BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c25628_g1_i3 len=1496 path=[4625:0-331 4607:332-348 4624:349-382
23221:383-391 10957:392-409 11888:410-455 23248:456-460
18243:461-1495]

Length=1496
                                                                      Score     E

sp|P37122.1|C76A2_SOLME  RecName: Full=Cytochrome P450 76A2; AltN...    333   2e-135   Solanum melongena [aubergine]
ref|XP_006339111.1|  PREDICTED: cytochrome P450 76A2-like               339   8e-135   
ref|XP_009785657.1|  PREDICTED: cytochrome P450 76A1-like isoform X2    327   6e-134   
ref|XP_009616474.1|  PREDICTED: cytochrome P450 76A1-like               323   7e-134   
ref|XP_009786696.1|  PREDICTED: cytochrome P450 76A1-like               324   1e-133   
ref|XP_006341183.1|  PREDICTED: cytochrome P450 76A1-like               325   7e-133   
ref|XP_009785656.1|  PREDICTED: cytochrome P450 76A1-like isoform X1    319   1e-131   
ref|XP_004249462.1|  PREDICTED: cytochrome P450 76A2-like               322   4e-130   
ref|XP_004246574.1|  PREDICTED: LOW QUALITY PROTEIN: cytochrome P...    320   1e-129   
ref|XP_010057042.1|  PREDICTED: cytochrome P450 76A2-like               315   1e-125   
dbj|BAC53891.1|  cytochrome P450                                        327   3e-125   Petunia x hybrida [garden petunia]
ref|XP_010056841.1|  PREDICTED: cytochrome P450 76A1-like               313   2e-124   
gb|AGT03776.1|  CYP76 hydroxylase                                       332   2e-124   
gb|KCW74001.1|  hypothetical protein EUGRSUZ_E02618                     309   6e-124   
dbj|BAC53892.1|  cytochrome P450                                        381   5e-123   Petunia x hybrida [garden petunia]
ref|XP_010057043.1|  PREDICTED: cytochrome P450 76A1-like               306   9e-123   
gb|KCW74002.1|  hypothetical protein EUGRSUZ_E02619                     306   1e-122   
ref|XP_009788755.1|  PREDICTED: cytochrome P450 76A2-like               380   2e-122   
ref|XP_009589554.1|  PREDICTED: cytochrome P450 76A2-like               379   3e-122   
ref|XP_006341182.1|  PREDICTED: cytochrome P450 76A2-like               377   3e-121   
ref|XP_004246901.1|  PREDICTED: cytochrome P450 76A2-like               375   2e-120   
sp|P37121.1|C76A1_SOLME  RecName: Full=Cytochrome P450 76A1; AltN...    315   1e-119   Solanum melongena [aubergine]
emb|CAN76784.1|  hypothetical protein VITISV_028823                     290   1e-119   Vitis vinifera
ref|XP_002283772.1|  PREDICTED: cytochrome P450 76A1                    289   3e-119   Vitis vinifera
ref|XP_010683910.1|  PREDICTED: cytochrome P450 76A2-like               285   2e-115   
ref|XP_011094547.1|  PREDICTED: cytochrome P450 76A2-like               290   2e-111   
ref|XP_009602679.1|  PREDICTED: cytochrome P450 76A2-like               349   2e-110   
gb|KCW48743.1|  hypothetical protein EUGRSUZ_K02382                     288   2e-110   
ref|XP_009757934.1|  PREDICTED: cytochrome P450 76A2-like               348   3e-110   
gb|KDP20523.1|  hypothetical protein JCGZ_05069                         264   6e-110   
ref|XP_011019179.1|  PREDICTED: cytochrome P450 76A2-like               346   2e-109   
ref|XP_002309107.1|  hypothetical protein POPTR_0006s09580g             346   3e-109   Populus trichocarpa [western balsam poplar]
gb|KDP43102.1|  hypothetical protein JCGZ_27051                         254   6e-107   
ref|XP_006339108.1|  PREDICTED: cytochrome P450 76A2-like               339   9e-107   
gb|AJD20226.1|  putative N-methylcoclaurine 3-hydroxylase               256   1e-106   
gb|KDP27487.1|  hypothetical protein JCGZ_20022                         337   9e-106   
ref|XP_007027589.1|  Cytochrome P450 76A2                               337   8e-105   
ref|XP_002528650.1|  cytochrome P450, putative                          251   2e-104   Ricinus communis
ref|XP_006339110.1|  PREDICTED: cytochrome P450 76A2-like               333   5e-104   
ref|XP_008392600.1|  PREDICTED: cytochrome P450 76A2-like               332   9e-104   
ref|XP_002528654.1|  cytochrome P450, putative                          247   1e-103   Ricinus communis
ref|XP_009350795.1|  PREDICTED: cytochrome P450 76A2-like               331   2e-103   
ref|XP_007203742.1|  hypothetical protein PRUPE_ppa018268mg             330   3e-103   
ref|XP_008241319.1|  PREDICTED: cytochrome P450 76A2-like               330   3e-103   
ref|XP_009334561.1|  PREDICTED: cytochrome P450 76A2-like               330   3e-103   
ref|XP_006339109.1|  PREDICTED: cytochrome P450 76A2-like               329   1e-102   
ref|XP_010036736.1|  PREDICTED: cytochrome P450 76A1-like               328   3e-102   
ref|XP_002277725.1|  PREDICTED: cytochrome P450 76A1                    327   3e-102   Vitis vinifera
ref|XP_002277661.2|  PREDICTED: cytochrome P450 76A1-like               328   4e-102   Vitis vinifera
emb|CAN77399.1|  hypothetical protein VITISV_015277                     327   8e-102   Vitis vinifera
ref|XP_002528649.1|  cytochrome P450, putative                          233   1e-101   Ricinus communis
ref|XP_006339107.1|  PREDICTED: cytochrome P450 76A2-like               326   1e-101   
ref|XP_010112510.1|  Cytochrome P450 76A2                               325   2e-101   
ref|XP_002528653.1|  cytochrome P450, putative                          244   1e-100   Ricinus communis
ref|XP_006482364.1|  PREDICTED: cytochrome P450 76A2-like               323   1e-100   
ref|XP_010037101.1|  PREDICTED: cytochrome P450 76A1-like               323   2e-100   
ref|XP_004249463.1|  PREDICTED: cytochrome P450 76A2-like               323   2e-100   
emb|CBI30226.3|  unnamed protein product                                327   3e-100   
gb|KDO61008.1|  hypothetical protein CISIN_1g036305mg                   322   6e-100   
ref|XP_010037099.1|  PREDICTED: cytochrome P450 76A1-like               322   8e-100   
ref|XP_006430324.1|  hypothetical protein CICLE_v10013315mg             322   9e-100   
ref|XP_008241318.1|  PREDICTED: cytochrome P450 76A2-like               319   5e-99    
emb|CAN77400.1|  hypothetical protein VITISV_015278                     317   7e-99    Vitis vinifera
gb|KCW48764.1|  hypothetical protein EUGRSUZ_K02408                     315   3e-98    
ref|XP_011094433.1|  PREDICTED: cytochrome P450 76A1-like               239   9e-98    
ref|XP_009603940.1|  PREDICTED: cytochrome P450 76A2-like               315   4e-97    
ref|XP_002528644.1|  cytochrome P450, putative                          238   2e-96    Ricinus communis
ref|XP_003520677.1|  PREDICTED: cytochrome P450 76A2-like               311   7e-96    
ref|XP_002528645.1|  cytochrome P450, putative                          310   1e-95    Ricinus communis
gb|KHN18720.1|  Cytochrome P450 76A2                                    311   1e-95    
ref|XP_004249632.1|  PREDICTED: cytochrome P450 76A2-like               310   2e-95    
ref|XP_007162842.1|  hypothetical protein PHAVU_001G185500g             310   2e-95    
ref|XP_004303043.1|  PREDICTED: cytochrome P450 76A2-like               310   3e-95    
ref|XP_009774708.1|  PREDICTED: cytochrome P450 76A2-like               309   4e-95    
ref|XP_002277746.1|  PREDICTED: cytochrome P450 76A1                    308   7e-95    Vitis vinifera
ref|XP_004305369.1|  PREDICTED: cytochrome P450 76A2-like               308   2e-94    
gb|AJD25180.1|  cytochrome P450 CYP76A36                                307   4e-94    
gb|AJD25179.1|  cytochrome P450 CYP76A35                                242   8e-94    
ref|XP_011101481.1|  PREDICTED: cytochrome P450 76A1                    228   1e-92    
gb|EYU29599.1|  hypothetical protein MIMGU_mgv1a026574mg                301   3e-92    
gb|EYU38602.1|  hypothetical protein MIMGU_mgv1a006828mg                220   1e-91    
gb|KEH24104.1|  cytochrome P450 family protein                          300   1e-91    
ref|XP_011100232.1|  PREDICTED: cytochrome P450 76A2-like               301   1e-91    
emb|CBI30225.3|  unnamed protein product                                308   6e-90    
ref|XP_004494132.1|  PREDICTED: cytochrome P450 76A2-like               296   6e-90    
emb|CDP15344.1|  unnamed protein product                                286   3e-89    
gb|AIW00679.1|  flavonoid 3',5'-hydroxylase                             291   2e-88    
ref|XP_002283777.2|  PREDICTED: cytochrome P450 76A1                    283   5e-85    Vitis vinifera
ref|XP_007204461.1|  hypothetical protein PRUPE_ppa023213mg             280   2e-84    
ref|XP_010045880.1|  PREDICTED: cytochrome P450 76A1-like               280   3e-84    
ref|XP_002267565.2|  PREDICTED: cytochrome P450 76A2-like               280   1e-83    Vitis vinifera
gb|AHX24364.1|  CYP76A26-like protein                                   278   5e-83    
gb|AHX24367.1|  CYP76A26-like protein                                   277   1e-82    
ref|XP_002528647.1|  cytochrome P450, putative                          277   1e-82    Ricinus communis
gb|AHX24365.1|  CYP76A26-like protein                                   276   3e-82    
ref|XP_010036187.1|  PREDICTED: cytochrome P450 76A1-like               275   5e-82    
gb|KCW84354.1|  hypothetical protein EUGRSUZ_B01206                     274   8e-82    
ref|XP_010036221.1|  PREDICTED: cytochrome P450 76A1-like               274   1e-81    
ref|XP_010036165.1|  PREDICTED: cytochrome P450 76A1-like               271   1e-80    
ref|XP_010036151.1|  PREDICTED: cytochrome P450 76A1-like               270   4e-80    
gb|AHX24366.1|  CYP76A26-like protein                                   270   5e-80    
ref|XP_011094434.1|  PREDICTED: cytochrome P450 76A1-like               269   9e-80    
gb|AHX24369.1|  CYP76A26-like protein                                   269   1e-79    
ref|XP_006481913.1|  PREDICTED: cytochrome P450 76A2-like               267   4e-79    
gb|KDO61009.1|  hypothetical protein CISIN_1g010359mg                   267   5e-79    
ref|XP_006430323.1|  hypothetical protein CICLE_v10011511mg             267   5e-79    
ref|XP_010045881.1|  PREDICTED: cytochrome P450 76A1-like               266   1e-78    
gb|KDP26153.1|  hypothetical protein JCGZ_22834                         266   1e-78    
ref|XP_009613392.1|  PREDICTED: cytochrome P450 76A2-like               265   1e-78    
ref|XP_010036177.1|  PREDICTED: cytochrome P450 76A1-like               265   5e-78    
gb|AHK60833.1|  iridoid oxidase                                         265   6e-78    
gb|AHX24370.1|  CYP76A26                                                264   8e-78    
gb|AHX24368.1|  CYP76A26-like protein                                   263   3e-77    
gb|KDP27489.1|  hypothetical protein JCGZ_20024                         261   2e-76    
emb|CBI38806.3|  unnamed protein product                                157   9e-76    
ref|XP_006423711.1|  hypothetical protein CICLE_v10028239mg             166   2e-75    
ref|XP_010658029.1|  PREDICTED: ripening-related P-450 enzyme-lik...    177   2e-75    
ref|XP_006477331.1|  PREDICTED: geraniol 8-hydroxylase-like             177   2e-75    
ref|XP_006487469.1|  PREDICTED: geraniol 8-hydroxylase-like             166   3e-75    
ref|XP_011017516.1|  PREDICTED: geraniol 8-hydroxylase-like             166   3e-75    
ref|XP_002276576.1|  PREDICTED: geraniol 8-hydroxylase                  158   4e-75    Vitis vinifera
ref|NP_001268152.1|  ripening-related P-450 enzyme-like                 176   1e-74    
gb|KDP24880.1|  hypothetical protein JCGZ_25133                         254   3e-74    
ref|XP_006440464.1|  hypothetical protein CICLE_v10019826mg             176   4e-74    
ref|XP_010544670.1|  PREDICTED: cytochrome P450 76C4-like isoform X1    153   2e-73    
emb|CAN75686.1|  hypothetical protein VITISV_010578                     157   2e-73    Vitis vinifera
gb|AGX93050.1|  geraniol 10-hydroxylase-like protein                    153   4e-73    
ref|XP_002271652.1|  PREDICTED: geraniol 8-hydroxylase                  157   4e-73    Vitis vinifera
ref|XP_011013817.1|  PREDICTED: geraniol 8-hydroxylase-like             166   5e-73    
ref|XP_010544671.1|  PREDICTED: cytochrome P450 76C2-like isoform X2    152   2e-72    
ref|XP_003536316.1|  PREDICTED: geraniol 8-hydroxylase-like             158   2e-72    
ref|XP_009787971.1|  PREDICTED: geraniol 8-hydroxylase-like             157   4e-72    
ref|XP_010108078.1|  Cytochrome P450 76C4                               160   5e-72    
ref|XP_003631427.1|  PREDICTED: geraniol 8-hydroxylase-like             170   5e-72    
gb|AGX93055.1|  geraniol 10-hydroxylase-like protein                    153   1e-71    
gb|AGX93051.1|  geraniol 10-hydroxylase-like protein                    154   1e-71    
ref|XP_009757342.1|  PREDICTED: geraniol 8-hydroxylase-like             172   1e-71    
emb|CBI33813.3|  unnamed protein product                                167   2e-71    
ref|XP_002276561.1|  PREDICTED: geraniol 8-hydroxylase                  166   2e-71    Vitis vinifera
ref|XP_011099226.1|  PREDICTED: geraniol 8-hydroxylase-like             152   2e-71    
ref|XP_010920218.1|  PREDICTED: geraniol 8-hydroxylase-like             156   2e-71    
ref|XP_009780149.1|  PREDICTED: geraniol 8-hydroxylase-like             154   2e-71    
ref|XP_010053380.1|  PREDICTED: geraniol 8-hydroxylase-like             168   3e-71    
ref|XP_004232064.1|  PREDICTED: geraniol 8-hydroxylase-like             159   4e-71    
gb|AGX93054.1|  geraniol 10-hydroxylase-like protein                    152   4e-71    
ref|XP_004310057.1|  PREDICTED: geraniol 8-hydroxylase-like             163   5e-71    
ref|XP_006338234.1|  PREDICTED: geraniol 8-hydroxylase-like             162   7e-71    
sp|Q8VWZ7.1|C76B6_CATRO  RecName: Full=Geraniol 8-hydroxylase; Al...    154   7e-71    Catharanthus roseus [chatas]
gb|AGX93053.1|  geraniol 10-hydroxylase-like protein                    155   9e-71    
ref|XP_010661587.1|  PREDICTED: geraniol 8-hydroxylase-like isofo...    158   9e-71    
ref|XP_006338233.1|  PREDICTED: geraniol 8-hydroxylase-like             158   1e-70    
ref|XP_010676619.1|  PREDICTED: geraniol 8-hydroxylase-like             154   1e-70    
ref|XP_010053379.1|  PREDICTED: geraniol 8-hydroxylase-like             166   1e-70    
ref|XP_010506518.1|  PREDICTED: cytochrome P450 76C2-like               148   2e-70    
gb|EYU29984.1|  hypothetical protein MIMGU_mgv1a026778mg                150   2e-70    
ref|XP_010518179.1|  PREDICTED: cytochrome P450 76C2-like               148   3e-70    
ref|XP_002301305.2|  cytochrome P450 family protein                     176   5e-70    Populus trichocarpa [western balsam poplar]
gb|AFS28686.1|  putative geraniol 10-hydroxylase                        152   6e-70    
gb|EYU44354.1|  hypothetical protein MIMGU_mgv11b004416mg               150   7e-70    
gb|AFS28687.1|  putative geraniol 10-hydroxylase                        151   7e-70    
dbj|BAP90522.1|  geraniol 10-hydroxylase                                149   9e-70    
ref|XP_007227491.1|  hypothetical protein PRUPE_ppa004517mg             157   1e-69    
ref|XP_002303546.2|  hypothetical protein POPTR_0003s11810g             155   1e-69    Populus trichocarpa [western balsam poplar]
ref|XP_010661589.1|  PREDICTED: geraniol 8-hydroxylase-like             149   2e-69    
ref|XP_010508144.1|  PREDICTED: cytochrome P450 76C2-like               147   2e-69    
ref|XP_010103208.1|  Cytochrome P450 76C1                               152   5e-69    
gb|KCW77657.1|  hypothetical protein EUGRSUZ_D01955                     161   5e-69    
ref|XP_004496721.1|  PREDICTED: geraniol 8-hydroxylase-like             147   6e-69    
gb|KFK37346.1|  hypothetical protein AALP_AA4G244600                    148   6e-69    
ref|XP_006338232.1|  PREDICTED: geraniol 8-hydroxylase-like             152   7e-69    
ref|XP_002299579.2|  hypothetical protein POPTR_0001s08320g             156   7e-69    Populus trichocarpa [western balsam poplar]
ref|XP_004232063.1|  PREDICTED: geraniol 8-hydroxylase-like             152   7e-69    
ref|XP_010692296.1|  PREDICTED: geraniol 8-hydroxylase-like isofo...    160   8e-69    
ref|XP_009138804.1|  PREDICTED: cytochrome P450 76C4-like               159   8e-69    
ref|XP_009596429.1|  PREDICTED: geraniol 8-hydroxylase-like             150   1e-68    
emb|CDY37049.1|  BnaA04g26270D                                          149   2e-68    
ref|XP_009142346.1|  PREDICTED: cytochrome P450 76C4-like               149   2e-68    
ref|XP_009777857.1|  PREDICTED: geraniol 8-hydroxylase-like             145   2e-68    
ref|XP_007225781.1|  hypothetical protein PRUPE_ppa004617mg             149   2e-68    
sp|D1MI46.1|C76BA_SWEMU  RecName: Full=Geraniol 8-hydroxylase; Al...    149   2e-68    Swertia mussotii
ref|XP_006606065.1|  PREDICTED: geraniol 8-hydroxylase-like             153   3e-68    
ref|XP_011033850.1|  PREDICTED: geraniol 8-hydroxylase-like isofo...    150   3e-68    
gb|AGX93052.1|  geraniol 10-hydroxylase-like protein                    154   3e-68    
ref|XP_011033851.1|  PREDICTED: geraniol 8-hydroxylase-like isofo...    150   3e-68    
ref|XP_006360240.1|  PREDICTED: geraniol 8-hydroxylase-like             149   3e-68    
ref|XP_008222068.1|  PREDICTED: geraniol 8-hydroxylase-like             149   3e-68    
dbj|BAC53893.1|  cytochrome P450                                        148   4e-68    Petunia x hybrida [garden petunia]
ref|XP_008222093.1|  PREDICTED: geraniol 8-hydroxylase-like             153   4e-68    
gb|KEH43873.1|  cytochrome P450 family protein                          149   5e-68    
ref|XP_009763141.1|  PREDICTED: geraniol 8-hydroxylase-like             164   6e-68    
ref|XP_011036810.1|  PREDICTED: cytochrome P450 76A1-like               237   1e-67    
ref|XP_007201998.1|  hypothetical protein PRUPE_ppa022979mg             238   1e-67    
ref|XP_008222069.1|  PREDICTED: geraniol 8-hydroxylase-like             147   1e-67    
ref|XP_011036815.1|  PREDICTED: cytochrome P450 76A1-like               237   1e-67    
ref|XP_010920219.1|  PREDICTED: geraniol 8-hydroxylase-like isofo...    144   1e-67    
ref|XP_006388387.1|  hypothetical protein POPTR_0201s00200g             168   1e-67    
ref|XP_007224608.1|  hypothetical protein PRUPE_ppa026952mg             152   1e-67    
ref|XP_008437178.1|  PREDICTED: geraniol 8-hydroxylase-like             149   1e-67    
ref|XP_006295493.1|  hypothetical protein CARUB_v10024597mg             146   2e-67    
gb|KCW47877.1|  hypothetical protein EUGRSUZ_K01623                     237   2e-67    
gb|KHG21745.1|  Cytochrome P450 protein                                 146   2e-67    
ref|XP_006360237.1|  PREDICTED: geraniol 8-hydroxylase-like             144   2e-67    
ref|XP_010036342.1|  PREDICTED: cytochrome P450 76A1-like               236   2e-67    
ref|XP_007226675.1|  hypothetical protein PRUPE_ppa021147mg             153   3e-67    
ref|XP_010692297.1|  PREDICTED: geraniol 8-hydroxylase-like isofo...    166   3e-67    
ref|XP_009372314.1|  PREDICTED: geraniol 8-hydroxylase-like             150   3e-67    
emb|CDY27377.1|  BnaC04g50280D                                          143   3e-67    
ref|XP_009372317.1|  PREDICTED: geraniol 8-hydroxylase-like             144   3e-67    
ref|XP_009372315.1|  PREDICTED: geraniol 8-hydroxylase-like             150   3e-67    
ref|XP_010499912.1|  PREDICTED: cytochrome P450 76C4-like               147   3e-67    
ref|XP_010676979.1|  PREDICTED: geraniol 8-hydroxylase-like             159   3e-67    
ref|XP_011029123.1|  PREDICTED: geraniol 8-hydroxylase-like             146   3e-67    
ref|XP_004233427.1|  PREDICTED: geraniol 8-hydroxylase-like             142   4e-67    
ref|XP_008241321.1|  PREDICTED: cytochrome P450 76A1                    236   4e-67    
ref|XP_010478790.1|  PREDICTED: cytochrome P450 76C4-like isoform X1    146   5e-67    
ref|XP_003556053.1|  PREDICTED: geraniol 8-hydroxylase-like             149   5e-67    
ref|XP_006382516.1|  hypothetical protein POPTR_0005s02900g             235   5e-67    
ref|XP_003557080.2|  PREDICTED: geraniol 8-hydroxylase-like             152   5e-67    
ref|XP_006360236.1|  PREDICTED: geraniol 8-hydroxylase-like             148   6e-67    
ref|XP_010654031.1|  PREDICTED: cytochrome P450 76A1                    235   7e-67    
ref|XP_006293636.1|  hypothetical protein CARUB_v10022591mg             142   9e-67    
gb|AAS92624.1|  cytochrome P450                                         146   9e-67    Hypericum androsaemum
ref|XP_009102613.1|  PREDICTED: cytochrome P450 76C4-like               144   1e-66    
ref|XP_006360234.1|  PREDICTED: geraniol 8-hydroxylase-like             142   1e-66    
ref|XP_002301302.2|  hypothetical protein POPTR_0002s15110g             148   1e-66    Populus trichocarpa [western balsam poplar]
gb|AIO11760.1|  cytochrome p450                                         149   1e-66    
ref|XP_002509653.1|  cytochrome P450, putative                          146   1e-66    Ricinus communis
ref|XP_009630529.1|  PREDICTED: geraniol 8-hydroxylase-like             156   1e-66    
ref|XP_010112509.1|  Cytochrome P450 76A2                               234   2e-66    
ref|XP_010667793.1|  PREDICTED: geraniol 8-hydroxylase-like             151   2e-66    
gb|AGI78466.1|  CYP76AD4                                                142   2e-66    
ref|XP_004233425.1|  PREDICTED: geraniol 8-hydroxylase-like             141   2e-66    
ref|XP_009143151.1|  PREDICTED: cytochrome P450 76C3-like               142   2e-66    
ref|XP_004233424.1|  PREDICTED: geraniol 8-hydroxylase-like             143   3e-66    
ref|XP_009793557.1|  PREDICTED: geraniol 8-hydroxylase-like             155   3e-66    
ref|XP_006382521.1|  hypothetical protein POPTR_0005s02950g             233   4e-66    
ref|XP_006360238.1|  PREDICTED: geraniol 8-hydroxylase-like             142   5e-66    
ref|XP_009794425.1|  PREDICTED: geraniol 8-hydroxylase-like             147   5e-66    
ref|XP_004248012.1|  PREDICTED: geraniol 8-hydroxylase-like             144   5e-66    
gb|AAQ05825.1|AF479661_1  cytochrome P450                               144   5e-66    Pastinaca sativa
ref|NP_182081.1|  cytochrome P450 76C2                                  146   5e-66    Arabidopsis thaliana [mouse-ear cress]
ref|XP_006382522.1|  hypothetical protein POPTR_0005s02960g             233   6e-66    
ref|XP_006439139.1|  hypothetical protein CICLE_v10033708mg             233   7e-66    
ref|XP_002276121.1|  PREDICTED: geraniol 8-hydroxylase-like isofo...    141   7e-66    Vitis vinifera
ref|XP_011017515.1|  PREDICTED: geraniol 8-hydroxylase-like             162   7e-66    
ref|XP_009372318.1|  PREDICTED: geraniol 8-hydroxylase-like             142   8e-66    
gb|ADE80941.1|  flavonoid 3'-hydroxylase                                152   8e-66    
ref|XP_010544666.1|  PREDICTED: cytochrome P450 76C4-like               149   9e-66    
ref|XP_002878356.1|  predicted protein                                  142   9e-66    
ref|XP_006382524.1|  hypothetical protein POPTR_0005s02990g             232   9e-66    
emb|CDX74750.1|  BnaA05g04960D                                          142   1e-65    
ref|XP_010508143.1|  PREDICTED: cytochrome P450 76C2-like               140   1e-65    
emb|CAN79423.1|  hypothetical protein VITISV_011260                     153   1e-65    Vitis vinifera
ref|XP_004232059.1|  PREDICTED: geraniol 8-hydroxylase                  141   1e-65    
gb|KDO61005.1|  hypothetical protein CISIN_1g0379902mg                  225   1e-65    
ref|XP_006307271.1|  hypothetical protein CARUB_v10008885mg             145   1e-65    
ref|XP_002301306.2|  hypothetical protein POPTR_0002s15150g             161   1e-65    Populus trichocarpa [western balsam poplar]
ref|XP_003589660.1|  Cytochrome P450 monooxygenase                      144   1e-65    
ref|XP_004496849.1|  PREDICTED: geraniol 8-hydroxylase-like             139   2e-65    
ref|XP_010038981.1|  PREDICTED: cytochrome P450 76A1-like               232   2e-65    
ref|XP_006482365.1|  PREDICTED: cytochrome P450 76A2-like               231   2e-65    
ref|XP_006382520.1|  hypothetical protein POPTR_0005s02940g             231   2e-65    
ref|XP_004233426.2|  PREDICTED: geraniol 8-hydroxylase-like             143   2e-65    
ref|XP_010680621.1|  PREDICTED: geraniol 8-hydroxylase-like             144   2e-65    
ref|XP_010691516.1|  PREDICTED: geraniol 8-hydroxylase-like             149   2e-65    
ref|XP_011074592.1|  PREDICTED: ferruginol synthase-like                146   2e-65    
ref|XP_010691514.1|  PREDICTED: geraniol 8-hydroxylase-like             149   2e-65    
ref|XP_010680509.1|  PREDICTED: geraniol 8-hydroxylase-like             142   3e-65    
ref|XP_006360239.1|  PREDICTED: geraniol 8-hydroxylase-like             142   3e-65    
emb|CDY37051.1|  BnaA04g26290D                                          144   3e-65    
ref|XP_002301307.2|  cytochrome P450 family protein                     168   3e-65    Populus trichocarpa [western balsam poplar]
ref|XP_011089001.1|  PREDICTED: geraniol 8-hydroxylase-like             143   3e-65    
gb|AET43291.1|  CYP76AD2                                                142   3e-65    
ref|XP_010687566.1|  PREDICTED: geraniol 8-hydroxylase-like             144   3e-65    
gb|EYU36335.1|  hypothetical protein MIMGU_mgv1a004314mg                139   4e-65    
emb|CDY18919.1|  BnaC04g04310D                                          139   4e-65    
ref|XP_009794426.1|  PREDICTED: geraniol 8-hydroxylase-like isofo...    142   4e-65    
ref|NP_850439.1|  cytochrome P450 76C1                                  142   5e-65    Arabidopsis thaliana [mouse-ear cress]
ref|XP_008389814.1|  PREDICTED: geraniol 8-hydroxylase-like             139   6e-65    
ref|XP_004505592.1|  PREDICTED: geraniol 8-hydroxylase-like             141   6e-65    
ref|XP_007226839.1|  hypothetical protein PRUPE_ppa017329mg             144   6e-65    
ref|XP_007153084.1|  hypothetical protein PHAVU_003G005500g             147   7e-65    
ref|XP_009613834.1|  PREDICTED: geraniol 8-hydroxylase-like             138   7e-65    
ref|XP_007224897.1|  hypothetical protein PRUPE_ppa022132mg             140   7e-65    
gb|KDP25563.1|  hypothetical protein JCGZ_20719                         139   7e-65    
ref|NP_182079.1|  cytochrome P450 76C4                                  144   7e-65    
emb|CBI38803.3|  unnamed protein product                                144   7e-65    
ref|XP_011091112.1|  PREDICTED: geraniol 8-hydroxylase-like             141   7e-65    
ref|XP_008390127.1|  PREDICTED: geraniol 8-hydroxylase-like             140   7e-65    
emb|CBI30229.3|  unnamed protein product                                229   1e-64    
ref|XP_006338756.1|  PREDICTED: geraniol 8-hydroxylase-like             142   1e-64    
ref|XP_006358837.1|  PREDICTED: geraniol 8-hydroxylase-like             139   1e-64    
ref|XP_002882022.1|  CYP76C3                                            140   1e-64    
ref|XP_008389819.1|  PREDICTED: geraniol 8-hydroxylase-like             139   1e-64    
emb|CDX89091.1|  BnaA04g00950D                                          140   1e-64    
ref|XP_009138803.1|  PREDICTED: cytochrome P450 76C4-like               140   2e-64    
ref|XP_010691493.1|  PREDICTED: geraniol 8-hydroxylase-like             148   2e-64    
ref|XP_010103209.1|  Cytochrome P450 76C4                               138   2e-64    
ref|XP_010506519.1|  PREDICTED: cytochrome P450 76C2-like isoform X1    142   2e-64    
gb|KFK37349.1|  hypothetical protein AALP_AA4G245200                    141   3e-64    
gb|KDP43097.1|  hypothetical protein JCGZ_27046                         228   3e-64    
ref|XP_009631781.1|  PREDICTED: geraniol 8-hydroxylase-like             137   3e-64    
dbj|BAA28540.1|  cytochrome P450 monooxygenase                          139   4e-64    
gb|EMS49735.1|  Cytochrome P450 76C4                                    137   4e-64    
ref|XP_004310184.1|  PREDICTED: geraniol 8-hydroxylase-like             148   4e-64    
ref|XP_010105779.1|  Cytochrome P450 76C4                               149   4e-64    
gb|AGC29948.1|  CYP75B65                                                146   5e-64    
ref|XP_004310205.1|  PREDICTED: geraniol 8-hydroxylase-like             151   6e-64    
ref|XP_006360235.1|  PREDICTED: geraniol 8-hydroxylase-like             140   6e-64    
ref|XP_004147597.1|  PREDICTED: LOW QUALITY PROTEIN: geraniol 8-h...    144   7e-64    
ref|XP_010277464.1|  PREDICTED: geraniol 8-hydroxylase-like             162   7e-64    
ref|XP_006397736.1|  hypothetical protein EUTSA_v10001282mg             140   8e-64    
dbj|BAC42787.1|  putative cytochrome P450                               139   9e-64    
ref|NP_182082.2|  cytochrome P450 76C3                                  139   9e-64    
ref|NP_174633.1|  cytochrome P450, family 76, subfamily C, polype...    139   9e-64    
ref|XP_011091100.1|  PREDICTED: geraniol 8-hydroxylase-like             137   1e-63    
ref|XP_010523700.1|  PREDICTED: cytochrome P450 76C4-like               142   1e-63    
ref|XP_006293419.1|  hypothetical protein CARUB_v10025190mg             138   1e-63    
gb|AAC06159.1|  putative cytochrome P450                                139   1e-63    
ref|XP_006397737.1|  hypothetical protein EUTSA_v10001412mg             147   1e-63    
gb|EMT03552.1|  Cytochrome P450 76C4                                    136   1e-63    
ref|XP_008222072.1|  PREDICTED: geraniol 8-hydroxylase-like             136   1e-63    
ref|XP_002528643.1|  cytochrome P450, putative                          226   1e-63    
ref|XP_006451465.1|  hypothetical protein CICLE_v10008099mg             161   2e-63    
ref|XP_002882021.1|  CYP76C2                                            140   2e-63    
ref|XP_010508139.1|  PREDICTED: cytochrome P450 76C3-like               136   2e-63    
gb|EPS67290.1|  hypothetical protein M569_07486                         138   2e-63    
ref|XP_003623778.1|  Cytochrome P450                                    147   2e-63    
ref|XP_009142349.1|  PREDICTED: cytochrome P450 76C3-like               145   2e-63    
gb|KDP29244.1|  hypothetical protein JCGZ_16633                         226   2e-63    
gb|AES93118.1|  geraniol-10-hydroxylase                                 140   3e-63    
gb|AAF97287.1|AC010164_9  Putative cytochrome P450                      140   3e-63    
ref|XP_002298058.1|  hypothetical protein POPTR_0001s08860g             140   3e-63    
ref|XP_004246575.1|  PREDICTED: cytochrome P450 76A1-like               225   4e-63    
ref|XP_008392536.1|  PREDICTED: cytochrome P450 76A1                    225   5e-63    
ref|XP_009142347.1|  PREDICTED: cytochrome P450 76C2-like               143   6e-63    
ref|XP_006287545.1|  hypothetical protein CARUB_v10000754mg             139   8e-63    
ref|XP_010518180.1|  PREDICTED: cytochrome P450 76C3-like               136   8e-63    
ref|XP_002510830.1|  (S)-N-methylcoclaurine 3'-hydroxylase isozym...    138   8e-63    
gb|AAZ07704.1|  cytochrome P450 monooxygenase isoform I                 135   1e-62    
ref|XP_011029198.1|  PREDICTED: probable (S)-N-methylcoclaurine 3...    139   1e-62    
ref|XP_002877896.1|  CYP76G1                                            224   1e-62    
ref|XP_009116769.1|  PREDICTED: cytochrome P450 76C3                    139   1e-62    
ref|XP_010478793.1|  PREDICTED: cytochrome P450 76C4-like               147   1e-62    
emb|CDP18467.1|  unnamed protein product                                222   2e-62    
emb|CDY52338.1|  BnaA09g38870D                                          139   2e-62    
emb|CDY37050.1|  BnaA04g26280D                                          141   2e-62    
gb|ABR16821.1|  unknown                                                 145   2e-62    
ref|XP_004232060.1|  PREDICTED: geraniol 8-hydroxylase-like             136   2e-62    
ref|XP_008389841.1|  PREDICTED: geraniol 8-hydroxylase-like             151   2e-62    
ref|XP_004303044.1|  PREDICTED: cytochrome P450 76A2-like               223   3e-62    
ref|XP_009610421.1|  PREDICTED: probable (S)-N-methylcoclaurine 3...    144   3e-62    
ref|XP_007027586.1|  Cytochrome P450                                    229   3e-62    
ref|XP_009774376.1|  PREDICTED: geraniol 8-hydroxylase-like             143   4e-62    
ref|XP_010691517.1|  PREDICTED: geraniol 8-hydroxylase-like             139   6e-62    
gb|ADZ54783.1|  flavonoid 3'-monooxygenase                              140   6e-62    
ref|XP_008389839.1|  PREDICTED: geraniol 8-hydroxylase-like             135   6e-62    
ref|XP_009607443.1|  PREDICTED: geraniol 8-hydroxylase-like             143   9e-62    
ref|XP_010105781.1|  7-ethoxycoumarin O-deethylase                      137   1e-61    
ref|XP_009757123.1|  PREDICTED: probable (S)-N-methylcoclaurine 3...    140   1e-61    
gb|KHG20073.1|  Cytochrome P450 protein                                 138   2e-61    
ref|XP_007142620.1|  hypothetical protein PHAVU_007G003100g             221   2e-61    
gb|ADJ68324.1|  geraniol 10-hydroxylase                                 144   2e-61    
ref|XP_010692294.1|  PREDICTED: geraniol 8-hydroxylase-like             134   3e-61    
ref|XP_010491421.1|  PREDICTED: flavonoid 3'-monooxygenase-like         134   3e-61    
gb|KEH40908.1|  cytochrome P450 family protein                          136   3e-61    
ref|XP_010112571.1|  (S)-N-methylcoclaurine 3'-hydroxylase isozyme 2    136   3e-61    
ref|NP_001289844.1|  flavonoid 3'-monooxygenase                         138   4e-61    
gb|ABA64468.1|  flavonoid 3'-hydroxylase                                139   5e-61    
ref|XP_002318833.1|  hypothetical protein POPTR_0012s13580g             134   5e-61    
ref|XP_004511453.1|  PREDICTED: geraniol 8-hydroxylase-like             152   5e-61    
ref|XP_010692298.1|  PREDICTED: geraniol 8-hydroxylase-like             142   5e-61    
ref|XP_008240031.1|  PREDICTED: flavonoid 3'-monooxygenase              138   5e-61    
emb|CDY27374.1|  BnaC04g50310D                                          136   6e-61    
ref|XP_006381328.1|  hypothetical protein POPTR_0006s11830g             214   6e-61    
ref|XP_006345132.1|  PREDICTED: flavonoid 3'-monooxygenase-like         135   7e-61    
gb|AIT52346.1|  flavonoid 3'-monooxygenase 1                            137   8e-61    
ref|XP_010508141.1|  PREDICTED: cytochrome P450 76C3-like isoform X1    134   1e-60    
ref|XP_003607445.1|  Cytochrome P450                                    137   1e-60    
gb|ADZ28515.1|  flavonoid-3'-hydroxylase                                132   1e-60    
dbj|BAO58432.1|  flavonoid 3'-hydroxylase                               135   1e-60    
ref|XP_009597267.1|  PREDICTED: flavonoid 3'-monooxygenase              134   1e-60    
gb|KFK35289.1|  hypothetical protein AALP_AA5G265500                    140   1e-60    
gb|AET43289.1|  CYP76AD1                                                142   2e-60    
emb|CDP02458.1|  unnamed protein product                                146   2e-60    
gb|KHG16052.1|  Cytochrome P450 protein                                 136   2e-60    
ref|XP_006341260.1|  PREDICTED: cytochrome P450 76A2-like               218   2e-60    
gb|KHN15753.1|  Cytochrome P450 76C1                                    135   2e-60    
gb|ACV74415.1|  putative flavonoid-3'-hydroxylase                       134   2e-60    
gb|AGT50313.1|  flavonoid 3'-hydroxylase                                136   2e-60    
ref|XP_004138005.1|  PREDICTED: cytochrome P450 76A2-like               218   2e-60    
gb|AHI58943.1|  flavonoid 3'-hydroxylase                                133   2e-60    
ref|XP_002509713.1|  (S)-N-methylcoclaurine 3'-hydroxylase isozym...    135   2e-60    
ref|XP_009626046.1|  PREDICTED: cytochrome P450 76A1                    218   2e-60    
gb|ACM62746.1|  flavonoid 3'-hydroxylase                                142   2e-60    
ref|NP_196416.1|  Flavonoid 3'-monooxygenase                            135   3e-60    
ref|XP_002871298.1|  hypothetical protein ARALYDRAFT_487632             134   3e-60    
ref|XP_010558964.1|  PREDICTED: LOW QUALITY PROTEIN: cytochrome P...    217   3e-60    
ref|XP_006878550.1|  hypothetical protein AMTR_s00011p00233580          133   3e-60    
dbj|BAF96945.1|  flavonoid 3'-hydroxylase                               133   4e-60    
gb|AGT50318.1|  flavonoid 3'-hydroxylase                                135   4e-60    
ref|XP_004168914.1|  PREDICTED: LOW QUALITY PROTEIN: cytochrome P...    217   5e-60    
gb|AHZ08763.1|  flavonoid 3'-monooxygenase                              134   6e-60    
gb|AGT50311.1|  flavonoid 3'-hydroxylase                                135   6e-60    
gb|AET43292.1|  CYP76AD3                                                130   8e-60    
ref|XP_010030579.1|  PREDICTED: flavonoid 3'-monooxygenase-like         134   9e-60    
gb|EYU44352.1|  hypothetical protein MIMGU_mgv1a007369mg                139   9e-60    
ref|XP_003596030.1|  Cytochrome P450                                    139   1e-59    
ref|XP_002450934.1|  hypothetical protein SORBIDRAFT_05g021400          139   1e-59    
dbj|BAC42682.1|  putative cytochrome P450                               216   2e-59    
ref|NP_190865.2|  cytochrome P450, family 76, subfamily G, polype...    216   2e-59    
ref|XP_009793679.1|  PREDICTED: cytochrome P450 76A1                    215   2e-59    
emb|CDY27371.1|  BnaC04g50340D                                          130   2e-59    
gb|AGO02167.1|  flavonoid 3'-hydroxylase                                131   2e-59    
gb|AGT50310.1|  flavonoid 3'-hydroxylase                                135   2e-59    
gb|AFK73718.1|  cytochrome P450                                         130   2e-59    
dbj|BAN62871.1|  flavonoid 3'-hydroxylase                               130   2e-59    
ref|XP_011030061.1|  PREDICTED: probable (S)-N-methylcoclaurine 3...    131   2e-59    
ref|XP_010478791.1|  PREDICTED: cytochrome P450 76C4-like isoform X2    146   2e-59    
gb|AGT50309.1|  flavonoid 3'-hydroxylase                                134   3e-59    
gb|AJA79074.1|  flavonoid 3' hydroxylase                                137   3e-59    
ref|XP_007209917.1|  hypothetical protein PRUPE_ppa004433mg             137   3e-59    
ref|XP_006293048.1|  hypothetical protein CARUB_v10019335mg             214   3e-59    
ref|XP_010423152.1|  PREDICTED: flavonoid 3'-monooxygenase-like         129   4e-59    
ref|XP_009788494.1|  PREDICTED: flavonoid 3'-monooxygenase              131   4e-59    
ref|XP_010452770.1|  PREDICTED: flavonoid 3'-monooxygenase              129   4e-59    
ref|XP_009338402.1|  PREDICTED: flavonoid 3'-monooxygenase              131   4e-59    
ref|XP_010695803.1|  PREDICTED: LOW QUALITY PROTEIN: geraniol 8-h...    135   4e-59    
gb|ACR14867.1|  flavonoid 3' hydroxylase                                132   5e-59    
gb|KEH43874.1|  cytochrome P450 family protein                          145   5e-59    
ref|XP_004505635.1|  PREDICTED: geraniol 8-hydroxylase-like             134   5e-59    
emb|CDX69984.1|  BnaA10g23330D                                          130   6e-59    
dbj|BAJ17668.1|  flavonoid 3' hydroxylase                               133   6e-59    
ref|XP_003598945.1|  Flavonoid 3'-hydroxylase                           132   8e-59    
gb|ADB77825.1|  flavonoid 3'-hydroxylase allele 1                       138   8e-59    
dbj|BAE47004.1|  flavonoid 3'-hydroxylase                               131   8e-59    
gb|ACN65827.1|  flavonoid 3'-hydroxylase                                132   9e-59    
gb|ABC58722.1|  flavonoid 3'-hydroxylase                                130   1e-58    
gb|ACO35752.1|  flavonoid 3'-hydroxylase                                136   1e-58    
ref|XP_004488758.1|  PREDICTED: cytochrome P450 71A1-like               133   1e-58    
gb|ACO35753.1|  flavonoid 3'-hydroxylase                                134   1e-58    
ref|XP_006399285.1|  hypothetical protein EUTSA_v10013289mg             128   1e-58    
gb|ACY06905.1|  flavonoid 3'-hydroxylase                                135   1e-58    
dbj|BAD91808.1|  flavonoid 3'-hydroxylase                               130   1e-58    
ref|XP_008393217.1|  PREDICTED: flavonoid 3'-monooxygenase-like         132   1e-58    
gb|ABY89688.1|  flavonoid 3` hydroxylase 2 protein                      129   1e-58    
ref|XP_009122411.1|  PREDICTED: flavonoid 3'-monooxygenase              129   1e-58    
ref|XP_003525448.1|  PREDICTED: flavonoid 3'-monooxygenase-like i...    130   1e-58    
gb|ABY89687.1|  flavonoid 3` hydroxylase 1 protein                      129   1e-58    
ref|XP_007037548.1|  Flavonoid 3'-hydroxylase isoform 2                 131   1e-58    
gb|KHN15752.1|  Cytochrome P450 76C4                                    134   1e-58    
gb|KHN48735.1|  Flavonoid 3'-monooxygenase                              130   1e-58    
dbj|BAC10997.1|  flavonoid 3',5'-hydroxylase                            128   1e-58    
ref|XP_010431310.1|  PREDICTED: cytochrome P450 76A1-like               213   1e-58    
ref|XP_007037547.1|  Flavonoid 3'-hydroxylase isoform 1                 131   1e-58    
gb|KCW84353.1|  hypothetical protein EUGRSUZ_B01205                     211   2e-58    
gb|AAG49301.1|AF313491_1  flavonoid 3'-hydroxylase                      130   2e-58    
gb|AEX07282.1|  F3'H                                                    131   2e-58    
dbj|BAP94456.1|  flavonoid 3'-hydroxylas                                127   2e-58    
ref|XP_006404367.1|  hypothetical protein EUTSA_v10010304mg             145   2e-58    
gb|ACR14869.1|  flavonoid 3' hydroxylase IIb                            130   2e-58    
gb|AGT28741.1|  flavonoid 3'-hydroxylase                                132   3e-58    
gb|KCW83706.1|  hypothetical protein EUGRSUZ_B00580                     129   3e-58    
dbj|BAF49324.1|  flavonoid 3'-hydroxylase                               130   3e-58    
ref|XP_002284151.1|  PREDICTED: flavonoid 3'-monooxygenase              129   3e-58    
ref|XP_010248827.1|  PREDICTED: cytochrome P450 71A1-like               138   3e-58    
gb|AIY22749.1|  flavonoid 3'-hydroxylase                                130   3e-58    
ref|XP_008374610.1|  PREDICTED: flavonoid 3'-monooxygenase-like         131   4e-58    
gb|KDP31334.1|  hypothetical protein JCGZ_11710                         133   4e-58    
gb|ADB77826.1|  flavonoid 3'-hydroxylase allele 2                       136   4e-58    
ref|XP_010030575.1|  PREDICTED: flavonoid 3'-monooxygenase-like         130   4e-58    
gb|KHG07922.1|  Flavonoid 3',5'-hydroxylase                             134   4e-58    
ref|XP_010247479.1|  PREDICTED: flavonoid 3',5'-hydroxylase 2-like      128   4e-58    
dbj|BAN05297.1|  flavonoid 3'-hydroxylase                               128   4e-58    
gb|AEE60888.1|  flavonoid 3'-hydroxylase                                130   4e-58    
gb|ADP24158.1|  flavonoid 3'-hydroxylase                                133   5e-58    
gb|AFK73714.1|  cytochrome P450                                         127   6e-58    
ref|NP_001190075.1|  cytochrome P450, family 76, subfamily G, pol...    211   6e-58    
dbj|BAL63027.1|  flavonoid 3'-hydroxylase                               131   6e-58    
gb|KEH33153.1|  flavonoid hydroxylase                                   129   7e-58    
ref|XP_010504051.1|  PREDICTED: cytochrome P450 76A1-like               211   7e-58    
gb|AFK73713.1|  cytochrome P450                                         135   7e-58    
gb|AAP31058.1|  flavonoid 3',5'-hydroxylase                             129   8e-58    
emb|CAI54278.1|  flavonoid-3'-hydroxylase                               129   8e-58    
gb|AHA49900.1|  flavonoid 3' hydroxylase                                130   8e-58    
emb|CDP04799.1|  unnamed protein product                                130   8e-58    
dbj|BAO04188.1|  flavonoid 3'5'-hydroxylase                             128   8e-58    
ref|XP_011009110.1|  PREDICTED: flavonoid 3',5'-hydroxylase 2-like      128   9e-58    
dbj|BAO66642.1|  flavonoid 3',5'-hydroxylase                            128   9e-58    
ref|XP_011041604.1|  PREDICTED: probable (S)-N-methylcoclaurine 3...    134   9e-58    
ref|XP_006854384.1|  hypothetical protein AMTR_s00039p00175330          130   1e-57    
gb|AAX51796.1|  flavonoid 3'5'-hydroxylase                              128   1e-57    
ref|NP_001267916.1|  flavonoid 3' hydroxylase                           129   1e-57    
dbj|BAE47005.1|  flavonoid 3'-hydroxylase                               129   1e-57    
ref|XP_010105825.1|  Flavonoid 3'-monooxygenase                         130   1e-57    
gb|ACN38268.1|  flavonoid 3' hydroxylase                                129   1e-57    
gb|AIY22747.1|  flavonoid 3'-hydroxylase                                127   1e-57    
gb|AAG49315.1|AF315465_1  flavonoid 3'-hydroxylase                      126   1e-57    
gb|KHN37270.1|  Cytochrome P450 76A2                                    209   1e-57    
gb|AIY22748.1|  flavonoid 3'-hydroxylase                                127   1e-57    



>sp|P37122.1|C76A2_SOLME RecName: Full=Cytochrome P450 76A2; AltName: Full=CYPLXXVIA2; 
AltName: Full=Cytochrome P-450EG7 [Solanum melongena]
 emb|CAA50648.1| P450 hydroxylase [Solanum melongena]
Length=505

 Score =   333 bits (854),  Expect(2) = 2e-135, Method: Compositional matrix adjust.
 Identities = 155/271 (57%), Positives = 209/271 (77%), Gaps = 1/271 (0%)
 Frame = -2

Query  1273  NMLDLGSVPHQTIAAMRNKYGPVVWLRIGSVSTLAIQSAKAAAELFKNHDVPFAGRSIGD  1094
             NM +LG+ P++ +A +R KYGPV+WL++GS  T+ +Q+A+A+ ELFKNHD+ FA R I D
Sbjct  47    NMFELGTEPYKKMAVLRQKYGPVLWLKLGSTYTMVVQTAQASEELFKNHDISFANRVIPD  106

Query  1093  VMLAQGYNKGSMALAQYGSYWRVLRRICSVEMFVHKKVNETAAVRRKCIDDLLRWVENEA  914
             V  A  Y +GS+A+A YG +WR  RRIC++EMFVHKK++ET  VRRKC+D++L+W+E EA
Sbjct  107   VNQAHSYYQGSLAIAPYGPFWRFQRRICTIEMFVHKKISETEPVRRKCVDNMLKWIEKEA  166

Query  913   GSIKRGSGIHVTRFVFLATFNLLGNIMFSSDLVDPVSEKGSKFFNAMMGIMERGGTPNIS  734
              S ++GSGI VTRFVFLA+FN+LGN++ S DL D  SE+ S+FF AM  I E  G  N+S
Sbjct  167   NSAEKGSGIEVTRFVFLASFNMLGNLILSKDLADLESEEASEFFIAMKRINEWSGIANVS  226

Query  733   DIFPCLRWLDLQGLRTKTDKDLQIALQIVSTFVQKRSKEGQDDSGKRKSDFLDVLLSFEG  554
             DIFP L+  DLQ LR K  +D+  A++I+S F+++R +E +  + K K DFLDVLL F+G
Sbjct  227   DIFPFLKKFDLQSLRKKMARDMGKAVEIMSMFLKEREEERKKGTEKGK-DFLDVLLEFQG  285

Query  553   SGKDEPPKLSEHQINIFILEMFLAGTDTTSS  461
             +GKDEP KLSEH+I IF+LEMFLAGT+TTSS
Sbjct  286   TGKDEPAKLSEHEIKIFVLEMFLAGTETTSS  316


 Score =   178 bits (452),  Expect(2) = 2e-135, Method: Compositional matrix adjust.
 Identities = 81/114 (71%), Positives = 95/114 (83%), Gaps = 0/114 (0%)
 Frame = -1

Query  344  NTALTSSTVEWALTELLRNPKAMTKAKEEIRGIVGPTRRFEESDIDNLQYLQAVVKETLR  165
             T  TSS+VEWALTELLR+P+AM K K EI   + P R+FE+SDI+NL Y+QAV+KE+LR
Sbjct  310  GTETTSSSVEWALTELLRHPEAMAKVKTEISQAIEPNRKFEDSDIENLPYMQAVLKESLR  369

Query  164  LHPPAPFLIPRRAIQDTKFMGYDIPKDTQVFINVWAIGRDHESWEDPLSFKPER  3
            LHPP PFLIPR  IQDTKFMGYD+PKDTQV +N WAIGRD E W+DP+SFKPER
Sbjct  370  LHPPLPFLIPRETIQDTKFMGYDVPKDTQVLVNAWAIGRDPECWDDPMSFKPER  423



>ref|XP_006339111.1| PREDICTED: cytochrome P450 76A2-like [Solanum tuberosum]
Length=506

 Score =   339 bits (870),  Expect(2) = 8e-135, Method: Compositional matrix adjust.
 Identities = 159/272 (58%), Positives = 212/272 (78%), Gaps = 2/272 (1%)
 Frame = -2

Query  1273  NMLDLGSVPHQTIAAMRNKYGPVVWLRIG-SVSTLAIQSAKAAAELFKNHDVPFAGRSIG  1097
             NM +LG+ P++ ++A++ KYGPV+ L++G S + + +Q+A+AAAELFKNHD  FA R + 
Sbjct  47    NMFELGTEPYKKMSALKQKYGPVLGLKVGTSTNIMVVQTAQAAAELFKNHDTSFADRPLV  106

Query  1096  DVMLAQGYNKGSMALAQYGSYWRVLRRICSVEMFVHKKVNETAAVRRKCIDDLLRWVENE  917
             DV  A  Y +GS ALA+YG +WR  RRIC+VEMFVHKK++ET  VRRKC+D++L+W+E  
Sbjct  107   DVNSAHNYYQGSPALARYGPFWRFQRRICTVEMFVHKKISETVPVRRKCVDNMLKWIEKA  166

Query  916   AGSIKRGSGIHVTRFVFLATFNLLGNIMFSSDLVDPVSEKGSKFFNAMMGIMERGGTPNI  737
             A S ++GSGI VTRFVFLA+FN+LGN++ S DL DP SE+ S+FFNAM GIME  G PN+
Sbjct  167   ANSAEKGSGIEVTRFVFLASFNMLGNLILSKDLADPESEEASEFFNAMKGIMEWSGIPNV  226

Query  736   SDIFPCLRWLDLQGLRTKTDKDLQIALQIVSTFVQKRSKEGQDDSGKRKSDFLDVLLSFE  557
             SDIFP LR  DLQ LR K  +D+  A++I+S  +++R +E +    KRK DFLDVLL FE
Sbjct  227   SDIFPFLRKFDLQSLRKKMTRDMGKAMEIMSMLLKEREEERKKGMEKRK-DFLDVLLEFE  285

Query  556   GSGKDEPPKLSEHQINIFILEMFLAGTDTTSS  461
             G+GKDEP KLSEH+I +FILE+FLAGT+TT+S
Sbjct  286   GTGKDEPAKLSEHEIKVFILELFLAGTETTNS  317


 Score =   170 bits (431),  Expect(2) = 8e-135, Method: Compositional matrix adjust.
 Identities = 77/114 (68%), Positives = 93/114 (82%), Gaps = 0/114 (0%)
 Frame = -1

Query  344  NTALTSSTVEWALTELLRNPKAMTKAKEEIRGIVGPTRRFEESDIDNLQYLQAVVKETLR  165
             T  T+S+VEWALTELLR+P+AM + K EI  +VG   +FEESDI+NL Y+QAV+KE+LR
Sbjct  311  GTETTNSSVEWALTELLRHPQAMAEVKTEISKVVGLNNKFEESDIENLPYMQAVLKESLR  370

Query  164  LHPPAPFLIPRRAIQDTKFMGYDIPKDTQVFINVWAIGRDHESWEDPLSFKPER  3
            LHPP PFLIPR  IQDTKFMGYD+ K T+V +N WAIGRD E W+DP+SFKPER
Sbjct  371  LHPPLPFLIPRETIQDTKFMGYDVLKGTRVLVNAWAIGRDPECWDDPMSFKPER  424



>ref|XP_009785657.1| PREDICTED: cytochrome P450 76A1-like isoform X2 [Nicotiana sylvestris]
Length=508

 Score =   327 bits (837),  Expect(2) = 6e-134, Method: Compositional matrix adjust.
 Identities = 160/275 (58%), Positives = 214/275 (78%), Gaps = 6/275 (2%)
 Frame = -2

Query  1273  NMLDL-GSVPHQTIAAMRNKYGPVVWLRIGS-VSTLAIQSAKAAAELFKNHDVPFAGRSI  1100
             NM DL GS P++ +A ++ KYGP+VWL+IGS ++T+ +Q+A+AAAELFKNHDV FA R+I
Sbjct  47    NMFDLAGSEPYKKVANLKQKYGPIVWLKIGSSMNTIVVQTAQAAAELFKNHDVTFADRNI  106

Query  1099  GDVMLAQGYNKGSMALAQYGSYWRVLRRICSVEMFVHKKVNETAAVRRKCIDDLLRWVEN  920
              DV LA  + + SMALA YG+YWR+ RRIC+VEMFV+K++NET  +RRK +D +L+W+E 
Sbjct  107   VDVNLAHNFYQVSMALAPYGNYWRLQRRICTVEMFVNKRINETVQIRRKSMDKMLQWIEK  166

Query  919   EAG--SIKRGSGIHVTRFVFLATFNLLGNIMFSSDLVDPVSEKGSKFFNAMMGIMERGGT  746
             ++   ++ R SGI VTR+VFLA+FN+LGN+M S DL DP SEKGS+FF AM GIME  G 
Sbjct  167   QSNLENVDR-SGIEVTRYVFLASFNMLGNLMLSKDLADPESEKGSEFFKAMTGIMEWSGV  225

Query  745   PNISDIFPCLRWLDLQGLRTKTDKDLQIALQIVSTFVQKRSKEGQDDSGKRKSDFLDVLL  566
             PNISDIF CL+  D+QGLR K ++D+  A +I   ++++R +E Q    KRK D +DVLL
Sbjct  226   PNISDIFSCLKRFDIQGLRKKMERDMGKAKEITFGYLKERIEERQKGGEKRK-DLMDVLL  284

Query  565   SFEGSGKDEPPKLSEHQINIFILEMFLAGTDTTSS  461
              FEG+GKDEP KLSEH+I + I+EMFLAGT+TTS+
Sbjct  285   DFEGNGKDEPAKLSEHEITMTIMEMFLAGTETTSN  319


 Score =   180 bits (457),  Expect(2) = 6e-134, Method: Compositional matrix adjust.
 Identities = 80/114 (70%), Positives = 95/114 (83%), Gaps = 0/114 (0%)
 Frame = -1

Query  344  NTALTSSTVEWALTELLRNPKAMTKAKEEIRGIVGPTRRFEESDIDNLQYLQAVVKETLR  165
             T  TS++VEWALTELLRNP+AM K K EI  +VGP R+FEE DIDNL Y+QAV+KE+LR
Sbjct  313  GTETTSNSVEWALTELLRNPEAMVKVKAEILEVVGPNRKFEECDIDNLPYMQAVLKESLR  372

Query  164  LHPPAPFLIPRRAIQDTKFMGYDIPKDTQVFINVWAIGRDHESWEDPLSFKPER  3
            LHPP PFLIPRRAI++TKFMGYD+PK TQ+ +N W+IGRD E W+DP  FKPER
Sbjct  373  LHPPLPFLIPRRAIENTKFMGYDVPKGTQLLVNAWSIGRDPECWDDPFEFKPER  426



>ref|XP_009616474.1| PREDICTED: cytochrome P450 76A1-like [Nicotiana tomentosiformis]
Length=508

 Score =   323 bits (828),  Expect(2) = 7e-134, Method: Compositional matrix adjust.
 Identities = 160/275 (58%), Positives = 212/275 (77%), Gaps = 6/275 (2%)
 Frame = -2

Query  1273  NMLDL-GSVPHQTIAAMRNKYGPVVWLRIGS-VSTLAIQSAKAAAELFKNHDVPFAGRSI  1100
             NM DL GS PH+ +A  + KYGP+VWL+IGS ++T+ +Q+A+AAAELFKNHDV FA R+I
Sbjct  47    NMFDLAGSEPHKKVANWKQKYGPIVWLKIGSSMNTIVVQTAQAAAELFKNHDVTFADRNI  106

Query  1099  GDVMLAQGYNKGSMALAQYGSYWRVLRRICSVEMFVHKKVNETAAVRRKCIDDLLRWVEN  920
              DV LA    +GS++LA YG+YWR+ RRIC+ EMFV+K++NET  +RRK +D +L+W+E 
Sbjct  107   VDVNLAHNIYQGSISLAPYGNYWRMQRRICTSEMFVNKRINETVQIRRKSMDKMLQWIEK  166

Query  919   EAG--SIKRGSGIHVTRFVFLATFNLLGNIMFSSDLVDPVSEKGSKFFNAMMGIMERGGT  746
             +A   +I R SGI VT +VFLA+FN+LGN++ S DL DP S+KGS+FFNAM GIM+  G 
Sbjct  167   QANLVNINR-SGIEVTHYVFLASFNMLGNLILSKDLADPESDKGSEFFNAMTGIMQWAGV  225

Query  745   PNISDIFPCLRWLDLQGLRTKTDKDLQIALQIVSTFVQKRSKEGQDDSGKRKSDFLDVLL  566
             PNISDIF CL+  D+QGLR K ++D+  A +I   ++++R++E Q    KRK D LDVLL
Sbjct  226   PNISDIFSCLKRFDIQGLRKKMERDMGKAKEITFGYLKERTEERQKGREKRK-DLLDVLL  284

Query  565   SFEGSGKDEPPKLSEHQINIFILEMFLAGTDTTSS  461
              FEGSGKDE  KLSEH+I + I+EMFLAGT+TTSS
Sbjct  285   DFEGSGKDEQAKLSEHEITMTIMEMFLAGTETTSS  319


 Score =   183 bits (465),  Expect(2) = 7e-134, Method: Compositional matrix adjust.
 Identities = 83/114 (73%), Positives = 94/114 (82%), Gaps = 0/114 (0%)
 Frame = -1

Query  344  NTALTSSTVEWALTELLRNPKAMTKAKEEIRGIVGPTRRFEESDIDNLQYLQAVVKETLR  165
             T  TSS+VEWALTELL NP+AM K K EI  +VGP R+FEE DIDNL Y+QAV+KE+LR
Sbjct  313  GTETTSSSVEWALTELLHNPEAMAKVKAEISEVVGPDRKFEECDIDNLPYMQAVLKESLR  372

Query  164  LHPPAPFLIPRRAIQDTKFMGYDIPKDTQVFINVWAIGRDHESWEDPLSFKPER  3
            LHPP PFLIPRRA QDTKFMGYD+PK TQV +NVW+IGRD E W+DP  FKPER
Sbjct  373  LHPPLPFLIPRRATQDTKFMGYDVPKGTQVLVNVWSIGRDLECWDDPFEFKPER  426



>ref|XP_009786696.1| PREDICTED: cytochrome P450 76A1-like [Nicotiana sylvestris]
Length=508

 Score =   324 bits (830),  Expect(2) = 1e-133, Method: Compositional matrix adjust.
 Identities = 160/274 (58%), Positives = 208/274 (76%), Gaps = 4/274 (1%)
 Frame = -2

Query  1273  NMLDL-GSVPHQTIAAMRNKYGPVVWLRIG-SVSTLAIQSAKAAAELFKNHDVPFAGRSI  1100
             NM DL GS P++  A ++ KYGP+VWL+IG S++T+ +Q+A+AAAELFKNHDV FA R I
Sbjct  47    NMFDLAGSEPYKKAANLKQKYGPIVWLKIGPSMNTIIVQTAQAAAELFKNHDVTFADRYI  106

Query  1099  GDVMLAQGYNKGSMALAQYGSYWRVLRRICSVEMFVHKKVNETAAVRRKCIDDLLRWVEN  920
              DV LA   ++ SMALA YG+YWR+LRRIC+VEMFV+K++NET  +RRK +D +L+W+E 
Sbjct  107   VDVNLAHNNHQASMALAPYGNYWRMLRRICTVEMFVNKRINETVQIRRKSMDKMLQWIEK  166

Query  919   EAGSIKRG-SGIHVTRFVFLATFNLLGNIMFSSDLVDPVSEKGSKFFNAMMGIMERGGTP  743
             +A  +    SGI VTR+VFLA+FN+LGN++ S DL DP SEKGS+FF AM GIM+  G P
Sbjct  167   QANLVNTNRSGIEVTRYVFLASFNMLGNLILSKDLADPESEKGSEFFKAMTGIMQWAGVP  226

Query  742   NISDIFPCLRWLDLQGLRTKTDKDLQIALQIVSTFVQKRSKEGQDDSGKRKSDFLDVLLS  563
             NISDIF CL+  D+Q LR K + D+  A +I   ++++R +EGQ    KRK D LDVLL 
Sbjct  227   NISDIFSCLKRFDIQDLRKKMEHDMGKAKEITFGYLKERIEEGQKGGEKRK-DLLDVLLD  285

Query  562   FEGSGKDEPPKLSEHQINIFILEMFLAGTDTTSS  461
             FEGSGKDE  KLSEH+I + I+E FLAGT+TTSS
Sbjct  286   FEGSGKDEQAKLSEHEITMTIMEFFLAGTETTSS  319


 Score =   182 bits (462),  Expect(2) = 1e-133, Method: Compositional matrix adjust.
 Identities = 84/113 (74%), Positives = 94/113 (83%), Gaps = 0/113 (0%)
 Frame = -1

Query  341  TALTSSTVEWALTELLRNPKAMTKAKEEIRGIVGPTRRFEESDIDNLQYLQAVVKETLRL  162
            T  TSS+VE ALTELLRNP+AM K K EI  +VGP R+FEESDIDNL Y+QAV+KE+LRL
Sbjct  314  TETTSSSVELALTELLRNPEAMAKVKAEISEVVGPNRKFEESDIDNLPYMQAVLKESLRL  373

Query  161  HPPAPFLIPRRAIQDTKFMGYDIPKDTQVFINVWAIGRDHESWEDPLSFKPER  3
            HPP PFLIPRRA QDTKFMGYD+PK TQV +NVW+IGRD E W DP  FKPER
Sbjct  374  HPPLPFLIPRRATQDTKFMGYDVPKGTQVLVNVWSIGRDPECWNDPFEFKPER  426



>ref|XP_006341183.1| PREDICTED: cytochrome P450 76A1-like [Solanum tuberosum]
Length=513

 Score =   325 bits (833),  Expect(2) = 7e-133, Method: Compositional matrix adjust.
 Identities = 163/278 (59%), Positives = 213/278 (77%), Gaps = 9/278 (3%)
 Frame = -2

Query  1273  NMLDL-GSVPHQTIAAMRNKYGPVVWLRIG-SVSTLAIQSAKAAAELFKNHDVPFAGRSI  1100
             NM DL GS P++ IA++++KYGP++WL+IG S++T+ IQ+A ++ ELFKNHD  F+ R+I
Sbjct  49    NMFDLAGSEPYKKIASLKDKYGPILWLKIGPSMNTMVIQTAYSSGELFKNHDAIFSDRNI  108

Query  1099  GDVMLAQGYNKGSMALAQYGSYWRVLRRICSVEMFVHKKVNETAAVRRKCIDDLLRWVEN  920
              DV LA  + KGSMALA YG+YWR  RRIC+VEMFVHK++NET  VR++ ++ +L W+E 
Sbjct  109   IDVNLAHNFYKGSMALAPYGNYWRFSRRICTVEMFVHKRINETTLVRQESMNKMLGWIEK  168

Query  919   EAGSIKRGS---GIHVTRFVFLATFNLLGNIMFSSDLV-DPVSEKGSKFFNAMMGIMERG  752
             +A S   G+   GI VTR+VFLA+FN+LGN++ S DLV DP SE+GS FFNAMMGIME  
Sbjct  169   KASS--GGAVLEGIEVTRYVFLASFNMLGNLILSKDLVTDPESEQGSMFFNAMMGIMEWS  226

Query  751   GTPNISDIFPCLRWLDLQGLRTKTDKDLQIALQIVSTFVQKRSKE-GQDDSGKRKSDFLD  575
             G PNISDIFPCL+  D+QGLR K  +D+  A++I   F+++R +E  + +  K   D LD
Sbjct  227   GVPNISDIFPCLKMFDIQGLRKKMKRDMGKAIEITKKFIEERIEERKKGEENKSIKDLLD  286

Query  574   VLLSFEGSGKDEPPKLSEHQINIFILEMFLAGTDTTSS  461
             VLL FEGSGKDEP KLSEH+I I ILEMFLAGT+TTSS
Sbjct  287   VLLDFEGSGKDEPAKLSEHEITIIILEMFLAGTETTSS  324


 Score =   178 bits (451),  Expect(2) = 7e-133, Method: Compositional matrix adjust.
 Identities = 80/114 (70%), Positives = 95/114 (83%), Gaps = 0/114 (0%)
 Frame = -1

Query  344  NTALTSSTVEWALTELLRNPKAMTKAKEEIRGIVGPTRRFEESDIDNLQYLQAVVKETLR  165
             T  TSS+VEWALTELLR+P AMTK K EI  ++GP ++FEE DID+L Y+QA++KE+LR
Sbjct  318  GTETTSSSVEWALTELLRHPPAMTKVKLEISQVIGPNKKFEERDIDSLPYMQAILKESLR  377

Query  164  LHPPAPFLIPRRAIQDTKFMGYDIPKDTQVFINVWAIGRDHESWEDPLSFKPER  3
            LHPP PFLIPR+AIQDTKFMG+D+PK TQV +NVWAIGRD E W DP  FKPER
Sbjct  378  LHPPLPFLIPRKAIQDTKFMGHDVPKGTQVLVNVWAIGRDPECWNDPFEFKPER  431



>ref|XP_009785656.1| PREDICTED: cytochrome P450 76A1-like isoform X1 [Nicotiana sylvestris]
Length=517

 Score =   319 bits (817),  Expect(2) = 1e-131, Method: Compositional matrix adjust.
 Identities = 160/284 (56%), Positives = 214/284 (75%), Gaps = 15/284 (5%)
 Frame = -2

Query  1273  NMLDL-GSVPHQTIAAMRNKYGPVVWLRIGS-VSTLAIQSAKAAAELFKNHDVPFAGRSI  1100
             NM DL GS P++ +A ++ KYGP+VWL+IGS ++T+ +Q+A+AAAELFKNHDV FA R+I
Sbjct  47    NMFDLAGSEPYKKVANLKQKYGPIVWLKIGSSMNTIVVQTAQAAAELFKNHDVTFADRNI  106

Query  1099  GDVMLAQGYNKGSMALAQYGSYWRVLRRICSVEMFVHKKVNETAAVRRKCIDDLLRWVEN  920
              DV LA  + + SMALA YG+YWR+ RRIC+VEMFV+K++NET  +RRK +D +L+W+E 
Sbjct  107   VDVNLAHNFYQVSMALAPYGNYWRLQRRICTVEMFVNKRINETVQIRRKSMDKMLQWIEK  166

Query  919   EAG--SIKRGSGIHVTRFVFLATFNLLGNIMFSSDLVDPVSEKGSKFFNAMMGIMERGGT  746
             ++   ++ R SGI VTR+VFLA+FN+LGN+M S DL DP SEKGS+FF AM GIME  G 
Sbjct  167   QSNLENVDR-SGIEVTRYVFLASFNMLGNLMLSKDLADPESEKGSEFFKAMTGIMEWSGV  225

Query  745   PNISDIFPCLRWLDLQGLRTKTDKDLQIALQIVSTFVQKRSKEGQDDSGKRKSDFLDVLL  566
             PNISDIF CL+  D+QGLR K ++D+  A +I   ++++R +E Q    KRK D +DVLL
Sbjct  226   PNISDIFSCLKRFDIQGLRKKMERDMGKAKEITFGYLKERIEERQKGGEKRK-DLMDVLL  284

Query  565   SFEGSGKDEPPKLSEHQINIFIL---------EMFLAGTDTTSS  461
              FEG+GKDEP KLSEH+I + I+         EMFLAGT+TTS+
Sbjct  285   DFEGNGKDEPAKLSEHEITMTIMVKDLSRKHSEMFLAGTETTSN  328


 Score =   180 bits (457),  Expect(2) = 1e-131, Method: Compositional matrix adjust.
 Identities = 80/114 (70%), Positives = 95/114 (83%), Gaps = 0/114 (0%)
 Frame = -1

Query  344  NTALTSSTVEWALTELLRNPKAMTKAKEEIRGIVGPTRRFEESDIDNLQYLQAVVKETLR  165
             T  TS++VEWALTELLRNP+AM K K EI  +VGP R+FEE DIDNL Y+QAV+KE+LR
Sbjct  322  GTETTSNSVEWALTELLRNPEAMVKVKAEILEVVGPNRKFEECDIDNLPYMQAVLKESLR  381

Query  164  LHPPAPFLIPRRAIQDTKFMGYDIPKDTQVFINVWAIGRDHESWEDPLSFKPER  3
            LHPP PFLIPRRAI++TKFMGYD+PK TQ+ +N W+IGRD E W+DP  FKPER
Sbjct  382  LHPPLPFLIPRRAIENTKFMGYDVPKGTQLLVNAWSIGRDPECWDDPFEFKPER  435



>ref|XP_004249462.1| PREDICTED: cytochrome P450 76A2-like [Solanum lycopersicum]
Length=499

 Score =   322 bits (826),  Expect(2) = 4e-130, Method: Compositional matrix adjust.
 Identities = 153/272 (56%), Positives = 205/272 (75%), Gaps = 6/272 (2%)
 Frame = -2

Query  1273  NMLDLGSVPHQTIAAMRNKYGPVVWLRIG-SVSTLAIQSAKAAAELFKNHDVPFAGRSIG  1097
             NM +LG+  ++ +AA++ KYGPV+ L++G S + + +Q+A+AAAELFKNHD  FA R   
Sbjct  44    NMFELGTESYKKMAALKQKYGPVLGLKVGTSTNIMVVQTAQAAAELFKNHDTSFADRPQV  103

Query  1096  DVMLAQGYNKGSMALAQYGSYWRVLRRICSVEMFVHKKVNETAAVRRKCIDDLLRWVENE  917
             DV  A  Y +GS ALA+YG +WR  RR+C+VEMFVHKK++ET  VRRKC+DD+L+W+E  
Sbjct  104   DVNSAHNYYQGSPALARYGPFWRFQRRLCTVEMFVHKKISETVRVRRKCVDDMLKWIEKA  163

Query  916   AGSIKRGSGIHVTRFVFLATFNLLGNIMFSSDLVDPVSEKGSKFFNAMMGIMERGGTPNI  737
               S ++GSGI VTRFVFLA+FN+LGN++ S DL DP SE+ S+FF+AM GIME  G  N+
Sbjct  164   GCSAEKGSGIEVTRFVFLASFNMLGNLILSKDLADPESEEASEFFHAMKGIMEWSGVANV  223

Query  736   SDIFPCLRWLDLQGLRTKTDKDLQIALQIVSTFVQKRSKEGQDDSGKRKSDFLDVLLSFE  557
             SD+FP LR  DLQ LR K  +D+  A++I+S  +++R K       ++  DFLDVLL FE
Sbjct  224   SDVFPFLRKFDLQSLRKKMTRDMGKAMEIMSMLLKERKK-----GMEKMKDFLDVLLEFE  278

Query  556   GSGKDEPPKLSEHQINIFILEMFLAGTDTTSS  461
             G+GKDEP KLSEH+I +FILE+FLAGT+TTSS
Sbjct  279   GTGKDEPAKLSEHEIKVFILELFLAGTETTSS  310


 Score =   172 bits (435),  Expect(2) = 4e-130, Method: Compositional matrix adjust.
 Identities = 78/114 (68%), Positives = 92/114 (81%), Gaps = 0/114 (0%)
 Frame = -1

Query  344  NTALTSSTVEWALTELLRNPKAMTKAKEEIRGIVGPTRRFEESDIDNLQYLQAVVKETLR  165
             T  TSS+VEWALTELLR+P+AM + K EI   VG   +FEESDI+NL Y+QAV+KE+LR
Sbjct  304  GTETTSSSVEWALTELLRHPQAMAEVKTEISKAVGSNNKFEESDIENLPYMQAVIKESLR  363

Query  164  LHPPAPFLIPRRAIQDTKFMGYDIPKDTQVFINVWAIGRDHESWEDPLSFKPER  3
            LHPP PFLIPR  IQDTKFMGYD+ K T+V +N WAIGRD E W+DP+SFKPER
Sbjct  364  LHPPLPFLIPRETIQDTKFMGYDVLKGTRVLVNAWAIGRDPECWDDPMSFKPER  417



>ref|XP_004246574.1| PREDICTED: LOW QUALITY PROTEIN: cytochrome P450 76A1-like [Solanum 
lycopersicum]
Length=512

 Score =   320 bits (819),  Expect(2) = 1e-129, Method: Compositional matrix adjust.
 Identities = 161/279 (58%), Positives = 211/279 (76%), Gaps = 11/279 (4%)
 Frame = -2

Query  1273  NMLDL-GSVPHQTIAAMRNKYGPVVWLRIG-SVSTLAIQSAKAAAELFKNHDVPFAGRSI  1100
             N  DL GS P++ IA++++KYGP++WL+IG S++ + IQ++ +++ELFK HDV F+ R+I
Sbjct  48    NXFDLAGSEPYKKIASLKDKYGPILWLKIGPSMNIMVIQTSYSSSELFKYHDVTFSDRNI  107

Query  1099  GDVMLAQGYNKGSMALAQYGSYWRVLRRICSVEMFVHKKVNETAAVRRKCIDDLLRWVEN  920
              DV LA  + KGSMALA YG+YWR  RRIC+VEMFVHK++NET  +R+K ++ +L W+E 
Sbjct  108   VDVNLAHNFYKGSMALAPYGNYWRFSRRICTVEMFVHKRINETTLIRQKSMNRMLGWIEK  167

Query  919   EAGSIKRG----SGIHVTRFVFLATFNLLGNIMFSSDLV-DPVSEKGSKFFNAMMGIMER  755
             +A S   G     GI VTR+VFLA+FN+LGN++ S DLV DP SEKGS FFNAMMGIME 
Sbjct  168   KASS---GGGVIEGIEVTRYVFLASFNMLGNMILSKDLVTDPESEKGSMFFNAMMGIMEW  224

Query  754   GGTPNISDIFPCLRWLDLQGLRTKTDKDLQIALQIVSTFVQKRSKE-GQDDSGKRKSDFL  578
              G PNISDIFPCL+  DLQGLR K  +D+  A++I+  F+++R +E  + +  K   D L
Sbjct  225   SGVPNISDIFPCLKMFDLQGLRKKMKRDMGKAIEIIKNFIEERIEERKKGEENKSIKDLL  284

Query  577   DVLLSFEGSGKDEPPKLSEHQINIFILEMFLAGTDTTSS  461
             DVLL FEGSGK EP KLSEH+I I ILEMFLAGT+TTSS
Sbjct  285   DVLLDFEGSGKGEPAKLSEHEITIIILEMFLAGTETTSS  323


 Score =   172 bits (437),  Expect(2) = 1e-129, Method: Compositional matrix adjust.
 Identities = 77/114 (68%), Positives = 94/114 (82%), Gaps = 0/114 (0%)
 Frame = -1

Query  344  NTALTSSTVEWALTELLRNPKAMTKAKEEIRGIVGPTRRFEESDIDNLQYLQAVVKETLR  165
             T  TSS+VEWALTELLR+P+AMTK K EI  ++GP ++F+E  ID+L Y+QA++KE+L 
Sbjct  317  GTETTSSSVEWALTELLRHPRAMTKVKLEISQVIGPNKKFKERHIDSLPYMQAILKESLC  376

Query  164  LHPPAPFLIPRRAIQDTKFMGYDIPKDTQVFINVWAIGRDHESWEDPLSFKPER  3
            LHPP PFLIPR+AIQDTKFMG+D+PK TQV +NVWAIGRD E W DP  FKPER
Sbjct  377  LHPPLPFLIPRKAIQDTKFMGHDVPKGTQVLVNVWAIGRDPECWNDPFEFKPER  430



>ref|XP_010057042.1| PREDICTED: cytochrome P450 76A2-like [Eucalyptus grandis]
Length=511

 Score =   315 bits (807),  Expect(2) = 1e-125, Method: Compositional matrix adjust.
 Identities = 149/274 (54%), Positives = 203/274 (74%), Gaps = 3/274 (1%)
 Frame = -2

Query  1273  NMLDLGSVPHQTIAAMRNKYGPVVWLRIGSVSTLAIQSAKAAAELFKNHDVPFAGRSIGD  1094
             N+  LG++PH+T+A +R KYGP +WLR+GS+ T+ I S++ AAE FKN D+ FA R++ D
Sbjct  47    NIFSLGTMPHRTVAGLREKYGPTIWLRLGSIDTMVILSSRVAAEFFKNQDLNFADRTVID  106

Query  1093  VMLAQGYNKGSMALAQYGSYWRVLRRICSVEMFVHKKVNETAAVRRKCIDDLLRWVENEA  914
             V+  + Y++GS+A+A YG+YWRV+RR+ + +M V K++NETA VRRKC++++L W+   A
Sbjct  107   VLRCRDYHEGSVAVAPYGTYWRVMRRLLTTDMLVAKRLNETALVRRKCVENMLAWIGEAA  166

Query  913   GSIKR--GSGIHVTRFVFLATFNLLGNIMFSSDLVDPVSEKGSKFFNAMMGIMERGGTPN  740
              S K   G GIH+ RFVFL  FNLL N+M S DL DP S+ GS+FF AM G+ME  G PN
Sbjct  167   SSDKAQVGEGIHLARFVFLMNFNLLANLMLSRDLFDPDSKTGSEFFTAMNGLMELSGQPN  226

Query  739   ISDIFPCLRWLDLQGLRTKTDKDLQIALQIVSTFVQKRSKEGQDDSG-KRKSDFLDVLLS  563
             + D+FP LR LD QGLR K D+++  A+ I S  V++R +E + + G   + DFLDVLL 
Sbjct  227   VVDLFPWLRRLDPQGLRRKMDREMGKAMSIASELVRERIEEKKQNGGDDDRRDFLDVLLE  286

Query  562   FEGSGKDEPPKLSEHQINIFILEMFLAGTDTTSS  461
             FEG+GKDEP KLSE QIN FILE+F+AGT+TTSS
Sbjct  287   FEGNGKDEPAKLSEKQINTFILEIFMAGTETTSS  320


 Score =   164 bits (415),  Expect(2) = 1e-125, Method: Compositional matrix adjust.
 Identities = 75/114 (66%), Positives = 92/114 (81%), Gaps = 0/114 (0%)
 Frame = -1

Query  344  NTALTSSTVEWALTELLRNPKAMTKAKEEIRGIVGPTRRFEESDIDNLQYLQAVVKETLR  165
             T  TSST+EWALTELL NP +  K + E+  +VG  R+  E+DID L YLQAVVKET+R
Sbjct  314  GTETTSSTIEWALTELLLNPDSKVKVEAELSRVVGSNRKVLETDIDQLPYLQAVVKETMR  373

Query  164  LHPPAPFLIPRRAIQDTKFMGYDIPKDTQVFINVWAIGRDHESWEDPLSFKPER  3
            LHPP PFL+PRRAI+DT FMGY+IP++TQVF+N WAIGRD + WEDP++FKPER
Sbjct  374  LHPPVPFLLPRRAIRDTIFMGYNIPENTQVFVNAWAIGRDPDVWEDPMAFKPER  427



>dbj|BAC53891.1| cytochrome P450 [Petunia x hybrida]
Length=507

 Score =   327 bits (837),  Expect(2) = 3e-125, Method: Compositional matrix adjust.
 Identities = 155/272 (57%), Positives = 210/272 (77%), Gaps = 3/272 (1%)
 Frame = -2

Query  1273  NMLDLGSVPHQTIAAMRNKYGPVVWLRIGSVSTLAIQSAKAAAELFKNHDVPFAGRSIGD  1094
             NM DLG +PH  +  MRN+YGPV+WL+IG+++TL IQSA+AA   FKNHD  F  R + +
Sbjct  46    NMFDLGDLPHIKMEGMRNQYGPVMWLKIGAINTLVIQSAQAATAFFKNHDANFLERVVVE  105

Query  1093  VMLAQGYNKGSMALAQYGSYWRVLRRICSVEMFVHKKVNETAAVRRKCIDDLLRWVENEA  914
             V     Y +GS+ALA YG+YWR+LRRICS+E+FVH ++N + ++RRK +D +++W+E   
Sbjct  106   VNRVCNYLQGSLALAPYGNYWRMLRRICSMELFVHSRINNSESIRRKSVDKMIQWIETH-  164

Query  913   GSIKRGSGIHVTRFVFLATFNLLGNIMFSSDL-VDPVSEKGSKFFNAMMGIMERGGTPNI  737
             G  ++G GI +TRFVFLA+FN+LGN++ S +L  DP S   S+FF+AMMG +E  GTPNI
Sbjct  165   GKKEQGQGIEITRFVFLASFNMLGNLIMSKELAADPDSTTASEFFDAMMGQVEWSGTPNI  224

Query  736   SDIFPCLRWLDLQGLRTKTDKDLQIALQIVSTFVQKRSKEGQDDSGKRKSDFLDVLLSFE  557
             SD+FP LRWLD+QGLR K  +D+    +I+STF+++R KE Q++   + +DFLDVLL+FE
Sbjct  225   SDVFPLLRWLDIQGLRRKMKRDMGKGKEILSTFIKERIKE-QENGRAKGTDFLDVLLAFE  283

Query  556   GSGKDEPPKLSEHQINIFILEMFLAGTDTTSS  461
             G GKDEP KLSEH+INIFILEMFLAGT+T+SS
Sbjct  284   GKGKDEPAKLSEHEINIFILEMFLAGTETSSS  315


 Score =   151 bits (382),  Expect(2) = 3e-125, Method: Compositional matrix adjust.
 Identities = 79/114 (69%), Positives = 91/114 (80%), Gaps = 0/114 (0%)
 Frame = -1

Query  344  NTALTSSTVEWALTELLRNPKAMTKAKEEIRGIVGPTRRFEESDIDNLQYLQAVVKETLR  165
             T  +SST EWALTELLRNP+ M + K EI  +VGP ++FEESDID + Y+QAVVKET R
Sbjct  309  GTETSSSTTEWALTELLRNPETMARVKAEIAEVVGPNKKFEESDIDKVPYMQAVVKETFR  368

Query  164  LHPPAPFLIPRRAIQDTKFMGYDIPKDTQVFINVWAIGRDHESWEDPLSFKPER  3
            LHPP PFL+PR+A QDTKFMGYD+PK TQ+FIN WAIGRD E W DPL F PER
Sbjct  369  LHPPLPFLLPRKATQDTKFMGYDVPKGTQIFINAWAIGRDPECWHDPLDFIPER  422



>ref|XP_010056841.1| PREDICTED: cytochrome P450 76A1-like [Eucalyptus grandis]
 gb|KCW73724.1| hypothetical protein EUGRSUZ_E02332 [Eucalyptus grandis]
Length=511

 Score =   313 bits (801),  Expect(2) = 2e-124, Method: Compositional matrix adjust.
 Identities = 147/274 (54%), Positives = 203/274 (74%), Gaps = 3/274 (1%)
 Frame = -2

Query  1273  NMLDLGSVPHQTIAAMRNKYGPVVWLRIGSVSTLAIQSAKAAAELFKNHDVPFAGRSIGD  1094
             N+  LG++PH+T+A +R KYGP++WLR+GS+ T+ I S++ AAE FKN D+ FA R++ D
Sbjct  47    NIFSLGTMPHRTLAGLREKYGPMIWLRLGSIDTMVILSSRVAAEFFKNQDLNFADRTVID  106

Query  1093  VMLAQGYNKGSMALAQYGSYWRVLRRICSVEMFVHKKVNETAAVRRKCIDDLLRWVENEA  914
             V+  + Y++GS+A+A YG+YWRV+RR+ + +M V K++NE A +RRKC++++L W+   A
Sbjct  107   VLRCRDYHEGSVAVAPYGTYWRVMRRLLTTDMLVTKRLNEMAPIRRKCVENMLAWIGEAA  166

Query  913   GSIKR--GSGIHVTRFVFLATFNLLGNIMFSSDLVDPVSEKGSKFFNAMMGIMERGGTPN  740
              S K   G GIH+ RFVFL  FNLL N+M S DL DP S+ GS+FF AM G+ME  G PN
Sbjct  167   SSDKARVGEGIHLARFVFLMNFNLLANLMLSRDLFDPDSKTGSEFFTAMNGLMELSGQPN  226

Query  739   ISDIFPCLRWLDLQGLRTKTDKDLQIALQIVSTFVQKRSKEGQDDSG-KRKSDFLDVLLS  563
             + D+FP LR LD QGLR K D+++  A+ I S  V++R +E + + G   + DFLDVLL 
Sbjct  227   VVDLFPWLRRLDPQGLRRKMDREMGKAMSIASELVRERIEEKKQNGGDDDRRDFLDVLLE  286

Query  562   FEGSGKDEPPKLSEHQINIFILEMFLAGTDTTSS  461
             FEG+GKDEP KLSE QIN FILE+F+AGT+TTSS
Sbjct  287   FEGNGKDEPAKLSEKQINTFILEIFMAGTETTSS  320


 Score =   162 bits (411),  Expect(2) = 2e-124, Method: Compositional matrix adjust.
 Identities = 74/114 (65%), Positives = 91/114 (80%), Gaps = 0/114 (0%)
 Frame = -1

Query  344  NTALTSSTVEWALTELLRNPKAMTKAKEEIRGIVGPTRRFEESDIDNLQYLQAVVKETLR  165
             T  TSST+EWALTELL NP +  K + E+  +VG   +  E+DID L YLQAVVKET+R
Sbjct  314  GTETTSSTIEWALTELLLNPDSKVKVEAELSRVVGSNGKVLETDIDQLPYLQAVVKETMR  373

Query  164  LHPPAPFLIPRRAIQDTKFMGYDIPKDTQVFINVWAIGRDHESWEDPLSFKPER  3
            LHPP PFL+PRRAI+DT FMGY+IP++TQVF+N WAIGRD + WEDP++FKPER
Sbjct  374  LHPPVPFLVPRRAIRDTIFMGYNIPENTQVFVNAWAIGRDPDVWEDPMAFKPER  427



>gb|AGT03776.1| CYP76 hydroxylase [Withania somnifera]
Length=515

 Score =   332 bits (851),  Expect(2) = 2e-124, Method: Compositional matrix adjust.
 Identities = 154/272 (57%), Positives = 205/272 (75%), Gaps = 1/272 (0%)
 Frame = -2

Query  1273  NMLDLGSVPHQTIAAMRNKYGPVVWLRIG-SVSTLAIQSAKAAAELFKNHDVPFAGRSIG  1097
             N+  LG+ P + +A +  KYGPV+WL++G S + + +Q+A+AAAELFKNHD+ FA R I 
Sbjct  48    NVFQLGTEPFKAMACLEQKYGPVLWLKLGTSTNIMVVQTARAAAELFKNHDISFADRFIP  107

Query  1096  DVMLAQGYNKGSMALAQYGSYWRVLRRICSVEMFVHKKVNETAAVRRKCIDDLLRWVENE  917
              V  A  Y +GSMAL QYGSYWR  RRIC+VEMF+HKK++ET  VRRKC+D++L+W+   
Sbjct  108   IVNQAHNYCQGSMALCQYGSYWRFQRRICTVEMFIHKKISETVPVRRKCVDNMLKWIGKA  167

Query  916   AGSIKRGSGIHVTRFVFLATFNLLGNIMFSSDLVDPVSEKGSKFFNAMMGIMERGGTPNI  737
             A S ++GSGI VTRFVFLA+FN+LGN++ S DL DP SE+ S+FFNAM GIM   G  N+
Sbjct  168   ANSAEKGSGIEVTRFVFLASFNMLGNLILSKDLADPESEEASEFFNAMKGIMVWSGVTNV  227

Query  736   SDIFPCLRWLDLQGLRTKTDKDLQIALQIVSTFVQKRSKEGQDDSGKRKSDFLDVLLSFE  557
             SDIFP LR  D+Q LR K ++D+  A++I S F+++R +E +  + K   DFLD LL FE
Sbjct  228   SDIFPFLRKFDVQNLRKKMERDMGKAMEIASIFLKEREEERKKGAEKIGKDFLDALLEFE  287

Query  556   GSGKDEPPKLSEHQINIFILEMFLAGTDTTSS  461
             G+GKDEP KLSEH+I + ++EMFLAGT+TTSS
Sbjct  288   GTGKDEPAKLSEHEIKVLLVEMFLAGTETTSS  319


 Score =   143 bits (361),  Expect(2) = 2e-124, Method: Compositional matrix adjust.
 Identities = 76/114 (67%), Positives = 92/114 (81%), Gaps = 0/114 (0%)
 Frame = -1

Query  344  NTALTSSTVEWALTELLRNPKAMTKAKEEIRGIVGPTRRFEESDIDNLQYLQAVVKETLR  165
             T  TSS+VEWAL ELLR+P+AM K K EI  ++GP R+FEE+DIDNL Y+QAV+KE+LR
Sbjct  313  GTETTSSSVEWALAELLRHPQAMDKVKTEISKLIGPNRKFEENDIDNLPYMQAVIKESLR  372

Query  164  LHPPAPFLIPRRAIQDTKFMGYDIPKDTQVFINVWAIGRDHESWEDPLSFKPER  3
            LHPP P LIPR  + DTKFMGYD+PK T+V +N W IGRD E W+DP+SFKPER
Sbjct  373  LHPPLPLLIPRETVHDTKFMGYDVPKGTRVLVNAWEIGRDPECWDDPMSFKPER  426



>gb|KCW74001.1| hypothetical protein EUGRSUZ_E02618 [Eucalyptus grandis]
Length=458

 Score =   309 bits (791),  Expect(2) = 6e-124, Method: Compositional matrix adjust.
 Identities = 146/267 (55%), Positives = 198/267 (74%), Gaps = 3/267 (1%)
 Frame = -2

Query  1252  VPHQTIAAMRNKYGPVVWLRIGSVSTLAIQSAKAAAELFKNHDVPFAGRSIGDVMLAQGY  1073
             +PH+T+A +R KYGP +WLR+GS+ T+ I S++ AAE FKN D+ FA R++ DV+  + Y
Sbjct  1     MPHRTVAGLREKYGPTIWLRLGSIDTMVILSSRVAAEFFKNQDLNFADRTVIDVLRCRDY  60

Query  1072  NKGSMALAQYGSYWRVLRRICSVEMFVHKKVNETAAVRRKCIDDLLRWVENEAGSIKR--  899
             ++GS+A+A YG+YWRV+RR+ + +M V K++NETA VRRKC++++L W+   A S K   
Sbjct  61    HEGSVAVAPYGTYWRVMRRLLTTDMLVAKRLNETALVRRKCVENMLAWIGEAASSDKAQV  120

Query  898   GSGIHVTRFVFLATFNLLGNIMFSSDLVDPVSEKGSKFFNAMMGIMERGGTPNISDIFPC  719
             G GIH+ RFVFL  FNLL N+M S DL DP S+ GS+FF AM G+ME  G PN+ D+FP 
Sbjct  121   GEGIHLARFVFLMNFNLLANLMLSRDLFDPDSKTGSEFFTAMNGLMELSGQPNVVDLFPW  180

Query  718   LRWLDLQGLRTKTDKDLQIALQIVSTFVQKRSKEGQDDSG-KRKSDFLDVLLSFEGSGKD  542
             LR LD QGLR K D+++  A+ I S  V++R +E + + G   + DFLDVLL FEG+GKD
Sbjct  181   LRRLDPQGLRRKMDREMGKAMSIASELVRERIEEKKQNGGDDDRRDFLDVLLEFEGNGKD  240

Query  541   EPPKLSEHQINIFILEMFLAGTDTTSS  461
             EP KLSE QIN FILE+F+AGT+TTSS
Sbjct  241   EPAKLSEKQINTFILEIFMAGTETTSS  267


 Score =   164 bits (416),  Expect(2) = 6e-124, Method: Compositional matrix adjust.
 Identities = 75/114 (66%), Positives = 92/114 (81%), Gaps = 0/114 (0%)
 Frame = -1

Query  344  NTALTSSTVEWALTELLRNPKAMTKAKEEIRGIVGPTRRFEESDIDNLQYLQAVVKETLR  165
             T  TSST+EWALTELL NP +  K + E+  +VG  R+  E+DID L YLQAVVKET+R
Sbjct  261  GTETTSSTIEWALTELLLNPDSKVKVEAELSRVVGSNRKVLETDIDQLPYLQAVVKETMR  320

Query  164  LHPPAPFLIPRRAIQDTKFMGYDIPKDTQVFINVWAIGRDHESWEDPLSFKPER  3
            LHPP PFL+PRRAI+DT FMGY+IP++TQVF+N WAIGRD + WEDP++FKPER
Sbjct  321  LHPPVPFLLPRRAIRDTIFMGYNIPENTQVFVNAWAIGRDPDVWEDPMAFKPER  374



>dbj|BAC53892.1| cytochrome P450 [Petunia x hybrida]
Length=510

 Score =   381 bits (979),  Expect = 5e-123, Method: Compositional matrix adjust.
 Identities = 191/292 (65%), Positives = 236/292 (81%), Gaps = 2/292 (1%)
 Frame = -2

Query  1336  SRNKSRSGRlppgppglpvlGNMLDLGSVPHQTIAAMRNKYGPVVWLRIGSVSTLAIQSA  1157
             SR KS S RLPPGPPG P+ GN+ DLG++PHQTIA M+ +YGPVV LRIGSV T+AI SA
Sbjct  24    SRKKSCSHRLPPGPPGWPIFGNLFDLGTLPHQTIAGMKLRYGPVVLLRIGSVKTIAILSA  83

Query  1156  KAAAELFKNHDVPFAGRSIGDVMLAQGYNKGSMALAQYGSYWRVLRRICSVEMFVHKKVN  977
             K A E FKNHD  FA R I D ML   YNK S+ LA YG+YWRVLRRIC+VEMF +K++N
Sbjct  84    KVATEFFKNHDACFADRKIIDTMLVHNYNKSSLVLAPYGTYWRVLRRICTVEMFTNKRIN  143

Query  976   ETAAVRRKCIDDLLRWVENEAGSIKRGSGIHVTRFVFLATFNLLGNIMFSSDLVDPVSEK  797
             ETA +R+KCID +L+W++ EA S+K+GSGI V RF+FLA+FN++GN+M S DLVDP S+K
Sbjct  144   ETAHLRQKCIDSMLQWIDKEAKSMKKGSGIEVARFIFLASFNMMGNLMLSRDLVDPESKK  203

Query  796   GSKFFNAMMGIMERGGTPNISDIFPCLRWLDLQGLRTKTDKDLQIALQIVSTFVQKRSKE  617
              S+FF AM G+ME  G PNISDIFPCLRWLD+QGLR K  +D+  A+++ STFV++R KE
Sbjct  204   ASEFFTAMEGLMEWSGQPNISDIFPCLRWLDIQGLRQKAGRDMGKAIEVASTFVKERLKE  263

Query  616   GQDDSGKRKSDFLDVLLSFEGSGKDEPPKLSEHQINIFILEMFLAGTDTTSS  461
              ++  G+ K DFL+VLL FEGSGKDEP KLSEHQINIFILEMF+AG++T+SS
Sbjct  264   HKE--GEYKKDFLEVLLEFEGSGKDEPAKLSEHQINIFILEMFIAGSETSSS  313


 Score =   182 bits (462),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 83/110 (75%), Positives = 94/110 (85%), Gaps = 0/110 (0%)
 Frame = -1

Query  332  TSSTVEWALTELLRNPKAMTKAKEEIRGIVGPTRRFEESDIDNLQYLQAVVKETLRLHPP  153
            +SS+VEWAL ELL NP+AMT+ K EI  +VG  R+FEESDIDNL Y+QAVVKETLRLHPP
Sbjct  311  SSSSVEWALAELLCNPEAMTRVKAEINEVVGSNRKFEESDIDNLHYMQAVVKETLRLHPP  370

Query  152  APFLIPRRAIQDTKFMGYDIPKDTQVFINVWAIGRDHESWEDPLSFKPER  3
            AP L+PRRAIQDT FMGYDI +DTQVF+N WAIGRD E WEDP +FKPER
Sbjct  371  APLLVPRRAIQDTSFMGYDISEDTQVFVNAWAIGRDPECWEDPWAFKPER  420



>ref|XP_010057043.1| PREDICTED: cytochrome P450 76A1-like [Eucalyptus grandis]
Length=511

 Score =   306 bits (785),  Expect(2) = 9e-123, Method: Compositional matrix adjust.
 Identities = 145/274 (53%), Positives = 201/274 (73%), Gaps = 3/274 (1%)
 Frame = -2

Query  1273  NMLDLGSVPHQTIAAMRNKYGPVVWLRIGSVSTLAIQSAKAAAELFKNHDVPFAGRSIGD  1094
             N+  LG++PH+ +A +  KYGP++WLR+GS+ T+ I S++ AAE FKN D+ FA R++ D
Sbjct  47    NIFSLGTMPHRMLAGLSEKYGPMIWLRLGSIDTMVILSSRVAAEFFKNQDLNFADRTVID  106

Query  1093  VMLAQGYNKGSMALAQYGSYWRVLRRICSVEMFVHKKVNETAAVRRKCIDDLLRWVENEA  914
             V+  + Y++GS+A+A YG+YWRV+RR+ + +M V K++ ETA +RRKC++++L W+   A
Sbjct  107   VLRCRDYHEGSVAVAPYGTYWRVMRRLLTTDMLVAKRLKETAPIRRKCVENMLAWIGEAA  166

Query  913   GSIKR--GSGIHVTRFVFLATFNLLGNIMFSSDLVDPVSEKGSKFFNAMMGIMERGGTPN  740
              S K   G GIH+ R VFL  FNLLGN+M S DL DP S+ GS+FF AM G+ME  G PN
Sbjct  167   PSDKARVGEGIHLARIVFLMNFNLLGNLMLSRDLFDPDSKVGSEFFTAMNGLMELSGQPN  226

Query  739   ISDIFPCLRWLDLQGLRTKTDKDLQIALQIVSTFVQKRSKEGQDDSG-KRKSDFLDVLLS  563
             + D+FP LR LD QGLR K D+++  A+ I S  V++R +E + + G   + DFLDVLL 
Sbjct  227   VVDLFPWLRRLDPQGLRRKMDREMGKAMSIASELVRERIEEKKQNGGDDDRRDFLDVLLE  286

Query  562   FEGSGKDEPPKLSEHQINIFILEMFLAGTDTTSS  461
             FEG+GKDEP KLSE QIN FILE+F+AGT+TTSS
Sbjct  287   FEGNGKDEPAKLSEKQINTFILEIFMAGTETTSS  320


 Score =   163 bits (412),  Expect(2) = 9e-123, Method: Compositional matrix adjust.
 Identities = 74/114 (65%), Positives = 91/114 (80%), Gaps = 0/114 (0%)
 Frame = -1

Query  344  NTALTSSTVEWALTELLRNPKAMTKAKEEIRGIVGPTRRFEESDIDNLQYLQAVVKETLR  165
             T  TSST+EWALTELL NP +  K + E+  +VG  R+  E+DID L YLQAVVKET+R
Sbjct  314  GTETTSSTIEWALTELLLNPDSKVKVEAELSRVVGSNRKVLETDIDQLPYLQAVVKETMR  373

Query  164  LHPPAPFLIPRRAIQDTKFMGYDIPKDTQVFINVWAIGRDHESWEDPLSFKPER  3
            LHPP PFL+PRRAI+DT FMG ++PK+TQVF+N WAIGRD + WEDP++FKPER
Sbjct  374  LHPPVPFLVPRRAIRDTIFMGCNVPKNTQVFVNAWAIGRDPDVWEDPMAFKPER  427



>gb|KCW74002.1| hypothetical protein EUGRSUZ_E02619, partial [Eucalyptus grandis]
Length=482

 Score =   306 bits (785),  Expect(2) = 1e-122, Method: Compositional matrix adjust.
 Identities = 145/274 (53%), Positives = 201/274 (73%), Gaps = 3/274 (1%)
 Frame = -2

Query  1273  NMLDLGSVPHQTIAAMRNKYGPVVWLRIGSVSTLAIQSAKAAAELFKNHDVPFAGRSIGD  1094
             N+  LG++PH+ +A +  KYGP++WLR+GS+ T+ I S++ AAE FKN D+ FA R++ D
Sbjct  18    NIFSLGTMPHRMLAGLSEKYGPMIWLRLGSIDTMVILSSRVAAEFFKNQDLNFADRTVID  77

Query  1093  VMLAQGYNKGSMALAQYGSYWRVLRRICSVEMFVHKKVNETAAVRRKCIDDLLRWVENEA  914
             V+  + Y++GS+A+A YG+YWRV+RR+ + +M V K++ ETA +RRKC++++L W+   A
Sbjct  78    VLRCRDYHEGSVAVAPYGTYWRVMRRLLTTDMLVAKRLKETAPIRRKCVENMLAWIGEAA  137

Query  913   GSIKR--GSGIHVTRFVFLATFNLLGNIMFSSDLVDPVSEKGSKFFNAMMGIMERGGTPN  740
              S K   G GIH+ R VFL  FNLLGN+M S DL DP S+ GS+FF AM G+ME  G PN
Sbjct  138   PSDKARVGEGIHLARIVFLMNFNLLGNLMLSRDLFDPDSKVGSEFFTAMNGLMELSGQPN  197

Query  739   ISDIFPCLRWLDLQGLRTKTDKDLQIALQIVSTFVQKRSKEGQDDSG-KRKSDFLDVLLS  563
             + D+FP LR LD QGLR K D+++  A+ I S  V++R +E + + G   + DFLDVLL 
Sbjct  198   VVDLFPWLRRLDPQGLRRKMDREMGKAMSIASELVRERIEEKKQNGGDDDRRDFLDVLLE  257

Query  562   FEGSGKDEPPKLSEHQINIFILEMFLAGTDTTSS  461
             FEG+GKDEP KLSE QIN FILE+F+AGT+TTSS
Sbjct  258   FEGNGKDEPAKLSEKQINTFILEIFMAGTETTSS  291


 Score =   162 bits (411),  Expect(2) = 1e-122, Method: Compositional matrix adjust.
 Identities = 74/114 (65%), Positives = 91/114 (80%), Gaps = 0/114 (0%)
 Frame = -1

Query  344  NTALTSSTVEWALTELLRNPKAMTKAKEEIRGIVGPTRRFEESDIDNLQYLQAVVKETLR  165
             T  TSST+EWALTELL NP +  K + E+  +VG  R+  E+DID L YLQAVVKET+R
Sbjct  285  GTETTSSTIEWALTELLLNPDSKVKVEAELSRVVGSNRKVLETDIDQLPYLQAVVKETMR  344

Query  164  LHPPAPFLIPRRAIQDTKFMGYDIPKDTQVFINVWAIGRDHESWEDPLSFKPER  3
            LHPP PFL+PRRAI+DT FMG ++PK+TQVF+N WAIGRD + WEDP++FKPER
Sbjct  345  LHPPVPFLVPRRAIRDTIFMGCNVPKNTQVFVNAWAIGRDPDVWEDPMAFKPER  398



>ref|XP_009788755.1| PREDICTED: cytochrome P450 76A2-like [Nicotiana sylvestris]
Length=505

 Score =   380 bits (975),  Expect = 2e-122, Method: Compositional matrix adjust.
 Identities = 194/293 (66%), Positives = 236/293 (81%), Gaps = 3/293 (1%)
 Frame = -2

Query  1336  SRNKSRSGRlppgppglpvlGNMLDLGSVPHQTIAAMRNKYGPVVWLRIGSVSTLAIQSA  1157
             SR +S S  LPPGPPGLP+ GNM DLG++P+QTIA+ ++KYGP+VW  IGSV T++I SA
Sbjct  24    SRKRSSSYNLPPGPPGLPIFGNMFDLGTLPYQTIASFKHKYGPIVWFNIGSVKTMSILSA  83

Query  1156  KAAAELFKNHDVPFAGRSIGDVMLAQGYNKGSMALAQYGSYWRVLRRICSVEMFVHKKVN  977
             K AA+ FKNHD  FA R I D ML   YNKGS+ALA YG+YWRVLRRIC+VEMFV+K++N
Sbjct  84    KTAADFFKNHDFAFAERKIIDTMLVHDYNKGSLALAPYGTYWRVLRRICTVEMFVNKRIN  143

Query  976   ETAAVRRKCIDDLLRWVENEAGSIK-RGSGIHVTRFVFLATFNLLGNIMFSSDLVDPVSE  800
             ET  +RRKC+ D+L+W+E+EA  ++ +GSGI VTRFVFL+TFN+LGN+MFS DLV P S+
Sbjct  144   ETVDIRRKCVHDMLQWIEDEANVVEIKGSGIEVTRFVFLSTFNMLGNLMFSRDLVHPGSK  203

Query  799   KGSKFFNAMMGIMERGGTPNISDIFPCLRWLDLQGLRTKTDKDLQIALQIVSTFVQKRSK  620
             K S+FF AMM IME  G PN+SDIFPCLR  DLQGL  K  +D+  AL+I STFV++R K
Sbjct  204   KASEFFTAMMRIMEWSGNPNVSDIFPCLRRFDLQGLNKKMQRDMGNALEIASTFVKERMK  263

Query  619   EGQDDSGKRKSDFLDVLLSFEGSGKDEPPKLSEHQINIFILEMFLAGTDTTSS  461
             E +D  G  K DFLDVLL FEGSGKDEP KL+EHQINIFILEMFLAG++TTSS
Sbjct  264   ERED--GGEKKDFLDVLLDFEGSGKDEPAKLTEHQINIFILEMFLAGSETTSS  314


 Score =   179 bits (454),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 79/110 (72%), Positives = 95/110 (86%), Gaps = 0/110 (0%)
 Frame = -1

Query  332  TSSTVEWALTELLRNPKAMTKAKEEIRGIVGPTRRFEESDIDNLQYLQAVVKETLRLHPP  153
            TSS++EW LTE+LR+P+AM K K EI  +VG  ++ EESDIDNL Y+QAV+KE LRLHPP
Sbjct  312  TSSSIEWTLTEILRHPEAMAKVKAEISEVVGKNKKLEESDIDNLPYMQAVIKEALRLHPP  371

Query  152  APFLIPRRAIQDTKFMGYDIPKDTQVFINVWAIGRDHESWEDPLSFKPER  3
             PFL+PRRAI DTKFMGYDIP+DTQVF+NVW+IGRD E W+DPL+FKPER
Sbjct  372  LPFLVPRRAIHDTKFMGYDIPEDTQVFVNVWSIGRDSEYWDDPLNFKPER  421



>ref|XP_009589554.1| PREDICTED: cytochrome P450 76A2-like [Nicotiana tomentosiformis]
Length=506

 Score =   379 bits (974),  Expect = 3e-122, Method: Compositional matrix adjust.
 Identities = 177/272 (65%), Positives = 223/272 (82%), Gaps = 2/272 (1%)
 Frame = -2

Query  1273  NMLDLGSVPHQTIAAMRNKYGPVVWLRIGSVSTLAIQSAKAAAELFKNHDVPFAGRSIGD  1094
             NM +LG++P+QTIA+ ++KYGP+VW  IGSV T++I SAK AAE FKNHD  FA R I D
Sbjct  45    NMFNLGTLPYQTIASFKHKYGPIVWFNIGSVKTMSILSAKTAAEFFKNHDFAFAERKIMD  104

Query  1093  VMLAQGYNKGSMALAQYGSYWRVLRRICSVEMFVHKKVNETAAVRRKCIDDLLRWVENEA  914
              ML   YNKGS+A+A YG+YWRVLRRIC+VEMFV+K++N T  +R+KC+DD+L+W+E EA
Sbjct  105   TMLVHDYNKGSLAIAPYGTYWRVLRRICTVEMFVNKRINATVHIRQKCVDDMLQWIEEEA  164

Query  913   GSIK-RGSGIHVTRFVFLATFNLLGNIMFSSDLVDPVSEKGSKFFNAMMGIMERGGTPNI  737
               ++ +GSGI VTRFVFL+TFN+LGN+MFS DLV P S+K S+FF AMM IME  G PN+
Sbjct  165   NVVEIKGSGIEVTRFVFLSTFNMLGNLMFSRDLVHPGSKKASEFFTAMMRIMEWSGNPNV  224

Query  736   SDIFPCLRWLDLQGLRTKTDKDLQIALQIVSTFVQKRSKEGQDDSGKRKSDFLDVLLSFE  557
             SDIFPCLR  DLQGL+ K  +++  AL+I STFV++R KE ++D G++K DFLDVLL FE
Sbjct  225   SDIFPCLRRFDLQGLKKKMHREMGKALEIASTFVKERIKE-REDGGEKKKDFLDVLLDFE  283

Query  556   GSGKDEPPKLSEHQINIFILEMFLAGTDTTSS  461
             GSGKDEP KL+EHQINIFILEMFLAG++TTSS
Sbjct  284   GSGKDEPAKLTEHQINIFILEMFLAGSETTSS  315


 Score =   176 bits (447),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 81/110 (74%), Positives = 93/110 (85%), Gaps = 0/110 (0%)
 Frame = -1

Query  332  TSSTVEWALTELLRNPKAMTKAKEEIRGIVGPTRRFEESDIDNLQYLQAVVKETLRLHPP  153
            TSS+VEW LTELL +P+AM K K EI  IVG  R+ EESDIDNL Y+QAV+KE LRLHPP
Sbjct  313  TSSSVEWTLTELLCHPEAMAKVKAEISEIVGKNRKLEESDIDNLPYMQAVIKEALRLHPP  372

Query  152  APFLIPRRAIQDTKFMGYDIPKDTQVFINVWAIGRDHESWEDPLSFKPER  3
             PFL+PRRAI DTKFMGYDIP++TQVF+NVW+IGRD E W+DPL FKPER
Sbjct  373  LPFLVPRRAIHDTKFMGYDIPENTQVFVNVWSIGRDPEYWDDPLDFKPER  422



>ref|XP_006341182.1| PREDICTED: cytochrome P450 76A2-like [Solanum tuberosum]
Length=507

 Score =   377 bits (967),  Expect = 3e-121, Method: Compositional matrix adjust.
 Identities = 179/272 (66%), Positives = 219/272 (81%), Gaps = 2/272 (1%)
 Frame = -2

Query  1273  NMLDLGSVPHQTIAAMRNKYGPVVWLRIGSVSTLAIQSAKAAAELFKNHDVPFAGRSIGD  1094
             NM DLG++P+QTIA  + KYGPVVW +IGSV T++I SA  A E FKNHD  FA R I D
Sbjct  46    NMFDLGTLPYQTIAEFKQKYGPVVWFKIGSVKTMSILSANTATEFFKNHDFAFAERKIID  105

Query  1093  VMLAQGYNKGSMALAQYGSYWRVLRRICSVEMFVHKKVNETAAVRRKCIDDLLRWVENEA  914
              ML   YN GS+A+A+YG+YWRVLRRIC+VEMFVHK++NET  +RRKC+DD++ W+E E 
Sbjct  106   TMLVHDYNLGSLAIARYGTYWRVLRRICTVEMFVHKRINETVDIRRKCVDDMIHWIEKEV  165

Query  913   GSIK-RGSGIHVTRFVFLATFNLLGNIMFSSDLVDPVSEKGSKFFNAMMGIMERGGTPNI  737
              S++ +GSGI VTRFVFL+TFN+LGN+MFS DLV P S+K S+FFNAMM IM   GTPNI
Sbjct  166   NSVEVKGSGIEVTRFVFLSTFNMLGNLMFSRDLVHPGSKKASEFFNAMMRIMILSGTPNI  225

Query  736   SDIFPCLRWLDLQGLRTKTDKDLQIALQIVSTFVQKRSKEGQDDSGKRKSDFLDVLLSFE  557
             SDIFP LR  DLQGL+ K  +++ IAL I STFV++R KE ++D  ++K+DFLDVLL FE
Sbjct  226   SDIFPRLRRFDLQGLKKKMHREMGIALGIASTFVKERMKE-REDGEEKKNDFLDVLLEFE  284

Query  556   GSGKDEPPKLSEHQINIFILEMFLAGTDTTSS  461
             GSGKDEP KLSEHQI IFILEMFLAG++TTSS
Sbjct  285   GSGKDEPAKLSEHQITIFILEMFLAGSETTSS  316


 Score =   179 bits (455),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 82/110 (75%), Positives = 94/110 (85%), Gaps = 0/110 (0%)
 Frame = -1

Query  332  TSSTVEWALTELLRNPKAMTKAKEEIRGIVGPTRRFEESDIDNLQYLQAVVKETLRLHPP  153
            TSS+VEW LTELLR+P+AM + K EI  IVG  ++FEESDIDNL Y+QAVVKE LRLHPP
Sbjct  314  TSSSVEWTLTELLRHPEAMARVKAEIFQIVGQNKKFEESDIDNLPYMQAVVKEVLRLHPP  373

Query  152  APFLIPRRAIQDTKFMGYDIPKDTQVFINVWAIGRDHESWEDPLSFKPER  3
             PFL+PRRA+ DT FMGYDIP+DTQVF+NVWAIGRD E W+DPL FKPER
Sbjct  374  LPFLVPRRAMHDTNFMGYDIPEDTQVFVNVWAIGRDPEYWDDPLDFKPER  423



>ref|XP_004246901.1| PREDICTED: cytochrome P450 76A2-like [Solanum lycopersicum]
Length=507

 Score =   375 bits (962),  Expect = 2e-120, Method: Compositional matrix adjust.
 Identities = 179/272 (66%), Positives = 216/272 (79%), Gaps = 2/272 (1%)
 Frame = -2

Query  1273  NMLDLGSVPHQTIAAMRNKYGPVVWLRIGSVSTLAIQSAKAAAELFKNHDVPFAGRSIGD  1094
             NM DLG++P+QTIA  + KYGP+VW +IGSV T++I SAK A E FKNHD  FA R I D
Sbjct  46    NMFDLGALPYQTIAQYKQKYGPIVWFKIGSVKTMSILSAKTATEFFKNHDFVFAERKIMD  105

Query  1093  VMLAQGYNKGSMALAQYGSYWRVLRRICSVEMFVHKKVNETAAVRRKCIDDLLRWVENEA  914
              ML   YN GS+A+A+YG+YWRVLRRIC+VEMFVHK++NET  +RRKC+DD++ W+ENE 
Sbjct  106   TMLVHDYNLGSLAIARYGTYWRVLRRICTVEMFVHKRINETMDIRRKCVDDMIHWIENEV  165

Query  913   GSIK-RGSGIHVTRFVFLATFNLLGNIMFSSDLVDPVSEKGSKFFNAMMGIMERGGTPNI  737
              S + +GSGI VTRFVFL+TFN+LGN+MFS DLV P S+K S+FFNAMM IM     PNI
Sbjct  166   SSKEVKGSGIEVTRFVFLSTFNMLGNLMFSRDLVHPGSKKASEFFNAMMRIMVLSSIPNI  225

Query  736   SDIFPCLRWLDLQGLRTKTDKDLQIALQIVSTFVQKRSKEGQDDSGKRKSDFLDVLLSFE  557
             SDIFPCLR  DLQGL+ K  +++ IAL I STFV++R KE +    K+K DFLDVLL FE
Sbjct  226   SDIFPCLRRFDLQGLKKKMHREIGIALGIASTFVKERMKEREHGEVKKK-DFLDVLLEFE  284

Query  556   GSGKDEPPKLSEHQINIFILEMFLAGTDTTSS  461
             GSGKDEP KLSEHQI IFILEMFLAG++TTSS
Sbjct  285   GSGKDEPSKLSEHQITIFILEMFLAGSETTSS  316


 Score =   174 bits (440),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 80/110 (73%), Positives = 93/110 (85%), Gaps = 0/110 (0%)
 Frame = -1

Query  332  TSSTVEWALTELLRNPKAMTKAKEEIRGIVGPTRRFEESDIDNLQYLQAVVKETLRLHPP  153
            TSS+VEW LTELLR+P+AM + K EI  IV   ++FEES+IDNL Y+QAVVKE LRLHPP
Sbjct  314  TSSSVEWTLTELLRHPEAMGRVKAEISRIVVQKKKFEESEIDNLPYMQAVVKEVLRLHPP  373

Query  152  APFLIPRRAIQDTKFMGYDIPKDTQVFINVWAIGRDHESWEDPLSFKPER  3
             PFL+PRRA+ DT FMGYDIP+DTQVF+NVWAIGRD E W+DPL FKPER
Sbjct  374  LPFLVPRRAMHDTNFMGYDIPEDTQVFVNVWAIGRDPEYWDDPLDFKPER  423



>sp|P37121.1|C76A1_SOLME RecName: Full=Cytochrome P450 76A1; AltName: Full=CYPLXXVIA1; 
AltName: Full=Cytochrome P-450EG8, partial [Solanum melongena]
 emb|CAA50649.1| unnamed protein product [Solanum melongena]
Length=467

 Score =   315 bits (808),  Expect(2) = 1e-119, Method: Compositional matrix adjust.
 Identities = 158/276 (57%), Positives = 209/276 (76%), Gaps = 5/276 (2%)
 Frame = -2

Query  1273  NMLDL-GSVPHQTIAAMRNKYGPVVWLRIGS-VSTLAIQSAKAAAELFKNHDVPFAGRSI  1100
             NM DL GS P++ IA ++ KYGP++WL+IGS ++T+ IQ+A +A+ELF+NHDV F+ R I
Sbjct  3     NMFDLAGSAPYKKIACLKEKYGPILWLKIGSSMNTMVIQTANSASELFRNHDVSFSDRPI  62

Query  1099  GDVMLAQGYNKGSMALAQYGSYWRVLRRICSVEMFVHKKVNETAAVRRKCIDDLLRWVEN  920
              DV LA  Y KGSMALA YG+YWR  RRIC+VEMFVHK++NET  +R++ +D +LR  E 
Sbjct  63    VDVNLAHNYYKGSMALAPYGNYWRFSRRICTVEMFVHKRINETTNIRQESVDKMLRLDEE  122

Query  919   EA-GSIKRGSGIHVTRFVFLATFNLLGNIMFSSDLV-DPVSEKGSKFFNAMMGIMERGGT  746
             +A  S   G GI VTR++FLA+FN++GN++FS DLV DP S++GS+FFNAM+GIME  G 
Sbjct  123   KASSSGGGGEGIEVTRYMFLASFNMVGNMIFSKDLVTDPESKQGSEFFNAMIGIMEWAGV  182

Query  745   PNISDIFPCLRWLDLQGLRTKTDKDLQIALQIVSTFVQKRSKEGQDDSGKRK-SDFLDVL  569
             PNISDIFPCL+  D+QGLR K ++D+    +I   F+++R +E +     R   D LDVL
Sbjct  183   PNISDIFPCLKMFDVQGLRKKMERDMGKGKEITKKFIEERIEERKKGEKNRSIKDLLDVL  242

Query  568   LSFEGSGKDEPPKLSEHQINIFILEMFLAGTDTTSS  461
             + FEGSGKDEP KLSE +I + ILEMFLAGT+TTSS
Sbjct  243   IDFEGSGKDEPDKLSEDEITVIILEMFLAGTETTSS  278


 Score =   144 bits (363),  Expect(2) = 1e-119, Method: Compositional matrix adjust.
 Identities = 79/114 (69%), Positives = 93/114 (82%), Gaps = 0/114 (0%)
 Frame = -1

Query  344  NTALTSSTVEWALTELLRNPKAMTKAKEEIRGIVGPTRRFEESDIDNLQYLQAVVKETLR  165
             T  TSS+VEWALTELLR+P+AM K K EI  ++GP ++FEE DID+L Y+QAV+KE LR
Sbjct  272  GTETTSSSVEWALTELLRHPQAMAKVKLEILQVIGPNKKFEECDIDSLPYMQAVLKEQLR  331

Query  164  LHPPAPFLIPRRAIQDTKFMGYDIPKDTQVFINVWAIGRDHESWEDPLSFKPER  3
            LHPP P LIPR+AIQDTKFMGYDIPK TQV +N WAIGRD E W++P  FKPER
Sbjct  332  LHPPLPLLIPRKAIQDTKFMGYDIPKGTQVLVNAWAIGRDPEYWDNPFEFKPER  385



>emb|CAN76784.1| hypothetical protein VITISV_028823 [Vitis vinifera]
Length=511

 Score =   290 bits (742),  Expect(2) = 1e-119, Method: Compositional matrix adjust.
 Identities = 132/274 (48%), Positives = 195/274 (71%), Gaps = 3/274 (1%)
 Frame = -2

Query  1273  NMLDLGSVPHQTIAAMRNKYGPVVWLRIGSVSTLAIQSAKAAAELFKNHDVPFAGRSIGD  1094
             N+ DLG++PHQT+  +R++YGPV+WL++G+++T+ IQSAK AAELFKNHD+PF+ R +  
Sbjct  44    NIFDLGTMPHQTLYRLRSQYGPVLWLQLGAINTVVIQSAKVAAELFKNHDLPFSDRKVPC  103

Query  1093  VMLAQGYNKGSMALAQYGSYWRVLRRICSVEMFVHKKVNETAAVRRKCIDDLLRWVENEA  914
              + A  YN+GSMA++ YG+YWR LR++CS E+ V K++NE A +R KC+D +++W+E++A
Sbjct  104   ALTALNYNQGSMAMSNYGTYWRTLRKVCSSELLVIKRINEMAPLRHKCVDRMIQWIEDDA  163

Query  913   --GSIKRGSG-IHVTRFVFLATFNLLGNIMFSSDLVDPVSEKGSKFFNAMMGIMERGGTP  743
                 ++ GSG + V+  VF   FNL+ N+M S D  D   ++G++F++AM  IME  G P
Sbjct  164   TMARVQGGSGEVEVSHLVFCVAFNLIANLMLSRDFFDMKPKEGNEFYBAMNKIMELAGKP  223

Query  742   NISDIFPCLRWLDLQGLRTKTDKDLQIALQIVSTFVQKRSKEGQDDSGKRKSDFLDVLLS  563
             N +D FP L+WLD QG++    ++L  A+ I++ FV++R +E Q    K K DFLDVLL 
Sbjct  224   NTADFFPFLKWLDPQGIKRNMVRELGRAMDIIAGFVKERVEERQTGIEKEKRDFLDVLLE  283

Query  562   FEGSGKDEPPKLSEHQINIFILEMFLAGTDTTSS  461
             +   GK+   KLSE  +NI ILEMF  GT+TTSS
Sbjct  284   YRRDGKEGSEKLSERNMNIIILEMFFGGTETTSS  317


 Score =   169 bits (427),  Expect(2) = 1e-119, Method: Compositional matrix adjust.
 Identities = 79/114 (69%), Positives = 91/114 (80%), Gaps = 0/114 (0%)
 Frame = -1

Query  344  NTALTSSTVEWALTELLRNPKAMTKAKEEIRGIVGPTRRFEESDIDNLQYLQAVVKETLR  165
             T  TSST+EWA+TELLR PK+M K KEE+  +VGP R+ EESDID L YLQAVVKETLR
Sbjct  311  GTETTSSTIEWAMTELLRKPKSMRKVKEELDRVVGPDRKVEESDIDELLYLQAVVKETLR  370

Query  164  LHPPAPFLIPRRAIQDTKFMGYDIPKDTQVFINVWAIGRDHESWEDPLSFKPER  3
            LHP  P LIPR A+QDT FMGY IP++TQVF+N W+IGRD E+W  PLSFKP R
Sbjct  371  LHPALPLLIPRNALQDTNFMGYFIPQNTQVFVNAWSIGRDPEAWHKPLSFKPRR  424



>ref|XP_002283772.1| PREDICTED: cytochrome P450 76A1 [Vitis vinifera]
 ref|XP_010654032.1| PREDICTED: cytochrome P450 76A1 [Vitis vinifera]
Length=511

 Score =   289 bits (739),  Expect(2) = 3e-119, Method: Compositional matrix adjust.
 Identities = 132/274 (48%), Positives = 195/274 (71%), Gaps = 3/274 (1%)
 Frame = -2

Query  1273  NMLDLGSVPHQTIAAMRNKYGPVVWLRIGSVSTLAIQSAKAAAELFKNHDVPFAGRSIGD  1094
             N+ DLG++PHQT+  +R++YGPV+WL++G+++T+ IQSAK AAELFKNHD+PF+ R +  
Sbjct  44    NIFDLGTMPHQTLYRLRSQYGPVLWLQLGAINTVVIQSAKVAAELFKNHDLPFSDRKVPC  103

Query  1093  VMLAQGYNKGSMALAQYGSYWRVLRRICSVEMFVHKKVNETAAVRRKCIDDLLRWVENEA  914
              + A  YN+GSMA++ YG+YWR LR++CS E+ V K++NE A +R KC+D +++W+E++A
Sbjct  104   ALTALNYNQGSMAMSNYGTYWRTLRKVCSSELLVIKRINEMAPLRHKCVDRMIQWIEDDA  163

Query  913   --GSIKRGSG-IHVTRFVFLATFNLLGNIMFSSDLVDPVSEKGSKFFNAMMGIMERGGTP  743
                 ++ GSG + V+  VF   FNL+ N+M S D  D   ++G++F++AM  IME  G P
Sbjct  164   TMARVQGGSGEVEVSHLVFCVAFNLIANLMLSRDFFDMKPKEGNEFYDAMNKIMELAGKP  223

Query  742   NISDIFPCLRWLDLQGLRTKTDKDLQIALQIVSTFVQKRSKEGQDDSGKRKSDFLDVLLS  563
             N +D FP L+WLD QG++    ++L  A+ I++ FV++R +E Q    K K DFLDVLL 
Sbjct  224   NTADFFPFLKWLDPQGIKRNMVRELGRAMDIIAGFVKERVEERQTGIEKEKRDFLDVLLE  283

Query  562   FEGSGKDEPPKLSEHQINIFILEMFLAGTDTTSS  461
             +   GK+   KLSE  +NI ILEMF  GT+TTSS
Sbjct  284   YRRDGKEGSEKLSERNMNIIILEMFFGGTETTSS  317


 Score =   169 bits (427),  Expect(2) = 3e-119, Method: Compositional matrix adjust.
 Identities = 79/114 (69%), Positives = 91/114 (80%), Gaps = 0/114 (0%)
 Frame = -1

Query  344  NTALTSSTVEWALTELLRNPKAMTKAKEEIRGIVGPTRRFEESDIDNLQYLQAVVKETLR  165
             T  TSST+EWA+TELLR PK+M K KEE+  +VGP R+ EESDID L YLQAVVKETLR
Sbjct  311  GTETTSSTIEWAMTELLRKPKSMRKVKEELDRVVGPDRKVEESDIDELLYLQAVVKETLR  370

Query  164  LHPPAPFLIPRRAIQDTKFMGYDIPKDTQVFINVWAIGRDHESWEDPLSFKPER  3
            LHP  P LIPR A+QDT FMGY IP++TQVF+N W+IGRD E+W  PLSFKP R
Sbjct  371  LHPALPLLIPRNALQDTNFMGYFIPQNTQVFVNAWSIGRDPEAWHKPLSFKPRR  424



>ref|XP_010683910.1| PREDICTED: cytochrome P450 76A2-like [Beta vulgaris subsp. vulgaris]
Length=511

 Score =   285 bits (729),  Expect(2) = 2e-115, Method: Compositional matrix adjust.
 Identities = 128/273 (47%), Positives = 194/273 (71%), Gaps = 2/273 (1%)
 Frame = -2

Query  1273  NMLDLGSVPHQTIAAMRNKYGPVVWLRIGSVSTLAIQSAKAAAELFKNHDVPFAGRSIGD  1094
             NM DLG++PH+ +A +  K+GPV+WLR+GS   + I +A+ AAE FK+HD+ F  R+I +
Sbjct  45    NMFDLGTMPHRALAKLGTKHGPVIWLRLGSQRIMVILTAEIAAEFFKHHDLSFVDRNINE  104

Query  1093  VMLAQGYNKGSMALAQYGSYWRVLRRICSVEMFVHKKVNETAAVRRKCIDDLLRWVENEA  914
              M    Y+KGS+ LA YG +WRV++++C +EM   K++ E+A+VR KC+ DL++W+E+ A
Sbjct  105   TMRVLDYHKGSLILAPYGPHWRVMKKLCVIEMLTSKRIRESASVREKCVADLIKWIEDAA  164

Query  913   GSIKRGS--GIHVTRFVFLATFNLLGNIMFSSDLVDPVSEKGSKFFNAMMGIMERGGTPN  740
                  G    I V  FVFLA FNLLGN++ S +L+DP S +GS+F+ AM G+ +  G PN
Sbjct  165   RVDDDGEIQAIEVAHFVFLAEFNLLGNLLLSKNLLDPSSMRGSEFYAAMNGLTQWTGLPN  224

Query  739   ISDIFPCLRWLDLQGLRTKTDKDLQIALQIVSTFVQKRSKEGQDDSGKRKSDFLDVLLSF  560
             ++D FP L+WLDLQGL+ KT +D++    I++  +++R +E +  +   K D LD+LL F
Sbjct  225   VADFFPWLKWLDLQGLQQKTKRDMRKLFDILTQLMKERIQEKEMRTENGKKDILDLLLEF  284

Query  559   EGSGKDEPPKLSEHQINIFILEMFLAGTDTTSS  461
             EG GK+EP KLS++ I+IF+LE F+AGT++T+S
Sbjct  285   EGDGKEEPQKLSDYHISIFMLEFFMAGTESTTS  317


 Score =   160 bits (404),  Expect(2) = 2e-115, Method: Compositional matrix adjust.
 Identities = 76/117 (65%), Positives = 91/117 (78%), Gaps = 3/117 (3%)
 Frame = -1

Query  344  NTALTSSTVE---WALTELLRNPKAMTKAKEEIRGIVGPTRRFEESDIDNLQYLQAVVKE  174
             T  T+ST+E   WALTELL N  +M+K K E+  IVG  R F+E++ID L YLQAV+KE
Sbjct  311  GTESTTSTIESKQWALTELLANVDSMSKVKYELDQIVGQQREFQEANIDELPYLQAVIKE  370

Query  173  TLRLHPPAPFLIPRRAIQDTKFMGYDIPKDTQVFINVWAIGRDHESWEDPLSFKPER  3
            TLRLHPP PFL+PR+A++D  FMGYDIP  TQVF+NVWAIGRD ESW+DPL F PER
Sbjct  371  TLRLHPPVPFLVPRKAVEDVNFMGYDIPCGTQVFVNVWAIGRDPESWDDPLRFMPER  427



>ref|XP_011094547.1| PREDICTED: cytochrome P450 76A2-like [Sesamum indicum]
Length=504

 Score =   290 bits (743),  Expect(2) = 2e-111, Method: Compositional matrix adjust.
 Identities = 149/271 (55%), Positives = 203/271 (75%), Gaps = 6/271 (2%)
 Frame = -2

Query  1273  NMLDLGSVPHQTIAAMRNKYGPVVWLRIGSVSTLAIQSAKAAAELFKNHDVPFAGRSIGD  1094
             +M +LG  PH+ IA +  KYGPVVWL++GS++T+A+  AK A+E FKNHD+ FA R+I +
Sbjct  44    HMFNLGGTPHRAIAELEQKYGPVVWLKLGSINTMALLKAKPASEFFKNHDLSFADRTIVE  103

Query  1093  VMLAQGYNKGSMALAQYGSYWRVLRRICSVEMFVHKKVNETAAVRRKCIDDLLRWVENEA  914
              M A GYN GS+ALA YGS WRVLRRIC+VEMFV K+++ET  +RRKC+DD+L W+E + 
Sbjct  104   TMTAHGYNYGSLALAPYGSRWRVLRRICTVEMFVSKRISETEGIRRKCVDDMLSWIEKDG  163

Query  913   GSIKRGSGIHVTRFVFLATFNLLGNIMFSSDLVDPVSEKGSKFFNAMMGIMERGGTPNIS  734
                  G+ I V R+ FLA+FN+LGN+M S DLVDP SEKG +F++AM  +ME    PN+S
Sbjct  164   N----GNAIPVGRYAFLASFNMLGNLMMSRDLVDPESEKGLEFYDAMKKVMEWSARPNVS  219

Query  733   DIFPCLRWLDLQGLRTKTDKDLQIALQIVSTFVQKRSKEGQDDSGKRKSDFLDVLLSFEG  554
             D+FP +RW+DLQGL+ + ++D+  A+ IVS FV++R ++ ++   K K DFLDVLL  E 
Sbjct  220   DLFPWIRWIDLQGLKRRANRDMGTAMGIVSGFVKERIQQRKNGEWKEK-DFLDVLLESE-  277

Query  553   SGKDEPPKLSEHQINIFILEMFLAGTDTTSS  461
             S K E  KL+E +I IFILE+FLAGT+TTS+
Sbjct  278   SCKVESEKLTETEIIIFILEIFLAGTETTST  308


 Score =   141 bits (355),  Expect(2) = 2e-111, Method: Compositional matrix adjust.
 Identities = 79/114 (69%), Positives = 93/114 (82%), Gaps = 0/114 (0%)
 Frame = -1

Query  344  NTALTSSTVEWALTELLRNPKAMTKAKEEIRGIVGPTRRFEESDIDNLQYLQAVVKETLR  165
             T  TS+++EWA++ELLRNP+ M K K+EI  +VG   RF ES IDNL YLQAV+KETLR
Sbjct  302  GTETTSTSIEWAMSELLRNPETMAKLKDEISSVVGLGERFLESHIDNLPYLQAVIKETLR  361

Query  164  LHPPAPFLIPRRAIQDTKFMGYDIPKDTQVFINVWAIGRDHESWEDPLSFKPER  3
            LHPP PFL+PRRAIQDT FMGY +PK+TQVF+NVWAIGRD E WED + FKPER
Sbjct  362  LHPPLPFLLPRRAIQDTNFMGYCVPKNTQVFVNVWAIGRDQEYWEDAVCFKPER  415



>ref|XP_009602679.1| PREDICTED: cytochrome P450 76A2-like [Nicotiana tomentosiformis]
Length=507

 Score =   349 bits (895),  Expect = 2e-110, Method: Compositional matrix adjust.
 Identities = 159/272 (58%), Positives = 214/272 (79%), Gaps = 1/272 (0%)
 Frame = -2

Query  1273  NMLDLGSVPHQTIAAMRNKYGPVVWLRIG-SVSTLAIQSAKAAAELFKNHDVPFAGRSIG  1097
             NM +LG++P++ +A ++ KYGPV+WL+IG S++++ +Q+A+AAA+LFKNHD+ FA R   
Sbjct  47    NMFELGTLPYKKVAVLKQKYGPVLWLKIGPSINSMVVQTAQAAADLFKNHDISFADRCPV  106

Query  1096  DVMLAQGYNKGSMALAQYGSYWRVLRRICSVEMFVHKKVNETAAVRRKCIDDLLRWVENE  917
             DV  A  Y +GSMAL QYGS+WR  RRIC+VEMFV+KK+NET +VRRKC++D+++W+E E
Sbjct  107   DVNQAHNYYQGSMALGQYGSFWRFQRRICTVEMFVNKKINETVSVRRKCVNDMVKWIEKE  166

Query  916   AGSIKRGSGIHVTRFVFLATFNLLGNIMFSSDLVDPVSEKGSKFFNAMMGIMERGGTPNI  737
             A  +K+GSGI +TRFVFLA+FN+LGN++FS DL DP SE+ S FFNAM GIME  G PN+
Sbjct  167   ANVVKKGSGIELTRFVFLASFNMLGNLIFSKDLADPDSEEASDFFNAMKGIMEWSGIPNV  226

Query  736   SDIFPCLRWLDLQGLRTKTDKDLQIALQIVSTFVQKRSKEGQDDSGKRKSDFLDVLLSFE  557
             SDIFP L+  DLQ LR K  +D+  A++  S F+++R +E      KR  DFLDVLL FE
Sbjct  227   SDIFPSLKRFDLQSLRKKMTRDMGKAMEFGSAFLKEREEERIKGGEKRDKDFLDVLLEFE  286

Query  556   GSGKDEPPKLSEHQINIFILEMFLAGTDTTSS  461
             G+GKDEP KLSEH+I I ++EMFLAG++TTSS
Sbjct  287   GTGKDEPAKLSEHEIKILVMEMFLAGSETTSS  318


 Score =   186 bits (471),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 83/110 (75%), Positives = 97/110 (88%), Gaps = 0/110 (0%)
 Frame = -1

Query  332  TSSTVEWALTELLRNPKAMTKAKEEIRGIVGPTRRFEESDIDNLQYLQAVVKETLRLHPP  153
            TSS+VEWALTELLR+P+AM K KEE+  +VGP ++FEESDIDNL Y+QA++KE+LRLHPP
Sbjct  316  TSSSVEWALTELLRHPEAMAKVKEELSKVVGPNKKFEESDIDNLPYMQAILKESLRLHPP  375

Query  152  APFLIPRRAIQDTKFMGYDIPKDTQVFINVWAIGRDHESWEDPLSFKPER  3
             PFLIPR  IQDTKFMGYDIPK TQV +NVWAIGRD E W+DP+SFKPER
Sbjct  376  LPFLIPRSTIQDTKFMGYDIPKGTQVLVNVWAIGRDPECWDDPMSFKPER  425



>gb|KCW48743.1| hypothetical protein EUGRSUZ_K02382 [Eucalyptus grandis]
Length=488

 Score =   288 bits (736),  Expect(2) = 2e-110, Method: Compositional matrix adjust.
 Identities = 149/292 (51%), Positives = 205/292 (70%), Gaps = 10/292 (3%)
 Frame = -2

Query  1330  NKSRSGRlppgppglpvlGNMLDLGSVPHQTIAAMRNKYGPVVWLRIGSVSTLAIQSAKA  1151
             ++SRS RLPPGP   P+ GN+ +LG +P +T+A +R KYGPV+WLR+GS+ T+   S++ 
Sbjct  29    HRSRSHRLPPGPSRWPIFGNLFNLGKMPRRTLAGLREKYGPVIWLRLGSIDTMVTLSSRV  88

Query  1150  AAELFKNHDVPFAGRSIGDVMLAQGYNKGSMALAQYGSYWRVLRRICSVEMFVHKKVNET  971
             AAE FKNHD+ F  R+I D+M +Q Y KGS+ALA YG+YWRV RR+ +  + V +++NET
Sbjct  89    AAEFFKNHDLNFVERTITDLMQSQEYYKGSIALAPYGTYWRVSRRLLTAGILVARRLNET  148

Query  970   AAVRRKCIDDLLRWVENEAGS--IKRGSGIHVTRFVFLATFNLLGNIMFSSDLVDPVSEK  797
             A ++RKC+DD+L W+   A +  ++ G G+H+ RFVFL  FNLLGN+M S DL+DP S+ 
Sbjct  149   APIQRKCVDDMLTWIGEAASTDKVRLGEGVHLARFVFLMAFNLLGNLMLSRDLLDPDSKV  208

Query  796   GSKFFNAMMGIMERGGTPNISDIFPCLRWLDLQGLRTKTDKDLQIALQIVSTFVQKRSKE  617
             GS+FF AM G+ME  G   I+D+FP LRWL  QGLR K D+D+  A++I S FV++R +E
Sbjct  209   GSEFFEAMSGLMEWSGHVTIADLFPWLRWLGPQGLRRKMDRDMGKAMRIASDFVRERIEE  268

Query  616   GQDDSGKRKSDFLDVLLSFEGSGKDEPPKLSEHQINIFILEMFLAGTDTTSS  461
              +      + DFLDVL  FEG+GKDEP KLSE   NI         T+T+SS
Sbjct  269   KKIGGNDDRRDFLDVLPEFEGNGKDEPAKLSETNQNIH--------TETSSS  312


 Score =   140 bits (354),  Expect(2) = 2e-110, Method: Compositional matrix adjust.
 Identities = 67/114 (59%), Positives = 83/114 (73%), Gaps = 15/114 (13%)
 Frame = -1

Query  344  NTALTSSTVEWALTELLRNPKAMTKAKEEIRGIVGPTRRFEESDIDNLQYLQAVVKETLR  165
            +T  +SSTVEWALTELLR+P +M K + E+                 L YLQAVVK+TLR
Sbjct  306  HTETSSSTVEWALTELLRDPNSMAKVQAEL---------------SRLSYLQAVVKDTLR  350

Query  164  LHPPAPFLIPRRAIQDTKFMGYDIPKDTQVFINVWAIGRDHESWEDPLSFKPER  3
            LHPP PFL+PR+ + +T FMGYDIPK+TQVF+N WAIGRD + WEDP++FKPER
Sbjct  351  LHPPLPFLVPRKVMANTIFMGYDIPKNTQVFVNSWAIGRDPDVWEDPMAFKPER  404



>ref|XP_009757934.1| PREDICTED: cytochrome P450 76A2-like [Nicotiana sylvestris]
Length=506

 Score =   348 bits (894),  Expect = 3e-110, Method: Compositional matrix adjust.
 Identities = 158/272 (58%), Positives = 214/272 (79%), Gaps = 1/272 (0%)
 Frame = -2

Query  1273  NMLDLGSVPHQTIAAMRNKYGPVVWLRIG-SVSTLAIQSAKAAAELFKNHDVPFAGRSIG  1097
             NM +LGS+P++ +A ++ KYGP++WL+IG S++++ +Q+A+AAA+LFKNHD+ FA R   
Sbjct  46    NMFELGSLPYKKVAVLKQKYGPILWLKIGPSINSMVVQTAQAAADLFKNHDISFADRCTV  105

Query  1096  DVMLAQGYNKGSMALAQYGSYWRVLRRICSVEMFVHKKVNETAAVRRKCIDDLLRWVENE  917
             DV  A  Y +GSMAL QYGS+WR+ RRIC+VEMFV+KK+NET +VR KC++++++W+E E
Sbjct  106   DVNQAHNYYQGSMALGQYGSFWRLQRRICTVEMFVNKKINETVSVRGKCVNEMVKWIEKE  165

Query  916   AGSIKRGSGIHVTRFVFLATFNLLGNIMFSSDLVDPVSEKGSKFFNAMMGIMERGGTPNI  737
             A  +K+GSGI VTRFVFLA+FN+LGN++FS DL DP SE+ S FFNAM GIME  G PN+
Sbjct  166   ANVVKKGSGIEVTRFVFLASFNMLGNLIFSKDLADPESEEASDFFNAMKGIMEWSGVPNV  225

Query  736   SDIFPCLRWLDLQGLRTKTDKDLQIALQIVSTFVQKRSKEGQDDSGKRKSDFLDVLLSFE  557
             SDIFP LR  DLQ LR K  +D+  A++  S F+++R +E      KR  DFLDVLL FE
Sbjct  226   SDIFPSLRRFDLQSLRKKMTRDMGKAMEFGSAFLKEREEERIKGGQKRNKDFLDVLLEFE  285

Query  556   GSGKDEPPKLSEHQINIFILEMFLAGTDTTSS  461
             G+GKDEP KLS+H+I I ++EMFLAG++TTSS
Sbjct  286   GTGKDEPAKLSQHEIKILVMEMFLAGSETTSS  317


 Score =   181 bits (460),  Expect = 4e-47, Method: Compositional matrix adjust.
 Identities = 81/110 (74%), Positives = 95/110 (86%), Gaps = 0/110 (0%)
 Frame = -1

Query  332  TSSTVEWALTELLRNPKAMTKAKEEIRGIVGPTRRFEESDIDNLQYLQAVVKETLRLHPP  153
            TSS+VEWALTELLR+P+AM K K E+  +VGP ++FEESDIDNL Y+Q V+KE+LRLHPP
Sbjct  315  TSSSVEWALTELLRHPEAMAKVKAELSKVVGPNKKFEESDIDNLPYMQGVLKESLRLHPP  374

Query  152  APFLIPRRAIQDTKFMGYDIPKDTQVFINVWAIGRDHESWEDPLSFKPER  3
             PFLIPR  IQDTKF+GYDIPK TQV +NVWAIGRD E W+DP+SFKPER
Sbjct  375  LPFLIPRSTIQDTKFLGYDIPKGTQVLVNVWAIGRDPECWDDPMSFKPER  424



>gb|KDP20523.1| hypothetical protein JCGZ_05069 [Jatropha curcas]
Length=513

 Score =   264 bits (674),  Expect(2) = 6e-110, Method: Compositional matrix adjust.
 Identities = 123/274 (45%), Positives = 189/274 (69%), Gaps = 3/274 (1%)
 Frame = -2

Query  1273  NMLDLGSVPHQTIAAMRNKYGPVVWLRIGSVSTLAIQSAKAAAELFKNHDVPFAGRSIGD  1094
             N+ +LG+ PHQ +   R KYGP++WLR+GS++TL IQSAKAA ELFKNHD  F  R + +
Sbjct  48    NIFNLGTTPHQNLYKYRFKYGPILWLRLGSINTLVIQSAKAAEELFKNHDFSFCDRKVPE  107

Query  1093  VMLAQGYNKGSMALAQYGSYWRVLRRICSVEMFVHKKVNETAAVRRKCIDDLLRWVENEA  914
                A  YN+ S++L QYGS WR  RR+ +VE+  +K++N+T ++R+KC++++L+++E + 
Sbjct  108   CYTAHNYNQSSVSLGQYGSRWRFHRRLVTVELMTNKRINDTTSIRQKCVNNMLQFIEEDI  167

Query  913   GSIK-RGSG--IHVTRFVFLATFNLLGNIMFSSDLVDPVSEKGSKFFNAMMGIMERGGTP  743
              S + RG    + V R+VF+ +FNL+GN++ S DL++  S++G +FF+A+  +   G  P
Sbjct  168   SSAQARGESMEVEVARYVFIMSFNLIGNLVLSWDLLNSQSKEGPEFFDALNKVARMGAKP  227

Query  742   NISDIFPCLRWLDLQGLRTKTDKDLQIALQIVSTFVQKRSKEGQDDSGKRKSDFLDVLLS  563
             N++D+FP  +  D Q +++  +K+L   L+IV  FV+KR +E +    +   DFLDVLL 
Sbjct  228   NVADLFPFFKGSDPQRIKSNMEKELGQTLKIVEGFVRKRIEERKLVKERENKDFLDVLLE  287

Query  562   FEGSGKDEPPKLSEHQINIFILEMFLAGTDTTSS  461
             +EG GK+EP K+S   I I ILEMF  GT+TTSS
Sbjct  288   YEGVGKEEPDKISIQNIFIMILEMFFGGTETTSS  321


 Score =   163 bits (413),  Expect(2) = 6e-110, Method: Compositional matrix adjust.
 Identities = 76/114 (67%), Positives = 89/114 (78%), Gaps = 0/114 (0%)
 Frame = -1

Query  344  NTALTSSTVEWALTELLRNPKAMTKAKEEIRGIVGPTRRFEESDIDNLQYLQAVVKETLR  165
             T  TSSTVEWA+ EL R+P++M + KEE+  +VGP R+ EESDI  L YLQAV+KET+R
Sbjct  315  GTETTSSTVEWAMAELFRSPESMRRVKEELNRVVGPKRKVEESDIHGLPYLQAVIKETMR  374

Query  164  LHPPAPFLIPRRAIQDTKFMGYDIPKDTQVFINVWAIGRDHESWEDPLSFKPER  3
            LHP  P LIPR  + DT FMGY IPKDTQVF+NVWAI RD + WEDPLSFKPER
Sbjct  375  LHPIFPLLIPRNTLYDTNFMGYLIPKDTQVFVNVWAIARDPDVWEDPLSFKPER  428



>ref|XP_011019179.1| PREDICTED: cytochrome P450 76A2-like [Populus euphratica]
Length=508

 Score =   346 bits (888),  Expect = 2e-109, Method: Compositional matrix adjust.
 Identities = 161/271 (59%), Positives = 215/271 (79%), Gaps = 1/271 (0%)
 Frame = -2

Query  1273  NMLDLGSVPHQTIAAMRNKYGPVVWLRIGSVSTLAIQSAKAAAELFKNHDVPFAGRSIGD  1094
             N+ DLGS+PH+T+  MR KYG V+WLR+G+++T+ I SAKAA E FKNHD+ FA R+I +
Sbjct  47    NLFDLGSMPHRTLTGMRQKYGDVIWLRLGAMNTMVILSAKAATEFFKNHDLSFADRTITE  106

Query  1093  VMLAQGYNKGSMALAQYGSYWRVLRRICSVEMFVHKKVNETAAVRRKCIDDLLRWVENEA  914
              M A GY++GS+ALA YGSYWRVLRR+ +V+M V K++NETA+ RRKC+DD+L+W+E E+
Sbjct  107   TMRAHGYDQGSLALAPYGSYWRVLRRLVTVDMIVTKRINETASTRRKCVDDMLQWIEEES  166

Query  913   GSIKRGSGIHVTRFVFLATFNLLGNIMFSSDLVDPVSEKGSKFFNAMMGIMERGGTPNIS  734
               + + +GIHV+RFVFL TFN+LGN+M S DL+DP S+ GS+FF+AMMG+ME  G  N++
Sbjct  167   CKVGKAAGIHVSRFVFLMTFNMLGNLMLSRDLLDPESKVGSEFFDAMMGLMEWSGHANLA  226

Query  733   DIFPCLRWLDLQGLRTKTDKDLQIALQIVSTFVQKRSKEGQDDSGKRKSDFLDVLLSFEG  554
             D FP LR LDLQGLR   ++DL  A++I S FV++R ++ +  +  RK DFLDVLL F G
Sbjct  227   DFFPWLRRLDLQGLRKNMERDLGKAMEIASKFVKERVEDKKVTTDSRK-DFLDVLLEFRG  285

Query  553   SGKDEPPKLSEHQINIFILEMFLAGTDTTSS  461
             SGKDEP KLSE  +NIFILE+FLAG++TTSS
Sbjct  286   SGKDEPDKLSERDLNIFILEIFLAGSETTSS  316


 Score =   161 bits (408),  Expect = 5e-40, Method: Compositional matrix adjust.
 Identities = 73/110 (66%), Positives = 91/110 (83%), Gaps = 0/110 (0%)
 Frame = -1

Query  332  TSSTVEWALTELLRNPKAMTKAKEEIRGIVGPTRRFEESDIDNLQYLQAVVKETLRLHPP  153
            TSST+EWALTELL N ++M K K E+  +V  +++ EESD++NL +LQAVVKETLRLHPP
Sbjct  314  TSSTIEWALTELLCNQESMIKVKAELAQVVRASKKVEESDMENLPFLQAVVKETLRLHPP  373

Query  152  APFLIPRRAIQDTKFMGYDIPKDTQVFINVWAIGRDHESWEDPLSFKPER  3
             PFL+PRRA+QDT FMGYDIPK+TQV +N WAIGRD ++W+DP  F PER
Sbjct  374  IPFLVPRRAMQDTNFMGYDIPKNTQVLVNAWAIGRDPDAWDDPSCFMPER  423



>ref|XP_002309107.1| hypothetical protein POPTR_0006s09580g [Populus trichocarpa]
 gb|EEE92630.1| hypothetical protein POPTR_0006s09580g [Populus trichocarpa]
Length=508

 Score =   346 bits (887),  Expect = 3e-109, Method: Compositional matrix adjust.
 Identities = 162/271 (60%), Positives = 215/271 (79%), Gaps = 1/271 (0%)
 Frame = -2

Query  1273  NMLDLGSVPHQTIAAMRNKYGPVVWLRIGSVSTLAIQSAKAAAELFKNHDVPFAGRSIGD  1094
             N+ DLGS+PH+T+  MR KYG V+WLR+G+++T+ I SAKAA E FKNHD+ FA R+I +
Sbjct  47    NLFDLGSMPHRTLTDMRQKYGNVIWLRLGAMNTMVILSAKAATEFFKNHDLSFADRTITE  106

Query  1093  VMLAQGYNKGSMALAQYGSYWRVLRRICSVEMFVHKKVNETAAVRRKCIDDLLRWVENEA  914
              M A GY++GS+ALA YGSYWRVLRR+ +V+M V K++NETA++RRKC+DD+L+W+E E+
Sbjct  107   TMRAHGYDQGSLALAPYGSYWRVLRRLVTVDMIVTKRINETASIRRKCVDDMLQWIEEES  166

Query  913   GSIKRGSGIHVTRFVFLATFNLLGNIMFSSDLVDPVSEKGSKFFNAMMGIMERGGTPNIS  734
               + + +GIHV+RFVFL TFN+LGN+M S DL+DP S+ GS+FF+AMMG+ME  G  N++
Sbjct  167   CKVGKAAGIHVSRFVFLMTFNMLGNLMLSRDLLDPESKVGSEFFDAMMGLMEWSGHANLA  226

Query  733   DIFPCLRWLDLQGLRTKTDKDLQIALQIVSTFVQKRSKEGQDDSGKRKSDFLDVLLSFEG  554
             D FP LR LDLQGLR   ++DL  A++I S FV++R ++    S  RK DFLDVLL F G
Sbjct  227   DFFPWLRRLDLQGLRKNMERDLGKAMEIASKFVKERVEDKIVTSDSRK-DFLDVLLEFRG  285

Query  553   SGKDEPPKLSEHQINIFILEMFLAGTDTTSS  461
             SGKDEP KLSE  +NIFILE+FLAG++TTSS
Sbjct  286   SGKDEPDKLSERDVNIFILEIFLAGSETTSS  316


 Score =   165 bits (417),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 75/110 (68%), Positives = 92/110 (84%), Gaps = 0/110 (0%)
 Frame = -1

Query  332  TSSTVEWALTELLRNPKAMTKAKEEIRGIVGPTRRFEESDIDNLQYLQAVVKETLRLHPP  153
            TSSTVEWALTELL NP++M K K E+  +V  +++ EESD++NL +LQAVVKETLRLHPP
Sbjct  314  TSSTVEWALTELLCNPESMIKVKAELAQVVRASKKVEESDMENLPFLQAVVKETLRLHPP  373

Query  152  APFLIPRRAIQDTKFMGYDIPKDTQVFINVWAIGRDHESWEDPLSFKPER  3
             PFL+PRRA+QDT FMGYDIPK+TQV +N WAIGRD ++W+DP  F PER
Sbjct  374  IPFLVPRRAMQDTNFMGYDIPKNTQVLVNAWAIGRDPDAWDDPSCFMPER  423



>gb|KDP43102.1| hypothetical protein JCGZ_27051 [Jatropha curcas]
Length=512

 Score =   254 bits (650),  Expect(2) = 6e-107, Method: Compositional matrix adjust.
 Identities = 126/273 (46%), Positives = 184/273 (67%), Gaps = 4/273 (1%)
 Frame = -2

Query  1273  NMLDLGSVPHQTIAAMRNKYGPVVWLRIGSVSTLAIQSAKAAAELFKNHDVPFAGRSIGD  1094
             N+L LGS+PH+T+  +R KYGPV+WL +G  +TL IQSAKAA ELFKNHD+ F+ R + +
Sbjct  50    NILHLGSMPHRTLYNLRFKYGPVLWLSLGCSNTLVIQSAKAAEELFKNHDITFSDRKVPE  109

Query  1093  VMLAQGYNKGSMALAQYGSYWRVLRRICSVEMFVHKKVNETAAVRRKCIDDLLRWVENEA  914
                A  Y +GS+A  +YGSYW+ LRR  +VE+   KK+N++A +R+KCID ++ ++E + 
Sbjct  110   SWTAHNYYQGSLAFGRYGSYWQFLRRTVTVELMTSKKINDSALIRQKCIDKMIEYIEEDV  169

Query  913   GS--IKRGSG-IHVTRFVFLATFNLLGNIMFSSDLVDPVSEKGSKFFNAMMGIMERGGTP  743
              +   K  SG + V R+VF+  FNL+GN++ S DL++  S++G++FF+AM  +ME GG P
Sbjct  170   ATANAKGDSGEVVVARYVFVMAFNLIGNLVLSKDLLNAQSKEGTEFFDAMDKVMEWGGKP  229

Query  742   NISDIFPCLRWLDLQGLRTKTDKDLQIALQIVSTFVQKRSKEGQDDSGKRKSDFLDVLLS  563
             NI+D FP L+ LD Q ++      L   + IV  FV++R +E +      K D LD LL 
Sbjct  230   NIADFFPFLKGLDPQRVKKNMKVALGRTINIVDKFVKERVEEKKLMKENVKRDLLDALLE  289

Query  562   FEGSGKDEPPKLSEHQINIFILEMFLAGTDTTS  464
             +EG GK  P K+S H ++I ILE+F  GT+TTS
Sbjct  290   YEGDGKG-PDKISTHNMHIIILEIFFGGTETTS  321


 Score =   162 bits (410),  Expect(2) = 6e-107, Method: Compositional matrix adjust.
 Identities = 73/114 (64%), Positives = 91/114 (80%), Gaps = 1/114 (1%)
 Frame = -1

Query  344  NTALTSSTVEWALTELLRNPKAMTKAKEEIRGIVGPTRRFEESDIDNLQYLQAVVKETLR  165
             T  TS T+EWA++EL  NP++M K KEE+  ++G  R+ EESDID L YLQAVVKET+R
Sbjct  316  GTETTSGTIEWAMSELFSNPESMMKVKEELNQVIG-KRKVEESDIDELPYLQAVVKETMR  374

Query  164  LHPPAPFLIPRRAIQDTKFMGYDIPKDTQVFINVWAIGRDHESWEDPLSFKPER  3
            LHP  P L+PR  +QDT FMGY+IPKDTQVF+N W+IGRD ++WEDPLSFKPE+
Sbjct  375  LHPVIPLLVPRNTLQDTNFMGYEIPKDTQVFVNAWSIGRDPDAWEDPLSFKPEK  428



>ref|XP_006339108.1| PREDICTED: cytochrome P450 76A2-like [Solanum tuberosum]
Length=506

 Score =   339 bits (870),  Expect = 9e-107, Method: Compositional matrix adjust.
 Identities = 159/272 (58%), Positives = 212/272 (78%), Gaps = 2/272 (1%)
 Frame = -2

Query  1273  NMLDLGSVPHQTIAAMRNKYGPVVWLRIG-SVSTLAIQSAKAAAELFKNHDVPFAGRSIG  1097
             NM +LG+ P + ++ ++ KYGPV+WL++G S + + +Q+A+AAAELFKNHD+ FA R I 
Sbjct  47    NMFELGTEPFKKMSVLKQKYGPVLWLKLGTSTNIMVVQTAQAAAELFKNHDISFADRFIP  106

Query  1096  DVMLAQGYNKGSMALAQYGSYWRVLRRICSVEMFVHKKVNETAAVRRKCIDDLLRWVENE  917
             DV  A  Y +GS+ALA YG +WR  RRIC+VEMFVHKK++ET  VRRKC+D++L+W+E  
Sbjct  107   DVNQAHSYYQGSLALAPYGPFWRFQRRICTVEMFVHKKISETVPVRRKCVDNMLKWIEKA  166

Query  916   AGSIKRGSGIHVTRFVFLATFNLLGNIMFSSDLVDPVSEKGSKFFNAMMGIMERGGTPNI  737
             A S ++GSGI VTRFVFLA+FN+LGN++ S +L DP SE+ S+FFNAM GIME  G  N+
Sbjct  167   ANSAEKGSGIEVTRFVFLASFNMLGNLILSKNLADPESEEASEFFNAMKGIMEWSGITNV  226

Query  736   SDIFPCLRWLDLQGLRTKTDKDLQIALQIVSTFVQKRSKEGQDDSGKRKSDFLDVLLSFE  557
             SDIFP LR  DLQ LR K  +D+  A++I+S F+++R +E +    KRK DFLDVLL FE
Sbjct  227   SDIFPFLRKFDLQSLRKKMTRDMGKAIEIMSMFLKEREEERKKGMEKRK-DFLDVLLEFE  285

Query  556   GSGKDEPPKLSEHQINIFILEMFLAGTDTTSS  461
             G+GKDEP KLSEH+I IFILE+FLAG++TTS+
Sbjct  286   GTGKDEPAKLSEHEIKIFILEIFLAGSETTSN  317


 Score =   146 bits (368),  Expect = 8e-35, Method: Compositional matrix adjust.
 Identities = 77/110 (70%), Positives = 95/110 (86%), Gaps = 0/110 (0%)
 Frame = -1

Query  332  TSSTVEWALTELLRNPKAMTKAKEEIRGIVGPTRRFEESDIDNLQYLQAVVKETLRLHPP  153
            TS++VEWALTELLR+P+AM K K EI  ++GP R+FEESDI+NL Y+Q+V+KE+LRLHPP
Sbjct  315  TSNSVEWALTELLRHPEAMAKVKTEISKVIGPNRKFEESDIENLPYMQSVIKESLRLHPP  374

Query  152  APFLIPRRAIQDTKFMGYDIPKDTQVFINVWAIGRDHESWEDPLSFKPER  3
             PFL+PR  IQDTKFMGYD+PK T+V +N WAIGRD E W+DP+SFKPER
Sbjct  375  LPFLLPRETIQDTKFMGYDVPKGTRVLVNAWAIGRDPECWDDPMSFKPER  424



>gb|AJD20226.1| putative N-methylcoclaurine 3-hydroxylase [Podophyllum peltatum]
 gb|AJD20230.1| corytuberine synthase [Podophyllum peltatum]
Length=510

 Score =   256 bits (653),  Expect(2) = 1e-106, Method: Compositional matrix adjust.
 Identities = 118/274 (43%), Positives = 188/274 (69%), Gaps = 7/274 (3%)
 Frame = -2

Query  1273  NMLDLGSVPHQTIAAMRNKYGPVVWLRIGSVSTLAIQSAKAAAELFKNHDVPFAGRSIGD  1094
             NM DLGS P++ +A +  KYGPV+WLR+G  +T+ I S +AA E+FKNHD+ F  R+I +
Sbjct  50    NMFDLGSTPNEALANLSKKYGPVLWLRLGLQNTIVISSTEAAMEMFKNHDLTFVNRNITE  109

Query  1093  VMLAQGYNKGSMALAQYGSYWRVLRRICSVEMFVHKKVNETAAVRRKCIDDLLRWVENEA  914
              +    Y++G+++   YG YWR+LRRI + E+F + +++ +  +R+KC+D++++W+ NE 
Sbjct  110   ALRVHSYHQGAISTMNYGPYWRMLRRITTTELFSNNRIDNSENLRQKCVDNMIKWISNE-  168

Query  913   GSIKRGSGIHVTRFVFLATFNLLGNIMFSSDLVDPVSEKGSKFFNAMMGIMERGGTPNIS  734
              S+++G  + +  F+ L +FN++GN+M S DLVDP S + ++FF A   +++  G PN++
Sbjct  169   -SMEKGV-VEIAHFISLMSFNVIGNLMLSRDLVDPSSIRAAEFFTAAEKVVQCIGAPNMA  226

Query  733   DIFPCLRWLDLQGLRTKTDKDLQIALQIVSTFVQKR--SKEGQDDSGKRKSDFLDVLLSF  560
             D+FP LRWLD QG++ K  + L  ALQ+ + FV++R   +E + +    K D LDVLL F
Sbjct  227   DLFPFLRWLDPQGIKKKMKQSLGKALQVATGFVKERIAQRESKSEESNNK-DLLDVLLEF  285

Query  559   EGSGKD-EPPKLSEHQINIFILEMFLAGTDTTSS  461
             +G+ KD EP  +SE  INI +LE+F A TDT +S
Sbjct  286   QGNQKDGEPATISETNINILMLELFTAATDTITS  319


 Score =   159 bits (403),  Expect(2) = 1e-106, Method: Compositional matrix adjust.
 Identities = 71/113 (63%), Positives = 89/113 (79%), Gaps = 0/113 (0%)
 Frame = -1

Query  341  TALTSSTVEWALTELLRNPKAMTKAKEEIRGIVGPTRRFEESDIDNLQYLQAVVKETLRL  162
            T   +ST+EWA+TELLRNP  M K ++E+  IVG  ++ EE DI+ L +LQAVVKETLRL
Sbjct  314  TDTITSTMEWAITELLRNPSTMKKVEDELEHIVGKNKKVEEGDIEKLHFLQAVVKETLRL  373

Query  161  HPPAPFLIPRRAIQDTKFMGYDIPKDTQVFINVWAIGRDHESWEDPLSFKPER  3
            HPP P LIPRR+++D + MGY IPK+TQV +NVWA+GRD  SW+DPL FKPER
Sbjct  374  HPPVPLLIPRRSMEDRELMGYSIPKNTQVLVNVWAMGRDPSSWDDPLVFKPER  426



>gb|KDP27487.1| hypothetical protein JCGZ_20022 [Jatropha curcas]
Length=505

 Score =   337 bits (863),  Expect = 9e-106, Method: Compositional matrix adjust.
 Identities = 159/271 (59%), Positives = 213/271 (79%), Gaps = 2/271 (1%)
 Frame = -2

Query  1273  NMLDLGSVPHQTIAAMRNKYGPVVWLRIGSVSTLAIQSAKAAAELFKNHDVPFAGRSIGD  1094
             N+LDLG++PH+T+  +R KYG V+ LR+GSV+T+ I SAK A+ELFK HD+ FA R+I +
Sbjct  44    NLLDLGTMPHRTLTKLREKYGGVIGLRLGSVNTMVILSAKPASELFKYHDLSFAERNITE  103

Query  1093  VMLAQGYNKGSMALAQYGSYWRVLRRICSVEMFVHKKVNETAAVRRKCIDDLLRWVENEA  914
              M + GYN+GS+A+A YGSYWRVLRR+ +V+M V+K++NETA++RRKC+DD+LRW++ E 
Sbjct  104   TMRSHGYNEGSLAIAPYGSYWRVLRRLVTVDMLVNKRINETASIRRKCVDDMLRWIKEET  163

Query  913   GSIKRGSGIHVTRFVFLATFNLLGNIMFSSDLVDPVSEKGSKFFNAMMGIMERGGTPNIS  734
                    GIH+ RFVFL TFN LGN+MFS DLVDP S++GS+FF AMMG+ME  G  N++
Sbjct  164   YE-ANDHGIHLARFVFLMTFNSLGNLMFSKDLVDPESKEGSEFFTAMMGLMETSGYANVA  222

Query  733   DIFPCLRWLDLQGLRTKTDKDLQIALQIVSTFVQKRSKEGQDDSGKRKSDFLDVLLSFEG  554
             D FP LRWLD QGL+ + DK+L  AL+I S FV++R +E +   G R+ DFLDVLL FEG
Sbjct  223   DYFPWLRWLDPQGLKRRMDKELGKALEIASKFVKERIEE-KKVVGDRRKDFLDVLLEFEG  281

Query  553   SGKDEPPKLSEHQINIFILEMFLAGTDTTSS  461
             +GKDEP K+S+   NIFILE+F+AG++TTSS
Sbjct  282   NGKDEPAKISDRDTNIFILEIFMAGSETTSS  312


 Score =   171 bits (434),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 75/110 (68%), Positives = 94/110 (85%), Gaps = 0/110 (0%)
 Frame = -1

Query  332  TSSTVEWALTELLRNPKAMTKAKEEIRGIVGPTRRFEESDIDNLQYLQAVVKETLRLHPP  153
            TSST+EWA+TELL NP++MTKAK E+  ++GP R+ EE+DIDNL +LQA+VKETLRLHPP
Sbjct  310  TSSTIEWAMTELLCNPESMTKAKAELASVIGPNRKVEETDIDNLPFLQAIVKETLRLHPP  369

Query  152  APFLIPRRAIQDTKFMGYDIPKDTQVFINVWAIGRDHESWEDPLSFKPER  3
             PFL+PRRA+ +TKFMGY+IP +TQV +N WAIGRD   W++PL FKPER
Sbjct  370  IPFLVPRRAMHNTKFMGYEIPVNTQVLVNAWAIGRDPNVWDEPLCFKPER  419



>ref|XP_007027589.1| Cytochrome P450 76A2 [Theobroma cacao]
 gb|EOY08091.1| Cytochrome P450 76A2 [Theobroma cacao]
Length=598

 Score =   337 bits (865),  Expect = 8e-105, Method: Compositional matrix adjust.
 Identities = 158/274 (58%), Positives = 213/274 (78%), Gaps = 5/274 (2%)
 Frame = -2

Query  1273  NMLDLGSVPHQTIAAMRNKYGPVVWLRIGSVSTLAIQSAKAAAELFKNHDVPFAGRSIGD  1094
             NM DLG++PH+T+  +R+KYGPV+WLR+G+V+T+ + S KAA ELFKNHD+ FA R+I +
Sbjct  134   NMFDLGTMPHRTLTCLRDKYGPVIWLRLGTVNTMVLLSTKAATELFKNHDLSFAERNITE  193

Query  1093  VMLAQGYNKGSMALAQYGSYWRVLRRICSVEMFVHKKVNETAAVRRKCIDDLLRWVENEA  914
             +M A  Y+K S+ALA YGSYWRVLRR+ +V+M V+K++NET  +RRKC+DD+L W+E+EA
Sbjct  194   IMRAHDYHKSSLALAPYGSYWRVLRRLVTVDMLVNKRINETTCIRRKCVDDMLLWIEDEA  253

Query  913   GSIKRGS---GIHVTRFVFLATFNLLGNIMFSSDLVDPVSEKGSKFFNAMMGIMERGGTP  743
                +  S   GIHV RFVFL TFNLLGN+M S DL DP S++GS+ F  M+ +ME  G  
Sbjct  254   RKKQGDSHRDGIHVARFVFLLTFNLLGNLMLSRDLFDPDSKEGSELFMVMLRLMEWSGQG  313

Query  742   NISDIFPCLRWLDLQGLRTKTDKDLQIALQIVSTFVQKRSKEGQDDSGKRKSDFLDVLLS  563
             NI+D FP LRWLD QGL+ K +KDL  A++I S FV+++ +  Q   G+ K DFLD+L+ 
Sbjct  314   NIADFFPWLRWLDPQGLKRKMEKDLGKAIEIASKFVKEKLQ--QKKVGEDKRDFLDLLIE  371

Query  562   FEGSGKDEPPKLSEHQINIFILEMFLAGTDTTSS  461
             FEG+GKDEP KLS+H++NIFILE+FLAG++TTSS
Sbjct  372   FEGNGKDEPAKLSDHELNIFILEIFLAGSETTSS  405


 Score =   171 bits (434),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 78/110 (71%), Positives = 89/110 (81%), Gaps = 0/110 (0%)
 Frame = -1

Query  332  TSSTVEWALTELLRNPKAMTKAKEEIRGIVGPTRRFEESDIDNLQYLQAVVKETLRLHPP  153
            TSST+EWA  ELL NP AM KAK E+  +VGP ++ EE DI+NL YL AVVKET RLHPP
Sbjct  403  TSSTIEWAFAELLCNPDAMIKAKAELTRVVGPNKKVEERDIENLHYLHAVVKETFRLHPP  462

Query  152  APFLIPRRAIQDTKFMGYDIPKDTQVFINVWAIGRDHESWEDPLSFKPER  3
             PFLIPR+A+QDT FMGY IPK+TQVF+N WAIGRD E W+DPL FKPER
Sbjct  463  LPFLIPRKAMQDTNFMGYHIPKNTQVFVNAWAIGRDPEVWDDPLLFKPER  512


 Score = 90.5 bits (223),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 42/80 (53%), Positives = 56/80 (70%), Gaps = 1/80 (1%)
 Frame = -1

Query  344  NTALTSSTVEWALTELLRNPKAMTKAKEEIRGIVGPTRRFEESDIDNLQYLQAVVKETLR  165
             T  TS T+EWA+ ELL NP+ + K + E+R I  P+++ EE+DI+NL YLQAV+K TLR
Sbjct  5    GTDTTSGTLEWAMAELLHNPRTLEKVQAELRSI-NPSKKIEENDIENLPYLQAVIKGTLR  63

Query  164  LHPPAPFLIPRRAIQDTKFM  105
            LHPP PFL+P  A    K +
Sbjct  64   LHPPLPFLVPHNAKNSCKML  83



>ref|XP_002528650.1| cytochrome P450, putative [Ricinus communis]
 gb|EEF33753.1| cytochrome P450, putative [Ricinus communis]
Length=504

 Score =   251 bits (642),  Expect(2) = 2e-104, Method: Compositional matrix adjust.
 Identities = 121/273 (44%), Positives = 180/273 (66%), Gaps = 3/273 (1%)
 Frame = -2

Query  1273  NMLDLGSVPHQTIAAMRNKYGPVVWLRIGSVSTLAIQSAKAAAELFKNHDVPFAGRSIGD  1094
             N+ DLG  PHQ +  +R KYGPV+WLR+G ++TL IQS KAA ELFK HD+ F+ R +  
Sbjct  52    NIFDLGGNPHQNLYKLRFKYGPVLWLRLGCINTLVIQSTKAAEELFKRHDISFSDRKVPQ  111

Query  1093  VMLAQGYNKGSMALAQYGSYWRVLRRICSVEMFVHKKVNETAAVRRKCIDDLLRWVENEA  914
                A  +NK S+AL QY S+WR  RR  ++E+   K+V+ETAA+R+KCID+++R++E++A
Sbjct  112   SFTAHNFNKASLALGQYDSHWRFHRRFVTLELMTKKRVHETAAIRQKCIDNMIRYIEDDA  171

Query  913   GSIK-RGSG--IHVTRFVFLATFNLLGNIMFSSDLVDPVSEKGSKFFNAMMGIMERGGTP  743
              + + RG    + ++  VF+ +FNL+GN++ S DL++  SE+G+KFF+AM   ME GG P
Sbjct  172   SAARARGESGELVISHHVFVLSFNLIGNLVLSRDLLNSHSEEGTKFFDAMGKAMEWGGKP  231

Query  742   NISDIFPCLRWLDLQGLRTKTDKDLQIALQIVSTFVQKRSKEGQDDSGKRKSDFLDVLLS  563
             N++D  P L   D Q ++    + L   + IV  FV++  +E +    +   DFLD LL 
Sbjct  232   NLADFLPLLHPFDPQRVKKNMKQYLGQTIDIVERFVKQSIEEKKLMKERETRDFLDALLE  291

Query  562   FEGSGKDEPPKLSEHQINIFILEMFLAGTDTTS  464
             F+G  K+EP  +S H + I ILE+F  GT+TTS
Sbjct  292   FKGGAKEEPDAISTHDMLIIILEIFFGGTETTS  324


 Score =   157 bits (396),  Expect(2) = 2e-104, Method: Compositional matrix adjust.
 Identities = 71/114 (62%), Positives = 88/114 (77%), Gaps = 0/114 (0%)
 Frame = -1

Query  344  NTALTSSTVEWALTELLRNPKAMTKAKEEIRGIVGPTRRFEESDIDNLQYLQAVVKETLR  165
             T  TS T+EWA+TEL R+P++M + KEE+  ++GP ++  ESDID L YLQAV+KE +R
Sbjct  319  GTETTSGTLEWAMTELFRSPESMRRVKEELNQVIGPEKKVVESDIDQLPYLQAVIKEAMR  378

Query  164  LHPPAPFLIPRRAIQDTKFMGYDIPKDTQVFINVWAIGRDHESWEDPLSFKPER  3
            LHP  P LIPR   +DT FMGY I KDTQVF+N WAIGRD ++WEDPLSFKPER
Sbjct  379  LHPVVPLLIPRNTKEDTTFMGYFIRKDTQVFVNAWAIGRDPDAWEDPLSFKPER  432



>ref|XP_006339110.1| PREDICTED: cytochrome P450 76A2-like [Solanum tuberosum]
Length=541

 Score =   333 bits (855),  Expect = 5e-104, Method: Compositional matrix adjust.
 Identities = 156/272 (57%), Positives = 210/272 (77%), Gaps = 2/272 (1%)
 Frame = -2

Query  1273  NMLDLGSVPHQTIAAMRNKYGPVVWLRIG-SVSTLAIQSAKAAAELFKNHDVPFAGRSIG  1097
             NM +LG+ P++ +AA++ KYGPV+WL++G S + + +Q+A AAAELFKNHD  FA R I 
Sbjct  47    NMFELGTEPYKRMAALKQKYGPVLWLKLGTSTNIMVVQTAPAAAELFKNHDTSFADRFIP  106

Query  1096  DVMLAQGYNKGSMALAQYGSYWRVLRRICSVEMFVHKKVNETAAVRRKCIDDLLRWVENE  917
             DV  A  Y +GS+A+ +YGS+WR  RRIC+VEMFVHK+++ET  VRR+C+D++L+W+E E
Sbjct  107   DVNQAHSYYQGSLAIGRYGSFWRFQRRICTVEMFVHKRISETVPVRRRCVDNMLKWIEKE  166

Query  916   AGSIKRGSGIHVTRFVFLATFNLLGNIMFSSDLVDPVSEKGSKFFNAMMGIMERGGTPNI  737
             A S ++GSGI VTRFVFLA+FN+LGN++ S DL DP SE+ S FFNAM  IME  G  N+
Sbjct  167   ANSAEKGSGIEVTRFVFLASFNMLGNLILSKDLADPESEEASDFFNAMKRIMEWSGIANV  226

Query  736   SDIFPCLRWLDLQGLRTKTDKDLQIALQIVSTFVQKRSKEGQDDSGKRKSDFLDVLLSFE  557
             SDIFP LR  D Q LR K  +D+  A++I+S F+++R +E +  + K K DFLDVLL FE
Sbjct  227   SDIFPFLRKFDFQKLRKKMARDMGKAIEIMSMFLKEREEERKKGAEKGK-DFLDVLLEFE  285

Query  556   GSGKDEPPKLSEHQINIFILEMFLAGTDTTSS  461
             G+GKDEP KLSEH+I + I+EMFLAG++TTSS
Sbjct  286   GTGKDEPAKLSEHEIKVLIVEMFLAGSETTSS  317


 Score =   145 bits (367),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 79/110 (72%), Positives = 94/110 (85%), Gaps = 0/110 (0%)
 Frame = -1

Query  332  TSSTVEWALTELLRNPKAMTKAKEEIRGIVGPTRRFEESDIDNLQYLQAVVKETLRLHPP  153
            TSS+VEWALTELLR+P+AM K K EI  ++GP  +FEESDI+NL Y+QAV+KE+LRLHPP
Sbjct  315  TSSSVEWALTELLRHPEAMDKVKTEISKVIGPNSKFEESDIENLPYMQAVIKESLRLHPP  374

Query  152  APFLIPRRAIQDTKFMGYDIPKDTQVFINVWAIGRDHESWEDPLSFKPER  3
             PFL+PR  IQDTKFMGYDIPK T+V +N WAIGRD E W+DP+SFKPER
Sbjct  375  LPFLLPRETIQDTKFMGYDIPKGTRVLVNTWAIGRDPECWDDPMSFKPER  424



>ref|XP_008392600.1| PREDICTED: cytochrome P450 76A2-like [Malus domestica]
Length=513

 Score =   332 bits (851),  Expect = 9e-104, Method: Compositional matrix adjust.
 Identities = 152/271 (56%), Positives = 209/271 (77%), Gaps = 1/271 (0%)
 Frame = -2

Query  1273  NMLDLGSVPHQTIAAMRNKYGPVVWLRIGSVSTLAIQSAKAAAELFKNHDVPFAGRSIGD  1094
             NM DLG++PH+T+  + +K+GPV+WL +G  +T+++QSAKAAAE FKNHD+ F  R++ +
Sbjct  52    NMFDLGTMPHRTLTDLGHKFGPVIWLTLGVRNTMSVQSAKAAAEFFKNHDLSFVERTVNE  111

Query  1093  VMLAQGYNKGSMALAQYGSYWRVLRRICSVEMFVHKKVNETAAVRRKCIDDLLRWVENEA  914
                   Y+KGS+A+A YG++WRV+RR+ +VEM V+K++NETA +RRKCID++  W+E EA
Sbjct  112   NARVHDYHKGSLAMAPYGTHWRVMRRLVTVEMVVNKRINETAFIRRKCIDNMQLWIEEEA  171

Query  913   GSIKRGSGIHVTRFVFLATFNLLGNIMFSSDLVDPVSEKGSKFFNAMMGIMERGGTPNIS  734
               +K G G+HV RFVFL TFNLLGN+M S DLVDP SE+G +FF AM G+ME  G+ N+ 
Sbjct  172   SKVKEGRGVHVARFVFLMTFNLLGNLMLSRDLVDPNSEEGMEFFKAMNGLMEWNGSGNVV  231

Query  733   DIFPCLRWLDLQGLRTKTDKDLQIALQIVSTFVQKRSKEGQDDSGKRKSDFLDVLLSFEG  554
             D FP LRWLD QGL+ K  +DL  A+QI S FV+ R +E ++  G++  DFLDVLL FEG
Sbjct  232   DFFPWLRWLDPQGLKRKMKRDLGKAIQIASKFVKXRIQE-REVGGEKTKDFLDVLLEFEG  290

Query  553   SGKDEPPKLSEHQINIFILEMFLAGTDTTSS  461
             +G DEP K+S+H +NIFILE+F+AG++TTSS
Sbjct  291   NGIDEPAKISDHDLNIFILEIFMAGSETTSS  321


 Score =   160 bits (405),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 73/111 (66%), Positives = 90/111 (81%), Gaps = 1/111 (1%)
 Frame = -1

Query  332  TSSTVEWALTELLRNPKAMTKAKEEIRGIVGPTRRFEESDIDNLQYLQAVVKETLRLHPP  153
            TSST EWALTELL NP  + +AK E+  ++GP+R+ EESDIDNL YLQ ++KETLRLHPP
Sbjct  319  TSSTTEWALTELLCNPATLVEAKAELNRVIGPSRKIEESDIDNLPYLQGIIKETLRLHPP  378

Query  152  APFLIPRRAIQDTKFMGYDIPKDTQVFINVWAIGRDHESWED-PLSFKPER  3
             PFL+PR+A+ DT FMGY +PKDTQVF+N +AIGRD ++W D P  FKPER
Sbjct  379  IPFLVPRKAMHDTSFMGYFVPKDTQVFVNAYAIGRDPDAWRDEPTLFKPER  429



>ref|XP_002528654.1| cytochrome P450, putative [Ricinus communis]
 gb|EEF33757.1| cytochrome P450, putative [Ricinus communis]
Length=514

 Score =   247 bits (631),  Expect(2) = 1e-103, Method: Compositional matrix adjust.
 Identities = 116/273 (42%), Positives = 185/273 (68%), Gaps = 3/273 (1%)
 Frame = -2

Query  1273  NMLDLGSVPHQTIAAMRNKYGPVVWLRIGSVSTLAIQSAKAAAELFKNHDVPFAGRSIGD  1094
             N+ DLG+ PHQ +  +  KYGPV+WLR+G ++T+ IQSAKAA ELF++HD+ F  R +  
Sbjct  49    NIFDLGANPHQNLYKLGIKYGPVLWLRLGYINTMVIQSAKAAEELFRHHDISFCDRKVPQ  108

Query  1093  VMLAQGYNKGSMALAQYGSYWRVLRRICSVEMFVHKKVNETAAVRRKCIDDLLRWVENEA  914
                A  Y+K ++AL +Y S+WR  RR  ++E+  +K++NETA +R+KCID +++++E +A
Sbjct  109   SFTACNYSKAALALGRYDSHWRFHRRFVTLELMTNKRINETAVLRQKCIDKMIQYIEEDA  168

Query  913   GSIK-RGSG--IHVTRFVFLATFNLLGNIMFSSDLVDPVSEKGSKFFNAMMGIMERGGTP  743
              + + RG    + ++ +VF+ +FNL+GN+ FS DL++  SE+G++FF+AM  +ME GG P
Sbjct  169   SAARARGESGELVISHYVFVMSFNLIGNLAFSRDLLNSHSEEGTEFFDAMDKVMEWGGKP  228

Query  742   NISDIFPCLRWLDLQGLRTKTDKDLQIALQIVSTFVQKRSKEGQDDSGKRKSDFLDVLLS  563
             N++D  P L+ LD Q ++   ++ L   + +V  FV++R +E +    +   DFLD LL 
Sbjct  229   NLADFLPFLQELDPQRVKKNMEQYLGRTVDVVERFVKERIEEKKLMKERETRDFLDALLE  288

Query  562   FEGSGKDEPPKLSEHQINIFILEMFLAGTDTTS  464
             F+G  K+EP  +S H + I ILE+F  GT+TTS
Sbjct  289   FKGDAKEEPDSISIHSMLIIILEIFFGGTETTS  321


 Score =   159 bits (401),  Expect(2) = 1e-103, Method: Compositional matrix adjust.
 Identities = 72/114 (63%), Positives = 86/114 (75%), Gaps = 0/114 (0%)
 Frame = -1

Query  344  NTALTSSTVEWALTELLRNPKAMTKAKEEIRGIVGPTRRFEESDIDNLQYLQAVVKETLR  165
             T  TS T+EWA+ EL R+P+ M + KEE+  ++GP R   ESDID L YLQAV+KE +R
Sbjct  316  GTETTSGTLEWAMAELFRSPETMRRVKEELNKVIGPNRTVMESDIDRLPYLQAVIKEAMR  375

Query  164  LHPPAPFLIPRRAIQDTKFMGYDIPKDTQVFINVWAIGRDHESWEDPLSFKPER  3
            LHP  P LIPR   +DT FMGY IPKDTQVF+N WAIGRD ++WEDPLSFKPER
Sbjct  376  LHPVLPLLIPRNTTEDTTFMGYFIPKDTQVFVNAWAIGRDPDAWEDPLSFKPER  429



>ref|XP_009350795.1| PREDICTED: cytochrome P450 76A2-like [Pyrus x bretschneideri]
 ref|XP_009350796.1| PREDICTED: cytochrome P450 76A2-like [Pyrus x bretschneideri]
Length=513

 Score =   331 bits (848),  Expect = 2e-103, Method: Compositional matrix adjust.
 Identities = 152/271 (56%), Positives = 210/271 (77%), Gaps = 1/271 (0%)
 Frame = -2

Query  1273  NMLDLGSVPHQTIAAMRNKYGPVVWLRIGSVSTLAIQSAKAAAELFKNHDVPFAGRSIGD  1094
             NM DLG++PH+T+  + +K+GPV+WL +G  +T+++QSAKAAAE FKNHD+ F  R++ +
Sbjct  52    NMFDLGTMPHRTLTDLGHKFGPVIWLTLGVRNTMSVQSAKAAAEFFKNHDLSFVERTVNE  111

Query  1093  VMLAQGYNKGSMALAQYGSYWRVLRRICSVEMFVHKKVNETAAVRRKCIDDLLRWVENEA  914
                   Y+KGS+A+A YG++WRV+RR+ +VEM V+K++NETA +RRKCID++  W+E EA
Sbjct  112   NARVHDYHKGSLAMAPYGTHWRVMRRLVTVEMVVNKRINETAFIRRKCIDNMQLWIEEEA  171

Query  913   GSIKRGSGIHVTRFVFLATFNLLGNIMFSSDLVDPVSEKGSKFFNAMMGIMERGGTPNIS  734
               +K G G+HV RFVFL TFNLLGN+M S DLVDP SE+G +FF AM G+M+  G+ N+ 
Sbjct  172   SKVKEGRGVHVARFVFLMTFNLLGNLMLSRDLVDPNSEEGMEFFKAMNGLMKWNGSGNVV  231

Query  733   DIFPCLRWLDLQGLRTKTDKDLQIALQIVSTFVQKRSKEGQDDSGKRKSDFLDVLLSFEG  554
             D FP LRWLD QGL+ K  +DL  A+QI S FV++R +E ++  G++  DFLDVLL FEG
Sbjct  232   DFFPWLRWLDPQGLKRKMKRDLGKAIQIASKFVKERFQE-RELGGEKTKDFLDVLLEFEG  290

Query  553   SGKDEPPKLSEHQINIFILEMFLAGTDTTSS  461
             +G DEP K+S+H +NIFILE+FLAG++TTSS
Sbjct  291   NGIDEPAKISDHDLNIFILEIFLAGSETTSS  321


 Score =   159 bits (402),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 73/111 (66%), Positives = 89/111 (80%), Gaps = 1/111 (1%)
 Frame = -1

Query  332  TSSTVEWALTELLRNPKAMTKAKEEIRGIVGPTRRFEESDIDNLQYLQAVVKETLRLHPP  153
            TSST EWALTELL NP  + +AK E+  ++GP+R+ EESDIDNL YLQ ++KETLRLHPP
Sbjct  319  TSSTTEWALTELLCNPATLVEAKAELNRVIGPSRKIEESDIDNLPYLQGIIKETLRLHPP  378

Query  152  APFLIPRRAIQDTKFMGYDIPKDTQVFINVWAIGRDHESWED-PLSFKPER  3
             PFL+PR+A+ DT FMGY +PKDTQVF+N +AIGRD + W D P  FKPER
Sbjct  379  IPFLVPRKAMHDTSFMGYFVPKDTQVFVNAYAIGRDPDVWCDEPTLFKPER  429



>ref|XP_007203742.1| hypothetical protein PRUPE_ppa018268mg [Prunus persica]
 gb|EMJ04941.1| hypothetical protein PRUPE_ppa018268mg [Prunus persica]
Length=509

 Score =   330 bits (846),  Expect = 3e-103, Method: Compositional matrix adjust.
 Identities = 154/271 (57%), Positives = 208/271 (77%), Gaps = 1/271 (0%)
 Frame = -2

Query  1273  NMLDLGSVPHQTIAAMRNKYGPVVWLRIGSVSTLAIQSAKAAAELFKNHDVPFAGRSIGD  1094
             NM DLG++PH+T+  + +K+GPV+WLR+G+ +T+ IQSAKAAA+LFK+HD+ FAGR+  +
Sbjct  48    NMFDLGTMPHKTLTDLTHKFGPVIWLRLGARNTMVIQSAKAAADLFKHHDMSFAGRTTTE  107

Query  1093  VMLAQGYNKGSMALAQYGSYWRVLRRICSVEMFVHKKVNETAAVRRKCIDDLLRWVENEA  914
                   Y+KGS+ALA YG++WR+LRR+ +VEM V+K++NET  +RRKC+D+L  W+E EA
Sbjct  108   ASRVLDYHKGSLALAPYGAHWRMLRRLMTVEMLVNKRINETTFIRRKCLDNLQLWIEEEA  167

Query  913   GSIKRGSGIHVTRFVFLATFNLLGNIMFSSDLVDPVSEKGSKFFNAMMGIMERGGTPNIS  734
               ++ G G+HV RFVFL +FNLLGN+M S DLVDP S +G +FF+AM G+ME  G  N++
Sbjct  168   SKLEEGHGVHVARFVFLMSFNLLGNLMLSRDLVDPNSREGLEFFSAMAGLMEWNGHANMA  227

Query  733   DIFPCLRWLDLQGLRTKTDKDLQIALQIVSTFVQKRSKEGQDDSGKRKSDFLDVLLSFEG  554
             D FP LRWLD QGL+ K  +DL  AL+I S FV++R +E Q   G R  DFLDVLL FEG
Sbjct  228   DFFPWLRWLDPQGLKRKMKRDLGKALEIASKFVEERMEEKQ-VGGVRARDFLDVLLEFEG  286

Query  553   SGKDEPPKLSEHQINIFILEMFLAGTDTTSS  461
             +G DEP K+S   +NIFILE+FLAG++TTSS
Sbjct  287   NGIDEPAKISHRDVNIFILEIFLAGSETTSS  317


 Score =   156 bits (395),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 73/111 (66%), Positives = 92/111 (83%), Gaps = 1/111 (1%)
 Frame = -1

Query  332  TSSTVEWALTELLRNPKAMTKAKEEIRGIVGPTRRFEESDIDNLQYLQAVVKETLRLHPP  153
            TSST+EWALTELL NP+ +TKAK E+  ++GP R+ EE+DI+ L YLQ ++KETLRLHPP
Sbjct  315  TSSTIEWALTELLCNPETLTKAKAELTQVIGPNRKVEETDIEKLPYLQGIIKETLRLHPP  374

Query  152  APFLIPRRAIQDTKFMGYDIPKDTQVFINVWAIGRDHESWED-PLSFKPER  3
             PFLIPR+A++ TKFMGY IPK+TQVF+N +AIGRD + W D P +FKPER
Sbjct  375  IPFLIPRKAMEYTKFMGYFIPKNTQVFVNAYAIGRDPDVWVDEPNAFKPER  425



>ref|XP_008241319.1| PREDICTED: cytochrome P450 76A2-like [Prunus mume]
Length=509

 Score =   330 bits (846),  Expect = 3e-103, Method: Compositional matrix adjust.
 Identities = 154/271 (57%), Positives = 208/271 (77%), Gaps = 1/271 (0%)
 Frame = -2

Query  1273  NMLDLGSVPHQTIAAMRNKYGPVVWLRIGSVSTLAIQSAKAAAELFKNHDVPFAGRSIGD  1094
             NM DLG++PHQT+  + +K+GPV+WLR+G+ +T+ IQSAKAAA+LFK+HD+ FAGR+  +
Sbjct  48    NMFDLGTMPHQTLTELTHKFGPVIWLRLGARNTMVIQSAKAAADLFKHHDMSFAGRTTTE  107

Query  1093  VMLAQGYNKGSMALAQYGSYWRVLRRICSVEMFVHKKVNETAAVRRKCIDDLLRWVENEA  914
                   Y+KGS+ALA YG++WR+LRR+ +VEM V+K++NETA +R+KC+D+L  W+E EA
Sbjct  108   ASRVLDYHKGSLALAPYGAHWRMLRRLVTVEMLVNKRINETAFIRKKCLDNLQLWIEEEA  167

Query  913   GSIKRGSGIHVTRFVFLATFNLLGNIMFSSDLVDPVSEKGSKFFNAMMGIMERGGTPNIS  734
               ++ G G+H+ RFVFL +FNLLGN+M S DLVDP S +G +FF+AM G+ME  G  N++
Sbjct  168   SKLEEGHGVHMARFVFLMSFNLLGNLMLSRDLVDPNSREGLEFFSAMAGLMEWNGHANMA  227

Query  733   DIFPCLRWLDLQGLRTKTDKDLQIALQIVSTFVQKRSKEGQDDSGKRKSDFLDVLLSFEG  554
             D FP LRWLD QGL+ K  +DL  AL+I S FV +R +E Q   G R  DFLDVLL FEG
Sbjct  228   DFFPWLRWLDPQGLKRKMKRDLGKALEIASKFVGERMEEKQ-VGGVRARDFLDVLLEFEG  286

Query  553   SGKDEPPKLSEHQINIFILEMFLAGTDTTSS  461
             +G DEP K+S   +NIFILE+FLAG++TTSS
Sbjct  287   NGIDEPAKISHRDVNIFILEIFLAGSETTSS  317


 Score =   154 bits (390),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 72/111 (65%), Positives = 91/111 (82%), Gaps = 1/111 (1%)
 Frame = -1

Query  332  TSSTVEWALTELLRNPKAMTKAKEEIRGIVGPTRRFEESDIDNLQYLQAVVKETLRLHPP  153
            TSST+EWALTELL NP+ +TKAK E+  ++GP R+ EE+DI+ L YLQ ++KETLRLHPP
Sbjct  315  TSSTIEWALTELLCNPETLTKAKAELTQVIGPNRKVEETDIEKLPYLQGIIKETLRLHPP  374

Query  152  APFLIPRRAIQDTKFMGYDIPKDTQVFINVWAIGRDHESWED-PLSFKPER  3
             PFLIPR+A++DTKF  Y IPK+TQVF+N +AIGRD + W D P +FKPER
Sbjct  375  IPFLIPRKAMEDTKFTNYFIPKNTQVFVNTYAIGRDPDVWVDEPNAFKPER  425



>ref|XP_009334561.1| PREDICTED: cytochrome P450 76A2-like [Pyrus x bretschneideri]
 ref|XP_009342774.1| PREDICTED: cytochrome P450 76A2-like [Pyrus x bretschneideri]
Length=513

 Score =   330 bits (847),  Expect = 3e-103, Method: Compositional matrix adjust.
 Identities = 151/271 (56%), Positives = 210/271 (77%), Gaps = 1/271 (0%)
 Frame = -2

Query  1273  NMLDLGSVPHQTIAAMRNKYGPVVWLRIGSVSTLAIQSAKAAAELFKNHDVPFAGRSIGD  1094
             NM DLG++PH+T+  + +K+GPV+WL +G  +T+++QSAKAAAE FKNHD+ F  R++ +
Sbjct  52    NMFDLGTMPHRTLTDLGHKFGPVIWLTLGVRNTMSVQSAKAAAEFFKNHDLSFVERTVNE  111

Query  1093  VMLAQGYNKGSMALAQYGSYWRVLRRICSVEMFVHKKVNETAAVRRKCIDDLLRWVENEA  914
                   Y+KGS+A+A YG++WRV+RR+ +VEM V+K++NETA +RRKCID++  W+E EA
Sbjct  112   NARVHDYHKGSLAMAPYGTHWRVMRRLVTVEMVVNKRINETAFIRRKCIDNMQLWIEEEA  171

Query  913   GSIKRGSGIHVTRFVFLATFNLLGNIMFSSDLVDPVSEKGSKFFNAMMGIMERGGTPNIS  734
               +K G G+HV RFVFL TFNLLGN+M S DLVDP SE+G +FF AM G+M+  G+ N+ 
Sbjct  172   SKVKEGRGVHVARFVFLMTFNLLGNLMLSRDLVDPNSEEGMEFFKAMNGLMKWNGSGNVV  231

Query  733   DIFPCLRWLDLQGLRTKTDKDLQIALQIVSTFVQKRSKEGQDDSGKRKSDFLDVLLSFEG  554
             D FP LRWLD QGL+ K  +DL  A+QI S FV++R +E ++  G++  DFLDVLL FEG
Sbjct  232   DFFPWLRWLDPQGLKRKMKRDLGKAIQIASKFVKERFQE-RELGGEKTKDFLDVLLEFEG  290

Query  553   SGKDEPPKLSEHQINIFILEMFLAGTDTTSS  461
             +G DEP K+S+H +NIFILE+F+AG++TTSS
Sbjct  291   NGIDEPAKISDHDLNIFILEIFMAGSETTSS  321


 Score =   159 bits (402),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 73/111 (66%), Positives = 89/111 (80%), Gaps = 1/111 (1%)
 Frame = -1

Query  332  TSSTVEWALTELLRNPKAMTKAKEEIRGIVGPTRRFEESDIDNLQYLQAVVKETLRLHPP  153
            TSST EWALTELL NP  + +AK E+  ++GP+R+ EESDIDNL YLQ ++KETLRLHPP
Sbjct  319  TSSTTEWALTELLCNPATLVEAKAELNRVIGPSRKIEESDIDNLPYLQGIIKETLRLHPP  378

Query  152  APFLIPRRAIQDTKFMGYDIPKDTQVFINVWAIGRDHESWED-PLSFKPER  3
             PFL+PR+A+ DT FMGY +PKDTQVF+N +AIGRD + W D P  FKPER
Sbjct  379  IPFLVPRKAMHDTSFMGYFVPKDTQVFVNAYAIGRDPDVWCDEPTLFKPER  429



>ref|XP_006339109.1| PREDICTED: cytochrome P450 76A2-like [Solanum tuberosum]
Length=505

 Score =   329 bits (843),  Expect = 1e-102, Method: Compositional matrix adjust.
 Identities = 154/272 (57%), Positives = 207/272 (76%), Gaps = 2/272 (1%)
 Frame = -2

Query  1273  NMLDLGSVPHQTIAAMRNKYGPVVWLRIG-SVSTLAIQSAKAAAELFKNHDVPFAGRSIG  1097
             NM +LG  P++ ++ ++ KYGPV+ L++G S + + +Q+A AAAELFKNHD  FA R + 
Sbjct  47    NMFELGKEPYKKMSVLQQKYGPVLGLKLGPSTNIMVVQTAHAAAELFKNHDTSFADRPMV  106

Query  1096  DVMLAQGYNKGSMALAQYGSYWRVLRRICSVEMFVHKKVNETAAVRRKCIDDLLRWVENE  917
             DV LA  Y +GS+A+ +YGS+WR  RRIC+VEMFVHKK++ET  +RRKC+D++L+W+E  
Sbjct  107   DVNLAHNYYQGSLAIGRYGSFWRFQRRICTVEMFVHKKISETVPIRRKCVDNMLKWIEKA  166

Query  916   AGSIKRGSGIHVTRFVFLATFNLLGNIMFSSDLVDPVSEKGSKFFNAMMGIMERGGTPNI  737
               S ++GSGI VTRFVFLA+FN+LGN++ S DL DP SE+ S FFNAM GIME  G  N+
Sbjct  167   GSSAEKGSGIEVTRFVFLASFNMLGNLVLSKDLADPESEEASDFFNAMKGIMEWSGIANV  226

Query  736   SDIFPCLRWLDLQGLRTKTDKDLQIALQIVSTFVQKRSKEGQDDSGKRKSDFLDVLLSFE  557
             SDIFP LR  DLQ LR K  +D+  A++I+S  +++R +E +    KRK DFLDVLL FE
Sbjct  227   SDIFPLLRKFDLQKLRKKMTRDMGKAMEIMSMLLKEREEERKKGMEKRK-DFLDVLLEFE  285

Query  556   GSGKDEPPKLSEHQINIFILEMFLAGTDTTSS  461
             G+GKDEP KLSEH+I + I+EMFLAG++TTSS
Sbjct  286   GTGKDEPAKLSEHEIKVLIVEMFLAGSETTSS  317


 Score =   175 bits (444),  Expect = 6e-45, Method: Compositional matrix adjust.
 Identities = 81/110 (74%), Positives = 95/110 (86%), Gaps = 1/110 (1%)
 Frame = -1

Query  332  TSSTVEWALTELLRNPKAMTKAKEEIRGIVGPTRRFEESDIDNLQYLQAVVKETLRLHPP  153
            TSS+VEWALTELLR+P+AM K K EI  +VG ++ FEESDI+NL Y+QAV+KE+LRLHPP
Sbjct  315  TSSSVEWALTELLRHPEAMAKVKTEISKVVGLSK-FEESDIENLPYMQAVIKESLRLHPP  373

Query  152  APFLIPRRAIQDTKFMGYDIPKDTQVFINVWAIGRDHESWEDPLSFKPER  3
             PFLIPR+ IQDTKFMGYDIPK TQV +N WAIGRD E W+DP+SFKPER
Sbjct  374  LPFLIPRKTIQDTKFMGYDIPKGTQVLVNAWAIGRDPECWDDPMSFKPER  423



>ref|XP_010036736.1| PREDICTED: cytochrome P450 76A1-like [Eucalyptus grandis]
 gb|KCW48374.1| hypothetical protein EUGRSUZ_K02083 [Eucalyptus grandis]
Length=510

 Score =   328 bits (840),  Expect = 3e-102, Method: Compositional matrix adjust.
 Identities = 169/292 (58%), Positives = 219/292 (75%), Gaps = 2/292 (1%)
 Frame = -2

Query  1330  NKSRSGRlppgppglpvlGNMLDLGSVPHQTIAAMRNKYGPVVWLRIGSVSTLAIQSAKA  1151
              KSRS RLPPGPPG P+ GNM +LG +PH+T+A +R KYGPV+WLR+GS+ T+ I S++ 
Sbjct  28    KKSRSCRLPPGPPGWPIFGNMFNLGMMPHRTLAGLRQKYGPVIWLRLGSIDTMVILSSRV  87

Query  1150  AAELFKNHDVPFAGRSIGDVMLAQGYNKGSMALAQYGSYWRVLRRICSVEMFVHKKVNET  971
             A E FKN D+ FA R++ D+M +  Y++GS+ALA YGSYWR+ RR+ +V+M V K++NET
Sbjct  88    ATEFFKNQDLNFAERTVTDLMRSHDYHEGSVALAPYGSYWRMSRRLLTVDMLVAKRLNET  147

Query  970   AAVRRKCIDDLLRWVENEAGS--IKRGSGIHVTRFVFLATFNLLGNIMFSSDLVDPVSEK  797
             A +RRKCID +L W+   A +  ++ G GIH+ RFVFL TFNLLGN+M S DL DP S+ 
Sbjct  148   APIRRKCIDKMLTWIGEAASAEKVRLGEGIHLARFVFLTTFNLLGNLMLSRDLFDPDSKV  207

Query  796   GSKFFNAMMGIMERGGTPNISDIFPCLRWLDLQGLRTKTDKDLQIALQIVSTFVQKRSKE  617
             GS FF AM G+ME  G  NI+D+FP LRWLD QGLR K D+D+  A++I S FV++R +E
Sbjct  208   GSDFFVAMAGLMEWTGHANIADLFPWLRWLDPQGLRRKMDRDMGKAMRIASDFVRERIEE  267

Query  616   GQDDSGKRKSDFLDVLLSFEGSGKDEPPKLSEHQINIFILEMFLAGTDTTSS  461
              +      + DFLDVLL FEG+GKDEP KLSE QIN FILE+FLAG +TTSS
Sbjct  268   RKIGREDDRRDFLDVLLEFEGNGKDEPAKLSEKQINTFILEIFLAGAETTSS  319


 Score =   167 bits (422),  Expect = 6e-42, Method: Compositional matrix adjust.
 Identities = 75/110 (68%), Positives = 91/110 (83%), Gaps = 0/110 (0%)
 Frame = -1

Query  332  TSSTVEWALTELLRNPKAMTKAKEEIRGIVGPTRRFEESDIDNLQYLQAVVKETLRLHPP  153
            TSST+EWA+TELL NP++M K K E+  +VG  R+ +E+DID L YLQAVVKET RLHPP
Sbjct  317  TSSTIEWAITELLLNPESMVKVKSELSQVVGSARKVQEADIDQLPYLQAVVKETFRLHPP  376

Query  152  APFLIPRRAIQDTKFMGYDIPKDTQVFINVWAIGRDHESWEDPLSFKPER  3
             PFL+PRRA++DT FMGYDIPK+TQVF+N WAIGRD + W DP+ FKPER
Sbjct  377  IPFLVPRRAMRDTVFMGYDIPKNTQVFVNTWAIGRDPDVWMDPMVFKPER  426



>ref|XP_002277725.1| PREDICTED: cytochrome P450 76A1 [Vitis vinifera]
Length=508

 Score =   327 bits (839),  Expect = 3e-102, Method: Compositional matrix adjust.
 Identities = 154/272 (57%), Positives = 208/272 (76%), Gaps = 2/272 (1%)
 Frame = -2

Query  1273  NMLDLGSVPHQTIAAMRNKYGPVVWLRIGSVSTLAIQSAKAAAELFKNHDVPFAGRSIGD  1094
             NM DLG++PH+T+A +R+KYG VVWL +G++ T  +QS+KAAAELFKN D+ F+ R+I +
Sbjct  46    NMFDLGAMPHETLAGLRHKYGDVVWLNLGAIKTTVVQSSKAAAELFKNQDLCFSDRTITE  105

Query  1093  VMLAQGYNKGSMALAQYGSYWRVLRRICSVEMFVHKKVNETAAVRRKCIDDLLRWVENEA  914
              M AQGY++ S+ALA YG +WR LRR+ ++EM V K++NETA VRRKC+DD+L W+E EA
Sbjct  106   TMRAQGYHESSLALAPYGPHWRSLRRLMTMEMLVTKRINETAGVRRKCVDDMLSWIEEEA  165

Query  913   -GSIKRGSGIHVTRFVFLATFNLLGNIMFSSDLVDPVSEKGSKFFNAMMGIMERGGTPNI  737
              G    G GI V  FVFLA+FN+LGN+M S DL+ P S++GS+FF  M+ +ME  G PN 
Sbjct  166   RGVGGEGRGIQVAHFVFLASFNMLGNLMLSCDLLHPGSKEGSEFFEVMVRVMEWPGHPNS  225

Query  736   SDIFPCLRWLDLQGLRTKTDKDLQIALQIVSTFVQKRSKEGQDDSGKRKSDFLDVLLSFE  557
             +D FP LRW+D QGLR K ++DL IA++I S FVQ+R K G      +K DFLDVLL F+
Sbjct  226   ADFFPWLRWMDPQGLRKKAERDLGIAMKIASGFVQERIKRGPAAEDHKK-DFLDVLLDFQ  284

Query  556   GSGKDEPPKLSEHQINIFILEMFLAGTDTTSS  461
             GSGK+EPP++S+  +NI ILE+F+AG++TTSS
Sbjct  285   GSGKNEPPQISDKDLNIIILEIFMAGSETTSS  316


 Score =   167 bits (424),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 76/110 (69%), Positives = 92/110 (84%), Gaps = 0/110 (0%)
 Frame = -1

Query  332  TSSTVEWALTELLRNPKAMTKAKEEIRGIVGPTRRFEESDIDNLQYLQAVVKETLRLHPP  153
            TSSTVEWALTELLR+P+ M K K E+  +VG + + EE  ID+LQYLQAVVKET RLHPP
Sbjct  314  TSSTVEWALTELLRHPECMAKVKAELGRVVGASGKLEERHIDDLQYLQAVVKETFRLHPP  373

Query  152  APFLIPRRAIQDTKFMGYDIPKDTQVFINVWAIGRDHESWEDPLSFKPER  3
             PFL+PR+A++DT FMGY IPK+TQ+F+NVWAIGR+ E WE+P SFKPER
Sbjct  374  IPFLVPRKAVRDTNFMGYHIPKNTQLFVNVWAIGREAELWEEPSSFKPER  423



>ref|XP_002277661.2| PREDICTED: cytochrome P450 76A1-like [Vitis vinifera]
Length=518

 Score =   328 bits (840),  Expect = 4e-102, Method: Compositional matrix adjust.
 Identities = 154/272 (57%), Positives = 208/272 (76%), Gaps = 2/272 (1%)
 Frame = -2

Query  1273  NMLDLGSVPHQTIAAMRNKYGPVVWLRIGSVSTLAIQSAKAAAELFKNHDVPFAGRSIGD  1094
             NM DLG++PH+T+A +R+KYG VVWL +G++ T  +QS+KAAAELFKN D+ F+ R+I +
Sbjct  56    NMFDLGAMPHETLAGLRHKYGDVVWLNLGAIKTTVVQSSKAAAELFKNKDLCFSDRTITE  115

Query  1093  VMLAQGYNKGSMALAQYGSYWRVLRRICSVEMFVHKKVNETAAVRRKCIDDLLRWVENEA  914
              M AQGY++ S+ALA YG +WR LRR+ ++EM V K++NETA VRRKC+DD+L W+E EA
Sbjct  116   TMRAQGYHESSLALAPYGPHWRSLRRLMTMEMLVTKRINETAGVRRKCVDDMLSWIEEEA  175

Query  913   -GSIKRGSGIHVTRFVFLATFNLLGNIMFSSDLVDPVSEKGSKFFNAMMGIMERGGTPNI  737
              G    G GI V  FVFLA+FN+LGN+M S DL+ P S++GS+FF  M+ +ME  G PN 
Sbjct  176   RGVGGEGRGIQVAHFVFLASFNMLGNLMLSCDLLHPGSKEGSEFFEVMVRVMEWSGHPNF  235

Query  736   SDIFPCLRWLDLQGLRTKTDKDLQIALQIVSTFVQKRSKEGQDDSGKRKSDFLDVLLSFE  557
             +D FP LRW+D QGLR K ++DL IA++I S FVQ+R K G      +K DFLDVLL F+
Sbjct  236   ADFFPWLRWMDPQGLRKKAERDLGIAMKIASGFVQERIKRGPAAEDHKK-DFLDVLLDFQ  294

Query  556   GSGKDEPPKLSEHQINIFILEMFLAGTDTTSS  461
             GSGK+EPP++S+  +NI ILE+F+AG++TTSS
Sbjct  295   GSGKNEPPQISDKDLNIIILEIFMAGSETTSS  326


 Score =   168 bits (425),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 76/110 (69%), Positives = 92/110 (84%), Gaps = 0/110 (0%)
 Frame = -1

Query  332  TSSTVEWALTELLRNPKAMTKAKEEIRGIVGPTRRFEESDIDNLQYLQAVVKETLRLHPP  153
            TSSTVEWALTELLR+P+ M K K E+  +VG   + EE+ ID+LQYLQAVVKET RLHPP
Sbjct  324  TSSTVEWALTELLRHPECMAKVKAELGRVVGANGKLEENHIDDLQYLQAVVKETFRLHPP  383

Query  152  APFLIPRRAIQDTKFMGYDIPKDTQVFINVWAIGRDHESWEDPLSFKPER  3
             PFL+PR+A++DT FMGY IPK+TQ+F+NVWAIGR+ E WE+P SFKPER
Sbjct  384  IPFLVPRKAVRDTNFMGYHIPKNTQLFVNVWAIGREAELWEEPSSFKPER  433



>emb|CAN77399.1| hypothetical protein VITISV_015277 [Vitis vinifera]
Length=508

 Score =   327 bits (837),  Expect = 8e-102, Method: Compositional matrix adjust.
 Identities = 154/272 (57%), Positives = 208/272 (76%), Gaps = 2/272 (1%)
 Frame = -2

Query  1273  NMLDLGSVPHQTIAAMRNKYGPVVWLRIGSVSTLAIQSAKAAAELFKNHDVPFAGRSIGD  1094
             NM DLG++PH+T+A +R+KYG VVWL +G++ T  +QS+KAAAELFKN D+ F+ R+I +
Sbjct  46    NMFDLGAMPHETLAGLRHKYGDVVWLNLGAIKTTVVQSSKAAAELFKNXDLCFSDRTITE  105

Query  1093  VMLAQGYNKGSMALAQYGSYWRVLRRICSVEMFVHKKVNETAAVRRKCIDDLLRWVENEA  914
              M AQGY++ S+ALA YG +WR LRR+ ++EM V K++NETA VRRKC+DD+L W+E EA
Sbjct  106   TMRAQGYHESSLALAPYGPHWRSLRRLMTMEMLVTKRINETAGVRRKCVDDMLSWIEEEA  165

Query  913   -GSIKRGSGIHVTRFVFLATFNLLGNIMFSSDLVDPVSEKGSKFFNAMMGIMERGGTPNI  737
              G    G GI V  FVFLA+FN+LGN+M S DL+ P S++GS+FF  M+ +ME  G PN 
Sbjct  166   RGVGGEGRGIQVAHFVFLASFNMLGNLMLSCDLLHPGSKEGSEFFEVMVRVMEWPGHPNS  225

Query  736   SDIFPCLRWLDLQGLRTKTDKDLQIALQIVSTFVQKRSKEGQDDSGKRKSDFLDVLLSFE  557
             +D FP LRW+D QGLR K ++DL IA++I S FVQ+R K G      +K DFLDVLL F+
Sbjct  226   ADFFPWLRWMDPQGLRKKAERDLGIAMKIASGFVQERIKRGPAAEDHKK-DFLDVLLDFQ  284

Query  556   GSGKDEPPKLSEHQINIFILEMFLAGTDTTSS  461
             GSGK+EPP++S+  +NI ILE+F+AG++TTSS
Sbjct  285   GSGKNEPPQISDKDLNIIILEIFMAGSETTSS  316


 Score =   166 bits (421),  Expect = 8e-42, Method: Compositional matrix adjust.
 Identities = 76/110 (69%), Positives = 91/110 (83%), Gaps = 0/110 (0%)
 Frame = -1

Query  332  TSSTVEWALTELLRNPKAMTKAKEEIRGIVGPTRRFEESDIDNLQYLQAVVKETLRLHPP  153
            TSSTVEWALTELLR+P+ M K K E+  +VG   + EE  ID+LQYLQAVVKET RLHPP
Sbjct  314  TSSTVEWALTELLRHPECMAKVKAELGRVVGAXGKLEERHIDDLQYLQAVVKETFRLHPP  373

Query  152  APFLIPRRAIQDTKFMGYDIPKDTQVFINVWAIGRDHESWEDPLSFKPER  3
             PFL+PR+A++DT FMGY IPK+TQ+F+NVWAIGR+ E WE+P SFKPER
Sbjct  374  IPFLVPRKAVRDTNFMGYHIPKNTQLFVNVWAIGREAELWEEPSSFKPER  423



>ref|XP_002528649.1| cytochrome P450, putative [Ricinus communis]
 gb|EEF33752.1| cytochrome P450, putative [Ricinus communis]
Length=524

 Score =   233 bits (593),  Expect(2) = 1e-101, Method: Compositional matrix adjust.
 Identities = 110/274 (40%), Positives = 181/274 (66%), Gaps = 3/274 (1%)
 Frame = -2

Query  1273  NMLDLGSVPHQTIAAMRNKYGPVVWLRIGSVSTLAIQSAKAAAELFKNHDVPFAGRSIGD  1094
             N+ DLG++PH+ +   R KYGPV+WLR+G  +TL IQSA+AA ELFKNHD+ F  R + D
Sbjct  59    NIFDLGTIPHRNLYKFRYKYGPVLWLRLGFTNTLVIQSARAAEELFKNHDISFCDRKVPD  118

Query  1093  VMLAQGYNKGSMALAQYGSYWRVLRRICSVEMFVHKKVNETAAVRRKCIDDLLRWVENEA  914
                A  Y++G+++L +YGS WR  RR+ ++++  +K++ E+A +R KCI+ +++++E + 
Sbjct  119   CCTAHNYDQGAVSLGRYGSIWRFHRRLITLDLMTNKRIKESAFLRIKCINSMIQYIEEDT  178

Query  913   GSIK-RGS--GIHVTRFVFLATFNLLGNIMFSSDLVDPVSEKGSKFFNAMMGIMERGGTP  743
              + + RG    + +  ++F+ TFNL+GN++ S DL +  S +G +F +AM  I    G P
Sbjct  179   AAARARGELGEVVIAHYLFVMTFNLIGNLVLSQDLANSQSNEGLEFSHAMDKITVLSGKP  238

Query  742   NISDIFPCLRWLDLQGLRTKTDKDLQIALQIVSTFVQKRSKEGQDDSGKRKSDFLDVLLS  563
             N +D++P L+  D Q ++   ++++  AL++V  FV++R +E + +  + K DFLD LL 
Sbjct  239   NATDLWPFLKMFDPQRIKRDMEREMGKALRVVEGFVRERIEERKLEKERSKKDFLDALLE  298

Query  562   FEGSGKDEPPKLSEHQINIFILEMFLAGTDTTSS  461
             FE   +  P K+S   + I ILE+F AGT+TTSS
Sbjct  299   FESDEEAGPDKISIQTMFIIILEIFFAGTETTSS  332


 Score =   167 bits (422),  Expect(2) = 1e-101, Method: Compositional matrix adjust.
 Identities = 77/114 (68%), Positives = 94/114 (82%), Gaps = 0/114 (0%)
 Frame = -1

Query  344  NTALTSSTVEWALTELLRNPKAMTKAKEEIRGIVGPTRRFEESDIDNLQYLQAVVKETLR  165
             T  TSST+EWA+TELLR P+++ + KEE++ +VG  R+ EESDID L YLQAV+KET+R
Sbjct  326  GTETTSSTMEWAMTELLRCPESIKRVKEELKRVVGQKRKVEESDIDQLPYLQAVLKETMR  385

Query  164  LHPPAPFLIPRRAIQDTKFMGYDIPKDTQVFINVWAIGRDHESWEDPLSFKPER  3
            LHP  P LIPR +++DT FMGY IPKDTQVF+NVWAIGRD ESW+DP SFKPER
Sbjct  386  LHPTLPLLIPRNSLEDTNFMGYLIPKDTQVFVNVWAIGRDPESWQDPNSFKPER  439



>ref|XP_006339107.1| PREDICTED: cytochrome P450 76A2-like [Solanum tuberosum]
Length=506

 Score =   326 bits (835),  Expect = 1e-101, Method: Compositional matrix adjust.
 Identities = 151/272 (56%), Positives = 210/272 (77%), Gaps = 2/272 (1%)
 Frame = -2

Query  1273  NMLDLGSVPHQTIAAMRNKYGPVVWLRIG-SVSTLAIQSAKAAAELFKNHDVPFAGRSIG  1097
             NM +LG+ P++ ++ ++ KYGPV+WL++G S   + +Q+A+AA ELFKNHD+ FA R I 
Sbjct  47    NMFELGTEPYKRMSVLKQKYGPVLWLKLGTSTKIMVVQTAQAAEELFKNHDISFADRFIP  106

Query  1096  DVMLAQGYNKGSMALAQYGSYWRVLRRICSVEMFVHKKVNETAAVRRKCIDDLLRWVENE  917
             D   A  Y +GS+ALA YGS+WR  RRIC+VEMFVHK+++ET  VRR+C+D++L+W+E E
Sbjct  107   DANQAHSYYQGSLALAPYGSFWRFKRRICTVEMFVHKRISETVPVRRRCVDNMLKWIEKE  166

Query  916   AGSIKRGSGIHVTRFVFLATFNLLGNIMFSSDLVDPVSEKGSKFFNAMMGIMERGGTPNI  737
             A S ++GSGI VTR VFLA+FN++GN++ S DL DP SE+ S+FFNAM GIM+  G  N+
Sbjct  167   ANSAEKGSGIEVTRLVFLASFNMVGNLVLSKDLADPESEEASEFFNAMKGIMDWSGIANV  226

Query  736   SDIFPCLRWLDLQGLRTKTDKDLQIALQIVSTFVQKRSKEGQDDSGKRKSDFLDVLLSFE  557
             SDIF  LR  DLQ LR K ++D+  AL+I+S F+++R +E +    ++ +DFLDVLL FE
Sbjct  227   SDIFRFLRKFDLQNLRKKMERDMGKALEIMSMFLKEREEE-RKKGVEKGNDFLDVLLEFE  285

Query  556   GSGKDEPPKLSEHQINIFILEMFLAGTDTTSS  461
             G+GKDEP KLSE +I IF+LEMFLAG++TT+S
Sbjct  286   GTGKDEPTKLSEQEIKIFVLEMFLAGSETTNS  317


 Score =   174 bits (442),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 77/110 (70%), Positives = 93/110 (85%), Gaps = 0/110 (0%)
 Frame = -1

Query  332  TSSTVEWALTELLRNPKAMTKAKEEIRGIVGPTRRFEESDIDNLQYLQAVVKETLRLHPP  153
            T+S+VEWALTELLR+P+AM + K EI  +VGP   FEESDI+NL Y+QAV+KE+LRLHPP
Sbjct  315  TNSSVEWALTELLRHPQAMAEVKTEISKVVGPNNTFEESDIENLPYMQAVIKESLRLHPP  374

Query  152  APFLIPRRAIQDTKFMGYDIPKDTQVFINVWAIGRDHESWEDPLSFKPER  3
             PFLIPR  IQDTKFMGYD+PK TQV +N WA+GRD + W+DP+SFKPER
Sbjct  375  LPFLIPRETIQDTKFMGYDVPKGTQVLVNAWALGRDPQCWDDPMSFKPER  424



>ref|XP_010112510.1| Cytochrome P450 76A2 [Morus notabilis]
 gb|EXC33898.1| Cytochrome P450 76A2 [Morus notabilis]
Length=509

 Score =   325 bits (834),  Expect = 2e-101, Method: Compositional matrix adjust.
 Identities = 157/273 (58%), Positives = 210/273 (77%), Gaps = 4/273 (1%)
 Frame = -2

Query  1273  NMLDLGSVPHQTIAAMRNKYGPVVWLRIGSVSTLAIQSAKAAAELFKNHDVPFAGRSIGD  1094
             N  DLG +PH+++A +R+KYG V+WL++G+++T+ I S+KAAAE FKNHD+ F  R++ +
Sbjct  45    NTFDLGPMPHRSLAQLRHKYGDVLWLKLGAINTMVILSSKAAAEFFKNHDLSFVERTVTE  104

Query  1093  VMLAQGYNKGSMALAQYGSYWRVLRRICSVEMFVHKKVNETAAVRRKCIDDLLRWVENEA  914
                  GY+KGS+ALA YGSYWRV+RR+ +VEM V+K++ ETA +RRKC+DD+L W+E EA
Sbjct  105   TSRVYGYHKGSVALANYGSYWRVMRRLVTVEMLVNKRIRETAFLRRKCVDDMLLWIEEEA  164

Query  913   GSIKRGSGIHVTRFVFLATFNLLGNIMFSSDLVDPVSEKGSKFFNAMMGIMERGGTPNIS  734
             G  K   G+HV RFVFL TFNLLGN+M S DL  P SE+GS+FF AM GIME GG  N+S
Sbjct  165   G--KANCGVHVARFVFLMTFNLLGNLMLSKDLFGPDSEEGSEFFVAMEGIMEWGGHANMS  222

Query  733   DIFPCLRWLDLQGLRTKTDKDLQIALQIVSTFVQKR--SKEGQDDSGKRKSDFLDVLLSF  560
             DIFP LR LD QGLR K ++D+  A++I S FV++R  S + Q    +RK DFLDVLL +
Sbjct  223   DIFPWLRRLDPQGLRRKMERDMGKAMKIASKFVKERKNSTDQQYVERERKKDFLDVLLEY  282

Query  559   EGSGKDEPPKLSEHQINIFILEMFLAGTDTTSS  461
             EG+G DEP K+S+ ++NIFILE+FLAG++TTSS
Sbjct  283   EGNGNDEPAKISDDELNIFILEIFLAGSETTSS  315


 Score =   165 bits (418),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 78/111 (70%), Positives = 91/111 (82%), Gaps = 1/111 (1%)
 Frame = -1

Query  332  TSSTVEWALTELLRNPKAMTKAKEEIRGIVGPTRRFEESDIDNLQYLQAVVKETLRLHPP  153
            TSST+EWALTEL+R+PKAM KAK E+  +VGP  + EESDI+ L YLQAV+KETLRLHPP
Sbjct  313  TSSTIEWALTELIRSPKAMNKAKTELTQVVGPNGKVEESDIEKLPYLQAVIKETLRLHPP  372

Query  152  APFLIPRRAIQDTKFMGYDIPKDTQVFINVWAIGRDHESWED-PLSFKPER  3
             PFL+PRRA  DT FMGY IPK+TQVF+N WAIGRD + W D P+ FKPER
Sbjct  373  IPFLVPRRAKNDTNFMGYFIPKNTQVFVNAWAIGRDPDVWADEPMCFKPER  423



>ref|XP_002528653.1| cytochrome P450, putative [Ricinus communis]
 gb|EEF33756.1| cytochrome P450, putative [Ricinus communis]
Length=515

 Score =   244 bits (622),  Expect(2) = 1e-100, Method: Compositional matrix adjust.
 Identities = 116/273 (42%), Positives = 183/273 (67%), Gaps = 3/273 (1%)
 Frame = -2

Query  1273  NMLDLGSVPHQTIAAMRNKYGPVVWLRIGSVSTLAIQSAKAAAELFKNHDVPFAGRSIGD  1094
             N+ DLG+ PHQ +  +  KYGPV+WLR+G ++T+ IQSAKAA ELFK+HD+ F  R +  
Sbjct  49    NIFDLGANPHQNLYKLGFKYGPVLWLRLGYINTMVIQSAKAAEELFKHHDISFCDRKVPQ  108

Query  1093  VMLAQGYNKGSMALAQYGSYWRVLRRICSVEMFVHKKVNETAAVRRKCIDDLLRWVENEA  914
                A+ Y K ++AL +Y S+WR  RR  ++E+  +K++NETA +R+KCID ++R+++ +A
Sbjct  109   SFTARNYCKAALALGRYDSHWRFHRRFVTLELMTNKRINETAVLRQKCIDKMIRYIDEDA  168

Query  913   GSIK-RGSG--IHVTRFVFLATFNLLGNIMFSSDLVDPVSEKGSKFFNAMMGIMERGGTP  743
              + + RG    + ++ +VF+ +FNL+GN+  S DL++  SE+G++FF+AM   ME GG P
Sbjct  169   SAARARGESGELVISHYVFVMSFNLIGNLALSRDLLNSHSEEGTEFFDAMDKAMEWGGKP  228

Query  742   NISDIFPCLRWLDLQGLRTKTDKDLQIALQIVSTFVQKRSKEGQDDSGKRKSDFLDVLLS  563
             N++D  P L+ LD Q ++   ++ L   + IV  FV++R +E +    +  SDFLD LL 
Sbjct  229   NLADFLPFLQGLDPQRVKKNMEQYLGRTIDIVERFVKERIEEKKLMKERDTSDFLDALLE  288

Query  562   FEGSGKDEPPKLSEHQINIFILEMFLAGTDTTS  464
             F+G   +EP  +S H + I +LE+F  GT+TTS
Sbjct  289   FKGDAIEEPDAISTHSMLIILLEIFFGGTETTS  321


 Score =   152 bits (383),  Expect(2) = 1e-100, Method: Compositional matrix adjust.
 Identities = 68/114 (60%), Positives = 86/114 (75%), Gaps = 0/114 (0%)
 Frame = -1

Query  344  NTALTSSTVEWALTELLRNPKAMTKAKEEIRGIVGPTRRFEESDIDNLQYLQAVVKETLR  165
             T  TS T+EW + EL R+P++M + KEE+  ++GP R+  ESDID L YLQAV+KE +R
Sbjct  316  GTETTSGTLEWVMAELFRSPESMRRVKEELNQVIGPHRKVVESDIDQLPYLQAVIKEGMR  375

Query  164  LHPPAPFLIPRRAIQDTKFMGYDIPKDTQVFINVWAIGRDHESWEDPLSFKPER  3
            LHP  P L+PR  ++DT FM Y I KDTQVF+N WAIGRD ++WEDPLSFKPER
Sbjct  376  LHPVLPLLVPRNTMEDTTFMEYFIAKDTQVFVNAWAIGRDPDAWEDPLSFKPER  429



>ref|XP_006482364.1| PREDICTED: cytochrome P450 76A2-like [Citrus sinensis]
Length=500

 Score =   323 bits (828),  Expect = 1e-100, Method: Compositional matrix adjust.
 Identities = 153/275 (56%), Positives = 207/275 (75%), Gaps = 10/275 (4%)
 Frame = -2

Query  1273  NMLDLGSVPHQTIAAMRNKYGPVVWLRIGSVSTLAIQSAKAAAELFKNHDVPFAGRSIGD  1094
             NM DLG+VPH+T+  +R KYG V+WL+ G+++T+AI SAKAA + FKNHD  FA R + +
Sbjct  45    NMFDLGTVPHRTLTELRQKYGDVIWLKFGAINTMAILSAKAATDFFKNHDSTFAERKVTE  104

Query  1093  VMLAQGYNKGSMALAQYGSYWRVLRRICSVEMFVHKKVNETAAVRRKCIDDLLRWVENEA  914
              M   GY+K S+ALA YG++WRVLRR+ +VEM V K++NETA+VRRKC++D+L W+E EA
Sbjct  105   TMRVHGYDKSSLALAPYGAFWRVLRRLVTVEMLVTKRINETASVRRKCVNDMLLWIEQEA  164

Query  913   GSIKRGSGIHVTRFVFLATFNLLGNIMFSSDLVDPVSEKGSKFFNAMMGIMERGGTPNIS  734
                   SG+HV R VFL+TFNLLGN+M S DL+D  S  G++FF AMMG+ME  G  N++
Sbjct  165   ------SGVHVARLVFLSTFNLLGNLMLSRDLLDRESNDGAEFFQAMMGLMEWSGHANLA  218

Query  733   DIFPCLRWLDLQGLRTKTDKDLQIALQIVSTFVQKRSKEGQDD----SGKRKSDFLDVLL  566
             D FP LR LD QGLR K ++D+  AL+I S FV++R ++   +    S +++ DFLDV+L
Sbjct  219   DFFPILRRLDPQGLRRKMERDVGKALEIASKFVKERLEQKDKNVTGTSDEKRKDFLDVML  278

Query  565   SFEGSGKDEPPKLSEHQINIFILEMFLAGTDTTSS  461
              FEG+GKDEP K+SE  +NIFILE+FLAG++TTSS
Sbjct  279   DFEGNGKDEPAKVSEKDLNIFILEIFLAGSETTSS  313


 Score =   165 bits (417),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 76/110 (69%), Positives = 89/110 (81%), Gaps = 0/110 (0%)
 Frame = -1

Query  332  TSSTVEWALTELLRNPKAMTKAKEEIRGIVGPTRRFEESDIDNLQYLQAVVKETLRLHPP  153
            TSST+EWALTELL NP+++ KAK E+   VG  R FEE DIDNL YL+AV+KETLRLHPP
Sbjct  311  TSSTIEWALTELLSNPESLNKAKAELGQAVGADRTFEEDDIDNLPYLKAVIKETLRLHPP  370

Query  152  APFLIPRRAIQDTKFMGYDIPKDTQVFINVWAIGRDHESWEDPLSFKPER  3
             P L+PRRA++DT F GY IPKDTQV +N WAIGRD E W++P SFKPER
Sbjct  371  IPLLVPRRAMEDTNFQGYHIPKDTQVLVNAWAIGRDPEVWDEPWSFKPER  420



>ref|XP_010037101.1| PREDICTED: cytochrome P450 76A1-like [Eucalyptus grandis]
Length=510

 Score =   323 bits (828),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 161/291 (55%), Positives = 216/291 (74%), Gaps = 2/291 (1%)
 Frame = -2

Query  1327  KSRSGRlppgppglpvlGNMLDLGSVPHQTIAAMRNKYGPVVWLRIGSVSTLAIQSAKAA  1148
             +SRS RLPPGP   P+ GN+ +LG +PH+T+A +R KYGPV+WLR+GS+ T+ I S++ A
Sbjct  29    RSRSHRLPPGPSRWPIFGNLFNLGKMPHRTLAGLREKYGPVIWLRLGSIDTMVILSSRVA  88

Query  1147  AELFKNHDVPFAGRSIGDVMLAQGYNKGSMALAQYGSYWRVLRRICSVEMFVHKKVNETA  968
             AE FKNHD+ F  R+I D+M +Q Y KGS+ALA YG+YWRV RR+ + +M V +++NETA
Sbjct  89    AEFFKNHDLNFVERTITDLMQSQEYCKGSIALAPYGTYWRVSRRLLTADMLVARRLNETA  148

Query  967   AVRRKCIDDLLRWVENEAGS--IKRGSGIHVTRFVFLATFNLLGNIMFSSDLVDPVSEKG  794
              ++RKC+DD+L W+   A +  ++ G G+H+ RFVFL  FNLLGN+M S DL+DP S+ G
Sbjct  149   PIQRKCVDDMLTWIGEAASTDKVRLGEGVHLARFVFLMAFNLLGNLMLSRDLLDPDSKVG  208

Query  793   SKFFNAMMGIMERGGTPNISDIFPCLRWLDLQGLRTKTDKDLQIALQIVSTFVQKRSKEG  614
             S+FF AM G+ME  G   I+D+FP LRWL  QGLR K D+D+  A++I S FV++R +E 
Sbjct  209   SEFFEAMSGLMEWSGHVTIADLFPWLRWLGPQGLRRKMDRDMGKAMRIASDFVRERIEEK  268

Query  613   QDDSGKRKSDFLDVLLSFEGSGKDEPPKLSEHQINIFILEMFLAGTDTTSS  461
             +      + DFLDVLL FEG+GKDEP KLSE QI  FILEMFLAG +T+SS
Sbjct  269   KIGGNDDRRDFLDVLLEFEGNGKDEPAKLSEKQIKTFILEMFLAGAETSSS  319


 Score =   167 bits (422),  Expect = 7e-42, Method: Compositional matrix adjust.
 Identities = 74/110 (67%), Positives = 93/110 (85%), Gaps = 0/110 (0%)
 Frame = -1

Query  332  TSSTVEWALTELLRNPKAMTKAKEEIRGIVGPTRRFEESDIDNLQYLQAVVKETLRLHPP  153
            +SSTVEWALTELLR+P +M K + E+  +VG  R+ +E+DID L YLQAVVKETLRLHPP
Sbjct  317  SSSTVEWALTELLRDPNSMAKVQAELSRVVGSNRKVQETDIDQLSYLQAVVKETLRLHPP  376

Query  152  APFLIPRRAIQDTKFMGYDIPKDTQVFINVWAIGRDHESWEDPLSFKPER  3
             PFL+PR+A+ +T FMGYDIPK+TQVF+N WAIGR+ + WEDP++FKPER
Sbjct  377  LPFLVPRKAMANTIFMGYDIPKNTQVFVNSWAIGREPDVWEDPMAFKPER  426



>ref|XP_004249463.1| PREDICTED: cytochrome P450 76A2-like [Solanum lycopersicum]
Length=518

 Score =   323 bits (828),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 151/272 (56%), Positives = 206/272 (76%), Gaps = 6/272 (2%)
 Frame = -2

Query  1273  NMLDLGSVPHQTIAAMRNKYGPVVWLRIG-SVSTLAIQSAKAAAELFKNHDVPFAGRSIG  1097
             NM +LG  P++ ++A++ KYGPV+ L++G S + + +Q+A+AAAELFKNHD  FA R I 
Sbjct  47    NMFELGKEPYKKMSALKQKYGPVLGLKLGPSTNIMVVQTAEAAAELFKNHDTSFADRPIV  106

Query  1096  DVMLAQGYNKGSMALAQYGSYWRVLRRICSVEMFVHKKVNETAAVRRKCIDDLLRWVENE  917
             DV  A  Y +GS+A+ +YGS+WR  RRIC+VEMFVHKK++ET  +RRKC+D++L+W+E  
Sbjct  107   DVNQAHNYFQGSLAVGRYGSFWRFQRRICTVEMFVHKKISETVPIRRKCVDNMLKWIEKT  166

Query  916   AGSIKRGSGIHVTRFVFLATFNLLGNIMFSSDLVDPVSEKGSKFFNAMMGIMERGGTPNI  737
               S ++G+GI VTRFVFLA+FN+LGN++ S DL DP SE+ S+FFNAM GIME  G  N+
Sbjct  167   VNSAEKGNGIEVTRFVFLASFNMLGNLILSKDLADPESEEASEFFNAMKGIMEWSGIANV  226

Query  736   SDIFPCLRWLDLQGLRTKTDKDLQIALQIVSTFVQKRSKEGQDDSGKRKSDFLDVLLSFE  557
             SDIFP LR  DLQ LR K  +D+  A++I+S  +++R K       ++  DFLDVLL FE
Sbjct  227   SDIFPFLRMFDLQKLRKKMTRDMGKAMEIMSMLLKERKK-----GMEKMKDFLDVLLEFE  281

Query  556   GSGKDEPPKLSEHQINIFILEMFLAGTDTTSS  461
             G+GKDEP KLSEH+I + I+EMFLAG++TTSS
Sbjct  282   GTGKDEPAKLSEHEIKVLIVEMFLAGSETTSS  313


 Score =   170 bits (430),  Expect = 7e-43, Method: Compositional matrix adjust.
 Identities = 77/110 (70%), Positives = 89/110 (81%), Gaps = 0/110 (0%)
 Frame = -1

Query  332  TSSTVEWALTELLRNPKAMTKAKEEIRGIVGPTRRFEESDIDNLQYLQAVVKETLRLHPP  153
            TSS+VEWALTELLR+P+AM + K EI   VG   RFEESDI+NL Y+QAV+KE+LRLHPP
Sbjct  311  TSSSVEWALTELLRHPQAMAEVKTEISKAVGSNNRFEESDIENLPYMQAVIKESLRLHPP  370

Query  152  APFLIPRRAIQDTKFMGYDIPKDTQVFINVWAIGRDHESWEDPLSFKPER  3
             PFLIPR  I DT FMGYD+ K TQV +N WAIGRD E W+DP+SFKPER
Sbjct  371  LPFLIPRETIHDTNFMGYDVLKGTQVLVNAWAIGRDPECWDDPMSFKPER  420



>emb|CBI30226.3| unnamed protein product [Vitis vinifera]
Length=660

 Score =   327 bits (838),  Expect = 3e-100, Method: Compositional matrix adjust.
 Identities = 154/272 (57%), Positives = 208/272 (76%), Gaps = 2/272 (1%)
 Frame = -2

Query  1273  NMLDLGSVPHQTIAAMRNKYGPVVWLRIGSVSTLAIQSAKAAAELFKNHDVPFAGRSIGD  1094
             NM DLG++PH+T+A +R+KYG VVWL +G++ T  +QS+KAAAELFKN D+ F+ R+I +
Sbjct  46    NMFDLGAMPHETLAGLRHKYGDVVWLNLGAIKTTVVQSSKAAAELFKNQDLCFSDRTITE  105

Query  1093  VMLAQGYNKGSMALAQYGSYWRVLRRICSVEMFVHKKVNETAAVRRKCIDDLLRWVENEA  914
              M AQGY++ S+ALA YG +WR LRR+ ++EM V K++NETA VRRKC+DD+L W+E EA
Sbjct  106   TMRAQGYHESSLALAPYGPHWRSLRRLMTMEMLVTKRINETAGVRRKCVDDMLSWIEEEA  165

Query  913   -GSIKRGSGIHVTRFVFLATFNLLGNIMFSSDLVDPVSEKGSKFFNAMMGIMERGGTPNI  737
              G    G GI V  FVFLA+FN+LGN+M S DL+ P S++GS+FF  M+ +ME  G PN 
Sbjct  166   RGVGGEGRGIQVAHFVFLASFNMLGNLMLSCDLLHPGSKEGSEFFEVMVRVMEWPGHPNS  225

Query  736   SDIFPCLRWLDLQGLRTKTDKDLQIALQIVSTFVQKRSKEGQDDSGKRKSDFLDVLLSFE  557
             +D FP LRW+D QGLR K ++DL IA++I S FVQ+R K G      +K DFLDVLL F+
Sbjct  226   ADFFPWLRWMDPQGLRKKAERDLGIAMKIASGFVQERIKRGPAAEDHKK-DFLDVLLDFQ  284

Query  556   GSGKDEPPKLSEHQINIFILEMFLAGTDTTSS  461
             GSGK+EPP++S+  +NI ILE+F+AG++TTSS
Sbjct  285   GSGKNEPPQISDKDLNIIILEIFMAGSETTSS  316


 Score =   167 bits (424),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 76/110 (69%), Positives = 92/110 (84%), Gaps = 0/110 (0%)
 Frame = -1

Query  332  TSSTVEWALTELLRNPKAMTKAKEEIRGIVGPTRRFEESDIDNLQYLQAVVKETLRLHPP  153
            TSSTVEWALTELLR+P+ M K K E+  +VG + + EE  ID+LQYLQAVVKET RLHPP
Sbjct  314  TSSTVEWALTELLRHPECMAKVKAELGRVVGASGKLEERHIDDLQYLQAVVKETFRLHPP  373

Query  152  APFLIPRRAIQDTKFMGYDIPKDTQVFINVWAIGRDHESWEDPLSFKPER  3
             PFL+PR+A++DT FMGY IPK+TQ+F+NVWAIGR+ E WE+P SFKPER
Sbjct  374  IPFLVPRKAVRDTNFMGYHIPKNTQLFVNVWAIGREAELWEEPSSFKPER  423



>gb|KDO61008.1| hypothetical protein CISIN_1g036305mg [Citrus sinensis]
Length=515

 Score =   322 bits (825),  Expect = 6e-100, Method: Compositional matrix adjust.
 Identities = 152/275 (55%), Positives = 206/275 (75%), Gaps = 10/275 (4%)
 Frame = -2

Query  1273  NMLDLGSVPHQTIAAMRNKYGPVVWLRIGSVSTLAIQSAKAAAELFKNHDVPFAGRSIGD  1094
             NM DLG+VPH+T+  +R KYG V+WL+ G+++T+ I SAKAA + FKNHD  FA R + +
Sbjct  60    NMFDLGTVPHRTLTELRQKYGDVIWLKFGAINTMVILSAKAATDFFKNHDSTFAERKVTE  119

Query  1093  VMLAQGYNKGSMALAQYGSYWRVLRRICSVEMFVHKKVNETAAVRRKCIDDLLRWVENEA  914
              M   GY+K S+ALA YG++WRVLRR+ +VEM V K++NETA+VRRKC++D+L W+E EA
Sbjct  120   TMRVHGYDKSSLALAPYGAFWRVLRRLVTVEMLVTKRINETASVRRKCVNDMLLWIEQEA  179

Query  913   GSIKRGSGIHVTRFVFLATFNLLGNIMFSSDLVDPVSEKGSKFFNAMMGIMERGGTPNIS  734
                   SG+HV R VFL+TFNLLGN+M S DL+D  S  G++FF AMMG+ME  G  N++
Sbjct  180   ------SGVHVARLVFLSTFNLLGNLMLSRDLLDRESNDGAEFFQAMMGLMEWSGHANLA  233

Query  733   DIFPCLRWLDLQGLRTKTDKDLQIALQIVSTFVQKRSKEGQDD----SGKRKSDFLDVLL  566
             D FP LR LD QGLR K ++D+  AL+I S FV++R ++   +    S +++ DFLDV+L
Sbjct  234   DFFPILRRLDPQGLRRKMERDVGKALEIASKFVKERLEQKDKNVTGTSDEKRKDFLDVML  293

Query  565   SFEGSGKDEPPKLSEHQINIFILEMFLAGTDTTSS  461
              FEG+GKDEP K+SE  +NIFILE+FLAG++TTSS
Sbjct  294   DFEGNGKDEPAKVSEKDLNIFILEIFLAGSETTSS  328


 Score =   167 bits (423),  Expect = 5e-42, Method: Compositional matrix adjust.
 Identities = 77/110 (70%), Positives = 90/110 (82%), Gaps = 0/110 (0%)
 Frame = -1

Query  332  TSSTVEWALTELLRNPKAMTKAKEEIRGIVGPTRRFEESDIDNLQYLQAVVKETLRLHPP  153
            TSST+EWALTELL NP+++ KAK E+   VG  R FEE DIDNL YL+AV+KETLRLHPP
Sbjct  326  TSSTIEWALTELLTNPESLNKAKAELAQAVGADRTFEEDDIDNLPYLKAVIKETLRLHPP  385

Query  152  APFLIPRRAIQDTKFMGYDIPKDTQVFINVWAIGRDHESWEDPLSFKPER  3
             PFL+PRRA++DT F GY IPKDTQV +N WAIGRD E W++P SFKPER
Sbjct  386  IPFLVPRRAMEDTNFQGYHIPKDTQVLVNAWAIGRDPEVWDEPWSFKPER  435



>ref|XP_010037099.1| PREDICTED: cytochrome P450 76A1-like [Eucalyptus grandis]
Length=510

 Score =   322 bits (824),  Expect = 8e-100, Method: Compositional matrix adjust.
 Identities = 161/291 (55%), Positives = 215/291 (74%), Gaps = 2/291 (1%)
 Frame = -2

Query  1327  KSRSGRlppgppglpvlGNMLDLGSVPHQTIAAMRNKYGPVVWLRIGSVSTLAIQSAKAA  1148
             +SRS RLPPGP   P+ GN+ +LG +PH+T+A +R KYGPV+WLR+GS+ T+ I S++ A
Sbjct  29    RSRSHRLPPGPSRWPIFGNLFNLGKMPHRTLAGLREKYGPVIWLRLGSIDTMVILSSRVA  88

Query  1147  AELFKNHDVPFAGRSIGDVMLAQGYNKGSMALAQYGSYWRVLRRICSVEMFVHKKVNETA  968
             AE FKNHD+ F  R+I D+M +Q Y KGS+ALA YG+YWRV RR+ + +M V +++NETA
Sbjct  89    AEFFKNHDLNFVERTITDLMQSQEYCKGSIALAPYGTYWRVSRRLLTADMLVARRLNETA  148

Query  967   AVRRKCIDDLLRWVENEAGS--IKRGSGIHVTRFVFLATFNLLGNIMFSSDLVDPVSEKG  794
              ++RKC+DD+L W+   A +  ++ G G+H+ RFVFL  FNLLGN+M S DL+DP S+ G
Sbjct  149   PIQRKCVDDMLTWIGEAASTDKVRLGEGVHLARFVFLMAFNLLGNLMLSRDLLDPDSKVG  208

Query  793   SKFFNAMMGIMERGGTPNISDIFPCLRWLDLQGLRTKTDKDLQIALQIVSTFVQKRSKEG  614
             S+FF AM G+ME  G   I+D+FP LRWL  QGLR K D+D+  A++I S FV++R +E 
Sbjct  209   SEFFEAMSGLMEWSGHVTIADLFPWLRWLGPQGLRRKMDRDMGKAMRIASDFVRERIEEK  268

Query  613   QDDSGKRKSDFLDVLLSFEGSGKDEPPKLSEHQINIFILEMFLAGTDTTSS  461
             +      + DFLDVLL FEG+GKDEP KLSE QI  FILEMFLAG  T+SS
Sbjct  269   KIGGNDDRRDFLDVLLEFEGNGKDEPAKLSEKQIKTFILEMFLAGARTSSS  319


 Score =   168 bits (425),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 75/110 (68%), Positives = 92/110 (84%), Gaps = 0/110 (0%)
 Frame = -1

Query  332  TSSTVEWALTELLRNPKAMTKAKEEIRGIVGPTRRFEESDIDNLQYLQAVVKETLRLHPP  153
            +SSTVEWALTELLR P +M K + E+  +VG  R+ +E+DID L YLQAVVKETLRLHPP
Sbjct  317  SSSTVEWALTELLREPNSMAKVQAELSRVVGSNRKVQETDIDQLSYLQAVVKETLRLHPP  376

Query  152  APFLIPRRAIQDTKFMGYDIPKDTQVFINVWAIGRDHESWEDPLSFKPER  3
             PFL+PR+A+ +T FMGYDIPK+TQVF+N WAIGRD + WEDP++FKPER
Sbjct  377  LPFLVPRKAMANTIFMGYDIPKNTQVFVNSWAIGRDPDVWEDPMAFKPER  426



>ref|XP_006430324.1| hypothetical protein CICLE_v10013315mg [Citrus clementina]
 gb|ESR43564.1| hypothetical protein CICLE_v10013315mg [Citrus clementina]
Length=515

 Score =   322 bits (824),  Expect = 9e-100, Method: Compositional matrix adjust.
 Identities = 165/295 (56%), Positives = 218/295 (74%), Gaps = 10/295 (3%)
 Frame = -2

Query  1333  RNKSRSGRlppgppglpvlGNMLDLGSVPHQTIAAMRNKYGPVVWLRIGSVSTLAIQSAK  1154
             R  SR  + PPGPPG P++GNM DLG+VPH+T+  +R KYG V+WL+ G+++T+AI SAK
Sbjct  40    RKSSRPKQHPPGPPGWPIIGNMFDLGTVPHRTLTELRQKYGDVLWLKFGAINTMAILSAK  99

Query  1153  AAAELFKNHDVPFAGRSIGDVMLAQGYNKGSMALAQYGSYWRVLRRICSVEMFVHKKVNE  974
             AA + FKNHD  FA R + + M   GY+K S+ALA YG++WRVLRR+ +VEM   K++NE
Sbjct  100   AATDFFKNHDSTFAERKVTETMRVHGYDKSSLALAPYGAFWRVLRRLVTVEMLATKRINE  159

Query  973   TAAVRRKCIDDLLRWVENEAGSIKRGSGIHVTRFVFLATFNLLGNIMFSSDLVDPVSEKG  794
             TA+VRRKC++D+L W+E EA      SG+HV R VFL+TFNLLGN+M S DL+D  S  G
Sbjct  160   TASVRRKCVNDMLLWIEQEA------SGVHVARLVFLSTFNLLGNLMLSRDLLDRESNDG  213

Query  793   SKFFNAMMGIMERGGTPNISDIFPCLRWLDLQGLRTKTDKDLQIALQIVSTFV----QKR  626
             ++FF AMMG+ME  G  N++D FP LR LD QGLR K ++D+  AL+I S FV    +K+
Sbjct  214   AEFFQAMMGLMEWSGHANLADFFPILRRLDPQGLRRKMERDVGKALEIASKFVKERLEKK  273

Query  625   SKEGQDDSGKRKSDFLDVLLSFEGSGKDEPPKLSEHQINIFILEMFLAGTDTTSS  461
              K     S +++ DFLDVLL FEG+GKDEP K+SE  +NIFILE+FLAG++TTSS
Sbjct  274   DKYITGTSDEKRKDFLDVLLDFEGNGKDEPAKVSEKDLNIFILEIFLAGSETTSS  328


 Score =   167 bits (423),  Expect = 5e-42, Method: Compositional matrix adjust.
 Identities = 77/110 (70%), Positives = 90/110 (82%), Gaps = 0/110 (0%)
 Frame = -1

Query  332  TSSTVEWALTELLRNPKAMTKAKEEIRGIVGPTRRFEESDIDNLQYLQAVVKETLRLHPP  153
            TSST+EWALTELL NP+++ KAK E+   VG  R FEE DIDNL YL+AV+KETLRLHPP
Sbjct  326  TSSTIEWALTELLTNPESLNKAKAELAQAVGADRTFEEDDIDNLPYLKAVIKETLRLHPP  385

Query  152  APFLIPRRAIQDTKFMGYDIPKDTQVFINVWAIGRDHESWEDPLSFKPER  3
             PFL+PRRA++DT F GY IPKDTQV +N WAIGRD E W++P SFKPER
Sbjct  386  IPFLVPRRAMEDTNFQGYHIPKDTQVLVNAWAIGRDPEVWDEPWSFKPER  435



>ref|XP_008241318.1| PREDICTED: cytochrome P450 76A2-like [Prunus mume]
Length=509

 Score =   319 bits (818),  Expect = 5e-99, Method: Compositional matrix adjust.
 Identities = 150/264 (57%), Positives = 199/264 (75%), Gaps = 1/264 (0%)
 Frame = -2

Query  1273  NMLDLGSVPHQTIAAMRNKYGPVVWLRIGSVSTLAIQSAKAAAELFKNHDVPFAGRSIGD  1094
             NM DLG++PH+T+  +  K+GPV+WLR+G+ +T+++QSAKAA+E FKNHD+ FA R+I +
Sbjct  48    NMFDLGTMPHRTLTELTPKFGPVIWLRLGARATMSVQSAKAASEFFKNHDLSFANRTINE  107

Query  1093  VMLAQGYNKGSMALAQYGSYWRVLRRICSVEMFVHKKVNETAAVRRKCIDDLLRWVENEA  914
                   Y+KGS+ALA YGS+WRVLRR+ +V+M V+K++NETA VRRKC D+L  W+E EA
Sbjct  108   ACRVYDYHKGSLALAPYGSHWRVLRRLMTVDMVVNKRINETAFVRRKCFDNLQLWIEEEA  167

Query  913   GSIKRGSGIHVTRFVFLATFNLLGNIMFSSDLVDPVSEKGSKFFNAMMGIMERGGTPNIS  734
               +K G G+HV RFVFL TFNLLGN+M S DLVDP S +G +FF AM G+ME  G   ++
Sbjct  168   SKLKEGHGVHVARFVFLMTFNLLGNLMLSRDLVDPKSNEGLEFFKAMNGLMEWNGAAYMA  227

Query  733   DIFPCLRWLDLQGLRTKTDKDLQIALQIVSTFVQKRSKEGQDDSGKRKSDFLDVLLSFEG  554
             D FP LRWLD QGL+ K  KDL  A+QI S FV++R  E +    ++  DFLD+LL FEG
Sbjct  228   DYFPWLRWLDPQGLKRKMKKDLGKAIQIASKFVKERM-EARGVGREKTRDFLDLLLEFEG  286

Query  553   SGKDEPPKLSEHQINIFILEMFLA  482
             +G DEP K+SEH +NIFILE+F+A
Sbjct  287   NGIDEPDKISEHDLNIFILEIFMA  310


 Score =   154 bits (389),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 71/105 (68%), Positives = 86/105 (82%), Gaps = 1/105 (1%)
 Frame = -1

Query  314  WALTELLRNPKAMTKAKEEIRGIVGPTRRFEESDIDNLQYLQAVVKETLRLHPPAPFLIP  135
            WA+TELL NP+ + KAK E+  ++GP R+ EESDIDNL YLQ ++KETLRLHPP PFL+P
Sbjct  321  WAMTELLCNPETLMKAKAELTQVIGPNRKIEESDIDNLPYLQGIIKETLRLHPPVPFLLP  380

Query  134  RRAIQDTKFMGYDIPKDTQVFINVWAIGRDHESWED-PLSFKPER  3
            R+A+ DTKFMGY IPKDTQVF+N +AIGRD + W D P SFKPER
Sbjct  381  RKAMDDTKFMGYFIPKDTQVFVNAYAIGRDPDVWVDEPNSFKPER  425



>emb|CAN77400.1| hypothetical protein VITISV_015278 [Vitis vinifera]
Length=456

 Score =   317 bits (813),  Expect = 7e-99, Method: Compositional matrix adjust.
 Identities = 149/265 (56%), Positives = 202/265 (76%), Gaps = 2/265 (1%)
 Frame = -2

Query  1252  VPHQTIAAMRNKYGPVVWLRIGSVSTLAIQSAKAAAELFKNHDVPFAGRSIGDVMLAQGY  1073
             +PH+T+A +R+KYG VVWL +G++ T  +QS+KAAAELFKN D+ F+ R+I + M AQGY
Sbjct  1     MPHETLAGLRHKYGDVVWLNLGAIKTTVVQSSKAAAELFKNQDLCFSDRTITETMRAQGY  60

Query  1072  NKGSMALAQYGSYWRVLRRICSVEMFVHKKVNETAAVRRKCIDDLLRWVENEA-GSIKRG  896
             ++ S+ALA YG +WR LRR+ ++EM V K++NETA VRRKC+DD+L W+E EA G    G
Sbjct  61    HESSLALAPYGPHWRSLRRLMTMEMLVTKRINETAGVRRKCVDDMLSWIEEEARGVGGEG  120

Query  895   SGIHVTRFVFLATFNLLGNIMFSSDLVDPVSEKGSKFFNAMMGIMERGGTPNISDIFPCL  716
              GI V  FVFLA+FN+LGN+M S DL+ P S++GS+FF  M+ +ME  G PN +D FP L
Sbjct  121   RGIQVAHFVFLASFNMLGNLMLSCDLLHPGSKEGSEFFEVMVRVMEWXGHPNXADFFPWL  180

Query  715   RWLDLQGLRTKTDKDLQIALQIVSTFVQKRSKEGQDDSGKRKSDFLDVLLSFEGSGKDEP  536
             RW+D QGLR K ++DL IA++I S FVQ+R K G      +K DFLDVLL F+GSGK+EP
Sbjct  181   RWMDPQGLRKKAERDLGIAMKIASGFVQERIKRGPAAEDHKK-DFLDVLLDFQGSGKNEP  239

Query  535   PKLSEHQINIFILEMFLAGTDTTSS  461
             P++S+  +NI ILE+F+AG++TTSS
Sbjct  240   PQISDKDLNIIILEIFMAGSETTSS  264


 Score =   167 bits (423),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 76/110 (69%), Positives = 91/110 (83%), Gaps = 0/110 (0%)
 Frame = -1

Query  332  TSSTVEWALTELLRNPKAMTKAKEEIRGIVGPTRRFEESDIDNLQYLQAVVKETLRLHPP  153
            TSSTVEWALTELLR+P+ M K K E+  +VG   + EE  ID+LQYLQAVVKET RLHPP
Sbjct  262  TSSTVEWALTELLRHPZCMXKVKAELGRVVGANGKLEERHIDDLQYLQAVVKETFRLHPP  321

Query  152  APFLIPRRAIQDTKFMGYDIPKDTQVFINVWAIGRDHESWEDPLSFKPER  3
             PFL+PR+A++DT FMGY IPK+TQ+F+NVWAIGR+ E WE+P SFKPER
Sbjct  322  IPFLVPRKAVRDTNFMGYHIPKNTQLFVNVWAIGREAELWEEPSSFKPER  371



>gb|KCW48764.1| hypothetical protein EUGRSUZ_K02408, partial [Eucalyptus grandis]
Length=443

 Score =   315 bits (807),  Expect = 3e-98, Method: Compositional matrix adjust.
 Identities = 147/266 (55%), Positives = 198/266 (74%), Gaps = 2/266 (1%)
 Frame = -2

Query  1252  VPHQTIAAMRNKYGPVVWLRIGSVSTLAIQSAKAAAELFKNHDVPFAGRSIGDVMLAQGY  1073
             +PH+T+A +R KYGPV+WLR+GS+ T+ I S++ AAE FKNHD+ F  R+I D+M +Q Y
Sbjct  1     MPHRTLAGLREKYGPVIWLRLGSIDTMVILSSRVAAEFFKNHDLNFVERTITDLMQSQEY  60

Query  1072  NKGSMALAQYGSYWRVLRRICSVEMFVHKKVNETAAVRRKCIDDLLRWVENEAGS--IKR  899
              KGS+ALA YG+YWRV RR+ + +M V +++NETA ++RKC+DD+L W+   A +  ++ 
Sbjct  61    CKGSIALAPYGTYWRVSRRLLTADMLVARRLNETAPIQRKCVDDMLTWIGEAASTDKVRL  120

Query  898   GSGIHVTRFVFLATFNLLGNIMFSSDLVDPVSEKGSKFFNAMMGIMERGGTPNISDIFPC  719
             G G+H+ RFVFL  FNLLGN+M S DL+DP S+ GS+FF AM G+ME  G   I+D+FP 
Sbjct  121   GEGVHLARFVFLMAFNLLGNLMLSRDLLDPDSKVGSEFFEAMSGLMEWSGHVTIADLFPW  180

Query  718   LRWLDLQGLRTKTDKDLQIALQIVSTFVQKRSKEGQDDSGKRKSDFLDVLLSFEGSGKDE  539
             LRWL  QGLR K D+D+  A++I S FV++R +E +      + DFLDVLL FEG+GKDE
Sbjct  181   LRWLGPQGLRRKMDRDMGKAMRIASDFVRERIEEKKIGGNDDRRDFLDVLLEFEGNGKDE  240

Query  538   PPKLSEHQINIFILEMFLAGTDTTSS  461
             P KLSE QI  FILEMFLAG +T+SS
Sbjct  241   PAKLSEKQIKTFILEMFLAGAETSSS  266


 Score =   167 bits (422),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 74/110 (67%), Positives = 93/110 (85%), Gaps = 0/110 (0%)
 Frame = -1

Query  332  TSSTVEWALTELLRNPKAMTKAKEEIRGIVGPTRRFEESDIDNLQYLQAVVKETLRLHPP  153
            +SSTVEWALTELLR+P +M K + E+  +VG  R+ +E+DID L YLQAVVKETLRLHPP
Sbjct  264  SSSTVEWALTELLRDPNSMAKVQAELSRVVGSNRKVQETDIDQLSYLQAVVKETLRLHPP  323

Query  152  APFLIPRRAIQDTKFMGYDIPKDTQVFINVWAIGRDHESWEDPLSFKPER  3
             PFL+PR+A+ +T FMGYDIPK+TQVF+N WAIGR+ + WEDP++FKPER
Sbjct  324  LPFLVPRKAMANTIFMGYDIPKNTQVFVNSWAIGREPDVWEDPMAFKPER  373



>ref|XP_011094433.1| PREDICTED: cytochrome P450 76A1-like [Sesamum indicum]
Length=511

 Score =   239 bits (611),  Expect(2) = 9e-98, Method: Compositional matrix adjust.
 Identities = 115/274 (42%), Positives = 174/274 (64%), Gaps = 4/274 (1%)
 Frame = -2

Query  1273  NMLDLGSVPHQTIAAMRNKYGPVVWLRIGSVSTLAIQSAKAAAELFKNHDVPFAGRSIGD  1094
             N+ DLG +PHQT   ++ KYGPV+WL++G+V+T+ +QSA+ A ELFK  D+PFA R   D
Sbjct  47    NIFDLGEIPHQTFYQLQAKYGPVIWLKLGAVNTMVVQSAETATELFKKCDLPFADRKAPD  106

Query  1093  VMLAQGYNKGSMALAQYGSYWRVLRRICSVEMFVHKKVNETAAVRRKCIDDLLRWVENEA  914
              + A  Y++GS+A+  Y  YWR LRRIC  E  VHK+V+ +  +RR C++  ++W++ + 
Sbjct  107   SLTALDYHQGSVAIGAYREYWRTLRRICMTEFLVHKRVDASIPIRRNCLEKTIKWIKEDV  166

Query  913   GSIKRGSG---IHVTRFVFLATFNLLGNIMFSSDLVDPVSEKGSKFFNAMMGIMERGGTP  743
                K+  G   I + RF+FL +FN++GN+M S ++++   +K  +FF+A +  +E  G P
Sbjct  167   EKSKKNGGSGEIQLDRFLFLNSFNIIGNLMLSREVMESKLDKAGEFFDAFVLFLEWCGKP  226

Query  742   NISDIFPCLRWLDLQGLRTKTDKDLQIALQIVSTFVQKRSKEGQDDSGKRKSDFLDVLLS  563
             N++D F  L+W D Q +R  T+K L+  L   S  V++R +E Q    K ++DFLD LL 
Sbjct  227   NMADSFQFLKWADPQRIRKNTEKYLERLLGFASEIVKERIQEKQSGKVKERNDFLDALLD  286

Query  562   FEGSGKDE-PPKLSEHQINIFILEMFLAGTDTTS  464
              E   K E   KLS   + I +LEMF  GT+TTS
Sbjct  287   EEDDIKAEGADKLSVKNVTIVLLEMFFGGTETTS  320


 Score =   147 bits (370),  Expect(2) = 9e-98, Method: Compositional matrix adjust.
 Identities = 66/114 (58%), Positives = 86/114 (75%), Gaps = 0/114 (0%)
 Frame = -1

Query  344  NTALTSSTVEWALTELLRNPKAMTKAKEEIRGIVGPTRRFEESDIDNLQYLQAVVKETLR  165
             T  TS T+EW + ELLR+P +M K +EEI  +VG +R  EESD++ L YLQA VKE LR
Sbjct  315  GTETTSGTIEWGMAELLRHPSSMKKIQEEIDRVVGRSRMVEESDLNKLPYLQATVKEILR  374

Query  164  LHPPAPFLIPRRAIQDTKFMGYDIPKDTQVFINVWAIGRDHESWEDPLSFKPER  3
            L+PP   L+PR+A++DT+FMGY +PK+TQ+ +N WAI RD  +W DPLSFKPER
Sbjct  375  LYPPLQMLLPRKAMEDTEFMGYVVPKNTQILVNAWAIHRDPAAWSDPLSFKPER  428



>ref|XP_009603940.1| PREDICTED: cytochrome P450 76A2-like [Nicotiana tomentosiformis]
Length=511

 Score =   315 bits (806),  Expect = 4e-97, Method: Compositional matrix adjust.
 Identities = 152/271 (56%), Positives = 212/271 (78%), Gaps = 2/271 (1%)
 Frame = -2

Query  1273  NMLDLGSVPHQTIAAMRNKYGPVVWLRIGSVSTLAIQSAKAAAELFKNHDVPFAGRSIGD  1094
             NM +LG+ PH+T+ +++ KYG VVWL++GS++T+ I SA+AAAE FKNHDV FA RS+ +
Sbjct  49    NMFELGNEPHKTLMSLKQKYGSVVWLKLGSINTMVILSAEAAAEFFKNHDVAFAERSVTE  108

Query  1093  VMLAQGYNKGSMALAQYGSYWRVLRRICSVEMFVHKKVNETAAVRRKCIDDLLRWVENEA  914
             VM + GY+KGS+ALA YG+YWR+++RI +V+M V+K++NET  +RRKCIDDL  W+ NE 
Sbjct  109   VMKSHGYHKGSLALAPYGTYWRIMKRIMTVQMLVNKRINETVDIRRKCIDDLTEWINNE-  167

Query  913   GSIKRGSGIHVTRFVFLATFNLLGNIMFSSDLVDPVSEKGSKFFNAMMGIMERGGTPNIS  734
             G I    GIHV +F+FLA+FN+LGN++ S +LVDP SEKGS+FF AM+ +ME  G  NI 
Sbjct  168   GRINSSGGIHVAKFIFLASFNMLGNLLLSRELVDPKSEKGSEFFTAMVELMECSGHQNIV  227

Query  733   DIFPCLRWLDLQGLRTKTDKDLQIALQIVSTFVQKRSKEGQDDSGKRKSDFLDVLLSFEG  554
             D+FP LRW+D QGLR K D+ L   ++IVS F+ +R +E  + +G++K DFL+VLL +EG
Sbjct  228   DVFPWLRWIDPQGLRKKMDRGLGKTIEIVSGFLNERFEE-LERTGEKKKDFLEVLLEYEG  286

Query  553   SGKDEPPKLSEHQINIFILEMFLAGTDTTSS  461
              GKDEP KLS+ ++ + ILE+FLAG++TTSS
Sbjct  287   KGKDEPEKLSDQELILIILEIFLAGSETTSS  317


 Score =   172 bits (437),  Expect = 7e-44, Method: Compositional matrix adjust.
 Identities = 78/111 (70%), Positives = 98/111 (88%), Gaps = 1/111 (1%)
 Frame = -1

Query  332  TSSTVEWALTELLRNPKAMTKAKEEIRGIVGPT-RRFEESDIDNLQYLQAVVKETLRLHP  156
            TSS++EWA+TELL NP+AM K K E+  ++G T ++FEE++IDNL+YLQAVVKETLRLHP
Sbjct  315  TSSSIEWAMTELLSNPEAMDKVKAELTEVLGNTNKKFEETNIDNLKYLQAVVKETLRLHP  374

Query  155  PAPFLIPRRAIQDTKFMGYDIPKDTQVFINVWAIGRDHESWEDPLSFKPER  3
            P PFL+PR+AIQ+T+F+GY+IPKDTQVF+NVWAIGRD E W+DP  FKPER
Sbjct  375  PIPFLVPRKAIQETEFLGYNIPKDTQVFVNVWAIGRDPECWKDPFDFKPER  425



>ref|XP_002528644.1| cytochrome P450, putative [Ricinus communis]
 gb|EEF33747.1| cytochrome P450, putative [Ricinus communis]
Length=514

 Score =   238 bits (608),  Expect(2) = 2e-96, Method: Compositional matrix adjust.
 Identities = 127/275 (46%), Positives = 175/275 (64%), Gaps = 9/275 (3%)
 Frame = -2

Query  1273  NMLDLGSVPHQTIAAMRNKYGPVVWLRIGSVSTLAIQSAKAAAELFKNHDVPFAGRSIGD  1094
             NM  LG  P Q+ A +   +GP++ + +GS+ T+ I S + A ++FKNHD   AGR I +
Sbjct  48    NMFQLGLSPQQSFAKLAGIHGPIMTIWLGSMCTVVISSNEVARDMFKNHDAVLAGRKILE  107

Query  1093  VMLAQGYNKGSMALAQYGSYWRVLRRICSVEMFVHKKVNETAAVRRKCIDDLLRWVENEA  914
              M  +G N+GSM  AQYG +WR+LRR+ + E F   +++    VR +CID ++++VE EA
Sbjct  108   AMKGEGNNEGSMITAQYGQHWRMLRRLSTTEFFAASRLDSFQGVRSRCIDRMVQFVE-EA  166

Query  913   GSIKRGS-GIHVTRFVFLATFNLLGNIMFSSDLVDPVSEKGSKFFNAMMGIMERGGTPNI  737
             G  + G+  I V RFVFL  FNLLGN+MFS DL+DP SEKG+KFF     +ME  G PNI
Sbjct  167   G--RNGTQAIDVGRFVFLMAFNLLGNLMFSKDLLDPKSEKGAKFFYHAGKVMELTGRPNI  224

Query  736   SDIFPCLRWLDLQGLRTKTDKDLQIALQIVSTFVQKR---SKEGQDDSGKRKSDFLDVLL  566
             +D  P  +W D QG+R      ++ A +I S F+++R    + G  D GK+K DFLDVLL
Sbjct  225   ADFVPIFKWFDPQGIRRNAQFHVERAFEIASGFIRERMETMENGGSDEGKKK-DFLDVLL  283

Query  565   SFEGSGKDEPPKLSEHQINIFILEMFLAGTDTTSS  461
              F G   +E  + S   INI I EMF+AGTDTT+S
Sbjct  284   EFRGH-NEETYRFSSKTINIIIFEMFMAGTDTTTS  317


 Score =   143 bits (361),  Expect(2) = 2e-96, Method: Compositional matrix adjust.
 Identities = 64/114 (56%), Positives = 81/114 (71%), Gaps = 0/114 (0%)
 Frame = -1

Query  344  NTALTSSTVEWALTELLRNPKAMTKAKEEIRGIVGPTRRFEESDIDNLQYLQAVVKETLR  165
             T  T+S +EWA+ ELL NPK +   + EIR  + P  + EE DIDNL YL+AV+KE LR
Sbjct  311  GTDTTTSILEWAMAELLHNPKELENVQAEIRSTIEPNNKLEEKDIDNLPYLKAVIKEALR  370

Query  164  LHPPAPFLIPRRAIQDTKFMGYDIPKDTQVFINVWAIGRDHESWEDPLSFKPER  3
            LHPP PFL+P  A+   K  GY IPK+TQ+ +NVWAIGRD + W+ PL+FKPER
Sbjct  371  LHPPLPFLVPHMAMDSCKMQGYYIPKETQILVNVWAIGRDPKIWDKPLNFKPER  424



>ref|XP_003520677.1| PREDICTED: cytochrome P450 76A2-like [Glycine max]
Length=516

 Score =   311 bits (797),  Expect = 7e-96, Method: Compositional matrix adjust.
 Identities = 142/271 (52%), Positives = 199/271 (73%), Gaps = 0/271 (0%)
 Frame = -2

Query  1273  NMLDLGSVPHQTIAAMRNKYGPVVWLRIGSVSTLAIQSAKAAAELFKNHDVPFAGRSIGD  1094
             NM  LG +PH+T+  +R+K+GPVVWL+IG+++T+AI SA+AA   FK+HD  FA R+I +
Sbjct  52    NMFQLGDMPHRTLTNLRDKFGPVVWLKIGAMNTMAILSAEAATVFFKHHDHAFADRTITE  111

Query  1093  VMLAQGYNKGSMALAQYGSYWRVLRRICSVEMFVHKKVNETAAVRRKCIDDLLRWVENEA  914
             +M    Y+K S+ALA YG YWR++RR+ +V+M V K++N+TA++RRKC++D++ WV  EA
Sbjct  112   IMRVHNYDKSSLALAPYGPYWRLMRRLVTVDMLVSKRINDTASIRRKCVNDMINWVAKEA  171

Query  913   GSIKRGSGIHVTRFVFLATFNLLGNIMFSSDLVDPVSEKGSKFFNAMMGIMERGGTPNIS  734
                + G G+HV+RFVFL TFNL GN+M S DL DP SE GS+FF+AMMG+ME  G  N++
Sbjct  172   SKSEHGRGVHVSRFVFLMTFNLFGNLMLSRDLFDPESEDGSEFFSAMMGLMEWTGHANVT  231

Query  733   DIFPCLRWLDLQGLRTKTDKDLQIALQIVSTFVQKRSKEGQDDSGKRKSDFLDVLLSFEG  554
             D+FP L WLD QGLR K D+D+  AL I S FV++R ++       +  DFLDVL+ F+ 
Sbjct  232   DLFPWLSWLDPQGLRRKMDRDMGKALGIASRFVKQRLEQQLHRGTNKSRDFLDVLIDFQS  291

Query  553   SGKDEPPKLSEHQINIFILEMFLAGTDTTSS  461
             +   E   +S+  +NIFILEMFLAG++TTSS
Sbjct  292   TNSQEALNVSDKDLNIFILEMFLAGSETTSS  322


 Score =   158 bits (400),  Expect = 7e-39, Method: Compositional matrix adjust.
 Identities = 73/110 (66%), Positives = 87/110 (79%), Gaps = 0/110 (0%)
 Frame = -1

Query  332  TSSTVEWALTELLRNPKAMTKAKEEIRGIVGPTRRFEESDIDNLQYLQAVVKETLRLHPP  153
            TSST+EWA+TELL N + + K K E+  +VG  R  EESDID L YLQ VVKETLRLHPP
Sbjct  320  TSSTIEWAMTELLCNRECLLKVKRELSWVVGCGREVEESDIDKLPYLQGVVKETLRLHPP  379

Query  152  APFLIPRRAIQDTKFMGYDIPKDTQVFINVWAIGRDHESWEDPLSFKPER  3
             P L+PR+A +DT+FMGY IPKDTQVF+N WAIGRD  +W++PL FKPER
Sbjct  380  IPLLVPRKATEDTEFMGYYIPKDTQVFVNAWAIGRDPSAWDEPLVFKPER  429



>ref|XP_002528645.1| cytochrome P450, putative [Ricinus communis]
 gb|EEF33748.1| cytochrome P450, putative [Ricinus communis]
Length=502

 Score =   310 bits (795),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 149/271 (55%), Positives = 205/271 (76%), Gaps = 4/271 (1%)
 Frame = -2

Query  1273  NMLDLGSVPHQTIAAMRNKYGPVVWLRIGSVSTLAIQSAKAAAELFKNHDVPFAGRSIGD  1094
             N+LDLGSVPH T+  +R KYG ++ LR+G+++T+ I SAKAA+ELFKNHD+ FA R +  
Sbjct  46    NLLDLGSVPHSTLTDLRQKYGDILGLRLGAINTVVILSAKAASELFKNHDLTFAERFLTI  105

Query  1093  VMLAQGYNKGSMALAQYGSYWRVLRRICSVEMFVHKKVNETAAVRRKCIDDLLRWVENEA  914
              M   GY++GS+ALA YGSYWRV++R+ +V+M V KK+NETA VRRKC+DD+LRW+E E+
Sbjct  106   TMRVHGYDQGSLALAPYGSYWRVMKRLVTVDMLVSKKINETAFVRRKCMDDMLRWIEGES  165

Query  913   GSIKRGSGIHVTRFVFLATFNLLGNIMFSSDLVDPVSEKGSKFFNAMMGIMERGGTPNIS  734
                 +G G  V RFVFL + NLLGN+M S +LVDP S +G++FF ++ G+ E  G  N++
Sbjct  166   ---YKGCGSQVARFVFLMSTNLLGNLMLSCNLVDPESREGTQFFRSITGLTEASGYANVA  222

Query  733   DIFPCLRWLDLQGLRTKTDKDLQIALQIVSTFVQKRSKEGQDDSGKRKSDFLDVLLSFEG  554
             D  P L+WLD QGL++K +++L  AL+I S FV++R +E +    KRK DFLDVLL  EG
Sbjct  223   DYLPWLKWLDPQGLKSKMERELGKALEIASQFVKERIEEKKLGEDKRK-DFLDVLLEHEG  281

Query  553   SGKDEPPKLSEHQINIFILEMFLAGTDTTSS  461
             +GKDEP K+S+  +NIFILE+F+AG +TTSS
Sbjct  282   NGKDEPDKISDRDLNIFILEIFIAGAETTSS  312


 Score =   172 bits (437),  Expect = 5e-44, Method: Compositional matrix adjust.
 Identities = 78/110 (71%), Positives = 92/110 (84%), Gaps = 0/110 (0%)
 Frame = -1

Query  332  TSSTVEWALTELLRNPKAMTKAKEEIRGIVGPTRRFEESDIDNLQYLQAVVKETLRLHPP  153
            TSS++EWA+TELL NP+ M KAK E+  ++G  R+ EESDIDNL +LQAVVKETLRLHPP
Sbjct  310  TSSSIEWAMTELLCNPEPMRKAKAELASVIGANRKVEESDIDNLPFLQAVVKETLRLHPP  369

Query  152  APFLIPRRAIQDTKFMGYDIPKDTQVFINVWAIGRDHESWEDPLSFKPER  3
             PFL+PRRA QDTKFMGY IP++TQV +N WAIGRD + W DPLSFKPER
Sbjct  370  IPFLVPRRATQDTKFMGYHIPENTQVLVNAWAIGRDKDVWNDPLSFKPER  419



>gb|KHN18720.1| Cytochrome P450 76A2 [Glycine soja]
Length=516

 Score =   311 bits (796),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 142/271 (52%), Positives = 199/271 (73%), Gaps = 0/271 (0%)
 Frame = -2

Query  1273  NMLDLGSVPHQTIAAMRNKYGPVVWLRIGSVSTLAIQSAKAAAELFKNHDVPFAGRSIGD  1094
             NM  LG +PH+T+  +R+K+GPVVWL+IG+++T+AI SA+AA   FK+HD  FA R+I +
Sbjct  52    NMFQLGDMPHRTLTNLRDKFGPVVWLKIGAMNTMAIFSAEAATVFFKHHDHAFADRTITE  111

Query  1093  VMLAQGYNKGSMALAQYGSYWRVLRRICSVEMFVHKKVNETAAVRRKCIDDLLRWVENEA  914
             +M    Y+K S+ALA YG YWR++RR+ +V+M V K++N+TA++RRKC++D++ WV  EA
Sbjct  112   IMRVHNYDKSSLALAPYGPYWRLMRRLVTVDMLVSKRINDTASIRRKCVNDMINWVAKEA  171

Query  913   GSIKRGSGIHVTRFVFLATFNLLGNIMFSSDLVDPVSEKGSKFFNAMMGIMERGGTPNIS  734
                + G G+HV+RFVFL TFNL GN+M S DL DP SE GS+FF+AMMG+ME  G  N++
Sbjct  172   SKSEHGRGVHVSRFVFLMTFNLFGNLMLSRDLFDPESEDGSEFFSAMMGLMEWTGHANVT  231

Query  733   DIFPCLRWLDLQGLRTKTDKDLQIALQIVSTFVQKRSKEGQDDSGKRKSDFLDVLLSFEG  554
             D+FP L WLD QGLR K D+D+  AL I S FV++R ++       +  DFLDVL+ F+ 
Sbjct  232   DLFPWLSWLDPQGLRRKMDRDMGKALGIASRFVKQRLEQQLHRGTNKSRDFLDVLIDFQS  291

Query  553   SGKDEPPKLSEHQINIFILEMFLAGTDTTSS  461
             +   E   +S+  +NIFILEMFLAG++TTSS
Sbjct  292   TNSQEALNVSDKDLNIFILEMFLAGSETTSS  322


 Score =   158 bits (399),  Expect = 8e-39, Method: Compositional matrix adjust.
 Identities = 73/110 (66%), Positives = 87/110 (79%), Gaps = 0/110 (0%)
 Frame = -1

Query  332  TSSTVEWALTELLRNPKAMTKAKEEIRGIVGPTRRFEESDIDNLQYLQAVVKETLRLHPP  153
            TSST+EWA+TELL N + + K K E+  +VG  R  EESDID L YLQ VVKETLRLHPP
Sbjct  320  TSSTIEWAMTELLCNRECLLKVKRELSWVVGCGREVEESDIDKLPYLQGVVKETLRLHPP  379

Query  152  APFLIPRRAIQDTKFMGYDIPKDTQVFINVWAIGRDHESWEDPLSFKPER  3
             P L+PR+A +DT+FMGY IPKDTQVF+N WAIGRD  +W++PL FKPER
Sbjct  380  IPLLVPRKATEDTEFMGYYIPKDTQVFVNAWAIGRDPSAWDEPLVFKPER  429



>ref|XP_004249632.1| PREDICTED: cytochrome P450 76A2-like [Solanum lycopersicum]
Length=507

 Score =   310 bits (794),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 150/271 (55%), Positives = 213/271 (79%), Gaps = 3/271 (1%)
 Frame = -2

Query  1273  NMLDLGSVPHQTIAAMRNKYGPVVWLRIGSVSTLAIQSAKAAAELFKNHDVPFAGRSIGD  1094
             +ML+LG+ PH+T+  ++ KYGPVVWL++GS++T+ I SAKAA E F+NHD+ FA RS+ +
Sbjct  47    SMLELGNEPHKTLMDLKQKYGPVVWLKLGSINTMVILSAKAAGEFFRNHDMAFAERSVTE  106

Query  1093  VMLAQGYNKGSMALAQYGSYWRVLRRICSVEMFVHKKVNETAAVRRKCIDDLLRWVENEA  914
             VM + GY+KGS+ALA YG+YWR+++RI +V+M V+K++ ET  VRRKCIDDL+ W+EN  
Sbjct  107   VMKSHGYDKGSLALAPYGTYWRIMKRIMTVQMLVNKRITETVEVRRKCIDDLIEWIENRE  166

Query  913   GSIKRGSGIHVTRFVFLATFNLLGNIMFSSDLVDPVSEKGSKFFNAMMGIMERGGTPNIS  734
              S     GIHV +FVFLA+FN+LG ++ S +LVDP SEKG++FF AM+G+ME  G  NI 
Sbjct  167   FS--SSEGIHVAKFVFLASFNMLGKLVLSRELVDPKSEKGTEFFAAMVGLMECSGHQNIV  224

Query  733   DIFPCLRWLDLQGLRTKTDKDLQIALQIVSTFVQKRSKEGQDDSGKRKSDFLDVLLSFEG  554
             D+FP LRWLD QGLR K D+ L   ++IVS F+++R +E ++ +G++K DFL+VLL +EG
Sbjct  225   DVFPWLRWLDPQGLRRKMDRGLGKTIEIVSGFLKERFEE-RERTGEKKKDFLEVLLEYEG  283

Query  553   SGKDEPPKLSEHQINIFILEMFLAGTDTTSS  461
              GKDEP K+S+ ++ + ILE+FLAG++TTSS
Sbjct  284   KGKDEPEKISDQELILIILEIFLAGSETTSS  314


 Score =   172 bits (437),  Expect = 6e-44, Method: Compositional matrix adjust.
 Identities = 78/110 (71%), Positives = 95/110 (86%), Gaps = 0/110 (0%)
 Frame = -1

Query  332  TSSTVEWALTELLRNPKAMTKAKEEIRGIVGPTRRFEESDIDNLQYLQAVVKETLRLHPP  153
            TSS++EWA+TELL NP+AM K K E+  ++G T++FEE+DIDN +YLQAVVKETLRLHPP
Sbjct  312  TSSSIEWAMTELLCNPEAMDKVKTELSEVLGDTKKFEENDIDNHKYLQAVVKETLRLHPP  371

Query  152  APFLIPRRAIQDTKFMGYDIPKDTQVFINVWAIGRDHESWEDPLSFKPER  3
             PFL+PR+AIQDT+F+GY IPK TQVF+N WAIGRD E W+DPL FKPER
Sbjct  372  IPFLVPRKAIQDTEFVGYHIPKGTQVFVNTWAIGRDPECWKDPLDFKPER  421



>ref|XP_007162842.1| hypothetical protein PHAVU_001G185500g [Phaseolus vulgaris]
 gb|ESW34836.1| hypothetical protein PHAVU_001G185500g [Phaseolus vulgaris]
Length=515

 Score =   310 bits (794),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 143/271 (53%), Positives = 201/271 (74%), Gaps = 2/271 (1%)
 Frame = -2

Query  1273  NMLDLGSVPHQTIAAMRNKYGPVVWLRIGSVSTLAIQSAKAAAELFKNHDVPFAGRSIGD  1094
             N+  LG +PH+T+A +R K+GPVVWL+IG++ T+ I SA AA+  FK+HD  FA R+I +
Sbjct  47    NLFQLGDMPHRTLADLRAKHGPVVWLQIGAMKTMVILSADAASVFFKHHDHAFADRTITE  106

Query  1093  VMLAQGYNKGSMALAQYGSYWRVLRRICSVEMFVHKKVNETAAVRRKCIDDLLRWVENEA  914
              M A  YNK S+ALA YG YWR++RR+ +V+M V K++NETA+VRRKC++D++ W+  EA
Sbjct  107   TMRAHNYNKSSLALAPYGPYWRLMRRLVTVDMLVAKRINETASVRRKCVNDMITWLSKEA  166

Query  913   GSIKRGSGIHVTRFVFLATFNLLGNIMFSSDLVDPVSEKGSKFFNAMMGIMERGGTPNIS  734
             G ++ G G++V RFVFL +FNL GN+M S DL DP SE GS+FF AM G++E  G  N++
Sbjct  167   GKLEEGDGVYVARFVFLMSFNLFGNLMLSRDLFDPESETGSEFFAAMAGLLEWTGHANVA  226

Query  733   DIFPCLRWLDLQGLRTKTDKDLQIALQIVSTFVQKRSKEGQDDSGKRKSDFLDVLLSFEG  554
             D+FP L+WLD QGLR K D+D+  AL+I S FV++R +E + D  K   DFLDVL+ F+ 
Sbjct  227   DMFPWLKWLDPQGLRKKMDRDMGKALEIASKFVKQRLEEQRRD--KETRDFLDVLIDFQS  284

Query  553   SGKDEPPKLSEHQINIFILEMFLAGTDTTSS  461
             S  +E   +S+  +NIFILE+F+AG++TTSS
Sbjct  285   SNTEEALTISDKDLNIFILEIFMAGSETTSS  315


 Score =   167 bits (422),  Expect = 8e-42, Method: Compositional matrix adjust.
 Identities = 76/110 (69%), Positives = 89/110 (81%), Gaps = 0/110 (0%)
 Frame = -1

Query  332  TSSTVEWALTELLRNPKAMTKAKEEIRGIVGPTRRFEESDIDNLQYLQAVVKETLRLHPP  153
            TSS +EWA+TELLRN + + K K E+ G+VG  R  EESDIDNL YLQAVVKETLRLHPP
Sbjct  313  TSSIIEWAMTELLRNRECLEKVKSELDGVVGNGREIEESDIDNLPYLQAVVKETLRLHPP  372

Query  152  APFLIPRRAIQDTKFMGYDIPKDTQVFINVWAIGRDHESWEDPLSFKPER  3
             P L+PR+AI+DT+FMGYDIPKDTQV +N WAIGRD   W+ PL FKP+R
Sbjct  373  IPLLVPRKAIKDTQFMGYDIPKDTQVLVNAWAIGRDPSFWDQPLDFKPQR  422



>ref|XP_004303043.1| PREDICTED: cytochrome P450 76A2-like [Fragaria vesca subsp. vesca]
Length=512

 Score =   310 bits (793),  Expect = 3e-95, Method: Compositional matrix adjust.
 Identities = 145/275 (53%), Positives = 203/275 (74%), Gaps = 4/275 (1%)
 Frame = -2

Query  1273  NMLDLGSVPHQTIAAMRNKYGPVVWLRIGSVSTLAIQSAKAAAELFKNHDVPFAGRSIGD  1094
             NMLDLG++PH+T+  +R+++G V+WLR+G  +T+ IQSAKAA E FKNHD+ F  R+I  
Sbjct  46    NMLDLGAMPHKTLTELRHRFGSVLWLRLGVRNTMVIQSAKAATEFFKNHDLTFVERNINI  105

Query  1093  VMLAQGYNKGSMALAQYGSYWRVLRRICSVEMFVHKKVNETAAVRRKCIDDLLRWVENEA  914
                   Y+KGS+ALA YG+ WRVLRR+ +V+M  +K++NETA++RRKC++++ +W+E EA
Sbjct  106   GARVHDYHKGSLALAPYGTQWRVLRRLVTVDMLTNKRINETASIRRKCVENMQKWIEEEA  165

Query  913   GSIKRG----SGIHVTRFVFLATFNLLGNIMFSSDLVDPVSEKGSKFFNAMMGIMERGGT  746
               ++       G+HV RFVFL TFNLLGN+M S DLVDP S++G +FF+AM G+ME  G 
Sbjct  166   TKLEENGSSSEGVHVARFVFLMTFNLLGNLMLSRDLVDPNSKEGLEFFDAMRGLMETNGH  225

Query  745   PNISDIFPCLRWLDLQGLRTKTDKDLQIALQIVSTFVQKRSKEGQDDSGKRKSDFLDVLL  566
              NI+D FP LRWLD QG++ +  K +  AL+I S FV+ R KE +   G++  DFLDVLL
Sbjct  226   GNIADYFPWLRWLDPQGVKRRMKKHVGKALEIASCFVKARMKERKLVGGEKTKDFLDVLL  285

Query  565   SFEGSGKDEPPKLSEHQINIFILEMFLAGTDTTSS  461
              FE +  DE  K+S+H +NIFILE+F+AG++TTSS
Sbjct  286   DFEDNENDESAKISDHHLNIFILEIFMAGSETTSS  320


 Score =   166 bits (421),  Expect = 9e-42, Method: Compositional matrix adjust.
 Identities = 76/111 (68%), Positives = 91/111 (82%), Gaps = 1/111 (1%)
 Frame = -1

Query  332  TSSTVEWALTELLRNPKAMTKAKEEIRGIVGPTRRFEESDIDNLQYLQAVVKETLRLHPP  153
            TSST EWALTELL NP+ + KAK E+  ++GP R+ EESD+DNL YLQ ++KET RLHPP
Sbjct  318  TSSTTEWALTELLCNPETLNKAKSELNRVIGPNRKIEESDVDNLPYLQCIIKETFRLHPP  377

Query  152  APFLIPRRAIQDTKFMGYDIPKDTQVFINVWAIGRDHESWED-PLSFKPER  3
             PFL+PR+A+QDTKFMGY +PKDTQVF+N +AIGRD E W D P SFKPER
Sbjct  378  IPFLVPRKAVQDTKFMGYFVPKDTQVFVNAYAIGRDPEVWTDEPESFKPER  428



>ref|XP_009774708.1| PREDICTED: cytochrome P450 76A2-like [Nicotiana sylvestris]
Length=508

 Score =   309 bits (792),  Expect = 4e-95, Method: Compositional matrix adjust.
 Identities = 147/271 (54%), Positives = 208/271 (77%), Gaps = 2/271 (1%)
 Frame = -2

Query  1273  NMLDLGSVPHQTIAAMRNKYGPVVWLRIGSVSTLAIQSAKAAAELFKNHDVPFAGRSIGD  1094
             NM +LG+ PH+T+  ++ KYGPVVWL++GS++T+ I SA AA E FKNHDV FA RS+ +
Sbjct  47    NMFELGNEPHKTLMGLKQKYGPVVWLKLGSINTMVILSADAATEFFKNHDVAFAERSVTE  106

Query  1093  VMLAQGYNKGSMALAQYGSYWRVLRRICSVEMFVHKKVNETAAVRRKCIDDLLRWVENEA  914
             VM + GY+KGS+ALA YG+YWR+++RI +V+M ++K++N+T  +RRKCIDDL+ W+ NE 
Sbjct  107   VMKSHGYHKGSLALAPYGTYWRIMKRIMTVQMLINKRINQTVDIRRKCIDDLIEWINNE-  165

Query  913   GSIKRGSGIHVTRFVFLATFNLLGNIMFSSDLVDPVSEKGSKFFNAMMGIMERGGTPNIS  734
             G +    GIHV +F+FLA+FN+LG ++ S +LVDP SE GS+FF AM+  ME  G  NI 
Sbjct  166   GRVNSSGGIHVAKFIFLASFNMLGKLLLSRELVDPKSENGSEFFTAMVEFMECSGHQNIV  225

Query  733   DIFPCLRWLDLQGLRTKTDKDLQIALQIVSTFVQKRSKEGQDDSGKRKSDFLDVLLSFEG  554
             D+FP LRW+D QGLR K D+ L   ++IVS F+ +R +E +  +G++K DFL+VLL +EG
Sbjct  226   DVFPWLRWIDPQGLRKKMDRGLGKTIEIVSGFLNERFEESE-RTGEKKKDFLEVLLEYEG  284

Query  553   SGKDEPPKLSEHQINIFILEMFLAGTDTTSS  461
              GKDE  KLS+H++ + ILE+FLAG++TTSS
Sbjct  285   KGKDEQEKLSDHELILIILEIFLAGSETTSS  315


 Score =   174 bits (442),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 78/110 (71%), Positives = 93/110 (85%), Gaps = 0/110 (0%)
 Frame = -1

Query  332  TSSTVEWALTELLRNPKAMTKAKEEIRGIVGPTRRFEESDIDNLQYLQAVVKETLRLHPP  153
            TSS++EWA+TELL NP+AM K K E+  ++G  ++ EE DIDNL+YLQ VVKETLRLHPP
Sbjct  313  TSSSIEWAMTELLSNPEAMNKVKAELAEVLGNNKKLEEVDIDNLKYLQVVVKETLRLHPP  372

Query  152  APFLIPRRAIQDTKFMGYDIPKDTQVFINVWAIGRDHESWEDPLSFKPER  3
             PFL+PR+AIQ+T+FMGY IPKDTQVF+NVWAIGRD E WEDP  FKPER
Sbjct  373  IPFLVPRKAIQETEFMGYTIPKDTQVFVNVWAIGRDPECWEDPFDFKPER  422



>ref|XP_002277746.1| PREDICTED: cytochrome P450 76A1 [Vitis vinifera]
Length=509

 Score =   308 bits (790),  Expect = 7e-95, Method: Compositional matrix adjust.
 Identities = 146/272 (54%), Positives = 198/272 (73%), Gaps = 2/272 (1%)
 Frame = -2

Query  1273  NMLDLGSVPHQTIAAMRNKYGPVVWLRIGSVSTLAIQSAKAAAELFKNHDVPFAGRSIGD  1094
             N+ DLG++PHQ +A +R+ YG VVWL +G + T+ +QS+KAAAELFKNHD+ F+ RSI +
Sbjct  46    NIFDLGTLPHQKLAGLRDTYGDVVWLNLGYIGTMVVQSSKAAAELFKNHDLSFSDRSIHE  105

Query  1093  VMLAQGYNKGSMALAQYGSYWRVLRRICSVEMFVHKKVNETAAVRRKCIDDLLRWVENEA  914
              M    YN+ S++LA YG YWR LRR+ +V+M   K++NET  +RRKC+DDLL W+E EA
Sbjct  106   TMRVHQYNESSLSLAPYGPYWRSLRRLVTVDMLTMKRINETVPIRRKCVDDLLLWIEEEA  165

Query  913   -GSIKRGSGIHVTRFVFLATFNLLGNIMFSSDLVDPVSEKGSKFFNAMMGIMERGGTPNI  737
              G     +G+ + RF FLATFN++GN+M S DL+DP S KGS+FF AM   ME  G  N 
Sbjct  166   RGMDGTATGLELGRFFFLATFNMIGNLMLSRDLLDPQSRKGSEFFTAMRISMESSGHTNF  225

Query  736   SDIFPCLRWLDLQGLRTKTDKDLQIALQIVSTFVQKRSKEGQDDSGKRKSDFLDVLLSFE  557
             +D FP L+WLD QGL+ + + DL  +++I S FV++R ++G+ +  KRK DFLDVLL F+
Sbjct  226   ADFFPWLKWLDPQGLKKRMEVDLGKSIEIASGFVKERMRQGRAEESKRK-DFLDVLLEFQ  284

Query  556   GSGKDEPPKLSEHQINIFILEMFLAGTDTTSS  461
             G GKDE  K+SE  INIFI EMF+A ++TTSS
Sbjct  285   GDGKDEATKISEKGINIFITEMFMAASETTSS  316


 Score =   171 bits (433),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 77/110 (70%), Positives = 95/110 (86%), Gaps = 0/110 (0%)
 Frame = -1

Query  332  TSSTVEWALTELLRNPKAMTKAKEEIRGIVGPTRRFEESDIDNLQYLQAVVKETLRLHPP  153
            TSST+EWA+TELLR+P++MTK K E+  ++G  R+ EESD+D+L YL AVVKETLRLHP 
Sbjct  314  TSSTMEWAMTELLRSPESMTKVKAELGRVIGEKRKLEESDLDDLPYLHAVVKETLRLHPA  373

Query  152  APFLIPRRAIQDTKFMGYDIPKDTQVFINVWAIGRDHESWEDPLSFKPER  3
            APFL+PRRA++DTKFMGY IPK TQVF+NVWAIGR+ E+W+D L FKPER
Sbjct  374  APFLVPRRAVEDTKFMGYHIPKGTQVFVNVWAIGREAETWDDALCFKPER  423



>ref|XP_004305369.1| PREDICTED: cytochrome P450 76A2-like [Fragaria vesca subsp. vesca]
Length=517

 Score =   308 bits (788),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 146/276 (53%), Positives = 200/276 (72%), Gaps = 5/276 (2%)
 Frame = -2

Query  1273  NMLDLGSVPHQTIAAMRNKYGPVVWLRIGSVSTLAIQSAKAAAELFKNHDVPFAGRSIGD  1094
             NMLDLG +PH+T   +R+ +GPV+WLRIG+ +T+AI SAKAA E FKNHD+ FA RS+ +
Sbjct  45    NMLDLGQMPHKTQTKLRHTFGPVIWLRIGARNTMAILSAKAATEFFKNHDISFAERSVTE  104

Query  1093  VMLAQGYNKGSMALAQYGSYWRVLRRICSVEMFVHKKVNETAAVRRKCIDDLLRWVENEA  914
                   Y+KGS+ALA YGS+WR+LRR+ +V++  +K++N+TAA+R KC+D++ +W+E EA
Sbjct  105   GSKVLDYHKGSLALAPYGSHWRLLRRLLTVDILTNKRINDTAAIRSKCVDNMQKWIEEEA  164

Query  913   GSIKRGS----GIHVTRFVFLATFNLLGNIMFSSDLVDPVSEKGSKFFNAMMGIMERGGT  746
               ++       G+H+ RFVFL +FNLLGN++ S DLVDP SE+G +FF  M G+ME  G 
Sbjct  165   SKLQENGTSSRGVHLARFVFLMSFNLLGNLLLSRDLVDPNSEEGLEFFELMKGVMETNGL  224

Query  745   PNISDIFPCLRWLDLQGLRTKTDKDLQIALQIVSTFVQKRSKEGQDDSG-KRKSDFLDVL  569
              N++D FP LRW D QG++ +  KDL   L++ S FV+ R  E     G K   DFLDVL
Sbjct  225   ANMADYFPWLRWFDPQGVKKRMKKDLAKLLELASGFVKVRLHERLLVGGEKTNKDFLDVL  284

Query  568   LSFEGSGKDEPPKLSEHQINIFILEMFLAGTDTTSS  461
             L F+G+G DEP K+S+H INIFILE+FLAG +TTSS
Sbjct  285   LEFQGNGIDEPTKISDHDINIFILEIFLAGAETTSS  320


 Score =   162 bits (410),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 77/111 (69%), Positives = 91/111 (82%), Gaps = 1/111 (1%)
 Frame = -1

Query  332  TSSTVEWALTELLRNPKAMTKAKEEIRGIVGPTRRFEESDIDNLQYLQAVVKETLRLHPP  153
            TSST+EWA+TELL NP+ + KAK E+R ++G  R+  ESDIDNL YLQ +VKETLRLHPP
Sbjct  318  TSSTIEWAMTELLCNPETLIKAKTELRQVIGQNRKMNESDIDNLPYLQVIVKETLRLHPP  377

Query  152  APFLIPRRAIQDTKFMGYDIPKDTQVFINVWAIGRDHESWED-PLSFKPER  3
             PFLIPR+AI DTKFMGY IPK+TQVF+N +AIGRD + W D P SFKPER
Sbjct  378  VPFLIPRKAILDTKFMGYFIPKNTQVFVNAYAIGRDPDVWIDEPDSFKPER  428



>gb|AJD25180.1| cytochrome P450 CYP76A36 [Salvia miltiorrhiza]
Length=513

 Score =   307 bits (786),  Expect = 4e-94, Method: Compositional matrix adjust.
 Identities = 139/279 (50%), Positives = 203/279 (73%), Gaps = 9/279 (3%)
 Frame = -2

Query  1273  NMLDLGSVPHQTIAAMRNKYGPVVWLRIGSVSTLAIQSAKAAAELFKNHDVPFAGRSIGD  1094
             NM +LG +PH+TIA +  ++GPVVWLRIGS+ T+ +Q+A AAA+LFKNHD  F  R+I +
Sbjct  45    NMFELGPMPHKTIAGLSREHGPVVWLRIGSIDTMVVQTAAAAADLFKNHDASFVERTITE  104

Query  1093  VMLAQGYNKGSMALAQYGSYWRVLRRICSVEMFVHKKVNETAAVRRKCIDDLLRWVENEA  914
             VM A G+++ +++L+  G YWR ++R+ + EM V K++ E+ AVRR+C+ D++ W+  EA
Sbjct  105   VMRAHGFDRAAVSLSPPGPYWRAMKRMMTAEMLVQKRIGESEAVRRRCVGDMVEWIGREA  164

Query  913   GS--------IKRGSGIHVTRFVFLATFNLLGNIMFSSDLVDPVSEKGSKFFNAMMGIME  758
             G            G G+HV RFVFLA+FN+L N+M S DLV P +E+GS+FF AM+ +M 
Sbjct  165   GKGNAVRASRTCDGGGVHVARFVFLASFNMLANLMLSQDLVSPDAEEGSEFFAAMIELMS  224

Query  757   RGGTPNISDIFPCLRWLDLQGLRTKTDKDLQIALQIVSTFVQKRSKEGQDDSGKRKSDFL  578
               G PNI D+FPCLRWLD QGLR K D+ +   L+IV+ FV+KR +E + +   +K DFL
Sbjct  225   CSGQPNIVDLFPCLRWLDPQGLRRKIDRGMGKTLKIVAGFVEKRIREKKSNPNSKK-DFL  283

Query  577   DVLLSFEGSGKDEPPKLSEHQINIFILEMFLAGTDTTSS  461
             +VLL + G+G+DE  ++S+HQ++I I+E+FLAG++TTSS
Sbjct  284   EVLLEYRGNGEDESDQISDHQLHIIIMEVFLAGSETTSS  322


 Score =   158 bits (399),  Expect = 9e-39, Method: Compositional matrix adjust.
 Identities = 69/110 (63%), Positives = 90/110 (82%), Gaps = 0/110 (0%)
 Frame = -1

Query  332  TSSTVEWALTELLRNPKAMTKAKEEIRGIVGPTRRFEESDIDNLQYLQAVVKETLRLHPP  153
            TSST+EWA+ ELL +P+AM  A+ E+  +VG  +RFEE+ ID+L YLQAV+KETLRLHPP
Sbjct  320  TSSTIEWAMVELLSHPEAMAAARSELARVVGEGKRFEEAHIDDLPYLQAVMKETLRLHPP  379

Query  152  APFLIPRRAIQDTKFMGYDIPKDTQVFINVWAIGRDHESWEDPLSFKPER  3
             PFL+PRRA+++  FMGY IPK+TQ+F+N WAIGRD + WE+  +FKPER
Sbjct  380  IPFLVPRRAVREVNFMGYQIPKNTQLFVNAWAIGRDPQRWEEAAAFKPER  429



>gb|AJD25179.1| cytochrome P450 CYP76A35 [Salvia miltiorrhiza]
Length=503

 Score =   242 bits (618),  Expect(2) = 8e-94, Method: Compositional matrix adjust.
 Identities = 131/291 (45%), Positives = 190/291 (65%), Gaps = 3/291 (1%)
 Frame = -2

Query  1333  RNKSRSGRlppgppglpvlGNMLDLGSVPHQTIAAMRNKYGPVVWLRIGSVSTLAIQSAK  1154
             +N+S   RLPPGPPG P++GN+ DLG+ PH+    ++++YGPV+WL++G+++T+ +QSA 
Sbjct  25    KNRSSKLRLPPGPPGWPIIGNIFDLGTQPHRDFHILQSRYGPVLWLKLGNLNTVVVQSAA  84

Query  1153  AAAELFKNHDVPFAGRSIGDVMLAQGYNKGSMALAQYGSYWRVLRRICSVEMFVHKKVNE  974
             AAAELFK +D+ FA R   D M A  Y  GS+A A Y  YWR+LRR+ S E+ V K++N 
Sbjct  85    AAAELFKRNDLAFADRKTPDSMTACDYINGSLAQAPYNEYWRILRRLSSSELMVQKRINS  144

Query  973   TAAVRRKCIDDLLRWVENEAGSIKRGSGIHVTRFVFLATFNLLGNIMFSSDLVDPVSEKG  794
             +A  R+KCID +++W+  +A        I + R++ + +FNL+ N M + D++D  SE G
Sbjct  145   SAQQRKKCIDKMIQWIREDASEF---GEIQLDRYLLIMSFNLVSNFMLTRDIMDFKSEMG  201

Query  793   SKFFNAMMGIMERGGTPNISDIFPCLRWLDLQGLRTKTDKDLQIALQIVSTFVQKRSKEG  614
             ++F  AM   +   G PN+ D F  L+WLD QG+R +T   L+  L++VS  V++R +E 
Sbjct  202   NEFLEAMHNFISWQGKPNVVDAFEFLKWLDPQGIRRRTKTHLEQLLKMVSVVVKERIQER  261

Query  613   QDDSGKRKSDFLDVLLSFEGSGKDEPPKLSEHQINIFILEMFLAGTDTTSS  461
                 G    DFLD LL +EG GK    KLSE  INI ILEMF  GT+TTS+
Sbjct  262   NLQKGNGTRDFLDALLDYEGDGKGSVEKLSEKNINIIILEMFFGGTETTSN  312


 Score =   131 bits (329),  Expect(2) = 8e-94, Method: Compositional matrix adjust.
 Identities = 70/114 (61%), Positives = 88/114 (77%), Gaps = 0/114 (0%)
 Frame = -1

Query  344  NTALTSSTVEWALTELLRNPKAMTKAKEEIRGIVGPTRRFEESDIDNLQYLQAVVKETLR  165
             T  TS+T  WA+ ELLR+P +M K K EI  +VGP+R  EE D++ L YLQAV +ET+R
Sbjct  306  GTETTSNTTVWAMAELLRSPDSMRKLKAEIDRVVGPSRAVEEDDLNELTYLQAVAEETMR  365

Query  164  LHPPAPFLIPRRAIQDTKFMGYDIPKDTQVFINVWAIGRDHESWEDPLSFKPER  3
            LHPP P L+PR+A +DTKFMGY+IPKDT + +N WAI RD +SW+DPLSFKPER
Sbjct  366  LHPPLPMLLPRKAREDTKFMGYNIPKDTTLIVNAWAIHRDPDSWDDPLSFKPER  419



>ref|XP_011101481.1| PREDICTED: cytochrome P450 76A1 [Sesamum indicum]
 ref|XP_011101482.1| PREDICTED: cytochrome P450 76A1 [Sesamum indicum]
Length=511

 Score =   228 bits (582),  Expect(2) = 1e-92, Method: Compositional matrix adjust.
 Identities = 114/271 (42%), Positives = 170/271 (63%), Gaps = 4/271 (1%)
 Frame = -2

Query  1273  NMLDLGSVPHQTIAAMRNKYGPVVWLRIGSVSTLAIQSAKAAAELFKNHDVPFAGRSIGD  1094
              +L     PHQ+ A +  K+GPV+ L +GS++T+ I S++AA  +FKNHDV  AGR I +
Sbjct  51    QLLGAAFAPHQSFAKLAKKHGPVMTLHLGSMTTVVISSSEAARVMFKNHDVVLAGRKIYE  110

Query  1093  VMLAQGYNKGSMALAQYGSYWRVLRRICSVEMFVHKKVNETAAVRRKCIDDLLRWVENEA  914
              M ++  N+GS+  AQYG  WR+LRR+C+ E F    ++    VR KC+  +++++ + A
Sbjct  111   SMKSEIGNEGSLITAQYGPRWRMLRRLCTTEFFAAAPLDAMRGVRAKCVHQMVQYIRDAA  170

Query  913   GSIKRGSGIHVTRFVFLATFNLLGNIMFSSDLVDPVSEKGSKFFNAMMGIMERGGTPNIS  734
              +   G GI V RF FL  FNL+GN++FS DL+DP SE G+KFF      ME  G PN++
Sbjct  171   AN---GLGIDVGRFFFLMAFNLIGNLIFSKDLLDPESETGAKFFYHAGKAMEFAGKPNVA  227

Query  733   DIFPCLRWLDLQGLRTKTDKDLQIALQIVSTFVQKRSKEGQDDSGKRKSDFLDVLLSFEG  554
             D  P L+ +D QG+R +T   ++    I   F+++R ++G     KR+ D+LDVLL + G
Sbjct  228   DFLPMLKRVDPQGIRRRTQFHVKRGFDIAGEFLKERMEKGSSVEKKRR-DYLDVLLEYGG  286

Query  553   SGKDEPPKLSEHQINIFILEMFLAGTDTTSS  461
              G++E    +   INI + EMF AGTDTT+S
Sbjct  287   DGEEEHVGFAPTTINIIVFEMFSAGTDTTTS  317


 Score =   141 bits (355),  Expect(2) = 1e-92, Method: Compositional matrix adjust.
 Identities = 58/114 (51%), Positives = 86/114 (75%), Gaps = 0/114 (0%)
 Frame = -1

Query  344  NTALTSSTVEWALTELLRNPKAMTKAKEEIRGIVGPTRRFEESDIDNLQYLQAVVKETLR  165
             T  T+ST+EWA+ ELL NP+ + K + E+R  + P ++ +E D+++L YL+AV+KETLR
Sbjct  311  GTDTTTSTLEWAMAELLHNPQTLHKVQAELRTAIPPGKKLQEEDLEHLPYLRAVIKETLR  370

Query  164  LHPPAPFLIPRRAIQDTKFMGYDIPKDTQVFINVWAIGRDHESWEDPLSFKPER  3
            LHPP PFL+P  A+     +G+ +PK+TQ+ +NVWAIGRD ++W+DPL F+PER
Sbjct  371  LHPPLPFLVPHMAMDSCNMLGFHVPKETQILVNVWAIGRDPKTWKDPLEFRPER  424



>gb|EYU29599.1| hypothetical protein MIMGU_mgv1a026574mg [Erythranthe guttata]
Length=500

 Score =   301 bits (771),  Expect = 3e-92, Method: Compositional matrix adjust.
 Identities = 139/273 (51%), Positives = 202/273 (74%), Gaps = 8/273 (3%)
 Frame = -2

Query  1273  NMLDLGSVPHQTIAAMRNKYGPVVWLRIGSVSTLAIQSAKAAAELFKNHDVPFAGRSIGD  1094
             NM  LGS+PH+TIA +++ YGPVVWLRIGS++T+A+ +A AAAELFKNHD  FA R+I D
Sbjct  43    NMFQLGSMPHKTIAGLKSHYGPVVWLRIGSINTMALLTAGAAAELFKNHDASFAERTITD  102

Query  1093  VMLAQGYNKGSMALAQYGSYWRVLRRICSVEMFVHKKVNETAAVRRKCIDDLLRWVENEA  914
             VM +  ++K +++L+ YG YWR ++R+ +VEM VHK++ ET  +RR+C+ ++++W++NE+
Sbjct  103   VMTSHNFHKAALSLSPYGPYWRSMKRMMTVEMLVHKRIVETEPIRRRCVSNMVQWIQNES  162

Query  913   GSIKRGSGIHVTRFVFLATFNLLGNIMFSSDLVDPVSEKGSKFFNAMMGIMERGGTPNIS  734
              S   G G+HV RFVFLA+FN+LGN+M S DLV P SE+GS+FF AM+ +ME  G PNI 
Sbjct  163   SS-SGGHGVHVARFVFLASFNMLGNLMLSRDLVSPESEEGSEFFAAMIDMMEWSGHPNIG  221

Query  733   DIFPCLRWLDLQGLRTKTDKDLQIALQIVSTFVQKRSKEGQDDSGKRKSDFLDVLLSFEG  554
             D+FP ++W+D QGLR   ++ +   L+IV  FV++R       S     DFL+VLL +EG
Sbjct  222   DLFPWMKWMDPQGLRRNAERGMGKILKIVGGFVEERQ-----SSNANNKDFLEVLLKYEG  276

Query  553   SGK--DEPPKLSEHQINIFILEMFLAGTDTTSS  461
              G   D+  ++S+H +NI I+E+FLAG++TTSS
Sbjct  277   DGGKIDDQRQISDHDLNIIIMEVFLAGSETTSS  309


 Score =   165 bits (418),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 77/110 (70%), Positives = 88/110 (80%), Gaps = 0/110 (0%)
 Frame = -1

Query  332  TSSTVEWALTELLRNPKAMTKAKEEIRGIVGPTRRFEESDIDNLQYLQAVVKETLRLHPP  153
            TSST EWA+ ELL +P+AM KAK E+  +VG    FEES ID L YLQAV+KETLRLHPP
Sbjct  307  TSSTTEWAMVELLSHPEAMNKAKVELDEVVGKGNTFEESHIDKLPYLQAVLKETLRLHPP  366

Query  152  APFLIPRRAIQDTKFMGYDIPKDTQVFINVWAIGRDHESWEDPLSFKPER  3
             PFL+PRRAI +T FMGY IPKDTQ+F+N W IGRD E W+DPLSFKPER
Sbjct  367  IPFLVPRRAIHETDFMGYRIPKDTQLFVNAWVIGRDPECWDDPLSFKPER  416



>gb|EYU38602.1| hypothetical protein MIMGU_mgv1a006828mg [Erythranthe guttata]
Length=430

 Score =   220 bits (560),  Expect(2) = 1e-91, Method: Compositional matrix adjust.
 Identities = 110/239 (46%), Positives = 157/239 (66%), Gaps = 1/239 (0%)
 Frame = -2

Query  1174  LAIQSAKAAAELFKNHDVPFAGRSIGDVMLAQGYNKGSMALAQYGSYWRVLRRICSVEMF  995
             + +QSA+AAAELFK +D+P+A R + D + A  Y+KGS+A+  YG+YWR LRRIC+ E  
Sbjct  1     MVVQSAEAAAELFKKYDLPYADRKVPDSLTALDYHKGSVAIGAYGAYWRKLRRICTTEFL  60

Query  994   VHKKVNETAAVRRKCIDDLLRWVENEAGSIKRGSGIHVTRFVFLATFNLLGNIMFSSDLV  815
             VHK+VN +  +R+KCIDDL+ W++ E+     G GI + RF+F+ +FN +GNIM S D+V
Sbjct  61    VHKRVNASMKLRQKCIDDLVGWIKEESEKEYSGGGIRLDRFLFVTSFNAIGNIMLSKDVV  120

Query  814   DPVSEKGSKFFNAMMGIMERGGTPNISDIFPCLRWLDLQGLRTKTDKDLQIALQIVSTFV  635
                 +  S+FF+  +  +E  G PNI+D  P L+W+D Q +R  ++K L+  L+I S FV
Sbjct  121   QSKEKVSSEFFDLFITFLEWIGKPNIADFVPFLKWVDPQRIRRNSEKYLERLLEIASGFV  180

Query  634   QKRSKEGQDDSGKRKSDFLDVLLSFEGSGKDE-PPKLSEHQINIFILEMFLAGTDTTSS  461
              +R +E +    K   DFLD LL  EG    + P KL+   INI +LEMF  GT+TTSS
Sbjct  181   NERIEEKKSGKEKETHDFLDALLDDEGDDVAQGPEKLTVKNINILLLEMFFGGTETTSS  239


 Score =   146 bits (369),  Expect(2) = 1e-91, Method: Compositional matrix adjust.
 Identities = 64/114 (56%), Positives = 87/114 (76%), Gaps = 0/114 (0%)
 Frame = -1

Query  344  NTALTSSTVEWALTELLRNPKAMTKAKEEIRGIVGPTRRFEESDIDNLQYLQAVVKETLR  165
             T  TSSTVEW ++EL+RNP  M K +EE+  +VG  R+ EE+D++N+ YLQA VKE +R
Sbjct  233  GTETTSSTVEWGMSELMRNPDQMAKLREEVDRVVGRDRKVEETDLNNMPYLQATVKEIMR  292

Query  164  LHPPAPFLIPRRAIQDTKFMGYDIPKDTQVFINVWAIGRDHESWEDPLSFKPER  3
            LHP  P L+PR ++Q+T+FMGY +PKDTQ+ +N +AI RD  SW DP++FKPER
Sbjct  293  LHPVFPLLLPRNSMQETEFMGYVVPKDTQILVNTYAIQRDPGSWADPIAFKPER  346



>gb|KEH24104.1| cytochrome P450 family protein [Medicago truncatula]
Length=519

 Score =   300 bits (769),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 140/272 (51%), Positives = 199/272 (73%), Gaps = 3/272 (1%)
 Frame = -2

Query  1273  NMLDLGSVPHQTIAAMRNKYGPVVWLRIGSVSTLAIQSAKAAAELFKNHDVPFAGRSIGD  1094
             NM  LG +PH+T+  +R KYGPV+WL+IG+V+T+AI SAK A   FKNHD  F+ R++ +
Sbjct  58    NMFQLGEMPHRTLTNLRQKYGPVLWLKIGAVNTMAILSAKEATIFFKNHDHNFSDRTVIE  117

Query  1093  VMLAQGYNKGSMALAQYGSYWRVLRRICSVEMFVHKKVNETAAVRRKCIDDLLRWVENEA  914
              M A  Y+K S+ALA YG YWR++RR+ +V+M V K++N+TA++RR+C++D+L W+  EA
Sbjct  118   TMRAHNYDKSSLALAPYGPYWRLMRRLVTVDMLVMKRINDTASIRRRCVNDMLTWIAKEA  177

Query  913   GSIKRGSGIHVTRFVFLATFNLLGNIMFSSDLVDPVSEKGSKFFNAMMGIMERGGTPNIS  734
               ++ G G+HV+RFVF  +FNL GN+M S D+ D  SE GS+FF A+MG++E  G  N+S
Sbjct  178   RELEAGRGLHVSRFVFFMSFNLFGNLMLSRDMFDMKSESGSEFFTAVMGLLEWTGHANVS  237

Query  733   DIFPCLRWLDLQGLRTKTDKDLQIALQIVSTFVQKR-SKEGQDDSGKRKSDFLDVLLSFE  557
             D+FP LRWLD QGLR K D+D+  A++I STFV++R   E + D   R  DFLDVLL F+
Sbjct  238   DLFPWLRWLDPQGLRRKMDRDMGKAIEIASTFVKERLDLEVERDEKSR--DFLDVLLEFQ  295

Query  556   GSGKDEPPKLSEHQINIFILEMFLAGTDTTSS  461
              +   +   +S+  +N+FILEMFLAG++TTSS
Sbjct  296   RNENQDAVNISDKDLNVFILEMFLAGSETTSS  327


 Score =   157 bits (396),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 73/110 (66%), Positives = 88/110 (80%), Gaps = 1/110 (1%)
 Frame = -1

Query  332  TSSTVEWALTELLRNPKAMTKAKEEIRGIVGPTRRFEESDIDNLQYLQAVVKETLRLHPP  153
            TSST+EWA+TELL N   M K K E+  ++G T+  EESDID L YLQ VVKETLRLHPP
Sbjct  325  TSSTIEWAMTELLCNRDCMLKLKTELSSVIG-TKDVEESDIDKLPYLQGVVKETLRLHPP  383

Query  152  APFLIPRRAIQDTKFMGYDIPKDTQVFINVWAIGRDHESWEDPLSFKPER  3
             P L+PR+A+QDT+FMGY +PKDTQVF+N WAIGRD + W++PL FKPER
Sbjct  384  IPLLVPRKAVQDTEFMGYFVPKDTQVFVNTWAIGRDPDVWDEPLVFKPER  433



>ref|XP_011100232.1| PREDICTED: cytochrome P450 76A2-like [Sesamum indicum]
Length=547

 Score =   301 bits (771),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 146/274 (53%), Positives = 199/274 (73%), Gaps = 4/274 (1%)
 Frame = -2

Query  1273  NMLDLGSVPHQTIAAMRNKYGPVVWLRIGSVSTLAIQSAKAAAELFKNHDVPFAGRSIGD  1094
             NM DLGS+PH+T+A ++  YGPVVWLRIGS++T+A+ +AKAAAELFKNHD  FA R+I +
Sbjct  79    NMFDLGSMPHKTVAGLKKDYGPVVWLRIGSINTVALLTAKAAAELFKNHDANFAERTITE  138

Query  1093  VMLAQGYNKGSMALAQYGSYWRVLRRICSVEMFVHKKVNETAAVRRKCIDDLLRWVENEA  914
             VM    ++K +++L+ YGSYWRV++RI +VEM V K++ ET  +RR+CI D++ W+  EA
Sbjct  139   VMKVHDFHKTALSLSPYGSYWRVMKRIMTVEMLVQKRIKETEPIRRRCIGDMVEWINKEA  198

Query  913   GSIKRGSG--IHVTRFVFLATFNLLGNIMFSSDLVDPVSEKGSKFFNAMMGIMERGGTPN  740
              +   G    IHV RFVFLA+FN+LGN+M S DLV P S +GS+FF AM+ +ME  G PN
Sbjct  199   KAAAGGESGRIHVARFVFLASFNMLGNLMLSRDLVSPESVEGSEFFAAMIELMEWSGHPN  258

Query  739   ISDIFPCLRWLDLQGLRTKTDKDLQIALQIVSTFVQKRSKEGQDDSGKRKSDFLDVLLSF  560
             I D+FP L+WLD QGLR   ++ +   L+IV  FV +R KE Q   G  K DFL+VLL  
Sbjct  259   IVDLFPWLKWLDPQGLRRNAERGMARTLKIVGRFVAERLKERQLGGGAGK-DFLEVLLEC  317

Query  559   EGS-GKDEPPKLSEHQINIFILEMFLAGTDTTSS  461
             EG+   D+   +SEH++N+ I E+FLAG++TTSS
Sbjct  318   EGNRNDDQRHNISEHELNVIITEVFLAGSETTSS  351


 Score =   166 bits (421),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 74/110 (67%), Positives = 93/110 (85%), Gaps = 0/110 (0%)
 Frame = -1

Query  332  TSSTVEWALTELLRNPKAMTKAKEEIRGIVGPTRRFEESDIDNLQYLQAVVKETLRLHPP  153
            TSS++EWA+ ELL +P+ M KAK E+  +VG + +FEES I++L YLQAV+KETLRLHPP
Sbjct  349  TSSSIEWAMVELLSHPEIMRKAKNELARVVGKSNKFEESHIESLPYLQAVLKETLRLHPP  408

Query  152  APFLIPRRAIQDTKFMGYDIPKDTQVFINVWAIGRDHESWEDPLSFKPER  3
             PFL+PRRAIQ+T FMGY IPK+TQ+F+N W+IGRD E W+DPLSFKPER
Sbjct  409  IPFLVPRRAIQETNFMGYQIPKNTQLFVNAWSIGRDPECWDDPLSFKPER  458



>emb|CBI30225.3| unnamed protein product [Vitis vinifera]
Length=1065

 Score =   308 bits (789),  Expect = 6e-90, Method: Compositional matrix adjust.
 Identities = 146/272 (54%), Positives = 198/272 (73%), Gaps = 2/272 (1%)
 Frame = -2

Query  1273  NMLDLGSVPHQTIAAMRNKYGPVVWLRIGSVSTLAIQSAKAAAELFKNHDVPFAGRSIGD  1094
             N+ DLG++PHQ +A +R+ YG VVWL +G + T+ +QS+KAAAELFKNHD+ F+ RSI +
Sbjct  576   NIFDLGTLPHQKLAGLRDTYGDVVWLNLGYIGTMVVQSSKAAAELFKNHDLSFSDRSIHE  635

Query  1093  VMLAQGYNKGSMALAQYGSYWRVLRRICSVEMFVHKKVNETAAVRRKCIDDLLRWVENEA  914
              M    YN+ S++LA YG YWR LRR+ +V+M   K++NET  +RRKC+DDLL W+E EA
Sbjct  636   TMRVHQYNESSLSLAPYGPYWRSLRRLVTVDMLTMKRINETVPIRRKCVDDLLLWIEEEA  695

Query  913   -GSIKRGSGIHVTRFVFLATFNLLGNIMFSSDLVDPVSEKGSKFFNAMMGIMERGGTPNI  737
              G     +G+ + RF FLATFN++GN+M S DL+DP S KGS+FF AM   ME  G  N 
Sbjct  696   RGMDGTATGLELGRFFFLATFNMIGNLMLSRDLLDPQSRKGSEFFTAMRISMESSGHTNF  755

Query  736   SDIFPCLRWLDLQGLRTKTDKDLQIALQIVSTFVQKRSKEGQDDSGKRKSDFLDVLLSFE  557
             +D FP L+WLD QGL+ + + DL  +++I S FV++R ++G+ +  KRK DFLDVLL F+
Sbjct  756   ADFFPWLKWLDPQGLKKRMEVDLGKSIEIASGFVKERMRQGRAEESKRK-DFLDVLLEFQ  814

Query  556   GSGKDEPPKLSEHQINIFILEMFLAGTDTTSS  461
             G GKDE  K+SE  INIFI EMF+A ++TTSS
Sbjct  815   GDGKDEATKISEKGINIFITEMFMAASETTSS  846


 Score =   235 bits (599),  Expect = 4e-64, Method: Compositional matrix adjust.
 Identities = 121/266 (45%), Positives = 168/266 (63%), Gaps = 9/266 (3%)
 Frame = -2

Query  1273  NMLDLGSVPHQTIAAMRNKYGPVVWLRIGSVSTLAIQSAKAAAELFKNHDVPFAGRSIGD  1094
             N+  LG  PH + A +  K+GP++ L +GS+ST+ I S + A E+FKNHDV  AGR I +
Sbjct  65    NIFQLGWAPHVSFAKLAGKHGPIMTLWLGSMSTVVISSNEVAREMFKNHDVVLAGRKIYE  124

Query  1093  VMLAQGYNKGSMALAQYGSYWRVLRRICSVEMFVHKKVNETAAVRRKCIDDLLRWVENEA  914
              M     N+GS+  AQYG  WR+LRR+C+ E FV  +++    VR  CID ++++V  EA
Sbjct  125   AMKGDRGNEGSIITAQYGPQWRMLRRLCTSEFFVTSRLDAMRGVRGGCIDRMVQFV-TEA  183

Query  913   GSIKRGSGIH---VTRFVFLATFNLLGNIMFSSDLVDPVSEKGSKFFNAMMGIMERGGTP  743
             G+    SG H   V RF+FL  FNL+GN+MFS DL+DP SE+G++FF     +ME  G P
Sbjct  184   GT----SGTHAIDVGRFIFLMAFNLIGNLMFSKDLLDPKSERGAEFFYHAGKVMELAGRP  239

Query  742   NISDIFPCLRWLDLQGLRTKTDKDLQIALQIVSTFVQKRSKEGQDDSGKRKS-DFLDVLL  566
             N++D  P LRW D QG+R KT   ++ A  I   F+++R +     SG+ KS DFLDVLL
Sbjct  240   NVADFLPILRWFDPQGIRRKTQFHVERAFAIAGGFIKERMETMAKGSGEAKSKDFLDVLL  299

Query  565   SFEGSGKDEPPKLSEHQINIFILEMF  488
              F G G +EP + S   IN+ + EMF
Sbjct  300   EFRGDGVEEPSRFSSRTINVIVFEMF  325


 Score =   171 bits (434),  Expect = 5e-42, Method: Compositional matrix adjust.
 Identities = 77/110 (70%), Positives = 95/110 (86%), Gaps = 0/110 (0%)
 Frame = -1

Query  332  TSSTVEWALTELLRNPKAMTKAKEEIRGIVGPTRRFEESDIDNLQYLQAVVKETLRLHPP  153
            TSST+EWA+TELLR+P++MTK K E+  ++G  R+ EESD+D+L YL AVVKETLRLHP 
Sbjct  844  TSSTMEWAMTELLRSPESMTKVKAELGRVIGEKRKLEESDLDDLPYLHAVVKETLRLHPA  903

Query  152  APFLIPRRAIQDTKFMGYDIPKDTQVFINVWAIGRDHESWEDPLSFKPER  3
            APFL+PRRA++DTKFMGY IPK TQVF+NVWAIGR+ E+W+D L FKPER
Sbjct  904  APFLVPRRAVEDTKFMGYHIPKGTQVFVNVWAIGREAETWDDALCFKPER  953


 Score =   139 bits (349),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 60/106 (57%), Positives = 79/106 (75%), Gaps = 0/106 (0%)
 Frame = -1

Query  320  VEWALTELLRNPKAMTKAKEEIRGIVGPTRRFEESDIDNLQYLQAVVKETLRLHPPAPFL  141
            +EWA+ ELL  P+ + K + E+R +V P  + EE D++NL YL AV+KETLRLHPP PFL
Sbjct  336  LEWAMAELLHTPRILNKVQAELRSVVKPGSKLEEKDMENLPYLIAVIKETLRLHPPLPFL  395

Query  140  IPRRAIQDTKFMGYDIPKDTQVFINVWAIGRDHESWEDPLSFKPER  3
            +P  A+   K +GY IPK+TQV +NVWAIGRD ++W+DPL F PER
Sbjct  396  VPHMAMNSCKMLGYCIPKETQVLVNVWAIGRDPKTWKDPLVFMPER  441



>ref|XP_004494132.1| PREDICTED: cytochrome P450 76A2-like [Cicer arietinum]
Length=511

 Score =   296 bits (757),  Expect = 6e-90, Method: Compositional matrix adjust.
 Identities = 138/273 (51%), Positives = 198/273 (73%), Gaps = 5/273 (2%)
 Frame = -2

Query  1273  NMLDLGSVPHQTIAAMRNKYGPVVWLRIGSVSTLAIQSAKAAAELFKNHDVPFAGRSIGD  1094
             NM  LG +PH+T+  +R KYGP++WL+IG+V+T+AI SAK A   FKNHD  F+ R++ +
Sbjct  48    NMFQLGEMPHRTLTNLREKYGPILWLKIGAVNTMAILSAKEATIFFKNHDHAFSDRTVIE  107

Query  1093  VMLAQGYNKGSMALAQYGSYWRVLRRICSVEMFVHKKVNETAAVRRKCIDDLLRWVENEA  914
              M    Y+K S+ALA YGSYWR++RR+ +V+M V K++N+T ++RRKC++D+L WV  EA
Sbjct  108   TMRVHNYDKSSLALAPYGSYWRLMRRLVTVDMLVLKRINDTVSIRRKCVNDMLAWVAKEA  167

Query  913   GS--IKRGSGIHVTRFVFLATFNLLGNIMFSSDLVDPVSEKGSKFFNAMMGIMERGGTPN  740
              +  ++ G G+HV RF+F  +FN+ GN+M S DL D  SE GS+FF A+MG+ME  G  N
Sbjct  168   RARELEDGRGLHVARFIFFMSFNMFGNLMLSRDLFDMESENGSEFFAAVMGMMEWTGHAN  227

Query  739   ISDIFPCLRWLDLQGLRTKTDKDLQIALQIVSTFVQKRSKEGQDDSGKRKSDFLDVLLSF  560
             ++D+FP LRWLD QGLR K D+D+  AL+I STFV++R +  +D+  +   DFLDVLL F
Sbjct  228   VADLFPWLRWLDPQGLRRKMDRDMGKALEIASTFVKERLEVERDEVSR---DFLDVLLEF  284

Query  559   EGSGKDEPPKLSEHQINIFILEMFLAGTDTTSS  461
             + +       +S+  +NIFILEMFLAG++TT+S
Sbjct  285   QRNENQHALNISDKDLNIFILEMFLAGSETTTS  317


 Score =   156 bits (394),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 72/110 (65%), Positives = 88/110 (80%), Gaps = 1/110 (1%)
 Frame = -1

Query  332  TSSTVEWALTELLRNPKAMTKAKEEIRGIVGPTRRFEESDIDNLQYLQAVVKETLRLHPP  153
            T+ST+EWA+TELL N   M K K E+  ++G T+  EESDID L YLQA+VKETLRLHPP
Sbjct  315  TTSTIEWAMTELLCNSNCMLKVKTELSSLIG-TKDVEESDIDKLPYLQAIVKETLRLHPP  373

Query  152  APFLIPRRAIQDTKFMGYDIPKDTQVFINVWAIGRDHESWEDPLSFKPER  3
             P L+PR+A+QDT F+GY IPKDTQVF+N WAIGRD + W++PL FKPER
Sbjct  374  IPLLVPRKAVQDTDFIGYFIPKDTQVFVNTWAIGRDPDVWDEPLVFKPER  423



>emb|CDP15344.1| unnamed protein product [Coffea canephora]
Length=282

 Score =   286 bits (732),  Expect = 3e-89, Method: Compositional matrix adjust.
 Identities = 133/237 (56%), Positives = 185/237 (78%), Gaps = 2/237 (1%)
 Frame = -2

Query  1273  NMLDLGSVPHQTIAAMRNKYGPVVWLRIGSVSTLAIQSAKAAAELFKNHDVPFAGRSIGD  1094
             NM DLGS+PH+T+A ++NKYGPVVWLRIG+++T+A+QS+KAAAELF+NHD+ F  R++ +
Sbjct  45    NMFDLGSMPHRTLAGLKNKYGPVVWLRIGAMNTMAVQSSKAAAELFRNHDISFVERTVTE  104

Query  1093  VMLAQGYNKGSMALAQYGSYWRVLRRICSVEMFVHKKVNETAAVRRKCIDDLLRWVENEA  914
              M +  ++K S++LA YGSYWRVL+R+ +VEM V+K++NET A+RRKC+DD++ W++ EA
Sbjct  105   NMKSHNFDKSSLSLAPYGSYWRVLKRMMTVEMIVNKRINETVAIRRKCVDDMVSWIKKEA  164

Query  913   GSIKRG-SGIHVTRFVFLATFNLLGNIMFSSDLVDPVSEKGSKFFNAMMGIMERGGTPNI  737
              + K    GIH+  FVFLA+FN+LGN+M S DLV+P  E+G +FF+AM+ + E  G PNI
Sbjct  165   HAGKESWRGIHLAHFVFLASFNMLGNLMLSKDLVEPEKEEGVEFFSAMVRLAEWVGHPNI  224

Query  736   SDIFPCLRWLDLQGLRTKTDKDLQIALQIVSTFVQKRSKEGQDDSGKRKSDFLDVLL  566
              D+FP LRWLD QGLR KT  ++    QIVS FV++R +E Q   G RK+DFL+VLL
Sbjct  225   VDLFPWLRWLDPQGLRKKTAGEMWKTTQIVSRFVKERLQERQ-RGGPRKNDFLEVLL  280



>gb|AIW00679.1| flavonoid 3',5'-hydroxylase, partial [Paeonia lactiflora]
Length=503

 Score =   291 bits (746),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 137/271 (51%), Positives = 193/271 (71%), Gaps = 1/271 (0%)
 Frame = -2

Query  1273  NMLDLGSVPHQTIAAMRNKYGPVVWLRIGSVSTLAIQSAKAAAELFKNHDVPFAGRSIGD  1094
             N+ DLG++PHQ++  +R+KYGPV+WL+ GS++T+ IQS KAAA+LFKNHD+ F+ R    
Sbjct  43    NLFDLGTMPHQSLYHLRSKYGPVLWLKFGSMNTMVIQSPKAAAQLFKNHDLNFSDRKCPG  102

Query  1093  VMLAQGYNKGSMALAQYGSYWRVLRRICSVEMFVHKKVNETAAVRRKCIDDLLRWVENEA  914
             V+ A  Y +G++A  +YG YWRVLRR+CS EM V K++NE A +R+KCID ++ W+E +A
Sbjct  103   VLKAHDYFQGTLAFGRYGPYWRVLRRLCSSEMLVTKRINEIAPLRQKCIDAMIGWIEKDA  162

Query  913   GSIKRGSGIHVTRFVFLATFNLLGNIMFSSDLVDPVSEKGSKFFNAMMGIMERGGTPNIS  734
                + G  + +  F+F  TFN++GN+M S DL+D  S++G  F+NAM GIME  GTPN+S
Sbjct  163   REKESGE-VKLPDFLFPMTFNVVGNLMLSRDLLDLNSKEGHDFYNAMGGIMENVGTPNLS  221

Query  733   DIFPCLRWLDLQGLRTKTDKDLQIALQIVSTFVQKRSKEGQDDSGKRKSDFLDVLLSFEG  554
             D FP LRWLDLQGL  +  +D+  A  +V  FV++R ++ Q    K + DFLD LL FEG
Sbjct  222   DFFPWLRWLDLQGLHRRMVRDMGQAKSLVGGFVKERVQDQQFGQEKERKDFLDALLEFEG  281

Query  553   SGKDEPPKLSEHQINIFILEMFLAGTDTTSS  461
               K+ P K+++   NI ILEMF AG++TTSS
Sbjct  282   DAKEWPRKMTDRNTNIIILEMFFAGSETTSS  312


 Score =   135 bits (339),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 71/110 (65%), Positives = 89/110 (81%), Gaps = 0/110 (0%)
 Frame = -1

Query  332  TSSTVEWALTELLRNPKAMTKAKEEIRGIVGPTRRFEESDIDNLQYLQAVVKETLRLHPP  153
            TSST+EW + E++R P+ M K KEE+  ++ P ++ EESD++ L YLQAVVKETLRLHP 
Sbjct  310  TSSTIEWGMAEIIRKPEIMKKVKEELERVIIPNKKVEESDVEKLPYLQAVVKETLRLHPA  369

Query  152  APFLIPRRAIQDTKFMGYDIPKDTQVFINVWAIGRDHESWEDPLSFKPER  3
             P L+PR A+QD  FMG+DIPKDTQVF+N WAIGRD +SW+DPLSFKPER
Sbjct  370  LPLLLPRNALQDVNFMGFDIPKDTQVFVNTWAIGRDPDSWDDPLSFKPER  419



>ref|XP_002283777.2| PREDICTED: cytochrome P450 76A1 [Vitis vinifera]
Length=512

 Score =   283 bits (724),  Expect = 5e-85, Method: Compositional matrix adjust.
 Identities = 126/274 (46%), Positives = 195/274 (71%), Gaps = 3/274 (1%)
 Frame = -2

Query  1273  NMLDLGSVPHQTIAAMRNKYGPVVWLRIGSVSTLAIQSAKAAAELFKNHDVPFAGRSIGD  1094
             N+ DLG++PHQT+  +R ++GPV+WL++G+++T+ +QSAKAAAELFKNHD+PF+ R++  
Sbjct  48    NIFDLGTLPHQTLHRLRPQHGPVLWLQLGAINTMVVQSAKAAAELFKNHDLPFSDRNVPF  107

Query  1093  VMLAQGYNKGSMALAQYGSYWRVLRRICSVEMFVHKKVNETAAVRRKCIDDLLRWVENEA  914
              + A  Y++GSMAL +YG YWR++R++C+ E+ V+K++NE  ++RRKC+DD++RW+E +A
Sbjct  108   TLTAHNYDQGSMALGKYGPYWRMIRKVCASELLVNKRINEMGSLRRKCVDDMIRWIEEDA  167

Query  913   ---GSIKRGSGIHVTRFVFLATFNLLGNIMFSSDLVDPVSEKGSKFFNAMMGIMERGGTP  743
                G+  R   + +  F+F   FNL+GNI  S D+VD  S+ G +FF AM G+ME  G P
Sbjct  168   AKSGAEGRAGEVELPHFLFCMAFNLIGNITLSRDVVDIKSKDGHEFFQAMNGVMEWAGRP  227

Query  742   NISDIFPCLRWLDLQGLRTKTDKDLQIALQIVSTFVQKRSKEGQDDSGKRKSDFLDVLLS  563
             NI+D FP L+ LD  G+     +D+  AL +++ FV +R +E Q    + K DFLDVLL 
Sbjct  228   NIADFFPLLKRLDPLGMMRNMVRDMGQALNLIARFVNERDEERQSGMVREKRDFLDVLLE  287

Query  562   FEGSGKDEPPKLSEHQINIFILEMFLAGTDTTSS  461
                  K+ P ++S++++ I +LEMF AG++TTSS
Sbjct  288   CRDDEKEGPHEMSDNKVKIIVLEMFFAGSETTSS  321


 Score =   138 bits (347),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 76/110 (69%), Positives = 94/110 (85%), Gaps = 0/110 (0%)
 Frame = -1

Query  332  TSSTVEWALTELLRNPKAMTKAKEEIRGIVGPTRRFEESDIDNLQYLQAVVKETLRLHPP  153
            TSST+EWA+TELLR P++M KA+EE+  +VGP  + EESDID L YLQAVVKETLRLHPP
Sbjct  319  TSSTLEWAMTELLRRPESMRKAQEELDRVVGPHGKVEESDIDQLLYLQAVVKETLRLHPP  378

Query  152  APFLIPRRAIQDTKFMGYDIPKDTQVFINVWAIGRDHESWEDPLSFKPER  3
             P L+PR A+QDT FMGY +PK+TQVF+N WAIGRD ++W++PLSFKP+R
Sbjct  379  IPLLLPRNALQDTNFMGYFVPKNTQVFVNAWAIGRDPDAWKEPLSFKPDR  428



>ref|XP_007204461.1| hypothetical protein PRUPE_ppa023213mg [Prunus persica]
 gb|EMJ05660.1| hypothetical protein PRUPE_ppa023213mg [Prunus persica]
Length=462

 Score =   280 bits (716),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 137/259 (53%), Positives = 182/259 (70%), Gaps = 16/259 (6%)
 Frame = -2

Query  1273  NMLDLGSVPHQTIAAMRNKYGPVVWLRIGSVSTLAIQSAKAAAELFKNHDVPFAGRSIGD  1094
             NM DLG++PH+T+  +  K+GPV+WLR+G+ +T+++QSAKAA+E FKNHD+ FA R+  +
Sbjct  46    NMFDLGTMPHRTLTELTPKFGPVIWLRLGARATMSVQSAKAASEFFKNHDLSFANRTTNE  105

Query  1093  VMLAQGYNKGSMALAQYGSYWRVLRRICSVEMFVHKKVNETAAVRRKCIDDLLRWVENEA  914
             V     Y+KG               R+ +V+M V+K++NETA VRRKC D+L  W+E EA
Sbjct  106   VCRVYDYHKG---------------RLMTVDMVVNKRINETAFVRRKCFDNLQLWIEEEA  150

Query  913   GSIKRGSGIHVTRFVFLATFNLLGNIMFSSDLVDPVSEKGSKFFNAMMGIMERGGTPNIS  734
               +K G G+HV RFVFL TFNLLGN+M S DLVDP S +G +FF AM G+ME  GT N++
Sbjct  151   SKLKEGHGVHVARFVFLMTFNLLGNLMLSRDLVDPKSNEGLEFFKAMNGLMEWNGTANMA  210

Query  733   DIFPCLRWLDLQGLRTKTDKDLQIALQIVSTFVQKRSKEGQDDSGKRKSDFLDVLLSFEG  554
             D FP LRWLD QGL+ K  KDL  A+QI S FV++R  E +    ++  DFLD+LL FEG
Sbjct  211   DYFPWLRWLDPQGLKRKMKKDLGKAIQIASKFVKERM-EARGMGREKTRDFLDLLLEFEG  269

Query  553   SGKDEPPKLSEHQINIFIL  497
             +G DEP K+SEH +NIFIL
Sbjct  270   NGIDEPDKISEHDLNIFIL  288


 Score =   128 bits (322),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 59/88 (67%), Positives = 71/88 (81%), Gaps = 1/88 (1%)
 Frame = -1

Query  263  EEIRGIVGPTRRFEESDIDNLQYLQAVVKETLRLHPPAPFLIPRRAIQDTKFMGYDIPKD  84
             E+  ++GP R+ EESDIDNL YLQ ++KETLRLHPP PFL+PR+A+ DT FMGY IPKD
Sbjct  291  SELTQVIGPNRKIEESDIDNLPYLQGIIKETLRLHPPIPFLLPRKAMDDTNFMGYFIPKD  350

Query  83   TQVFINVWAIGRDHESWED-PLSFKPER  3
            TQVF+N +AIGRD + W D P SFKPER
Sbjct  351  TQVFVNAYAIGRDPDVWVDEPNSFKPER  378



>ref|XP_010045880.1| PREDICTED: cytochrome P450 76A1-like, partial [Eucalyptus grandis]
Length=475

 Score =   280 bits (715),  Expect = 3e-84, Method: Compositional matrix adjust.
 Identities = 133/274 (49%), Positives = 191/274 (70%), Gaps = 3/274 (1%)
 Frame = -2

Query  1273  NMLDLGSVPHQTIAAMRNKYGPVVWLRIGSVSTLAIQSAKAAAELFKNHDVPFAGRSIGD  1094
             N+LDLG++PHQ +   R K+GPV WL++GSV+T+ IQSA+AAAE FK HD  FA R    
Sbjct  11    NILDLGTMPHQNLHNFRAKHGPVTWLKLGSVNTMVIQSAQAAAEFFKGHDSAFADRKCPH  70

Query  1093  VMLAQGYNKGSMALAQYGSYWRVLRRICSVEMFVHKKVNETAAVRRKCIDDLLRWVENE-  917
              + A GY++GS+A+ +YGSYWRVLRR+CS E+ V K+VNETA +R+KC+D++  ++E E 
Sbjct  71    ALTALGYDQGSLAIGRYGSYWRVLRRLCSAELLVTKRVNETAHLRQKCVDNMAMYLEEEM  130

Query  916   -AGSIKRGSGIHVTRFVFLATFNLLGNIMFSSDLVDPVSEKGSKFFNAMMGIMERGGTPN  740
              A  +    GI ++ F+FL TFN++GN++ S DL+DP S+ G +FF+AM   ME  G PN
Sbjct  131   AAKQVTTEQGIDLSHFLFLMTFNVVGNMVLSRDLLDPKSKDGPEFFDAMNWFMEWAGKPN  190

Query  739   ISDIFPCLRWLDLQGLRTKTDKDLQIALQIVSTFVQKRSKEGQDDSGKRKS-DFLDVLLS  563
             ++D  P L+WLD QG++    KD+  A++    FV++R +E +     R + DFLD +L 
Sbjct  191   VADFLPWLKWLDPQGIKASMAKDMGRAMKFAEGFVKERLEERKLRGEMRTTNDFLDAVLD  250

Query  562   FEGSGKDEPPKLSEHQINIFILEMFLAGTDTTSS  461
             +EG GK+ P K+S   + I ILEMF AG++TTSS
Sbjct  251   YEGDGKEGPRKISSPNVIIIILEMFFAGSETTSS  284


 Score =   133 bits (335),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 74/110 (67%), Positives = 89/110 (81%), Gaps = 0/110 (0%)
 Frame = -1

Query  332  TSSTVEWALTELLRNPKAMTKAKEEIRGIVGPTRRFEESDIDNLQYLQAVVKETLRLHPP  153
            TSST+EWA+ ELLR P +M KAK EI  IVG  R+ EESD + + +LQAVVKETLRLHPP
Sbjct  282  TSSTIEWAMAELLRQPVSMKKAKYEINQIVGLNRKLEESDTEKMPFLQAVVKETLRLHPP  341

Query  152  APFLIPRRAIQDTKFMGYDIPKDTQVFINVWAIGRDHESWEDPLSFKPER  3
             P L+PR AI++T FMG+DIPKDTQVF+N W IGRD ++WEDP +FKPER
Sbjct  342  VPLLLPRNAIKETNFMGFDIPKDTQVFVNAWGIGRDPDAWEDPSAFKPER  391



>ref|XP_002267565.2| PREDICTED: cytochrome P450 76A2-like [Vitis vinifera]
Length=512

 Score =   280 bits (715),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 125/274 (46%), Positives = 195/274 (71%), Gaps = 3/274 (1%)
 Frame = -2

Query  1273  NMLDLGSVPHQTIAAMRNKYGPVVWLRIGSVSTLAIQSAKAAAELFKNHDVPFAGRSIGD  1094
             N+ DLG++PHQT+  +R ++GPV+WL++G+++T+ +QSAKAAAELFKNHD+ F+ R++  
Sbjct  48    NIFDLGTLPHQTLYRLRPQHGPVLWLQLGAINTMVVQSAKAAAELFKNHDLSFSDRNVPF  107

Query  1093  VMLAQGYNKGSMALAQYGSYWRVLRRICSVEMFVHKKVNETAAVRRKCIDDLLRWVENEA  914
              + A  Y++GSMAL +YG YWR++R++C+ E+ V+K++NE  ++RRKC+DD++RW+E +A
Sbjct  108   TLTAHNYDQGSMALGKYGPYWRMIRKVCASELLVNKRINEMGSLRRKCVDDMIRWIEEDA  167

Query  913   ---GSIKRGSGIHVTRFVFLATFNLLGNIMFSSDLVDPVSEKGSKFFNAMMGIMERGGTP  743
                G+  R   + +  F+F   FNL+GNI  S D+VD  S+ G +FF AM G++E  G P
Sbjct  168   AKSGAEGRAGEVELPHFLFCMAFNLIGNITLSRDVVDIKSKDGHEFFQAMNGVVEWAGRP  227

Query  742   NISDIFPCLRWLDLQGLRTKTDKDLQIALQIVSTFVQKRSKEGQDDSGKRKSDFLDVLLS  563
             NI+D FP L+ LD  G+     +D+  AL +++ FV++R +E Q    + K DFLDVLL 
Sbjct  228   NIADFFPLLKRLDPLGMMRNMVRDMGQALNLIARFVKERDEERQSGMVREKRDFLDVLLE  287

Query  562   FEGSGKDEPPKLSEHQINIFILEMFLAGTDTTSS  461
                  K+ P ++S++++ I +LEMF AG+DTTSS
Sbjct  288   CRDDEKEGPHEMSDNKVKIIVLEMFFAGSDTTSS  321


 Score =   138 bits (348),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 76/110 (69%), Positives = 94/110 (85%), Gaps = 0/110 (0%)
 Frame = -1

Query  332  TSSTVEWALTELLRNPKAMTKAKEEIRGIVGPTRRFEESDIDNLQYLQAVVKETLRLHPP  153
            TSST+EWA+TELLR P++M KA+EE+  +VGP  + EESDID L YLQAVVKETLRLHPP
Sbjct  319  TSSTLEWAMTELLRRPESMRKAQEELDRVVGPHGKVEESDIDQLLYLQAVVKETLRLHPP  378

Query  152  APFLIPRRAIQDTKFMGYDIPKDTQVFINVWAIGRDHESWEDPLSFKPER  3
             P L+PR A+QDT FMGY +PK+TQVF+N WAIGRD ++W++PLSFKP+R
Sbjct  379  IPLLLPRNALQDTNFMGYFVPKNTQVFVNAWAIGRDPDAWKEPLSFKPDR  428



>gb|AHX24364.1| CYP76A26-like protein [Lonicera japonica]
Length=510

 Score =   278 bits (710),  Expect = 5e-83, Method: Compositional matrix adjust.
 Identities = 125/270 (46%), Positives = 189/270 (70%), Gaps = 2/270 (1%)
 Frame = -2

Query  1273  NMLDLGSVPHQTIAAMRNKYGPVVWLRIGSVSTLAIQSAKAAAELFKNHDVPFAGRSIGD  1094
             NM +LG +PHQT+  +R+KYGP+VWLR+GS+ TL +QS  AAAELFK HDV F+ R + D
Sbjct  49    NMFELGDLPHQTMYKLRSKYGPLVWLRLGSIHTLVVQSPAAAAELFKKHDVAFSDRKVPD  108

Query  1093  VMLAQGYNKGSMALAQYGSYWRVLRRICSVEMFVHKKVNETAAVRRKCIDDLLRWVENEA  914
              + A  +N GS+ +  YG +WRVLRR+CS+E  V+K++N+T A+RR+ +D+++ W+E E+
Sbjct  109   ALTAFNFNAGSLGMNAYGGHWRVLRRLCSMEFLVNKRMNDTTALRRRIMDNMVHWIEEES  168

Query  913   GSIKRGSGIHVTRFVFLATFNLLGNIMFSSDLVDPVSEKGSKFFNAMMGIMERGGTPNIS  734
                 R   + ++RF+FL  FNL+GN+M S DL++    +G +FF++M  ++E  GTPNI+
Sbjct  169   QGGTR--EVQLSRFLFLMAFNLVGNLMLSRDLLNAGDPEGREFFDSMNKVLELAGTPNIA  226

Query  733   DIFPCLRWLDLQGLRTKTDKDLQIALQIVSTFVQKRSKEGQDDSGKRKSDFLDVLLSFEG  554
             D  P L+WLD  G++ +  +D+   ++I S FVQ+R +E +        DFLD LL ++G
Sbjct  227   DFLPFLKWLDPLGIKKRMVEDMGKTMKISSRFVQERLQERKSGKVNDTKDFLDTLLEYKG  286

Query  553   SGKDEPPKLSEHQINIFILEMFLAGTDTTS  464
              GKD P +++E  +NI ILEMF AG++TTS
Sbjct  287   DGKDGPDEITEKNVNIVILEMFFAGSETTS  316


 Score =   134 bits (336),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 73/110 (66%), Positives = 87/110 (79%), Gaps = 0/110 (0%)
 Frame = -1

Query  332  TSSTVEWALTELLRNPKAMTKAKEEIRGIVGPTRRFEESDIDNLQYLQAVVKETLRLHPP  153
            TS ++EW   ELLRNP A+   +EEI  +VG  R+ EESD+DNL YLQAVVKETLRLHP 
Sbjct  315  TSISIEWGFAELLRNPAALKNVREEIDRVVGRERKVEESDMDNLPYLQAVVKETLRLHPA  374

Query  152  APFLIPRRAIQDTKFMGYDIPKDTQVFINVWAIGRDHESWEDPLSFKPER  3
             P L+PR  +Q+T +MGY IPKDTQVF+N WAIGRD +SWEDPL+FKPER
Sbjct  375  LPLLLPRNTMQETNYMGYLIPKDTQVFVNAWAIGRDPDSWEDPLTFKPER  424



>gb|AHX24367.1| CYP76A26-like protein [Rauvolfia serpentina]
Length=514

 Score =   277 bits (708),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 126/273 (46%), Positives = 190/273 (70%), Gaps = 3/273 (1%)
 Frame = -2

Query  1273  NMLDLGSVPHQTIAAMRNKYGPVVWLRIGSVSTLAIQSAKAAAELFKNHDVPFAGRSIGD  1094
             NM DLG +PHQT+  +R+KYGP+VWL++GS++T+ +Q+A +AAELFK HDVPF  R + D
Sbjct  49    NMFDLGDLPHQTLYKLRSKYGPIVWLQLGSINTMVVQNAVSAAELFKKHDVPFCDRKVPD  108

Query  1093  VMLAQGYNKGSMALAQYGSYWRVLRRICSVEMFVHKKVNETAAVRRKCIDDLLRWVENE-  917
              + A  +N+GS+ +  YG +WRVLRR+CS+E  V+K++NET  +RR+  D+++RW+E + 
Sbjct  109   TLTAFNFNQGSLGMNTYGGHWRVLRRLCSMEFLVNKRMNETTDLRRRIEDNMVRWIEEDS  168

Query  916   -AGSIKRGSG-IHVTRFVFLATFNLLGNIMFSSDLVDPVSEKGSKFFNAMMGIMERGGTP  743
              A   + G+G + ++RF+FL  FNL+GN+M S DL+D    +G +FF+ M  I+E  GTP
Sbjct  169   LASKAQGGTGAVQLSRFLFLMAFNLVGNLMLSRDLLDNKDPEGREFFDCMNEILELAGTP  228

Query  742   NISDIFPCLRWLDLQGLRTKTDKDLQIALQIVSTFVQKRSKEGQDDSGKRKSDFLDVLLS  563
             NI+D  P L+ LD  G++ +   ++   ++I S FVQ+R    +      K DFLDV+L 
Sbjct  229   NIADFLPFLKKLDPLGMKKRMIDNMSRTMKISSKFVQERLDNRKSGKFSEKKDFLDVMLE  288

Query  562   FEGSGKDEPPKLSEHQINIFILEMFLAGTDTTS  464
             ++G GKD P K +E  +NI I+EMF AG++TTS
Sbjct  289   YQGDGKDGPDKFTEKHVNIVIMEMFFAGSETTS  321


 Score =   156 bits (394),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 69/110 (63%), Positives = 87/110 (79%), Gaps = 0/110 (0%)
 Frame = -1

Query  332  TSSTVEWALTELLRNPKAMTKAKEEIRGIVGPTRRFEESDIDNLQYLQAVVKETLRLHPP  153
            TS ++EW  TELLRNP+A  K +EE+  +VG  R  EE+D++NL YLQAVVKETLRLHP 
Sbjct  320  TSISIEWGFTELLRNPRAFKKVREELDRVVGVNRMVEETDMENLPYLQAVVKETLRLHPA  379

Query  152  APFLIPRRAIQDTKFMGYDIPKDTQVFINVWAIGRDHESWEDPLSFKPER  3
             P L+PR  ++DT++MGY +PK TQVF+N WAIGRD E W+DPL+FKPER
Sbjct  380  LPMLLPRNTMEDTEYMGYLVPKGTQVFVNAWAIGRDSEYWDDPLTFKPER  429



>ref|XP_002528647.1| cytochrome P450, putative [Ricinus communis]
 gb|EEF33750.1| cytochrome P450, putative [Ricinus communis]
Length=512

 Score =   277 bits (708),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 127/274 (46%), Positives = 190/274 (69%), Gaps = 3/274 (1%)
 Frame = -2

Query  1273  NMLDLGSVPHQTIAAMRNKYGPVVWLRIGSVSTLAIQSAKAAAELFKNHDVPFAGRSIGD  1094
             N+ DLG++PHQT+  +R KYGPV+WLR+GS +T+ IQSA AA ELFKNHD  F  RS  D
Sbjct  45    NIFDLGTMPHQTLYKLRFKYGPVLWLRLGSKNTMVIQSAAAAEELFKNHDSSFCDRSSLD  104

Query  1093  VMLAQGYNKGSMALAQYGSYWRVLRRICSVEMFVHKKVNETAAVRRKCIDDLLRWVENE-  917
             V+ +  Y KGS+A+ +YG +WRVLRRIC++E+  +K+VNETA +RRKCID +++++E   
Sbjct  105   VLTSHNYCKGSLAIGRYGPFWRVLRRICTMELMTNKRVNETAPLRRKCIDQMIKYIEENV  164

Query  916   --AGSIKRGSGIHVTRFVFLATFNLLGNIMFSSDLVDPVSEKGSKFFNAMMGIMERGGTP  743
               A + +  + + +   +FL  FN++GN+  S DL+DP  ++G  F+ AM   M   G P
Sbjct  165   AAASAREEATEVDLVHLLFLTAFNVVGNLTLSRDLLDPHCKEGHDFYKAMDKFMVWVGRP  224

Query  742   NISDIFPCLRWLDLQGLRTKTDKDLQIALQIVSTFVQKRSKEGQDDSGKRKSDFLDVLLS  563
             NI+D  P  +W+D QGL+   ++DL  A++I+S FV++R +E +    ++  DFLDVLL 
Sbjct  225   NIADFLPFFKWIDPQGLKRNMNRDLGQAIRIISGFVKERIEENKLGKERKTKDFLDVLLD  284

Query  562   FEGSGKDEPPKLSEHQINIFILEMFLAGTDTTSS  461
             F+G GK+ P K+   ++ I +LEMF AG++TTS+
Sbjct  285   FKGDGKEAPQKIPYDKVIIIVLEMFFAGSETTST  318


 Score =   163 bits (412),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 75/110 (68%), Positives = 89/110 (81%), Gaps = 0/110 (0%)
 Frame = -1

Query  332  TSSTVEWALTELLRNPKAMTKAKEEIRGIVGPTRRFEESDIDNLQYLQAVVKETLRLHPP  153
            TS+T+EWA+ ELLR+P  M K KEE+  +VG   + EESDID L YLQAVVKETLRLHP 
Sbjct  316  TSTTMEWAMAELLRSPDKMKKLKEELDEVVGENNKVEESDIDKLPYLQAVVKETLRLHPA  375

Query  152  APFLIPRRAIQDTKFMGYDIPKDTQVFINVWAIGRDHESWEDPLSFKPER  3
             P L+PR A+QDT FMGY IPK+TQVF+N WAIGRD +SW+DPL+FKPER
Sbjct  376  IPLLLPRNAMQDTNFMGYHIPKNTQVFVNAWAIGRDPDSWKDPLTFKPER  425



>gb|AHX24365.1| CYP76A26-like protein [Cinchona calisaya]
Length=516

 Score =   276 bits (705),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 127/273 (47%), Positives = 189/273 (69%), Gaps = 3/273 (1%)
 Frame = -2

Query  1273  NMLDLGSVPHQTIAAMRNKYGPVVWLRIGSVSTLAIQSAKAAAELFKNHDVPFAGRSIGD  1094
             NM DLG +PHQT+  +R+KYGPV+WL++GS++T+ +Q+A AAAELFK HDVPFA R + D
Sbjct  51    NMFDLGDLPHQTLYRLRSKYGPVIWLQLGSINTMVVQNAVAAAELFKKHDVPFADRKVPD  110

Query  1093  VMLAQGYNKGSMALAQYGSYWRVLRRICSVEMFVHKKVNETAAVRRKCIDDLLRWVENEA  914
              + A  +N+GS+ +  +G +WRVLRR+CS+E  V+KK+NET  +RR+  D+++RW+E+E 
Sbjct  111   ALTAFEFNQGSLGMNTFGGHWRVLRRLCSMEFLVNKKMNETTDLRRRIEDNMIRWIEDEC  170

Query  913   GSIKRGSG---IHVTRFVFLATFNLLGNIMFSSDLVDPVSEKGSKFFNAMMGIMERGGTP  743
              S K   G   + ++R +FL  FNL+GN+M S DL+D    +  +FF++M  I+E  GTP
Sbjct  171   VSSKAQGGNGAVQLSRLLFLMAFNLVGNLMLSRDLLDNRDPESKEFFDSMNEILELAGTP  230

Query  742   NISDIFPCLRWLDLQGLRTKTDKDLQIALQIVSTFVQKRSKEGQDDSGKRKSDFLDVLLS  563
             NI+D  P L+ LD  G++ +   ++   ++I S FVQ+R    +      K DFLDV+L 
Sbjct  231   NIADFLPFLKRLDPLGMKKRMIANMTKTMRISSKFVQERLDNRKAGKFSDKKDFLDVMLE  290

Query  562   FEGSGKDEPPKLSEHQINIFILEMFLAGTDTTS  464
             +EG GKD P + +E  +NI I+EMF AG++TTS
Sbjct  291   YEGDGKDGPDRFTEKHVNIVIMEMFFAGSETTS  323


 Score =   128 bits (322),  Expect = 8e-29, Method: Compositional matrix adjust.
 Identities = 70/110 (64%), Positives = 84/110 (76%), Gaps = 0/110 (0%)
 Frame = -1

Query  332  TSSTVEWALTELLRNPKAMTKAKEEIRGIVGPTRRFEESDIDNLQYLQAVVKETLRLHPP  153
            TS ++EW  TELLRNP A  K +EEI  +VG  R  EESD++NL YLQA VKETLRLHP 
Sbjct  322  TSISIEWGFTELLRNPHAFKKVREEIDRVVGVNRMVEESDMENLPYLQAAVKETLRLHPA  381

Query  152  APFLIPRRAIQDTKFMGYDIPKDTQVFINVWAIGRDHESWEDPLSFKPER  3
             P L+PR   +DT +MGY++PK TQVF+N WAIGRD E W+DPL+FKPER
Sbjct  382  LPLLLPRNTAEDTDYMGYEVPKGTQVFVNAWAIGRDPEYWDDPLTFKPER  431



>ref|XP_010036187.1| PREDICTED: cytochrome P450 76A1-like [Eucalyptus grandis]
Length=506

 Score =   275 bits (703),  Expect = 5e-82, Method: Compositional matrix adjust.
 Identities = 130/274 (47%), Positives = 187/274 (68%), Gaps = 3/274 (1%)
 Frame = -2

Query  1273  NMLDLGSVPHQTIAAMRNKYGPVVWLRIGSVSTLAIQSAKAAAELFKNHDVPFAGRSIGD  1094
             N+LDLG+ PHQ +   R K+GPV WL++GSV+T+ IQSA+AAAE FK HD  FA R    
Sbjct  42    NILDLGTTPHQNLHNFRAKHGPVTWLKLGSVNTMVIQSAQAAAEFFKGHDFAFADRKCPH  101

Query  1093  VMLAQGYNKGSMALAQYGSYWRVLRRICSVEMFVHKKVNETAAVRRKCIDDLLRWVENEA  914
              + A  Y++GS+A+ +YG YWRVLRR+CSVE  V K+VNET  +R+KC+D+++ ++E E 
Sbjct  102   ALTALNYDQGSLAVGRYGGYWRVLRRLCSVEFLVTKRVNETVHLRQKCVDNVIVYLEEEM  161

Query  913   G--SIKRGSGIHVTRFVFLATFNLLGNIMFSSDLVDPVSEKGSKFFNAMMGIMERGGTPN  740
                 +    GI ++ F+FL  FN++GN++ S DL+DP S+ G +FF+AM   ME  G PN
Sbjct  162   AVKQVTTEQGIDLSHFLFLMAFNVVGNMVLSRDLLDPKSKDGPEFFDAMNRFMEWAGKPN  221

Query  739   ISDIFPCLRWLDLQGLRTKTDKDLQIALQIVSTFVQKRSKEGQDDSGKRKS-DFLDVLLS  563
             ++D  P L+WLD QG++    KD+  A++I   FV++R +E +     R + DFLD +L 
Sbjct  222   VADFLPWLKWLDPQGIKASMAKDMGRAMKIAEGFVKERLEERKLRGEMRTTNDFLDAVLD  281

Query  562   FEGSGKDEPPKLSEHQINIFILEMFLAGTDTTSS  461
             +EG GK+ P K+S   + I ILEMF AG++TTSS
Sbjct  282   YEGDGKEGPRKISSQNVIIIILEMFFAGSETTSS  315


 Score =   140 bits (353),  Expect = 7e-33, Method: Compositional matrix adjust.
 Identities = 77/110 (70%), Positives = 93/110 (85%), Gaps = 0/110 (0%)
 Frame = -1

Query  332  TSSTVEWALTELLRNPKAMTKAKEEIRGIVGPTRRFEESDIDNLQYLQAVVKETLRLHPP  153
            TSST+EWA+ ELLR P +M KAK+EI  IVG  R+ EESD + +++LQAVVKETLRLHPP
Sbjct  313  TSSTIEWAMAELLRQPVSMKKAKDEINQIVGLNRKLEESDTEKMRFLQAVVKETLRLHPP  372

Query  152  APFLIPRRAIQDTKFMGYDIPKDTQVFINVWAIGRDHESWEDPLSFKPER  3
             P LIPR AI++T FMG+DIPKDTQVF+NVW IGRD ++WEDPL+FKPER
Sbjct  373  LPLLIPRNAIKETNFMGFDIPKDTQVFVNVWGIGRDPDAWEDPLAFKPER  422



>gb|KCW84354.1| hypothetical protein EUGRSUZ_B01206 [Eucalyptus grandis]
Length=498

 Score =   274 bits (701),  Expect = 8e-82, Method: Compositional matrix adjust.
 Identities = 130/274 (47%), Positives = 187/274 (68%), Gaps = 3/274 (1%)
 Frame = -2

Query  1273  NMLDLGSVPHQTIAAMRNKYGPVVWLRIGSVSTLAIQSAKAAAELFKNHDVPFAGRSIGD  1094
             N+LDLG+ PHQ +   R K+GPV WL++GSV+T+ IQSA+AAAE FK HD  FA R    
Sbjct  42    NILDLGTTPHQNLHNFRAKHGPVTWLKLGSVNTMVIQSAQAAAEFFKGHDSAFADRKCPH  101

Query  1093  VMLAQGYNKGSMALAQYGSYWRVLRRICSVEMFVHKKVNETAAVRRKCIDDLLRWVENEA  914
              + A GY++GS+A+ +YG YWRVLRR+CS E+ V K+VNETA +R+KC+D+++ ++E E 
Sbjct  102   ALTALGYDQGSLAIGRYGGYWRVLRRLCSAELLVTKRVNETAHLRQKCVDNMVVYLEEEM  161

Query  913   G--SIKRGSGIHVTRFVFLATFNLLGNIMFSSDLVDPVSEKGSKFFNAMMGIMERGGTPN  740
                 +    GI ++ F+FL  FN++GN++ S DL+DP S+ G +FF+AM   ME  G PN
Sbjct  162   AVKQVTTEQGIDLSHFLFLMAFNVVGNMVLSRDLLDPKSKDGPEFFDAMNRFMEWAGKPN  221

Query  739   ISDIFPCLRWLDLQGLRTKTDKDLQIALQIVSTFVQKRSKEGQDDSGKRKS-DFLDVLLS  563
             ++D  P L+WLD QG++    KD+  A +    FV++R +E +     R + DFLD +L 
Sbjct  222   VADFLPWLKWLDPQGIKASMAKDMGRAKKFAEGFVKERLEERKLRGEMRTTNDFLDAVLD  281

Query  562   FEGSGKDEPPKLSEHQINIFILEMFLAGTDTTSS  461
             +EG GK+ P K+S   + I ILEMF AG++TTSS
Sbjct  282   YEGDGKEGPRKISSQNVIIIILEMFFAGSETTSS  315


 Score =   119 bits (299),  Expect = 8e-26, Method: Compositional matrix adjust.
 Identities = 70/110 (64%), Positives = 85/110 (77%), Gaps = 8/110 (7%)
 Frame = -1

Query  332  TSSTVEWALTELLRNPKAMTKAKEEIRGIVGPTRRFEESDIDNLQYLQAVVKETLRLHPP  153
            TSST+EWA+ ELLR P +M KAK+EI  IVG        D + + +LQAVVKETLRLHPP
Sbjct  313  TSSTIEWAMAELLRQPVSMRKAKDEINQIVG--------DTEKMPFLQAVVKETLRLHPP  364

Query  152  APFLIPRRAIQDTKFMGYDIPKDTQVFINVWAIGRDHESWEDPLSFKPER  3
             P L+PR AI++T FMG+DIPKDTQVF+N W IGRD ++WEDP +FKPER
Sbjct  365  VPLLLPRNAIKETNFMGFDIPKDTQVFVNAWGIGRDPDAWEDPSAFKPER  414



>ref|XP_010036221.1| PREDICTED: cytochrome P450 76A1-like [Eucalyptus grandis]
Length=506

 Score =   274 bits (701),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 131/274 (48%), Positives = 186/274 (68%), Gaps = 3/274 (1%)
 Frame = -2

Query  1273  NMLDLGSVPHQTIAAMRNKYGPVVWLRIGSVSTLAIQSAKAAAELFKNHDVPFAGRSIGD  1094
             N+LDLG+ PHQ +   R K+GPV WL++GSV+T+ IQSA+AAAE FK HD  FA R    
Sbjct  42    NILDLGTTPHQNLHHFRAKHGPVTWLKLGSVNTMVIQSAQAAAEFFKGHDFAFADRKCPH  101

Query  1093  VMLAQGYNKGSMALAQYGSYWRVLRRICSVEMFVHKKVNETAAVRRKCIDDLLRWVENEA  914
              M A  Y++GS+A+ +YG YWRVLRR+CSVE+ V K+VNETA +R+KC+D+++ ++E E 
Sbjct  102   AMTALNYDQGSLAVGRYGGYWRVLRRLCSVELLVTKRVNETAHLRQKCVDNMVAYLEEEM  161

Query  913   G--SIKRGSGIHVTRFVFLATFNLLGNIMFSSDLVDPVSEKGSKFFNAMMGIMERGGTPN  740
                 +    GI ++ F+ L  FN++GN++ S DL DP S+ G +FF+AM   ME  G PN
Sbjct  162   AVKQVTTEQGIDLSHFLLLMGFNVVGNMVLSRDLWDPKSKDGPEFFDAMNRFMEWAGKPN  221

Query  739   ISDIFPCLRWLDLQGLRTKTDKDLQIALQIVSTFVQKRSKEGQDDSGKRKS-DFLDVLLS  563
             ++D  P L+WLD QG++    KD+  A+ I   FV++R +E +     R + DFLD +L 
Sbjct  222   VADFLPWLKWLDPQGIKASMAKDMGRAMNIAEGFVKERLEERKLRGEMRTTNDFLDAVLD  281

Query  562   FEGSGKDEPPKLSEHQINIFILEMFLAGTDTTSS  461
             +EG GK+ P K+S   + I ILEMF AG++TTSS
Sbjct  282   YEGDGKEGPRKISSQNVIIIILEMFFAGSETTSS  315


 Score =   167 bits (422),  Expect = 7e-42, Method: Compositional matrix adjust.
 Identities = 74/110 (67%), Positives = 94/110 (85%), Gaps = 0/110 (0%)
 Frame = -1

Query  332  TSSTVEWALTELLRNPKAMTKAKEEIRGIVGPTRRFEESDIDNLQYLQAVVKETLRLHPP  153
            TSST+EW + ELLR P++M KAK+EI  +VG TR+ EE+D + + +LQAVVKETLRLHPP
Sbjct  313  TSSTIEWEMAELLRQPESMKKAKDEIDQVVGLTRKLEENDTEKMPFLQAVVKETLRLHPP  372

Query  152  APFLIPRRAIQDTKFMGYDIPKDTQVFINVWAIGRDHESWEDPLSFKPER  3
             PFL+PR A+++T FMG+DIPKDTQVF+NVW IGRD ++WEDPL+FKPER
Sbjct  373  LPFLVPRNALKETNFMGFDIPKDTQVFVNVWGIGRDPDAWEDPLAFKPER  422



>ref|XP_010036165.1| PREDICTED: cytochrome P450 76A1-like [Eucalyptus grandis]
Length=506

 Score =   271 bits (693),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 131/274 (48%), Positives = 188/274 (69%), Gaps = 3/274 (1%)
 Frame = -2

Query  1273  NMLDLGSVPHQTIAAMRNKYGPVVWLRIGSVSTLAIQSAKAAAELFKNHDVPFAGRSIGD  1094
             N+LDLG+ PHQ +   R K+GPV WL++GSV+T+ IQSA+AA E FK HD  FA R    
Sbjct  42    NILDLGTTPHQNLHNFRAKHGPVTWLKLGSVNTMVIQSAQAATEFFKGHDFAFADRKCPH  101

Query  1093  VMLAQGYNKGSMALAQYGSYWRVLRRICSVEMFVHKKVNETAAVRRKCIDDLLRWVENEA  914
              + A  Y++GS+A+ +YG YWRVLRR+CSVE  V K+VNETA +R+KC+D+++ ++E E 
Sbjct  102   ALTALNYDQGSLAVGRYGGYWRVLRRLCSVEFLVTKRVNETAHLRQKCVDNMVVYLEEEM  161

Query  913   G--SIKRGSGIHVTRFVFLATFNLLGNIMFSSDLVDPVSEKGSKFFNAMMGIMERGGTPN  740
                 +    GI ++ F+FL  FN++GN++ S DL+DP S+ G +FF+AM   ME  G PN
Sbjct  162   AVKQVTTEQGIDLSHFLFLMAFNVVGNLVLSRDLLDPKSKDGPEFFDAMNRFMEWAGKPN  221

Query  739   ISDIFPCLRWLDLQGLRTKTDKDLQIALQIVSTFVQKRSKEGQDDSGKRKS-DFLDVLLS  563
             ++D  P L+WLD QG++    KD+  A++I   FV++R +E +     R + DFLD +L 
Sbjct  222   VADFLPWLKWLDPQGIKASMAKDMGRAMKIAEGFVKERLEERKQRGEMRTTNDFLDAVLD  281

Query  562   FEGSGKDEPPKLSEHQINIFILEMFLAGTDTTSS  461
             +EG+GK+ P K+S   I I ILEMF AG++TTSS
Sbjct  282   YEGNGKEGPRKISSQNIIIIILEMFFAGSETTSS  315


 Score =   131 bits (330),  Expect = 5e-30, Method: Compositional matrix adjust.
 Identities = 74/110 (67%), Positives = 90/110 (82%), Gaps = 0/110 (0%)
 Frame = -1

Query  332  TSSTVEWALTELLRNPKAMTKAKEEIRGIVGPTRRFEESDIDNLQYLQAVVKETLRLHPP  153
            TSST+EWA+ ELL  P +M KAK+EI  IVG  R+ EESD + + +LQAVVKETLRLHPP
Sbjct  313  TSSTIEWAMAELLHQPVSMKKAKDEINQIVGLNRKLEESDTEKMPFLQAVVKETLRLHPP  372

Query  152  APFLIPRRAIQDTKFMGYDIPKDTQVFINVWAIGRDHESWEDPLSFKPER  3
             P LIPR AI++T FMG+DIPKDTQVF+NVW IGR  ++WE+PL+FKPER
Sbjct  373  LPLLIPRNAIKETNFMGFDIPKDTQVFVNVWGIGRYPDAWENPLTFKPER  422



>ref|XP_010036151.1| PREDICTED: cytochrome P450 76A1-like [Eucalyptus grandis]
 gb|KCW84344.1| hypothetical protein EUGRSUZ_B01192 [Eucalyptus grandis]
Length=507

 Score =   270 bits (690),  Expect = 4e-80, Method: Compositional matrix adjust.
 Identities = 129/274 (47%), Positives = 191/274 (70%), Gaps = 3/274 (1%)
 Frame = -2

Query  1273  NMLDLGSVPHQTIAAMRNKYGPVVWLRIGSVSTLAIQSAKAAAELFKNHDVPFAGRSIGD  1094
             N+LDLG++PHQ +  +R K+GPV+WL++GSV+T+ IQSA+AA ELFK HD  FA R    
Sbjct  43    NILDLGTMPHQNLHNLRAKHGPVLWLKLGSVNTMVIQSARAAMELFKGHDFVFADRKCSQ  102

Query  1093  VMLAQGYNKGSMALAQYGSYWRVLRRICSVEMFVHKKVNETAAVRRKCIDDLLRWVENEA  914
                A GY++GS+AL ++G YWR LRR+CS E+ V+K+VN+TA +R+KC+D ++ ++E E 
Sbjct  103   AFTALGYDQGSLALGRHGDYWRALRRLCSAELLVNKRVNDTAHLRQKCVDSMIMYIEEEM  162

Query  913   G--SIKRGSGIHVTRFVFLATFNLLGNIMFSSDLVDPVSEKGSKFFNAMMGIMERGGTPN  740
                   +G GI ++ F+FL  FN++GN++ S DL+DP S+ G +F++AM   ME  G PN
Sbjct  163   AVKQATKGQGIDLSHFLFLLAFNVVGNMVLSRDLLDPKSKDGPEFYDAMNRFMEWAGKPN  222

Query  739   ISDIFPCLRWLDLQGLRTKTDKDLQIALQIVSTFVQKRSKEGQDDSGKRKS-DFLDVLLS  563
             ++D  P L+WLD QG++    KD+  A++I   FV++R +E +     R + DFLD +L 
Sbjct  223   VADFMPWLKWLDPQGIKAGMAKDMGRAMRIAEGFVKERLEERKLRGEMRTTNDFLDAVLD  282

Query  562   FEGSGKDEPPKLSEHQINIFILEMFLAGTDTTSS  461
             +EG GK+ P K+S   I I ILEMF AG+++TSS
Sbjct  283   YEGDGKEGPHKISSQNIIIIILEMFFAGSESTSS  316


 Score =   136 bits (342),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 74/110 (67%), Positives = 93/110 (85%), Gaps = 0/110 (0%)
 Frame = -1

Query  332  TSSTVEWALTELLRNPKAMTKAKEEIRGIVGPTRRFEESDIDNLQYLQAVVKETLRLHPP  153
            TSST+EWA+ ELLR P++M KAK+EI  +VG  R+ EE+D + + +LQAVVKETLRLHPP
Sbjct  314  TSSTIEWAMAELLRQPESMKKAKDEIDQVVGLNRKLEENDTEKMPFLQAVVKETLRLHPP  373

Query  152  APFLIPRRAIQDTKFMGYDIPKDTQVFINVWAIGRDHESWEDPLSFKPER  3
             P LIPR A+++TKFMG+DIPKDTQVF+N W+IGRD + WEDPL+FKPER
Sbjct  374  LPLLIPRNALKETKFMGFDIPKDTQVFVNAWSIGRDPDDWEDPLAFKPER  423



>gb|AHX24366.1| CYP76A26-like protein [Amsonia hubrichtii]
Length=514

 Score =   270 bits (690),  Expect = 5e-80, Method: Compositional matrix adjust.
 Identities = 129/273 (47%), Positives = 191/273 (70%), Gaps = 3/273 (1%)
 Frame = -2

Query  1273  NMLDLGSVPHQTIAAMRNKYGPVVWLRIGSVSTLAIQSAKAAAELFKNHDVPFAGRSIGD  1094
             NM DLG +PHQT+   R+KYGPVVWLR+GS++T+ +Q+A +AAELFK HDVPF+ R + D
Sbjct  49    NMFDLGDLPHQTLYKFRSKYGPVVWLRLGSINTMVVQNAVSAAELFKKHDVPFSDRKVPD  108

Query  1093  VMLAQGYNKGSMALAQYGSYWRVLRRICSVEMFVHKKVNETAAVRRKCIDDLLRWVENE-  917
              + A  +N+GS+ +  YG +WRVLRR+CS+E  V+K++NET  +RR+  D+++RW+E + 
Sbjct  109   TLTAFQFNQGSLGMNTYGGHWRVLRRLCSMEFLVNKRMNETTDLRRRIEDNMVRWIEEDS  168

Query  916   -AGSIKRGSG-IHVTRFVFLATFNLLGNIMFSSDLVDPVSEKGSKFFNAMMGIMERGGTP  743
              A   + G+G + ++RF+FL  FNL+GN+M S DL+D    +G +FF+ M  I+E  GTP
Sbjct  169   LASKAQGGTGAVQLSRFLFLMAFNLVGNLMLSRDLLDNKDPEGREFFDCMNEILELAGTP  228

Query  742   NISDIFPCLRWLDLQGLRTKTDKDLQIALQIVSTFVQKRSKEGQDDSGKRKSDFLDVLLS  563
             NI+D  P L+ LD  G++ +   ++   ++I S FVQ+R    +      K DFLDV+L 
Sbjct  229   NIADFLPLLKKLDPLGMKKRMIDNMSRTMKISSKFVQERLDNRKTGKINEKKDFLDVMLE  288

Query  562   FEGSGKDEPPKLSEHQINIFILEMFLAGTDTTS  464
             ++G GKD P K +EH +NI I+EMF AG++TTS
Sbjct  289   YQGDGKDGPDKFTEHHVNIVIMEMFFAGSETTS  321


 Score =   155 bits (393),  Expect = 5e-38, Method: Compositional matrix adjust.
 Identities = 71/110 (65%), Positives = 86/110 (78%), Gaps = 0/110 (0%)
 Frame = -1

Query  332  TSSTVEWALTELLRNPKAMTKAKEEIRGIVGPTRRFEESDIDNLQYLQAVVKETLRLHPP  153
            TS ++EW  TELLRNP+A  K +EEI  +VG  R  EESD++NL YLQAVVKETLRLHP 
Sbjct  320  TSISIEWGFTELLRNPRAFKKVREEIDRVVGVKRMVEESDMENLPYLQAVVKETLRLHPA  379

Query  152  APFLIPRRAIQDTKFMGYDIPKDTQVFINVWAIGRDHESWEDPLSFKPER  3
             P L+PR  ++DT ++GY IPK TQVF+N WAIGRD + WEDPL+FKPER
Sbjct  380  LPMLLPRNTMEDTDYLGYLIPKGTQVFVNAWAIGRDADYWEDPLTFKPER  429



>ref|XP_011094434.1| PREDICTED: cytochrome P450 76A1-like [Sesamum indicum]
Length=511

 Score =   269 bits (688),  Expect = 9e-80, Method: Compositional matrix adjust.
 Identities = 122/273 (45%), Positives = 187/273 (68%), Gaps = 3/273 (1%)
 Frame = -2

Query  1273  NMLDLGSVPHQTIAAMRNKYGPVVWLRIGSVSTLAIQSAKAAAELFKNHDVPFAGRSIGD  1094
             N+L LG +PH+T+   +  YGPV+WL++GSV T+ +Q A +A+ELFK HD+PFA R + D
Sbjct  46    NLLQLGDLPHETMHKWKQTYGPVIWLKLGSVYTMVVQDAASASELFKKHDLPFADRKVPD  105

Query  1093  VMLAQGYNKGSMALAQYGSYWRVLRRICSVEMFVHKKVNETAAVRRKCIDDLLRWV--EN  920
             V+ A  +N+G++ + Q+G +WRVLRR+CS+E  V+K++NET  +R +  +++ RW+  E+
Sbjct  106   VLTAYDFNQGTLGMNQFGGHWRVLRRLCSMEFLVNKRMNETTELRHRIRENMERWILEES  165

Query  919   EAGSIKRGSG-IHVTRFVFLATFNLLGNIMFSSDLVDPVSEKGSKFFNAMMGIMERGGTP  743
              A   + G+G I ++RF+FL  FNL+GN+M S DL+D    +  +FF+ M  ++E  GTP
Sbjct  166   AAARAQGGTGAIQLSRFLFLLAFNLVGNLMLSRDLLDAKDPESREFFDCMNKVLELAGTP  225

Query  742   NISDIFPCLRWLDLQGLRTKTDKDLQIALQIVSTFVQKRSKEGQDDSGKRKSDFLDVLLS  563
             NI+D  P L+W+D  G++    K+L   ++I S F+Q+R    +    + K DFLDVLL 
Sbjct  226   NIADYLPYLKWMDPAGMKRNMTKNLGRTMKISSKFIQERLNNRKAGKFQEKKDFLDVLLE  285

Query  562   FEGSGKDEPPKLSEHQINIFILEMFLAGTDTTS  464
             +EG GKD P +++E  INI I EMF AG++TTS
Sbjct  286   YEGDGKDGPDRITEKNINIIITEMFFAGSETTS  318


 Score =   123 bits (309),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 65/110 (59%), Positives = 83/110 (75%), Gaps = 0/110 (0%)
 Frame = -1

Query  332  TSSTVEWALTELLRNPKAMTKAKEEIRGIVGPTRRFEESDIDNLQYLQAVVKETLRLHPP  153
            TS ++EW   ELLR+P    K +EE+  +VG  RR EE D++N+ YLQAVVKETLRLHP 
Sbjct  317  TSISIEWGFAELLRSPHTFKKLREELDRVVGVNRRVEEKDVENMPYLQAVVKETLRLHPA  376

Query  152  APFLIPRRAIQDTKFMGYDIPKDTQVFINVWAIGRDHESWEDPLSFKPER  3
             P L+PR  +++T ++GYDIPK TQVF+N W IGRD + WEDPL+FKPER
Sbjct  377  LPLLLPRNTMENTNYLGYDIPKGTQVFVNAWGIGRDPKCWEDPLAFKPER  426



>gb|AHX24369.1| CYP76A26-like protein [Vinca minor]
Length=514

 Score =   269 bits (687),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 122/273 (45%), Positives = 184/273 (67%), Gaps = 3/273 (1%)
 Frame = -2

Query  1273  NMLDLGSVPHQTIAAMRNKYGPVVWLRIGSVSTLAIQSAKAAAELFKNHDVPFAGRSIGD  1094
             NM DLG +PHQT+  +R+KYGP+VWL++GS++T+ +Q+A AA ELFK HDVPF  R + D
Sbjct  49    NMFDLGDLPHQTLYKLRSKYGPIVWLQLGSINTMVVQNAVAAGELFKKHDVPFCDRKVPD  108

Query  1093  VMLAQGYNKGSMALAQYGSYWRVLRRICSVEMFVHKKVNETAAVRRKCIDDLLRWVENEA  914
              +    +N  S+ +  YG +WRVLRR+CS+E  V+K++NET  +RR+  D+++RW+E ++
Sbjct  109   TLTTFNFNSSSLGMNTYGGHWRVLRRLCSMEFLVNKRMNETTDLRRRIEDNMVRWIEEDS  168

Query  913   GSIKRGSG---IHVTRFVFLATFNLLGNIMFSSDLVDPVSEKGSKFFNAMMGIMERGGTP  743
              + K   G   + ++RF+FL  FNL+GN+M S DL+D    +  +FF++M  I+E  GTP
Sbjct  169   LASKSQGGTGAVQLSRFLFLMAFNLVGNLMLSRDLLDNKDPESREFFDSMNEILELAGTP  228

Query  742   NISDIFPCLRWLDLQGLRTKTDKDLQIALQIVSTFVQKRSKEGQDDSGKRKSDFLDVLLS  563
             NI+D  P L+ LD  GL+ +   ++   ++I S FVQ+R    +      K DFLDV+L 
Sbjct  229   NIADFLPFLKKLDPLGLKKRMIDNMTRTMKISSKFVQERLDNRKAGKFNEKKDFLDVMLE  288

Query  562   FEGSGKDEPPKLSEHQINIFILEMFLAGTDTTS  464
             + G GKD P + +E  +NI I+EMF AG++TTS
Sbjct  289   YRGDGKDGPDQFTEQHVNIVIMEMFFAGSETTS  321


 Score =   160 bits (404),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 73/110 (66%), Positives = 86/110 (78%), Gaps = 0/110 (0%)
 Frame = -1

Query  332  TSSTVEWALTELLRNPKAMTKAKEEIRGIVGPTRRFEESDIDNLQYLQAVVKETLRLHPP  153
            TS ++EW  TELLRNP A  K +EEI  +VG  R  EESD++NL YLQAVVKETLRLHP 
Sbjct  320  TSISIEWGFTELLRNPNAFKKVREEIDRVVGINRMVEESDMENLPYLQAVVKETLRLHPA  379

Query  152  APFLIPRRAIQDTKFMGYDIPKDTQVFINVWAIGRDHESWEDPLSFKPER  3
             P L+PR  ++DT++MGY +PK TQVF+N WAIGRD E WEDPLSFKPER
Sbjct  380  LPMLLPRNTMEDTEYMGYLVPKGTQVFVNAWAIGRDAEYWEDPLSFKPER  429



>ref|XP_006481913.1| PREDICTED: cytochrome P450 76A2-like [Citrus sinensis]
Length=512

 Score =   267 bits (683),  Expect = 4e-79, Method: Compositional matrix adjust.
 Identities = 129/274 (47%), Positives = 191/274 (70%), Gaps = 4/274 (1%)
 Frame = -2

Query  1273  NMLDLGSVPHQTIAAMRNKYGPVVWLRIGSVSTLAIQSAKAAAELFKNHDVPFAGRSIGD  1094
             N  DLG++PHQ++  +R KYGPV+WL++GSV+T+ IQSAKAA E+FKN D  F  R + D
Sbjct  49    NFFDLGNMPHQSLYKLRAKYGPVLWLKLGSVNTVVIQSAKAANEMFKNQDHIFCDRKVPD  108

Query  1093  VMLAQGYNKGSMALAQYGSYWRVLRRICSVEMFVHKKVNETAAVRRKCIDDLLRWVENEA  914
              ++A+ Y +GS+A  +YG YWR+LRR+C+ E+ V++++NETA +RRKCID  ++ +EN+ 
Sbjct  109   ALIARNYYQGSLAFGRYGVYWRILRRLCASELSVNRRINETAPIRRKCIDKTIQCIENDV  168

Query  913   GSIK-RGSG--IHVTRFVFLATFNLLGNIMFSSDLVDPVSEKGSKFFNAMMGIMERGGTP  743
                + RG    + ++ ++FL  F+L+GN+  S +L++  S++  +FF AM+  ME  G P
Sbjct  169   AEAQARGESGQVDLSHYLFLMAFSLIGNLTLSRELLNLQSKQELEFFAAMVKCMEWVGKP  228

Query  742   NISDIFPCLRWLDLQGLRTKTDKDLQIALQIVSTFVQKRSKEGQDDSGKRKSDFLDVLLS  563
             N+SD FP LR LD QG+R    KD+   LQI+S +V++R  E Q      K DFLD L+ 
Sbjct  229   NMSDYFPFLRSLDPQGIRRNMMKDMGCVLQIISGYVKERLDE-QKLLNDEKKDFLDGLIQ  287

Query  562   FEGSGKDEPPKLSEHQINIFILEMFLAGTDTTSS  461
             +EG GK+ P +LS+  INI + EMFLAG++TTSS
Sbjct  288   YEGDGKEGPDRLSDQNINIIVTEMFLAGSETTSS  321


 Score =   133 bits (334),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 74/110 (67%), Positives = 90/110 (82%), Gaps = 0/110 (0%)
 Frame = -1

Query  332  TSSTVEWALTELLRNPKAMTKAKEEIRGIVGPTRRFEESDIDNLQYLQAVVKETLRLHPP  153
            TSST+EWA+ ELLRNP+AM K K+E+  +VG  R+ EE DI  L Y +AV+KETLRLHPP
Sbjct  319  TSSTMEWAVAELLRNPEAMRKTKDELDRVVGRNRKVEEKDIVELPYFKAVLKETLRLHPP  378

Query  152  APFLIPRRAIQDTKFMGYDIPKDTQVFINVWAIGRDHESWEDPLSFKPER  3
             P L+PR A++DT+FMGY IPKDTQVF+NVW IGRD + WE+PLSFKPER
Sbjct  379  GPLLLPRNAMKDTEFMGYQIPKDTQVFVNVWTIGRDPDCWENPLSFKPER  428



>gb|KDO61009.1| hypothetical protein CISIN_1g010359mg [Citrus sinensis]
Length=512

 Score =   267 bits (683),  Expect = 5e-79, Method: Compositional matrix adjust.
 Identities = 129/274 (47%), Positives = 191/274 (70%), Gaps = 4/274 (1%)
 Frame = -2

Query  1273  NMLDLGSVPHQTIAAMRNKYGPVVWLRIGSVSTLAIQSAKAAAELFKNHDVPFAGRSIGD  1094
             N  DLG++PHQ++  +R KYGPV+WL++GSV+T+ IQSAKAA E+FKN D  F  R + D
Sbjct  49    NFFDLGNMPHQSLYKLRAKYGPVLWLKLGSVNTVVIQSAKAANEMFKNQDHIFCDRKVPD  108

Query  1093  VMLAQGYNKGSMALAQYGSYWRVLRRICSVEMFVHKKVNETAAVRRKCIDDLLRWVENEA  914
              ++A+ Y +GS+A  +YG YWR+LRR+C+ E+ V++++NETA +RRKCID  ++ +EN+ 
Sbjct  109   ALIARNYYQGSLAFGRYGVYWRILRRLCASELSVNRRINETAPIRRKCIDKTIQCIENDV  168

Query  913   GSIK-RGSG--IHVTRFVFLATFNLLGNIMFSSDLVDPVSEKGSKFFNAMMGIMERGGTP  743
                + RG    + ++ ++FL  F+L+GN+  S +L++  S++  +FF AM+  ME  G P
Sbjct  169   AEAQARGESGQVDLSHYLFLMAFSLIGNLTLSRELLNLQSKQELEFFAAMVKCMEWVGKP  228

Query  742   NISDIFPCLRWLDLQGLRTKTDKDLQIALQIVSTFVQKRSKEGQDDSGKRKSDFLDVLLS  563
             N+SD FP LR LD QG+R    KD+   LQI+S +V++R  E Q      K DFLD L+ 
Sbjct  229   NMSDYFPFLRSLDPQGIRRNMMKDMGCVLQIISGYVKERLDE-QKLLNDEKKDFLDGLIQ  287

Query  562   FEGSGKDEPPKLSEHQINIFILEMFLAGTDTTSS  461
             +EG GK+ P +LS+  INI + EMFLAG++TTSS
Sbjct  288   YEGDGKEGPDRLSDQNINIIVTEMFLAGSETTSS  321


 Score =   134 bits (336),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 76/110 (69%), Positives = 91/110 (83%), Gaps = 0/110 (0%)
 Frame = -1

Query  332  TSSTVEWALTELLRNPKAMTKAKEEIRGIVGPTRRFEESDIDNLQYLQAVVKETLRLHPP  153
            TSST+EWA+ ELLRNP+AM K K+E+  +VG  R+ EE DI  L Y +AV+KETLRLHPP
Sbjct  319  TSSTMEWAVAELLRNPEAMRKTKDELDRVVGRNRKVEEKDIVELPYFKAVLKETLRLHPP  378

Query  152  APFLIPRRAIQDTKFMGYDIPKDTQVFINVWAIGRDHESWEDPLSFKPER  3
            AP L+PR A+ DT+FMGY IPKDTQVF+NVWAIGRD + WE+PLSFKPER
Sbjct  379  APLLLPRNAMTDTEFMGYQIPKDTQVFVNVWAIGRDPDCWENPLSFKPER  428



>ref|XP_006430323.1| hypothetical protein CICLE_v10011511mg [Citrus clementina]
 gb|ESR43563.1| hypothetical protein CICLE_v10011511mg [Citrus clementina]
Length=512

 Score =   267 bits (683),  Expect = 5e-79, Method: Compositional matrix adjust.
 Identities = 129/274 (47%), Positives = 191/274 (70%), Gaps = 4/274 (1%)
 Frame = -2

Query  1273  NMLDLGSVPHQTIAAMRNKYGPVVWLRIGSVSTLAIQSAKAAAELFKNHDVPFAGRSIGD  1094
             N  DLG++PHQ++  +R KYGPV+WL++GSV+T+ IQSAKAA E+FKN D  F  R + D
Sbjct  49    NFFDLGNMPHQSLYKLRAKYGPVLWLKLGSVNTVVIQSAKAANEMFKNQDHIFCDRKVPD  108

Query  1093  VMLAQGYNKGSMALAQYGSYWRVLRRICSVEMFVHKKVNETAAVRRKCIDDLLRWVENEA  914
              ++A+ Y +GS+A  +YG YWR+LRR+C+ E+ V++++NETA +RRKCID  ++ +EN+ 
Sbjct  109   ALIARNYYQGSLAFGRYGVYWRILRRLCASELSVNRRINETAPIRRKCIDKTIQCIENDV  168

Query  913   GSIK-RGSG--IHVTRFVFLATFNLLGNIMFSSDLVDPVSEKGSKFFNAMMGIMERGGTP  743
                + RG    + ++ ++FL  F+L+GN+  S +L++  S++  +FF AM+  ME  G P
Sbjct  169   AEAQARGESGQVDLSHYLFLMAFSLIGNLTLSRELLNLQSKQELEFFAAMVKCMEWVGKP  228

Query  742   NISDIFPCLRWLDLQGLRTKTDKDLQIALQIVSTFVQKRSKEGQDDSGKRKSDFLDVLLS  563
             N+SD FP LR LD QG+R    KD+   LQI+S +V++R  E Q      K DFLD L+ 
Sbjct  229   NMSDYFPFLRSLDPQGIRRNMMKDMGCVLQIISGYVKERLDE-QKLLNDEKKDFLDGLIK  287

Query  562   FEGSGKDEPPKLSEHQINIFILEMFLAGTDTTSS  461
             +EG GK+ P +LS+  INI + EMFLAG++TTSS
Sbjct  288   YEGDGKEGPDRLSDQNINIIVTEMFLAGSETTSS  321


 Score =   134 bits (336),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 76/110 (69%), Positives = 91/110 (83%), Gaps = 0/110 (0%)
 Frame = -1

Query  332  TSSTVEWALTELLRNPKAMTKAKEEIRGIVGPTRRFEESDIDNLQYLQAVVKETLRLHPP  153
            TSST+EWA+ ELLRNP+AM K K+E+  +VG  R+ EE DI  L Y +AV+KETLRLHPP
Sbjct  319  TSSTMEWAVAELLRNPEAMRKTKDELDRVVGRNRKVEEKDIVELPYFKAVLKETLRLHPP  378

Query  152  APFLIPRRAIQDTKFMGYDIPKDTQVFINVWAIGRDHESWEDPLSFKPER  3
            AP L+PR A+ DT+FMGY IPKDTQVF+NVWAIGRD + WE+PLSFKPER
Sbjct  379  APLLLPRNAMTDTEFMGYQIPKDTQVFVNVWAIGRDPDCWENPLSFKPER  428



>ref|XP_010045881.1| PREDICTED: cytochrome P450 76A1-like [Eucalyptus grandis]
Length=507

 Score =   266 bits (680),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 132/275 (48%), Positives = 197/275 (72%), Gaps = 5/275 (2%)
 Frame = -2

Query  1273  NMLDLGSVPHQTIAAMRNKYGPVVWLRIGSVSTLAIQSAKAAAELFKNHDVPFAGRSIGD  1094
             N+LDLG++ HQ +  +R K+GPV+WL++GSV+T+AIQSA+AA ELFK HD  FA R    
Sbjct  43    NILDLGTMAHQNLHNLRAKHGPVLWLKLGSVNTVAIQSAQAAMELFKGHDFVFADRKCPH  102

Query  1093  VMLAQGYNKGSMALAQYGSYWRVLRRICSVEMFVHKKVNETAAVRRKCIDDLLRWVENEA  914
              + A GY++GS+A+ +YG YWR LRR+CS E+FV+K+VN+ A +R+KC+D ++ ++E E 
Sbjct  103   ALTALGYDQGSLAVGRYGDYWRALRRLCSAELFVNKRVNDAAHLRQKCVDSMIMYIEEEM  162

Query  913   GSIKRGS---GIHVTRFVFLATFNLLGNIMFSSDLVDPVSEKGSKFFNAMMGIMERGGTP  743
              ++K+ +   GI ++ F+FL  FN++GN++ S DL+DP S+ G +F++AM  +ME  G P
Sbjct  163   -AVKQATKEQGIDLSHFLFLLAFNVVGNMVLSRDLLDPKSKDGPEFYDAMNLVMEWAGKP  221

Query  742   NISDIFPCLRWLDLQGLRTKTDKDLQIALQIVSTFVQKRSKEGQDDSGKRKS-DFLDVLL  566
             N++D  P L+WLD QG++    KD+  A++I   FV++R +E +     R + DFLD LL
Sbjct  222   NVADFMPWLKWLDPQGIKASMAKDMGRAMKIAEGFVKERLEERKLRGEMRTTNDFLDTLL  281

Query  565   SFEGSGKDEPPKLSEHQINIFILEMFLAGTDTTSS  461
              +EG GK+ P K+S   INI ILEMF AG++TTSS
Sbjct  282   DYEGDGKEGPHKISSQNINIIILEMFFAGSETTSS  316


 Score =   137 bits (346),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 73/110 (66%), Positives = 95/110 (86%), Gaps = 0/110 (0%)
 Frame = -1

Query  332  TSSTVEWALTELLRNPKAMTKAKEEIRGIVGPTRRFEESDIDNLQYLQAVVKETLRLHPP  153
            TSST+EWA+ ELLR P++M KAK+EI  +VG  R+ EE+D +N+ +LQAVVKETLRLHPP
Sbjct  314  TSSTIEWAMAELLRQPESMKKAKDEIDQVVGLNRKLEENDTENMPFLQAVVKETLRLHPP  373

Query  152  APFLIPRRAIQDTKFMGYDIPKDTQVFINVWAIGRDHESWEDPLSFKPER  3
             P L+PR A+++TKFMG+DIPKDTQVF+N W+IGRD ++WEDPL+FKP+R
Sbjct  374  VPLLLPRNALKETKFMGFDIPKDTQVFVNAWSIGRDPDAWEDPLAFKPKR  423



>gb|KDP26153.1| hypothetical protein JCGZ_22834 [Jatropha curcas]
Length=510

 Score =   266 bits (680),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 129/274 (47%), Positives = 187/274 (68%), Gaps = 3/274 (1%)
 Frame = -2

Query  1273  NMLDLGSVPHQTIAAMRNKYGPVVWLRIGSVSTLAIQSAKAAAELFKNHDVPFAGRSIGD  1094
             N+ DLG++ H+ +  ++ KYGPV+ LRIGSV T+ IQSAKAA ELFKNHD  F  R++  
Sbjct  47    NIFDLGTLAHRILYELKFKYGPVLRLRIGSVDTVVIQSAKAAMELFKNHDASFCARTVPC  106

Query  1093  VMLAQGYNKGSMALAQYGSYWRVLRRICSVEMFVHKKVNETAAVRRKCIDDLLRWVENE-  917
             V  +  Y +GS+AL ++G YWR LRRIC++E+  ++++NET  +RRKCID ++R +E++ 
Sbjct  107   VFTSHNYKEGSLALGRFGPYWRTLRRICAIELLANRRINETVQIRRKCIDVMIRSIEDDM  166

Query  916   -AGSIKRGSG-IHVTRFVFLATFNLLGNIMFSSDLVDPVSEKGSKFFNAMMGIMERGGTP  743
              AG     SG +H+  ++FL +FNL+GN+M S DL D   ++G +FF AM  +M   GTP
Sbjct  167   AAGKASGESGKVHIPHYLFLMSFNLIGNLMLSKDLFDSKCKEGYEFFEAMDKVMVWAGTP  226

Query  742   NISDIFPCLRWLDLQGLRTKTDKDLQIALQIVSTFVQKRSKEGQDDSGKRKSDFLDVLLS  563
             N++D  P L+WLD QGL+    +D+  A  IV+ FV++R ++ +    K   DFLDVLL 
Sbjct  227   NLADFLPFLQWLDPQGLKRNMSRDMGRAKDIVAGFVKERIEDYKMGKKKANKDFLDVLLE  286

Query  562   FEGSGKDEPPKLSEHQINIFILEMFLAGTDTTSS  461
             FEG GK+   K+   ++ I ILEMF AG++TTSS
Sbjct  287   FEGDGKEWEGKIPYDKMIIIILEMFFAGSETTSS  320


 Score =   154 bits (390),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 70/110 (64%), Positives = 85/110 (77%), Gaps = 0/110 (0%)
 Frame = -1

Query  332  TSSTVEWALTELLRNPKAMTKAKEEIRGIVGPTRRFEESDIDNLQYLQAVVKETLRLHPP  153
            TSST+EW + EL  NP+A+ K K+E+  +VG  R+ EESDID L YLQAV+KET+RLHP 
Sbjct  318  TSSTMEWVMAELFSNPEALRKVKDELDAVVGENRKVEESDIDKLPYLQAVIKETVRLHPV  377

Query  152  APFLIPRRAIQDTKFMGYDIPKDTQVFINVWAIGRDHESWEDPLSFKPER  3
             P LIPR  I+DT FMGY I + TQV +N WAIGRD ESWEDP++FKPER
Sbjct  378  IPLLIPRNTIEDTNFMGYHISEGTQVLVNAWAIGRDPESWEDPMNFKPER  427



>ref|XP_009613392.1| PREDICTED: cytochrome P450 76A2-like [Nicotiana tomentosiformis]
Length=453

 Score =   265 bits (676),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 121/235 (51%), Positives = 171/235 (73%), Gaps = 2/235 (1%)
 Frame = -2

Query  1183  VSTLAIQSAKAAAELFKNHDVPFAGRS-IGDVMLAQGYNKGSMALAQYGSYWRVLRRICS  1007
             +  +   S++  AE+     V   G     D+ +   YN  S+ALA YG+YWR+LRRIC+
Sbjct  16    IPVMITYSSERVAEIHIREIVHLHGVCPYVDLEVVHNYNSSSLALAPYGTYWRMLRRICT  75

Query  1006  VEMFVHKKVNETAAVRRKCIDDLLRWVENEAGSIKRGSGIHVTRFVFLATFNLLGNIMFS  827
              EMF +K++NET  +RRKCID +L+W++ EA S++ G G+ V+RFV+LA+FN++GN+M S
Sbjct  76    TEMFTNKRINETVHLRRKCIDYMLQWIDKEANSLENGKGVEVSRFVYLASFNMIGNLMLS  135

Query  826   SDLVDPVSEKGSKFFNAMMGIMERGGTPNISDIFPCLRWLDLQGLRTKTDKDLQIALQIV  647
              DLVDP S+  S FF  +  ++E  G PNISDI+PCL+WLDLQGLR K++ D+  A+++ 
Sbjct  136   HDLVDPESKTASDFFTTLKKVIEWSGRPNISDIYPCLKWLDLQGLRQKSEHDMGKAVEVA  195

Query  646   STFVQKRSKEGQDDSGKRKSDFLDVLLSFEGSGKDEPPKLSEHQINIFILEMFLA  482
             S FV++R KE Q +  ++K+DF++VLL FEG+GKDEP KLSEHQINIFILEMF+ 
Sbjct  196   SAFVKERMKE-QKEGREKKNDFVEVLLEFEGNGKDEPAKLSEHQINIFILEMFIG  249


 Score =   167 bits (424),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 76/104 (73%), Positives = 89/104 (86%), Gaps = 1/104 (1%)
 Frame = -1

Query  314  WALTELLRNPKAMTKAKEEIRGIVGPTRRFEESDIDNLQYLQAVVKETLRLHPPAPFLIP  135
            WALTELL NP+ MTK K E+  +VG  R+ EESDID L Y+QAV+K TLRLHPP PFL+P
Sbjct  260  WALTELLHNPEVMTKVKAELSEVVG-NRKLEESDIDKLHYMQAVIKGTLRLHPPIPFLLP  318

Query  134  RRAIQDTKFMGYDIPKDTQVFINVWAIGRDHESWEDPLSFKPER  3
            RRA+QDT+FMGYDIP+DTQVF+NVWAIGRD E WEDPL+F+PER
Sbjct  319  RRAVQDTRFMGYDIPEDTQVFVNVWAIGRDPEFWEDPLAFRPER  362



>ref|XP_010036177.1| PREDICTED: cytochrome P450 76A1-like [Eucalyptus grandis]
Length=507

 Score =   265 bits (676),  Expect = 5e-78, Method: Compositional matrix adjust.
 Identities = 129/274 (47%), Positives = 191/274 (70%), Gaps = 3/274 (1%)
 Frame = -2

Query  1273  NMLDLGSVPHQTIAAMRNKYGPVVWLRIGSVSTLAIQSAKAAAELFKNHDVPFAGRSIGD  1094
             N+ DLG++PHQ +  +R K+GPV+WL++GSV+T+ IQSA+AA ELFK HD  FA R    
Sbjct  43    NIFDLGTMPHQNLHNLRAKHGPVLWLKLGSVNTMVIQSARAAMELFKGHDFVFADRKCSQ  102

Query  1093  VMLAQGYNKGSMALAQYGSYWRVLRRICSVEMFVHKKVNETAAVRRKCIDDLLRWVENEA  914
                A GY++GS+AL ++G YWR LRR+CS E+ V+K+VN+TA +R+KC+D ++ ++E E 
Sbjct  103   AFTALGYDQGSLALGRHGDYWRALRRLCSAELLVNKRVNDTAHLRQKCVDSMIMYIEEEM  162

Query  913   G--SIKRGSGIHVTRFVFLATFNLLGNIMFSSDLVDPVSEKGSKFFNAMMGIMERGGTPN  740
                   +G GI ++ F+FL  FN++GN++ S DL+DP S+ G +F++AM   ME  G PN
Sbjct  163   AVKQATKGQGIDLSHFLFLLAFNVVGNMVLSRDLLDPKSKDGPEFYDAMNRFMEWAGKPN  222

Query  739   ISDIFPCLRWLDLQGLRTKTDKDLQIALQIVSTFVQKRSKEGQDDSGKRKS-DFLDVLLS  563
             ++D  P L+WLD QG++    KD+  A++I   FV++R +E +     R + DFLD +L 
Sbjct  223   VADFMPWLKWLDPQGIKAGMAKDMGRAMRIAEGFVKERLEERKLRGEMRTTNDFLDAVLD  282

Query  562   FEGSGKDEPPKLSEHQINIFILEMFLAGTDTTSS  461
             +EG GK+ P K+S   INI ILEMF AG+++TSS
Sbjct  283   YEGDGKEGPHKISSQNINIIILEMFFAGSESTSS  316


 Score =   137 bits (344),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 74/110 (67%), Positives = 94/110 (85%), Gaps = 0/110 (0%)
 Frame = -1

Query  332  TSSTVEWALTELLRNPKAMTKAKEEIRGIVGPTRRFEESDIDNLQYLQAVVKETLRLHPP  153
            TSST+EWA+ ELLR P++M KAK+EI  +VG  R+ EE+D + + +LQAVVKETLRLHPP
Sbjct  314  TSSTIEWAMAELLRQPESMKKAKDEIDQVVGLNRKLEENDTEKMPFLQAVVKETLRLHPP  373

Query  152  APFLIPRRAIQDTKFMGYDIPKDTQVFINVWAIGRDHESWEDPLSFKPER  3
             P LIPR A+++TKFMG+DIPKDTQVF+N W+IGRD ++WEDPL+FKPER
Sbjct  374  LPLLIPRNALKETKFMGFDIPKDTQVFVNAWSIGRDPDAWEDPLAFKPER  423



>gb|AHK60833.1| iridoid oxidase [Catharanthus roseus]
Length=515

 Score =   265 bits (676),  Expect = 6e-78, Method: Compositional matrix adjust.
 Identities = 125/273 (46%), Positives = 190/273 (70%), Gaps = 3/273 (1%)
 Frame = -2

Query  1273  NMLDLGSVPHQTIAAMRNKYGPVVWLRIGSVSTLAIQSAKAAAELFKNHDVPFAGRSIGD  1094
             NM DLG +PHQT+  +++KYGP+VWL++GS++T+ +Q+A +AAELFK HDVPF  R + D
Sbjct  50    NMFDLGDLPHQTLYKLKSKYGPIVWLQLGSINTMVVQNAVSAAELFKKHDVPFCDRKVPD  109

Query  1093  VMLAQGYNKGSMALAQYGSYWRVLRRICSVEMFVHKKVNETAAVRRKCIDDLLRWVENE-  917
              + A  +N+GS+ +  YG +WRVLRR+CS+E  V+K++NET  +RR+  D+++RW+E + 
Sbjct  110   TLTAFNFNQGSLGMNTYGGHWRVLRRLCSMEFLVNKRMNETTDLRRRIEDNMVRWIEEDS  169

Query  916   -AGSIKRGSG-IHVTRFVFLATFNLLGNIMFSSDLVDPVSEKGSKFFNAMMGIMERGGTP  743
              A   + G+G + ++RF+FL  FNL+GN+M S DL+D    +G +FF+ M  I+E  GTP
Sbjct  170   LASKAQGGTGAVQLSRFLFLMAFNLVGNLMLSRDLMDNKDPEGREFFDCMNEILELAGTP  229

Query  742   NISDIFPCLRWLDLQGLRTKTDKDLQIALQIVSTFVQKRSKEGQDDSGKRKSDFLDVLLS  563
             NI+D  P L+ LD  G++ +   ++   ++I S FVQ+R    +      K DFLDV+L 
Sbjct  230   NIADFLPLLKKLDPLGMKKRMVDNMSRTMKISSKFVQERLDNRKAGKINEKKDFLDVMLE  289

Query  562   FEGSGKDEPPKLSEHQINIFILEMFLAGTDTTS  464
             ++G GKD P K +E  +NI I+EMF AG++TTS
Sbjct  290   YQGDGKDGPDKFTEQHVNIVIMEMFFAGSETTS  322


 Score =   157 bits (396),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 72/110 (65%), Positives = 86/110 (78%), Gaps = 0/110 (0%)
 Frame = -1

Query  332  TSSTVEWALTELLRNPKAMTKAKEEIRGIVGPTRRFEESDIDNLQYLQAVVKETLRLHPP  153
            TS ++EW  TELLRNP A  K +EEI  +VG  R  EE+D++NL YLQAVVKETLRLHP 
Sbjct  321  TSISIEWGFTELLRNPHAFKKVREEIDRVVGVNRMVEETDMENLPYLQAVVKETLRLHPA  380

Query  152  APFLIPRRAIQDTKFMGYDIPKDTQVFINVWAIGRDHESWEDPLSFKPER  3
             P L+PR  ++DT++MGY IPK TQVF+N WAIGRD E W+DPLSFKPER
Sbjct  381  LPMLLPRNTMEDTEYMGYLIPKGTQVFVNAWAIGRDPEYWQDPLSFKPER  430



>gb|AHX24370.1| CYP76A26 [Catharanthus roseus]
Length=515

 Score =   264 bits (675),  Expect = 8e-78, Method: Compositional matrix adjust.
 Identities = 125/273 (46%), Positives = 190/273 (70%), Gaps = 3/273 (1%)
 Frame = -2

Query  1273  NMLDLGSVPHQTIAAMRNKYGPVVWLRIGSVSTLAIQSAKAAAELFKNHDVPFAGRSIGD  1094
             NM DLG +PHQT+  +++KYGP+VWL++GS++T+ +Q+A +AAELFK HDVPF  R + D
Sbjct  50    NMFDLGDLPHQTLYKLKSKYGPIVWLQLGSINTMVVQNAVSAAELFKKHDVPFCDRKVPD  109

Query  1093  VMLAQGYNKGSMALAQYGSYWRVLRRICSVEMFVHKKVNETAAVRRKCIDDLLRWVENE-  917
              + A  +N+GS+ +  YG +WRVLRR+CS+E  V+K++NET  +RR+  D+++RW+E + 
Sbjct  110   TLTAFNFNQGSLGMNTYGGHWRVLRRLCSMEFLVNKRMNETTDLRRRIEDNMVRWIEEDS  169

Query  916   -AGSIKRGSG-IHVTRFVFLATFNLLGNIMFSSDLVDPVSEKGSKFFNAMMGIMERGGTP  743
              A   + G+G + ++RF+FL  FNL+GN+M S DL+D    +G +FF+ M  I+E  GTP
Sbjct  170   LASKAQGGTGAVQLSRFLFLMAFNLVGNLMLSRDLMDNKDPEGREFFDCMNEILELAGTP  229

Query  742   NISDIFPCLRWLDLQGLRTKTDKDLQIALQIVSTFVQKRSKEGQDDSGKRKSDFLDVLLS  563
             NI+D  P L+ LD  G++ +   ++   ++I S FVQ+R    +      K DFLDV+L 
Sbjct  230   NIADFLPLLKKLDPLGMKKRMVDNMSRTMKISSKFVQERLDNRKAGKINEKKDFLDVMLE  289

Query  562   FEGSGKDEPPKLSEHQINIFILEMFLAGTDTTS  464
             ++G GKD P K +E  +NI I+EMF AG++TTS
Sbjct  290   YQGDGKDGPDKFTEQHVNIVIMEMFFAGSETTS  322


 Score =   158 bits (399),  Expect = 8e-39, Method: Compositional matrix adjust.
 Identities = 73/110 (66%), Positives = 86/110 (78%), Gaps = 0/110 (0%)
 Frame = -1

Query  332  TSSTVEWALTELLRNPKAMTKAKEEIRGIVGPTRRFEESDIDNLQYLQAVVKETLRLHPP  153
            TS ++EW  TELLRNP A  K +EEI  +VG  R  EESD++NL YLQAVVKETLRLHP 
Sbjct  321  TSISIEWGFTELLRNPHAFKKVREEIDRVVGVNRMVEESDMENLPYLQAVVKETLRLHPA  380

Query  152  APFLIPRRAIQDTKFMGYDIPKDTQVFINVWAIGRDHESWEDPLSFKPER  3
             P L+PR  ++DT++MGY IPK TQVF+N WAIGRD E W+DPLSFKPER
Sbjct  381  LPMLLPRNTMEDTEYMGYLIPKGTQVFVNAWAIGRDPEYWQDPLSFKPER  430



>gb|AHX24368.1| CYP76A26-like protein [Tabernaemontana elegans]
Length=514

 Score =   263 bits (671),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 124/273 (45%), Positives = 189/273 (69%), Gaps = 3/273 (1%)
 Frame = -2

Query  1273  NMLDLGSVPHQTIAAMRNKYGPVVWLRIGSVSTLAIQSAKAAAELFKNHDVPFAGRSIGD  1094
             NM DLG +PHQ++  +R+KYGP+VWL++GS++T+ +Q+A +AAELFK HDVPF  R + D
Sbjct  49    NMFDLGDLPHQSMYKLRSKYGPIVWLQLGSINTMVVQNAVSAAELFKKHDVPFCDRKVPD  108

Query  1093  VMLAQGYNKGSMALAQYGSYWRVLRRICSVEMFVHKKVNETAAVRRKCIDDLLRWVENE-  917
              + A  +N+GS+ +  YG +WRVLRR+CS+E  V+K++NET  +RR+  D+++RW+E + 
Sbjct  109   TLTAFDFNRGSLGMNTYGGHWRVLRRLCSMEFLVNKRMNETTDLRRRIEDNMVRWIEEDS  168

Query  916   -AGSIKRGSG-IHVTRFVFLATFNLLGNIMFSSDLVDPVSEKGSKFFNAMMGIMERGGTP  743
              A   + G+G + ++RF+FL  FNL+GN+M S DL+D    +  +FF+ M  I+E  GTP
Sbjct  169   LASKAQGGTGAVQLSRFLFLMAFNLVGNLMLSRDLLDSKDPESREFFDCMNEILELAGTP  228

Query  742   NISDIFPCLRWLDLQGLRTKTDKDLQIALQIVSTFVQKRSKEGQDDSGKRKSDFLDVLLS  563
             NI+D  P L+ LD  G++ +   ++   ++I S FVQ+R    +      K DFLDV+L 
Sbjct  229   NIADFLPLLKKLDPLGMKKRMVDNMTRTMKISSKFVQERLDNRKAGKVNEKKDFLDVMLE  288

Query  562   FEGSGKDEPPKLSEHQINIFILEMFLAGTDTTS  464
             ++G GKD P K +E  +NI I+EMF AG++TTS
Sbjct  289   YQGDGKDGPDKFTEQHVNIVIMEMFFAGSETTS  321


 Score =   155 bits (392),  Expect = 6e-38, Method: Compositional matrix adjust.
 Identities = 70/110 (64%), Positives = 86/110 (78%), Gaps = 0/110 (0%)
 Frame = -1

Query  332  TSSTVEWALTELLRNPKAMTKAKEEIRGIVGPTRRFEESDIDNLQYLQAVVKETLRLHPP  153
            TS ++EW  TELLRNP A  K +EEI  +VG  R  EE+D++NL YLQAVVKETLRLHP 
Sbjct  320  TSISIEWGFTELLRNPYAFKKVREEIDRVVGVNRMVEETDMENLPYLQAVVKETLRLHPA  379

Query  152  APFLIPRRAIQDTKFMGYDIPKDTQVFINVWAIGRDHESWEDPLSFKPER  3
             P L+PR  ++DT++MGY IPK TQVF+N WAIGRD + W+DPL+FKPER
Sbjct  380  LPMLLPRNTMEDTEYMGYLIPKGTQVFVNAWAIGRDADYWQDPLTFKPER  429



>gb|KDP27489.1| hypothetical protein JCGZ_20024 [Jatropha curcas]
Length=510

 Score =   261 bits (666),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 125/274 (46%), Positives = 186/274 (68%), Gaps = 3/274 (1%)
 Frame = -2

Query  1273  NMLDLGSVPHQTIAAMRNKYGPVVWLRIGSVSTLAIQSAKAAAELFKNHDVPFAGRSIGD  1094
             N+ DLG++ H+ +  ++ KYGPV+ LRIG V T+ IQSAKA  ELFKNHD  F  R++  
Sbjct  47    NIFDLGTMAHRILYELKFKYGPVLRLRIGLVDTVVIQSAKAVMELFKNHDASFCDRTVPC  106

Query  1093  VMLAQGYNKGSMALAQYGSYWRVLRRICSVEMFVHKKVNETAAVRRKCIDDLLRWVENE-  917
             V+ +  Y +GS+A+ ++G YWR +RRIC++E+  ++++NET  +RRKCID ++R +E++ 
Sbjct  107   VLTSHNYKEGSIAVGRFGPYWRTIRRICAIELLANRRINETVQIRRKCIDVMIRSIEDDM  166

Query  916   -AGSIKRGSG-IHVTRFVFLATFNLLGNIMFSSDLVDPVSEKGSKFFNAMMGIMERGGTP  743
              AG     SG +H+  ++F+ TFNL+GN+M S DL D   ++G +FF AM  +M   GTP
Sbjct  167   AAGKASGESGKVHIPHYLFVMTFNLIGNLMLSKDLFDSKCKEGYEFFEAMDKVMVWAGTP  226

Query  742   NISDIFPCLRWLDLQGLRTKTDKDLQIALQIVSTFVQKRSKEGQDDSGKRKSDFLDVLLS  563
             N++D  P L+WLD QGL+    +D+  A  IV+ FV++R ++ +    K   DFLDVLL 
Sbjct  227   NLADFLPFLQWLDPQGLKRNMSRDMGRAKDIVAGFVKERIEDYKMGKKKANKDFLDVLLE  286

Query  562   FEGSGKDEPPKLSEHQINIFILEMFLAGTDTTSS  461
             FEG GK+   K+   ++ I ILEMF AG++TTSS
Sbjct  287   FEGDGKEWEGKIPYDKMIIIILEMFFAGSETTSS  320


 Score =   157 bits (397),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 71/110 (65%), Positives = 85/110 (77%), Gaps = 0/110 (0%)
 Frame = -1

Query  332  TSSTVEWALTELLRNPKAMTKAKEEIRGIVGPTRRFEESDIDNLQYLQAVVKETLRLHPP  153
            TSST+EW + EL  NP+A+ K K+E+  +VG  R+ EESDID L YLQAV+KET+RLHP 
Sbjct  318  TSSTMEWVMAELFSNPEALRKVKDELDAVVGENRKVEESDIDKLPYLQAVIKETVRLHPV  377

Query  152  APFLIPRRAIQDTKFMGYDIPKDTQVFINVWAIGRDHESWEDPLSFKPER  3
             P L+PR  I+DT FMGY I K TQV IN WAIGRD ESWEDP++FKPER
Sbjct  378  VPLLLPRNTIEDTNFMGYHISKGTQVLINAWAIGRDPESWEDPMNFKPER  427



>emb|CBI38806.3| unnamed protein product [Vitis vinifera]
Length=1183

 Score =   157 bits (398),  Expect(2) = 9e-76, Method: Compositional matrix adjust.
 Identities = 91/271 (34%), Positives = 140/271 (52%), Gaps = 9/271 (3%)
 Frame = -2

Query  1273  NMLDLGSVPHQTIAAMRNKYGPVVWLRIGSVSTLAIQSAKAAAELFKNHDVPFAGRSIGD  1094
             N+L+LG  PHQ+   +   YGP++ L++GS +T+ I S K A E+    D  FA R++ +
Sbjct  672   NLLELGDKPHQSFTTLSKTYGPLMSLKLGSTTTIVISSPKTAQEVLNKKDQAFASRTVLN  731

Query  1093  VMLAQGYNKGSMALAQYGSYWRVLRRICSVEMFVHKKVNETAAVRRKCIDDLLRWVENEA  914
              +  Q ++K SM      ++WR LR+ICS+++F  ++V  +  +RRK +  LL   E+  
Sbjct  732   AIQIQDHHKFSMVFLPASAHWRNLRKICSMQIFSPQRVEASQDLRRKVVQQLL---EHAR  788

Query  913   GSIKRGSGIHVTRFVFLATFNLLGNIMFSSDLVDPVSEKGSKFFNAMMGIMERGGTPNIS  734
              S   G  + V R  F  T NLL N  FS DL    S    +F + +  IM   G PN++
Sbjct  789   ESCNSGRAVDVGRAAFTTTLNLLSNTFFSVDLAHYDSNLSQEFKDLIWSIMVEAGKPNLA  848

Query  733   DIFPCLRWLDLQGLRTKTDKDLQIALQIVSTFVQKRSKEGQDDSGKRKSDFLDVLLSFEG  554
             D FP LR +D QG++ +        L +   F+ +R       +    +D LD LL+   
Sbjct  849   DFFPGLRLVDPQGIQKRMTVYFNKLLDVFDGFINQRLPL---KASSPDNDVLDALLNLNK  905

Query  553   SGKDEPPKLSEHQINIFILEMFLAGTDTTSS  461
                 E   LS + I   + ++F AGTDT SS
Sbjct  906   QHDHE---LSSNDIRHLLTDLFSAGTDTISS  933


 Score =   155 bits (393),  Expect(2) = 9e-76, Method: Composition-based stats.
 Identities = 69/113 (61%), Positives = 86/113 (76%), Gaps = 0/113 (0%)
 Frame = -1

Query  341   TALTSSTVEWALTELLRNPKAMTKAKEEIRGIVGPTRRFEESDIDNLQYLQAVVKETLRL  162
             T   SST+EWA+ ELL NPKAM KA++E+  +VG  R  EESD+  L YLQAVVKET RL
Sbjct  928   TDTISSTIEWAMAELLNNPKAMAKAQDELSQVVGKDRIVEESDVTKLPYLQAVVKETFRL  987

Query  161   HPPAPFLIPRRAIQDTKFMGYDIPKDTQVFINVWAIGRDHESWEDPLSFKPER  3
             HPPAPFL+PR+A  D++ +GY +PK+ QV +NVWAIGRD  +W +P SF PER
Sbjct  988   HPPAPFLVPRKAEMDSEILGYAVPKNAQVLVNVWAIGRDSRTWSNPNSFVPER  1040


 Score =   159 bits (403),  Expect(2) = 8e-74, Method: Composition-based stats.
 Identities = 72/113 (64%), Positives = 87/113 (77%), Gaps = 0/113 (0%)
 Frame = -1

Query  341  TALTSSTVEWALTELLRNPKAMTKAKEEIRGIVGPTRRFEESDIDNLQYLQAVVKETLRL  162
            T  TSST+EWA+ ELL NPKAM KA++E+  +VG  R  EESDI  L YL AVVKET RL
Sbjct  305  TDTTSSTIEWAMAELLNNPKAMAKARDELSQVVGKDRIVEESDISKLPYLHAVVKETFRL  364

Query  161  HPPAPFLIPRRAIQDTKFMGYDIPKDTQVFINVWAIGRDHESWEDPLSFKPER  3
            HPPAPFL+PR+A  D++ +GY +PK+ QV INVWAIGRD ++W DP SF PER
Sbjct  365  HPPAPFLLPRKAEMDSEILGYAVPKNAQVIINVWAIGRDSKTWSDPHSFGPER  417


 Score =   147 bits (370),  Expect(2) = 8e-74, Method: Compositional matrix adjust.
 Identities = 82/271 (30%), Positives = 141/271 (52%), Gaps = 9/271 (3%)
 Frame = -2

Query  1273  NMLDLGSVPHQTIAAMRNKYGPVVWLRIGSVSTLAIQSAKAAAELFKNHDVPFAGRSIGD  1094
             N+L+LG  PH +   +  KYGP++ L++GS++T+ I S + A ++    D  F+GR++ +
Sbjct  49    NLLELGDKPHHSFTTLSKKYGPLMSLKLGSITTIVISSPETAQQVLNKKDQTFSGRTVPN  108

Query  1093  VMLAQGYNKGSMALAQYGSYWRVLRRICSVEMFVHKKVNETAAVRRKCIDDLLRWVENEA  914
              +    ++  S+      ++WR LR+ICS+++F  ++V+    +R+K +  LL   ++  
Sbjct  109   AIQVASHHHFSIGFLPASAHWRNLRKICSMQIFSLQRVDAFHGLRQKVVQQLL---DHAH  165

Query  913   GSIKRGSGIHVTRFVFLATFNLLGNIMFSSDLVDPVSEKGSKFFNAMMGIMERGGTPNIS  734
              S   G  + + R  F    NLL N +FS DL    S    +F   +  I+   G PN++
Sbjct  166   ESCSSGRAVDIGRAAFTIALNLLSNTVFSVDLAHYDSNLSQEFKELIWSILVEVGKPNLA  225

Query  733   DIFPCLRWLDLQGLRTKTDKDLQIALQIVSTFVQKRSKEGQDDSGKRKSDFLDVLLSFEG  554
             D FP LR +D QG+  +          +  +F+ +R    Q  +    +D LD LL+   
Sbjct  226   DFFPGLRLVDPQGIHKRMSVYFNKLFDVFDSFINQRL---QLRASSTDNDVLDALLNLNK  282

Query  553   SGKDEPPKLSEHQINIFILEMFLAGTDTTSS  461
                 E   LS + I   ++++F AGTDTTSS
Sbjct  283   QHDHE---LSCNDIRHLLVDLFSAGTDTTSS  310



>ref|XP_006423711.1| hypothetical protein CICLE_v10028239mg [Citrus clementina]
 gb|ESR36951.1| hypothetical protein CICLE_v10028239mg [Citrus clementina]
Length=506

 Score =   166 bits (420),  Expect(2) = 2e-75, Method: Compositional matrix adjust.
 Identities = 89/272 (33%), Positives = 154/272 (57%), Gaps = 6/272 (2%)
 Frame = -2

Query  1273  NMLDLGSVPHQTIAAMRNKYGPVVWLRIGSVSTLAIQSAKAAAELFKNHDVPFAGRSIGD  1094
             N+L+LG  PH+++A +   YGP++ L++G V+T+ + SA  A  + ++HD  F  R + D
Sbjct  55    NLLELGEKPHKSLAELAKIYGPILSLKLGEVTTVVVSSAPMAKYILQDHDSSFYNRMVKD  114

Query  1093  VMLAQGYNKGSMALAQYGSYWRVLRRICSVEMFVHKKVNETAAVRRKCIDDLLRWVENEA  914
              +    +N+  M +    + W+ LR++C++ +F  +K++    +RRK I +LL +VE   
Sbjct  115   AIFPHQHNEFGMVILPVSTTWKNLRKLCNLHIFTTQKLDANQELRRKKIKNLLSYVEENC  174

Query  913   GSIKRGSGIHVTRFVFLATFNLLGNIMFSSDLVDPVSEKGSKFFNAMMGIMERGGTPNIS  734
                + G  I +++ VF  + NLL N +FS DL D  +E+  KF + +  I+   G PN+S
Sbjct  175   ---RAGKAIDISQVVFNTSLNLLSNTIFSVDLADDTTER--KFKDTVSSILVEIGKPNLS  229

Query  733   DIFPCLRWLDLQGLRTKTDKDLQIALQIVSTFVQKRSKE-GQDDSGKRKSDFLDVLLSFE  557
             D FP L+ LDLQG+R++        L++    + +R K+  Q D      +  DVL +  
Sbjct  230   DHFPLLKRLDLQGIRSRMTFYFGKMLEVFDGLIDQRLKQRQQHDYNSTSIESKDVLGTLL  289

Query  556   GSGKDEPPKLSEHQINIFILEMFLAGTDTTSS  461
                +D+  ++  + I    L++F+AGTDTTSS
Sbjct  290   DIIQDKSVEIDRNYIKHLFLDLFVAGTDTTSS  321


 Score =   145 bits (367),  Expect(2) = 2e-75, Method: Compositional matrix adjust.
 Identities = 66/114 (58%), Positives = 84/114 (74%), Gaps = 0/114 (0%)
 Frame = -1

Query  344  NTALTSSTVEWALTELLRNPKAMTKAKEEIRGIVGPTRRFEESDIDNLQYLQAVVKETLR  165
             T  TSST+EWA+ ELLR+P A++KA+ E+   +G  +  EESDI  L YLQAVVKETLR
Sbjct  315  GTDTTSSTLEWAMAELLRSPDALSKARLELEQTIGKGKTIEESDITRLPYLQAVVKETLR  374

Query  164  LHPPAPFLIPRRAIQDTKFMGYDIPKDTQVFINVWAIGRDHESWEDPLSFKPER  3
            LHP  P L+PR+A+ D +  G+ +PK  QVF+N WAIGRD  +WE+PLSF PER
Sbjct  375  LHPAVPLLLPRKALADVEIAGFIVPKGAQVFVNAWAIGRDELTWENPLSFMPER  428



>ref|XP_010658029.1| PREDICTED: ripening-related P-450 enzyme-like isoform X1 [Vitis 
vinifera]
 ref|XP_010658036.1| PREDICTED: ripening-related P-450 enzyme-like isoform X1 [Vitis 
vinifera]
Length=499

 Score =   177 bits (450),  Expect(2) = 2e-75, Method: Compositional matrix adjust.
 Identities = 93/271 (34%), Positives = 153/271 (56%), Gaps = 6/271 (2%)
 Frame = -2

Query  1273  NMLDLGSVPHQTIAAMRNKYGPVVWLRIGSVSTLAIQSAKAAAELFKNHDVPFAGRSIGD  1094
             ++L+LG+ PH+++A +   YGP++ L++G V+T+ I SA  A E+ +  D+ F  RSI D
Sbjct  46    SLLNLGNRPHESLANLAKTYGPIMTLKLGYVTTIVISSAPMAKEVLQKQDLSFCNRSIPD  105

Query  1093  VMLAQGYNKGSMALAQYGSYWRVLRRICSVEMFVHKKVNETAAVRRKCIDDLLRWVENEA  914
              + A  +N+ SMA     + WR LRR C+  +F  +K++    +R + + +LL  VE   
Sbjct  106   AIRAAKHNQLSMAWLPVSTTWRALRRTCNSHLFTPQKLDSNTHLRHQKVQELLANVEQ--  163

Query  913   GSIKRGSGIHVTRFVFLATFNLLGNIMFSSDLVDPVSEKGSKFFNAMMGIMERGGTPNIS  734
              S + G  + + +  F  + NLL N +FS DLVDP+SE   +F   + G+ME  G PN+ 
Sbjct  164   -SCQAGGPVDIGQEAFRTSLNLLSNTIFSVDLVDPISETAQEFKELVRGVMEEAGKPNLV  222

Query  733   DIFPCLRWLDLQGLRTKTDKDLQIALQIVSTFVQKRSKEGQDDSGKRKSDFLDVLLSFEG  554
             D FP LR +D Q +R +        ++I    +++R +  ++      SD LDVLL+   
Sbjct  223   DYFPVLRRIDPQSIRRRLTIYFGRMIEIFDRMIKQRLQLRKNQGSIASSDVLDVLLNI--  280

Query  553   SGKDEPPKLSEHQINIFILEMFLAGTDTTSS  461
               +D   ++    +   +L++F AGTDTTSS
Sbjct  281   -SEDNSSEIERSHMEHLLLDLFAAGTDTTSS  310


 Score =   134 bits (336),  Expect(2) = 2e-75, Method: Compositional matrix adjust.
 Identities = 62/114 (54%), Positives = 79/114 (69%), Gaps = 0/114 (0%)
 Frame = -1

Query  344  NTALTSSTVEWALTELLRNPKAMTKAKEEIRGIVGPTRRFEESDIDNLQYLQAVVKETLR  165
             T  TSST+EWA+ ELL NP+ + KA+ E+   +G  ++ +ESDI  L YLQAVVKET R
Sbjct  304  GTDTTSSTLEWAMAELLHNPETLLKARMELLQTIGQDKQVKESDISRLPYLQAVVKETFR  363

Query  164  LHPPAPFLIPRRAIQDTKFMGYDIPKDTQVFINVWAIGRDHESWEDPLSFKPER  3
            LHP  PFL+PRR   D    G+ +PK+ QV +N WAIGRD  +WE+P SF PER
Sbjct  364  LHPAVPFLLPRRVEGDADIDGFAVPKNAQVLVNAWAIGRDPNTWENPNSFVPER  417



>ref|XP_006477331.1| PREDICTED: geraniol 8-hydroxylase-like [Citrus sinensis]
Length=499

 Score =   177 bits (450),  Expect(2) = 2e-75, Method: Compositional matrix adjust.
 Identities = 94/271 (35%), Positives = 146/271 (54%), Gaps = 6/271 (2%)
 Frame = -2

Query  1273  NMLDLGSVPHQTIAAMRNKYGPVVWLRIGSVSTLAIQSAKAAAELFKNHDVPFAGRSIGD  1094
             N+L+LG  PH+++A +   +GP++ L+ G V+T+   SA  A E+ +N D  F  R+I D
Sbjct  46    NLLELGDKPHKSLAKLAKIHGPIMSLKFGQVTTVVFSSAAMAKEILQNQDTSFCNRTIPD  105

Query  1093  VMLAQGYNKGSMALAQYGSYWRVLRRICSVEMFVHKKVNETAAVRRKCIDDLLRWVENEA  914
              + A G+++  M      + WR  R+IC+   F  ++++    +RRK I DLL +V+   
Sbjct  106   AIYAHGHHEFGMPWLPVATLWRNFRKICNSHAFSSRQLDANQHLRRKKIQDLLAYVQENC  165

Query  913   GSIKRGSGIHVTRFVFLATFNLLGNIMFSSDLVDPVSEKGSKFFNAMMGIMERGGTPNIS  734
                + G+ IH+ +  F  T NL+ N +FS DL DP S+   +F     G+ME  G PN+S
Sbjct  166   ---RAGTAIHIGQAAFDTTLNLISNTIFSIDLADPTSKTAREFKQINWGMMEEAGKPNLS  222

Query  733   DIFPCLRWLDLQGLRTKTDKDLQIALQIVSTFVQKRSKEGQDDSGKRKSDFLDVLLSFEG  554
             D FP L  LDLQG+R +        L +    + +R K+ Q+       D LD LL    
Sbjct  223   DFFPALENLDLQGIRRRMTVYFGKMLDVFDRLIDQRLKQRQERDFTESKDMLDALLKI--  280

Query  553   SGKDEPPKLSEHQINIFILEMFLAGTDTTSS  461
               +D+  ++  + I    L +F AGTDTTSS
Sbjct  281   -CEDKSVEIDINDIKHLFLVLFTAGTDTTSS  310


 Score =   134 bits (337),  Expect(2) = 2e-75, Method: Compositional matrix adjust.
 Identities = 62/114 (54%), Positives = 78/114 (68%), Gaps = 0/114 (0%)
 Frame = -1

Query  344  NTALTSSTVEWALTELLRNPKAMTKAKEEIRGIVGPTRRFEESDIDNLQYLQAVVKETLR  165
             T  TSST+EWA+TELLRNP  ++K + E+   +G     EESDI  L YLQAV+KET R
Sbjct  304  GTDTTSSTLEWAMTELLRNPDILSKVRLELEQTIGKCNPIEESDISRLPYLQAVLKETFR  363

Query  164  LHPPAPFLIPRRAIQDTKFMGYDIPKDTQVFINVWAIGRDHESWEDPLSFKPER  3
            LHP AP L+PR+A  DT+  G+ +P   QV +N WAIGRD   W++P SF PER
Sbjct  364  LHPAAPLLLPRKASADTEVAGFMVPNGAQVLVNTWAIGRDASLWDNPYSFVPER  417



>ref|XP_006487469.1| PREDICTED: geraniol 8-hydroxylase-like [Citrus sinensis]
Length=506

 Score =   166 bits (419),  Expect(2) = 3e-75, Method: Compositional matrix adjust.
 Identities = 89/272 (33%), Positives = 154/272 (57%), Gaps = 6/272 (2%)
 Frame = -2

Query  1273  NMLDLGSVPHQTIAAMRNKYGPVVWLRIGSVSTLAIQSAKAAAELFKNHDVPFAGRSIGD  1094
             N+L+LG  PH+++A +   YGP++ L++G V+T+ + SA  A  + ++HD  F  R + D
Sbjct  55    NLLELGEKPHKSLAELAKIYGPILSLKLGEVTTVVVSSAPMAKYILQDHDSSFYNRMVKD  114

Query  1093  VMLAQGYNKGSMALAQYGSYWRVLRRICSVEMFVHKKVNETAAVRRKCIDDLLRWVENEA  914
              +    +N+  M L    + W+ LR++C++ +F  +K++    +RRK I +LL +VE   
Sbjct  115   AIFPHQHNEFGMVLLPVSTTWKNLRKLCNLHIFTTQKLDANQELRRKKIKNLLSYVEENC  174

Query  913   GSIKRGSGIHVTRFVFLATFNLLGNIMFSSDLVDPVSEKGSKFFNAMMGIMERGGTPNIS  734
                + G  I +++ VF  + NLL N +FS DL D  +E+  KF + +  I+   G PN+S
Sbjct  175   ---RAGKAIDISQVVFNTSLNLLSNTIFSVDLADDTTER--KFKDTVSSILVEIGKPNLS  229

Query  733   DIFPCLRWLDLQGLRTKTDKDLQIALQIVSTFVQKRSKE-GQDDSGKRKSDFLDVLLSFE  557
             D FP L+ LDLQG+R++        L++    + +R K+  Q D      +  DVL +  
Sbjct  230   DHFPLLKRLDLQGIRSRMTFYFGKMLEVFDGLIDQRLKQRQQHDYNSTSIESKDVLGTLL  289

Query  556   GSGKDEPPKLSEHQINIFILEMFLAGTDTTSS  461
                +D+  ++  + +    L++F+AGTDTTSS
Sbjct  290   DIIQDKSVEIDRNYMKHLFLDLFVAGTDTTSS  321


 Score =   145 bits (366),  Expect(2) = 3e-75, Method: Compositional matrix adjust.
 Identities = 66/114 (58%), Positives = 84/114 (74%), Gaps = 0/114 (0%)
 Frame = -1

Query  344  NTALTSSTVEWALTELLRNPKAMTKAKEEIRGIVGPTRRFEESDIDNLQYLQAVVKETLR  165
             T  TSST+EWA+ ELLR+P A++KA+ E+   +G  +  EESDI  L YLQAVVKETLR
Sbjct  315  GTDTTSSTLEWAMAELLRSPDALSKARLELEQTIGKGKTIEESDITRLPYLQAVVKETLR  374

Query  164  LHPPAPFLIPRRAIQDTKFMGYDIPKDTQVFINVWAIGRDHESWEDPLSFKPER  3
            LHP  P L+PR+A+ D +  G+ +PK  QVF+N WAIGRD  +WE+PLSF PER
Sbjct  375  LHPAVPLLLPRKALADVEIAGFIVPKGAQVFVNAWAIGRDELTWENPLSFMPER  428



>ref|XP_011017516.1| PREDICTED: geraniol 8-hydroxylase-like [Populus euphratica]
Length=500

 Score =   166 bits (420),  Expect(2) = 3e-75, Method: Compositional matrix adjust.
 Identities = 91/274 (33%), Positives = 149/274 (54%), Gaps = 9/274 (3%)
 Frame = -2

Query  1273  NMLDLGSVPHQTIAAMRNKYGPVVWLRIGSVSTLAIQSAKAAAELFKNHDVPFAGRSIGD  1094
             N+L L   PH+T A +   YGP++ L++GS +T+ I S   A E  + HD   + R+I D
Sbjct  47    NILALSDKPHRTFAKLSQTYGPIMTLKLGSRTTIVISSPNIAKEALQKHDQALSSRTIPD  106

Query  1093  VMLAQGYN--KGSMALAQYGSYWRVLRRICSVEMFVHKKVNETAAVRRKCIDDLLRWVEN  920
              +  Q YN  K SM      ++W+ L+++ + +MF  ++++ + A+R K + +LL +V  
Sbjct  107   AIRVQHYNYHKNSMVWLPVSTHWKFLKKLAATQMFTSQRLDASRALREKKVQELLEYVHE  166

Query  919   EAGSIKRGSGIHVTRFVFLATFNLLGNIMFSSDLVDPVSEKGSKFFNAMMGIMERGGTPN  740
                +   G  + V R VF    NL+ N  FS D+ +  S    +F + ++G +E+ G  N
Sbjct  167   NCNN---GHAVDVGRSVFTTVLNLISNTFFSLDVTNYNSGLSQEFSDLVVGFLEQIGKSN  223

Query  739   ISDIFPCLRWLDLQGLRTKTDKDLQIALQIVSTFVQKRSK-EGQDDSGKRKSDFLDVLLS  563
             I+D FP LR +D QG+R KT+  L+   QI  + + +R++      + K   D LD LL 
Sbjct  224   IADYFPILRLVDPQGIRRKTNNYLKRLTQIFDSIINERTRLRSSSVASKASHDVLDTLLI  283

Query  562   FEGSGKDEPPKLSEHQINIFILEMFLAGTDTTSS  461
                    E   LS  +I + +++ F+AGTDTTSS
Sbjct  284   LAQENNSE---LSSTEIQVLLIDFFVAGTDTTSS  314


 Score =   145 bits (365),  Expect(2) = 3e-75, Method: Compositional matrix adjust.
 Identities = 67/114 (59%), Positives = 83/114 (73%), Gaps = 3/114 (3%)
 Frame = -1

Query  344  NTALTSSTVEWALTELLRNPKAMTKAKEEIRGIVGPTRRFEESDIDNLQYLQAVVKETLR  165
             T  TSSTVEWA+TELLRNP  M KAK E++ + GP    +ESDI    YLQA+VKET R
Sbjct  308  GTDTTSSTVEWAMTELLRNPDKMFKAKNELQQVEGPV---QESDISKCPYLQAIVKETFR  364

Query  164  LHPPAPFLIPRRAIQDTKFMGYDIPKDTQVFINVWAIGRDHESWEDPLSFKPER  3
            LHPP PFL+PR+A+ + +  G+ +PK+ Q+ IN+WAIGRD   W DP SFKPER
Sbjct  365  LHPPVPFLLPRKAVSEVEMQGFTVPKNAQILINIWAIGRDPAIWPDPNSFKPER  418



>ref|XP_002276576.1| PREDICTED: geraniol 8-hydroxylase [Vitis vinifera]
Length=499

 Score =   158 bits (400),  Expect(2) = 4e-75, Method: Compositional matrix adjust.
 Identities = 91/271 (34%), Positives = 140/271 (52%), Gaps = 9/271 (3%)
 Frame = -2

Query  1273  NMLDLGSVPHQTIAAMRNKYGPVVWLRIGSVSTLAIQSAKAAAELFKNHDVPFAGRSIGD  1094
             N+L+LG  PHQ+   +   YGP++ L++GS +T+ I S K A E+    D  FA R++ +
Sbjct  49    NLLELGDKPHQSFTTLSKTYGPLMSLKLGSTTTIVISSPKTAQEVLNKKDQAFASRTVLN  108

Query  1093  VMLAQGYNKGSMALAQYGSYWRVLRRICSVEMFVHKKVNETAAVRRKCIDDLLRWVENEA  914
              +  Q ++K SM      ++WR LR+ICS+++F  ++V  +  +RRK +  LL   E+  
Sbjct  109   AIQIQDHHKFSMVFLPASAHWRNLRKICSMQIFSPQRVEASQDLRRKVVQQLL---EHAR  165

Query  913   GSIKRGSGIHVTRFVFLATFNLLGNIMFSSDLVDPVSEKGSKFFNAMMGIMERGGTPNIS  734
              S   G  + V R  F  T NLL N  FS DL    S    +F + +  IM   G PN++
Sbjct  166   ESCNSGRAVDVGRAAFTTTLNLLSNTFFSVDLAHYDSNLSQEFKDLIWSIMVEAGKPNLA  225

Query  733   DIFPCLRWLDLQGLRTKTDKDLQIALQIVSTFVQKRSKEGQDDSGKRKSDFLDVLLSFEG  554
             D FP LR +D QG++ +        L +   F+ +R       +    +D LD LL+   
Sbjct  226   DFFPGLRLVDPQGIQKRMTVYFNKLLDVFDGFINQRLPLK---ASSPDNDVLDALLNLNK  282

Query  553   SGKDEPPKLSEHQINIFILEMFLAGTDTTSS  461
                 E   LS + I   + ++F AGTDT SS
Sbjct  283   QHDHE---LSSNDIRHLLTDLFSAGTDTISS  310


 Score =   152 bits (385),  Expect(2) = 4e-75, Method: Compositional matrix adjust.
 Identities = 69/114 (61%), Positives = 86/114 (75%), Gaps = 0/114 (0%)
 Frame = -1

Query  344  NTALTSSTVEWALTELLRNPKAMTKAKEEIRGIVGPTRRFEESDIDNLQYLQAVVKETLR  165
             T   SST+EWA+ ELL NPKAM KA++E+  +VG  R  EESD+  L YLQAVVKET R
Sbjct  304  GTDTISSTIEWAMAELLNNPKAMAKAQDELSQVVGKDRIVEESDVTKLPYLQAVVKETFR  363

Query  164  LHPPAPFLIPRRAIQDTKFMGYDIPKDTQVFINVWAIGRDHESWEDPLSFKPER  3
            LHPPAPFL+PR+A  D++ +GY +PK+ QV +NVWAIGRD  +W +P SF PER
Sbjct  364  LHPPAPFLVPRKAEMDSEILGYAVPKNAQVLVNVWAIGRDSRTWSNPNSFVPER  417



>ref|NP_001268152.1| ripening-related P-450 enzyme-like [Vitis vinifera]
 emb|CAB85635.1| putative ripening-related P-450 enzyme [Vitis vinifera]
Length=499

 Score =   176 bits (445),  Expect(2) = 1e-74, Method: Compositional matrix adjust.
 Identities = 93/271 (34%), Positives = 151/271 (56%), Gaps = 6/271 (2%)
 Frame = -2

Query  1273  NMLDLGSVPHQTIAAMRNKYGPVVWLRIGSVSTLAIQSAKAAAELFKNHDVPFAGRSIGD  1094
             ++L+LG+ PH+++A +   YGP++ L++G V+T+ I SA  A E+ +  D+ F  RSI D
Sbjct  46    SLLNLGNRPHESLANLAKTYGPIMTLKLGYVTTIVISSAPMAKEVLQKQDLSFCNRSIPD  105

Query  1093  VMLAQGYNKGSMALAQYGSYWRVLRRICSVEMFVHKKVNETAAVRRKCIDDLLRWVENEA  914
              + A  +N+ SMA     + WR LRR C+  +F  +K++    +R + + +LL  VE   
Sbjct  106   AIRAAKHNQLSMAWIPVSTTWRALRRTCNSHLFTSQKLDSNTHLRHQKVQELLANVEQ--  163

Query  913   GSIKRGSGIHVTRFVFLATFNLLGNIMFSSDLVDPVSEKGSKFFNAMMGIMERGGTPNIS  734
              S + G  + + +  F  + NLL N +FS DLVDP+SE   +F   + G+ME  G PN+ 
Sbjct  164   -SCQAGGPVDIGQEAFRTSLNLLSNTIFSVDLVDPISETAQEFKELVRGVMEEAGKPNLV  222

Query  733   DIFPCLRWLDLQGLRTKTDKDLQIALQIVSTFVQKRSKEGQDDSGKRKSDFLDVLLSFEG  554
               FP LR +D QG+R +        ++I    +++R +  +       SD LDVLL+   
Sbjct  223   YYFPVLRQIDPQGIRRRLTIYFGRMIEIFDRMIKQRLQLRKIQGSIASSDVLDVLLNISE  282

Query  553   SGKDEPPKLSEHQINIFILEMFLAGTDTTSS  461
                +E   +    +   +L++F AGTDTTSS
Sbjct  283   DNSNE---IERSHMEHLLLDLFAAGTDTTSS  310


 Score =   134 bits (336),  Expect(2) = 1e-74, Method: Compositional matrix adjust.
 Identities = 62/114 (54%), Positives = 79/114 (69%), Gaps = 0/114 (0%)
 Frame = -1

Query  344  NTALTSSTVEWALTELLRNPKAMTKAKEEIRGIVGPTRRFEESDIDNLQYLQAVVKETLR  165
             T  TSST+EWA+ ELL NP+ + KA+ E+   +G  ++ +ESDI  L YLQAVVKET R
Sbjct  304  GTDTTSSTLEWAMAELLHNPETLLKARMELLQTIGQDKQVKESDISRLPYLQAVVKETFR  363

Query  164  LHPPAPFLIPRRAIQDTKFMGYDIPKDTQVFINVWAIGRDHESWEDPLSFKPER  3
            LHP  PFL+PRR   D    G+ +PK+ QV +N WAIGRD  +WE+P SF PER
Sbjct  364  LHPAVPFLLPRRVEGDADIDGFAVPKNAQVLVNAWAIGRDPNTWENPNSFVPER  417



>gb|KDP24880.1| hypothetical protein JCGZ_25133 [Jatropha curcas]
Length=510

 Score =   254 bits (650),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 130/274 (47%), Positives = 183/274 (67%), Gaps = 3/274 (1%)
 Frame = -2

Query  1273  NMLDLGSVPHQTIAAMRNKYGPVVWLRIGSVSTLAIQSAKAAAELFKNHDVPFAGRSIGD  1094
             N+ DLG + H+ +  ++ KYGPV+ LR+GSV T+ IQSAKAA ELFKNHD  F  R++  
Sbjct  47    NIFDLGIMAHRILYELKLKYGPVLRLRLGSVDTVVIQSAKAAMELFKNHDASFCDRTVPC  106

Query  1093  VMLAQGYNKGSMALAQYGSYWRVLRRICSVEMFVHKKVNETAAVRRKCIDDLLRWVENE-  917
             V+    Y  GS+AL ++G YWR LRRIC++E+  ++++NET  +RRKCID ++R +E++ 
Sbjct  107   VLTPHNYKDGSLALGRFGPYWRTLRRICAIELLANRRMNETVQIRRKCIDVMIRSIEDDM  166

Query  916   -AGSIKRGSGI-HVTRFVFLATFNLLGNIMFSSDLVDPVSEKGSKFFNAMMGIMERGGTP  743
              AG     SGI H+  ++F+ TFNL+GN+M S DL D   ++G +FF AM  +M   GTP
Sbjct  167   AAGKASGESGIVHIPHYLFVMTFNLIGNLMLSKDLFDSKCKEGYEFFEAMDKVMVWAGTP  226

Query  742   NISDIFPCLRWLDLQGLRTKTDKDLQIALQIVSTFVQKRSKEGQDDSGKRKSDFLDVLLS  563
             N++D  P L+WLD QGL     +D+  A  IV+ FV++R ++ +    K   DFLDVLL 
Sbjct  227   NLADFLPFLQWLDPQGLIRNMSRDMGRAKDIVAGFVKERIEDYKMGKKKANKDFLDVLLE  286

Query  562   FEGSGKDEPPKLSEHQINIFILEMFLAGTDTTSS  461
             FEG GK+   K+   +I I ILEMF AG +TTSS
Sbjct  287   FEGDGKEWEGKIPYDKIIIIILEMFFAGPETTSS  320


 Score =   154 bits (389),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 70/110 (64%), Positives = 84/110 (76%), Gaps = 0/110 (0%)
 Frame = -1

Query  332  TSSTVEWALTELLRNPKAMTKAKEEIRGIVGPTRRFEESDIDNLQYLQAVVKETLRLHPP  153
            TSST+EW + EL  +PKA+ K K+E+  +VG  R+ EESDID L YLQAV+KET RLHP 
Sbjct  318  TSSTMEWVMAELFSDPKALRKVKDELDTVVGENRKVEESDIDKLPYLQAVIKETCRLHPV  377

Query  152  APFLIPRRAIQDTKFMGYDIPKDTQVFINVWAIGRDHESWEDPLSFKPER  3
             P L+PR  I+DT FMGY I K TQV +N WAIGRD ESWEDP++FKPER
Sbjct  378  VPLLLPRNTIEDTNFMGYHISKGTQVLVNAWAIGRDPESWEDPMNFKPER  427



>ref|XP_006440464.1| hypothetical protein CICLE_v10019826mg [Citrus clementina]
 gb|ESR53704.1| hypothetical protein CICLE_v10019826mg [Citrus clementina]
Length=499

 Score =   176 bits (446),  Expect(2) = 4e-74, Method: Compositional matrix adjust.
 Identities = 94/271 (35%), Positives = 146/271 (54%), Gaps = 6/271 (2%)
 Frame = -2

Query  1273  NMLDLGSVPHQTIAAMRNKYGPVVWLRIGSVSTLAIQSAKAAAELFKNHDVPFAGRSIGD  1094
             N+L+LG  PH+++A +   +GP++ L+ G V+T+   SA  A E+ +N D  F  R+I D
Sbjct  46    NLLELGDKPHKSLAKLAKIHGPIMSLKFGQVTTVVFSSAAMAKEILQNQDTSFCNRTIPD  105

Query  1093  VMLAQGYNKGSMALAQYGSYWRVLRRICSVEMFVHKKVNETAAVRRKCIDDLLRWVENEA  914
              + A G+++  M      + WR LR+IC+   F  ++++    +RRK I DLL +V+   
Sbjct  106   AIYAHGHHEFGMPWLPVATLWRNLRKICNSHAFSSRQLDANQHLRRKKIQDLLAYVQENC  165

Query  913   GSIKRGSGIHVTRFVFLATFNLLGNIMFSSDLVDPVSEKGSKFFNAMMGIMERGGTPNIS  734
                + G+ IH+ +  F  T NL+ N +FS DL DP S+   +F     G+ME  G PN+S
Sbjct  166   ---RAGTAIHIGQAAFDTTLNLISNTIFSIDLADPTSKTAREFKQTNWGMMEEAGKPNLS  222

Query  733   DIFPCLRWLDLQGLRTKTDKDLQIALQIVSTFVQKRSKEGQDDSGKRKSDFLDVLLSFEG  554
             D FP L  LDLQG+R +        L +    + +R K+ Q+       D L  LL    
Sbjct  223   DFFPVLENLDLQGIRRRMTVYFGKMLDVFDRLIDQRLKQRQERDFTESKDMLGALLKI--  280

Query  553   SGKDEPPKLSEHQINIFILEMFLAGTDTTSS  461
               +D+  ++  + I    L +F AGTDTTSS
Sbjct  281   -CEDKSVEIDINDIKHLFLVLFAAGTDTTSS  310


 Score =   131 bits (330),  Expect(2) = 4e-74, Method: Compositional matrix adjust.
 Identities = 61/114 (54%), Positives = 77/114 (68%), Gaps = 0/114 (0%)
 Frame = -1

Query  344  NTALTSSTVEWALTELLRNPKAMTKAKEEIRGIVGPTRRFEESDIDNLQYLQAVVKETLR  165
             T  TSST+EWA+TELLRNP  ++K + E+   +G     EESDI  L YLQAV+KET R
Sbjct  304  GTDTTSSTLEWAMTELLRNPDILSKVRLELEQTIGKGNPIEESDITRLPYLQAVLKETFR  363

Query  164  LHPPAPFLIPRRAIQDTKFMGYDIPKDTQVFINVWAIGRDHESWEDPLSFKPER  3
            LHP  P L+PR+A  DT+  G+ +P   QV +N WAIGRD   W++P SF PER
Sbjct  364  LHPAVPLLLPRKASADTEVAGFMVPNGAQVLVNTWAIGRDASLWDNPYSFVPER  417



>ref|XP_010544670.1| PREDICTED: cytochrome P450 76C4-like isoform X1 [Tarenaya hassleriana]
Length=508

 Score =   153 bits (386),  Expect(2) = 2e-73, Method: Compositional matrix adjust.
 Identities = 71/114 (62%), Positives = 86/114 (75%), Gaps = 0/114 (0%)
 Frame = -1

Query  344  NTALTSSTVEWALTELLRNPKAMTKAKEEIRGIVGPTRRFEESDIDNLQYLQAVVKETLR  165
             T  +SSTVEWA+ ELLRNPK M KA+EEIR ++G     +ESDI  L YLQAVVKET R
Sbjct  307  GTDTSSSTVEWAMVELLRNPKVMAKAQEEIRRMIGEHEIVQESDIAKLPYLQAVVKETFR  366

Query  164  LHPPAPFLIPRRAIQDTKFMGYDIPKDTQVFINVWAIGRDHESWEDPLSFKPER  3
            LHPPAP LIPR+A  D + +G+ +PK+ QV INVWAIGRD   WE+P+ F+PER
Sbjct  367  LHPPAPLLIPRKAESDVQILGFLVPKNAQVLINVWAIGRDPNVWENPMKFEPER  420


 Score =   152 bits (385),  Expect(2) = 2e-73, Method: Compositional matrix adjust.
 Identities = 85/271 (31%), Positives = 153/271 (56%), Gaps = 3/271 (1%)
 Frame = -2

Query  1273  NMLDLGSVPHQTIAAMRNKYGPVVWLRIGSVSTLAIQSAKAAAELFKNHDVPFAGRSIGD  1094
             N+LD+G  PH ++A +   YGPV+ L++G+++T+ + S +AA E+ + HD   +GR+  D
Sbjct  46    NILDVGKNPHHSLADLSKTYGPVMSLKLGNLTTVVVSSPEAAKEVLQVHDQVLSGRTPSD  105

Query  1093  VMLAQGYNKGSMALAQYGSYWRVLRRICSVEMFVHKKVNETAAVRRKCIDDLLRWVENEA  914
              + A G++  S+      ++WR LR+I + ++F  +++  T  +R   + +LL ++    
Sbjct  106   PVRAIGHHDVSVVWLPASAHWRQLRKILATQLFSPQRLEATKPLRMNKLRELLGFL---G  162

Query  913   GSIKRGSGIHVTRFVFLATFNLLGNIMFSSDLVDPVSEKGSKFFNAMMGIMERGGTPNIS  734
              S  RG  + + R  F+ + N++ NI+FS D     S+   ++ +A + IME  G PNI+
Sbjct  163   ESCSRGEAVDIARSTFVTSLNIISNILFSVDFAGYDSKISYEYQDAAVRIMEVAGKPNIA  222

Query  733   DIFPCLRWLDLQGLRTKTDKDLQIALQIVSTFVQKRSKEGQDDSGKRKSDFLDVLLSFEG  554
             D FP L +LDLQG R +     +   ++   F+  R  +    +G++    +D+L S   
Sbjct  223   DFFPFLGFLDLQGSRKEIKACTERLFRVFQGFIDARIAKRLTHAGRKDGSSVDLLDSLLD  282

Query  553   SGKDEPPKLSEHQINIFILEMFLAGTDTTSS  461
               + +  +L    +  F+L+MFLAGTDT+SS
Sbjct  283   LAQGDKSELGLKDVKHFLLDMFLAGTDTSSS  313



>emb|CAN75686.1| hypothetical protein VITISV_010578 [Vitis vinifera]
Length=499

 Score =   157 bits (396),  Expect(2) = 2e-73, Method: Compositional matrix adjust.
 Identities = 72/114 (63%), Positives = 87/114 (76%), Gaps = 0/114 (0%)
 Frame = -1

Query  344  NTALTSSTVEWALTELLRNPKAMTKAKEEIRGIVGPTRRFEESDIDNLQYLQAVVKETLR  165
             T  TSST+EWA+ ELL NPKAM KA++E+  +VG  R  EESDI  L YL AVVKET R
Sbjct  304  GTDTTSSTIEWAMAELLNNPKAMAKARDELSQVVGKDRIVEESDISKLPYLHAVVKETFR  363

Query  164  LHPPAPFLIPRRAIQDTKFMGYDIPKDTQVFINVWAIGRDHESWEDPLSFKPER  3
            LHPPAPFL+PR+A  D++ +GY +PK+ QV INVWAIGRD ++W DP SF PER
Sbjct  364  LHPPAPFLLPRKAEMDSEILGYAVPKNAQVIINVWAIGRDSKTWSDPHSFGPER  417


 Score =   148 bits (374),  Expect(2) = 2e-73, Method: Compositional matrix adjust.
 Identities = 83/271 (31%), Positives = 140/271 (52%), Gaps = 9/271 (3%)
 Frame = -2

Query  1273  NMLDLGSVPHQTIAAMRNKYGPVVWLRIGSVSTLAIQSAKAAAELFKNHDVPFAGRSIGD  1094
             N+L+LG  PH +   +  KYGP++ L++GS++T+ I S + A ++    D  F+GR++ +
Sbjct  49    NLLELGDKPHHSFTTLSKKYGPLMSLKLGSITTIVISSPETAQQVLNKKDQTFSGRTVPN  108

Query  1093  VMLAQGYNKGSMALAQYGSYWRVLRRICSVEMFVHKKVNETAAVRRKCIDDLLRWVENEA  914
              +    +   S+      ++WR LR+ICS+++F  ++V+    +RRK +  LL   ++  
Sbjct  109   AIQVANHQHFSIGFLPASAHWRNLRKICSMQIFSLQRVDAFHGLRRKVVQQLL---DHAH  165

Query  913   GSIKRGSGIHVTRFVFLATFNLLGNIMFSSDLVDPVSEKGSKFFNAMMGIMERGGTPNIS  734
              S   G  + + R  F    NLL N +FS DL    S    +F   +  I+   G PN++
Sbjct  166   ESCSSGRAVDIGRTAFTIALNLLSNTVFSVDLAHYDSNLSQEFKELIWSILVEVGKPNLA  225

Query  733   DIFPCLRWLDLQGLRTKTDKDLQIALQIVSTFVQKRSKEGQDDSGKRKSDFLDVLLSFEG  554
             D FP LR +D QG+  +          +  +F+ +R    Q  +    +D LD LL+   
Sbjct  226   DFFPGLRLVDPQGIHKRMSVYFNKLFDVFDSFINQRL---QLRASSTDNDVLDALLNLNK  282

Query  553   SGKDEPPKLSEHQINIFILEMFLAGTDTTSS  461
                 E   LS + I   ++++F AGTDTTSS
Sbjct  283   QHDHE---LSCNDIRHLLVDLFSAGTDTTSS  310



>gb|AGX93050.1| geraniol 10-hydroxylase-like protein [Lonicera japonica]
Length=498

 Score =   153 bits (386),  Expect(2) = 4e-73, Method: Compositional matrix adjust.
 Identities = 82/267 (31%), Positives = 138/267 (52%), Gaps = 6/267 (2%)
 Frame = -2

Query  1261  LGSVPHQTIAAMRNKYGPVVWLRIGSVSTLAIQSAKAAAELFKNHDVPFAGRSIGDVMLA  1082
             LG  PHQ++A +   YGP++ L++G ++T+ I S+ AA E+ +  D+ F+ R + D + A
Sbjct  48    LGDQPHQSLAKLAKIYGPIMSLKLGRITTVVISSSDAAKEVLQKKDLAFSSRHVPDALHA  107

Query  1081  QGYNKGSMALAQYGSYWRVLRRICSVEMFVHKKVNETAAVRRKCIDDLLRWVENEAGSIK  902
                 K S+        WR LR+I +  +F   +++    +R + +++L+ +    + S  
Sbjct  108   HNQFKFSVVWLPVAPQWRSLRKILNSNIFSGNRLDANQHLRCRKVEELITYCRKSSHS--  165

Query  901   RGSGIHVTRFVFLATFNLLGNIMFSSDLVDPVSEKGSKFFNAMMGIMERGGTPNISDIFP  722
              G  + + R  F  + NLL N +FS DL DP  +   +F   +  IM   G PN+ D FP
Sbjct  166   -GDAVDIGRAAFRTSLNLLSNTIFSKDLTDPYQDSAKEFKELVGNIMVEAGKPNLVDFFP  224

Query  721   CLRWLDLQGLRTKTDKDLQIALQIVSTFVQKRSKEGQDDSGKRKSDFLDVLLSFEGSGKD  542
              L+ +D QG+R +        L++    + +R +         K+D LDV LS     K+
Sbjct  225   SLKKIDPQGIRHRMTIHFGKVLELFGGLINERLELKSSQKSDEKNDVLDVCLSI---SKE  281

Query  541   EPPKLSEHQINIFILEMFLAGTDTTSS  461
              P ++    I    L++F+AGTDTTSS
Sbjct  282   NPDEIDRTHIERMCLDLFVAGTDTTSS  308


 Score =   151 bits (381),  Expect(2) = 4e-73, Method: Compositional matrix adjust.
 Identities = 66/114 (58%), Positives = 86/114 (75%), Gaps = 0/114 (0%)
 Frame = -1

Query  344  NTALTSSTVEWALTELLRNPKAMTKAKEEIRGIVGPTRRFEESDIDNLQYLQAVVKETLR  165
             T  TSST+EWA+ E+LRNP+ + KAK E+  ++G  +   E+D+ NL YL+ +VKETLR
Sbjct  302  GTDTTSSTLEWAMAEVLRNPETLVKAKAELEEVIGKGKILAEADVSNLPYLRCIVKETLR  361

Query  164  LHPPAPFLIPRRAIQDTKFMGYDIPKDTQVFINVWAIGRDHESWEDPLSFKPER  3
            +HPP PFLIPR+   D +  GY +PK++QVF+NVWAIGRD   WEDPLSFKPER
Sbjct  362  IHPPVPFLIPRKVEMDVEACGYTVPKNSQVFVNVWAIGRDPTLWEDPLSFKPER  415



>ref|XP_002271652.1| PREDICTED: geraniol 8-hydroxylase [Vitis vinifera]
Length=499

 Score =   157 bits (397),  Expect(2) = 4e-73, Method: Compositional matrix adjust.
 Identities = 72/114 (63%), Positives = 87/114 (76%), Gaps = 0/114 (0%)
 Frame = -1

Query  344  NTALTSSTVEWALTELLRNPKAMTKAKEEIRGIVGPTRRFEESDIDNLQYLQAVVKETLR  165
             T  TSST+EWA+ ELL NPKAM KA++E+  +VG  R  EESDI  L YL AVVKET R
Sbjct  304  GTDTTSSTIEWAMAELLNNPKAMAKARDELSQVVGKDRIVEESDISKLPYLHAVVKETFR  363

Query  164  LHPPAPFLIPRRAIQDTKFMGYDIPKDTQVFINVWAIGRDHESWEDPLSFKPER  3
            LHPPAPFL+PR+A  D++ +GY +PK+ QV INVWAIGRD ++W DP SF PER
Sbjct  364  LHPPAPFLLPRKAEMDSEILGYAVPKNAQVIINVWAIGRDSKTWSDPHSFGPER  417


 Score =   147 bits (370),  Expect(2) = 4e-73, Method: Compositional matrix adjust.
 Identities = 82/271 (30%), Positives = 141/271 (52%), Gaps = 9/271 (3%)
 Frame = -2

Query  1273  NMLDLGSVPHQTIAAMRNKYGPVVWLRIGSVSTLAIQSAKAAAELFKNHDVPFAGRSIGD  1094
             N+L+LG  PH +   +  KYGP++ L++GS++T+ I S + A ++    D  F+GR++ +
Sbjct  49    NLLELGDKPHHSFTTLSKKYGPLMSLKLGSITTIVISSPETAQQVLNKKDQTFSGRTVPN  108

Query  1093  VMLAQGYNKGSMALAQYGSYWRVLRRICSVEMFVHKKVNETAAVRRKCIDDLLRWVENEA  914
              +    ++  S+      ++WR LR+ICS+++F  ++V+    +R+K +  LL   ++  
Sbjct  109   AIQVASHHHFSIGFLPASAHWRNLRKICSMQIFSLQRVDAFHGLRQKVVQQLL---DHAH  165

Query  913   GSIKRGSGIHVTRFVFLATFNLLGNIMFSSDLVDPVSEKGSKFFNAMMGIMERGGTPNIS  734
              S   G  + + R  F    NLL N +FS DL    S    +F   +  I+   G PN++
Sbjct  166   ESCSSGRAVDIGRAAFTIALNLLSNTVFSVDLAHYDSNLSQEFKELIWSILVEVGKPNLA  225

Query  733   DIFPCLRWLDLQGLRTKTDKDLQIALQIVSTFVQKRSKEGQDDSGKRKSDFLDVLLSFEG  554
             D FP LR +D QG+  +          +  +F+ +R    Q  +    +D LD LL+   
Sbjct  226   DFFPGLRLVDPQGIHKRMSVYFNKLFDVFDSFINQRL---QLRASSTDNDVLDALLNLNK  282

Query  553   SGKDEPPKLSEHQINIFILEMFLAGTDTTSS  461
                 E   LS + I   ++++F AGTDTTSS
Sbjct  283   QHDHE---LSCNDIRHLLVDLFSAGTDTTSS  310



>ref|XP_011013817.1| PREDICTED: geraniol 8-hydroxylase-like [Populus euphratica]
Length=496

 Score =   166 bits (419),  Expect(2) = 5e-73, Method: Compositional matrix adjust.
 Identities = 102/292 (35%), Positives = 165/292 (57%), Gaps = 9/292 (3%)
 Frame = -2

Query  1333  RNKSRSGRlppgppglpvlGNMLDLGSVPHQTIAAMRNKYGPVVWLRIGSVSTLAIQSAK  1154
             R KSR   LPPGP  LP++GN+L LG  PH+T+A +   YGP++ L++G ++T+ I S  
Sbjct  27    RRKSRCTVLPPGPRQLPIIGNILALGDKPHRTLANLSQTYGPLMTLKLGRITTIVISSPN  86

Query  1153  AAAELFKNHDVPFAGRSIGDVMLAQGYNKGSMALAQYGSYWRVLRRICSVEMFVHKKVNE  974
              A E  + HD   + R++ D +  + ++K SM      ++W+ L+++ + +MF  ++++ 
Sbjct  87    IAKEALQKHDQALSSRTVPDAL--RVHHKNSMIWLPASTHWKFLKKLTATQMFTSQRLDA  144

Query  973   TAAVRRKCIDDLLRWVENEAGSIKRGSGIHVTRFVFLATFNLLGNIMFSSDLVDPVSEKG  794
             + A+R K + +LL +V  +  +   G  + V R VF    NL+ N  FS D+    S+  
Sbjct  145   SRALRGKKVQELLEYVHEKCSN---GHAVDVGRSVFTTVLNLISNTFFSLDVTTYNSDLS  201

Query  793   SKFFNAMMGIMERGGTPNISDIFPCLRWLDLQGLRTKTDKDLQIALQIVSTFVQKRSK-E  617
              +F + ++G+ME+ G PNI+D FP LR +D QG+R KT   L+   +I  + + +R++  
Sbjct  202   QEFSDLVVGVMEQIGKPNIADYFPILRLVDPQGIRRKTSNYLKRLTKIFDSIINERTRLR  261

Query  616   GQDDSGKRKSDFLDVLLSFEGSGKDEPPKLSEHQINIFILEMFLAGTDTTSS  461
                 + K   D LD LL        E   LS   I I +L+ F AGTDTTSS
Sbjct  262   SSSVASKASHDVLDALLILAKENNTE---LSSTDIQILLLDFFNAGTDTTSS  310


 Score =   138 bits (348),  Expect(2) = 5e-73, Method: Compositional matrix adjust.
 Identities = 65/114 (57%), Positives = 81/114 (71%), Gaps = 3/114 (3%)
 Frame = -1

Query  344  NTALTSSTVEWALTELLRNPKAMTKAKEEIRGIVGPTRRFEESDIDNLQYLQAVVKETLR  165
             T  TSST EWA+TELL  P  M +AK E++ I GP    +ESDI    YLQA+VKET R
Sbjct  304  GTDTTSSTEEWAMTELLLKPDKMVRAKNELQEIEGPV---QESDISKCPYLQAIVKETFR  360

Query  164  LHPPAPFLIPRRAIQDTKFMGYDIPKDTQVFINVWAIGRDHESWEDPLSFKPER  3
            LHPPAPFL+PR+A+ + +  G+ +PK+ Q+ IN+WAIGRD   W DP SFKPER
Sbjct  361  LHPPAPFLLPRKAVSEVEMQGFTVPKNAQILINIWAIGRDPAIWPDPNSFKPER  414



>ref|XP_010544671.1| PREDICTED: cytochrome P450 76C2-like isoform X2 [Tarenaya hassleriana]
Length=508

 Score =   152 bits (385),  Expect(2) = 2e-72, Method: Compositional matrix adjust.
 Identities = 85/271 (31%), Positives = 153/271 (56%), Gaps = 3/271 (1%)
 Frame = -2

Query  1273  NMLDLGSVPHQTIAAMRNKYGPVVWLRIGSVSTLAIQSAKAAAELFKNHDVPFAGRSIGD  1094
             N+LD+G  PH ++A +   YGPV+ L++G+++T+ + S +AA E+ + HD   +GR+  D
Sbjct  46    NILDVGKNPHHSLADLSKTYGPVMSLKLGNLTTVVVSSPEAAKEVLQVHDQVLSGRTPSD  105

Query  1093  VMLAQGYNKGSMALAQYGSYWRVLRRICSVEMFVHKKVNETAAVRRKCIDDLLRWVENEA  914
              + A G++  S+      ++WR LR+I + ++F  +++  T  +R   + +LL ++    
Sbjct  106   PVRAIGHHDVSVVWLPASAHWRQLRKILATQLFSPQRLEATKPLRMNKLRELLGFL---G  162

Query  913   GSIKRGSGIHVTRFVFLATFNLLGNIMFSSDLVDPVSEKGSKFFNAMMGIMERGGTPNIS  734
              S  RG  + + R  F+ + N++ NI+FS D     S+   ++ +A + IME  G PNI+
Sbjct  163   ESCSRGEAVDIARSTFVTSLNIISNILFSVDFAGYDSKISYEYQDAAVRIMEVAGKPNIA  222

Query  733   DIFPCLRWLDLQGLRTKTDKDLQIALQIVSTFVQKRSKEGQDDSGKRKSDFLDVLLSFEG  554
             D FP L +LDLQG R +     +   ++   F+  R  +    +G++    +D+L S   
Sbjct  223   DFFPFLGFLDLQGSRKEIKACTERLFRVFQGFIDARIAKRLTHAGRKDGSSVDLLDSLLD  282

Query  553   SGKDEPPKLSEHQINIFILEMFLAGTDTTSS  461
               + +  +L    +  F+L+MFLAGTDT+SS
Sbjct  283   LAQGDKSELGLKDVKHFLLDMFLAGTDTSSS  313


 Score =   149 bits (376),  Expect(2) = 2e-72, Method: Compositional matrix adjust.
 Identities = 69/114 (61%), Positives = 84/114 (74%), Gaps = 0/114 (0%)
 Frame = -1

Query  344  NTALTSSTVEWALTELLRNPKAMTKAKEEIRGIVGPTRRFEESDIDNLQYLQAVVKETLR  165
             T  +SSTVEWA+ ELLRNPK M KA+ EI  ++ P    +ESDI  L YLQAVVKET R
Sbjct  307  GTDTSSSTVEWAMVELLRNPKVMAKAQAEIARVIDPKGVVQESDIAKLPYLQAVVKETFR  366

Query  164  LHPPAPFLIPRRAIQDTKFMGYDIPKDTQVFINVWAIGRDHESWEDPLSFKPER  3
            LHPPAP LIPR+A  D + +G+ +PK+ QV INVWAIGRD   WE+P+ F+PER
Sbjct  367  LHPPAPLLIPRKAESDVQILGFLVPKNAQVLINVWAIGRDPNVWENPMKFEPER  420



>ref|XP_003536316.1| PREDICTED: geraniol 8-hydroxylase-like [Glycine max]
 gb|KHN37833.1| Cytochrome P450 76C1 [Glycine soja]
Length=497

 Score =   158 bits (399),  Expect(2) = 2e-72, Method: Compositional matrix adjust.
 Identities = 92/271 (34%), Positives = 144/271 (53%), Gaps = 8/271 (3%)
 Frame = -2

Query  1273  NMLDLGSVPHQTIAAMRNKYGPVVWLRIGSVSTLAIQSAKAAAELFKNHDVPFAGRSIGD  1094
             N+L+LG  PHQ++A +   +GPV+ L++G+V+T+ I SA  A E+   HD   + R I  
Sbjct  44    NLLELGQNPHQSMAKLAKIHGPVMSLKLGTVTTIVISSADMAKEVLVTHDESLSNRPIPQ  103

Query  1093  VMLAQGYNKGSMALAQYGSYWRVLRRICSVEMFVHKKVNETAAVRRKCIDDLLRWVENEA  914
              +    +   S+A       WR +R+IC+ ++F HK ++E+  VRRK +  LL  V    
Sbjct  104   SVSVLNHEHYSLAFLPVSPLWREMRKICNGQLFAHKTLDESQDVRRKIVQQLLSDVHK--  161

Query  913   GSIKRGSGIHVTRFVFLATFNLLGNIMFSSDLVDPVSEKGSKFFNAMMGIMERGGTPNIS  734
              S + G  + V R  F  T NLL N +FS DLV      G +F + +  I +  G+PN++
Sbjct  162   -SCQIGEAVDVGRQAFKTTLNLLSNTIFSEDLVLSKGTAG-EFKDLVTNITKLVGSPNMA  219

Query  733   DIFPCLRWLDLQGLRTKTDKDLQIALQIVSTFVQKRSKEGQDDSGKRKSDFLDVLLSFEG  554
             D FP L+ +D QG + +  K++   L I    ++KR K  +       +D LD LL    
Sbjct  220   DYFPVLKRIDPQGAKRQQTKNVAKVLDIFDGLIRKRLKLRESKGSNTHNDMLDALLDISK  279

Query  553   SGKDEPPKLSEHQINIFILEMFLAGTDTTSS  461
               +     + EH  +    ++F+AGTDTTSS
Sbjct  280   ENEMMDKTIIEHLAH----DLFVAGTDTTSS  306


 Score =   143 bits (361),  Expect(2) = 2e-72, Method: Compositional matrix adjust.
 Identities = 64/114 (56%), Positives = 83/114 (73%), Gaps = 0/114 (0%)
 Frame = -1

Query  344  NTALTSSTVEWALTELLRNPKAMTKAKEEIRGIVGPTRRFEESDIDNLQYLQAVVKETLR  165
             T  TSST+EWA+TE++ NP+ M++AK+E+  ++G  +  EESDI  L YLQA++KET R
Sbjct  300  GTDTTSSTIEWAMTEVVLNPEIMSRAKKELEEVIGKGKPVEESDIGKLPYLQAIIKETFR  359

Query  164  LHPPAPFLIPRRAIQDTKFMGYDIPKDTQVFINVWAIGRDHESWEDPLSFKPER  3
            LHPP PFL+PR+A +D    G+ IPKD QV INVW IGRD   WE+P  F PER
Sbjct  360  LHPPVPFLLPRKAERDVDLCGFTIPKDAQVLINVWTIGRDPTLWENPTLFSPER  413



>ref|XP_009787971.1| PREDICTED: geraniol 8-hydroxylase-like [Nicotiana sylvestris]
Length=492

 Score =   157 bits (397),  Expect(2) = 4e-72, Method: Compositional matrix adjust.
 Identities = 90/271 (33%), Positives = 147/271 (54%), Gaps = 11/271 (4%)
 Frame = -2

Query  1273  NMLDLGSVPHQTIAAMRNKYGPVVWLRIGSVSTLAIQSAKAAAELFKNHDVPFAGRSIGD  1094
             N+  LG  PH+++A +   YGP++ L++G V+T+ I S+  A E+ +  D+ FA RS+ D
Sbjct  44    NLHLLGDKPHKSLAKLSKIYGPIMNLKLGQVNTVVISSSVLAREVMQKRDLVFANRSVAD  103

Query  1093  VMLAQGYNKGSMALAQYGSYWRVLRRICSVEMFVHKKVNETAAVRRKCIDDLLRWVENEA  914
              + A+ ++  S+      + WR LR+I +  +F   K++    +R K I++L   V++  
Sbjct  104   ALRARNHSDSSVVFLPVNTRWRTLRKIMNSNIFSGSKLDANQHLRTKKIEEL---VDHFH  160

Query  913   GSIKRGSGIHVTRFVFLATFNLLGNIMFSSDLVDPVSEKGSKFFNAMMGIMERGGTPNIS  734
              S K G+ + + R  F  + NLL N +FS DL DP S+   +F + + GIM   G PN+ 
Sbjct  161   KSAKNGATVDIGRAAFRTSLNLLSNTIFSKDLSDPFSDSAKEFKDLVWGIMVEAGKPNLV  220

Query  733   DIFPCLRWLDLQGLRTKTDKDLQIALQIVSTFVQKRSKEGQDDSGKRKSDFLDVLLSFEG  554
             D FP L  +D QG+R +        L ++S  + +R KE +        D LD LL+   
Sbjct  221   DYFPFLVKIDPQGIRRRMTDHFTKVLDLMSGLIDERLKE-RKLRNHANVDVLDALLNIS-  278

Query  553   SGKDEPPKLSEHQINIFILEMFLAGTDTTSS  461
                   P+L  + I    L++F+AGTDTTS+
Sbjct  279   ------PELDRNHIEHLCLDLFVAGTDTTSN  303


 Score =   144 bits (362),  Expect(2) = 4e-72, Method: Compositional matrix adjust.
 Identities = 63/114 (55%), Positives = 86/114 (75%), Gaps = 0/114 (0%)
 Frame = -1

Query  344  NTALTSSTVEWALTELLRNPKAMTKAKEEIRGIVGPTRRFEESDIDNLQYLQAVVKETLR  165
             T  TS+T+EWA+ ELL+NP  + KA+EE+  ++G  +  +E+DI  L YL+ +VKETLR
Sbjct  297  GTDTTSNTLEWAVAELLKNPHTLEKAQEELAHVIGRGKLVDETDIAQLPYLRCIVKETLR  356

Query  164  LHPPAPFLIPRRAIQDTKFMGYDIPKDTQVFINVWAIGRDHESWEDPLSFKPER  3
            +HP  PFLIPR+  +D +F GY +PKD+QV +NVWAIGRD + WE+PL FKPER
Sbjct  357  IHPALPFLIPRKVEEDVEFCGYIVPKDSQVLVNVWAIGRDSDLWENPLDFKPER  410



>ref|XP_010108078.1| Cytochrome P450 76C4 [Morus notabilis]
 gb|EXC17810.1| Cytochrome P450 76C4 [Morus notabilis]
Length=498

 Score =   160 bits (405),  Expect(2) = 5e-72, Method: Compositional matrix adjust.
 Identities = 84/271 (31%), Positives = 145/271 (54%), Gaps = 7/271 (3%)
 Frame = -2

Query  1273  NMLDLGSVPHQTIAAMRNKYGPVVWLRIGSVSTLAIQSAKAAAELFKNHDVPFAGRSIGD  1094
             N+  LG  PH++++ +   +GP++ L++G V+ + + S   A E+ + HD   + R+I D
Sbjct  46    NLHQLGDKPHKSLSRLAQLHGPLMSLKLGQVTAIVVSSPAMAKEVLQTHDQHLSNRTIPD  105

Query  1093  VMLAQGYNKGSMALAQYGSYWRVLRRICSVEMFVHKKVNETAAVRRKCIDDLLRWVENEA  914
              +   G+    +      ++WR LR+IC+ ++F  K ++    +RR+ + +L   V    
Sbjct  106   ALHILGHQHTGLPWIPVSNHWRTLRKICNTQLFAVKVLDTNQELRRRKVRELFEGVRRSG  165

Query  913   GSIKRGSGIHVTRFVFLATFNLLGNIMFSSDLVDPVSEKGSKFFNAMMGIMERGGTPNIS  734
              +   G  + +    F  T NLL N +FS DL DP SE   +F     GIM+  GTPN+ 
Sbjct  166   SA---GESVDIGSEAFTTTLNLLSNTIFSVDLADPKSELAREFKEVAWGIMKEAGTPNLG  222

Query  733   DIFPCLRWLDLQGLRTKTDKDLQIALQIVSTFVQKRSKEGQDDSGKRKSDFLDVLLSFEG  554
             D FP LR +D QG+R +     +  L ++   + +R +  ++ SG    D LD LL+   
Sbjct  223   DYFPLLRKIDPQGIRRRMTVHFERILSLLDGMINQRLRV-RESSGVVHGDVLDTLLNIIE  281

Query  553   SGKDEPPKLSEHQINIFILEMFLAGTDTTSS  461
                ++   ++ HQ+  F+L +F+AGTDTT+S
Sbjct  282   EKTED---INRHQVLHFLLVLFVAGTDTTAS  309


 Score =   140 bits (353),  Expect(2) = 5e-72, Method: Compositional matrix adjust.
 Identities = 64/114 (56%), Positives = 81/114 (71%), Gaps = 0/114 (0%)
 Frame = -1

Query  344  NTALTSSTVEWALTELLRNPKAMTKAKEEIRGIVGPTRRFEESDIDNLQYLQAVVKETLR  165
             T  T+ST +WA+ ELLRNP+ ++KA+ E+  I+G  ++ EESDI  L YLQAVVKET R
Sbjct  303  GTDTTASTFQWAMAELLRNPEVLSKARAELNQIIGKGKQVEESDIARLPYLQAVVKETFR  362

Query  164  LHPPAPFLIPRRAIQDTKFMGYDIPKDTQVFINVWAIGRDHESWEDPLSFKPER  3
            LHP  P L+PRRA  D +  G+ IPK  Q+ +N WAIGRD  +WEDP  FKPER
Sbjct  363  LHPVVPLLLPRRAETDVEIGGFKIPKGAQIMVNAWAIGRDSGTWEDPNEFKPER  416



>ref|XP_003631427.1| PREDICTED: geraniol 8-hydroxylase-like [Vitis vinifera]
 ref|XP_010661621.1| PREDICTED: geraniol 8-hydroxylase-like [Vitis vinifera]
 ref|XP_010661624.1| PREDICTED: geraniol 8-hydroxylase-like [Vitis vinifera]
 ref|XP_010661630.1| PREDICTED: geraniol 8-hydroxylase-like [Vitis vinifera]
 ref|XP_010661639.1| PREDICTED: geraniol 8-hydroxylase-like [Vitis vinifera]
Length=499

 Score =   170 bits (431),  Expect(2) = 5e-72, Method: Compositional matrix adjust.
 Identities = 92/271 (34%), Positives = 151/271 (56%), Gaps = 6/271 (2%)
 Frame = -2

Query  1273  NMLDLGSVPHQTIAAMRNKYGPVVWLRIGSVSTLAIQSAKAAAELFKNHDVPFAGRSIGD  1094
             N+L+LG+ PH+++A +   YGP++ L++G V+T+ I SA  A E+ +  D+ F  R + D
Sbjct  46    NLLNLGNRPHESLAELAKTYGPIMTLKLGYVTTIVISSAPMAKEVLQKQDLSFCNRFVPD  105

Query  1093  VMLAQGYNKGSMALAQYGSYWRVLRRICSVEMFVHKKVNETAAVRRKCIDDLLRWVENEA  914
              + A  +N+ SMA     + WRVLR+IC+  +F  +K++    +R   + +LL  VE   
Sbjct  106   AIRATNHNQLSMAWMPVSTTWRVLRKICNSHLFTTQKLDSNTHLRHHKVQELLAKVEE--  163

Query  913   GSIKRGSGIHVTRFVFLATFNLLGNIMFSSDLVDPVSEKGSKFFNAMMGIMERGGTPNIS  734
              S + G  +++ R  F  + NLL N +FS DLVDP+SE   +F   +  I+E    PN+ 
Sbjct  164   -SRQAGDAVYIGREAFRTSLNLLSNTIFSVDLVDPISETVLEFQELVRCIIEEIERPNLV  222

Query  733   DIFPCLRWLDLQGLRTKTDKDLQIALQIVSTFVQKRSKEGQDDSGKRKSDFLDVLLSFEG  554
             D FP LR +D QG+R +        + I    +++R +  +       SD LD LL+   
Sbjct  223   DYFPVLRKIDPQGIRRRLTIYFGKMIGIFDRMIKQRLQLRKMQGSIATSDVLDTLLNISE  282

Query  553   SGKDEPPKLSEHQINIFILEMFLAGTDTTSS  461
                +E   +  + +   +L++F+AGTDTTSS
Sbjct  283   DNSNE---IERNHMEHLLLDLFVAGTDTTSS  310


 Score =   130 bits (326),  Expect(2) = 5e-72, Method: Compositional matrix adjust.
 Identities = 62/114 (54%), Positives = 78/114 (68%), Gaps = 0/114 (0%)
 Frame = -1

Query  344  NTALTSSTVEWALTELLRNPKAMTKAKEEIRGIVGPTRRFEESDIDNLQYLQAVVKETLR  165
             T  TSST+EWA+ ELL NP+ + KA+ E+   +G  ++ +ESDI  L +LQAVVKET R
Sbjct  304  GTDTTSSTLEWAMAELLHNPEKLLKARVELLQTIGKDKQVKESDITRLPFLQAVVKETFR  363

Query  164  LHPPAPFLIPRRAIQDTKFMGYDIPKDTQVFINVWAIGRDHESWEDPLSFKPER  3
            LHP  PFLIP R  +DT   G  +PK+ QV +N WAIGRD   WE+P SF PER
Sbjct  364  LHPVVPFLIPHRVEEDTDIDGLTVPKNAQVLVNAWAIGRDPNIWENPNSFVPER  417



>gb|AGX93055.1| geraniol 10-hydroxylase-like protein [Vinca minor]
Length=493

 Score =   153 bits (387),  Expect(2) = 1e-71, Method: Compositional matrix adjust.
 Identities = 83/271 (31%), Positives = 146/271 (54%), Gaps = 8/271 (3%)
 Frame = -2

Query  1273  NMLDLGSVPHQTIAAMRNKYGPVVWLRIGSVSTLAIQSAKAAAELFKNHDVPFAGRSIGD  1094
             N+  LG  PH+++A +  KYGP++ L++G ++TL I S+  A E+ +  D+ F+ RS+ +
Sbjct  42    NLHLLGDHPHKSLAKLSKKYGPIMSLKLGRITTLVISSSTTAKEVLQKQDLAFSSRSVPN  101

Query  1093  VMLAQGYNKGSMALAQYGSYWRVLRRICSVEMFVHKKVNETAAVRRKCIDDLLRWVENEA  914
              + A    + S+      S WR LR+I +  +F   +++    +R + +++L+ +     
Sbjct  102   ALHAHNQFQYSVVWLPVASRWRSLRKILNSNIFSGNRLDANQHLRCRKVEELIAYCRKNC  161

Query  913   GSIKRGSGIHVTRFVFLATFNLLGNIMFSSDLVDPVSEKGSKFFNAMMGIMERGGTPNIS  734
              S   G  + + R  F  + NLL N +FS DL DP S+   +F + +  IM   G PN+ 
Sbjct  162   QS---GEAVDLGRAAFRTSLNLLSNTIFSKDLTDPYSDSAKEFKDLVWNIMVEAGKPNLV  218

Query  733   DIFPCLRWLDLQGLRTKTDKDLQIALQIVSTFVQKRSKEGQDDSGKRKSDFLDVLLSFEG  554
             D FP L  +D QG+R +        +Q+ +  + +R  + +   G   +D LDVLL+   
Sbjct  219   DFFPVLEKVDPQGIRRRMTVHFGKVIQLFNGLINERLDKRKSRGG--YNDVLDVLLT---  273

Query  553   SGKDEPPKLSEHQINIFILEMFLAGTDTTSS  461
             + ++ P ++    I    L++F+AGTDTTSS
Sbjct  274   TTEENPEEIDRTHIERMCLDLFVAGTDTTSS  304


 Score =   146 bits (368),  Expect(2) = 1e-71, Method: Compositional matrix adjust.
 Identities = 64/114 (56%), Positives = 82/114 (72%), Gaps = 0/114 (0%)
 Frame = -1

Query  344  NTALTSSTVEWALTELLRNPKAMTKAKEEIRGIVGPTRRFEESDIDNLQYLQAVVKETLR  165
             T  TSST+EWA+ E+LRNP+ M K +EE+  +VG  +  EE D+  L YL+ VVKETLR
Sbjct  298  GTDTTSSTLEWAMAEMLRNPEKMKKTQEELAEVVGRGKLIEEGDVSRLPYLRCVVKETLR  357

Query  164  LHPPAPFLIPRRAIQDTKFMGYDIPKDTQVFINVWAIGRDHESWEDPLSFKPER  3
            +HPP PFLIPR+ +QD +  GY +PK +QV +N WAIGRD   W+D L FKPER
Sbjct  358  VHPPVPFLIPRKVVQDVEVCGYKVPKGSQVLVNAWAIGRDETFWKDALGFKPER  411



>gb|AGX93051.1| geraniol 10-hydroxylase-like protein [Cinchona calisaya]
Length=493

 Score =   154 bits (388),  Expect(2) = 1e-71, Method: Compositional matrix adjust.
 Identities = 85/271 (31%), Positives = 147/271 (54%), Gaps = 8/271 (3%)
 Frame = -2

Query  1273  NMLDLGSVPHQTIAAMRNKYGPVVWLRIGSVSTLAIQSAKAAAELFKNHDVPFAGRSIGD  1094
             N+  LG  PH+++A +  K+GP++ L++G ++T+ + S+  A E+ +  D+ F+ RSI D
Sbjct  42    NLHLLGDQPHKSLAKLAKKHGPLMSLKLGQITTVVVTSSDMAKEVLQKQDLAFSFRSIPD  101

Query  1093  VMLAQGYNKGSMALAQYGSYWRVLRRICSVEMFVHKKVNETAAVRRKCIDDLLRWVENEA  914
              + A    + S+      S WR LR+I +  +F   +++    +R K + +L+ +    +
Sbjct  102   ALHAHDQYRYSVVWLPVASRWRSLRKILNSNIFSGNRLDANQHLRLKKVQELVAYCRKNS  161

Query  913   GSIKRGSGIHVTRFVFLATFNLLGNIMFSSDLVDPVSEKGSKFFNAMMGIMERGGTPNIS  734
                + G  + V R  F  + NLL N +FS DL DP S+   +F + +  IM   G PN+ 
Sbjct  162   ---QVGEAVDVGRAAFRTSLNLLSNTLFSKDLTDPYSDSAKEFKDLVWNIMLEAGKPNLV  218

Query  733   DIFPCLRWLDLQGLRTKTDKDLQIALQIVSTFVQKRSKEGQDDSGKRKSDFLDVLLSFEG  554
             D FP L  +D QG+R +        L++    V +R ++G+   G   SD LDVLL+   
Sbjct  219   DFFPVLEKIDPQGIRRRMTIHFGKVLKLFGGLVDERLEQGKSKGG--NSDVLDVLLT---  273

Query  553   SGKDEPPKLSEHQINIFILEMFLAGTDTTSS  461
             + ++ P ++    I    L++F+AGTDTTS+
Sbjct  274   TSEEAPGEIDRTHIERMCLDLFVAGTDTTSN  304


 Score =   145 bits (366),  Expect(2) = 1e-71, Method: Compositional matrix adjust.
 Identities = 63/114 (55%), Positives = 84/114 (74%), Gaps = 0/114 (0%)
 Frame = -1

Query  344  NTALTSSTVEWALTELLRNPKAMTKAKEEIRGIVGPTRRFEESDIDNLQYLQAVVKETLR  165
             T  TS+T+EWA+ E+LRNP+ M KAK E+  ++G  +  EE+D+  L YL+ +VKETLR
Sbjct  298  GTDTTSNTLEWAMAEVLRNPEKMKKAKAELAEVIGKGKLVEEADVSRLPYLRCIVKETLR  357

Query  164  LHPPAPFLIPRRAIQDTKFMGYDIPKDTQVFINVWAIGRDHESWEDPLSFKPER  3
            +HPP PFLIPRR  QD +  GY++PK +QV +N WAIGRD   WE+ L+FKPER
Sbjct  358  IHPPVPFLIPRRVDQDVEVCGYNVPKGSQVLVNAWAIGRDETVWENALAFKPER  411



>ref|XP_009757342.1| PREDICTED: geraniol 8-hydroxylase-like [Nicotiana sylvestris]
Length=494

 Score =   172 bits (435),  Expect(2) = 1e-71, Method: Compositional matrix adjust.
 Identities = 85/267 (32%), Positives = 154/267 (58%), Gaps = 6/267 (2%)
 Frame = -2

Query  1261  LGSVPHQTIAAMRNKYGPVVWLRIGSVSTLAIQSAKAAAELFKNHDVPFAGRSIGDVMLA  1082
             LG  PHQ++A +  KYGP++ LR+G + T+ I S+  A ++ KN D+ F+ R+I D + +
Sbjct  50    LGDQPHQSLARLAEKYGPIISLRMGQIRTVVISSSAVAKQVLKNQDLAFSSRTIPDALHS  109

Query  1081  QGYNKGSMALAQYGSYWRVLRRICSVEMFVHKKVNETAAVRRKCIDDLLRWVENEAGSIK  902
               + + S+      + WR LR+I +  +F   +++E   +R + I D + +        +
Sbjct  110   HNHYQFSVVFLPVTTRWRSLRKILNSNIFSGNRLDEYQHLRSQKIQDFIAYC---CQCSQ  166

Query  901   RGSGIHVTRFVFLATFNLLGNIMFSSDLVDPVSEKGSKFFNAMMGIMERGGTPNISDIFP  722
              G  +++ +  F  + NLL + +FS D+VDP +  G +F +A+  IME  G PN++D FP
Sbjct  167   TGKAVNIGQAAFETSMNLLSSTIFSKDVVDPYANSGKEFKDAVWKIMEEAGKPNLADYFP  226

Query  721   CLRWLDLQGLRTKTDKDLQIALQIVSTFVQKRSKEGQDDSGKRKSDFLDVLLSFEGSGKD  542
              L+W+D QG+R +  K     LQ +  ++ +R ++ +       +D LDVLL+   +  +
Sbjct  227   VLKWIDPQGIRRRIGKHFDNLLQQIEGWIDERLEQRRKSPNSGSTDVLDVLLN---TSPE  283

Query  541   EPPKLSEHQINIFILEMFLAGTDTTSS  461
             +P  + ++QI    L++F+AGTDT+S+
Sbjct  284   DPQAIDKNQIVHLCLDLFVAGTDTSSN  310


 Score =   127 bits (319),  Expect(2) = 1e-71, Method: Compositional matrix adjust.
 Identities = 57/114 (50%), Positives = 82/114 (72%), Gaps = 1/114 (1%)
 Frame = -1

Query  344  NTALTSSTVEWALTELLRNPKAMTKAKEEIRGIVGPTRRFEESDIDNLQYLQAVVKETLR  165
             T  +S+T+EWA+ E++RNP  M KAK E+  ++G  +  EE+DI  L YLQ +VKETLR
Sbjct  304  GTDTSSNTLEWAMVEVMRNPDIMRKAKAELAQVIGKGKVIEEADIARLPYLQCIVKETLR  363

Query  164  LHPPAPFLIPRRAIQDTKFMGYDIPKDTQVFINVWAIGRDHESWEDPLSFKPER  3
            +HPP PFL+ R+  QD +  GY IP+ +QV ++VW++GRD   WE+PL+F P+R
Sbjct  364  MHPPVPFLM-RKVDQDVEACGYFIPEGSQVLVHVWSMGRDPTIWENPLAFNPQR  416



>emb|CBI33813.3| unnamed protein product [Vitis vinifera]
Length=594

 Score =   167 bits (422),  Expect(2) = 2e-71, Method: Compositional matrix adjust.
 Identities = 102/291 (35%), Positives = 168/291 (58%), Gaps = 6/291 (2%)
 Frame = -2

Query  1333  RNKSRSGRlppgppglpvlGNMLDLGSVPHQTIAAMRNKYGPVVWLRIGSVSTLAIQSAK  1154
             R+KS +G+LPPGP   P++GN+L+LG+ PH+++A +   YGPV+ L++G V+T+ I SA 
Sbjct  25    RSKSGAGKLPPGPVPFPIIGNLLNLGNKPHESLANLAKIYGPVMSLKLGCVTTVVITSAT  84

Query  1153  AAAELFKNHDVPFAGRSIGDVMLAQGYNKGSMALAQYGSYWRVLRRICSVEMFVHKKVNE  974
              A E+ +  D  F  R+I D + A  +N+ SM      + WR LR+IC+  +F ++K++ 
Sbjct  85    MAKEVLQKKDQSFCNRTIPDALRALNHNQISMVWLPVSTKWRTLRKICNSHIFTNQKLDS  144

Query  973   TAAVRRKCIDDLLRWVENEAGSIKRGSGIHVTRFVFLATFNLLGNIMFSSDLVDPVSEKG  794
             +  +R + + DLL  VE    S + G  + + +  F  T NLL N  FS DLV+P S+  
Sbjct  145   SNYLRHQKVQDLLANVEQ---SCQAGDVVDIGQEAFRTTLNLLSNTTFSVDLVEPSSDTV  201

Query  793   SKFFNAMMGIMERGGTPNISDIFPCLRWLDLQGLRTKTDKDLQIALQIVSTFVQKRSKEG  614
              +F   +  +ME    PN++D FP +R +D QG+R +        ++++   V++R +  
Sbjct  202   QEFKELVRHMMEEAAKPNLADYFPVVRKIDPQGIRRRMAIHFGKMIKVLDKKVKQRLRSR  261

Query  613   QDDSGKRKSDFLDVLLSFEGSGKDEPPKLSEHQINIFILEMFLAGTDTTSS  461
             Q       SD LD LL+     +D    L    I+  +L++F+AGTDTT++
Sbjct  262   QVQGWMASSDVLDTLLNI---SEDSNNFLDITHIDHLLLDLFVAGTDTTAN  309


 Score =   132 bits (331),  Expect(2) = 2e-71, Method: Compositional matrix adjust.
 Identities = 60/113 (53%), Positives = 79/113 (70%), Gaps = 0/113 (0%)
 Frame = -1

Query  341  TALTSSTVEWALTELLRNPKAMTKAKEEIRGIVGPTRRFEESDIDNLQYLQAVVKETLRL  162
            T  T++T+EWA+ ELL NP+ + + + E+R  +G  +  +ESDI  L YLQAVVKET RL
Sbjct  304  TDTTANTLEWAMAELLHNPETLLRVQAELRQTIGKDKLVKESDIARLPYLQAVVKETFRL  363

Query  161  HPPAPFLIPRRAIQDTKFMGYDIPKDTQVFINVWAIGRDHESWEDPLSFKPER  3
            HP  PFL+PR+   DT+  G+ +PKD QV +NVWAIGRD   WE+P  F PER
Sbjct  364  HPAVPFLLPRKVEVDTEMCGFIVPKDAQVLVNVWAIGRDPNLWENPNLFMPER  416



>ref|XP_002276561.1| PREDICTED: geraniol 8-hydroxylase [Vitis vinifera]
Length=498

 Score =   166 bits (421),  Expect(2) = 2e-71, Method: Compositional matrix adjust.
 Identities = 102/291 (35%), Positives = 168/291 (58%), Gaps = 6/291 (2%)
 Frame = -2

Query  1333  RNKSRSGRlppgppglpvlGNMLDLGSVPHQTIAAMRNKYGPVVWLRIGSVSTLAIQSAK  1154
             R+KS +G+LPPGP   P++GN+L+LG+ PH+++A +   YGPV+ L++G V+T+ I SA 
Sbjct  25    RSKSGAGKLPPGPVPFPIIGNLLNLGNKPHESLANLAKIYGPVMSLKLGCVTTVVITSAT  84

Query  1153  AAAELFKNHDVPFAGRSIGDVMLAQGYNKGSMALAQYGSYWRVLRRICSVEMFVHKKVNE  974
              A E+ +  D  F  R+I D + A  +N+ SM      + WR LR+IC+  +F ++K++ 
Sbjct  85    MAKEVLQKKDQSFCNRTIPDALRALNHNQISMVWLPVSTKWRTLRKICNSHIFTNQKLDS  144

Query  973   TAAVRRKCIDDLLRWVENEAGSIKRGSGIHVTRFVFLATFNLLGNIMFSSDLVDPVSEKG  794
             +  +R + + DLL  VE    S + G  + + +  F  T NLL N  FS DLV+P S+  
Sbjct  145   SNYLRHQKVQDLLANVEQ---SCQAGDVVDIGQEAFRTTLNLLSNTTFSVDLVEPSSDTV  201

Query  793   SKFFNAMMGIMERGGTPNISDIFPCLRWLDLQGLRTKTDKDLQIALQIVSTFVQKRSKEG  614
              +F   +  +ME    PN++D FP +R +D QG+R +        ++++   V++R +  
Sbjct  202   QEFKELVRHMMEEAAKPNLADYFPVVRKIDPQGIRRRMAIHFGKMIKVLDKKVKQRLRSR  261

Query  613   QDDSGKRKSDFLDVLLSFEGSGKDEPPKLSEHQINIFILEMFLAGTDTTSS  461
             Q       SD LD LL+     +D    L    I+  +L++F+AGTDTT++
Sbjct  262   QVQGWMASSDVLDTLLNI---SEDSNNFLDITHIDHLLLDLFVAGTDTTAN  309


 Score =   132 bits (331),  Expect(2) = 2e-71, Method: Compositional matrix adjust.
 Identities = 60/113 (53%), Positives = 79/113 (70%), Gaps = 0/113 (0%)
 Frame = -1

Query  341  TALTSSTVEWALTELLRNPKAMTKAKEEIRGIVGPTRRFEESDIDNLQYLQAVVKETLRL  162
            T  T++T+EWA+ ELL NP+ + + + E+R  +G  +  +ESDI  L YLQAVVKET RL
Sbjct  304  TDTTANTLEWAMAELLHNPETLLRVQAELRQTIGKDKLVKESDIARLPYLQAVVKETFRL  363

Query  161  HPPAPFLIPRRAIQDTKFMGYDIPKDTQVFINVWAIGRDHESWEDPLSFKPER  3
            HP  PFL+PR+   DT+  G+ +PKD QV +NVWAIGRD   WE+P  F PER
Sbjct  364  HPAVPFLLPRKVEVDTEMCGFIVPKDAQVLVNVWAIGRDPNLWENPNLFMPER  416



>ref|XP_011099226.1| PREDICTED: geraniol 8-hydroxylase-like [Sesamum indicum]
Length=494

 Score =   152 bits (385),  Expect(2) = 2e-71, Method: Compositional matrix adjust.
 Identities = 83/267 (31%), Positives = 144/267 (54%), Gaps = 7/267 (3%)
 Frame = -2

Query  1261  LGSVPHQTIAAMRNKYGPVVWLRIGSVSTLAIQSAKAAAELFKNHDVPFAGRSIGDVMLA  1082
             LG  PHQ++A +   +GP++ LR+G ++T+ + SA  A E+ +  D+ F+ R+I D + A
Sbjct  46    LGDQPHQSLAKLAKTHGPLMCLRLGFINTVVVSSAAMAKEVLQKQDLVFSSRTIPDAIHA  105

Query  1081  QGYNKGSMALAQYGSYWRVLRRICSVEMFVHKKVNETAAVRRKCIDDLLRWVENEAGSIK  902
                 K S+      S WR LR++ +  +F   +++    +R + + +L+ +    + +  
Sbjct  106   HDQFKYSVVWLPVASRWRSLRKVLNSNIFSGSRLDANQHLRCRKVQELIAYCRKNSQT--  163

Query  901   RGSGIHVTRFVFLATFNLLGNIMFSSDLVDPVSEKGSKFFNAMMGIMERGGTPNISDIFP  722
              G  + V R  F  + NLL N +FS DL DP S+   +F + +  IM   G PN+ D FP
Sbjct  164   -GEPVDVGRAAFRTSLNLLSNTIFSKDLTDPFSDSAKEFKDLVWNIMVEAGKPNLVDFFP  222

Query  721   CLRWLDLQGLRTKTDKDLQIALQIVSTFVQKRSKEGQDDSGKRKSDFLDVLLSFEGSGKD  542
              L  LD QG+R +        + + S  + +R ++G+  +    SD +D+LL+   + K+
Sbjct  223   MLEKLDPQGIRRRMTIHFGKVIDLFSGLINERLEKGKTQNAG-NSDVIDILLA---TSKE  278

Query  541   EPPKLSEHQINIFILEMFLAGTDTTSS  461
              P ++    I    L++F+AGTDTTSS
Sbjct  279   NPEEIDRVHIERMCLDLFVAGTDTTSS  305


 Score =   146 bits (368),  Expect(2) = 2e-71, Method: Compositional matrix adjust.
 Identities = 64/114 (56%), Positives = 85/114 (75%), Gaps = 0/114 (0%)
 Frame = -1

Query  344  NTALTSSTVEWALTELLRNPKAMTKAKEEIRGIVGPTRRFEESDIDNLQYLQAVVKETLR  165
             T  TSST+EWA+ E L+NP+ + KAK E+  ++G  +  +E+DI  L YL+ +VKETLR
Sbjct  299  GTDTTSSTLEWAMAEALKNPETVKKAKAELEEVIGKGKVLDEADISRLPYLRCMVKETLR  358

Query  164  LHPPAPFLIPRRAIQDTKFMGYDIPKDTQVFINVWAIGRDHESWEDPLSFKPER  3
            +HPP PFLIPRR  QD +  GY +PK++QVF+N WAIGRD + W+DPL FKPER
Sbjct  359  IHPPVPFLIPRRVDQDVEVCGYTVPKNSQVFVNAWAIGRDPDVWKDPLEFKPER  412



>ref|XP_010920218.1| PREDICTED: geraniol 8-hydroxylase-like [Elaeis guineensis]
Length=500

 Score =   156 bits (395),  Expect(2) = 2e-71, Method: Compositional matrix adjust.
 Identities = 92/273 (34%), Positives = 151/273 (55%), Gaps = 11/273 (4%)
 Frame = -2

Query  1273  NMLDLGSVPHQTIAAMRNKYGPVVWLRIGSVSTLAIQSAKAAAELFKNHDVPFAGRSIGD  1094
             ++  +G+ PHQ++A +   YGP++ LR+G V+T+ + S + A E+ +  D  F+GRSI D
Sbjct  47    SLFQIGNKPHQSLARLAKTYGPLMTLRLGQVTTIVVSSPEVAREVLQMKDAVFSGRSIPD  106

Query  1093  VMLAQGYNKGSMALAQYGSYWRVLRRICSVEMFVHKKVNETAAVRRKCIDDLLRWVENEA  914
              + A G+   S+A       WR LRRIC+ E+F  + ++   ++RR+ + +LL ++ + +
Sbjct  107   AVRALGHADVSVAWQPPAKQWRSLRRICNTELFNSQTLDAHQSLRRQKVQELLSYISDRS  166

Query  913   GSIKRGSGIHVTRFVFLATFNLLGNIMFSSDLVDPVSEKGSKFFNAMMGIMERGGTPNIS  734
                 +G  + + R VF  + NLL   +FS DLVD  SE   +F   ++ IM+  G  N+S
Sbjct  167   ---LKGLPVDIGRVVFTTSLNLLSRTIFSVDLVDLHSESSQEFKQVVLEIMKEAGGSNLS  223

Query  733   DIFPCLRWLDLQGLRTKTDKDLQIALQIVSTFVQKR--SKEGQDDSGKRKSDFLDVLLSF  560
             D FP L  +DLQG R +     +    I+   + +R  SKE Q  S     DFL+VLL  
Sbjct  224   DFFPRLAPIDLQGRRRRLTALFEKLQDILDEQINRRLQSKEEQQAS----KDFLEVLLHR  279

Query  559   EGSGKDEPPKLSEHQINIFILEMFLAGTDTTSS  461
             +    +   K+    +    +++F AGTDT+SS
Sbjct  280   QVQQDNF--KMDRQVMKSLFMDLFAAGTDTSSS  310


 Score =   142 bits (357),  Expect(2) = 2e-71, Method: Compositional matrix adjust.
 Identities = 63/114 (55%), Positives = 83/114 (73%), Gaps = 0/114 (0%)
 Frame = -1

Query  344  NTALTSSTVEWALTELLRNPKAMTKAKEEIRGIVGPTRRFEESDIDNLQYLQAVVKETLR  165
             T  +SSTVEWA+ E+LRNP+ M KA++E+  ++G  +  EESDI  L YLQAVVKET R
Sbjct  304  GTDTSSSTVEWAMAEVLRNPRCMAKARDEVERVIGREKEVEESDIGRLPYLQAVVKETFR  363

Query  164  LHPPAPFLIPRRAIQDTKFMGYDIPKDTQVFINVWAIGRDHESWEDPLSFKPER  3
            LHPP PFL+PR+A    +  GY +P+ T+V +NVWA GRD E+W +P  F+PER
Sbjct  364  LHPPVPFLLPRKAESTVELDGYTVPEGTRVLVNVWAFGRDGEAWPEPNEFRPER  417



>ref|XP_009780149.1| PREDICTED: geraniol 8-hydroxylase-like [Nicotiana sylvestris]
Length=493

 Score =   154 bits (389),  Expect(2) = 2e-71, Method: Compositional matrix adjust.
 Identities = 90/271 (33%), Positives = 143/271 (53%), Gaps = 10/271 (4%)
 Frame = -2

Query  1273  NMLDLGSVPHQTIAAMRNKYGPVVWLRIGSVSTLAIQSAKAAAELFKNHDVPFAGRSIGD  1094
             N+  LG  PH ++A +   YGP++ L++G V+T+ I S+  A E+ +  D+ FA RS+ D
Sbjct  44    NLHLLGDKPHISLAKLSKIYGPIMNLKLGQVNTVVISSSVLAREVMQKRDLVFANRSVAD  103

Query  1093  VMLAQGYNKGSMALAQYGSYWRVLRRICSVEMFVHKKVNETAAVRRKCIDDLLRWVENEA  914
              + AQ ++  S+      + WR LR+I +  +F   K++    +R K I +L   V++  
Sbjct  104   ALRAQNHSDSSVVFLPVNTRWRTLRKIMNSNIFSGSKLDANQHLRNKKIQEL---VDHFH  160

Query  913   GSIKRGSGIHVTRFVFLATFNLLGNIMFSSDLVDPVSEKGSKFFNAMMGIMERGGTPNIS  734
              S K G  + + R  F  + NLL N +FS DL DP S+   +F + + GIM   G PN+ 
Sbjct  161   KSAKNGGTVDIGRAAFRTSLNLLSNTIFSKDLSDPFSDSAKEFKDLVWGIMVEAGKPNLV  220

Query  733   DIFPCLRWLDLQGLRTKTDKDLQIALQIVSTFVQKRSKEGQDDSGKRKSDFLDVLLSFEG  554
             D FP L  +D QG+R +        L ++S  + +R KE +        D LD LL+   
Sbjct  221   DYFPFLVKIDPQGIRRRMTDHFTKVLDLMSGLIDERLKE-RKLRNHANVDVLDALLNI--  277

Query  553   SGKDEPPKLSEHQINIFILEMFLAGTDTTSS  461
                  P +   + I    L++F+AGTDTTS+
Sbjct  278   ----SPEEFDRNHIEHLCLDLFVAGTDTTSN  304


 Score =   144 bits (362),  Expect(2) = 2e-71, Method: Compositional matrix adjust.
 Identities = 63/114 (55%), Positives = 86/114 (75%), Gaps = 0/114 (0%)
 Frame = -1

Query  344  NTALTSSTVEWALTELLRNPKAMTKAKEEIRGIVGPTRRFEESDIDNLQYLQAVVKETLR  165
             T  TS+T+EWA+ ELL+NP  + KA+EE+  ++G  +  +E+DI  L YL+ +VKETLR
Sbjct  298  GTDTTSNTLEWAVAELLKNPHTLEKAQEELAHVIGRGKLVDETDIAQLPYLRCIVKETLR  357

Query  164  LHPPAPFLIPRRAIQDTKFMGYDIPKDTQVFINVWAIGRDHESWEDPLSFKPER  3
            +HP  PFLIPR+  +D +F GY +PKD+QV +NVWAIGRD + WE+PL FKPER
Sbjct  358  IHPALPFLIPRKVEEDVEFCGYIVPKDSQVLVNVWAIGRDSDLWENPLDFKPER  411



>ref|XP_010053380.1| PREDICTED: geraniol 8-hydroxylase-like [Eucalyptus grandis]
 gb|KCW77658.1| hypothetical protein EUGRSUZ_D01956 [Eucalyptus grandis]
Length=498

 Score =   168 bits (426),  Expect(2) = 3e-71, Method: Compositional matrix adjust.
 Identities = 92/271 (34%), Positives = 150/271 (55%), Gaps = 7/271 (3%)
 Frame = -2

Query  1273  NMLDLGSVPHQTIAAMRNKYGPVVWLRIGSVSTLAIQSAKAAAELFKNHDVPFAGRSIGD  1094
             N+L LGS PH+++A + + YGP++ L++G V+T+ + S   A E+ + HD  F+ R+I D
Sbjct  46    NLLSLGSQPHRSLARLSHTYGPIIKLQLGYVTTIVVSSPPIAREILQTHDAIFSDRTIPD  105

Query  1093  VMLAQGYNKGSMALAQYGSYWRVLRRICSVEMFVHKKVNETAAVRRKCIDDLLRWVENEA  914
              + A   N+  +        WR LR+IC++ +F HKK+     +R++ I +LL ++    
Sbjct  106   SITALRQNELGLPWIPVSPLWRNLRKICNLHIFSHKKLEANQHIRQEKIQELLSYIN---  162

Query  913   GSIKRGSGIHVTRFVFLATFNLLGNIMFSSDLVDPVSEKGSKFFNAMMGIMERGGTPNIS  734
             GS+ RG  + +    F A  NLL   M S DL +P S     F + +  IM   G PNI+
Sbjct  163   GSLSRGDAVDIGEVAFKAVVNLLSKTMLSEDLANP-SGSAKDFKDLVWRIMVEAGKPNIA  221

Query  733   DIFPCLRWLDLQGLRTKTDKDLQIALQIVSTFVQKRSKEGQDDSGKRKSDFLDVLLSFEG  554
             D FP L+ +D QG R +         ++  + ++KR ++       RK+D LD LL    
Sbjct  222   DYFPALKKIDPQGSRRRMTVYFTKIFELFDSLIEKRLRDRAAVGSIRKNDVLDTLLD---  278

Query  553   SGKDEPPKLSEHQINIFILEMFLAGTDTTSS  461
             + +D+  ++    I  F+L++F+AGTDTTSS
Sbjct  279   AREDKSEEVDIFLIKHFLLDLFVAGTDTTSS  309


 Score =   129 bits (325),  Expect(2) = 3e-71, Method: Compositional matrix adjust.
 Identities = 59/114 (52%), Positives = 80/114 (70%), Gaps = 0/114 (0%)
 Frame = -1

Query  344  NTALTSSTVEWALTELLRNPKAMTKAKEEIRGIVGPTRRFEESDIDNLQYLQAVVKETLR  165
             T  TSSTVEWAL+EL+ +P+ +++A+ E+  ++G  +  EES+I  L YLQAV+KET R
Sbjct  303  GTDTTSSTVEWALSELIHSPEKLSRAQAELDRVIGKGKPIEESEIARLPYLQAVIKETFR  362

Query  164  LHPPAPFLIPRRAIQDTKFMGYDIPKDTQVFINVWAIGRDHESWEDPLSFKPER  3
            LHPP P  +PR++  +    G+ IPK  QVF+NVWAIGRD   W+DP  F PER
Sbjct  363  LHPPVPLYLPRKSGSEIGIAGFTIPKGAQVFVNVWAIGRDPSIWKDPEVFMPER  416



>ref|XP_004232064.1| PREDICTED: geraniol 8-hydroxylase-like [Solanum lycopersicum]
Length=500

 Score =   159 bits (402),  Expect(2) = 4e-71, Method: Compositional matrix adjust.
 Identities = 81/268 (30%), Positives = 150/268 (56%), Gaps = 7/268 (3%)
 Frame = -2

Query  1261  LGSVPHQTIAAMRNKYGPVVWLRIGSVSTLAIQSAKAAAELFKNHDVPFAGRSIGDVMLA  1082
             +G  PH+++A +   YGP++ LR+G ++T+ I S+  A ++ +  D+ F+ R+I D + A
Sbjct  51    VGDQPHKSLARLAQIYGPMMSLRMGQITTVVISSSAVAKQVLQKQDLAFSSRTIPDAICA  110

Query  1081  QGYNKGSMALAQYGSYWRVLRRICSVEMFVHKKVNETAAVRRKCIDDLLRWVENEAGSIK  902
               +++ S+      S WR LR+I +  MF   K++ T  +R + + D + +    +   +
Sbjct  111   NNHHQFSVVFLPAASRWRSLRKILNSNMFSSNKLDATQHLRSQRMQDFIGYCSKCS---Q  167

Query  901   RGSGIHVTRFVFLATFNLLGNIMFSSDLVDPVSEKGSKFFNAMMGIMERGGTPNISDIFP  722
              G  +++ +  F    NLL N +FS D+VDP +  G +F + +  ++E  G PN +D FP
Sbjct  168   TGESVNIGKAAFETMVNLLSNTIFSKDVVDPYANSGKEFKDVIRSVLEESGKPNFADYFP  227

Query  721   CLRWLDLQGLRTKTDKDLQIAL-QIVSTFVQKRSKEGQDDSGKRKSDFLDVLLSFEGSGK  545
              L+ +D QG+R +T K     L  I+   + +R ++ +      ++DFL V+L+   + +
Sbjct  228   LLKRIDPQGIRRRTGKHFDKLLHHIMKGLIDERLEKRRKSQNGSRTDFLQVMLN---TSE  284

Query  544   DEPPKLSEHQINIFILEMFLAGTDTTSS  461
             ++P  +    I    L++F+AGTDTTSS
Sbjct  285   EDPQAIDRDHIQHLCLDLFVAGTDTTSS  312


 Score =   139 bits (349),  Expect(2) = 4e-71, Method: Compositional matrix adjust.
 Identities = 64/114 (56%), Positives = 82/114 (72%), Gaps = 1/114 (1%)
 Frame = -1

Query  344  NTALTSSTVEWALTELLRNPKAMTKAKEEIRGIVGPTRRFEESDIDNLQYLQAVVKETLR  165
             T  TSST+EWA+ E++R P  M KA+ E+  ++G     EE DI  L YLQ +VKETLR
Sbjct  306  GTDTTSSTLEWAMVEVMRKPYIMNKARSELADVIGKGTIIEEVDIARLPYLQCIVKETLR  365

Query  164  LHPPAPFLIPRRAIQDTKFMGYDIPKDTQVFINVWAIGRDHESWEDPLSFKPER  3
            +HPP PFLI R+  QD +  GY +PKD+QV +NVW+IGRD  +WEDPL+FKPER
Sbjct  366  MHPPVPFLI-RKVDQDVEACGYFVPKDSQVLVNVWSIGRDPATWEDPLTFKPER  418



>gb|AGX93054.1| geraniol 10-hydroxylase-like protein [Tabernaemontana elegans]
Length=493

 Score =   152 bits (384),  Expect(2) = 4e-71, Method: Compositional matrix adjust.
 Identities = 83/271 (31%), Positives = 148/271 (55%), Gaps = 8/271 (3%)
 Frame = -2

Query  1273  NMLDLGSVPHQTIAAMRNKYGPVVWLRIGSVSTLAIQSAKAAAELFKNHDVPFAGRSIGD  1094
             N+  LG  PH+++A +  K+GP++ L++G ++T+ I S+  A E+ +  D+ F+ RS+ D
Sbjct  42    NLHLLGDQPHKSLAKLSKKHGPLMSLKLGHITTVVISSSGMAKEVLQKQDLAFSSRSVPD  101

Query  1093  VMLAQGYNKGSMALAQYGSYWRVLRRICSVEMFVHKKVNETAAVRRKCIDDLLRWVENEA  914
              + A    + S+      S WR LR+I +  +F   +++    +R + + +L+ +     
Sbjct  102   ALHAHNQFQFSVVWLPVASRWRSLRKILNSNIFSGNRLDANQHLRCRKVQELIAYCRK--  159

Query  913   GSIKRGSGIHVTRFVFLATFNLLGNIMFSSDLVDPVSEKGSKFFNAMMGIMERGGTPNIS  734
              + + G  + V R  F  + NLL N +FS DL DP S+   +F + +  IM   G PN+ 
Sbjct  160   -NCQTGEAVDVGRAAFRTSLNLLSNTIFSKDLTDPYSDSAKEFKDLVWNIMVEAGKPNLV  218

Query  733   DIFPCLRWLDLQGLRTKTDKDLQIALQIVSTFVQKRSKEGQDDSGKRKSDFLDVLLSFEG  554
             D FP L  +D QG+R +        L++ +  + +R ++ +  SG   +D LDVLL+   
Sbjct  219   DFFPVLEKVDPQGIRKRMTVHFGKVLKLFNGLINERLEQKRLQSG--NNDVLDVLLT---  273

Query  553   SGKDEPPKLSEHQINIFILEMFLAGTDTTSS  461
             + ++ P ++    I    L++F+AGTDTTSS
Sbjct  274   TSEESPEEIDRTHIERMCLDLFVAGTDTTSS  304


 Score =   145 bits (366),  Expect(2) = 4e-71, Method: Compositional matrix adjust.
 Identities = 64/114 (56%), Positives = 82/114 (72%), Gaps = 0/114 (0%)
 Frame = -1

Query  344  NTALTSSTVEWALTELLRNPKAMTKAKEEIRGIVGPTRRFEESDIDNLQYLQAVVKETLR  165
             T  TSST+EWA+ E+L+NP  M K + EI  ++G  +  EE+D+  L YL+ VVKETLR
Sbjct  298  GTDTTSSTLEWAMAEMLKNPDKMQKTQAEIAEVIGKGKAIEEADVARLPYLRCVVKETLR  357

Query  164  LHPPAPFLIPRRAIQDTKFMGYDIPKDTQVFINVWAIGRDHESWEDPLSFKPER  3
            +HPP PFLIPR+  QD +  GY +PK +QV +N WAIGRD   WEDPL+FKPER
Sbjct  358  IHPPVPFLIPRKVDQDVEVCGYKVPKGSQVLVNAWAIGRDGTVWEDPLAFKPER  411



>ref|XP_004310057.1| PREDICTED: geraniol 8-hydroxylase-like [Fragaria vesca subsp. 
vesca]
Length=505

 Score =   163 bits (413),  Expect(2) = 5e-71, Method: Compositional matrix adjust.
 Identities = 91/275 (33%), Positives = 149/275 (54%), Gaps = 14/275 (5%)
 Frame = -2

Query  1273  NMLDLGSVPHQTIAAMRNKYGPVVWLRIGSVSTLAIQSAKAAAELFKNHDVPFAGRSIGD  1094
             N+ +LG  PH ++A +  +YGP++ L++G ++T+ + S   A E+ + HD  F  R++ D
Sbjct  48    NLFELGDKPHVSLAKLSQRYGPIISLQLGQLTTVVVSSPDLAKEILRTHDQVFCNRTLPD  107

Query  1093  VMLAQGYNKGSMALAQYGSYWRVLRRICSVEMFVHKKVNETAAVR----RKCIDDLLRWV  926
              + A  ++  SMA     + WR LR IC++++F  K ++   A R    +K IDD+    
Sbjct  108   AIHACNHSGYSMAWLPVSARWRNLRTICNLQLFSPKVLDANQANRHVKVQKLIDDV----  163

Query  925   ENEAGSIKRGSGIHVTRFVFLATFNLLGNIMFSSDLVDPVSEKGSKFFNAMMGIMERGGT  746
              NE  S++ G  I + R  F  T NLL   +FS D  DP SE   +F   + G+ME  G 
Sbjct  164   -NE--SMRAGEAIDIGRAAFTTTLNLLSQTIFSVDFADPSSETAREFKKTVWGMMEEIGK  220

Query  745   PNISDIFPCLRWLDLQGLRTKTDKDLQIALQIVSTFVQKRSKEGQDDSGKRKSDFLDVLL  566
             PN++D FP LR LD QG+R +     Q  + I    + +R +  + D+    +D LD+LL
Sbjct  221   PNLADYFPLLRKLDPQGIRRRLTYYFQKTVDIFYQMIHQRLESRRGDNYITTNDMLDILL  280

Query  565   SFEGSGKDEPPKLSEHQINIFILEMFLAGTDTTSS  461
             +     K++   +   +     L++F AGTDT+S+
Sbjct  281   NISEEKKED---MDMPETQHLFLDLFAAGTDTSSA  312


 Score =   134 bits (337),  Expect(2) = 5e-71, Method: Compositional matrix adjust.
 Identities = 61/114 (54%), Positives = 83/114 (73%), Gaps = 0/114 (0%)
 Frame = -1

Query  344  NTALTSSTVEWALTELLRNPKAMTKAKEEIRGIVGPTRRFEESDIDNLQYLQAVVKETLR  165
             T  +S+T+EWA+ ELLRNP+ ++KA+ E+  ++G  +  EES +  L YLQA++KETLR
Sbjct  306  GTDTSSATLEWAMAELLRNPEVLSKAQAELHQVIGKGKLVEESYVARLPYLQAILKETLR  365

Query  164  LHPPAPFLIPRRAIQDTKFMGYDIPKDTQVFINVWAIGRDHESWEDPLSFKPER  3
            LHP  P L+PR+A  + +  GY IP+  QV INVWAIGRD  +WE+P SFKPER
Sbjct  366  LHPTVPLLLPRKAKANIEIGGYVIPEGAQVLINVWAIGRDPITWENPYSFKPER  419



>ref|XP_006338234.1| PREDICTED: geraniol 8-hydroxylase-like [Solanum tuberosum]
Length=496

 Score =   162 bits (411),  Expect(2) = 7e-71, Method: Compositional matrix adjust.
 Identities = 82/268 (31%), Positives = 152/268 (57%), Gaps = 7/268 (3%)
 Frame = -2

Query  1261  LGSVPHQTIAAMRNKYGPVVWLRIGSVSTLAIQSAKAAAELFKNHDVPFAGRSIGDVMLA  1082
             +G  PH+++A +   YGP++ LR+G ++T+ + S+  A ++ +  D+ F+ R+I D + A
Sbjct  47    VGDQPHKSLARLAQIYGPMMSLRMGQITTVVVSSSAVAKQVLQKQDLAFSSRTIPDAIRA  106

Query  1081  QGYNKGSMALAQYGSYWRVLRRICSVEMFVHKKVNETAAVRRKCIDDLLRWVENEAGSIK  902
               +++ S+      S WR LR+I +  MF   K++ T  +R + + D + +    + +  
Sbjct  107   HNHHQFSVVFLPVASRWRSLRKILNSNMFSSNKLDATQHLRTQKMQDFIGYCRKCSQT--  164

Query  901   RGSGIHVTRFVFLATFNLLGNIMFSSDLVDPVSEKGSKFFNAMMGIMERGGTPNISDIFP  722
              G  +++ +  F    NLL N +FS D+VDP +  G +F + +  +ME  G PN +D FP
Sbjct  165   -GESVNIGQAAFETMINLLSNTIFSKDVVDPYANSGKEFKDVVWDVMEESGRPNFADYFP  223

Query  721   CLRWLDLQGLRTKTDKDLQIAL-QIVSTFVQKRSKEGQDDSGKRKSDFLDVLLSFEGSGK  545
              L+ +D QG+R +  K     L QI+   V +R ++ +      ++DFL+V+L+   + +
Sbjct  224   VLKRIDPQGIRRRIGKHFDKLLHQIIKGLVDERLEQRRKSPNGSRTDFLEVMLN---TSE  280

Query  544   DEPPKLSEHQINIFILEMFLAGTDTTSS  461
             ++P  +  + I    L++F+AGTDTTSS
Sbjct  281   EDPQAIDRNHIQHLCLDLFVAGTDTTSS  308


 Score =   134 bits (337),  Expect(2) = 7e-71, Method: Compositional matrix adjust.
 Identities = 61/114 (54%), Positives = 82/114 (72%), Gaps = 1/114 (1%)
 Frame = -1

Query  344  NTALTSSTVEWALTELLRNPKAMTKAKEEIRGIVGPTRRFEESDIDNLQYLQAVVKETLR  165
             T  TSST+EWA+ E++R P  M K K E+  ++G  +  EE DI  L YLQ +VKETLR
Sbjct  302  GTDTTSSTLEWAMVEVMRKPYIMNKTKSELADVIGKGKIIEEGDIARLPYLQCIVKETLR  361

Query  164  LHPPAPFLIPRRAIQDTKFMGYDIPKDTQVFINVWAIGRDHESWEDPLSFKPER  3
            +HPP PFLI R+  +D +  GY +PK++QV ++VW+IGRD  +WEDPL+FKPER
Sbjct  362  MHPPVPFLI-RKVDRDVEACGYFVPKESQVLVHVWSIGRDPATWEDPLTFKPER  414



>sp|Q8VWZ7.1|C76B6_CATRO RecName: Full=Geraniol 8-hydroxylase; AltName: Full=Cytochrome 
P450 76B6; AltName: Full=Geraniol 10-hydroxylase; Short=CrG10H 
[Catharanthus roseus]
 emb|CAC80883.1| geraniol 10-hydroxylase [Catharanthus roseus]
 gb|AHA82034.1| geraniol 10-hydroxylase [Catharanthus roseus]
Length=493

 Score =   154 bits (390),  Expect(2) = 7e-71, Method: Compositional matrix adjust.
 Identities = 84/267 (31%), Positives = 145/267 (54%), Gaps = 8/267 (3%)
 Frame = -2

Query  1261  LGSVPHQTIAAMRNKYGPVVWLRIGSVSTLAIQSAKAAAELFKNHDVPFAGRSIGDVMLA  1082
             LG  PH+++A +  K+GP++ L++G ++T+ I S+  A E+ +  D+ F+ RS+ + + A
Sbjct  46    LGDQPHKSLAKLSKKHGPIMSLKLGQITTIVISSSTMAKEVLQKQDLAFSSRSVPNALHA  105

Query  1081  QGYNKGSMALAQYGSYWRVLRRICSVEMFVHKKVNETAAVRRKCIDDLLRWVENEAGSIK  902
                 K S+      S WR LR++ +  +F   +++    +R + + +L+ +    + S  
Sbjct  106   HNQFKFSVVWLPVASRWRSLRKVLNSNIFSGNRLDANQHLRTRKVQELIAYCRKNSQS--  163

Query  901   RGSGIHVTRFVFLATFNLLGNIMFSSDLVDPVSEKGSKFFNAMMGIMERGGTPNISDIFP  722
              G  + V R  F  + NLL N++FS DL DP S+   +F + +  IM   G PN+ D FP
Sbjct  164   -GEAVDVGRAAFRTSLNLLSNLIFSKDLTDPYSDSAKEFKDLVWNIMVEAGKPNLVDFFP  222

Query  721   CLRWLDLQGLRTKTDKDLQIALQIVSTFVQKRSKEGQDDSGKRKSDFLDVLLSFEGSGKD  542
              L  +D QG+R +        L++    V +R +  Q  S   K+D LDVLL+   + ++
Sbjct  223   LLEKVDPQGIRHRMTIHFGEVLKLFGGLVNERLE--QRRSKGEKNDVLDVLLT---TSQE  277

Query  541   EPPKLSEHQINIFILEMFLAGTDTTSS  461
              P ++    I    L++F+AGTDTTSS
Sbjct  278   SPEEIDRTHIERMCLDLFVAGTDTTSS  304


 Score =   142 bits (357),  Expect(2) = 7e-71, Method: Compositional matrix adjust.
 Identities = 61/114 (54%), Positives = 84/114 (74%), Gaps = 0/114 (0%)
 Frame = -1

Query  344  NTALTSSTVEWALTELLRNPKAMTKAKEEIRGIVGPTRRFEESDIDNLQYLQAVVKETLR  165
             T  TSST+EWA++E+L+NP  M K ++E+  ++G  +  EESDI+ L YL+ V+KETLR
Sbjct  298  GTDTTSSTLEWAMSEMLKNPDKMKKTQDELAQVIGRGKTIEESDINRLPYLRCVMKETLR  357

Query  164  LHPPAPFLIPRRAIQDTKFMGYDIPKDTQVFINVWAIGRDHESWEDPLSFKPER  3
            +HPP PFLIPR+  Q  +  GY++PK +QV +N WAIGRD   W+D L+FKPER
Sbjct  358  IHPPVPFLIPRKVEQSVEVCGYNVPKGSQVLVNAWAIGRDETVWDDALAFKPER  411



>gb|AGX93053.1| geraniol 10-hydroxylase-like protein [Rauvolfia serpentina]
Length=493

 Score =   155 bits (392),  Expect(2) = 9e-71, Method: Compositional matrix adjust.
 Identities = 83/271 (31%), Positives = 148/271 (55%), Gaps = 8/271 (3%)
 Frame = -2

Query  1273  NMLDLGSVPHQTIAAMRNKYGPVVWLRIGSVSTLAIQSAKAAAELFKNHDVPFAGRSIGD  1094
             N+  LG  PH+++A +  K+GP++ L++G ++T+ + S+  A E+ + HD+ F+ RSI +
Sbjct  42    NLHMLGDQPHKSLAKLSKKHGPIMSLKLGQITTVVVSSSGMAKEVLQKHDLAFSSRSIPN  101

Query  1093  VMLAQGYNKGSMALAQYGSYWRVLRRICSVEMFVHKKVNETAAVRRKCIDDLLRWVENEA  914
              + A    + S+      S WR LR+  +  +F   +++    +R + +++L+ +     
Sbjct  102   ALHAHNQYQFSVVWLPVASRWRSLRKTLNSNIFSGNRLDANQHLRSRKVEELIAYCRKNC  161

Query  913   GSIKRGSGIHVTRFVFLATFNLLGNIMFSSDLVDPVSEKGSKFFNAMMGIMERGGTPNIS  734
              +   G  + V R  F  + NLL N++FS DL DP S+   +F + +  IM   G PN+ 
Sbjct  162   QT---GEAVDVGRAAFRTSLNLLSNLIFSKDLTDPYSDSAKEFKDLVWNIMVEAGKPNLV  218

Query  733   DIFPCLRWLDLQGLRTKTDKDLQIALQIVSTFVQKRSKEGQDDSGKRKSDFLDVLLSFEG  554
             D FP L  +D QG+R +        L++    V +R ++ +   G  K+D LDVLL+   
Sbjct  219   DYFPVLEKVDPQGIRRRMTVHFGKVLKLFDGLVNERLEQRRSRGG--KNDVLDVLLT---  273

Query  553   SGKDEPPKLSEHQINIFILEMFLAGTDTTSS  461
             + ++ P ++    I    L++F+AGTDTTSS
Sbjct  274   NSEENPEEIDRTHIERMCLDLFVAGTDTTSS  304


 Score =   141 bits (355),  Expect(2) = 9e-71, Method: Compositional matrix adjust.
 Identities = 63/114 (55%), Positives = 80/114 (70%), Gaps = 0/114 (0%)
 Frame = -1

Query  344  NTALTSSTVEWALTELLRNPKAMTKAKEEIRGIVGPTRRFEESDIDNLQYLQAVVKETLR  165
             T  TSST+EWA+ E+L+NP  M K + E+  ++G  +  EESD+  L YL+ VVKETLR
Sbjct  298  GTDTTSSTLEWAMAEMLKNPDKMKKTQAELAEVIGRGKAIEESDLPRLPYLRCVVKETLR  357

Query  164  LHPPAPFLIPRRAIQDTKFMGYDIPKDTQVFINVWAIGRDHESWEDPLSFKPER  3
            +HPP PFLIPRR  QD +  GY +PK +QV +N W IGRD   WED L+FKPER
Sbjct  358  IHPPVPFLIPRRVEQDVEVCGYKVPKGSQVLVNAWTIGRDEAVWEDALAFKPER  411



>ref|XP_010661587.1| PREDICTED: geraniol 8-hydroxylase-like isoform X1 [Vitis vinifera]
Length=496

 Score =   158 bits (400),  Expect(2) = 9e-71, Method: Compositional matrix adjust.
 Identities = 89/271 (33%), Positives = 144/271 (53%), Gaps = 9/271 (3%)
 Frame = -2

Query  1273  NMLDLGSVPHQTIAAMRNKYGPVVWLRIGSVSTLAIQSAKAAAELFKNHDVPFAGRSIGD  1094
             N+L LG  PH+++A +   YGPV+ L++GS++T+ I S++ A E+   +D  F+ R++ D
Sbjct  46    NILKLGDKPHRSLANLSKTYGPVMSLKLGSIATIVISSSETAKEVLHRNDQAFSSRTVPD  105

Query  1093  VMLAQGYNKGSMALAQYGSYWRVLRRICSVEMFVHKKVNETAAVRRKCIDDLLRWVENEA  914
              + A  +++ S+       +WR +R+IC+ E+F  ++++ +  +RRK + +LL  VE   
Sbjct  106   AVRAHNHHESSVVWVPASVHWRKIRKICTREIFSVQQLDASQGLRRKIVQELLDHVEE--  163

Query  913   GSIKRGSGIHVTRFVFLATFNLLGNIMFSSDLVDPVSEKGSKFFNAMMGIMERGGTPNIS  734
                 RG  + +   VF A+ NLL N +FS +L    S    +F N   G+ME  G PN  
Sbjct  164   -CCSRGCAVDINGAVFTASLNLLSNTIFSINLAHHGSNFSQEFKNIARGVMEGVGRPNFV  222

Query  733   DIFPCLRWLDLQGLRTKTDKDLQIALQIVSTFVQKRSKEGQDDSGKRKSDFLDVLLSFEG  554
             D FP  R +D QG+R            I    + +R +     + K   D LD LL+   
Sbjct  223   DYFPAFRLIDPQGIRWNMKIYFNKLFHIFDGIINQRLQSKTSSASK---DVLDALLNLTK  279

Query  553   SGKDEPPKLSEHQINIFILEMFLAGTDTTSS  461
                +E    S   I   +L++F+AGTDTTSS
Sbjct  280   ENDNE---WSCSDIKHLLLDLFVAGTDTTSS  307


 Score =   138 bits (347),  Expect(2) = 9e-71, Method: Compositional matrix adjust.
 Identities = 62/114 (54%), Positives = 82/114 (72%), Gaps = 0/114 (0%)
 Frame = -1

Query  344  NTALTSSTVEWALTELLRNPKAMTKAKEEIRGIVGPTRRFEESDIDNLQYLQAVVKETLR  165
             T  TSSTVEWA+ ELL NP+ + KA++EIRG++G     +ESDI    YLQ++VKET R
Sbjct  301  GTDTTSSTVEWAMAELLCNPEKIAKAQKEIRGVLGNEGIVQESDISKFPYLQSIVKETFR  360

Query  164  LHPPAPFLIPRRAIQDTKFMGYDIPKDTQVFINVWAIGRDHESWEDPLSFKPER  3
            LHPPAP L+P +A  D +  G+ IPK++QV +N WAIGRD  +W +P +F PER
Sbjct  361  LHPPAPLLVPHKAETDVEICGFTIPKNSQVLVNAWAIGRDPSTWPNPNAFMPER  414



>ref|XP_006338233.1| PREDICTED: geraniol 8-hydroxylase-like [Solanum tuberosum]
Length=495

 Score =   158 bits (399),  Expect(2) = 1e-70, Method: Compositional matrix adjust.
 Identities = 79/267 (30%), Positives = 149/267 (56%), Gaps = 6/267 (2%)
 Frame = -2

Query  1261  LGSVPHQTIAAMRNKYGPVVWLRIGSVSTLAIQSAKAAAELFKNHDVPFAGRSIGDVMLA  1082
             LG  PH+++A +  KYGP++ LR+G ++T+ I S+  A ++ +  D+ F+ R+I D +  
Sbjct  47    LGDQPHKSLARLAQKYGPMMGLRMGQITTVVISSSAVAKQVLQKQDLSFSSRTIPDAIRT  106

Query  1081  QGYNKGSMALAQYGSYWRVLRRICSVEMFVHKKVNETAAVRRKCIDDLLRWVENEAGSIK  902
               ++  S+      S WR +R+I +  +F   K++ T  +R + + D + +        +
Sbjct  107   NNHHHLSVVFLPVCSLWRSMRKILNSNLFSGNKLDATQHLRSQKMQDFIAYC---GKCSQ  163

Query  901   RGSGIHVTRFVFLATFNLLGNIMFSSDLVDPVSEKGSKFFNAMMGIMERGGTPNISDIFP  722
              G  +++ +  F    NLL N +FS D+VDP +  G +F + +  +ME  G PN ++ FP
Sbjct  164   TGESVNIGQAAFETMLNLLSNTIFSKDVVDPYANSGKEFKDIVWDVMEECGKPNFANYFP  223

Query  721   CLRWLDLQGLRTKTDKDLQIALQIVSTFVQKRSKEGQDDSGKRKSDFLDVLLSFEGSGKD  542
              L+ +D QG+R +  K     LQ++   + +R ++ +      ++DFL+V+L+   + ++
Sbjct  224   LLKRIDPQGIRRRIGKHSDKLLQLIGGLIDERLEQRRQLPNGGRTDFLEVMLN---TSEE  280

Query  541   EPPKLSEHQINIFILEMFLAGTDTTSS  461
             +P     + I    L++F+AGTDTTSS
Sbjct  281   DPQAFDRNHIEHLCLDLFIAGTDTTSS  307


 Score =   138 bits (347),  Expect(2) = 1e-70, Method: Compositional matrix adjust.
 Identities = 63/114 (55%), Positives = 82/114 (72%), Gaps = 1/114 (1%)
 Frame = -1

Query  344  NTALTSSTVEWALTELLRNPKAMTKAKEEIRGIVGPTRRFEESDIDNLQYLQAVVKETLR  165
             T  TSST+EWA+ E++R P  M KAK E   ++G  +  EE DI  L YLQ +VKETLR
Sbjct  301  GTDTTSSTLEWAMVEVMRKPYIMNKAKSEFADVIGKGKIIEEGDIGRLPYLQCIVKETLR  360

Query  164  LHPPAPFLIPRRAIQDTKFMGYDIPKDTQVFINVWAIGRDHESWEDPLSFKPER  3
            +HPP PFLI R+  Q+ +  GY +PK++QV +NVW+IGRD  +WEDPL+FKPER
Sbjct  361  MHPPVPFLI-RKVDQEVEACGYFVPKNSQVLVNVWSIGRDPATWEDPLTFKPER  413



>ref|XP_010676619.1| PREDICTED: geraniol 8-hydroxylase-like [Beta vulgaris subsp. 
vulgaris]
Length=546

 Score =   154 bits (390),  Expect(2) = 1e-70, Method: Compositional matrix adjust.
 Identities = 84/271 (31%), Positives = 148/271 (55%), Gaps = 6/271 (2%)
 Frame = -2

Query  1273  NMLDLGSVPHQTIAAMRNKYGPVVWLRIGSVSTLAIQSAKAAAELFKNHDVPFAGRSIGD  1094
             N+  LG+ PH ++  +  +YGP++ L++G V T+ I SA  A E  + +D+ F+ R + D
Sbjct  93    NLFSLGTKPHISLTELAKRYGPLMTLQLGRVPTVIISSAAMAKEALQRNDLAFSNRMVID  152

Query  1093  VMLAQGYNKGSMALAQYGSYWRVLRRICSVEMFVHKKVNETAAVRRKCIDDLLRWVENEA  914
              + A  +++ S+        WR LR+IC+ ++F   +++ + ++R K + DLL + +  +
Sbjct  153   AVCAVNHHENSIVWLPLSPKWRNLRKICNSKVFATSRLDASQSLRTKKVKDLLSYAQKCS  212

Query  913   GSIKRGSGIHVTRFVFLATFNLLGNIMFSSDLVDPVSEKGSKFFNAMMGIMERGGTPNIS  734
              S      + V +  F  T NLL + +FS DL DP S+   +F   + G+ME  G PN +
Sbjct  213   ES---NIAMDVGQAAFTTTLNLLSSTIFSVDLGDPSSKFSREFKEIVRGVMEEAGKPNFA  269

Query  733   DIFPCLRWLDLQGLRTKTDKDLQIALQIVSTFVQKRSKEGQDDSGKRKSDFLDVLLSFEG  554
             D FP L+  D QG+R +T    Q  + + ++ + +R +  +       +D LD LL   G
Sbjct  270   DYFPFLKRFDPQGIRRRTSVQFQKMIDLFNSMIDQRLQGNKPSDSILGNDVLDALL---G  326

Query  553   SGKDEPPKLSEHQINIFILEMFLAGTDTTSS  461
               +D+  ++    I   ++++F AGTDTTSS
Sbjct  327   INQDKTEEIDPINIPSLLVDLFAAGTDTTSS  357


 Score =   141 bits (355),  Expect(2) = 1e-70, Method: Compositional matrix adjust.
 Identities = 64/114 (56%), Positives = 82/114 (72%), Gaps = 0/114 (0%)
 Frame = -1

Query  344  NTALTSSTVEWALTELLRNPKAMTKAKEEIRGIVGPTRRFEESDIDNLQYLQAVVKETLR  165
             T  TSST+EWA+ ELLRNP+ + KA++E+R  +G     +ESDI  L YLQA+VKET R
Sbjct  351  GTDTTSSTMEWAMAELLRNPEKLKKAQQELRETIGKGNPVQESDIARLPYLQAIVKETFR  410

Query  164  LHPPAPFLIPRRAIQDTKFMGYDIPKDTQVFINVWAIGRDHESWEDPLSFKPER  3
            LHP  PFL+PR+   D K  G+ +PK+ QV +NVWAIGRD  +WE P SF+PER
Sbjct  411  LHPAVPFLVPRKVDSDVKLFGFTVPKNAQVLVNVWAIGRDPNNWERPNSFEPER  464



>ref|XP_010053379.1| PREDICTED: geraniol 8-hydroxylase-like [Eucalyptus grandis]
Length=498

 Score =   166 bits (421),  Expect(2) = 1e-70, Method: Compositional matrix adjust.
 Identities = 91/271 (34%), Positives = 150/271 (55%), Gaps = 7/271 (3%)
 Frame = -2

Query  1273  NMLDLGSVPHQTIAAMRNKYGPVVWLRIGSVSTLAIQSAKAAAELFKNHDVPFAGRSIGD  1094
             N+L LGS PH+++A + + YGP++ L++G V+T+ + S   A E+ + HD  F+ R+I D
Sbjct  46    NLLSLGSQPHRSLARLSHTYGPIIKLQLGHVTTIVVSSRPIAREILQTHDAIFSDRTIPD  105

Query  1093  VMLAQGYNKGSMALAQYGSYWRVLRRICSVEMFVHKKVNETAAVRRKCIDDLLRWVENEA  914
              + A   N+  +        WR LR+IC++ +F HKK+     +R++ + +LL ++    
Sbjct  106   SVTALRQNELGLPWIPVSPLWRNLRKICNLHIFSHKKLEANQHIRQEKVQELLSYINR--  163

Query  913   GSIKRGSGIHVTRFVFLATFNLLGNIMFSSDLVDPVSEKGSKFFNAMMGIMERGGTPNIS  734
              S+ RG  + +    F A  NLL   M S DL +P S     F + +  IM   G PNI+
Sbjct  164   -SLSRGDAVDIGEVTFKAVVNLLSKTMLSEDLANP-SGSTKDFKDLVWRIMVEAGKPNIA  221

Query  733   DIFPCLRWLDLQGLRTKTDKDLQIALQIVSTFVQKRSKEGQDDSGKRKSDFLDVLLSFEG  554
             D FP L+ +DLQG R +         ++  + ++KR +E       RK+D LD LL    
Sbjct  222   DYFPALKKIDLQGSRRRMTVYFTKIFELFDSLIEKRLRERATVGSIRKNDVLDTLLD---  278

Query  553   SGKDEPPKLSEHQINIFILEMFLAGTDTTSS  461
             + +D+  +++   I  F+ ++F+AGTDTTSS
Sbjct  279   AREDKSEEVNIFLIKHFLSDLFVAGTDTTSS  309


 Score =   129 bits (325),  Expect(2) = 1e-70, Method: Compositional matrix adjust.
 Identities = 59/114 (52%), Positives = 80/114 (70%), Gaps = 0/114 (0%)
 Frame = -1

Query  344  NTALTSSTVEWALTELLRNPKAMTKAKEEIRGIVGPTRRFEESDIDNLQYLQAVVKETLR  165
             T  TSSTVEWAL+EL+ +P+ +++A+ E+  ++G  +  EES+I  L YLQAV+KET R
Sbjct  303  GTDTTSSTVEWALSELIHSPEKLSRAQAELDRVIGKGKPIEESEIARLPYLQAVIKETFR  362

Query  164  LHPPAPFLIPRRAIQDTKFMGYDIPKDTQVFINVWAIGRDHESWEDPLSFKPER  3
            LHPP P  +PR++  +    G+ IPK  QVF+NVWAIGRD   W+DP  F PER
Sbjct  363  LHPPVPLYLPRKSGSEIGIAGFTIPKGAQVFVNVWAIGRDPSIWKDPEVFMPER  416



>ref|XP_010506518.1| PREDICTED: cytochrome P450 76C2-like [Camelina sativa]
Length=521

 Score =   148 bits (373),  Expect(2) = 2e-70, Method: Compositional matrix adjust.
 Identities = 69/116 (59%), Positives = 86/116 (74%), Gaps = 0/116 (0%)
 Frame = -1

Query  350  I*NTALTSSTVEWALTELLRNPKAMTKAKEEIRGIVGPTRRFEESDIDNLQYLQAVVKET  171
            I  T  TSSTVEWA+ ELLR+PK+MTK ++EI G++G     +ESDI  L YLQAVVKET
Sbjct  321  IAGTDTTSSTVEWAMAELLRSPKSMTKVQDEINGVMGQNGVIQESDISELSYLQAVVKET  380

Query  170  LRLHPPAPFLIPRRAIQDTKFMGYDIPKDTQVFINVWAIGRDHESWEDPLSFKPER  3
             RLHP AP L+PR+A  D   +G+ +PK+TQV +NVWAIGRD   WE+P  F+PER
Sbjct  381  FRLHPAAPLLLPRKAETDVDILGFLVPKNTQVLVNVWAIGRDPNVWENPNRFEPER  436


 Score =   147 bits (370),  Expect(2) = 2e-70, Method: Compositional matrix adjust.
 Identities = 84/277 (30%), Positives = 160/277 (58%), Gaps = 14/277 (5%)
 Frame = -2

Query  1273  NMLDLGSVPHQTIAAMRNKYGPVVWLRIGSVSTLAIQSAKAAAELFKNHDVPFAGRSIGD  1094
             N+  +G  PH++ A +  KYGPV+ L++G ++++ I S  AA E+ + HD   +GR +  
Sbjct  61    NIHLVGKHPHRSFADLSKKYGPVMSLKLGFLNSVVIASRDAAREVLRTHDQILSGRYVNA  120

Query  1093  VMLAQGYNKGSMALAQYGSY-WRVLRRICSVEMFVHKKVNETAAVRRKCIDDLLRWVENE  917
              + +  ++  S+A     S  WR+LR++   +MF  +++  T A+R K   +L+ +V   
Sbjct  121   AVQSNNHHDFSVAWVHPTSTRWRMLRKLSVTQMFSPQRIEATKAMRMKRAQELVNFVRE-  179

Query  916   AGSIKRGSGIHVTRFVFLATFNLLGNIMFSSDLVDPVSEKGSKFFNAMMGIMERGGTPNI  737
               S +R   + ++R +F+   N++ NI+FS ++    S+  S F   M G+ME  G P++
Sbjct  180   --SSEREEAVDISRALFVTALNIISNILFSVNIGSYNSKDSSVFQELMTGVMEAIGNPDL  237

Query  736   SDIFPCLRWLDLQG----LRTKTDKDLQIALQIVST-FVQKRSKEGQDDSGKRKSDFLDV  572
             ++ FP +R+LDLQG    ++  ++K  Q+  +I +   V+K S+  + D+    +DF+D 
Sbjct  238   ANFFPFMRFLDLQGNSKKMKDCSEKLFQVFREIYNARIVEKSSRTNERDASS--NDFMDA  295

Query  571   LLSFEGSGKDEPPKLSEHQINIFILEMFLAGTDTTSS  461
             L+      + + P+++ ++I   + ++F+AGTDTTSS
Sbjct  296   LIDLH---QGDQPEINTNEIEHLLFDLFIAGTDTTSS  329



>gb|EYU29984.1| hypothetical protein MIMGU_mgv1a026778mg, partial [Erythranthe 
guttata]
Length=478

 Score =   150 bits (380),  Expect(2) = 2e-70, Method: Compositional matrix adjust.
 Identities = 81/267 (30%), Positives = 140/267 (52%), Gaps = 6/267 (2%)
 Frame = -2

Query  1261  LGSVPHQTIAAMRNKYGPVVWLRIGSVSTLAIQSAKAAAELFKNHDVPFAGRSIGDVMLA  1082
             LG  PH+++  +   YGP++ LR+G V T+ + SA  A E+ +NHD+ F+GR++ D + A
Sbjct  29    LGDQPHKSLTRLSKIYGPIMHLRLGFVHTVLVSSAAMAKEVMQNHDLVFSGRTVPDAIRA  88

Query  1081  QGYNKGSMALAQYGSYWRVLRRICSVEMFVHKKVNETAAVRRKCIDDLLRWVENEAGSIK  902
               ++  S+      + WR LR+  +  +F    +     +R K +++L+ +    + S  
Sbjct  89    HDHSSYSVIWLPVAARWRSLRKTINSNIFSGNSLEGNRQLRHKKVEELIEYCRTNSQS--  146

Query  901   RGSGIHVTRFVFLATFNLLGNIMFSSDLVDPVSEKGSKFFNAMMGIMERGGTPNISDIFP  722
              G+ + V    F  + N+L N +FS DL DP S+   +F   +  +M   G PN+ D FP
Sbjct  147   -GTAVDVGGAAFRTSLNILSNTIFSRDLTDPFSDSSKEFKELIWNMMVEAGKPNLVDFFP  205

Query  721   CLRWLDLQGLRTKTDKDLQIALQIVSTFVQKRSKEGQDDSGKRKSDFLDVLLSFEGSGKD  542
              LR  DLQG+R +        + + S  + +R ++ +        D +DVLL+   +G+ 
Sbjct  206   LLRKFDLQGIRRRMTVHFGKVIDLFSDLIDERLEKMKSGEYDPTGDVIDVLLA---AGEK  262

Query  541   EPPKLSEHQINIFILEMFLAGTDTTSS  461
              P ++    I    L++F AGT+TTSS
Sbjct  263   NPEEIDRIHIERMCLDLFAAGTETTSS  289


 Score =   144 bits (363),  Expect(2) = 2e-70, Method: Compositional matrix adjust.
 Identities = 65/114 (57%), Positives = 86/114 (75%), Gaps = 0/114 (0%)
 Frame = -1

Query  344  NTALTSSTVEWALTELLRNPKAMTKAKEEIRGIVGPTRRFEESDIDNLQYLQAVVKETLR  165
             T  TSSTVEWA+ E L+NP+ M +AK E+  ++G  +  +E+DI  L YL+ ++KETLR
Sbjct  283  GTETTSSTVEWAMAEALKNPETMKRAKAELAEVIGAGKIVDEADIPRLPYLRCMLKETLR  342

Query  164  LHPPAPFLIPRRAIQDTKFMGYDIPKDTQVFINVWAIGRDHESWEDPLSFKPER  3
            +HPPAPFLIPRRA +D    GY +P+++QVF+N WAIGRD E WE+PL FKPER
Sbjct  343  IHPPAPFLIPRRAERDVVVCGYTVPENSQVFVNAWAIGRDPEIWEEPLVFKPER  396



>ref|XP_010518179.1| PREDICTED: cytochrome P450 76C2-like [Camelina sativa]
Length=509

 Score =   148 bits (373),  Expect(2) = 3e-70, Method: Compositional matrix adjust.
 Identities = 69/116 (59%), Positives = 86/116 (74%), Gaps = 0/116 (0%)
 Frame = -1

Query  350  I*NTALTSSTVEWALTELLRNPKAMTKAKEEIRGIVGPTRRFEESDIDNLQYLQAVVKET  171
            I  T  TSSTVEWA+ ELLR+PK+MTK ++EI G++G     +ESDI  L YLQAVVKET
Sbjct  310  IAGTDTTSSTVEWAMAELLRSPKSMTKVQDEINGVMGQNGVIQESDISELSYLQAVVKET  369

Query  170  LRLHPPAPFLIPRRAIQDTKFMGYDIPKDTQVFINVWAIGRDHESWEDPLSFKPER  3
             RLHP AP L+PR+A  D   +G+ +PK+TQV +NVWAIGRD   WE+P  F+PER
Sbjct  370  FRLHPAAPLLLPRKAETDVDILGFLVPKNTQVLVNVWAIGRDPNVWENPNRFEPER  425


 Score =   146 bits (369),  Expect(2) = 3e-70, Method: Compositional matrix adjust.
 Identities = 83/277 (30%), Positives = 161/277 (58%), Gaps = 14/277 (5%)
 Frame = -2

Query  1273  NMLDLGSVPHQTIAAMRNKYGPVVWLRIGSVSTLAIQSAKAAAELFKNHDVPFAGRSIGD  1094
             N+  +G  PH++ A +  KYGPV+ L++G ++++ I S  AA E+ + HD   +GR +  
Sbjct  50    NIHLVGKHPHRSFADLSKKYGPVMSLKLGFLNSVVIASRDAAREVLRTHDQILSGRYVNA  109

Query  1093  VMLAQGYNKGSMALAQYGSY-WRVLRRICSVEMFVHKKVNETAAVRRKCIDDLLRWVENE  917
              + +  ++  S+A     S  WR+LR++   +MF  +++  T A+R K   +L+ ++   
Sbjct  110   AVQSNNHHDFSVAWVHPTSTRWRMLRKLSVTQMFSPQRIEATKAMRMKRAQELVNFI---  166

Query  916   AGSIKRGSGIHVTRFVFLATFNLLGNIMFSSDLVDPVSEKGSKFFNAMMGIMERGGTPNI  737
             + S +R   + ++R +F+   N++ NI+FS ++    S+  S F   M G+ME  G P++
Sbjct  167   SESSEREEAVDISRALFVTALNIISNILFSVNIGSYNSKDSSVFQELMTGVMEAIGNPDL  226

Query  736   SDIFPCLRWLDLQG----LRTKTDKDLQIALQIVST-FVQKRSKEGQDDSGKRKSDFLDV  572
             ++ FP +R+LDLQG    ++  ++K  Q+  +I +   V+K S+  + D+    +DF+D 
Sbjct  227   ANFFPFMRFLDLQGNSKKMKDCSEKLFQVFREIYNARIVEKSSRTNEKDASS--NDFMDA  284

Query  571   LLSFEGSGKDEPPKLSEHQINIFILEMFLAGTDTTSS  461
             L+      + + P+++ ++I   + ++F+AGTDTTSS
Sbjct  285   LIDLH---QGDQPEINTNEIEHLLFDLFIAGTDTTSS  318



>ref|XP_002301305.2| cytochrome P450 family protein [Populus trichocarpa]
 gb|EEE80578.2| cytochrome P450 family protein [Populus trichocarpa]
Length=500

 Score =   176 bits (446),  Expect(2) = 5e-70, Method: Compositional matrix adjust.
 Identities = 93/274 (34%), Positives = 156/274 (57%), Gaps = 9/274 (3%)
 Frame = -2

Query  1273  NMLDLGSVPHQTIAAMRNKYGPVVWLRIGSVSTLAIQSAKAAAELFKNHDVPFAGRSIGD  1094
             N+L LG  PH+T+A +   YGP++ L++G ++T+ I S   A E  + HD   + R++ D
Sbjct  47    NILALGDKPHRTLAKLSQTYGPLMTLKLGRITTIVISSPNIAKEALQKHDQALSSRTVPD  106

Query  1093  VMLAQGYN--KGSMALAQYGSYWRVLRRICSVEMFVHKKVNETAAVRRKCIDDLLRWVEN  920
              +  Q YN  K SM      ++W+ LR++ + +MF  ++++ + A+R K + +LL +V  
Sbjct  107   ALHVQYYNYHKNSMVWLPASTHWKFLRKLTATQMFTSQRLDASRALRGKKVQELLEYVHE  166

Query  919   EAGSIKRGSGIHVTRFVFLATFNLLGNIMFSSDLVDPVSEKGSKFFNAMMGIMERGGTPN  740
             +  +   G  + V R VF    NL+ N  FS D+ +  S+   +F N ++G++E+ G PN
Sbjct  167   KCNN---GHAVDVGRSVFTTVLNLISNTFFSLDVTNYNSDLSQEFSNLVVGVLEQIGKPN  223

Query  739   ISDIFPCLRWLDLQGLRTKTDKDLQIALQIVSTFVQKRSK-EGQDDSGKRKSDFLDVLLS  563
             I+D FP LR +D QG+R KT+  L+   QI  + + +R++      + K   D LD LL 
Sbjct  224   IADYFPILRLVDPQGIRRKTNNYLKRLTQIFDSIINERTRLRSSSVASKASHDVLDALLI  283

Query  562   FEGSGKDEPPKLSEHQINIFILEMFLAGTDTTSS  461
                  K+   +LS   I + +++ F+AGTDTTSS
Sbjct  284   L---AKENNTELSSTDIQVLLIDFFIAGTDTTSS  314


 Score =   117 bits (294),  Expect(2) = 5e-70, Method: Compositional matrix adjust.
 Identities = 66/114 (58%), Positives = 82/114 (72%), Gaps = 3/114 (3%)
 Frame = -1

Query  344  NTALTSSTVEWALTELLRNPKAMTKAKEEIRGIVGPTRRFEESDIDNLQYLQAVVKETLR  165
             T  TSSTVEWA+TELL NP  M KAK E++ + GP    +ESDI    YLQA+VKET R
Sbjct  308  GTDTTSSTVEWAMTELLLNPDKMVKAKNELQQVEGPV---QESDISKCPYLQAIVKETFR  364

Query  164  LHPPAPFLIPRRAIQDTKFMGYDIPKDTQVFINVWAIGRDHESWEDPLSFKPER  3
            LHPPAP L+PR+A+ + +  G+ +PK+ Q+ IN+WAIGRD   W DP SFKPER
Sbjct  365  LHPPAPLLLPRKAVSEVEMQGFTVPKNAQILINIWAIGRDPAIWPDPNSFKPER  418



>gb|AFS28686.1| putative geraniol 10-hydroxylase, partial [Olea europaea]
Length=411

 Score =   152 bits (383),  Expect(2) = 6e-70, Method: Compositional matrix adjust.
 Identities = 84/271 (31%), Positives = 141/271 (52%), Gaps = 7/271 (3%)
 Frame = -2

Query  1273  NMLDLGSVPHQTIAAMRNKYGPVVWLRIGSVSTLAIQSAKAAAELFKNHDVPFAGRSIGD  1094
             N+  LG  PH+++A +   YGP++ LR GS++T+ I S+  A E+ +  D+ F+ R I +
Sbjct  1     NLHLLGDQPHKSLAKLAKTYGPIMCLRFGSINTVVITSSAMAKEVLQKQDLAFSSRHIPN  60

Query  1093  VMLAQGYNKGSMALAQYGSYWRVLRRICSVEMFVHKKVNETAAVRRKCIDDLLRWVENEA  914
              + A    K S+      S WR LR+I +  MF   +++    +R + + +L+ +    +
Sbjct  61    AIHAHNQFKYSVVWLPVASTWRSLRKILNSNMFSGNRLDANQHLRVRKVQELITYCRKNS  120

Query  913   GSIKRGSGIHVTRFVFLATFNLLGNIMFSSDLVDPVSEKGSKFFNAMMGIMERGGTPNIS  734
              +   G  + + R  F  + NLL N +FS DL DP S+   +F + +  +M   G PN+ 
Sbjct  121   QA---GEAVDIGRAAFRTSLNLLSNTIFSKDLTDPFSDSAKEFXDLVWNVMVEAGKPNLV  177

Query  733   DIFPCLRWLDLQGLRTKTDKDLQIALQIVSTFVQKRSKEGQDDSGKRKSDFLDVLLSFEG  554
             D FP L  L   G+R +        +++    + +R K    D+ K  SD LDVLL    
Sbjct  178   DFFPVLEKLXPLGIRRRMTIHFGKIIELFGGLINERLKRRXSDNSK-NSDVLDVLLD---  233

Query  553   SGKDEPPKLSEHQINIFILEMFLAGTDTTSS  461
             + ++ P ++    I    L++F+AGTDTTSS
Sbjct  234   TSQENPEEIDRVHIERLCLDLFVAGTDTTSS  264


 Score =   142 bits (357),  Expect(2) = 6e-70, Method: Compositional matrix adjust.
 Identities = 63/114 (55%), Positives = 81/114 (71%), Gaps = 0/114 (0%)
 Frame = -1

Query  344  NTALTSSTVEWALTELLRNPKAMTKAKEEIRGIVGPTRRFEESDIDNLQYLQAVVKETLR  165
             T  TSST+EWA+ E L+NP  M KAK E+  ++G  +  EE+D+  L YL+ +VKE LR
Sbjct  258  GTDTTSSTLEWAMAETLKNPATMKKAKAELEEVIGKGKVLEEADVSRLPYLRCMVKEALR  317

Query  164  LHPPAPFLIPRRAIQDTKFMGYDIPKDTQVFINVWAIGRDHESWEDPLSFKPER  3
            +HPP PFLIPRR  QD +  GY +PK++QV +N WAIGRD   WE+PL FKPER
Sbjct  318  IHPPVPFLIPRRVEQDVEVSGYTVPKNSQVLVNAWAIGRDPTLWENPLEFKPER  371



>gb|EYU44354.1| hypothetical protein MIMGU_mgv11b004416mg [Erythranthe guttata]
Length=486

 Score =   150 bits (378),  Expect(2) = 7e-70, Method: Compositional matrix adjust.
 Identities = 84/271 (31%), Positives = 146/271 (54%), Gaps = 13/271 (5%)
 Frame = -2

Query  1273  NMLDLGSVPHQTIAAMRNKYGPVVWLRIGSVSTLAIQSAKAAAELFKNHDVPFAGRSIGD  1094
             N+  LG  PH+++  +   +GP+++LR+G ++T+ I SA+ A E+ + HD+ F+ RSI +
Sbjct  43    NLHLLGDQPHKSLCRLAKTHGPLMYLRLGFINTVVISSAEMAKEVLQKHDLAFSSRSIPN  102

Query  1093  VMLAQGYNKGSMALAQYGSYWRVLRRICSVEMFVHKKVNETAAVRRKCIDDLLRWVENEA  914
              + A    K S+     G  WR LR+  +  MF   +++    +R + + +L+ +     
Sbjct  103   AIHAHDQFKYSVVWLPVGPRWRSLRKALTANMFSSSRLDSGQKLRCRKVQELVDYC----  158

Query  913   GSIKRGSGIHVTRFVFLATFNLLGNIMFSSDLVDPVSEKGSKFFNAMMGIMERGGTPNIS  734
                + G  + V R  F  + NLL + +F  DL DP S+   +F + +  IM   G PN+ 
Sbjct  159   ---RSGEVVDVGRAAFRTSLNLLSSTIFCKDLTDPFSDSAKEFRDLVWNIMVEAGKPNLV  215

Query  733   DIFPCLRWLDLQGLRTKTDKDLQIALQIVSTFVQKRSKEGQDDSGKRKSDFLDVLLSFEG  554
             D FP L  LD QG+R +T       L +    + +R ++G+ D   + +D +DVLL+   
Sbjct  216   DFFPILGKLDPQGVRRRTTVHFGELLYLFGGLIDERLEKGKSD---QNADVMDVLLA---  269

Query  553   SGKDEPPKLSEHQINIFILEMFLAGTDTTSS  461
             + K+ P ++    I    L++F+AGTDT+SS
Sbjct  270   AWKENPEEIDRTHIERMCLDLFIAGTDTSSS  300


 Score =   143 bits (361),  Expect(2) = 7e-70, Method: Compositional matrix adjust.
 Identities = 67/114 (59%), Positives = 80/114 (70%), Gaps = 0/114 (0%)
 Frame = -1

Query  344  NTALTSSTVEWALTELLRNPKAMTKAKEEIRGIVGPTRRFEESDIDNLQYLQAVVKETLR  165
             T  +SSTVEWA+ E L NP+ M KAK E+  IVG  +  EE+DI  L YL+ +VKETLR
Sbjct  294  GTDTSSSTVEWAMAEALANPEIMKKAKAELEEIVGKGKVLEEADISRLPYLRCMVKETLR  353

Query  164  LHPPAPFLIPRRAIQDTKFMGYDIPKDTQVFINVWAIGRDHESWEDPLSFKPER  3
            LHPP PFLIPRR   D    GY +PK++QV +N WAIGRD   WE+PL FKPER
Sbjct  354  LHPPVPFLIPRRVEDDVDVCGYTVPKNSQVLVNAWAIGRDAGIWENPLEFKPER  407



>gb|AFS28687.1| putative geraniol 10-hydroxylase, partial [Olea europaea]
Length=411

 Score =   151 bits (382),  Expect(2) = 7e-70, Method: Compositional matrix adjust.
 Identities = 84/271 (31%), Positives = 141/271 (52%), Gaps = 7/271 (3%)
 Frame = -2

Query  1273  NMLDLGSVPHQTIAAMRNKYGPVVWLRIGSVSTLAIQSAKAAAELFKNHDVPFAGRSIGD  1094
             N+  LG  PH+++A +   YGP++ LR GS++T+ I S+  A E+ +  D+ F+ R   +
Sbjct  1     NLHLLGDQPHKSLAKLAKTYGPIMCLRFGSINTVVITSSAMAKEVLQKQDLAFSSRHXPN  60

Query  1093  VMLAQGYNKGSMALAQYGSYWRVLRRICSVEMFVHKKVNETAAVRRKCIDDLLRWVENEA  914
              + A    K S+      S WR LR+I +  MF   +++    +R + + +L+ +    +
Sbjct  61    AIHAHNQFKYSVVWLPVASTWRSLRKILNSNMFSGNRLDANQHLRVRKVQELITYCRKNS  120

Query  913   GSIKRGSGIHVTRFVFLATFNLLGNIMFSSDLVDPVSEKGSKFFNAMMGIMERGGTPNIS  734
              +   G    + R  F  + NLL N +FS DL DP S+   +F + +  +M   G PN+ 
Sbjct  121   QA---GEAXDIGRAAFRTSLNLLSNTIFSKDLTDPFSDSAKEFKDLVWNVMVEAGKPNLV  177

Query  733   DIFPCLRWLDLQGLRTKTDKDLQIALQIVSTFVQKRSKEGQDDSGKRKSDFLDVLLSFEG  554
             D FP L  LD  G+R +        +++    + +R K  + D+ K  SD LDVLL    
Sbjct  178   DFFPVLEKLDPLGIRRRMTIHFGKIIZLFGGLINERLKRRKSDNSK-NSDVLDVLLD---  233

Query  553   SGKDEPPKLSEHQINIFILEMFLAGTDTTSS  461
             + ++ P ++    I    L++F+AGTDTTSS
Sbjct  234   TSQENPEEIDRVHIERLCLDLFVAGTDTTSS  264


 Score =   142 bits (357),  Expect(2) = 7e-70, Method: Compositional matrix adjust.
 Identities = 63/114 (55%), Positives = 81/114 (71%), Gaps = 0/114 (0%)
 Frame = -1

Query  344  NTALTSSTVEWALTELLRNPKAMTKAKEEIRGIVGPTRRFEESDIDNLQYLQAVVKETLR  165
             T  TSST+EWA+ E L+NP  M KAK E+  ++G  +  EE+D+  L YL+ +VKE LR
Sbjct  258  GTDTTSSTLEWAMAETLKNPATMKKAKAELEEVIGKGKVLEEADVSRLPYLRCMVKEALR  317

Query  164  LHPPAPFLIPRRAIQDTKFMGYDIPKDTQVFINVWAIGRDHESWEDPLSFKPER  3
            +HPP PFLIPRR  QD +  GY +PK++QV +N WAIGRD   WE+PL FKPER
Sbjct  318  IHPPVPFLIPRRVEQDVEVSGYTVPKNSQVLVNAWAIGRDPTLWENPLEFKPER  371



>dbj|BAP90522.1| geraniol 10-hydroxylase [Ophiorrhiza pumila]
Length=512

 Score =   149 bits (377),  Expect(2) = 9e-70, Method: Compositional matrix adjust.
 Identities = 82/271 (30%), Positives = 144/271 (53%), Gaps = 8/271 (3%)
 Frame = -2

Query  1273  NMLDLGSVPHQTIAAMRNKYGPVVWLRIGSVSTLAIQSAKAAAELFKNHDVPFAGRSIGD  1094
             N+  LG  PH+++A +   +GP++ L++G ++TLAI S+  A E+ +  D+ F+ RSI D
Sbjct  61    NLHLLGDQPHKSLAKLAKTHGPLMSLKLGQITTLAISSSGMAKEVLQKQDLAFSSRSIPD  120

Query  1093  VMLAQGYNKGSMALAQYGSYWRVLRRICSVEMFVHKKVNETAAVRRKCIDDLLRWVENEA  914
              + A    + S+      + WR LR+I +  +F   +++    +R + + +L+ +     
Sbjct  121   AIHAHNQFQYSVVWLPVATRWRSLRKILNSNIFSGNRLDANQHLRCRKVQELIAYCRK--  178

Query  913   GSIKRGSGIHVTRFVFLATFNLLGNIMFSSDLVDPVSEKGSKFFNAMMGIMERGGTPNIS  734
              + + G  + + R  F  + NLL N +FS DL DP S+   +F + +  IM   G PN+ 
Sbjct  179   -NCQTGEAVDIGRAAFRTSLNLLSNTIFSKDLTDPYSDSAKEFKDLVWNIMVEAGKPNLV  237

Query  733   DIFPCLRWLDLQGLRTKTDKDLQIALQIVSTFVQKRSKEGQDDSGKRKSDFLDVLLSFEG  554
             D FP L   D QG+R +        L++    + +R   G+   G   +D LDVLL+   
Sbjct  238   DFFPVLEKFDPQGIRRRMTIHFGKVLEMFGGLINERLDNGKSRGG--NNDVLDVLLN---  292

Query  553   SGKDEPPKLSEHQINIFILEMFLAGTDTTSS  461
             + ++ P ++    I    L++F+AGTDTTS+
Sbjct  293   ASEETPDEIDRTHIERLCLDLFVAGTDTTSN  323


 Score =   144 bits (362),  Expect(2) = 9e-70, Method: Compositional matrix adjust.
 Identities = 62/114 (54%), Positives = 83/114 (73%), Gaps = 0/114 (0%)
 Frame = -1

Query  344  NTALTSSTVEWALTELLRNPKAMTKAKEEIRGIVGPTRRFEESDIDNLQYLQAVVKETLR  165
             T  TS+T+EWA+ E+L+ P+ M KAK E+  ++G  +  EE+D+  L YL+ +VKETLR
Sbjct  317  GTDTTSNTLEWAMAEMLKTPEKMKKAKAELAEVIGKGKAIEEADVSRLPYLRCIVKETLR  376

Query  164  LHPPAPFLIPRRAIQDTKFMGYDIPKDTQVFINVWAIGRDHESWEDPLSFKPER  3
            LHPP PFLIPR+  QD +  GY++PK TQV +N WAIGRD  +WE+ L FKPER
Sbjct  377  LHPPVPFLIPRKVEQDVEVCGYNVPKGTQVLVNAWAIGRDETTWENALEFKPER  430



>ref|XP_007227491.1| hypothetical protein PRUPE_ppa004517mg [Prunus persica]
 gb|EMJ28690.1| hypothetical protein PRUPE_ppa004517mg [Prunus persica]
Length=505

 Score =   157 bits (398),  Expect(2) = 1e-69, Method: Compositional matrix adjust.
 Identities = 84/271 (31%), Positives = 142/271 (52%), Gaps = 6/271 (2%)
 Frame = -2

Query  1273  NMLDLGSVPHQTIAAMRNKYGPVVWLRIGSVSTLAIQSAKAAAELFKNHDVPFAGRSIGD  1094
             N+L+LG+ PHQ++  +   YGP++ L++G V+T+ + S   A ++ + HD   + R++ D
Sbjct  47    NLLELGNKPHQSLTKLSQIYGPIITLQLGQVTTVVVSSPNTAKQVLQTHDQFLSNRTVPD  106

Query  1093  VMLAQGYNKGSMALAQYGSYWRVLRRICSVEMFVHKKVNETAAVRRKCIDDLLRWVENEA  914
              + A    + S+      + WR LR+IC+ ++F  K ++     R   + +L+  V   A
Sbjct  107   AIQACDLRQDSLPWIPPSAKWRSLRQICNSQLFAAKILDANQPNRCVKVQELISQVNESA  166

Query  913   GSIKRGSGIHVTRFVFLATFNLLGNIMFSSDLVDPVSEKGSKFFNAMMGIMERGGTPNIS  734
              +   G  + + R  F  T NLL   +FS DL DP SE   +F   + G+ME  GTPN+ 
Sbjct  167   VN---GEAVDIGRAAFKTTLNLLSRTIFSVDLADPSSEMAREFKETVWGLMEGAGTPNVG  223

Query  733   DIFPCLRWLDLQGLRTKTDKDLQIALQIVSTFVQKRSKEGQDDSGKRKSDFLDVLLSFEG  554
             D FP LR +D QG+R +  K      Q+    + +R    +     + +D LD LL+   
Sbjct  224   DFFPVLRKIDPQGIRRRMIKHFNKMEQLFDRMISQRLASRKAHDYVKTNDMLDTLLNISE  283

Query  553   SGKDEPPKLSEHQINIFILEMFLAGTDTTSS  461
             +  ++   + + +I    L +F AGTDTTS+
Sbjct  284   ANSED---MDKTKIQHLFLALFAAGTDTTSA  311


 Score =   135 bits (340),  Expect(2) = 1e-69, Method: Compositional matrix adjust.
 Identities = 61/114 (54%), Positives = 83/114 (73%), Gaps = 0/114 (0%)
 Frame = -1

Query  344  NTALTSSTVEWALTELLRNPKAMTKAKEEIRGIVGPTRRFEESDIDNLQYLQAVVKETLR  165
             T  TS+T+EWA+ ELLR+P+ ++KA++E+  I+G  +  EE+DI  L  LQA++KETLR
Sbjct  305  GTDTTSATLEWAMAELLRDPEKLSKAQQELEQIIGKGKPVEEADIARLPNLQAIIKETLR  364

Query  164  LHPPAPFLIPRRAIQDTKFMGYDIPKDTQVFINVWAIGRDHESWEDPLSFKPER  3
            LHP AP L+PR+A  D +  GY +PK  QVF+N WAIGRD   W++P SF PER
Sbjct  365  LHPAAPLLLPRKADSDVEICGYIVPKGAQVFVNAWAIGRDPSIWDNPSSFMPER  418



>ref|XP_002303546.2| hypothetical protein POPTR_0003s11810g [Populus trichocarpa]
 gb|EEE78525.2| hypothetical protein POPTR_0003s11810g [Populus trichocarpa]
Length=505

 Score =   155 bits (393),  Expect(2) = 1e-69, Method: Compositional matrix adjust.
 Identities = 98/291 (34%), Positives = 159/291 (55%), Gaps = 6/291 (2%)
 Frame = -2

Query  1333  RNKSRSGRlppgppglpvlGNMLDLGSVPHQTIAAMRNKYGPVVWLRIGSVSTLAIQSAK  1154
             R+K +SG+LPPGP  LP++GN+LDLG  PH+++A +   +G ++ L++G V+T+ + SA 
Sbjct  27    RSKRKSGKLPPGPSRLPIVGNLLDLGDKPHKSLAKLAKTHGQLMSLKLGQVTTIVVSSAT  86

Query  1153  AAAELFKNHDVPFAGRSIGDVMLAQGYNKGSMALAQYGSYWRVLRRICSVEMFVHKKVNE  974
              A E+ + HD+ F  R++ D + A  +++  +A     + WR LR+IC+  +F  +K++ 
Sbjct  87    MAKEVLQKHDLTFCNRTVVDAVRALDHHEAGIAWLPVATRWRNLRKICNSHIFTSQKLDA  146

Query  973   TAAVRRKCIDDLLRWVENEAGSIKRGSGIHVTRFVFLATFNLLGNIMFSSDLVDPVSEKG  794
                +RRK + DLL  V+        G  + + +  F AT N L N + S DL D  S+  
Sbjct  147   NQDLRRKKVQDLLAEVQERCLV---GEAVDLRQAAFTATLNALSNTVLSLDLTDLSSDIA  203

Query  793   SKFFNAMMGIMERGGTPNISDIFPCLRWLDLQGLRTKTDKDLQIALQIVSTFVQKRSKEG  614
              +F   +  IM+  G PN+ D FP LR +D QG+R +T         +    + +R +  
Sbjct  204   REFKEHISCIMDEAGKPNLVDYFPLLRRIDPQGIRRRTAIHFGKVFDLFDRLIIERLQLR  263

Query  613   QDDSGKRKSDFLDVLLSFEGSGKDEPPKLSEHQINIFILEMFLAGTDTTSS  461
             +        D LD LL+      +E   +   +I  F L++F AGTDTTSS
Sbjct  264   KVKGYIPLDDMLDTLLTISEVNNEE---MDATRIKHFFLDLFGAGTDTTSS  311


 Score =   137 bits (344),  Expect(2) = 1e-69, Method: Compositional matrix adjust.
 Identities = 64/114 (56%), Positives = 79/114 (69%), Gaps = 0/114 (0%)
 Frame = -1

Query  344  NTALTSSTVEWALTELLRNPKAMTKAKEEIRGIVGPTRRFEESDIDNLQYLQAVVKETLR  165
             T  TSST+EWA+ ELL +PK + KA+ E+   +G     EESDI  L YLQAV+KETLR
Sbjct  305  GTDTTSSTLEWAMAELLHSPKTLLKARAELERTIGEGNLLEESDITRLPYLQAVIKETLR  364

Query  164  LHPPAPFLIPRRAIQDTKFMGYDIPKDTQVFINVWAIGRDHESWEDPLSFKPER  3
            LHP  PFL+P +A  D +  G+ +PK+ QV +NVWAIGRD   WEDP SF PER
Sbjct  365  LHPAVPFLLPHKAGADAEIGGFTVPKNAQVLVNVWAIGRDPSMWEDPNSFVPER  418



>ref|XP_010661589.1| PREDICTED: geraniol 8-hydroxylase-like [Vitis vinifera]
Length=496

 Score =   149 bits (377),  Expect(2) = 2e-69, Method: Compositional matrix adjust.
 Identities = 83/271 (31%), Positives = 142/271 (52%), Gaps = 9/271 (3%)
 Frame = -2

Query  1273  NMLDLGSVPHQTIAAMRNKYGPVVWLRIGSVSTLAIQSAKAAAELFKNHDVPFAGRSIGD  1094
             N+L LG  PHQ++  +   YGP++ L++GS +T+ + S++AA E+   +D  F+ R++ +
Sbjct  46    NLLKLGEKPHQSLTILSKTYGPLMSLKLGSTTTIVVSSSEAAQEVLNKNDQAFSSRTVLN  105

Query  1093  VMLAQGYNKGSMALAQYGSYWRVLRRICSVEMFVHKKVNETAAVRRKCIDDLLRWVENEA  914
              +    ++  S+      ++WR LR+ICS +MF   +V    A+R   +  LL   +   
Sbjct  106   AIQVADHHHFSIVFLPASAHWRNLRKICSKQMFSSHRVEAGQAMRENIVQQLLGHAQESC  165

Query  913   GSIKRGSGIHVTRFVFLATFNLLGNIMFSSDLVDPVSEKGSKFFNAMMGIMERGGTPNIS  734
              S   G  + + R  F  T NLL N +FS +L    S    +F + +  IME  G PN++
Sbjct  166   SS---GRAVDIGRATFTTTLNLLSNTIFSVNLAHYNSNFSQEFKDLIWSIMEEAGKPNLA  222

Query  733   DIFPCLRWLDLQGLRTKTDKDLQIALQIVSTFVQKRSKEGQDDSGKRKSDFLDVLLSFEG  554
             D FP LR +D QG+  +        +++   F+++R       +    +D LD LL+ + 
Sbjct  223   DFFPVLRLVDPQGILRRMTVCFNKLVEVFDGFIEQRLPL---KASSANNDVLDGLLNLDK  279

Query  553   SGKDEPPKLSEHQINIFILEMFLAGTDTTSS  461
                 E   LS + +   ++++F AGTDTTSS
Sbjct  280   QHDHE---LSSNDVRHLLVDLFSAGTDTTSS  307


 Score =   142 bits (358),  Expect(2) = 2e-69, Method: Compositional matrix adjust.
 Identities = 65/114 (57%), Positives = 79/114 (69%), Gaps = 0/114 (0%)
 Frame = -1

Query  344  NTALTSSTVEWALTELLRNPKAMTKAKEEIRGIVGPTRRFEESDIDNLQYLQAVVKETLR  165
             T  TSSTVEWA+ ELL NP  M KA+ E+  +VG  +  EESDI  L YLQAVVKET R
Sbjct  301  GTDTTSSTVEWAMAELLNNPNLMAKARSELGKVVGKEKMVEESDISKLPYLQAVVKETFR  360

Query  164  LHPPAPFLIPRRAIQDTKFMGYDIPKDTQVFINVWAIGRDHESWEDPLSFKPER  3
            LHPP PFL+PR+    ++ +GY +PK+  V +NVWAIGRD   W +P SF PER
Sbjct  361  LHPPVPFLVPRKTEMKSEILGYAVPKNAHVLVNVWAIGRDSTIWSNPNSFVPER  414



>ref|XP_010508144.1| PREDICTED: cytochrome P450 76C2-like [Camelina sativa]
Length=511

 Score =   147 bits (370),  Expect(2) = 2e-69, Method: Compositional matrix adjust.
 Identities = 67/113 (59%), Positives = 85/113 (75%), Gaps = 0/113 (0%)
 Frame = -1

Query  341  TALTSSTVEWALTELLRNPKAMTKAKEEIRGIVGPTRRFEESDIDNLQYLQAVVKETLRL  162
            T  TSSTVEWA+ ELLR+PK+MTK ++EI G++G     +ESDI  L YLQAVVKET RL
Sbjct  313  TDTTSSTVEWAMAELLRSPKSMTKVQDEINGVMGQNGVIQESDISELSYLQAVVKETFRL  372

Query  161  HPPAPFLIPRRAIQDTKFMGYDIPKDTQVFINVWAIGRDHESWEDPLSFKPER  3
            HP AP L+PR+A  D   +G+ +PK+TQV +NVWAIGRD   WE+P  F+P+R
Sbjct  373  HPAAPLLLPRKAETDVDILGFIVPKNTQVLVNVWAIGRDPNVWENPNRFEPKR  425


 Score =   144 bits (364),  Expect(2) = 2e-69, Method: Compositional matrix adjust.
 Identities = 82/277 (30%), Positives = 161/277 (58%), Gaps = 14/277 (5%)
 Frame = -2

Query  1273  NMLDLGSVPHQTIAAMRNKYGPVVWLRIGSVSTLAIQSAKAAAELFKNHDVPFAGRSIGD  1094
             N+  +G  PH++ A +  KYGPV+ L++G ++++ I S  AA E+ + HD   +GR +  
Sbjct  50    NIHLVGKHPHRSFADLSKKYGPVMSLKLGFLNSVVISSRDAAREVLRTHDQILSGRYVNA  109

Query  1093  VMLAQGYNKGSMALAQYGSY-WRVLRRICSVEMFVHKKVNETAAVRRKCIDDLLRWVENE  917
              + +  ++  S+A     S  WR+LR++   +MF  +++  T A+R K   +L+ ++   
Sbjct  110   AVQSNNHHDFSVAWVHPTSTRWRMLRKLSVTQMFSPQRIEATKAMRMKRAQELVNFI---  166

Query  916   AGSIKRGSGIHVTRFVFLATFNLLGNIMFSSDLVDPVSEKGSKFFNAMMGIMERGGTPNI  737
             + S +R   + ++R +F+   N++ NI+FS ++    S+  S F   + G+M+  G P++
Sbjct  167   SESSEREEAVDISRALFVTALNIISNILFSVNIGSYNSKDSSVFQELITGVMDAIGNPDL  226

Query  736   SDIFPCLRWLDLQG----LRTKTDKDLQIALQIVST-FVQKRSKEGQDDSGKRKSDFLDV  572
             ++ FP +R+LDLQG    ++  +DK  Q+  +I +   V+K S+  + D+    +DF+D 
Sbjct  227   ANFFPFMRFLDLQGNSKKMKDCSDKLFQVFREIYNARIVEKSSRTNEKDASS--NDFMDA  284

Query  571   LLSFEGSGKDEPPKLSEHQINIFILEMFLAGTDTTSS  461
             L+      + + P+++ ++I   + ++F+AGTDTTSS
Sbjct  285   LIDLH---QGDEPEININEIEHLLFDLFIAGTDTTSS  318



>ref|XP_010103208.1| Cytochrome P450 76C1 [Morus notabilis]
 gb|EXB94994.1| Cytochrome P450 76C1 [Morus notabilis]
Length=513

 Score =   152 bits (385),  Expect(2) = 5e-69, Method: Compositional matrix adjust.
 Identities = 83/273 (30%), Positives = 144/273 (53%), Gaps = 5/273 (2%)
 Frame = -2

Query  1273  NMLDLGSVPHQTIAAMRNKYGPVVWLRIGSVSTLAIQSAKAAAELFKNHDVPFAGRSIGD  1094
             N+L+LG  PH+++A +   YGP++ L++G ++T+ + S   A E+ + H   F+ R+I +
Sbjct  46    NLLELGDKPHKSLARLSQTYGPIMCLKLGQLTTIVVSSPTMAKEVMQTHSQFFSNRTITE  105

Query  1093  VMLAQGYNKGSMALAQYGSYWRVLRRICSVEMFVHKKVNETAAVRRKCIDDLLRWVENEA  914
                A  +++ S+  +   + WR LR+I +V +   + ++    +R   + +LLR V    
Sbjct  106   AARATDHSQVSVVFSPVSTLWRELRKISTVHLLAARVLDANMNLRHNKVQELLRHVHQ--  163

Query  913   GSIKRGSGIHVTRFVFLATFNLLGNIMFSSDLVDPVSEKGSKFFNAMMGIMERGGTPNIS  734
              S++ G  +   +  F AT NLL    FS DL D  S+   +   A+ GI E  G PN++
Sbjct  164   -SVEVGEAVEFGKAAFKATLNLLSTTFFSMDLADSNSDNVRELMEAVHGISEELGKPNVA  222

Query  733   DIFPCLRWLDLQGLRTKTDKDLQIALQIVSTFVQKRSKEGQDDSGKRKSDFLDVLLSFE-  557
             D FP L+ +D QG+R +     Q  L +    + +R +  +  S  +  D LD L+    
Sbjct  223   DYFPILKKIDPQGIRRRISIHFQKMLDLFDRAIDQRLRLRKPSSSVKYDDILDTLIDMMV  282

Query  556   -GSGKDEPPKLSEHQINIFILEMFLAGTDTTSS  461
              G  K E   L ++ I   +L++F AGT+TT+S
Sbjct  283   IGEEKREYDHLDKNTIEHLLLDLFGAGTETTTS  315


 Score =   138 bits (347),  Expect(2) = 5e-69, Method: Compositional matrix adjust.
 Identities = 63/114 (55%), Positives = 82/114 (72%), Gaps = 0/114 (0%)
 Frame = -1

Query  344  NTALTSSTVEWALTELLRNPKAMTKAKEEIRGIVGPTRRFEESDIDNLQYLQAVVKETLR  165
             T  T+ST EW++ ELL+ P+ M+KA+ E+  ++G   + +ESDI  L YLQA+VKETLR
Sbjct  309  GTETTTSTFEWSMAELLKAPEIMSKAQAELEQVIGKGNQVKESDITRLPYLQAIVKETLR  368

Query  164  LHPPAPFLIPRRAIQDTKFMGYDIPKDTQVFINVWAIGRDHESWEDPLSFKPER  3
            LHPP PFLIPR+A  D +  G  IPKD+QV +NVWA+GRD   WE+P  F PER
Sbjct  369  LHPPVPFLIPRKAESDVEVCGRTIPKDSQVLVNVWAMGRDPSIWENPNKFMPER  422



>gb|KCW77657.1| hypothetical protein EUGRSUZ_D01955 [Eucalyptus grandis]
Length=487

 Score =   161 bits (407),  Expect(2) = 5e-69, Method: Compositional matrix adjust.
 Identities = 89/271 (33%), Positives = 142/271 (52%), Gaps = 18/271 (7%)
 Frame = -2

Query  1273  NMLDLGSVPHQTIAAMRNKYGPVVWLRIGSVSTLAIQSAKAAAELFKNHDVPFAGRSIGD  1094
             N+L LGS PH+++A + + YGP++ L++G V+T+ + S   A E+ + HD  F+ R+I D
Sbjct  46    NLLSLGSQPHRSLARLSHTYGPIIKLQLGHVTTIVVSSRPIAREILQTHDAIFSDRTIPD  105

Query  1093  VMLAQGYNKGSMALAQYGSYWRVLRRICSVEMFVHKKVNETAAVRRKCIDDLLRWVENEA  914
              + A   N+  +        WR LR+IC++ +F HKK+     +R++ + +LL ++    
Sbjct  106   SVTALRQNELGLPWIPVSPLWRNLRKICNLHIFSHKKLEANQHIRQEKVQELLSYINR--  163

Query  913   GSIKRGSGIHVTRFVFLATFNLLGNIMFSSDLVDPVSEKGSKFFNAMMGIMERGGTPNIS  734
              S+ RG  + +    F A  NLL   M S DL +P S     F + +  IM   G PNI+
Sbjct  164   -SLSRGDAVDIGEVTFKAVVNLLSKTMLSEDLANP-SGSTKDFKDLVWRIMVEAGKPNIA  221

Query  733   DIFPCLRWLDLQGLRTKTDKDLQIALQIVSTFVQKRSKEGQDDSGKRKSDFLDVLLSFEG  554
             D FP L+ +DLQG R +         ++  + ++KR +E       RK+D LD LL    
Sbjct  222   DYFPALKKIDLQGSRRRMTVYFTKIFELFDSLIEKRLRERATVGSIRKNDVLDTLLDARE  281

Query  553   SGKDEPPKLSEHQINIFILEMFLAGTDTTSS  461
                +E              ++F+AGTDTTSS
Sbjct  282   DKSEE--------------DLFVAGTDTTSS  298


 Score =   129 bits (325),  Expect(2) = 5e-69, Method: Compositional matrix adjust.
 Identities = 59/114 (52%), Positives = 80/114 (70%), Gaps = 0/114 (0%)
 Frame = -1

Query  344  NTALTSSTVEWALTELLRNPKAMTKAKEEIRGIVGPTRRFEESDIDNLQYLQAVVKETLR  165
             T  TSSTVEWAL+EL+ +P+ +++A+ E+  ++G  +  EES+I  L YLQAV+KET R
Sbjct  292  GTDTTSSTVEWALSELIHSPEKLSRAQAELDRVIGKGKPIEESEIARLPYLQAVIKETFR  351

Query  164  LHPPAPFLIPRRAIQDTKFMGYDIPKDTQVFINVWAIGRDHESWEDPLSFKPER  3
            LHPP P  +PR++  +    G+ IPK  QVF+NVWAIGRD   W+DP  F PER
Sbjct  352  LHPPVPLYLPRKSGSEIGIAGFTIPKGAQVFVNVWAIGRDPSIWKDPEVFMPER  405



>ref|XP_004496721.1| PREDICTED: geraniol 8-hydroxylase-like [Cicer arietinum]
Length=500

 Score =   147 bits (372),  Expect(2) = 6e-69, Method: Compositional matrix adjust.
 Identities = 83/271 (31%), Positives = 142/271 (52%), Gaps = 8/271 (3%)
 Frame = -2

Query  1273  NMLDLGSVPHQTIAAMRNKYGPVVWLRIGSVSTLAIQSAKAAAELFKNHDVPFAGRSIGD  1094
             N+L+LG  PH+ +A +   YGP++ L+ G ++T+ I SA  A E+   +D   + R+I  
Sbjct  47    NLLELGEKPHKPLATLAKTYGPIMSLKFGQITTVVISSADMAKEVLLTNDQFLSNRTIPQ  106

Query  1093  VMLAQGYNKGSMALAQYGSYWRVLRRICSVEMFVHKKVNETAAVRRKCIDDLLRWVENEA  914
              +    +   S+A       W+ LR+IC+ ++F H+ ++ +  +RR  +  LL  +    
Sbjct  107   SVSVLNHEHYSLAFIPVSPLWKELRKICNTQLFSHQTLDASQDIRRNKVQQLLNDIHQ--  164

Query  913   GSIKRGSGIHVTRFVFLATFNLLGNIMFSSDLVDPVSEKGSKFFNAMMGIMERGGTPNIS  734
              S + G  I +   VF  T NLL N +FS DL+      G +F + +  I +  GTPN++
Sbjct  165   -SCQIGEAIDIGTIVFKTTINLLSNTIFSVDLIHSNGAAG-EFKDLVTDITKLVGTPNVA  222

Query  733   DIFPCLRWLDLQGLRTKTDKDLQIALQIVSTFVQKRSKEGQDDSGKRKSDFLDVLLSFEG  554
             D FP L+ LD QG++ +  K+++  L I    V +R K  +  S     D LD +L+   
Sbjct  223   DFFPILKMLDPQGVKRRQTKNVRKVLDIFEDLVSQRLKMREGTSVDSHKDMLDAMLNISK  282

Query  553   SGKDEPPKLSEHQINIFILEMFLAGTDTTSS  461
               +     + +H  +    ++F+AGTDTT+S
Sbjct  283   ENEFMDTNMIQHLSH----DLFVAGTDTTAS  309


 Score =   142 bits (359),  Expect(2) = 6e-69, Method: Compositional matrix adjust.
 Identities = 66/114 (58%), Positives = 83/114 (73%), Gaps = 0/114 (0%)
 Frame = -1

Query  344  NTALTSSTVEWALTELLRNPKAMTKAKEEIRGIVGPTRRFEESDIDNLQYLQAVVKETLR  165
             T  T+ST+EWA+TEL+RNP+AM KAK E+   +G +   EES+I  L YLQA++KETLR
Sbjct  303  GTDTTASTLEWAMTELMRNPEAMRKAKMELEQTIGCSVPLEESNISKLPYLQAIIKETLR  362

Query  164  LHPPAPFLIPRRAIQDTKFMGYDIPKDTQVFINVWAIGRDHESWEDPLSFKPER  3
            LHPP PFL+PR+A +D +   Y IPKD QV +NVW IGRD   W +P SF PER
Sbjct  363  LHPPVPFLLPRKAERDVEIGDYTIPKDAQVLVNVWTIGRDPTIWVNPTSFSPER  416



>gb|KFK37346.1| hypothetical protein AALP_AA4G244600 [Arabis alpina]
Length=505

 Score =   148 bits (373),  Expect(2) = 6e-69, Method: Compositional matrix adjust.
 Identities = 86/278 (31%), Positives = 152/278 (55%), Gaps = 16/278 (6%)
 Frame = -2

Query  1273  NMLDLGSVPHQTIAAMRNKYGPVVWLRIGSVSTLAIQSAKAAAELFKNHDVPFAGRSIGD  1094
             N+  +G  PHQ+ A +   YGP++ L++G ++++ I S +AA E+ + HD   + R    
Sbjct  45    NIHQIGKNPHQSFADLSKTYGPLMSLKLGCLNSVVIASPEAAREVLRTHDQILSSRKSTS  104

Query  1093  VMLAQGYNKGSMA-LAQYGSYWRVLRRICSVEMFVHKKVNETAAVRRKCIDDLLRWVENE  917
              + +  ++K S+A +      WR+ R++    +F   ++  T A+R K + +L+ ++   
Sbjct  105   SIRSIDHDKYSVAWIPPSSDRWRLFRKLSVTHLFSPHRIEATKALRMKKVQELVSFIRE-  163

Query  916   AGSIKRGSGIHVTRFVFLATFNLLGNIMFSSDLVDPVSEKGSKFFNAMMGIMERGGTPNI  737
               S +R   + ++R  F+   N++ NI+FS +LV   SEK + F  A++  ME  G P++
Sbjct  164   --SSEREEAVDISRASFITVLNIISNILFSVNLVSYDSEKSNVFQEAVIAGMEAAGNPDL  221

Query  736   SDIFPCLRWLDLQGLRTKTDKDLQIALQIVSTFVQKRSKEG------QDDSGKRKSDFLD  575
             ++ FP L +LDLQG R K     ++  ++   F   ++ E       +DD+    SDFLD
Sbjct  222   ANFFPFLEFLDLQGNRKKIKSFAEVFFKVFREFADAKTAEKSLRNNLKDDTN---SDFLD  278

Query  574   VLLSFEGSGKDEPPKLSEHQINIFILEMFLAGTDTTSS  461
             V+L    +G +  P+L  + I   +L+MF AGTDT SS
Sbjct  279   VILEL-STGVE--PELDNNDIEHLLLDMFTAGTDTNSS  313


 Score =   142 bits (358),  Expect(2) = 6e-69, Method: Compositional matrix adjust.
 Identities = 66/114 (58%), Positives = 81/114 (71%), Gaps = 0/114 (0%)
 Frame = -1

Query  344  NTALTSSTVEWALTELLRNPKAMTKAKEEIRGIVGPTRRFEESDIDNLQYLQAVVKETLR  165
             T   SSTVEWA+ ELLRNPK M KA+ EI  ++G     +ESDI  L YLQAVVKET R
Sbjct  307  GTDTNSSTVEWAMAELLRNPKTMAKAQAEIDRVIGKNGVVQESDISELPYLQAVVKETFR  366

Query  164  LHPPAPFLIPRRAIQDTKFMGYDIPKDTQVFINVWAIGRDHESWEDPLSFKPER  3
            LHP  P L+PR+A  D + +G+ + KDTQV +NVWAIGRD   WE+P+ F+PER
Sbjct  367  LHPAVPLLLPRKAETDVEILGFFVSKDTQVLVNVWAIGRDPSVWENPMRFEPER  420



>ref|XP_006338232.1| PREDICTED: geraniol 8-hydroxylase-like [Solanum tuberosum]
Length=495

 Score =   152 bits (385),  Expect(2) = 7e-69, Method: Compositional matrix adjust.
 Identities = 82/267 (31%), Positives = 144/267 (54%), Gaps = 6/267 (2%)
 Frame = -2

Query  1261  LGSVPHQTIAAMRNKYGPVVWLRIGSVSTLAIQSAKAAAELFKNHDVPFAGRSIGDVMLA  1082
             LG  PHQ++  +  KYGP++ LR+G  +T+ I S+  A E+ +  D+ F+ R+I D + A
Sbjct  47    LGGQPHQSLDKLAQKYGPIISLRLGQKTTVVISSSAVAKEVLQKQDLAFSSRTIPDAIYA  106

Query  1081  QGYNKGSMALAQYGSYWRVLRRICSVEMFVHKKVNETAAVRRKCIDDLLRWVENEAGSIK  902
               + + S+      + WR LR+I +  +F   +++    +R   I DL+ +     G  +
Sbjct  107   LNHYQFSVVWLPVANRWRSLRKILNSYIFSGSRLDANQHLRSGKIQDLIAYCR---GFSE  163

Query  901   RGSGIHVTRFVFLATFNLLGNIMFSSDLVDPVSEKGSKFFNAMMGIMERGGTPNISDIFP  722
              G  +++ +  F  + NLL N +FS D+VDP +  G +F + +  IME  G PN++D FP
Sbjct  164   TGEAVNIGQAAFETSMNLLSNTIFSKDVVDPYANSGKEFKDVVSNIMEDAGKPNLADYFP  223

Query  721   CLRWLDLQGLRTKTDKDLQIALQIVSTFVQKRSKEGQDDSGKRKSDFLDVLLSFEGSGKD  542
               + +D QG+R +  K     LQ     + +R +  +  +    +D LDVLL+   + ++
Sbjct  224   VFKAIDPQGIRRRVGKHFGKLLQQFEGLIDERLEARKKSATIGSTDVLDVLLN---TSEE  280

Query  541   EPPKLSEHQINIFILEMFLAGTDTTSS  461
             +   +  + I    L++F AGTDTTS+
Sbjct  281   DAQTIDRNHIERLCLDLFTAGTDTTSN  307


 Score =   137 bits (345),  Expect(2) = 7e-69, Method: Compositional matrix adjust.
 Identities = 62/114 (54%), Positives = 83/114 (73%), Gaps = 1/114 (1%)
 Frame = -1

Query  344  NTALTSSTVEWALTELLRNPKAMTKAKEEIRGIVGPTRRFEESDIDNLQYLQAVVKETLR  165
             T  TS+T+EWA+ E++R P  M KAK E+  ++G  +  EE+D+  L YLQ +VKETLR
Sbjct  301  GTDTTSNTLEWAMVEVMRKPYIMKKAKAELAEVIGQGKAIEEADVARLSYLQCIVKETLR  360

Query  164  LHPPAPFLIPRRAIQDTKFMGYDIPKDTQVFINVWAIGRDHESWEDPLSFKPER  3
            +HPP PFLI R+  QD +  GY +PKD+QV ++VW+IGRD   WEDPL+FKPER
Sbjct  361  MHPPVPFLI-RKVDQDVEACGYFVPKDSQVLVHVWSIGRDPAIWEDPLTFKPER  413



>ref|XP_002299579.2| hypothetical protein POPTR_0001s08320g [Populus trichocarpa]
 gb|EEE84384.2| hypothetical protein POPTR_0001s08320g [Populus trichocarpa]
Length=502

 Score =   156 bits (394),  Expect(2) = 7e-69, Method: Compositional matrix adjust.
 Identities = 86/271 (32%), Positives = 145/271 (54%), Gaps = 5/271 (2%)
 Frame = -2

Query  1273  NMLDLGSVPHQTIAAMRNKYGPVVWLRIGSVSTLAIQSAKAAAELFKNHDVPFAGRSIGD  1094
             ++LDLG  PH+++A +   +GP++ L++G ++T+ I S   A E+ + HDV F+ R+I D
Sbjct  48    SLLDLGDKPHKSLARLAKTHGPLMSLKLGQITTIVISSPTLAKEVLQKHDVSFSNRTIPD  107

Query  1093  VMLAQGYNKGSMALAQYGSYWRVLRRICSVEMFVHKKVNETAAVRRKCIDDLLRWVENEA  914
              + A  +++  +        WR LR++C+  +F ++K++    +RRK I +L+  V+   
Sbjct  108   ALRAHKHHELGLPWVPIAMRWRNLRKVCNSYIFTNQKLDANQDLRRKKIQELVALVQEHC  167

Query  913   GSIKRGSGIHVTRFVFLATFNLLGNIMFSSDLVDPVSEKGSKFFNAMMGIMERGGTPNIS  734
              +   G  + + +  F    N L N +FS +L D  SE  S+    + GIME  G PN++
Sbjct  168   LA---GEAMDIGQAAFTTALNALSNSIFSLNLSDSNSETASQLKEVVGGIMEEAGKPNLA  224

Query  733   DIFPCLRWLDLQGLRTKTDKDLQIALQIVSTFVQKRSKEGQDDSGKRKSDFLDVLLSFEG  554
             D FP LR +DLQG++ +        L I    V +R +  +       +D LD LL+   
Sbjct  225   DYFPVLRRIDLQGIKRRMTIHFGKILNIFDGIVNERLQLRKMQGYVPVNDMLDTLLTISE  284

Query  553   SGKDEPPKLSEHQINIFILEMFLAGTDTTSS  461
                ++   +   QI    L++F AGTDTTSS
Sbjct  285   DNNED--IMETSQIKHLFLDLFAAGTDTTSS  313


 Score =   134 bits (336),  Expect(2) = 7e-69, Method: Compositional matrix adjust.
 Identities = 62/114 (54%), Positives = 78/114 (68%), Gaps = 0/114 (0%)
 Frame = -1

Query  344  NTALTSSTVEWALTELLRNPKAMTKAKEEIRGIVGPTRRFEESDIDNLQYLQAVVKETLR  165
             T  TSST+EWA+ ELL NP+ ++ A+ E+   +G     EESDI  L YLQAV+KET R
Sbjct  307  GTDTTSSTLEWAMAELLHNPRTLSIARTELEQTIGKGSLIEESDIVRLPYLQAVIKETFR  366

Query  164  LHPPAPFLIPRRAIQDTKFMGYDIPKDTQVFINVWAIGRDHESWEDPLSFKPER  3
            LHP  P L+PR+A ++ +  GY IPK  Q+F+N WAIGRD   WEDP SF PER
Sbjct  367  LHPAVPLLLPRKAGENVEISGYTIPKGAQLFVNAWAIGRDPSLWEDPESFVPER  420



>ref|XP_004232063.1| PREDICTED: geraniol 8-hydroxylase-like [Solanum lycopersicum]
Length=495

 Score =   152 bits (383),  Expect(2) = 7e-69, Method: Compositional matrix adjust.
 Identities = 83/267 (31%), Positives = 142/267 (53%), Gaps = 6/267 (2%)
 Frame = -2

Query  1261  LGSVPHQTIAAMRNKYGPVVWLRIGSVSTLAIQSAKAAAELFKNHDVPFAGRSIGDVMLA  1082
             LG  PHQ++  +  KYGP++ LR+G  +T+ I S+  A ++ +  D+ F+ R+I D + A
Sbjct  47    LGGQPHQSLDKLAQKYGPIISLRLGLKTTVVISSSAVAKQVLQKQDLAFSSRTIPDAIYA  106

Query  1081  QGYNKGSMALAQYGSYWRVLRRICSVEMFVHKKVNETAAVRRKCIDDLLRWVENEAGSIK  902
               + + S+      + WR LR+I +  +F    ++    +R   I DL+ +     G  +
Sbjct  107   LNHYQFSVVWLPVANRWRSLRKILNSYIFSASSLDANQHLRSGKIQDLIAYC---GGCSQ  163

Query  901   RGSGIHVTRFVFLATFNLLGNIMFSSDLVDPVSEKGSKFFNAMMGIMERGGTPNISDIFP  722
              G  +++ +  F  + NLL N +FS D+VDP +  G  F + +  I E  G PN+SD FP
Sbjct  164   TGEAVNIEQAAFETSMNLLSNTIFSKDVVDPYANSGKVFKDVVSSITEDAGKPNLSDYFP  223

Query  721   CLRWLDLQGLRTKTDKDLQIALQIVSTFVQKRSKEGQDDSGKRKSDFLDVLLSFEGSGKD  542
               + +D QG+R +  K     LQ     + +R +  +  +    +D LDVLL+   + K+
Sbjct  224   LFKTIDPQGIRRRVGKHFGKLLQQFEGLIDERLEARRKSATIGSTDVLDVLLN---TSKE  280

Query  541   EPPKLSEHQINIFILEMFLAGTDTTSS  461
             +   +  + I    L++F+AGTDTTSS
Sbjct  281   DAQAIDRNHIERLCLDLFVAGTDTTSS  307


 Score =   138 bits (347),  Expect(2) = 7e-69, Method: Compositional matrix adjust.
 Identities = 63/114 (55%), Positives = 83/114 (73%), Gaps = 1/114 (1%)
 Frame = -1

Query  344  NTALTSSTVEWALTELLRNPKAMTKAKEEIRGIVGPTRRFEESDIDNLQYLQAVVKETLR  165
             T  TSST+EWA+ E++R P  M KAK E+  ++G  +  EE+D+  L YLQ +VKETLR
Sbjct  301  GTDTTSSTLEWAMVEVMRKPYIMNKAKAELAEVIGQGKAIEEADVARLPYLQCIVKETLR  360

Query  164  LHPPAPFLIPRRAIQDTKFMGYDIPKDTQVFINVWAIGRDHESWEDPLSFKPER  3
            +HPP PFLI R+  QD +  GY +PKD+QV ++VW+IGRD   WEDPL+FKPER
Sbjct  361  IHPPVPFLI-RKVDQDVEACGYFVPKDSQVLVHVWSIGRDPAIWEDPLTFKPER  413



>ref|XP_010692296.1| PREDICTED: geraniol 8-hydroxylase-like isoform X1 [Beta vulgaris 
subsp. vulgaris]
Length=487

 Score =   160 bits (406),  Expect(2) = 8e-69, Method: Compositional matrix adjust.
 Identities = 87/271 (32%), Positives = 150/271 (55%), Gaps = 12/271 (4%)
 Frame = -2

Query  1273  NMLDLGSVPHQTIAAMRNKYGPVVWLRIGSVSTLAIQSAKAAAELFKNHDVPFAGRSIGD  1094
             N+  LG  PH+++A +   YGP++ L++GS++T+ I S + A E+F  HD+ F+GR+  D
Sbjct  40    NIFKLGDKPHRSVAELAKIYGPIMSLKLGSITTIVISSPEVAREMFLKHDLDFSGRANTD  99

Query  1093  VMLAQGYNKGSMALAQYGSYWRVLRRICSVEMFVHKKVNETAAVRRKCIDDLLRWVENEA  914
              + A  +++ SM     G  WR LR+I +V++F  K+++ +  +R+K +D+L+ +  + +
Sbjct  100   ALRAANHDQLSMVFLPVGPKWRNLRKIATVQLFTGKRLDASQIIRQKKVDELIEYARHCS  159

Query  913   GSIKRGSGIHVTRFVFLATFNLLGNIMFSSDLVDPVSEKGSKFFNAMMGIMERGGTPNIS  734
                +RG  +++ +  F  T NLL +  FS DL   VS    +F + +  +M  G  PN+S
Sbjct  160   ---ERGLPLNIGKAAFTTTLNLLSSTFFSMDLASHVSSDSQEFKDLVWQMMVEGARPNVS  216

Query  733   DIFPCLRWLDLQGLRTKTDKDLQIALQIVSTFVQKRSKEGQDDSGKRKSDFLDVLLSFEG  554
             D FP ++  DLQG+  +        L I    ++ R +  +D     K D LD LL    
Sbjct  217   DFFPIVKEFDLQGVLRRATYCANKMLGIFEEIIEGRLRNPKD----TKDDVLDTLLKLV-  271

Query  553   SGKDEPPKLSEHQINIFILEMFLAGTDTTSS  461
                 E  +LS  ++   + ++F AGTDTT+S
Sbjct  272   ----EDKELSLDEVKHLLFDLFAAGTDTTAS  298


 Score =   129 bits (324),  Expect(2) = 8e-69, Method: Compositional matrix adjust.
 Identities = 59/114 (52%), Positives = 81/114 (71%), Gaps = 0/114 (0%)
 Frame = -1

Query  344  NTALTSSTVEWALTELLRNPKAMTKAKEEIRGIVGPTRRFEESDIDNLQYLQAVVKETLR  165
             T  T+ST+EWA+TELLRNP  M KA+ E+  + G     +E++I  L Y+QA+VKET R
Sbjct  292  GTDTTASTLEWAMTELLRNPDKMAKAQNELDEVFGKGVIIQETNISKLTYIQAIVKETYR  351

Query  164  LHPPAPFLIPRRAIQDTKFMGYDIPKDTQVFINVWAIGRDHESWEDPLSFKPER  3
            LHP APFLIP +A ++ +   Y +PK+TQ+++NVW+IGRD   W +PL F PER
Sbjct  352  LHPAAPFLIPYKAEKNVELCDYFVPKNTQLWVNVWSIGRDPRVWPNPLMFSPER  405



>ref|XP_009138804.1| PREDICTED: cytochrome P450 76C4-like [Brassica rapa]
Length=500

 Score =   159 bits (403),  Expect(2) = 8e-69, Method: Compositional matrix adjust.
 Identities = 102/291 (35%), Positives = 170/291 (58%), Gaps = 9/291 (3%)
 Frame = -2

Query  1333  RNKSRSGRlppgppglpvlGNMLDLGSVPHQTIAAMRNKYGPVVWLRIGSVSTLAIQSAK  1154
             R+K RS  LPPGPPG P++GN+L +G  PH+++A +   YGPV+ LR+GS++T+ I S +
Sbjct  22    RSKRRSTLLPPGPPGWPIIGNILQIGKAPHRSLADLSRIYGPVMSLRLGSLTTVIISSPE  81

Query  1153  AAAELFKNHDVPFAGRSIGDVMLAQGYNKGSMALAQYGSYWRVLRRICSVEMFVHKKVNE  974
             AA E+ K HD   +GR I D + +   +     L      WR+ R+I + +MF  + ++ 
Sbjct  82    AAREVLKTHDQVLSGRIILDPIQSIHQDVSMAWLPSTSPRWRLWRKISATQMFSPQCLDA  141

Query  973   TAAVRRKCIDDLLRWVENEAGSIKRGSGIHVTRFVFLATFNLLGNIMFSSDLVDPVSEKG  794
             T  VR K +++L+ ++       +RG  I++ R  F+ + NL+ N +FS+DL    S+  
Sbjct  142   TKTVRMKKVNELVTFISEIC---ERGESINIARASFVTSLNLISNTLFSTDLGSYDSKIS  198

Query  793   SKFFNAMMGIMERGGTPNISDIFPCLRWLDLQGLRTKTDKDLQIALQIVSTFVQKRSKEG  614
              +   +++ IME  G PN+++ FP + +LDLQG+R +      +  Q+   F+  R+ E 
Sbjct  199   MELQESVVRIMETIGKPNLANYFPLIGFLDLQGIRKEMKVCSDVLFQVFQGFIDARNNE-  257

Query  613   QDDSGKRKSDFLDVLLSFEGSGKDEPPKLSEHQINIFILEMFLAGTDTTSS  461
                + + +SD LD L+      K+  P+L  ++I  FI ++FLAGTDT S+
Sbjct  258   --KTTRNESDLLDSLMDLV---KENGPELKVNEIKHFIFDLFLAGTDTNST  303


 Score =   130 bits (327),  Expect(2) = 8e-69, Method: Compositional matrix adjust.
 Identities = 60/114 (53%), Positives = 78/114 (68%), Gaps = 0/114 (0%)
 Frame = -1

Query  344  NTALTSSTVEWALTELLRNPKAMTKAKEEIRGIVGPTRRFEESDIDNLQYLQAVVKETLR  165
             T   S+TVEWA+ ELLRNPK M KA+ E+  +VG     +ES I +L YLQA+VKETLR
Sbjct  297  GTDTNSTTVEWAMAELLRNPKTMAKAQAEMDDVVGLNGVVQESHISDLPYLQALVKETLR  356

Query  164  LHPPAPFLIPRRAIQDTKFMGYDIPKDTQVFINVWAIGRDHESWEDPLSFKPER  3
            LHPP P L P +A  + + +G+ +PK+ QV +N WAIGRD   WE+   F+PER
Sbjct  357  LHPPGPLLGPHKAESNAEILGFLVPKNAQVLVNAWAIGRDSGIWENAEQFEPER  410



>ref|XP_009596429.1| PREDICTED: geraniol 8-hydroxylase-like [Nicotiana tomentosiformis]
Length=497

 Score =   150 bits (378),  Expect(2) = 1e-68, Method: Compositional matrix adjust.
 Identities = 89/271 (33%), Positives = 143/271 (53%), Gaps = 7/271 (3%)
 Frame = -2

Query  1273  NMLDLGSVPHQTIAAMRNKYGPVVWLRIGSVSTLAIQSAKAAAELFKNHDVPFAGRSIGD  1094
             N+  LG  PH ++A +   +GP++ L++G ++T+ I S+  A E+ +  D+ FA RS+ D
Sbjct  44    NLHLLGDKPHISLAKLSKIHGPIMNLKLGQINTVVISSSVLAREVMQKRDLAFANRSVAD  103

Query  1093  VMLAQGYNKGSMALAQYGSYWRVLRRICSVEMFVHKKVNETAAVRRKCIDDLLRWVENEA  914
              + A+ ++  S+      S WR LR+I +  +F   K++    +R K I +L   V++  
Sbjct  104   ALRARNHSDFSVVFLPVNSRWRTLRKIMNSNIFSGNKLDANQHLRTKKIQEL---VDHCH  160

Query  913   GSIKRGSGIHVTRFVFLATFNLLGNIMFSSDLVDPVSEKGSKFFNAMMGIMERGGTPNIS  734
              S K G  + + R  F  + NLL N +FS DL DP S+   +F + +  IM   G PN+ 
Sbjct  161   KSAKNGETVDIGRAAFRTSLNLLSNTIFSKDLSDPFSDSAKEFKDLVWSIMVEAGKPNLV  220

Query  733   DIFPCLRWLDLQGLRTKTDKDLQIALQIVSTFVQKRSKEGQDDSGKRKSDFLDVLLSFEG  554
             D FP L  +D QG+R +        L ++S  + +R KE +        D LD LL+   
Sbjct  221   DYFPFLVKIDPQGIRRRMTDHFTKILDLMSGLIDERLKE-RKLRNHANVDVLDALLNI--  277

Query  553   SGKDEPPKLSEHQINIFILEMFLAGTDTTSS  461
                D P +L  + I    L++F AGTDTTS+
Sbjct  278   -SHDSPEELDRNLIEQMCLDLFAAGTDTTSN  307


 Score =   139 bits (351),  Expect(2) = 1e-68, Method: Compositional matrix adjust.
 Identities = 62/114 (54%), Positives = 84/114 (74%), Gaps = 0/114 (0%)
 Frame = -1

Query  344  NTALTSSTVEWALTELLRNPKAMTKAKEEIRGIVGPTRRFEESDIDNLQYLQAVVKETLR  165
             T  TS+T+EWA+ ELL+NP  + KA+EE+  ++G  +  +E+DI  L YL+ +VKETLR
Sbjct  301  GTDTTSNTLEWAMAELLQNPHILEKAQEELAQMIGRGKLVDEADIAQLPYLRCIVKETLR  360

Query  164  LHPPAPFLIPRRAIQDTKFMGYDIPKDTQVFINVWAIGRDHESWEDPLSFKPER  3
            +HP  PFLIPR+  +D +  GY +PKD+QV +NVWAIGRD   WE+PL FKPER
Sbjct  361  IHPALPFLIPRKVEEDVELCGYIVPKDSQVLVNVWAIGRDSGLWENPLVFKPER  414



>emb|CDY37049.1| BnaA04g26270D [Brassica napus]
Length=511

 Score =   149 bits (375),  Expect(2) = 2e-68, Method: Compositional matrix adjust.
 Identities = 68/114 (60%), Positives = 86/114 (75%), Gaps = 0/114 (0%)
 Frame = -1

Query  344  NTALTSSTVEWALTELLRNPKAMTKAKEEIRGIVGPTRRFEESDIDNLQYLQAVVKETLR  165
             T   SSTVEWA+TELL+NPKAMTK ++EI  ++G     +ESDI  L YLQAVVKET R
Sbjct  312  GTDTNSSTVEWAMTELLQNPKAMTKVQDEIDSVIGQNGVVQESDISQLPYLQAVVKETFR  371

Query  164  LHPPAPFLIPRRAIQDTKFMGYDIPKDTQVFINVWAIGRDHESWEDPLSFKPER  3
            LHP AP L+PR+A  D + +G+ +PKDTQV +NVWA+GRD  +WE+P  F+PER
Sbjct  372  LHPAAPLLLPRKAETDVEILGFLVPKDTQVLVNVWAVGRDPSTWENPNRFEPER  425


 Score =   140 bits (352),  Expect(2) = 2e-68, Method: Compositional matrix adjust.
 Identities = 85/276 (31%), Positives = 151/276 (55%), Gaps = 12/276 (4%)
 Frame = -2

Query  1273  NMLDLGSVPHQTIAAMRNKYGPVVWLRIGSVSTLAIQSAKAAAELFKNHDVPFAGRSIGD  1094
             NM  +G  PH++ A +   YGPV+ L++G ++T+ I S  AA E+ +  D   +GR   +
Sbjct  50    NMHLVGKNPHRSFAHLSETYGPVMSLKLGCLNTVVIASPNAAREVLRTQDQILSGRYWNE  109

Query  1093  VMLAQGYNKGSMA-LAQYGSYWRVLRRICSVEMFVHKKVNETAAVRRKCIDDLLRWVENE  917
              + +  ++  S+A L      WR+LR+I    +F  +++  T A+R K + +L+ +V   
Sbjct  110   AVRSIDHHSFSVAWLHPSSPLWRLLRKISVTHLFSPQRIEATQALRMKKVQELINFVSEC  169

Query  916   AGSIKRGSGIHVTRFVFLATFNLLGNIMFSSDLVDPVSEKGSKFFNAMMGIMERGGTPNI  737
             +    R   + ++R  F+   N++ NI+FS DL +  S K S F + ++G+ME  G  ++
Sbjct  170   S---DREEAVDISRASFVTALNIISNILFSIDLGNYDSRKSSDFQDMVIGVMESAGNTDL  226

Query  736   SDIFPCLRWLDLQGLRTK----TDKDLQIALQIVSTFVQKRSKEGQDDSGKRKSDFLDVL  569
             +D FP +R+LD+QG R K    +++  +   ++    ++  S + +D     K DFLD L
Sbjct  227   ADFFPFMRFLDVQGTRKKFKDCSERLFRAFRRLYDDRIKGNSLQTEDKDVSSK-DFLDAL  285

Query  568   LSFEGSGKDEPPKLSEHQINIFILEMFLAGTDTTSS  461
             +      + E   L+ +QI   +L++F AGTDT SS
Sbjct  286   IDLNQGDEAE---LNMYQIEHLLLDLFSAGTDTNSS  318



>ref|XP_009142346.1| PREDICTED: cytochrome P450 76C4-like [Brassica rapa]
Length=511

 Score =   149 bits (375),  Expect(2) = 2e-68, Method: Compositional matrix adjust.
 Identities = 68/114 (60%), Positives = 86/114 (75%), Gaps = 0/114 (0%)
 Frame = -1

Query  344  NTALTSSTVEWALTELLRNPKAMTKAKEEIRGIVGPTRRFEESDIDNLQYLQAVVKETLR  165
             T   SSTVEWA+TELL+NPKAMTK ++EI  ++G     +ESDI  L YLQAVVKET R
Sbjct  312  GTDTNSSTVEWAMTELLQNPKAMTKVQDEIDSVIGQNGVVQESDISQLPYLQAVVKETFR  371

Query  164  LHPPAPFLIPRRAIQDTKFMGYDIPKDTQVFINVWAIGRDHESWEDPLSFKPER  3
            LHP AP L+PR+A  D + +G+ +PKDTQV +NVWA+GRD  +WE+P  F+PER
Sbjct  372  LHPAAPLLLPRKAETDVEILGFLVPKDTQVLVNVWAVGRDPSTWENPNRFEPER  425


 Score =   140 bits (352),  Expect(2) = 2e-68, Method: Compositional matrix adjust.
 Identities = 85/276 (31%), Positives = 151/276 (55%), Gaps = 12/276 (4%)
 Frame = -2

Query  1273  NMLDLGSVPHQTIAAMRNKYGPVVWLRIGSVSTLAIQSAKAAAELFKNHDVPFAGRSIGD  1094
             NM  +G  PH++ A +   YGPV+ L++G ++T+ I S  AA E+ +  D   +GR   +
Sbjct  50    NMHLVGKNPHRSFAHLSETYGPVMSLKLGCLNTVVIASPNAAREVLRTQDQILSGRYWNE  109

Query  1093  VMLAQGYNKGSMA-LAQYGSYWRVLRRICSVEMFVHKKVNETAAVRRKCIDDLLRWVENE  917
              + +  ++  S+A L      WR+LR+I    +F  +++  T A+R K + +L+ +V   
Sbjct  110   AVRSIDHHSFSVAWLHPSSPLWRLLRKISVTHLFSPQRIEATQALRMKKVQELITFVSEC  169

Query  916   AGSIKRGSGIHVTRFVFLATFNLLGNIMFSSDLVDPVSEKGSKFFNAMMGIMERGGTPNI  737
             +    R   + ++R  F+   N++ NI+FS DL +  S K S F + ++G+ME  G  ++
Sbjct  170   S---DREEAVDISRASFVTALNIISNILFSIDLGNYDSRKSSDFQDMVIGVMESAGNTDL  226

Query  736   SDIFPCLRWLDLQGLRTK----TDKDLQIALQIVSTFVQKRSKEGQDDSGKRKSDFLDVL  569
             +D FP +R+LD+QG R K    +++  +   ++    ++  S + +D     K DFLD L
Sbjct  227   ADFFPFMRFLDVQGTRKKFKDCSERLFRAFRRLYDDRIKGNSLQTEDKDVSSK-DFLDAL  285

Query  568   LSFEGSGKDEPPKLSEHQINIFILEMFLAGTDTTSS  461
             +      + E   L+ +QI   +L++F AGTDT SS
Sbjct  286   IDLNQGDEAE---LNMYQIEHLLLDLFSAGTDTNSS  318



>ref|XP_009777857.1| PREDICTED: geraniol 8-hydroxylase-like [Nicotiana sylvestris]
Length=495

 Score =   145 bits (366),  Expect(2) = 2e-68, Method: Compositional matrix adjust.
 Identities = 64/114 (56%), Positives = 84/114 (74%), Gaps = 0/114 (0%)
 Frame = -1

Query  344  NTALTSSTVEWALTELLRNPKAMTKAKEEIRGIVGPTRRFEESDIDNLQYLQAVVKETLR  165
             T  T+ST+EWA+ E++R P+ M KA+ E+  ++G  +  EE+D+  L YLQ ++KETLR
Sbjct  300  GTDTTTSTLEWAMAEIIRQPEIMEKAQAELAKVIGKGKIVEEADVSRLPYLQCIIKETLR  359

Query  164  LHPPAPFLIPRRAIQDTKFMGYDIPKDTQVFINVWAIGRDHESWEDPLSFKPER  3
            +HPPAPFLIPR+  QD +   Y IPK +QV +NVWAIGRD  SWEDPL FKPER
Sbjct  360  MHPPAPFLIPRKVEQDVEMFDYIIPKGSQVLVNVWAIGRDSTSWEDPLVFKPER  413


 Score =   143 bits (361),  Expect(2) = 2e-68, Method: Compositional matrix adjust.
 Identities = 81/271 (30%), Positives = 138/271 (51%), Gaps = 7/271 (3%)
 Frame = -2

Query  1273  NMLDLGSVPHQTIAAMRNKYGPVVWLRIGSVSTLAIQSAKAAAELFKNHDVPFAGRSIGD  1094
             N+  LG  PH ++A +   YGP++ L++G ++T+ I S+  A ++ KN D  F+ R I +
Sbjct  43    NLHLLGQKPHISLANLAKIYGPIMSLKLGQITTIVISSSTMAKQVLKNQDQAFSARFIPN  102

Query  1093  VMLAQGYNKGSMALAQYGSYWRVLRRICSVEMFVHKKVNETAAVRRKCIDDLLRWVENEA  914
              + A  + K S+        WR LRRI +  +    +++    +R + + +LL +    A
Sbjct  103   ALQAHNHYKFSVVWLHVCPQWRTLRRILNTNLLSSNRLDANQHLRSQKVKELLAYC---A  159

Query  913   GSIKRGSGIHVTRFVFLATFNLLGNIMFSSDLVDPVSEKGSKFFNAMMGIMERGGTPNIS  734
                + G  + V +  F    NLL N +FS DL DP S+   +  + + GIM   G PN+ 
Sbjct  160   KCCQEGEVVDVGQVAFKTNLNLLSNTLFSKDLADPFSDSKVELKDVIWGIMAEVGKPNLV  219

Query  733   DIFPCLRWLDLQGLRTKTDKDLQIALQIVSTFVQKRSKEGQDDSGKRKSDFLDVLLSFEG  554
             D FP L  +D QG+R +        +++    + +R +E    S  +     DVL  F  
Sbjct  220   DFFPLLEKIDPQGIRRRATFHFGKLIKLFDGLINERLEEKSRFSSAKS----DVLEDFLY  275

Query  553   SGKDEPPKLSEHQINIFILEMFLAGTDTTSS  461
               ++ P +++ + I   IL++F AGTDTT+S
Sbjct  276   ISEENPEEINHNHIKSMILDLFGAGTDTTTS  306



>ref|XP_007225781.1| hypothetical protein PRUPE_ppa004617mg [Prunus persica]
 gb|EMJ26980.1| hypothetical protein PRUPE_ppa004617mg [Prunus persica]
Length=499

 Score =   149 bits (376),  Expect(2) = 2e-68, Method: Compositional matrix adjust.
 Identities = 85/271 (31%), Positives = 148/271 (55%), Gaps = 6/271 (2%)
 Frame = -2

Query  1273  NMLDLGSVPHQTIAAMRNKYGPVVWLRIGSVSTLAIQSAKAAAELFKNHDVPFAGRSIGD  1094
             N+L+LG+ PH ++  +  +YGP++ L++G ++T+ + S+  A ++ + HD  F  R+I D
Sbjct  45    NLLELGNKPHISLTKLSKRYGPIMTLQLGQITTVIVSSSAVAKQVLRTHDQFFCNRTIPD  104

Query  1093  VMLAQGYNKGSMALAQYGSYWRVLRRICSVEMFVHKKVNETAAVRRKCIDDLLRWVENEA  914
              + A  + K  M      S WR LR+IC+  +F  K ++   A R   + +L+  V+   
Sbjct  105   AVQACKHAKYGMPWLTVSSTWRNLRKICNSHLFAAKVLDANQANRHLKVQELIADVKE--  162

Query  913   GSIKRGSGIHVTRFVFLATFNLLGNIMFSSDLVDPVSEKGSKFFNAMMGIMERGGTPNIS  734
              S+ +G  + V R  F  T NL+   +FS DL DP SE+  +F   +  IME  G PN++
Sbjct  163   -SVVKGKAVEVGRAAFKTTLNLMSRTVFSVDLADPNSERAREFKELVWSIMEEAGKPNLA  221

Query  733   DIFPCLRWLDLQGLRTKTDKDLQIALQIVSTFVQKRSKEGQDDSGKRKSDFLDVLLSFEG  554
             D F  L+ +D  G+R +  K  Q  + +    + +R +  +       +D LD L++   
Sbjct  222   DYFRVLKKIDPMGIRRRLGKHFQKMIDLFDRMIVQRLESRKSRDYVTGNDMLDTLINM-S  280

Query  553   SGKDEPPKLSEHQINIFILEMFLAGTDTTSS  461
               K+E   ++E Q ++F L++F AGT+TTS+
Sbjct  281   EEKNEDMDMAETQ-HLF-LDLFGAGTETTSA  309


 Score =   139 bits (351),  Expect(2) = 2e-68, Method: Compositional matrix adjust.
 Identities = 63/114 (55%), Positives = 82/114 (72%), Gaps = 0/114 (0%)
 Frame = -1

Query  344  NTALTSSTVEWALTELLRNPKAMTKAKEEIRGIVGPTRRFEESDIDNLQYLQAVVKETLR  165
             T  TS+T+EWA+ ELLRNP+ ++KA+EE++ +VG  +  EESDI  L YLQA++KET R
Sbjct  303  GTETTSATLEWAMAELLRNPEKLSKAQEELKQVVGKGKPVEESDITRLPYLQAIIKETFR  362

Query  164  LHPPAPFLIPRRAIQDTKFMGYDIPKDTQVFINVWAIGRDHESWEDPLSFKPER  3
            LHP  P L+PRRA  D +  GY +PK  QV +N WAIGRD   W++P SF PER
Sbjct  363  LHPVVPLLLPRRAQADIEICGYIVPKGAQVLVNAWAIGRDPSIWDNPTSFIPER  416



>sp|D1MI46.1|C76BA_SWEMU RecName: Full=Geraniol 8-hydroxylase; AltName: Full=Cytochrome 
P450 76B10; AltName: Full=Geraniol 10-hydroxylase; Short=SmG10H 
[Swertia mussotii]
 gb|ACZ48680.1| geraniol 10-hydroxylase [Swertia mussotii]
Length=495

 Score =   149 bits (376),  Expect(2) = 2e-68, Method: Compositional matrix adjust.
 Identities = 87/275 (32%), Positives = 148/275 (54%), Gaps = 16/275 (6%)
 Frame = -2

Query  1273  NMLDLGSVPHQTIAAMRNKYGPVVWLRIGSVSTLAIQSAKAAAELFKNHDVPFAGRSIGD  1094
             N+  LG  PH+++A +  K+GP++ L++G V+T+ + S+  A E+ +  D+ F+ RSI +
Sbjct  44    NLHLLGDQPHKSLAKLAKKHGPIMGLQLGQVTTIVVTSSGMAKEVLQKQDLAFSSRSIPN  103

Query  1093  VMLAQGYNKGSMALAQYGSYWRVLRRICSVEMFVHKKVNETAAVRRKCIDDLLRWVENEA  914
              + A    K S+      S WR LR+  +  MF   +++    +R + + +L+ +     
Sbjct  104   AIHAHDQYKYSVIWLPVASRWRGLRKALNSNMFSGNRLDANQHLRSRKVQELIAYCRK--  161

Query  913   GSIKRGSGIHVTRFVFLATFNLLGNIMFSSDLVDPVSEKGSKFFNAMMGIMERGGTPNIS  734
              S + G  I V R  F  + NLL N MFS DL DP S+   +F + +  +M   G PN+ 
Sbjct  162   -SSQTGDAIDVGRAAFRTSLNLLSNTMFSKDLTDPYSDSAKEFKDLVWNVMVEAGKPNLV  220

Query  733   DIFPCLRWLDLQGLRTKTD----KDLQIALQIVSTFVQKRSKEGQDDSGKRKSDFLDVLL  566
             D FP L  +D QG+R +      K L++   ++   +Q++  +G +D      D LDVLL
Sbjct  221   DYFPLLDKVDPQGIRKRMTIHFGKILELFGGLIDERLQQKKAKGVND------DVLDVLL  274

Query  565   SFEGSGKDEPPKLSEHQINIFILEMFLAGTDTTSS  461
             +   + ++ P ++    I    L++F+AGTDTTSS
Sbjct  275   T---TSEESPEEIDRTHIQRMCLDLFVAGTDTTSS  306


 Score =   139 bits (350),  Expect(2) = 2e-68, Method: Compositional matrix adjust.
 Identities = 60/114 (53%), Positives = 83/114 (73%), Gaps = 0/114 (0%)
 Frame = -1

Query  344  NTALTSSTVEWALTELLRNPKAMTKAKEEIRGIVGPTRRFEESDIDNLQYLQAVVKETLR  165
             T  TSST+EWA++E+L+NP+ M  A+ E+  ++G  +  EE+D+  L YL+  +KETLR
Sbjct  300  GTDTTSSTLEWAMSEMLKNPEKMKAAQAELAQVIGKGKAVEEADLARLPYLRCAIKETLR  359

Query  164  LHPPAPFLIPRRAIQDTKFMGYDIPKDTQVFINVWAIGRDHESWEDPLSFKPER  3
            +HPP P LIPRR  Q+ +  GY +PK++QV +NVWAI RD   W+DPLSFKPER
Sbjct  360  IHPPVPLLIPRRTEQEVEVCGYTVPKNSQVLVNVWAISRDDAIWKDPLSFKPER  413



>ref|XP_006606065.1| PREDICTED: geraniol 8-hydroxylase-like [Glycine max]
Length=498

 Score =   153 bits (386),  Expect(2) = 3e-68, Method: Compositional matrix adjust.
 Identities = 83/271 (31%), Positives = 150/271 (55%), Gaps = 10/271 (4%)
 Frame = -2

Query  1273  NMLDLGSVPHQTIAAMRNKYGPVVWLRIGSVSTLAIQSAKAAAELFKNHDVPFAGRSIGD  1094
             N+L+LG  PH+++A +   +GP++ L++G ++T+ + SA+ A E+   +D   + R+I  
Sbjct  47    NLLELGEKPHKSLAKLAKIHGPIMSLKLGQITTVVVSSAQMAKEVLLTNDQFLSNRTIPQ  106

Query  1093  VMLAQGYNKGSMALAQYGSYWRVLRRICSVEMFVHKKVNETAAVRRKCIDDLLRWVENEA  914
              +    + + S+A      +WR LR+IC+ ++F HK ++ +  VRRK +  L+  +    
Sbjct  107   SVSVLNHEQYSLAFMPISPFWRELRKICNTQLFAHKSLDASQDVRRKIVQQLVSDIHQ--  164

Query  913   GSIKRGSGIHVTRFVFLATFNLLGNIMFSSDLVDPVSEKGSKFFNAMMGIMERGGTPNIS  734
              S + G  + +    F  T NLL N +FS DL+     K  +F + +  I +  GTPN++
Sbjct  165   -SSQIGEAVDIGTAAFKTTINLLSNTIFSMDLIHSTG-KAEEFKDLVTNITKLVGTPNLA  222

Query  733   DIFPCLRWLDLQGLRTKTDKDLQIALQIVSTFVQKRSKEGQDDSGKRKSDFLDVLLSFEG  554
             D FP L+ +D Q ++ +  K+ +  L + +  V +R K+ +D  GK  +D LD +L+   
Sbjct  223   DFFPVLKMVDPQSIKRRQSKNSKKVLDMFNHLVSQRLKQRED--GKVHNDMLDAMLNISN  280

Query  553   SGKDEPPKLSEHQINIFILEMFLAGTDTTSS  461
               K     + EH  +    ++F+AGTDTT+S
Sbjct  281   DNKYMDKNMIEHLSH----DIFVAGTDTTAS  307


 Score =   135 bits (340),  Expect(2) = 3e-68, Method: Compositional matrix adjust.
 Identities = 61/113 (54%), Positives = 80/113 (71%), Gaps = 0/113 (0%)
 Frame = -1

Query  341  TALTSSTVEWALTELLRNPKAMTKAKEEIRGIVGPTRRFEESDIDNLQYLQAVVKETLRL  162
            T  T+ST+EWA+TEL+RNP  M+KAK+E+  +       EE+DI  L YLQA+VKETLRL
Sbjct  302  TDTTASTLEWAMTELVRNPDVMSKAKQELEQMTSKGNPIEEADIAKLPYLQAIVKETLRL  361

Query  161  HPPAPFLIPRRAIQDTKFMGYDIPKDTQVFINVWAIGRDHESWEDPLSFKPER  3
            HPP PFL+PR+A +D    GY IPKD +V +N+W I RD   W++P  F P+R
Sbjct  362  HPPVPFLLPRKAGKDVDIGGYTIPKDAKVLVNMWTICRDPTLWDNPTMFSPDR  414



>ref|XP_011033850.1| PREDICTED: geraniol 8-hydroxylase-like isoform X1 [Populus euphratica]
Length=519

 Score =   150 bits (379),  Expect(2) = 3e-68, Method: Compositional matrix adjust.
 Identities = 96/291 (33%), Positives = 157/291 (54%), Gaps = 6/291 (2%)
 Frame = -2

Query  1333  RNKSRSGRlppgppglpvlGNMLDLGSVPHQTIAAMRNKYGPVVWLRIGSVSTLAIQSAK  1154
             R+K +SG+LPPGP  LP++GN+ DLG  PH+++A +   +G ++ L++G V+T+ + SA 
Sbjct  46    RSKRKSGKLPPGPSRLPIVGNLWDLGDKPHKSLAKLAKTHGQLMSLKLGQVTTIVVSSAA  105

Query  1153  AAAELFKNHDVPFAGRSIGDVMLAQGYNKGSMALAQYGSYWRVLRRICSVEMFVHKKVNE  974
              A E+ + HD+ F  R+I D + A  +++  +A     + WR LRRIC+  +F  +K++ 
Sbjct  106   MAKEVLQKHDLTFCNRTIVDAVRALDHHESGIAWLPVATRWRNLRRICNSHIFTAQKLDA  165

Query  973   TAAVRRKCIDDLLRWVENEAGSIKRGSGIHVTRFVFLATFNLLGNIMFSSDLVDPVSEKG  794
                +RRK + D+L  V+        G  + +    F AT N L N + S +L D  S+  
Sbjct  166   NQDLRRKKVQDILAEVQERCLV---GEAVDLRHAAFTATLNALSNTVLSLNLTDLSSDIA  222

Query  793   SKFFNAMMGIMERGGTPNISDIFPCLRWLDLQGLRTKTDKDLQIALQIVSTFVQKRSKEG  614
              +F   +  IM+  G P + D FP LR +D QG+R +        L +    + +R +  
Sbjct  223   REFKERISCIMDEAGKPTLVDYFPLLRRIDPQGIRRRMAIHFGKVLDLFDRLIIERLQLR  282

Query  613   QDDSGKRKSDFLDVLLSFEGSGKDEPPKLSEHQINIFILEMFLAGTDTTSS  461
             ++       D LD LL+      +E   +   +I  F L++F AGTDTTSS
Sbjct  283   KEKGYIPLDDMLDTLLTISEVNNEE---IDATRIKHFFLDLFGAGTDTTSS  330


 Score =   137 bits (346),  Expect(2) = 3e-68, Method: Compositional matrix adjust.
 Identities = 65/114 (57%), Positives = 79/114 (69%), Gaps = 0/114 (0%)
 Frame = -1

Query  344  NTALTSSTVEWALTELLRNPKAMTKAKEEIRGIVGPTRRFEESDIDNLQYLQAVVKETLR  165
             T  TSST+EWA+ ELL +PK + KA+ E+   +G     EESDI  L YLQAV+KETLR
Sbjct  324  GTDTTSSTLEWAMAELLHSPKTLLKARAELERTIGEGNLLEESDITRLPYLQAVIKETLR  383

Query  164  LHPPAPFLIPRRAIQDTKFMGYDIPKDTQVFINVWAIGRDHESWEDPLSFKPER  3
            LHP  PFL+P RA  D +  G+ +PK+ QV +NVWAIGRD   WEDP SF PER
Sbjct  384  LHPAVPFLLPHRAGADAEIGGFTVPKNAQVLVNVWAIGRDPSMWEDPNSFVPER  437



>gb|AGX93052.1| geraniol 10-hydroxylase-like protein [Amsonia hubrichtii]
Length=493

 Score =   154 bits (388),  Expect(2) = 3e-68, Method: Compositional matrix adjust.
 Identities = 83/271 (31%), Positives = 147/271 (54%), Gaps = 8/271 (3%)
 Frame = -2

Query  1273  NMLDLGSVPHQTIAAMRNKYGPVVWLRIGSVSTLAIQSAKAAAELFKNHDVPFAGRSIGD  1094
             N+  LG  PH+++A +  KYGP++ L++G V+T+ I S+  A E+ +  D+ F+ RS+ D
Sbjct  42    NLHLLGEQPHKSLAKLSKKYGPIMGLQLGRVTTVVISSSGVAKEVLQKQDLAFSSRSVPD  101

Query  1093  VMLAQGYNKGSMALAQYGSYWRVLRRICSVEMFVHKKVNETAAVRRKCIDDLLRWVENEA  914
              + A    + S+      S WR LR+I +  +F   +++    +R + +++L+ +    +
Sbjct  102   ALHAHNQFQFSVVWLPVASQWRSLRKILNSNIFSGNRLDANQHLRSRKVEELIAYCRKNS  161

Query  913   GSIKRGSGIHVTRFVFLATFNLLGNIMFSSDLVDPVSEKGSKFFNAMMGIMERGGTPNIS  734
              +   G  + V R  F  + NLL N +FS DL DP S+   +F + +  IM   G PN+ 
Sbjct  162   QT---GEAVDVGRAAFRTSLNLLSNTIFSKDLTDPYSDSAKEFKDLVWNIMLEAGKPNLV  218

Query  733   DIFPCLRWLDLQGLRTKTDKDLQIALQIVSTFVQKRSKEGQDDSGKRKSDFLDVLLSFEG  554
             D FP L  +D QG+R +        L++    + +R ++ +   G   +D L+VLL+   
Sbjct  219   DFFPVLEKVDPQGIRRRMTVHFGKVLKLFDGLINERLEQRRSRGG--NNDVLEVLLT---  273

Query  553   SGKDEPPKLSEHQINIFILEMFLAGTDTTSS  461
             + ++ P ++    I    L++F+AGTDTTSS
Sbjct  274   TSEESPEEIDRTHIERMCLDLFVAGTDTTSS  304


 Score =   134 bits (337),  Expect(2) = 3e-68, Method: Compositional matrix adjust.
 Identities = 59/114 (52%), Positives = 78/114 (68%), Gaps = 0/114 (0%)
 Frame = -1

Query  344  NTALTSSTVEWALTELLRNPKAMTKAKEEIRGIVGPTRRFEESDIDNLQYLQAVVKETLR  165
             T  TSST+EWA+ E+L+NP  M K + E+  ++G  +   E+D+  L YL+  VKETLR
Sbjct  298  GTDTTSSTLEWAMAEMLKNPDKMKKTQAELAEVIGKGKTVAEADVARLPYLRCAVKETLR  357

Query  164  LHPPAPFLIPRRAIQDTKFMGYDIPKDTQVFINVWAIGRDHESWEDPLSFKPER  3
            +HPP PFLIPRR  Q  +  GY +PK +QV +N WAIGRD   W+D L+FKPER
Sbjct  358  IHPPVPFLIPRRTEQAVEVCGYKVPKGSQVLVNAWAIGRDETLWDDALAFKPER  411



>ref|XP_011033851.1| PREDICTED: geraniol 8-hydroxylase-like isoform X2 [Populus euphratica]
Length=500

 Score =   150 bits (378),  Expect(2) = 3e-68, Method: Compositional matrix adjust.
 Identities = 96/291 (33%), Positives = 157/291 (54%), Gaps = 6/291 (2%)
 Frame = -2

Query  1333  RNKSRSGRlppgppglpvlGNMLDLGSVPHQTIAAMRNKYGPVVWLRIGSVSTLAIQSAK  1154
             R+K +SG+LPPGP  LP++GN+ DLG  PH+++A +   +G ++ L++G V+T+ + SA 
Sbjct  27    RSKRKSGKLPPGPSRLPIVGNLWDLGDKPHKSLAKLAKTHGQLMSLKLGQVTTIVVSSAA  86

Query  1153  AAAELFKNHDVPFAGRSIGDVMLAQGYNKGSMALAQYGSYWRVLRRICSVEMFVHKKVNE  974
              A E+ + HD+ F  R+I D + A  +++  +A     + WR LRRIC+  +F  +K++ 
Sbjct  87    MAKEVLQKHDLTFCNRTIVDAVRALDHHESGIAWLPVATRWRNLRRICNSHIFTAQKLDA  146

Query  973   TAAVRRKCIDDLLRWVENEAGSIKRGSGIHVTRFVFLATFNLLGNIMFSSDLVDPVSEKG  794
                +RRK + D+L  V+        G  + +    F AT N L N + S +L D  S+  
Sbjct  147   NQDLRRKKVQDILAEVQERCLV---GEAVDLRHAAFTATLNALSNTVLSLNLTDLSSDIA  203

Query  793   SKFFNAMMGIMERGGTPNISDIFPCLRWLDLQGLRTKTDKDLQIALQIVSTFVQKRSKEG  614
              +F   +  IM+  G P + D FP LR +D QG+R +        L +    + +R +  
Sbjct  204   REFKERISCIMDEAGKPTLVDYFPLLRRIDPQGIRRRMAIHFGKVLDLFDRLIIERLQLR  263

Query  613   QDDSGKRKSDFLDVLLSFEGSGKDEPPKLSEHQINIFILEMFLAGTDTTSS  461
             ++       D LD LL+      +E   +   +I  F L++F AGTDTTSS
Sbjct  264   KEKGYIPLDDMLDTLLTISEVNNEE---IDATRIKHFFLDLFGAGTDTTSS  311


 Score =   137 bits (346),  Expect(2) = 3e-68, Method: Compositional matrix adjust.
 Identities = 65/114 (57%), Positives = 79/114 (69%), Gaps = 0/114 (0%)
 Frame = -1

Query  344  NTALTSSTVEWALTELLRNPKAMTKAKEEIRGIVGPTRRFEESDIDNLQYLQAVVKETLR  165
             T  TSST+EWA+ ELL +PK + KA+ E+   +G     EESDI  L YLQAV+KETLR
Sbjct  305  GTDTTSSTLEWAMAELLHSPKTLLKARAELERTIGEGNLLEESDITRLPYLQAVIKETLR  364

Query  164  LHPPAPFLIPRRAIQDTKFMGYDIPKDTQVFINVWAIGRDHESWEDPLSFKPER  3
            LHP  PFL+P RA  D +  G+ +PK+ QV +NVWAIGRD   WEDP SF PER
Sbjct  365  LHPAVPFLLPHRAGADAEIGGFTVPKNAQVLVNVWAIGRDPSMWEDPNSFVPER  418



>ref|XP_006360240.1| PREDICTED: geraniol 8-hydroxylase-like [Solanum tuberosum]
Length=492

 Score =   149 bits (377),  Expect(2) = 3e-68, Method: Compositional matrix adjust.
 Identities = 86/272 (32%), Positives = 145/272 (53%), Gaps = 11/272 (4%)
 Frame = -2

Query  1273  NMLDLGSVPHQTIAAMRNKYGPVVWLRIGSVSTLAIQSAKAAAELFKNHDVPFAGRSIGD  1094
             N+  LG+ PH ++A +  KYGP++ L++G ++T+ I S+  A E+ +  D+ F+GR + D
Sbjct  42    NLHFLGNKPHISLAQLAKKYGPIMHLKLGQINTVVISSSILAKEVMQKQDLSFSGRFVPD  101

Query  1093  VMLAQGY-NKGSMALAQYGSYWRVLRRICSVEMFVHKKVNETAAVRRKCIDDLLRWVENE  917
              + A  + N   + L    S WR LR++ +  +F   K++    +R K I +L+ +    
Sbjct  102   GVHACNHSNYSVVMLPVNNSQWRTLRKVMNSHIFSGNKLDANKHLRTKKIQELIDYCHKS  161

Query  916   AGSIKRGSGIHVTRFVFLATFNLLGNIMFSSDLVDPVSEKGSKFFNAMMGIMERGGTPNI  737
               + +    + + R  F  + NLL N +FS DL DP S+   +F   +  IM   G PN+
Sbjct  162   GQNCE---AVDIGRAAFRTSLNLLSNTIFSKDLTDPFSDSDKEFKGWVWNIMAEAGKPNL  218

Query  736   SDIFPCLRWLDLQGLRTKTDKDLQIALQIVSTFVQKRSKEGQDDSGKRKSDFLDVLLSFE  557
              D FP L+ +D QG+R +        LQ++S  + +R KE ++ + +   D LD LLS  
Sbjct  219   VDFFPFLKKIDPQGIRRRLTNHFSKVLQLMSGLIDERLKE-REMANRENVDVLDALLSI-  276

Query  556   GSGKDEPPKLSEHQINIFILEMFLAGTDTTSS  461
                   P ++  + I    L++F AGTDTTS+
Sbjct  277   -----SPEEIDRNHIKHLCLDLFAAGTDTTSN  303


 Score =   138 bits (347),  Expect(2) = 3e-68, Method: Compositional matrix adjust.
 Identities = 61/114 (54%), Positives = 81/114 (71%), Gaps = 0/114 (0%)
 Frame = -1

Query  344  NTALTSSTVEWALTELLRNPKAMTKAKEEIRGIVGPTRRFEESDIDNLQYLQAVVKETLR  165
             T  TS+T+EWA+ ELL+NP  + KA++E+  ++G  +  +E D+  L YLQ +VKE LR
Sbjct  297  GTDTTSNTLEWAMAELLKNPHTLEKAQKELAQVIGRGKLVDEVDVAQLPYLQCIVKEALR  356

Query  164  LHPPAPFLIPRRAIQDTKFMGYDIPKDTQVFINVWAIGRDHESWEDPLSFKPER  3
            LHPP  FLIPR+  +D +  GY IPK +QV +NVWAIGRD   WE+PL FKPER
Sbjct  357  LHPPVSFLIPRKVEEDVELCGYTIPKGSQVLVNVWAIGRDSGIWENPLDFKPER  410



>ref|XP_008222068.1| PREDICTED: geraniol 8-hydroxylase-like [Prunus mume]
Length=506

 Score =   149 bits (376),  Expect(2) = 3e-68, Method: Compositional matrix adjust.
 Identities = 83/271 (31%), Positives = 139/271 (51%), Gaps = 6/271 (2%)
 Frame = -2

Query  1273  NMLDLGSVPHQTIAAMRNKYGPVVWLRIGSVSTLAIQSAKAAAELFKNHDVPFAGRSIGD  1094
             N+L+LG+ PH ++  +   YGP++ L++G V+T+ + S   A ++ + HD   + R++ D
Sbjct  48    NLLELGNKPHLSLTKLSQIYGPIITLQLGQVTTVVVSSPNTAKQVLRTHDQLLSNRTVPD  107

Query  1093  VMLAQGYNKGSMALAQYGSYWRVLRRICSVEMFVHKKVNETAAVRRKCIDDLLRWVENEA  914
              + A    + S+      + WR LR+IC+ ++F  K ++     R   + +L+  V   A
Sbjct  108   AIQACDPRQDSLPWIPPSAKWRSLRQICNSQLFAAKILDANQPNRCVKVQELISQVNESA  167

Query  913   GSIKRGSGIHVTRFVFLATFNLLGNIMFSSDLVDPVSEKGSKFFNAMMGIMERGGTPNIS  734
              +   G  + + R  F  T NLL   +FS DL DP SE   +F   + G+ME  GTPN+ 
Sbjct  168   VN---GEVVDIGRAAFKTTLNLLSCTVFSVDLADPRSEMAREFKETVWGLMEGAGTPNVG  224

Query  733   DIFPCLRWLDLQGLRTKTDKDLQIALQIVSTFVQKRSKEGQDDSGKRKSDFLDVLLSFEG  554
             D FP LR +D QG+R +  K      Q+    + +R            +D LD LL+   
Sbjct  225   DFFPVLRKIDPQGIRRRMIKHFNKMEQLFDRMISQRLASRIAHDYVTTNDMLDTLLNISE  284

Query  553   SGKDEPPKLSEHQINIFILEMFLAGTDTTSS  461
             +  ++   + + +I    L +F AGTDTTS+
Sbjct  285   ANSED---MDKTKIQHLFLALFSAGTDTTSA  312


 Score =   139 bits (349),  Expect(2) = 3e-68, Method: Compositional matrix adjust.
 Identities = 62/114 (54%), Positives = 83/114 (73%), Gaps = 0/114 (0%)
 Frame = -1

Query  344  NTALTSSTVEWALTELLRNPKAMTKAKEEIRGIVGPTRRFEESDIDNLQYLQAVVKETLR  165
             T  TS+T+EWA+ ELLR+P+ ++KA++E+  I+G  +  EE+DI  L YLQA++KET R
Sbjct  306  GTDTTSATLEWAMAELLRDPEKLSKAQQELEQIIGKGKPVEEADIARLPYLQAIIKETFR  365

Query  164  LHPPAPFLIPRRAIQDTKFMGYDIPKDTQVFINVWAIGRDHESWEDPLSFKPER  3
            LHP AP L+PR+A  D +  GY +PK  QVF+N WAIGRD   WE+P SF PER
Sbjct  366  LHPAAPLLLPRKADSDVEICGYIVPKGAQVFVNAWAIGRDPSIWENPSSFMPER  419



>dbj|BAC53893.1| cytochrome P450 [Petunia x hybrida]
Length=532

 Score =   148 bits (373),  Expect(2) = 4e-68, Method: Compositional matrix adjust.
 Identities = 82/271 (30%), Positives = 145/271 (54%), Gaps = 7/271 (3%)
 Frame = -2

Query  1273  NMLDLGSVPHQTIAAMRNKYGPVVWLRIGSVSTLAIQSAKAAAELFKNHDVPFAGRSIGD  1094
             N+  LG+ PH ++A +   YGP++ L++G V+T+ I S+  A ++ K  D+ F+ R + D
Sbjct  43    NLHLLGAKPHISLAQLAQIYGPIMSLKLGQVTTVVISSSAMAKQVLKYQDLAFSTRFVPD  102

Query  1093  VMLAQGYNKGSMALAQYGSYWRVLRRICSVEMFVHKKVNETAAVRRKCIDDLLRWVENEA  914
              +    +NK S+        WR LRRI +  +    +++    +R + + +LL +    A
Sbjct  103   ALQTHNHNKFSVVWLPVSPQWRTLRRILNTNILSSNRLDSNQHLRSQKLKELLAYC---A  159

Query  913   GSIKRGSGIHVTRFVFLATFNLLGNIMFSSDLVDPVSEKGSKFFNAMMGIMERGGTPNIS  734
                +    + V + VF    NLL N +FS DL DP S+   +  + + G++   G PN+ 
Sbjct  160   TCSQEAKVVDVGQAVFKTNLNLLSNTLFSKDLADPFSDSKVELKDVIWGVIAEIGKPNLV  219

Query  733   DIFPCLRWLDLQGLRTKTDKDLQIALQIVSTFVQKRSKEGQDDSGKRKSDFLDVLLSFEG  554
             D FP L  +D QG+R +T       +++  + + +R +E +  S   KSD L+VLL+   
Sbjct  220   DYFPILEKIDPQGIRRRTTIHFGKLMRLFDSLINERVEEKR-RSHSEKSDVLEVLLNI--  276

Query  553   SGKDEPPKLSEHQINIFILEMFLAGTDTTSS  461
               K+ P +++++ I    L++F A TDTT+S
Sbjct  277   -NKENPEEINQNHIKAMFLDLFGAATDTTTS  306


 Score =   139 bits (351),  Expect(2) = 4e-68, Method: Compositional matrix adjust.
 Identities = 60/113 (53%), Positives = 81/113 (72%), Gaps = 0/113 (0%)
 Frame = -1

Query  341  TALTSSTVEWALTELLRNPKAMTKAKEEIRGIVGPTRRFEESDIDNLQYLQAVVKETLRL  162
            T  T+ST+EWA+ E+LR P+ M KA+ E+  ++G  +  EE+D+  L YLQ ++KET R+
Sbjct  301  TDTTTSTLEWAMAEILRQPEIMKKAQAELAEVIGKGKPIEEADVSRLPYLQCIIKETFRM  360

Query  161  HPPAPFLIPRRAIQDTKFMGYDIPKDTQVFINVWAIGRDHESWEDPLSFKPER  3
            HP  PFL+PR+  QD +  GY +PK +QV +NVWAIGRD   WEDPL FKPER
Sbjct  361  HPATPFLLPRKVEQDVEVCGYIVPKGSQVLVNVWAIGRDSTYWEDPLMFKPER  413



>ref|XP_008222093.1| PREDICTED: geraniol 8-hydroxylase-like [Prunus mume]
Length=500

 Score =   153 bits (387),  Expect(2) = 4e-68, Method: Compositional matrix adjust.
 Identities = 80/271 (30%), Positives = 145/271 (54%), Gaps = 6/271 (2%)
 Frame = -2

Query  1273  NMLDLGSVPHQTIAAMRNKYGPVVWLRIGSVSTLAIQSAKAAAELFKNHDVPFAGRSIGD  1094
             N+L+LG+ PH ++  +  +YGP++ L++G ++T+ + S+  A ++ + +D  F  R+  D
Sbjct  45    NLLELGNKPHISLTKLSKRYGPIMTLQLGQITTVVVSSSIVAKQVLQTYDRFFCNRTNAD  104

Query  1093  VMLAQGYNKGSMALAQYGSYWRVLRRICSVEMFVHKKVNETAAVRRKCIDDLLRWVENEA  914
              + A  + K  M      + WR LRRIC+ ++F  K +N   A R   + +L   + + +
Sbjct  105   ALQACSHAKHGMPFIPVSAKWRNLRRICNSQLFATKVLNANQANRHLKVQEL---IADVS  161

Query  913   GSIKRGSGIHVTRFVFLATFNLLGNIMFSSDLVDPVSEKGSKFFNAMMGIMERGGTPNIS  734
              S+ +G  + V R  F+ T NLL   +FS DL DP SE   +F   + GIME  G PN++
Sbjct  162   ESVVKGKAVEVGRAAFITTLNLLSRTVFSVDLADPKSETAREFKELVWGIMEEVGKPNLA  221

Query  733   DIFPCLRWLDLQGLRTKTDKDLQIALQIVSTFVQKRSKEGQDDSGKRKSDFLDVLLSFEG  554
             D FP L+ +D  G+R +  K  +  + +  + + +R +  +       +D LD L++   
Sbjct  222   DYFPVLKKIDPMGIRRRLTKHFRKMIDLFDSLIFQRLETRKSHDYVTANDMLDTLINMSE  281

Query  553   SGKDEPPKLSEHQINIFILEMFLAGTDTTSS  461
                ++      H +    L++F+A T+TTS+
Sbjct  282   EKNEDMDIPETHHL---FLDLFVAATETTSA  309


 Score =   134 bits (337),  Expect(2) = 4e-68, Method: Compositional matrix adjust.
 Identities = 60/113 (53%), Positives = 81/113 (72%), Gaps = 0/113 (0%)
 Frame = -1

Query  341  TALTSSTVEWALTELLRNPKAMTKAKEEIRGIVGPTRRFEESDIDNLQYLQAVVKETLRL  162
            T  TS+T+EWA+ ELL NP+ ++KA+EE+  ++G  +  EE+DI  L YLQA++KET RL
Sbjct  304  TETTSATLEWAMAELLCNPEKLSKAQEELEQVIGKGKPVEETDIAQLPYLQAIIKETFRL  363

Query  161  HPPAPFLIPRRAIQDTKFMGYDIPKDTQVFINVWAIGRDHESWEDPLSFKPER  3
            HP  PFL+PR+A  D +  GY +PK  QV +N WAIGRD   W++P SF PER
Sbjct  364  HPALPFLLPRKAEADLEICGYFVPKGAQVLVNAWAIGRDPGIWDNPASFIPER  416



>gb|KEH43873.1| cytochrome P450 family protein [Medicago truncatula]
Length=499

 Score =   149 bits (375),  Expect(2) = 5e-68, Method: Compositional matrix adjust.
 Identities = 88/271 (32%), Positives = 146/271 (54%), Gaps = 8/271 (3%)
 Frame = -2

Query  1273  NMLDLGSVPHQTIAAMRNKYGPVVWLRIGSVSTLAIQSAKAAAELFKNHDVPFAGRSIGD  1094
             N+L+LG  PH+++A +   +GP++ L+ G ++T+ I SA  A E+   +D   + R+I  
Sbjct  46    NLLELGEKPHKSLAKLAKIHGPLMSLKFGQITTIVISSATMAKEVLLTNDKFLSKRNIPQ  105

Query  1093  VMLAQGYNKGSMALAQYGSYWRVLRRICSVEMFVHKKVNETAAVRRKCIDDLLRWVENEA  914
              +    + + S+A       W+ LR+IC+ ++  HK ++ +  VRRK I  LL  +    
Sbjct  106   TVSVLNHEQYSLAFMPISPLWKELRKICNTQLLSHKSLDASQDVRRKKIQQLLNDIHQ--  163

Query  913   GSIKRGSGIHVTRFVFLATFNLLGNIMFSSDLVDPVSEKGSKFFNAMMGIMERGGTPNIS  734
              S K G  I +   VF  T NLL N +FS DL+      G +F + +  I +  GTPN++
Sbjct  164   -SSKIGEAIDIGTIVFKTTINLLSNTIFSMDLIHSNGAAG-EFKDVVTNITKLAGTPNVA  221

Query  733   DIFPCLRWLDLQGLRTKTDKDLQIALQIVSTFVQKRSKEGQDDSGKRKSDFLDVLLSFEG  554
             D FP L+ LD QGL+ +  K++   L I    V +R +  +  S     D LD +L+   
Sbjct  222   DFFPVLKLLDPQGLKRRQTKNVGKLLDIFEDLVNQRLEMREGTSVDTNKDMLDAMLNI--  279

Query  553   SGKDEPPKLSEHQINIFILEMFLAGTDTTSS  461
             S ++E   + ++ I     ++F+AGTDTT+S
Sbjct  280   SKENE--FMDKNMIQHLSHDIFVAGTDTTTS  308


 Score =   138 bits (348),  Expect(2) = 5e-68, Method: Compositional matrix adjust.
 Identities = 63/113 (56%), Positives = 83/113 (73%), Gaps = 0/113 (0%)
 Frame = -1

Query  341  TALTSSTVEWALTELLRNPKAMTKAKEEIRGIVGPTRRFEESDIDNLQYLQAVVKETLRL  162
            T  T+ST+EWA+TEL+RNP+AM KAK+E++  +G     EES+I  L YL A++KETLR 
Sbjct  303  TDTTTSTLEWAMTELIRNPEAMQKAKKELKQTIGCGVPLEESNITELPYLNAIIKETLRK  362

Query  161  HPPAPFLIPRRAIQDTKFMGYDIPKDTQVFINVWAIGRDHESWEDPLSFKPER  3
            HPP PFL+PR+A ++ +  GY IPKD+QV +NVW I RD   WE+P  F PER
Sbjct  363  HPPVPFLLPRKAERNVEISGYIIPKDSQVLVNVWTICRDANLWENPTLFSPER  415



>ref|XP_009763141.1| PREDICTED: geraniol 8-hydroxylase-like [Nicotiana sylvestris]
Length=498

 Score =   164 bits (416),  Expect(2) = 6e-68, Method: Compositional matrix adjust.
 Identities = 84/267 (31%), Positives = 150/267 (56%), Gaps = 6/267 (2%)
 Frame = -2

Query  1261  LGSVPHQTIAAMRNKYGPVVWLRIGSVSTLAIQSAKAAAELFKNHDVPFAGRSIGDVMLA  1082
             LG  PHQ++  +  KYGP++ LR+G ++T+ I S+  A E+ +  D+ F+ R+I D + A
Sbjct  50    LGGQPHQSLTKLAEKYGPIISLRLGQITTVVISSSAVAKEVIQKQDLAFSSRTIPDAIHA  109

Query  1081  QGYNKGSMALAQYGSYWRVLRRICSVEMFVHKKVNETAAVRRKCIDDLLRWVENEAGSIK  902
               + + S+      S WR LR+I +  +F   +++    +R + I DL+ +    + +  
Sbjct  110   LNHYQFSVIWLPVHSRWRSLRKIMNTYIFSGNRLDANQHLRSQKIQDLIAYCRRCSQT--  167

Query  901   RGSGIHVTRFVFLATFNLLGNIMFSSDLVDPVSEKGSKFFNAMMGIMERGGTPNISDIFP  722
              G  +++ +  F  + NLL + +FS D+VDP +  G +F +A+  I E  G PN++D FP
Sbjct  168   -GDAVNIGQAAFETSMNLLSSTIFSKDVVDPYANSGKEFKDAVCKITEEAGKPNLADYFP  226

Query  721   CLRWLDLQGLRTKTDKDLQIALQIVSTFVQKRSKEGQDDSGKRKSDFLDVLLSFEGSGKD  542
              L+ +D QG+R    K+    LQ +   + +R +E +    +   D LDVLL+   + ++
Sbjct  227   LLKRIDPQGIRRCVGKNFDKLLQQIEVLIDERLEESRKSPTRDSIDVLDVLLN---TSQE  283

Query  541   EPPKLSEHQINIFILEMFLAGTDTTSS  461
             +P  +  + I    L++F+AGTDTTS+
Sbjct  284   DPEAIDRNHIERLCLDLFIAGTDTTSN  310


 Score =   122 bits (306),  Expect(2) = 6e-68, Method: Compositional matrix adjust.
 Identities = 56/114 (49%), Positives = 80/114 (70%), Gaps = 1/114 (1%)
 Frame = -1

Query  344  NTALTSSTVEWALTELLRNPKAMTKAKEEIRGIVGPTRRFEESDIDNLQYLQAVVKETLR  165
             T  TS+T+EWA+ E++R P  M KAK E+  ++G  +  EE+D+  L YLQ +VKETLR
Sbjct  304  GTDTTSNTLEWAMVEIMRKPDIMEKAKAELAEVIGKGKIVEEADVARLPYLQYIVKETLR  363

Query  164  LHPPAPFLIPRRAIQDTKFMGYDIPKDTQVFINVWAIGRDHESWEDPLSFKPER  3
            ++P  PF+I R+  QD +  GY +P+ +QV +N+W+IGRD   WE+PL FKPER
Sbjct  364  MYPTVPFMI-RKVDQDVEACGYFVPRASQVLVNLWSIGRDPTIWEEPLVFKPER  416



>ref|XP_011036810.1| PREDICTED: cytochrome P450 76A1-like [Populus euphratica]
Length=516

 Score =   237 bits (605),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 110/264 (42%), Positives = 169/264 (64%), Gaps = 4/264 (2%)
 Frame = -2

Query  1273  NMLDLGSVPHQTIAAMRNKYGPVVWLRIGSVSTLAIQSAKAAAELFKNHDVPFAGRSIGD  1094
             N+  LG  PH++ A +   +GP++ + +GS+  + + S++ A E+FKNHD   AGR I +
Sbjct  47    NIFQLGWAPHESFAKLARVHGPIMTIWLGSMCNVVVSSSEVAREMFKNHDAVLAGRKIYE  106

Query  1093  VMLAQGYNKGSMALAQYGSYWRVLRRICSVEMFVHKKVNETAAVRRKCIDDLLRWVENEA  914
              M     N+GS+  AQYG +WR+LRR+C+ E FV  +++     R +CID +L+++E+  
Sbjct  107   AMKGDFGNEGSIITAQYGPHWRMLRRLCTTEFFVTSRLDAMQGARTRCIDGMLQYIED--  164

Query  913   GSIKRGSGIHVTRFVFLATFNLLGNIMFSSDLVDPVSEKGSKFFNAMMGIMERGGTPNIS  734
             GS    S I + R++FL  FNL+GN+MFS DL+DP SEKG+KFF     +ME  G PN++
Sbjct  165   GSANGTSAIDLGRYIFLMAFNLIGNLMFSKDLLDPKSEKGAKFFQHAGKVMELAGKPNMA  224

Query  733   DIFPCLRWLDLQGLRTKTDKDLQIALQIVSTFVQKRSKEGQDDSGK--RKSDFLDVLLSF  560
             D  P LRWLD QG+R KT   +  A +I   F+++R++  Q ++ +  ++ D+LDVLL F
Sbjct  225   DFLPILRWLDPQGIRRKTQFHVARAFEIAGGFIEERTESMQKENSRDDKRKDYLDVLLEF  284

Query  559   EGSGKDEPPKLSEHQINIFILEMF  488
              G G +EP + S   IN+ + EMF
Sbjct  285   RGDGVEEPSRFSSTTINVIVFEMF  308


 Score =   146 bits (368),  Expect = 8e-35, Method: Compositional matrix adjust.
 Identities = 61/106 (58%), Positives = 83/106 (78%), Gaps = 0/106 (0%)
 Frame = -1

Query  320  VEWALTELLRNPKAMTKAKEEIRGIVGPTRRFEESDIDNLQYLQAVVKETLRLHPPAPFL  141
            +EWA+ ELLRNPK +   + E+R  +GP+++ EE DI+NL YL+AV++ETLRLHPP PFL
Sbjct  319  MEWAMAELLRNPKVLKTVQSELRSTIGPSKKLEEKDIENLPYLKAVIRETLRLHPPLPFL  378

Query  140  IPRRAIQDTKFMGYDIPKDTQVFINVWAIGRDHESWEDPLSFKPER  3
            +P  A+   K +GY IPK+T + +NVWAIGRD ++W+DPL FKPER
Sbjct  379  VPHMAMNPCKMLGYYIPKETTILVNVWAIGRDSKTWDDPLVFKPER  424



>ref|XP_007201998.1| hypothetical protein PRUPE_ppa022979mg [Prunus persica]
 gb|EMJ03197.1| hypothetical protein PRUPE_ppa022979mg [Prunus persica]
Length=528

 Score =   238 bits (606),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 116/268 (43%), Positives = 173/268 (65%), Gaps = 6/268 (2%)
 Frame = -2

Query  1273  NMLDLG-SVPHQTIAAMRNKYGPVVWLRIGSVSTLAIQSAKAAAELFKNHDVPFAGRSIG  1097
             N+  LG   PH++ A +   +GP++ L +GS+ST+ I S++ A E+FKNHDV  AGR I 
Sbjct  53    NIFQLGLGPPHESFAMLARNHGPIMTLWLGSMSTVVISSSQVAREMFKNHDVVLAGRKIY  112

Query  1096  DVMLAQGYNKGSMALAQYGSYWRVLRRICSVEMFVHKKVNETAAVRRKCIDDLLRWVENE  917
             + M     N+GS+  AQYG +WR+LRR+C+ E FV  +++    VR KCID +++++E+ 
Sbjct  113   EAMKGDYGNEGSLITAQYGPHWRMLRRLCTTEFFVTSRIDAMCRVRAKCIDGMVQFIEDA  172

Query  916   AGSIK-RGSGIHVTRFVFLATFNLLGNIMFSSDLVDPVSEKGSKFFNAMMGIMERGGTPN  740
             A  +  +  GI + RF+FL  FNL+GN+MFS DL+DP SE+G+ FF     +ME  G PN
Sbjct  173   ASEMSTKTDGIDLGRFIFLMAFNLIGNLMFSKDLLDPKSERGAMFFYHAGKVMELAGKPN  232

Query  739   ISDIFPCLRWLDLQGLRTKTDKDLQIALQIVSTFVQKR---SKEGQDDSGKRKSDFLDVL  569
             ++D FP LRWLD QG+R  T   ++ A +I   F+++R    + G +D  +R  DFLDVL
Sbjct  233   MADFFPILRWLDPQGIRRNTQFHVEKAFEIAGEFIRERMESMENGGNDGIERTKDFLDVL  292

Query  568   LSFEGSGKDEPPKLSEHQ-INIFILEMF  488
             L + G G DEP + S  + +N+ + EMF
Sbjct  293   LEYRGDGVDEPSRFSSSRTVNVIVFEMF  320


 Score =   140 bits (352),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 60/106 (57%), Positives = 80/106 (75%), Gaps = 0/106 (0%)
 Frame = -1

Query  320  VEWALTELLRNPKAMTKAKEEIRGIVGPTRRFEESDIDNLQYLQAVVKETLRLHPPAPFL  141
            +EWA+ ELL NPK + K + E+R  +  + + +E DI+NL YL+AV+KETLRLHPP PFL
Sbjct  331  LEWAMAELLNNPKTLKKVQAELRSTISSSDKLQEKDIENLPYLKAVIKETLRLHPPLPFL  390

Query  140  IPRRAIQDTKFMGYDIPKDTQVFINVWAIGRDHESWEDPLSFKPER  3
            +P  A+   K +G+ IPK TQ+ +NVWAIGRD ++WEDPL FKPER
Sbjct  391  VPHMAMDSCKMLGHHIPKGTQILVNVWAIGRDPKTWEDPLLFKPER  436



>ref|XP_008222069.1| PREDICTED: geraniol 8-hydroxylase-like [Prunus mume]
Length=500

 Score =   147 bits (372),  Expect(2) = 1e-67, Method: Compositional matrix adjust.
 Identities = 84/271 (31%), Positives = 146/271 (54%), Gaps = 7/271 (3%)
 Frame = -2

Query  1273  NMLDLGSVPHQTIAAMRNKYGPVVWLRIGSVSTLAIQSAKAAAELFKNHDVPFAGRSIGD  1094
             N+L+LG+ PH ++  +  +YGP++ L++G ++T+ + S+  A ++ + HD  F  R+I D
Sbjct  47    NLLELGNKPHLSLTKLSQRYGPIMTLQLGQITTVVVSSSAVAKQVLRTHDQFFCNRTIPD  106

Query  1093  VMLAQGYNKGSMALAQYGSYWRVLRRICSVEMFVHKKVNETAAVRRKCIDDLLRWVENEA  914
              + A  + K  M      S WR LR+IC+ ++F  K ++   A R   + +LL  V+   
Sbjct  107   AVQACKHAKYGMPWLTVASTWRNLRKICNSQLFAAKVLDANQANRHLKVQELLADVKEGV  166

Query  913   GSIKRGSGIHVTRFVFLATFNLLGNIMFSSDLVDPVSEKGSKFFNAMMGIMERGGTPNIS  734
                  G  + V R  F  T NL+   +FS DL DP S + ++    +  IME  G PN++
Sbjct  167   ----EGKAVEVGRAAFKTTLNLMSRTVFSVDLADPNSVRATEIKELVWNIMEEAGKPNLA  222

Query  733   DIFPCLRWLDLQGLRTKTDKDLQIALQIVSTFVQKRSKEGQDDSGKRKSDFLDVLLSFEG  554
             D FP L+ +D  G+R +  K  Q  + +    + +R +  +       +D LD L++   
Sbjct  223   DYFPVLKKIDPMGIRRRLGKHFQKMIDLFDRMIVQRLESRKSRDYVTGNDMLDTLINM-S  281

Query  553   SGKDEPPKLSEHQINIFILEMFLAGTDTTSS  461
               K+E   ++E Q ++F L++F AGT+TTS+
Sbjct  282   EEKNEDMDMAETQ-HLF-LDLFGAGTETTSA  310


 Score =   138 bits (348),  Expect(2) = 1e-67, Method: Compositional matrix adjust.
 Identities = 62/114 (54%), Positives = 82/114 (72%), Gaps = 0/114 (0%)
 Frame = -1

Query  344  NTALTSSTVEWALTELLRNPKAMTKAKEEIRGIVGPTRRFEESDIDNLQYLQAVVKETLR  165
             T  TS+T+EWA+ ELLRNP+ ++KA+EE++ +VG  +  EESDI  L YLQA++KET R
Sbjct  304  GTETTSATLEWAMAELLRNPEKLSKAQEELKKVVGKGKPVEESDITRLPYLQAIIKETFR  363

Query  164  LHPPAPFLIPRRAIQDTKFMGYDIPKDTQVFINVWAIGRDHESWEDPLSFKPER  3
            LHP  P L+PR+A  D +  GY +PK  QV +N WAIGRD   W++P SF PER
Sbjct  364  LHPVVPLLLPRKAQADVEICGYIVPKGAQVLVNAWAIGRDPSIWDNPTSFIPER  417



>ref|XP_011036815.1| PREDICTED: cytochrome P450 76A1-like [Populus euphratica]
Length=517

 Score =   237 bits (605),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 112/265 (42%), Positives = 168/265 (63%), Gaps = 5/265 (2%)
 Frame = -2

Query  1273  NMLDLGSVPHQTIAAMRNKYGPVVWLRIGSVSTLAIQSAKAAAELFKNHDVPFAGRSIGD  1094
             N+  LG  PH++ A +   +GP++ + +GS+S + I S++ A E+FKNHD   AGR I +
Sbjct  47    NIFQLGWAPHESFAKLARVHGPIMTIWLGSMSNVVISSSEVAREMFKNHDAVLAGRKIYE  106

Query  1093  VMLAQGYNKGSMALAQYGSYWRVLRRICSVEMFVHKKVNETAAVRRKCIDDLLRWVENEA  914
              M     N+GS+  AQYG +WR+LRR+C+ E FV  +++     R +CID +L+++E+  
Sbjct  107   AMKGDFGNEGSIITAQYGPHWRMLRRLCTTEFFVTSRLDSMQGARTRCIDGMLQYIED--  164

Query  913   GSIKRGSGIHVTRFVFLATFNLLGNIMFSSDLVDPVSEKGSKFFNAMMGIMERGGTPNIS  734
             GS    S I + R++FL  FNL+GN+MFS DL+DP SE+G+KFF     +ME  G PN++
Sbjct  165   GSANGTSAIDLGRYIFLMAFNLIGNLMFSKDLLDPKSERGAKFFQHAGKVMELAGKPNMA  224

Query  733   DIFPCLRWLDLQGLRTKTDKDLQIALQIVSTFVQKRSKEGQDDSGKR---KSDFLDVLLS  563
             D  P LRWLD QG+R KT   +  A +I   F+++R++  Q +   R   + D+LDVLL 
Sbjct  225   DFLPILRWLDPQGIRRKTQFHVARAFEIAGGFIKERTESMQKEINSRDDKRKDYLDVLLE  284

Query  562   FEGSGKDEPPKLSEHQINIFILEMF  488
             F G G +EP + S   IN+ + EMF
Sbjct  285   FRGDGVEEPSRFSSTTINVIVFEMF  309


 Score =   144 bits (364),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 60/106 (57%), Positives = 82/106 (77%), Gaps = 0/106 (0%)
 Frame = -1

Query  320  VEWALTELLRNPKAMTKAKEEIRGIVGPTRRFEESDIDNLQYLQAVVKETLRLHPPAPFL  141
            +EWA+ ELLRNPK +   + E+R  +GP ++ E+ DI+NL YL+AV++ETLRLHPP PFL
Sbjct  320  LEWAMAELLRNPKVLKTVQSELRSTIGPNKKLEDKDIENLPYLKAVIRETLRLHPPLPFL  379

Query  140  IPRRAIQDTKFMGYDIPKDTQVFINVWAIGRDHESWEDPLSFKPER  3
            +P  A+   K +GY IPK+T + +NVWAIGRD ++W+DPL FKPER
Sbjct  380  VPHMAMNPCKMLGYYIPKETTILVNVWAIGRDSKTWDDPLVFKPER  425



>ref|XP_010920219.1| PREDICTED: geraniol 8-hydroxylase-like isoform X1 [Elaeis guineensis]
Length=501

 Score =   144 bits (362),  Expect(2) = 1e-67, Method: Compositional matrix adjust.
 Identities = 66/114 (58%), Positives = 82/114 (72%), Gaps = 0/114 (0%)
 Frame = -1

Query  344  NTALTSSTVEWALTELLRNPKAMTKAKEEIRGIVGPTRRFEESDIDNLQYLQAVVKETLR  165
             T   SSTVEWA+TELLRNP+ M KA++E+  ++G  +  EESDI  L YL+AVVKET R
Sbjct  305  GTDTNSSTVEWAMTELLRNPRCMAKARDEVARVIGREKEVEESDIGRLPYLRAVVKETFR  364

Query  164  LHPPAPFLIPRRAIQDTKFMGYDIPKDTQVFINVWAIGRDHESWEDPLSFKPER  3
            LHPPAPFL+PR+     +  GY +PK T+V +NVWA GRD E W +P  FKPER
Sbjct  365  LHPPAPFLLPRKVESTVELHGYTVPKGTRVLVNVWAYGRDGEVWPEPNEFKPER  418


 Score =   142 bits (358),  Expect(2) = 1e-67, Method: Compositional matrix adjust.
 Identities = 82/271 (30%), Positives = 143/271 (53%), Gaps = 6/271 (2%)
 Frame = -2

Query  1273  NMLDLGSVPHQTIAAMRNKYGPVVWLRIGSVSTLAIQSAKAAAELFKNHDVPFAGRSIGD  1094
             ++  LG  PHQ++A +   YGP++ LR+G V T+ + S + A E+ +  D  F+GRS+ D
Sbjct  47    SLFQLGDKPHQSLARLAKTYGPLMTLRLGQVFTIVVSSPEIAREVLQKKDAAFSGRSVAD  106

Query  1093  VMLAQGYNKGSMALAQYGSYWRVLRRICSVEMFVHKKVNETAAVRRKCIDDLLRWVENEA  914
              + A G+   S       + WR LRRIC+  +F  + ++   ++RR+ I +LL ++ + +
Sbjct  107   ALRALGHADISTLWLPPSNQWRSLRRICNTTLFNSQTLDARQSLRRQKIQELLSYITDRS  166

Query  913   GSIKRGSGIHVTRFVFLATFNLLGNIMFSSDLVDPVSEKGSKFFNAMMGIMERGGTPNIS  734
                 +G  + + R  F  + NL+   +FS DLVD  SE   +F + + GI++  G  N+S
Sbjct  167   ---LKGLPVDIGRVAFTTSLNLMSRTIFSVDLVDLYSESSQEFNDVVHGIVKEVGGSNLS  223

Query  733   DIFPCLRWLDLQGLRTKTDKDLQIALQIVSTFVQKRSKEGQDDSGKRKSDFLDVLLSFEG  554
             D FP L  +D QG R +     +    I    + +R +   +    R+ D L+VLL  + 
Sbjct  224   DFFPRLAPIDPQGRRRRLTVLFKKLHDIFDEQIDRRLQSKAEHQTNRQ-DVLEVLLHLQ-  281

Query  553   SGKDEPPKLSEHQINIFILEMFLAGTDTTSS  461
               + +   +    +    +++F+AGTDT SS
Sbjct  282   -VQQDSLNIDRQVMKALFVDLFVAGTDTNSS  311



>ref|XP_006388387.1| hypothetical protein POPTR_0201s00200g [Populus trichocarpa]
 gb|ERP47301.1| hypothetical protein POPTR_0201s00200g [Populus trichocarpa]
Length=496

 Score =   168 bits (425),  Expect(2) = 1e-67, Method: Compositional matrix adjust.
 Identities = 90/272 (33%), Positives = 155/272 (57%), Gaps = 9/272 (3%)
 Frame = -2

Query  1273  NMLDLGSVPHQTIAAMRNKYGPVVWLRIGSVSTLAIQSAKAAAELFKNHDVPFAGRSIGD  1094
             N+L LG  PH+T+A +   YGP++ L++G ++T+ I S   A E  + HD   + R++ D
Sbjct  47    NILALGDKPHRTLAKLSQTYGPLMTLKLGRITTIVISSPNIAKEALQKHDQALSSRTVPD  106

Query  1093  VMLAQGYNKGSMALAQYGSYWRVLRRICSVEMFVHKKVNETAAVRRKCIDDLLRWVENEA  914
              +  +G++K S+      S+W+ L+++ + +MF  ++++ + A+R K + +LL +V  + 
Sbjct  107   AV--RGHHKNSILWLPASSHWKFLKKLTATQMFTSQRLDASRALRGKKVQELLEYVHEKC  164

Query  913   GSIKRGSGIHVTRFVFLATFNLLGNIMFSSDLVDPVSEKGSKFFNAMMGIMERGGTPNIS  734
                 +G  + V R VF    NL+ N  FS D+ +  S+   +F   ++G+ME+ G  NI+
Sbjct  165   N---KGHAVDVGRSVFTTVLNLISNTFFSLDIANYNSDLSQEFSYLVVGVMEQIGKANIA  221

Query  733   DIFPCLRWLDLQGLRTKTDKDLQIALQIVSTFVQKRSK-EGQDDSGKRKSDFLDVLLSFE  557
             D FP LR +D QG+R KT+  L+   QI  + + +R++      + K   D LD LL   
Sbjct  222   DYFPILRLVDPQGIRRKTNNYLKRLTQIFDSIINERTRLRSSSVASKASHDVLDALLIL-  280

Query  556   GSGKDEPPKLSEHQINIFILEMFLAGTDTTSS  461
                K+   +LS   I + +L+ F+AGTDTTSS
Sbjct  281   --AKENNTELSSTDIQVLLLDFFIAGTDTTSS  310


 Score =   117 bits (294),  Expect(2) = 1e-67, Method: Compositional matrix adjust.
 Identities = 66/114 (58%), Positives = 82/114 (72%), Gaps = 3/114 (3%)
 Frame = -1

Query  344  NTALTSSTVEWALTELLRNPKAMTKAKEEIRGIVGPTRRFEESDIDNLQYLQAVVKETLR  165
             T  TSSTVEWA+TELL NP  M KAK E++ + GP    +ESDI    YLQA+VKET R
Sbjct  304  GTDTTSSTVEWAMTELLLNPDKMVKAKNELQQVEGPV---QESDISKCPYLQAIVKETFR  360

Query  164  LHPPAPFLIPRRAIQDTKFMGYDIPKDTQVFINVWAIGRDHESWEDPLSFKPER  3
            LHPPAP L+PR+A+ + +  G+ +PK+ Q+ IN+WAIGRD   W DP SFKPER
Sbjct  361  LHPPAPLLLPRKAVSEVEMQGFTVPKNAQILINIWAIGRDPTIWPDPNSFKPER  414



>ref|XP_007224608.1| hypothetical protein PRUPE_ppa026952mg [Prunus persica]
 gb|EMJ25807.1| hypothetical protein PRUPE_ppa026952mg [Prunus persica]
Length=500

 Score =   152 bits (385),  Expect(2) = 1e-67, Method: Compositional matrix adjust.
 Identities = 80/271 (30%), Positives = 145/271 (54%), Gaps = 6/271 (2%)
 Frame = -2

Query  1273  NMLDLGSVPHQTIAAMRNKYGPVVWLRIGSVSTLAIQSAKAAAELFKNHDVPFAGRSIGD  1094
             N+L+LG+ PH ++  +  +YGP++ L++G ++T+ + S+  A ++ + +D  F  R+  D
Sbjct  45    NLLELGNKPHISLTKLSKRYGPIMTLQLGQITTVVVSSSIVAKQVLRTYDRFFCNRTNAD  104

Query  1093  VMLAQGYNKGSMALAQYGSYWRVLRRICSVEMFVHKKVNETAAVRRKCIDDLLRWVENEA  914
              + A  + K  M      + WR LRRIC+ ++F  K ++   A R   + +L   + + +
Sbjct  105   ALQACSHAKHGMPFIPVSAKWRNLRRICNSQLFATKVLDANQANRHLKVQEL---IADVS  161

Query  913   GSIKRGSGIHVTRFVFLATFNLLGNIMFSSDLVDPVSEKGSKFFNAMMGIMERGGTPNIS  734
              S+ +G  I V R  F+ T NLL   +FS DL DP SE   +F   + GIME  G PN++
Sbjct  162   ESVVKGKAIEVGRAAFITTLNLLSRTVFSVDLADPKSETAREFKELVWGIMEEVGKPNLA  221

Query  733   DIFPCLRWLDLQGLRTKTDKDLQIALQIVSTFVQKRSKEGQDDSGKRKSDFLDVLLSFEG  554
             D FP L+ +D  G+R +  K  +  + +  + + +R +  +       +D LD L++   
Sbjct  222   DYFPVLKKIDPMGIRRRLTKHFRKMIDLFDSLIFQRLETRKSHDYVTANDMLDTLINMSE  281

Query  553   SGKDEPPKLSEHQINIFILEMFLAGTDTTSS  461
                ++      H +    L++F+A T+TTS+
Sbjct  282   EKNEDMDIPETHHL---FLDLFVAATETTSA  309


 Score =   133 bits (334),  Expect(2) = 1e-67, Method: Compositional matrix adjust.
 Identities = 59/113 (52%), Positives = 81/113 (72%), Gaps = 0/113 (0%)
 Frame = -1

Query  341  TALTSSTVEWALTELLRNPKAMTKAKEEIRGIVGPTRRFEESDIDNLQYLQAVVKETLRL  162
            T  TS+T+EWA+ ELL NP+ ++KA+EE+  ++G  +  EE+DI  L YLQA+++ET RL
Sbjct  304  TETTSATLEWAMAELLCNPEKLSKAQEELEQVIGKGKPVEETDIARLPYLQAIIRETFRL  363

Query  161  HPPAPFLIPRRAIQDTKFMGYDIPKDTQVFINVWAIGRDHESWEDPLSFKPER  3
            HP  PFL+PR+A  D +  GY +PK  QV +N WAIGRD   W++P SF PER
Sbjct  364  HPALPFLVPRKAEADLEICGYFVPKGAQVLVNAWAIGRDPGIWDNPASFIPER  416



>ref|XP_008437178.1| PREDICTED: geraniol 8-hydroxylase-like [Cucumis melo]
Length=497

 Score =   149 bits (375),  Expect(2) = 1e-67, Method: Compositional matrix adjust.
 Identities = 82/273 (30%), Positives = 141/273 (52%), Gaps = 6/273 (2%)
 Frame = -2

Query  1273  NMLDLGSVPHQTIAAMRNKYGPVVWLRIGSVSTLAIQSAKAAAELFKNHDVPFAGRSIGD  1094
             N+L LG  PH+++A +   YGP++ L++G V+T+ I S+  A ++ + HD   + R++ D
Sbjct  41    NLLALGDQPHKSLANLAKSYGPIMTLKLGQVTTVVISSSAMAKQVLQTHDQFLSSRTVPD  100

Query  1093  VMLAQGYNKGSMALAQYGSYWRVLRRICSVEMFVHKKVNETAAVRRKCIDDLLRWVENEA  914
              M    ++   +        WR LRR+C+ ++   + ++    +RR  +++L+   E   
Sbjct  101   SMTTHNHDLFGLPWMPVSPLWRNLRRVCNTQLLAPRILDANENLRRGQVEELV--TEISR  158

Query  913   GSIKRGSGIHVTRFVFLATFNLLGNIMFSSDLVDPVSEKGSKFFNAMMGIMERGGTPNIS  734
              ++K    +   +  F+ T NLL N +FS D VDP S+ G +F  A+ GIME    PN  
Sbjct  159   CALKGDEAVDFGKVAFVTTVNLLWNTIFSEDFVDPNSKIGREFKVAVRGIMEEAVKPNFG  218

Query  733   DIFPCLRWLDLQGLRTKTDKDLQIALQIVSTFVQKRSKEGQDD--SGKRKSDFLDVLLSF  560
             D FP L+  D+QG++ +          ++   + +R  E +    S K K DFL  LL+ 
Sbjct  219   DYFPLLKRFDVQGIKKRQSVYFDRIFDVLEQIIDERIDEQKKSFGSNKIKHDFLHYLLNL  278

Query  559   EGSGKDEPPKLSEHQINIFILEMFLAGTDTTSS  461
                  D   KL   +    +  +F+AGTDT+S+
Sbjct  279   GDENSDI--KLGRDEFKHLLAVLFIAGTDTSSA  309


 Score =   137 bits (344),  Expect(2) = 1e-67, Method: Compositional matrix adjust.
 Identities = 60/114 (53%), Positives = 87/114 (76%), Gaps = 1/114 (1%)
 Frame = -1

Query  344  NTALTSSTVEWALTELLRNPKAMTKAKEEIRGIVGPTRRFEESDIDNLQYLQAVVKETLR  165
             T  +S+T +WA+ ELL+NP+ ++KA++EIR ++G     +ESDI  L YLQAV+KETLR
Sbjct  303  GTDTSSATFQWAMAELLKNPQKLSKAQQEIRSVIGKGNPIKESDISRLPYLQAVIKETLR  362

Query  164  LHPPAPFLIPRRAIQDTKFMGYDIPKDTQVFINVWAIGRDHESWEDPLSFKPER  3
            LH P PFL+PR+A++D +  G+ IPKD QV +N+WA+GRD  +W++P  F+PER
Sbjct  363  LHSP-PFLLPRKALEDVEISGFTIPKDAQVLVNLWAMGRDSNAWKNPEVFEPER  415



>ref|XP_006295493.1| hypothetical protein CARUB_v10024597mg [Capsella rubella]
 gb|EOA28391.1| hypothetical protein CARUB_v10024597mg [Capsella rubella]
Length=1007

 Score =   146 bits (368),  Expect(2) = 2e-67, Method: Compositional matrix adjust.
 Identities = 68/114 (60%), Positives = 83/114 (73%), Gaps = 0/114 (0%)
 Frame = -1

Query  344  NTALTSSTVEWALTELLRNPKAMTKAKEEIRGIVGPTRRFEESDIDNLQYLQAVVKETLR  165
             T  TSSTVEWAL ELLR PK MTK ++EI  ++G     +ESDI  L YLQAVVKET R
Sbjct  313  GTDTTSSTVEWALAELLRTPKTMTKVQDEINHVIGENGVIQESDISELPYLQAVVKETFR  372

Query  164  LHPPAPFLIPRRAIQDTKFMGYDIPKDTQVFINVWAIGRDHESWEDPLSFKPER  3
            LHP AP L+PR+A  D   +G+ +PK+TQV +N WAIGRD  +WE+P SF+PER
Sbjct  373  LHPAAPLLLPRKAEADVDVLGFLVPKNTQVLVNAWAIGRDPNAWENPNSFEPER  426


 Score =   139 bits (351),  Expect(2) = 2e-67, Method: Compositional matrix adjust.
 Identities = 80/275 (29%), Positives = 150/275 (55%), Gaps = 10/275 (4%)
 Frame = -2

Query  1273  NMLDLGSVPHQTIAAMRNKYGPVVWLRIGSVSTLAIQSAKAAAELFKNHDVPFAGRSIGD  1094
             N+  +G  PH++ A +   YGPV+ L++G ++++ I S  AA E+ + HD   + R +  
Sbjct  51    NVHLIGKNPHRSFADLSKMYGPVMSLKLGFLNSVVISSRDAAREVLRTHDQILSARYLNA  110

Query  1093  VMLAQGYNKGSMA-LAQYGSYWRVLRRICSVEMFVHKKVNETAAVRRKCIDDLLRWVENE  917
              + +  ++  S+A L    + WR+LR++ + ++F  +++  T A+R K   +L+ ++   
Sbjct  111   AVQSNNHHDFSVAWLHPTSTRWRMLRKLSATQLFSPQRIEATKALRMKRAQELVNFISEC  170

Query  916   AGSIKRGSGIHVTRFVFLATFNLLGNIMFSSDLVDPVSEKGSKFFNAMMGIMERGGTPNI  737
             +   +R   + ++R  F+   N++ NI+FS +L    S+  + F   M G+ME  G P+ 
Sbjct  171   S---EREEAVDISRASFVTALNIVSNILFSVNLGSYDSKNSNVFQELMTGVMEALGNPDF  227

Query  736   SDIFPCLRWLDLQGLRTKTDKDLQIALQIVSTFVQKRSKEGQDDSGKR---KSDFLDVLL  566
             ++ FP +R+LDLQG   K     +   Q+       R  E    +G++    SDF+D L+
Sbjct  228   ANFFPIMRFLDLQGNSKKMKDYSERLFQVFRELYNARIVENSSRTGEKDVSSSDFVDALI  287

Query  565   SFEGSGKDEPPKLSEHQINIFILEMFLAGTDTTSS  461
                   + E P+++ ++I   +L++F AGTDTTSS
Sbjct  288   DLH---EREQPEINNNEIEHLLLDLFAAGTDTTSS  319


 Score =   145 bits (367),  Expect(2) = 2e-66, Method: Compositional matrix adjust.
 Identities = 70/114 (61%), Positives = 83/114 (73%), Gaps = 0/114 (0%)
 Frame = -1

Query  344  NTALTSSTVEWALTELLRNPKAMTKAKEEIRGIVGPTRRFEESDIDNLQYLQAVVKETLR  165
             T  +SSTVEWA+ ELLRNPK M KA+ EI  ++G     EESDI  L YLQAVVKET R
Sbjct  815  GTDTSSSTVEWAMAELLRNPKTMVKAQAEIDRVIGQNGIVEESDIAELPYLQAVVKETFR  874

Query  164  LHPPAPFLIPRRAIQDTKFMGYDIPKDTQVFINVWAIGRDHESWEDPLSFKPER  3
            LHP APFLIPR+A  D + +G+ + KDTQV +NVWAIGRD   WE+P  F+PER
Sbjct  875  LHPGAPFLIPRKAESDVEVLGFMVRKDTQVLVNVWAIGRDPSVWENPTRFEPER  928


 Score =   136 bits (342),  Expect(2) = 2e-66, Method: Compositional matrix adjust.
 Identities = 86/276 (31%), Positives = 150/276 (54%), Gaps = 12/276 (4%)
 Frame = -2

Query  1273  NMLDLGSVPHQTIAAMRNKYGPVVWLRIGSVSTLAIQSAKAAAELFKNHDVPFAGRSIGD  1094
             N+  +G  PH++ A +   YGPV+ L++GS++T+ I S +AA E+ + HD   +GRS  +
Sbjct  553   NIHLVGKHPHRSFADLSKTYGPVISLKLGSLNTVVIASPEAAREVLRTHDQILSGRSPTN  612

Query  1093  VMLAQGYNKGSMA-LAQYGSYWRVLRRICSVEMFVHKKVNETAAVRRKCIDDLLRWVENE  917
              + +  +   S+  L    + WR+ RR+   ++F  +++  T  +R   + DL+ ++ NE
Sbjct  613   AIRSINHQDASLVWLPASSARWRLFRRLSVTQLFSPQRLEATKGMRVNKVKDLVGFI-NE  671

Query  916   AGSIKRGSGIHVTRFVFLATFNLLGNIMFSSDLVD-PVSEKGSKFFNAMMGIMERGGTPN  740
             +    R   + ++R  F+ T N++ NI+FS DL      +  +   + ++ +ME  G P+
Sbjct  672   SSD--REEFVDISRASFITTLNIISNILFSVDLGSYNAKDSINGVQDTVISLMEAVGKPD  729

Query  739   ISDIFPCLRWLDLQGLRTKTDKDLQIALQIVSTFVQKRSKEGQDDSGKR---KSDFLDVL  569
              ++ FP LR+LDLQG +       +    +   F+  +  E    S  R   K+DF+D L
Sbjct  730   AANYFPLLRFLDLQGNKKTMKVCTERLFGVFRGFIDAKIAEKSSQSNPRDISKNDFVDNL  789

Query  568   LSFEGSGKDEPPKLSEHQINIFILEMFLAGTDTTSS  461
             L ++G   DE  +L    I  F+L+MF AGTDT+SS
Sbjct  790   LDYKG---DE-AELKISDIEHFVLDMFTAGTDTSSS  821



>gb|KCW47877.1| hypothetical protein EUGRSUZ_K01623, partial [Eucalyptus grandis]
Length=514

 Score =   237 bits (604),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 117/267 (44%), Positives = 172/267 (64%), Gaps = 10/267 (4%)
 Frame = -2

Query  1273  NMLDLGSVPHQTIAAMRNKYGPVVWLRIGSVSTLAIQSAKAAAELFKNHDVPFAGRSIGD  1094
             N+  L   PH++ A +  +YGP++ L +GS+ T+ I S + A E+FKNHDV  AGR I +
Sbjct  47    NIFQLSWTPHKSFANLAREYGPIMTLWLGSMCTVVISSDEVAREMFKNHDVVLAGRKIYE  106

Query  1093  VMLAQGYNKGSMALAQYGSYWRVLRRICSVEMFVHKKVNETAAVRRKCIDDLLRWVEN--  920
              M     N+GS+  AQYG +WR+LRR+ + E FV ++++ T +VR +C+D ++R++E+  
Sbjct  107   AMKGDYSNEGSIITAQYGPHWRMLRRLSTTEFFVARRLDATESVRSRCVDRMVRFIEDAG  166

Query  919   EAGSIKRGSGIHVTRFVFLATFNLLGNIMFSSDLVDPVSEKGSKFFNAMMGIMERGGTPN  740
             E+G+      I V RF FL  FNL+GN+MFS DL+DP S++G+KFF     +ME  G PN
Sbjct  167   ESGT----KSIDVGRFFFLMAFNLIGNLMFSKDLLDPKSKRGAKFFYHAGKVMELAGKPN  222

Query  739   ISDIFPCLRWLDLQGLRTKTDKDLQIALQIVSTFVQKR---SKEGQDDSGKRKSDFLDVL  569
             ++D  P LRWLD QG+R  T   ++ A +I   F+++R    +EG+    +RK DFLDVL
Sbjct  223   VADFLPILRWLDPQGIRRNTQFHVERAFEIAGQFIKERMESMREGEVAEDRRK-DFLDVL  281

Query  568   LSFEGSGKDEPPKLSEHQINIFILEMF  488
             L F G G +EP K S   IN+ + EMF
Sbjct  282   LEFRGDGAEEPSKFSSRTINVIVFEMF  308


 Score =   142 bits (358),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 61/106 (58%), Positives = 81/106 (76%), Gaps = 0/106 (0%)
 Frame = -1

Query  320  VEWALTELLRNPKAMTKAKEEIRGIVGPTRRFEESDIDNLQYLQAVVKETLRLHPPAPFL  141
            +EWA+ ELL NP  + K + E+R  +G  R+FEE D++ L YL+AV+KETLRLHPP PFL
Sbjct  319  LEWAMAELLHNPHTLAKVQSELRSTIGLNRKFEEKDVEILPYLKAVIKETLRLHPPLPFL  378

Query  140  IPRRAIQDTKFMGYDIPKDTQVFINVWAIGRDHESWEDPLSFKPER  3
            +P  A+   K +GY IPK+TQV +NVWAIGRD ++W++PL FKPER
Sbjct  379  VPHMAMSSCKMLGYYIPKETQVLVNVWAIGRDPKTWKEPLKFKPER  424



>gb|KHG21745.1| Cytochrome P450 protein [Gossypium arboreum]
Length=500

 Score =   146 bits (369),  Expect(2) = 2e-67, Method: Compositional matrix adjust.
 Identities = 85/271 (31%), Positives = 138/271 (51%), Gaps = 6/271 (2%)
 Frame = -2

Query  1273  NMLDLGSVPHQTIAAMRNKYGPVVWLRIGSVSTLAIQSAKAAAELFKNHDVPFAGRSIGD  1094
             N+ DLG  PH+++A     +GPV+ L++GS+ T+ + S   A E+ +  D+ F  R+I D
Sbjct  47    NLFDLGDKPHRSLAKFARIHGPVMSLKLGSLITVVVSSETTAKEILQKQDLIFCNRTIVD  106

Query  1093  VMLAQGYNKGSMALAQYGSYWRVLRRICSVEMFVHKKVNETAAVRRKCIDDLLRWVENEA  914
              + A  + +  +        WR LR++ +  +F   K++    +RR  I  L+  V    
Sbjct  107   AVRASQHYEFGLPWLPVSPLWRTLRKVSNTHIFSSLKLDSNEYLRRHKIQQLIAKV---G  163

Query  913   GSIKRGSGIHVTRFVFLATFNLLGNIMFSSDLVDPVSEKGSKFFNAMMGIMERGGTPNIS  734
              S  +G  +++ +  F  T NLL N MFS DLVD  S +  +F   +  IM   GTPN++
Sbjct  164   ESRLKGEAVNIGQAAFDTTINLLSNTMFSVDLVDSNSARAEEFRKTVYSIMVEAGTPNLA  223

Query  733   DIFPCLRWLDLQGLRTKTDKDLQIALQIVSTFVQKRSKEGQDDSGKRKSDFLDVLLSFEG  554
             D FP LR +D QG+R +        L++    + +R +  +       +D LD LL    
Sbjct  224   DYFPLLRKMDPQGVRHRITVHFDKLLKLFGNMIDERQQSRKSQDYTASNDVLDTLLDIIE  283

Query  553   SGKDEPPKLSEHQINIFILEMFLAGTDTTSS  461
                +E   L+++ I    L +F AGTDTTS+
Sbjct  284   GDIEE---LNKNLITHLFLVLFAAGTDTTSN  311


 Score =   139 bits (349),  Expect(2) = 2e-67, Method: Compositional matrix adjust.
 Identities = 60/114 (53%), Positives = 82/114 (72%), Gaps = 0/114 (0%)
 Frame = -1

Query  344  NTALTSSTVEWALTELLRNPKAMTKAKEEIRGIVGPTRRFEESDIDNLQYLQAVVKETLR  165
             T  TS+T+EWA+ E+ RNP  + KAK+E+  ++G  +  EESDI+ L YLQA++KET R
Sbjct  305  GTDTTSNTLEWAMAEIFRNPHVLLKAKKELDQVIGKGKLIEESDINRLPYLQAIIKETFR  364

Query  164  LHPPAPFLIPRRAIQDTKFMGYDIPKDTQVFINVWAIGRDHESWEDPLSFKPER  3
            +HP  P L+PRRA  DT   G+++P+ +QV +NVWAIGRD   WE+P SF PER
Sbjct  365  MHPAVPLLLPRRAGSDTDLCGFNVPEGSQVLVNVWAIGRDPSIWENPNSFMPER  418



>ref|XP_006360237.1| PREDICTED: geraniol 8-hydroxylase-like [Solanum tuberosum]
Length=492

 Score =   144 bits (364),  Expect(2) = 2e-67, Method: Compositional matrix adjust.
 Identities = 88/272 (32%), Positives = 142/272 (52%), Gaps = 11/272 (4%)
 Frame = -2

Query  1273  NMLDLGSVPHQTIAAMRNKYGPVVWLRIGSVSTLAIQSAKAAAELFKNHDVPFAGRSIGD  1094
             N+  LG  PH ++  +  KYGP++ L++G ++T+ I S+  A E+ +  D+ F+ R   D
Sbjct  42    NLHLLGDKPHISLTQLAKKYGPIMNLKLGQINTVVISSSVLAKEVMQKQDLAFSNRFGID  101

Query  1093  VMLAQGYNKGSMA-LAQYGSYWRVLRRICSVEMFVHKKVNETAAVRRKCIDDLLRWVENE  917
              + A  +N  S+  L    S WR LR+I +  +F   K++    +R K I +L+ +    
Sbjct  102   AIRACNHNDFSVIWLPVNNSQWRTLRKIMNSHIFSGNKLDANEHLRTKKIQELIDYCHK-  160

Query  916   AGSIKRGSGIHVTRFVFLATFNLLGNIMFSSDLVDPVSEKGSKFFNAMMGIMERGGTPNI  737
               S K G  + + R  F  + NLL N +FS DL DP S+   +F   +  IM   G PN+
Sbjct  161   --SSKVGEAVDIGRAAFRTSLNLLSNTIFSKDLTDPFSDSAKEFKELVWKIMVEVGKPNL  218

Query  736   SDIFPCLRWLDLQGLRTKTDKDLQIALQIVSTFVQKRSKEGQDDSGKRKSDFLDVLLSFE  557
              D FP L+ +D QG+R ++       L ++S  + +R KE ++   +   D LD LL   
Sbjct  219   VDYFPFLKKIDPQGIRRRSTDYFTKILHLMSDLIDERLKE-RELGNRENVDVLDALLDI-  276

Query  556   GSGKDEPPKLSEHQINIFILEMFLAGTDTTSS  461
                   P ++  +QI    L++F AGTDTTS+
Sbjct  277   -----SPGEIDRNQIEQLCLDLFAAGTDTTSN  303


 Score =   140 bits (354),  Expect(2) = 2e-67, Method: Compositional matrix adjust.
 Identities = 62/114 (54%), Positives = 81/114 (71%), Gaps = 0/114 (0%)
 Frame = -1

Query  344  NTALTSSTVEWALTELLRNPKAMTKAKEEIRGIVGPTRRFEESDIDNLQYLQAVVKETLR  165
             T  TS+T+EWA+ ELL+NP    KA+EE+  ++G  +  +E+D+  L YL+ +VKET R
Sbjct  297  GTDTTSNTLEWAMAELLKNPHTFEKAQEELAQVIGRGKLIDEADVAKLPYLRCIVKETFR  356

Query  164  LHPPAPFLIPRRAIQDTKFMGYDIPKDTQVFINVWAIGRDHESWEDPLSFKPER  3
            +HP  PFLIPR+  +D    GY IPKD+QV +NVWAIGRD   WEDPL FKPER
Sbjct  357  IHPQVPFLIPRKVEEDVDLYGYTIPKDSQVLVNVWAIGRDSSLWEDPLDFKPER  410



>ref|XP_010036342.1| PREDICTED: cytochrome P450 76A1-like [Eucalyptus grandis]
Length=523

 Score =   236 bits (603),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 117/267 (44%), Positives = 172/267 (64%), Gaps = 10/267 (4%)
 Frame = -2

Query  1273  NMLDLGSVPHQTIAAMRNKYGPVVWLRIGSVSTLAIQSAKAAAELFKNHDVPFAGRSIGD  1094
             N+  L   PH++ A +  +YGP++ L +GS+ T+ I S + A E+FKNHDV  AGR I +
Sbjct  47    NIFQLSWTPHKSFANLAREYGPIMTLWLGSMCTVVISSDEVAREMFKNHDVVLAGRKIYE  106

Query  1093  VMLAQGYNKGSMALAQYGSYWRVLRRICSVEMFVHKKVNETAAVRRKCIDDLLRWVEN--  920
              M     N+GS+  AQYG +WR+LRR+ + E FV ++++ T +VR +C+D ++R++E+  
Sbjct  107   AMKGDYSNEGSIITAQYGPHWRMLRRLSTTEFFVARRLDATESVRSRCVDRMVRFIEDAG  166

Query  919   EAGSIKRGSGIHVTRFVFLATFNLLGNIMFSSDLVDPVSEKGSKFFNAMMGIMERGGTPN  740
             E+G+      I V RF FL  FNL+GN+MFS DL+DP S++G+KFF     +ME  G PN
Sbjct  167   ESGT----KSIDVGRFFFLMAFNLIGNLMFSKDLLDPKSKRGAKFFYHAGKVMELAGKPN  222

Query  739   ISDIFPCLRWLDLQGLRTKTDKDLQIALQIVSTFVQKR---SKEGQDDSGKRKSDFLDVL  569
             ++D  P LRWLD QG+R  T   ++ A +I   F+++R    +EG+    +RK DFLDVL
Sbjct  223   VADFLPILRWLDPQGIRRNTQFHVERAFEIAGQFIKERMESMREGEVAEDRRK-DFLDVL  281

Query  568   LSFEGSGKDEPPKLSEHQINIFILEMF  488
             L F G G +EP K S   IN+ + EMF
Sbjct  282   LEFRGDGAEEPSKFSSRTINVIVFEMF  308


 Score =   142 bits (358),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 61/106 (58%), Positives = 81/106 (76%), Gaps = 0/106 (0%)
 Frame = -1

Query  320  VEWALTELLRNPKAMTKAKEEIRGIVGPTRRFEESDIDNLQYLQAVVKETLRLHPPAPFL  141
            +EWA+ ELL NP  + K + E+R  +G  R+FEE D++ L YL+AV+KETLRLHPP PFL
Sbjct  319  LEWAMAELLHNPHTLAKVQSELRSTIGLNRKFEEKDVEILPYLKAVIKETLRLHPPLPFL  378

Query  140  IPRRAIQDTKFMGYDIPKDTQVFINVWAIGRDHESWEDPLSFKPER  3
            +P  A+   K +GY IPK+TQV +NVWAIGRD ++W++PL FKPER
Sbjct  379  VPHMAMSSCKMLGYYIPKETQVLVNVWAIGRDPKTWKEPLKFKPER  424



>ref|XP_007226675.1| hypothetical protein PRUPE_ppa021147mg [Prunus persica]
 gb|EMJ27874.1| hypothetical protein PRUPE_ppa021147mg [Prunus persica]
Length=489

 Score =   153 bits (387),  Expect(2) = 3e-67, Method: Compositional matrix adjust.
 Identities = 81/271 (30%), Positives = 145/271 (54%), Gaps = 6/271 (2%)
 Frame = -2

Query  1273  NMLDLGSVPHQTIAAMRNKYGPVVWLRIGSVSTLAIQSAKAAAELFKNHDVPFAGRSIGD  1094
             N+L+LG+ PH ++  +  +YGP++ L++G ++T+ + S+  A ++ + +D  F  R+  D
Sbjct  34    NLLELGNKPHISLTKLSKRYGPIMTLQLGQLTTVVVSSSIVAKQVLRTYDRFFCNRTNAD  93

Query  1093  VMLAQGYNKGSMALAQYGSYWRVLRRICSVEMFVHKKVNETAAVRRKCIDDLLRWVENEA  914
              + A  + K  M      + WR LRRIC+ ++F  K +N   A R+  + +L   + + +
Sbjct  94    ALQACSHAKHGMPFIPVSAKWRNLRRICNSQLFATKVLNANQANRQLKVQEL---IADVS  150

Query  913   GSIKRGSGIHVTRFVFLATFNLLGNIMFSSDLVDPVSEKGSKFFNAMMGIMERGGTPNIS  734
              S+ +G  + V R  FL T NLL   +FS DL DP SE   +F   + GIME  G PN++
Sbjct  151   ESVVKGKAVEVGRAAFLTTLNLLSRTVFSVDLADPKSETAREFKELVWGIMEEVGKPNLA  210

Query  733   DIFPCLRWLDLQGLRTKTDKDLQIALQIVSTFVQKRSKEGQDDSGKRKSDFLDVLLSFEG  554
             D FP L+ +D  G+R +  K  +  + +    + +R +  +       +D LD L++   
Sbjct  211   DYFPVLKKIDPMGIRRRLTKHFRKMIDLFDRLIFQRLETRKSHDYVTANDMLDTLINMSE  270

Query  553   SGKDEPPKLSEHQINIFILEMFLAGTDTTSS  461
                ++      H +    L++F+A T+TTS+
Sbjct  271   EKNEDMDIPETHHL---FLDLFVAATETTSA  298


 Score =   131 bits (330),  Expect(2) = 3e-67, Method: Compositional matrix adjust.
 Identities = 59/113 (52%), Positives = 80/113 (71%), Gaps = 0/113 (0%)
 Frame = -1

Query  341  TALTSSTVEWALTELLRNPKAMTKAKEEIRGIVGPTRRFEESDIDNLQYLQAVVKETLRL  162
            T  TS+T+EWA+ ELL NP+ ++KA+EE+  ++G  +  EE+D   L YLQA++KET RL
Sbjct  293  TETTSATLEWAMAELLCNPEKLSKAQEELEQVIGKGKPVEETDTARLPYLQAIIKETFRL  352

Query  161  HPPAPFLIPRRAIQDTKFMGYDIPKDTQVFINVWAIGRDHESWEDPLSFKPER  3
            HP  PFL+PR+A  D +  GY +PK  QV +N WAIGRD   W++P SF PER
Sbjct  353  HPALPFLLPRKAEADLEICGYFVPKGAQVLVNAWAIGRDPGFWDNPASFIPER  405



>ref|XP_010692297.1| PREDICTED: geraniol 8-hydroxylase-like isoform X2 [Beta vulgaris 
subsp. vulgaris]
Length=484

 Score =   166 bits (421),  Expect(2) = 3e-67, Method: Compositional matrix adjust.
 Identities = 87/271 (32%), Positives = 156/271 (58%), Gaps = 15/271 (6%)
 Frame = -2

Query  1273  NMLDLGSVPHQTIAAMRNKYGPVVWLRIGSVSTLAIQSAKAAAELFKNHDVPFAGRSIGD  1094
             N+  LG  PH+++A +   YGP++ L++GS++T+ I S + A E+F  HD+ F+GR+  D
Sbjct  40    NIFKLGDKPHRSVAELAKIYGPIMSLKLGSITTIVISSPEVAREMFLKHDLDFSGRANTD  99

Query  1093  VMLAQGYNKGSMALAQYGSYWRVLRRICSVEMFVHKKVNETAAVRRKCIDDLLRWVENEA  914
              + A  +++ SM     G  WR LR+I +V++F  K+++ +  +R+K +D+L+ +  + +
Sbjct  100   ALRAANHDQLSMVFLPVGPKWRNLRKIATVQLFTGKRLDASQIIRQKKVDELIEYARHCS  159

Query  913   GSIKRGSGIHVTRFVFLATFNLLGNIMFSSDLVDPVSEKGSKFFNAMMGIMERGGTPNIS  734
                +RG  +++ +  F  T NLL +  FS DL    S    +F +    IME G  PN+S
Sbjct  160   ---ERGLPLNIGKAAFTTTLNLLSSTFFSKDLASHDSSSSQEFKDIASNIMEEGAKPNLS  216

Query  733   DIFPCLRWLDLQGLRTKTDKDLQIALQIVSTFVQKRSKEGQDDSGKRKSDFLDVLLSFEG  554
             D FP ++ LDLQG+  ++   +   +++    + +RS + +D          DVL +   
Sbjct  217   DFFPIVKSLDLQGILKRSTGYVTQLMELFERIIDERSTDEKD----------DVLGTLLK  266

Query  553   SGKDEPPKLSEHQINIFILEMFLAGTDTTSS  461
               KD+  KLS  ++   ++++F+AGTDTTS+
Sbjct  267   LAKDD--KLSLEEVKHMLVDLFVAGTDTTSN  295


 Score =   118 bits (295),  Expect(2) = 3e-67, Method: Compositional matrix adjust.
 Identities = 51/114 (45%), Positives = 81/114 (71%), Gaps = 0/114 (0%)
 Frame = -1

Query  344  NTALTSSTVEWALTELLRNPKAMTKAKEEIRGIVGPTRRFEESDIDNLQYLQAVVKETLR  165
             T  TS+++EWA+  L+R+P+ + KA+ E+  ++G   + +ESDI  L Y+Q+++KE +R
Sbjct  289  GTDTTSNSLEWAMALLIRHPEKIAKAQSEMDEVLGKDGKMQESDIAKLPYVQSILKEVMR  348

Query  164  LHPPAPFLIPRRAIQDTKFMGYDIPKDTQVFINVWAIGRDHESWEDPLSFKPER  3
            L+PPAPFLIP +A QD    GY +PK++ +++NV++IG D   W+DP  F PER
Sbjct  349  LYPPAPFLIPHKAEQDVPLGGYLVPKNSTIWVNVYSIGHDPRVWQDPEIFSPER  402



>ref|XP_009372314.1| PREDICTED: geraniol 8-hydroxylase-like [Pyrus x bretschneideri]
Length=504

 Score =   150 bits (380),  Expect(2) = 3e-67, Method: Compositional matrix adjust.
 Identities = 84/271 (31%), Positives = 143/271 (53%), Gaps = 6/271 (2%)
 Frame = -2

Query  1273  NMLDLGSVPHQTIAAMRNKYGPVVWLRIGSVSTLAIQSAKAAAELFKNHDVPFAGRSIGD  1094
             N+L+LG+ PH ++  + ++YGP++ L++G ++T+ I S+  A E+ + HD  F  R++ D
Sbjct  47    NLLELGNKPHLSLTKLSHRYGPIMALQLGQITTVVISSSTVAKEVLRTHDQLFCNRTVPD  106

Query  1093  VMLAQGYNKGSMALAQYGSYWRVLRRICSVEMFVHKKVNETAAVRRKCIDDLLRWVENEA  914
              + A  ++K  MA       WR LR+IC+ ++F  K ++   A R   + DL+  V   A
Sbjct  107   AVRACQHSKYGMAWIPVSPAWRNLRKICNTQLFATKILDANQANRHLKVQDLISDVNESA  166

Query  913   GSIKRGSGIHVTRFVFLATFNLLGNIMFSSDLVDPVSEKGSKFFNAMMGIMERGGTPNIS  734
              +   G  + + R  F  + NLL   +FS DL DP S    +F   + GI E  G PN++
Sbjct  167   VN---GEVVDIGRAAFKTSLNLLSRTVFSVDLADPHSATAREFKELVWGIFEEVGKPNLA  223

Query  733   DIFPCLRWLDLQGLRTKTDKDLQIALQIVSTFVQKRSKEGQDDSGKRKSDFLDVLLSFEG  554
             D FP L+ +D  G+R +     +  L +    + +R +  +       +D LD L++   
Sbjct  224   DYFPVLKKIDPLGIRRRLTGHFRKMLDLFDRLMMQRFESRKVLDYIMTNDMLDTLINISE  283

Query  553   SGKDEPPKLSEHQINIFILEMFLAGTDTTSS  461
                ++   +   +I   +LE+F AGTDTTSS
Sbjct  284   EKNED---MDMDEIQHLLLELFAAGTDTTSS  311


 Score =   134 bits (336),  Expect(2) = 3e-67, Method: Compositional matrix adjust.
 Identities = 62/114 (54%), Positives = 82/114 (72%), Gaps = 0/114 (0%)
 Frame = -1

Query  344  NTALTSSTVEWALTELLRNPKAMTKAKEEIRGIVGPTRRFEESDIDNLQYLQAVVKETLR  165
             T  TSST+EWA+ ELLRNP+ ++K + E++ I+G  +  EESDI  L YLQA++KET R
Sbjct  305  GTDTTSSTLEWAMAELLRNPEKLSKIQAELKQIIGKGKLVEESDIARLPYLQAIIKETFR  364

Query  164  LHPPAPFLIPRRAIQDTKFMGYDIPKDTQVFINVWAIGRDHESWEDPLSFKPER  3
            L+P AP L+PR+A  D +  GY +PK  QVF+N WAIGRD   W++P SF PER
Sbjct  365  LYPVAPLLLPRKAETDVEIGGYIVPKGAQVFVNAWAIGRDPGIWDNPDSFVPER  418



>emb|CDY27377.1| BnaC04g50280D [Brassica napus]
Length=511

 Score =   143 bits (361),  Expect(2) = 3e-67, Method: Compositional matrix adjust.
 Identities = 64/114 (56%), Positives = 85/114 (75%), Gaps = 0/114 (0%)
 Frame = -1

Query  344  NTALTSSTVEWALTELLRNPKAMTKAKEEIRGIVGPTRRFEESDIDNLQYLQAVVKETLR  165
             T  +SST+EWA+ ELL NPK++ +A+ E+  ++G     +E+DI +L YLQAVVKET R
Sbjct  312  GTDTSSSTLEWAMAELLNNPKSLARAQTEMDCVIGQNGIVQEADISHLPYLQAVVKETFR  371

Query  164  LHPPAPFLIPRRAIQDTKFMGYDIPKDTQVFINVWAIGRDHESWEDPLSFKPER  3
            LHP APFL+PR+A  D K +G+ +PKDTQV +NVWAIGRD   WE+P  F+PER
Sbjct  372  LHPAAPFLVPRKAEADVKVLGFMVPKDTQVLVNVWAIGRDPAVWENPTRFEPER  425


 Score =   141 bits (355),  Expect(2) = 3e-67, Method: Compositional matrix adjust.
 Identities = 84/275 (31%), Positives = 149/275 (54%), Gaps = 10/275 (4%)
 Frame = -2

Query  1273  NMLDLGSVPHQTIAAMRNKYGPVVWLRIGSVSTLAIQSAKAAAELFKNHDVPFAGRSIGD  1094
             N+  +G  PH++ A +   YGPV+ L +GS+ ++ I S +AA E+ + HD   + R   D
Sbjct  50    NIHQVGKNPHRSFADLSKTYGPVMSLNLGSLKSVVITSPEAAREVLRTHDQILSARKSTD  109

Query  1093  VMLAQGYNKGSMA-LAQYGSYWRVLRRICSVEMFVHKKVNETAAVRRKCIDDLLRWVENE  917
              + + G+++ S+  L    + WR+LR++   +MF  +++  T A+R K + +L+ ++   
Sbjct  110   SIRSVGHHEVSVIWLPASSARWRMLRKLSINQMFSPQRMEATKALRMKKMQELVSFMHER  169

Query  916   AGSIKRGSGIHVTRFVFLATFNLLGNIMFSSDLVD-PVSEKGSKFFNAMMGIMERGGTPN  740
             +   ++   + ++R  F    N++ NI+FS DL    V+ K ++F + ++  ME  G P+
Sbjct  170   S---EKEEAVDISRASFTTVLNIISNILFSVDLGSYDVTSKSNRFRDTVIATMEAAGKPD  226

Query  739   ISDIFPCLRWLDLQGLRTKTDKDLQIALQIVSTFVQKRSKEGQDDSGK--RKSDFLDVLL  566
              ++ FP +R+LDLQG R       +   ++   F+  +  E   D+ K    SDFLD LL
Sbjct  227   AANYFPFMRFLDLQGNRKNMKACTEGLFRVFRGFIDAKRTEKSLDNSKDVSDSDFLDALL  286

Query  565   SFEGSGKDEPPKLSEHQINIFILEMFLAGTDTTSS  461
                   + E   L  + I   +L+MF AGTDT+SS
Sbjct  287   VLAEGDESE---LDNNDIEHLLLDMFAAGTDTSSS  318



>ref|XP_009372317.1| PREDICTED: geraniol 8-hydroxylase-like [Pyrus x bretschneideri]
Length=502

 Score =   144 bits (364),  Expect(2) = 3e-67, Method: Compositional matrix adjust.
 Identities = 88/271 (32%), Positives = 141/271 (52%), Gaps = 6/271 (2%)
 Frame = -2

Query  1273  NMLDLGSVPHQTIAAMRNKYGPVVWLRIGSVSTLAIQSAKAAAELFKNHDVPFAGRSIGD  1094
             N+L+LG+ PH ++  +   YGPV+ L++G V+T+ + S+ AA E+ + HD     R++  
Sbjct  51    NLLELGNKPHLSLTKLSQIYGPVITLQLGQVTTVVVSSSTAAKEVLRTHDEFLCNRTVPS  110

Query  1093  VMLAQGYNKGSMALAQYGSYWRVLRRICSVEMFVHKKVNETAAVRRKCIDDLLRWVENEA  914
              + A    + S++     + WR LR+IC+ ++F    +N   A R K + +L+  V    
Sbjct  111   AVRACYMGEHSLSWIPASAKWRSLRKICNSQLFAVNVLNARKANRHKKVQELIADVN---  167

Query  913   GSIKRGSGIHVTRFVFLATFNLLGNIMFSSDLVDPVSEKGSKFFNAMMGIMERGGTPNIS  734
              S  +G+ I + R  F  T NLL   MFS DL DP SE   +F   + G+ME  G PN+ 
Sbjct  168   ASKVKGNAIEIGRAAFSTTLNLLSRKMFSMDLADPRSETAKEFKKTVWGLMEEAGKPNLG  227

Query  733   DIFPCLRWLDLQGLRTKTDKDLQIALQIVSTFVQKRSKEGQDDSGKRKSDFLDVLLSFEG  554
             D FP L  LD QG++ +         Q+    + +R +  +     ++ D LD LLS   
Sbjct  228   DYFPVLAKLDPQGIQRRMTNHFFKMEQLFDQIIAQRLESRKAHDYVKRDDMLDTLLSISE  287

Query  553   SGKDEPPKLSEHQINIFILEMFLAGTDTTSS  461
                +E   + + ++    L +F AGTDTTSS
Sbjct  288   VNCEE---MDKTKMEHLFLVIFAAGTDTTSS  315


 Score =   140 bits (352),  Expect(2) = 3e-67, Method: Compositional matrix adjust.
 Identities = 63/114 (55%), Positives = 82/114 (72%), Gaps = 0/114 (0%)
 Frame = -1

Query  344  NTALTSSTVEWALTELLRNPKAMTKAKEEIRGIVGPTRRFEESDIDNLQYLQAVVKETLR  165
             T  TSST+EWA+ ELL NPK ++KA+EE+  ++G  +  EESDI  L YLQA++KET R
Sbjct  309  GTDTTSSTLEWAMAELLHNPKKLSKAQEELDQVIGKGKPVEESDIAGLPYLQAIIKETFR  368

Query  164  LHPPAPFLIPRRAIQDTKFMGYDIPKDTQVFINVWAIGRDHESWEDPLSFKPER  3
            LHP  P L+PR+A +D +  GY +PK  QVF+N WAIGRD   W+ P SF+PER
Sbjct  369  LHPAVPLLLPRKAEKDVEICGYIVPKGAQVFVNAWAIGRDPSIWDSPNSFEPER  422



>ref|XP_009372315.1| PREDICTED: geraniol 8-hydroxylase-like [Pyrus x bretschneideri]
Length=500

 Score =   150 bits (380),  Expect(2) = 3e-67, Method: Compositional matrix adjust.
 Identities = 84/271 (31%), Positives = 143/271 (53%), Gaps = 6/271 (2%)
 Frame = -2

Query  1273  NMLDLGSVPHQTIAAMRNKYGPVVWLRIGSVSTLAIQSAKAAAELFKNHDVPFAGRSIGD  1094
             N+L+LG+ PH ++  + ++YGP++ L++G ++T+ I S+  A E+ + HD  F  R++ D
Sbjct  47    NLLELGNKPHLSLTKLSHRYGPIMALQLGQITTVVISSSTVAKEVLRTHDQLFCNRTVPD  106

Query  1093  VMLAQGYNKGSMALAQYGSYWRVLRRICSVEMFVHKKVNETAAVRRKCIDDLLRWVENEA  914
              + A  ++K  MA       WR LR+IC+ ++F  K ++   A R   + DL+  V   A
Sbjct  107   AVRACQHSKYGMAWIPVSPAWRNLRKICNTQLFATKILDANQANRHLKVQDLISDVNESA  166

Query  913   GSIKRGSGIHVTRFVFLATFNLLGNIMFSSDLVDPVSEKGSKFFNAMMGIMERGGTPNIS  734
              +   G  + + R  F  + NLL   +FS DL DP S    +F   + GI E  G PN++
Sbjct  167   VN---GEVVDIGRAAFKTSLNLLSRTVFSVDLADPHSATAREFKELVWGIFEEVGKPNLA  223

Query  733   DIFPCLRWLDLQGLRTKTDKDLQIALQIVSTFVQKRSKEGQDDSGKRKSDFLDVLLSFEG  554
             D FP L+ +D  G+R +     +  L +    + +R +  +       +D LD L++   
Sbjct  224   DYFPVLKKIDPLGIRRRLTGHFRKMLDLFDRLMMQRFESRKVLDYIMTNDMLDTLINISE  283

Query  553   SGKDEPPKLSEHQINIFILEMFLAGTDTTSS  461
                ++   +   +I   +LE+F AGTDTTSS
Sbjct  284   EKNED---MDMDEIQHLLLELFAAGTDTTSS  311


 Score =   134 bits (337),  Expect(2) = 3e-67, Method: Compositional matrix adjust.
 Identities = 62/114 (54%), Positives = 82/114 (72%), Gaps = 0/114 (0%)
 Frame = -1

Query  344  NTALTSSTVEWALTELLRNPKAMTKAKEEIRGIVGPTRRFEESDIDNLQYLQAVVKETLR  165
             T  TSST+EWA+ ELLRNP+ ++K + E++ I+G  +  EESDI  L YLQA++KET R
Sbjct  305  GTDTTSSTLEWAMAELLRNPEKLSKIQAELKQIIGKGKLVEESDIARLPYLQAIIKETFR  364

Query  164  LHPPAPFLIPRRAIQDTKFMGYDIPKDTQVFINVWAIGRDHESWEDPLSFKPER  3
            L+P AP L+PR+A  D +  GY +PK  QVF+N WAIGRD   W++P SF PER
Sbjct  365  LYPVAPLLLPRKAETDVEIGGYIVPKGAQVFVNAWAIGRDPGIWDNPDSFVPER  418



>ref|XP_010499912.1| PREDICTED: cytochrome P450 76C4-like [Camelina sativa]
Length=511

 Score =   147 bits (372),  Expect(2) = 3e-67, Method: Compositional matrix adjust.
 Identities = 67/114 (59%), Positives = 84/114 (74%), Gaps = 0/114 (0%)
 Frame = -1

Query  344  NTALTSSTVEWALTELLRNPKAMTKAKEEIRGIVGPTRRFEESDIDNLQYLQAVVKETLR  165
             T   SSTVEWA+ ELLRNPK MTK ++EI  ++G    F+ESDI  L YLQAV+KET R
Sbjct  312  GTDTNSSTVEWAMAELLRNPKTMTKVQDEINQVIGQNSGFQESDISYLPYLQAVIKETFR  371

Query  164  LHPPAPFLIPRRAIQDTKFMGYDIPKDTQVFINVWAIGRDHESWEDPLSFKPER  3
            LHP APFL+PR+A  D + +G+ + KD+QV +NVWAIGRD   WE+P  F+PER
Sbjct  372  LHPAAPFLLPRKAEIDVEILGFHVLKDSQVLVNVWAIGRDPNLWENPTQFEPER  425


 Score =   137 bits (344),  Expect(2) = 3e-67, Method: Compositional matrix adjust.
 Identities = 81/277 (29%), Positives = 152/277 (55%), Gaps = 14/277 (5%)
 Frame = -2

Query  1273  NMLDLGSVPHQTIAAMRNKYGPVVWLRIGSVSTLAIQSAKAAAELFKNHDVPFAGRSIGD  1094
             N+  +G  PH +   +   YGPV+ L++G ++++ I S  AA E+ + HD+  +GR I +
Sbjct  50    NIHLVGKNPHHSFTKLSKTYGPVMSLKLGCLNSVVIASRDAAREVLRTHDLILSGRYINE  109

Query  1093  VMLAQGYNKGSMALAQYGS-YWRVLRRICSVEMFVHKKVNETAAVRRKCIDDLLRWVENE  917
              + +  +++ S+      S  +R+LRR+    +F  +++  T A+R K + +L+ ++   
Sbjct  110   AIRSNNHHELSVGWVHPSSPRFRMLRRLLVTHLFSPQRIEATKALRMKKVQELINFM---  166

Query  916   AGSIKRGSGIHVTRFVFLATFNLLGNIMFSSDLVDPVSEKGSKFFNAMMGIMERGGTPNI  737
             + S +R   I + R  F+ + N++ NI+FS +L    S+  S F   + G ME  G P++
Sbjct  167   SESSEREEPIDICRASFITSLNIISNILFSVNLGSYDSKDPSAFQEMVTGYMESNGNPDL  226

Query  736   SDIFPCLRWLDLQGLRTKTDKDLQIALQIVSTF-----VQKRSKEGQDDSGKRKSDFLDV  572
             ++ FP +R+LDLQG   K   + +   ++   F     V+  S+  + D   R  DFLD 
Sbjct  227   ANFFPFMRFLDLQGNSKKMKGNSESLFKVFRGFYDARVVENSSRTKEKDVSSR--DFLDA  284

Query  571   LLSFEGSGKDEPPKLSEHQINIFILEMFLAGTDTTSS  461
             L+  +   + + P+++  +I   +L++F+AGTDT SS
Sbjct  285   LIDLK---QGDEPEINIDEIEHLLLDLFVAGTDTNSS  318



>ref|XP_010676979.1| PREDICTED: geraniol 8-hydroxylase-like [Beta vulgaris subsp. 
vulgaris]
Length=500

 Score =   159 bits (402),  Expect(2) = 3e-67, Method: Compositional matrix adjust.
 Identities = 89/273 (33%), Positives = 144/273 (53%), Gaps = 10/273 (4%)
 Frame = -2

Query  1273  NMLDLGSVPHQTIAAMRNKYGPVVWLRIGSVSTLAIQSAKAAAELFKNHDVPFAGRSIGD  1094
             N++  G  PH  +  +  K+GP++ L++G V T+ I SA  A E  K HD+ F  R   D
Sbjct  47    NLVRHGDKPHVGLTQLAEKHGPLMTLQLGQVQTVVISSASMAKEALKTHDISFCNRRTVD  106

Query  1093  VMLAQGYNKGSMALAQYGSYWRVLRRICSVEMFVHKKVNETAAVRRKCIDDLLRWVE--N  920
             V  A+ YN+ S      G  WR +R+ C+V +    ++  +  +RR  ++DL+ +V+  N
Sbjct  107   VFHAERYNENSAVWLPVGPQWRNIRKFCTVHILSTARLVSSERLRRNKVNDLIAYVQKCN  166

Query  919   EAGSIKRGSGIHVTRFVFLATFNLLGNIMFSSDLVDPVSEKGSKFFNAMMGIMERGGTPN  740
             E+     G  + + + VF  + NLL    FS DL DP SE   +F   +  +ME  G  N
Sbjct  167   ES-----GLSVDIGQAVFTTSLNLLSCTFFSEDLGDPNSELAREFKTTIRALMEEAGKLN  221

Query  739   ISDIFPCLRWLDLQGLRTKTDKDLQIALQIVSTFVQKRSKEGQDDSGKRKSDFLDVLLSF  560
              ++ FP LR +DLQG R +    ++  + I +  + +R K  +  +  +  D LDVLL F
Sbjct  222   FANYFPILRKIDLQGGRRRASVHMKKIINIFNNLIDQRLKGKRVSNSLQDIDILDVLLGF  281

Query  559   EGSGKDEPPKLSEHQINIFILEMFLAGTDTTSS  461
             +  G     K+   +I   +L++F+ GTDT+SS
Sbjct  282   DNDGAH---KIETSKIPFLLLDVFIGGTDTSSS  311


 Score =   125 bits (314),  Expect(2) = 3e-67, Method: Compositional matrix adjust.
 Identities = 59/114 (52%), Positives = 78/114 (68%), Gaps = 0/114 (0%)
 Frame = -1

Query  344  NTALTSSTVEWALTELLRNPKAMTKAKEEIRGIVGPTRRFEESDIDNLQYLQAVVKETLR  165
             T  +SSTVEWA+ ELL+ P+ + KA+ E+R  +G     +ES I  L YL+AVVKETLR
Sbjct  305  GTDTSSSTVEWAMAELLQKPEKLKKAQAELRENIGKGNALDESHIFRLPYLRAVVKETLR  364

Query  164  LHPPAPFLIPRRAIQDTKFMGYDIPKDTQVFINVWAIGRDHESWEDPLSFKPER  3
            LHPP P L PR+   D    G+ +PK  ++ INVWAIGRD ++W+ P SF+PER
Sbjct  365  LHPPVPILAPRKVDADVMIFGFTVPKKAELLINVWAIGRDPDTWKHPNSFEPER  418



>ref|XP_011029123.1| PREDICTED: geraniol 8-hydroxylase-like [Populus euphratica]
Length=501

 Score =   146 bits (369),  Expect(2) = 3e-67, Method: Compositional matrix adjust.
 Identities = 84/271 (31%), Positives = 142/271 (52%), Gaps = 5/271 (2%)
 Frame = -2

Query  1273  NMLDLGSVPHQTIAAMRNKYGPVVWLRIGSVSTLAIQSAKAAAELFKNHDVPFAGRSIGD  1094
             N+LDLG  PH+++A +   +GP++ L++G ++T+ I S   A E+ + HDV  + R+I D
Sbjct  48    NLLDLGDKPHKSLARLAKTHGPLMSLKLGQITTVVISSPTLAKEVLQKHDVSLSNRTIPD  107

Query  1093  VMLAQGYNKGSMALAQYGSYWRVLRRICSVEMFVHKKVNETAAVRRKCIDDLLRWVENEA  914
              + +  +++  +        WR LR++C+  +F ++K++    +R K I +L+  V+   
Sbjct  108   AIRSHKHHELGLPWVPIAMRWRNLRKVCNSYIFTNQKLDANQELRLKKIQELVALVQEHC  167

Query  913   GSIKRGSGIHVTRFVFLATFNLLGNIMFSSDLVDPVSEKGSKFFNAMMGIMERGGTPNIS  734
              +   G  + + +  F    N L N +FS +L D  SE  S+    +  IME  G PN++
Sbjct  168   LA---GEAMVIGQAAFTTALNALSNSIFSLNLSDSNSETASQLKEVVGCIMEEAGKPNLA  224

Query  733   DIFPCLRWLDLQGLRTKTDKDLQIALQIVSTFVQKRSKEGQDDSGKRKSDFLDVLLSFEG  554
             D FP L  +DLQG++ +        L I    V +R +  +       +D LD LL+   
Sbjct  225   DYFPVLGRIDLQGIKRRMTIHFGKILNIFDGIVNERLQLRKMQGYVPVNDMLDTLLTISE  284

Query  553   SGKDEPPKLSEHQINIFILEMFLAGTDTTSS  461
                ++  K S  QI    L++F AGTDTTSS
Sbjct  285   DSNEDIMKTS--QIKHLFLDLFAAGTDTTSS  313


 Score =   138 bits (347),  Expect(2) = 3e-67, Method: Compositional matrix adjust.
 Identities = 64/114 (56%), Positives = 80/114 (70%), Gaps = 0/114 (0%)
 Frame = -1

Query  344  NTALTSSTVEWALTELLRNPKAMTKAKEEIRGIVGPTRRFEESDIDNLQYLQAVVKETLR  165
             T  TSST+EWA+ ELL NP+ ++KA+ E+   +G     EESDI  L YLQAV+KET R
Sbjct  307  GTDTTSSTLEWAMAELLHNPRTLSKARTELEQTIGKGCLIEESDIVRLPYLQAVIKETFR  366

Query  164  LHPPAPFLIPRRAIQDTKFMGYDIPKDTQVFINVWAIGRDHESWEDPLSFKPER  3
            LHP  P L+PR+A ++ +  GY IPK  Q+F+NVWAIGRD   WEDP SF PER
Sbjct  367  LHPAVPLLLPRKAGENVEISGYTIPKGAQLFVNVWAIGRDPSLWEDPESFVPER  420



>ref|XP_004233427.1| PREDICTED: geraniol 8-hydroxylase-like [Solanum lycopersicum]
Length=491

 Score =   142 bits (359),  Expect(2) = 4e-67, Method: Compositional matrix adjust.
 Identities = 89/272 (33%), Positives = 140/272 (51%), Gaps = 12/272 (4%)
 Frame = -2

Query  1273  NMLDLGSVPHQTIAAMRNKYGPVVWLRIGSVSTLAIQSAKAAAELFKNHDVPFAGRSIGD  1094
             N+  LG  PH ++  +  K+GP++ L+ G ++T+ I S+  A E+ +  D+ F+ R I D
Sbjct  42    NLHLLGHKPHVSLTQLAVKHGPIMNLKFGQINTVIISSSVLAREVTQKKDLTFSNRCIPD  101

Query  1093  VMLAQGYNKGSMALAQYGSYWRVLRRICSVEMFVHKKVNETAAVRRKCIDDLLRWVENEA  914
              + A  +N  S       S WR LR+I +  +F   +++    +R K I +L+ +  N  
Sbjct  102   ALRACNHNDFSAIWLPVDSQWRKLRKIMNYHIFSGNRLDANEHLRSKKIQELIDYCGNCG  161

Query  913   GSIKRGSGIHVTRFVFLATFNLLGNIMFSSDLVDPVSEKGSKFFNAMMGIMERGGTPNIS  734
                K G  ++++R  F    NLL N  FS DL DP ++   +F   +  I    G PN+ 
Sbjct  162   ---KVGETVNISRATFRTAMNLLSNTFFSIDLTDPFTDSAKEFKELVSNISIEAGKPNVV  218

Query  733   DIFPCLRWLDLQGLRTKTDKDLQIALQIVSTFVQKRSKEGQDDSGKRKS-DFLDVLLSFE  557
             D FP LR +D QG+R +  K     L I+S  + +R KE     GK  + D LD LL+  
Sbjct  219   DFFPFLRKIDPQGVRRRMTKYFTKILHIMSDLIDERLKERS--MGKHANVDVLDALLNI-  275

Query  556   GSGKDEPPKLSEHQINIFILEMFLAGTDTTSS  461
                   P ++  +QI    L++F AGTDTTS+
Sbjct  276   -----CPKEIDRNQIEQLCLDLFEAGTDTTSN  302


 Score =   141 bits (356),  Expect(2) = 4e-67, Method: Compositional matrix adjust.
 Identities = 61/113 (54%), Positives = 81/113 (72%), Gaps = 0/113 (0%)
 Frame = -1

Query  341  TALTSSTVEWALTELLRNPKAMTKAKEEIRGIVGPTRRFEESDIDNLQYLQAVVKETLRL  162
            T  TS+T+EWA+ ELL+NP  M KA+EE+  ++G  +    +D+ NL YL+ +VKE  R+
Sbjct  297  TDTTSNTLEWAMAELLKNPHTMKKAQEELAQVIGRGKLINAADVANLPYLRCIVKENFRI  356

Query  161  HPPAPFLIPRRAIQDTKFMGYDIPKDTQVFINVWAIGRDHESWEDPLSFKPER  3
            HP  PFLIPR+  +D  F GY IPKD+Q+ +NVWAIGRD   WE+PL FKPER
Sbjct  357  HPQVPFLIPRKTEEDVDFCGYIIPKDSQILVNVWAIGRDSSLWENPLDFKPER  409



>ref|XP_008241321.1| PREDICTED: cytochrome P450 76A1 [Prunus mume]
Length=516

 Score =   236 bits (601),  Expect = 4e-67, Method: Compositional matrix adjust.
 Identities = 116/268 (43%), Positives = 172/268 (64%), Gaps = 6/268 (2%)
 Frame = -2

Query  1273  NMLDLG-SVPHQTIAAMRNKYGPVVWLRIGSVSTLAIQSAKAAAELFKNHDVPFAGRSIG  1097
             N+  LG   PH++ A +   +GP++ L +GS+ST+ I S++ A E+FKNHDV  AGR I 
Sbjct  41    NIFQLGLGPPHESFAILARNHGPIMTLWLGSMSTVVISSSQVAREMFKNHDVVLAGRKIY  100

Query  1096  DVMLAQGYNKGSMALAQYGSYWRVLRRICSVEMFVHKKVNETAAVRRKCIDDLLRWVENE  917
             + M     N+GS+  AQYG +WR+LRR+C+ E FV  +++    VR KCID +++++E+ 
Sbjct  101   EAMKGDYGNEGSLITAQYGPHWRMLRRLCTTEFFVTSRLDAMCRVRAKCIDGMVQFIEDA  160

Query  916   AGSIK-RGSGIHVTRFVFLATFNLLGNIMFSSDLVDPVSEKGSKFFNAMMGIMERGGTPN  740
             A  +  +  GI + RF+FL  FNL+GN+MFS DL+DP SE+G+ FF     +ME  G PN
Sbjct  161   ASEMSTKTDGIDLGRFIFLMAFNLIGNLMFSKDLLDPKSERGAMFFYHAGKVMELAGKPN  220

Query  739   ISDIFPCLRWLDLQGLRTKTDKDLQIALQIVSTFVQKR---SKEGQDDSGKRKSDFLDVL  569
             ++D FP LRWLD QG+R  T   ++ A +I   F+++R    + G  D  +R  DFLDVL
Sbjct  221   MADFFPILRWLDPQGIRRNTQFHVEKAFEIAGEFIRERMESMENGGYDGIERTKDFLDVL  280

Query  568   LSFEGSGKDEPPKLSEHQ-INIFILEMF  488
             L + G G DEP + S  + +N+ + EMF
Sbjct  281   LEYRGDGVDEPSRFSSSRTVNVIVFEMF  308


 Score =   140 bits (354),  Expect = 5e-33, Method: Compositional matrix adjust.
 Identities = 60/106 (57%), Positives = 81/106 (76%), Gaps = 0/106 (0%)
 Frame = -1

Query  320  VEWALTELLRNPKAMTKAKEEIRGIVGPTRRFEESDIDNLQYLQAVVKETLRLHPPAPFL  141
            +EWA++ELL NPK + K + E+R  +  + + +E DI+NL YL+AV+KETLRLHPP PFL
Sbjct  319  LEWAMSELLNNPKTLKKVQAELRSTISSSDKLQEKDIENLPYLKAVIKETLRLHPPLPFL  378

Query  140  IPRRAIQDTKFMGYDIPKDTQVFINVWAIGRDHESWEDPLSFKPER  3
            +P  A+   K +G+ IPK TQ+ +NVWAIGRD ++WEDPL FKPER
Sbjct  379  VPHMAMDSCKMLGHHIPKGTQILVNVWAIGRDPKTWEDPLLFKPER  424



>ref|XP_010478790.1| PREDICTED: cytochrome P450 76C4-like isoform X1 [Camelina sativa]
Length=511

 Score =   146 bits (369),  Expect(2) = 5e-67, Method: Compositional matrix adjust.
 Identities = 66/113 (58%), Positives = 85/113 (75%), Gaps = 0/113 (0%)
 Frame = -1

Query  341  TALTSSTVEWALTELLRNPKAMTKAKEEIRGIVGPTRRFEESDIDNLQYLQAVVKETLRL  162
            T   SSTVEWA+ ELLRNPK MTK ++EI  ++G    F+ESDI  L YLQAV+KET RL
Sbjct  313  TDTNSSTVEWAMAELLRNPKTMTKVQDEINHVIGQNEDFQESDISKLPYLQAVIKETFRL  372

Query  161  HPPAPFLIPRRAIQDTKFMGYDIPKDTQVFINVWAIGRDHESWEDPLSFKPER  3
            HP APFL+PR+A  D + +G+ + K++QV +NVWAIGRD + WE+P  F+PER
Sbjct  373  HPAAPFLLPRKAETDVEILGFPVLKESQVLVNVWAIGRDPKLWENPTQFEPER  425


 Score =   137 bits (346),  Expect(2) = 5e-67, Method: Compositional matrix adjust.
 Identities = 80/277 (29%), Positives = 152/277 (55%), Gaps = 14/277 (5%)
 Frame = -2

Query  1273  NMLDLGSVPHQTIAAMRNKYGPVVWLRIGSVSTLAIQSAKAAAELFKNHDVPFAGRSIGD  1094
             N+  +G  PH +   +   YGPV+ L++G ++++ I S  AA E+ + HD+  +GR I +
Sbjct  50    NIHLVGKNPHHSFTNLSKTYGPVMSLKLGCLNSVVIASRDAAREVLRTHDLILSGRYINE  109

Query  1093  VMLAQGYNKGSMALAQYGS-YWRVLRRICSVEMFVHKKVNETAAVRRKCIDDLLRWVENE  917
              + +  +++ S+      S  +R+LRR+   ++F  +++  T A+R K + +L+ ++   
Sbjct  110   AIRSNNHHELSVGWVHPSSPRFRMLRRLLVTQLFSPQRIEATKALRMKKVQELINFI---  166

Query  916   AGSIKRGSGIHVTRFVFLATFNLLGNIMFSSDLVDPVSEKGSKFFNAMMGIMERGGTPNI  737
             + S +R   + + R  F+ + N++ NI+FS +L    S+  S F   + G ME  G P++
Sbjct  167   SESSEREEPLDICRASFITSLNIISNILFSVNLGSYDSKDPSAFQEMVTGYMESNGNPDL  226

Query  736   SDIFPCLRWLDLQGLRTKTDKDLQIALQIVSTF-----VQKRSKEGQDDSGKRKSDFLDV  572
             ++ FP +R+LDLQG   K  ++ +   ++   F     V+  S+  + D   R  DFLD 
Sbjct  227   ANFFPFMRFLDLQGNSKKMKRNSESLFKVFRGFYDARVVENSSRTEEKDVSSR--DFLDA  284

Query  571   LLSFEGSGKDEPPKLSEHQINIFILEMFLAGTDTTSS  461
             L+  +   + E   ++  +I   +L++F+AGTDT SS
Sbjct  285   LIDLQQGDQSE---INIDEIEHLLLDLFVAGTDTNSS  318



>ref|XP_003556053.1| PREDICTED: geraniol 8-hydroxylase-like [Glycine max]
Length=501

 Score =   149 bits (376),  Expect(2) = 5e-67, Method: Compositional matrix adjust.
 Identities = 83/271 (31%), Positives = 148/271 (55%), Gaps = 10/271 (4%)
 Frame = -2

Query  1273  NMLDLGSVPHQTIAAMRNKYGPVVWLRIGSVSTLAIQSAKAAAELFKNHDVPFAGRSIGD  1094
             N+L+LG  PH+++A +   +GP++ L++G ++T+ + SA+ A E+   +D   + R+I  
Sbjct  47    NLLELGEKPHKSLAKLAKIHGPIMSLKLGQITTVVVSSAQMAKEVLLTNDQFLSNRTIPQ  106

Query  1093  VMLAQGYNKGSMALAQYGSYWRVLRRICSVEMFVHKKVNETAAVRRKCIDDLLRWVENEA  914
              +    + + S+A       WR LR+IC+ ++F HK ++ +  VRRK +  L+  +    
Sbjct  107   SVSVLNHEQYSLAFMPISPLWRELRKICNTQLFAHKSLDASQDVRRKIVQQLVSDIHQ--  164

Query  913   GSIKRGSGIHVTRFVFLATFNLLGNIMFSSDLVDPVSEKGSKFFNAMMGIMERGGTPNIS  734
              S + G  + +    F  T NLL N +FS DL+     K  +F + +  I +  GTPN++
Sbjct  165   -SSQIGEAVDIGTAAFKTTINLLSNTIFSMDLIHSTG-KAEEFKDLVTNITKLVGTPNLA  222

Query  733   DIFPCLRWLDLQGLRTKTDKDLQIALQIVSTFVQKRSKEGQDDSGKRKSDFLDVLLSFEG  554
             D F  L+ +D QG++ +  K+++  L +    V +R K  Q + GK  +D LD +L+   
Sbjct  223   DFFQVLKLVDPQGVKRRQSKNVKKVLDMFDDLVSQRLK--QREEGKVHNDMLDAMLNISK  280

Query  553   SGKDEPPKLSEHQINIFILEMFLAGTDTTSS  461
               K     + EH  +    ++F+AGTDTT+S
Sbjct  281   DNKYMDKNMIEHLSH----DIFVAGTDTTAS  307


 Score =   135 bits (339),  Expect(2) = 5e-67, Method: Compositional matrix adjust.
 Identities = 62/114 (54%), Positives = 80/114 (70%), Gaps = 1/114 (1%)
 Frame = -1

Query  341  TALTSSTVEWALTELLRNPKAMTKAKEEIRGIVGPTRR-FEESDIDNLQYLQAVVKETLR  165
            T  T+ST+EWA+TEL+RNP  M+KAK+E+  ++       EE+DI  L YLQA++KETLR
Sbjct  302  TDTTASTLEWAMTELVRNPDVMSKAKQELEQMISKGNNPIEEADIGKLPYLQAIIKETLR  361

Query  164  LHPPAPFLIPRRAIQDTKFMGYDIPKDTQVFINVWAIGRDHESWEDPLSFKPER  3
            LHPP PFL+PR+A +D    GY IPKD QV +N W I RD   WE+P  F P+R
Sbjct  362  LHPPVPFLLPRKADKDVDIGGYTIPKDAQVLVNTWTICRDPTLWENPSVFSPDR  415



>ref|XP_006382516.1| hypothetical protein POPTR_0005s02900g [Populus trichocarpa]
 gb|ERP60313.1| hypothetical protein POPTR_0005s02900g [Populus trichocarpa]
Length=505

 Score =   235 bits (600),  Expect = 5e-67, Method: Compositional matrix adjust.
 Identities = 112/264 (42%), Positives = 168/264 (64%), Gaps = 4/264 (2%)
 Frame = -2

Query  1273  NMLDLGSVPHQTIAAMRNKYGPVVWLRIGSVSTLAIQSAKAAAELFKNHDVPFAGRSIGD  1094
             N+  LG  PH++ A +   +GP++ + +GS+  + I S++ A E+FKNHD   AGR I +
Sbjct  47    NIFLLGWAPHESFANLARVHGPIMTIWLGSMCNVVISSSEVAREMFKNHDAVLAGRKIYE  106

Query  1093  VMLAQGYNKGSMALAQYGSYWRVLRRICSVEMFVHKKVNETAAVRRKCIDDLLRWVENEA  914
              M     N+GS+  AQYG +WR+LRR+C+ E FV  +++     R +CID +L ++E+  
Sbjct  107   AMRGDFGNEGSIITAQYGPHWRMLRRLCTTEFFVTSRLDAMQGARTRCIDGMLLYIED--  164

Query  913   GSIKRGSGIHVTRFVFLATFNLLGNIMFSSDLVDPVSEKGSKFFNAMMGIMERGGTPNIS  734
             GS    S I + R++FL  FNL+GN+MFS DL+DP SEKG+KFF     +ME  G PN++
Sbjct  165   GSANGTSAIDLGRYIFLMAFNLIGNLMFSKDLLDPKSEKGAKFFQHAGKVMELAGKPNMA  224

Query  733   DIFPCLRWLDLQGLRTKTDKDLQIALQIVSTFVQKRSKEGQDDSGK--RKSDFLDVLLSF  560
             D  P LRWLD QG+R KT   +  A +I   F+++R++  Q ++ +  ++ D+LDVLL F
Sbjct  225   DFLPILRWLDPQGIRRKTQFHVARAFEIAGGFIKERTESTQKENSRDDKRKDYLDVLLEF  284

Query  559   EGSGKDEPPKLSEHQINIFILEMF  488
              G G +EP + S   IN  +LEMF
Sbjct  285   RGDGVEEPSRFSSTTINAIVLEMF  308


 Score =   115 bits (287),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 52/106 (49%), Positives = 71/106 (67%), Gaps = 11/106 (10%)
 Frame = -1

Query  320  VEWALTELLRNPKAMTKAKEEIRGIVGPTRRFEESDIDNLQYLQAVVKETLRLHPPAPFL  141
            +EWA+ ELLRNPK M   + E+R  +G  ++ E+ DI+NL YL+AV++ETLRLHPP PFL
Sbjct  319  LEWAMAELLRNPKVMKTVQSELRSTIGLNKKLEDKDIENLPYLKAVIRETLRLHPPLPFL  378

Query  140  IPRRAIQDTKFMGYDIPKDTQVFINVWAIGRDHESWEDPLSFKPER  3
            +P  A+   K +GY IPK+T +            +W+DPL FKPER
Sbjct  379  VPHMAMNPCKMLGYYIPKETTIL-----------TWDDPLVFKPER  413



>ref|XP_003557080.2| PREDICTED: geraniol 8-hydroxylase-like [Glycine max]
Length=483

 Score =   152 bits (384),  Expect(2) = 5e-67, Method: Compositional matrix adjust.
 Identities = 84/271 (31%), Positives = 147/271 (54%), Gaps = 10/271 (4%)
 Frame = -2

Query  1273  NMLDLGSVPHQTIAAMRNKYGPVVWLRIGSVSTLAIQSAKAAAELFKNHDVPFAGRSIGD  1094
             N+L+LG  PH+++A +   +GP++ L++G ++T+ + SA+ A E+   +D   + R+I  
Sbjct  32    NLLELGEKPHKSLAKLAKIHGPIISLKLGQITTVVVSSAQMAKEVLLTNDQFLSNRTIPQ  91

Query  1093  VMLAQGYNKGSMALAQYGSYWRVLRRICSVEMFVHKKVNETAAVRRKCIDDLLRWVENEA  914
              +    + + S+A       WR LR+IC+ ++F HK ++ +  VRRK +  L+  +    
Sbjct  92    SVSVLNHEQYSLAFMPISPLWRELRKICNTQLFAHKSLDASQDVRRKIVQQLVTDIHE--  149

Query  913   GSIKRGSGIHVTRFVFLATFNLLGNIMFSSDLVDPVSEKGSKFFNAMMGIMERGGTPNIS  734
              S + G  + +    F  T NLL N +FS DL+     K  +F + +  I +  G+PN++
Sbjct  150   -SSQMGEAVDIGTAAFKTTINLLSNTIFSVDLIHSTG-KAEEFKDLVTNITKLVGSPNLA  207

Query  733   DIFPCLRWLDLQGLRTKTDKDLQIALQIVSTFVQKRSKEGQDDSGKRKSDFLDVLLSFEG  554
             D FP L+ LD Q +R +  K+ +  L +    V +R K  Q + GK  +D LD +L+   
Sbjct  208   DFFPVLKLLDPQSVRRRQSKNSKKVLDMFDNLVSQRLK--QREEGKVHNDMLDAMLNISK  265

Query  553   SGKDEPPKLSEHQINIFILEMFLAGTDTTSS  461
               K     + EH  +    ++F+AGTDTT+S
Sbjct  266   ENKYMDKNMIEHLSH----DIFVAGTDTTAS  292


 Score =   131 bits (330),  Expect(2) = 5e-67, Method: Compositional matrix adjust.
 Identities = 60/113 (53%), Positives = 79/113 (70%), Gaps = 0/113 (0%)
 Frame = -1

Query  341  TALTSSTVEWALTELLRNPKAMTKAKEEIRGIVGPTRRFEESDIDNLQYLQAVVKETLRL  162
            T  T+ST+EWA+TEL+R+P  M+KAK+E+  I       EE DI  L YLQA+VKETLRL
Sbjct  287  TDTTASTLEWAMTELVRHPHVMSKAKQELEQITSKGNPIEEGDIGKLPYLQAIVKETLRL  346

Query  161  HPPAPFLIPRRAIQDTKFMGYDIPKDTQVFINVWAIGRDHESWEDPLSFKPER  3
            +PP PFL+PR+A +D    GY IPKD +V +N+W I RD   W++P  F P+R
Sbjct  347  YPPVPFLLPRKADRDVDIGGYTIPKDAKVLVNMWTICRDPTLWDNPTMFSPDR  399



>ref|XP_006360236.1| PREDICTED: geraniol 8-hydroxylase-like [Solanum tuberosum]
Length=493

 Score =   148 bits (373),  Expect(2) = 6e-67, Method: Compositional matrix adjust.
 Identities = 88/273 (32%), Positives = 146/273 (53%), Gaps = 13/273 (5%)
 Frame = -2

Query  1273  NMLDLGSVPHQTIAAMRNKYGPVVWLRIGSVSTLAIQSAKAAAELFKNHDVPFAGRSIGD  1094
             N+  LG  PH ++A +  K+GP++ L++G ++T+ I S+  A ++ +  D+ F+ R + D
Sbjct  43    NLHLLGHKPHISLAQLAKKHGPIMNLKLGQINTVVISSSALAKQVLQKQDLAFSNRFVPD  102

Query  1093  VMLAQGYNKGSMA-LAQYGSYWRVLRRICSVEMFVHKKVNETAAVRRKCIDDLLRWVENE  917
              + A  ++  S+  L+   S WR LR++ +  +F   K++    VR K I DL+ +  N 
Sbjct  103   ALRACNHSGLSVVWLSVNNSQWRTLRKVMNSHIFSGNKLDANEHVRTKKIQDLINYCHNC  162

Query  916   AGSIKRGSGIHVTRFVFLATFNLLGNIMFSSDLVDPVSEKGSKFFNAMMGIMERGGTPNI  737
             +   K G  + + R  F  + NL+ N +FS DL DP S+   +F   +  IM   G PN+
Sbjct  163   S---KVGEAVDMGRASFRTSLNLISNTIFSKDLTDPFSDSAKEFKELVWNIMVEVGKPNL  219

Query  736   SDIFPCLRWLDLQGLRTKTDKDLQIALQIVSTFVQKRSKEGQDDSGKRKS-DFLDVLLSF  560
              D FP L+ +D QG+R +  +     L ++S  + +R KE +   G R + D LD LL+ 
Sbjct  220   VDYFPLLKRIDPQGIRRRLTEYFSKVLHLISGLIDERIKERK--MGNRANVDVLDALLNI  277

Query  559   EGSGKDEPPKLSEHQINIFILEMFLAGTDTTSS  461
                    P ++  + I    LEMF AGTDT S+
Sbjct  278   ------SPDEIDRNHIEHLCLEMFAAGTDTISN  304


 Score =   135 bits (341),  Expect(2) = 6e-67, Method: Compositional matrix adjust.
 Identities = 60/114 (53%), Positives = 80/114 (70%), Gaps = 0/114 (0%)
 Frame = -1

Query  344  NTALTSSTVEWALTELLRNPKAMTKAKEEIRGIVGPTRRFEESDIDNLQYLQAVVKETLR  165
             T   S+T+EWA+ ELL+N   + KA++E+  I+G  +  +E+D+  L YL+ +VKET R
Sbjct  298  GTDTISNTLEWAMAELLKNQHTLEKAQKELEQIIGRGKLIDEADVAKLPYLRCIVKETFR  357

Query  164  LHPPAPFLIPRRAIQDTKFMGYDIPKDTQVFINVWAIGRDHESWEDPLSFKPER  3
            +HP  PFLI R+  +D  F GY IPKD+QV +NVWAIGRD   WEDPL FKPER
Sbjct  358  IHPQVPFLIQRKTEEDVDFCGYTIPKDSQVLVNVWAIGRDSSLWEDPLDFKPER  411



>ref|XP_010654031.1| PREDICTED: cytochrome P450 76A1 [Vitis vinifera]
Length=515

 Score =   235 bits (600),  Expect = 7e-67, Method: Compositional matrix adjust.
 Identities = 121/266 (45%), Positives = 168/266 (63%), Gaps = 9/266 (3%)
 Frame = -2

Query  1273  NMLDLGSVPHQTIAAMRNKYGPVVWLRIGSVSTLAIQSAKAAAELFKNHDVPFAGRSIGD  1094
             N+  LG  PH + A +  K+GP++ L +GS+ST+ I S + A E+FKNHDV  AGR I +
Sbjct  47    NIFQLGWAPHVSFAKLAGKHGPIMTLWLGSMSTVVISSNEVAREMFKNHDVVLAGRKIYE  106

Query  1093  VMLAQGYNKGSMALAQYGSYWRVLRRICSVEMFVHKKVNETAAVRRKCIDDLLRWVENEA  914
              M     N+GS+  AQYG  WR+LRR+C+ E FV  +++    VR  CID ++++V  EA
Sbjct  107   AMKGDRGNEGSIITAQYGPQWRMLRRLCTSEFFVTSRLDAMRGVRGGCIDRMVQFV-TEA  165

Query  913   GSIKRGSGIH---VTRFVFLATFNLLGNIMFSSDLVDPVSEKGSKFFNAMMGIMERGGTP  743
             G+    SG H   V RF+FL  FNL+GN+MFS DL+DP SE+G++FF     +ME  G P
Sbjct  166   GT----SGTHAIDVGRFIFLMAFNLIGNLMFSKDLLDPKSERGAEFFYHAGKVMELAGRP  221

Query  742   NISDIFPCLRWLDLQGLRTKTDKDLQIALQIVSTFVQKRSKEGQDDSGKRKS-DFLDVLL  566
             N++D  P LRW D QG+R KT   ++ A  I   F+++R +     SG+ KS DFLDVLL
Sbjct  222   NVADFLPILRWFDPQGIRRKTQFHVERAFAIAGGFIKERMETMAKGSGEAKSKDFLDVLL  281

Query  565   SFEGSGKDEPPKLSEHQINIFILEMF  488
              F G G +EP + S   IN+ + EMF
Sbjct  282   EFRGDGVEEPSRFSSRTINVIVFEMF  307


 Score =   139 bits (350),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 60/106 (57%), Positives = 79/106 (75%), Gaps = 0/106 (0%)
 Frame = -1

Query  320  VEWALTELLRNPKAMTKAKEEIRGIVGPTRRFEESDIDNLQYLQAVVKETLRLHPPAPFL  141
            +EWA+ ELL  P+ + K + E+R +V P  + EE D++NL YL AV+KETLRLHPP PFL
Sbjct  318  LEWAMAELLHTPRILNKVQAELRSVVKPGSKLEEKDMENLPYLIAVIKETLRLHPPLPFL  377

Query  140  IPRRAIQDTKFMGYDIPKDTQVFINVWAIGRDHESWEDPLSFKPER  3
            +P  A+   K +GY IPK+TQV +NVWAIGRD ++W+DPL F PER
Sbjct  378  VPHMAMNSCKMLGYCIPKETQVLVNVWAIGRDPKTWKDPLVFMPER  423



>ref|XP_006293636.1| hypothetical protein CARUB_v10022591mg, partial [Capsella rubella]
 gb|EOA26534.1| hypothetical protein CARUB_v10022591mg, partial [Capsella rubella]
Length=943

 Score =   142 bits (358),  Expect(2) = 9e-67, Method: Compositional matrix adjust.
 Identities = 66/114 (58%), Positives = 80/114 (70%), Gaps = 0/114 (0%)
 Frame = -1

Query  344  NTALTSSTVEWALTELLRNPKAMTKAKEEIRGIVGPTRRFEESDIDNLQYLQAVVKETLR  165
             T   SSTVEWA+ ELLRNP+ M KA+ EI  ++G     EESDI  L YLQAVVKET R
Sbjct  744  GTDTNSSTVEWAMAELLRNPETMAKAQSEIESVIGEKGVVEESDISELPYLQAVVKETFR  803

Query  164  LHPPAPFLIPRRAIQDTKFMGYDIPKDTQVFINVWAIGRDHESWEDPLSFKPER  3
            LHP  P L+PR+A  D + +G+ + KDTQV +NVWAIGRD   WE+P  F+PER
Sbjct  804  LHPAVPLLVPRKAESDVEVLGFLVAKDTQVLVNVWAIGRDPSVWENPTRFEPER  857


 Score =   140 bits (354),  Expect(2) = 9e-67, Method: Compositional matrix adjust.
 Identities = 83/277 (30%), Positives = 157/277 (57%), Gaps = 14/277 (5%)
 Frame = -2

Query  1273  NMLDLGSVPHQTIAAMRNKYGPVVWLRIGSVSTLAIQSAKAAAELFKNHDVPFAGRSIGD  1094
             N+  +G  PH + A +   YGP++ L+ GS++T+ + S +AA E+ + HD  F+ R   +
Sbjct  482   NIHLVGKNPHHSFADLSKTYGPIMSLKFGSLNTVVVTSPEAAREVLRTHDQIFSIRCPPN  541

Query  1093  VMLAQGYNKGSMA-LAQYGSYWRVLRRICSVEMFVHKKVNETAAVRRKCIDDLLRWVENE  917
              +L+  +++ S+  L    S WR+LR++ + ++F  +++  T  +R   + +L+ ++   
Sbjct  542   SILSINHHEVSVVWLPPSSSRWRLLRKLSATQLFSPQRIEGTKTLRVNKVKELVSYI---  598

Query  916   AGSIKRGSGIHVTRFVFLATFNLLGNIMFSSDLVDPVSEKGSKFFNAMMGIMERGGTPNI  737
             + S +R   + ++R  F+   N++ NI+FS DL    S + + F + ++G+ME  G P+ 
Sbjct  599   SESSEREKAVDISRATFITALNIMSNILFSVDLCSYNSNESNGFQDTVIGVMESVGNPDA  658

Query  736   SDIFPCLRWLDLQG----LRTKTDKDLQIALQIVSTFVQKRS-KEGQDDSGKRKSDFLDV  572
             S+ FP L +LDLQG    ++  T++  ++   I++   +++S ++   D   R  DFLD 
Sbjct  659   SNYFPFLGFLDLQGNKKTMKACTERLFKVFRGIINAKTEEKSLQKNPKDVTDR--DFLDT  716

Query  571   LLSFEGSGKDEPPKLSEHQINIFILEMFLAGTDTTSS  461
             LL      + E   L+ + I  F+L++F AGTDT SS
Sbjct  717   LLDLTEGDEAE---LNTNDIEHFLLDLFGAGTDTNSS  750


 Score =   142 bits (357),  Expect(2) = 2e-64, Method: Compositional matrix adjust.
 Identities = 66/114 (58%), Positives = 87/114 (76%), Gaps = 1/114 (1%)
 Frame = -1

Query  344  NTALTSSTVEWALTELLRNPKAMTKAKEEIRGIVGPTRRFEESDIDNLQYLQAVVKETLR  165
             T   SST+EWA+TELLR+P+ M KA+ EIR ++G     +ESDI +L YLQA+VKETLR
Sbjct  281  GTDTNSSTMEWAMTELLRSPEKMVKAQSEIRQVIGENGVVQESDIPSLPYLQAIVKETLR  340

Query  164  LHPPAPFLIPRRAIQDTKFMGYDIPKDTQVFINVWAIGRDHESWEDPLSFKPER  3
            LHPPA  LIPR++  D + +G+ IP+D+QV +NVWAIGRD   WE+P+ F+PER
Sbjct  341  LHPPAA-LIPRKSESDVQILGFFIPEDSQVLVNVWAIGRDSNVWENPMKFEPER  393


 Score =   133 bits (335),  Expect(2) = 2e-64, Method: Compositional matrix adjust.
 Identities = 77/274 (28%), Positives = 145/274 (53%), Gaps = 6/274 (2%)
 Frame = -2

Query  1273  NMLDLGSVPHQTIAAMRNKYGPVVWLRIGSVSTLAIQSAKAAAELFKNHDVPFAGRSIGD  1094
             N+  LG  PH+++AA    YGP++ L++G ++ + I S +AA E  + HD   + R+  D
Sbjct  17    NIFQLGCNPHRSLAAFSKTYGPIMSLKLGRLTAVVISSPEAAKEALRTHDHVMSARTFND  76

Query  1093  VMLAQGYNKGSMALAQYGSYWRVLRRICSVEMFVHKKVNETAAVRRKCIDDLLRWVENEA  914
              + A  ++K S+        WR L++  S  +   + ++   ++R + +++L+  V    
Sbjct  77    PIRAFDHHKHSIVWIPPSPRWRFLKKTISKYLLSPQNLDVIQSLRTRKVEELVSLVNQ--  134

Query  913   GSIKRGSGIHVTRFVFLATFNLLGNIMFSSDLVDPVSEKGS-KFFNAMMGIMERGGTPNI  737
                +RG  I + R  F+ +FN + N +FS DL    S   S +F   ++ +M+  G PN+
Sbjct  135   -FCERGEAIDLARASFVTSFNNISNALFSVDLASYGSNSSSYEFHETVVHLMKISGKPNV  193

Query  736   SDIFPCLRWLDLQGLRTKTDKDLQIALQIVSTFVQKR--SKEGQDDSGKRKSDFLDVLLS  563
              D F  +R+LDLQG R +    ++   +++  F+  R   +  Q ++  +++  +D+L S
Sbjct  194   GDYFQYMRFLDLQGTRKEAVVCIERLFKVIQEFIDARLAKRLSQTETEHKEASSIDMLDS  253

Query  562   FEGSGKDEPPKLSEHQINIFILEMFLAGTDTTSS  461
                  +    +LS + I   +L++F+AGTDT SS
Sbjct  254   LLDHTQQNEAELSINDIKHLLLDVFVAGTDTNSS  287



>gb|AAS92624.1| cytochrome P450 [Hypericum androsaemum]
Length=498

 Score =   146 bits (369),  Expect(2) = 9e-67, Method: Compositional matrix adjust.
 Identities = 88/273 (32%), Positives = 142/273 (52%), Gaps = 15/273 (5%)
 Frame = -2

Query  1273  NMLDLGSVPHQTIAAMRNKYGPVVWLRIGSVSTLAIQSAKAAAELFKNHDVPFAGRSIGD  1094
             N+L L   PH+++A +   +GP+V L++G V+T+ + S   A E+ + HD   + R I D
Sbjct  49    NLLALRDKPHKSLAKLARVHGPLVTLKLGQVTTVVVSSPATAREILQKHDATLSNRYIID  108

Query  1093  VMLAQGYNKGSMALAQYGSYWRVLRRICSVEMFVHKKVNETAAVRRKCIDDLLRWVENEA  914
              + AQG+++  +A    G  WR  R++C   +F ++K+N +  VR++ I  LL       
Sbjct  109   AIRAQGHHEAGLAWVPVGPTWRKFRKVCYSHIFTNQKLNSSQHVRQRTIQQLLAEARE--  166

Query  913   GSIKRGSGIHVTRFVFLATFNLLGNIMFSSDLVDPVSEKGSKFFNAMMGIMERGGTPNIS  734
              S + G  + V +  F A  + L   + S DL D  S+   +F      IM   G PN++
Sbjct  167   -SCRVGEAMDVGKAAFRAALSSLSISVMSLDLADAASDTAREFKELARCIMNDVGEPNLA  225

Query  733   DIFPCLRWLDLQGLRTKTDKDLQIALQIVSTFVQKR-SKEGQDDSGKRKSDFLDVLLSFE  557
             D FP L+  D QG+R + +      L +  + +  R  K G D+      D LD LL   
Sbjct  226   DYFPVLKRFDPQGVRGRVEISFGRILDLFGSIIADRMEKRGADE------DILDTLL---  276

Query  556   GSGKDEPPKLSE-HQINIFILEMFLAGTDTTSS  461
              +  DE P+L E + I   +L++F+AGT+TTSS
Sbjct  277   -TTHDENPELVEINDIKHLLLDLFVAGTETTSS  308


 Score =   136 bits (343),  Expect(2) = 9e-67, Method: Compositional matrix adjust.
 Identities = 64/115 (56%), Positives = 79/115 (69%), Gaps = 1/115 (1%)
 Frame = -1

Query  344  NTALTSSTVEWALTELLRNPKAMTKAKEEIRGIVGPTRRF-EESDIDNLQYLQAVVKETL  168
             T  TSST+EWA+ ELL  P  M KAK E+  I+G      +ES++  L YLQAV++ETL
Sbjct  302  GTETTSSTLEWAMAELLHKPTTMAKAKAELEQIIGKGNSIDQESEVSRLPYLQAVIQETL  361

Query  167  RLHPPAPFLIPRRAIQDTKFMGYDIPKDTQVFINVWAIGRDHESWEDPLSFKPER  3
            RLHP  P L+PRRA ++    G+ IPKD QV +NVWA+GRD E WEDP SF PER
Sbjct  362  RLHPAVPLLLPRRAGEEVHVSGFTIPKDAQVLVNVWAMGRDPEVWEDPCSFTPER  416



>ref|XP_009102613.1| PREDICTED: cytochrome P450 76C4-like [Brassica rapa]
Length=504

 Score =   144 bits (363),  Expect(2) = 1e-66, Method: Compositional matrix adjust.
 Identities = 81/275 (29%), Positives = 152/275 (55%), Gaps = 10/275 (4%)
 Frame = -2

Query  1273  NMLDLGSVPHQTIAAMRNKYGPVVWLRIGSVSTLAIQSAKAAAELFKNHDVPFAGRSIGD  1094
             N+  +G +PH++   +   YGP++ L+ G ++T+ + S +AA E+ K HD   +GR+  +
Sbjct  49    NIHQIGKLPHRSFTDLSRTYGPIMHLKFGRLNTVIVTSPEAAREVLKRHDQTLSGRNSPN  108

Query  1093  VMLAQGYNKGSMA-LAQYGSYWRVLRRICSVEMFVHKKVNETAAVRRKCIDDLLRWVENE  917
              + +  +   S+A +    + WR+LR++ +  MF  +++  T A+R K + +L+ +++  
Sbjct  109   SIRSINHQNVSVAWIHPSTARWRLLRKLSATHMFSPQRIEATKALRMKKVQELMSFMDE-  167

Query  916   AGSIKRGSGIHVTRFVFLATFNLLGNIMFSSDLVDPVSEKGSKFFNAMMGIMERGGTPNI  737
               S +R   + ++R  F+ T N++ NI+FS DL    SE  + F ++++G ME  G+P++
Sbjct  168   --SSEREEAVDISRASFITTLNIISNIIFSVDLCSYGSEISNGFHDSVIGGMEAAGSPDL  225

Query  736   SDIFPCLRWLDLQGLRTKTDKDLQIALQIVSTFVQKRSKEG---QDDSGKRKSDFLDVLL  566
             ++ FP L +LDLQG   +     +   ++   F+  ++ E     D       DFLD LL
Sbjct  226   ANFFPFLGFLDLQGNSKRMKFCTERLFKVFRGFIDIKTAEKSLRNDPKDASNRDFLDALL  285

Query  565   SFEGSGKDEPPKLSEHQINIFILEMFLAGTDTTSS  461
                   + E   L  + I   +L+MF+AGTDT+S+
Sbjct  286   DLTVGDEAE---LDNNDIEHLLLDMFIAGTDTSSN  317


 Score =   138 bits (348),  Expect(2) = 1e-66, Method: Compositional matrix adjust.
 Identities = 64/114 (56%), Positives = 81/114 (71%), Gaps = 0/114 (0%)
 Frame = -1

Query  344  NTALTSSTVEWALTELLRNPKAMTKAKEEIRGIVGPTRRFEESDIDNLQYLQAVVKETLR  165
             T  +S+TVEWA+ ELL NPK M KA+ EI+ I+G     +E DI  L Y+QAVVKETLR
Sbjct  311  GTDTSSNTVEWAMAELLTNPKTMVKAQSEIQRIIGQNGFVQEPDISELPYIQAVVKETLR  370

Query  164  LHPPAPFLIPRRAIQDTKFMGYDIPKDTQVFINVWAIGRDHESWEDPLSFKPER  3
            LHP  P L+PR+A +D +  GY +PKD QV +NVWAIGRD   WE+P  F+P+R
Sbjct  371  LHPAVPLLLPRKAEKDVEVFGYLVPKDAQVLVNVWAIGRDPNVWENPTQFEPDR  424



>ref|XP_006360234.1| PREDICTED: geraniol 8-hydroxylase-like [Solanum tuberosum]
Length=491

 Score =   142 bits (357),  Expect(2) = 1e-66, Method: Compositional matrix adjust.
 Identities = 62/113 (55%), Positives = 81/113 (72%), Gaps = 0/113 (0%)
 Frame = -1

Query  341  TALTSSTVEWALTELLRNPKAMTKAKEEIRGIVGPTRRFEESDIDNLQYLQAVVKETLRL  162
            T  TS+T+EWA+ ELL+NP  + KA+EE+  ++G  +    +D+ NL YL+ +VKE  R+
Sbjct  297  TDTTSNTLEWAMAELLKNPHTLEKAQEELAQVIGRGKLINAADVANLPYLRCIVKENFRI  356

Query  161  HPPAPFLIPRRAIQDTKFMGYDIPKDTQVFINVWAIGRDHESWEDPLSFKPER  3
            HP  PFLIPR+  +D  F GY IPKD+QV +NVWAIGRD   WEDPL FKPER
Sbjct  357  HPQVPFLIPRKTEEDVDFCGYIIPKDSQVLVNVWAIGRDSSLWEDPLDFKPER  409


 Score =   140 bits (354),  Expect(2) = 1e-66, Method: Compositional matrix adjust.
 Identities = 86/272 (32%), Positives = 140/272 (51%), Gaps = 12/272 (4%)
 Frame = -2

Query  1273  NMLDLGSVPHQTIAAMRNKYGPVVWLRIGSVSTLAIQSAKAAAELFKNHDVPFAGRSIGD  1094
             N+  LG  PH ++  +   +GP++ L+ G ++T+ + SA  A E+ +  D+ F+ R I D
Sbjct  42    NLHLLGDKPHISLTQLAKNHGPIMNLKFGQINTVIVSSAVLAREVTQKKDLMFSNRCIPD  101

Query  1093  VMLAQGYNKGSMALAQYGSYWRVLRRICSVEMFVHKKVNETAAVRRKCIDDLLRWVENEA  914
              + A  +N  S       S WR LR+I +  +F   +++    +R K I +L+ +  N +
Sbjct  102   ALRACNHNDFSAIWLPVDSQWRTLRKIMNYHIFSGNRLDANEHLRSKKIQELIDYCGNCS  161

Query  913   GSIKRGSGIHVTRFVFLATFNLLGNIMFSSDLVDPVSEKGSKFFNAMMGIMERGGTPNIS  734
                K G  ++++R  F    NLL N  FS DL DP ++   +F   +  I    G PN+ 
Sbjct  162   ---KVGETVNISRATFRTAMNLLSNTFFSIDLTDPFTDSAKEFKELVSNISIEAGKPNVV  218

Query  733   DIFPCLRWLDLQGLRTKTDKDLQIALQIVSTFVQKRSKEGQDDSGKRKS-DFLDVLLSFE  557
             D FP L+ +D QG+R +  K     L ++S  + +R KE     GK  + D LD LL+  
Sbjct  219   DFFPFLQKIDPQGIRRRMTKYFTKILHLMSDLIDERLKERS--MGKHANVDVLDALLNI-  275

Query  556   GSGKDEPPKLSEHQINIFILEMFLAGTDTTSS  461
                   P ++  +QI    L++F AGTDTTS+
Sbjct  276   -----CPKEIDRNQIEQLCLDLFEAGTDTTSN  302



>ref|XP_002301302.2| hypothetical protein POPTR_0002s15110g [Populus trichocarpa]
 gb|EEE80575.2| hypothetical protein POPTR_0002s15110g [Populus trichocarpa]
Length=430

 Score =   148 bits (374),  Expect(2) = 1e-66, Method: Compositional matrix adjust.
 Identities = 82/249 (33%), Positives = 137/249 (55%), Gaps = 9/249 (4%)
 Frame = -2

Query  1198  LRIGSVSTLAIQSAKAAAELFKNHDVPFAGRSIGDVMLAQGYN--KGSMALAQYGSYWRV  1025
             L++G ++T+ I S   A E  + HD   + R++ D +  Q YN  K SM      + W+ 
Sbjct  3     LKLGRITTIVISSPNIAKEALQKHDQALSSRTVPDALHVQYYNYHKNSMIWLPASTQWKF  62

Query  1024  LRRICSVEMFVHKKVNETAAVRRKCIDDLLRWVENEAGSIKRGSGIHVTRFVFLATFNLL  845
             LR++ + +MF  ++++ + A+R K + +LL +V  +  +   G  + V R VF    NL+
Sbjct  63    LRKLTATQMFTSQRLDASRALRGKKVQELLEYVHEKCNN---GHAVDVGRSVFTTVLNLI  119

Query  844   GNIMFSSDLVDPVSEKGSKFFNAMMGIMERGGTPNISDIFPCLRWLDLQGLRTKTDKDLQ  665
              N  FS D+ +  S+   +F N ++G +E+ G PNI+D FP LR +D QG+R KT+  L+
Sbjct  120   SNTFFSLDVTNYNSDLSQEFSNLVVGFLEQIGKPNIADYFPILRLVDPQGIRRKTNNYLK  179

Query  664   IALQIVSTFVQKRSK-EGQDDSGKRKSDFLDVLLSFEGSGKDEPPKLSEHQINIFILEMF  488
                QI  + + +R++      + K   D LD LL      K+   +LS   I + +++ F
Sbjct  180   RLTQIFDSIINERTRLRSSSVASKASHDVLDALLIL---AKENNTELSSTDIQVLLIDFF  236

Query  487   LAGTDTTSS  461
             +AGTDTTSS
Sbjct  237   IAGTDTTSS  245


 Score =   134 bits (337),  Expect(2) = 1e-66, Method: Compositional matrix adjust.
 Identities = 65/113 (58%), Positives = 81/113 (72%), Gaps = 4/113 (4%)
 Frame = -1

Query  341  TALTSSTVEWALTELLRNPKAMTKAKEEIRGIVGPTRRFEESDIDNLQYLQAVVKETLRL  162
            T  TSSTVEWA+TELL NP  M KAK E++ + GP    +ESDI    YLQA+VKET RL
Sbjct  240  TDTTSSTVEWAMTELLLNPDKMVKAKNELQQVEGPV---QESDISKCPYLQAIVKETFRL  296

Query  161  HPPAPFLIPRRAIQDTKFMGYDIPKDTQVFINVWAIGRDHESWEDPLSFKPER  3
            HPP+PFL PR+A+ + +  G+ +PK+ QV I +WAIGRD   W +P SFKPER
Sbjct  297  HPPSPFL-PRKAVSEVEMQGFTVPKNAQVLITIWAIGRDPAIWPEPNSFKPER  348



>gb|AIO11760.1| cytochrome p450 [Croton stellatopilosus]
 emb|CDM63950.1| cytochrom p450 reductase [Croton stellatopilosus]
Length=507

 Score =   149 bits (376),  Expect(2) = 1e-66, Method: Compositional matrix adjust.
 Identities = 86/271 (32%), Positives = 146/271 (54%), Gaps = 5/271 (2%)
 Frame = -2

Query  1273  NMLDLGSVPHQTIAAMRNKYGPVVWLRIGSVSTLAIQSAKAAAELFKNHDVPFAGRSIGD  1094
             N+L+LG  PH+++A +   YGP++ L++G ++T+ I SA  A ++    D  F  R++ +
Sbjct  51    NLLELGDKPHKSLANLAKIYGPLMTLKLGQITTIVISSANLAKQVLLTLDPSFCNRNVVE  110

Query  1093  VMLAQGYNKGSMALAQYGSYWRVLRRICSVEMFVHKKVNETAAVRRKCIDDLLRWVENEA  914
              + A+ +++ S+     G+ WR LR+IC+  +F ++K++    +RRK I DL+  VE   
Sbjct  111   AIQAREHHQVSVVWLPVGAPWRNLRKICNSYIFSNQKLDSNQELRRKKIQDLVDQVE---  167

Query  913   GSIKRGSGIHVTRFVFLATFNLLGNIMFSSDLVDPVSEKGSKFFNAMMGIMERGGTPNIS  734
              S + G+ + +    F A+ N+L   +FS DL D  S+   +F   +  +M+  G PN++
Sbjct  168   ASCRLGAAVDIGELAFKASLNVLSTSVFSLDLSDSKSDIVREFKEVVRCVMDEVGKPNLA  227

Query  733   DIFPCLRWLDLQGLRTKTDKDLQIALQIVSTFVQKRSKEGQDDSGKRKSDFLDVLLSFEG  554
             D FP LR +D Q  + + D    +  +I    + KR    +       +D LD LLS   
Sbjct  228   DYFPILRKIDPQRRKQRVDIQFGVLFEIFDRIIDKRLLLRKQPGYIPANDVLDTLLSL--  285

Query  553   SGKDEPPKLSEHQINIFILEMFLAGTDTTSS  461
             S  D    L  + I     ++F+AGTDTTSS
Sbjct  286   SEDDNSEGLDLNCIKHLFFDLFVAGTDTTSS  316


 Score =   133 bits (335),  Expect(2) = 1e-66, Method: Compositional matrix adjust.
 Identities = 62/114 (54%), Positives = 78/114 (68%), Gaps = 0/114 (0%)
 Frame = -1

Query  344  NTALTSSTVEWALTELLRNPKAMTKAKEEIRGIVGPTRRFEESDIDNLQYLQAVVKETLR  165
             T  TSST+EWAL ELL+NPK + KA+ EI   +G  +  +ESD+  L YLQAV+KET R
Sbjct  310  GTDTTSSTLEWALAELLKNPKTLIKAQAEIEQTIGKGKLIQESDVVKLPYLQAVIKETFR  369

Query  164  LHPPAPFLIPRRAIQDTKFMGYDIPKDTQVFINVWAIGRDHESWEDPLSFKPER  3
            LHP  PFL+PR+A +  +  G+ +PKD QV +N WAIGRD   WED   F PER
Sbjct  370  LHPAVPFLLPRKAGEHVEIGGFTVPKDAQVLVNAWAIGRDPSLWEDADLFIPER  423



>ref|XP_002509653.1| cytochrome P450, putative [Ricinus communis]
 gb|EEF51040.1| cytochrome P450, putative [Ricinus communis]
Length=501

 Score =   146 bits (368),  Expect(2) = 1e-66, Method: Compositional matrix adjust.
 Identities = 94/291 (32%), Positives = 163/291 (56%), Gaps = 6/291 (2%)
 Frame = -2

Query  1333  RNKSRSGRlppgppglpvlGNMLDLGSVPHQTIAAMRNKYGPVVWLRIGSVSTLAIQSAK  1154
             R+K+  G+LPPGP  LP++GN+ +LG  PHQ++A +   +GP++ L++G ++T+ I SA 
Sbjct  28    RSKTGPGKLPPGPTPLPLVGNLFELGDKPHQSLAKLAKIHGPLMSLKLGQITTVVISSAT  87

Query  1153  AAAELFKNHDVPFAGRSIGDVMLAQGYNKGSMALAQYGSYWRVLRRICSVEMFVHKKVNE  974
              A E+ +  D+ FA R     + A  +++ SM     G+ WR LR+IC+  +F ++K++ 
Sbjct  88    LAKEVLQTLDLSFANRICVQAVHAHDHHEASMPWLPVGAPWRNLRKICNSYLFSNQKLDG  147

Query  973   TAAVRRKCIDDLLRWVENEAGSIKRGSGIHVTRFVFLATFNLLGNIMFSSDLVDPVSEKG  794
                +R+K I +L+  V+    S + G+  +++   F    ++L + +FS DL D  S+  
Sbjct  148   NQDIRQKKIQELIADVKE---SCRLGAATNISHVAFKTVLSVLSSNVFSLDLTDSNSDSV  204

Query  793   SKFFNAMMGIMERGGTPNISDIFPCLRWLDLQGLRTKTDKDLQIALQIVSTFVQKRSKEG  614
              +F      IM+  G PN++D FP LR +D QG+R +T       L +    + +R +  
Sbjct  205   REFKEVARCIMDEVGKPNLADYFPVLRKIDPQGVRRRTAIYFGRMLDLFDPIIDQRLELR  264

Query  613   QDDSGKRKSDFLDVLLSFEGSGKDEPPKLSEHQINIFILEMFLAGTDTTSS  461
             +++     +D LD LL+     K E   +  + +    L++F AGTDTTSS
Sbjct  265   KEEGYISANDMLDTLLALIEENKTE---MDINSMKHLFLDLFAAGTDTTSS  312


 Score =   136 bits (343),  Expect(2) = 1e-66, Method: Compositional matrix adjust.
 Identities = 62/114 (54%), Positives = 81/114 (71%), Gaps = 0/114 (0%)
 Frame = -1

Query  344  NTALTSSTVEWALTELLRNPKAMTKAKEEIRGIVGPTRRFEESDIDNLQYLQAVVKETLR  165
             T  TSST+EWA+TELLRNPK ++KA+ EI+  +G     +ESD+  L YL+A++KET R
Sbjct  306  GTDTTSSTLEWAMTELLRNPKTLSKARAEIKQTIGTGSLLQESDMARLPYLKAIIKETFR  365

Query  164  LHPPAPFLIPRRAIQDTKFMGYDIPKDTQVFINVWAIGRDHESWEDPLSFKPER  3
            LHP  P L+PR+A  D +  G+ IPKD QV +N WAIGRD   WE+P  F+PER
Sbjct  366  LHPAVPLLLPRKAGGDVEMNGFTIPKDAQVLVNAWAIGRDPFLWEEPELFRPER  419



>ref|XP_009630529.1| PREDICTED: geraniol 8-hydroxylase-like [Nicotiana tomentosiformis]
Length=499

 Score =   156 bits (395),  Expect(2) = 1e-66, Method: Compositional matrix adjust.
 Identities = 79/267 (30%), Positives = 150/267 (56%), Gaps = 6/267 (2%)
 Frame = -2

Query  1261  LGSVPHQTIAAMRNKYGPVVWLRIGSVSTLAIQSAKAAAELFKNHDVPFAGRSIGDVMLA  1082
             LG  PHQ++A +  KYGP++ LR+G ++T+ I S+  A E+ +  D+ F+ R+I D + A
Sbjct  50    LGDQPHQSLAKLAEKYGPIISLRLGQITTVLISSSAVAKEVIQKQDLAFSSRTIPDAIHA  109

Query  1081  QGYNKGSMALAQYGSYWRVLRRICSVEMFVHKKVNETAAVRRKCIDDLLRWVENEAGSIK  902
               + + S+      + WR LR+I +  +F   +++    +R + I DL+ +    +   +
Sbjct  110   LNHYQFSVIWLPVNTRWRSLRKIMNTYIFSGNRLDANQHLRFRKIQDLIAYCRRCS---Q  166

Query  901   RGSGIHVTRFVFLATFNLLGNIMFSSDLVDPVSEKGSKFFNAMMGIMERGGTPNISDIFP  722
              G  +++ +     + N+L +I+FS D+VDP +  G  F + +  + E  G PN++D +P
Sbjct  167   TGDVVNIGQAASETSLNILSSIIFSKDVVDPYANSGKGFKDVVCKMSEEAGKPNLADYYP  226

Query  721   CLRWLDLQGLRTKTDKDLQIALQIVSTFVQKRSKEGQDDSGKRKSDFLDVLLSFEGSGKD  542
              L+ +D QG+R +  K     LQ++   + +R ++ +       +D LDVLL+   + ++
Sbjct  227   VLKRIDPQGIRRRIGKHFDKLLQLIEGLIDERLEQRRKSPNSGSTDVLDVLLN---TSQE  283

Query  541   EPPKLSEHQINIFILEMFLAGTDTTSS  461
             +P  +  + I    L++F+AGTDTTS+
Sbjct  284   DPKAIDRNHIERLCLDLFIAGTDTTSN  310


 Score =   126 bits (316),  Expect(2) = 1e-66, Method: Compositional matrix adjust.
 Identities = 60/115 (52%), Positives = 82/115 (71%), Gaps = 2/115 (2%)
 Frame = -1

Query  344  NTALTSSTVEWALTELLRNPKA-MTKAKEEIRGIVGPTRRFEESDIDNLQYLQAVVKETL  168
             T  TS+T+EWA+ E++R P + M KAKEE+  ++G  +  EE+D+  L YLQ +VKETL
Sbjct  304  GTDTTSNTLEWAMVEVMRKPDSIMRKAKEELAQVIGKGKVIEEADVARLPYLQCIVKETL  363

Query  167  RLHPPAPFLIPRRAIQDTKFMGYDIPKDTQVFINVWAIGRDHESWEDPLSFKPER  3
            R+HP  P LI R+  QD +  GY IPK +QV ++VW++GRD   WEDPL+FKPER
Sbjct  364  RIHPAVPLLI-RKVDQDVEACGYFIPKGSQVLVHVWSMGRDPTIWEDPLAFKPER  417



>ref|XP_010112509.1| Cytochrome P450 76A2 [Morus notabilis]
 gb|EXC33897.1| Cytochrome P450 76A2 [Morus notabilis]
Length=517

 Score =   234 bits (597),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 111/270 (41%), Positives = 169/270 (63%), Gaps = 10/270 (4%)
 Frame = -2

Query  1273  NMLDLGSVPHQTIAAMRNKYGPVVWLRIGSVSTLAIQSAKAAAELFKNHDVPFAGRSIGD  1094
             N+  L   PH++   +   +GP++ L +GS+ST+ I S + A E+FKNHD+  AGR I +
Sbjct  47    NIFQLDRTPHKSFVKLAQTHGPIMTLWLGSMSTVVISSHEVAREMFKNHDMVLAGRKIYE  106

Query  1093  VMLAQGYNKGSMALAQYGSYWRVLRRICSVEMFVHKKVNETAAVRRKCIDDLLRWVENEA  914
              M  +  N+GS+  AQYG +WR+LRR+C+ E FV  +++    VR +CID ++ ++++  
Sbjct  107   AMKGEQSNEGSLITAQYGPHWRMLRRLCTTEFFVTSRLDAMQGVRARCIDRMVNFIDD--  164

Query  913   GSIKRGSGIHVTRFVFLATFNLLGNIMFSSDLVDPVSEKGSKFFNAMMGIMERGGTPNIS  734
              S    S + V RF FL +FNL+GN+MFS DL+DP SE+G+KFF     +ME  G PN++
Sbjct  165   ASAHGTSPVDVGRFFFLMSFNLIGNLMFSKDLLDPKSERGAKFFFHAGKVMELAGKPNVA  224

Query  733   DIFPCLRWLDLQGLRTKTDKDLQIALQIVSTFVQKRSKEGQ--------DDSGKRKSDFL  578
             D  P LRW+D QG+R KT   ++ A +I   F+++R++  +        +D    + DFL
Sbjct  225   DFLPVLRWIDPQGIRRKTQFHVERAFEIAGGFIKERTESTKNEQKVVETNDKKDEREDFL  284

Query  577   DVLLSFEGSGKDEPPKLSEHQINIFILEMF  488
             DVLL F G+G +EP K S   IN+ + EMF
Sbjct  285   DVLLEFRGNGVEEPSKFSSRTINVIVFEMF  314


 Score =   149 bits (375),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 64/106 (60%), Positives = 84/106 (79%), Gaps = 0/106 (0%)
 Frame = -1

Query  320  VEWALTELLRNPKAMTKAKEEIRGIVGPTRRFEESDIDNLQYLQAVVKETLRLHPPAPFL  141
            +EWA+ ELL NPK + K + E+R  VGP ++ +ESDI+NL YL+AV+KETLRLHPP PFL
Sbjct  325  LEWAMAELLHNPKTLNKVQSELRRTVGPNKKLDESDIENLPYLKAVIKETLRLHPPLPFL  384

Query  140  IPRRAIQDTKFMGYDIPKDTQVFINVWAIGRDHESWEDPLSFKPER  3
            +P  A+   K +GY IPK+TQ+ +NVWAIGRD ++WE+PL FKPER
Sbjct  385  VPHMAMDSCKMLGYYIPKETQILVNVWAIGRDPKTWENPLEFKPER  430



>ref|XP_010667793.1| PREDICTED: geraniol 8-hydroxylase-like [Beta vulgaris subsp. 
vulgaris]
Length=418

 Score =   151 bits (382),  Expect(2) = 2e-66, Method: Compositional matrix adjust.
 Identities = 84/271 (31%), Positives = 150/271 (55%), Gaps = 12/271 (4%)
 Frame = -2

Query  1273  NMLDLGSVPHQTIAAMRNKYGPVVWLRIGSVSTLAIQSAKAAAELFKNHDVPFAGRSIGD  1094
             N+  LG+ PH++ A +   YGP++ L++GSV+T+ I S + A E+F  HD+ F+GR +  
Sbjct  41    NIHQLGNKPHRSAAELSKTYGPIMSLKLGSVTTIVISSPEIAQEMFLKHDLAFSGRMLPH  100

Query  1093  VMLAQGYNKGSMALAQYGSYWRVLRRICSVEMFVHKKVNETAAVRRKCIDDLLRWVENEA  914
              + A  +++ S+A       WR LR+I +V++F  ++++ + A+R+K +++L+ +V+   
Sbjct  101   ALTATNHHEYSVAFLPICPRWRNLRKIATVQLFTSRQLDASQALRQKKVNELVEFVQQ--  158

Query  913   GSIKRGSGIHVTRFVFLATFNLLGNIMFSSDLVDPVSEKGSKFFNAMMGIMERGGTPNIS  734
                + G  + + +  F  T NLL N  FS D+   VS +  +F + +  + E G  PN+S
Sbjct  159   -CCETGVSVDIGKAAFTTTLNLLANTFFSMDVASHVSSESQEFKDLVWNVQEEGARPNVS  217

Query  733   DIFPCLRWLDLQGLRTKTDKDLQIALQIVSTFVQKRSKEGQDDSGKRKSDFLDVLLSFEG  554
             D FP ++  DLQG+  ++   L   L+     +  R      D    K D L +LL    
Sbjct  218   DFFPLVKNFDLQGVYKRSSYYLNKMLRFFEEIIDAR----LSDPMAPKDDVLGILLKL--  271

Query  553   SGKDEPPKLSEHQINIFILEMFLAGTDTTSS  461
               +DE   L+E + N  ++ +F+AGT +TS+
Sbjct  272   -VEDEELNLNEVKHN--LVGLFIAGTSSTSN  299


 Score =   130 bits (328),  Expect(2) = 2e-66, Method: Compositional matrix adjust.
 Identities = 60/113 (53%), Positives = 81/113 (72%), Gaps = 0/113 (0%)
 Frame = -1

Query  341  TALTSSTVEWALTELLRNPKAMTKAKEEIRGIVGPTRRFEESDIDNLQYLQAVVKETLRL  162
            T+ TS+T+EWA+TELL NP+ M KA+ EI  I+G     +ESDI  L Y+QA+ KET R+
Sbjct  294  TSSTSNTLEWAMTELLLNPEKMKKAQTEIDQILGKDAFIQESDISKLPYIQAIAKETHRM  353

Query  161  HPPAPFLIPRRAIQDTKFMGYDIPKDTQVFINVWAIGRDHESWEDPLSFKPER  3
            HP  PFLIP +A++D    GY +PK+TQ+++NVW+IG D   W +P SF PER
Sbjct  354  HPATPFLIPHKAVKDDNLWGYFVPKNTQIWVNVWSIGYDPSIWINPHSFSPER  406



>gb|AGI78466.1| CYP76AD4 [Celosia cristata]
Length=494

 Score =   142 bits (359),  Expect(2) = 2e-66, Method: Compositional matrix adjust.
 Identities = 62/114 (54%), Positives = 84/114 (74%), Gaps = 0/114 (0%)
 Frame = -1

Query  344  NTALTSSTVEWALTELLRNPKAMTKAKEEIRGIVGPTRRFEESDIDNLQYLQAVVKETLR  165
             T  TSST EW + EL+RNP+ M KA++EI  ++G  R+ +ESDI  L YLQA++KETLR
Sbjct  298  GTDTTSSTFEWVMAELIRNPEMMAKAQDEIEQVLGKDRQIQESDIIKLPYLQAIIKETLR  357

Query  164  LHPPAPFLIPRRAIQDTKFMGYDIPKDTQVFINVWAIGRDHESWEDPLSFKPER  3
            LHPP  FL+PR+A  D +  GY +PKD Q+ +N+WAIGRD ++WE+P  F P+R
Sbjct  358  LHPPTVFLLPRKADTDVELYGYIVPKDAQILVNLWAIGRDSQAWENPKVFSPDR  411


 Score =   139 bits (351),  Expect(2) = 2e-66, Method: Compositional matrix adjust.
 Identities = 77/271 (28%), Positives = 146/271 (54%), Gaps = 10/271 (4%)
 Frame = -2

Query  1273  NMLDLGSVPHQTIAAMRNKYGPVVWLRIGSVSTLAIQSAKAAAELFKNHDVPFAGRSIGD  1094
             N+L++G  PH++ A +   +GP++ L++GSV+T+ + SA+ A E+F   D P + R++ +
Sbjct  44    NILEVGKKPHRSFANLAKIHGPLISLKLGSVTTIVVSSAEVAKEMFLKKDQPLSNRTVPN  103

Query  1093  VMLAQGYNKGSMALAQYGSYWRVLRRICSVEMFVHKKVNETAAVRRKCIDDLLRWVENEA  914
              + A  ++K +M+       WR  R+I +V +    +++   ++R   +  L ++V+  A
Sbjct  104   SVTAGDHHKLTMSWLPVSPKWRNFRKITAVHLLSPLRLDACQSLRHAKVQQLFQYVQECA  163

Query  913   GSIKRGSGIHVTRFVFLATFNLLGNIMFSSDLVDPVSEKGSKFFNAMMGIMERGGTPNIS  734
                ++G  + + +  F  + NLL  + FS +L    S +  +F   +  IME  G PN +
Sbjct  164   ---QKGQAVDIGKAAFTTSLNLLSKLFFSKELASHKSRESQEFKQLIWNIMEDIGKPNYA  220

Query  733   DIFPCLRWLDLQGLRTKTDKDLQIALQIVSTFVQKRSKEGQDDSGKRKSDFLDVLLSFEG  554
             D FP L  +D  G+R +   +    +++    +++R +  ++ S    +D LDVLL    
Sbjct  221   DYFPILGCVDPSGIRRRLASNFDKLIEVFQCIIRQRLE--RNPSTPPTNDVLDVLLELYK  278

Query  553   SGKDEPPKLSEHQINIFILEMFLAGTDTTSS  461
                    +LS  +IN  ++++F AGTDTTSS
Sbjct  279   QN-----ELSMGEINHLLVDIFDAGTDTTSS  304



>ref|XP_004233425.1| PREDICTED: geraniol 8-hydroxylase-like [Solanum lycopersicum]
Length=492

 Score =   141 bits (356),  Expect(2) = 2e-66, Method: Compositional matrix adjust.
 Identities = 62/114 (54%), Positives = 86/114 (75%), Gaps = 0/114 (0%)
 Frame = -1

Query  344  NTALTSSTVEWALTELLRNPKAMTKAKEEIRGIVGPTRRFEESDIDNLQYLQAVVKETLR  165
             T  TS+T+EWA+ ELL+NP+A+ KA++E+  ++G  +  +E+D+  L YL+ +VKET R
Sbjct  297  GTDTTSNTLEWAMAELLKNPRALEKAQKELEQVIGRGKPIDEADVAKLPYLRCIVKETFR  356

Query  164  LHPPAPFLIPRRAIQDTKFMGYDIPKDTQVFINVWAIGRDHESWEDPLSFKPER  3
            +HP APFLIPR+  +D +  GY I KD+QV +NVWAIGRD   WEDPL+FKPER
Sbjct  357  IHPQAPFLIPRKVEEDVELYGYTIRKDSQVLVNVWAIGRDSSLWEDPLNFKPER  410


 Score =   140 bits (354),  Expect(2) = 2e-66, Method: Compositional matrix adjust.
 Identities = 87/273 (32%), Positives = 142/273 (52%), Gaps = 13/273 (5%)
 Frame = -2

Query  1273  NMLDLGSVPHQTIAAMRNKYGPVVWLRIGSVSTLAIQSAKAAAELFKNHDVPFAGRSIGD  1094
             N+  LG  PH ++  +  KYGP++ L++G ++ + I S+  A E  +  D+ F+ R + D
Sbjct  42    NLHLLGHKPHISLTQLAKKYGPIMNLKLGQINAVVISSSVLAKEAMQKQDLAFSNRFVID  101

Query  1093  VMLAQGYNKGSMA-LAQYGSYWRVLRRICSVEMFVHKKVNETAAVRRKCIDDLLRWVENE  917
              + A  ++  S+  L    S WR LR+I +  +F   K++    +R K + +L+ +    
Sbjct  102   AIRACNHDDFSVIWLPVNNSQWRTLRKIMNSHIFSGNKLDANEHLRTKKMQELIDYCHK-  160

Query  916   AGSIKRGSGIHVTRFVFLATFNLLGNIMFSSDLVDPVSEKGSKFFNAMMGIMERGGTPNI  737
               S K G  + + R  F  + NLL N +FS DL DP S+   +F   +  IM   G PN+
Sbjct  161   --SSKVGEAVDIGRAAFRTSLNLLSNTIFSKDLTDPFSDSAKEFKELVWKIMVEAGKPNL  218

Query  736   SDIFPCLRWLDLQGLRTKTDKDLQIALQIVSTFVQKRSKEGQDDSGKRKS-DFLDVLLSF  560
              D FP L+ +D QG+R ++       L  +S  + +R KE +   G R++ D LD LL  
Sbjct  219   VDYFPFLKKIDPQGIRRRSTNYFTEILHRMSDLIDERLKERE--LGNRENIDVLDALLDI  276

Query  559   EGSGKDEPPKLSEHQINIFILEMFLAGTDTTSS  461
                    P ++  +QI    L++F AGTDTTS+
Sbjct  277   ------SPDEIDRNQIEHLCLDLFAAGTDTTSN  303



>ref|XP_009143151.1| PREDICTED: cytochrome P450 76C3-like [Brassica rapa]
Length=511

 Score =   142 bits (359),  Expect(2) = 2e-66, Method: Compositional matrix adjust.
 Identities = 64/113 (57%), Positives = 85/113 (75%), Gaps = 1/113 (1%)
 Frame = -1

Query  341  TALTSSTVEWALTELLRNPKAMTKAKEEIRGIVGPTRRFEESDIDNLQYLQAVVKETLRL  162
            T   SST+EWA+TELLRNP+ M +A+ EIR ++G     +ESDI  L YL A+VKETLRL
Sbjct  313  TDTNSSTMEWAMTELLRNPEKMVRAQSEIRQVIGENGVVQESDISKLSYLLAIVKETLRL  372

Query  161  HPPAPFLIPRRAIQDTKFMGYDIPKDTQVFINVWAIGRDHESWEDPLSFKPER  3
            HPPAP LIPR++  D +  G+ +PK++QV +NVWA+GRD   WE+P+ F+PER
Sbjct  373  HPPAP-LIPRKSESDVQIFGFFVPKNSQVLVNVWAMGRDSNVWENPMKFEPER  424


 Score =   139 bits (350),  Expect(2) = 2e-66, Method: Compositional matrix adjust.
 Identities = 80/272 (29%), Positives = 142/272 (52%), Gaps = 7/272 (3%)
 Frame = -2

Query  1273  NMLDLGSVPHQTIAAMRNKYGPVVWLRIGSVSTLAIQSAKAAAELFKNHDVPFAGRSIGD  1094
             N+  LG  PH+++A     YGP++ L++G  + + I S +AA E  K HD   + R+  D
Sbjct  53    NIFQLGFNPHRSLAVFSKTYGPIMSLKLGRSTAVVISSPEAAKEALKTHDHVMSARTFND  112

Query  1093  VMLAQGYNKGSMALAQYGSYWRVLRRICSVEMFVHKKVNETAAVRRKCIDDLLRWVENEA  914
              + A  ++K S+      + WR L++I    +   + ++   ++R + +++LL  V    
Sbjct  113   PIRAFDHHKHSVVWIPASARWRFLKKIIVQNLLSPQNLDGIQSIRIRKVEELLSLVNTFC  172

Query  913   GSIKRGSGIHVTRFVFLATFNLLGNIMFSSDLVDPVSEKGS-KFFNAMMGIMERGGTPNI  737
                +RG  I + R  F+ +FN++ N +FS DL    S   S +F   ++ +ME  G PN 
Sbjct  173   ---ERGEAIDMARASFITSFNIISNALFSVDLATYNSNSSSFEFHETVVHLMEICGKPNA  229

Query  736   SDIFPCLRWLDLQGLRTKTDKDLQIALQIVSTFVQKRSKEGQDDSGKRKSDFLDVLLSFE  557
              D F  LR+LDLQG R ++   ++   ++   F+  R  +    +G   +D LD LL  +
Sbjct  230   GDFFRFLRFLDLQGSRKESTLCIEKLFRVFQEFIDDRVAKRLSQTGASSNDMLDALLDIK  289

Query  556   GSGKDEPPKLSEHQINIFILEMFLAGTDTTSS  461
                ++E   ++ + +    L++F+AGTDT SS
Sbjct  290   QQNQEE---ITINDMKHLFLDLFVAGTDTNSS  318



>ref|XP_004233424.1| PREDICTED: geraniol 8-hydroxylase-like [Solanum lycopersicum]
Length=493

 Score =   143 bits (360),  Expect(2) = 3e-66, Method: Compositional matrix adjust.
 Identities = 86/272 (32%), Positives = 140/272 (51%), Gaps = 11/272 (4%)
 Frame = -2

Query  1273  NMLDLGSVPHQTIAAMRNKYGPVVWLRIGSVSTLAIQSAKAAAELFKNHDVPFAGRSIGD  1094
             N+  LG  P  ++A +  KYGP++ L++G ++T+ I S+  A E+ +  D+ F+ R   D
Sbjct  43    NLHLLGDKPQISLAQLAKKYGPIMNLKLGQINTVVISSSVLAKEVMQKQDLSFSSRFGPD  102

Query  1093  VMLAQGYNKGSMA-LAQYGSYWRVLRRICSVEMFVHKKVNETAAVRRKCIDDLLRWVENE  917
              + A  +N  S+  L    S WR LR+  +  +F   K++    +R K + +L+ +    
Sbjct  103   ALCACNHNDFSVVWLPVNNSQWRSLRKSMNSHIFSVNKLDANKHLRTKKMQELIDYCHK-  161

Query  916   AGSIKRGSGIHVTRFVFLATFNLLGNIMFSSDLVDPVSEKGSKFFNAMMGIMERGGTPNI  737
               S + G  + + R  F  + NLL N +FS DL DP S+   +F   +  IM   G PN+
Sbjct  162   --SGQNGEAVDIGRAAFRTSLNLLSNTIFSKDLTDPFSDSDKEFRELVWNIMAEAGKPNL  219

Query  736   SDIFPCLRWLDLQGLRTKTDKDLQIALQIVSTFVQKRSKEGQDDSGKRKSDFLDVLLSFE  557
              D FP L+ +D QG+R +        LQ++S  + +R KE ++   +   D LD LLS  
Sbjct  220   VDFFPFLKKIDPQGIRRRLTNHFSKVLQLLSGLIDERLKE-REMGNRENVDVLDALLSI-  277

Query  556   GSGKDEPPKLSEHQINIFILEMFLAGTDTTSS  461
                   P ++    I    L++F AGTDTTS+
Sbjct  278   -----SPEEIDRKHIEHLYLDLFAAGTDTTSN  304


 Score =   138 bits (347),  Expect(2) = 3e-66, Method: Compositional matrix adjust.
 Identities = 60/114 (53%), Positives = 81/114 (71%), Gaps = 0/114 (0%)
 Frame = -1

Query  344  NTALTSSTVEWALTELLRNPKAMTKAKEEIRGIVGPTRRFEESDIDNLQYLQAVVKETLR  165
             T  TS+T+EWA+ ELL+NP  + KA+EE+  ++G  +  +E+D+  L YLQ +VKE LR
Sbjct  298  GTDTTSNTLEWAMAELLKNPHTLEKAQEELAQVIGRGKLVDEADVAQLPYLQCIVKEALR  357

Query  164  LHPPAPFLIPRRAIQDTKFMGYDIPKDTQVFINVWAIGRDHESWEDPLSFKPER  3
            LHPP   LIPR+  +D +  GY +PK +QV +NVWAIGRD   WE+PL FKPER
Sbjct  358  LHPPVSLLIPRKVEEDVELCGYTVPKGSQVLVNVWAIGRDSGIWENPLDFKPER  411



>ref|XP_009793557.1| PREDICTED: geraniol 8-hydroxylase-like [Nicotiana sylvestris]
Length=498

 Score =   155 bits (392),  Expect(2) = 3e-66, Method: Compositional matrix adjust.
 Identities = 80/267 (30%), Positives = 150/267 (56%), Gaps = 6/267 (2%)
 Frame = -2

Query  1261  LGSVPHQTIAAMRNKYGPVVWLRIGSVSTLAIQSAKAAAELFKNHDVPFAGRSIGDVMLA  1082
             LG  PHQ++A + +K+GP++ L++G ++T+ I S+  A E+ +  D+ F+ R+I D + A
Sbjct  50    LGGQPHQSLAKLADKFGPIISLKLGQITTVVISSSAVAKEIIQKQDLAFSSRTIPDAIHA  109

Query  1081  QGYNKGSMALAQYGSYWRVLRRICSVEMFVHKKVNETAAVRRKCIDDLLRWVENEAGSIK  902
                 + S+      + WR LR+I +  +F   K++    +R + I DL+ +    + +  
Sbjct  110   INQYQFSVIWLPVDTRWRSLRKIMNTYIFSGNKLDANQHLRSQKIQDLIAYCHRCSQT--  167

Query  901   RGSGIHVTRFVFLATFNLLGNIMFSSDLVDPVSEKGSKFFNAMMGIMERGGTPNISDIFP  722
                 + + +  F  + N+L +I+FS D+VD  +  G +F + +  I E  G PN++D +P
Sbjct  168   -RDAVSIGQVAFETSMNILSSIIFSKDVVDHYANLGKEFKDLVCKISEESGKPNLADYYP  226

Query  721   CLRWLDLQGLRTKTDKDLQIALQIVSTFVQKRSKEGQDDSGKRKSDFLDVLLSFEGSGKD  542
              L+ +D QG+R +  K L I L+ +   + +R ++ +  S    +D LDVLL+     ++
Sbjct  227   VLKRIDPQGIRRRLSKHLNILLEQIEGLIDERLEQRRKSSTSNSTDVLDVLLNI---SQE  283

Query  541   EPPKLSEHQINIFILEMFLAGTDTTSS  461
             +P  +  + I    L++F+AGTDTTS+
Sbjct  284   DPQAIDRNHIERLCLDLFIAGTDTTSN  310


 Score =   125 bits (315),  Expect(2) = 3e-66, Method: Compositional matrix adjust.
 Identities = 58/114 (51%), Positives = 81/114 (71%), Gaps = 1/114 (1%)
 Frame = -1

Query  344  NTALTSSTVEWALTELLRNPKAMTKAKEEIRGIVGPTRRFEESDIDNLQYLQAVVKETLR  165
             T  TS+T+EWA+ E++R P  M KAK E+  ++G  +  EE+D+ +L YLQ +VKETLR
Sbjct  304  GTDTTSNTLEWAMVEIMRKPYIMDKAKAELAEVIGKGKVIEEADVIHLPYLQCIVKETLR  363

Query  164  LHPPAPFLIPRRAIQDTKFMGYDIPKDTQVFINVWAIGRDHESWEDPLSFKPER  3
            +HP  P LI R+  Q+ +  GY IPKD+QV +++W+IGRD   WE+PL FKPER
Sbjct  364  IHPTVPLLI-RKVDQNVEACGYFIPKDSQVIVHLWSIGRDPTIWEEPLVFKPER  416



>ref|XP_006382521.1| hypothetical protein POPTR_0005s02950g [Populus trichocarpa]
 gb|ERP60318.1| hypothetical protein POPTR_0005s02950g [Populus trichocarpa]
Length=516

 Score =   233 bits (595),  Expect = 4e-66, Method: Compositional matrix adjust.
 Identities = 110/264 (42%), Positives = 170/264 (64%), Gaps = 4/264 (2%)
 Frame = -2

Query  1273  NMLDLGSVPHQTIAAMRNKYGPVVWLRIGSVSTLAIQSAKAAAELFKNHDVPFAGRSIGD  1094
             N+  LG  PH++ A +   +GP++ + +GS+  + I S++ A E+FKNHD   AGR I +
Sbjct  47    NIFLLGWAPHESFANLARVHGPIMTIWLGSMCNVVISSSEVAREMFKNHDAVLAGRKIYE  106

Query  1093  VMLAQGYNKGSMALAQYGSYWRVLRRICSVEMFVHKKVNETAAVRRKCIDDLLRWVENEA  914
              +     N+GS+  AQYG +WR+LRR+C+ E FV  +++     R +CID +L+++E++ 
Sbjct  107   AIRGDFGNEGSIITAQYGPHWRMLRRLCTTEFFVTSRLDAMQGARTRCIDGMLQYIEDD-  165

Query  913   GSIKRGSGIHVTRFVFLATFNLLGNIMFSSDLVDPVSEKGSKFFNAMMGIMERGGTPNIS  734
              S    S I + R++FL  FNL+GN+MFS DL+DP SEKG+KFF     ++E  G PN++
Sbjct  166   -SANGTSAIDLGRYIFLMAFNLIGNLMFSKDLLDPKSEKGAKFFQHAGKVVELAGKPNMA  224

Query  733   DIFPCLRWLDLQGLRTKTDKDLQIALQIVSTFVQKRSKEGQDDSGK--RKSDFLDVLLSF  560
             D FP LRWLD QG+R KT   +  A +I   F+++R++  Q ++ +  ++ D+LDVLL F
Sbjct  225   DCFPILRWLDPQGIRRKTQFHVARAFEIAGGFIKERTESTQKENSRDDKRKDYLDVLLEF  284

Query  559   EGSGKDEPPKLSEHQINIFILEMF  488
              G G +EP + S   IN  +LEMF
Sbjct  285   RGDGVEEPSRFSSTTINAIVLEMF  308


 Score =   141 bits (355),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 59/106 (56%), Positives = 80/106 (75%), Gaps = 0/106 (0%)
 Frame = -1

Query  320  VEWALTELLRNPKAMTKAKEEIRGIVGPTRRFEESDIDNLQYLQAVVKETLRLHPPAPFL  141
            +EWA+ ELL NPK M   + E+R  +GP ++ E+ DI+NL YL+AV++ETLRLHPP PFL
Sbjct  319  LEWAMAELLHNPKVMKTVQSELRSTIGPNKKLEDKDIENLPYLKAVIRETLRLHPPLPFL  378

Query  140  IPRRAIQDTKFMGYDIPKDTQVFINVWAIGRDHESWEDPLSFKPER  3
            +   A+   K +GY IPK+T + +NVWAIGRD ++W+DPL FKPER
Sbjct  379  VSHMAMNPCKMLGYYIPKETTILVNVWAIGRDSKTWDDPLVFKPER  424



>ref|XP_006360238.1| PREDICTED: geraniol 8-hydroxylase-like [Solanum tuberosum]
Length=493

 Score =   142 bits (358),  Expect(2) = 5e-66, Method: Compositional matrix adjust.
 Identities = 89/272 (33%), Positives = 140/272 (51%), Gaps = 10/272 (4%)
 Frame = -2

Query  1273  NMLDLGSVPHQTIAAMRNKYGPVVWLRIGSVSTLAIQSAKAAAELFKNHDVPFAGRSIGD  1094
             N+  LG  PH ++  +  KYGP++ L++G ++ + I S+  A E+ +  D+ F+ R + D
Sbjct  42    NLHLLGHKPHISLTQLAKKYGPIMNLKLGQINAVVISSSVLAKEVMQKQDLAFSNRFVID  101

Query  1093  VMLAQGYNKGSMALAQYGSY-WRVLRRICSVEMFVHKKVNETAAVRRKCIDDLLRWVENE  917
                A  +N  S       +Y WR LR+I +  +F   K++    +R K I +L+ +    
Sbjct  102   ASRACNHNDFSAIWLPVDNYKWRTLRKIMNSHIFSGNKLDANEHLRTKKIQELIDYCHK-  160

Query  916   AGSIKRGSGIHVTRFVFLATFNLLGNIMFSSDLVDPVSEKGSKFFNAMMGIMERGGTPNI  737
               S K G  + + R  F    NLL N +FS DL DP S+   +F   +  IM   G PN+
Sbjct  161   --SSKVGEAVDIGRATFRTFLNLLSNTIFSKDLTDPFSDSAKEFKELVWKIMVEIGKPNL  218

Query  736   SDIFPCLRWLDLQGLRTKTDKDLQIALQIVSTFVQKRSKEGQDDSGKRKSDFLDVLLSFE  557
              D FP L+ +D QG+R ++       L I+S  + +R KE ++   +   D LD LL   
Sbjct  219   VDYFPFLKKIDPQGIRRRSSDYYTKILHIMSDLIDERLKE-RELGNRENVDVLDALLDI-  276

Query  556   GSGKDEPPKLSEHQINIFILEMFLAGTDTTSS  461
              S  DE   +  +QI    L++F AGTDTTS+
Sbjct  277   -SAADE---IDRNQIEQLCLDLFAAGTDTTSN  304


 Score =   138 bits (348),  Expect(2) = 5e-66, Method: Compositional matrix adjust.
 Identities = 62/114 (54%), Positives = 80/114 (70%), Gaps = 0/114 (0%)
 Frame = -1

Query  344  NTALTSSTVEWALTELLRNPKAMTKAKEEIRGIVGPTRRFEESDIDNLQYLQAVVKETLR  165
             T  TS+T+EWA+ ELL+NP    KA+EE+  ++G  +  +E D+  L YLQ +VKE LR
Sbjct  298  GTDTTSNTLEWAMAELLKNPHTFEKAQEELAQVIGRGKLVDEVDVAQLPYLQCIVKEALR  357

Query  164  LHPPAPFLIPRRAIQDTKFMGYDIPKDTQVFINVWAIGRDHESWEDPLSFKPER  3
            LHPP  FLIPR+  +D +  GY IPK +QV +NVWAIGRD   WE+PL FKPER
Sbjct  358  LHPPVSFLIPRKVEEDVELCGYTIPKGSQVLVNVWAIGRDSGIWENPLDFKPER  411



>ref|XP_009794425.1| PREDICTED: geraniol 8-hydroxylase-like [Nicotiana sylvestris]
Length=499

 Score =   147 bits (370),  Expect(2) = 5e-66, Method: Compositional matrix adjust.
 Identities = 80/271 (30%), Positives = 142/271 (52%), Gaps = 7/271 (3%)
 Frame = -2

Query  1273  NMLDLGSVPHQTIAAMRNKYGPVVWLRIGSVSTLAIQSAKAAAELFKNHDVPFAGRSIGD  1094
             N+  LG+ PH+++A +   YGP++ L++G ++T+ I S+  A ++ +  D+ F+ R I D
Sbjct  41    NLHLLGAKPHKSLANLAKIYGPIMSLKLGQITTIVISSSAMAKQVLQKQDLAFSTRFIPD  100

Query  1093  VMLAQGYNKGSMALAQYGSYWRVLRRICSVEMFVHKKVNETAAVRRKCIDDLLRWVENEA  914
              + A  + K S+      + WR LRRI +  +  + +++    +R + + +LL +    A
Sbjct  101   ALQAHNHYKFSVPWLPVCTQWRTLRRILNTNILSYNRLDANQHLRSQKVKELLAYC---A  157

Query  913   GSIKRGSGIHVTRFVFLATFNLLGNIMFSSDLVDPVSEKGSKFFNAMMGIMERGGTPNIS  734
                ++G  + V +  F  + NLL N +FS DL DP S+   +    +  I    G PN+ 
Sbjct  158   KCCQQGEAVDVGQVAFKTSLNLLSNTLFSKDLADPFSDSKVELKEVIWSITTEVGKPNLV  217

Query  733   DIFPCLRWLDLQGLRTKTDKDLQIALQIVSTFVQKRSKEGQDDSGKRKSDFLDVLLSFEG  554
             D FP    +D QG+R +T        ++    + +R KE + + G+ KSD L+ LL    
Sbjct  218   DFFPIFEKIDPQGIRRRTTICFGKLFKLFDELINERLKEKRRNRGE-KSDVLEALLDISA  276

Query  553   SGKDEPPKLSEHQINIFILEMFLAGTDTTSS  461
                +E   + ++ I    L++F AGTDTT+S
Sbjct  277   KNPEE---IGQNHIKSMFLDLFGAGTDTTTS  304


 Score =   134 bits (336),  Expect(2) = 5e-66, Method: Compositional matrix adjust.
 Identities = 58/114 (51%), Positives = 80/114 (70%), Gaps = 0/114 (0%)
 Frame = -1

Query  344  NTALTSSTVEWALTELLRNPKAMTKAKEEIRGIVGPTRRFEESDIDNLQYLQAVVKETLR  165
             T  T+ST+EWA+ E+LR P+ M KA+ E+  ++G  +  EE+D+  L YLQ ++KETLR
Sbjct  298  GTDTTTSTLEWAMAEMLRQPEIMRKAQVELGEVIGKGKIVEEADVSQLPYLQCIIKETLR  357

Query  164  LHPPAPFLIPRRAIQDTKFMGYDIPKDTQVFINVWAIGRDHESWEDPLSFKPER  3
            +HPP P L+PR+  QD +   Y IPK +QV +N WAIGRD   W+DPL F+PER
Sbjct  358  MHPPFPLLVPRKVEQDVELCDYIIPKGSQVLVNAWAIGRDSTFWKDPLVFRPER  411



>ref|XP_004248012.1| PREDICTED: geraniol 8-hydroxylase-like [Solanum lycopersicum]
Length=494

 Score =   144 bits (362),  Expect(2) = 5e-66, Method: Compositional matrix adjust.
 Identities = 78/271 (29%), Positives = 140/271 (52%), Gaps = 6/271 (2%)
 Frame = -2

Query  1273  NMLDLGSVPHQTIAAMRNKYGPVVWLRIGSVSTLAIQSAKAAAELFKNHDVPFAGRSIGD  1094
             N+  LG+ PH ++A +   YGP++ L++G ++T+ I S+  A ++ K  D  F+ R   +
Sbjct  41    NLQLLGAKPHISLANLAKNYGPIMSLKLGQITTIVISSSTIAKQVLKTQDQAFSSRFAPN  100

Query  1093  VMLAQGYNKGSMALAQYGSYWRVLRRICSVEMFVHKKVNETAAVRRKCIDDLLRWVENEA  914
              + A  + K S+A       WR LRRI +  +    K++    +R + +  L+ + +  +
Sbjct  101   ALQAHNHYKFSVAWLPVCPQWRTLRRILNTNLLSSNKLDANQHLRSQKVKQLIDYCDKCS  160

Query  913   GSIKRGSGIHVTRFVFLATFNLLGNIMFSSDLVDPVSEKGSKFFNAMMGIMERGGTPNIS  734
                ++G  + + + VF  + NLL N +FS DL DP S+   +    + GIM   G PN+ 
Sbjct  161   ---QQGEALDIGQVVFKTSLNLLSNTLFSKDLADPFSDSKVELKEVIWGIMAEVGKPNLV  217

Query  733   DIFPCLRWLDLQGLRTKTDKDLQIALQIVSTFVQKRSKEGQDDSGKRKSDFLDVLLSFEG  554
             D FP L  +DLQG+R +         ++    + +R +E +      KSD L++ L+   
Sbjct  218   DFFPILEKIDLQGIRRRAIIHFGKLFKLFDDLINERLEEKKRPGFMEKSDVLEIFLNIT-  276

Query  553   SGKDEPPKLSEHQINIFILEMFLAGTDTTSS  461
               +  P ++  + I    +++F AGTDTT+S
Sbjct  277   --EKNPQEIDHNHIKSMFMDLFGAGTDTTTS  305


 Score =   136 bits (343),  Expect(2) = 5e-66, Method: Compositional matrix adjust.
 Identities = 61/114 (54%), Positives = 81/114 (71%), Gaps = 0/114 (0%)
 Frame = -1

Query  344  NTALTSSTVEWALTELLRNPKAMTKAKEEIRGIVGPTRRFEESDIDNLQYLQAVVKETLR  165
             T  T+ST+EWA+ ELL+ P+ + KA+ E+  I+G  +  EE+D+  L YLQ ++KETLR
Sbjct  299  GTDTTTSTLEWAMAELLKQPEIIKKAQVELAEIIGKGKLIEEADVFRLPYLQCIIKETLR  358

Query  164  LHPPAPFLIPRRAIQDTKFMGYDIPKDTQVFINVWAIGRDHESWEDPLSFKPER  3
            LHPP P L+PR+  QD +   Y IPK +QV +NVWAIGRD   W+DPL FKPER
Sbjct  359  LHPPVPLLVPRKVDQDVELCDYIIPKGSQVLVNVWAIGRDFTFWKDPLEFKPER  412



>gb|AAQ05825.1|AF479661_1 cytochrome P450 [Pastinaca sativa]
Length=496

 Score =   144 bits (363),  Expect(2) = 5e-66, Method: Compositional matrix adjust.
 Identities = 82/272 (30%), Positives = 146/272 (54%), Gaps = 12/272 (4%)
 Frame = -2

Query  1273  NMLDLGSVPHQTIAAMRNKYGPVVWLRIGSVSTLAIQSAKAAAELFKNHDVPFAGRSIGD  1094
             N+  LG  PH+++A +   YGP++ L++G ++T+ I S+  A ++ +  D+ F+ R++ +
Sbjct  39    NIHKLGKHPHKSLANLAQVYGPIMRLKLGHMTTVVISSSTTARQVLRKQDIAFSNRALPN  98

Query  1093  VMLAQGYNKGSMALAQYGSYWRVLRRICSVEMFVHKKVNETAAVRRKCIDDLLRWVENEA  914
              + A  +NK S      GS WR LR+I S+ +F   K++    +R + + DL+R+ E  +
Sbjct  99    AVRALDHNKYSAVWLPVGSQWRGLRKIMSMNLFTANKLDANQHLRSQKVHDLIRYCEKCS  158

Query  913   GSIKRGSGIHVTRFVFLATFNLLGNIMFSSDLVDPVSEKGSKFFNAMM-GIMERGGTPNI  737
              S   G  + +    FL + NL+ N +FS D++D      +K F  ++  IM   G PN+
Sbjct  159   QS---GEAVDIGGAAFLTSLNLMSNTIFSKDMIDSYENSEAKVFRDLVWNIMVEIGKPNL  215

Query  736   SDIFPCLRWLDLQGLRTKTDKDLQIALQIVSTFVQKRSKEGQDDSGKRKSDFLDVLLSFE  557
              D FP L+W+D QG++ +   +    +++    V +R    + +  +   D LD LL   
Sbjct  216   VDYFPLLQWMDPQGIKRRLAYNFDTLIKLFDVMVDERL---ELNGPQNSRDVLDELLKLV  272

Query  556   GSGKDEPPKLSEHQINIFILEMFLAGTDTTSS  461
              +  DE   + +  I    L++F AGTDT+SS
Sbjct  273   NT--DE---IDKSHIQHMFLDLFGAGTDTSSS  299


 Score =   136 bits (342),  Expect(2) = 5e-66, Method: Compositional matrix adjust.
 Identities = 61/115 (53%), Positives = 84/115 (73%), Gaps = 1/115 (1%)
 Frame = -1

Query  344  NTALTSSTVEWALTELLRNPK-AMTKAKEEIRGIVGPTRRFEESDIDNLQYLQAVVKETL  168
             T  +SSTVEWA++E+LR P   + KAK E+  ++G  +  EE+DI  L YL+ +VKETL
Sbjct  293  GTDTSSSTVEWAMSEILRKPATVLVKAKAELDQVIGNGKIVEEADISKLDYLRCIVKETL  352

Query  167  RLHPPAPFLIPRRAIQDTKFMGYDIPKDTQVFINVWAIGRDHESWEDPLSFKPER  3
            RLHPPAP L+PR+  ++ +  GY +PK++QV +N WAIGRD   WE+PLSF+PER
Sbjct  353  RLHPPAPLLVPRQVQEEVELCGYTVPKNSQVLVNAWAIGRDPMLWENPLSFQPER  407



>ref|NP_182081.1| cytochrome P450 76C2 [Arabidopsis thaliana]
 sp|O64637.1|C76C2_ARATH RecName: Full=Cytochrome P450 76C2; AltName: Full=Protein YELLOW-LEAF-SPECIFIC 
GENE 6 [Arabidopsis thaliana]
 gb|AAC06158.1| putative cytochrome P450 [Arabidopsis thaliana]
 gb|AAL32678.1| putative cytochrome P450 [Arabidopsis thaliana]
 gb|AAM47979.1| putative cytochrome P450 [Arabidopsis thaliana]
 gb|AEC10572.1| cytochrome P450 76C2 [Arabidopsis thaliana]
Length=512

 Score =   146 bits (368),  Expect(2) = 5e-66, Method: Compositional matrix adjust.
 Identities = 69/114 (61%), Positives = 82/114 (72%), Gaps = 0/114 (0%)
 Frame = -1

Query  344  NTALTSSTVEWALTELLRNPKAMTKAKEEIRGIVGPTRRFEESDIDNLQYLQAVVKETLR  165
             T   SSTVEWA+ ELLRNP+ M KA+ EI  ++G     EESDI  L YLQAVVKET R
Sbjct  313  GTDTNSSTVEWAMAELLRNPETMVKAQAEIDCVIGQKGVVEESDISALPYLQAVVKETFR  372

Query  164  LHPPAPFLIPRRAIQDTKFMGYDIPKDTQVFINVWAIGRDHESWEDPLSFKPER  3
            LHP AP L+PR+A  D + +G+ +PKDTQVF+NVWAIGRD   WE+   FKPER
Sbjct  373  LHPAAPLLVPRKAESDVEVLGFMVPKDTQVFVNVWAIGRDPNVWENSSRFKPER  426


 Score =   134 bits (338),  Expect(2) = 5e-66, Method: Compositional matrix adjust.
 Identities = 78/276 (28%), Positives = 153/276 (55%), Gaps = 11/276 (4%)
 Frame = -2

Query  1273  NMLDLGSVPHQTIAAMRNKYGPVVWLRIGSVSTLAIQSAKAAAELFKNHDVPFAGRSIGD  1094
             N+  +G  PH + A +   YGP++ L+ GS++T+ + S +AA E+ + +D   + R+  +
Sbjct  50    NIHLVGRNPHHSFADLSKTYGPIMSLKFGSLNTVVVTSPEAAREVLRTYDQILSSRTPTN  109

Query  1093  VMLAQGYNKGSMA-LAQYGSYWRVLRRICSVEMFVHKKVNETAAVRRKCIDDLLRWVENE  917
              + +  ++K S+  L    S WR+LR++ + ++F  +++  T  +R   + +L+ ++   
Sbjct  110   SIRSINHDKVSVVWLPPSSSRWRLLRKLSATQLFSPQRIEATKTLRENKVKELVSFM---  166

Query  916   AGSIKRGSGIHVTRFVFLATFNLLGNIMFSSDLVDPVSEKGSKFFNAMMGIMERGGTPNI  737
             + S +R   + ++R  F+   N++ NI+FS DL +  S K   F + ++G+ME  G P+ 
Sbjct  167   SESSEREEAVDISRATFITALNIISNILFSVDLGNYDSNKSGVFQDTVIGVMEAVGNPDA  226

Query  736   SDIFPCLRWLDLQG----LRTKTDKDLQIALQIVSTFVQKRSKEGQDDSGKRKSDFLDVL  569
             ++ FP L +LDLQG    L+  +++  ++    +   + ++S    +    R+ DF+DVL
Sbjct  227   ANFFPFLGFLDLQGNRKTLKACSERLFKVFRGFIDAKLAEKSLRDTNSKDVRERDFVDVL  286

Query  568   LSFEGSGKDEPPKLSEHQINIFILEMFLAGTDTTSS  461
             L      + E   L+ + I   +L++F AGTDT SS
Sbjct  287   LDLTEGDEAE---LNTNDIVHLLLDLFGAGTDTNSS  319



>ref|XP_006382522.1| hypothetical protein POPTR_0005s02960g [Populus trichocarpa]
 gb|ERP60319.1| hypothetical protein POPTR_0005s02960g [Populus trichocarpa]
Length=516

 Score =   233 bits (593),  Expect = 6e-66, Method: Compositional matrix adjust.
 Identities = 108/264 (41%), Positives = 167/264 (63%), Gaps = 4/264 (2%)
 Frame = -2

Query  1273  NMLDLGSVPHQTIAAMRNKYGPVVWLRIGSVSTLAIQSAKAAAELFKNHDVPFAGRSIGD  1094
             N+  LG  PH++   +   +GP++ + +GS+  + I S++ A E+FKNHD   AGR I +
Sbjct  47    NIFQLGWAPHESFTNLARVHGPIMTIWLGSMCNVVISSSEVAREMFKNHDAVLAGRKIYE  106

Query  1093  VMLAQGYNKGSMALAQYGSYWRVLRRICSVEMFVHKKVNETAAVRRKCIDDLLRWVENEA  914
              M     N+GS+  AQYG +WR+LRR+C+ E FV  +++     R +CID +L+++E+  
Sbjct  107   AMKGDFGNEGSIITAQYGPHWRMLRRLCTTEFFVSSRLDAMQGARTRCIDGMLQYIED--  164

Query  913   GSIKRGSGIHVTRFVFLATFNLLGNIMFSSDLVDPVSEKGSKFFNAMMGIMERGGTPNIS  734
             GS      I + R++FL  FNL+GN+MFS DL+DP SEKG+KFF     + E  G PN++
Sbjct  165   GSANGTRAIDLGRYIFLMAFNLIGNLMFSKDLLDPKSEKGAKFFQHAGKVTELAGKPNMA  224

Query  733   DIFPCLRWLDLQGLRTKTDKDLQIALQIVSTFVQKRSKEGQDDSGK--RKSDFLDVLLSF  560
             D FP LRWLD QG+R KT   +  A +I   F+++R++  Q ++ +  ++ D+LDV+L F
Sbjct  225   DFFPILRWLDPQGIRRKTQFHVARAFEIAGGFIKERTESVQKENSRDDKRKDYLDVILEF  284

Query  559   EGSGKDEPPKLSEHQINIFILEMF  488
              G G +EP + S   IN+ + EMF
Sbjct  285   RGDGVEEPSRFSSTTINVIVFEMF  308


 Score =   143 bits (361),  Expect = 7e-34, Method: Compositional matrix adjust.
 Identities = 58/106 (55%), Positives = 82/106 (77%), Gaps = 0/106 (0%)
 Frame = -1

Query  320  VEWALTELLRNPKAMTKAKEEIRGIVGPTRRFEESDIDNLQYLQAVVKETLRLHPPAPFL  141
            +EWA+ ELLRNP  +   + E+R I+GP ++ E+ D++NL YL+AV++ETLRLHPP PFL
Sbjct  319  LEWAMAELLRNPTVLKTVQSELRSIIGPNKKLEDKDVENLPYLKAVIRETLRLHPPLPFL  378

Query  140  IPRRAIQDTKFMGYDIPKDTQVFINVWAIGRDHESWEDPLSFKPER  3
            +P  A+   K +GY +PK+T + +NVWAIGRD ++W+DPL FKPER
Sbjct  379  VPHMAMNPCKMLGYYVPKETTILVNVWAIGRDSKTWDDPLVFKPER  424



>ref|XP_006439139.1| hypothetical protein CICLE_v10033708mg [Citrus clementina]
 gb|ESR52379.1| hypothetical protein CICLE_v10033708mg [Citrus clementina]
Length=512

 Score =   233 bits (593),  Expect = 7e-66, Method: Compositional matrix adjust.
 Identities = 117/265 (44%), Positives = 172/265 (65%), Gaps = 11/265 (4%)
 Frame = -2

Query  1273  NMLDLGSVP---HQTIAAMRNKYGPVVWLRIGSVSTLAIQSAKAAAELFKNHDVPFAGRS  1103
             N+  LG +P   H + A + +K+GP++ L +GS+ T+ + S + A ++FKNHDV  AGR 
Sbjct  50    NIFQLGWMPMPPHASFAILAHKHGPLMTLWLGSMCTVVVSSNEVARDMFKNHDVVLAGRK  109

Query  1102  IGDVMLAQGYNKGSMALAQYGSYWRVLRRICSVEMFVHKKVNETAAVRRKCIDDLLRWVE  923
             I + M      +GS+  +QYG++WR+LRR+C+ E FV  +++ T  VR KCID ++++VE
Sbjct  110   IYEAMKGDYGTEGSIITSQYGAHWRMLRRLCTTEFFVTSRLDATRGVRSKCIDRMVQFVE  169

Query  922   NEAGSIKRGSGIHVTRFVFLATFNLLGNIMFSSDLVDPVSEKGSKFFNAMMGIMERGGTP  743
              EAG+    + I V RF FL  FNL+GN+MFS DL+ P SE+G+KF      +ME  G P
Sbjct  170   -EAGAC---APIDVGRFTFLMAFNLIGNLMFSKDLLGPESERGAKFSYHAGKVMELAGKP  225

Query  742   NISDIFPCLRWLDLQGLRTKTDKDLQIALQIVSTFVQKRSKEGQDDSGKRKSDFLDVLLS  563
             N++D  P LRWLD QG+R KT   ++ A +I   F+++R     +D+ ++K DFLDVLL+
Sbjct  226   NVADFLPILRWLDPQGIRKKTQFHVERAFEIAGGFIKER----MEDNEEKKKDFLDVLLA  281

Query  562   FEGSGKDEPPKLSEHQINIFILEMF  488
             F G G DEP K S   IN+ + EMF
Sbjct  282   FRGDGVDEPAKFSSRTINVIVFEMF  306


 Score =   139 bits (350),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 59/106 (56%), Positives = 81/106 (76%), Gaps = 0/106 (0%)
 Frame = -1

Query  320  VEWALTELLRNPKAMTKAKEEIRGIVGPTRRFEESDIDNLQYLQAVVKETLRLHPPAPFL  141
            +EWA+ ELL +P+ + K ++E+R +V P ++ EE DI+ L YL+AV+KETLRLHPP PFL
Sbjct  317  LEWAMAELLHDPETLKKVQDELRSVVSPNKKLEEEDIEQLPYLKAVIKETLRLHPPLPFL  376

Query  140  IPRRAIQDTKFMGYDIPKDTQVFINVWAIGRDHESWEDPLSFKPER  3
            +P  A+      GY IPK+TQ+ +NVWAIGRD ++W+DPL FKPER
Sbjct  377  VPHMAMDSCNMQGYYIPKETQILVNVWAIGRDPKTWKDPLLFKPER  422



>ref|XP_002276121.1| PREDICTED: geraniol 8-hydroxylase-like isoform X2 [Vitis vinifera]
Length=465

 Score =   141 bits (356),  Expect(2) = 7e-66, Method: Compositional matrix adjust.
 Identities = 84/271 (31%), Positives = 135/271 (50%), Gaps = 40/271 (15%)
 Frame = -2

Query  1273  NMLDLGSVPHQTIAAMRNKYGPVVWLRIGSVSTLAIQSAKAAAELFKNHDVPFAGRSIGD  1094
             N+L LG  PH+++A +   YGPV+ L++GS++T+ I S++ A E+   +D  F+ R++ D
Sbjct  46    NILKLGDKPHRSLANLSKTYGPVMSLKLGSIATIVISSSETAKEVLHRNDQAFSSRTVPD  105

Query  1093  VMLAQGYNKGSMALAQYGSYWRVLRRICSVEMFVHKKVNETAAVRRKCIDDLLRWVENEA  914
              + A  +++ S+       +WR +R+IC+ E+F  ++++ +  +RRK + +LL  VE   
Sbjct  106   AVRAHNHHESSVVWVPASVHWRKIRKICTREIFSVQQLDASQGLRRKIVQELLDHVEE--  163

Query  913   GSIKRGSGIHVTRFVFLATFNLLGNIMFSSDLVDPVSEKGSKFFNAMMGIMERGGTPNIS  734
                 RG  + +   VF A+ NLL N +FS +L    S    +F N   G+ME  G PN  
Sbjct  164   -CCSRGCAVDINGAVFTASLNLLSNTIFSINLAHHGSNFSQEFKNIARGVMEGVGRPNFV  222

Query  733   DIFPCLRWLDLQGLRTKTDKDLQIALQIVSTFVQKRSKEGQDDSGKRKSDFLDVLLSFEG  554
             D FP  R +D Q  +                                  D LD LL+   
Sbjct  223   DYFPAFRLIDPQASK----------------------------------DVLDALLNLTK  248

Query  553   SGKDEPPKLSEHQINIFILEMFLAGTDTTSS  461
                +E    S   I   +L++F+AGTDTTSS
Sbjct  249   ENDNE---WSCSDIKHLLLDLFVAGTDTTSS  276


 Score =   138 bits (348),  Expect(2) = 7e-66, Method: Compositional matrix adjust.
 Identities = 62/114 (54%), Positives = 82/114 (72%), Gaps = 0/114 (0%)
 Frame = -1

Query  344  NTALTSSTVEWALTELLRNPKAMTKAKEEIRGIVGPTRRFEESDIDNLQYLQAVVKETLR  165
             T  TSSTVEWA+ ELL NP+ + KA++EIRG++G     +ESDI    YLQ++VKET R
Sbjct  270  GTDTTSSTVEWAMAELLCNPEKIAKAQKEIRGVLGNEGIVQESDISKFPYLQSIVKETFR  329

Query  164  LHPPAPFLIPRRAIQDTKFMGYDIPKDTQVFINVWAIGRDHESWEDPLSFKPER  3
            LHPPAP L+P +A  D +  G+ IPK++QV +N WAIGRD  +W +P +F PER
Sbjct  330  LHPPAPLLVPHKAETDVEICGFTIPKNSQVLVNAWAIGRDPSTWPNPNAFMPER  383



>ref|XP_011017515.1| PREDICTED: geraniol 8-hydroxylase-like [Populus euphratica]
 ref|XP_011013816.1| PREDICTED: geraniol 8-hydroxylase-like [Populus euphratica]
Length=496

 Score =   162 bits (410),  Expect(2) = 7e-66, Method: Compositional matrix adjust.
 Identities = 84/272 (31%), Positives = 155/272 (57%), Gaps = 9/272 (3%)
 Frame = -2

Query  1273  NMLDLGSVPHQTIAAMRNKYGPVVWLRIGSVSTLAIQSAKAAAELFKNHDVPFAGRSIGD  1094
             N+L LG  PH+T+A +   YGP++ L++G ++T+ I S   A E  + HD   + R++ D
Sbjct  47    NILALGDKPHRTLAKLSQTYGPLMTLKLGRITTIVISSPNIANEALQKHDQALSSRTVPD  106

Query  1093  VMLAQGYNKGSMALAQYGSYWRVLRRICSVEMFVHKKVNETAAVRRKCIDDLLRWVENEA  914
              +  + +++ S+      ++W+ LR++ + +MF  ++++ + A+R K + ++L +V    
Sbjct  107   AL--RVHHRNSILWLPASTHWKFLRKLTATQMFTSQRLDASRALRGKKVQEMLEYVHENC  164

Query  913   GSIKRGSGIHVTRFVFLATFNLLGNIMFSSDLVDPVSEKGSKFFNAMMGIMERGGTPNIS  734
              +   G  + + R VF  + NL+ N  FS D+ +  S+   +F + ++G+ E+ G PNI+
Sbjct  165   DN---GRAVDIRRSVFTTSLNLISNTFFSLDIANYNSDLSQEFSDLVVGVTEQIGKPNIA  221

Query  733   DIFPCLRWLDLQGLRTKTDKDLQIALQIVSTFVQKRSKEGQDDSGKRKS-DFLDVLLSFE  557
             D FP LR +D QG+R KT+  L+   QI  + +++R++        + S D LD LL   
Sbjct  222   DYFPILRLVDPQGIRRKTNIYLKRLTQIFDSIIKERTRPRSSSVASKASHDILDALLIL-  280

Query  556   GSGKDEPPKLSEHQINIFILEMFLAGTDTTSS  461
                K+   +LS   I + +++ F+ GTDTTSS
Sbjct  281   --AKENNSELSSTDIQVLLIDFFIGGTDTTSS  310


 Score =   118 bits (295),  Expect(2) = 7e-66, Method: Compositional matrix adjust.
 Identities = 65/114 (57%), Positives = 82/114 (72%), Gaps = 3/114 (3%)
 Frame = -1

Query  344  NTALTSSTVEWALTELLRNPKAMTKAKEEIRGIVGPTRRFEESDIDNLQYLQAVVKETLR  165
             T  TSSTVEWA+TELL NP  M KAK+E++ + GP    +ESDI    YLQA+VKET R
Sbjct  304  GTDTTSSTVEWAMTELLLNPDKMVKAKKELQQVEGPV---QESDISKCLYLQAIVKETFR  360

Query  164  LHPPAPFLIPRRAIQDTKFMGYDIPKDTQVFINVWAIGRDHESWEDPLSFKPER  3
            LHPP P L+PR+A+ + +  G+ +PK+ Q+ IN+WAIGRD   W DP SFKPER
Sbjct  361  LHPPVPLLLPRKAVSEVEIQGFTVPKNAQILINIWAIGRDPAIWPDPNSFKPER  414



>ref|XP_009372318.1| PREDICTED: geraniol 8-hydroxylase-like [Pyrus x bretschneideri]
Length=502

 Score =   142 bits (357),  Expect(2) = 8e-66, Method: Compositional matrix adjust.
 Identities = 64/114 (56%), Positives = 83/114 (73%), Gaps = 0/114 (0%)
 Frame = -1

Query  344  NTALTSSTVEWALTELLRNPKAMTKAKEEIRGIVGPTRRFEESDIDNLQYLQAVVKETLR  165
             T  TSST+EWA+ ELLRNPK ++KA+EE+  ++G  +  EES I  L YLQA++KET R
Sbjct  309  GTDTTSSTLEWAMAELLRNPKKLSKAQEELDQVIGKGKLVEESSIAGLPYLQAIIKETFR  368

Query  164  LHPPAPFLIPRRAIQDTKFMGYDIPKDTQVFINVWAIGRDHESWEDPLSFKPER  3
            LHPPAP L+ R+A +D +  GY +PK  QVF+N WAIGRD   W+ P SF+PER
Sbjct  369  LHPPAPLLLTRKAEEDVEICGYIVPKGAQVFVNAWAIGRDPSIWDSPNSFEPER  422


 Score =   138 bits (347),  Expect(2) = 8e-66, Method: Compositional matrix adjust.
 Identities = 83/271 (31%), Positives = 140/271 (52%), Gaps = 6/271 (2%)
 Frame = -2

Query  1273  NMLDLGSVPHQTIAAMRNKYGPVVWLRIGSVSTLAIQSAKAAAELFKNHDVPFAGRSIGD  1094
             N+L+LG+ PH ++  +   YGPV+ L++G V+T+ + S+ AA E+ + HD     R +  
Sbjct  51    NLLELGNKPHLSLTKLSQIYGPVITLQLGQVTTVVVSSSTAAKEVLRTHDQLLCNRMVPS  110

Query  1093  VMLAQGYNKGSMALAQYGSYWRVLRRICSVEMFVHKKVNETAAVRRKCIDDLLRWVENEA  914
              + A    + ++A     + WR LR+IC+ ++F    ++ + A R K + +L+  V    
Sbjct  111   AVRACDMGEHNLAWIPASAKWRSLRKICNSQLFAVTVLDASKANRHKKVQELIADVN---  167

Query  913   GSIKRGSGIHVTRFVFLATFNLLGNIMFSSDLVDPVSEKGSKFFNAMMGIMERGGTPNIS  734
              S  +G  + + R  F  T NLL   +FS DL DP SE   +F   + G++E  G PN+ 
Sbjct  168   ASKVKGKAVEIGRAAFSTTLNLLSRTIFSMDLADPRSETTKEFKQTVSGLLEEAGKPNLG  227

Query  733   DIFPCLRWLDLQGLRTKTDKDLQIALQIVSTFVQKRSKEGQDDSGKRKSDFLDVLLSFEG  554
             D FP L  LD QG++ +         ++    + +R +  +      + D LD LLS   
Sbjct  228   DYFPVLGKLDPQGIQRRMTNHFLKMERLFDQIIAQRLESRKAHDYVTRDDMLDTLLSISE  287

Query  553   SGKDEPPKLSEHQINIFILEMFLAGTDTTSS  461
                +E   + ++++    L +F AGTDTTSS
Sbjct  288   VNCEE---MDKNKMEHLFLVIFAAGTDTTSS  315



>gb|ADE80941.1| flavonoid 3'-hydroxylase [Epimedium sagittatum]
Length=514

 Score =   152 bits (384),  Expect(2) = 8e-66, Method: Compositional matrix adjust.
 Identities = 91/273 (33%), Positives = 144/273 (53%), Gaps = 8/273 (3%)
 Frame = -2

Query  1273  NMLDLGSVPHQTIAAMRNKYGPVVWLRIGSVSTLAIQSAKAAAELFKNHDVPFAGRSIGD  1094
             N+L LG VPH ++AA+  KYGP++ LR+GSV  +   S+  A ++FK HDV F+ R    
Sbjct  44    NLLHLGRVPHHSLAALAKKYGPLMHLRLGSVHVIVAASSSVATQIFKTHDVNFSSRPPNS  103

Query  1093  VMLAQGYNKGSMALAQYGSYWRVLRRICSVEMFVHKKVNETAAVRRKCIDDLLRWVENEA  914
                   YN   +  A YG  WR+LR+ICSV +F  K +++   +R++ +  L+  +  +A
Sbjct  104   GAKHIAYNYQDLVFAPYGPKWRMLRKICSVHLFSAKALDDFRHIRQEEVLVLINAL-FQA  162

Query  913   GSIKRGSGIHVTRFVFLATFNLLGNIMFSSDLVDPVS--EKGSKFFNAMMGIMERGGTPN  740
             G     +   + + + + T N+LG +M    +    S  EK  +F   ++ +M   G  N
Sbjct  163   GK----APTDLAKLLNVCTTNVLGRVMLGRRVFGDGSGDEKSEEFKQMVVEMMVLAGVFN  218

Query  739   ISDIFPCLRWLDLQGLRTKTDKDLQIALQIVSTFVQKRSKEGQDDSGKRKSDFLDVLLSF  560
             I D  P L WLDLQG+ +K  K L          + +  KE   + G   +D L VL+  
Sbjct  219   IGDFVPSLEWLDLQGVASKM-KKLHNRFDEFLNKILEEHKESNGEDGHVHTDLLSVLIGL  277

Query  559   EGSGKDEPPKLSEHQINIFILEMFLAGTDTTSS  461
             +   + E  KL++  I   +L++F AGTDT+SS
Sbjct  278   KDDAEGEGGKLTDTNIKALLLDLFTAGTDTSSS  310


 Score =   127 bits (320),  Expect(2) = 8e-66, Method: Compositional matrix adjust.
 Identities = 56/114 (49%), Positives = 78/114 (68%), Gaps = 0/114 (0%)
 Frame = -1

Query  344  NTALTSSTVEWALTELLRNPKAMTKAKEEIRGIVGPTRRFEESDIDNLQYLQAVVKETLR  165
             T  +SSTVEWA+ EL+RNPK + +A+EE+  +VG  R   ESD+  L + QA++KET R
Sbjct  304  GTDTSSSTVEWAIAELIRNPKLLAQAQEELNQVVGRDRLVSESDLGQLTFFQAIIKETFR  363

Query  164  LHPPAPFLIPRRAIQDTKFMGYDIPKDTQVFINVWAIGRDHESWEDPLSFKPER  3
            LHP  P  +PR A +  +  GY IPK++ + +NVWAI RD + W +PL FKP+R
Sbjct  364  LHPSTPLSLPRMASESCEIDGYHIPKNSTLLVNVWAIARDPDVWSEPLEFKPDR  417



>ref|XP_010544666.1| PREDICTED: cytochrome P450 76C4-like [Tarenaya hassleriana]
Length=513

 Score =   149 bits (376),  Expect(2) = 9e-66, Method: Compositional matrix adjust.
 Identities = 69/114 (61%), Positives = 86/114 (75%), Gaps = 0/114 (0%)
 Frame = -1

Query  344  NTALTSSTVEWALTELLRNPKAMTKAKEEIRGIVGPTRRFEESDIDNLQYLQAVVKETLR  165
             T   SSTVEWA+ ELLRNP+ M +A+EEIR ++G     +ESDI  L YLQAVVKET R
Sbjct  312  GTDTNSSTVEWAMAELLRNPEKMERAQEEIRRMIGEHEIVQESDIAKLPYLQAVVKETFR  371

Query  164  LHPPAPFLIPRRAIQDTKFMGYDIPKDTQVFINVWAIGRDHESWEDPLSFKPER  3
            LHPPAP LIPR+A  D + +G+ +PK+ QV INVWAIGRD + WE+P+ F+PER
Sbjct  372  LHPPAPLLIPRKAESDVQILGFLVPKNAQVLINVWAIGRDPDVWENPMKFEPER  425


 Score =   130 bits (328),  Expect(2) = 9e-66, Method: Compositional matrix adjust.
 Identities = 76/271 (28%), Positives = 144/271 (53%), Gaps = 3/271 (1%)
 Frame = -2

Query  1273  NMLDLGSVPHQTIAAMRNKYGPVVWLRIGSVSTLAIQSAKAAAELFKNHDVPFAGRSIGD  1094
             N+LDLG  PH+++A +   YGPV+ L++G+V+T+ + S +AA  + + HD   + R+   
Sbjct  51    NILDLGKSPHRSLAELSKTYGPVMSLKLGTVTTVVVSSPEAAKNVLQTHDHVLSARTFNY  110

Query  1093  VMLAQGYNKGSMALAQYGSYWRVLRRICSVEMFVHKKVNETAAVRRKCIDDLLRWVENEA  914
              + + G++  S+      + WR+LR++ + ++F  +++  T +VR   + +LL+++    
Sbjct  111   SVRSFGHHDVSIVWLPPTAPWRLLRKVSANQLFSPQRLEATKSVRMDKVKELLKFLSE--  168

Query  913   GSIKRGSGIHVTRFVFLATFNLLGNIMFSSDLVDPVSEKGSKFFNAMMGIMERGGTPNIS  734
              S +RG  +   R  F+A  N++ N +FS D     S+    + + ++ +ME  G  +I+
Sbjct  169   -SSERGEAVDFARASFVAVLNIVSNALFSVDFASYDSQASQDYRDIVIRVMEVAGKIDIA  227

Query  733   DIFPCLRWLDLQGLRTKTDKDLQIALQIVSTFVQKRSKEGQDDSGKRKSDFLDVLLSFEG  554
             + FP L +LDLQG   +          +   F+  RS+E    +  +     D+L +   
Sbjct  228   NFFPFLGFLDLQGTGKEARDCTGKLFNVFQGFIDARSRERLSRTEPKDVPGTDLLDALLD  287

Query  553   SGKDEPPKLSEHQINIFILEMFLAGTDTTSS  461
               +D   +L    I+  +L++F AGTDT SS
Sbjct  288   LTRDNEAELDMKSISHLLLDLFGAGTDTNSS  318



>ref|XP_002878356.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH54615.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
Length=518

 Score =   142 bits (359),  Expect(2) = 9e-66, Method: Compositional matrix adjust.
 Identities = 67/114 (59%), Positives = 82/114 (72%), Gaps = 0/114 (0%)
 Frame = -1

Query  344  NTALTSSTVEWALTELLRNPKAMTKAKEEIRGIVGPTRRFEESDIDNLQYLQAVVKETLR  165
             T   S+TVEWAL ELLRNP+AM  AK EI  IVGP R   +S++    YLQAVV ETLR
Sbjct  315  GTETNSTTVEWALAELLRNPEAMANAKVEINFIVGPNRYVRDSNLFEFPYLQAVVTETLR  374

Query  164  LHPPAPFLIPRRAIQDTKFMGYDIPKDTQVFINVWAIGRDHESWEDPLSFKPER  3
            LHPP+PFLIPR+A  DT+ +GY IP++ Q+ +N WAIGRD   WE+   F+PER
Sbjct  375  LHPPSPFLIPRKAESDTEILGYPIPENAQILVNAWAIGRDPSVWENAEQFEPER  428


 Score =   137 bits (344),  Expect(2) = 9e-66, Method: Compositional matrix adjust.
 Identities = 88/279 (32%), Positives = 152/279 (54%), Gaps = 17/279 (6%)
 Frame = -2

Query  1273  NMLDL-GSVPHQTIAAMRNKYGPVVWLRIGSVSTLAIQSAKAAAELFKNHDVPFAGRSIG  1097
             N+L + G  PH+++A +   YGPV+ LR+GS++T+ I S  AA E+ K  D   +GR+  
Sbjct  52    NLLQIIGKAPHRSLADLSRVYGPVMSLRLGSLATVVISSPDAAREVLKTLDHVLSGRTSS  111

Query  1096  DVMLAQGYNKGSMA-LAQYGSYWRVLRRICSVEMFVHKKVNETAAVRRKCIDDLLRWVEN  920
             + + A G++  S+A L    S WR+ R++ + ++F  ++   T +VR K   +L+ ++  
Sbjct  112   ETVRAFGHHDVSIAWLPSTSSRWRLWRKVLATKLFSRERHKATKSVRSKKAKELITFIIE  171

Query  919   EAGSIKRGSGIHVTRFVFLATFNLLGNIMFSSDL--VDP-VSEKGSKFFNAMMGIMERGG  749
                  +RG  + + R  F+ + N++ N++FS DL   DP  S +     + MM IM   G
Sbjct  172   RG---ERGFSVDIARACFITSLNVISNVVFSIDLGGYDPRASTELQDSLSRMMKIM---G  225

Query  748   TPNISDIFPCLRWLDLQGLRTKTDKDLQIALQIVSTFVQKRSKEGQDDSGKR---KSDFL  578
              PN+ + FP L +LD+QG+R +     +   QI    V  R  E    +G R   + D L
Sbjct  226   KPNLVNYFPSLEFLDIQGIRKEMKVCSERLFQIFQGLVNARIAERSSQTGPRDALRGDLL  285

Query  577   DVLLSFEGSGKDEPPKLSEHQINIFILEMFLAGTDTTSS  461
             D L+      ++E  ++  + IN F+ ++F+AGT+T S+
Sbjct  286   DSLIDL---IQEEGSEVDMNDINHFLCDLFIAGTETNST  321



>ref|XP_006382524.1| hypothetical protein POPTR_0005s02990g [Populus trichocarpa]
 gb|ERP60321.1| hypothetical protein POPTR_0005s02990g [Populus trichocarpa]
Length=516

 Score =   232 bits (592),  Expect = 9e-66, Method: Compositional matrix adjust.
 Identities = 109/264 (41%), Positives = 167/264 (63%), Gaps = 4/264 (2%)
 Frame = -2

Query  1273  NMLDLGSVPHQTIAAMRNKYGPVVWLRIGSVSTLAIQSAKAAAELFKNHDVPFAGRSIGD  1094
             N+  LG  PH++   +   +GP++ + +GS+  + I S++ A E+FKNHD   AGR I +
Sbjct  47    NIFQLGWAPHESFTNLARVHGPIMTIWLGSMCNVVISSSEVAREMFKNHDAVLAGRKIYE  106

Query  1093  VMLAQGYNKGSMALAQYGSYWRVLRRICSVEMFVHKKVNETAAVRRKCIDDLLRWVENEA  914
              M     N+GS+  AQYG +WR+LRR+C+ E FV  +++     R +CID +L+++E+  
Sbjct  107   AMKGDFGNEGSIITAQYGPHWRMLRRLCTTEFFVTSRLDAMQGARTRCIDGMLQYIED--  164

Query  913   GSIKRGSGIHVTRFVFLATFNLLGNIMFSSDLVDPVSEKGSKFFNAMMGIMERGGTPNIS  734
             GS    S I + R++FL  FNL+GN+MFS DL+DP SEKG+KFF     +ME  G PN++
Sbjct  165   GSANGTSAIDLGRYIFLMAFNLIGNLMFSKDLLDPKSEKGAKFFQHAGKVMELAGKPNMA  224

Query  733   DIFPCLRWLDLQGLRTKTDKDLQIALQIVSTFVQKRSKEGQDDSGK--RKSDFLDVLLSF  560
             D    LRWLD QG+R KT   +  A +I   F+++R++  Q ++ +  ++ D+LDVLL F
Sbjct  225   DFLTILRWLDPQGIRRKTQFHVARAFEIAGGFIKERTESMQKENSRDDKRKDYLDVLLEF  284

Query  559   EGSGKDEPPKLSEHQINIFILEMF  488
              G G +EP + S   IN+ + EMF
Sbjct  285   RGDGVEEPSRFSSTTINVIVFEMF  308


 Score =   144 bits (364),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 60/106 (57%), Positives = 82/106 (77%), Gaps = 0/106 (0%)
 Frame = -1

Query  320  VEWALTELLRNPKAMTKAKEEIRGIVGPTRRFEESDIDNLQYLQAVVKETLRLHPPAPFL  141
            +EWA+ ELLRNPK +   + E+R  +GP ++ E+ DI+NL YL+AV++ETLRLHPP PFL
Sbjct  319  LEWAMAELLRNPKVLKTVQSELRSTIGPNKKLEDKDIENLPYLKAVIRETLRLHPPLPFL  378

Query  140  IPRRAIQDTKFMGYDIPKDTQVFINVWAIGRDHESWEDPLSFKPER  3
            +P  A+   K +GY IPK+T + +NVWAIGRD ++W+DPL FKPER
Sbjct  379  VPHMAMNPCKMLGYYIPKETTILVNVWAIGRDSKTWDDPLVFKPER  424



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 4101634907730