDWELEGNVSSE  291
            P+RFLGS ID KG++F  +PFGAGRR+C GLPL NRMLH +LGSL++ FDW+LEG +S  
Sbjct  142  PDRFLGSEIDVKGRDFGLIPFGAGRRICPGLPLANRMLHLMLGSLINYFDWKLEGEISPN  201

Query  290  SLDMAERMGITVRKFEPLKAIP  225
             ++M E+  I V    PL+AIP
Sbjct  202  EMNMEEKYRIAVHMATPLRAIP  223



>ref|XP_009793557.1| PREDICTED: geraniol 8-hydroxylase-like [Nicotiana sylvestris]
Length=498

 Score =   111 bits (278),  Expect = 9e-26, Method: Composition-based stats.
 Identities = 46/83 (55%), Positives = 63/83 (76%), Gaps = 0/83 (0%)
 Frame = -2

Query  473  KPERFLGSNIDFKGQNFEFLPFGAGRRMCAGLPLGNRMLHFVLGSLLHTFDWELEGNVSS  294
            KPERF GS ID +GQ+FE +PFG GRR+C GLPL  R L  +LGSLL++FDW+ EG+++ 
Sbjct  413  KPERFWGSKIDVRGQDFELIPFGVGRRICPGLPLAARTLSVMLGSLLNSFDWKAEGDIAP  472

Query  293  ESLDMAERMGITVRKFEPLKAIP  225
            E LD+ E+ G+T+ +  PL+ IP
Sbjct  473  EHLDVEEKFGLTLARSIPLRVIP  495



>ref|XP_010667628.1| PREDICTED: geraniol 8-hydroxylase-like [Beta vulgaris subsp. 
vulgaris]
Length=215

 Score =   108 bits (269),  Expect = 9e-26, Method: Compositional matrix adjust.
 Identities = 49/83 (59%), Positives = 63/83 (76%), Gaps = 0/83 (0%)
 Frame = -2

Query  473  KPERFLGSNIDFKGQNFEFLPFGAGRRMCAGLPLGNRMLHFVLGSLLHTFDWELEGNVSS  294
            +PERFL   ID +G NFE +PFGAGRR+C GLPL  +++ FVLGSL+H FDWELE  VS 
Sbjct  127  EPERFLKMEIDVRGHNFELIPFGAGRRICPGLPLAIQIIPFVLGSLIHGFDWELEAGVSP  186

Query  293  ESLDMAERMGITVRKFEPLKAIP  225
            E++DM E  GI++ K + L+AIP
Sbjct  187  ENIDMEENFGISLEKAQRLRAIP  209



>ref|XP_010103208.1| Cytochrome P450 76C1 [Morus notabilis]
 gb|EXB94994.1| Cytochrome P450 76C1 [Morus notabilis]
Length=513

 Score =   111 bits (278),  Expect = 9e-26, Method: Compositional matrix adjust.
 Identities = 49/82 (60%), Positives = 65/82 (79%), Gaps = 0/82 (0%)
 Frame = -2

Query  470  PERFLGSNIDFKGQNFEFLPFGAGRRMCAGLPLGNRMLHFVLGSLLHTFDWELEGNVSSE  291
            PERFL  N+DF G++FE +PFGAGRR+C GLPL  RMLH +LGSLLH+FDW+LE  V  E
Sbjct  420  PERFLELNMDFGGRDFELIPFGAGRRICPGLPLATRMLHLMLGSLLHSFDWKLEDGVRPE  479

Query  290  SLDMAERMGITVRKFEPLKAIP  225
            +++M E+ GIT++  + L+AIP
Sbjct  480  TMNMEEKFGITLQMAQHLRAIP  501



>ref|XP_006495031.1| PREDICTED: geraniol 8-hydroxylase-like [Citrus sinensis]
Length=477

 Score =   111 bits (277),  Expect = 9e-26, Method: Compositional matrix adjust.
 Identities = 48/82 (59%), Positives = 68/82 (83%), Gaps = 4/82 (5%)
 Frame = -2

Query  470  PERFLGSNIDFKGQNFEFLPFGAGRRMCAGLPLGNRMLHFVLGSLLHTFDWELEGNVSSE  291
            PERFLGS+++FKGQ+FE +PFGAGRR+C GLPL  RML+ +LGSL+++FDW+LE    +E
Sbjct  397  PERFLGSDVEFKGQHFELIPFGAGRRICPGLPLAIRMLYLMLGSLINSFDWKLE----NE  452

Query  290  SLDMAERMGITVRKFEPLKAIP  225
             +DM E+ G+T++K +PL+ IP
Sbjct  453  DMDMEEKFGLTIKKTQPLRTIP  474



>gb|KCW84353.1| hypothetical protein EUGRSUZ_B01205 [Eucalyptus grandis]
Length=423

 Score =   110 bits (276),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 49/85 (58%), Positives = 64/85 (75%), Gaps = 0/85 (0%)
 Frame = -2

Query  473  KPERFLGSNIDFKGQNFEFLPFGAGRRMCAGLPLGNRMLHFVLGSLLHTFDWELEGNVSS  294
            KP+RF+GS ID KGQNFE +PFG+GRR+C GL L +R+LH  L +LL+ FDWEL    + 
Sbjct  336  KPKRFMGSKIDCKGQNFELIPFGSGRRICIGLSLADRVLHLGLATLLYHFDWELGDGSTP  395

Query  293  ESLDMAERMGITVRKFEPLKAIPRR  219
            ++LDM ER+GI  RK  PLK IP++
Sbjct  396  KTLDMKERVGIIQRKLHPLKVIPKK  420



>ref|XP_011013817.1| PREDICTED: geraniol 8-hydroxylase-like [Populus euphratica]
Length=496

 Score =   111 bits (277),  Expect = 1e-25, Method: Composition-based stats.
 Identities = 44/85 (52%), Positives = 65/85 (76%), Gaps = 0/85 (0%)
 Frame = -2

Query  473  KPERFLGSNIDFKGQNFEFLPFGAGRRMCAGLPLGNRMLHFVLGSLLHTFDWELEGNVSS  294
            KPERFL    D KG++FE +PFGAGRR+C GLPL ++M+H  L SL+H+FDW++  +++ 
Sbjct  411  KPERFLECQADVKGRDFELIPFGAGRRICPGLPLAHKMVHLTLASLIHSFDWKIADDLTP  470

Query  293  ESLDMAERMGITVRKFEPLKAIPRR  219
            E +DM++  G+T+ K EPL+AIP +
Sbjct  471  EDIDMSQTFGLTLHKREPLRAIPMK  495



>ref|XP_006487472.1| PREDICTED: geraniol 8-hydroxylase-like isoform X2 [Citrus sinensis]
Length=457

 Score =   110 bits (276),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 49/82 (60%), Positives = 67/82 (82%), Gaps = 4/82 (5%)
 Frame = -2

Query  470  PERFLGSNIDFKGQNFEFLPFGAGRRMCAGLPLGNRMLHFVLGSLLHTFDWELEGNVSSE  291
            PERFLG ++DFKG+NFE +PFGAGRR+C GLPL  RMLH +LGSL+++FDW+LE    +E
Sbjct  377  PERFLGLDVDFKGRNFELIPFGAGRRICPGLPLAIRMLHLMLGSLINSFDWKLE----NE  432

Query  290  SLDMAERMGITVRKFEPLKAIP  225
            ++DM E+ G+TV+K +PL  +P
Sbjct  433  NMDMEEKFGLTVQKAQPLHVVP  454



>gb|KEH43873.1| cytochrome P450 family protein [Medicago truncatula]
Length=499

 Score =   111 bits (277),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 48/82 (59%), Positives = 66/82 (80%), Gaps = 0/82 (0%)
 Frame = -2

Query  470  PERFLGSNIDFKGQNFEFLPFGAGRRMCAGLPLGNRMLHFVLGSLLHTFDWELEGNVSSE  291
            PERFLGS+ID KG+NFE +PFG GRR+C GL L NRML  +LGSL+++FDWELEG +  E
Sbjct  413  PERFLGSDIDVKGRNFELVPFGGGRRICPGLQLANRMLLLMLGSLVNSFDWELEGGMKPE  472

Query  290  SLDMAERMGITVRKFEPLKAIP  225
             +DM ++ G+T++K +PL+ +P
Sbjct  473  DMDMDDKFGLTLQKAKPLRILP  494



>gb|KDO61006.1| hypothetical protein CISIN_1g0379901mg, partial [Citrus sinensis]
Length=209

 Score =   107 bits (268),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 50/88 (57%), Positives = 63/88 (72%), Gaps = 5/88 (6%)
 Frame = -2

Query  473  KPERFLGSN-----IDFKGQNFEFLPFGAGRRMCAGLPLGNRMLHFVLGSLLHTFDWELE  309
            KPERFL        +++KG +FEF+PFG+GRRMC  +PL +R+L   LGSLLH+FDW L 
Sbjct  116  KPERFLEPTNYNMMVEYKGHHFEFIPFGSGRRMCPAMPLASRVLPLALGSLLHSFDWVLA  175

Query  308  GNVSSESLDMAERMGITVRKFEPLKAIP  225
              +  E +DM ERMGIT+RK  PLKAIP
Sbjct  176  DGLKPEEMDMTERMGITLRKSVPLKAIP  203



>emb|CAN81641.1| hypothetical protein VITISV_036425 [Vitis vinifera]
Length=473

 Score =   110 bits (276),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 47/82 (57%), Positives = 64/82 (78%), Gaps = 0/82 (0%)
 Frame = -2

Query  470  PERFLGSNIDFKGQNFEFLPFGAGRRMCAGLPLGNRMLHFVLGSLLHTFDWELEGNVSSE  291
            PERFL   ID KG++F+ +PFGAGRR+C GL LG+RM+H +L SLLH+FDW+LE  +  E
Sbjct  389  PERFLECEIDVKGRDFQLIPFGAGRRICPGLLLGHRMVHLMLASLLHSFDWKLEDGLKPE  448

Query  290  SLDMAERMGITVRKFEPLKAIP  225
             +DM E+ G T+RK +PL+A+P
Sbjct  449  DMDMTEKFGFTLRKAQPLQAVP  470



>gb|AIO11760.1| cytochrome p450 [Croton stellatopilosus]
 emb|CDM63950.1| cytochrom p450 reductase [Croton stellatopilosus]
Length=507

 Score =   111 bits (277),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 48/85 (56%), Positives = 67/85 (79%), Gaps = 0/85 (0%)
 Frame = -2

Query  470  PERFLGSNIDFKGQNFEFLPFGAGRRMCAGLPLGNRMLHFVLGSLLHTFDWELEGNVSSE  291
            PERFLGS+ID +G+NFE +PFGAGRR+C GLPL  RMLH +LGSL++ FDW+LE  ++  
Sbjct  421  PERFLGSDIDARGRNFELIPFGAGRRICPGLPLAIRMLHLMLGSLINLFDWKLESGINPN  480

Query  290  SLDMAERMGITVRKFEPLKAIPRRV  216
             ++M +R GIT++K  PL A+P ++
Sbjct  481  VMNMEDRFGITLQKANPLLAVPLKL  505



>ref|XP_006423714.1| hypothetical protein CICLE_v10028277mg [Citrus clementina]
 gb|ESR36954.1| hypothetical protein CICLE_v10028277mg [Citrus clementina]
 gb|KDO53970.1| hypothetical protein CISIN_1g011030mg [Citrus sinensis]
Length=495

 Score =   111 bits (277),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 49/82 (60%), Positives = 67/82 (82%), Gaps = 4/82 (5%)
 Frame = -2

Query  470  PERFLGSNIDFKGQNFEFLPFGAGRRMCAGLPLGNRMLHFVLGSLLHTFDWELEGNVSSE  291
            PERFLG ++DFKG+NFE +PFGAGRR+C GLPL  RMLH +LGSL+++FDW+LE    +E
Sbjct  415  PERFLGLDVDFKGRNFELIPFGAGRRICPGLPLAIRMLHLMLGSLINSFDWKLE----NE  470

Query  290  SLDMAERMGITVRKFEPLKAIP  225
            ++DM E+ G+TV+K +PL  +P
Sbjct  471  NMDMEEKFGLTVQKAQPLHVVP  492



>ref|XP_006341260.1| PREDICTED: cytochrome P450 76A2-like [Solanum tuberosum]
Length=509

 Score =   111 bits (277),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 53/84 (63%), Positives = 64/84 (76%), Gaps = 1/84 (1%)
 Frame = -2

Query  473  KPERFLGSN-IDFKGQNFEFLPFGAGRRMCAGLPLGNRMLHFVLGSLLHTFDWELEGNVS  297
            KPERFL  N ID+KG +FEF+PFG+GRRMC  +PL +RML   LGS+LH FDW L   V 
Sbjct  418  KPERFLEPNMIDYKGHHFEFIPFGSGRRMCPAVPLASRMLPLTLGSVLHKFDWVLANGVK  477

Query  296  SESLDMAERMGITVRKFEPLKAIP  225
             E+LDM ERMG+T++K  PLKAIP
Sbjct  478  PENLDMNERMGMTLKKAIPLKAIP  501



>ref|XP_006487471.1| PREDICTED: geraniol 8-hydroxylase-like isoform X1 [Citrus sinensis]
Length=495

 Score =   111 bits (277),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 49/82 (60%), Positives = 67/82 (82%), Gaps = 4/82 (5%)
 Frame = -2

Query  470  PERFLGSNIDFKGQNFEFLPFGAGRRMCAGLPLGNRMLHFVLGSLLHTFDWELEGNVSSE  291
            PERFLG ++DFKG+NFE +PFGAGRR+C GLPL  RMLH +LGSL+++FDW+LE    +E
Sbjct  415  PERFLGLDVDFKGRNFELIPFGAGRRICPGLPLAIRMLHLMLGSLINSFDWKLE----NE  470

Query  290  SLDMAERMGITVRKFEPLKAIP  225
            ++DM E+ G+TV+K +PL  +P
Sbjct  471  NMDMEEKFGLTVQKAQPLHVVP  492



>ref|XP_010661703.1| PREDICTED: cytochrome P450 76C4-like [Vitis vinifera]
Length=380

 Score =   110 bits (275),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 46/85 (54%), Positives = 66/85 (78%), Gaps = 0/85 (0%)
 Frame = -2

Query  470  PERFLGSNIDFKGQNFEFLPFGAGRRMCAGLPLGNRMLHFVLGSLLHTFDWELEGNVSSE  291
            PERFLG +ID KG++FE +PFGAGRR+C  LPL +RM+H +L SLLH++ W+L+  +  E
Sbjct  296  PERFLGCDIDVKGRDFELIPFGAGRRICLALPLAHRMVHLILVSLLHSYAWKLDDGMKPE  355

Query  290  SLDMAERMGITVRKFEPLKAIPRRV  216
             +DM E++G T++K +PL+AIP  V
Sbjct  356  DMDMNEKLGFTLQKAQPLRAIPIEV  380



>emb|CBI38806.3| unnamed protein product [Vitis vinifera]
Length=1183

 Score =   113 bits (283),  Expect = 1e-25, Method: Composition-based stats.
 Identities = 47/81 (58%), Positives = 63/81 (78%), Gaps = 0/81 (0%)
 Frame = -2

Query  470  PERFLGSNIDFKGQNFEFLPFGAGRRMCAGLPLGNRMLHFVLGSLLHTFDWELEGNVSSE  291
            PERFL  +ID KG++F+ +PFGAGRR+C GL LG RM+H VL SLLH+FDW+LEG +  E
Sbjct  415  PERFLECDIDVKGRDFQLIPFGAGRRICPGLLLGRRMVHLVLASLLHSFDWKLEGGMKPE  474

Query  290  SLDMAERMGITVRKFEPLKAI  228
             +DM+E  G +VRK +PL+ +
Sbjct  475  DMDMSETFGFSVRKAQPLRVV  495


 Score = 96.7 bits (239),  Expect = 9e-20, Method: Composition-based stats.
 Identities = 39/68 (57%), Positives = 55/68 (81%), Gaps = 0/68 (0%)
 Frame = -2

Query  470   PERFLGSNIDFKGQNFEFLPFGAGRRMCAGLPLGNRMLHFVLGSLLHTFDWELEGNVSSE  291
             PERFL   ID KG++F+ +PFGAGRR+C GL LG+RM+H +L SLLH+FDW+LE ++  E
Sbjct  1038  PERFLECQIDVKGRDFQLIPFGAGRRICPGLLLGHRMVHLMLASLLHSFDWKLEDSMRPE  1097

Query  290   SLDMAERM  267
              +DM+E++
Sbjct  1098  DMDMSEKI  1105



>ref|XP_007201998.1| hypothetical protein PRUPE_ppa022979mg [Prunus persica]
 gb|EMJ03197.1| hypothetical protein PRUPE_ppa022979mg [Prunus persica]
Length=528

 Score =   111 bits (278),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 53/85 (62%), Positives = 66/85 (78%), Gaps = 2/85 (2%)
 Frame = -2

Query  473  KPERFLGSN--IDFKGQNFEFLPFGAGRRMCAGLPLGNRMLHFVLGSLLHTFDWELEGNV  300
            KPERFL  N  +D+KGQ+FEF+PFG+GRRMC  +PL +R+L   LGSLLH+FDW L   +
Sbjct  433  KPERFLEPNMDVDYKGQHFEFIPFGSGRRMCPAVPLVSRVLPLALGSLLHSFDWVLPEGL  492

Query  299  SSESLDMAERMGITVRKFEPLKAIP  225
              E++DMAERMGIT+RK  PLK IP
Sbjct  493  EPENMDMAERMGITLRKSVPLKVIP  517



>ref|XP_009116769.1| PREDICTED: cytochrome P450 76C3 [Brassica rapa]
Length=497

 Score =   111 bits (277),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 49/83 (59%), Positives = 63/83 (76%), Gaps = 0/83 (0%)
 Frame = -2

Query  473  KPERFLGSNIDFKGQNFEFLPFGAGRRMCAGLPLGNRMLHFVLGSLLHTFDWELEGNVSS  294
            KPERFLG  ID KG +FE +PFGAGRR+C GLPLG R++H VL SLL+ FDWE +  +  
Sbjct  410  KPERFLGREIDVKGNDFELIPFGAGRRICPGLPLGFRIVHLVLASLLYGFDWEYQNGILP  469

Query  293  ESLDMAERMGITVRKFEPLKAIP  225
            E++DM+E  G+T+ K EPL A+P
Sbjct  470  ENVDMSEAFGVTLHKAEPLCAVP  492



>ref|XP_006494719.1| PREDICTED: geraniol 8-hydroxylase-like [Citrus sinensis]
Length=495

 Score =   110 bits (276),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 48/82 (59%), Positives = 68/82 (83%), Gaps = 4/82 (5%)
 Frame = -2

Query  470  PERFLGSNIDFKGQNFEFLPFGAGRRMCAGLPLGNRMLHFVLGSLLHTFDWELEGNVSSE  291
            PERFLGS+++FKGQ+FE +PFGAGRR+C GLPL  RML+ +LGSL+++FDW+LE    +E
Sbjct  415  PERFLGSDVEFKGQHFELIPFGAGRRICPGLPLAIRMLYLMLGSLINSFDWKLE----NE  470

Query  290  SLDMAERMGITVRKFEPLKAIP  225
             +DM E+ G+T++K +PL+ IP
Sbjct  471  DMDMEEKFGLTIKKAQPLRTIP  492



>ref|XP_006360237.1| PREDICTED: geraniol 8-hydroxylase-like [Solanum tuberosum]
Length=492

 Score =   110 bits (276),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 49/83 (59%), Positives = 65/83 (78%), Gaps = 0/83 (0%)
 Frame = -2

Query  473  KPERFLGSNIDFKGQNFEFLPFGAGRRMCAGLPLGNRMLHFVLGSLLHTFDWELEGNVSS  294
            KPERF  SNID +GQ+FE +PFGAGRR+C GLPL  RM+   LGSL++TF+W+L+G ++ 
Sbjct  407  KPERFWESNIDVRGQDFELIPFGAGRRICPGLPLAIRMIPIALGSLINTFNWKLDGGIAP  466

Query  293  ESLDMAERMGITVRKFEPLKAIP  225
            + LDM E+ GIT+ K +PL AIP
Sbjct  467  KDLDMEEKFGITLAKAQPLLAIP  489



>ref|XP_011069673.1| PREDICTED: ferruginol synthase-like [Sesamum indicum]
Length=514

 Score =   111 bits (277),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 44/85 (52%), Positives = 63/85 (74%), Gaps = 0/85 (0%)
 Frame = -2

Query  473  KPERFLGSNIDFKGQNFEFLPFGAGRRMCAGLPLGNRMLHFVLGSLLHTFDWELEGNVSS  294
            +PERF    +DFKG NFE +PFGAGRR+C GLPL  RM+H  + SL+H FDWELE  ++ 
Sbjct  429  EPERFFNREVDFKGHNFELIPFGAGRRICPGLPLAYRMVHLTVASLIHNFDWELEPGITP  488

Query  293  ESLDMAERMGITVRKFEPLKAIPRR  219
            + +D+ E+ G++++K  PLKA+P +
Sbjct  489  QDVDLNEKFGLSLKKAIPLKAVPTK  513



>ref|XP_010661589.1| PREDICTED: geraniol 8-hydroxylase-like [Vitis vinifera]
Length=496

 Score =   110 bits (276),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 47/82 (57%), Positives = 64/82 (78%), Gaps = 0/82 (0%)
 Frame = -2

Query  470  PERFLGSNIDFKGQNFEFLPFGAGRRMCAGLPLGNRMLHFVLGSLLHTFDWELEGNVSSE  291
            PERFL   ID KG++F+ +PFGAGRR+C GL LG+RM+H +L SLLH+FDW+LE  +  E
Sbjct  412  PERFLECEIDVKGRDFQLIPFGAGRRICPGLLLGHRMVHLMLASLLHSFDWKLEDGLKPE  471

Query  290  SLDMAERMGITVRKFEPLKAIP  225
             +DM E+ G T+RK +PL+A+P
Sbjct  472  DMDMTEKFGFTLRKAQPLQAVP  493



>ref|XP_003557080.2| PREDICTED: geraniol 8-hydroxylase-like [Glycine max]
Length=483

 Score =   110 bits (275),  Expect = 2e-25, Method: Composition-based stats.
 Identities = 44/85 (52%), Positives = 68/85 (80%), Gaps = 0/85 (0%)
 Frame = -2

Query  470  PERFLGSNIDFKGQNFEFLPFGAGRRMCAGLPLGNRMLHFVLGSLLHTFDWELEGNVSSE  291
            P+RFLGS+ID KG+NFE  P+GAGRR+C GL L NRML  +LGSL+++FDW+L  ++ ++
Sbjct  397  PDRFLGSDIDVKGRNFELAPYGAGRRICPGLSLANRMLLLMLGSLINSFDWKLGHDIETQ  456

Query  290  SLDMAERMGITVRKFEPLKAIPRRV  216
             +DM ++ GIT++K +PL+ +P ++
Sbjct  457  DMDMDDKFGITLQKAQPLRIVPLKI  481



>ref|XP_010045881.1| PREDICTED: cytochrome P450 76A1-like [Eucalyptus grandis]
Length=507

 Score =   110 bits (276),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 49/85 (58%), Positives = 64/85 (75%), Gaps = 0/85 (0%)
 Frame = -2

Query  473  KPERFLGSNIDFKGQNFEFLPFGAGRRMCAGLPLGNRMLHFVLGSLLHTFDWELEGNVSS  294
            KP+RF+GS ID KGQNFE +PFG+GRR+C GL L +R+LH  L +LL+ FDWEL    + 
Sbjct  420  KPKRFMGSKIDCKGQNFELIPFGSGRRICIGLSLADRVLHLGLATLLYHFDWELGDGSTP  479

Query  293  ESLDMAERMGITVRKFEPLKAIPRR  219
            ++LDM ER+GI  RK  PLK IP++
Sbjct  480  KTLDMKERVGIIQRKLHPLKVIPKK  504



>ref|XP_011074592.1| PREDICTED: ferruginol synthase-like, partial [Sesamum indicum]
Length=464

 Score =   110 bits (275),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 44/86 (51%), Positives = 66/86 (77%), Gaps = 0/86 (0%)
 Frame = -2

Query  473  KPERFLGSNIDFKGQNFEFLPFGAGRRMCAGLPLGNRMLHFVLGSLLHTFDWELEGNVSS  294
            +PERFL S ID +GQ+FE +PFG+GRR+C GLPL  R++H ++ SL+H FDW+LEG ++ 
Sbjct  368  EPERFLDSKIDIRGQDFELIPFGSGRRICPGLPLAYRIVHVLVASLIHNFDWKLEGGITP  427

Query  293  ESLDMAERMGITVRKFEPLKAIPRRV  216
            + LDM E+   +++K  PLKA+P ++
Sbjct  428  DELDMKEKFQFSLQKVVPLKAVPVKL  453



>gb|EPS66524.1| hypothetical protein M569_08252, partial [Genlisea aurea]
Length=512

 Score =   110 bits (276),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 46/85 (54%), Positives = 64/85 (75%), Gaps = 0/85 (0%)
 Frame = -2

Query  473  KPERFLGSNIDFKGQNFEFLPFGAGRRMCAGLPLGNRMLHFVLGSLLHTFDWELEGNVSS  294
            +PERFLGS +DFKGQ FE LPFG+GRR+C G+PL  RML   + +L+H FDW+LE   + 
Sbjct  428  EPERFLGSKVDFKGQYFELLPFGSGRRLCPGMPLATRMLPITVAALIHNFDWKLEDGANP  487

Query  293  ESLDMAERMGITVRKFEPLKAIPRR  219
            +S+D  ER G+++RK  P++AIP +
Sbjct  488  KSIDTVERFGLSLRKAVPIRAIPSK  512



>gb|AHX24367.1| CYP76A26-like protein [Rauvolfia serpentina]
Length=514

 Score =   110 bits (276),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 45/87 (52%), Positives = 66/87 (76%), Gaps = 0/87 (0%)
 Frame = -2

Query  473  KPERFLGSNIDFKGQNFEFLPFGAGRRMCAGLPLGNRMLHFVLGSLLHTFDWELEGNVSS  294
            KPERFL S++++KGQ+FE +PFG+GRR+C G PL +R++H  L +L+  FDW+L   V  
Sbjct  426  KPERFLNSSVEYKGQHFELIPFGSGRRICVGFPLAHRVVHLTLATLVQAFDWDLGAGVKP  485

Query  293  ESLDMAERMGITVRKFEPLKAIPRRVV  213
            E +D+ ER+G+T+RK  PLK IP++ V
Sbjct  486  EDIDLEERLGLTLRKKNPLKVIPKKRV  512



>ref|XP_010105781.1| 7-ethoxycoumarin O-deethylase [Morus notabilis]
 gb|EXC06134.1| 7-ethoxycoumarin O-deethylase [Morus notabilis]
Length=507

 Score =   110 bits (276),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 48/85 (56%), Positives = 66/85 (78%), Gaps = 0/85 (0%)
 Frame = -2

Query  470  PERFLGSNIDFKGQNFEFLPFGAGRRMCAGLPLGNRMLHFVLGSLLHTFDWELEGNVSSE  291
            P RFL SNID +G +FEF PFGAGRR+C GLPL  R+L  +LGSLLH+FDW LE  V+ E
Sbjct  421  PGRFLDSNIDVRGHDFEFTPFGAGRRLCPGLPLAIRILPLMLGSLLHSFDWMLEDGVTPE  480

Query  290  SLDMAERMGITVRKFEPLKAIPRRV  216
            +++M ++ G+T++  +PL+AIPR +
Sbjct  481  TINMEDKFGLTLQMAQPLRAIPRSI  505



>ref|XP_004147600.1| PREDICTED: geraniol 8-hydroxylase-like [Cucumis sativus]
Length=451

 Score =   110 bits (274),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 48/84 (57%), Positives = 67/84 (80%), Gaps = 1/84 (1%)
 Frame = -2

Query  473  KPERFLG-SNIDFKGQNFEFLPFGAGRRMCAGLPLGNRMLHFVLGSLLHTFDWELEGNVS  297
            KPERFL  S ID+KG+N E +PFGAGRR+C GLPL NRM H++L SL+H+FDW+LE  ++
Sbjct  365  KPERFLELSEIDYKGRNMELIPFGAGRRICPGLPLANRMGHWILASLIHSFDWKLEDGIT  424

Query  296  SESLDMAERMGITVRKFEPLKAIP  225
             ++++M E++G+T+    PLKAIP
Sbjct  425  PKNMNMDEKVGLTLVMAHPLKAIP  448



>emb|CDP18467.1| unnamed protein product [Coffea canephora]
Length=444

 Score =   110 bits (274),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 52/84 (62%), Positives = 62/84 (74%), Gaps = 1/84 (1%)
 Frame = -2

Query  473  KPERFLG-SNIDFKGQNFEFLPFGAGRRMCAGLPLGNRMLHFVLGSLLHTFDWELEGNVS  297
            KPERFL  S  DFKG +FEF+PFG+GRR+C  +PL +R+L   LGS+LH FDW L   + 
Sbjct  356  KPERFLEPSTADFKGHHFEFIPFGSGRRICPAVPLASRVLPMALGSILHLFDWSLADGIK  415

Query  296  SESLDMAERMGITVRKFEPLKAIP  225
             E LDM ERMGIT+RK  PLKAIP
Sbjct  416  PEELDMGERMGITLRKAVPLKAIP  439



>ref|XP_003521519.1| PREDICTED: geraniol 8-hydroxylase-like [Glycine max]
 gb|KHN04086.1| Cytochrome P450 76C4 [Glycine soja]
Length=516

 Score =   110 bits (275),  Expect = 2e-25, Method: Composition-based stats.
 Identities = 47/82 (57%), Positives = 62/82 (76%), Gaps = 0/82 (0%)
 Frame = -2

Query  470  PERFLGSNIDFKGQNFEFLPFGAGRRMCAGLPLGNRMLHFVLGSLLHTFDWELEGNVSSE  291
            PERFL S+IDFKGQ+FE +PFGAGRR+C GLPL +R +H VL SLL+ ++W+L      E
Sbjct  415  PERFLESDIDFKGQDFELIPFGAGRRICPGLPLASRTVHIVLASLLYNYNWKLTDGQKPE  474

Query  290  SLDMAERMGITVRKFEPLKAIP  225
             +DM+E+ GIT+ K +PL  IP
Sbjct  475  DMDMSEKYGITLHKAQPLLVIP  496



>gb|ACU20890.1| unknown [Glycine max]
Length=516

 Score =   110 bits (275),  Expect = 2e-25, Method: Composition-based stats.
 Identities = 47/82 (57%), Positives = 62/82 (76%), Gaps = 0/82 (0%)
 Frame = -2

Query  470  PERFLGSNIDFKGQNFEFLPFGAGRRMCAGLPLGNRMLHFVLGSLLHTFDWELEGNVSSE  291
            PERFL S+IDFKGQ+FE +PFGAGRR+C GLPL +R +H VL SLL+ ++W+L      E
Sbjct  415  PERFLESDIDFKGQDFELIPFGAGRRICPGLPLASRTVHIVLASLLYNYNWKLTDGQKPE  474

Query  290  SLDMAERMGITVRKFEPLKAIP  225
             +DM+E+ GIT+ K +PL  IP
Sbjct  475  DMDMSEKYGITLHKAQPLLVIP  496



>ref|XP_011091126.1| PREDICTED: geraniol 8-hydroxylase-like [Sesamum indicum]
Length=498

 Score =   110 bits (275),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 45/85 (53%), Positives = 65/85 (76%), Gaps = 0/85 (0%)
 Frame = -2

Query  470  PERFLGSNIDFKGQNFEFLPFGAGRRMCAGLPLGNRMLHFVLGSLLHTFDWELEGNVSSE  291
            PERFL + ID +GQ+FE LPFG GRR+C GLPL  RM+H VL + +  +DW+LEG + +E
Sbjct  414  PERFLETEIDVRGQHFELLPFGGGRRICVGLPLAYRMIHLVLATFISDYDWKLEGGLKTE  473

Query  290  SLDMAERMGITVRKFEPLKAIPRRV  216
             +DM+E+ G+T++K  PLKA+P ++
Sbjct  474  EMDMSEKFGLTLQKAIPLKALPVKI  498



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 520632026487