BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c25620_g2_i2 len=1415 path=[4278:0-227 4506:228-261 8606:262-268
4547:269-374 477:375-392 495:393-417 25:418-431 39:432-478
4757:479-505 4784:506-570 360:571-590 380:591-648 8195:649-666
4943:667-747 6870:748-752 5029:753-812 8283:813-836 1911:837-876
752:877-943 2012:944-985 8907:986-988 2056:989-1016 8923:1017-1026
8933:1027-1046 6346:1047-1091 8954:1092-1103 8966:1104-1109
8972:1110-1113 8976:1114-1131 7423:1132-1163 2230:1164-1200
9017:1201-1204 8086:1205-1205 598:1206-1250 2316:1251-1293
441:1294-1304 452:1305-1414]

Length=1415
                                                                      Score     E

gb|AAT68601.1|  benzoyl coenzyme A: benzyl alcohol benzoyl transf...    533   0.0      Petunia x hybrida [garden petunia]
sp|Q8GT20.1|BEBT_TOBAC  RecName: Full=Benzyl alcohol O-benzoyltra...    530   0.0      Nicotiana tabacum [American tobacco]
ref|XP_009804829.1|  PREDICTED: benzyl alcohol O-benzoyltransferase     530   0.0      
ref|XP_004290447.1|  PREDICTED: benzyl alcohol O-benzoyltransfera...    530   0.0      
ref|XP_009619718.1|  PREDICTED: benzyl alcohol O-benzoyltransferase     529   0.0      
emb|CDP21409.1|  unnamed protein product                                529   0.0      
emb|CAA64636.1|  hsr201                                                 528   0.0      Nicotiana tabacum [American tobacco]
ref|XP_009803456.1|  PREDICTED: benzyl alcohol O-benzoyltransfera...    526   1e-180   
ref|XP_004243496.2|  PREDICTED: benzyl alcohol O-benzoyltransferase     526   3e-180   
ref|XP_004243495.1|  PREDICTED: benzyl alcohol O-benzoyltransfera...    524   1e-179   
dbj|BAF49304.1|  putative acyltransferase                               523   2e-179   Clitoria ternatea
gb|ACJ85557.1|  unknown                                                 520   2e-178   Medicago truncatula
ref|XP_008232530.1|  PREDICTED: benzyl alcohol O-benzoyltransferase     520   4e-178   
ref|XP_008462816.1|  PREDICTED: benzyl alcohol O-benzoyltransfera...    519   6e-178   
gb|AFK36385.1|  unknown                                                 518   2e-177   
ref|XP_008359502.1|  PREDICTED: benzyl alcohol O-benzoyltransfera...    518   2e-177   
ref|XP_003518844.1|  PREDICTED: benzyl alcohol O-benzoyltransferase     516   7e-177   
gb|AAW51125.1|  putative alcohol acyl-transferases                      516   9e-177   Cucumis melo [Oriental melon]
ref|XP_010275172.1|  PREDICTED: benzyl alcohol O-benzoyltransferase     515   2e-176   
gb|KDP39568.1|  hypothetical protein JCGZ_02588                         515   2e-176   
ref|XP_009372579.1|  PREDICTED: benzyl alcohol O-benzoyltransfera...    514   4e-176   
ref|XP_004151058.1|  PREDICTED: benzyl alcohol O-benzoyltransfera...    512   4e-175   
ref|XP_006484694.1|  PREDICTED: benzyl alcohol O-benzoyltransfera...    511   7e-175   
ref|XP_006437408.1|  hypothetical protein CICLE_v10031489mg             511   9e-175   
ref|XP_003536235.1|  PREDICTED: benzyl alcohol O-benzoyltransfera...    509   4e-174   
gb|KHF99421.1|  Benzyl alcohol O-benzoyltransferase                     509   4e-174   
emb|CDP18599.1|  unnamed protein product                                509   6e-174   
ref|XP_011085895.1|  PREDICTED: LOW QUALITY PROTEIN: benzyl alcoh...    506   1e-172   
ref|XP_004498016.1|  PREDICTED: benzyl alcohol O-benzoyltransfera...    502   4e-171   
ref|XP_007145940.1|  hypothetical protein PHAVU_007G280800g             501   8e-171   
ref|XP_007029788.1|  Benzoyl coenzyme A: Benzyl alcohol benzoyl t...    498   7e-170   
ref|XP_009388282.1|  PREDICTED: benzyl alcohol O-benzoyltransferase     496   8e-169   
gb|EYU34530.1|  hypothetical protein MIMGU_mgv1a006233mg                495   9e-169   
gb|AJD25145.1|  benzoyl-CoA:benzyl alcohol O-benzoyltransferase         495   2e-168   
ref|XP_002325454.2|  transferase family protein                         495   2e-168   Populus trichocarpa [western balsam poplar]
gb|EYU41389.1|  hypothetical protein MIMGU_mgv1a006154mg                494   3e-168   
ref|XP_011012995.1|  PREDICTED: benzyl alcohol O-benzoyltransfera...    493   6e-168   
sp|Q8GT21.1|BEBT_CLABR  RecName: Full=Benzyl alcohol O-benzoyltra...    489   3e-166   Clarkia breweri [fairy fans]
gb|KEH40969.1|  benzyl alcohol O-benzoyltransferase                     489   4e-166   
ref|XP_003554685.1|  PREDICTED: benzyl alcohol O-benzoyltransfera...    488   1e-165   
gb|EYU41386.1|  hypothetical protein MIMGU_mgv1a006089mg                488   1e-165   
gb|KEH40971.1|  benzyl alcohol O-benzoyltransferase                     488   1e-165   
dbj|BAE72881.1|  benzoyl CoA benzoic acid benzoyltransferase            487   2e-165   Glandularia x hybrida [garden verbena]
ref|XP_010038484.1|  PREDICTED: benzyl alcohol O-benzoyltransfera...    486   3e-165   
ref|XP_009374085.1|  PREDICTED: benzyl alcohol O-benzoyltransfera...    485   2e-164   
ref|XP_010672751.1|  PREDICTED: benzyl alcohol O-benzoyltransfera...    484   5e-164   
ref|XP_007029777.1|  Benzoyl coenzyme A: Benzyl alcohol benzoyl t...    483   1e-163   
ref|XP_002319767.1|  transferase family protein                         482   2e-163   Populus trichocarpa [western balsam poplar]
gb|KEH40970.1|  benzyl alcohol O-benzoyltransferase                     474   7e-161   
ref|XP_009803457.1|  PREDICTED: benzyl alcohol O-benzoyltransfera...    474   8e-161   
ref|XP_002264599.1|  PREDICTED: benzyl alcohol O-benzoyltransferase     472   2e-159   Vitis vinifera
emb|CDP09539.1|  unnamed protein product                                469   2e-158   
ref|XP_008462820.1|  PREDICTED: benzyl alcohol O-benzoyltransfera...    466   3e-157   
gb|KHN43217.1|  Benzyl alcohol O-benzoyltransferase                     464   6e-157   
ref|XP_011085899.1|  PREDICTED: benzyl alcohol O-benzoyltransfera...    464   4e-156   
gb|EYU41395.1|  hypothetical protein MIMGU_mgv1a006288mg                462   8e-156   
ref|XP_003521737.1|  PREDICTED: benzyl alcohol O-benzoyltransfera...    463   8e-156   
ref|XP_002466979.1|  hypothetical protein SORBIDRAFT_01g017800          462   9e-156   Sorghum bicolor [broomcorn]
ref|XP_010040517.1|  PREDICTED: benzyl alcohol O-benzoyltransfera...    461   2e-155   
ref|XP_004982683.1|  PREDICTED: benzyl alcohol O-benzoyltransfera...    461   2e-155   
ref|XP_010040516.1|  PREDICTED: benzyl alcohol O-benzoyltransfera...    461   3e-155   
ref|XP_010644575.1|  PREDICTED: methanol O-anthraniloyltransferas...    460   5e-155   
ref|XP_008462818.1|  PREDICTED: benzyl alcohol O-benzoyltransfera...    460   9e-155   
ref|XP_011085894.1|  PREDICTED: benzyl alcohol O-benzoyltransfera...    459   9e-155   
ref|XP_007029776.1|  Benzoyl coenzyme A: Benzyl alcohol benzoyl t...    461   3e-154   
ref|XP_002319766.1|  hypothetical protein POPTR_0013s07230g             458   3e-154   Populus trichocarpa [western balsam poplar]
ref|NP_001152518.1|  10-deacetylbaccatin III 10-O-acetyltransferase     458   4e-154   Zea mays [maize]
tpg|DAA49395.1|  TPA: 10-deacetylbaccatin III 10-O-acetyltransferase    458   4e-154   
ref|XP_011098396.1|  PREDICTED: benzyl alcohol O-benzoyltransfera...    457   1e-153   
ref|XP_011046333.1|  PREDICTED: benzyl alcohol O-benzoyltransfera...    457   1e-153   
ref|XP_003549135.1|  PREDICTED: 13-hydroxylupanine O-tigloyltrans...    456   2e-153   
gb|ACT82248.1|  alcohol acyltransferase                                 456   2e-153   Vasconcellea cundinamarcensis
ref|XP_011046335.1|  PREDICTED: benzyl alcohol O-benzoyltransfera...    455   5e-153   
ref|XP_011009229.1|  PREDICTED: benzyl alcohol O-benzoyltransfera...    455   6e-153   
ref|XP_007029787.1|  Benzoyl coenzyme A: Benzyl alcohol benzoyl t...    454   6e-152   
ref|XP_007029786.1|  Benzoyl coenzyme A: Benzyl alcohol benzoyl t...    455   8e-152   
dbj|BAJ92444.1|  predicted protein                                      453   1e-151   
ref|XP_006370913.1|  hypothetical protein POPTR_0019s01680g             451   2e-151   
ref|XP_006878638.1|  hypothetical protein AMTR_s00011p00264170          452   2e-151   
emb|CAN74729.1|  hypothetical protein VITISV_042062                     451   3e-151   Vitis vinifera
ref|XP_002265841.1|  PREDICTED: methanol O-anthraniloyltransferase      451   3e-151   Vitis vinifera
ref|XP_002266114.1|  PREDICTED: methanol O-anthraniloyltransferas...    450   5e-151   Vitis vinifera
gb|ABK96738.1|  unknown                                                 449   1e-150   Populus trichocarpa x Populus deltoides
ref|XP_002271603.1|  PREDICTED: methanol O-anthraniloyltransferase      448   2e-150   Vitis vinifera
emb|CAN77583.1|  hypothetical protein VITISV_040970                     448   3e-150   Vitis vinifera
ref|XP_004151857.1|  PREDICTED: benzyl alcohol O-benzoyltransfera...    448   3e-150   
ref|XP_007029790.1|  Benzoyl coenzyme A: Benzyl alcohol benzoyl t...    448   4e-150   
gb|KDP39576.1|  hypothetical protein JCGZ_02596                         447   5e-150   
ref|XP_008678444.1|  PREDICTED: benzyl alcohol O-benzoyltransfera...    448   5e-150   
gb|KHN31434.1|  Benzyl alcohol O-benzoyltransferase                     448   7e-150   
ref|XP_002319765.2|  hypothetical protein POPTR_0013s07220g             446   8e-150   Populus trichocarpa [western balsam poplar]
ref|XP_002266420.1|  PREDICTED: methanol O-anthraniloyltransferase      447   8e-150   Vitis vinifera
emb|CBI37442.3|  unnamed protein product                                447   1e-149   
ref|XP_007029781.1|  Benzoyl coenzyme A: Benzyl alcohol benzoyl t...    450   1e-149   
ref|XP_002270962.1|  PREDICTED: methanol O-anthraniloyltransferas...    446   2e-149   Vitis vinifera
emb|CAN69948.1|  hypothetical protein VITISV_009219                     446   2e-149   Vitis vinifera
ref|XP_004156760.1|  PREDICTED: LOW QUALITY PROTEIN: benzyl alcoh...    446   2e-149   
sp|Q3ZPN4.1|ACMAT_VITLA  RecName: Full=Methanol O-anthraniloyltra...    445   5e-149   Vitis labrusca [Concord grape]
ref|XP_004151858.1|  PREDICTED: benzyl alcohol O-benzoyltransfera...    445   5e-149   
ref|XP_007147136.1|  hypothetical protein PHAVU_006G098800g             445   7e-149   
ref|XP_007029789.1|  Benzoyl coenzyme A: Benzyl alcohol benzoyl t...    444   1e-148   
gb|KHN31436.1|  Benzyl alcohol O-benzoyltransferase                     443   2e-148   
gb|AES82607.2|  benzyl alcohol O-benzoyltransferase                     444   2e-148   
ref|XP_004156786.1|  PREDICTED: benzyl alcohol O-benzoyltransfera...    447   2e-148   
ref|XP_003520833.1|  PREDICTED: benzyl alcohol O-benzoyltransfera...    443   3e-148   
ref|XP_003574156.1|  PREDICTED: benzyl alcohol O-benzoyltransferase     443   4e-148   
ref|NP_001266678.1|  10-deacetylbaccatin III 10-O-acetyltransferase     442   8e-148   
emb|CAN68818.1|  hypothetical protein VITISV_012041                     442   8e-148   Vitis vinifera
ref|NP_001064997.1|  Os10g0503300                                       442   1e-147   Oryza sativa Japonica Group [Japonica rice]
ref|XP_008779984.1|  PREDICTED: benzyl alcohol O-benzoyltransfera...    441   2e-147   
gb|AAG13627.1|AC078840_18  putative hypersensitivity-related (hsr...    444   4e-147   Oryza sativa Japonica Group [Japonica rice]
ref|XP_002270240.1|  PREDICTED: methanol O-anthraniloyltransferase      439   7e-147   Vitis vinifera
ref|XP_011009230.1|  PREDICTED: benzyl alcohol O-benzoyltransfera...    437   8e-147   
ref|XP_004506306.1|  PREDICTED: 13-hydroxylupanine O-tigloyltrans...    439   1e-146   
ref|XP_003626389.1|  Benzoyl coenzyme A benzyl alcohol benzoyl tr...    443   1e-146   
ref|XP_009386561.1|  PREDICTED: benzyl alcohol O-benzoyltransfera...    439   2e-146   
emb|CAN72252.1|  hypothetical protein VITISV_017467                     438   3e-146   Vitis vinifera
gb|ABX57719.1|  acyltransferase                                         437   3e-146   Vanda hybrid cultivar
ref|XP_003626388.1|  Benzoyl coenzyme A benzyl alcohol benzoyl tr...    437   5e-146   
ref|XP_002265049.1|  PREDICTED: methanol O-anthraniloyltransferase      437   7e-146   Vitis vinifera
ref|XP_006370914.1|  hypothetical protein POPTR_0019s01690g             437   7e-146   
ref|XP_007147133.1|  hypothetical protein PHAVU_006G098500g             436   2e-145   
gb|KEH40977.1|  benzyl alcohol O-benzoyltransferase                     434   4e-145   
emb|CBI37443.3|  unnamed protein product                                436   4e-145   
ref|XP_003521736.1|  PREDICTED: benzyl alcohol O-benzoyltransfera...    435   7e-145   
ref|XP_006470741.1|  PREDICTED: anthraniloyl-CoA:methanol acyltra...    432   5e-144   
ref|NP_197256.1|  HXXXD-type acyl-transferase family protein            431   1e-143   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006470749.1|  PREDICTED: anthraniloyl-CoA:methanol acyltra...    430   3e-143   
gb|KHN04051.1|  Benzyl alcohol O-benzoyltransferase                     428   3e-143   
gb|AFK34239.1|  unknown                                                 430   3e-143   
ref|XP_011085897.1|  PREDICTED: benzyl alcohol O-benzoyltransfera...    430   8e-143   
ref|XP_003626383.1|  Benzoyl coenzyme A benzyl alcohol benzoyl tr...    431   8e-143   
ref|XP_007147132.1|  hypothetical protein PHAVU_006G098400g             430   1e-142   
ref|XP_006446267.1|  hypothetical protein CICLE_v10015194mg             427   7e-142   
ref|XP_006446260.1|  hypothetical protein CICLE_v10015249mg             426   8e-142   
ref|XP_010941428.1|  PREDICTED: benzyl alcohol O-benzoyltransfera...    425   1e-141   
ref|XP_002524018.1|  3'-N-debenzoyl-2'-deoxytaxol N-benzoyltransf...    425   4e-141   Ricinus communis
ref|XP_006470571.1|  PREDICTED: anthraniloyl-CoA:methanol acyltra...    425   4e-141   
ref|XP_003626386.1|  Alcohol acetyltransferase                          424   9e-141   
gb|AES82601.2|  benzyl alcohol O-benzoyltransferase                     426   9e-141   
ref|XP_007147135.1|  hypothetical protein PHAVU_006G098700g             423   3e-140   
gb|ABR16407.1|  unknown                                                 422   3e-140   Picea sitchensis
gb|ABR16595.1|  unknown                                                 422   6e-140   Picea sitchensis
ref|XP_007209120.1|  hypothetical protein PRUPE_ppa005455mg             422   9e-140   
ref|XP_004151856.1|  PREDICTED: LOW QUALITY PROTEIN: benzyl alcoh...    421   1e-139   
ref|XP_010667725.1|  PREDICTED: benzyl alcohol O-benzoyltransfera...    421   2e-139   
ref|XP_006470570.1|  PREDICTED: anthraniloyl-CoA:methanol acyltra...    421   2e-139   
ref|XP_011007948.1|  PREDICTED: methanol O-anthraniloyltransferas...    421   2e-139   
gb|KDP39567.1|  hypothetical protein JCGZ_02587                         420   2e-139   
ref|XP_002304071.1|  hypothetical protein POPTR_0003s01420g             420   3e-139   Populus trichocarpa [western balsam poplar]
ref|XP_011041077.1|  PREDICTED: benzyl alcohol O-benzoyltransfera...    420   4e-139   
ref|XP_003616154.1|  Benzoyl coenzyme A benzyl alcohol benzoyl tr...    419   7e-139   
ref|XP_007147134.1|  hypothetical protein PHAVU_006G098600g             419   7e-139   
ref|XP_007147137.1|  hypothetical protein PHAVU_006G098900g             420   7e-139   
gb|KGN63331.1|  hypothetical protein Csa_2G429040                       419   8e-139   
ref|XP_006400294.1|  hypothetical protein EUTSA_v10013454mg             419   1e-138   
ref|XP_010941427.1|  PREDICTED: benzyl alcohol O-benzoyltransfera...    417   1e-138   
ref|XP_006446263.1|  hypothetical protein CICLE_v10015199mg             418   2e-138   
gb|KCW84614.1|  hypothetical protein EUGRSUZ_B01445                     416   3e-138   
ref|XP_002298962.2|  hypothetical protein POPTR_0001s45210g             418   3e-138   Populus trichocarpa [western balsam poplar]
ref|XP_010045974.1|  PREDICTED: benzyl alcohol O-benzoyltransfera...    415   5e-138   
ref|XP_008238035.1|  PREDICTED: methanol O-anthraniloyltransferas...    416   1e-137   
ref|XP_008462821.1|  PREDICTED: benzyl alcohol O-benzoyltransfera...    416   2e-137   
ref|XP_009131598.1|  PREDICTED: (Z)-3-hexen-1-ol acetyltransferase      416   2e-137   
emb|CAA94432.1|  unknown                                                416   2e-137   Cucumis melo [Oriental melon]
ref|XP_008343918.1|  PREDICTED: methanol O-anthraniloyltransferas...    415   4e-137   
dbj|BAK02525.1|  predicted protein                                      415   4e-137   
ref|XP_008391402.1|  PREDICTED: methanol O-anthraniloyltransferas...    414   6e-137   
gb|AGW30203.1|  alcohol acyl transferase                                414   8e-137   
emb|CDX78752.1|  BnaA03g06640D                                          414   1e-136   
gb|AAS79797.1|  alcohol acyl transferase                                413   2e-136   Malus domestica [apple tree]
ref|NP_001275839.1|  alcohol acyl transferase                           413   2e-136   
ref|XP_004294711.1|  PREDICTED: benzyl alcohol O-benzoyltransfera...    413   2e-136   
sp|Q5H873.1|HLTT_LUPAL  RecName: Full=13-hydroxylupanine O-tigloy...    412   3e-136   Lupinus albus
ref|XP_009368287.1|  PREDICTED: methanol O-anthraniloyltransferas...    412   3e-136   
ref|XP_004156759.1|  PREDICTED: benzyl alcohol O-benzoyltransfera...    412   4e-136   
gb|AGW30201.1|  alcohol acyl transferase                                412   5e-136   
gb|AGW30205.1|  alcohol acyl transferase                                411   7e-136   
gb|ABN48480.1|  quinolizidine alkaloid O-tigloyltransferase             411   8e-136   Lupinus albus
ref|XP_008384757.1|  PREDICTED: methanol O-anthraniloyltransferas...    411   1e-135   
ref|XP_003626382.1|  Benzoyl coenzyme A benzyl alcohol benzoyl tr...    410   2e-135   
ref|XP_007208844.1|  hypothetical protein PRUPE_ppa025565mg             414   2e-135   
ref|XP_004305015.1|  PREDICTED: benzyl alcohol O-benzoyltransfera...    410   3e-135   
gb|AAR99826.1|  alcohol acyl transferase                                410   4e-135   Malus domestica [apple tree]
ref|XP_009368754.1|  PREDICTED: methanol O-anthraniloyltransferas...    409   8e-135   
ref|XP_002517500.1|  Taxadien-5-alpha-ol O-acetyltransferase, put...    409   1e-134   Ricinus communis
gb|AAS48090.1|  alcohol acyl transferase                                407   2e-134   Pyrus communis
ref|XP_009130368.1|  PREDICTED: (Z)-3-hexen-1-ol acetyltransferas...    408   2e-134   
gb|AJD18611.1|  alcohol acyltransferase                                 407   3e-134   
gb|KFK25971.1|  hypothetical protein AALP_AA8G186800                    408   4e-134   
ref|XP_004301775.1|  PREDICTED: benzyl alcohol O-benzoyltransfera...    406   5e-134   
ref|XP_010453955.1|  PREDICTED: (Z)-3-hexen-1-ol acetyltransferas...    406   8e-134   
ref|XP_009365780.1|  PREDICTED: methanol O-anthraniloyltransferas...    405   2e-133   
ref|XP_009365778.1|  PREDICTED: methanol O-anthraniloyltransferas...    405   3e-133   
ref|XP_008364483.1|  PREDICTED: benzyl alcohol O-benzoyltransfera...    404   3e-133   
gb|KFK25975.1|  hypothetical protein AALP_AA8G187200                    405   4e-133   
ref|XP_010420481.1|  PREDICTED: (Z)-3-hexen-1-ol acetyltransferas...    404   4e-133   
gb|AGW30202.1|  alcohol acyl transferase                                402   6e-133   
ref|XP_010492711.1|  PREDICTED: (Z)-3-hexen-1-ol acetyltransferas...    403   1e-132   
ref|XP_002300497.2|  hypothetical protein POPTR_0001s45180g             403   3e-132   Populus trichocarpa [western balsam poplar]
ref|XP_003591040.1|  Benzoyl coenzyme A benzyl alcohol benzoyl tr...    402   3e-132   
ref|XP_009365763.1|  PREDICTED: methanol O-anthraniloyltransferas...    402   5e-132   
gb|AFK49108.1|  unknown                                                 402   5e-132   
ref|XP_010453953.1|  PREDICTED: (Z)-3-hexen-1-ol acetyltransferas...    401   5e-132   
ref|XP_010420482.1|  PREDICTED: (Z)-3-hexen-1-ol acetyltransferas...    401   6e-132   
ref|XP_011041078.1|  PREDICTED: benzyl alcohol O-benzoyltransfera...    401   8e-132   
ref|XP_002298956.2|  hypothetical protein POPTR_0001s45160g             401   8e-132   Populus trichocarpa [western balsam poplar]
ref|XP_009130369.1|  PREDICTED: (Z)-3-hexen-1-ol acetyltransferas...    401   9e-132   
gb|KEH40976.1|  benzyl alcohol O-benzoyltransferase                     399   9e-132   
ref|XP_007029780.1|  Benzoyl coenzyme A: Benzyl alcohol benzoyl t...    401   1e-131   
ref|XP_009336751.1|  PREDICTED: methanol O-anthraniloyltransferas...    400   1e-131   
ref|XP_008677983.1|  PREDICTED: benzyl alcohol O-benzoyltransfera...    401   2e-131   
gb|EYU41397.1|  hypothetical protein MIMGU_mgv1a024853mg                399   2e-131   
ref|XP_010689158.1|  PREDICTED: benzyl alcohol O-benzoyltransfera...    399   2e-131   
ref|XP_009336752.1|  PREDICTED: methanol O-anthraniloyltransferas...    400   2e-131   
ref|XP_010492712.1|  PREDICTED: (Z)-3-hexen-1-ol acetyltransferas...    399   2e-131   
ref|XP_004494963.1|  PREDICTED: benzyl alcohol O-benzoyltransfera...    399   3e-131   
ref|XP_008373467.1|  PREDICTED: methanol O-anthraniloyltransferas...    400   3e-131   
ref|XP_006470742.1|  PREDICTED: anthraniloyl-CoA:methanol acyltra...    399   5e-131   
emb|CDY43120.1|  BnaA05g32660D                                          399   5e-131   
ref|XP_010689156.1|  PREDICTED: benzyl alcohol O-benzoyltransfera...    398   8e-131   
ref|XP_008356442.1|  PREDICTED: methanol O-anthraniloyltransferas...    398   1e-130   
ref|XP_006470748.1|  PREDICTED: anthraniloyl-CoA:methanol acyltra...    398   2e-130   
ref|XP_003536109.1|  PREDICTED: benzyl alcohol O-benzoyltransfera...    398   2e-130   
ref|XP_002524024.1|  3'-N-debenzoyl-2'-deoxytaxol N-benzoyltransf...    396   3e-130   Ricinus communis
ref|XP_006470747.1|  PREDICTED: anthraniloyl-CoA:methanol acyltra...    397   3e-130   
emb|CDY50708.1|  BnaC05g47750D                                          397   3e-130   
emb|CDY50709.1|  BnaC05g47740D                                          397   4e-130   
ref|XP_006446264.1|  hypothetical protein CICLE_v10015163mg             397   4e-130   
emb|CBI25251.3|  unnamed protein product                                395   1e-129   
ref|XP_008373476.1|  PREDICTED: methanol O-anthraniloyltransferas...    395   3e-129   
gb|AHC32224.2|  alcohol acyl transferase 1                              394   4e-129   
ref|XP_008368021.1|  PREDICTED: methanol O-anthraniloyltransferas...    394   4e-129   
ref|XP_006446261.1|  hypothetical protein CICLE_v10015234mg             394   4e-129   
gb|EYU41396.1|  hypothetical protein MIMGU_mgv1a005907mg                394   5e-129   
ref|XP_007209131.1|  hypothetical protein PRUPE_ppa005625mg             394   6e-129   
ref|XP_010689157.1|  PREDICTED: benzyl alcohol O-benzoyltransfera...    393   9e-129   
gb|AEM43830.1|  alcohol acyl transferase                                391   1e-128   
gb|KGN63336.1|  hypothetical protein Csa_2G430570                       391   2e-128   
ref|XP_006368247.1|  hypothetical protein POPTR_0001s00950g             392   3e-128   
ref|XP_008355599.1|  PREDICTED: methanol O-anthraniloyltransferas...    392   3e-128   
dbj|BAB78588.1|  alcohol acetyltransferase                              392   4e-128   Cucumis melo [Oriental melon]
gb|AAL77060.1|AF468022_1  putative acyltransferase                      391   7e-128   Cucumis melo [Oriental melon]
ref|NP_001284403.1|  benzyl alcohol O-benzoyltransferase-like           390   1e-127   
ref|XP_006368249.1|  hypothetical protein POPTR_0001s00970g             390   1e-127   
ref|XP_006377894.1|  hypothetical protein POPTR_0011s15660g             390   1e-127   
ref|XP_011040637.1|  PREDICTED: benzyl alcohol O-benzoyltransfera...    390   3e-127   
ref|XP_008373466.1|  PREDICTED: methanol O-anthraniloyltransferas...    389   4e-127   
ref|XP_009374321.1|  PREDICTED: methanol O-anthraniloyltransferas...    389   5e-127   
ref|XP_004986631.1|  PREDICTED: benzyl alcohol O-benzoyltransfera...    389   6e-127   
ref|XP_006289628.1|  hypothetical protein CARUB_v10003180mg             388   8e-127   
gb|EYU41390.1|  hypothetical protein MIMGU_mgv1a009242mg                383   2e-126   
ref|XP_004239236.1|  PREDICTED: methanol O-anthraniloyltransferas...    386   4e-126   
ref|XP_011018694.1|  PREDICTED: methanol O-anthraniloyltransferas...    386   8e-126   
ref|XP_002884383.1|  chat-3-HEXEN-1-OL ACETYLTRANSFERASE                385   9e-126   
ref|XP_010110383.1|  Benzyl alcohol O-benzoyltransferase                384   3e-125   
ref|XP_006376283.1|  hypothetical protein POPTR_0013s11650g             382   6e-125   
ref|XP_010557037.1|  PREDICTED: (Z)-3-hexen-1-ol acetyltransferas...    383   1e-124   
gb|AIC83790.1|  alcohol acyltransferase                                 382   2e-124   
gb|ACV74416.1|  putative alcohol acyl transferase                       382   4e-124   Camellia sinensis [black tea]
ref|XP_002438993.1|  hypothetical protein SORBIDRAFT_10g029610          380   8e-124   Sorghum bicolor [broomcorn]
gb|EAZ02323.1|  hypothetical protein OsI_24425                          380   1e-123   Oryza sativa Indica Group [Indian rice]
gb|EPS68008.1|  hypothetical protein M569_06766                         380   1e-123   
ref|NP_001058545.2|  Os06g0710700                                       380   1e-123   Oryza sativa Japonica Group [Japonica rice]
ref|XP_004986643.1|  PREDICTED: benzyl alcohol O-benzoyltransfera...    380   2e-123   
ref|XP_003516503.1|  PREDICTED: anthraniloyl-CoA:methanol acyltra...    379   4e-123   
gb|KCW72711.1|  hypothetical protein EUGRSUZ_E01163                     379   4e-123   
ref|XP_006657332.1|  PREDICTED: benzyl alcohol O-benzoyltransfera...    378   6e-123   
emb|CBI29212.3|  unnamed protein product                                376   8e-123   
gb|KHN41759.1|  Benzyl alcohol O-benzoyltransferase                     378   1e-122   
ref|NP_186998.1|  acetyl CoA:(Z)-3-hexen-1-ol acetyltransferase         376   5e-122   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010436740.1|  PREDICTED: (Z)-3-hexen-1-ol acetyltransferas...    374   6e-122   
ref|XP_002437575.1|  hypothetical protein SORBIDRAFT_10g029620          375   6e-122   Sorghum bicolor [broomcorn]
gb|AAN85436.1|  acyltransferase 2                                       375   7e-122   Capsicum chinense [bonnet pepper]
ref|XP_010110389.1|  Benzyl alcohol O-benzoyltransferase                376   2e-121   
ref|XP_007200171.1|  hypothetical protein PRUPE_ppa016489mg             369   2e-121   
gb|AAM61186.1|  putative hypersensitivity-related gene                  374   2e-121   Arabidopsis thaliana [mouse-ear cress]
gb|KFK38057.1|  hypothetical protein AALP_AA3G064500                    381   3e-121   
ref|XP_010557036.1|  PREDICTED: (Z)-3-hexen-1-ol acetyltransferas...    374   3e-121   
ref|XP_010558858.1|  PREDICTED: (Z)-3-hexen-1-ol acetyltransferas...    374   6e-121   
ref|XP_010558859.1|  PREDICTED: (Z)-3-hexen-1-ol acetyltransferas...    373   8e-121   
ref|XP_006361592.1|  PREDICTED: anthraniloyl-CoA:methanol acyltra...    372   1e-120   
ref|XP_009778012.1|  PREDICTED: methanol O-anthraniloyltransferas...    372   2e-120   
ref|XP_004966402.1|  PREDICTED: benzyl alcohol O-benzoyltransfera...    372   2e-120   
ref|XP_003563544.1|  PREDICTED: benzyl alcohol O-benzoyltransfera...    371   3e-120   
ref|XP_003575185.1|  PREDICTED: benzyl alcohol O-benzoyltransfera...    371   4e-120   
ref|XP_008362881.1|  PREDICTED: methanol O-anthraniloyltransferas...    371   4e-120   
ref|XP_006297655.1|  hypothetical protein CARUB_v10013677mg             370   1e-119   
ref|XP_010557044.1|  PREDICTED: (Z)-3-hexen-1-ol acetyltransferas...    370   2e-119   
ref|XP_009759678.1|  PREDICTED: methanol O-anthraniloyltransferas...    369   3e-119   
ref|XP_008645066.1|  PREDICTED: benzyl alcohol O-benzoyltransfera...    368   5e-119   
ref|XP_002298960.2|  hypothetical protein POPTR_0001s45190g             368   6e-119   
ref|XP_002447250.1|  hypothetical protein SORBIDRAFT_06g031260          368   7e-119   
ref|XP_004966401.1|  PREDICTED: benzyl alcohol O-benzoyltransfera...    367   9e-119   
ref|XP_008380361.1|  PREDICTED: LOW QUALITY PROTEIN: benzyl alcoh...    362   1e-118   
ref|XP_008348383.1|  PREDICTED: benzyl alcohol O-benzoyltransfera...    362   2e-118   
gb|EMT31153.1|  2-alpha-hydroxytaxane 2-O-benzoyltransferase            366   3e-118   
ref|XP_010489657.1|  PREDICTED: (Z)-3-hexen-1-ol acetyltransferas...    366   3e-118   
ref|XP_010058392.1|  PREDICTED: methanol O-anthraniloyltransferas...    367   5e-118   
gb|KFK38056.1|  hypothetical protein AALP_AA3G064500                    373   6e-118   
gb|AGK82816.1|  alcohol acyltransferase 2                               365   7e-118   
ref|XP_002437572.1|  hypothetical protein SORBIDRAFT_10g029590          365   8e-118   
ref|XP_010450554.1|  PREDICTED: (Z)-3-hexen-1-ol acetyltransferase      365   1e-117   
ref|XP_010058386.1|  PREDICTED: methanol O-anthraniloyltransferas...    365   1e-117   
ref|XP_010521555.1|  PREDICTED: (Z)-3-hexen-1-ol acetyltransferas...    364   3e-117   
ref|XP_009589917.1|  PREDICTED: methanol O-anthraniloyltransferas...    363   3e-117   
ref|XP_004244681.1|  PREDICTED: methanol O-anthraniloyltransferase      363   4e-117   
gb|AIW04708.1|  alcohol acyltransferase 1                               361   2e-116   
ref|XP_010665210.1|  PREDICTED: methanol O-anthraniloyltransferas...    359   2e-116   
ref|XP_010058390.1|  PREDICTED: methanol O-anthraniloyltransferas...    362   3e-116   
ref|NP_001234496.1|  alcohol acyl transferase                           360   8e-116   
ref|XP_006351055.1|  PREDICTED: anthraniloyl-CoA:methanol acyltra...    359   2e-115   
gb|EMT07181.1|  Taxadien-5-alpha-ol O-acetyltransferase                 357   9e-115   
gb|KCW72714.1|  hypothetical protein EUGRSUZ_E01167                     356   4e-114   
ref|XP_010665177.1|  PREDICTED: methanol O-anthraniloyltransferas...    353   4e-114   
ref|XP_008660766.1|  PREDICTED: benzyl alcohol O-benzoyltransfera...    356   7e-114   
dbj|BAC58010.1|  alcohol acyltransferase                                354   2e-113   
gb|KCW72709.1|  hypothetical protein EUGRSUZ_E01161                     354   2e-113   
ref|XP_002873835.1|  transferase family protein                         352   3e-113   
ref|XP_010058394.1|  PREDICTED: methanol O-anthraniloyltransferas...    356   5e-113   
ref|XP_004517186.1|  PREDICTED: benzyl alcohol O-benzoyltransfera...    348   5e-113   
emb|CDP21408.1|  unnamed protein product                                347   7e-113   
ref|XP_010550256.1|  PREDICTED: LOW QUALITY PROTEIN: (Z)-3-hexen-...    351   4e-112   
ref|XP_008238086.1|  PREDICTED: methanol O-anthraniloyltransferas...    353   5e-112   
ref|XP_010058391.1|  PREDICTED: methanol O-anthraniloyltransferas...    348   3e-111   
ref|XP_008359513.1|  PREDICTED: benzyl alcohol O-benzoyltransfera...    342   1e-110   
emb|CAE04720.1|  OSJNBa0043L24.8                                        346   2e-110   
emb|CAH67336.1|  OSIGBa0157A06.5                                        344   9e-110   
ref|XP_003581404.1|  PREDICTED: benzyl alcohol O-benzoyltransfera...    344   1e-109   
ref|XP_011082158.1|  PREDICTED: methanol O-anthraniloyltransferas...    343   4e-109   
gb|ACF07921.1|  alcohol acyl transferase                                340   3e-108   
ref|XP_006408298.1|  hypothetical protein EUTSA_v10022248mg             339   4e-108   
gb|KCW72712.1|  hypothetical protein EUGRSUZ_E01165                     338   4e-108   
gb|KCW72707.1|  hypothetical protein EUGRSUZ_E01159                     338   6e-108   
ref|XP_010045975.1|  PREDICTED: benzyl alcohol O-benzoyltransfera...    336   8e-108   
gb|KCW84616.1|  hypothetical protein EUGRSUZ_B01447                     333   2e-107   
emb|CDP11061.1|  unnamed protein product                                338   2e-107   
dbj|BAJ96970.1|  predicted protein                                      338   4e-107   
ref|NP_001059277.1|  Os07g0244200                                       337   4e-107   
ref|XP_006654215.1|  PREDICTED: benzyl alcohol O-benzoyltransfera...    337   6e-107   
gb|AAT01406.1|  hypothetical protein                                    336   2e-106   
ref|XP_002444747.1|  hypothetical protein SORBIDRAFT_07g027100          332   3e-105   
ref|XP_010549748.1|  PREDICTED: (Z)-3-hexen-1-ol acetyltransferas...    332   4e-105   
ref|XP_010058393.1|  PREDICTED: methanol O-anthraniloyltransferas...    336   2e-104   
ref|XP_006370717.1|  hypothetical protein POPTR_0001s45150g             326   3e-104   
ref|XP_004960441.1|  PREDICTED: benzyl alcohol O-benzoyltransfera...    329   4e-104   
ref|XP_010550257.1|  PREDICTED: (Z)-3-hexen-1-ol acetyltransferas...    330   1e-103   
ref|XP_002440560.1|  hypothetical protein SORBIDRAFT_09g003170          329   1e-103   
gb|EYU41388.1|  hypothetical protein MIMGU_mgv1a021683mg                326   4e-103   
ref|XP_006446721.1|  hypothetical protein CICLE_v10017956mg             325   5e-103   
gb|ACU24193.1|  unknown                                                 323   8e-103   
dbj|BAJ88238.1|  predicted protein                                      326   9e-103   
ref|XP_006350348.1|  PREDICTED: anthraniloyl-CoA:methanol acyltra...    325   4e-102   
ref|XP_008660976.1|  PREDICTED: benzyl alcohol O-benzoyltransfera...    325   5e-102   
ref|NP_001148135.1|  taxadien-5-alpha-ol O-acetyltransferase            323   6e-102   
ref|XP_007029779.1|  Benzoyl coenzyme A: Benzyl alcohol benzoyl t...    317   8e-102   
ref|XP_008670946.1|  PREDICTED: benzyl alcohol O-benzoyltransfera...    324   9e-102   
ref|XP_006657584.1|  PREDICTED: benzyl alcohol O-benzoyltransfera...    323   1e-101   
emb|CDP17523.1|  unnamed protein product                                322   3e-101   
ref|XP_008660975.1|  PREDICTED: benzyl alcohol O-benzoyltransfera...    323   3e-101   
gb|EAZ04276.1|  hypothetical protein OsI_26418                          320   2e-100   
gb|ACR36326.1|  unknown                                                 318   7e-100   
gb|KDP39569.1|  hypothetical protein JCGZ_02589                         315   7e-100   
ref|NP_001059940.1|  Os07g0550600                                       318   1e-99    
ref|XP_006657816.1|  PREDICTED: benzyl alcohol O-benzoyltransfera...    318   1e-99    
ref|XP_008662941.1|  PREDICTED: benzyl alcohol O-benzoyltransfera...    316   2e-98    
gb|AAS07101.1|  putative hypersensitivity-related protein               312   3e-97    
gb|EEC75861.1|  hypothetical protein OsI_12874                          312   3e-97    
ref|XP_010527080.1|  PREDICTED: (Z)-3-hexen-1-ol acetyltransferas...    311   6e-97    
gb|EAY80579.1|  hypothetical protein OsI_35761                          311   7e-97    
gb|KGN63335.1|  hypothetical protein Csa_2G429070                       306   1e-96    
emb|CAN68586.1|  hypothetical protein VITISV_027876                     307   1e-96    
tpg|DAA49394.1|  TPA: hypothetical protein ZEAMMB73_141384              303   7e-96    
gb|KDP39572.1|  hypothetical protein JCGZ_02592                         304   1e-95    
ref|XP_003626378.1|  Benzoyl coenzyme A benzyl alcohol benzoyl tr...    305   1e-95    
ref|XP_010058385.1|  PREDICTED: methanol O-anthraniloyltransferas...    306   1e-95    
ref|XP_002461609.1|  hypothetical protein SORBIDRAFT_02g005330          307   2e-95    
ref|XP_004151707.1|  PREDICTED: benzyl alcohol O-benzoyltransfera...    299   8e-95    
ref|XP_010108951.1|  Benzyl alcohol O-benzoyltransferase                300   9e-95    
ref|XP_010644207.1|  PREDICTED: methanol O-anthraniloyltransferas...    303   2e-94    
gb|AAV32163.1|  hypothetical protein                                    305   2e-94    
gb|KDO44967.1|  hypothetical protein CISIN_1g0133461mg                  299   3e-94    
gb|EYU26841.1|  hypothetical protein MIMGU_mgv1a011322mg                298   4e-94    
ref|XP_004514200.1|  PREDICTED: benzyl alcohol O-benzoyltransfera...    304   1e-93    
gb|AAS55785.1|  putative benzyl alcohol benzoyl transferase             303   1e-93    
gb|EEE63107.1|  hypothetical protein OsJ_17915                          300   1e-92    
ref|XP_002438731.1|  hypothetical protein SORBIDRAFT_10g025140          301   2e-92    
gb|EEE51952.1|  hypothetical protein OsJ_33591                          297   1e-91    
gb|EEE62279.1|  hypothetical protein OsJ_17067                          296   2e-91    
gb|EAY96502.1|  hypothetical protein OsI_18404                          296   3e-91    
ref|NP_001054603.1|  Os05g0141300                                       296   4e-91    
gb|KDP39574.1|  hypothetical protein JCGZ_02594                         290   4e-91    
ref|XP_008373477.1|  PREDICTED: methanol O-anthraniloyltransferas...    290   1e-90    
ref|XP_002464781.1|  hypothetical protein SORBIDRAFT_01g026670          295   1e-90    
gb|KEH17123.1|  benzyl alcohol O-benzoyltransferase                     288   7e-90    
ref|XP_006661593.1|  PREDICTED: benzyl alcohol O-benzoyltransfera...    292   2e-89    
ref|XP_004983290.1|  PREDICTED: benzyl alcohol O-benzoyltransfera...    290   1e-88    
ref|XP_003626385.1|  Benzoyl coenzyme A benzyl alcohol benzoyl tr...    285   2e-88    
gb|EMS66480.1|  Omega-hydroxypalmitate O-feruloyl transferase           290   2e-88    
gb|KHN16174.1|  Benzyl alcohol O-benzoyltransferase                     285   4e-88    
gb|EAY73940.1|  hypothetical protein OsI_01825                          285   1e-86    
ref|XP_004983466.1|  PREDICTED: benzyl alcohol O-benzoyltransfera...    284   2e-86    
emb|CDM80509.1|  unnamed protein product                                283   3e-86    
ref|NP_001148798.1|  transferase family protein                         283   6e-86    
ref|NP_001042981.1|  Os01g0350000                                       282   1e-85    
ref|XP_010231737.1|  PREDICTED: benzyl alcohol O-benzoyltransfera...    280   6e-85    
ref|XP_002524021.1|  transferase, putative                              273   7e-85    
ref|XP_010665859.1|  PREDICTED: benzyl alcohol O-benzoyltransfera...    274   1e-84    
gb|KDO54864.1|  hypothetical protein CISIN_1g041010mg                   273   2e-84    
gb|EEE61303.1|  hypothetical protein OsJ_15395                          278   3e-84    
ref|NP_001064288.1|  Os10g0195600                                       279   3e-84    
ref|XP_003573843.1|  PREDICTED: benzyl alcohol O-benzoyltransfera...    278   4e-84    
ref|XP_008348656.1|  PREDICTED: benzyl alcohol O-benzoyltransfera...    278   5e-84    
gb|AGW30204.1|  truncated alcohol acyl transferase                      273   6e-84    
gb|EAY77933.1|  hypothetical protein OsI_32974                          278   9e-84    
ref|XP_010109027.1|  Benzyl alcohol O-benzoyltransferase                277   9e-84    
ref|XP_003576099.1|  PREDICTED: benzyl alcohol O-benzoyltransfera...    275   4e-83    
gb|AAP51790.2|  Transferase family protein                              275   5e-83    
tpg|DAA46610.1|  TPA: hypothetical protein ZEAMMB73_163572              275   7e-83    
ref|XP_004983469.1|  PREDICTED: benzyl alcohol O-benzoyltransfera...    274   1e-82    
gb|EEE50698.1|  hypothetical protein OsJ_30968                          273   6e-82    
ref|XP_003577635.1|  PREDICTED: benzyl alcohol O-benzoyltransfera...    271   1e-81    
ref|XP_004983425.1|  PREDICTED: benzyl alcohol O-benzoyltransfera...    272   1e-81    
ref|XP_006290244.1|  hypothetical protein CARUB_v100037961mg            266   4e-81    
ref|XP_002464832.1|  hypothetical protein SORBIDRAFT_01g027380          270   5e-81    
ref|XP_003576147.1|  PREDICTED: benzyl alcohol O-benzoyltransfera...    270   5e-81    
gb|EAY77467.1|  hypothetical protein OsI_32511                          270   7e-81    
ref|XP_004951311.1|  PREDICTED: benzyl alcohol O-benzoyltransfera...    268   2e-80    
ref|XP_006664808.1|  PREDICTED: benzyl alcohol O-benzoyltransfera...    269   2e-80    
ref|XP_006388975.1|  hypothetical protein POPTR_0065s002301g            260   7e-79    
gb|EMS47942.1|  Omega-hydroxypalmitate O-feruloyl transferase           264   1e-78    
gb|EAY77473.1|  hypothetical protein OsI_32516                          263   2e-78    
gb|EMT02065.1|  hypothetical protein F775_43251                         259   2e-77    
emb|CAN74177.1|  hypothetical protein VITISV_029256                     261   2e-77    
ref|XP_007217533.1|  hypothetical protein PRUPE_ppa023329mg             260   3e-77    
gb|EMT22321.1|  10-deacetylbaccatin III 10-O-acetyltransferase          257   4e-77    
ref|XP_009371837.1|  PREDICTED: benzyl alcohol O-benzoyltransferase     259   5e-77    
ref|XP_002272487.1|  PREDICTED: benzyl alcohol O-benzoyltransferase     259   5e-77    
ref|XP_002464789.1|  hypothetical protein SORBIDRAFT_01g026760          259   5e-77    
gb|KEH15838.1|  benzyl alcohol O-benzoyltransferase                     252   8e-77    
gb|EMS57280.1|  Omega-hydroxypalmitate O-feruloyl transferase           257   3e-76    
gb|EAZ20412.1|  hypothetical protein OsJ_36019                          257   4e-76    
dbj|BAC65990.1|  putative benzoyl coenzyme A                            257   8e-76    
gb|EMT01643.1|  10-deacetylbaccatin III 10-O-acetyltransferase          258   8e-76    
ref|XP_007210147.1|  hypothetical protein PRUPE_ppa025118mg             251   2e-75    
gb|ABA98392.1|  Transferase family protein                              258   3e-75    
ref|XP_004983468.1|  PREDICTED: benzyl alcohol O-benzoyltransfera...    255   3e-75    
gb|KDO49560.1|  hypothetical protein CISIN_1g036972mg                   249   3e-75    
ref|XP_004174118.1|  PREDICTED: benzyl alcohol O-benzoyltransfera...    246   4e-75    
ref|XP_002524020.1|  transferase, putative                              247   5e-75    
ref|XP_006653585.1|  PREDICTED: benzyl alcohol O-benzoyltransfera...    249   7e-75    
gb|AIZ00468.1|  alcohol acyl transferase                                245   2e-74    
ref|NP_001066733.1|  Os12g0458100                                       253   2e-74    
gb|EAY77468.1|  hypothetical protein OsI_32512                          253   2e-74    
gb|AAL75750.1|  Putative hsr201 hypersensitivity-related protein        252   2e-74    
ref|NP_001176004.1|  Os10g0106701                                       252   4e-74    
ref|XP_006664809.1|  PREDICTED: benzyl alcohol O-benzoyltransfera...    252   4e-74    
emb|CDX70765.1|  BnaC03g08490D                                          247   5e-74    
ref|XP_008659223.1|  PREDICTED: benzyl alcohol O-benzoyltransfera...    251   9e-74    
gb|EAY77476.1|  hypothetical protein OsI_32518                          253   1e-73    
gb|ABB46590.2|  Transferase family protein                              252   2e-73    
ref|XP_009612665.1|  PREDICTED: methanol O-anthraniloyltransferas...    244   3e-73    
ref|XP_006661592.1|  PREDICTED: benzyl alcohol O-benzoyltransfera...    249   4e-73    
gb|AAG12486.2|AC037197_11  Putative hsr201 hypersensitivity-relat...    251   5e-73    
gb|EAY77618.1|  hypothetical protein OsI_32660                          249   6e-73    
ref|XP_004983467.1|  PREDICTED: benzyl alcohol O-benzoyltransfera...    249   1e-72    
ref|NP_001176003.1|  Os10g0105900                                       248   1e-72    
gb|AAG12479.2|AC037197_4  Putative hsr201 hypersensitivity-relate...    247   2e-72    
ref|XP_003563141.1|  PREDICTED: benzyl alcohol O-benzoyltransfera...    246   4e-72    
gb|EAZ20409.1|  hypothetical protein OsJ_36017                          246   5e-72    
gb|EMT08739.1|  hypothetical protein F775_52254                         245   5e-72    
gb|KDP30452.1|  hypothetical protein JCGZ_17140                         241   5e-72    
gb|ADD62404.1|  fatty omega-hydroxyacid/fatty alcohol 0-hydroxyci...    244   2e-71    
gb|EMT22320.1|  Taxadien-5-alpha-ol O-acetyltransferase                 242   6e-71    
gb|EMT25790.1|  Taxadien-5-alpha-ol O-acetyltransferase                 240   8e-71    
ref|XP_008464403.1|  PREDICTED: omega-hydroxypalmitate O-feruloyl...    242   1e-70    
ref|XP_003532502.1|  PREDICTED: omega-hydroxypalmitate O-feruloyl...    242   1e-70    
gb|EAY94788.1|  hypothetical protein OsI_16567                          236   4e-70    
ref|XP_011073101.1|  PREDICTED: omega-hydroxypalmitate O-feruloyl...    241   4e-70    
ref|XP_004979328.1|  PREDICTED: omega-hydroxypalmitate O-feruloyl...    241   4e-70    
ref|XP_003525421.1|  PREDICTED: omega-hydroxypalmitate O-feruloyl...    240   5e-70    
ref|XP_004138033.1|  PREDICTED: omega-hydroxypalmitate O-feruloyl...    239   1e-69    
ref|XP_011073100.1|  PREDICTED: omega-hydroxypalmitate O-feruloyl...    241   2e-69    
ref|XP_002298961.1|  hypothetical protein POPTR_0001s45200g             236   3e-69    
ref|XP_010250620.1|  PREDICTED: omega-hydroxypalmitate O-feruloyl...    237   8e-69    
gb|ABR16192.1|  unknown                                                 237   1e-68    
gb|KDP32472.1|  hypothetical protein JCGZ_13397                         236   2e-68    
ref|XP_009381343.1|  PREDICTED: omega-hydroxypalmitate O-feruloyl...    236   3e-68    
dbj|BAK02782.1|  predicted protein                                      236   3e-68    
gb|EMT30544.1|  3'-N-debenzoyl-2'-deoxytaxol N-benzoyltransferase       238   3e-68    
ref|XP_010086996.1|  Omega-hydroxypalmitate O-feruloyl transferase      235   4e-68    
emb|CAT00082.1|  hydroxycinnamoyl-CoA shikimate/quinate hydroxyci...    236   4e-68    
ref|XP_010249109.1|  PREDICTED: omega-hydroxypalmitate O-feruloyl...    235   4e-68    
ref|XP_002511135.1|  Taxadien-5-alpha-ol O-acetyltransferase, put...    235   5e-68    
gb|ACN28372.1|  unknown                                                 236   6e-68    
dbj|BAJ89613.1|  predicted protein                                      235   7e-68    
ref|XP_009379971.1|  PREDICTED: omega-hydroxypalmitate O-feruloyl...    236   7e-68    
emb|CDO98678.1|  unnamed protein product                                234   1e-67    
ref|XP_003580168.1|  PREDICTED: omega-hydroxypalmitate O-feruloyl...    235   1e-67    
ref|XP_004304536.1|  PREDICTED: omega-hydroxypalmitate O-feruloyl...    234   1e-67    



>gb|AAT68601.1| benzoyl coenzyme A: benzyl alcohol benzoyl transferase [Petunia 
x hybrida]
 gb|AAU06226.1| benzoyl-CoA:benzyl alcohol/phenylethanol benzoyltransferase [Petunia 
x hybrida]
Length=460

 Score =   533 bits (1372),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 249/392 (64%), Positives = 314/392 (80%), Gaps = 5/392 (1%)
 Frame = -1

Query  1415  FYRNEPSMSGKDPVQVIRQALAKALVFFYPFAGRLREGPGRKLMVDCTGEGVMFIEADAD  1236
             FYR + SM GKDPV+VI++A+A+ LVF+YPFAGRLREG  RKLMVDCTGEGVMF+EA+AD
Sbjct  52    FYRKDSSMGGKDPVEVIKKAIAETLVFYYPFAGRLREGNDRKLMVDCTGEGVMFVEANAD  111

Query  1235  ATLQHFAIGGELKPPFPCFDQLLYNVPGSAEILNSPLFLIQVTRLRCGGFIFTLRMNHTM  1056
              TL+ F  G EL+PPFPC ++LLY+VPGSA +L+ PL LIQVTRLRCGGFIF LR+NHTM
Sbjct  112   VTLEEF--GDELQPPFPCLEELLYDVPGSAGVLHCPLLLIQVTRLRCGGFIFALRLNHTM  169

Query  1055  ADASGLVHFLNTIAEIARGAEAPAVQPVWQREFFSARNPPRITCTHFEYEEEPAADSMVT  876
             +DA GLV F+  + E+ARGA AP+  PVW RE  +ARNPP++TCTH EYEE P  D+  T
Sbjct  170   SDAPGLVQFMTAVGEMARGATAPSTLPVWCRELLNARNPPQVTCTHHEYEEVP--DTKGT  227

Query  875   NIPLDNLVHRSFLFGPTEISVLRSSLPPHLRKCSTVEILTALVWRCRTIALGFHPDEEVR  696
              IPLD++VHRSF FGPTE+S LR  +PPHL  CST E+LTA +WRCRTI++   P+EEVR
Sbjct  228   LIPLDDMVHRSFFFGPTEVSALRRFVPPHLHNCSTFEVLTAALWRCRTISIKPDPEEEVR  287

Query  695   MLLLINARFKFKDTPMPSGYTGNAFAYPGAKTTAGKLRKNPLGYAVELVTSIKRCFSEEY  516
             +L ++NAR +F +  +PSGY GNAFA+P A TTA KL KNPLGYA+ELV   K   +EEY
Sbjct  288   VLCIVNARSRF-NPQLPSGYYGNAFAFPVAVTTAEKLCKNPLGYALELVKKTKSDVTEEY  346

Query  515   MQSMVDLMVLKGRPPFHVAGSFIMSDLTRSKISDVDYGWGKPVFGGPAHGGAGDVPGVIT  336
             M+S+ DLMV+KGRP F V  ++++SD+TR+   +VD+GWGK V+GGPA GG G +PGV +
Sbjct  347   MKSVADLMVIKGRPHFTVVRTYLVSDVTRAGFGEVDFGWGKAVYGGPAKGGVGAIPGVAS  406

Query  335   FHVPYENKKGENGTLIPICLPAFALDKFVNEL  240
             F++P+ NKKGENG ++PICLP FA++KFV EL
Sbjct  407   FYIPFRNKKGENGIVVPICLPGFAMEKFVKEL  438



>sp|Q8GT20.1|BEBT_TOBAC RecName: Full=Benzyl alcohol O-benzoyltransferase; AltName: Full=Benzoyl 
coenzyme A:benzyl alcohol benzoyl transferase [Nicotiana 
tabacum]
 gb|AAN09798.1| benzoyl coenzyme A: benzyl alcohol benzoyl transferase [Nicotiana 
tabacum]
Length=460

 Score =   530 bits (1366),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 246/392 (63%), Positives = 313/392 (80%), Gaps = 5/392 (1%)
 Frame = -1

Query  1415  FYRNEPSMSGKDPVQVIRQALAKALVFFYPFAGRLREGPGRKLMVDCTGEGVMFIEADAD  1236
             FY  + SM  KDPV+VI++A+A+ LVF+YPFAGRLREG GRKLMVDCTGEG+MF+EADAD
Sbjct  52    FYHKDSSMGRKDPVKVIKKAIAETLVFYYPFAGRLREGNGRKLMVDCTGEGIMFVEADAD  111

Query  1235  ATLQHFAIGGELKPPFPCFDQLLYNVPGSAEILNSPLFLIQVTRLRCGGFIFTLRMNHTM  1056
              TL+ F  G EL+PPFPC ++LLY+VP SA +LN PL LIQVTRLRCGGFIF LR+NHTM
Sbjct  112   VTLEQF--GDELQPPFPCLEELLYDVPDSAGVLNCPLLLIQVTRLRCGGFIFALRLNHTM  169

Query  1055  ADASGLVHFLNTIAEIARGAEAPAVQPVWQREFFSARNPPRITCTHFEYEEEPAADSMVT  876
             +DA GLV F+  + E+ARGA AP++ PVW RE  +ARNPP++TCTH EY+E    D+  T
Sbjct  170   SDAPGLVQFMTAVGEMARGASAPSILPVWCRELLNARNPPQVTCTHHEYDE--VRDTKGT  227

Query  875   NIPLDNLVHRSFLFGPTEISVLRSSLPPHLRKCSTVEILTALVWRCRTIALGFHPDEEVR  696
              IPLD++VH+SF FGP+E+S LR  +P HLRKCST E+LTA++WRCRT++L   P+EEVR
Sbjct  228   IIPLDDMVHKSFFFGPSEVSALRRFVPHHLRKCSTFELLTAVLWRCRTMSLKPDPEEEVR  287

Query  695   MLLLINARFKFKDTPMPSGYTGNAFAYPGAKTTAGKLRKNPLGYAVELVTSIKRCFSEEY  516
              L ++NAR +F + P+P+GY GNAFA+P A TTA KL KNPLGYA+ELV   K   +EEY
Sbjct  288   ALCIVNARSRF-NPPLPTGYYGNAFAFPVAVTTAAKLSKNPLGYALELVKKTKSDVTEEY  346

Query  515   MQSMVDLMVLKGRPPFHVAGSFIMSDLTRSKISDVDYGWGKPVFGGPAHGGAGDVPGVIT  336
             M+S+ DLMVLKGRP F V  +F++SD+TR    +VD+GWGK V+GGPA GG G +PGV +
Sbjct  347   MKSVADLMVLKGRPHFTVVRTFLVSDVTRGGFGEVDFGWGKAVYGGPAKGGVGAIPGVAS  406

Query  335   FHVPYENKKGENGTLIPICLPAFALDKFVNEL  240
             F++P++NKKGENG ++PICLP FA++ FV EL
Sbjct  407   FYIPFKNKKGENGIVVPICLPGFAMETFVKEL  438



>ref|XP_009804829.1| PREDICTED: benzyl alcohol O-benzoyltransferase [Nicotiana sylvestris]
Length=460

 Score =   530 bits (1366),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 246/392 (63%), Positives = 313/392 (80%), Gaps = 5/392 (1%)
 Frame = -1

Query  1415  FYRNEPSMSGKDPVQVIRQALAKALVFFYPFAGRLREGPGRKLMVDCTGEGVMFIEADAD  1236
             FY    SM GKDPV +I++A+A+ LVF+YPFAGRLREG GRKLMVDCTGEG+MF+EADAD
Sbjct  52    FYSKNSSMEGKDPVNIIKKAIAETLVFYYPFAGRLREGNGRKLMVDCTGEGIMFVEADAD  111

Query  1235  ATLQHFAIGGELKPPFPCFDQLLYNVPGSAEILNSPLFLIQVTRLRCGGFIFTLRMNHTM  1056
              TL+ F  G EL+PPFPC ++LLY+VP SA +L+ PL LIQVTRLRCGGFIF LR+NHTM
Sbjct  112   VTLEEF--GDELQPPFPCLEELLYDVPNSAGVLHCPLLLIQVTRLRCGGFIFALRLNHTM  169

Query  1055  ADASGLVHFLNTIAEIARGAEAPAVQPVWQREFFSARNPPRITCTHFEYEEEPAADSMVT  876
             +DA GLV F+  + EIA GA AP+V PVW RE  +ARNPP++TCTH EY+E P  D+  T
Sbjct  170   SDAPGLVQFMTAVGEIACGASAPSVLPVWCRELLNARNPPQVTCTHHEYDEVP--DTKGT  227

Query  875   NIPLDNLVHRSFLFGPTEISVLRSSLPPHLRKCSTVEILTALVWRCRTIALGFHPDEEVR  696
              IPLD++VH+SF FGP E+S LR  +P HLRKCST E+LTA++WRCRT++L   P+EEVR
Sbjct  228   IIPLDDMVHKSFFFGPAEVSALRRFVPHHLRKCSTFELLTAVLWRCRTMSLKPDPEEEVR  287

Query  695   MLLLINARFKFKDTPMPSGYTGNAFAYPGAKTTAGKLRKNPLGYAVELVTSIKRCFSEEY  516
             +L ++NAR +F + P+P+GY GNAFA+P A TTA KLRKNPLGYA+ELV   K   +EEY
Sbjct  288   VLCIVNARSRF-NPPLPTGYYGNAFAFPVAVTTAAKLRKNPLGYALELVKKTKTDVTEEY  346

Query  515   MQSMVDLMVLKGRPPFHVAGSFIMSDLTRSKISDVDYGWGKPVFGGPAHGGAGDVPGVIT  336
             M+S+ DLMVLKGRP F V  ++++SD+TR    +VD+GWGK V+GGPA GG G +PGV +
Sbjct  347   MKSVADLMVLKGRPHFTVVRTYLVSDVTRGGFGEVDFGWGKAVYGGPAKGGVGAIPGVAS  406

Query  335   FHVPYENKKGENGTLIPICLPAFALDKFVNEL  240
             F++P++NKKGENG ++PICLP FA++ F+ EL
Sbjct  407   FYIPFKNKKGENGIVVPICLPGFAMETFIKEL  438



>ref|XP_004290447.1| PREDICTED: benzyl alcohol O-benzoyltransferase-like [Fragaria 
vesca subsp. vesca]
Length=463

 Score =   530 bits (1366),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 247/393 (63%), Positives = 315/393 (80%), Gaps = 5/393 (1%)
 Frame = -1

Query  1415  FYRNEPSMSGKDPVQVIRQALAKALVFFYPFAGRLREGPGRKLMVDCTGEGVMFIEADAD  1236
             FYR +PSM GKD V+VIR+A+++ALVF+YPFAGRLREGPGRKLMVDCTGEG++FIEADAD
Sbjct  51    FYRYDPSMKGKDCVKVIREAISQALVFYYPFAGRLREGPGRKLMVDCTGEGILFIEADAD  110

Query  1235  ATLQHFAIGGELKPPFPCFDQLLYNVPGSAEILNSPLFLIQVTRLRCGGFIFTLRMNHTM  1056
              TL+ F  G  L+PPFPC ++LLYNVPGS  +LNSPL LIQVTRL+CGGFIF LR+NHTM
Sbjct  111   VTLRQF--GDALQPPFPCLEELLYNVPGSDGVLNSPLLLIQVTRLKCGGFIFALRLNHTM  168

Query  1055  ADASGLVHFLNTIAEIARGAEAPAVQPVWQREFFSARNPPRITCTHFEYEEEPAADSMVT  876
             +DA+GLV F+  + E ARGA  P++ PVW RE F+ARNPPR+TCTH EY++ P  D+  T
Sbjct  169   SDAAGLVQFMTAVGEAARGARVPSILPVWAREAFNARNPPRVTCTHHEYDDVP--DTHGT  226

Query  875   NIPLDNLVHRSFLFGPTEISVLRSSLPPHLRKCSTVEILTALVWRCRTIALG-FHPDEEV  699
              IPLD++ HRSF F PTEIS +R  LP HLRKCST EILTA +WRCRTIAL    P++EV
Sbjct  227   LIPLDDMAHRSFFFRPTEISAIRRFLPDHLRKCSTFEILTAALWRCRTIALEPKDPEQEV  286

Query  698   RMLLLINARFKFKDTPMPSGYTGNAFAYPGAKTTAGKLRKNPLGYAVELVTSIKRCFSEE  519
             R+L ++NAR K  + P+P+G+ GNAFA+P A TTA KL KNPLG+A+ELV S K   +EE
Sbjct  287   RVLCIVNARSKIVNPPLPTGFYGNAFAFPVALTTAAKLCKNPLGFALELVKSAKADVTEE  346

Query  518   YMQSMVDLMVLKGRPPFHVAGSFIMSDLTRSKISDVDYGWGKPVFGGPAHGGAGDVPGVI  339
             YMQS+ DLMV++GRP F V G++++SD+TR+   DVD+GWGK  +GGPA GG G +PGV 
Sbjct  347   YMQSLADLMVIRGRPHFTVVGTYLVSDVTRAGFGDVDFGWGKAAYGGPAKGGVGAIPGVA  406

Query  338   TFHVPYENKKGENGTLIPICLPAFALDKFVNEL  240
             +F++P+ +  GE+G ++P+CLPA A+++FV EL
Sbjct  407   SFYIPFRDNNGEDGIVVPVCLPAPAMERFVKEL  439



>ref|XP_009619718.1| PREDICTED: benzyl alcohol O-benzoyltransferase [Nicotiana tomentosiformis]
Length=460

 Score =   529 bits (1362),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 245/392 (63%), Positives = 313/392 (80%), Gaps = 5/392 (1%)
 Frame = -1

Query  1415  FYRNEPSMSGKDPVQVIRQALAKALVFFYPFAGRLREGPGRKLMVDCTGEGVMFIEADAD  1236
             FY  + SM  KDPV+VI++A+A+ LVF+YPFAGRLREG GRKLMVDCTGEG++F+EADAD
Sbjct  52    FYHKDSSMGRKDPVKVIKKAIAETLVFYYPFAGRLREGNGRKLMVDCTGEGIIFVEADAD  111

Query  1235  ATLQHFAIGGELKPPFPCFDQLLYNVPGSAEILNSPLFLIQVTRLRCGGFIFTLRMNHTM  1056
              TL+ F  G EL+PPFPC ++LLY+VP SA +LN PL LIQVTRLRCGGFIF LR+NHTM
Sbjct  112   VTLEQF--GDELQPPFPCLEELLYDVPDSAGVLNCPLLLIQVTRLRCGGFIFALRLNHTM  169

Query  1055  ADASGLVHFLNTIAEIARGAEAPAVQPVWQREFFSARNPPRITCTHFEYEEEPAADSMVT  876
             +DA GLV F+  + E+ARGA AP++ PVW RE  +ARNPP++TCTH EY+E    D+  T
Sbjct  170   SDAPGLVQFMTAVGEMARGASAPSILPVWCRELLNARNPPQVTCTHHEYDE--VRDTKGT  227

Query  875   NIPLDNLVHRSFLFGPTEISVLRSSLPPHLRKCSTVEILTALVWRCRTIALGFHPDEEVR  696
              IPLD++VH+SF FGP+E+S LR  +P HLRKCST E+LTA++WRCRT++L   P+EEVR
Sbjct  228   IIPLDDMVHKSFFFGPSEVSALRRFVPHHLRKCSTFELLTAVLWRCRTMSLKPDPEEEVR  287

Query  695   MLLLINARFKFKDTPMPSGYTGNAFAYPGAKTTAGKLRKNPLGYAVELVTSIKRCFSEEY  516
              L ++NAR +F + P+P+GY GNAFA+P A TTA KL KNPLGYA+ELV   K   +EEY
Sbjct  288   ALCIVNARSRF-NPPLPTGYYGNAFAFPVAVTTAAKLSKNPLGYALELVKKTKSDVTEEY  346

Query  515   MQSMVDLMVLKGRPPFHVAGSFIMSDLTRSKISDVDYGWGKPVFGGPAHGGAGDVPGVIT  336
             M+S+ DLMVLKGRP F V  +F++SD+TR    +VD+GWGK V+GGPA GG G +PGV +
Sbjct  347   MKSVADLMVLKGRPHFTVVRTFLVSDVTRGGFGEVDFGWGKAVYGGPAKGGVGAIPGVAS  406

Query  335   FHVPYENKKGENGTLIPICLPAFALDKFVNEL  240
             F++P++NKKGENG ++PICLP FA++ FV EL
Sbjct  407   FYIPFKNKKGENGIVVPICLPGFAMETFVKEL  438



>emb|CDP21409.1| unnamed protein product [Coffea canephora]
Length=456

 Score =   529 bits (1362),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 257/415 (62%), Positives = 324/415 (78%), Gaps = 21/415 (5%)
 Frame = -1

Query  1415  FYRNEPSMSGKDPVQVIRQALAKALVFFYPFAGRLREGPGRKLMVDCTGEGVMFIEADAD  1236
             FYR++     +DPV+VIR+A+AKALVF+YPFAGRLRE  GRKL+VDCTGEGVMFIEADA+
Sbjct  49    FYRSDDGR--RDPVKVIREAIAKALVFYYPFAGRLRECAGRKLVVDCTGEGVMFIEADAE  106

Query  1235  ATLQHFAIGGELKPPFPCFDQLLYNVPGSAEILNSPLFLIQVTRLRCGGFIFTLRMNHTM  1056
              TL+ F  G EL+PPFPC ++LLY+VP SA +L+ PL LIQVTRLRCGGFIF LR+NHTM
Sbjct  107   VTLEQF--GEELQPPFPCLEELLYDVPESAGVLHCPLLLIQVTRLRCGGFIFALRLNHTM  164

Query  1055  ADASGLVHFLNTIAEIARGAEAPAVQPVWQREFFSARNPPRITCTHFEYEEEPAADSMVT  876
             +DA+GLV F+N + EIARGA AP+V PVWQRE  +AR+PPR+TCTH EY+E   AD+  T
Sbjct  165   SDAAGLVQFMNAVGEIARGASAPSVLPVWQRELLNARDPPRVTCTHHEYDE--VADTKGT  222

Query  875   NIPLDNLVHRSFLFGPTEISVLRSSLPPHL-RKCSTVEILTALVWRCRTIALGFHPDEEV  699
              IPLD++VHRSF FGPTE+S LR S+P  + RKCST EILTA +WRCRTIAL   P+EEV
Sbjct  223   IIPLDDMVHRSFFFGPTEVSALRKSIPLDISRKCSTFEILTACLWRCRTIALQPEPNEEV  282

Query  698   RMLLLINARFKFKDTPMPSGYTGNAFAYPGAKTTAGKLRKNPLGYAVELVTSIKRCFSEE  519
             R+L ++NAR KF D P+P GY GNAFA+P A TTAG+L K PLGYA+ELV   K   +E+
Sbjct  283   RVLCIVNARSKF-DPPLPQGYYGNAFAFPVALTTAGELCKRPLGYALELVNKSKCDVTED  341

Query  518   YMQSMVDLMVLKGRPPFHVAGSFIMSDLTRSKISDVDYGWGKPVFGGPAHGGAGDVPGVI  339
             YM+S+ DLMV+KGRP F V  ++++SD+TR+  ++VD+GWGKP +GGPA GG G +PGV 
Sbjct  342   YMKSVADLMVIKGRPHFTVVRTYLVSDVTRAGFNEVDFGWGKPAYGGPAKGGVGAIPGVA  401

Query  338   TFHVPYENKKGENGTLIPICLPAFALDKFVNELAN-------------TFLRAAL  213
             +F++P++NK GE G ++PICLP FA+D FV EL N             TF+R+AL
Sbjct  402   SFYIPFKNKNGEKGIVVPICLPGFAMDAFVRELENLLSKNHHSIDDHSTFVRSAL  456



>emb|CAA64636.1| hsr201 [Nicotiana tabacum]
Length=460

 Score =   528 bits (1361),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 245/392 (63%), Positives = 312/392 (80%), Gaps = 5/392 (1%)
 Frame = -1

Query  1415  FYRNEPSMSGKDPVQVIRQALAKALVFFYPFAGRLREGPGRKLMVDCTGEGVMFIEADAD  1236
             FY  + SM  KDPV+VI++A+A+ LVF+YPFAGRLREG GRKLMVDCTGEG+MF+EADAD
Sbjct  52    FYHKDSSMGRKDPVKVIKKAIAETLVFYYPFAGRLREGNGRKLMVDCTGEGIMFVEADAD  111

Query  1235  ATLQHFAIGGELKPPFPCFDQLLYNVPGSAEILNSPLFLIQVTRLRCGGFIFTLRMNHTM  1056
              TL+ F  G EL+PPFPC ++LLY+VP SA +LN PL LIQVTRLRCGGFIF LR+NHTM
Sbjct  112   VTLEQF--GDELQPPFPCLEELLYDVPDSAGVLNCPLLLIQVTRLRCGGFIFALRLNHTM  169

Query  1055  ADASGLVHFLNTIAEIARGAEAPAVQPVWQREFFSARNPPRITCTHFEYEEEPAADSMVT  876
             +DA GLV F+  + E+ARG  AP++ PVW RE  +ARNPP++TCTH EY+E    D+  T
Sbjct  170   SDAPGLVQFMTAVGEMARGGSAPSILPVWCRELLNARNPPQVTCTHHEYDE--VRDTKGT  227

Query  875   NIPLDNLVHRSFLFGPTEISVLRSSLPPHLRKCSTVEILTALVWRCRTIALGFHPDEEVR  696
              IPLD++VH+SF FGP+E+S LR  +P HLRKCST E+LTA++WRCRT++L   P+EEVR
Sbjct  228   IIPLDDMVHKSFFFGPSEVSALRRFVPHHLRKCSTFELLTAVLWRCRTMSLKPDPEEEVR  287

Query  695   MLLLINARFKFKDTPMPSGYTGNAFAYPGAKTTAGKLRKNPLGYAVELVTSIKRCFSEEY  516
              L ++NAR +F + P+P+GY GNAFA+P A TTA KL KNPLGYA+ELV   K   +EEY
Sbjct  288   ALCIVNARSRF-NPPLPTGYYGNAFAFPVAVTTAAKLSKNPLGYALELVKKTKSDVTEEY  346

Query  515   MQSMVDLMVLKGRPPFHVAGSFIMSDLTRSKISDVDYGWGKPVFGGPAHGGAGDVPGVIT  336
             M+S+ DLMVLKGRP F V  +F++SD+TR    +VD+GWGK V+GGPA GG G +PGV +
Sbjct  347   MKSVADLMVLKGRPHFTVVRTFLVSDVTRGGFGEVDFGWGKAVYGGPAKGGVGAIPGVAS  406

Query  335   FHVPYENKKGENGTLIPICLPAFALDKFVNEL  240
             F++P++NKKGENG ++PICLP FA++ FV EL
Sbjct  407   FYIPFKNKKGENGIVVPICLPGFAMETFVKEL  438



>ref|XP_009803456.1| PREDICTED: benzyl alcohol O-benzoyltransferase-like isoform X1 
[Nicotiana sylvestris]
Length=462

 Score =   526 bits (1355),  Expect = 1e-180, Method: Compositional matrix adjust.
 Identities = 243/393 (62%), Positives = 312/393 (79%), Gaps = 5/393 (1%)
 Frame = -1

Query  1415  FYRNEPSMSGKDPVQVIRQALAKALVFFYPFAGRLREGPGRKLMVDCTGEGVMFIEADAD  1236
             FY    SM GKDPV VI++A+A+ LVF+YPFAGRLREG GRKLMVDCTGEG+MF+EADAD
Sbjct  52    FYSKNSSMEGKDPVNVIKKAIAETLVFYYPFAGRLREGTGRKLMVDCTGEGIMFVEADAD  111

Query  1235  ATLQHFAIGGELKPPFPCFDQLLYNVPGSAEILNSPLFLIQVTRLRCGGFIFTLRMNHTM  1056
              TL+ F  G EL+PPFPC D+LL++VP SA +LN PL LIQVTRL CGGFIF+LR+NHTM
Sbjct  112   VTLEEF--GDELQPPFPCLDELLFDVPHSAGVLNCPLLLIQVTRLICGGFIFSLRLNHTM  169

Query  1055  ADASGLVHFLNTIAEIARGAEAPAVQPVWQREFFSARNPPRITCTHFEYEEEPAADSMVT  876
             +DA GLV F+  + E+ARGA AP+V PVW RE  +ARNPP++TCTH EY+E P  D+  T
Sbjct  170   SDAPGLVQFMTAVGEMARGASAPSVLPVWCRELLNARNPPQVTCTHHEYDEVP--DTKDT  227

Query  875   NIPLDNLVHRSFLFGPTEISVLRSSLPPHLRKCSTVEILTALVWRCRTIALGFHPDEEVR  696
              IPLD++VH+SF FGP+E+S LR  +P HLRKCST E+LTA++WRCRT++L   P+EEVR
Sbjct  228   IIPLDDMVHKSFFFGPSEVSALRRFVPYHLRKCSTFELLTAVLWRCRTMSLKPDPEEEVR  287

Query  695   MLLLINARFKFK-DTPMPSGYTGNAFAYPGAKTTAGKLRKNPLGYAVELVTSIKRCFSEE  519
             +L ++NAR   + + P+P+GY GNAF +P A TTA KL KNPL YA+ELV   K   +EE
Sbjct  288   ILCIVNARSNARFNPPLPTGYYGNAFVFPVAVTTAAKLSKNPLAYALELVKKTKTDVTEE  347

Query  518   YMQSMVDLMVLKGRPPFHVAGSFIMSDLTRSKISDVDYGWGKPVFGGPAHGGAGDVPGVI  339
             YM+S+ DLMVLKGRP F V  ++++SD+TR+   +VD+GWGK V+GGPA GG G +PGV 
Sbjct  348   YMKSVADLMVLKGRPHFTVVRTYLVSDVTRAGFREVDFGWGKAVYGGPAKGGVGAIPGVA  407

Query  338   TFHVPYENKKGENGTLIPICLPAFALDKFVNEL  240
             +F++P++NKKGENG ++PICLP FA++ F+ EL
Sbjct  408   SFYIPFKNKKGENGIVVPICLPGFAMETFIKEL  440



>ref|XP_004243496.2| PREDICTED: benzyl alcohol O-benzoyltransferase [Solanum lycopersicum]
Length=485

 Score =   526 bits (1354),  Expect = 3e-180, Method: Compositional matrix adjust.
 Identities = 244/402 (61%), Positives = 321/402 (80%), Gaps = 9/402 (2%)
 Frame = -1

Query  1415  FYRNEPSMS---GKDPVQVIRQALAKALVFFYPFAGRLREGPGRKLMVDCTGEGVMFIEA  1245
             FYR +  +S     DPV+VI++A+A+ LVF+YPFAGRLREG GRKLMVDCTGEGVMF+EA
Sbjct  72    FYRKDSDISTGGNHDPVKVIKKAIAETLVFYYPFAGRLREGNGRKLMVDCTGEGVMFVEA  131

Query  1244  DADATLQHFAIGGELKPPFPCFDQLLYNVPGSAEILNSPLFLIQVTRLRCGGFIFTLRMN  1065
             DAD TL+ F  G EL+PPFPC ++LLY+VPGSAE+LNSPL LIQVTRL+CGGFIF +R+N
Sbjct  132   DADVTLEQF--GDELQPPFPCLEELLYDVPGSAEVLNSPLLLIQVTRLKCGGFIFAVRLN  189

Query  1064  HTMADASGLVHFLNTIAEIARGAEAPAVQPVWQREFFSARNPPRITCTHFEYEEEPAADS  885
             HTM+DA+GLV F+  + E+ARGA  P+  PVW RE  ++R+PPR+TCTH EY+E P  D+
Sbjct  190   HTMSDAAGLVQFMTAVGEMARGASVPSTLPVWSRELLNSRDPPRVTCTHHEYDEVP--DT  247

Query  884   MVTNIPLDNLVHRSFLFGPTEISVLRSSLPPHLRKCSTVEILTALVWRCRTIALGFHPDE  705
               T IPLD++VH+SF FGP+++S LR  +PPHLRK ST E+LT+++WRCRTI+L   P+E
Sbjct  248   KGTIIPLDDMVHKSFFFGPSQVSALRRFIPPHLRKSSTFELLTSVLWRCRTISLKPDPEE  307

Query  704   EVRMLLLINARFKFKDTPMPSGYTGNAFAYPGAKTTAGKLRKNPLGYAVELVTSIKRCFS  525
             EVR+L L+NAR KF + P+P+G+ GNAFA+P A TTA KL KNPLGYA+ELV   K   +
Sbjct  308   EVRVLCLVNARSKF-NPPLPNGFYGNAFAFPVAVTTAAKLCKNPLGYALELVKKAKSDVT  366

Query  524   EEYMQSMVDLMVLKGRPPFHVAGSFIMSDLTRSKISDVDYGWGKPVFGGPAHGGAGDVPG  345
             EEYM+S+ DLMV+KGRP F V  ++++SD+TR+   +VD+GWGK  +GGPA GG G +PG
Sbjct  367   EEYMKSVADLMVMKGRPHFTVVRTYLVSDVTRAGFGEVDFGWGKAAYGGPAKGGVGAIPG  426

Query  344   VITFHVPYENKKGENGTLIPICLPAFALDKFVNELANTFLRA  219
             V +F++P++NK GENG ++P+CLPAFA++ FV EL N  L++
Sbjct  427   VASFYIPFKNKNGENGIVVPVCLPAFAMEIFVREL-NGMLKS  467



>ref|XP_004243495.1| PREDICTED: benzyl alcohol O-benzoyltransferase-like [Solanum 
lycopersicum]
Length=471

 Score =   524 bits (1349),  Expect = 1e-179, Method: Compositional matrix adjust.
 Identities = 247/400 (62%), Positives = 316/400 (79%), Gaps = 13/400 (3%)
 Frame = -1

Query  1415  FYRNEP------SMSGK--DPVQVIRQALAKALVFFYPFAGRLREGPGRKLMVDCTGEGV  1260
             FYR +       SM G   +PV+VI++A+A+ALVF+YPFAGRLREG GRKLMVDC+GEGV
Sbjct  54    FYRKDSYSDLDSSMGGNYNEPVKVIKKAIAEALVFYYPFAGRLREGNGRKLMVDCSGEGV  113

Query  1259  MFIEADADATLQHFAIGGELKPPFPCFDQLLYNVPGSAEILNSPLFLIQVTRLRCGGFIF  1080
             MF+EADAD TL+ F  G ELKPPFPC ++LLY+VPGSA +LN PL LIQVTRL+CG FIF
Sbjct  114   MFVEADADVTLEQF--GDELKPPFPCLEELLYDVPGSAGVLNCPLLLIQVTRLKCGSFIF  171

Query  1079  TLRMNHTMADASGLVHFLNTIAEIARGAEAPAVQPVWQREFFSARNPPRITCTHFEYEEE  900
              +R+NHTM+DA+GLV F+  + E+ARGA AP+  PVW RE  +ARNPPR+TCTH EY+E 
Sbjct  172   AVRLNHTMSDATGLVEFMTAVGEMARGASAPSTLPVWSRELLNARNPPRVTCTHHEYDEV  231

Query  899   PAADSMVTNIPLDNLVHRSFLFGPTEISVLRSSLPPHLRKCSTVEILTALVWRCRTIALG  720
             P  D+  T IPLD++VH+SF FGP+E+S LR  LPPHLRKCST E+LT+++WRCRTI+L 
Sbjct  232   P--DTNGTIIPLDDMVHKSFFFGPSEVSALRRFLPPHLRKCSTFELLTSVIWRCRTISLK  289

Query  719   FHPDEEVRMLLLINARFKFKDTPMPSGYTGNAFAYPGAKTTAGKLRKNPLGYAVELVTSI  540
               P EEVR+L L+NARFKF + P+P+G+ GNAFA+P A  TA KL KNPLGYA+ELV   
Sbjct  290   PDPAEEVRVLCLVNARFKF-NPPLPNGFYGNAFAFPVAVATAEKLVKNPLGYALELVKKA  348

Query  539   KRCFSEEYMQSMVDLMVLKGRPPFHVAGSFIMSDLTRSKISDVDYGWGKPVFGGPAHGGA  360
             K   +EEYM+S+ DLMV+ GRP F V  +F++SD+TR+   +VD+GWGKPV+GGPA GG 
Sbjct  349   KSDVTEEYMKSVADLMVINGRPHFAVVRTFLVSDVTRAGFGEVDFGWGKPVYGGPAKGGV  408

Query  359   GDVPGVITFHVPYENKKGENGTLIPICLPAFALDKFVNEL  240
             G  PG+ +F++P+ NK GENG ++P+CLPAFA++ FV E+
Sbjct  409   GPFPGMASFYIPFRNKNGENGIVVPMCLPAFAMEIFVKEI  448



>dbj|BAF49304.1| putative acyltransferase [Clitoria ternatea]
Length=461

 Score =   523 bits (1347),  Expect = 2e-179, Method: Compositional matrix adjust.
 Identities = 251/393 (64%), Positives = 306/393 (78%), Gaps = 6/393 (2%)
 Frame = -1

Query  1415  FYRNEPSMSGKDPVQVIRQALAKALVFFYPFAGRLREGPGRKLMVDCTGEGVMFIEADAD  1236
             FYR   +M+GKDPV+VIR+ALAK LVF+YPFAGRLREGPGRKLMVDCTGEGV+FIEA AD
Sbjct  53    FYRYNETMAGKDPVEVIRKALAKTLVFYYPFAGRLREGPGRKLMVDCTGEGVLFIEAHAD  112

Query  1235  ATLQHFAIGGELKPPFPCFDQLLYNVPGSAEILNSPLFLIQVTRLRCGGFIFTLRMNHTM  1056
              TLQ F  G  L+PPFP  D LLYN+P S  +LNSPL LIQVTRL+CGGFI  LR+NHTM
Sbjct  113   VTLQQF--GDSLQPPFPGLDHLLYNLPNSDGVLNSPLLLIQVTRLKCGGFILALRLNHTM  170

Query  1055  ADASGLVHFLNTIAEIARGAEAPAVQPVWQREFFSARNPPRITCTHFEYEEEPAADSMVT  876
             +DA+GLV F++ + EIARG E P++ PVW+RE  +ARNPP++TCTH EYE+ P  DS  T
Sbjct  171   SDAAGLVQFMSAVGEIARGMEEPSIPPVWRRELLNARNPPKVTCTHREYEQVP--DSKGT  228

Query  875   NIPLDNLVHRSFLFGPTEISVLRSSLPPHL-RKCSTVEILTALVWRCRTIALGFHPDEEV  699
              IPLD++ HRSF FGP EIS +R  +P    R+CS  EILTA +WRCRTIAL    DEEV
Sbjct  229   IIPLDDMAHRSFFFGPAEISAIRRLIPAQQQRQCSNFEILTACLWRCRTIALQPDSDEEV  288

Query  698   RMLLLINARFKFKDTPMPSGYTGNAFAYPGAKTTAGKLRKNPLGYAVELVTSIKRCFSEE  519
             R+L ++NAR KF + P+P+GY GNAFA+P A TTAGKL  NPLGYA+ELV   K   SEE
Sbjct  289   RILCIVNARGKF-NPPLPAGYYGNAFAFPVAVTTAGKLCGNPLGYALELVRKAKGDVSEE  347

Query  518   YMQSMVDLMVLKGRPPFHVAGSFIMSDLTRSKISDVDYGWGKPVFGGPAHGGAGDVPGVI  339
             YM S+ DLMV KGRP F V  S+++SD+TR+   DVD+GWGKPV+GGPA GG G +PGV 
Sbjct  348   YMHSLADLMVTKGRPHFTVVRSYLVSDVTRAGFGDVDFGWGKPVYGGPAKGGVGAIPGVA  407

Query  338   TFHVPYENKKGENGTLIPICLPAFALDKFVNEL  240
             +F++P+ N KGE G +IP+CLP+ A+D+FV EL
Sbjct  408   SFYIPFRNSKGEEGLVIPVCLPSQAMDRFVREL  440



>gb|ACJ85557.1| unknown [Medicago truncatula]
Length=459

 Score =   520 bits (1340),  Expect = 2e-178, Method: Compositional matrix adjust.
 Identities = 241/396 (61%), Positives = 315/396 (80%), Gaps = 5/396 (1%)
 Frame = -1

Query  1415  FYRNEPSMSGKDPVQVIRQALAKALVFFYPFAGRLREGPGRKLMVDCTGEGVMFIEADAD  1236
             FY+ +P+M+GKDPV +IR+A AK LVF+YPFAGRLREGPGRKLMVDCTGEGV+FIEADAD
Sbjct  48    FYKYDPNMAGKDPVDIIRKASAKTLVFYYPFAGRLREGPGRKLMVDCTGEGVLFIEADAD  107

Query  1235  ATLQHFAIGGELKPPFPCFDQLLYNVPGSAEILNSPLFLIQVTRLRCGGFIFTLRMNHTM  1056
              +L+ F  G  L+PPFPC D+LL++VPGS+E+LN PL +IQVTRL+CGGFIF LR+NHTM
Sbjct  108   VSLKEF--GDALQPPFPCLDELLFDVPGSSEVLNCPLLVIQVTRLKCGGFIFALRLNHTM  165

Query  1055  ADASGLVHFLNTIAEIARGAEAPAVQPVWQREFFSARNPPRITCTHFEYEEEPAADSMVT  876
             +DA+GLV F++ + EI+ G   P++ PVW RE  ++R+PPR+TCTH EYE+ P  D+  T
Sbjct  166   SDAAGLVQFMSALGEISCGMNEPSILPVWHRELLNSRDPPRVTCTHREYEQVP--DTKGT  223

Query  875   NIPLDNLVHRSFLFGPTEISVLRSSLPPHLRKCSTVEILTALVWRCRTIALGFHPDEEVR  696
              IPLD++ HRSF FGPTE++ +R+ LPPH +K S  EILTA +WRCRTIAL    DEEVR
Sbjct  224   IIPLDDMAHRSFFFGPTEVAKIRALLPPHQQKQSNFEILTACLWRCRTIALQPDTDEEVR  283

Query  695   MLLLINARFKFKDTPMPSGYTGNAFAYPGAKTTAGKLRKNPLGYAVELVTSIKRCFSEEY  516
             ++ ++NAR KF + P+P+GY GNAFA+P A TTAGKL +NPLGYA+ELV   K   ++EY
Sbjct  284   IICIVNARGKF-NPPLPNGYYGNAFAFPVAVTTAGKLMENPLGYALELVKKAKSDVTQEY  342

Query  515   MQSMVDLMVLKGRPPFHVAGSFIMSDLTRSKISDVDYGWGKPVFGGPAHGGAGDVPGVIT  336
             M S+ DLMV+KGRP F V  S+++SD+TR+   DV++GWGK V+GGPA GG G +PGV +
Sbjct  343   MHSVADLMVIKGRPHFTVVRSYLVSDVTRAGFGDVEFGWGKAVYGGPAKGGVGAIPGVAS  402

Query  335   FHVPYENKKGENGTLIPICLPAFALDKFVNELANTF  228
             F++P++N KGE G +IP+CLPA A++KFV EL +  
Sbjct  403   FYIPFKNAKGEEGLVIPLCLPAQAMEKFVKELDSVL  438



>ref|XP_008232530.1| PREDICTED: benzyl alcohol O-benzoyltransferase [Prunus mume]
Length=461

 Score =   520 bits (1338),  Expect = 4e-178, Method: Compositional matrix adjust.
 Identities = 241/399 (60%), Positives = 311/399 (78%), Gaps = 6/399 (2%)
 Frame = -1

Query  1415  FYRNEPSMSGKDPVQVIRQALAKALVFFYPFAGRLREGPGRKLMVDCTGEGVMFIEADAD  1236
             FYR +PSM G DPV VIR+A+A+ LVF+YPFAGRLREGP RKLMVDCT EG++FIEADAD
Sbjct  51    FYRYDPSMQGSDPVTVIREAIAETLVFYYPFAGRLREGPARKLMVDCTAEGILFIEADAD  110

Query  1235  ATLQHFAIGGELKPPFPCFDQLLYNVPGSAEILNSPLFLIQVTRLRCGGFIFTLRMNHTM  1056
              TLQ F  G  L+PPFPC ++LLYNVPGS  +LN PL LIQVTRL+CGGFIF LR+NHTM
Sbjct  111   VTLQQF--GDALQPPFPCLEELLYNVPGSDGVLNCPLLLIQVTRLKCGGFIFALRLNHTM  168

Query  1055  ADASGLVHFLNTIAEIARGAEAPAVQPVWQREFFSARNPPRITCTHFEYEEEPAADSMVT  876
             +DA+GLV F+  + E+ARGA  P+ QPVW+RE   AR+PPR+TC H EY+E   AD+  T
Sbjct  169   SDAAGLVQFMMAVGEMARGARVPSFQPVWKRELLKARDPPRVTCAHHEYDE--VADTKGT  226

Query  875   NIPLDNLVHRSFLFGPTEISVLRSSLPPHLRKCSTVEILTALVWRCRTIALGFHPDEEVR  696
              IPLD++ HRSF F P E+S +R  +P HL KCST E+LTA +WRCRTIAL   P+EEVR
Sbjct  227   IIPLDDMAHRSFFFRPIEMSAIRRFVPQHLSKCSTFEVLTACLWRCRTIALQPDPEEEVR  286

Query  695   MLLLINARFKFKDTPMPSGYTGNAFAYPGAKTTAGKLRKNPLGYAVELVTSIKRCFSEEY  516
             +L ++NAR KF +  +P GY GNAFA+P A TTAG+L +NPLGYA+ELV   K   +EEY
Sbjct  287   VLCIVNARAKF-NPALPLGYYGNAFAFPVALTTAGRLCQNPLGYALELVKQAKADVTEEY  345

Query  515   MQSMVDLMVLKGRPPFHVAGSFIMSDLTRSKISDVDYGWGKPVFGGPAHGGAGDVPGVIT  336
             M+S+ DLMV++GRP F V G++++SD+TR+   +VD+GWGK  +GGPA GG G +PGV +
Sbjct  346   MRSLADLMVIRGRPHFTVVGTYLVSDVTRAGFGEVDFGWGKAAYGGPAKGGVGAIPGVAS  405

Query  335   FHVPYENKKGENGTLIPICLPAFALDKFVNELANTFLRA  219
             F++P+++  G++G ++PICLPA A+++F+ EL NT L A
Sbjct  406   FYIPFKDNNGQDGIVVPICLPAPAMERFIKEL-NTMLNA  443



>ref|XP_008462816.1| PREDICTED: benzyl alcohol O-benzoyltransferase-like [Cucumis 
melo]
Length=459

 Score =   519 bits (1337),  Expect = 6e-178, Method: Compositional matrix adjust.
 Identities = 240/399 (60%), Positives = 321/399 (80%), Gaps = 6/399 (2%)
 Frame = -1

Query  1415  FYRNEPSMSGKDPVQVIRQALAKALVFFYPFAGRLREGPGRKLMVDCTGEGVMFIEADAD  1236
             FYR++P M+G DP +VI++A+AKALVF+YPFAGRLREGPGRKL V+CTGEGVMFIEADAD
Sbjct  48    FYRHDPRMAGTDPARVIKEAIAKALVFYYPFAGRLREGPGRKLFVECTGEGVMFIEADAD  107

Query  1235  ATLQHFAIGGELKPPFPCFDQLLYNVPGSAEILNSPLFLIQVTRLRCGGFIFTLRMNHTM  1056
              +L+ F  G  L+PPFPC ++LL++VP S+ +L+ PL LIQVTRL+CGGFIF LR+NHTM
Sbjct  108   VSLEQF--GDALQPPFPCLEELLFDVPNSSGVLDCPLLLIQVTRLKCGGFIFALRLNHTM  165

Query  1055  ADASGLVHFLNTIAEIARGAEAPAVQPVWQREFFSARNPPRITCTHFEYEEEPAADSMVT  876
             +DASGLV F+  + E+ARGA AP+V+PVWQR   +AR+PP++TC H EY+E    D+  T
Sbjct  166   SDASGLVQFMMAVGEMARGATAPSVRPVWQRALLNARDPPKVTCHHREYDE--VVDTKGT  223

Query  875   NIPLDNLVHRSFLFGPTEISVLRSSLPPHLRKCSTVEILTALVWRCRTIALGFHPDEEVR  696
              IPLD++ HRSF FGP+EIS +R +LP HLR+CS+ E+LTA +WR RTI+L   P+EEVR
Sbjct  224   IIPLDDMAHRSFFFGPSEISAIRKALPSHLRQCSSFEVLTACLWRFRTISLQPDPEEEVR  283

Query  695   MLLLINARFKFKDTPMPSGYTGNAFAYPGAKTTAGKLRKNPLGYAVELVTSIKRCFSEEY  516
             +L ++N+R KF + P+P+GY GNAFA+P A TTAGKL +NPLGYA+ELV   K   +E+Y
Sbjct  284   VLCIVNSRSKF-NPPLPTGYYGNAFAFPVALTTAGKLCQNPLGYALELVRKAKADVTEDY  342

Query  515   MQSMVDLMVLKGRPPFHVAGSFIMSDLTRSKISDVDYGWGKPVFGGPAHGGAGDVPGVIT  336
             M+S+ DLMV+KGRP F V  ++++SD+TR+   DVD+GWGK ++GGPA GG G +PGV +
Sbjct  343   MKSVADLMVIKGRPHFTVVRTYLVSDVTRAGFEDVDFGWGKAMYGGPAKGGVGAIPGVAS  402

Query  335   FHVPYENKKGENGTLIPICLPAFALDKFVNELANTFLRA  219
             F++P++NKKGE G L+P+CLPA A+++FV EL +  L+A
Sbjct  403   FYIPFKNKKGERGILVPLCLPAPAMERFVKEL-DALLKA  440



>gb|AFK36385.1| unknown [Medicago truncatula]
Length=459

 Score =   518 bits (1333),  Expect = 2e-177, Method: Compositional matrix adjust.
 Identities = 240/396 (61%), Positives = 314/396 (79%), Gaps = 5/396 (1%)
 Frame = -1

Query  1415  FYRNEPSMSGKDPVQVIRQALAKALVFFYPFAGRLREGPGRKLMVDCTGEGVMFIEADAD  1236
             FY+ +P+M+GKDPV +IR+A AK LVF+YPFAGRLREGPGRKLMVDCTGEGV+FIEADAD
Sbjct  48    FYKYDPNMAGKDPVDIIRKASAKTLVFYYPFAGRLREGPGRKLMVDCTGEGVLFIEADAD  107

Query  1235  ATLQHFAIGGELKPPFPCFDQLLYNVPGSAEILNSPLFLIQVTRLRCGGFIFTLRMNHTM  1056
              +L+ F  G  L+PPFPC D+LL++VPGS+E+LN PL +IQVTRL+CGGFIF LR+NHTM
Sbjct  108   VSLKEF--GDALQPPFPCLDELLFDVPGSSEVLNCPLLVIQVTRLKCGGFIFALRLNHTM  165

Query  1055  ADASGLVHFLNTIAEIARGAEAPAVQPVWQREFFSARNPPRITCTHFEYEEEPAADSMVT  876
             +DA+GLV F++ + EI+ G   P++ PVW RE  ++R+PPR+TCTH EYE+ P  D+  T
Sbjct  166   SDAAGLVQFMSALGEISCGMNEPSILPVWHRELLNSRDPPRVTCTHREYEQVP--DTKGT  223

Query  875   NIPLDNLVHRSFLFGPTEISVLRSSLPPHLRKCSTVEILTALVWRCRTIALGFHPDEEVR  696
              IPLD++ HRSF FGPTE++ +R+ LPPH +K S  EILTA +WRCRTIAL    DEEVR
Sbjct  224   IIPLDDMAHRSFFFGPTEVAKIRALLPPHQQKQSNFEILTACLWRCRTIALQPDTDEEVR  283

Query  695   MLLLINARFKFKDTPMPSGYTGNAFAYPGAKTTAGKLRKNPLGYAVELVTSIKRCFSEEY  516
             ++ ++NAR KF + P+P+GY GNAFA+P A TTAGKL +NPLGYA+ELV   K   ++EY
Sbjct  284   IICIVNARGKF-NPPLPNGYYGNAFAFPVAVTTAGKLMENPLGYALELVKKAKSDVTQEY  342

Query  515   MQSMVDLMVLKGRPPFHVAGSFIMSDLTRSKISDVDYGWGKPVFGGPAHGGAGDVPGVIT  336
             M S+ DLMV+KGRP F V  S+++ D+TR+   DV++GWGK V+GGPA GG G +PGV +
Sbjct  343   MHSVADLMVIKGRPHFTVVRSYLVFDVTRAGFGDVEFGWGKAVYGGPAKGGVGAIPGVAS  402

Query  335   FHVPYENKKGENGTLIPICLPAFALDKFVNELANTF  228
             F++P++N KGE G +IP+CLPA A++KFV EL +  
Sbjct  403   FYIPFKNAKGEEGLVIPLCLPAQAMEKFVKELDSVL  438



>ref|XP_008359502.1| PREDICTED: benzyl alcohol O-benzoyltransferase-like [Malus domestica]
Length=461

 Score =   518 bits (1333),  Expect = 2e-177, Method: Compositional matrix adjust.
 Identities = 245/399 (61%), Positives = 309/399 (77%), Gaps = 6/399 (2%)
 Frame = -1

Query  1415  FYRNEPSMSGKDPVQVIRQALAKALVFFYPFAGRLREGPGRKLMVDCTGEGVMFIEADAD  1236
             FY+ +PSM G+DPV V+R+A+A+ LVF+YPFAGRLREGP RKL V+CT EGVMFIEADAD
Sbjct  51    FYKYDPSMQGRDPVHVLREAIAQTLVFYYPFAGRLREGPNRKLTVECTAEGVMFIEADAD  110

Query  1235  ATLQHFAIGGELKPPFPCFDQLLYNVPGSAEILNSPLFLIQVTRLRCGGFIFTLRMNHTM  1056
              TL+ F  G  L+PPFPC ++LLYNV GS  +LN PL LIQVTRL+CGGFI  LR+NHTM
Sbjct  111   VTLEQF--GDALQPPFPCLEELLYNVRGSDGVLNCPLLLIQVTRLQCGGFIVALRLNHTM  168

Query  1055  ADASGLVHFLNTIAEIARGAEAPAVQPVWQREFFSARNPPRITCTHFEYEEEPAADSMVT  876
             +DA+GLV F+  + EIARGA +P VQPVWQRE  +AR PPR+TCTH EYEE    D+  T
Sbjct  169   SDAAGLVQFMTALGEIARGAVSPTVQPVWQRELLNARYPPRVTCTHREYEE--VEDTKGT  226

Query  875   NIPLDNLVHRSFLFGPTEISVLRSSLPPHLRKCSTVEILTALVWRCRTIALGFHPDEEVR  696
              IPLD++VHRSF F PTE+S +R  +P  L KCST E+LTA +WRCRTIAL   P+EEVR
Sbjct  227   IIPLDDMVHRSFFFRPTEVSAIRRFVPQFLSKCSTFEVLTACLWRCRTIALQKDPNEEVR  286

Query  695   MLLLINARFKFKDTPMPSGYTGNAFAYPGAKTTAGKLRKNPLGYAVELVTSIKRCFSEEY  516
             +L ++NAR KF + P+P GY GNAFA+P A TTAG+L  NPLGYA+ELV   K   +EEY
Sbjct  287   VLCIVNARSKF-NPPLPVGYYGNAFAFPVAVTTAGRLCNNPLGYALELVRKAKADVTEEY  345

Query  515   MQSMVDLMVLKGRPPFHVAGSFIMSDLTRSKISDVDYGWGKPVFGGPAHGGAGDVPGVIT  336
             M+S+ DLMV+KGRP F V  S++MSD+TR+   +VD+GWGK  +GGPA GG G +PGV +
Sbjct  346   MRSLADLMVIKGRPHFTVVNSYLMSDVTRAGFGEVDFGWGKAAYGGPAKGGVGAIPGVAS  405

Query  335   FHVPYENKKGENGTLIPICLPAFALDKFVNELANTFLRA  219
             F++P+ + +GE+G ++PICLPA A++ FV EL +T L A
Sbjct  406   FYIPFRDNRGEDGIVVPICLPAAAMEIFVKEL-DTMLNA  443



>ref|XP_003518844.1| PREDICTED: benzyl alcohol O-benzoyltransferase [Glycine max]
Length=459

 Score =   516 bits (1330),  Expect = 7e-177, Method: Compositional matrix adjust.
 Identities = 240/392 (61%), Positives = 312/392 (80%), Gaps = 5/392 (1%)
 Frame = -1

Query  1415  FYRNEPSMSGKDPVQVIRQALAKALVFFYPFAGRLREGPGRKLMVDCTGEGVMFIEADAD  1236
             FYR++PSM+GKDPV VIR+A+AK LVF+YPFAGRLREG GRKLMVDCTGEGV+FIEADAD
Sbjct  48    FYRHDPSMAGKDPVDVIRKAVAKTLVFYYPFAGRLREGLGRKLMVDCTGEGVLFIEADAD  107

Query  1235  ATLQHFAIGGELKPPFPCFDQLLYNVPGSAEILNSPLFLIQVTRLRCGGFIFTLRMNHTM  1056
              TL+ F  G  L+PPFPC+++LLY+VPGS  +LN+PL LIQVTRL+CGGFI  +R+NHTM
Sbjct  108   VTLKQF--GDALQPPFPCWEELLYDVPGSQGVLNTPLLLIQVTRLKCGGFILAVRLNHTM  165

Query  1055  ADASGLVHFLNTIAEIARGAEAPAVQPVWQREFFSARNPPRITCTHFEYEEEPAADSMVT  876
             +DA+GLV F++ + EIARG + P++ PVW+RE  +AR+PPR+TCTH EYE  P  D+  T
Sbjct  166   SDAAGLVQFMSALGEIARGRQEPSIPPVWRRELLNARDPPRVTCTHREYEHVP--DTKGT  223

Query  875   NIPLDNLVHRSFLFGPTEISVLRSSLPPHLRKCSTVEILTALVWRCRTIALGFHPDEEVR  696
              IPLD++ HRSF FGP+E++ +RS +P   ++CS  E+LTA +WRCRTIAL    DEEVR
Sbjct  224   IIPLDHMAHRSFFFGPSEVAAIRSLIPQTDQRCSNFEVLTACLWRCRTIALQPDKDEEVR  283

Query  695   MLLLINARFKFKDTPMPSGYTGNAFAYPGAKTTAGKLRKNPLGYAVELVTSIKRCFSEEY  516
             +L ++NAR KF D P+PSGY GNAFA+P A TTAGKL  NPLGYA+ELV   K   +EEY
Sbjct  284   ILCIVNARSKF-DPPLPSGYYGNAFAFPVAVTTAGKLCDNPLGYALELVRKAKADVTEEY  342

Query  515   MQSMVDLMVLKGRPPFHVAGSFIMSDLTRSKISDVDYGWGKPVFGGPAHGGAGDVPGVIT  336
             M S+ DLMV KGRP F V  S+++SD+TR+   ++++GWGK V+GGPA GG G +PGV +
Sbjct  343   MHSVADLMVTKGRPHFTVVRSYLVSDVTRAGFGNIEFGWGKAVYGGPAKGGVGAIPGVAS  402

Query  335   FHVPYENKKGENGTLIPICLPAFALDKFVNEL  240
             F++P++N KGE G +IP+CLP+ A+++F  EL
Sbjct  403   FYIPFKNAKGEEGLVIPVCLPSEAMERFQKEL  434



>gb|AAW51125.1| putative alcohol acyl-transferases [Cucumis melo]
Length=459

 Score =   516 bits (1329),  Expect = 9e-177, Method: Compositional matrix adjust.
 Identities = 239/399 (60%), Positives = 320/399 (80%), Gaps = 6/399 (2%)
 Frame = -1

Query  1415  FYRNEPSMSGKDPVQVIRQALAKALVFFYPFAGRLREGPGRKLMVDCTGEGVMFIEADAD  1236
             FYR++P M+G DP +VI++A+AKALVF+YPFAGRLREGPGRKL V+CTGEGVMFIEADAD
Sbjct  48    FYRHDPRMAGTDPARVIKEAIAKALVFYYPFAGRLREGPGRKLFVECTGEGVMFIEADAD  107

Query  1235  ATLQHFAIGGELKPPFPCFDQLLYNVPGSAEILNSPLFLIQVTRLRCGGFIFTLRMNHTM  1056
              +L+ F  G  L+PPFPC ++ L++VP S+ +L+ PL LIQVTRL+CGGFIF LR+NHTM
Sbjct  108   VSLEQF--GDALQPPFPCLEEPLFDVPNSSGVLDCPLLLIQVTRLKCGGFIFALRLNHTM  165

Query  1055  ADASGLVHFLNTIAEIARGAEAPAVQPVWQREFFSARNPPRITCTHFEYEEEPAADSMVT  876
             +DASGLV F+  + E+ARGA AP+V+PVWQR   +AR+PP++TC H EY+E    D+  T
Sbjct  166   SDASGLVQFMMAVGEMARGATAPSVRPVWQRALLNARDPPKVTCHHREYDE--VVDTKGT  223

Query  875   NIPLDNLVHRSFLFGPTEISVLRSSLPPHLRKCSTVEILTALVWRCRTIALGFHPDEEVR  696
              IPLD++ HRSF FGP+EIS +R +LP HLR+CS+ E+LTA +WR RTI+L   P+EEVR
Sbjct  224   IIPLDDMAHRSFFFGPSEISAIRKALPSHLRQCSSFEVLTACLWRFRTISLQPDPEEEVR  283

Query  695   MLLLINARFKFKDTPMPSGYTGNAFAYPGAKTTAGKLRKNPLGYAVELVTSIKRCFSEEY  516
             +L ++N+R KF + P+P+GY GNAFA+P A TTAGKL +NPLGYA+ELV   K   +E+Y
Sbjct  284   VLCIVNSRSKF-NPPLPTGYYGNAFAFPVALTTAGKLCQNPLGYALELVRKAKADVTEDY  342

Query  515   MQSMVDLMVLKGRPPFHVAGSFIMSDLTRSKISDVDYGWGKPVFGGPAHGGAGDVPGVIT  336
             M+S+ DLMV+KGRP F V  ++++SD+TR+   DVD+GWGK ++GGPA GG G +PGV +
Sbjct  343   MKSVADLMVIKGRPHFTVVRTYLVSDVTRAGFEDVDFGWGKAMYGGPAKGGVGAIPGVAS  402

Query  335   FHVPYENKKGENGTLIPICLPAFALDKFVNELANTFLRA  219
             F++P++NKKGE G L+P+CLPA A+++FV EL +  L+A
Sbjct  403   FYIPFKNKKGERGILVPLCLPAPAMERFVKEL-DALLKA  440



>ref|XP_010275172.1| PREDICTED: benzyl alcohol O-benzoyltransferase [Nelumbo nucifera]
Length=459

 Score =   515 bits (1327),  Expect = 2e-176, Method: Compositional matrix adjust.
 Identities = 240/394 (61%), Positives = 308/394 (78%), Gaps = 5/394 (1%)
 Frame = -1

Query  1415  FYRNEPSMSGKDPVQVIRQALAKALVFFYPFAGRLREGPGRKLMVDCTGEGVMFIEADAD  1236
             FYR +PSM G++P Q IRQA+AKALVF+YPFAGRLREGP RKL V+CTGEGVMFIEADAD
Sbjct  50    FYRYDPSMEGRNPTQAIRQAIAKALVFYYPFAGRLREGPHRKLTVECTGEGVMFIEADAD  109

Query  1235  ATLQHFAIGGELKPPFPCFDQLLYNVPGSAEILNSPLFLIQVTRLRCGGFIFTLRMNHTM  1056
               L+ F  G  L+PPFPC ++LL++VPGS  +LN PL LIQVTRL CGGFIF LR+NHTM
Sbjct  110   VRLEQF--GDALQPPFPCLEELLFDVPGSGGVLNCPLLLIQVTRLMCGGFIFALRLNHTM  167

Query  1055  ADASGLVHFLNTIAEIARGAEAPAVQPVWQREFFSARNPPRITCTHFEYEEEPAADSMVT  876
             +DA+GLV F+N + E+ARGA AP+V PVWQRE  +ARNPP ++C H EY+E    D+  T
Sbjct  168   SDAAGLVQFMNAVGEMARGAHAPSVPPVWQRELLNARNPPHVSCVHREYDE--VVDTRGT  225

Query  875   NIPLDNLVHRSFLFGPTEISVLRSSLPPHLRKCSTVEILTALVWRCRTIALGFHPDEEVR  696
              IPLD++VHRSF FGPTEI  LR  +PPHLRK ST E+LTA +WRCRT+A+    DE VR
Sbjct  226   IIPLDDMVHRSFFFGPTEILALRRHVPPHLRKSSTFEVLTACLWRCRTVAIQPDSDEVVR  285

Query  695   MLLLINARFKFKDTPMPSGYTGNAFAYPGAKTTAGKLRKNPLGYAVELVTSIKRCFSEEY  516
             M+ ++NAR +F+  P+P+GY GNAFA+P A +TAGKL +NP GYA+ LV   K   ++EY
Sbjct  286   MICIVNARDRFQ-PPLPAGYYGNAFAFPVALSTAGKLCQNPFGYALGLVKKAKSDVTDEY  344

Query  515   MQSMVDLMVLKGRPPFHVAGSFIMSDLTRSKISDVDYGWGKPVFGGPAHGGAGDVPGVIT  336
             M+S+ DLMV +GRP F V  S+++SD+TR+  +DVD+GWGKP +GGPA GG G +PGV +
Sbjct  345   MRSLADLMVTRGRPHFTVVRSYLVSDVTRAGFADVDFGWGKPAYGGPAKGGVGAIPGVAS  404

Query  335   FHVPYENKKGENGTLIPICLPAFALDKFVNELAN  234
             F++P+ N KGE+G ++PICLP  A+++FV EL +
Sbjct  405   FYIPFRNSKGEDGIVLPICLPGPAMERFVWELQS  438



>gb|KDP39568.1| hypothetical protein JCGZ_02588 [Jatropha curcas]
Length=459

 Score =   515 bits (1326),  Expect = 2e-176, Method: Compositional matrix adjust.
 Identities = 237/405 (59%), Positives = 313/405 (77%), Gaps = 5/405 (1%)
 Frame = -1

Query  1415  FYRNEPSMSGKDPVQVIRQALAKALVFFYPFAGRLREGPGRKLMVDCTGEGVMFIEADAD  1236
             FYR +PSM GKDPV+VIR+A+ K LVF+YPFAGRLREGP RKLMV+CTGEGV+FIEADAD
Sbjct  51    FYRYDPSMKGKDPVKVIREAIGKTLVFYYPFAGRLREGPERKLMVECTGEGVLFIEADAD  110

Query  1235  ATLQHFAIGGELKPPFPCFDQLLYNVPGSAEILNSPLFLIQVTRLRCGGFIFTLRMNHTM  1056
              +L+ F  G  L+PPFPC + LL++VPGS  +LNS L LIQVTRL CGGFIF LR+NHTM
Sbjct  111   VSLEDF--GDALQPPFPCLEDLLFDVPGSTSVLNSALLLIQVTRLSCGGFIFALRLNHTM  168

Query  1055  ADASGLVHFLNTIAEIARGAEAPAVQPVWQREFFSARNPPRITCTHFEYEEEPAADSMVT  876
             +DA GLV F++ + EIARGA+AP+V PVW+R   +ARNPPR+TCTH EY+E   AD+  T
Sbjct  169   SDAPGLVQFMSAVGEIARGAQAPSVLPVWERHLLNARNPPRVTCTHREYDE--VADTKGT  226

Query  875   NIPLDNLVHRSFLFGPTEISVLRSSLPPHLRKCSTVEILTALVWRCRTIALGFHPDEEVR  696
              +PLD++ H+SF FGP+EIS LRS +PPHL  CST E+LTA +W+CRTIAL   P+EE+R
Sbjct  227   IVPLDDMAHQSFFFGPSEISALRSLVPPHLSNCSTFELLTACLWKCRTIALQPEPEEEMR  286

Query  695   MLLLINARFKFKDTPMPSGYTGNAFAYPGAKTTAGKLRKNPLGYAVELVTSIKRCFSEEY  516
             M+ ++N R +F + P+P+GY GN F +P A  TAG+L + PLG+A+EL+  +KR  +EEY
Sbjct  287   MICIVNGRARF-NPPLPTGYYGNGFVFPVAVATAGELAQKPLGFALELIREVKRSVNEEY  345

Query  515   MQSMVDLMVLKGRPPFHVAGSFIMSDLTRSKISDVDYGWGKPVFGGPAHGGAGDVPGVIT  336
             M+S+ DLMV+KGRP F V  S+++SD+T +   +VD+GWGK  +GGPA GG G +PGV +
Sbjct  346   MRSVADLMVVKGRPHFTVVRSYLVSDVTHAGFGEVDFGWGKAAYGGPAKGGVGAIPGVAS  405

Query  335   FHVPYENKKGENGTLIPICLPAFALDKFVNELANTFLRAAL*MST  201
             F++P +N+KGENG ++PI LPA A++ F+ EL       A+  +T
Sbjct  406   FYIPSKNEKGENGIVLPIVLPAQAMEIFIKELKGMLQNQAISSAT  450



>ref|XP_009372579.1| PREDICTED: benzyl alcohol O-benzoyltransferase-like [Pyrus x 
bretschneideri]
Length=461

 Score =   514 bits (1325),  Expect = 4e-176, Method: Compositional matrix adjust.
 Identities = 240/392 (61%), Positives = 305/392 (78%), Gaps = 5/392 (1%)
 Frame = -1

Query  1415  FYRNEPSMSGKDPVQVIRQALAKALVFFYPFAGRLREGPGRKLMVDCTGEGVMFIEADAD  1236
             FY+ +PSM G+DPV V+R+A+A+ LVF+YPFAGRLREGP RKL V+CT EGVMFIEADAD
Sbjct  51    FYKYDPSMQGRDPVHVLREAIAQTLVFYYPFAGRLREGPDRKLTVECTAEGVMFIEADAD  110

Query  1235  ATLQHFAIGGELKPPFPCFDQLLYNVPGSAEILNSPLFLIQVTRLRCGGFIFTLRMNHTM  1056
              TL+ F  G  L+PPFPC ++LLYNVPGS  +LN PL LIQVTRL+CGGFI  LR+NHTM
Sbjct  111   VTLEQF--GDALQPPFPCLEELLYNVPGSDGVLNCPLLLIQVTRLQCGGFIVALRLNHTM  168

Query  1055  ADASGLVHFLNTIAEIARGAEAPAVQPVWQREFFSARNPPRITCTHFEYEEEPAADSMVT  876
             +DA+GLV F+  + EIARGA +P VQPVWQR   +AR PPR+TCTH EYEE    D+  T
Sbjct  169   SDAAGLVQFMTALGEIARGAVSPTVQPVWQRALLNARYPPRVTCTHREYEE--VEDTKGT  226

Query  875   NIPLDNLVHRSFLFGPTEISVLRSSLPPHLRKCSTVEILTALVWRCRTIALGFHPDEEVR  696
              IPLD++VHRSF F PTE+S +R  +P  L KCST E+LTA +WRCRTIAL   P+EEVR
Sbjct  227   IIPLDDMVHRSFFFRPTEVSAIRRFVPQFLSKCSTFEVLTACLWRCRTIALQKDPNEEVR  286

Query  695   MLLLINARFKFKDTPMPSGYTGNAFAYPGAKTTAGKLRKNPLGYAVELVTSIKRCFSEEY  516
             +L ++N+R KF + P+P GY GNAFA+P A TTAG+L  NPLGYA+ELV   K   +EEY
Sbjct  287   VLCIVNSRSKF-NPPLPVGYYGNAFAFPVAVTTAGRLCNNPLGYALELVRKAKADVTEEY  345

Query  515   MQSMVDLMVLKGRPPFHVAGSFIMSDLTRSKISDVDYGWGKPVFGGPAHGGAGDVPGVIT  336
             M+S+ DLMV+KGRP F V  S+++SD+TR+   +VD+GWGK  +GGPA GG G +PGV +
Sbjct  346   MRSLADLMVIKGRPHFTVVNSYLVSDVTRAGFGEVDFGWGKAAYGGPAKGGVGAIPGVAS  405

Query  335   FHVPYENKKGENGTLIPICLPAFALDKFVNEL  240
             F++P+ + +GE+G ++PICLPA A++ FV EL
Sbjct  406   FYIPFRDNRGEDGIVVPICLPAAAMEIFVKEL  437



>ref|XP_004151058.1| PREDICTED: benzyl alcohol O-benzoyltransferase-like [Cucumis 
sativus]
 ref|XP_004164522.1| PREDICTED: benzyl alcohol O-benzoyltransferase-like [Cucumis 
sativus]
 gb|KGN63337.1| hypothetical protein Csa_2G431070 [Cucumis sativus]
Length=459

 Score =   512 bits (1318),  Expect = 4e-175, Method: Compositional matrix adjust.
 Identities = 236/399 (59%), Positives = 318/399 (80%), Gaps = 6/399 (2%)
 Frame = -1

Query  1415  FYRNEPSMSGKDPVQVIRQALAKALVFFYPFAGRLREGPGRKLMVDCTGEGVMFIEADAD  1236
             FYR++P M+G DP +VI++A+AKALVF+YPFAGRLREGPGRKL V+CTGEGV+F EADAD
Sbjct  48    FYRHDPRMAGTDPARVIKEAIAKALVFYYPFAGRLREGPGRKLFVECTGEGVLFTEADAD  107

Query  1235  ATLQHFAIGGELKPPFPCFDQLLYNVPGSAEILNSPLFLIQVTRLRCGGFIFTLRMNHTM  1056
              +L+ F  G  L+PPFPC ++LL++VP S+ +L+ PL LIQVTRL+CGGFI  LR+NHTM
Sbjct  108   VSLEQF--GDALQPPFPCLEELLFDVPNSSGVLDCPLLLIQVTRLKCGGFILALRLNHTM  165

Query  1055  ADASGLVHFLNTIAEIARGAEAPAVQPVWQREFFSARNPPRITCTHFEYEEEPAADSMVT  876
             +DASGLV F+  + E+ARGA AP+V+PVWQR   +AR+PP++TC H EY+E    D+  T
Sbjct  166   SDASGLVQFMMAVGEMARGATAPSVRPVWQRALLNARDPPKVTCHHREYDE--VVDTKGT  223

Query  875   NIPLDNLVHRSFLFGPTEISVLRSSLPPHLRKCSTVEILTALVWRCRTIALGFHPDEEVR  696
              IPLD++ HRSF FGP+EI+ +R++LP HLR+CS+ E+LTA +WR RTI+L   P+EEVR
Sbjct  224   IIPLDDMAHRSFFFGPSEIAAIRNALPSHLRQCSSFEVLTACLWRFRTISLQPDPEEEVR  283

Query  695   MLLLINARFKFKDTPMPSGYTGNAFAYPGAKTTAGKLRKNPLGYAVELVTSIKRCFSEEY  516
             +L ++N+R KF + P+P+GY GNAFA+P A TTAGKL +NPLGYA+ELV   K   +EEY
Sbjct  284   VLCIVNSRSKF-NPPLPTGYYGNAFAFPVALTTAGKLCQNPLGYALELVRKAKADVTEEY  342

Query  515   MQSMVDLMVLKGRPPFHVAGSFIMSDLTRSKISDVDYGWGKPVFGGPAHGGAGDVPGVIT  336
             M+S+ DLM++KGRP F V  S+++SD+TR+   DVD+GWGK  +GGPA GG G +PGV +
Sbjct  343   MKSVADLMMIKGRPHFTVVRSYLVSDVTRAGFEDVDFGWGKATYGGPAKGGVGAIPGVAS  402

Query  335   FHVPYENKKGENGTLIPICLPAFALDKFVNELANTFLRA  219
             F++P++NKK E G L+P+CLPA A+++FV EL +  L+A
Sbjct  403   FYIPFKNKKEERGILVPLCLPAPAMERFVKEL-DALLKA  440



>ref|XP_006484694.1| PREDICTED: benzyl alcohol O-benzoyltransferase-like [Citrus sinensis]
Length=458

 Score =   511 bits (1316),  Expect = 7e-175, Method: Compositional matrix adjust.
 Identities = 239/396 (60%), Positives = 309/396 (78%), Gaps = 5/396 (1%)
 Frame = -1

Query  1415  FYRNEPSMSGKDPVQVIRQALAKALVFFYPFAGRLREGPGRKLMVDCTGEGVMFIEADAD  1236
             FY+  P ++GKDPV+VIR+A+A+ LV +YPFAGRLREGP RKLMVDCTGEGV+FIEADAD
Sbjct  48    FYKYNPFVNGKDPVKVIREAIAQTLVSYYPFAGRLREGPNRKLMVDCTGEGVLFIEADAD  107

Query  1235  ATLQHFAIGGELKPPFPCFDQLLYNVPGSAEILNSPLFLIQVTRLRCGGFIFTLRMNHTM  1056
              TL+ F  G  L+PPFP  ++LL++VPGSA +LN PL LIQVTRL+CGGFIF LR+NHTM
Sbjct  108   VTLEQF--GDALQPPFPGLEELLFDVPGSAGVLNCPLLLIQVTRLKCGGFIFALRLNHTM  165

Query  1055  ADASGLVHFLNTIAEIARGAEAPAVQPVWQREFFSARNPPRITCTHFEYEEEPAADSMVT  876
              DA+GLV F++ + E+ARG  AP V PVW+R   +AR+PPR+TCTH EY+E   AD+  T
Sbjct  166   GDAAGLVQFMSAVGELARGLRAPTVPPVWERHVLNARDPPRVTCTHHEYDE--VADTKNT  223

Query  875   NIPLDNLVHRSFLFGPTEISVLRSSLPPHLRKCSTVEILTALVWRCRTIALGFHPDEEVR  696
              IPLD++ HRSF FGP E+S +R  LP HLR+CS  EILTA ++RCRTIAL   P+EE+R
Sbjct  224   IIPLDDMSHRSFFFGPQEVSAIRRILPQHLRRCSAFEILTACLFRCRTIALQPDPNEEMR  283

Query  695   MLLLINARFKFKDTPMPSGYTGNAFAYPGAKTTAGKLRKNPLGYAVELVTSIKRCFSEEY  516
             ++ ++NAR K  + P+P+GY GN FA+P A TTA KL KNPLG+A+ELV   K   ++EY
Sbjct  284   IICIVNARSKI-NPPLPAGYYGNGFAFPVAITTAEKLSKNPLGFALELVRKAKNDVNDEY  342

Query  515   MQSMVDLMVLKGRPPFHVAGSFIMSDLTRSKISDVDYGWGKPVFGGPAHGGAGDVPGVIT  336
             M+S+ DLMV+KGRP F V  S+++SD+TR+   DVD+GWGKPV+GGPA GG G +PGV +
Sbjct  343   MRSLADLMVIKGRPHFAVVRSYLVSDVTRAGFGDVDFGWGKPVYGGPAKGGVGAIPGVAS  402

Query  335   FHVPYENKKGENGTLIPICLPAFALDKFVNELANTF  228
             F++P+ NKKGE G ++P+CLPA A+ +FV EL  T 
Sbjct  403   FYIPFRNKKGEEGIVVPVCLPAPAMARFVEELEKTL  438



>ref|XP_006437408.1| hypothetical protein CICLE_v10031489mg [Citrus clementina]
 gb|ESR50648.1| hypothetical protein CICLE_v10031489mg [Citrus clementina]
Length=458

 Score =   511 bits (1315),  Expect = 9e-175, Method: Compositional matrix adjust.
 Identities = 239/396 (60%), Positives = 309/396 (78%), Gaps = 5/396 (1%)
 Frame = -1

Query  1415  FYRNEPSMSGKDPVQVIRQALAKALVFFYPFAGRLREGPGRKLMVDCTGEGVMFIEADAD  1236
             FY+  P ++GKDPV+VIR+A+A+ LV +YPFAGRLREGP RKLMVDCTGEGV+FIEADAD
Sbjct  48    FYKYNPFVNGKDPVKVIREAVAQTLVSYYPFAGRLREGPNRKLMVDCTGEGVLFIEADAD  107

Query  1235  ATLQHFAIGGELKPPFPCFDQLLYNVPGSAEILNSPLFLIQVTRLRCGGFIFTLRMNHTM  1056
              TL+ F  G  L+PPFP  ++LL++VPGSA +LN PL LIQVTRL+CGGFIF LR+NHTM
Sbjct  108   VTLEQF--GDALQPPFPGLEELLFDVPGSAGVLNCPLLLIQVTRLKCGGFIFALRLNHTM  165

Query  1055  ADASGLVHFLNTIAEIARGAEAPAVQPVWQREFFSARNPPRITCTHFEYEEEPAADSMVT  876
              DA+GLV F++ + E+ARG  AP V PVW+R   +AR+PPR+TCTH EY+E   AD+  T
Sbjct  166   GDAAGLVQFMSAVGELARGLRAPTVPPVWERHVLNARDPPRVTCTHHEYDE--VADTKNT  223

Query  875   NIPLDNLVHRSFLFGPTEISVLRSSLPPHLRKCSTVEILTALVWRCRTIALGFHPDEEVR  696
              IPLD++ HRSF FGP E+S +R  LP HLR+CS  EILTA ++RCRTIAL   P+EE+R
Sbjct  224   IIPLDDMSHRSFFFGPQEVSAIRRILPQHLRRCSAFEILTACLFRCRTIALQPDPNEEMR  283

Query  695   MLLLINARFKFKDTPMPSGYTGNAFAYPGAKTTAGKLRKNPLGYAVELVTSIKRCFSEEY  516
             ++ ++NAR K  + P+P+GY GN FA+P A TTA KL KNPLG+A+ELV   K   ++EY
Sbjct  284   IICIVNARSKI-NPPLPAGYYGNGFAFPVAITTAEKLSKNPLGFALELVRKAKNDVNDEY  342

Query  515   MQSMVDLMVLKGRPPFHVAGSFIMSDLTRSKISDVDYGWGKPVFGGPAHGGAGDVPGVIT  336
             M+S+ DLMV+KGRP F V  S+++SD+TR+   DVD+GWGKPV+GGPA GG G +PGV +
Sbjct  343   MRSLADLMVIKGRPHFAVVRSYLVSDVTRAGFGDVDFGWGKPVYGGPAKGGVGAIPGVAS  402

Query  335   FHVPYENKKGENGTLIPICLPAFALDKFVNELANTF  228
             F++P+ NKKGE G ++P+CLPA A+ +FV EL  T 
Sbjct  403   FYIPFRNKKGEEGIVVPVCLPAPAMARFVEELEKTL  438



>ref|XP_003536235.1| PREDICTED: benzyl alcohol O-benzoyltransferase-like [Glycine 
max]
Length=454

 Score =   509 bits (1311),  Expect = 4e-174, Method: Compositional matrix adjust.
 Identities = 244/399 (61%), Positives = 314/399 (79%), Gaps = 9/399 (2%)
 Frame = -1

Query  1415  FYRNEPSMSGKDPVQVIRQALAKALVFFYPFAGRLREGPGRKLMVDCTGE-GVMFIEADA  1239
              YR++PSM+GKDPV+VIR+ALA+ LVF+YPFAGRLREG  RKLMVDCTGE GV+FIEADA
Sbjct  48    IYRHDPSMAGKDPVEVIRKALARTLVFYYPFAGRLREGRDRKLMVDCTGELGVLFIEADA  107

Query  1238  DATLQHFAIGGELKPPFPCFDQLLYNVPGSAEILNSPLFLIQVTRLRCGGFIFTLRMNHT  1059
             D TL+HF  G  L+PPFPC+++LLY+VPGS  +LN+PL LIQVTRL+CGGFI TLR+NHT
Sbjct  108   DVTLKHF--GDALQPPFPCWEELLYDVPGSQGVLNTPLLLIQVTRLKCGGFILTLRLNHT  165

Query  1058  MADASGLVHFLNTIAEIARGAEAPAVQPVWQREFFSARNPPRITCTHFEYEEEPAADSMV  879
             M+DA+GLV F++ + EIARG   P+V PVW+RE  +AR+PPR+TCTH EYE+ P  D+  
Sbjct  166   MSDAAGLVQFMSALGEIARGRHEPSVPPVWRRELLNARDPPRVTCTHREYEQVP--DTKG  223

Query  878   TNIPLDNLVHRSFLFGPTEISVLRSSLPPHLRKCST--VEILTALVWRCRTIALGFHPDE  705
             T IPLD++ HRSF FGP+E+S +R  L P   +CS+   E+LTA +WRCRTIAL    DE
Sbjct  224   TIIPLDDMAHRSFFFGPSEVSAIRR-LIPRADQCSSSNFEVLTACLWRCRTIALQPDKDE  282

Query  704   EVRMLLLINARFKFKDTPMPSGYTGNAFAYPGAKTTAGKLRKNPLGYAVELVTSIKRCFS  525
             EVR+L ++NAR KF D P+PSGY GNAFA+P A TTAGKL +NPLGYAVELV   K   +
Sbjct  283   EVRILCIVNARAKF-DPPLPSGYYGNAFAFPAAVTTAGKLCENPLGYAVELVRKAKADVT  341

Query  524   EEYMQSMVDLMVLKGRPPFHVAGSFIMSDLTRSKISDVDYGWGKPVFGGPAHGGAGDVPG  345
             EEYM S+ +LMV KGRP F V  S+++SD+TR+   +V++GWGK V+GGPA GG G +PG
Sbjct  342   EEYMHSVANLMVAKGRPHFTVVRSYVVSDVTRAGFGNVEFGWGKAVYGGPAKGGVGAIPG  401

Query  344   VITFHVPYENKKGENGTLIPICLPAFALDKFVNELANTF  228
             V +F++P++N KGE G +IP+CLP+ A+++F  EL +  
Sbjct  402   VASFYIPFKNAKGEEGLVIPVCLPSEAMERFQKELNSVL  440



>gb|KHF99421.1| Benzyl alcohol O-benzoyltransferase [Gossypium arboreum]
Length=454

 Score =   509 bits (1311),  Expect = 4e-174, Method: Compositional matrix adjust.
 Identities = 238/392 (61%), Positives = 305/392 (78%), Gaps = 8/392 (2%)
 Frame = -1

Query  1415  FYRNEPSMSGKDPVQVIRQALAKALVFFYPFAGRLREGPGRKLMVDCTGEGVMFIEADAD  1236
             FY+  PSM GKDPV+VIR+ALA+ALVF+YPFAGRLREGP RKLMVDCTGEG+MFIEADAD
Sbjct  51    FYKYNPSMQGKDPVRVIREALAQALVFYYPFAGRLREGPQRKLMVDCTGEGLMFIEADAD  110

Query  1235  ATLQHFAIGGELKPPFPCFDQLLYNVPGSAEILNSPLFLIQVTRLRCGGFIFTLRMNHTM  1056
              TL+ F  G  L+PPFPC ++LLY+VPGS  +LN P+ LIQVTRLRCGGFIF LR+NHTM
Sbjct  111   VTLEQF--GDVLQPPFPCLEELLYDVPGSTGVLNCPVILIQVTRLRCGGFIFALRLNHTM  168

Query  1055  ADASGLVHFLNTIAEIARGAEAPAVQPVWQREFFSARNPPRITCTHFEYEEEPAADSMVT  876
             +DA+GL  F++ + E+ARG   P++ PVW+R   +AR+PPR+TC H EYEE        T
Sbjct  169   SDAAGLAQFMSAVGEMARGWLTPSIPPVWERHLLAARDPPRVTCKHREYEEVEG-----T  223

Query  875   NIPLDNLVHRSFLFGPTEISVLRSSLPPHLRKCSTVEILTALVWRCRTIALGFHPDEEVR  696
              +P D++VHRSF FGPTE+S LR  +P HLRKCST E+LTA +WRCRTIA+  +P+EEVR
Sbjct  224   IVPYDDMVHRSFFFGPTEVSALRKLVPEHLRKCSTFELLTACLWRCRTIAIQANPEEEVR  283

Query  695   MLLLINARFKFKDTPMPSGYTGNAFAYPGAKTTAGKLRKNPLGYAVELVTSIKRCFSEEY  516
             ++ ++NAR +F + P+PSGY GNAFA+P A   AGKL +NPL Y++ELV   K   +EEY
Sbjct  284   IICIVNARSRF-NPPLPSGYYGNAFAFPVAVAQAGKLCQNPLEYSLELVKQAKNDVTEEY  342

Query  515   MQSMVDLMVLKGRPPFHVAGSFIMSDLTRSKISDVDYGWGKPVFGGPAHGGAGDVPGVIT  336
             M+S+ DLMV+KGRP F V  S+++SD+T ++  D D+GWGK V+GGPA GG G +PGV +
Sbjct  343   MKSLADLMVIKGRPHFTVIRSYLVSDVTHARFGDADFGWGKAVYGGPAKGGVGAIPGVAS  402

Query  335   FHVPYENKKGENGTLIPICLPAFALDKFVNEL  240
             F +P +NKKGE G ++PI LPA A++ FV EL
Sbjct  403   FLIPVKNKKGEAGVVLPITLPARAMEIFVKEL  434



>emb|CDP18599.1| unnamed protein product [Coffea canephora]
Length=460

 Score =   509 bits (1310),  Expect = 6e-174, Method: Compositional matrix adjust.
 Identities = 242/395 (61%), Positives = 312/395 (79%), Gaps = 8/395 (2%)
 Frame = -1

Query  1415  FYRNEPSM--SGKDPVQVIRQALAKALVFFYPFAGRLREGPGRKLMVDCTGEGVMFIEAD  1242
             FYR++     S +DPV+VIR+A+AKALV +YPFAGRLRE  GRKL+ DCTGEGVMFIEAD
Sbjct  49    FYRSDDDHLHSRRDPVKVIREAIAKALVSYYPFAGRLRECAGRKLVADCTGEGVMFIEAD  108

Query  1241  ADATLQHFAIGGELKPPFPCFDQLLYNVPGSAEILNSPLFLIQVTRLRCGGFIFTLRMNH  1062
             A+ TL+ F  G EL+PPFPC ++LLY+VP SA +L+SPL LIQVTRLRCGGFIF +R+NH
Sbjct  109   AEVTLEQF--GEELQPPFPCLEELLYDVPESAGVLHSPLLLIQVTRLRCGGFIFAVRLNH  166

Query  1061  TMADASGLVHFLNTIAEIARGAEAPAVQPVWQREFFSARNPPRITCTHFEYEEEPAADSM  882
             T+AD +GLV F+N + EIARGA AP+V PVWQRE  +AR+PPR+TC H EY+E P  D+ 
Sbjct  167   TIADGTGLVQFMNAVGEIARGASAPSVLPVWQRERLNARDPPRVTCIHHEYDEVP--DTK  224

Query  881   VTNIPLDNLVHRSFLFGPTEISVLRSSLPPHL-RKCSTVEILTALVWRCRTIALGFHPDE  705
              T IPLD++VHRSF FGPTE+S LR S+P  + RKCST E+LTA +WRCRTIAL   P+E
Sbjct  225   GTIIPLDDMVHRSFFFGPTEVSALRKSIPLDISRKCSTFEVLTACLWRCRTIALQPEPNE  284

Query  704   EVRMLLLINARFKFKDTPMPSGYTGNAFAYPGAKTTAGKLRKNPLGYAVELVTSIKRCFS  525
             EVR++ ++NAR KF D P+P GY GN FA+P A TTAG+L K PLGYA+ELVT  K   +
Sbjct  285   EVRVICVVNARSKF-DPPLPQGYYGNGFAFPVALTTAGELCKRPLGYALELVTKAKGDVT  343

Query  524   EEYMQSMVDLMVLKGRPPFHVAGSFIMSDLTRSKISDVDYGWGKPVFGGPAHGGAGDVPG  345
             E+YM+S+ DLMV+KGRP F    ++++SD+TR   ++VD+GWG+P +GGPA GG G +PG
Sbjct  344   EDYMKSVADLMVIKGRPHFTAVRTYVVSDVTRIGFNEVDFGWGRPEYGGPAKGGVGAIPG  403

Query  344   VITFHVPYENKKGENGTLIPICLPAFALDKFVNEL  240
             +++F++P  N+ GE G ++PICLP FA+D+FV EL
Sbjct  404   LLSFYIPVTNRNGEKGRVVPICLPGFAMDRFVREL  438



>ref|XP_011085895.1| PREDICTED: LOW QUALITY PROTEIN: benzyl alcohol O-benzoyltransferase-like 
[Sesamum indicum]
Length=466

 Score =   506 bits (1302),  Expect = 1e-172, Method: Compositional matrix adjust.
 Identities = 237/401 (59%), Positives = 305/401 (76%), Gaps = 6/401 (1%)
 Frame = -1

Query  1415  FYRNEPSMSGKDPVQVIRQALAKALVFFYPFAGRLREGPGRKLMVDCTGEGVMFIEADAD  1236
             FYR  P+M+ KDPV VIR ALA+ALVF+YPFAGRLRE  GRKL+V+CTGEGV+FIEADAD
Sbjct  50    FYRRNPAMNRKDPVMVIRDALARALVFYYPFAGRLREAAGRKLVVECTGEGVLFIEADAD  109

Query  1235  ATLQHFAIGGE---LKPPFPCFDQLLYNVPGSAEILNSPLFLIQVTRLRCGGFIFTLRMN  1065
              TLQ F        L+PPFPC ++LLY+VP SA ++N PL LIQVTRLRCGGFIF LR+N
Sbjct  110   VTLQQFGDASSAVPLQPPFPCLEELLYDVPESAGVVNCPLLLIQVTRLRCGGFIFALRLN  169

Query  1064  HTMADASGLVHFLNTIAEIARGAEAPAVQPVWQREFFSARNPPRITCTHFEYEEEPAADS  885
             HTM+DA+GLV F+  + E+AR AE P+V PVWQR+  +AR+PPR++CT  EY++ P  D+
Sbjct  170   HTMSDAAGLVQFMAAVGELARAAEMPSVLPVWQRDLLNARDPPRVSCTLHEYDDVP--DT  227

Query  884   MVTNIPLDNLVHRSFLFGPTEISVLRSSLPPHLRKCSTVEILTALVWRCRTIALGFHPDE  705
               T IPLD++VHRSF FG  EIS LR  LP HLR CST EILTA +WRCRTIA+   P+E
Sbjct  228   RGTLIPLDDMVHRSFFFGTAEISALRRRLPSHLRSCSTFEILTACLWRCRTIAISPDPNE  287

Query  704   EVRMLLLINARFKFKDTPMPSGYTGNAFAYPGAKTTAGKLRKNPLGYAVELVTSIKRCFS  525
             EVR+L ++N+R +F + P+P+GY GNAFA+  A ++A KL +NPLGYA+ELV   K   +
Sbjct  288   EVRILCIVNSRKRF-NPPLPAGYYGNAFAFAVAISSAEKLSRNPLGYALELVRKTKADVT  346

Query  524   EEYMQSMVDLMVLKGRPPFHVAGSFIMSDLTRSKISDVDYGWGKPVFGGPAHGGAGDVPG  345
             EEYM+S+ DLMV++GRP F V  ++++SD+T +   DVD+GWGK  +GGPA GG G +PG
Sbjct  347   EEYMKSVADLMVIRGRPHFAVVRTYLVSDVTHAGFGDVDFGWGKAAYGGPAKGGVGAIPG  406

Query  344   VITFHVPYENKKGENGTLIPICLPAFALDKFVNELANTFLR  222
             V +F++P+ N KGENG ++PICL A A++ FV EL     R
Sbjct  407   VASFYIPFTNNKGENGIVVPICLAANAMEVFVKELEKMLKR  447



>ref|XP_004498016.1| PREDICTED: benzyl alcohol O-benzoyltransferase-like [Cicer arietinum]
Length=463

 Score =   502 bits (1292),  Expect = 4e-171, Method: Compositional matrix adjust.
 Identities = 237/395 (60%), Positives = 311/395 (79%), Gaps = 8/395 (2%)
 Frame = -1

Query  1415  FYRNEPSMSGKDPVQVIRQALAKALVFFYPFAGRLREGPGRKLMVDCTGEGVMFIEADAD  1236
             FY  +P+M GKDPV VIR+ALAK LVF+YPFAGRLREG  RKLMVDC GEGV+FIEADAD
Sbjct  48    FYNYDPNMKGKDPVDVIRKALAKTLVFYYPFAGRLREGNDRKLMVDCNGEGVLFIEADAD  107

Query  1235  ATLQHFAIGGELKPPFPCFDQLLYNVPGSAEILNSPLFLIQVTRLRCGGFIFTLRMNHTM  1056
              +++ F  GG+L+PPFPC+DQLL++VPGS++++N+PL LIQVTRL+CGGFIF LR+NHTM
Sbjct  108   VSVEEF--GGQLQPPFPCWDQLLFDVPGSSQVINTPLLLIQVTRLKCGGFIFALRLNHTM  165

Query  1055  ADASGLVHFLNTIAEIARGAEAPAVQPVWQREFFSARNPPRITCTHFEYEEEPAADSMVT  876
             +DA+GLV F+N + EI+RG   P++ PVW RE  +AR+PPR+TCTH EYE+ P  D+  T
Sbjct  166   SDAAGLVQFMNALGEISRGMNEPSIPPVWYRELLNARDPPRVTCTHREYEQIP--DTKGT  223

Query  875   NIPLDNLVHRSFLFGPTEISVLRSSLPPHLRKC---STVEILTALVWRCRTIALGFHPDE  705
              I LD++ HRSF FGPTE++ +R+ LPPH ++    S  EILTA +WRCRTIAL    DE
Sbjct  224   IISLDDMDHRSFFFGPTEVAAIRALLPPHQQQQHQHSNFEILTACLWRCRTIALQPDTDE  283

Query  704   EVRMLLLINARFKFKDTPMPSGYTGNAFAYPGAKTTAGKLRKNPLGYAVELVTSIKRCFS  525
             EVR++ ++NAR KF + P+P+G+ GNAFA+P A TTAGKL +NPLGYA+ELV   K   +
Sbjct  284   EVRIICIVNARGKF-NPPLPNGFYGNAFAFPVAVTTAGKLIENPLGYALELVRKAKADVT  342

Query  524   EEYMQSMVDLMVLKGRPPFHVAGSFIMSDLTRSKISDVDYGWGKPVFGGPAHGGAGDVPG  345
             EEYM S+ DLMV  GRP F V  S+++SD+TR+   +V++GWGK V+GGPA GG G +PG
Sbjct  343   EEYMHSIADLMVTNGRPHFTVVRSYLVSDVTRAGFGEVEFGWGKAVYGGPAKGGVGAIPG  402

Query  344   VITFHVPYENKKGENGTLIPICLPAFALDKFVNEL  240
             V +F++P++N KGE G +IP+CLP  A+++FV EL
Sbjct  403   VASFYIPFKNDKGEEGLVIPVCLPTQAMERFVKEL  437



>ref|XP_007145940.1| hypothetical protein PHAVU_007G280800g [Phaseolus vulgaris]
 gb|ESW17934.1| hypothetical protein PHAVU_007G280800g [Phaseolus vulgaris]
Length=458

 Score =   501 bits (1289),  Expect = 8e-171, Method: Compositional matrix adjust.
 Identities = 233/396 (59%), Positives = 303/396 (77%), Gaps = 5/396 (1%)
 Frame = -1

Query  1415  FYRNEPSMSGKDPVQVIRQALAKALVFFYPFAGRLREGPGRKLMVDCTGEGVMFIEADAD  1236
             FYR +PS +G+DPV VIR+ALAK LVF+YPFAGRLREGPGRKLMVDCTGEGV+FIEADAD
Sbjct  48    FYRYDPSQAGRDPVAVIREALAKTLVFYYPFAGRLREGPGRKLMVDCTGEGVLFIEADAD  107

Query  1235  ATLQHFAIGGELKPPFPCFDQLLYNVPGSAEILNSPLFLIQVTRLRCGGFIFTLRMNHTM  1056
              TL HF  G  L+PPFPC++ LLY++P S  +L++PL LIQVTRL+CGGFIF LR+NHTM
Sbjct  108   VTLDHF--GHSLQPPFPCWENLLYDLPSSQGVLHTPLLLIQVTRLKCGGFIFALRLNHTM  165

Query  1055  ADASGLVHFLNTIAEIARGAEAPAVQPVWQREFFSARNPPRITCTHFEYEEEPAADSMVT  876
             +DA+GLV F+  + EIARG + P V PVW+RE   AR+PPR+TC+H EY+  P  D+  T
Sbjct  166   SDAAGLVQFMKAVGEIARGRQEPTVPPVWRRELLKARDPPRVTCSHREYDVVP--DTKGT  223

Query  875   NIPLDNLVHRSFLFGPTEISVLRSSLPPHLRKCSTVEILTALVWRCRTIALGFHPDEEVR  696
              IPLD++ HRSF FG +E+S +R  L PH  +CS+ ++LTA +WRCRT+AL    DEEVR
Sbjct  224   IIPLDDMAHRSFFFGRSELSAIRRLLAPHQNQCSSFDVLTACLWRCRTLALQPDSDEEVR  283

Query  695   MLLLINARFKFKDTPMPSGYTGNAFAYPGAKTTAGKLRKNPLGYAVELVTSIKRCFSEEY  516
             ++ ++NAR KF + P+P GY GN FA+  A TTAGKL +NPLGYA+ELV   K   SEEY
Sbjct  284   IICIVNARSKF-NPPLPEGYYGNVFAFSVAVTTAGKLCENPLGYALELVRKAKAEVSEEY  342

Query  515   MQSMVDLMVLKGRPPFHVAGSFIMSDLTRSKISDVDYGWGKPVFGGPAHGGAGDVPGVIT  336
             MQS+ DLMV +GRP F V  S+++SD+ R+   +VD+GWGK V+GGPA GG G +PGV +
Sbjct  343   MQSLADLMVTRGRPHFTVVRSYLVSDVRRAGFEEVDFGWGKAVYGGPAKGGVGAIPGVAS  402

Query  335   FHVPYENKKGENGTLIPICLPAFALDKFVNELANTF  228
             F++P+ N KG+ G ++P+CLP+ A+ +F  EL +  
Sbjct  403   FYIPFRNDKGDEGLVMPVCLPSEAMLRFEKELHSVL  438



>ref|XP_007029788.1| Benzoyl coenzyme A: Benzyl alcohol benzoyl transferase [Theobroma 
cacao]
 gb|EOY10290.1| Benzoyl coenzyme A: Benzyl alcohol benzoyl transferase [Theobroma 
cacao]
Length=454

 Score =   498 bits (1283),  Expect = 7e-170, Method: Compositional matrix adjust.
 Identities = 234/392 (60%), Positives = 300/392 (77%), Gaps = 8/392 (2%)
 Frame = -1

Query  1415  FYRNEPSMSGKDPVQVIRQALAKALVFFYPFAGRLREGPGRKLMVDCTGEGVMFIEADAD  1236
             FY+  PSM GKDP +VIR+ALA+ LVF+YPFAGRLREGP RKLMVDCTGEGVMFIEADAD
Sbjct  49    FYQYSPSMQGKDPARVIREALAQTLVFYYPFAGRLREGPQRKLMVDCTGEGVMFIEADAD  108

Query  1235  ATLQHFAIGGELKPPFPCFDQLLYNVPGSAEILNSPLFLIQVTRLRCGGFIFTLRMNHTM  1056
              TL+ F  G  L+PPFPC + LL++VPGSA +LN PL LIQVTRLRCGGFIF LR+NH+M
Sbjct  109   VTLEQF--GDALQPPFPCLEDLLHDVPGSAGVLNCPLLLIQVTRLRCGGFIFALRLNHSM  166

Query  1055  ADASGLVHFLNTIAEIARGAEAPAVQPVWQREFFSARNPPRITCTHFEYEEEPAADSMVT  876
             +DA+GL  F++ + E+ARG  AP+++PVW+R    AR+PPR+TC H EYEE        T
Sbjct  167   SDAAGLTQFMSAVGEMARGWLAPSIRPVWKRHLLGARDPPRVTCKHREYEEVEG-----T  221

Query  875   NIPLDNLVHRSFLFGPTEISVLRSSLPPHLRKCSTVEILTALVWRCRTIALGFHPDEEVR  696
              +P D + HRSF FG  E+  LR  +P HLRKCS  E+LTA +WRCRTIA+  + +EEVR
Sbjct  222   IVPFDEMAHRSFFFGSAELLALRKLVPLHLRKCSRFELLTACLWRCRTIAIQANLEEEVR  281

Query  695   MLLLINARFKFKDTPMPSGYTGNAFAYPGAKTTAGKLRKNPLGYAVELVTSIKRCFSEEY  516
             ++ ++N+R KF + P+PSGY GNAFA+P A   AGKLR+NPLGYA+ELV   K   +EEY
Sbjct  282   IICIVNSRSKF-NPPLPSGYYGNAFAFPVAVAKAGKLRQNPLGYALELVKQAKADVTEEY  340

Query  515   MQSMVDLMVLKGRPPFHVAGSFIMSDLTRSKISDVDYGWGKPVFGGPAHGGAGDVPGVIT  336
             M+S+ DLMV++GRP F V  S+++SD+TR+   DVD+GWGK V+GGPA GG G +PG+ +
Sbjct  341   MKSLADLMVIRGRPHFTVVRSYLVSDVTRAGFGDVDFGWGKAVYGGPAKGGVGAIPGLAS  400

Query  335   FHVPYENKKGENGTLIPICLPAFALDKFVNEL  240
             F +P +NKKGE+G ++PI LP  A++ FV EL
Sbjct  401   FLIPSKNKKGEDGIVLPITLPPPAMEIFVKEL  432



>ref|XP_009388282.1| PREDICTED: benzyl alcohol O-benzoyltransferase [Musa acuminata 
subsp. malaccensis]
Length=457

 Score =   496 bits (1276),  Expect = 8e-169, Method: Compositional matrix adjust.
 Identities = 229/394 (58%), Positives = 302/394 (77%), Gaps = 5/394 (1%)
 Frame = -1

Query  1415  FYRNEPSMSGKDPVQVIRQALAKALVFFYPFAGRLREGPGRKLMVDCTGEGVMFIEADAD  1236
             FYRN+PSM G+D  +VIR+ALA+ALVF+YPFAGRLRE  GRKL+V+CTGEG++FIEADAD
Sbjct  48    FYRNDPSMGGRDQAKVIREALARALVFYYPFAGRLREAAGRKLVVECTGEGILFIEADAD  107

Query  1235  ATLQHFAIGGELKPPFPCFDQLLYNVPGSAEILNSPLFLIQVTRLRCGGFIFTLRMNHTM  1056
               L+ F  G EL+PPFPC ++L+YNVPGS  +L+ PL LIQVTRL CGGFIF +R+NHTM
Sbjct  108   VRLEQF--GDELQPPFPCLEELVYNVPGSDGVLDCPLLLIQVTRLLCGGFIFAIRLNHTM  165

Query  1055  ADASGLVHFLNTIAEIARGAEAPAVQPVWQREFFSARNPPRITCTHFEYEEEPAADSMVT  876
             +DA GLV F+N +AE+ARGA AP+V P+W RE   AR+PPR TC H EY++ P  D+  T
Sbjct  166   SDAPGLVQFMNAVAELARGAAAPSVPPLWSREILEARSPPRATCKHREYDDVP--DTRGT  223

Query  875   NIPLDNLVHRSFLFGPTEISVLRSSLPPHLRKCSTVEILTALVWRCRTIALGFHPDEEVR  696
              +PLD++VHRSF FG  E++ LR  +PPHLR  ST EILTA +W+CRTIA+    DEEVR
Sbjct  224   IVPLDDMVHRSFFFGKREVAALRRRVPPHLRNSSTFEILTACLWKCRTIAISPDADEEVR  283

Query  695   MLLLINARFKFKDTPMPSGYTGNAFAYPGAKTTAGKLRKNPLGYAVELVTSIKRCFSEEY  516
             M+ ++NAR K  D  +P GY GNAF +P A + AGKL  NPLGYA++LV   K   ++EY
Sbjct  284   MICIVNARGK-SDLGLPVGYYGNAFVFPVAVSKAGKLCANPLGYALDLVRKAKSDVTDEY  342

Query  515   MQSMVDLMVLKGRPPFHVAGSFIMSDLTRSKISDVDYGWGKPVFGGPAHGGAGDVPGVIT  336
             ++S+ DLMVL+GRP F V  S+++SD+T++   DVD+GWGK  +GGPA GG G +PGV +
Sbjct  343   VRSVADLMVLRGRPHFTVVRSYLVSDVTKAGFGDVDFGWGKAAYGGPAKGGVGAIPGVAS  402

Query  335   FHVPYENKKGENGTLIPICLPAFALDKFVNELAN  234
             F++P+ N KGE+G ++P+CLP  A++KF  E+ +
Sbjct  403   FYIPFRNGKGEDGIVVPVCLPGPAMEKFTMEMES  436



>gb|EYU34530.1| hypothetical protein MIMGU_mgv1a006233mg [Erythranthe guttata]
Length=451

 Score =   495 bits (1275),  Expect = 9e-169, Method: Compositional matrix adjust.
 Identities = 235/392 (60%), Positives = 301/392 (77%), Gaps = 6/392 (2%)
 Frame = -1

Query  1415  FYRNEPSMSGKDPVQVIRQALAKALVFFYPFAGRLREGPGRKLMVDCTGEGVMFIEADAD  1236
             FYRN P +   DPV VIR A+++ALVF+YPFAGRLRE   RKL+V+CTGEGVMFIEADAD
Sbjct  47    FYRNIPFIQA-DPVHVIRAAISEALVFYYPFAGRLREVADRKLVVECTGEGVMFIEADAD  105

Query  1235  ATLQHFAIGGELKPPFPCFDQLLYNVPGSAEILNSPLFLIQVTRLRCGGFIFTLRMNHTM  1056
              +LQ F  G +L+PPFPC ++LLY+VPGS+ I+N+PL LIQ TRLRCGGFIF +R+NHTM
Sbjct  106   VSLQQF--GDDLQPPFPCLEELLYDVPGSSGIVNTPLLLIQATRLRCGGFIFAVRLNHTM  163

Query  1055  ADASGLVHFLNTIAEIARGAEAPAVQPVWQREFFSARNPPRITCTHFEYEEEPAADSMVT  876
             +DA GL+ F+  + EIARGA++P+  PVW+R   +AR PPR+TCTH EY+E P  D+  T
Sbjct  164   SDAFGLLQFMTAVGEIARGAKSPSTPPVWERHLLNARAPPRVTCTHREYDEVP--DTKGT  221

Query  875   NIPLDNLVHRSFLFGPTEISVLRSSLPPHLRKCSTVEILTALVWRCRTIALGFHPDEEVR  696
              IPLD++VHRSF FG  EIS LR  LPPHLR+CST E+LTA +WRCRTIA+   P+EEVR
Sbjct  222   IIPLDDMVHRSFFFGAAEISALRGRLPPHLRRCSTFELLTACLWRCRTIAISPEPNEEVR  281

Query  695   MLLLINARFKFKDTPMPSGYTGNAFAYPGAKTTAGKLRKNPLGYAVELVTSIKRCFSEEY  516
             ML ++N R +F    +P GY GNAFA P A  TAG L  NP  YA+EL+   K   +EEY
Sbjct  282   MLCIVNYRSRFNRL-LPKGYYGNAFALPVAIATAGDLSTNPFEYALELIRKAKSEVTEEY  340

Query  515   MQSMVDLMVLKGRPPFHVAGSFIMSDLTRSKISDVDYGWGKPVFGGPAHGGAGDVPGVIT  336
             M+S+ D+MV++GRP F V  SF++SDLTR+ I DVD+G GK V+GGPA GG G +PGV++
Sbjct  341   MRSLADMMVIRGRPHFAVVRSFVVSDLTRAGIGDVDFGLGKAVYGGPAKGGVGAIPGVLS  400

Query  335   FHVPYENKKGENGTLIPICLPAFALDKFVNEL  240
             F++P++NKKGENG ++P+ L A A++ FV EL
Sbjct  401   FYIPFKNKKGENGIVVPVFLAADAMEVFVKEL  432



>gb|AJD25145.1| benzoyl-CoA:benzyl alcohol O-benzoyltransferase [Populus trichocarpa]
Length=460

 Score =   495 bits (1274),  Expect = 2e-168, Method: Compositional matrix adjust.
 Identities = 237/392 (60%), Positives = 305/392 (78%), Gaps = 5/392 (1%)
 Frame = -1

Query  1415  FYRNEPSMSGKDPVQVIRQALAKALVFFYPFAGRLREGPGRKLMVDCTGEGVMFIEADAD  1236
             FYRN PSM GKDPV++IR+ALAK LVF+YPFAGRLREGP RKLMV+CTGEG++FIEADAD
Sbjct  51    FYRNNPSMQGKDPVKIIREALAKTLVFYYPFAGRLREGPNRKLMVECTGEGILFIEADAD  110

Query  1235  ATLQHFAIGGELKPPFPCFDQLLYNVPGSAEILNSPLFLIQVTRLRCGGFIFTLRMNHTM  1056
              TL+ F  G  L+PPFPC ++LL++VPGS+ +LN PL LIQVTRL+CGGF+F LR+NHTM
Sbjct  111   VTLEQF--GDALQPPFPCLEELLFDVPGSSGVLNCPLLLIQVTRLKCGGFLFALRLNHTM  168

Query  1055  ADASGLVHFLNTIAEIARGAEAPAVQPVWQREFFSARNPPRITCTHFEYEEEPAADSMVT  876
             +DA GLV F+  + E+ARGA AP+V  VW+R+  +A +PPR+TCTH EYEE   AD+  T
Sbjct  169   SDAVGLVQFMAAVGEMARGANAPSVPAVWERQVLNASDPPRVTCTHREYEE--VADTKGT  226

Query  875   NIPLDNLVHRSFLFGPTEISVLRSSLPPHLRKCSTVEILTALVWRCRTIALGFHPDEEVR  696
              IPLD++ HRSF FGP+E+S LR  +PPHL  CST EILTA +W+CRTIAL   P EE+R
Sbjct  227   IIPLDDMAHRSFFFGPSEMSALRKFVPPHLSHCSTFEILTACLWKCRTIALQPDPTEEMR  286

Query  695   MLLLINARFKFKDTPMPSGYTGNAFAYPGAKTTAGKLRKNPLGYAVELVTSIKRCFSEEY  516
             +L ++NAR KF + P+P GY GN FA+P A  TA +L KNP GYA+ELV   K   +EEY
Sbjct  287   ILCIVNAREKF-NPPLPRGYYGNGFAFPVAVATAEELSKNPFGYALELVRKAKADVTEEY  345

Query  515   MQSMVDLMVLKGRPPFHVAGSFIMSDLTRSKISDVDYGWGKPVFGGPAHGGAGDVPGVIT  336
             M+S+  LMV+KGRP F V  ++++SDL R+   +VD+GWG  ++GG A GG G +PGV +
Sbjct  346   MRSVSSLMVIKGRPHFTVVRAYLVSDLRRAGFEEVDFGWGNAIYGGAAKGGVGAIPGVAS  405

Query  335   FHVPYENKKGENGTLIPICLPAFALDKFVNEL  240
             F++P+ NKKGENG ++P CLPA A+++FV EL
Sbjct  406   FYIPFTNKKGENGVVVPFCLPAPAMERFVKEL  437



>ref|XP_002325454.2| transferase family protein [Populus trichocarpa]
 gb|EEE99835.2| transferase family protein [Populus trichocarpa]
Length=460

 Score =   495 bits (1274),  Expect = 2e-168, Method: Compositional matrix adjust.
 Identities = 237/392 (60%), Positives = 305/392 (78%), Gaps = 5/392 (1%)
 Frame = -1

Query  1415  FYRNEPSMSGKDPVQVIRQALAKALVFFYPFAGRLREGPGRKLMVDCTGEGVMFIEADAD  1236
             FYRN PSM GKDPV++IR+ALAK LVF+YPFAGRLREGP RKLMV+CTGEG++FIEADAD
Sbjct  51    FYRNNPSMQGKDPVKIIREALAKTLVFYYPFAGRLREGPNRKLMVECTGEGILFIEADAD  110

Query  1235  ATLQHFAIGGELKPPFPCFDQLLYNVPGSAEILNSPLFLIQVTRLRCGGFIFTLRMNHTM  1056
              TL+ F  G  L+PPFPC ++LL++VPGS+ +LN PL LIQVTRL+CGGF+F LR+NHTM
Sbjct  111   VTLEQF--GDALQPPFPCLEELLFDVPGSSGVLNCPLLLIQVTRLKCGGFLFALRLNHTM  168

Query  1055  ADASGLVHFLNTIAEIARGAEAPAVQPVWQREFFSARNPPRITCTHFEYEEEPAADSMVT  876
             +DA GLV F+  + E+ARGA AP+V  VW+R+  +A +PPR+TCTH EYEE   AD+  T
Sbjct  169   SDAVGLVQFMAAVGEMARGANAPSVPAVWERQVLNASDPPRVTCTHREYEE--VADTKGT  226

Query  875   NIPLDNLVHRSFLFGPTEISVLRSSLPPHLRKCSTVEILTALVWRCRTIALGFHPDEEVR  696
              IPLD++ HRSF FGP+E+S LR  +PPHL  CST EILTA +W+CRTIAL   P EE+R
Sbjct  227   IIPLDDMAHRSFFFGPSEMSALRKFVPPHLSHCSTFEILTACLWKCRTIALQPDPTEEMR  286

Query  695   MLLLINARFKFKDTPMPSGYTGNAFAYPGAKTTAGKLRKNPLGYAVELVTSIKRCFSEEY  516
             +L ++NAR KF + P+P GY GN FA+P A  TA +L KNP GYA+ELV   K   +EEY
Sbjct  287   ILCIVNAREKF-NPPLPRGYYGNGFAFPVAVATAEELSKNPFGYALELVRKAKADVTEEY  345

Query  515   MQSMVDLMVLKGRPPFHVAGSFIMSDLTRSKISDVDYGWGKPVFGGPAHGGAGDVPGVIT  336
             M+S+  LMV+KGRP F V  ++++SDL R+   +VD+GWG  ++GG A GG G +PGV +
Sbjct  346   MRSVSSLMVIKGRPHFTVVRAYLVSDLRRAGFEEVDFGWGNAIYGGAAKGGVGAIPGVAS  405

Query  335   FHVPYENKKGENGTLIPICLPAFALDKFVNEL  240
             F++P+ NKKGENG ++P CLPA A+++FV EL
Sbjct  406   FYIPFTNKKGENGVVVPFCLPAPAMERFVKEL  437



>gb|EYU41389.1| hypothetical protein MIMGU_mgv1a006154mg [Erythranthe guttata]
Length=455

 Score =   494 bits (1272),  Expect = 3e-168, Method: Compositional matrix adjust.
 Identities = 239/392 (61%), Positives = 305/392 (78%), Gaps = 6/392 (2%)
 Frame = -1

Query  1415  FYRNEPSMSGKDPVQVIRQALAKALVFFYPFAGRLREGPGRKLMVDCTGEGVMFIEADAD  1236
             FYRN PS+   DPV+VIR A+++ALVF+YPFAGRLRE   RKL+V+CTGEGVMFIEADAD
Sbjct  47    FYRNIPSVQA-DPVKVIRAAISEALVFYYPFAGRLREVADRKLVVECTGEGVMFIEADAD  105

Query  1235  ATLQHFAIGGELKPPFPCFDQLLYNVPGSAEILNSPLFLIQVTRLRCGGFIFTLRMNHTM  1056
               LQ F  G +L+PPFPC ++LLY+VPGS+ I+NSPL LIQVTRLRCGGFI  LR+NHTM
Sbjct  106   VALQQF--GDDLQPPFPCLEELLYDVPGSSGIVNSPLLLIQVTRLRCGGFILALRLNHTM  163

Query  1055  ADASGLVHFLNTIAEIARGAEAPAVQPVWQREFFSARNPPRITCTHFEYEEEPAADSMVT  876
             +DA GLV F+  + EIARGA++P++ PVW+R   +AR PPR+TCTH EY+E P  D+  T
Sbjct  164   SDAFGLVQFMTAVGEIARGAKSPSIPPVWERHLLNARAPPRVTCTHREYDEVP--DTKGT  221

Query  875   NIPLDNLVHRSFLFGPTEISVLRSSLPPHLRKCSTVEILTALVWRCRTIALGFHPDEEVR  696
              IPLD++VHRSF FG  EIS LR  LPPHLR+CST E+LTA +WRCRTIA+   P+EEVR
Sbjct  222   IIPLDDMVHRSFFFGAAEISALRGRLPPHLRRCSTFELLTACLWRCRTIAISPEPNEEVR  281

Query  695   MLLLINARFKFKDTPMPSGYTGNAFAYPGAKTTAGKLRKNPLGYAVELVTSIKRCFSEEY  516
             ML ++N R +  + P+P GY GNAFA+P A   AG L  NP  YA+EL+   K   +EEY
Sbjct  282   MLCIVNYRSRI-NPPLPKGYYGNAFAFPAAVAAAGDLSSNPFEYALELIRKTKSDVTEEY  340

Query  515   MQSMVDLMVLKGRPPFHVAGSFIMSDLTRSKISDVDYGWGKPVFGGPAHGGAGDVPGVIT  336
             M+S+ DL+V++GRP F V  S+++SDLTR+ I D+D+GWGK V GGPA GG G +PGV +
Sbjct  341   MRSLADLLVIRGRPHFTVVRSYVVSDLTRAGIGDLDFGWGKAVSGGPAKGGVGAIPGVAS  400

Query  335   FHVPYENKKGENGTLIPICLPAFALDKFVNEL  240
             F++P++NKKGENG ++P+CLPA A++ FV EL
Sbjct  401   FYIPFKNKKGENGIVVPVCLPADAMEVFVKEL  432



>ref|XP_011012995.1| PREDICTED: benzyl alcohol O-benzoyltransferase-like [Populus 
euphratica]
Length=459

 Score =   493 bits (1270),  Expect = 6e-168, Method: Compositional matrix adjust.
 Identities = 235/392 (60%), Positives = 304/392 (78%), Gaps = 5/392 (1%)
 Frame = -1

Query  1415  FYRNEPSMSGKDPVQVIRQALAKALVFFYPFAGRLREGPGRKLMVDCTGEGVMFIEADAD  1236
             FYRN PSM GKDPV++IR+ALAK LVF+YPFAGRLREGP RKLMV+CTGEG++FIEADAD
Sbjct  51    FYRNNPSMQGKDPVKIIREALAKTLVFYYPFAGRLREGPNRKLMVECTGEGILFIEADAD  110

Query  1235  ATLQHFAIGGELKPPFPCFDQLLYNVPGSAEILNSPLFLIQVTRLRCGGFIFTLRMNHTM  1056
              TL+ F  G  L+PPFPC ++LL++VPGS+ +LN PL LIQVTRL+CGGF+F LR+NHTM
Sbjct  111   VTLEQF--GDALQPPFPCLEELLFDVPGSSGVLNCPLLLIQVTRLKCGGFLFALRLNHTM  168

Query  1055  ADASGLVHFLNTIAEIARGAEAPAVQPVWQREFFSARNPPRITCTHFEYEEEPAADSMVT  876
             +DA GLV F+  + E+ARGA  P+V  VW+R+  +A NPPR+TCTH EYEE   AD+  T
Sbjct  169   SDAVGLVQFMAAVGEMARGANVPSVPAVWERQVLNASNPPRVTCTHREYEE--VADTKGT  226

Query  875   NIPLDNLVHRSFLFGPTEISVLRSSLPPHLRKCSTVEILTALVWRCRTIALGFHPDEEVR  696
              IPLD++ HRSF FGP+E+S LR  +PPHL  CST EILTA +W+CRTIAL   P EE+R
Sbjct  227   IIPLDDMAHRSFFFGPSEMSALRKFVPPHLSHCSTFEILTACLWKCRTIALQPDPTEEMR  286

Query  695   MLLLINARFKFKDTPMPSGYTGNAFAYPGAKTTAGKLRKNPLGYAVELVTSIKRCFSEEY  516
             ++ ++NAR KF + P+P GY GN FA+P A  TAG+L +NP GYA+ELV   K   +EEY
Sbjct  287   IICIVNAREKF-NPPLPRGYYGNGFAFPVAVATAGELSRNPFGYALELVRKAKADVTEEY  345

Query  515   MQSMVDLMVLKGRPPFHVAGSFIMSDLTRSKISDVDYGWGKPVFGGPAHGGAGDVPGVIT  336
             M+S+  LMV+KGRP F V  ++++SDL R+   +VD+GWG  ++GG A GG G +PGV +
Sbjct  346   MRSVSSLMVIKGRPHFTVVRAYLVSDLRRAGFEEVDFGWGNAIYGGAAKGGVGAIPGVAS  405

Query  335   FHVPYENKKGENGTLIPICLPAFALDKFVNEL  240
             F++P+ NK GENG ++P CLPA A+++FV EL
Sbjct  406   FYIPFTNKNGENGVVVPFCLPAPAMERFVKEL  437



>sp|Q8GT21.1|BEBT_CLABR RecName: Full=Benzyl alcohol O-benzoyltransferase; AltName: Full=Benzoyl 
coenzyme A:benzyl alcohol benzoyl transferase [Clarkia 
breweri]
 gb|AAN09796.1| benzoyl coenzyme A: benzyl alcohol benzoyl transferase [Clarkia 
breweri]
Length=456

 Score =   489 bits (1259),  Expect = 3e-166, Method: Compositional matrix adjust.
 Identities = 233/398 (59%), Positives = 300/398 (75%), Gaps = 9/398 (2%)
 Frame = -1

Query  1415  FYR-NEPSMSGKDPVQVIRQALAKALVFFYPFAGRLREGPGRKLMVDCTGEGVMFIEADA  1239
             FY+ N  SM  +DPVQVIR+ +A+ALV++YPFAGRLRE  GRKL+V+CTGEGVMFIEADA
Sbjct  50    FYKHNNESMQERDPVQVIREGIARALVYYYPFAGRLREVDGRKLVVECTGEGVMFIEADA  109

Query  1238  DATLQHFAIGGELKPPFPCFDQLLYNVPGSAEILNSPLFLIQVTRLRCGGFIFTLRMNHT  1059
             D TL+ F  G  L+PPFPCFDQLL++VPGS  IL+SPL LIQVTRL+CG FIF LR+NHT
Sbjct  110   DVTLEQF--GDALQPPFPCFDQLLFDVPGSGGILDSPLLLIQVTRLKCGSFIFALRLNHT  167

Query  1058  MADASGLVHFLNTIAEIARGAEAPAVQPVWQREFFSARNPPRITCTHFEYEEEPAADSMV  879
             MADA+G+V F+  + E+ARGA  P+  PVW R   +AR PP++T  H EYEE     ++ 
Sbjct  168   MADAAGIVLFMKAVGEMARGAATPSTLPVWDRHILNARVPPQVTFNHREYEE--VKGTIF  225

Query  878   TNIPLDNLVHRSFLFGPTEISVLRSSLPPHLRKCST-VEILTALVWRCRTIALGFHPDEE  702
             T  P D+L HRSF FG TEIS +R  +PPHLR CST +E+LTA +WRCRT+A+  +PDEE
Sbjct  226   T--PFDDLAHRSFFFGSTEISAMRKQIPPHLRSCSTTIEVLTACLWRCRTLAIKPNPDEE  283

Query  701   VRMLLLINARFKFKDTPMPSGYTGNAFAYPGAKTTAGKLRKNPLGYAVELVTSIKRCFSE  522
             VRM+ ++NAR KF + P+P GY GNAFA P A TTAGKL  NPLG+A+EL+   KR  +E
Sbjct  284   VRMICIVNARSKF-NPPLPDGYYGNAFAIPAAVTTAGKLCNNPLGFALELIRKAKREVTE  342

Query  521   EYMQSMVDLMVLKGRPPFHVAGSFIMSDLTRSKISDVDYGWGKPVFGGPAHGGAGDVPGV  342
             EYM S+ DLMV  GRP F V  ++++SD+TR+   +VD+GWG+ V+GGPA GG G +PGV
Sbjct  343   EYMHSVADLMVATGRPHFTVVNTYLVSDVTRAGFGEVDFGWGEAVYGGPAKGGVGVIPGV  402

Query  341   ITFHVPYENKKGENGTLIPICLPAFALDKFVNELANTF  228
              +F++P  N++GE G ++PICLP+ A++ F   L NT 
Sbjct  403   TSFYIPLRNRQGEKGIVLPICLPSAAMEIFAEALNNTL  440



>gb|KEH40969.1| benzyl alcohol O-benzoyltransferase [Medicago truncatula]
Length=458

 Score =   489 bits (1258),  Expect = 4e-166, Method: Compositional matrix adjust.
 Identities = 227/398 (57%), Positives = 298/398 (75%), Gaps = 5/398 (1%)
 Frame = -1

Query  1415  FYRNEPSMSGKDPVQVIRQALAKALVFFYPFAGRLREGPGRKLMVDCTGEGVMFIEADAD  1236
             FY+ +P+M+GKDPV +IR+ALAK LVF+YPFAGRLREGPGRKLMVDCTGEGV+FIEADAD
Sbjct  48    FYKYDPNMAGKDPVDIIRKALAKTLVFYYPFAGRLREGPGRKLMVDCTGEGVLFIEADAD  107

Query  1235  ATLQHFAIGGELKPPFPCFDQLLYNVPGSAEILNSPLFLIQVTRLRCGGFIFTLRMNHTM  1056
              +L+ F  G +L PPFPC D+LLY+VPGS+++LN+PL LIQVTRL+CGGFIF  RMNHTM
Sbjct  108   VSLKEF--GEDLHPPFPCIDELLYDVPGSSDMLNTPLLLIQVTRLKCGGFIFAFRMNHTM  165

Query  1055  ADASGLVHFLNTIAEIARGAEAPAVQPVWQREFFSARNPPRITCTHFEYEEEPAADSMVT  876
             +D SG++ FLN + EI+RG   P++ PVW RE  +AR+PP +TCTH EY+ EP  D+  T
Sbjct  166   SDGSGMLQFLNALGEISRGMSKPSISPVWSRELLNARDPPIVTCTHREYDPEP--DNKGT  223

Query  875   NIPLDNLVHRSFLFGPTEISVLRSSLPPH-LRKCSTVEILTALVWRCRTIALGFHPDEEV  699
               PLD++VHR+F  GPTE++ +RS LP H L+K S  E++ A  WRCRTIAL    +EEV
Sbjct  224   MFPLDDMVHRTFFIGPTEVAAIRSLLPTHQLQKYSNFEVIAAYFWRCRTIALQLDSNEEV  283

Query  698   RMLLLINARFKFKDTPMPSGYTGNAFAYPGAKTTAGKLRKNPLGYAVELVTSIKRCFSEE  519
             RM+ L++AR K     +P GY GNA A+P A TTAGKL +NPL YA+ LV   K   ++E
Sbjct  284   RMICLVDARNKSVYKQLPKGYYGNAIAFPVAVTTAGKLIENPLEYALNLVKKAKANVNKE  343

Query  518   YMQSMVDLMVLKGRPPFHVAGSFIMSDLTRSKISDVDYGWGKPVFGGPAHGGAGDVPGVI  339
             YM S+ DLMV+KGRPP   AG +++SD+TR+ + DV++GWGK ++GG A GG   +PG  
Sbjct  344   YMHSVADLMVIKGRPPLTTAGLYLVSDITRAGLGDVEFGWGKALYGGMAKGGDVAIPGQA  403

Query  338   TFHVPYENKKGENGTLIPICLPAFALDKFVNELANTFL  225
              FH+P++N KGE G +IP  LPA  +++ V E  +  +
Sbjct  404   VFHIPFKNAKGEEGLVIPFFLPAQVMERLVKEFHSLLM  441



>ref|XP_003554685.1| PREDICTED: benzyl alcohol O-benzoyltransferase-like [Glycine 
max]
 gb|KHN43218.1| Benzyl alcohol O-benzoyltransferase [Glycine soja]
Length=464

 Score =   488 bits (1256),  Expect = 1e-165, Method: Compositional matrix adjust.
 Identities = 240/402 (60%), Positives = 294/402 (73%), Gaps = 9/402 (2%)
 Frame = -1

Query  1415  FYRNEPSMSGKDPVQVIRQALAKALVFFYPFAGRLREGPGRKLMVDCTGEGVMFIEADAD  1236
              Y N+PSM+GKDPV+VIRQALAK LVF+YPFAGRLREGP RKLMVDCTGEGVMFIEADAD
Sbjct  51    IYHNQPSMAGKDPVEVIRQALAKTLVFYYPFAGRLREGPDRKLMVDCTGEGVMFIEADAD  110

Query  1235  ATLQHFAIGGE-LKPPFPCFDQLLYNVPGSAEILNSPLFLIQVTRLRCGGFIFTLRMNHT  1059
              TL  F  GGE L+PPFPCF +LLYNVP + EI N+PL LIQVTRLRCGGFI   RMNHT
Sbjct  111   VTLYQF--GGEALQPPFPCFQELLYNVPETEEITNTPLLLIQVTRLRCGGFILATRMNHT  168

Query  1058  MADASGLVHFLNTIAEIARGAEAPAVQPVWQREFFSARNPPRITCTHFEYEEEPAADSMV  879
             M+D +GL  F+NT AE+ARG ++P++ PVW+RE   AR+PPRITC H EYE  P      
Sbjct  169   MSDGAGLSQFMNTWAEMARGVKSPSIVPVWRRELLMARDPPRITCNHREYEHVPDTKEGT  228

Query  878   TNIPLD---NLVHRSFLFGPTEISVLRSSLPPHLRKCSTVEILTALVWRCRTIALGFHPD  708
                  D   N+VHRSF  GP EI+ LR  +P +L+ C+T +I+TA +WRCRT AL    D
Sbjct  229   ITSSYDNDNNMVHRSFFLGPVEIAALRRLIPHNLKYCTTFDIITACLWRCRTKALQIEAD  288

Query  707   EEVRMLLLINARFKFKDTPMPSGYTGNAFAYPGAKTTAGKLRKNPLGYAVELVTSIKRCF  528
             E+VRM+ ++NAR +F + P+P GY GN FAYP A TTAGKL  NP GYAVEL+  +KR  
Sbjct  289   EDVRMMCIVNARARF-NPPLPVGYYGNVFAYPAAITTAGKLCGNPFGYAVELINKVKREV  347

Query  527   SEEYMQSMVDLMVLKGRPPFHVAGSFIMSDLTRSKISDVDYGWGKPVFGGPAHGGAGDVP  348
             +EEYM S+ DL+V+KGR  F+   S+I+SDL+R+K  +VD+GWG  VFGGPA  GAG  P
Sbjct  348   TEEYMHSVADLLVIKGRCLFNTVRSYIVSDLSRAKFRNVDFGWGDAVFGGPAKCGAGAFP  407

Query  347   GVITFHVPYENKKGENGTLIPICLPAFALDKFVNELANTFLR  222
             GV ++  P +N KGE G +  I LP  A+++F  EL N  LR
Sbjct  408   GV-SYFTPGKNAKGEEGIIFAIGLPDEAMERFAKEL-NDMLR  447



>gb|EYU41386.1| hypothetical protein MIMGU_mgv1a006089mg [Erythranthe guttata]
Length=458

 Score =   488 bits (1255),  Expect = 1e-165, Method: Compositional matrix adjust.
 Identities = 234/392 (60%), Positives = 303/392 (77%), Gaps = 6/392 (2%)
 Frame = -1

Query  1415  FYRNEPSMSGKDPVQVIRQALAKALVFFYPFAGRLREGPGRKLMVDCTGEGVMFIEADAD  1236
             FYRN PS+   DPV+VIR A+++ALVF+YPFAGRLRE   RKL+V+CTGEGVMFIEADAD
Sbjct  47    FYRNIPSIQA-DPVKVIRAAISEALVFYYPFAGRLREVADRKLVVECTGEGVMFIEADAD  105

Query  1235  ATLQHFAIGGELKPPFPCFDQLLYNVPGSAEILNSPLFLIQVTRLRCGGFIFTLRMNHTM  1056
               LQ F  G +L+PPFPC D+LLY+VPGS  ++N PL LIQVTRLRCGGFIF LR+NHTM
Sbjct  106   VALQQF--GDDLQPPFPCLDELLYDVPGSCGVVNCPLLLIQVTRLRCGGFIFALRLNHTM  163

Query  1055  ADASGLVHFLNTIAEIARGAEAPAVQPVWQREFFSARNPPRITCTHFEYEEEPAADSMVT  876
             +DA+GLV F++ + EIARGA++P   PVW+R   +AR PPR+TCTH EY++ P  D+  T
Sbjct  164   SDAAGLVQFMSAVGEIARGAKSPLTPPVWERHLLNARAPPRVTCTHREYDDVP--DTKGT  221

Query  875   NIPLDNLVHRSFLFGPTEISVLRSSLPPHLRKCSTVEILTALVWRCRTIALGFHPDEEVR  696
              IPLD++VHRSF FG  EIS LR  L PHLR+CST E+LTA +WRCRTIA+   P+EEVR
Sbjct  222   IIPLDDMVHRSFFFGAAEISALRGRLSPHLRRCSTFELLTACLWRCRTIAISPDPNEEVR  281

Query  695   MLLLINARFKFKDTPMPSGYTGNAFAYPGAKTTAGKLRKNPLGYAVELVTSIKRCFSEEY  516
             ML ++N+R +F + P+P GY GNAFA+P A   AG+L  NP  YA+EL+   K   +EEY
Sbjct  282   MLCIVNSRSRF-NPPLPKGYYGNAFAFPVAVAAAGELSTNPFEYALELIRKTKSDVTEEY  340

Query  515   MQSMVDLMVLKGRPPFHVAGSFIMSDLTRSKISDVDYGWGKPVFGGPAHGGAGDVPGVIT  336
             M+S+ D+MV++GRP F V  S+++SD+T +   DVD+GWGK  +GGPA GG G +PGV +
Sbjct  341   MRSLADMMVIRGRPHFTVVRSYLVSDVTHAGFGDVDFGWGKAAYGGPAKGGVGAIPGVAS  400

Query  335   FHVPYENKKGENGTLIPICLPAFALDKFVNEL  240
             F++P++NK GENG ++P+CLPA A++ FV EL
Sbjct  401   FYIPFKNKNGENGIVVPVCLPADAMEVFVKEL  432



>gb|KEH40971.1| benzyl alcohol O-benzoyltransferase [Medicago truncatula]
Length=461

 Score =   488 bits (1255),  Expect = 1e-165, Method: Compositional matrix adjust.
 Identities = 224/397 (56%), Positives = 294/397 (74%), Gaps = 5/397 (1%)
 Frame = -1

Query  1415  FYRNEPSMSGKDPVQVIRQALAKALVFFYPFAGRLREGPGRKLMVDCTGEGVMFIEADAD  1236
             FY+ +P+M+GKDPV +IR+ALAK LVF+YPFAGRLREGP RKLMVDC  EG++FIEADAD
Sbjct  48    FYKYDPNMAGKDPVDIIRKALAKTLVFYYPFAGRLREGPSRKLMVDCNDEGILFIEADAD  107

Query  1235  ATLQHFAIGGELKPPFPCFDQLLYNVPGSAEILNSPLFLIQVTRLRCGGFIFTLRMNHTM  1056
              TL+ F  G +L PPFPC D+LLY+VPGS+ +LN+PL LIQVTRL+CGGFIF LR+NHT+
Sbjct  108   VTLEQF--GEDLHPPFPCIDELLYDVPGSSVVLNTPLLLIQVTRLKCGGFIFALRLNHTI  165

Query  1055  ADASGLVHFLNTIAEIARGAEAPAVQPVWQREFFSARNPPRITCTHFEYEEEPAADSMVT  876
             +D+SGL  FL+ + EI+RG   P++ PVW RE  +ARNPPRITCTH EYEE P     V 
Sbjct  166   SDSSGLFKFLSALGEISRGMNEPSISPVWCRELLNARNPPRITCTHHEYEEVPRNKGTV-  224

Query  875   NIPLDNLVHRSFLFGPTEISVLRSSLPPH-LRKCSTVEILTALVWRCRTIALGFHPDEEV  699
              IPLD++VH +F FGPTE++ +RS LP H L++ +  EI++A  WRCRTIAL    +EEV
Sbjct  225   -IPLDDMVHHTFFFGPTEVAAIRSLLPVHPLQQHTDFEIISAFCWRCRTIALQLDTNEEV  283

Query  698   RMLLLINARFKFKDTPMPSGYTGNAFAYPGAKTTAGKLRKNPLGYAVELVTSIKRCFSEE  519
             R + +++ R K  +  +P GY GNA A     TTAGKL +NPL YA+ LV   K   ++E
Sbjct  284   RFICVVDGRSKSVNLQLPKGYYGNALANSAMVTTAGKLIENPLAYALNLVKKAKANVTQE  343

Query  518   YMQSMVDLMVLKGRPPFHVAGSFIMSDLTRSKISDVDYGWGKPVFGGPAHGGAGDVPGVI  339
             YM S+ DLMV+KGRP F+V  S+++SD+TR     VDYGWGKP++GGPA G  GD+PG+ 
Sbjct  344   YMHSIADLMVIKGRPHFNVVKSYLVSDVTRGGFEKVDYGWGKPIYGGPARGADGDIPGLA  403

Query  338   TFHVPYENKKGENGTLIPICLPAFALDKFVNELANTF  228
             +FH+P++N KGE G +IP   P   +++FV E+ +  
Sbjct  404   SFHIPFKNAKGEEGLVIPFYFPNQVMERFVKEMDSVL  440



>dbj|BAE72881.1| benzoyl CoA benzoic acid benzoyltransferase [Verbena x hybrida]
Length=461

 Score =   487 bits (1254),  Expect = 2e-165, Method: Compositional matrix adjust.
 Identities = 226/399 (57%), Positives = 297/399 (74%), Gaps = 5/399 (1%)
 Frame = -1

Query  1415  FYRNEPSMSGKDPVQVIRQALAKALVFFYPFAGRLREGPGRKLMVDCTGEGVMFIEADAD  1236
             FYR++P M  K+P +VIR+ALAK LVF+YPFAGRL+EGP +KLMVDC+GEGV+FIEA+AD
Sbjct  51    FYRHDPKMRNKNPARVIREALAKVLVFYYPFAGRLKEGPAKKLMVDCSGEGVLFIEAEAD  110

Query  1235  ATLQHFAIGGELKPPFPCFDQLLYNVPGSAEILNSPLFLIQVTRLRCGGFIFTLRMNHTM  1056
              TL  F  G  L+PPFPC ++LLY+VPGS  +L+SPL LIQVTRL CGGFIF LR+NHTM
Sbjct  111   VTLNQF--GDALQPPFPCLEELLYDVPGSGGVLDSPLLLIQVTRLLCGGFIFALRLNHTM  168

Query  1055  ADASGLVHFLNTIAEIARGAEAPAVQPVWQREFFSARNPPRITCTHFEYEEEPAADSMVT  876
             +DA GLV F+  + E+A+GA  P++ PVWQRE   AR  P +TCTH EY+E    D+  T
Sbjct  169   SDAPGLVQFMTALGEMAQGAPRPSILPVWQRELLFARVQPHVTCTHHEYDE--VKDTKGT  226

Query  875   NIPLDNLVHRSFLFGPTEISVLRSSLPPHLRKCSTVEILTALVWRCRTIALGFHPDEEVR  696
              IPLD++ HRSF FGPTE++ LR  +P  L+KCST E+LTA +WRCRTIAL   P+EE+R
Sbjct  227   IIPLDDMAHRSFFFGPTEVAALRRFVPSSLQKCSTFEVLTACLWRCRTIALKPDPEEEMR  286

Query  695   MLLLINARFKFKDTPMPSGYTGNAFAYPGAKTTAGKLRKNPLGYAVELVTSIKRCFSEEY  516
             ++ ++NAR KF + P+P GY GN FA+P A + AG L   PLG+A++LV   K   ++EY
Sbjct  287   IICIVNARAKF-NPPLPKGYYGNGFAFPVAISRAGDLSTKPLGHALKLVMQAKNAVNDEY  345

Query  515   MQSMVDLMVLKGRPPFHVAGSFIMSDLTRSKISDVDYGWGKPVFGGPAHGGAGDVPGVIT  336
             M+S+ DLMV+KGRP F V  S+++SD+TR+    VD+GWG   +GGPA GG G +PGV +
Sbjct  346   MRSLTDLMVIKGRPHFTVVRSYLVSDVTRAGFDAVDFGWGNAAYGGPAKGGVGAIPGVAS  405

Query  335   FHVPYENKKGENGTLIPICLPAFALDKFVNELANTFLRA  219
             F++P+ N KGE G ++PICLP  A++ FV EL N   + 
Sbjct  406   FYIPFTNHKGETGIVLPICLPNAAMETFVKELNNMLAKG  444



>ref|XP_010038484.1| PREDICTED: benzyl alcohol O-benzoyltransferase-like [Eucalyptus 
grandis]
 ref|XP_010038489.1| PREDICTED: benzyl alcohol O-benzoyltransferase-like [Eucalyptus 
grandis]
 gb|KCW84617.1| hypothetical protein EUGRSUZ_B01448 [Eucalyptus grandis]
Length=458

 Score =   486 bits (1252),  Expect = 3e-165, Method: Compositional matrix adjust.
 Identities = 228/385 (59%), Positives = 300/385 (78%), Gaps = 6/385 (2%)
 Frame = -1

Query  1391  SGKDPVQVIRQALAKALVFFYPFAGRLREGPG-RKLMVDCTGEGVMFIEADADATLQHFA  1215
             SG+DP + IR+ LA+ALVF+YPFAGRLRE PG RKL+VDC  EGV+F+EADAD TL  F 
Sbjct  56    SGRDPARAIREGLARALVFYYPFAGRLRELPGSRKLVVDCNEEGVLFVEADADVTLDQF-  114

Query  1214  IGGELKPPFPCFDQLLYNVPGSAEILNSPLFLIQVTRLRCGGFIFTLRMNHTMADASGLV  1035
              G  L+PPFPC ++L+++VPGS+ +L++P+ LIQVTRL+CGGFIF +R+NH M+DA+GLV
Sbjct  115   -GDALQPPFPCLEELIFDVPGSSAVLDAPVLLIQVTRLKCGGFIFAVRLNHAMSDAAGLV  173

Query  1034  HFLNTIAEIARGAEAPAVQPVWQREFFSARNPPRITCTHFEYEEEPAADSMVTNIPLDNL  855
              F+  + E+A+GA+AP+V PVWQRE   AR+PPRITCTH EYE+    D+  T IPLD++
Sbjct  174   QFMTAVGEMAKGADAPSVLPVWQRELLDARDPPRITCTHREYEQ--VEDTKGTLIPLDDM  231

Query  854   VHRSFLFGPTEISVLRSSLPPHLRKCSTVEILTALVWRCRTIALGFHPDEEVRMLLLINA  675
              HRSF FG  ++S LRS +PPH R  ST E+LTA +WRCRTIA+   P+EEVR+L + NA
Sbjct  232   EHRSFFFGAAQMSALRSRVPPHQRASSTFEVLTACLWRCRTIAIQPDPEEEVRVLCIGNA  291

Query  674   RFKFKDTPMPSGYTGNAFAYPGAKTTAGKLRKNPLGYAVELVTSIKRCFSEEYMQSMVDL  495
             R KF + P+P+GY GNAFA+P A T A KL +NPLGYA+ELV   K   +EEYM+S+ DL
Sbjct  292   RTKF-NPPLPAGYYGNAFAFPVAVTRADKLCQNPLGYALELVKKAKADVTEEYMRSLADL  350

Query  494   MVLKGRPPFHVAGSFIMSDLTRSKISDVDYGWGKPVFGGPAHGGAGDVPGVITFHVPYEN  315
             MVL+GRP F V  SF++SD T++   +VD+GWGKPV+GGPA GG G +PGV +F++P+ N
Sbjct  351   MVLRGRPHFTVVRSFLVSDTTKAGFGNVDFGWGKPVYGGPAKGGVGAIPGVASFYIPFRN  410

Query  314   KKGENGTLIPICLPAFALDKFVNEL  240
             ++GENG ++P+CLPA A+  FV EL
Sbjct  411   REGENGIVVPVCLPAPAMRIFVQEL  435



>ref|XP_009374085.1| PREDICTED: benzyl alcohol O-benzoyltransferase-like [Pyrus x 
bretschneideri]
Length=458

 Score =   485 bits (1248),  Expect = 2e-164, Method: Compositional matrix adjust.
 Identities = 235/392 (60%), Positives = 301/392 (77%), Gaps = 8/392 (2%)
 Frame = -1

Query  1415  FYRNEPSMSGKDPVQVIRQALAKALVFFYPFAGRLREGPGRKLMVDCTGEGVMFIEADAD  1236
             FYR + SM G+DPV VIR+A+A+ LVF+YPFAGRL+EGP RKL V+CT EG+MFIEADAD
Sbjct  51    FYRYDLSMQGRDPVHVIREAIAQTLVFYYPFAGRLKEGPNRKLAVECTAEGIMFIEADAD  110

Query  1235  ATLQHFAIGGELKPPFPCFDQLLYNVPGSAEILNSPLFLIQVTRLRCGGFIFTLRMNHTM  1056
              TL+HF  G  L PPFPC ++LLYNVPGS  +LN PL LIQVTRL+CGGF+F LR+NHTM
Sbjct  111   ITLEHF--GDNLHPPFPCLEELLYNVPGSDGVLNCPLLLIQVTRLQCGGFVFALRLNHTM  168

Query  1055  ADASGLVHFLNTIAEIARGAEAPAVQPVWQREFFSARNPPRITCTHFEYEEEPAADSMVT  876
             +DA+GLV F+  +AEIARGA     QPVWQRE  +AR+PPR+TCTH EYEE    D+  T
Sbjct  169   SDAAGLVQFMTAVAEIARGA---TFQPVWQRELLNARDPPRVTCTHREYEE--VEDTYGT  223

Query  875   NIPLDNLVHRSFLFGPTEISVLRSSLPPHLRKCSTVEILTALVWRCRTIALGFHPDEEVR  696
              IPLD++VHRSF F PTE+S +R  +P +L KCS   +LTA +WRCRTIAL   P+EEVR
Sbjct  224   IIPLDDMVHRSFFFRPTEVSAIRRFVPQYLSKCSPFGVLTACLWRCRTIALQRDPNEEVR  283

Query  695   MLLLINARFKFKDTPMPSGYTGNAFAYPGAKTTAGKLRKNPLGYAVELVTSIKRCFSEEY  516
             +L ++NAR KF + P+P GY GN FA+P A TTA +L  NPLGYA+ELV   K   +EEY
Sbjct  284   VLCIVNARSKF-NPPLPVGYYGNTFAFPVAVTTAWRLCNNPLGYALELVRKAKAHVTEEY  342

Query  515   MQSMVDLMVLKGRPPFHVAGSFIMSDLTRSKISDVDYGWGKPVFGGPAHGGAGDVPGVIT  336
             M+S+ DLMV+KGRP F V  S++MSD+TR+   +VD+GWGK  +GGP  GG G +PGV +
Sbjct  343   MRSLADLMVIKGRPHFTVVNSYLMSDVTRAGFGEVDFGWGKAAYGGPGEGGVGAIPGVAS  402

Query  335   FHVPYENKKGENGTLIPICLPAFALDKFVNEL  240
             F++P+ +  GE+G ++P+CLPA A+++F+ EL
Sbjct  403   FYIPFRDNIGEDGIVVPVCLPAAAMERFIKEL  434



>ref|XP_010672751.1| PREDICTED: benzyl alcohol O-benzoyltransferase-like [Beta vulgaris 
subsp. vulgaris]
Length=472

 Score =   484 bits (1246),  Expect = 5e-164, Method: Compositional matrix adjust.
 Identities = 229/398 (58%), Positives = 303/398 (76%), Gaps = 12/398 (3%)
 Frame = -1

Query  1415  FYRNEPSMSG------KDPVQVIRQALAKALVFFYPFAGRLREGPGRKLMVDCTGEGVMF  1254
             FYRN    SG      +DP +VI++A+AKALV +YPFAGRLRE  GRKL+V+C G+G+MF
Sbjct  56    FYRNMDDHSGGSVLKGRDPARVIKEAVAKALVSYYPFAGRLREKAGRKLVVECNGKGIMF  115

Query  1253  IEADADATLQHFAIGGELKPPFPCFDQLLYNVPGSAEILNSPLFLIQVTRLRCGGFIFTL  1074
             IEA+AD +L+ F  G  L+PPFPC ++LL++VP S  +L+SPL LIQVTRL+CGGFI  L
Sbjct  116   IEAEADVSLEDF--GEALQPPFPCLEELLFDVPSSTTVLDSPLILIQVTRLKCGGFILAL  173

Query  1073  RMNHTMADASGLVHFLNTIAEIARGAEAPAVQPVWQREFFSARNPPRITCTHFEYEEEPA  894
             R+NHTMADA GLV F+N +AE+ARGA++P++QPVW+R   SARNPPR+TC H EYEE   
Sbjct  174   RLNHTMADAPGLVQFMNAVAELARGAQSPSIQPVWERHLLSARNPPRVTCEHREYEE--I  231

Query  893   ADSMVTNIPLDNLVHRSFLFGPTEISVLRSSLPPHLRKCSTVEILTALVWRCRTIALGFH  714
             AD+  T IPLD++VH+SF FGPTEI+ LR  +P HL K ST EILTA +WRCRTIAL   
Sbjct  232   ADTKGTIIPLDDMVHKSFFFGPTEIAALRRFIPQHL-KSSTFEILTACLWRCRTIALQPD  290

Query  713   PDEEVRMLLLINARFKFKDTPMPSGYTGNAFAYPGAKTTAGKLRKNPLGYAVELVTSIKR  534
             P+E VR++ ++NAR  F  + +PSG+ GNAFA+P A +TAGKL  NP+GYA+ L+   K 
Sbjct  291   PEEIVRIMCIVNARSLFNPS-LPSGFYGNAFAFPIALSTAGKLATNPIGYALGLIKKTKS  349

Query  533   CFSEEYMQSMVDLMVLKGRPPFHVAGSFIMSDLTRSKISDVDYGWGKPVFGGPAHGGAGD  354
               ++EYM S+ DLMVLKGRP F V  +F++SD+TR+  +D+DYGWG P +GGPA GG G 
Sbjct  350   DVTQEYMASLADLMVLKGRPHFTVVRTFVVSDVTRAGFADLDYGWGPPAYGGPAKGGVGA  409

Query  353   VPGVITFHVPYENKKGENGTLIPICLPAFALDKFVNEL  240
             +PGV +F++P++N  G+ G ++P+CLP  A++ FV EL
Sbjct  410   IPGVASFYIPFKNGNGDKGIVVPLCLPGNAMEIFVKEL  447



>ref|XP_007029777.1| Benzoyl coenzyme A: Benzyl alcohol benzoyl transferase, putative 
[Theobroma cacao]
 gb|EOY10279.1| Benzoyl coenzyme A: Benzyl alcohol benzoyl transferase, putative 
[Theobroma cacao]
Length=471

 Score =   483 bits (1243),  Expect = 1e-163, Method: Compositional matrix adjust.
 Identities = 224/392 (57%), Positives = 290/392 (74%), Gaps = 9/392 (2%)
 Frame = -1

Query  1415  FYRNEPSMSGKDPVQVIRQALAKALVFFYPFAGRLREGPGRKLMVDCTGEGVMFIEADAD  1236
             FY+  PSM GKDP +VIR+AL K LVF+YPFAGRLREGP  KLMVDCTG+GV+FIEADAD
Sbjct  67    FYKYNPSMQGKDPAKVIREALGKTLVFYYPFAGRLREGPNGKLMVDCTGDGVLFIEADAD  126

Query  1235  ATLQHFAIGGELKPPFPCFDQLLYNVPGSAEILNSPLFLIQVTRLRCGGFIFTLRMNHTM  1056
               L+ F  G  L+PPFPC DQLLY+VPGS EILN PL LIQVT ++CGG IF LR+NHTM
Sbjct  127   VKLEQF--GEALQPPFPCLDQLLYDVPGSGEILNCPLLLIQVTTMKCGGIIFALRLNHTM  184

Query  1055  ADASGLVHFLNTIAEIARGAEAPAVQPVWQREFFSARNPPRITCTHFEYEEEPAADSMVT  876
             AD +GL  F++ +AE+A+GA +P++ PVW+R   S R PP++TCTH EY++     S   
Sbjct  185   ADGAGLFQFISAMAEMAQGAISPSILPVWERHLLSCRTPPQVTCTHHEYDKVDDIKSCTN  244

Query  875   NIPLDNLVHRSFLFGPTEISVLRSSLPPHLRKCSTVEILTALVWRCRTIALGFHPDEEVR  696
               PL+N+VHRSF F P++I+ +R  +P HLR CST E+LTA +WR RT+AL F PDE+VR
Sbjct  245   FTPLENMVHRSFFFNPSDITAIRRFVPSHLRHCSTFEVLTACLWRYRTLALQFDPDEQVR  304

Query  695   MLLLINARFKFKDTPMPSGYTGNAFAYPGAKTTAGKLRKNPLGYAVELVTSIKRCFSEEY  516
             +L ++N R KF + P+P GY GNA  YP A TTAGKL +NPLGYA+ELV   K+  +EEY
Sbjct  305   LLCIVNVRSKF-NPPLPKGYYGNAIVYPVAVTTAGKLCQNPLGYAIELVKQTKKSVTEEY  363

Query  515   MQSMVDLMVLKGRPPFHVAGSFIMSDLTRSKISDVDYGWGKPVFGGPAHGGAGDVPGVIT  336
             ++S+ D +  KGRPP  +   +++SD   +K SDVD+GWGK ++GGPA G       V +
Sbjct  364   VKSVADFLATKGRPPVSLVRVYLVSDARHAKFSDVDFGWGKAMYGGPAKG------VVAS  417

Query  335   FHVPYENKKGENGTLIPICLPAFALDKFVNEL  240
             F +P+ NKKGENG ++PI LPA A+++FV EL
Sbjct  418   FQIPHRNKKGENGLVVPIYLPASAMERFVREL  449



>ref|XP_002319767.1| transferase family protein [Populus trichocarpa]
 gb|EEE95690.1| transferase family protein [Populus trichocarpa]
 gb|AJD25144.1| benzoyl-CoA:salicyl alcohol O-benzoyltransferase [Populus trichocarpa]
Length=459

 Score =   482 bits (1241),  Expect = 2e-163, Method: Compositional matrix adjust.
 Identities = 232/392 (59%), Positives = 302/392 (77%), Gaps = 5/392 (1%)
 Frame = -1

Query  1415  FYRNEPSMSGKDPVQVIRQALAKALVFFYPFAGRLREGPGRKLMVDCTGEGVMFIEADAD  1236
             FYR+ PS+ GKDPV+VIR+A+AK LVF+YPFAGRLREG  RKLMV+CTGEG++FIEADAD
Sbjct  51    FYRHNPSVQGKDPVKVIREAIAKTLVFYYPFAGRLREGQNRKLMVECTGEGILFIEADAD  110

Query  1235  ATLQHFAIGGELKPPFPCFDQLLYNVPGSAEILNSPLFLIQVTRLRCGGFIFTLRMNHTM  1056
              TL+ F  G  L+PPFPC ++L+++VPGS+ +LN PL LIQVTRL+CGGFIF LR+NHTM
Sbjct  111   VTLEQF--GDALQPPFPCLEELIFDVPGSSGVLNCPLLLIQVTRLKCGGFIFGLRLNHTM  168

Query  1055  ADASGLVHFLNTIAEIARGAEAPAVQPVWQREFFSARNPPRITCTHFEYEEEPAADSMVT  876
             +DASG+V F+  + E+ARGA  P+V  VW+R   +ARNPPR+TC H EYEE   AD+  T
Sbjct  169   SDASGIVQFMAAVGEMARGATTPSVPAVWERHVLNARNPPRVTCIHREYEE--VADTNGT  226

Query  875   NIPLDNLVHRSFLFGPTEISVLRSSLPPHLRKCSTVEILTALVWRCRTIALGFHPDEEVR  696
              IPLD++ HRSF FGP+EIS LR  +PPHL +CST EILTA +W+CRTIAL   P EE+R
Sbjct  227   IIPLDDMAHRSFFFGPSEISALRKLIPPHLSRCSTFEILTACLWKCRTIALQPDPTEEMR  286

Query  695   MLLLINARFKFKDTPMPSGYTGNAFAYPGAKTTAGKLRKNPLGYAVELVTSIKRCFSEEY  516
             ++ ++NAR KF + P+P+GY GN FA+P A  TAG+L + P GYA+ELV   K   +EEY
Sbjct  287   IICIVNAREKF-NPPLPTGYYGNGFAFPVAVATAGELSEKPFGYALELVRKAKADVTEEY  345

Query  515   MQSMVDLMVLKGRPPFHVAGSFIMSDLTRSKISDVDYGWGKPVFGGPAHGGAGDVPGVIT  336
             M+S+  LMV KGRP F V  ++++SDL  +    VD+GWG  ++GG A GG G +PGV +
Sbjct  346   MRSVASLMVTKGRPHFTVVRAYLVSDLRSAGFEVVDFGWGNAIYGGAAKGGVGAIPGVAS  405

Query  335   FHVPYENKKGENGTLIPICLPAFALDKFVNEL  240
             F +P++NKKGENG ++P CLPA A+++FV EL
Sbjct  406   FLIPFKNKKGENGIVVPFCLPAPAMERFVEEL  437



>gb|KEH40970.1| benzyl alcohol O-benzoyltransferase [Medicago truncatula]
Length=436

 Score =   474 bits (1221),  Expect = 7e-161, Method: Compositional matrix adjust.
 Identities = 223/376 (59%), Positives = 293/376 (78%), Gaps = 9/376 (2%)
 Frame = -1

Query  1343  LVFFYPF----AGRLREGPGRKLMVDCTGEGVMFIEADADATLQHFAIGGELKPPFPCFD  1176
             ++ FY +    AGRLREGPGRKLMVDCTGEGV+FIEADAD +L+ F  G  L+PPFPC D
Sbjct  45    VIQFYKYDPNMAGRLREGPGRKLMVDCTGEGVLFIEADADVSLKEF--GDALQPPFPCLD  102

Query  1175  QLLYNVPGSAEILNSPLFLIQVTRLRCGGFIFTLRMNHTMADASGLVHFLNTIAEIARGA  996
             +LL++VPGS+E+LN PL +IQVTRL+CGGFIF LR+NHTM+DA+GLV F++ + EI+ G 
Sbjct  103   ELLFDVPGSSEVLNCPLLVIQVTRLKCGGFIFALRLNHTMSDAAGLVQFMSALGEISCGM  162

Query  995   EAPAVQPVWQREFFSARNPPRITCTHFEYEEEPAADSMVTNIPLDNLVHRSFLFGPTEIS  816
               P++ PVW RE  ++R+PPR+TCTH EYE+ P  D+  T IPLD++ HRSF FGPTE++
Sbjct  163   NEPSILPVWHRELLNSRDPPRVTCTHREYEQVP--DTKGTIIPLDDMAHRSFFFGPTEVA  220

Query  815   VLRSSLPPHLRKCSTVEILTALVWRCRTIALGFHPDEEVRMLLLINARFKFKDTPMPSGY  636
              +R+ LPPH +K S  EILTA +WRCRTIAL    DEEVR++ ++NAR KF + P+P+GY
Sbjct  221   KIRALLPPHQQKQSNFEILTACLWRCRTIALQPDTDEEVRIICIVNARGKF-NPPLPNGY  279

Query  635   TGNAFAYPGAKTTAGKLRKNPLGYAVELVTSIKRCFSEEYMQSMVDLMVLKGRPPFHVAG  456
              GNAFA+P A TTAGKL +NPLGYA+ELV   K   ++EYM S+ DLMV+KGRP F V  
Sbjct  280   YGNAFAFPVAVTTAGKLMENPLGYALELVKKAKSDVTQEYMHSVADLMVIKGRPHFTVVR  339

Query  455   SFIMSDLTRSKISDVDYGWGKPVFGGPAHGGAGDVPGVITFHVPYENKKGENGTLIPICL  276
             S+++SD+TR+   DV++GWGK V+GGPA GG G +PGV +F++P++N KGE G +IP+CL
Sbjct  340   SYLVSDVTRAGFGDVEFGWGKAVYGGPAKGGVGAIPGVASFYIPFKNAKGEEGLVIPLCL  399

Query  275   PAFALDKFVNELANTF  228
             PA A++KFV EL +  
Sbjct  400   PAQAMEKFVKELDSVL  415



>ref|XP_009803457.1| PREDICTED: benzyl alcohol O-benzoyltransferase-like isoform X2 
[Nicotiana sylvestris]
Length=415

 Score =   474 bits (1219),  Expect = 8e-161, Method: Compositional matrix adjust.
 Identities = 219/358 (61%), Positives = 284/358 (79%), Gaps = 5/358 (1%)
 Frame = -1

Query  1310  REGPGRKLMVDCTGEGVMFIEADADATLQHFAIGGELKPPFPCFDQLLYNVPGSAEILNS  1131
             +EG GRKLMVDCTGEG+MF+EADAD TL+ F  G EL+PPFPC D+LL++VP SA +LN 
Sbjct  40    QEGTGRKLMVDCTGEGIMFVEADADVTLEEF--GDELQPPFPCLDELLFDVPHSAGVLNC  97

Query  1130  PLFLIQVTRLRCGGFIFTLRMNHTMADASGLVHFLNTIAEIARGAEAPAVQPVWQREFFS  951
             PL LIQVTRL CGGFIF+LR+NHTM+DA GLV F+  + E+ARGA AP+V PVW RE  +
Sbjct  98    PLLLIQVTRLICGGFIFSLRLNHTMSDAPGLVQFMTAVGEMARGASAPSVLPVWCRELLN  157

Query  950   ARNPPRITCTHFEYEEEPAADSMVTNIPLDNLVHRSFLFGPTEISVLRSSLPPHLRKCST  771
             ARNPP++TCTH EY+E P  D+  T IPLD++VH+SF FGP+E+S LR  +P HLRKCST
Sbjct  158   ARNPPQVTCTHHEYDEVP--DTKDTIIPLDDMVHKSFFFGPSEVSALRRFVPYHLRKCST  215

Query  770   VEILTALVWRCRTIALGFHPDEEVRMLLLINARFKFK-DTPMPSGYTGNAFAYPGAKTTA  594
              E+LTA++WRCRT++L   P+EEVR+L ++NAR   + + P+P+GY GNAF +P A TTA
Sbjct  216   FELLTAVLWRCRTMSLKPDPEEEVRILCIVNARSNARFNPPLPTGYYGNAFVFPVAVTTA  275

Query  593   GKLRKNPLGYAVELVTSIKRCFSEEYMQSMVDLMVLKGRPPFHVAGSFIMSDLTRSKISD  414
              KL KNPL YA+ELV   K   +EEYM+S+ DLMVLKGRP F V  ++++SD+TR+   +
Sbjct  276   AKLSKNPLAYALELVKKTKTDVTEEYMKSVADLMVLKGRPHFTVVRTYLVSDVTRAGFRE  335

Query  413   VDYGWGKPVFGGPAHGGAGDVPGVITFHVPYENKKGENGTLIPICLPAFALDKFVNEL  240
             VD+GWGK V+GGPA GG G +PGV +F++P++NKKGENG ++PICLP FA++ F+ EL
Sbjct  336   VDFGWGKAVYGGPAKGGVGAIPGVASFYIPFKNKKGENGIVVPICLPGFAMETFIKEL  393



>ref|XP_002264599.1| PREDICTED: benzyl alcohol O-benzoyltransferase [Vitis vinifera]
 emb|CBI26419.3| unnamed protein product [Vitis vinifera]
Length=459

 Score =   472 bits (1215),  Expect = 2e-159, Method: Compositional matrix adjust.
 Identities = 230/398 (58%), Positives = 305/398 (77%), Gaps = 6/398 (2%)
 Frame = -1

Query  1415  FYRNEPSMSGKDPVQVIRQALAKALVFFYPFAGRLREGPGRKLMVDCTGEGVMFIEADAD  1236
             FY+  PSM G+DP +VI+ A+A+ALVF+YPFAGRLRE  GRKL+V+CTGEG++FIEADAD
Sbjct  50    FYKKVPSMHGRDPAKVIKDAVARALVFYYPFAGRLREEAGRKLVVECTGEGIVFIEADAD  109

Query  1235  ATLQHFAIGGELKPPFPCFDQLLYNVPGSAEILNSPLFLIQVTRLRCGGFIFTLRMNHTM  1056
              TL+ F  G  L+PPFP  ++L+Y+ PGS  +LNSPL LIQVTRL+CGGFIF LR+NHTM
Sbjct  110   VTLEQF--GDALQPPFPGLEELIYDAPGSGGVLNSPLLLIQVTRLQCGGFIFGLRLNHTM  167

Query  1055  ADASGLVHFLNTIAEIARGAEAPAVQPVWQREFFSARNPPRITCTHFEYEEEPAADSMVT  876
             +DA+GLV F++ + E+ARGA AP++ PVW+R+  +AR+PPR+T TH EY+E   AD+  T
Sbjct  168   SDAAGLVQFMSAVGEMARGASAPSIPPVWRRDLLNARDPPRVTRTHHEYDE--VADTKGT  225

Query  875   NIPLDNLVHRSFLFGPTEISVLRSSLPPHLRKCSTVEILTALVWRCRTIALGFHPDEEVR  696
              IPLD++ HRSF FGPTE + LR  L PHLR CST E+LTA +WRCRTIAL   P+EEVR
Sbjct  226   IIPLDDMEHRSFFFGPTEFAALRRLLSPHLRTCSTFELLTACLWRCRTIALRPDPEEEVR  285

Query  695   MLLLINARFKFKDTPMPSGYTGNAFAYPGAKTTAGKLRKNPLGYAVELVTSIKRCFSEEY  516
             +L ++NAR + +  P+P+GY GN F +P A ++AGKL +NPL YA++LV   K    +EY
Sbjct  286   VLCIVNARSRLQ-PPLPAGYYGNVFGFPVALSSAGKLCRNPLEYALDLVKGAKNSVDQEY  344

Query  515   MQSMVDLMVLKGRPPFHVAGSFIMSDLTRSKISDVDYGWGKPVFGGPAHGGAGDVPGVIT  336
             M+S+ DLMV  GR  F V  S+++SDLTR+   DVD+GWGK V+GG A GG G +PGV +
Sbjct  345   MKSVADLMVSTGRRHFTVVRSYLVSDLTRAGFGDVDFGWGKAVYGGAAKGGVGAIPGVAS  404

Query  335   FHVPYENKKGENGTLIPICLPAFALDKFVNELANTFLR  222
             F++P+ N KGE+G ++P CLPA A++ FV EL N+ L+
Sbjct  405   FYIPFRNHKGEDGIVVPFCLPAAAMEIFVKEL-NSLLK  441



>emb|CDP09539.1| unnamed protein product [Coffea canephora]
Length=437

 Score =   469 bits (1206),  Expect = 2e-158, Method: Compositional matrix adjust.
 Identities = 230/404 (57%), Positives = 289/404 (72%), Gaps = 42/404 (10%)
 Frame = -1

Query  1415  FYRNE------PSMSGKDPVQVIRQALAKALVFFYPFAGRLREGPGRKLMVDCTGEGVMF  1254
             FYRN        S    DPV+VIR+A+AKALVF+YP A RLREGPGRKLMV+CTGEGV+F
Sbjct  54    FYRNRDDPGINESRRRSDPVKVIREAIAKALVFYYPLAARLREGPGRKLMVECTGEGVLF  113

Query  1253  IEADADATLQHFAIGGELKPPFPCFDQLLYNVPGSAEILNSPLFLIQVTRLRCGGFIFTL  1074
             IEADAD TL+ F  G  ++PPFPC ++LLY+VP S  IL+ P+ LIQVTRLRCGGFIF L
Sbjct  114   IEADADVTLEQF--GDAIQPPFPCLEELLYDVPHSGGILHCPIVLIQVTRLRCGGFIFAL  171

Query  1073  RMNHTMADASGLVHFLNTIAEIARGAEAPAVQPVWQREFFSARNPPRITCTHFEYEEEPA  894
             RMNHT+AD  G+  F+N + EIAR A AP++QPVWQRE   AR+PPR+TC+H EY+E   
Sbjct  172   RMNHTIADGVGIAQFMNAVGEIARAASAPSIQPVWQRELLYARDPPRVTCSHHEYDEV-V  230

Query  893   ADSMVTNIPLDNLVHRSFLFGPTEISVLRSSLPPHL-RKCSTVEILTALVWRCRTIALGF  717
              D+  T +PLD++VHRSF FGP E+S LR S+P  L  +CST +ILTA +WRC+TIAL +
Sbjct  231   VDTKGTIVPLDDMVHRSFFFGPAEVSALRKSIPLDLSHRCSTFDILTAFLWRCQTIALQY  290

Query  716   HPDEEVRMLLLINARFKFKDTPMPSGYTGNAFAYPGAKTTAGKLRKNPLGYAVELVTSIK  537
              P+EEVR++ ++NARFKF + P+P GY GNA AYP A TTAG+L + P+GYAVELVT  K
Sbjct  291   DPNEEVRVICIVNARFKF-NPPLPQGYYGNAIAYPTALTTAGELCEKPVGYAVELVTKAK  349

Query  536   RCFSEEYMQSMVDLMVLKGRPPFHVAGSFIMSDLTRSKISDVDYGWGKPVFGGPAHGGAG  357
             R  +E+YM+S+ DLM+                         VD+GWGKPV+GGPA G   
Sbjct  350   RVVTEDYMKSVADLMI-------------------------VDFGWGKPVYGGPAQG---  381

Query  356   DVPGVITFHVPYENKKGENGTLIPICLPAFALDKFVNELANTFL  225
                 V  FH+P++NKKGE G ++PI LP  A+D+FVNEL N FL
Sbjct  382   ---TVACFHIPFKNKKGETGRVVPIFLPGLAMDRFVNELENFFL  422



>ref|XP_008462820.1| PREDICTED: benzyl alcohol O-benzoyltransferase-like [Cucumis 
melo]
Length=446

 Score =   466 bits (1198),  Expect = 3e-157, Method: Compositional matrix adjust.
 Identities = 219/392 (56%), Positives = 283/392 (72%), Gaps = 4/392 (1%)
 Frame = -1

Query  1415  FYRNEPSMSGKDPVQVIRQALAKALVFFYPFAGRLREGPGRKLMVDCTGEGVMFIEADAD  1236
             FY   P+M G+DPV+VI++A++K LVF+YPFAGR+RE  G+KL V+CTGEGV+FIEA+AD
Sbjct  53    FYPQNPNMEGRDPVKVIKEAVSKTLVFYYPFAGRVRERFGKKLFVECTGEGVLFIEANAD  112

Query  1235  ATLQHFAIGGELKPPFPCFDQLLYNVPGSAEILNSPLFLIQVTRLRCGGFIFTLRMNHTM  1056
              +LQ F     L+PPFPC DQLLY+VP S  IL+SPL LIQVTRL+CGGFIF +R NHT+
Sbjct  113   VSLQQFQDSSSLQPPFPCMDQLLYDVPDSDGILDSPLLLIQVTRLKCGGFIFAVRFNHTI  172

Query  1055  ADASGLVHFLNTIAEIARGAEAPAVQPVWQREFFSARNPPRITCTHFEYEEEPAADSMVT  876
              D  G+  FL  IAE+ARGA AP+V PVW+R   ++R+PPR+TC H EY+E    D   T
Sbjct  173   TDGIGMAQFLKAIAEMARGALAPSVLPVWKRALLNSRDPPRVTCLHHEYDE--VNDVNDT  230

Query  875   NIPLDNLVHRSFLFGPTEISVLRSSLPPHLRKCSTVEILTALVWRCRTIALGFHPDEEVR  696
              I LDN+V  SF FG TEIS++R +LP H     + E+L   +WR RTIAL   P+EEVR
Sbjct  231   TITLDNMVQHSFFFGLTEISIIRKTLPTHFHNYPSAELLMIFIWRLRTIALQLSPEEEVR  290

Query  695   MLLLINARFKFKDTPMPSGYTGNAFAYPGAKTTAGKLRKNPLGYAVELVTSIKRCFSEEY  516
             +L L+N R KF   P+  GY GNAFA+P A TTA KL +N LGYA+ELV + K   +EEY
Sbjct  291   LLCLVNLRTKFNYLPL--GYYGNAFAFPAAVTTAAKLSQNSLGYAIELVENSKAKVTEEY  348

Query  515   MQSMVDLMVLKGRPPFHVAGSFIMSDLTRSKISDVDYGWGKPVFGGPAHGGAGDVPGVIT  336
             ++SMVD M +KGRP F V GSF+M+DLT +   DVD+GW K +F GPA G  G VPG+I+
Sbjct  349   VKSMVDFMTVKGRPHFTVVGSFLMADLTEAGFEDVDFGWEKAIFAGPAIGKVGLVPGLIS  408

Query  335   FHVPYENKKGENGTLIPICLPAFALDKFVNEL  240
             F +P + + GE G ++P+CLPA A+++   EL
Sbjct  409   FCIPSKTRHGEKGIVVPLCLPAPAMERLAEEL  440



>gb|KHN43217.1| Benzyl alcohol O-benzoyltransferase [Glycine soja]
Length=408

 Score =   464 bits (1193),  Expect = 6e-157, Method: Compositional matrix adjust.
 Identities = 229/387 (59%), Positives = 284/387 (73%), Gaps = 9/387 (2%)
 Frame = -1

Query  1394  MSGKDPVQVIRQALAKALVFFYPFAGRLREGPGRKLMVDCTGEGVMFIEADADATLQHFA  1215
             M+GKDPV+VIRQALAK LVF+YPFAGRLREGP RKLMVDCTGEGVMFIEADAD TL  F 
Sbjct  1     MAGKDPVEVIRQALAKTLVFYYPFAGRLREGPDRKLMVDCTGEGVMFIEADADVTLYQF-  59

Query  1214  IGGE-LKPPFPCFDQLLYNVPGSAEILNSPLFLIQVTRLRCGGFIFTLRMNHTMADASGL  1038
              GGE L+PPFPCF +LLYNVP + EI N+PL LIQVTRL+C GFI   R NHT+ DA G+
Sbjct  60    -GGEALQPPFPCFQELLYNVPETEEITNTPLLLIQVTRLKCDGFILAFRFNHTIGDAGGI  118

Query  1037  VHFLNTIAEIARG-AEAPAVQPVWQREFFSARNPPRITCTHFEYEEEPAADSMVTNIPLD  861
               F+N  +E+AR  A  P++ PVW+RE   AR+PPRITC+H EY++    D+++T    D
Sbjct  119   SQFMNAWSEMARSHATKPSIAPVWRRELLRARDPPRITCSHREYDQ--LEDTIITP-SND  175

Query  860   NLVHRSFLFGPTEISVLRSSLPPHLRKCSTVEILTALVWRCRTIALGFHPDEEVRMLLLI  681
             N+V RSF FGPTEI+ +R  +P HLR+CST +++TA  WRCRT AL   PDEEVRM+ +I
Sbjct  176   NMVQRSFFFGPTEIAAIRRLVPHHLRQCSTFDLITACFWRCRTKALQMKPDEEVRMMCII  235

Query  680   NARFKFKDTPMPSGYTGNAFAYPGAKTTAGKLRKNPLGYAVELVTSIKRCFSEEYMQSMV  501
             NAR +F + P+P GY GNA A P A TTAGKL  NP GYAVEL+  +KR  +EEYM S+ 
Sbjct  236   NARARF-NPPLPVGYYGNAVALPAAVTTAGKLCGNPFGYAVELINKLKREVTEEYMHSVA  294

Query  500   DLMVLKGRPPFHVAGSFIMSDLTRSKISDVDYGWGKPVFGGPAHGGAGDVPGVITFHVPY  321
              LMV+K R  F    S I+SDLTR++  +VD+GWG  V+GG A  GAG  P   T+HV Y
Sbjct  295   YLMVIKERCSFTSVRSCIISDLTRARFREVDFGWGDAVYGGVAQAGAGTFPAA-TYHVSY  353

Query  320   ENKKGENGTLIPICLPAFALDKFVNEL  240
             +N KGE G ++PI LP  ++++F  EL
Sbjct  354   KNAKGEEGIVLPILLPTESMNRFAKEL  380



>ref|XP_011085899.1| PREDICTED: benzyl alcohol O-benzoyltransferase-like [Sesamum 
indicum]
Length=464

 Score =   464 bits (1193),  Expect = 4e-156, Method: Compositional matrix adjust.
 Identities = 227/399 (57%), Positives = 288/399 (72%), Gaps = 6/399 (2%)
 Frame = -1

Query  1415  FYRNEPSMSGKDPVQVIRQALAKALVFFYPFAGRLREGPGRKLMVDCTGEGVMFIEADAD  1236
             F+   P+M  KDPV+V R ALAKALVF+YPFAGRLRE  GRKL+V+CTGEG +FIEADAD
Sbjct  50    FFPKNPAMDRKDPVKVFRDALAKALVFYYPFAGRLRETAGRKLVVECTGEGALFIEADAD  109

Query  1235  ATLQHFAIGGELKPPFPCFDQLLYNVPGSAEILNSPLFLIQVTRLRCGGFIFTLRMNHTM  1056
               LQ F  G  L+PPFPC ++LLY+VPGS  ++N PL LIQVTRL+CGGFIF  R NHTM
Sbjct  110   VGLQQF--GDTLQPPFPCLEELLYDVPGSGGMVNCPLLLIQVTRLKCGGFIFAFRANHTM  167

Query  1055  ADASGLVHFLNTIAEIARGAEAPAVQPVWQREFFSARNPPRITCTHFEYEEEPAADSMVT  876
             +D  GL  F +T+AE+ARGAE P+V PVWQR   SAR+PP ++  H EYE  P  D+  T
Sbjct  168   SDGFGLFQFASTMAELARGAEIPSVLPVWQRHLVSARDPPHVSYMHDEYENIP--DAKET  225

Query  875   NIPLDNLVHRSFLFGPTEISVLRSSLPPHLRKCSTVEILTALVWRCRTIALGFHPDEEVR  696
              IPL+N+V RSF FGP EIS LR  L PHLR+C+T E+L A +WRCRTIA+   P+EEVR
Sbjct  226   LIPLENMVQRSFFFGPGEISALRRHLSPHLRRCTTFELLAACIWRCRTIAISPDPNEEVR  285

Query  695   MLLLINARFKFKDTPMPSGYTGNAFAYPGAKTTAGKLRKNPLGYAVELVTSIKRCFSEEY  516
             +L  +N R  F    +P+GY GN  A P A +TA  L K PL +A+ELV   K   +E+Y
Sbjct  286   ILCFVNGRRLFNPL-LPAGYYGNVVATPLAISTAENLCKQPLNFALELVMKAKSKVTEDY  344

Query  515   MQSMVDLMVLKGRPPFHV-AGSFIMSDLTRSKISDVDYGWGKPVFGGPAHGGAGDVPGVI  339
             ++S+ +LM+++GRP F V   ++I+SDLT     ++DYGWG PVFGGPA GGAG +PG++
Sbjct  345   IKSVANLMIIRGRPHFAVDMRTYIVSDLTHVASDNLDYGWGAPVFGGPAKGGAGVIPGLL  404

Query  338   TFHVPYENKKGENGTLIPICLPAFALDKFVNELANTFLR  222
             +FH+P +N KGE G L+PICLPA A++ FV EL     R
Sbjct  405   SFHIPIKNIKGERGKLVPICLPANAMEVFVKELETMVKR  443



>gb|EYU41395.1| hypothetical protein MIMGU_mgv1a006288mg [Erythranthe guttata]
Length=449

 Score =   462 bits (1189),  Expect = 8e-156, Method: Compositional matrix adjust.
 Identities = 226/396 (57%), Positives = 290/396 (73%), Gaps = 14/396 (4%)
 Frame = -1

Query  1415  FYRNEPSMSGKDPVQVIRQALAKALVFFYPFAGRLREGPGRKLMVDCTGEGVMFIEADAD  1236
             FYRN PS+   DPV+VIR+A+AKALV +YPFAGRLRE   RKL+V+CTGEGVMFIEADAD
Sbjct  51    FYRNIPSIEA-DPVEVIRKAIAKALVPYYPFAGRLREQAARKLVVECTGEGVMFIEADAD  109

Query  1235  ATLQHFAIGGELKPPFPCFDQLLYNVPGSAEILNSPLFLIQVTRLRCGGFIFTLRMNHTM  1056
               L+ F  G E++PP PC D+LLY+VPGS  I+N PL LIQVTRL+ GGFIF+LR NHTM
Sbjct  110   VALEQF--GDEIRPPVPCLDELLYDVPGSGGIINCPLLLIQVTRLKYGGFIFSLRFNHTM  167

Query  1055  ADASGLVHFLNTIAEIARGAEAPAVQPVWQREFFSARNPPRITCTHFEYEEEPAADSMVT  876
             +D +G+  F++ + E ARGAEAP++QP+W+R   SARNPPR+TCTH EY      D +V 
Sbjct  168   SDGTGIAEFMSAVGEFARGAEAPSIQPIWERHILSARNPPRVTCTHHEY------DDVVN  221

Query  875   NIPL---DNLVHRSFLFGPTEISVLRSSLPPHL-RKCSTVEILTALVWRCRTIALGFHPD  708
             NIP+    ++VHRSF FG  EIS L   LPPHL R C+  E+LTA +WRCRTIAL   P+
Sbjct  222   NIPIILDGDMVHRSFFFGAPEISALDGRLPPHLHRNCTKFELLTACLWRCRTIALSPDPN  281

Query  707   EEVRMLLLINARFKFKDTPMPSGYTGNAFAYPGAKTTAGKLRKNPLGYAVELVTSIKRCF  528
             EEVR+L +IN R +F + P+P+GY GNAF    A  TA  L KNP  YAVELV   K   
Sbjct  282   EEVRILCVINCRKRF-NPPLPAGYYGNAFVLAAAIATAESLSKNPFHYAVELVMKAKTKA  340

Query  527   SEEYMQSMVDLMVLKGRPPFHVAGSFIMSDLTRSKISDVDYGWGKPVFGGPAHGGAGDVP  348
             +EE+++S+ DLMV++GRP F + G++ +SD+      DVD+GWGKPV+GGPA G  G VP
Sbjct  341   TEEHVKSVADLMVIRGRPHFMLVGNYAVSDVRHLGFGDVDFGWGKPVYGGPAKGEVGVVP  400

Query  347   GVITFHVPYENKKGENGTLIPICLPAFALDKFVNEL  240
              + ++++P++NKKGENG ++PI L   A+D FV EL
Sbjct  401   ELSSYYIPFKNKKGENGIIVPISLQKNAMDVFVKEL  436



>ref|XP_003521737.1| PREDICTED: benzyl alcohol O-benzoyltransferase-like [Glycine 
max]
Length=475

 Score =   463 bits (1191),  Expect = 8e-156, Method: Compositional matrix adjust.
 Identities = 224/399 (56%), Positives = 295/399 (74%), Gaps = 8/399 (2%)
 Frame = -1

Query  1415  FYRNEPSMSGKDPVQVIRQALAKALVFFYPFAGRLREGPGRKLMVDCTGEGVMFIEADAD  1236
             FY NEPSM+GKDP +VIR+ALA+ LVF+YPFAGR+REGPGRKL+VDCTGEG+MFIEADAD
Sbjct  51    FYGNEPSMAGKDPAKVIREALAQTLVFYYPFAGRIREGPGRKLVVDCTGEGLMFIEADAD  110

Query  1235  ATLQHFAIGGELKPPFPCFDQLLYNVPGSAEILNSPLFLIQVTRLRCGGFIFTLRMNHTM  1056
             ATL    +G  L+PPFPCF+QLLY+VPGS  +++ PL L QVTR +CGGF   +R+NHTM
Sbjct  111   ATLDQ--LGDTLQPPFPCFEQLLYDVPGSEGVIDCPLMLFQVTRFKCGGFALAVRLNHTM  168

Query  1055  ADASGLVHFLNTIAEIARGAEAPAVQPVWQREFFSARNPPRITCTHFEYEEEPAADSMVT  876
             +D +G+  F+NT+AE+A+GA  P+V PVW+RE   AR+PP ITC H EYE+ P  ++M  
Sbjct  169   SDGAGIALFMNTLAEMAQGATEPSVPPVWRRELLQARDPPHITCNHREYEQIP--NNMEG  226

Query  875   NIPL--DNLVHRSFLFGPTEISVLRSSLPPHLRKCSTVEILTALVWRCRTIALGFHPDEE  702
              IP   + +V RSF FG ++I+ LR  +P +LRKC++ +++TA  WRCRT AL    DE+
Sbjct  227   IIPSYENKMVLRSFFFGASDIAALRRLVPHYLRKCTSFDLITACFWRCRTKALEIDADED  286

Query  701   VRMLLLINARFKFKDTPMPSGYTGNAFAYPGAKTTAGKLRKNPLGYAVELVTSIKRCFSE  522
             VRM++++NAR +F + P+P+GY GNAFAYP A TTAGKL +NP GYAVEL+  +K   +E
Sbjct  287   VRMMVIVNARARF-NPPLPAGYYGNAFAYPAAVTTAGKLCENPFGYAVELINKLKGEVTE  345

Query  521   EYMQSMVDLMVLKGRPPFHVAGSFIMSDLTRSKISDVDYGWGKPVFGGPAHGGAGDVPGV  342
             EYM S+ DLMV  GR  F    SFI+SDL       +D+GWG+ ++GG A GGAG  P V
Sbjct  346   EYMHSVADLMVTNGRCLFTTVRSFIVSDLRHFGFKQIDFGWGRALYGGVAKGGAGPFPAV  405

Query  341   ITFHVPYENKKGENGTLIPICLPAFALDKFVNELANTFL  225
               + + ++N KGE G L+PI LPA A+DKF NEL +  +
Sbjct  406   F-YLMAHKNAKGEEGILLPIWLPAKAMDKFANELDHMLI  443



>ref|XP_002466979.1| hypothetical protein SORBIDRAFT_01g017800 [Sorghum bicolor]
 gb|EER93977.1| hypothetical protein SORBIDRAFT_01g017800 [Sorghum bicolor]
Length=465

 Score =   462 bits (1190),  Expect = 9e-156, Method: Compositional matrix adjust.
 Identities = 219/395 (55%), Positives = 287/395 (73%), Gaps = 5/395 (1%)
 Frame = -1

Query  1415  FYRNEPSMSGKDPVQVIRQALAKALVFFYPFAGRLREGPGRKLMVDCTGEGVMFIEADAD  1236
             FYR    M G+DP  VIR A+A+ALV +YPFAGRLRE   RKL V+CTGEGV+FIEADAD
Sbjct  48    FYRRSALMGGRDPAPVIRDAVARALVHYYPFAGRLRELQARKLAVECTGEGVLFIEADAD  107

Query  1235  ATLQHFAIGGELKPPFPCFDQLLYNVPGSAEILNSPLFLIQVTRLRCGGFIFTLRMNHTM  1056
               L HF  G  L+PPFPC D+L+++VPGS+++L SPL L QVTRL CGGFI  +R++HTM
Sbjct  108   VRLDHF--GDALQPPFPCLDELIFDVPGSSQVLGSPLLLFQVTRLACGGFILGVRLHHTM  165

Query  1055  ADASGLVHFLNTIAEIARGAEAPAVQPVWQREFFSARNPPRITCTHFEYEEEPAADSMVT  876
             ADA GLV FL  +AE+ARGA AP V+PVW RE   AR+PPR    H EY+E P  D+  T
Sbjct  166   ADAQGLVQFLGAVAELARGAAAPTVRPVWCRELLEARDPPRPAFAHREYDEVP--DTKGT  223

Query  875   NIPLDNLVHRSFLFGPTEISVLRSSLPPHLR-KCSTVEILTALVWRCRTIALGFHPDEEV  699
              IPLD++VHRSF FG  E++ +R++LPP LR + ST ++LT L+W+CRT AL    DE +
Sbjct  224   LIPLDDMVHRSFFFGRQELAAIRANLPPALRARASTFDLLTGLLWKCRTAALAPDADEVM  283

Query  698   RMLLLINARFKFKDTPMPSGYTGNAFAYPGAKTTAGKLRKNPLGYAVELVTSIKRCFSEE  519
             RM+ ++NAR       +P GY GNAFA+P A  TAG+L  +PLGYAVELV   K   + E
Sbjct  284   RMICIVNARGGKSGIAIPEGYYGNAFAFPVAVATAGELAASPLGYAVELVKRAKGEVNVE  343

Query  518   YMQSMVDLMVLKGRPPFHVAGSFIMSDLTRSKISDVDYGWGKPVFGGPAHGGAGDVPGVI  339
             YM+S+ DLMVL+GRP F    +++ SD+T++   D+D+GWGKPV+GGPA GG G +PGV 
Sbjct  344   YMRSVADLMVLRGRPHFTAVRAYLASDVTKAGFGDLDFGWGKPVYGGPAKGGVGAIPGVA  403

Query  338   TFHVPYENKKGENGTLIPICLPAFALDKFVNELAN  234
             +F +P++N KGE+G ++P+CLP  A++ FV E+  
Sbjct  404   SFFIPFKNAKGEDGIVVPMCLPGLAMETFVQEMGK  438



>ref|XP_010040517.1| PREDICTED: benzyl alcohol O-benzoyltransferase-like isoform X2 
[Eucalyptus grandis]
Length=461

 Score =   461 bits (1187),  Expect = 2e-155, Method: Compositional matrix adjust.
 Identities = 220/392 (56%), Positives = 287/392 (73%), Gaps = 7/392 (2%)
 Frame = -1

Query  1415  FYRNEPSMSGKDPVQVIRQALAKALVFFYPFAGRLREGPGRKLMVDCTGEGVMFIEADAD  1236
             FYR + +  G+DP + IR+ LA ALVF+YPFAGRLRE PGRKL+VDC  EGV F+EA AD
Sbjct  53    FYRGDDT--GRDPARAIREGLANALVFYYPFAGRLREWPGRKLVVDCNEEGVAFVEASAD  110

Query  1235  ATLQHFAIGGELKPPFPCFDQLLYNVPGSAEILNSPLFLIQVTRLRCGGFIFTLRMNHTM  1056
              TL  F  G  L PPFPC ++LL+++PGS  +L+SPL LIQVTRL+CGGFIF + +NHTM
Sbjct  111   VTLDQF--GDALHPPFPCLEELLFDIPGSFSVLDSPLLLIQVTRLKCGGFIFAVHLNHTM  168

Query  1055  ADASGLVHFLNTIAEIARGAEAPAVQPVWQREFFSARNPPRITCTHFEYEEEPAADSMVT  876
             +DA+GLV  L  + E+ARGA AP++ PVWQRE   AR+PPRITC H E+++   AD+  T
Sbjct  169   SDATGLVQLLKAVGEMARGANAPSILPVWQRELLDARDPPRITCNHHEFDQ--VADTKGT  226

Query  875   NIPLDNLVHRSFLFGPTEISVLRSSLPPHLRKCSTVEILTALVWRCRTIALGFHPDEEVR  696
               PLD++ HRSF+F P ++S+LR+ LPPH R  ST EILTA VWRCRTIA    P+EEVR
Sbjct  227   LNPLDDMDHRSFIFSPAQMSILRNGLPPHQRVSSTFEILTAFVWRCRTIAHQHDPEEEVR  286

Query  695   MLLLINARFKFKDTPMPSGYTGNAFAYPGAKTTAGKLRKNPLGYAVELVTSIKRCFSEEY  516
             +L ++NAR KF + P+P+GY GNAFA PGA T+AGKL +NPLGYA+ELV   K   +EEY
Sbjct  287   LLCIVNARSKF-NPPLPAGYYGNAFASPGAVTSAGKLCQNPLGYALELVKKAKAEATEEY  345

Query  515   MQSMVDLMVLKGRPPFHVAGSFIMSDLTRSKISDVDYGWGKPVFGGPAHGGAGDVPGVIT  336
             M+S+ DLMV++GRP      SF++SD T+    DVD+GWGK ++GG A G  G  PG+ +
Sbjct  346   MRSLADLMVIRGRPRGTEVRSFMVSDTTKVGFGDVDFGWGKAMYGGQATGAVGANPGLAS  405

Query  335   FHVPYENKKGENGTLIPICLPAFALDKFVNEL  240
             F++   N +GE   ++ +CLPA  + +FV EL
Sbjct  406   FYILSRNYQGETSIIVTVCLPAPVMQRFVQEL  437



>ref|XP_004982683.1| PREDICTED: benzyl alcohol O-benzoyltransferase-like [Setaria 
italica]
Length=463

 Score =   461 bits (1187),  Expect = 2e-155, Method: Compositional matrix adjust.
 Identities = 223/397 (56%), Positives = 287/397 (72%), Gaps = 7/397 (2%)
 Frame = -1

Query  1415  FYRNEPSMSGKDPVQVIRQALAKALVFFYPFAGRLREGPGRKLMVDCTGEGVMFIEADAD  1236
             F+R    M  +DP  VIR A+A+ALV +YPFAGRLRE  GRKL VDCTGEGV+FIEADAD
Sbjct  48    FHRRSALMGARDPAPVIRGAIARALVHYYPFAGRLRELEGRKLAVDCTGEGVLFIEADAD  107

Query  1235  ATLQHFAIGGELKPPFPCFDQLLYNVPGSAEILNSPLFLIQVTRLRCGGFIFTLRMNHTM  1056
               L HF  G  L+PPFPC D+L+++VPGS+E+L SPL L QVTRL CGGFI  +R++HTM
Sbjct  108   VRLDHF--GDALQPPFPCLDELIFDVPGSSEVLGSPLLLFQVTRLACGGFILGVRLHHTM  165

Query  1055  ADASGLVHFLNTIAEIARGAEAPAVQPVWQREFFSARNPPRITCTHFEYEEEPAADSMVT  876
             ADA GLV FL  +AE+ARGA AP+V+PVW RE   AR+PPR    H EY+  P  D+  T
Sbjct  166   ADAQGLVQFLGAVAELARGAAAPSVRPVWGRELLEARDPPRPAFAHREYDVVP--DTKGT  223

Query  875   NIPLDNLVHRSFLFGPTEISVLRSSLPPHLR-KCSTVEILTALVWRCRTIALGFHPDEEV  699
              IPLD++VHRSF FG  E++ +R+ LPPHLR + ST ++LT L+WRCRT+AL    DEE+
Sbjct  224   IIPLDDMVHRSFFFGRREVAAVRAHLPPHLRSRASTFDLLTGLLWRCRTVALAPDADEEM  283

Query  698   RMLLLINARFKFKD--TPMPSGYTGNAFAYPGAKTTAGKLRKNPLGYAVELVTSIKRCFS  525
             RM+ ++NAR         +P GY GNAFA+P A  TAG L   PLG+AVELV   K    
Sbjct  284   RMICIVNARGGKSGGGAAIPEGYYGNAFAFPVAVATAGDLAARPLGHAVELVKRAKGEVG  343

Query  524   EEYMQSMVDLMVLKGRPPFHVAGSFIMSDLTRSKISDVDYGWGKPVFGGPAHGGAGDVPG  345
              EYM+S+ DLMVL+GRP F V  +++ SD+T++   D+D+GWGKPV+GGPA GG G +PG
Sbjct  344   AEYMRSVADLMVLRGRPHFTVVRAYLASDVTKAGFGDLDFGWGKPVYGGPAKGGVGAIPG  403

Query  344   VITFHVPYENKKGENGTLIPICLPAFALDKFVNELAN  234
             V +F +P++N KGE+G ++P+CLP  A++ FV EL  
Sbjct  404   VASFLIPFKNAKGEDGIVVPMCLPGPAMETFVRELGK  440



>ref|XP_010040516.1| PREDICTED: benzyl alcohol O-benzoyltransferase-like isoform X1 
[Eucalyptus grandis]
 gb|KCW45153.1| hypothetical protein EUGRSUZ_L01233 [Eucalyptus grandis]
Length=458

 Score =   461 bits (1186),  Expect = 3e-155, Method: Compositional matrix adjust.
 Identities = 220/392 (56%), Positives = 287/392 (73%), Gaps = 7/392 (2%)
 Frame = -1

Query  1415  FYRNEPSMSGKDPVQVIRQALAKALVFFYPFAGRLREGPGRKLMVDCTGEGVMFIEADAD  1236
             FYR + +  G+DP + IR+ LA ALVF+YPFAGRLRE PGRKL+VDC  EGV F+EA AD
Sbjct  50    FYRGDDT--GRDPARAIREGLANALVFYYPFAGRLREWPGRKLVVDCNEEGVAFVEASAD  107

Query  1235  ATLQHFAIGGELKPPFPCFDQLLYNVPGSAEILNSPLFLIQVTRLRCGGFIFTLRMNHTM  1056
              TL  F  G  L PPFPC ++LL+++PGS  +L+SPL LIQVTRL+CGGFIF + +NHTM
Sbjct  108   VTLDQF--GDALHPPFPCLEELLFDIPGSFSVLDSPLLLIQVTRLKCGGFIFAVHLNHTM  165

Query  1055  ADASGLVHFLNTIAEIARGAEAPAVQPVWQREFFSARNPPRITCTHFEYEEEPAADSMVT  876
             +DA+GLV  L  + E+ARGA AP++ PVWQRE   AR+PPRITC H E+++   AD+  T
Sbjct  166   SDATGLVQLLKAVGEMARGANAPSILPVWQRELLDARDPPRITCNHHEFDQ--VADTKGT  223

Query  875   NIPLDNLVHRSFLFGPTEISVLRSSLPPHLRKCSTVEILTALVWRCRTIALGFHPDEEVR  696
               PLD++ HRSF+F P ++S+LR+ LPPH R  ST EILTA VWRCRTIA    P+EEVR
Sbjct  224   LNPLDDMDHRSFIFSPAQMSILRNGLPPHQRVSSTFEILTAFVWRCRTIAHQHDPEEEVR  283

Query  695   MLLLINARFKFKDTPMPSGYTGNAFAYPGAKTTAGKLRKNPLGYAVELVTSIKRCFSEEY  516
             +L ++NAR KF + P+P+GY GNAFA PGA T+AGKL +NPLGYA+ELV   K   +EEY
Sbjct  284   LLCIVNARSKF-NPPLPAGYYGNAFASPGAVTSAGKLCQNPLGYALELVKKAKAEATEEY  342

Query  515   MQSMVDLMVLKGRPPFHVAGSFIMSDLTRSKISDVDYGWGKPVFGGPAHGGAGDVPGVIT  336
             M+S+ DLMV++GRP      SF++SD T+    DVD+GWGK ++GG A G  G  PG+ +
Sbjct  343   MRSLADLMVIRGRPRGTEVRSFMVSDTTKVGFGDVDFGWGKAMYGGQATGAVGANPGLAS  402

Query  335   FHVPYENKKGENGTLIPICLPAFALDKFVNEL  240
             F++   N +GE   ++ +CLPA  + +FV EL
Sbjct  403   FYILSRNYQGETSIIVTVCLPAPVMQRFVQEL  434



>ref|XP_010644575.1| PREDICTED: methanol O-anthraniloyltransferase-like [Vitis vinifera]
Length=445

 Score =   460 bits (1183),  Expect = 5e-155, Method: Compositional matrix adjust.
 Identities = 223/392 (57%), Positives = 279/392 (71%), Gaps = 8/392 (2%)
 Frame = -1

Query  1415  FYRNEPSMSGKDPVQVIRQALAKALVFFYPFAGRLREGPGRKLMVDCTGEGVMFIEADAD  1236
             FYRN P M GKDPV+VIR+ALAKALV++YPFAGRL EG  RKL+VDCTGEGV+FIEADAD
Sbjct  50    FYRNSPLMDGKDPVKVIREALAKALVYYYPFAGRLVEGSNRKLLVDCTGEGVLFIEADAD  109

Query  1235  ATLQHFAIGGELKPPFPCFDQLLYNVPGSAEILNSPLFLIQVTRLRCGGFIFTLRMNHTM  1056
              TL+H  +G  ++P  PCF++LLY+VPGS EIL  PL LIQVTRLRCGGF+  LR+NHTM
Sbjct  110   TTLEH--LGDAIQPHCPCFEELLYDVPGSGEILGCPLLLIQVTRLRCGGFVLALRLNHTM  167

Query  1055  ADASGLVHFLNTIAEIARGAEAPAVQPVWQREFFSARNPPRITCTHFEYEEEPAADSMVT  876
             +D+ GLV FLN ++E+ARGA+ P V PVW+RE  +ARNPPRITC H EYEE       + 
Sbjct  168   SDSPGLVQFLNAVSEMARGADVPPVLPVWERELLNARNPPRITCMHHEYEEVHDTRGTLG  227

Query  875   NIPLDNLVHRSFLFGPTEISVLRSSLPPHLRKCSTVEILTALVWRCRTIALGFHPDEEVR  696
              +   N VHRSF FGP EI  LR  +P  L  CST E+LTA VWRCRT+A G  PDE VR
Sbjct  228   VMDDHNTVHRSFFFGPKEIKALRKRIPQTLGPCSTFEVLTACVWRCRTVAFGVDPDETVR  287

Query  695   MLLLINARFKFKDTPMPSGYTGNAFAYPGAKTTAGKLRKNPLGYAVELVTSIKRCFSEEY  516
             +  L N R K +   +PSGY GNAFA P   T AG+L  NPLGYAV LV   K   SEEY
Sbjct  288   VSCLNNVRGK-RGLQLPSGYYGNAFANPAVVTKAGELCNNPLGYAVNLVKKAKAEMSEEY  346

Query  515   MQSMVDLMVLKGRPPFHVAGSFIMSDLTRSKISDVDYGWGKPVFGGPAHGGAGDVPGVIT  336
             ++S+ + MV+KGRP +   G+FI+SD TR    ++D+GWGKP++GG A   +     +I+
Sbjct  347   IRSVANFMVIKGRPSYTRTGNFIISDNTRVGFQEIDFGWGKPLYGGLAKAMS-----IIS  401

Query  335   FHVPYENKKGENGTLIPICLPAFALDKFVNEL  240
             F + + N KGE G ++PICLP   +++F  E+
Sbjct  402   FCLRFRNSKGEEGVVVPICLPLQVMERFGQEV  433



>ref|XP_008462818.1| PREDICTED: benzyl alcohol O-benzoyltransferase-like [Cucumis 
melo]
Length=461

 Score =   460 bits (1183),  Expect = 9e-155, Method: Compositional matrix adjust.
 Identities = 220/416 (53%), Positives = 292/416 (70%), Gaps = 21/416 (5%)
 Frame = -1

Query  1415  FYRNEPSMSGKDPVQVIRQALAKALVFFYPFAGRLREGPGRKLMVDCTGEGVMFIEADAD  1236
             FY N P M G DPV+VI++A+++ LVF+YPFAGRLREGPG+KL V+CT EG++FIEADA+
Sbjct  52    FYANNPRMEGSDPVKVIKKAISETLVFYYPFAGRLREGPGKKLFVECTAEGILFIEADAN  111

Query  1235  ATLQHFAIGGELKPPFPCFDQLLYNVPGSAEILNSPLFLIQVTRLRCGGFIFTLRMNHTM  1056
               LQ F  G  ++PPF   D +LYNVP S  I+NSPL L+QVTRLRCGGFIF +R+NHTM
Sbjct  112   VDLQQF--GDAVQPPFAFLDDVLYNVPNSDGIINSPLLLVQVTRLRCGGFIFAIRLNHTM  169

Query  1055  ADASGLVHFLNTIAEIARGAEAPAVQPVWQREFFSARNPPRITCTHFEYEEEPAADSMVT  876
              D  GL+ F+N + E+A G  AP+V PVWQR   +AR+PPR+T  H EY++    D+   
Sbjct  170   TDGFGLMQFMNAVCEMACGDTAPSVLPVWQRTLLNARDPPRVTHRHHEYDQ--VVDTKQI  227

Query  875   NIPLDNLVHRSFLFGPTEISVLRSSLPPHLRKCSTVEILTALVWRCRTIALGFHPDEEVR  696
             NIPL+ + HRS  FGPTEIS LR +LP HLR CS+ +++TA +WR RTIAL  +P++E+R
Sbjct  228   NIPLNEMAHRSVFFGPTEISTLRKTLPIHLRHCSSFDLITACLWRIRTIALQPNPNDEMR  287

Query  695   MLLLINARFKFKDTPMPSGYTGNAFAYPGAKTTAGKLRKNPLGYAVELVTSIKRCFSEEY  516
             +L + N R K K   +PSGY GN+FA P A  TAG L +NPL YAVEL+   K   +EEY
Sbjct  288   LLCVANLRSKSKY--LPSGYYGNSFALPAAVATAGNLCQNPLSYAVELIRKAKAKMTEEY  345

Query  515   MQSMVDLMVLKGRPPFHVAGSFIMSDLTRSKISDVDYGWGKPVFGGPAHGGAGDVPGVIT  336
             M+S+ D MV+ GRP      S+ +SD+T++    +D+GWGKP+FGGPA GG   VPG+ +
Sbjct  346   MKSVADFMVINGRPNLTAVRSYAVSDVTKTDFEKLDFGWGKPIFGGPAMGGVATVPGLTS  405

Query  335   FHVPYENKKGENGTLIPICLPAFALDKFV------------NELANT---FLRAAL  213
             F++ Y+NKKGE G ++P  LP  A+++FV            NE+ NT   F+RAAL
Sbjct  406   FYISYKNKKGEQGIVVPFSLPVQAMERFVVELDAVFKTKPLNEVGNTKKGFIRAAL  461



>ref|XP_011085894.1| PREDICTED: benzyl alcohol O-benzoyltransferase-like [Sesamum 
indicum]
Length=444

 Score =   459 bits (1182),  Expect = 9e-155, Method: Compositional matrix adjust.
 Identities = 222/398 (56%), Positives = 283/398 (71%), Gaps = 22/398 (6%)
 Frame = -1

Query  1415  FYRNEPSMSGKDPVQVIRQALAKALVFFYPFAGRLREGPGRKLMVDCTGEGVMFIEADAD  1236
             FYR  P+M+ KDPV VIR ALA+ALVF+YPFAGRLRE  GRKL+V+CTGEGV+FIEADAD
Sbjct  50    FYRRNPAMNRKDPVMVIRDALARALVFYYPFAGRLREAAGRKLVVECTGEGVLFIEADAD  109

Query  1235  ATLQHFAIGGELKPPFPCFDQLLYNVPGSAEILNSPLFLIQVTRLRCGGFIFTLRMNHTM  1056
              TLQ F                      S  ++N PL LIQVTRLRCGGFIF LR+NHTM
Sbjct  110   VTLQQFG-------------------DASGGVVNCPLLLIQVTRLRCGGFIFALRLNHTM  150

Query  1055  ADASGLVHFLNTIAEIARGAEAPAVQPVWQREFFSARNPPRITCTHFEYEEEPAADSMVT  876
             +DA G+V F+  + E+ARGAE P+V PVWQR+  +AR+PP + CTH EY++ P  D+  T
Sbjct  151   SDADGIVQFMAAVGELARGAEMPSVLPVWQRDLLNARDPPHVCCTHHEYDDVP--DTKGT  208

Query  875   NIPLDNLVHRSFLFGPTEISVLRSSLPPHLRKCSTVEILTALVWRCRTIALGFHPDEEVR  696
              IPLD++VHRSF FG  EIS LR  LP HLR C+T E+L A VWRCRTIA+   P+EEVR
Sbjct  209   LIPLDDMVHRSFFFGVAEISSLRRLLPSHLRSCTTFELLAACVWRCRTIAISPDPNEEVR  268

Query  695   MLLLINARFKFKDTPMPSGYTGNAFAYPGAKTTAGKLRKNPLGYAVELVTSIKRCFSEEY  516
              L ++N+R +F + P+P+GY GNAFA+P A +TA KL KNPLGYA+ELV   K   +EEY
Sbjct  269   FLCIVNSRKRF-NPPLPAGYYGNAFAFPAAISTAEKLSKNPLGYALELVRKTKADVTEEY  327

Query  515   MQSMVDLMVLKGRPPFHVAGSFIMSDLTRSKISDVDYGWGKPVFGGPAHGGAGDVPGVIT  336
             M+S+ DLMV++GRP F V  ++++S++  +   DVD+GWG   +GGPA GG   V GV++
Sbjct  328   MKSVADLMVIRGRPFFTVVRTYLVSNVIHAGFGDVDFGWGNAAYGGPAKGGIDPVLGVVS  387

Query  335   FHVPYENKKGENGTLIPICLPAFALDKFVNELANTFLR  222
             F+V  +N KGENG ++PICL A A++ FV EL     R
Sbjct  388   FYVASKNNKGENGIVVPICLAANAMEVFVKELEKMLKR  425



>ref|XP_007029776.1| Benzoyl coenzyme A: Benzyl alcohol benzoyl transferase [Theobroma 
cacao]
 gb|EOY10278.1| Benzoyl coenzyme A: Benzyl alcohol benzoyl transferase [Theobroma 
cacao]
Length=540

 Score =   461 bits (1187),  Expect = 3e-154, Method: Compositional matrix adjust.
 Identities = 221/392 (56%), Positives = 283/392 (72%), Gaps = 11/392 (3%)
 Frame = -1

Query  1415  FYRNEPSMSGKDPVQVIRQALAKALVFFYPFAGRLREGPGRKLMVDCTGEGVMFIEADAD  1236
             FYR  PSM G+DP +VIR ALAK LVF+YP+AGRLREGP RKL VDCTGEGV+F E DAD
Sbjct  147   FYRYSPSMQGRDPARVIRDALAKTLVFYYPYAGRLREGPNRKLTVDCTGEGVLFSEGDAD  206

Query  1235  ATLQHFAIGGELKPPFPCFDQLLYNVPGSAEILNSPLFLIQVTRLRCGGFIFTLRMNHTM  1056
              TL+ F  G EL+PPFPC ++LLY+VPG   +LN PL LIQVTRL+CGGFIF LR NHTM
Sbjct  207   VTLEQF--GEELQPPFPCMEELLYDVPGYGGVLNCPLLLIQVTRLKCGGFIFALRHNHTM  264

Query  1055  ADASGLVHFLNTIAEIARGAEAPAVQPVWQREFFSARNPPRITCTHFEYEEEPAADSMVT  876
             +DA GLV F++ + E+ARGA AP + PVW+R   +ARNPPRITCTH E+E+    ++ + 
Sbjct  265   SDAIGLVQFMSAMGEMARGALAPTISPVWERHLLNARNPPRITCTHHEFEQVIHTNANII  324

Query  875   NIPLDNLVHRSFLFGPTEISVLRSSLPPHLRKCSTVEILTALVWRCRTIALGFHPDEEVR  696
                LDN+VHRSF FGP ++S LR   PPH R+CST +I+ A +WRC TIAL   P+E+V 
Sbjct  325   T-QLDNMVHRSFFFGPKQVSALRRFAPPH-RRCSTFDIIAACLWRCHTIALQLDPNEDVG  382

Query  695   MLLLINARFKFKDTPMPSGYTGNAFAYPGAKTTAGKLRKNPLGYAVELVTSIKRCFSEEY  516
             ++ ++NAR KF + P+P GY GNA AYP   TT GKL +NPL YA+ELV   K   +EEY
Sbjct  383   IICVVNARSKF-NPPLPLGYYGNAIAYPATLTTVGKLCQNPLWYAIELVKQTKAKVTEEY  441

Query  515   MQSMVDLMVLKGRPPFHVAGSFIMSDLTRSKISDVDYGWGKPVFGGPAHGGAGDVPGVIT  336
             M+S  D +V +GRP   +  SF++SD+TR+K  DVD+GWGK  + G A    G      +
Sbjct  442   MKSTADFLVTRGRPALSLTRSFLVSDVTRAKFEDVDFGWGKAAYAGQAKIMDG------S  495

Query  335   FHVPYENKKGENGTLIPICLPAFALDKFVNEL  240
               +P+ NKKGE+G ++PICLPA  +++FV EL
Sbjct  496   HLLPFTNKKGEDGIIMPICLPATLMERFVKEL  527



>ref|XP_002319766.1| hypothetical protein POPTR_0013s07230g [Populus trichocarpa]
 gb|EEE95689.1| hypothetical protein POPTR_0013s07230g [Populus trichocarpa]
Length=456

 Score =   458 bits (1179),  Expect = 3e-154, Method: Compositional matrix adjust.
 Identities = 217/392 (55%), Positives = 288/392 (73%), Gaps = 8/392 (2%)
 Frame = -1

Query  1415  FYRNEPSMSGKDPVQVIRQALAKALVFFYPFAGRLREGPGRKLMVDCTGEGVMFIEADAD  1236
             FYR+ PSM GKDPV+VIR+A+AK LVF+YPFAGRLREG  RKLMV+CTGEG++FIEADAD
Sbjct  51    FYRHNPSMHGKDPVKVIREAIAKTLVFYYPFAGRLREGHNRKLMVECTGEGILFIEADAD  110

Query  1235  ATLQHFAIGGELKPPFPCFDQLLYNVPGSAEILNSPLFLIQVTRLRCGGFIFTLRMNHTM  1056
              TL+ F  G  L+PPFPC ++LL++VPGS+ +LN PL LIQV+RL+CGGF+F LR+NHTM
Sbjct  111   VTLEQF--GDPLQPPFPCLEELLFDVPGSSGVLNCPLLLIQVSRLKCGGFLFALRINHTM  168

Query  1055  ADASGLVHFLNTIAEIARGAEAPAVQPVWQREFFSARNPPRITCTHFEYEEEPAADSMVT  876
             +D  GLV F+  + E+ARGA AP+V PVW+R   +A +PPR+TC H  YEE   A S  +
Sbjct  169   SDGPGLVQFMAAVGEMARGANAPSVPPVWERHVLNATDPPRVTCRHRAYEE--VAGSKSS  226

Query  875   NIPLDNLVHRSFLFGPTEISVLRSSLPPHLRKCSTVEILTALVWRCRTIALGFHPDEEVR  696
              +  D+LVHRSF F P++I+ LR  +PPHL  CST EILTA +W CRTIAL   P+EE+R
Sbjct  227   ILTHDHLVHRSFFFSPSDITALRRLVPPHLSHCSTFEILTACLWICRTIALQPDPNEEMR  286

Query  695   MLLLINARFKFKDTPMPSGYTGNAFAYPGAKTTAGKLRKNPLGYAVELVTSIKRCFSEEY  516
             ++ L+NAR KF    +P GY GN F    A  TAG+L K P+GYA+ELV  +K   +EE+
Sbjct  287   VICLVNAREKFNPPLLPRGYYGNGFFLLAAVATAGELSKKPIGYALELVRKVKADMTEEH  346

Query  515   MQSMVDLMVLKGRPPFHVAGSFIMSDLTRSKISDVDYGWGKPVFGGPAHGGAGDVPGVIT  336
             M+S   LMV KGRP F V G++I+SDL R+ +   D+GWG  ++GG A      +P + +
Sbjct  347   MRSTASLMVSKGRPLFTVPGTYIVSDLRRAGLEKADFGWGNAIYGGTAKA----IPELAS  402

Query  335   FHVPYENKKGENGTLIPICLPAFALDKFVNEL  240
             F++P+ NKKGE+G ++P CLP+ A+++F  EL
Sbjct  403   FYIPFTNKKGEDGIVVPFCLPSPAVERFYKEL  434



>ref|NP_001152518.1| 10-deacetylbaccatin III 10-O-acetyltransferase [Zea mays]
 gb|ACG48011.1| 10-deacetylbaccatin III 10-O-acetyltransferase [Zea mays]
Length=462

 Score =   458 bits (1179),  Expect = 4e-154, Method: Compositional matrix adjust.
 Identities = 218/393 (55%), Positives = 285/393 (73%), Gaps = 5/393 (1%)
 Frame = -1

Query  1415  FYRNEPSMSGKDPVQVIRQALAKALVFFYPFAGRLREGPGRKLMVDCTGEGVMFIEADAD  1236
             FYR    M G+DP  V+R A+A+ALV +YPFAGRLRE  GRKL V+CTGEGV+FIEAD D
Sbjct  48    FYRRNALMGGRDPAPVVRDAVARALVHYYPFAGRLRELEGRKLAVECTGEGVLFIEADTD  107

Query  1235  ATLQHFAIGGELKPPFPCFDQLLYNVPGSAEILNSPLFLIQVTRLRCGGFIFTLRMNHTM  1056
               L HF  G  L+PPFPC ++L+++VPGS+E+L SPL L QVTRL CGGFI  +R++HTM
Sbjct  108   VRLDHF--GDALQPPFPCLEELIFDVPGSSEVLGSPLLLFQVTRLACGGFILGVRLHHTM  165

Query  1055  ADASGLVHFLNTIAEIARGAEAPAVQPVWQREFFSARNPPRITCTHFEYEEEPAADSMVT  876
             ADA GLV FL+ +AE+ARGA AP V+PVW RE   AR+PPR    H EY+E P  D+  T
Sbjct  166   ADAQGLVQFLDAVAELARGAAAPTVRPVWGRELLEARDPPRPAFAHREYDEVP--DTKGT  223

Query  875   NIPLDNLVHRSFLFGPTEISVLRSSLPPHLR-KCSTVEILTALVWRCRTIALGFHPDEEV  699
              IPLD++VHRSF FG  E++ +R++LPP LR + S  ++LT L+W+CRT AL    DE +
Sbjct  224   IIPLDDMVHRSFFFGRREVAAVRANLPPGLRSRASRFDLLTGLLWKCRTAALAPDADEVM  283

Query  698   RMLLLINARFKFKDTPMPSGYTGNAFAYPGAKTTAGKLRKNPLGYAVELVTSIKRCFSEE  519
             RM+ ++NAR       +P GY GNAFA+P A  TAG L   PLGYAVELV   K     E
Sbjct  284   RMICIVNARGGKSGAAIPEGYYGNAFAFPVAVATAGDLAARPLGYAVELVKRAKGEVDVE  343

Query  518   YMQSMVDLMVLKGRPPFHVAGSFIMSDLTRSKISDVDYGWGKPVFGGPAHGGAGDVPGVI  339
             YM+S+ DLMVL+GRP F V  +++ SD+T++   D+D+GWGKPV+GGPA GG G +PGV 
Sbjct  344   YMRSVADLMVLRGRPHFTVVRAYLASDVTKAGFGDLDFGWGKPVYGGPAKGGVGAIPGVA  403

Query  338   TFHVPYENKKGENGTLIPICLPAFALDKFVNEL  240
             +F +P++N KGE+G ++P+CLP  A++ FV E+
Sbjct  404   SFLIPFKNAKGEDGIVVPMCLPGPAMETFVKEM  436



>tpg|DAA49395.1| TPA: 10-deacetylbaccatin III 10-O-acetyltransferase [Zea mays]
Length=462

 Score =   458 bits (1179),  Expect = 4e-154, Method: Compositional matrix adjust.
 Identities = 218/393 (55%), Positives = 285/393 (73%), Gaps = 5/393 (1%)
 Frame = -1

Query  1415  FYRNEPSMSGKDPVQVIRQALAKALVFFYPFAGRLREGPGRKLMVDCTGEGVMFIEADAD  1236
             FYR    M G+DP  V+R A+A+ALV +YPFAGRLRE  GRKL V+CTGEGV+FIEAD D
Sbjct  48    FYRRSALMGGRDPAPVVRDAVARALVHYYPFAGRLRELEGRKLAVECTGEGVLFIEADTD  107

Query  1235  ATLQHFAIGGELKPPFPCFDQLLYNVPGSAEILNSPLFLIQVTRLRCGGFIFTLRMNHTM  1056
               L HF  G  L+PPFPC ++L+++VPGS+E+L SPL L QVTRL CGGFI  +R++HTM
Sbjct  108   VRLDHF--GDALQPPFPCLEELIFDVPGSSEVLGSPLLLFQVTRLACGGFILGVRLHHTM  165

Query  1055  ADASGLVHFLNTIAEIARGAEAPAVQPVWQREFFSARNPPRITCTHFEYEEEPAADSMVT  876
             ADA GLV FL+ +AE+ARGA AP V+PVW RE   AR+PPR    H EY+E P  D+  T
Sbjct  166   ADAQGLVQFLDAVAELARGAAAPTVRPVWGRELLEARDPPRPAFAHREYDEVP--DTKGT  223

Query  875   NIPLDNLVHRSFLFGPTEISVLRSSLPPHLR-KCSTVEILTALVWRCRTIALGFHPDEEV  699
              IPLD++VHRSF FG  E++ +R++LPP LR + S  ++LT L+W+CRT AL    DE +
Sbjct  224   IIPLDDMVHRSFFFGRREVAAVRANLPPGLRSRASRFDLLTGLLWKCRTAALAPDADEVM  283

Query  698   RMLLLINARFKFKDTPMPSGYTGNAFAYPGAKTTAGKLRKNPLGYAVELVTSIKRCFSEE  519
             RM+ ++NAR       +P GY GNAFA+P A  TAG L   PLGYAVELV   K     E
Sbjct  284   RMICIVNARGGKSGAAIPEGYYGNAFAFPVAVATAGDLAARPLGYAVELVKRAKGEVDVE  343

Query  518   YMQSMVDLMVLKGRPPFHVAGSFIMSDLTRSKISDVDYGWGKPVFGGPAHGGAGDVPGVI  339
             YM+S+ DLMVL+GRP F V  +++ SD+T++   D+D+GWGKPV+GGPA GG G +PGV 
Sbjct  344   YMRSVADLMVLRGRPHFTVVRAYLASDVTKAGFGDLDFGWGKPVYGGPAKGGVGAIPGVA  403

Query  338   TFHVPYENKKGENGTLIPICLPAFALDKFVNEL  240
             +F +P++N KGE+G ++P+CLP  A++ FV E+
Sbjct  404   SFLIPFKNAKGEDGIVVPMCLPGPAMETFVKEM  436



>ref|XP_011098396.1| PREDICTED: benzyl alcohol O-benzoyltransferase-like [Sesamum 
indicum]
Length=460

 Score =   457 bits (1176),  Expect = 1e-153, Method: Compositional matrix adjust.
 Identities = 220/393 (56%), Positives = 287/393 (73%), Gaps = 7/393 (2%)
 Frame = -1

Query  1415  FYRNEPSMSGKDPVQVIRQALAKALVFFYPFAGRLREGPGRKLMVDCTGEGVMFIEADAD  1236
             FYR  P+M GKDPV VIR A+++ALVF+YP AGRLRE  GRKL+V+CTGEGV+FIEA AD
Sbjct  50    FYRRNPAMDGKDPVMVIRDAVSRALVFYYPLAGRLREAAGRKLVVECTGEGVLFIEAVAD  109

Query  1235  ATLQHFAIGGELKPPFPCFDQLLYNVPGSAEILNSPLFLIQVTRLRCGGFIFTLRMNHTM  1056
              TLQ F  G  L PPFPC ++LLY+VPGS  ++N PL LIQVTRL+CGGFIF +R+NHTM
Sbjct  110   VTLQQF--GDALLPPFPCLEELLYDVPGSGGVVNCPLLLIQVTRLKCGGFIFAIRLNHTM  167

Query  1055  ADASGLVHFLNTIAEIARGAEAPAVQPVWQREFFSARNPPRITCTHFEYEEEPAADSMVT  876
             +DA GL  F++ + E+ARGA+ P+VQPVW+R+  SAR+PP I+CTH EY++    D   T
Sbjct  168   SDAVGLAQFMSAVGELARGAKIPSVQPVWRRDLLSARDPPYISCTHREYDD--VLDIKGT  225

Query  875   NIPLDNLVHRSFLFGPTEISVLRSSLPPHLRKCSTVEILTALVWRCRTIALGFHPDEEVR  696
              IP D++V+RSF FG TEIS LR  LPPHLR CST E+LTA +WRCRTIA+   P +EVR
Sbjct  226   LIPPDDMVYRSFFFGATEISALRERLPPHLRHCSTFELLTACLWRCRTIAITPDPKKEVR  285

Query  695   MLLLINARFKFKDTPMPSGYTGNAFAYPGAKTTAGKLRKNPLGYAVELVTSIKRCFSEEY  516
             +L  +N+R +F + P+P+GY GN      A  TA  L K PL YA+ELV   K   +EEY
Sbjct  286   VLCAVNSRKRF-NPPLPTGYYGNVLVLGVAIATAENLTKRPLAYALELVRKAKASITEEY  344

Query  515   MQSMVDLMVLKGRPPF-HVAGSFIMSDLTRSKISDVDYGWGKPVFGGPAHGGAGDVPGVI  339
             M+S+ DLMV++GRP F  V   ++++D+  +   DVD+GWGK V+GGPA    G +PGV 
Sbjct  345   MKSLADLMVIRGRPHFPMVQTYYLVNDVRHAGFRDVDFGWGKAVYGGPAI-SIGAIPGVT  403

Query  338   TFHVPYENKKGENGTLIPICLPAFALDKFVNEL  240
             + ++P++N  GEN  ++PICL A A++ FV EL
Sbjct  404   SLYIPFKNNNGENEIVVPICLAAKAMEVFVKEL  436



>ref|XP_011046333.1| PREDICTED: benzyl alcohol O-benzoyltransferase-like [Populus 
euphratica]
Length=452

 Score =   457 bits (1175),  Expect = 1e-153, Method: Compositional matrix adjust.
 Identities = 209/396 (53%), Positives = 288/396 (73%), Gaps = 11/396 (3%)
 Frame = -1

Query  1415  FYRNEPSMSGKDPVQVIRQALAKALVFFYPFAGRLREGPGRKLMVDCTGEGVMFIEADAD  1236
             FY  +PSM  +DPV+VI++ALAK LVF+YPFAGRLREGP RKL+V+CTGEG++FIEADAD
Sbjct  51    FYPYDPSMQRRDPVEVIKKALAKTLVFYYPFAGRLREGPKRKLLVECTGEGILFIEADAD  110

Query  1235  ATLQHFAIGGELKPPFPCFDQLLYNVPGSAEILNSPLFLIQVTRLRCGGFIFTLRMNHTM  1056
              TL+ F  G EL PP PC ++LLY+VPGS+ ++N PL LIQVTRL+CGG +F +R+NHTM
Sbjct  111   VTLEQF--GDELYPPIPCLEELLYDVPGSSGMINCPLLLIQVTRLKCGGIVFAIRLNHTM  168

Query  1055  ADASGLVHFLNTIAEIARGAEAPAVQPVWQREFFSARNPPRITCTHFEYEEEPAADSMVT  876
             +D +GL  FL+ + E+  GA+ P++QPVW+R   +ARNPP++TC H EY++    D    
Sbjct  169   SDGTGLNQFLSAMCEMVHGAQTPSIQPVWERHVLNARNPPQVTCLHHEYDQ--LVDDTTD  226

Query  875   NIPLDNLVHRSFLFGPTEISVLRSSLPPHLRKCSTVEILTALVWRCRTIALGFHPDEEVR  696
             NIPL    HRSF FGP  IS +R   P HLR CST ++LTA +WRCRTIAL  +P++E+R
Sbjct  227   NIPLTKKTHRSFFFGPANISAIRGFAPLHLRHCSTFDVLTAFLWRCRTIALQPNPNDEMR  286

Query  695   MLLLINARFKFKDTPMPSGYTGNAFAYPGAKTTAGKLRKNPLGYAVELVTSIKRCFSEEY  516
             +L  +NAR +F + P+P GY GN  AY  A   AG++ +N LG+ +ELV   K   +EEY
Sbjct  287   ILCTVNARNRF-NPPLPRGYYGNCMAYSVAMAKAGEISRNSLGFTLELVRKAKANVTEEY  345

Query  515   MQSMVDLMVLKGRPPFHVAGSFIMSDLTRSKISDVDYGWGKPVFGGPAHGGAGDVPGVIT  336
             M+S+ DL+V+KGRP + +  S+++SD+TR+  ++++ GWGKP + GPA G       V +
Sbjct  346   MRSVADLLVIKGRPWYTMVRSYLVSDVTRAMFAEMNLGWGKPKYAGPAKG------NVAS  399

Query  335   FHVPYENKKGENGTLIPICLPAFALDKFVNELANTF  228
             F +PY  KKGE+G L+ +CLP  A+++FV EL +TF
Sbjct  400   FQIPYRTKKGEDGVLVTLCLPTLAMERFVKELDSTF  435



>ref|XP_003549135.1| PREDICTED: 13-hydroxylupanine O-tigloyltransferase-like [Glycine 
max]
 gb|KHN31562.1| 13-hydroxylupanine O-tigloyltransferase [Glycine soja]
Length=455

 Score =   456 bits (1174),  Expect = 2e-153, Method: Compositional matrix adjust.
 Identities = 230/402 (57%), Positives = 290/402 (72%), Gaps = 14/402 (3%)
 Frame = -1

Query  1415  FYRNEPSMSGKDPVQVIRQALAKALVFFYPFAGRLREGPGRKLMVDCTGEGVMFIEADAD  1236
             F+  +PSM GKDPV+VIR+AL+K LVF+YPFAGRLREGP  KLMVDC GEGVMFIEADAD
Sbjct  51    FFPYQPSMEGKDPVEVIREALSKTLVFYYPFAGRLREGPDGKLMVDCNGEGVMFIEADAD  110

Query  1235  ATLQHFAIGGELKPPFPCFDQLLYNVPGSAEILNSPLFLIQVTRLRCGGFIFTLRMNHTM  1056
              T++ F  G    PPFPCFD+LLYNVPGS  ++++PL LIQVTRL+CGGFIF LRMNHTM
Sbjct  111   VTIEQF--GNNFMPPFPCFDELLYNVPGSDGMIDTPLLLIQVTRLKCGGFIFALRMNHTM  168

Query  1055  ADASGLVHFLNTIAEIARGAEAPAVQPVWQREFFSARNPPRITCTHFEYEEEPAADSMVT  876
              D SG+  FL  ++EIA GA  P++ P W RE   AR PPRITC H EY++ P  DS   
Sbjct  169   CDGSGICQFLKALSEIAHGAPKPSILPGWHREILCAREPPRITCIHQEYQQLP-PDSRSI  227

Query  875   NIPLDNLVHRSFLFGPTEISVLRSSLPPHL-RKCSTVEILTALVWRCRTIALGF-HPDEE  702
              IP      RSF FGP EI+ LR+ LP HL  K ++ E++TA +WRCRT +L + +P++E
Sbjct  228   FIPH----QRSFFFGPKEIASLRALLPHHLATKSTSFEVITACLWRCRTASLKWQNPNQE  283

Query  701   VRMLLLINARF---KFKDTPMPSGYTGNAFAYPGAKTTAGKLRKNPLGYAVELVTSIKRC  531
             VR+L ++NARF   +F + P+P G+ GNAF +P A TT GKL    LGYAVELV   K  
Sbjct  284   VRLLCIVNARFGNCRF-NPPLPDGFYGNAFVFPAAVTTVGKLLGRSLGYAVELVKKAKDE  342

Query  530   FSEEYMQSMVDLMVLKGRPPFHVAGSFIMSDLTRSKISDVDYGWGKPVFGGPAHGGAGDV  351
               EEY+ S+ DLM +KGRP F   GSF++SDLT+S + DV+ GWGK ++ G A GG GD+
Sbjct  343   ADEEYVHSVADLMAIKGRPCFTKLGSFMVSDLTKSGLIDVNLGWGKALYSGVAKGGLGDI  402

Query  350   PGVITFHVPYENKKGENGTLIPICLPAFALDKFVNELANTFL  225
             PGV +F+VPY N KGE G +IPICLP  A+++F  EL +T +
Sbjct  403   PGV-SFYVPYTNSKGERGRVIPICLPEDAMERFEKELHDTLM  443



>gb|ACT82248.1| alcohol acyltransferase [Vasconcellea cundinamarcensis]
Length=463

 Score =   456 bits (1174),  Expect = 2e-153, Method: Compositional matrix adjust.
 Identities = 213/406 (52%), Positives = 298/406 (73%), Gaps = 8/406 (2%)
 Frame = -1

Query  1415  FYRNEPSMSGKDPVQVIRQALAKALVFFYPFAGRLREGPGRKLMVDCTGEGVMFIEADAD  1236
             FY+N  SM GK+P ++I+ ALA+ LV +YP AGRLREG GRKLMV+CTGEG++FIEADAD
Sbjct  51    FYKNNSSMQGKNPAKIIKSALAETLVHYYPLAGRLREGFGRKLMVECTGEGILFIEADAD  110

Query  1235  ATLQHFAIGGELKPPFPCFDQLLYNVPGSAEILNSPLFLIQVTRLRCGGFIFTLRMNHTM  1056
              TL  F  G +L PPFPC  +LLY+VPGS+ I+++PL LIQVTRL+CGGFIF LR+NHTM
Sbjct  111   VTLHEF--GDDLPPPFPCLVELLYDVPGSSGIIDTPLLLIQVTRLKCGGFIFALRLNHTM  168

Query  1055  ADASGLVHFLNTIAEIARGAEAPAVQPVWQREFFSARNPPRITCTHFEYEEEPAADSMVT  876
             +DASGLV F+  + E+ARG  + ++QPVW+R   +AR+PPR+T  H EY++    D+  T
Sbjct  169   SDASGLVQFMTAVGEMARGQRSLSIQPVWERHLLNARDPPRVTHIHHEYDD--LEDTKGT  226

Query  875   NIPLDNLVHRSFLFGPTEISVLRSSLPPHLRKCSTVEILTALVWRCRTIALGFHPDEEVR  696
              IPLD++VHRSF FGP+E++ +R  +P H  + +T E+LTA +WRC TIAL   P+EE+R
Sbjct  227   IIPLDDMVHRSFFFGPSEMAAIRRLVPAHFHRSTTSEVLTAYLWRCYTIALQPDPEEEMR  286

Query  695   MLLLINARFKFKDTPMPSGYTGNAFAYPGAKTTAGKLRKNPLGYAVELVTSIKRCFSEEY  516
             ++ ++N+R K  + P+P+G+ GN  A+P A + A K+ +NP GY ++LV   K   +EEY
Sbjct  287   VICVVNSRTKL-NPPLPTGFYGNGIAFPAAISQAKKICENPFGYTLQLVKQTKVDVTEEY  345

Query  515   MQSMVDLMVLKGRPPFHVAGSFIMSDLTRSKISDVDYGWGK--PVFGGPAHGGAGDVPGV  342
             M+S  DLM +KGRP F V   +++SD+TR+    VD+GWG+  PV+GGPA GG G +PGV
Sbjct  346   MRSAADLMAMKGRPHFTVVRRYMVSDVTRAGFGLVDFGWGRPEPVYGGPAKGGVGPIPGV  405

Query  341   ITFHVPYENKKGENGTLIPICLPAFALDKFVNELANTFLRAAL*MS  204
              +F VP++N+KGE G ++P CLP  A+++F  +L N  L+  L +S
Sbjct  406   TSFFVPFKNRKGEKGIVVPTCLPTPAMERFA-KLMNEILQNQLLVS  450



>ref|XP_011046335.1| PREDICTED: benzyl alcohol O-benzoyltransferase-like [Populus 
euphratica]
Length=452

 Score =   455 bits (1171),  Expect = 5e-153, Method: Compositional matrix adjust.
 Identities = 205/396 (52%), Positives = 289/396 (73%), Gaps = 11/396 (3%)
 Frame = -1

Query  1415  FYRNEPSMSGKDPVQVIRQALAKALVFFYPFAGRLREGPGRKLMVDCTGEGVMFIEADAD  1236
             FY  +PSM  +DPV+VI++ALAK LVF+YPFAGRLREGP RKL+V+CTGEG++FIEADAD
Sbjct  51    FYTYDPSMQRRDPVKVIKEALAKTLVFYYPFAGRLREGPKRKLLVECTGEGILFIEADAD  110

Query  1235  ATLQHFAIGGELKPPFPCFDQLLYNVPGSAEILNSPLFLIQVTRLRCGGFIFTLRMNHTM  1056
              TL+ F  G  L PP PC ++LL++VPGS+ ++N PL L+QVTRL+CGG +F +R+NHTM
Sbjct  111   VTLEQF--GDALYPPIPCLEELLFDVPGSSGMINCPLLLVQVTRLKCGGIVFAIRLNHTM  168

Query  1055  ADASGLVHFLNTIAEIARGAEAPAVQPVWQREFFSARNPPRITCTHFEYEEEPAADSMVT  876
             +D +G+  FL+ + E+  GA+ P++QPVW+R   +ARNPP++TC H EY++    D    
Sbjct  169   SDGTGINQFLSAMCEMVHGAQTPSIQPVWERHVLNARNPPQVTCLHHEYDQ--LVDDTTD  226

Query  875   NIPLDNLVHRSFLFGPTEISVLRSSLPPHLRKCSTVEILTALVWRCRTIALGFHPDEEVR  696
             N+PL    HRSF FGP  IS +R   P HLR CST ++LTA +WRCRTIAL  +P++E+R
Sbjct  227   NVPLTKKTHRSFFFGPANISAIRGFAPLHLRHCSTFDVLTAFLWRCRTIALQPNPNDEMR  286

Query  695   MLLLINARFKFKDTPMPSGYTGNAFAYPGAKTTAGKLRKNPLGYAVELVTSIKRCFSEEY  516
             ML ++NAR +F + P+P GY GN  AY   + TAG++ +N LG+ +ELV   K   +EEY
Sbjct  287   MLCIVNARNRF-NPPLPRGYYGNCIAYSVVRATAGEISRNSLGFTLELVRKAKANVTEEY  345

Query  515   MQSMVDLMVLKGRPPFHVAGSFIMSDLTRSKISDVDYGWGKPVFGGPAHGGAGDVPGVIT  336
             M+S+ DL+V+KGRP + +  S+++SD+TR+  ++++ GWGKP + GPA G       V +
Sbjct  346   MRSVADLLVIKGRPCYTMVRSYLVSDVTRAMFAEMNLGWGKPKYAGPAKG------NVAS  399

Query  335   FHVPYENKKGENGTLIPICLPAFALDKFVNELANTF  228
             F +PY  KKGE+G L+ +CLP  A+++FV EL +TF
Sbjct  400   FQIPYRTKKGEDGVLVTLCLPTPAMERFVKELDSTF  435



>ref|XP_011009229.1| PREDICTED: benzyl alcohol O-benzoyltransferase-like [Populus 
euphratica]
Length=456

 Score =   455 bits (1171),  Expect = 6e-153, Method: Compositional matrix adjust.
 Identities = 216/392 (55%), Positives = 283/392 (72%), Gaps = 8/392 (2%)
 Frame = -1

Query  1415  FYRNEPSMSGKDPVQVIRQALAKALVFFYPFAGRLREGPGRKLMVDCTGEGVMFIEADAD  1236
             FYR+ PSM GKDPV+VIR+A+AK LVF+YPFAGRLREG  RKLMV+CTGEG++FIEADAD
Sbjct  51    FYRHNPSMHGKDPVKVIREAIAKTLVFYYPFAGRLREGHNRKLMVECTGEGILFIEADAD  110

Query  1235  ATLQHFAIGGELKPPFPCFDQLLYNVPGSAEILNSPLFLIQVTRLRCGGFIFTLRMNHTM  1056
              TL+ F  G  L+PPFPC ++LL++VPGS+ +LN PL LIQV+RL+CGGF+F LR+NHTM
Sbjct  111   VTLEQF--GDPLQPPFPCLEELLFDVPGSSGVLNCPLLLIQVSRLKCGGFLFALRLNHTM  168

Query  1055  ADASGLVHFLNTIAEIARGAEAPAVQPVWQREFFSARNPPRITCTHFEYEEEPAADSMVT  876
             +D  GL  F+  + E+ARGA AP+V PVW+R   +A +PPR+TC H  YEE   A S  +
Sbjct  169   SDGPGLEQFMAAVGEMARGANAPSVPPVWERHVLNATDPPRVTCRHLAYEE--VAGSTSS  226

Query  875   NIPLDNLVHRSFLFGPTEISVLRSSLPPHLRKCSTVEILTALVWRCRTIALGFHPDEEVR  696
              +  D+LVHRSF F P++I+ LR  +PPHL  CST EILTA +W CRTIAL  HP+EE+R
Sbjct  227   ILTHDHLVHRSFFFSPSDITALRRLVPPHLSHCSTFEILTACLWICRTIALQPHPNEEMR  286

Query  695   MLLLINARFKFKDTPMPSGYTGNAFAYPGAKTTAGKLRKNPLGYAVELVTSIKRCFSEEY  516
             ++ L+NA  KF    +P GY GN F    A  TAG+L + P+GYA+ELV   K   +EEY
Sbjct  287   IICLVNASGKFNPPLLPRGYYGNGFLLLAAVATAGELSRKPIGYALELVRKAKADMTEEY  346

Query  515   MQSMVDLMVLKGRPPFHVAGSFIMSDLTRSKISDVDYGWGKPVFGGPAHGGAGDVPGVIT  336
             M+S   LMV KGRP F V G++I+SDL       VD+GWG  ++GG A       P + +
Sbjct  347   MRSTASLMVSKGRPLFTVPGTYIVSDLRHVGFEKVDFGWGNAIYGGTAKAA----PELAS  402

Query  335   FHVPYENKKGENGTLIPICLPAFALDKFVNEL  240
             F++P+ NKKGE+G ++P CLP+ A+++F  EL
Sbjct  403   FYIPFTNKKGEDGIVVPFCLPSPAVERFYKEL  434



>ref|XP_007029787.1| Benzoyl coenzyme A: Benzyl alcohol benzoyl transferase isoform 
2, partial [Theobroma cacao]
 gb|EOY10289.1| Benzoyl coenzyme A: Benzyl alcohol benzoyl transferase isoform 
2, partial [Theobroma cacao]
Length=485

 Score =   454 bits (1167),  Expect = 6e-152, Method: Compositional matrix adjust.
 Identities = 218/392 (56%), Positives = 288/392 (73%), Gaps = 12/392 (3%)
 Frame = -1

Query  1415  FYRNEPSMSGKDPVQVIRQALAKALVFFYPFAGRLREGPGRKLMVDCTGEGVMFIEADAD  1236
             FYR +PSM GKDP  +I++AL KALVF+YP+AGRLREGP RKL+VDCTGEGV+FI+ADAD
Sbjct  65    FYRFKPSMQGKDPACIIKEALTKALVFYYPYAGRLREGPNRKLVVDCTGEGVLFIQADAD  124

Query  1235  ATLQHFAIGGELKPPFPCFDQLLYNVPGSAEILNSPLFLIQVTRLRCGGFIFTLRMNHTM  1056
              TL  F  G  L PPFPC+ +LLY VPGS E+LN PL  IQVTRL+CGGFIF  R NHTM
Sbjct  125   VTLDQF--GDSLHPPFPCYKELLYEVPGSNELLNCPLLQIQVTRLKCGGFIFAHRFNHTM  182

Query  1055  ADASGLVHFLNTIAEIARGAEAPAVQPVWQREFFSARNPPRITCTHFEYEEEPAADSMVT  876
             +DA+GL+ F+  + E+ARGA AP+  PVW+R   +AR+ P ITC H EY+     + +  
Sbjct  183   SDAAGLIQFMCAMGEMARGALAPSTPPVWERHLLNARHSPLITCVHDEYDNATLTNGI--  240

Query  875   NIPLDNLVHRSFLFGPTEISVLRSSLPPHLRKCSTVEILTALVWRCRTIALGFHPDEEVR  696
              +P DNL+HRSF FGPT+IS LR  +P +LR CST +I+TA +WRCRT A+   P+++VR
Sbjct  241   EMP-DNLLHRSFFFGPTQISALRRFVPHNLR-CSTFDIVTACLWRCRTKAMKLGPNDDVR  298

Query  695   MLLLINARFKFKDTPMPSGYTGNAFAYPGAKTTAGKLRKNPLGYAVELVTSIKRCFSEEY  516
              + ++NAR KF + P+PSG+ GNA  YP A TTAG+L +NP+ Y +ELV   K   +EEY
Sbjct  299   FICIVNARSKF-NPPLPSGFYGNALGYPVALTTAGQLCQNPMEYGIELVRQAKAKITEEY  357

Query  515   MQSMVDLMVLKGRPPFHVAGSFIMSDLTRSKISDVDYGWGKPVFGGPAHGGAGDVPGVIT  336
             M+S  DLMV++GRP  +    F++SDLTR+K  +VD+GWG+  FGGPA+GG       I+
Sbjct  358   MKSTADLMVIRGRPNVNTVRCFMVSDLTRAKFREVDFGWGEAEFGGPAYGG-----DRIS  412

Query  335   FHVPYENKKGENGTLIPICLPAFALDKFVNEL  240
             F++P +NK+GE G ++P+CLPA  ++ FV EL
Sbjct  413   FYIPSKNKEGEGGIVVPVCLPAPVMESFVKEL  444



>ref|XP_007029786.1| Benzoyl coenzyme A: Benzyl alcohol benzoyl transferase isoform 
1 [Theobroma cacao]
 gb|EOY10288.1| Benzoyl coenzyme A: Benzyl alcohol benzoyl transferase isoform 
1 [Theobroma cacao]
Length=525

 Score =   455 bits (1170),  Expect = 8e-152, Method: Compositional matrix adjust.
 Identities = 218/392 (56%), Positives = 288/392 (73%), Gaps = 12/392 (3%)
 Frame = -1

Query  1415  FYRNEPSMSGKDPVQVIRQALAKALVFFYPFAGRLREGPGRKLMVDCTGEGVMFIEADAD  1236
             FYR +PSM GKDP  +I++AL KALVF+YP+AGRLREGP RKL+VDCTGEGV+FI+ADAD
Sbjct  73    FYRFKPSMQGKDPACIIKEALTKALVFYYPYAGRLREGPNRKLVVDCTGEGVLFIQADAD  132

Query  1235  ATLQHFAIGGELKPPFPCFDQLLYNVPGSAEILNSPLFLIQVTRLRCGGFIFTLRMNHTM  1056
              TL  F  G  L PPFPC+ +LLY VPGS E+LN PL  IQVTRL+CGGFIF  R NHTM
Sbjct  133   VTLDQF--GDSLHPPFPCYKELLYEVPGSNELLNCPLLQIQVTRLKCGGFIFAHRFNHTM  190

Query  1055  ADASGLVHFLNTIAEIARGAEAPAVQPVWQREFFSARNPPRITCTHFEYEEEPAADSMVT  876
             +DA+GL+ F+  + E+ARGA AP+  PVW+R   +AR+ P ITC H EY+     + +  
Sbjct  191   SDAAGLIQFMCAMGEMARGALAPSTPPVWERHLLNARHSPLITCVHDEYDNATLTNGI--  248

Query  875   NIPLDNLVHRSFLFGPTEISVLRSSLPPHLRKCSTVEILTALVWRCRTIALGFHPDEEVR  696
              +P DNL+HRSF FGPT+IS LR  +P +LR CST +I+TA +WRCRT A+   P+++VR
Sbjct  249   EMP-DNLLHRSFFFGPTQISALRRFVPHNLR-CSTFDIVTACLWRCRTKAMKLGPNDDVR  306

Query  695   MLLLINARFKFKDTPMPSGYTGNAFAYPGAKTTAGKLRKNPLGYAVELVTSIKRCFSEEY  516
              + ++NAR KF + P+PSG+ GNA  YP A TTAG+L +NP+ Y +ELV   K   +EEY
Sbjct  307   FICIVNARSKF-NPPLPSGFYGNALGYPVALTTAGQLCQNPMEYGIELVRQAKAKITEEY  365

Query  515   MQSMVDLMVLKGRPPFHVAGSFIMSDLTRSKISDVDYGWGKPVFGGPAHGGAGDVPGVIT  336
             M+S  DLMV++GRP  +    F++SDLTR+K  +VD+GWG+  FGGPA+GG       I+
Sbjct  366   MKSTADLMVIRGRPNVNTVRCFMVSDLTRAKFREVDFGWGEAEFGGPAYGG-----DRIS  420

Query  335   FHVPYENKKGENGTLIPICLPAFALDKFVNEL  240
             F++P +NK+GE G ++P+CLPA  ++ FV EL
Sbjct  421   FYIPSKNKEGEGGIVVPVCLPAPVMESFVKEL  452



>dbj|BAJ92444.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=482

 Score =   453 bits (1165),  Expect = 1e-151, Method: Compositional matrix adjust.
 Identities = 216/404 (53%), Positives = 294/404 (73%), Gaps = 8/404 (2%)
 Frame = -1

Query  1415  FYRNEPSMSGKDPVQVIRQALAKALVFFYPFAGRLREGPGRKLMVDCTGEGVMFIEADAD  1236
             FYR + SM G+DP  V+R A+A+ALV +YPFAGRLRE  GRKL VDCTGEGV+FIEADA+
Sbjct  70    FYRRDASMGGRDPAAVVRDAVARALVHYYPFAGRLRELEGRKLAVDCTGEGVLFIEADAN  129

Query  1235  ATLQHFAIGGELKPPFPCFDQLLYNVPGSAEILNSPLFLIQVTRLRCGGFIFTLRMNHTM  1056
               L+HF  G  L+PPFP  ++L+++VPGS+E+L +PL L QVTRL CGGFI  +R+ HTM
Sbjct  130   VRLEHF--GDALQPPFPGLEELVFDVPGSSEVLGTPLLLFQVTRLACGGFILAVRLMHTM  187

Query  1055  ADASGLVHFLNTIAEIARGAEAPAVQPVWQREFFSARNPPRITCTHFEYEEEPAADSMVT  876
             +DA GLV FL  +AE+ARGA AP+V+PVW+RE   ARNPPR    H EY+E P  D+  T
Sbjct  188   SDAQGLVQFLAAVAELARGAAAPSVRPVWERELLEARNPPRPGFAHREYDEVP--DTKGT  245

Query  875   NIPLDNLVHRSFLFGPTEISVLRSSLPPHLRK-CSTVEILTALVWRCRTIALGFHPDEEV  699
              +PLD++ HRSF FG  E++ +RS L P LR+  +T E+LT  +W+CRT+AL    DE +
Sbjct  246   IVPLDDMAHRSFFFGAKEVAAIRSHLAPGLRRRATTFEVLTGSLWKCRTVALAPDADEVM  305

Query  698   RMLLLINARFKFKD--TPMPSGYTGNAFAYPGAKTTAGKLRKNPLGYAVELVTSIKRCFS  525
             RM+ ++NAR   +   + +P+GY GNAFA+P A + +G L  NPL YAV+LV   K   +
Sbjct  306   RMICIVNARGGKQGGASAIPTGYYGNAFAFPVAVSASGDLCANPLSYAVKLVKEAKSEVN  365

Query  524   EEYMQSMVDLMVLKGRPPFHVAGSFIMSDLTRSKISDVDYGWGKPVFGGPAHGGAGDVPG  345
              EYM+S+ DLMV +GRP F V  +++ SD+T++   D+D+GWG+PV+GGPA GG G +PG
Sbjct  366   VEYMRSVADLMVQRGRPHFTVVRAYLASDVTKAGFGDLDFGWGRPVYGGPAKGGVGAIPG  425

Query  344   VITFHVPYENKKGENGTLIPICLPAFALDKFVNELANTFLRAAL  213
             V +F +P++N KGE+G +IP+CLP  A+D+FV E+    LR A+
Sbjct  426   VASFLIPFKNAKGEDGIVIPMCLPGPAMDRFVEEMGK-LLRPAV  468



>ref|XP_006370913.1| hypothetical protein POPTR_0019s01680g [Populus trichocarpa]
 gb|ERP48710.1| hypothetical protein POPTR_0019s01680g [Populus trichocarpa]
Length=452

 Score =   451 bits (1161),  Expect = 2e-151, Method: Compositional matrix adjust.
 Identities = 206/396 (52%), Positives = 289/396 (73%), Gaps = 11/396 (3%)
 Frame = -1

Query  1415  FYRNEPSMSGKDPVQVIRQALAKALVFFYPFAGRLREGPGRKLMVDCTGEGVMFIEADAD  1236
             FY  +PSM  +DPV+VI++ALAK LVF+YPFAGRLREGP RKL+V+CTGEG++FIEADAD
Sbjct  51    FYPYDPSMQRRDPVEVIKEALAKTLVFYYPFAGRLREGPKRKLLVECTGEGILFIEADAD  110

Query  1235  ATLQHFAIGGELKPPFPCFDQLLYNVPGSAEILNSPLFLIQVTRLRCGGFIFTLRMNHTM  1056
              TL+ F  G  L PP PC ++LL++VPGS+ ++N PL LIQVTRL+CGG +F +R+NHTM
Sbjct  111   VTLEQF--GNALYPPIPCLEELLFDVPGSSGMINCPLLLIQVTRLKCGGIVFAIRLNHTM  168

Query  1055  ADASGLVHFLNTIAEIARGAEAPAVQPVWQREFFSARNPPRITCTHFEYEEEPAADSMVT  876
             +D +GL  FL+ + E+  GA+ P++QPVW+R+  +ARNPP++TC H EY++    D    
Sbjct  169   SDGTGLNQFLSAMCEMVHGAQTPSIQPVWERDVLNARNPPQVTCLHHEYDQ--LVDDTTD  226

Query  875   NIPLDNLVHRSFLFGPTEISVLRSSLPPHLRKCSTVEILTALVWRCRTIALGFHPDEEVR  696
             N+PL    HRSF FG   IS +R   P HLR CST ++LTA +WRCRTIAL  +P++E+R
Sbjct  227   NVPLTKKTHRSFFFGAANISAIRGFAPLHLRHCSTFDVLTAFLWRCRTIALQPNPNDEMR  286

Query  695   MLLLINARFKFKDTPMPSGYTGNAFAYPGAKTTAGKLRKNPLGYAVELVTSIKRCFSEEY  516
             +L ++NAR +F + P+P GY GN  AY  A  TAG++ +N LG+ +ELV   K   +EEY
Sbjct  287   ILCIVNARNRF-NPPLPRGYYGNCIAYSVAMATAGEISRNSLGFTLELVRKAKANVTEEY  345

Query  515   MQSMVDLMVLKGRPPFHVAGSFIMSDLTRSKISDVDYGWGKPVFGGPAHGGAGDVPGVIT  336
             M+S+ DL+V+KGRP + +  S+++SD+TR+  ++++ GWGKP + GPA G       V +
Sbjct  346   MRSVADLLVIKGRPWYTMVRSYLVSDVTRAMFAEMNLGWGKPKYAGPAKG------NVAS  399

Query  335   FHVPYENKKGENGTLIPICLPAFALDKFVNELANTF  228
             F +PY  KKGE+G L+ +CLP  A+++FV EL +TF
Sbjct  400   FQIPYRTKKGEDGVLMTLCLPTPAMERFVKELDSTF  435



>ref|XP_006878638.1| hypothetical protein AMTR_s00011p00264170 [Amborella trichopoda]
 gb|ERM94783.1| hypothetical protein AMTR_s00011p00264170 [Amborella trichopoda]
Length=476

 Score =   452 bits (1162),  Expect = 2e-151, Method: Compositional matrix adjust.
 Identities = 217/392 (55%), Positives = 291/392 (74%), Gaps = 5/392 (1%)
 Frame = -1

Query  1415  FYRNEPSMSGKDPVQVIRQALAKALVFFYPFAGRLREGPGRKLMVDCTGEGVMFIEADAD  1236
             FYR +P M G+DP +V+R AL++ALV++YPFAGRLREG  RKL V+C+GEGV+F+E DAD
Sbjct  49    FYRKDPQMDGRDPARVVRDALSEALVYYYPFAGRLREGENRKLSVECSGEGVLFVEGDAD  108

Query  1235  ATLQHFAIGGELKPPFPCFDQLLYNVPGSAEILNSPLFLIQVTRLRCGGFIFTLRMNHTM  1056
              +L+ F  G  L+PPFPC+++LL +VPGS  ++  PL  IQVTRLRCGGFIF LR+NHTM
Sbjct  109   VSLEEF--GDALQPPFPCWEKLLIHVPGSDGVIGCPLLFIQVTRLRCGGFIFALRLNHTM  166

Query  1055  ADASGLVHFLNTIAEIARGAEAPAVQPVWQREFFSARNPPRITCTHFEYEEEPAADSMVT  876
             +DASGLV F+N + E+ARG   P++ PVWQR   +ARNPP +T  H EY++ P  D+  T
Sbjct  167   SDASGLVQFMNGVGELARGLPRPSIFPVWQRHLLNARNPPCVTYAHREYDQVP--DTNNT  224

Query  875   NIPLDNLVHRSFLFGPTEISVLRSSLPPHLRKCSTVEILTALVWRCRTIALGFHPDEEVR  696
              +PLD++ HRSF FGP+E + LRS LPPHL K ST ++L A +W+CRT AL  + DE+VR
Sbjct  225   LMPLDDMAHRSFFFGPSEAAALRSQLPPHLAKASTFDLLAACLWKCRTTALTMNNDEDVR  284

Query  695   MLLLINARFKFKDTPMPSGYTGNAFAYPGAKTTAGKLRKNPLGYAVELVTSIKRCFSEEY  516
             ++ ++NAR KF+  P+P GY GNAFA P A + AG LR+NP GYAVELV   K   ++EY
Sbjct  285   LVCIVNARSKFR-PPLPQGYYGNAFALPIAVSKAGSLRRNPFGYAVELVRKAKEEVTDEY  343

Query  515   MQSMVDLMVLKGRPPFHVAGSFIMSDLTRSKISDVDYGWGKPVFGGPAHGGAGDVPGVIT  336
             M+S+ DLMV KGRP F V  +F++SD+ R+   +VD+GWGK V+GG A GG G +PGV +
Sbjct  344   MRSVADLMVTKGRPHFTVVNTFLVSDIRRAGFGEVDFGWGKAVYGGAAKGGVGAIPGVAS  403

Query  335   FHVPYENKKGENGTLIPICLPAFALDKFVNEL  240
             F + ++N  G +GT+IPICLP  A+ +F  E+
Sbjct  404   FFIAFKNGDGVDGTVIPICLPEAAMPRFTREV  435



>emb|CAN74729.1| hypothetical protein VITISV_042062 [Vitis vinifera]
Length=451

 Score =   451 bits (1159),  Expect = 3e-151, Method: Compositional matrix adjust.
 Identities = 222/392 (57%), Positives = 279/392 (71%), Gaps = 8/392 (2%)
 Frame = -1

Query  1415  FYRNEPSMSGKDPVQVIRQALAKALVFFYPFAGRLREGPGRKLMVDCTGEGVMFIEADAD  1236
             FY N P M GKDPV+VIR+AL KALV++YPFAGRL EG  RKLMVDCTGEGV+FIEADAD
Sbjct  51    FYPNNPLMKGKDPVKVIREALGKALVYYYPFAGRLIEGDNRKLMVDCTGEGVLFIEADAD  110

Query  1235  ATLQHFAIGGELKPPFPCFDQLLYNVPGSAEILNSPLFLIQVTRLRCGGFIFTLRMNHTM  1056
              TL++  +G  ++P  PCF++LLY+VPGS  IL SPL LIQVTRLRCGGFIF LR+NHTM
Sbjct  111   TTLEN--LGDAIQPMCPCFEELLYDVPGSGGILGSPLILIQVTRLRCGGFIFALRLNHTM  168

Query  1055  ADASGLVHFLNTIAEIARGAEAPAVQPVWQREFFSARNPPRITCTHFEYEEEPAADSMVT  876
             +DA GL+ FLN I+E+A+G   P++ P+W+RE  +ARNPPRIT  H EYEE       + 
Sbjct  169   SDALGLIQFLNAISEMAQGLSVPSLLPIWERELLNARNPPRITRIHHEYEEVTNNKGTLM  228

Query  875   NIPLDNLVHRSFLFGPTEISVLRSSLPPHLRKCSTVEILTALVWRCRTIALGFHPDEEVR  696
              +  +NLVHRSF FGP EI  LR+ LP  L  CST E+LTA VWRCRTIA    PDE VR
Sbjct  229   AMDENNLVHRSFFFGPKEIRALRNRLPASLGACSTFEVLTAYVWRCRTIAFAVDPDEVVR  288

Query  695   MLLLINARFKFKDTPMPSGYTGNAFAYPGAKTTAGKLRKNPLGYAVELVTSIKRCFSEEY  516
             +  LIN R K +   +P GY GNAF YP + T AG L KNPL YA+ L+   K   S+EY
Sbjct  289   ISCLINMRGK-RGFDLPPGYYGNAFVYPASITKAGMLCKNPLEYAIRLLKKAKAEMSQEY  347

Query  515   MQSMVDLMVLKGRPPFHVAGSFIMSDLTRSKISDVDYGWGKPVFGGPAHGGAGDVPGVIT  336
             ++S+ DLMV+KGRP F   G++ +SD+TR+   +V++GWGKPV+GG A   +     +I+
Sbjct  348   IKSVADLMVIKGRPSFTQPGNYFVSDVTRAGFGEVNFGWGKPVYGGLARALS-----IIS  402

Query  335   FHVPYENKKGENGTLIPICLPAFALDKFVNEL  240
             F   + N KGE G +IPICLP   +++F  EL
Sbjct  403   FCTRFRNSKGEEGNVIPICLPPPVMERFEQEL  434



>ref|XP_002265841.1| PREDICTED: methanol O-anthraniloyltransferase [Vitis vinifera]
 emb|CBI37446.3| unnamed protein product [Vitis vinifera]
Length=451

 Score =   451 bits (1159),  Expect = 3e-151, Method: Compositional matrix adjust.
 Identities = 222/392 (57%), Positives = 279/392 (71%), Gaps = 8/392 (2%)
 Frame = -1

Query  1415  FYRNEPSMSGKDPVQVIRQALAKALVFFYPFAGRLREGPGRKLMVDCTGEGVMFIEADAD  1236
             FY N P M GKDPV+VIR+AL KALV++YPFAGRL EG  RKLMVDCTGEGV+FIEADAD
Sbjct  51    FYPNNPLMKGKDPVKVIREALGKALVYYYPFAGRLIEGDNRKLMVDCTGEGVLFIEADAD  110

Query  1235  ATLQHFAIGGELKPPFPCFDQLLYNVPGSAEILNSPLFLIQVTRLRCGGFIFTLRMNHTM  1056
              TL++  +G  ++P  PCF++LLY+VPGS  IL SPL LIQVTRLRCGGFIF LR+NHTM
Sbjct  111   TTLEN--LGDAIQPMCPCFEELLYDVPGSGGILGSPLILIQVTRLRCGGFIFALRLNHTM  168

Query  1055  ADASGLVHFLNTIAEIARGAEAPAVQPVWQREFFSARNPPRITCTHFEYEEEPAADSMVT  876
             +DA GL+ FLN I+E+A+G   P++ P+W+RE  +ARNPPRIT  H EYEE       + 
Sbjct  169   SDALGLIQFLNAISEMAQGLSVPSLLPIWERELLNARNPPRITRIHHEYEEVTNNKGTLM  228

Query  875   NIPLDNLVHRSFLFGPTEISVLRSSLPPHLRKCSTVEILTALVWRCRTIALGFHPDEEVR  696
              +  +NLVHRSF FGP EI  LR+ LP  L  CST E+LTA VWRCRTIA    PDE VR
Sbjct  229   AMDENNLVHRSFFFGPKEIRALRNRLPASLGACSTFEVLTAYVWRCRTIAFAVDPDEVVR  288

Query  695   MLLLINARFKFKDTPMPSGYTGNAFAYPGAKTTAGKLRKNPLGYAVELVTSIKRCFSEEY  516
             +  LIN R K +   +P GY GNAF YP + T AG L KNPL YA+ L+   K   S+EY
Sbjct  289   ISCLINMRGK-RGFDLPPGYYGNAFVYPASITKAGMLCKNPLEYAIRLLKKAKAEMSQEY  347

Query  515   MQSMVDLMVLKGRPPFHVAGSFIMSDLTRSKISDVDYGWGKPVFGGPAHGGAGDVPGVIT  336
             ++S+ DLMV+KGRP F   G++ +SD+TR+   +V++GWGKPV+GG A   +     +I+
Sbjct  348   IKSVADLMVIKGRPSFTQPGNYFVSDVTRAGFGEVNFGWGKPVYGGLARALS-----IIS  402

Query  335   FHVPYENKKGENGTLIPICLPAFALDKFVNEL  240
             F   + N KGE G +IPICLP   +++F  EL
Sbjct  403   FCTRFRNSKGEEGNVIPICLPPPVMERFEQEL  434



>ref|XP_002266114.1| PREDICTED: methanol O-anthraniloyltransferase isoform X1 [Vitis 
vinifera]
Length=451

 Score =   450 bits (1158),  Expect = 5e-151, Method: Compositional matrix adjust.
 Identities = 222/392 (57%), Positives = 279/392 (71%), Gaps = 8/392 (2%)
 Frame = -1

Query  1415  FYRNEPSMSGKDPVQVIRQALAKALVFFYPFAGRLREGPGRKLMVDCTGEGVMFIEADAD  1236
             FY N P M GKDPV+VIR+AL KALV++YPFAGRL EG  RKLMVDCTGEGV+FIEADAD
Sbjct  51    FYPNNPLMKGKDPVKVIREALGKALVYYYPFAGRLIEGHNRKLMVDCTGEGVLFIEADAD  110

Query  1235  ATLQHFAIGGELKPPFPCFDQLLYNVPGSAEILNSPLFLIQVTRLRCGGFIFTLRMNHTM  1056
             +TL++  +G  ++P  PCF++LLY+VPGS  IL SPL LIQVTRLRCGGFIF LR+NHTM
Sbjct  111   STLEN--LGDAIQPMCPCFEELLYDVPGSGGILGSPLILIQVTRLRCGGFIFALRLNHTM  168

Query  1055  ADASGLVHFLNTIAEIARGAEAPAVQPVWQREFFSARNPPRITCTHFEYEEEPAADSMVT  876
             +D  GLV FL+ I+E+A+G   P++ P+WQRE  +ARNPPRIT  H EY+E   A   + 
Sbjct  169   SDGPGLVQFLDAISEMAQGLSVPSLLPIWQRELLNARNPPRITRIHHEYQEVTNAKGTLM  228

Query  875   NIPLDNLVHRSFLFGPTEISVLRSSLPPHLRKCSTVEILTALVWRCRTIALGFHPDEEVR  696
              +  +NLVHRSF FGP EI  LR+ LP  L  CST E+L A VWRCRTIA    PDE VR
Sbjct  229   TMDENNLVHRSFFFGPKEIRALRNRLPASLGACSTFEVLIAYVWRCRTIAFAVDPDEVVR  288

Query  695   MLLLINARFKFKDTPMPSGYTGNAFAYPGAKTTAGKLRKNPLGYAVELVTSIKRCFSEEY  516
             +  LIN R K +   +P GY GNAF YP + T AG L KNPL YA+ L+   K   S+EY
Sbjct  289   ISCLINMRGK-RGFDLPPGYYGNAFVYPASITKAGMLCKNPLEYAIRLLKKAKAEMSQEY  347

Query  515   MQSMVDLMVLKGRPPFHVAGSFIMSDLTRSKISDVDYGWGKPVFGGPAHGGAGDVPGVIT  336
             ++S+ DLMV+KGRP F   G++++SDLTR+   ++D+GWGKPV+GG A   +      I+
Sbjct  348   VKSVADLMVIKGRPSFTQPGNYLISDLTRAGFGEIDFGWGKPVYGGIARALSN-----IS  402

Query  335   FHVPYENKKGENGTLIPICLPAFALDKFVNEL  240
             F + + N KGE G +IPICLP    ++F  EL
Sbjct  403   FCMRFRNSKGEEGNVIPICLPPPVTERFEQEL  434



>gb|ABK96738.1| unknown [Populus trichocarpa x Populus deltoides]
Length=440

 Score =   449 bits (1154),  Expect = 1e-150, Method: Compositional matrix adjust.
 Identities = 214/392 (55%), Positives = 282/392 (72%), Gaps = 8/392 (2%)
 Frame = -1

Query  1415  FYRNEPSMSGKDPVQVIRQALAKALVFFYPFAGRLREGPGRKLMVDCTGEGVMFIEADAD  1236
             FYR+ PSM GKDPV+VIR+A+AK L+F+YPFAGRLREG  RKLMV+CTGEG++FIEADAD
Sbjct  51    FYRHNPSMHGKDPVKVIREAIAKTLLFYYPFAGRLREGHNRKLMVECTGEGILFIEADAD  110

Query  1235  ATLQHFAIGGELKPPFPCFDQLLYNVPGSAEILNSPLFLIQVTRLRCGGFIFTLRMNHTM  1056
              TL+ F  G  L+PPFPC ++LL++VPGS+ +LN PL LIQV+RL+CGGF+F LR+NHTM
Sbjct  111   VTLEQF--GDPLQPPFPCLEELLFDVPGSSGVLNCPLLLIQVSRLKCGGFLFALRLNHTM  168

Query  1055  ADASGLVHFLNTIAEIARGAEAPAVQPVWQREFFSARNPPRITCTHFEYEEEPAADSMVT  876
             +D  GLV F+  + E+ARGA AP+V PVW+R   +A +PPR++C H  YEE   A S  +
Sbjct  169   SDGPGLVQFMAAVGEMARGANAPSVPPVWERHVLNATDPPRVSCRHRAYEE--VAGSKSS  226

Query  875   NIPLDNLVHRSFLFGPTEISVLRSSLPPHLRKCSTVEILTALVWRCRTIALGFHPDEEVR  696
              I  D+LVHRSF F P+ I+ LR  +P HL  CS+ EILTA +W CRTIAL   P+EE+R
Sbjct  227   IITHDHLVHRSFFFSPSNITALRKLVPSHLGHCSSFEILTACLWICRTIALQPDPNEEMR  286

Query  695   MLLLINARFKFKDTPMPSGYTGNAFAYPGAKTTAGKLRKNPLGYAVELVTSIKRCFSEEY  516
             ++ L+NAR KF    +P GY GN F       TAG+L K P+GYA+ELV   K   +EEY
Sbjct  287   IICLVNAREKFNPPLLPRGYYGNGFGLLSEVATAGELSKRPIGYALELVKKAKAGMTEEY  346

Query  515   MQSMVDLMVLKGRPPFHVAGSFIMSDLTRSKISDVDYGWGKPVFGGPAHGGAGDVPGVIT  336
             M+S   LMV KGRP F V G++I+SDL R+    VD+GWG  ++GG A      +P + +
Sbjct  347   MRSTASLMVSKGRPLFTVPGTYIVSDLRRAGFEKVDFGWGNAIYGGTAKA----IPELAS  402

Query  335   FHVPYENKKGENGTLIPICLPAFALDKFVNEL  240
             F++P+ NKKGE+G ++  CLPA A+++   EL
Sbjct  403   FYIPFTNKKGEDGVVVQFCLPAPAMERLFKEL  434



>ref|XP_002271603.1| PREDICTED: methanol O-anthraniloyltransferase [Vitis vinifera]
Length=449

 Score =   448 bits (1153),  Expect = 2e-150, Method: Compositional matrix adjust.
 Identities = 221/401 (55%), Positives = 280/401 (70%), Gaps = 8/401 (2%)
 Frame = -1

Query  1415  FYRNEPSMSGKDPVQVIRQALAKALVFFYPFAGRLREGPGRKLMVDCTGEGVMFIEADAD  1236
             FYRN P M GKDPV+VIR+AL KAL+++YPFAGRL EG  RKLMVDCTGEGV+FIEADAD
Sbjct  51    FYRNNPLMDGKDPVKVIREALGKALIYYYPFAGRLIEGDNRKLMVDCTGEGVLFIEADAD  110

Query  1235  ATLQHFAIGGELKPPFPCFDQLLYNVPGSAEILNSPLFLIQVTRLRCGGFIFTLRMNHTM  1056
              TL++  +G  ++P  PCF++LLY+VPGS  IL SPL LIQVTRLRCGGFIF LR+NHT+
Sbjct  111   TTLEN--LGDAIQPMCPCFEELLYDVPGSTRILGSPLILIQVTRLRCGGFIFALRLNHTL  168

Query  1055  ADASGLVHFLNTIAEIARGAEAPAVQPVWQREFFSARNPPRITCTHFEYEEEPAADSMVT  876
             +DA+GL+ FLNTI E+A+G   P++ P+WQRE  +ARNPP+IT  H EYE+       + 
Sbjct  169   SDAAGLIQFLNTIGEMAQGLSVPSLLPIWQRELLNARNPPQITRIHHEYEKVTNTKGTLM  228

Query  875   NIPLDNLVHRSFLFGPTEISVLRSSLPPHLRKCSTVEILTALVWRCRTIALGFHPDEEVR  696
              +  +NLVHRSF FG  EI  LR+ LP  L  CST E+L A VWRCRTIA    PDE V 
Sbjct  229   AMDENNLVHRSFFFGREEIRALRNRLPASLGACSTFEVLMACVWRCRTIAFAVDPDEVVG  288

Query  695   MLLLINARFKFKDTPMPSGYTGNAFAYPGAKTTAGKLRKNPLGYAVELVTSIKRCFSEEY  516
             +  +IN R K     +P GY GNAF  P + T AG L KNPL +A+ LV   K   S+EY
Sbjct  289   ISCIINMRGK-HGLELPPGYYGNAFVTPASITKAGMLCKNPLEFAIRLVKKAKAEMSQEY  347

Query  515   MQSMVDLMVLKGRPPFHVAGSFIMSDLTRSKISDVDYGWGKPVFGGPAHGGAGDVPGVIT  336
             ++S+ DLMV+KGRP F   G++I+SD+TR+ I +VD+GWGKPV+GG A         +I+
Sbjct  348   IKSVADLMVIKGRPLFTQPGNYIVSDVTRAGIGEVDFGWGKPVYGGVAKASP-----IIS  402

Query  335   FHVPYENKKGENGTLIPICLPAFALDKFVNELANTFLRAAL  213
             F + + N KGE G +IPICLP   +++F  EL      A L
Sbjct  403   FRMWFRNSKGEEGNVIPICLPPPVMERFEQELKRMTKEAEL  443



>emb|CAN77583.1| hypothetical protein VITISV_040970 [Vitis vinifera]
Length=451

 Score =   448 bits (1153),  Expect = 3e-150, Method: Compositional matrix adjust.
 Identities = 222/392 (57%), Positives = 276/392 (70%), Gaps = 8/392 (2%)
 Frame = -1

Query  1415  FYRNEPSMSGKDPVQVIRQALAKALVFFYPFAGRLREGPGRKLMVDCTGEGVMFIEADAD  1236
             FY N P M GKDPV+VIR+AL KALV++YPFAGRL EG  RKLMVDCTGEGV+FIEADAD
Sbjct  51    FYPNNPLMKGKDPVKVIREALGKALVYYYPFAGRLIEGXNRKLMVDCTGEGVLFIEADAD  110

Query  1235  ATLQHFAIGGELKPPFPCFDQLLYNVPGSAEILNSPLFLIQVTRLRCGGFIFTLRMNHTM  1056
             +TL++  +G  ++P  PCF++LLY+VPGS  IL SPL LIQVTRLRCGGFIF LR+NHTM
Sbjct  111   STLEN--LGDAIQPMCPCFEELLYDVPGSGGILGSPLILIQVTRLRCGGFIFALRLNHTM  168

Query  1055  ADASGLVHFLNTIAEIARGAEAPAVQPVWQREFFSARNPPRITCTHFEYEEEPAADSMVT  876
             +D  GLV FL+ I+E+A+G   P++ P+WQRE  +ARNPPRIT  H EYEE       + 
Sbjct  169   SDGPGLVQFLDAISEMAQGLSVPSLLPIWQRELLNARNPPRITLIHHEYEEVTNTKGTLM  228

Query  875   NIPLDNLVHRSFLFGPTEISVLRSSLPPHLRKCSTVEILTALVWRCRTIALGFHPDEEVR  696
              +  +NLVHRSF FGP EI  LR+ LP  L  CST E+L A VWRCRTIA    PDE VR
Sbjct  229   TMDENNLVHRSFFFGPKEIRALRNRLPASLGACSTFEVLIAYVWRCRTIAFAVDPDEVVR  288

Query  695   MLLLINARFKFKDTPMPSGYTGNAFAYPGAKTTAGKLRKNPLGYAVELVTSIKRCFSEEY  516
             +  L N R K +   +P GY GNAF YP + T AG L KNPL YA+ L+   K   S+EY
Sbjct  289   ISCLTNMRGK-RGFDLPPGYYGNAFVYPASITKAGMLCKNPLEYAIRLLKKAKAEMSQEY  347

Query  515   MQSMVDLMVLKGRPPFHVAGSFIMSDLTRSKISDVDYGWGKPVFGGPAHGGAGDVPGVIT  336
             ++S+ DLMV+KGRP F   G++I+SDLTR+   + D+GWGKPV+GG A   +      I+
Sbjct  348   VKSVADLMVIKGRPLFTQPGNYIISDLTRAGFGEXDFGWGKPVYGGXARALS-----XIS  402

Query  335   FHVPYENKKGENGTLIPICLPAFALDKFVNEL  240
             F + + N KGE G +IPICLP    ++F  EL
Sbjct  403   FCMRFRNSKGEEGNVIPICLPPPVXERFEQEL  434



>ref|XP_004151857.1| PREDICTED: benzyl alcohol O-benzoyltransferase-like [Cucumis 
sativus]
 gb|KGN63330.1| hypothetical protein Csa_2G429030 [Cucumis sativus]
Length=461

 Score =   448 bits (1153),  Expect = 3e-150, Method: Compositional matrix adjust.
 Identities = 215/416 (52%), Positives = 290/416 (70%), Gaps = 21/416 (5%)
 Frame = -1

Query  1415  FYRNEPSMSGKDPVQVIRQALAKALVFFYPFAGRLREGPGRKLMVDCTGEGVMFIEADAD  1236
              Y + P M G DPV+VI++A++  LVF+YPFAGRLREGPG+KL V+CT EG++FIEADA+
Sbjct  52    LYAHNPRMEGSDPVKVIKKAISDTLVFYYPFAGRLREGPGKKLFVECTAEGILFIEADAN  111

Query  1235  ATLQHFAIGGELKPPFPCFDQLLYNVPGSAEILNSPLFLIQVTRLRCGGFIFTLRMNHTM  1056
               LQ F  G  ++PPF   D +LYNVP S  I+NSPL L+QVTRLRCGGFIF +R+NHTM
Sbjct  112   VALQQF--GDAVQPPFAFLDDVLYNVPSSDGIINSPLLLVQVTRLRCGGFIFAIRVNHTM  169

Query  1055  ADASGLVHFLNTIAEIARGAEAPAVQPVWQREFFSARNPPRITCTHFEYEEEPAADSMVT  876
              DA GL+ F+  + E+A G  AP+V PVWQR   +AR+PP +T  H EY++    D+   
Sbjct  170   TDAFGLMQFMTAVREMACGDTAPSVLPVWQRSLLNARDPPTVTHRHHEYDQ--VVDTKQI  227

Query  875   NIPLDNLVHRSFLFGPTEISVLRSSLPPHLRKCSTVEILTALVWRCRTIALGFHPDEEVR  696
             NI L+ + H S  FGPTEIS LR +LP HLR CS+ +++TA +WR RTIAL  +P++E+R
Sbjct  228   NISLNEMAHGSVFFGPTEISTLRKTLPIHLRYCSSFDLITACLWRTRTIALQPNPNDEMR  287

Query  695   MLLLINARFKFKDTPMPSGYTGNAFAYPGAKTTAGKLRKNPLGYAVELVTSIKRCFSEEY  516
             +L ++N R K K   +PSGY GNAFA P A  TAG L +NPL YAVEL+   K   +EEY
Sbjct  288   LLCVVNLRSKSKY--LPSGYYGNAFALPAAVATAGNLCQNPLSYAVELIRKAKAEMTEEY  345

Query  515   MQSMVDLMVLKGRPPFHVAGSFIMSDLTRSKISDVDYGWGKPVFGGPAHGGAGDVPGVIT  336
             M+S+ DLMV+ GRP      S+ +SD+T++ +  +D+GWG+ +FGGPA GG   VPG+ +
Sbjct  346   MKSVADLMVINGRPNLTAVRSYAVSDVTKTDLEKIDFGWGEAIFGGPAMGGVATVPGLTS  405

Query  335   FHVPYENKKGENGTLIPICLPAFALDKFV------------NELANT---FLRAAL  213
             F++ ++NKKGE GT++P  LP  A+++FV            NE+ NT   F+RAAL
Sbjct  406   FYISFKNKKGEQGTVVPFSLPVEAMERFVVELDAAFKTKPLNEVENTKQGFIRAAL  461



>ref|XP_007029790.1| Benzoyl coenzyme A: Benzyl alcohol benzoyl transferase [Theobroma 
cacao]
 gb|EOY10292.1| Benzoyl coenzyme A: Benzyl alcohol benzoyl transferase [Theobroma 
cacao]
Length=457

 Score =   448 bits (1152),  Expect = 4e-150, Method: Compositional matrix adjust.
 Identities = 220/393 (56%), Positives = 278/393 (71%), Gaps = 9/393 (2%)
 Frame = -1

Query  1415  FYRNEPSMSGKDPVQVIRQALAKALVFFYPFAGRLREGPGRKLMVDCTGEGVMFIEADAD  1236
             FYR  P M GKDP  ++R+ALA+ALVF+YP AGRLREGP RKLMVDC GEG +F+EADAD
Sbjct  51    FYRYNPCMQGKDPAMIVREALAQALVFYYPLAGRLREGPNRKLMVDCNGEGALFVEADAD  110

Query  1235  ATLQHFAIGGELKPPFPCFDQLLYNVPGSAEILNSPLFLIQVTRLRCGGFIFTLRMNHTM  1056
              TL+ F  G  L+PPFPC  +LLY+ P S  +LNSPL  IQVTRLRCGGFIF + +NH M
Sbjct  111   VTLEQF--GDALQPPFPCLHELLYDTPSSEGMLNSPLLFIQVTRLRCGGFIFAISLNHVM  168

Query  1055  ADASGLVHFLNTIAEIARGAEAPAVQPVWQREFFSARNPPRITCTHFEYEEEPAADSMVT  876
             +DASG++ F+  +AEIA GA AP + PVW+R    AR+PPR   TH EY++  AA    +
Sbjct  169   SDASGMIQFMFAMAEIAHGA-APLIPPVWERHLLDARDPPRAAFTHHEYDQVEAA----S  223

Query  875   NIPLDNLVHRSFLFGPTEISVLRSSLPPHLRKCSTVEILTALVWRCRTIALGFHPDEEVR  696
               P +N VHRSF FGP E+S LR  LP HL KCS  E+L A +WRCRTIA+   P+EEVR
Sbjct  224   ITPSENTVHRSFFFGPNEVSTLRRLLPEHLCKCSRFELLAACLWRCRTIAIKPDPEEEVR  283

Query  695   MLLLINARFKFKDTPMPSGYTGNAFAYPGAKTTAGKLRKNPLGYAVELVTSIKRCFSEEY  516
             ML ++N R KF + P+PSGY GNA A+P A TTA KL +NPLGYAV+LV   K   +EEY
Sbjct  284   MLSMVNVRRKF-NPPLPSGYYGNAVAFPAAITTARKLCQNPLGYAVKLVKQAKESVTEEY  342

Query  515   MQSMVDLMVLKGRPPFHVAGSFIMSDLTRSKISDVDYGWGKPVFGG-PAHGGAGDVPGVI  339
             ++S+  LMV+KGRP +    S ++SDLTR+   +VD+GWGK V+GG P  G    +    
Sbjct  343   VKSVAALMVIKGRPHYPTVRSCLISDLTRAGFGEVDFGWGKAVYGGLPKAGLGATLHAPS  402

Query  338   TFHVPYENKKGENGTLIPICLPAFALDKFVNEL  240
             +F +  +NKKGE G  +PICLPA A+++F  EL
Sbjct  403   SFLIAVKNKKGEAGIAMPICLPAPAMERFAKEL  435



>gb|KDP39576.1| hypothetical protein JCGZ_02596 [Jatropha curcas]
Length=454

 Score =   447 bits (1151),  Expect = 5e-150, Method: Compositional matrix adjust.
 Identities = 213/395 (54%), Positives = 285/395 (72%), Gaps = 10/395 (3%)
 Frame = -1

Query  1415  FYRNEPSMSGKDPVQVIRQALAKALVFFYPFAGRLREGPGRKLMVDCTGEGVMFIEADAD  1236
              YR++PSM GKDPVQVIR A+AKALVF+YPFAGRLREG  RKL++DC GEGV+FIEADA+
Sbjct  49    IYRHDPSMEGKDPVQVIRNAIAKALVFYYPFAGRLREGANRKLIMDCNGEGVLFIEADAN  108

Query  1235  ATLQHFAIGGELKPPFPCFDQLLYNVPGSAEILNSPLFLIQVTRLRCGGFIFTLRMNHTM  1056
              +L     G  L+PPFP  D+LL++VPGS+ ILN P+ LIQVTR +CGGF F +R NHTM
Sbjct  109   VSLDQS--GDALQPPFPFLDELLFDVPGSSGILNCPVVLIQVTRFKCGGFTFAIRFNHTM  166

Query  1055  ADASGLVHFLNTIAEIARGAEAPAVQPVWQREFFSARNPPRITCTHFEYEEEPAADSMVT  876
             +D  GL  FL+ IAE+ARG ++P++ PVW+R    ARNPPR+TC H EY+     +    
Sbjct  167   SDGPGLAQFLSAIAEMARGRQSPSIFPVWERHVLDARNPPRVTCIHREYDH--IENGQGI  224

Query  875   NIPLDNLVHRSFLFGPTEISVLRSS-LPPHLRKCSTVEILTALVWRCRTIALGFHPDEEV  699
               PLD++VHR+   GP+ +S LRS  +PPHL +C+ VEILTA +W+CRTIAL     +E+
Sbjct  225   PFPLDDIVHRAIFIGPSALSTLRSRYIPPHLSRCTDVEILTACLWKCRTIALQPDAGQEM  284

Query  698   RMLLLINARFKFKDTPMPSGYTGNAFAYPGAKTTAGKLRKNPLGYAVELVTSIKRCFSEE  519
             RM+LL NAR KF    +P GY GN F    A  TAG++ K+P+GY +EL+   K  F  E
Sbjct  285   RMILLNNAR-KFNPPLLPEGYYGNGFVLSTAVATAGEISKSPIGYGLELIRKGKMEFDRE  343

Query  518   YMQSMVDLMVLKGRPPFHVAGSFIMSDLTRSKISDVDYGWGKPVFGGPAHGGAGDVPGVI  339
             Y+QS+ DL+V+KGRP F   G++++SD+  ++  +VD+GWG  ++GGPA      +P   
Sbjct  344   YIQSVADLLVIKGRPHFTAEGTYVVSDVRHARFKEVDFGWGNAIYGGPAKA----IPIAA  399

Query  338   TFHVPYENKKGENGTLIPICLPAFALDKFVNELAN  234
             +F+VP+E+KKGENG +IPICLPA A+++FV EL N
Sbjct  400   SFYVPFESKKGENGIVIPICLPAQAMERFVKELKN  434



>ref|XP_008678444.1| PREDICTED: benzyl alcohol O-benzoyltransferase-like [Zea mays]
 gb|AFW61772.1| 10-deacetylbaccatin III 10-O-acetyltransferase [Zea mays]
Length=459

 Score =   448 bits (1152),  Expect = 5e-150, Method: Compositional matrix adjust.
 Identities = 216/395 (55%), Positives = 281/395 (71%), Gaps = 5/395 (1%)
 Frame = -1

Query  1415  FYRNEPSMSGKDPVQVIRQALAKALVFFYPFAGRLREGPGRKLMVDCTGEGVMFIEADAD  1236
             FYR    M G++P  VIR A+A+ALV +YPFAGRLRE  GRKL VDCTGEGV+FIEA+AD
Sbjct  48    FYRQNALMGGREPAPVIRDAIARALVPYYPFAGRLRELEGRKLAVDCTGEGVLFIEAEAD  107

Query  1235  ATLQHFAIGGELKPPFPCFDQLLYNVPGSAEILNSPLFLIQVTRLRCGGFIFTLRMNHTM  1056
               L HF  G EL+PPFPC ++L+++VPGS+E+L SPL L QVTRL CGGFI  +R++HTM
Sbjct  108   VRLDHF--GDELQPPFPCLEELIFDVPGSSEVLGSPLLLFQVTRLACGGFILGVRLHHTM  165

Query  1055  ADASGLVHFLNTIAEIARGAEAPAVQPVWQREFFSARNPPRITCTHFEYEEEPAADSMVT  876
             ADA GLV FL  +AE+ARGA  P V+PVW RE   AR+PPR    H EY+E P  D+  +
Sbjct  166   ADAQGLVQFLGAVAELARGAAGPTVRPVWGRELLEARDPPRPAFAHREYDEVP--DTKGS  223

Query  875   NIPLDNLVHRSFLFGPTEISVLRSSLPPHLR-KCSTVEILTALVWRCRTIALGFHPDEEV  699
              IPLD++VHRSF FG  E++ +R++LPP LR + S  ++LT L+W+CRT AL    DE +
Sbjct  224   IIPLDDMVHRSFFFGRHEVAAIRANLPPDLRSRASKFDLLTGLLWKCRTAALALDADEVM  283

Query  698   RMLLLINARFKFKDTPMPSGYTGNAFAYPGAKTTAGKLRKNPLGYAVELVTSIKRCFSEE  519
             RM+ ++ A        +P GY GNAFA P A  TAG L   PLGYAVELV   K   + E
Sbjct  284   RMICVVTAHGGKSGVAIPKGYYGNAFALPAAVATAGDLVAKPLGYAVELVKRAKGEVNVE  343

Query  518   YMQSMVDLMVLKGRPPFHVAGSFIMSDLTRSKISDVDYGWGKPVFGGPAHGGAGDVPGVI  339
             YM+S+ DLMVL+GRP F V  +++ SDLT++  S++D+GWG PV+GGPA+ G G  PG+ 
Sbjct  344   YMRSVADLMVLRGRPHFTVVRAYLASDLTKAGFSNLDFGWGNPVYGGPANVGVGTSPGMA  403

Query  338   TFHVPYENKKGENGTLIPICLPAFALDKFVNELAN  234
             TF VP +N KGE+G ++P+CLP  A++ FV E+  
Sbjct  404   TFLVPCKNAKGEDGIIVPMCLPGPAMETFVKEMGT  438



>gb|KHN31434.1| Benzyl alcohol O-benzoyltransferase [Glycine soja]
Length=471

 Score =   448 bits (1152),  Expect = 7e-150, Method: Compositional matrix adjust.
 Identities = 220/399 (55%), Positives = 290/399 (73%), Gaps = 12/399 (3%)
 Frame = -1

Query  1415  FYRNEPSMSGKDPVQVIRQALAKALVFFYPFAGRLREGPGRKLMVDCTGEGVMFIEADAD  1236
             FY NEPSM+GKDP +VIR+ALA+ LVF+YPFAGR+REGPGRKL+VDCTGEGVMFIEADAD
Sbjct  51    FYGNEPSMAGKDPAKVIREALAQTLVFYYPFAGRIREGPGRKLVVDCTGEGVMFIEADAD  110

Query  1235  ATLQHFAIGGELKPPFPCFDQLLYNVPGSAEILNSPLFLIQVTRLRCGGFIFTLRMNHTM  1056
             ATL    +G  L+PPFPCF+QLLY+VPGS  +++ PL L QVTR +CGGF   +R+NHTM
Sbjct  111   ATLDQ--LGDTLQPPFPCFEQLLYDVPGSEGVIDCPLMLFQVTRFKCGGFALAVRLNHTM  168

Query  1055  ADASGLVHFLNTIAEIARGAEAPAVQPVWQREFFSARNPPRITCTHFEYEEEPAADSMVT  876
             +D +G+  F+NT+AE+A+GA  P+V PVW+RE   AR+PP ITC H EYE+ P  ++M  
Sbjct  169   SDGAGIALFMNTLAEMAQGATEPSVPPVWRRELLQARDPPHITCNHREYEQIP--NNMEG  226

Query  875   NIPL--DNLVHRSFLFGPTEISVLRSSLPPHLRKCSTVEILTALVWRCRTIALGFHPDEE  702
              IP   + +V RSF FG ++I+ LR  +P + RKC++ +++TA  WRCRT AL    DE+
Sbjct  227   IIPSYENKMVLRSFFFGASDIAALRRLVPHYHRKCTSFDLITACFWRCRTKALEIDADED  286

Query  701   VRMLLLINARFKFKDTPMPSGYTGNAFAYPGAKTTAGKLRKNPLGYAVELVTSIKRCFSE  522
             VRM++++NAR +F + P+P+GY G    YP A TTAGKL +NP GYAVEL+  +K   +E
Sbjct  287   VRMMVIVNARARF-NPPLPAGYYG----YPAAVTTAGKLCENPFGYAVELINKLKGEVTE  341

Query  521   EYMQSMVDLMVLKGRPPFHVAGSFIMSDLTRSKISDVDYGWGKPVFGGPAHGGAGDVPGV  342
             EYM S+ DLMV  GR  F    SFI+SDL       +D+GWG+ ++GG A GGAG  P V
Sbjct  342   EYMHSVADLMVTNGRCLFTTVRSFIVSDLRHFGFKQIDFGWGRALYGGVAKGGAGPFPAV  401

Query  341   ITFHVPYENKKGENGTLIPICLPAFALDKFVNELANTFL  225
               + + ++N KGE G L+PI LPA A+DKF NEL +  +
Sbjct  402   F-YLMAHKNAKGEEGILLPIWLPAKAMDKFANELDHMLI  439



>ref|XP_002319765.2| hypothetical protein POPTR_0013s07220g [Populus trichocarpa]
 gb|EEE95688.2| hypothetical protein POPTR_0013s07220g [Populus trichocarpa]
Length=440

 Score =   446 bits (1148),  Expect = 8e-150, Method: Compositional matrix adjust.
 Identities = 212/392 (54%), Positives = 283/392 (72%), Gaps = 8/392 (2%)
 Frame = -1

Query  1415  FYRNEPSMSGKDPVQVIRQALAKALVFFYPFAGRLREGPGRKLMVDCTGEGVMFIEADAD  1236
             FYR+ PS+ GKDPV+VIR+A+AK LVF+YPFAGRL  G  RKLMV+CTGEG++FIEADAD
Sbjct  51    FYRHNPSLQGKDPVKVIREAIAKTLVFYYPFAGRLMAGHNRKLMVECTGEGILFIEADAD  110

Query  1235  ATLQHFAIGGELKPPFPCFDQLLYNVPGSAEILNSPLFLIQVTRLRCGGFIFTLRMNHTM  1056
              TL+ F  G  L+PPFPC ++LL++VPGS+ +LN PL LIQV+RL+CGGF+F+LR+NHTM
Sbjct  111   VTLEQF--GDPLQPPFPCLEELLFDVPGSSGVLNCPLLLIQVSRLKCGGFLFSLRLNHTM  168

Query  1055  ADASGLVHFLNTIAEIARGAEAPAVQPVWQREFFSARNPPRITCTHFEYEEEPAADSMVT  876
             +D  GLV F+  + E+ARGA AP+V PVW+R   +A +PPR++C H  YEE   A S  +
Sbjct  169   SDGPGLVQFMAAVGEMARGASAPSVPPVWERHVLNATDPPRVSCRHRAYEE--VAGSKSS  226

Query  875   NIPLDNLVHRSFLFGPTEISVLRSSLPPHLRKCSTVEILTALVWRCRTIALGFHPDEEVR  696
              +  D+LVHRSF F P++I+ LR  +PPHL  CS+ EILTA +W CR IAL   P+EE+R
Sbjct  227   ILTHDHLVHRSFFFSPSDITALRKLVPPHLGYCSSFEILTACLWICRAIALQPDPNEEMR  286

Query  695   MLLLINARFKFKDTPMPSGYTGNAFAYPGAKTTAGKLRKNPLGYAVELVTSIKRCFSEEY  516
             ++ L+NAR KF    +P GY GN F    A  TAG+L K P+GYA+ELV   K   +EEY
Sbjct  287   IICLVNAREKFNPPLLPRGYYGNGFGLLAAVATAGELSKRPIGYALELVKKAKAGMTEEY  346

Query  515   MQSMVDLMVLKGRPPFHVAGSFIMSDLTRSKISDVDYGWGKPVFGGPAHGGAGDVPGVIT  336
             M+S   LMV KGRP F V G++I+SDL R+    VD+GWG  ++GG A      +P + +
Sbjct  347   MRSTASLMVSKGRPLFTVPGTYIVSDLRRAGFEKVDFGWGNALYGGTAKA----IPELAS  402

Query  335   FHVPYENKKGENGTLIPICLPAFALDKFVNEL  240
             F++P+ NKKGE+G ++  CLPA A+++   EL
Sbjct  403   FYIPFTNKKGEDGVVVQFCLPAPAMERLFKEL  434



>ref|XP_002266420.1| PREDICTED: methanol O-anthraniloyltransferase [Vitis vinifera]
Length=451

 Score =   447 bits (1149),  Expect = 8e-150, Method: Compositional matrix adjust.
 Identities = 219/392 (56%), Positives = 277/392 (71%), Gaps = 8/392 (2%)
 Frame = -1

Query  1415  FYRNEPSMSGKDPVQVIRQALAKALVFFYPFAGRLREGPGRKLMVDCTGEGVMFIEADAD  1236
             FY N P M GKDP +VI++AL KALV++YPFAGRL EG  RKLMVDCTGEGV+FIEADAD
Sbjct  51    FYPNNPLMKGKDPAKVIKEALGKALVYYYPFAGRLIEGDNRKLMVDCTGEGVLFIEADAD  110

Query  1235  ATLQHFAIGGELKPPFPCFDQLLYNVPGSAEILNSPLFLIQVTRLRCGGFIFTLRMNHTM  1056
              TL++  +G  ++P  PCF++LLY+VPGS  IL SPL LIQVTRLRCGGFIF LR+NHTM
Sbjct  111   TTLEN--LGDAIQPMCPCFEELLYDVPGSGGILGSPLILIQVTRLRCGGFIFALRLNHTM  168

Query  1055  ADASGLVHFLNTIAEIARGAEAPAVQPVWQREFFSARNPPRITCTHFEYEEEPAADSMVT  876
             +D  GLV FL+ I+E+A+G   P++ P+WQRE  +ARNPPRIT  H EYEE       + 
Sbjct  169   SDGPGLVQFLDAISEMAQGLSVPSLLPIWQRELLNARNPPRITRIHHEYEEVTNTKGTLM  228

Query  875   NIPLDNLVHRSFLFGPTEISVLRSSLPPHLRKCSTVEILTALVWRCRTIALGFHPDEEVR  696
              +  +NLVHRSF FGP EI  LR+ LP  L  CST E+L A VWRCRTIA    PDE VR
Sbjct  229   TMDENNLVHRSFFFGPKEIRALRNRLPASLGACSTFEVLIAYVWRCRTIAFAVDPDEVVR  288

Query  695   MLLLINARFKFKDTPMPSGYTGNAFAYPGAKTTAGKLRKNPLGYAVELVTSIKRCFSEEY  516
             +  LIN R K +   +P GY GNAF YP + T AG L KNPL YA+ L+   K   S+EY
Sbjct  289   ISCLINMRGK-RGFDLPPGYYGNAFVYPASITKAGMLCKNPLEYAIRLLKKAKAEMSQEY  347

Query  515   MQSMVDLMVLKGRPPFHVAGSFIMSDLTRSKISDVDYGWGKPVFGGPAHGGAGDVPGVIT  336
             ++S+ D MV+KGRP F   G++++SD+TR+ I ++D+GWGKPV+GG A   +      I+
Sbjct  348   VKSVADHMVIKGRPSFTQPGNYLISDVTRAGIGEIDFGWGKPVYGGVARALSN-----IS  402

Query  335   FHVPYENKKGENGTLIPICLPAFALDKFVNEL  240
             F + + N KGE G +IPICLP   +++F  EL
Sbjct  403   FCMRFRNSKGEEGNVIPICLPPPVMERFEQEL  434



>emb|CBI37442.3| unnamed protein product [Vitis vinifera]
Length=475

 Score =   447 bits (1150),  Expect = 1e-149, Method: Compositional matrix adjust.
 Identities = 219/392 (56%), Positives = 277/392 (71%), Gaps = 8/392 (2%)
 Frame = -1

Query  1415  FYRNEPSMSGKDPVQVIRQALAKALVFFYPFAGRLREGPGRKLMVDCTGEGVMFIEADAD  1236
             FY N P M GKDP +VI++AL KALV++YPFAGRL EG  RKLMVDCTGEGV+FIEADAD
Sbjct  75    FYPNNPLMKGKDPAKVIKEALGKALVYYYPFAGRLIEGDNRKLMVDCTGEGVLFIEADAD  134

Query  1235  ATLQHFAIGGELKPPFPCFDQLLYNVPGSAEILNSPLFLIQVTRLRCGGFIFTLRMNHTM  1056
              TL++  +G  ++P  PCF++LLY+VPGS  IL SPL LIQVTRLRCGGFIF LR+NHTM
Sbjct  135   TTLEN--LGDAIQPMCPCFEELLYDVPGSGGILGSPLILIQVTRLRCGGFIFALRLNHTM  192

Query  1055  ADASGLVHFLNTIAEIARGAEAPAVQPVWQREFFSARNPPRITCTHFEYEEEPAADSMVT  876
             +D  GLV FL+ I+E+A+G   P++ P+WQRE  +ARNPPRIT  H EYEE       + 
Sbjct  193   SDGPGLVQFLDAISEMAQGLSVPSLLPIWQRELLNARNPPRITRIHHEYEEVTNTKGTLM  252

Query  875   NIPLDNLVHRSFLFGPTEISVLRSSLPPHLRKCSTVEILTALVWRCRTIALGFHPDEEVR  696
              +  +NLVHRSF FGP EI  LR+ LP  L  CST E+L A VWRCRTIA    PDE VR
Sbjct  253   TMDENNLVHRSFFFGPKEIRALRNRLPASLGACSTFEVLIAYVWRCRTIAFAVDPDEVVR  312

Query  695   MLLLINARFKFKDTPMPSGYTGNAFAYPGAKTTAGKLRKNPLGYAVELVTSIKRCFSEEY  516
             +  LIN R K +   +P GY GNAF YP + T AG L KNPL YA+ L+   K   S+EY
Sbjct  313   ISCLINMRGK-RGFDLPPGYYGNAFVYPASITKAGMLCKNPLEYAIRLLKKAKAEMSQEY  371

Query  515   MQSMVDLMVLKGRPPFHVAGSFIMSDLTRSKISDVDYGWGKPVFGGPAHGGAGDVPGVIT  336
             ++S+ D MV+KGRP F   G++++SD+TR+ I ++D+GWGKPV+GG A   +      I+
Sbjct  372   VKSVADHMVIKGRPSFTQPGNYLISDVTRAGIGEIDFGWGKPVYGGVARALSN-----IS  426

Query  335   FHVPYENKKGENGTLIPICLPAFALDKFVNEL  240
             F + + N KGE G +IPICLP   +++F  EL
Sbjct  427   FCMRFRNSKGEEGNVIPICLPPPVMERFEQEL  458



>ref|XP_007029781.1| Benzoyl coenzyme A: Benzyl alcohol benzoyl transferase [Theobroma 
cacao]
 gb|EOY10283.1| Benzoyl coenzyme A: Benzyl alcohol benzoyl transferase [Theobroma 
cacao]
Length=562

 Score =   450 bits (1158),  Expect = 1e-149, Method: Compositional matrix adjust.
 Identities = 218/392 (56%), Positives = 284/392 (72%), Gaps = 12/392 (3%)
 Frame = -1

Query  1415  FYRNEPSMSGKDPVQVIRQALAKALVFFYPFAGRLREGPGRKLMVDCTGEGVMFIEADAD  1236
             FYR +PSM GKDP  +I++AL KALVF+YP+AGRLREGP RKL+VDCTGEGV+FI+ADAD
Sbjct  161   FYRFKPSMQGKDPACIIKEALTKALVFYYPYAGRLREGPNRKLVVDCTGEGVLFIQADAD  220

Query  1235  ATLQHFAIGGELKPPFPCFDQLLYNVPGSAEILNSPLFLIQVTRLRCGGFIFTLRMNHTM  1056
              TL  F  G  L PPFPC+ +LLY VPGS EILN PL  IQVTRL+CGGFI   R NHTM
Sbjct  221   VTLDQF--GDSLHPPFPCYKELLYEVPGSNEILNCPLLQIQVTRLKCGGFILAHRFNHTM  278

Query  1055  ADASGLVHFLNTIAEIARGAEAPAVQPVWQREFFSARNPPRITCTHFEYEEEPAADSMVT  876
              DA G   F+  + E+ARGA AP+  PVW+R   +AR+ P ITC H EY+     + +  
Sbjct  279   NDAVGQSQFMCAMGEMARGALAPSTPPVWERHLLNARHSPLITCVHDEYDNATLTNGI--  336

Query  875   NIPLDNLVHRSFLFGPTEISVLRSSLPPHLRKCSTVEILTALVWRCRTIALGFHPDEEVR  696
              IP DNL+HRSF FGPT+IS LR  +P +LR CST +I+TA +WRCRT AL   P+++VR
Sbjct  337   EIP-DNLLHRSFFFGPTQISALRRFVPHNLR-CSTFDIVTACLWRCRTKALKLGPNDDVR  394

Query  695   MLLLINARFKFKDTPMPSGYTGNAFAYPGAKTTAGKLRKNPLGYAVELVTSIKRCFSEEY  516
              + ++N R KF + P+PSG+ GNA  YP A TTAG+L +NP+ YA++LV   K   +EEY
Sbjct  395   FICIVNVRSKF-NPPLPSGFYGNALGYPAALTTAGQLCQNPMEYAIQLVRQAKAKITEEY  453

Query  515   MQSMVDLMVLKGRPPFHVAGSFIMSDLTRSKISDVDYGWGKPVFGGPAHGGAGDVPGVIT  336
             M+S  DLMV++GRP  +    F++SDLTR+K  +VD+GWG+  FGGPA+GG      +I+
Sbjct  454   MKSTADLMVIRGRPNVNTVRCFMVSDLTRAKFREVDFGWGEAEFGGPAYGG-----DIIS  508

Query  335   FHVPYENKKGENGTLIPICLPAFALDKFVNEL  240
             F++P +NK+GE G ++P+CLPA  ++ FV EL
Sbjct  509   FYIPSKNKEGEGGIVVPVCLPAPVMESFVKEL  540



>ref|XP_002270962.1| PREDICTED: methanol O-anthraniloyltransferase isoform X1 [Vitis 
vinifera]
 emb|CBI37440.3| unnamed protein product [Vitis vinifera]
Length=451

 Score =   446 bits (1147),  Expect = 2e-149, Method: Compositional matrix adjust.
 Identities = 218/392 (56%), Positives = 277/392 (71%), Gaps = 8/392 (2%)
 Frame = -1

Query  1415  FYRNEPSMSGKDPVQVIRQALAKALVFFYPFAGRLREGPGRKLMVDCTGEGVMFIEADAD  1236
             FY N P M GKDP +VI++AL KALV++YPFAGRL EG  RKLMVDCTGEGV+FIEADAD
Sbjct  51    FYPNNPLMKGKDPAKVIKEALGKALVYYYPFAGRLIEGDNRKLMVDCTGEGVLFIEADAD  110

Query  1235  ATLQHFAIGGELKPPFPCFDQLLYNVPGSAEILNSPLFLIQVTRLRCGGFIFTLRMNHTM  1056
              TL++  +G  ++P  PC++++LY+VPGS EIL SPL LIQVTRLRCGGFIF LR+NHTM
Sbjct  111   TTLEN--LGDSIQPMCPCYEEILYDVPGSGEILGSPLILIQVTRLRCGGFIFALRLNHTM  168

Query  1055  ADASGLVHFLNTIAEIARGAEAPAVQPVWQREFFSARNPPRITCTHFEYEEEPAADSMVT  876
             +D  GLV FL+ I+E+A+G   P++ P+WQRE  +ARNPPRIT  H EYEE       + 
Sbjct  169   SDGPGLVQFLDAISEMAQGLSVPSLLPIWQRELLNARNPPRITRIHHEYEEVTNTRGTLM  228

Query  875   NIPLDNLVHRSFLFGPTEISVLRSSLPPHLRKCSTVEILTALVWRCRTIALGFHPDEEVR  696
              +  +NLVHRSF FG  EI  LR+ LP  L  CST E+L A VWRCRTIA    PDE VR
Sbjct  229   TMDENNLVHRSFFFGLKEIRALRNRLPASLGACSTFEVLIAYVWRCRTIAFAVDPDEVVR  288

Query  695   MLLLINARFKFKDTPMPSGYTGNAFAYPGAKTTAGKLRKNPLGYAVELVTSIKRCFSEEY  516
             +  LIN R K +   +P GY GNAF YP + T AG L KNPL YA+ L+   K   S+EY
Sbjct  289   ISCLINMRGK-RGFDLPPGYYGNAFVYPASITKAGMLCKNPLEYAIRLLKKAKAEMSQEY  347

Query  515   MQSMVDLMVLKGRPPFHVAGSFIMSDLTRSKISDVDYGWGKPVFGGPAHGGAGDVPGVIT  336
             ++S+ DLMV+KGRP F   G++++SDLTR+   ++D+GWGKPV+GG A   +      I+
Sbjct  348   VKSVADLMVIKGRPSFTQPGNYLISDLTRAGFGEIDFGWGKPVYGGIARALSN-----IS  402

Query  335   FHVPYENKKGENGTLIPICLPAFALDKFVNEL  240
             F + + N KGE G +IPICLP   +++F  EL
Sbjct  403   FCMRFRNSKGEEGNVIPICLPPPVMERFEQEL  434



>emb|CAN69948.1| hypothetical protein VITISV_009219 [Vitis vinifera]
Length=451

 Score =   446 bits (1147),  Expect = 2e-149, Method: Compositional matrix adjust.
 Identities = 218/392 (56%), Positives = 277/392 (71%), Gaps = 8/392 (2%)
 Frame = -1

Query  1415  FYRNEPSMSGKDPVQVIRQALAKALVFFYPFAGRLREGPGRKLMVDCTGEGVMFIEADAD  1236
             FY N P M GKDP +VI++AL KALV++YPFAGRL EG  RKLMVDCTGEGV+FIEADAD
Sbjct  51    FYPNNPLMKGKDPAKVIKEALGKALVYYYPFAGRLIEGDNRKLMVDCTGEGVLFIEADAD  110

Query  1235  ATLQHFAIGGELKPPFPCFDQLLYNVPGSAEILNSPLFLIQVTRLRCGGFIFTLRMNHTM  1056
              TL++  +G  ++P  PC++++LY+VPGS EIL SPL LIQVTRLRCGGFIF LR+NHTM
Sbjct  111   TTLEN--LGDSIQPMCPCYEEILYDVPGSGEILGSPLILIQVTRLRCGGFIFALRLNHTM  168

Query  1055  ADASGLVHFLNTIAEIARGAEAPAVQPVWQREFFSARNPPRITCTHFEYEEEPAADSMVT  876
             +D  GLV FL+ I+E+A+G   P++ P+WQRE  +ARNPPRIT  H EYEE       + 
Sbjct  169   SDGPGLVQFLDAISEMAQGLSVPSLLPIWQRELLNARNPPRITRIHHEYEEVTNTRGTLM  228

Query  875   NIPLDNLVHRSFLFGPTEISVLRSSLPPHLRKCSTVEILTALVWRCRTIALGFHPDEEVR  696
              +  +NLVHRSF FG  EI  LR+ LP  L  CST E+L A VWRCRTIA    PDE VR
Sbjct  229   TMDENNLVHRSFFFGLKEIRALRNRLPASLGACSTFEVLIAYVWRCRTIAFAVDPDEVVR  288

Query  695   MLLLINARFKFKDTPMPSGYTGNAFAYPGAKTTAGKLRKNPLGYAVELVTSIKRCFSEEY  516
             +  LIN R K +   +P GY GNAF YP + T AG L KNPL YA+ L+   K   S+EY
Sbjct  289   ISCLINMRGK-RGFDLPPGYYGNAFVYPASITKAGMLCKNPLEYAIRLLKKAKAEMSQEY  347

Query  515   MQSMVDLMVLKGRPPFHVAGSFIMSDLTRSKISDVDYGWGKPVFGGPAHGGAGDVPGVIT  336
             ++S+ DLMV+KGRP F   G++++SDLTR+   ++D+GWGKPV+GG A   +      I+
Sbjct  348   VKSVADLMVIKGRPSFTQPGNYLISDLTRAGFGEIDFGWGKPVYGGIARALSN-----IS  402

Query  335   FHVPYENKKGENGTLIPICLPAFALDKFVNEL  240
             F + + N KGE G +IPICLP   +++F  EL
Sbjct  403   FCMRFRNSKGEEGNVIPICLPPPVMERFEEEL  434



>ref|XP_004156760.1| PREDICTED: LOW QUALITY PROTEIN: benzyl alcohol O-benzoyltransferase-like 
[Cucumis sativus]
Length=461

 Score =   446 bits (1147),  Expect = 2e-149, Method: Compositional matrix adjust.
 Identities = 214/416 (51%), Positives = 289/416 (69%), Gaps = 21/416 (5%)
 Frame = -1

Query  1415  FYRNEPSMSGKDPVQVIRQALAKALVFFYPFAGRLREGPGRKLMVDCTGEGVMFIEADAD  1236
              Y + P M G DPV+VI++A++  LVF+YPFAGRLREGPG+KL V+CT EG++FIEADA+
Sbjct  52    LYAHNPRMEGSDPVKVIKKAISDTLVFYYPFAGRLREGPGKKLFVECTAEGILFIEADAN  111

Query  1235  ATLQHFAIGGELKPPFPCFDQLLYNVPGSAEILNSPLFLIQVTRLRCGGFIFTLRMNHTM  1056
               LQ F  G  ++PPF   D +LYNVP S  I+NSPL L+QVTRLRCGGFIF +R+NHTM
Sbjct  112   VALQQF--GDAVQPPFAFLDDVLYNVPSSDGIINSPLLLVQVTRLRCGGFIFAIRVNHTM  169

Query  1055  ADASGLVHFLNTIAEIARGAEAPAVQPVWQREFFSARNPPRITCTHFEYEEEPAADSMVT  876
              DA GL+ F+  + E+A G  AP+V PVWQR   +AR+PP +T  H EY++    D+   
Sbjct  170   TDAFGLMQFMTAVREMACGDTAPSVLPVWQRSLLNARDPPTVTHRHHEYDQ--VVDTKQI  227

Query  875   NIPLDNLVHRSFLFGPTEISVLRSSLPPHLRKCSTVEILTALVWRCRTIALGFHPDEEVR  696
             NI L+ + H S  FGPTEIS LR +LP HLR CS+ +++TA +WR RTIAL  +P++E+R
Sbjct  228   NISLNEMAHGSVFFGPTEISTLRKTLPIHLRYCSSFDLITACLWRTRTIALQPNPNDEMR  287

Query  695   MLLLINARFKFKDTPMPSGYTGNAFAYPGAKTTAGKLRKNPLGYAVELVTSIKRCFSEEY  516
             +L ++N R K K   +PSGY GNAFA P A  TAG L +NPL YAVEL+   K   +EEY
Sbjct  288   LLCVVNLRSKSKY--LPSGYYGNAFALPAAVATAGNLCQNPLSYAVELIRKAKAEMTEEY  345

Query  515   MQSMVDLMVLKGRPPFHVAGSFIMSDLTRSKISDVDYGWGKPVFGGPAHGGAGDVPGVIT  336
             M+S+ DLMV+ GRP      S+ +SD+T++ +  +D+GWG+ +FGGPA GG   VPG+ +
Sbjct  346   MKSVADLMVINGRPNLTAVRSYAVSDVTKTDLEKIDFGWGEAIFGGPAMGGVATVPGLTS  405

Query  335   FHVPYENKKGENGTLIPICLPAFALDKFV------------NELANT---FLRAAL  213
             F++ ++N KGE GT++P  LP  A+++FV            NE+ NT   F+RAAL
Sbjct  406   FYISFKNXKGEQGTVVPFSLPVEAMERFVVELDAAFKTKPLNEVENTKQGFIRAAL  461



>sp|Q3ZPN4.1|ACMAT_VITLA RecName: Full=Methanol O-anthraniloyltransferase; AltName: Full=Anthraniloyl-CoA:methanol 
acyltransferase; AltName: Full=Benzyl 
alcohol O-benzoyltransferase [Vitis labrusca]
 gb|AAW22989.1| anthraniloyal-CoA: methanol anthraniloyal transferase [Vitis 
labrusca]
Length=449

 Score =   445 bits (1144),  Expect = 5e-149, Method: Compositional matrix adjust.
 Identities = 221/401 (55%), Positives = 281/401 (70%), Gaps = 8/401 (2%)
 Frame = -1

Query  1415  FYRNEPSMSGKDPVQVIRQALAKALVFFYPFAGRLREGPGRKLMVDCTGEGVMFIEADAD  1236
             FYRN P M GKDPV+VIR+AL KALV++YPFAGRL EG  RKLMVDCTGEGV+FIEADAD
Sbjct  51    FYRNNPLMEGKDPVKVIREALGKALVYYYPFAGRLIEGDNRKLMVDCTGEGVLFIEADAD  110

Query  1235  ATLQHFAIGGELKPPFPCFDQLLYNVPGSAEILNSPLFLIQVTRLRCGGFIFTLRMNHTM  1056
              TL++  +G  ++P  PCF++LLY+VPGS  IL SPL LIQVTRLRCGGFIF LR+NHTM
Sbjct  111   TTLEN--LGDAIQPMCPCFEELLYDVPGSTTILGSPLILIQVTRLRCGGFIFALRLNHTM  168

Query  1055  ADASGLVHFLNTIAEIARGAEAPAVQPVWQREFFSARNPPRITCTHFEYEEEPAADSMVT  876
             +DA+GL+ FL+TI E+A+G   P++ P+WQRE  +ARNPPRIT  H EYE+       + 
Sbjct  169   SDAAGLIQFLDTIGEMAQGLSVPSLLPIWQRELLNARNPPRITRIHHEYEKVTNTKGTLM  228

Query  875   NIPLDNLVHRSFLFGPTEISVLRSSLPPHLRKCSTVEILTALVWRCRTIALGFHPDEEVR  696
              +  ++LVHRSF FG  EI  LR+ LP  L  CST E+L A VWRCRTIA    PDE VR
Sbjct  229   AMDENSLVHRSFFFGREEIRALRNRLPASLGACSTFEVLMACVWRCRTIAFAVDPDEVVR  288

Query  695   MLLLINARFKFKDTPMPSGYTGNAFAYPGAKTTAGKLRKNPLGYAVELVTSIKRCFSEEY  516
             +  +IN R K     +P GY GNAF  P + T AG L KNPL +A+ LV   K   S+EY
Sbjct  289   ISCIINMRGK-HGFELPPGYYGNAFVTPASITKAGMLCKNPLEFAIRLVKKAKAEMSQEY  347

Query  515   MQSMVDLMVLKGRPPFHVAGSFIMSDLTRSKISDVDYGWGKPVFGGPAHGGAGDVPGVIT  336
             ++S+ DLMV+KGRP F   G+F +SD+TR+ + +VD+GWGKPV+GG A         +I+
Sbjct  348   IKSVADLMVIKGRPLFTQPGNFTVSDVTRAGLGEVDFGWGKPVYGGVARACP-----IIS  402

Query  335   FHVPYENKKGENGTLIPICLPAFALDKFVNELANTFLRAAL  213
             F + + N KGE G++IPI LP   +++F  EL     +A L
Sbjct  403   FRMLFRNSKGEEGSVIPIWLPPPVMERFEQELKRMTKKAEL  443



>ref|XP_004151858.1| PREDICTED: benzyl alcohol O-benzoyltransferase-like [Cucumis 
sativus]
 gb|KGN63328.1| hypothetical protein Csa_2G429010 [Cucumis sativus]
Length=444

 Score =   445 bits (1144),  Expect = 5e-149, Method: Compositional matrix adjust.
 Identities = 216/392 (55%), Positives = 281/392 (72%), Gaps = 4/392 (1%)
 Frame = -1

Query  1415  FYRNEPSMSGKDPVQVIRQALAKALVFFYPFAGRLREGPGRKLMVDCTGEGVMFIEADAD  1236
             FY   P+M G+DPV VI++A+AK LVF+YPFAGR+RE  G+KL V+CTGEGV+FIEA+AD
Sbjct  51    FYPQNPNMEGRDPVTVIKEAVAKTLVFYYPFAGRVREKFGKKLFVECTGEGVLFIEANAD  110

Query  1235  ATLQHFAIGGELKPPFPCFDQLLYNVPGSAEILNSPLFLIQVTRLRCGGFIFTLRMNHTM  1056
              +LQ F     L+PPFPC DQLLY+VP S  IL+SPL LIQVTRL+CGGFIF +R NHT+
Sbjct  111   VSLQQFQDSSSLQPPFPCMDQLLYDVPDSDGILDSPLLLIQVTRLKCGGFIFAVRFNHTI  170

Query  1055  ADASGLVHFLNTIAEIARGAEAPAVQPVWQREFFSARNPPRITCTHFEYEEEPAADSMVT  876
              D  G+  FL  IAE+ARGA AP++ PVW+R   ++R+PPR+TC H EY+E    D   T
Sbjct  171   TDGIGMAQFLKAIAEMARGALAPSILPVWKRALLNSRDPPRVTCLHHEYDE--VNDINDT  228

Query  875   NIPLDNLVHRSFLFGPTEISVLRSSLPPHLRKCSTVEILTALVWRCRTIALGFHPDEEVR  696
              I LDN+V  SF FGPTEIS++  +LP H     + E+L   +WR RTIAL   P+EEVR
Sbjct  229   TITLDNMVQHSFFFGPTEISIIHRTLPTHFHNYPSAELLMIFIWRLRTIALQLSPEEEVR  288

Query  695   MLLLINARFKFKDTPMPSGYTGNAFAYPGAKTTAGKLRKNPLGYAVELVTSIKRCFSEEY  516
             +L ++N R KF   P+  G+ GNAFA P A TTA KL +N L YA+ELV + K   +EEY
Sbjct  289   LLCVVNLRTKFNYLPL--GFYGNAFALPAALTTAAKLSQNSLDYAIELVENAKAKVTEEY  346

Query  515   MQSMVDLMVLKGRPPFHVAGSFIMSDLTRSKISDVDYGWGKPVFGGPAHGGAGDVPGVIT  336
             ++SMVDLM +KGRP F V GSF+M+DLT +   DVD+GW K ++ GPA G  G VPG+I+
Sbjct  347   VKSMVDLMTVKGRPHFTVVGSFLMADLTEAGFEDVDFGWEKAIYAGPATGKVGLVPGLIS  406

Query  335   FHVPYENKKGENGTLIPICLPAFALDKFVNEL  240
             F +P + + GE G ++P+ LPA A+++ V EL
Sbjct  407   FCIPSKMRNGEKGIVVPLYLPAPAMERLVEEL  438



>ref|XP_007147136.1| hypothetical protein PHAVU_006G098800g [Phaseolus vulgaris]
 gb|ESW19130.1| hypothetical protein PHAVU_006G098800g [Phaseolus vulgaris]
Length=460

 Score =   445 bits (1144),  Expect = 7e-149, Method: Compositional matrix adjust.
 Identities = 212/396 (54%), Positives = 283/396 (71%), Gaps = 9/396 (2%)
 Frame = -1

Query  1415  FYRNEPSMSGKDPVQVIRQALAKALVFFYPFAGRLREGPGRKLMVDCTGEGVMFIEADAD  1236
              Y  + SM+ KDPV+VIR+AL++ LVF+YP AGR+REGP RKLMV+CTGEG MFIEADAD
Sbjct  56    IYGKQASMAEKDPVEVIRKALSQTLVFYYPLAGRVREGPHRKLMVECTGEGAMFIEADAD  115

Query  1235  ATLQHFAIGGELKPPFPCFDQLLYNVPGSAEILNSPLFLIQVTRLRCGGFIFTLRMNHTM  1056
              TL  F  G  L+PPFPCF +LLY+VPGS +I N+PL L+QVTRL+CGGFI    +NHTM
Sbjct  116   VTLHEF--GDSLQPPFPCFHELLYHVPGSQQITNTPLLLVQVTRLKCGGFILAFSINHTM  173

Query  1055  ADASGLVHFLNTIAEIARGAEAPAVQPVWQREFFSARNPPRITCTHFEYEEEPAADSMVT  876
              D +G+  F+NT A++ARG+  P++ PVW RE   AR+PPRITC H EYE  P  D++ +
Sbjct  174   CDGTGISQFMNTWAKMARGSTKPSIPPVWCRELLMARHPPRITCNHREYEHVP--DTITS  231

Query  875   NIPLDNLVHRSFLFGPTEISVLRSSLPPHLRKCSTVEILTALVWRCRTIALGFHPDEEVR  696
                 +N+V RSF FGP++I+ +R  +P HL+ C+T +I+TA  WRCRT AL    D+EVR
Sbjct  232   T---ENMVQRSFFFGPSQIAAIRLLVPTHLQHCTTFDIITACFWRCRTKALQIEADKEVR  288

Query  695   MLLLINARFKFKDTPMPSGYTGNAFAYPGAKTTAGKLRKNPLGYAVELVTSIKRCFSEEY  516
             M++++N R +F + P+P GY GNA A+P A TTAGKL +NP GYAVEL+  +K   +EEY
Sbjct  289   MIVIVNGRARF-NPPLPVGYYGNAIAFPAAVTTAGKLCENPFGYAVELIKKVKGVVTEEY  347

Query  515   MQSMVDLMVLKGRPPFHVAGSFIMSDLTRSKISDVDYGWGKPVFGGPAHGGAGDVPGVIT  336
             M S+ DLMV+K R  F    S ++SDLTR +  +V++GWG+ V+GG A  G G   G  T
Sbjct  348   MHSVADLMVIKDRCMFTTVRSCLISDLTRGRFREVNFGWGEAVYGGVAQAGIGSFLGG-T  406

Query  335   FHVPYENKKGENGTLIPICLPAFALDKFVNELANTF  228
               + ++N KGE G ++PI LPA A+++F  EL N F
Sbjct  407   CQMLHKNAKGEEGIVLPIWLPAKAMNRFAKELENMF  442



>ref|XP_007029789.1| Benzoyl coenzyme A: Benzyl alcohol benzoyl transferase [Theobroma 
cacao]
 gb|EOY10291.1| Benzoyl coenzyme A: Benzyl alcohol benzoyl transferase [Theobroma 
cacao]
Length=452

 Score =   444 bits (1141),  Expect = 1e-148, Method: Compositional matrix adjust.
 Identities = 227/397 (57%), Positives = 287/397 (72%), Gaps = 14/397 (4%)
 Frame = -1

Query  1415  FYRNEPSMSGKDPVQVIRQALAKALVFFYPFAGRLREGPGRKLMVDCTGEGVMFIEADAD  1236
             FYR+ PSM GKDPV++IR+ALAKALVF+YPFAGRLREGP RKLMVDCTGEGV+FIEADAD
Sbjct  51    FYRHNPSMQGKDPVKIIREALAKALVFYYPFAGRLREGPNRKLMVDCTGEGVLFIEADAD  110

Query  1235  ATLQHFAIGGELKPPFPCFDQLLYNVPGSAEILNSPLFLIQVTRLRCGGFIFTLRMNHTM  1056
              TL+ F  G EL PPFPC D+LLY+VPGS  +LN PL LIQ+TR++CGGFIF +R+NH M
Sbjct  111   VTLEQF--GDELHPPFPCLDELLYDVPGSEGMLNCPLLLIQITRMKCGGFIFAVRLNHVM  168

Query  1055  ADASGLVHFLNTIAEIARGAEAPAVQPVWQREFFSARNPPRITCTHFEYEEEPAADSMVT  876
             +D +GL   ++ + E+ARG   P++ PVW+R    A +PPR+  TH EY+E    + ++T
Sbjct  169   SDGAGLKQLVSAVGEMARGMVTPSIPPVWERHLLDAGDPPRVMFTHHEYDE---VEGIIT  225

Query  875   NIPLDNLVHRSFLFGPTEISVLRSSLPPHLRKCSTVEILTALVWRCRTIALGFHPDEEVR  696
               P DN+V R+F FGP EIS LR  LP HLR+CS  E+LTA +WRCRT A+   PD+EVR
Sbjct  226   --PPDNMVQRAFFFGPNEISSLRRLLPRHLRQCSKFELLTACLWRCRTAAINPDPDDEVR  283

Query  695   MLLLINARFKFKDTPMPSGYTGNAFAYPGAKTTAGKLRKNPLGYAVELVTSIKRCFSEEY  516
             M+ + N R KF + P+PSGY GNAF +P AKTTA KL +NPLGYAVELV   K   +EEY
Sbjct  284   MMCIANTRSKF-NPPLPSGYYGNAFVFPAAKTTARKLFRNPLGYAVELVKQAKARVTEEY  342

Query  515   MQSMVDLMVLKGRP-PFHVAGSFIMSDLTRSKISDVDYGWGKPVFGGPAHGGAGDVPGVI  339
             ++S+  LMV++ +   F V  SF++SD+T     DVDYGWGK VFGGPA        G I
Sbjct  343   VKSVSSLMVIRDKQLHFPVVRSFLISDVTSFGFGDVDYGWGKAVFGGPAKAV-----GPI  397

Query  338   TFHVPYENKKGENGTLIPICLPAFALDKFVNELANTF  228
             +F +  ++K GE GTL+ ICLPA A++ F  EL N  
Sbjct  398   SFLIQSKDKNGEVGTLVSICLPAPAMESFAKELDNIL  434



>gb|KHN31436.1| Benzyl alcohol O-benzoyltransferase [Glycine soja]
Length=440

 Score =   443 bits (1140),  Expect = 2e-148, Method: Compositional matrix adjust.
 Identities = 221/397 (56%), Positives = 285/397 (72%), Gaps = 9/397 (2%)
 Frame = -1

Query  1412  YRNEPSMSGKDPVQVIRQALAKALVFFYPFAGRLREGPGRKLMVDCTGEGVMFIEADADA  1233
             YRN+PSM+ KDPVQVIR+ALAK LVF+YPFAGRLRE P  KLMVDCTGEGV+FIEADAD 
Sbjct  44    YRNQPSMAEKDPVQVIRKALAKTLVFYYPFAGRLRERPDHKLMVDCTGEGVLFIEADADV  103

Query  1232  TLQHFAIGGELKPPFPCFDQLLYNVPGSAEILNSPLFLIQVTRLRCGGFIFTLRMNHTMA  1053
             TL    +G  L+PPFPCF+QLLYNVP S EI ++PL LIQVTRL+CGGFI  LR+NHTM+
Sbjct  104   TLDQ--LGDALQPPFPCFEQLLYNVPDSEEITDTPLLLIQVTRLKCGGFIQALRLNHTMS  161

Query  1052  DASGLVHFLNTIAEIARGAEAPAVQPVWQREFFSARNPPRITCTHFEYEEEPAADSMVTN  873
             DA+GLV FLN  AE+A GA++P++ PVW+RE   AR+PPRITC H EY E    +    +
Sbjct  162   DAAGLVQFLNAWAEMAGGAKSPSIAPVWRRELLMARDPPRITCKHHEYMEFVDTEIEEGS  221

Query  872   IPL--DNLVHRSFLFGPTEISVLRSSLPPHLRKCSTVEILTALVWRCRTIALGFHPDEEV  699
             + L  D++V RSF FGP++I+ LR  +P +   C+T +++TA +WRC T AL    D++V
Sbjct  222   LTLHDDDMVLRSFFFGPSQIASLRRLVPHY---CATFDLITACLWRCHTKALKIDADKDV  278

Query  698   RMLLLINARFKFKDTPMPSGYTGNAFAYPGAKTTAGKLRKNPLGYAVELVTSIKRCFSEE  519
             RM++ +NAR KF + P+P GY GNA AYP A TTAGKL  NP GYAVEL+  +K   ++E
Sbjct  279   RMMVAVNARAKF-NPPLPVGYYGNAIAYPAAVTTAGKLCGNPFGYAVELINKVKGKATQE  337

Query  518   YMQSMVDLMVLKGRPPFHVAGSFIMSDLTRSKISDVDYGWGKPVFGGPAHGGAGDVPGVI  339
             YM S+ DL+ +KGR    +  S  +SDL       +D+GWG  ++ GPA GG G  PGV 
Sbjct  338   YMHSVADLLAIKGRYIPRMVRSLTVSDLRGFDPRQIDFGWGHALYAGPAQGGLGPFPGV-  396

Query  338   TFHVPYENKKGENGTLIPICLPAFALDKFVNELANTF  228
             TF  P++N KGE+G ++PI LP  A+++F  EL   F
Sbjct  397   TFITPFKNAKGEDGLVLPIWLPTEAMNRFSKELDGMF  433



>gb|AES82607.2| benzyl alcohol O-benzoyltransferase [Medicago truncatula]
Length=459

 Score =   444 bits (1141),  Expect = 2e-148, Method: Compositional matrix adjust.
 Identities = 218/393 (55%), Positives = 281/393 (72%), Gaps = 5/393 (1%)
 Frame = -1

Query  1415  FYRNEPSMSGKDPVQVIRQALAKALVFFYPFAGRLREGPGRKLMVDCTGEGVMFIEADAD  1236
              Y +EPSM+ KDPV+V+R AL++ALV++YPFAGR+REG  RKLMVDCTGEGVMFIEA+AD
Sbjct  49    IYHHEPSMAEKDPVKVLRHALSQALVYYYPFAGRIREGASRKLMVDCTGEGVMFIEAEAD  108

Query  1235  ATLQHFAIGGELKPPFPCFDQLLYNVPGSAEILNSPLFLIQVTRLRCGGFIFTLRMNHTM  1056
              TL  F  G  L PPFPCF QLLY+V GS +I++ P+ LIQVTRL+CGGFI  +  NHTM
Sbjct  109   VTLDQF--GDALHPPFPCFHQLLYDVRGSEQIMDRPIRLIQVTRLKCGGFIVAMNWNHTM  166

Query  1055  ADASGLVHFLNTIAEIARGAEAPAVQPVWQREFFSARNPPRITCTHFEYEEEPAADSMVT  876
              DA+GL  F+N  AE+ARGA  P++QPVW RE   AR+PPRITC HFEYE+  + ++ + 
Sbjct  167   GDAAGLRQFMNAWAEMARGAYRPSIQPVWNREILMARDPPRITCNHFEYEQILSPNT-IK  225

Query  875   NIPLDNLVHRSFLFGPTEISVLRSSLPPHLRKCSTVEILTALVWRCRTIALGFHPDEEVR  696
                  +LVH+SF F  ++I+ LR  +P HLR+C+T +++ +  W CRT AL    DEEVR
Sbjct  226   EKDTASLVHQSFFFRASDIATLRLLVPFHLRQCTTFDLIASCFWCCRTKALQLEADEEVR  285

Query  695   MLLLINARFKFKDTPMP-SGYTGNAFAYPGAKTTAGKLRKNPLGYAVELVTSIKRCFSEE  519
             M+ + NAR +F     P  GY GN FAYP A TTA KL  NP GYAVELV  +K   +EE
Sbjct  286   MMCIANARSRFNVNNSPLVGYYGNCFAYPAAVTTARKLCGNPFGYAVELVRKLKAEVTEE  345

Query  518   YMQSMVDLMVLKGRPPFHVAGSFIMSDLTRSKISDVDYGWGKPVFGGPAHGGAGDVPGVI  339
             YM S+ DLMV+K R  F    S I+SDLTR+++S+V++GWG+ V+GG A GGAG  PG  
Sbjct  346   YMHSVADLMVIKERCLFTTVRSCIISDLTRARLSEVNFGWGEGVYGGVAKGGAGPFPGA-  404

Query  338   TFHVPYENKKGENGTLIPICLPAFALDKFVNEL  240
             T+ VPY+N KGE   ++PICLP+  + +F  EL
Sbjct  405   TYIVPYKNIKGEETLMLPICLPSEDMKRFAKEL  437



>ref|XP_004156786.1| PREDICTED: benzyl alcohol O-benzoyltransferase-like [Cucumis 
sativus]
Length=557

 Score =   447 bits (1150),  Expect = 2e-148, Method: Compositional matrix adjust.
 Identities = 217/401 (54%), Positives = 287/401 (72%), Gaps = 5/401 (1%)
 Frame = -1

Query  1415  FYRNEPSMSGKDPVQVIRQALAKALVFFYPFAGRLREGPGRKLMVDCTGEGVMFIEADAD  1236
             FY   P+M G+DPV VI++A+AK LVF+YPFAGR+RE  G+KL V+CTGEGV+FIEA+AD
Sbjct  51    FYPQNPNMEGRDPVTVIKEAVAKTLVFYYPFAGRVREKFGKKLFVECTGEGVLFIEANAD  110

Query  1235  ATLQHFAIGGELKPPFPCFDQLLYNVPGSAEILNSPLFLIQVTRLRCGGFIFTLRMNHTM  1056
              +LQ F     L+PPFPC DQLLY+VP S  IL+SPL LIQVTRL+CGGFIF +R NHT+
Sbjct  111   VSLQQFQDSSSLQPPFPCMDQLLYDVPDSDGILDSPLLLIQVTRLKCGGFIFAVRFNHTI  170

Query  1055  ADASGLVHFLNTIAEIARGAEAPAVQPVWQREFFSARNPPRITCTHFEYEEEPAADSMVT  876
              D  G+  FL  IAE+ARGA AP++ PVW+R   ++R+PPR+TC H EY+E    D   T
Sbjct  171   TDGIGMAQFLKAIAEMARGALAPSILPVWKRALLNSRDPPRVTCLHHEYDE--VNDINDT  228

Query  875   NIPLDNLVHRSFLFGPTEISVLRSSLPPHLRKCSTVEILTALVWRCRTIALGFHPDEEVR  696
              I LDN+V  SF FGPTEIS++  +LP H     + E+L   +WR RTIAL   P+EEVR
Sbjct  229   TITLDNMVQHSFFFGPTEISIIHRTLPTHFHNYPSAELLMIFIWRLRTIALQLSPEEEVR  288

Query  695   MLLLINARFKFKDTPMPSGYTGNAFAYPGAKTTAGKLRKNPLGYAVELVTSIKRCFSEEY  516
             +L ++N R KF   P+  G+ GNAFA P A TTA KL +N L YA+ELV + K   +EEY
Sbjct  289   LLCVVNLRTKFNYLPL--GFYGNAFALPAALTTAAKLSQNSLDYAIELVENAKAKVTEEY  346

Query  515   MQSMVDLMVLKGRPPFHVAGSFIMSDLTRSKISDVDYGWGKPVFGGPAHGGAGDVPGVIT  336
             ++SMVDLM +KGRP F V GSF+M+DLT +   DVD+GW K ++ GPA G  G VPG+I+
Sbjct  347   VKSMVDLMTVKGRPHFTVVGSFLMADLTEAGFEDVDFGWEKAIYAGPATGKVGLVPGLIS  406

Query  335   FHVPYENKKGENGTLIPICLPAFALDKFVNELANTFLRAAL  213
             F +P + + GE G ++P+ LPA A+++ V EL +  L++++
Sbjct  407   FCIPSKMRNGEKGIVVPLYLPAPAMERLVEEL-DALLKSSI  446



>ref|XP_003520833.1| PREDICTED: benzyl alcohol O-benzoyltransferase-like [Glycine 
max]
Length=452

 Score =   443 bits (1140),  Expect = 3e-148, Method: Compositional matrix adjust.
 Identities = 221/397 (56%), Positives = 285/397 (72%), Gaps = 9/397 (2%)
 Frame = -1

Query  1412  YRNEPSMSGKDPVQVIRQALAKALVFFYPFAGRLREGPGRKLMVDCTGEGVMFIEADADA  1233
             YRN+PSM+ KDPVQVIR+ALAK LVF+YPFAGRLRE P  KLMVDCTGEGV+FIEADAD 
Sbjct  56    YRNQPSMAEKDPVQVIRKALAKTLVFYYPFAGRLRERPDHKLMVDCTGEGVLFIEADADV  115

Query  1232  TLQHFAIGGELKPPFPCFDQLLYNVPGSAEILNSPLFLIQVTRLRCGGFIFTLRMNHTMA  1053
             TL    +G  L+PPFPCF+QLLYNVP S EI ++PL LIQVTRL+CGGFI  LR+NHTM+
Sbjct  116   TLDQ--LGDALQPPFPCFEQLLYNVPDSEEITDTPLLLIQVTRLKCGGFIQALRLNHTMS  173

Query  1052  DASGLVHFLNTIAEIARGAEAPAVQPVWQREFFSARNPPRITCTHFEYEEEPAADSMVTN  873
             DA+GLV FLN  AE+A GA++P++ PVW+RE   AR+PPRITC H EY E    +    +
Sbjct  174   DAAGLVQFLNAWAEMAGGAKSPSIAPVWRRELLMARDPPRITCKHHEYMEFVDTEIEEGS  233

Query  872   IPL--DNLVHRSFLFGPTEISVLRSSLPPHLRKCSTVEILTALVWRCRTIALGFHPDEEV  699
             + L  D++V RSF FGP++I+ LR  +P +   C+T +++TA +WRC T AL    D++V
Sbjct  234   LTLHDDDMVLRSFFFGPSQIASLRRLVPHY---CATFDLITACLWRCHTKALKIDADKDV  290

Query  698   RMLLLINARFKFKDTPMPSGYTGNAFAYPGAKTTAGKLRKNPLGYAVELVTSIKRCFSEE  519
             RM++ +NAR KF + P+P GY GNA AYP A TTAGKL  NP GYAVEL+  +K   ++E
Sbjct  291   RMMVAVNARAKF-NPPLPVGYYGNAIAYPAAVTTAGKLCGNPFGYAVELINKVKGKATQE  349

Query  518   YMQSMVDLMVLKGRPPFHVAGSFIMSDLTRSKISDVDYGWGKPVFGGPAHGGAGDVPGVI  339
             YM S+ DL+ +KGR    +  S  +SDL       +D+GWG  ++ GPA GG G  PGV 
Sbjct  350   YMHSVADLLAIKGRYIPRMVRSLTVSDLRGFDPRQIDFGWGHALYAGPAQGGLGPFPGV-  408

Query  338   TFHVPYENKKGENGTLIPICLPAFALDKFVNELANTF  228
             TF  P++N KGE+G ++PI LP  A+++F  EL   F
Sbjct  409   TFITPFKNAKGEDGLVLPIWLPTEAMNRFSKELDGMF  445



>ref|XP_003574156.1| PREDICTED: benzyl alcohol O-benzoyltransferase [Brachypodium 
distachyon]
Length=463

 Score =   443 bits (1139),  Expect = 4e-148, Method: Compositional matrix adjust.
 Identities = 215/404 (53%), Positives = 288/404 (71%), Gaps = 9/404 (2%)
 Frame = -1

Query  1415  FYRNEPSMSGKDPVQVIRQALAKALVFFYPFAGRLREGPGRKLMVDCTGEGVMFIEADAD  1236
             FYR + SM+G++P  V+R+A+++ALV +YPFAGRLRE   RKL VDCTGEGV+F EADAD
Sbjct  51    FYRRQASMAGRNPAAVVREAVSRALVPYYPFAGRLRELEARKLAVDCTGEGVLFTEADAD  110

Query  1235  ATLQHFAIGGELKPPFPCFDQLLYNVPGSAEILNSPLFLIQVTRLRCGGFIFTLRMNHTM  1056
               L+HF  G  L+PPFP  D+L+++VPGS+++L +PL L QVTRL CGGFI  +R+ HTM
Sbjct  111   VRLEHF--GDALQPPFPGLDELIFDVPGSSQVLGTPLLLFQVTRLACGGFILGVRLMHTM  168

Query  1055  ADASGLVHFLNTIAEIARGAEAPAVQPVWQREFFSARNPPRITCTHFEYEEEPAADSMVT  876
             ADA GLV FL  +AE+ARG   P V+PVW+R    AR+PPR    H EY+E P  D+  T
Sbjct  169   ADAQGLVQFLGAVAEMARGMATPTVKPVWERSLLEARDPPRPGYAHREYDEVP--DTNGT  226

Query  875   NIPLDNLVHRSFLFGPTEISVLRSSLPPHLR-KCSTVEILTALVWRCRTIALGFHPDEEV  699
              +PLD++ HRS  FG  E++ +RS LPP LR + +T E+LT  +WRCRT AL    DEE+
Sbjct  227   IVPLDDMAHRSLFFGAGEVAAIRSHLPPPLRSRATTFEVLTGCLWRCRTSALAPDADEEM  286

Query  698   RMLLLINAR---FKFKDTPMPSGYTGNAFAYPGAKTTAGKLRKNPLGYAVELVTSIKRCF  528
             RM+ ++NAR    K   + +PSGY GNAFA+P A   AG+L   PL +AVELV   K   
Sbjct  287   RMICIVNARGNANKNGKSAIPSGYYGNAFAFPVAVARAGELCARPLAHAVELVRRAKSEV  346

Query  527   SEEYMQSMVDLMVLKGRPPFHVAGSFIMSDLTRSKISDVDYGWGKPVFGGPAHGGAGDVP  348
               EYM+S+ DLMV +GRP F V  +++ SD+T++   D+D+GWG+PV+GGPA GG G +P
Sbjct  347   DVEYMRSVADLMVQRGRPHFTVVRAYLASDVTKAGFGDLDFGWGRPVYGGPAKGGVGAIP  406

Query  347   GVITFHVPYENKKGENGTLIPICLPAFALDKFVNELANTFLRAA  216
             GV +F +P++N KGE+G ++P+CLP  A+DKFV E+A   LR A
Sbjct  407   GVASFLIPFKNGKGEDGIVVPMCLPGPAMDKFVVEMAR-LLRPA  449



>ref|NP_001266678.1| 10-deacetylbaccatin III 10-O-acetyltransferase [Zea mays]
 gb|ACG41596.1| 10-deacetylbaccatin III 10-O-acetyltransferase [Zea mays]
Length=458

 Score =   442 bits (1137),  Expect = 8e-148, Method: Compositional matrix adjust.
 Identities = 215/395 (54%), Positives = 280/395 (71%), Gaps = 6/395 (2%)
 Frame = -1

Query  1415  FYRNEPSMSGKDPVQVIRQALAKALVFFYPFAGRLREGPGRKLMVDCTGEGVMFIEADAD  1236
             FYR    M G++P  VIR A+A+ALV +YPFAGRLRE  GRKL VDCTGEGV+FIEA+AD
Sbjct  48    FYRQNALMGGREPAPVIRDAIARALVPYYPFAGRLRELEGRKLAVDCTGEGVLFIEAEAD  107

Query  1235  ATLQHFAIGGELKPPFPCFDQLLYNVPGSAEILNSPLFLIQVTRLRCGGFIFTLRMNHTM  1056
               L HF  G EL+PPFPC ++L+++VP S+E+L SPL L QVTRL CGGFI  +R++HTM
Sbjct  108   VRLDHF--GDELQPPFPCLEELIFDVPDSSEVLGSPLLLFQVTRLACGGFILGVRLHHTM  165

Query  1055  ADASGLVHFLNTIAEIARGAEAPAVQPVWQREFFSARNPPRITCTHFEYEEEPAADSMVT  876
             ADA GLV FL  +AE+ARGA AP V+PVW RE   AR+PPR    H EY+E P  D+  +
Sbjct  166   ADAQGLVQFLGAVAELARGAAAPTVRPVWGRELLEARDPPRPAFAHREYDEVP--DTKGS  223

Query  875   NIPLDNLVHRSFLFGPTEISVLRSSLPPHLR-KCSTVEILTALVWRCRTIALGFHPDEEV  699
              IPLD++VHRSF FG  E++ +R++LPP LR + S  ++LT L+W+CRT AL    DE +
Sbjct  224   IIPLDDMVHRSF-FGRQEVAAIRANLPPDLRSRASKFDLLTGLLWKCRTAALALDADEVM  282

Query  698   RMLLLINARFKFKDTPMPSGYTGNAFAYPGAKTTAGKLRKNPLGYAVELVTSIKRCFSEE  519
             RM+ ++ A        +P GY GNAFA P A  TAG L   PLGYAVELV   K   + E
Sbjct  283   RMICVVTAHGGKSSVTIPKGYYGNAFALPAAVATAGDLVAKPLGYAVELVKRAKGEVNVE  342

Query  518   YMQSMVDLMVLKGRPPFHVAGSFIMSDLTRSKISDVDYGWGKPVFGGPAHGGAGDVPGVI  339
             YM+S+ DLMVL+GRP F V  +++ SDLT++   ++D+GWG PV+GGPA+ G G  PG+ 
Sbjct  343   YMRSVADLMVLRGRPHFTVVRAYLASDLTKAGFGNLDFGWGNPVYGGPANVGVGTSPGLA  402

Query  338   TFHVPYENKKGENGTLIPICLPAFALDKFVNELAN  234
             TF VP +N KGE+G ++P+CLP  A++ FV E+  
Sbjct  403   TFLVPCKNAKGEDGIIVPMCLPGPAMETFVKEMGT  437



>emb|CAN68818.1| hypothetical protein VITISV_012041 [Vitis vinifera]
Length=451

 Score =   442 bits (1136),  Expect = 8e-148, Method: Compositional matrix adjust.
 Identities = 216/392 (55%), Positives = 275/392 (70%), Gaps = 8/392 (2%)
 Frame = -1

Query  1415  FYRNEPSMSGKDPVQVIRQALAKALVFFYPFAGRLREGPGRKLMVDCTGEGVMFIEADAD  1236
             FY N P M GKDP +VI++AL KALV++YPFAGRL EG  RKLMVDCTGEGV+FIEADAD
Sbjct  51    FYPNNPLMKGKDPAKVIKEALGKALVYYYPFAGRLIEGDNRKLMVDCTGEGVLFIEADAD  110

Query  1235  ATLQHFAIGGELKPPFPCFDQLLYNVPGSAEILNSPLFLIQVTRLRCGGFIFTLRMNHTM  1056
              TL++  +G  ++P  PC++++LY+VPGS EIL SPL LIQVTRLRCGGFIF LR+NHTM
Sbjct  111   TTLEN--LGDSIQPMCPCYEEILYDVPGSGEILGSPLILIQVTRLRCGGFIFALRLNHTM  168

Query  1055  ADASGLVHFLNTIAEIARGAEAPAVQPVWQREFFSARNPPRITCTHFEYEEEPAADSMVT  876
             +D  GLV FL+ I+E+ +G   P++ P+WQRE  +ARN PRIT  H EYEE       + 
Sbjct  169   SDGPGLVQFLDAISEMXQGLSVPSLLPIWQRELLNARNXPRITRIHHEYEEVTNTXGTLM  228

Query  875   NIPLDNLVHRSFLFGPTEISVLRSSLPPHLRKCSTVEILTALVWRCRTIALGFHPDEEVR  696
              +  +NLVHRSF FG  EI  LR+ LP  L  CST E+L A VWRCRTIA    PDE VR
Sbjct  229   TMDENNLVHRSFFFGXKEIRALRNRLPASLGACSTFEVLIAYVWRCRTIAFAVDPDEVVR  288

Query  695   MLLLINARFKFKDTPMPSGYTGNAFAYPGAKTTAGKLRKNPLGYAVELVTSIKRCFSEEY  516
             +  LIN R K +   +P GY GNAF YP + T AG L KNPL YA+ L+   K   S+EY
Sbjct  289   ISCLINMRGK-RGFDLPPGYYGNAFVYPASITKAGMLCKNPLEYAIRLLKKAKAEMSQEY  347

Query  515   MQSMVDLMVLKGRPPFHVAGSFIMSDLTRSKISDVDYGWGKPVFGGPAHGGAGDVPGVIT  336
             ++S+ DLMV+KGRP F   G++++SDLTR+   ++D+GWGKPV+GG A   +      I+
Sbjct  348   VKSVADLMVIKGRPSFTQPGNYLISDLTRAGFGEIDFGWGKPVYGGIARALSN-----IS  402

Query  335   FHVPYENKKGENGTLIPICLPAFALDKFVNEL  240
             F + + N KGE G +IPICLP   +++F  EL
Sbjct  403   FCMRFRNSKGEEGNVIPICLPPPVMERFEQEL  434



>ref|NP_001064997.1| Os10g0503300 [Oryza sativa Japonica Group]
 dbj|BAF26911.1| Os10g0503300 [Oryza sativa Japonica Group]
 gb|EAY79120.1| hypothetical protein OsI_34226 [Oryza sativa Indica Group]
 gb|EAZ16606.1| hypothetical protein OsJ_32078 [Oryza sativa Japonica Group]
Length=475

 Score =   442 bits (1138),  Expect = 1e-147, Method: Compositional matrix adjust.
 Identities = 220/401 (55%), Positives = 285/401 (71%), Gaps = 11/401 (3%)
 Frame = -1

Query  1415  FYRNEPSMSGKDPVQVIRQALAKALVFFYPFAGRLREGPGRKLMVDCTGEGVMFIEADAD  1236
             FYR   +M G+DP  VIR A+A+ALV +YPFAGRLRE  GRKL VDCTGEGV+FIEADAD
Sbjct  52    FYRRSAAMGGRDPAPVIRAAVARALVSYYPFAGRLRELEGRKLAVDCTGEGVLFIEADAD  111

Query  1235  ATLQHFAIGGELKPPFPCFDQLLYNVPGSAEILNSPLFLIQVTRLRCGGFIFTLRMNHTM  1056
               L+HF  GG L+PPFPC ++L+++VPGS+E+L SPL L QVTRL CGGFI  +R++HTM
Sbjct  112   VRLEHF--GGALQPPFPCLEELVFDVPGSSEVLGSPLLLFQVTRLACGGFILAVRLHHTM  169

Query  1055  ADASGLVHFLNTIAEIARGAEAPAVQPV--WQREFFSARNPPRITCTHFEYEEEPAADSM  882
             ADA GLV FL  +AE+ARG  A A      W RE   AR+PPR    H EY+E P  D+ 
Sbjct  170   ADAQGLVQFLGAVAEMARGGAAAAPSVAPVWGREMLEARSPPRPAFAHREYDEVP--DTK  227

Query  881   VTNIPLDNLVHRSFLFGPTEISVLRSSLPPHLR-KCSTVEILTALVWRCRTIALGFHPDE  705
              T IPLD++ HRSF FG  E++ +RS L P +R + +T E+LT  +WRCRT AL    DE
Sbjct  228   GTIIPLDDMAHRSFFFGAREVAAVRSHLAPGIRERATTFEVLTGCLWRCRTAALAPDDDE  287

Query  704   EVRMLLLINARFKFKDTP----MPSGYTGNAFAYPGAKTTAGKLRKNPLGYAVELVTSIK  537
              +RM+ ++NAR   K       +P GY GNAFA+P A  TAG+LR  PLGYAVELV + K
Sbjct  288   VMRMICIVNARGGGKSGGGAGMIPEGYYGNAFAFPVAVATAGELRARPLGYAVELVRAAK  347

Query  536   RCFSEEYMQSMVDLMVLKGRPPFHVAGSFIMSDLTRSKISDVDYGWGKPVFGGPAHGGAG  357
                S EYM+S+ DLMV +GRP F V  ++++SD+T++   D+D+GWGKP +GGPA GG G
Sbjct  348   GEVSVEYMRSVADLMVQRGRPHFTVVRAYLVSDVTKAGFGDLDFGWGKPAYGGPAKGGVG  407

Query  356   DVPGVITFHVPYENKKGENGTLIPICLPAFALDKFVNELAN  234
              +PGV +F +P++N KGE+G ++P+CLP  A+DKFV E+  
Sbjct  408   AIPGVASFLIPFKNAKGEDGIVVPMCLPGPAMDKFVEEMGK  448



>ref|XP_008779984.1| PREDICTED: benzyl alcohol O-benzoyltransferase-like [Phoenix 
dactylifera]
Length=460

 Score =   441 bits (1134),  Expect = 2e-147, Method: Compositional matrix adjust.
 Identities = 213/395 (54%), Positives = 285/395 (72%), Gaps = 6/395 (2%)
 Frame = -1

Query  1415  FYRNEPSMSGKDPVQVIRQALAKALVFFYPFAGRLREGPGRKLMVDCTGEGVMFIEADAD  1236
             FYRN+PS  G+DP  VI++ L + LV +YP AGRLRE PGRKL+V+CTGEGV+F+EADAD
Sbjct  48    FYRNDPSKEGRDPATVIKETLGEVLVHYYPIAGRLREWPGRKLVVECTGEGVVFVEADAD  107

Query  1235  ATLQHFAIGGELKPPFPCFDQLLYNVPGSAEILNSPLFLIQVTRLRCGGFIFTLRMNHTM  1056
               L+ F  G    PPFPC ++LLY+      IL+ PL  IQVTRL+CGGFIF LR+NHT 
Sbjct  108   VRLEDF--GHAPSPPFPCVEELLYDTESFGSILDRPLLFIQVTRLKCGGFIFGLRINHTF  165

Query  1055  ADASGLVHFLNTIAEIARGAEAPAVQPVWQREFFSARNPPRITCTHFEYEEEPAADSMVT  876
              DA G+V FL  + E+ARGA AP + PVW+RE  +AR+PPRIT  H EYE     D + T
Sbjct  166   VDAPGVVQFLTGLGEMARGAAAPTLTPVWERELLNARSPPRITHAHPEYECLAGTDVLTT  225

Query  875   NIPLDNLVHRSFLFGPTEISVLRSSLPPHLRKCST-VEILTALVWRCRTIALGFHPDEEV  699
             + P D +V+RSF FGP EIS +R   PPHLR  S+  +++TA VWR RT ALG+ PD+EV
Sbjct  226   SPPAD-MVNRSFFFGPKEISAMRKHAPPHLRSTSSRFDLITASVWRSRTAALGYDPDDEV  284

Query  698   RMLLLINARFKFKDTPMPSGYTGNAFAYPGAKTTAGKLRKNPLGYAVELVTSIKRCFSEE  519
             R+L ++NAR + ++ P+PSGY GNA A+P A + AG+L ++PLGYA+ELV   K   ++E
Sbjct  285   RVLFVVNARGR-RNPPLPSGYYGNALAFPVASSAAGRLSRSPLGYALELVRKAKASVTDE  343

Query  518   YMQSMVDLMVLKGRPPFHVAGSFIMSDLTRSKISDVDYGWGKPVFGGPAHGGAGDVPGVI  339
             YMQS+ DLMVL+GRP F +A ++++SD+TR+    VD+GWG+ V+GGPA  G G VPGV 
Sbjct  344   YMQSVADLMVLRGRPHFAMARTYLVSDVTRAGFEAVDFGWGEGVYGGPASAGVGAVPGVA  403

Query  338   TFHVPYENKKGENGTLIPICLPAFALDKFVNELAN  234
             +F+  + N KGE G L+P+CLP  A+++F  E+ +
Sbjct  404   SFYTWHRN-KGEEGILVPMCLPGPAMERFQMEMES  437



>gb|AAG13627.1|AC078840_18 putative hypersensitivity-related (hsr)protein [Oryza sativa 
Japonica Group]
 gb|ABB47848.2| benzoyl-CoA:benzyl alcohol/phenylethanol benzoyltransferase, 
putative, expressed [Oryza sativa Japonica Group]
Length=553

 Score =   444 bits (1141),  Expect = 4e-147, Method: Compositional matrix adjust.
 Identities = 220/401 (55%), Positives = 285/401 (71%), Gaps = 11/401 (3%)
 Frame = -1

Query  1415  FYRNEPSMSGKDPVQVIRQALAKALVFFYPFAGRLREGPGRKLMVDCTGEGVMFIEADAD  1236
             FYR   +M G+DP  VIR A+A+ALV +YPFAGRLRE  GRKL VDCTGEGV+FIEADAD
Sbjct  52    FYRRSAAMGGRDPAPVIRAAVARALVSYYPFAGRLRELEGRKLAVDCTGEGVLFIEADAD  111

Query  1235  ATLQHFAIGGELKPPFPCFDQLLYNVPGSAEILNSPLFLIQVTRLRCGGFIFTLRMNHTM  1056
               L+HF  GG L+PPFPC ++L+++VPGS+E+L SPL L QVTRL CGGFI  +R++HTM
Sbjct  112   VRLEHF--GGALQPPFPCLEELVFDVPGSSEVLGSPLLLFQVTRLACGGFILAVRLHHTM  169

Query  1055  ADASGLVHFLNTIAEIARGAEAPAVQPV--WQREFFSARNPPRITCTHFEYEEEPAADSM  882
             ADA GLV FL  +AE+ARG  A A      W RE   AR+PPR    H EY+E P  D+ 
Sbjct  170   ADAQGLVQFLGAVAEMARGGAAAAPSVAPVWGREMLEARSPPRPAFAHREYDEVP--DTK  227

Query  881   VTNIPLDNLVHRSFLFGPTEISVLRSSLPPHLR-KCSTVEILTALVWRCRTIALGFHPDE  705
              T IPLD++ HRSF FG  E++ +RS L P +R + +T E+LT  +WRCRT AL    DE
Sbjct  228   GTIIPLDDMAHRSFFFGAREVAAVRSHLAPGIRERATTFEVLTGCLWRCRTAALAPDDDE  287

Query  704   EVRMLLLINARFKFKDTP----MPSGYTGNAFAYPGAKTTAGKLRKNPLGYAVELVTSIK  537
              +RM+ ++NAR   K       +P GY GNAFA+P A  TAG+LR  PLGYAVELV + K
Sbjct  288   VMRMICIVNARGGGKSGGGAGMIPEGYYGNAFAFPVAVATAGELRARPLGYAVELVRAAK  347

Query  536   RCFSEEYMQSMVDLMVLKGRPPFHVAGSFIMSDLTRSKISDVDYGWGKPVFGGPAHGGAG  357
                S EYM+S+ DLMV +GRP F V  ++++SD+T++   D+D+GWGKP +GGPA GG G
Sbjct  348   GEVSVEYMRSVADLMVQRGRPHFTVVRAYLVSDVTKAGFGDLDFGWGKPAYGGPAKGGVG  407

Query  356   DVPGVITFHVPYENKKGENGTLIPICLPAFALDKFVNELAN  234
              +PGV +F +P++N KGE+G ++P+CLP  A+DKFV E+  
Sbjct  408   AIPGVASFLIPFKNAKGEDGIVVPMCLPGPAMDKFVEEMGK  448



>ref|XP_002270240.1| PREDICTED: methanol O-anthraniloyltransferase [Vitis vinifera]
Length=445

 Score =   439 bits (1130),  Expect = 7e-147, Method: Compositional matrix adjust.
 Identities = 215/401 (54%), Positives = 277/401 (69%), Gaps = 8/401 (2%)
 Frame = -1

Query  1415  FYRNEPSMSGKDPVQVIRQALAKALVFFYPFAGRLREGPGRKLMVDCTGEGVMFIEADAD  1236
             FY N   M GKDP +VIR+ALAKAL+++YPFAGRL EG  RKL+VDCTGEGV+F+EADAD
Sbjct  50    FYGNSSLMDGKDPAKVIREALAKALIYYYPFAGRLVEGSNRKLLVDCTGEGVLFVEADAD  109

Query  1235  ATLQHFAIGGELKPPFPCFDQLLYNVPGSAEILNSPLFLIQVTRLRCGGFIFTLRMNHTM  1056
              TL++  +G  ++PP PCF++LLY+VPGS  IL  PL L QVTRLRCGGF+  LR+NHTM
Sbjct  110   TTLEY--LGDAIQPPCPCFEELLYDVPGSGGILGCPLLLFQVTRLRCGGFVLALRLNHTM  167

Query  1055  ADASGLVHFLNTIAEIARGAEAPAVQPVWQREFFSARNPPRITCTHFEYEEEPAADSMVT  876
             +D+ GL+ FLN ++EIA+GAE P+V PVWQRE  +ARNPP ITC H+E+EE       + 
Sbjct  168   SDSFGLLQFLNAVSEIAQGAEVPSVLPVWQRELLNARNPPCITCRHYEFEEVHDTKGTLG  227

Query  875   NIPLDNLVHRSFLFGPTEISVLRSSLPPHLRKCSTVEILTALVWRCRTIALGFHPDEEVR  696
              +  DN VHRSF FGP EI  L+  +P  L  C+T E L A VWRCRT+A G  P+E VR
Sbjct  228   VMDDDNTVHRSFFFGPKEIRSLKMRIPQALGPCTTYEALAACVWRCRTVAFGVDPNEFVR  287

Query  695   MLLLINARFKFKDTPMPSGYTGNAFAYPGAKTTAGKLRKNPLGYAVELVTSIKRCFSEEY  516
                 ++ R K +   +PSGY GNAFAYP A    G+L KNPLGYAVELV  +K   SEEY
Sbjct  288   FSSAMSMRGK-RGLQLPSGYYGNAFAYPAAIAKVGELCKNPLGYAVELVKKVKAEMSEEY  346

Query  515   MQSMVDLMVLKGRPPFHVAGSFIMSDLTRSKISDVDYGWGKPVFGGPAHGGAGDVPGVIT  336
             ++S+  LMV+KGRP +   G FI+SD TR    DVD+GWGKP++GG A   +     +I+
Sbjct  347   IKSLAALMVIKGRPLYTRTGFFIISDNTRVDFQDVDFGWGKPLYGGLAKASS-----LIS  401

Query  335   FHVPYENKKGENGTLIPICLPAFALDKFVNELANTFLRAAL  213
             F + + N KGE G ++PI LP   +++F  E+       A+
Sbjct  402   FFLRFRNSKGEEGIVVPIQLPLPVMERFEQEVKRMVAEEAV  442



>ref|XP_011009230.1| PREDICTED: benzyl alcohol O-benzoyltransferase-like [Populus 
euphratica]
Length=399

 Score =   437 bits (1125),  Expect = 8e-147, Method: Compositional matrix adjust.
 Identities = 211/385 (55%), Positives = 273/385 (71%), Gaps = 8/385 (2%)
 Frame = -1

Query  1394  MSGKDPVQVIRQALAKALVFFYPFAGRLREGPGRKLMVDCTGEGVMFIEADADATLQHFA  1215
             M GKDPV+VIR+A+AK LVF+YPFAGRLREG  RKLMV+CTGEG++FIEADAD TL+ F 
Sbjct  1     MHGKDPVKVIREAIAKTLVFYYPFAGRLREGHNRKLMVECTGEGILFIEADADVTLEQF-  59

Query  1214  IGGELKPPFPCFDQLLYNVPGSAEILNSPLFLIQVTRLRCGGFIFTLRMNHTMADASGLV  1035
              G  L+PPFPC ++LL++VPGS+ +LN PL LIQV+RL+CGGF+F LR+NHTM+D  GL 
Sbjct  60    -GDPLQPPFPCLEELLFDVPGSSGVLNCPLLLIQVSRLKCGGFLFALRLNHTMSDGPGLE  118

Query  1034  HFLNTIAEIARGAEAPAVQPVWQREFFSARNPPRITCTHFEYEEEPAADSMVTNIPLDNL  855
              F+  + E+ARGA AP+V PVW+R    A +PPR+TC H  YEE   A S  + +  D+L
Sbjct  119   QFMAAVGEMARGANAPSVPPVWERHVLKATDPPRVTCRHLAYEE--VAGSTSSILTHDHL  176

Query  854   VHRSFLFGPTEISVLRSSLPPHLRKCSTVEILTALVWRCRTIALGFHPDEEVRMLLLINA  675
             VHRSF F P++I+ LR  +PPHL  CST EILTA +W CRTIAL  HP+EE+R++ L+NA
Sbjct  177   VHRSFFFSPSDITALRRLVPPHLSHCSTFEILTACLWICRTIALQPHPNEEMRIICLVNA  236

Query  674   RFKFKDTPMPSGYTGNAFAYPGAKTTAGKLRKNPLGYAVELVTSIKRCFSEEYMQSMVDL  495
             R KF    +P GY GN F    A  TAG+L K P+GYA+ELV   K   +EE M+S   L
Sbjct  237   RGKFNPPLLPRGYYGNGFLLLAAVATAGELSKKPIGYALELVRKAKAAMTEECMRSTASL  296

Query  494   MVLKGRPPFHVAGSFIMSDLTRSKISDVDYGWGKPVFGGPAHGGAGDVPGVITFHVPYEN  315
             MV KGRP F V G++I+SDL       VD+GWG  ++GG A       P   +F++P+ N
Sbjct  297   MVSKGRPLFTVPGTYIVSDLRHVGFEKVDFGWGNAIYGGTAKAA----PEPASFYIPFTN  352

Query  314   KKGENGTLIPICLPAFALDKFVNEL  240
             KKGE+G L+  CLP+ A+++F   L
Sbjct  353   KKGEDGILVLFCLPSPAVERFYKGL  377



>ref|XP_004506306.1| PREDICTED: 13-hydroxylupanine O-tigloyltransferase-like [Cicer 
arietinum]
Length=450

 Score =   439 bits (1129),  Expect = 1e-146, Method: Compositional matrix adjust.
 Identities = 210/397 (53%), Positives = 279/397 (70%), Gaps = 12/397 (3%)
 Frame = -1

Query  1415  FYRNEPSMSGKDPVQVIRQALAKALVFFYPFAGRLREGPGRKLMVDCTGEGVMFIEADAD  1236
              YR  PSM GKDPVQVIR+AL+K LVF+YPFAGRL E    KLMV+C GEGVMFIEADAD
Sbjct  51    LYRYNPSMLGKDPVQVIREALSKTLVFYYPFAGRLMECSNGKLMVNCNGEGVMFIEADAD  110

Query  1235  ATLQHFAIGGELKPPFPCFDQLLYNVPGSAEILNSPLFLIQVTRLRCGGFIFTLRMNHTM  1056
              TL  F       PPFPCFD+LLYNVPGS  I++SPL LIQVTRL+CGGFIF+LRMNHTM
Sbjct  111   VTLDDF--DNNFVPPFPCFDELLYNVPGSDGIIDSPLLLIQVTRLKCGGFIFSLRMNHTM  168

Query  1055  ADASGLVHFLNTIAEIARGAEAPAVQPVWQREFFSARNPPRITCTHFEYEEEPAADSMVT  876
             +D SG+  FL  ++E+A  A+ P++ P+W RE   AR PP++TC H EY++ P       
Sbjct  169   SDGSGISQFLKALSELANEAKEPSILPMWCRELLCAREPPKVTCIHREYQQLPPDTK---  225

Query  875   NIPLDNLVHRSFLFGPTEISVLRSSLPPHLRKCSTVEILTALVWRCRTIALGF-HPDEEV  699
                  N +H SF FGP EI+ +R+ LP HL K ++ +ILTA +WRCRT AL + + +EE+
Sbjct  226   ----SNFIHHSFFFGPKEIAAIRALLPHHLSKSTSFKILTACLWRCRTKALQWKNSNEEI  281

Query  698   RMLLLINARFKFKDTPMPSGYTGNAFAYPGAKTTAGKLRKNPLGYAVELVTSIKRCFSEE  519
             R+L ++NAR +  + P+P G+ GN   +P A TT GKL   PLGYAVELV + K   +EE
Sbjct  282   RLLCIVNARCRL-NPPLPEGFYGNTVVFPAAVTTVGKLCGRPLGYAVELVKNAKNEATEE  340

Query  518   YMQSMVDLMVLKGRPPFHVAGSFIMSDLTRSKISDVDYGWGKPVFGGPAHGGAGDVPGVI  339
             Y+ SM+DLM   GRP F  +GSF++S+++++ + D+D+GWGK ++GG A  G GD+PGV 
Sbjct  341   YVHSMIDLMETNGRPCFTRSGSFVVSNISKASLKDLDFGWGKALYGGVAKAGLGDIPGV-  399

Query  338   TFHVPYENKKGENGTLIPICLPAFALDKFVNELANTF  228
             + ++ + N KGE G ++PICLP  A+++   EL N  
Sbjct  400   SVYMHFTNSKGEQGRVVPICLPINAMERLEKELDNIL  436



>ref|XP_003626389.1| Benzoyl coenzyme A benzyl alcohol benzoyl transferase [Medicago 
truncatula]
Length=560

 Score =   443 bits (1139),  Expect = 1e-146, Method: Compositional matrix adjust.
 Identities = 218/392 (56%), Positives = 281/392 (72%), Gaps = 5/392 (1%)
 Frame = -1

Query  1412  YRNEPSMSGKDPVQVIRQALAKALVFFYPFAGRLREGPGRKLMVDCTGEGVMFIEADADA  1233
             Y +EPSM+ KDPV+V+R AL++ALV++YPFAGR+REG  RKLMVDCTGEGVMFIEA+AD 
Sbjct  50    YHHEPSMAEKDPVKVLRHALSQALVYYYPFAGRIREGASRKLMVDCTGEGVMFIEAEADV  109

Query  1232  TLQHFAIGGELKPPFPCFDQLLYNVPGSAEILNSPLFLIQVTRLRCGGFIFTLRMNHTMA  1053
             TL  F  G  L PPFPCF QLLY+V GS +I++ P+ LIQVTRL+CGGFI  +  NHTM 
Sbjct  110   TLDQF--GDALHPPFPCFHQLLYDVRGSEQIMDRPIRLIQVTRLKCGGFIVAMNWNHTMG  167

Query  1052  DASGLVHFLNTIAEIARGAEAPAVQPVWQREFFSARNPPRITCTHFEYEEEPAADSMVTN  873
             DA+GL  F+N  AE+ARGA  P++QPVW RE   AR+PPRITC HFEYE+  + ++ +  
Sbjct  168   DAAGLRQFMNAWAEMARGAYRPSIQPVWNREILMARDPPRITCNHFEYEQILSPNT-IKE  226

Query  872   IPLDNLVHRSFLFGPTEISVLRSSLPPHLRKCSTVEILTALVWRCRTIALGFHPDEEVRM  693
                 +LVH+SF F  ++I+ LR  +P HLR+C+T +++ +  W CRT AL    DEEVRM
Sbjct  227   KDTASLVHQSFFFRASDIATLRLLVPFHLRQCTTFDLIASCFWCCRTKALQLEADEEVRM  286

Query  692   LLLINARFKFKDTPMP-SGYTGNAFAYPGAKTTAGKLRKNPLGYAVELVTSIKRCFSEEY  516
             + + NAR +F     P  GY GN FAYP A TTA KL  NP GYAVELV  +K   +EEY
Sbjct  287   MCIANARSRFNVNNSPLVGYYGNCFAYPAAVTTARKLCGNPFGYAVELVRKLKAEVTEEY  346

Query  515   MQSMVDLMVLKGRPPFHVAGSFIMSDLTRSKISDVDYGWGKPVFGGPAHGGAGDVPGVIT  336
             M S+ DLMV+K R  F    S I+SDLTR+++S+V++GWG+ V+GG A GGAG  PG  T
Sbjct  347   MHSVADLMVIKERCLFTTVRSCIISDLTRARLSEVNFGWGEGVYGGVAKGGAGPFPGA-T  405

Query  335   FHVPYENKKGENGTLIPICLPAFALDKFVNEL  240
             + VPY+N KGE   ++PICLP+  + +F  EL
Sbjct  406   YIVPYKNIKGEETLMLPICLPSEDMKRFAKEL  437



>ref|XP_009386561.1| PREDICTED: benzyl alcohol O-benzoyltransferase-like [Musa acuminata 
subsp. malaccensis]
Length=460

 Score =   439 bits (1128),  Expect = 2e-146, Method: Compositional matrix adjust.
 Identities = 221/404 (55%), Positives = 284/404 (70%), Gaps = 20/404 (5%)
 Frame = -1

Query  1415  FYRNE-PSMSG-------KDPVQVIRQALAKALVFFYPFAGRLREGPGRKLMVDCTGEGV  1260
             FYRN  PS+S        +DP +VIR+AL +ALV +YP AGRLRE PGRKL+V+CTGEGV
Sbjct  50    FYRNSVPSISTTGTGGGHRDPAKVIREALGRALVSYYPLAGRLREAPGRKLVVECTGEGV  109

Query  1259  MFIEADADATLQHFAIGGELKPPFPCFDQLLYNVPGSAEILNSPLFLIQVTRLRCGGFIF  1080
             +F+EADAD +L+ F  G  L PP P   +LL++VPGS  IL+ PL L+QVTRL CGGF+ 
Sbjct  110   LFVEADADISLEQF--GEALHPPLPFLGELLHDVPGSGGILHCPLVLMQVTRLLCGGFVV  167

Query  1079  TLRMNHTMADASGLVHFLNTIAEIARGAEAPAVQPVWQREFFSARNPPRITCTHFEYEEE  900
              LR+NHTMAD +GL  F+N + E+ARGA AP+V PVW RE   AR PPRITC H EY+  
Sbjct  168   ALRLNHTMADGAGLGQFMNAVGELARGAAAPSVSPVWARELLEARIPPRITCVHREYDPV  227

Query  899   PAADS---MVTNIPLDNLVHRSFLFGPTEISVLRSSLPPHLRKCSTVEILTALVWRCRTI  729
             P +D+     T +PLD++VHRSF FG  +++ LR  +PPHLR  ST +ILTA +WRCRTI
Sbjct  228   PPSDARGPATTIVPLDDMVHRSFFFGRADVAALRRCVPPHLRDRSTFDILTACLWRCRTI  287

Query  728   ALGFHPDEEVRMLLLINARFK-FKDTPMPSGYTGNAFAYPGAKTTAGKLRKNPLGYAVEL  552
             A+    +EEVR+L ++NAR K F    +P+GY GNA AY  A +TAG+L   P+GYA+EL
Sbjct  288   AISPGDEEEVRVLFIVNARAKRFAGLGLPAGYYGNAIAYATAISTAGELCARPVGYALEL  347

Query  551   VTSIKRCFSEEYMQSMVDLMVLKGRPPFHVAGSFIMSDLTRSKISDVDYGWGKPVFGGPA  372
             V   K   +EEYM+S+VDLMVL+GRP + V GS+++SD TRS +  VDYGWGKP++GGPA
Sbjct  348   VKEAKSMVTEEYMRSVVDLMVLRGRPHYKVRGSYLVSDATRSGLELVDYGWGKPLYGGPA  407

Query  371   HGGAGDVPGVITFHVPYENKKGENGTLIPICLPAFALDKFVNEL  240
              G       V +FH  + N KGE G ++P  LP   +DKF  EL
Sbjct  408   WG------RVASFHFRFRNSKGEEGVVVPHYLPRTTMDKFAMEL  445



>emb|CAN72252.1| hypothetical protein VITISV_017467 [Vitis vinifera]
Length=451

 Score =   438 bits (1126),  Expect = 3e-146, Method: Compositional matrix adjust.
 Identities = 216/392 (55%), Positives = 274/392 (70%), Gaps = 8/392 (2%)
 Frame = -1

Query  1415  FYRNEPSMSGKDPVQVIRQALAKALVFFYPFAGRLREGPGRKLMVDCTGEGVMFIEADAD  1236
             FY N P M GKDPV+VIR+AL KALV++YPFAGRL EG  RKLMVDCTGEGV+FIEADAD
Sbjct  51    FYPNNPLMKGKDPVKVIREALGKALVYYYPFAGRLIEGDNRKLMVDCTGEGVLFIEADAD  110

Query  1235  ATLQHFAIGGELKPPFPCFDQLLYNVPGSAEILNSPLFLIQVTRLRCGGFIFTLRMNHTM  1056
              TL++  +G  ++P  PCF++LLY+VPGS  IL SP+ LIQVTRLRCGGFIF LR+NHTM
Sbjct  111   TTLEN--LGDAIQPMCPCFEELLYDVPGSGGILGSPVVLIQVTRLRCGGFIFALRLNHTM  168

Query  1055  ADASGLVHFLNTIAEIARGAEAPAVQPVWQREFFSARNPPRITCTHFEYEEEPAADSMVT  876
             +   GLV FLN I+E+A+G   P++ P+WQRE  +ARNPPRITC H EYEE       + 
Sbjct  169   SGIPGLVQFLNAISEMAQGLSVPSLLPIWQRELLNARNPPRITCIHHEYEEVTNTKGTLM  228

Query  875   NIPLDNLVHRSFLFGPTEISVLRSSLPPHLRKCSTVEILTALVWRCRTIALGFHPDEEVR  696
              +  +NLVHRSF FGP EI  LR+ LP  L   +T E+LTA VWRCRTIA    PDE VR
Sbjct  229   AMDENNLVHRSFFFGPKEIRALRNRLPASLGASTTFEVLTAXVWRCRTIAFAVDPDEVVR  288

Query  695   MLLLINARFKFKDTPMPSGYTGNAFAYPGAKTTAGKLRKNPLGYAVELVTSIKRCFSEEY  516
             ++  I+ R K +   +P GY GNA   P + T AG L KNPL YAV LV   K   S+EY
Sbjct  289   IICSISMRGK-RGFELPPGYYGNAVVTPASITKAGMLCKNPLEYAVRLVKKAKAEMSQEY  347

Query  515   MQSMVDLMVLKGRPPFHVAGSFIMSDLTRSKISDVDYGWGKPVFGGPAHGGAGDVPGVIT  336
             ++S+ DLMV+KGRP F   G+++++D+TR    ++D+GWGKPV+ G A   +     +I+
Sbjct  348   VKSVADLMVIKGRPSFMHPGNYMVADVTRDGSGEIDFGWGKPVYSGLARAIS-----IIS  402

Query  335   FHVPYENKKGENGTLIPICLPAFALDKFVNEL  240
             F   + N KGE G +IPICLP   ++KF  E+
Sbjct  403   FCARFRNSKGEEGNVIPICLPPPVMEKFEQEI  434



>gb|ABX57719.1| acyltransferase [Vanda hybrid cultivar]
Length=447

 Score =   437 bits (1125),  Expect = 3e-146, Method: Compositional matrix adjust.
 Identities = 217/396 (55%), Positives = 278/396 (70%), Gaps = 7/396 (2%)
 Frame = -1

Query  1415  FYRNEPSMSGKDPVQVIRQALAKALVFFYPFAGRLREGPGRKLMVDCTGEGVMFIEADAD  1236
             FYR+EP+M+G++P  VIR ALA+ LVF+YPFAGRLREG G+KL VDCTGEGV+FIEA+AD
Sbjct  49    FYRHEPAMAGQNPASVIRDALARTLVFYYPFAGRLREGAGKKLFVDCTGEGVLFIEAEAD  108

Query  1235  ATLQHFAIGGELKPPFPCFDQLLYNVPGSAEILNSPLFLIQVTRLRCGGFIFTLRMNHTM  1056
               L+ F  G  L PPFPC ++LL++V GS+ +LN+PL LIQVT L CGGFI  LR+NHTM
Sbjct  109   VKLKDF--GDALHPPFPCLEELLFDVDGSSAVLNTPLLLIQVTLLSCGGFILALRLNHTM  166

Query  1055  ADASGLVHFLNTIAEIARGAEAPAVQPVWQREFFSARNPPRITCTHFEYEEEPAADSMVT  876
             +DA GLV  +  + E+ARG+ +P+V PVW+RE   AR  P     H EYE+ P  +  +T
Sbjct  167   SDAPGLVQLMTAVGELARGSSSPSVIPVWRRELLEARPSPAPFFPHPEYEQVPDTEGTIT  226

Query  875   NIPLDNLVHRSFLFGPTEISVLRSSLPPHLR-KCSTVEILTALVWRCRTIALG-FHPDEE  702
               PLDN  HRSF+FGP EIS+LRS LP  LR   ST +ILTA VWR RT AL    P E 
Sbjct  227   --PLDNTAHRSFIFGPREISILRSRLPSQLRGASSTFDILTACVWRSRTRALQPADPKEN  284

Query  701   VRMLLLINARFKFKDTPMPSGYTGNAFAYPGAKTTAGKLRKNPLGYAVELVTSIKRCFSE  522
              R++ ++N R +  + P+PSG+ GNAF  P A  TAG+L   PL YAVELV   K   S 
Sbjct  285   FRIICIVNIRGRI-NPPLPSGFYGNAFGLPVAIATAGELCSRPLDYAVELVKRAKSQVSG  343

Query  521   EYMQSMVDLMVLKGRPPFHVAGSFIMSDLTRSKISDVDYGWGKPVFGGPAHGGAGDVPGV  342
             +Y+ S+ D MV+KGRP F V  ++++SDLTR+   DVD+GWGKPV+GGPA GG G  PGV
Sbjct  344   DYLHSVADYMVMKGRPHFTVVRTYVISDLTRAGFGDVDFGWGKPVYGGPAKGGVGVSPGV  403

Query  341   ITFHVPYENKKGENGTLIPICLPAFALDKFVNELAN  234
               F +P+ N  GE G ++PICLP  A+ +FV E+ +
Sbjct  404   FNFFIPFVNASGEKGIVVPICLPPPAMRRFVAEIQS  439



>ref|XP_003626388.1| Benzoyl coenzyme A benzyl alcohol benzoyl transferase [Medicago 
truncatula]
 gb|AES82606.1| benzyl alcohol O-benzoyltransferase [Medicago truncatula]
Length=459

 Score =   437 bits (1125),  Expect = 5e-146, Method: Compositional matrix adjust.
 Identities = 211/393 (54%), Positives = 279/393 (71%), Gaps = 5/393 (1%)
 Frame = -1

Query  1415  FYRNEPSMSGKDPVQVIRQALAKALVFFYPFAGRLREGPGRKLMVDCTGEGVMFIEADAD  1236
              YR++PSM  KDP++V+R AL++ LV++YP AGR+REG GRKLMVDCTGEGVMFIEA+AD
Sbjct  49    IYRHKPSMVEKDPLKVLRHALSRTLVYYYPLAGRIREGAGRKLMVDCTGEGVMFIEAEAD  108

Query  1235  ATLQHFAIGGELKPPFPCFDQLLYNVPGSAEILNSPLFLIQVTRLRCGGFIFTLRMNHTM  1056
              TL  F  G  L PPFPCF QLLY+VPGS +I++ P+  IQVTRL+CGGFI  +  NHT+
Sbjct  109   VTLDQF--GDALHPPFPCFQQLLYDVPGSTQIIDRPIRQIQVTRLKCGGFIVAMNWNHTL  166

Query  1055  ADASGLVHFLNTIAEIARGAEAPAVQPVWQREFFSARNPPRITCTHFEYEEEPAADSMVT  876
              DA+GL  F+   AE+ARGA  P++QPVW RE   AR+PPRITC H EY++  + ++ + 
Sbjct  167   GDAAGLRQFMTAWAEMARGAHRPSIQPVWNREILMARDPPRITCNHLEYKQIFSPNT-IK  225

Query  875   NIPLDNLVHRSFLFGPTEISVLRSSLPPHLRKCSTVEILTALVWRCRTIALGFHPDEEVR  696
                  +LVHRSF F  ++I+ LR  +P HLR+C+T +++ +  W CRT AL    D+EVR
Sbjct  226   EEDTASLVHRSFFFRASDIAALRLLVPFHLRQCTTFDLIASCFWCCRTKALQLEADKEVR  285

Query  695   MLLLINARFKFKDTPMP-SGYTGNAFAYPGAKTTAGKLRKNPLGYAVELVTSIKRCFSEE  519
             M+ ++NAR +F     P  GY GN FAYP A TTAGKL  NP GYAVELV  +K   +EE
Sbjct  286   MMCVVNARSRFNINNSPLVGYYGNCFAYPAAVTTAGKLCGNPFGYAVELVRKLKAEVTEE  345

Query  518   YMQSMVDLMVLKGRPPFHVAGSFIMSDLTRSKISDVDYGWGKPVFGGPAHGGAGDVPGVI  339
             YM S+ DLMV+K R  F    S ++SDLTR+++S+V++GWG+ V+GG A GGAG  PG  
Sbjct  346   YMHSVADLMVIKERCLFTTVRSCVISDLTRARLSEVNFGWGEGVYGGVAKGGAGTFPGS-  404

Query  338   TFHVPYENKKGENGTLIPICLPAFALDKFVNEL  240
             T+ VPY+N  GE   ++PICLP+  + +F  EL
Sbjct  405   TYIVPYKNINGEETLMLPICLPSEDMKRFAKEL  437



>ref|XP_002265049.1| PREDICTED: methanol O-anthraniloyltransferase [Vitis vinifera]
Length=451

 Score =   437 bits (1124),  Expect = 7e-146, Method: Compositional matrix adjust.
 Identities = 215/392 (55%), Positives = 274/392 (70%), Gaps = 8/392 (2%)
 Frame = -1

Query  1415  FYRNEPSMSGKDPVQVIRQALAKALVFFYPFAGRLREGPGRKLMVDCTGEGVMFIEADAD  1236
             FY N P M GKDPV+VIR+AL KALV++YPFAGRL EG  RKLMVDCTGEGV+FIEADAD
Sbjct  51    FYPNNPLMKGKDPVKVIREALGKALVYYYPFAGRLIEGDNRKLMVDCTGEGVLFIEADAD  110

Query  1235  ATLQHFAIGGELKPPFPCFDQLLYNVPGSAEILNSPLFLIQVTRLRCGGFIFTLRMNHTM  1056
              TL++  +G  ++P  PCF++LLY+VPGS  IL SP+ LIQVTRLRCGGFIF LR+NHTM
Sbjct  111   TTLEN--LGDAIQPMCPCFEELLYDVPGSGGILGSPVVLIQVTRLRCGGFIFALRLNHTM  168

Query  1055  ADASGLVHFLNTIAEIARGAEAPAVQPVWQREFFSARNPPRITCTHFEYEEEPAADSMVT  876
             +   GLV FLN I+E+A+G   P++ P+WQRE  +ARNPPRITC H EYEE       + 
Sbjct  169   SGIPGLVQFLNAISEMAQGLSVPSLLPIWQRELLNARNPPRITCIHHEYEEVTNTKGTLM  228

Query  875   NIPLDNLVHRSFLFGPTEISVLRSSLPPHLRKCSTVEILTALVWRCRTIALGFHPDEEVR  696
              +  +NLVHRSF FGP EI  LR+ LP  L   +T E+LTA VWRCRTIA    PDE VR
Sbjct  229   AMDENNLVHRSFFFGPKEIRALRNRLPASLGASTTFEVLTACVWRCRTIAFAVDPDEVVR  288

Query  695   MLLLINARFKFKDTPMPSGYTGNAFAYPGAKTTAGKLRKNPLGYAVELVTSIKRCFSEEY  516
             ++  I+ R K +   +P GY GNA   P + T AG L KNPL YAV LV   K   S+EY
Sbjct  289   IICSISMRGK-RGFELPPGYYGNAVVTPASITKAGMLCKNPLEYAVRLVKKAKAEMSQEY  347

Query  515   MQSMVDLMVLKGRPPFHVAGSFIMSDLTRSKISDVDYGWGKPVFGGPAHGGAGDVPGVIT  336
             ++S+ DLMV+KGRP F   G+++++D+TR    ++D+GWGKPV+ G A   +     +I+
Sbjct  348   VKSVADLMVIKGRPSFMHPGNYMVADVTRDGSGEIDFGWGKPVYSGLARAIS-----IIS  402

Query  335   FHVPYENKKGENGTLIPICLPAFALDKFVNEL  240
             F   + N KGE G +IPICLP   +++F  E+
Sbjct  403   FCARFRNSKGEEGNVIPICLPPPVMERFEQEI  434



>ref|XP_006370914.1| hypothetical protein POPTR_0019s01690g [Populus trichocarpa]
 gb|ERP48711.1| hypothetical protein POPTR_0019s01690g [Populus trichocarpa]
Length=451

 Score =   437 bits (1123),  Expect = 7e-146, Method: Compositional matrix adjust.
 Identities = 202/396 (51%), Positives = 286/396 (72%), Gaps = 12/396 (3%)
 Frame = -1

Query  1415  FYRNEPSMSGKDPVQVIRQALAKALVFFYPFAGRLREGPGRKLMVDCTGEGVMFIEADAD  1236
             FY  + SM  +DPVQVI++ALAK LVF+YPFAGRLREGP RKL+V+CTGEG++FIEA+AD
Sbjct  51    FYPYDHSMQRRDPVQVIKEALAKTLVFYYPFAGRLREGPKRKLLVECTGEGILFIEANAD  110

Query  1235  ATLQHFAIGGELKPPFPCFDQLLYNVPGSAEILNSPLFLIQVTRLRCGGFIFTLRMNHTM  1056
              TL+ F  G  L PP PC ++LL++VPGS+ ++N PL LIQVTRL+CGG +F +R+NHTM
Sbjct  111   VTLEQF--GDALWPPIPCLEELLFDVPGSSGMINCPLLLIQVTRLKCGGIVFAIRLNHTM  168

Query  1055  ADASGLVHFLNTIAEIARGAEAPAVQPVWQREFFSARNPPRITCTHFEYEEEPAADSMVT  876
             +D +G+  FL+ + E+  GA+ P++QPVW+R   +ARNPP++TC H EY++    D+   
Sbjct  169   SDGTGINQFLSAMCEMVHGAQTPSIQPVWERHVLNARNPPQVTCLHHEYDQ--LVDT-TD  225

Query  875   NIPLDNLVHRSFLFGPTEISVLRSSLPPHLRKCSTVEILTALVWRCRTIALGFHPDEEVR  696
             N+PL    HRSF FG   IS +R   P HLR CST ++LTA +WRCRTIAL  +P++++R
Sbjct  226   NVPLTKKTHRSFFFGHAHISAIRGFAPLHLRHCSTFDVLTAFLWRCRTIALQPNPNDQMR  285

Query  695   MLLLINARFKFKDTPMPSGYTGNAFAYPGAKTTAGKLRKNPLGYAVELVTSIKRCFSEEY  516
             +L  +NAR +F + P+P GY GN  AY  A  TAG++ +N LG+ +ELV   K   +EEY
Sbjct  286   ILCTVNARNRF-NPPLPRGYYGNCMAYSVAMATAGEISRNSLGFTLELVRKAKANVTEEY  344

Query  515   MQSMVDLMVLKGRPPFHVAGSFIMSDLTRSKISDVDYGWGKPVFGGPAHGGAGDVPGVIT  336
             M+S+ DL+V+KGRP + +  S+++SD+TR+  ++++ GWGKP + GPA G       V +
Sbjct  345   MRSVADLLVIKGRPWYTMVRSYLVSDVTRAMFAEMNLGWGKPKYAGPAKG------NVAS  398

Query  335   FHVPYENKKGENGTLIPICLPAFALDKFVNELANTF  228
             F +PY  KKGE+G L+ +CLP  A+++F  EL +TF
Sbjct  399   FQIPYRTKKGEDGVLVTLCLPTPAMERFAKELDSTF  434



>ref|XP_007147133.1| hypothetical protein PHAVU_006G098500g [Phaseolus vulgaris]
 gb|ESW19127.1| hypothetical protein PHAVU_006G098500g [Phaseolus vulgaris]
Length=463

 Score =   436 bits (1122),  Expect = 2e-145, Method: Compositional matrix adjust.
 Identities = 216/398 (54%), Positives = 280/398 (70%), Gaps = 10/398 (3%)
 Frame = -1

Query  1412  YRNEPSMSGKDPVQVIRQALAKALVFFYPFAGRLREGPGRKLMVDCTGEGVMFIEADADA  1233
             YR + SM+ KDPV+VIR+AL++ LVF+YPFAGRLREGP RKLMVDCTGEGVMF+E DAD 
Sbjct  58    YRKQASMAEKDPVEVIRKALSQTLVFYYPFAGRLREGPQRKLMVDCTGEGVMFMEGDADV  117

Query  1232  TLQHFAIGGELKPPFPCFDQLLYNVPGSAEILNSPLFLIQVTRLRCGGFIFTLRMNHTMA  1053
             TL  F  G  L+PPFPCFD+LLY+VPGS +I N+PL L+QVTRL+CGGFI  L+ NHTM 
Sbjct  118   TLAEF--GDSLQPPFPCFDELLYDVPGSQQITNTPLLLVQVTRLKCGGFILALQFNHTMV  175

Query  1052  DASGLVHFLNTIAEIARGAEAPAVQPVWQREFFSARNPPRITCTHFEYEEEPAADSMVTN  873
             DA G   F+N  AE+ARGA  P++ PVW+RE   AR+PPRIT  H EYE+    D + ++
Sbjct  176   DAFGCQQFMNAWAEMARGATKPSIAPVWRRELLMARDPPRITRNHREYEQ--IQDILPSS  233

Query  872   IPLDNLVHRSFLFGPTEISVLRSSLPPHLRKCSTVEILTALVWRCRTIALGFHPDEEVRM  693
                 NL+ RSF FG  +I+ LR  +P HL+ CST +++ A +WRCRT A+    +E+VRM
Sbjct  234   N--HNLIQRSFFFGRLDIAALRKFIPQHLQHCSTFDLIAACLWRCRTKAMQIEANEDVRM  291

Query  692   LLLINARFKFKDTPMPSGYTGNAFAYPGAKTTAGKLRKNPLGYAVELVTSIKRCFSEEYM  513
             + ++NAR +F + P+P GY GNAFAYP A T+AGKL +NP GYAVEL+  +K    EEY+
Sbjct  292   MCIVNARGRF-NPPLPVGYYGNAFAYPAAVTSAGKLCQNPFGYAVELINKVKGEMKEEYL  350

Query  512   QSMVDLMVLKGRP-PFHVAGSFIMSDLTRSKISDVDYGWGKPVFGGPAHGGAGDVPGVIT  336
             QS+ DLMV+K R   F    S I+S L + K   +D+GWG+ V+GG A  GAG  PG  +
Sbjct  351   QSVADLMVMKERSLLFTTVRSCIVSYLVQVKFRAMDFGWGEAVYGGVAEAGAGSFPGA-S  409

Query  335   FHVPYENKKGENGTLIPICLPAFALDKFVNELANTFLR  222
             +    +N KGE G + PI LPA A+++F  E  N  LR
Sbjct  410   YFCSAKNGKGEEGIIFPISLPAEAMERFAKEF-NHMLR  446



>gb|KEH40977.1| benzyl alcohol O-benzoyltransferase [Medicago truncatula]
Length=425

 Score =   434 bits (1116),  Expect = 4e-145, Method: Compositional matrix adjust.
 Identities = 208/396 (53%), Positives = 270/396 (68%), Gaps = 39/396 (10%)
 Frame = -1

Query  1415  FYRNEPSMSGKDPVQVIRQALAKALVFFYPFAGRLREGPGRKLMVDCTGEGVMFIEADAD  1236
             FY ++P+M+GKDPV VIR+ALAK LVF+YPFAGRLREGPGRKLMVDCTGEGV+FIEADAD
Sbjct  48    FYNHDPNMAGKDPVDVIRKALAKTLVFYYPFAGRLREGPGRKLMVDCTGEGVLFIEADAD  107

Query  1235  ATLQHFAIGGELKPPFPCFDQLLYNVPGSAEILNSPLFLIQVTRLRCGGFIFTLRMNHTM  1056
              TL+ F  G  L PPFPC D+LLY VPGS++++N+PL LIQVTRL+CGGFIF +RMNHT+
Sbjct  108   VTLKEF--GDALHPPFPCLDELLYYVPGSSDVINTPLMLIQVTRLKCGGFIFAIRMNHTL  165

Query  1055  ADASGLVHFLNTIAEIARGAEAPAVQPVWQREFFSARNPPRITCTHFEYEEEPAADSMVT  876
             +DASG++ FL+ + EI+RG   P++ PVW RE  +AR+PPR+T  H EY+ EP  D+  T
Sbjct  166   SDASGMLQFLSALGEISRGMSKPSISPVWSRELLNARDPPRVTYNHREYDPEP--DNKGT  223

Query  875   NIPLDNLVHRSFLFGPTEISVLRSSLPPHLRKCSTVEILTALVWRCRTIALGFHPDEEVR  696
               PLD++VHR+F                                    IA     +EEVR
Sbjct  224   MFPLDDMVHRTFF-----------------------------------IAFQLDSNEEVR  248

Query  695   MLLLINARFKFKDTPMPSGYTGNAFAYPGAKTTAGKLRKNPLGYAVELVTSIKRCFSEEY  516
             ++ + +AR K  D  +P GY GNA  +P A TTAGKL +NPL YA+ LV   K   ++EY
Sbjct  249   IICIADARSKSVDQQLPYGYYGNAIVFPVAVTTAGKLIENPLAYALNLVKKAKASVNKEY  308

Query  515   MQSMVDLMVLKGRPPFHVAGSFIMSDLTRSKISDVDYGWGKPVFGGPAHGGAGDVPGVIT  336
             M S+ DLMV+KGRPP   AG +++SD+TR+   DVD+GWGK V+GGPA GG G +PG   
Sbjct  309   MHSVADLMVIKGRPPLTTAGLYLVSDVTRAGFRDVDFGWGKAVYGGPAKGGDGALPGQAV  368

Query  335   FHVPYENKKGENGTLIPICLPAFALDKFVNELANTF  228
             FH+P+ N KGE G +IP+ LP   +++ V EL +  
Sbjct  369   FHIPFTNDKGEKGLVIPVFLPTQVMERLVKELDSVL  404



>emb|CBI37443.3| unnamed protein product [Vitis vinifera]
Length=492

 Score =   436 bits (1122),  Expect = 4e-145, Method: Compositional matrix adjust.
 Identities = 215/392 (55%), Positives = 274/392 (70%), Gaps = 8/392 (2%)
 Frame = -1

Query  1415  FYRNEPSMSGKDPVQVIRQALAKALVFFYPFAGRLREGPGRKLMVDCTGEGVMFIEADAD  1236
             FY N P M GKDPV+VIR+AL KALV++YPFAGRL EG  RKLMVDCTGEGV+FIEADAD
Sbjct  51    FYPNNPLMKGKDPVKVIREALGKALVYYYPFAGRLIEGDNRKLMVDCTGEGVLFIEADAD  110

Query  1235  ATLQHFAIGGELKPPFPCFDQLLYNVPGSAEILNSPLFLIQVTRLRCGGFIFTLRMNHTM  1056
              TL++  +G  ++P  PCF++LLY+VPGS  IL SP+ LIQVTRLRCGGFIF LR+NHTM
Sbjct  111   TTLEN--LGDAIQPMCPCFEELLYDVPGSGGILGSPVVLIQVTRLRCGGFIFALRLNHTM  168

Query  1055  ADASGLVHFLNTIAEIARGAEAPAVQPVWQREFFSARNPPRITCTHFEYEEEPAADSMVT  876
             +   GLV FLN I+E+A+G   P++ P+WQRE  +ARNPPRITC H EYEE       + 
Sbjct  169   SGIPGLVQFLNAISEMAQGLSVPSLLPIWQRELLNARNPPRITCIHHEYEEVTNTKGTLM  228

Query  875   NIPLDNLVHRSFLFGPTEISVLRSSLPPHLRKCSTVEILTALVWRCRTIALGFHPDEEVR  696
              +  +NLVHRSF FGP EI  LR+ LP  L   +T E+LTA VWRCRTIA    PDE VR
Sbjct  229   AMDENNLVHRSFFFGPKEIRALRNRLPASLGASTTFEVLTACVWRCRTIAFAVDPDEVVR  288

Query  695   MLLLINARFKFKDTPMPSGYTGNAFAYPGAKTTAGKLRKNPLGYAVELVTSIKRCFSEEY  516
             ++  I+ R K +   +P GY GNA   P + T AG L KNPL YAV LV   K   S+EY
Sbjct  289   IICSISMRGK-RGFELPPGYYGNAVVTPASITKAGMLCKNPLEYAVRLVKKAKAEMSQEY  347

Query  515   MQSMVDLMVLKGRPPFHVAGSFIMSDLTRSKISDVDYGWGKPVFGGPAHGGAGDVPGVIT  336
             ++S+ DLMV+KGRP F   G+++++D+TR    ++D+GWGKPV+ G A   +     +I+
Sbjct  348   VKSVADLMVIKGRPSFMHPGNYMVADVTRDGSGEIDFGWGKPVYSGLARAIS-----IIS  402

Query  335   FHVPYENKKGENGTLIPICLPAFALDKFVNEL  240
             F   + N KGE G +IPICLP   +++F  E+
Sbjct  403   FCARFRNSKGEEGNVIPICLPPPVMERFEQEI  434



>ref|XP_003521736.1| PREDICTED: benzyl alcohol O-benzoyltransferase-like [Glycine 
max]
Length=464

 Score =   435 bits (1118),  Expect = 7e-145, Method: Compositional matrix adjust.
 Identities = 209/400 (52%), Positives = 276/400 (69%), Gaps = 2/400 (1%)
 Frame = -1

Query  1415  FYRNEPSMSGKDPVQVIRQALAKALVFFYPFAGRLREGPGRKLMVDCTGEGVMFIEADAD  1236
             FY N    S KDPV+VIR+AL K LVF+YPFAGRLREGPGRKLMVDC GEGV+FIEADAD
Sbjct  53    FYGNNKESSMKDPVEVIRKALTKTLVFYYPFAGRLREGPGRKLMVDCNGEGVLFIEADAD  112

Query  1235  ATLQHFAIGGELKPPFPCFDQLLYNVPGSAEILNSPLFLIQVTRLRCGGFIFTLRMNHTM  1056
              TL  F     L PPFPC ++LL++VPGS  + N PL LIQVTRL+CGGFIF LR+NH+M
Sbjct  113   VTLHQFGPSYLLHPPFPCLEELLHDVPGSRGVTNCPLLLIQVTRLKCGGFIFALRLNHSM  172

Query  1055  ADASGLVHFLNTIAEIARGAEAPAVQPVWQREFFSARNPPRITCTHFEYEEEPAADSMVT  876
             +D  G+  F+  +AEIA GA  P++ PVW RE  +ARNPPRI+ TH EYE E  A   + 
Sbjct  173   SDGFGIAKFMKALAEIACGATEPSLTPVWCRELLNARNPPRISRTHHEYEVENKAKGTMM  232

Query  875   NIPLDNLVHRSFLFGPTEISVLRSSLPPHLRKCSTVEILTALVWRCRTIALGFHPDEEVR  696
              IPL+++V R F FGP E++ LRS +P HL +C+T E++TA +WRCR  AL   P+++VR
Sbjct  233   -IPLNDVVQRCFFFGPREVASLRSLVPKHLGRCTTFEVITACMWRCRIRALQLDPEDDVR  291

Query  695   MLLLINARFKFKDTPMPSGYTGNAFAYPGAKTTAGKLRKNPLGYAVELVTSIKRCFSEEY  516
              +  IN   K  + P+P GY GN F    A TT+ +L +NP GYA+ELV + K    EEY
Sbjct  292   FIYTININAKV-NPPLPKGYYGNGFVLSAAVTTSRRLCENPFGYALELVKNAKSNVDEEY  350

Query  515   MQSMVDLMVLKGRPPFHVAGSFIMSDLTRSKISDVDYGWGKPVFGGPAHGGAGDVPGVIT  336
             ++S  DL+V+KGRP      S+++S+ TR  + +VD+GWGKP++GGPA GG    P + +
Sbjct  351   VRSTSDLIVVKGRPHQATTRSYLVSNTTRIGLDEVDFGWGKPIYGGPATGGITSFPQMTS  410

Query  335   FHVPYENKKGENGTLIPICLPAFALDKFVNELANTFLRAA  216
              +V  +N KGE+  ++PI LPA A+++F  EL      A+
Sbjct  411   VYVSCKNHKGEHVIVVPISLPAKAMERFATELEGMLRHAS  450



>ref|XP_006470741.1| PREDICTED: anthraniloyl-CoA:methanol acyltransferase-like [Citrus 
sinensis]
Length=445

 Score =   432 bits (1110),  Expect = 5e-144, Method: Compositional matrix adjust.
 Identities = 214/403 (53%), Positives = 279/403 (69%), Gaps = 12/403 (3%)
 Frame = -1

Query  1415  FYRNEPS--MSGKDPVQVIRQALAKALVFFYPFAGRLREGPGRKLMVDCTGEGVMFIEAD  1242
             FY+N+PS  M GKDPV+VIR+AL+KAL F+YP AGRL+E   RKLMVDC GEGV+F EA+
Sbjct  50    FYKNDPSPAMEGKDPVKVIREALSKALTFYYPLAGRLKEVSNRKLMVDCNGEGVLFTEAE  109

Query  1241  ADATLQHFAIGGELKPPFPCFDQLLYNVPGSAEILNSPLFLIQVTRLRCGGFIFTLRMNH  1062
             A+ TL+   +G  ++PP P   +LLYNVPGS  IL  PL LIQVTRL CGGFI  LR+NH
Sbjct  110   ANITLEQLEVGDAVRPPCPYLHELLYNVPGSEGILGCPLLLIQVTRLACGGFILALRLNH  169

Query  1061  TMADASGLVHFLNTIAEIARGAEAPAVQPVWQREFFSARNPPRITCTHFEYEEEPAADSM  882
             TM DA  L+ F+  I ++A+GA  P++ PVW+RE  S R PP+ITCTH EY+++   DS 
Sbjct  170   TMCDAFALLQFMKAIEDMAKGANEPSLLPVWERELLSPRIPPKITCTHHEYDDQ--TDST  227

Query  881   VTNIPLDNLV-HRSFLFGPTEISVLRSSLPPHLRK-CSTVEILTALVWRCRTIALGFHPD  708
             +   P D+++ H+SF FGP EI+ LR+ LP HLR  CST E+LTA +WRCRTIAL   PD
Sbjct  228   LAMNPNDHIINHKSFYFGPKEITALRNQLPQHLRDGCSTFELLTACIWRCRTIALQIDPD  287

Query  707   EEVRMLLLINARFKFKDTPMPSGYTGNAFAYPGAKTTAGKLRKNPLGYAVELVTSIKRCF  528
             E VR+   +N R    +  +P+GY GNA A P A +TAG L K  LGYAV+LV  +K   
Sbjct  288   EIVRVTCCVNIRGTKYNMMLPNGYYGNAIATPTACSTAGDLSKYSLGYAVDLVKKVKATA  347

Query  527   SEEYMQSMVDLMVLKGRPPFHVAGSFIMSDLTRSKISDVDYGWGKPVFGGPAHGGAGDVP  348
             SEEY++S++D M +KGRP   V GSF++SD+TR    ++D+GWGKPV+ GP         
Sbjct  348   SEEYVRSLIDFMEIKGRPMPAVKGSFVVSDITRGGFEEIDFGWGKPVYAGPPEAVL----  403

Query  347   GVITFHVPYENK-KGENGTLIPICLPAFALDKFVNELANTFLR  222
               ++F++ Y+NK  GE GTL+PICLP  A+ KF  EL    L+
Sbjct  404   -FMSFYIRYQNKDSGEYGTLVPICLPLRAMKKFEEELKKMTLQ  445



>ref|NP_197256.1| HXXXD-type acyl-transferase family protein [Arabidopsis thaliana]
 emb|CAC01898.1| putative protein [Arabidopsis thaliana]
 gb|ACF37204.1| At5g17540 [Arabidopsis thaliana]
 gb|AED92441.1| HXXXD-type acyl-transferase family protein [Arabidopsis thaliana]
Length=461

 Score =   431 bits (1109),  Expect = 1e-143, Method: Compositional matrix adjust.
 Identities = 214/398 (54%), Positives = 282/398 (71%), Gaps = 7/398 (2%)
 Frame = -1

Query  1415  FYRNEPSMSGKDPVQVIRQALAKALVFFYPFAGRLREGPGRKLMVDCTGEGVMFIEADAD  1236
             FYR+ P+ +  DPV VIR+ALA+ LV++YPFAGRLREGP RKL VDCTGEGV+FIEADAD
Sbjct  48    FYRHNPT-TNSDPVAVIRRALAETLVYYYPFAGRLREGPNRKLAVDCTGEGVLFIEADAD  106

Query  1235  ATLQHFAIGGELKPPFPCFDQLLYNVPGSAEILNSPLFLIQVTRLRCGGFIFTLRMNHTM  1056
              TL  F     LKPPFPCF++LL+NV GS E+LN+PL L+QVTRL+CGGFIF +R+NH M
Sbjct  107   VTLVEFEEKDALKPPFPCFEELLFNVEGSCEMLNTPLMLMQVTRLKCGGFIFAVRINHAM  166

Query  1055  ADASGLVHFLNTIAEIARGAEAPAVQPVWQREFFSARNPPRITCTHFEYEEEPAADSMVT  876
             +DA GL  FL T+ E  RG  AP V PVW+R   SAR   R+T  H EY+E PA  + + 
Sbjct  167   SDAGGLTLFLKTMCEFVRGYHAPTVAPVWERHLLSARVLLRVTHAHREYDEMPAIGTELG  226

Query  875   NIPLDNLVHRSFLFGPTEISVLRSSLPPHLRKCST-VEILTALVWRCRTIALGFHPDEEV  699
             +   DNLV RS  FGP E+S +R  LPP+L   ST +E+LT+ +WR RTIAL    D+E+
Sbjct  227   S-RRDNLVGRSLFFGPCEMSAIRRLLPPNLVNSSTNMEMLTSFLWRYRTIALRPDQDKEM  285

Query  698   RMLLLINARFKFKDTPMPSGYTGNAFAYPGAKTTAGKLRKNPLGYAVELVTSIKRCFSEE  519
             R++L++NAR K K+ P+P GY GNAFA+P A  TA +L K PL +A+ L+   K   +EE
Sbjct  286   RLILIVNARSKLKNPPLPRGYYGNAFAFPVAIATANELTKKPLEFALRLIKEAKSSVTEE  345

Query  518   YMQSMVDLMVLKGRPPFHVAGSFIMSDLTRSKISDVDYG-WGKPVFGGPAHGGAGDVPGV  342
             YM+S+ DLMV+KGRP F   G++++SD+     +D+D+G WGKPV+GG    G  D+PG 
Sbjct  346   YMRSLADLMVIKGRPSFSSDGAYLVSDV--RIFADIDFGIWGKPVYGGIGTAGVEDLPGA  403

Query  341   ITFHVPYENKKGENGTLIPICLPAFALDKFVNELANTF  228
              +F+V +E + GE G ++P+CLP  A+ +FV EL   F
Sbjct  404   -SFYVSFEKRNGEIGIVVPVCLPEKAMQRFVEELEGVF  440



>ref|XP_006470749.1| PREDICTED: anthraniloyl-CoA:methanol acyltransferase-like [Citrus 
sinensis]
Length=445

 Score =   430 bits (1105),  Expect = 3e-143, Method: Compositional matrix adjust.
 Identities = 212/403 (53%), Positives = 279/403 (69%), Gaps = 12/403 (3%)
 Frame = -1

Query  1415  FYRNEPS--MSGKDPVQVIRQALAKALVFFYPFAGRLREGPGRKLMVDCTGEGVMFIEAD  1242
             FY+N+PS  M GKDPV+VIR+AL+KAL F+YP AGRL+E   RKLMVDC GEGV+F EA+
Sbjct  50    FYKNDPSPAMEGKDPVKVIREALSKALTFYYPLAGRLKEVSNRKLMVDCNGEGVLFTEAE  109

Query  1241  ADATLQHFAIGGELKPPFPCFDQLLYNVPGSAEILNSPLFLIQVTRLRCGGFIFTLRMNH  1062
             A+ TL+   +G  ++PP P   +LLYNVPGS  IL  PL LIQVTRL CGGFI  LR+NH
Sbjct  110   ANITLEQLEVGDAVRPPCPYLHELLYNVPGSEGILGCPLLLIQVTRLACGGFILALRLNH  169

Query  1061  TMADASGLVHFLNTIAEIARGAEAPAVQPVWQREFFSARNPPRITCTHFEYEEEPAADSM  882
             TM DA  L+ F+  I ++A+GA  P++ PVW+RE  S R PP+ITCTH EY+++   DS 
Sbjct  170   TMCDAFALLQFMKAIEDMAKGANEPSLLPVWERELLSPRIPPKITCTHHEYDDQ--TDST  227

Query  881   VTNIPLDNLV-HRSFLFGPTEISVLRSSLPPHLRK-CSTVEILTALVWRCRTIALGFHPD  708
             +   P D+++ H+SF FGP EI+ LR+ LP HLR  CST E+LTA +WRCRT+AL   PD
Sbjct  228   LAMNPNDHIINHKSFYFGPKEITALRNQLPQHLRDGCSTFELLTACIWRCRTMALQIDPD  287

Query  707   EEVRMLLLINARFKFKDTPMPSGYTGNAFAYPGAKTTAGKLRKNPLGYAVELVTSIKRCF  528
             E VR+   +N R    +  +P+GY GNA A P A +TAG L K  L YAV+LV  +K   
Sbjct  288   EIVRVTCCVNIRGTKYNMMLPNGYYGNAIATPTACSTAGDLSKYSLAYAVDLVKKVKATA  347

Query  527   SEEYMQSMVDLMVLKGRPPFHVAGSFIMSDLTRSKISDVDYGWGKPVFGGPAHGGAGDVP  348
             SEEY++S++D M ++GRP   V GSF++SD+TR    +VD+GWGKPV+ GP         
Sbjct  348   SEEYVRSLIDFMEIRGRPMPAVKGSFVVSDITRGGFEEVDFGWGKPVYAGPPEAVL----  403

Query  347   GVITFHVPYENK-KGENGTLIPICLPAFALDKFVNELANTFLR  222
               ++F++ Y+NK  GE GTL+PICLP  A++KF  EL    L+
Sbjct  404   -FMSFYIKYQNKDSGEYGTLVPICLPLRAMEKFEEELKKMTLQ  445



>gb|KHN04051.1| Benzyl alcohol O-benzoyltransferase [Glycine soja]
Length=403

 Score =   428 bits (1101),  Expect = 3e-143, Method: Compositional matrix adjust.
 Identities = 205/390 (53%), Positives = 272/390 (70%), Gaps = 2/390 (1%)
 Frame = -1

Query  1385  KDPVQVIRQALAKALVFFYPFAGRLREGPGRKLMVDCTGEGVMFIEADADATLQHFAIGG  1206
             KDPV+VIR+AL K LVF+YPFAGRLREGPGRKLMVDC GEGV+FIEADAD TL  F    
Sbjct  2     KDPVEVIRKALTKTLVFYYPFAGRLREGPGRKLMVDCNGEGVLFIEADADVTLHQFGPSY  61

Query  1205  ELKPPFPCFDQLLYNVPGSAEILNSPLFLIQVTRLRCGGFIFTLRMNHTMADASGLVHFL  1026
              L PPFPC ++LL++VPGS  + N PL LIQVTRL+CGGFIF LR+NH+M+D  G+  F+
Sbjct  62    LLHPPFPCLEELLHDVPGSRGVTNCPLLLIQVTRLKCGGFIFALRLNHSMSDGFGIAKFM  121

Query  1025  NTIAEIARGAEAPAVQPVWQREFFSARNPPRITCTHFEYEEEPAADSMVTNIPLDNLVHR  846
               +AEIA GA  P++ PVW RE  +ARNPPRI+ TH EYE E  A   +  IPL+++V R
Sbjct  122   KALAEIACGATEPSLTPVWCRELLNARNPPRISRTHHEYEVENKAKGTMM-IPLNDVVQR  180

Query  845   SFLFGPTEISVLRSSLPPHLRKCSTVEILTALVWRCRTIALGFHPDEEVRMLLLINARFK  666
              F FGP E++ LRS +P HL +C+T E++TA +WRCR  AL   P+++VR +  IN   K
Sbjct  181   CFFFGPREVASLRSLVPKHLGRCTTFEVITACMWRCRIRALQLDPEDDVRFIYTININAK  240

Query  665   FKDTPMPSGYTGNAFAYPGAKTTAGKLRKNPLGYAVELVTSIKRCFSEEYMQSMVDLMVL  486
               + P+P GY GN F    A TT+ +L +NP GYA+ELV + K    EEY++S  DL+V+
Sbjct  241   V-NPPLPKGYYGNGFVLSAAVTTSRRLCENPFGYALELVKNAKSNVDEEYVRSTSDLIVV  299

Query  485   KGRPPFHVAGSFIMSDLTRSKISDVDYGWGKPVFGGPAHGGAGDVPGVITFHVPYENKKG  306
             KGRP      S+++S+ TR  + +VD+GWGKP++GGPA GG    P + + +V  +N KG
Sbjct  300   KGRPHQATTRSYLVSNTTRIGLDEVDFGWGKPIYGGPATGGMTSFPQMTSVYVSCKNHKG  359

Query  305   ENGTLIPICLPAFALDKFVNELANTFLRAA  216
             E+  ++PI LPA A+++F  EL      A+
Sbjct  360   EHVIVVPISLPAKAMERFATELEGMLRHAS  389



>gb|AFK34239.1| unknown [Medicago truncatula]
Length=445

 Score =   430 bits (1105),  Expect = 3e-143, Method: Compositional matrix adjust.
 Identities = 208/393 (53%), Positives = 277/393 (70%), Gaps = 5/393 (1%)
 Frame = -1

Query  1415  FYRNEPSMSGKDPVQVIRQALAKALVFFYPFAGRLREGPGRKLMVDCTGEGVMFIEADAD  1236
              YR+EPSM  KDPV+V+R AL++ALV++YPFAGR+REG GRKLMVDCTGEGVMF+EA+AD
Sbjct  49    IYRHEPSMKEKDPVKVLRHALSQALVYYYPFAGRIREGAGRKLMVDCTGEGVMFVEAEAD  108

Query  1235  ATLQHFAIGGELKPPFPCFDQLLYNVPGSAEILNSPLFLIQVTRLRCGGFIFTLRMNHTM  1056
              TL  F  G  L PP PCF++LLY+VPGS  I++ P+ LIQVTRL+CG FI  + +NHTM
Sbjct  109   VTLDEF--GDALHPPLPCFEELLYDVPGSELIIDRPIRLIQVTRLKCGSFILVVYLNHTM  166

Query  1055  ADASGLVHFLNTIAEIARGAEAPAVQPVWQREFFSARNPPRITCTHFEYEEEPAADSMVT  876
             +D +GL  F+N  AE+ARGA  P++QPVW RE   AR+PP ITC H EYE+  ++++ + 
Sbjct  167   SDGAGLKLFMNAWAEMARGAHKPSIQPVWNREILMARDPPHITCNHHEYEQIFSSNT-IK  225

Query  875   NIPLDNLVHRSFLFGPTEISVLRSSLPPHLRKCSTVEILTALVWRCRTIALGFHPDEEVR  696
                   LVH+SF F  ++I VLR  +P HLR C+T +++T+  W CRT AL    D+E+R
Sbjct  226   EEDTTTLVHQSFFFRTSDIVVLRLLVPFHLRHCTTFDLITSCFWCCRTKALQLEADDEIR  285

Query  695   MLLLINARFKFKDTPMP-SGYTGNAFAYPGAKTTAGKLRKNPLGYAVELVTSIKRCFSEE  519
             M+ ++NAR +F     P  GY GN FAYP A TTAGKL  N LGYAVELV  +K   +EE
Sbjct  286   MMCIVNARSRFNANNSPLVGYYGNCFAYPAAVTTAGKLCGNSLGYAVELVRKLKAEVTEE  345

Query  518   YMQSMVDLMVLKGRPPFHVAGSFIMSDLTRSKISDVDYGWGKPVFGGPAHGGAGDVPGVI  339
             YM S+ DLMV+K R  F    S ++SD+TR K+ +VD+GWG+ V+GG A  GAG  PG  
Sbjct  346   YMHSVADLMVIKERCLFTTIRSCVVSDVTRIKLREVDFGWGEAVYGGAAKSGAGPFPGA-  404

Query  338   TFHVPYENKKGENGTLIPICLPAFALDKFVNEL  240
              + +P++N +GE G ++ +CL   A+ +F  EL
Sbjct  405   AYIIPHKNVEGEEGFILLVCLSFEAMKRFAKEL  437



>ref|XP_011085897.1| PREDICTED: benzyl alcohol O-benzoyltransferase-like [Sesamum 
indicum]
Length=465

 Score =   430 bits (1105),  Expect = 8e-143, Method: Compositional matrix adjust.
 Identities = 212/395 (54%), Positives = 278/395 (70%), Gaps = 8/395 (2%)
 Frame = -1

Query  1415  FYRNEPSMSGKDPVQVIRQALAKALVFFYPFAGRLREGPGRKLMVDCTGEGVMFIEADAD  1236
             F+   P+M  KDPV+V R ALAKALVF+YP AGRLRE  GRKL+V+CTGEG +FIEADAD
Sbjct  50    FFPKNPAMDIKDPVKVFRDALAKALVFYYPLAGRLRETAGRKLVVECTGEGALFIEADAD  109

Query  1235  ATLQHFAIGGELKPPFPCFDQLLYNVPGSAEILNSPLFLIQVTRLRCGGFIFTLRMNHTM  1056
               LQ F  G  L+PPFPC ++LLY+VPGS  ++N PL LIQ TRL+CGGFI  LR+NHTM
Sbjct  110   VRLQQF--GDTLQPPFPCLEELLYDVPGSGGVVNCPLLLIQATRLKCGGFILALRVNHTM  167

Query  1055  ADASGLVHFLNTIAEIARGAEAPAVQPVWQREFFSARNPPRITCTHFEYEEEPAADSMVT  876
              D  GL+ F +T+AE+ARGAE P+V PVWQR   SAR+PP ++  H EYE  P  D+  T
Sbjct  168   CDGFGLILFASTMAELARGAEIPSVLPVWQRHLLSARDPPHVSYMHDEYENIP--DTQGT  225

Query  875   NIPLDNLVHRSFLFGPTEISVLRSSLPPHL--RKCSTVEILTALVWRCRTIALGFHPDEE  702
              IP +N+V RSF FGP EIS LR   PP +   +C+T E+L A +WRCRTIA+   P+EE
Sbjct  226   LIPFENMVERSFFFGPGEISALRHQSPPFVTSSRCTTFELLAAYIWRCRTIAISPDPNEE  285

Query  701   VRMLLLINARFKFKDTPMPSGYTGNAFAYPGAKTTAGKLRKNPLGYAVELVTSIKRCFSE  522
             VR+L  +N R K  + P+P+GY GN  A P A +TAG L K PL +A+ELV   K   +E
Sbjct  286   VRILCFVNGR-KLFNPPLPAGYYGNVVATPLAISTAGNLCKQPLDFALELVMKAKSKVTE  344

Query  521   EYMQSMVDLMVLKGRPPFHV-AGSFIMSDLTRSKISDVDYGWGKPVFGGPAHGGAGDVPG  345
             +Y++S+ DLMV++GRP F     ++++SD+      +++ G G PVF GPA  G G +PG
Sbjct  345   DYIKSVADLMVIRGRPHFAFDMRTYVVSDVAYLGSENLEIGGGSPVFCGPAKAGVGVIPG  404

Query  344   VITFHVPYENKKGENGTLIPICLPAFALDKFVNEL  240
             + + ++P++N KGE G L+PICLPA A++ FV EL
Sbjct  405   LGSLNIPFKNNKGEKGKLVPICLPANAMEVFVKEL  439



>ref|XP_003626383.1| Benzoyl coenzyme A benzyl alcohol benzoyl transferase [Medicago 
truncatula]
Length=510

 Score =   431 bits (1108),  Expect = 8e-143, Method: Compositional matrix adjust.
 Identities = 209/397 (53%), Positives = 278/397 (70%), Gaps = 5/397 (1%)
 Frame = -1

Query  1415  FYRNEPSMSGKDPVQVIRQALAKALVFFYPFAGRLREGPGRKLMVDCTGEGVMFIEADAD  1236
              YR+EPSM  KDPV+V+R AL++ALV++YPFAGR+REG GRKLMVDCTGEGVMF+EA+AD
Sbjct  49    IYRHEPSMKEKDPVKVLRHALSQALVYYYPFAGRIREGAGRKLMVDCTGEGVMFVEAEAD  108

Query  1235  ATLQHFAIGGELKPPFPCFDQLLYNVPGSAEILNSPLFLIQVTRLRCGGFIFTLRMNHTM  1056
              TL  F  G  L PP PCF++LLY+VPGS  I++ P+ LIQVTRL+CG FI  + +NHTM
Sbjct  109   VTLDEF--GDALHPPLPCFEELLYDVPGSELIIDRPIRLIQVTRLKCGSFILVVYLNHTM  166

Query  1055  ADASGLVHFLNTIAEIARGAEAPAVQPVWQREFFSARNPPRITCTHFEYEEEPAADSMVT  876
             +D +GL  F+N  AE+ARGA  P++QPVW RE   AR+PP ITC H EYE+  ++++ + 
Sbjct  167   SDGAGLKLFMNAWAEMARGAHKPSIQPVWNREILMARDPPHITCNHHEYEQIFSSNT-IK  225

Query  875   NIPLDNLVHRSFLFGPTEISVLRSSLPPHLRKCSTVEILTALVWRCRTIALGFHPDEEVR  696
                   LVH+SF F  ++I VLR  +P HLR C+T +++T+  W CRT AL    D+E+R
Sbjct  226   EEDTTTLVHQSFFFRTSDIVVLRLLVPFHLRHCTTFDLITSCFWCCRTKALQLEADDEIR  285

Query  695   MLLLINARFKFKDTPMP-SGYTGNAFAYPGAKTTAGKLRKNPLGYAVELVTSIKRCFSEE  519
             M+ ++NAR +F     P  GY GN FAYP A TTAGKL  N LGYAVELV  +K   +EE
Sbjct  286   MMCIVNARSRFNANNSPLVGYYGNCFAYPAAVTTAGKLCGNSLGYAVELVRKLKAEVTEE  345

Query  518   YMQSMVDLMVLKGRPPFHVAGSFIMSDLTRSKISDVDYGWGKPVFGGPAHGGAGDVPGVI  339
             YM S+ DLMV+K R  F    S ++SD+TR K+ +VD+GWG+ V+GG A  GAG  PG  
Sbjct  346   YMHSVADLMVIKERCLFTTIRSCVVSDVTRIKLREVDFGWGEAVYGGAAKSGAGPFPGA-  404

Query  338   TFHVPYENKKGENGTLIPICLPAFALDKFVNELANTF  228
              + +P++N +GE G ++ +CL   A+ +F  EL   F
Sbjct  405   AYIIPHKNVEGEEGFILLVCLSFEAMKRFAKELDEIF  441



>ref|XP_007147132.1| hypothetical protein PHAVU_006G098400g [Phaseolus vulgaris]
 gb|ESW19126.1| hypothetical protein PHAVU_006G098400g [Phaseolus vulgaris]
Length=485

 Score =   430 bits (1105),  Expect = 1e-142, Method: Compositional matrix adjust.
 Identities = 214/398 (54%), Positives = 278/398 (70%), Gaps = 10/398 (3%)
 Frame = -1

Query  1412  YRNEPSMSGKDPVQVIRQALAKALVFFYPFAGRLREGPGRKLMVDCTGEGVMFIEADADA  1233
             Y  + SM+ KDPV+VIRQAL++ LVF+YPFAGRLREGP RKLMVDCTGEG MFIEADAD 
Sbjct  96    YGKQESMAEKDPVEVIRQALSQTLVFYYPFAGRLREGPQRKLMVDCTGEGAMFIEADADV  155

Query  1232  TLQHFAIGGELKPPFPCFDQLLYNVPGSAEILNSPLFLIQVTRLRCGGFIFTLRMNHTMA  1053
             TL  F  G  L+PPFPCF +L+Y+VP S +I  +PL L+QVTRL+CGGFI  LR +HTMA
Sbjct  156   TLAEF--GDSLQPPFPCFHELMYDVPCSQQITETPLLLVQVTRLKCGGFILALRFSHTMA  213

Query  1052  DASGLVHFLNTIAEIARGAEAPAVQPVWQREFFSARNPPRITCTHFEYEEEPAADSMVTN  873
             D  G   F+N   E+ARGA  P++ PVW+RE   AR+PPRIT  H EYE+    D++ ++
Sbjct  214   DGFGYQQFMNAWVEMARGATKPSIAPVWRRELLMARDPPRITRNHPEYEQ--IQDTLPSS  271

Query  872   IPLDNLVHRSFLFGPTEISVLRSSLPPHLRKCSTVEILTALVWRCRTIALGFHPDEEVRM  693
                 NL+ RSF FG  +I+ LR S+P HL+ CST +++TA +WRCRT A+    +E+VRM
Sbjct  272   N--HNLIQRSFFFGRLDIAALRKSIPQHLQHCSTFDLITACLWRCRTKAMQIEANEDVRM  329

Query  692   LLLINARFKFKDTPMPSGYTGNAFAYPGAKTTAGKLRKNPLGYAVELVTSIKRCFSEEYM  513
             + ++NAR +F + P+P GY GNAFAYP A T+AGKL +NP GYAVEL+  +K    EEY+
Sbjct  330   MCIVNARGRF-NPPLPVGYYGNAFAYPAAVTSAGKLCQNPFGYAVELINKVKGEMKEEYL  388

Query  512   QSMVDLMVLKGRP-PFHVAGSFIMSDLTRSKISDVDYGWGKPVFGGPAHGGAGDVPGVIT  336
             QS+ DLMV+K R   F    S I+S L + K   +D+GWG+ V+GG A  GAG  PG  +
Sbjct  389   QSVADLMVMKERSLLFTTVRSCIVSYLVQVKFRAMDFGWGEAVYGGVAEAGAGSFPGA-S  447

Query  335   FHVPYENKKGENGTLIPICLPAFALDKFVNELANTFLR  222
             +    +N KGE G + PI LPA A+++F  E  N  LR
Sbjct  448   YFCSAKNGKGEEGIIFPISLPAEAMERFTKEF-NHMLR  484



>ref|XP_006446267.1| hypothetical protein CICLE_v10015194mg [Citrus clementina]
 gb|ESR59507.1| hypothetical protein CICLE_v10015194mg [Citrus clementina]
Length=456

 Score =   427 bits (1097),  Expect = 7e-142, Method: Compositional matrix adjust.
 Identities = 211/406 (52%), Positives = 280/406 (69%), Gaps = 19/406 (5%)
 Frame = -1

Query  1415  FYRNEPS--MSGKDPVQVIRQALAKALVFFYPFAGRLREGPGRKLMVDCTGEGVMFIEAD  1242
             FY+N+PS  M G+DPV+VIR+A++KALVF+YP AGRL+EG  R+LMV+C  EGV+FIEAD
Sbjct  50    FYKNDPSPSMQGRDPVKVIREAISKALVFYYPLAGRLKEGYNRRLMVECNAEGVLFIEAD  109

Query  1241  ADATLQHFAIGGELKPPFPCFDQLLYNVPGSAEILNSPLFLIQVTRLRCGGFIFTLRMNH  1062
             A+ TL+   +G +++PP P  +QLLY+VPGS  IL  PLFLIQVTRL CGGFIF LRMNH
Sbjct  110   ANFTLEQ--LGDDIQPPCPYLNQLLYDVPGSEGILGCPLFLIQVTRLTCGGFIFALRMNH  167

Query  1061  TMADASGLVHFLNTIAEIARGAEAPAVQPVWQREFFSARNPPRITCTHFEYEEEPAADSM  882
             TM D SGLV FL  I ++ RG  +P + P+WQR   +ARNPPR+TC H EY+E       
Sbjct  168   TMCDGSGLVQFLKGIEDMVRGKCSPTLFPIWQRHILNARNPPRVTCIHHEYDE-------  220

Query  881   VTN--IPLDNLVHRSFLFGPTEISVLRSSLPPHLRKCSTVEILTALVWRCRTIALGFHPD  708
             + N  +P DN+ H+SF FG  E   LR+ LP HL+ CST ++LTA +W+CRTIAL   P+
Sbjct  221   INNNEVPSDNMAHKSFYFGAKETKALRNQLPFHLKDCSTFDLLTAFIWKCRTIALKLEPE  280

Query  707   EEVRMLLLINARFKFKDTPMPSGYTGNAFAYPGAKTTAGKLRKNPLGYAVELVTSIKRCF  528
             E  R+  +INAR K   T +PSGY GNAFA+P   + A  L KNP+GYAVELV   K   
Sbjct  281   EIARVSCIINARGKRYKTDIPSGYYGNAFAFPAVCSKAEHLCKNPIGYAVELVKKAKAQM  340

Query  527   SEEYMQSMVDLMVLKGRP-PFHVAGSFIMSDLTRSKISDVDYGWGKPVFGGPAHGGAGDV  351
             ++EY++S+ DLMV+KGR   F   G+FI+SDL+     +VD GWGKP++ G A  GA + 
Sbjct  341   NDEYIRSVADLMVIKGRRIKFPTRGNFIVSDLSNLGFGEVDLGWGKPIYAGTA--GAVE-  397

Query  350   PGVITFHVPYENKKGENGTLIPICLPAFALDKFVNELANTFLRAAL  213
               +I+F V ++NK GE G  +PICLP   +++F  E     ++  +
Sbjct  398   --LISFFVKHQNKNGEPGIFVPICLPQSVMERFQEEQRRMMIQGTM  441



>ref|XP_006446260.1| hypothetical protein CICLE_v10015249mg [Citrus clementina]
 gb|ESR59500.1| hypothetical protein CICLE_v10015249mg [Citrus clementina]
Length=445

 Score =   426 bits (1096),  Expect = 8e-142, Method: Compositional matrix adjust.
 Identities = 210/403 (52%), Positives = 276/403 (68%), Gaps = 12/403 (3%)
 Frame = -1

Query  1415  FYRNEPS--MSGKDPVQVIRQALAKALVFFYPFAGRLREGPGRKLMVDCTGEGVMFIEAD  1242
             FY+N+PS  M GKDPV+VIR+AL+KAL F+YP AGRL+E   RKLMVDC GEGV+F EA+
Sbjct  50    FYKNDPSPAMEGKDPVKVIREALSKALTFYYPLAGRLKEVSNRKLMVDCNGEGVLFTEAE  109

Query  1241  ADATLQHFAIGGELKPPFPCFDQLLYNVPGSAEILNSPLFLIQVTRLRCGGFIFTLRMNH  1062
              + TL+   +G  ++PP P   +LLYNVPGS  IL  PL LIQVTRL CGGFI  LR+NH
Sbjct  110   GNITLEQLEVGDAVRPPCPYLHELLYNVPGSDGILGCPLLLIQVTRLACGGFILALRLNH  169

Query  1061  TMADASGLVHFLNTIAEIARGAEAPAVQPVWQREFFSARNPPRITCTHFEYEEEPAADSM  882
             TM DA  L+ F+  I ++A+GA  P++ PVW+RE  S R PP+ITC H EY+++   DS 
Sbjct  170   TMCDAFALLQFMKAIEDMAKGANEPSLLPVWERELLSPRIPPKITCAHHEYDDQ--TDST  227

Query  881   VTNIPLDNLV-HRSFLFGPTEISVLRSSLPPHLRK-CSTVEILTALVWRCRTIALGFHPD  708
             +   P D+++ H+SF FGP EI+ LR+ LP HLR  CST E+LTA +WRCRTIAL   PD
Sbjct  228   LAMNPNDHIIKHKSFYFGPKEITALRNQLPQHLRDGCSTFELLTACIWRCRTIALQIDPD  287

Query  707   EEVRMLLLINARFKFKDTPMPSGYTGNAFAYPGAKTTAGKLRKNPLGYAVELVTSIKRCF  528
             E VR+   +N R    +  +P+GY GNA A P A +TAG L K  LGYA++LV  +K   
Sbjct  288   EIVRVTCCVNIRGTKYNMKLPNGYYGNAIATPTACSTAGDLSKYSLGYALDLVKKVKATA  347

Query  527   SEEYMQSMVDLMVLKGRPPFHVAGSFIMSDLTRSKISDVDYGWGKPVFGGPAHGGAGDVP  348
             SEEY++S++D M +KGRP   V GSF++SD+TR    ++D+GWGKPV+ GP         
Sbjct  348   SEEYVRSLIDFMEIKGRPMPAVKGSFVVSDITRGGFEEIDFGWGKPVYAGPPEAVL----  403

Query  347   GVITFHVPYENK-KGENGTLIPICLPAFALDKFVNELANTFLR  222
               ++F++ Y+N   GE GTL+PICLP  A+ KF  EL    L+
Sbjct  404   -FMSFYIKYQNNDSGEYGTLVPICLPLRAMKKFEEELKKMTLQ  445



>ref|XP_010941428.1| PREDICTED: benzyl alcohol O-benzoyltransferase-like, partial 
[Elaeis guineensis]
Length=414

 Score =   425 bits (1092),  Expect = 1e-141, Method: Compositional matrix adjust.
 Identities = 204/371 (55%), Positives = 269/371 (73%), Gaps = 5/371 (1%)
 Frame = -1

Query  1415  FYRNEPSMSGKDPVQVIRQALAKALVFFYPFAGRLREGPGRKLMVDCTGEGVMFIEADAD  1236
             FY N+PS  G+DP +VI++AL K LV +YP AGRLRE PGRKL+V+CTGEGV+F+EADAD
Sbjct  48    FYCNDPSKEGRDPARVIKEALGKVLVHYYPIAGRLREWPGRKLVVECTGEGVVFVEADAD  107

Query  1235  ATLQHFAIGGELKPPFPCFDQLLYNVPGSAEILNSPLFLIQVTRLRCGGFIFTLRMNHTM  1056
               L+ F  G    PPFPC ++LLY+      +L+ PL  +QVTRL+CGGFIF LR+NHT+
Sbjct  108   VRLEEF--GDAPSPPFPCVEKLLYDADSLGSVLDCPLLFVQVTRLKCGGFIFGLRINHTI  165

Query  1055  ADASGLVHFLNTIAEIARGAEAPAVQPVWQREFFSARNPPRITCTHFEYEEEPAADSMVT  876
              DA G+V FL  + E+ARGA AP V PVW+RE  +AR PPRIT  H EYE   A D M T
Sbjct  166   MDAPGVVQFLTALGEMARGAAAPTVPPVWERELLTARFPPRITHVHPEYEFSAATDVM-T  224

Query  875   NIPLDNLVHRSFLFGPTEISVLRSSLPPHLRKCST-VEILTALVWRCRTIALGFHPDEEV  699
              +P  ++V+RSF FGP EIS LR   PPHLR  S+  E++TA VWR RT ALG+ PD+EV
Sbjct  225   TVPRSDMVNRSFFFGPKEISALRKYAPPHLRPTSSRFELITASVWRSRTAALGYDPDDEV  284

Query  698   RMLLLINARFKFKDTPMPSGYTGNAFAYPGAKTTAGKLRKNPLGYAVELVTSIKRCFSEE  519
             R+L ++NAR + +  P+PSGY GNA A+P A + AG+L ++PLGYA+E+V   K   ++E
Sbjct  285   RVLFVVNARGR-RSPPLPSGYYGNALAFPVASSAAGRLMRSPLGYALEVVKKAKASVTDE  343

Query  518   YMQSMVDLMVLKGRPPFHVAGSFIMSDLTRSKISDVDYGWGKPVFGGPAHGGAGDVPGVI  339
             YMQS+ DLMV++GRP F +A ++++SD+TR+    VD+GWG+ V+GGPA  G G VPGV 
Sbjct  344   YMQSVADLMVVRGRPHFAMARTYLVSDVTRAGFEAVDFGWGEGVYGGPASAGVGAVPGVA  403

Query  338   TFHVPYENKKG  306
             +F+  + N KG
Sbjct  404   SFYTWHRNDKG  414



>ref|XP_002524018.1| 3'-N-debenzoyl-2'-deoxytaxol N-benzoyltransferase, putative [Ricinus 
communis]
 gb|EEF38386.1| 3'-N-debenzoyl-2'-deoxytaxol N-benzoyltransferase, putative [Ricinus 
communis]
Length=455

 Score =   425 bits (1092),  Expect = 4e-141, Method: Compositional matrix adjust.
 Identities = 209/392 (53%), Positives = 277/392 (71%), Gaps = 9/392 (2%)
 Frame = -1

Query  1415  FYRNEPSMSGKDPVQVIRQALAKALVFFYPFAGRLREGPGRKLMVDCTGEGVMFIEADAD  1236
              Y+++PSM GKDPV+VI++ALAKALVF+YPFAGRLRE P RKL+V+CT EGV+FIEADAD
Sbjct  51    IYKHDPSMQGKDPVKVIKEALAKALVFYYPFAGRLREWPNRKLVVECTSEGVLFIEADAD  110

Query  1235  ATLQHFAIGGELKPPFPCFDQLLYNVPGSAEILNSPLFLIQVTRLRCGGFIFTLRMNHTM  1056
              TL+      +     P  D+LL++VPGS+ ++N PL LIQVTR +CGGFIFTLR+NHTM
Sbjct  111   VTLEQCRDALQPP--LPLLDELLFDVPGSSGVINCPLLLIQVTRFKCGGFIFTLRLNHTM  168

Query  1055  ADASGLVHFLNTIAEIARGAEAPAVQPVWQREFFSARNPPRITCTHFEYEEEPAADSMVT  876
             +D  GLV F+  + E+ARG + P++ PVW+R+   ARNPP  TCTH EY E    +  V 
Sbjct  169   SDGFGLVQFMTAVGEMARGKQTPSIFPVWERQVLDARNPPITTCTHPEYNEN---NRTVV  225

Query  875   NIPLDNLVHRSFLFGPTEISVLRSSLPPHLRKCSTVEILTALVWRCRTIALGFHPDEEVR  696
               PLD+L   +F FGPTEIS LR      L +CST EILTA +W+CRTIAL  +P +E+R
Sbjct  226   PFPLDDLAEEAFFFGPTEISALRRHASSRLCRCSTFEILTACLWKCRTIALQPNPTQEIR  285

Query  695   MLLLINARFKFKDTPMPSGYTGNAFAYPGAKTTAGKLRKNPLGYAVELVTSIKRCFSEEY  516
             M+ L NAR KF    +P GY GN F    A TTAG+L K P+ YA+EL+   K   + EY
Sbjct  286   MICLTNARDKFDPPLIPKGYYGNGFVLSTAVTTAGELLKEPMNYAIELIKRTKANMTREY  345

Query  515   MQSMVDLMVLKGRPPFHVAGSFIMSDLTRSKISDVDYGWGKPVFGGPAHGGAGDVPGVIT  336
             +QS+ D +V+KGRP F + G++I+SD+  +K ++VD+GWG+  +GGP       +P + +
Sbjct  346   VQSVADTLVIKGRPVFPLEGTYIISDVRHAKFTEVDFGWGRAKYGGPVKA----IPMLSS  401

Query  335   FHVPYENKKGENGTLIPICLPAFALDKFVNEL  240
             F VP+ENKKGENG ++PICLPA A+ +F  EL
Sbjct  402   FCVPFENKKGENGFILPICLPAQAMKRFAKEL  433



>ref|XP_006470571.1| PREDICTED: anthraniloyl-CoA:methanol acyltransferase-like [Citrus 
sinensis]
Length=456

 Score =   425 bits (1092),  Expect = 4e-141, Method: Compositional matrix adjust.
 Identities = 209/406 (51%), Positives = 280/406 (69%), Gaps = 19/406 (5%)
 Frame = -1

Query  1415  FYRNEPS--MSGKDPVQVIRQALAKALVFFYPFAGRLREGPGRKLMVDCTGEGVMFIEAD  1242
             FY+N+PS  M G+DPV+VIR+A++KALVF+YP AGRL+EG  RKLMV+C  EGV+FIEAD
Sbjct  50    FYKNDPSPSMQGRDPVKVIREAISKALVFYYPLAGRLKEGYNRKLMVECNAEGVLFIEAD  109

Query  1241  ADATLQHFAIGGELKPPFPCFDQLLYNVPGSAEILNSPLFLIQVTRLRCGGFIFTLRMNH  1062
             A+ TL+   +G +++PP P  +QLLY+VPGS  IL  PLFLIQ+TRL CGGFIF LRMNH
Sbjct  110   ANFTLEQ--LGDDIQPPCPYLNQLLYDVPGSEGILGCPLFLIQMTRLTCGGFIFALRMNH  167

Query  1061  TMADASGLVHFLNTIAEIARGAEAPAVQPVWQREFFSARNPPRITCTHFEYEEEPAADSM  882
             TM D  GLV FL  I ++ RG  +P + P+WQR   +ARNPPR+TC H EY+E       
Sbjct  168   TMCDGFGLVQFLKAIEDMVRGKCSPTLFPIWQRHILNARNPPRVTCIHHEYDE-------  220

Query  881   VTN--IPLDNLVHRSFLFGPTEISVLRSSLPPHLRKCSTVEILTALVWRCRTIALGFHPD  708
             + N  +P DN+ H+SF FG  E   LR+ LP HL+ CST ++LTA +W+CRTIAL   P+
Sbjct  221   INNNEVPSDNMAHKSFYFGAKETKALRNQLPFHLKDCSTFDLLTAFIWKCRTIALKLEPE  280

Query  707   EEVRMLLLINARFKFKDTPMPSGYTGNAFAYPGAKTTAGKLRKNPLGYAVELVTSIKRCF  528
             E  ++  +IN R K   T +PSGY GNAFA+P   + A +L KNP+GYAVELV   K   
Sbjct  281   EIAQVSCIINVRGKRYKTDIPSGYYGNAFAFPAVCSKAEQLCKNPIGYAVELVKKAKAQM  340

Query  527   SEEYMQSMVDLMVLKGRP-PFHVAGSFIMSDLTRSKISDVDYGWGKPVFGGPAHGGAGDV  351
             ++EY++S+ DLMV+KGR   F   G+FI+SDL+     +VD GWGKP++ G A  GA + 
Sbjct  341   NDEYIRSVADLMVIKGRRIKFPTRGNFIVSDLSNLGFGEVDLGWGKPIYAGTA--GAVE-  397

Query  350   PGVITFHVPYENKKGENGTLIPICLPAFALDKFVNELANTFLRAAL  213
               +I+F V ++NK GE G  +PICLP   +++F  EL    ++  +
Sbjct  398   --LISFFVKHQNKNGEPGNFVPICLPQSVMERFQEELRRMMIQGTM  441



>ref|XP_003626386.1| Alcohol acetyltransferase [Medicago truncatula]
 gb|AES82604.1| benzyl alcohol O-benzoyltransferase [Medicago truncatula]
Length=462

 Score =   424 bits (1091),  Expect = 9e-141, Method: Compositional matrix adjust.
 Identities = 205/398 (52%), Positives = 276/398 (69%), Gaps = 5/398 (1%)
 Frame = -1

Query  1415  FYRNEPSMSGKDPVQVIRQALAKALVFFYPFAGRLREGPGRKLMVDCTG-EGVMFIEADA  1239
              YR+EPSM  KDPV+V++ AL+K LV++YP AGR+REG   KLMVDCTG EGVMFIEA+A
Sbjct  50    IYRHEPSMVKKDPVKVLKCALSKTLVYYYPLAGRIREGARDKLMVDCTGGEGVMFIEAEA  109

Query  1238  DATLQHFAIGGELKPPFPCFDQLLYNVPGSAEILNSPLFLIQVTRLRCGGFIFTLRMNHT  1059
             D TL  F  G  L PPFPCF +L+Y+VP + +I++ P+ LIQ+TRL+CGGFI  +  NH 
Sbjct  110   DVTLNEF--GDALHPPFPCFQELIYDVPSTKQIIDHPILLIQITRLKCGGFIVGVNWNHA  167

Query  1058  MADASGLVHFLNTIAEIARGAEAPAVQPVWQREFFSARNPPRITCTHFEYEEEPAADSMV  879
             + DA+GL  F+N  AE+ARGA  P++QPVW+RE   AR+PPRITC H EYE+   ++   
Sbjct  168   IGDATGLKQFMNVWAEMARGAHQPSIQPVWRREILMARDPPRITCNHREYEQILTSNINK  227

Query  878   TNIPLDNLVHRSFLFGPTEISVLRSSLPPHLRKCSTVEILTALVWRCRTIALGFHPDEEV  699
                    +VH+SF F  + I+ +R  +P HLR+CST +++TA  W CRT AL   PDEEV
Sbjct  228   EEDAATTIVHQSFFFTLSHIAAIRHLIPFHLRQCSTFDLITACFWCCRTKALQLEPDEEV  287

Query  698   RMLLLINARFKFKDTPMP-SGYTGNAFAYPGAKTTAGKLRKNPLGYAVELVTSIKRCFSE  522
             RM+ ++NAR +F+    P  GY GN FA+P A TTAGKL  NPLGYAVEL+   K   +E
Sbjct  288   RMMCIVNARSRFRADHSPLVGYYGNCFAFPAAVTTAGKLCGNPLGYAVELIRKAKAQVTE  347

Query  521   EYMQSMVDLMVLKGRPPFHVAGSFIMSDLTRSKISDVDYGWGKPVFGGPAHGGAGDVPGV  342
             EYM S+ DLMV+K R  F    S ++SDLTR+K ++V++GWG+ V+GG   GGAG +PG 
Sbjct  348   EYMHSLADLMVIKERCLFTTVRSCVVSDLTRAKYAEVNFGWGEAVYGGVVKGGAGPLPGA  407

Query  341   ITFHVPYENKKGENGTLIPICLPAFALDKFVNELANTF  228
              T+ +P++N +GE G ++ I L +  + +F  EL   F
Sbjct  408   -TYIIPHKNAEGEEGLILLIFLTSEVMKRFAEELDKMF  444



>gb|AES82601.2| benzyl alcohol O-benzoyltransferase [Medicago truncatula]
Length=502

 Score =   426 bits (1094),  Expect = 9e-141, Method: Compositional matrix adjust.
 Identities = 206/389 (53%), Positives = 275/389 (71%), Gaps = 5/389 (1%)
 Frame = -1

Query  1415  FYRNEPSMSGKDPVQVIRQALAKALVFFYPFAGRLREGPGRKLMVDCTGEGVMFIEADAD  1236
              YR+EPSM  KDPV+V+R AL++ALV++YPFAGR+REG GRKLMVDCTGEGVMF+EA+AD
Sbjct  49    IYRHEPSMKEKDPVKVLRHALSQALVYYYPFAGRIREGAGRKLMVDCTGEGVMFVEAEAD  108

Query  1235  ATLQHFAIGGELKPPFPCFDQLLYNVPGSAEILNSPLFLIQVTRLRCGGFIFTLRMNHTM  1056
              TL  F  G  L PP PCF++LLY+VPGS  I++ P+ LIQVTRL+CG FI  + +NHTM
Sbjct  109   VTLDEF--GDALHPPLPCFEELLYDVPGSELIIDRPIRLIQVTRLKCGSFILVVYLNHTM  166

Query  1055  ADASGLVHFLNTIAEIARGAEAPAVQPVWQREFFSARNPPRITCTHFEYEEEPAADSMVT  876
             +D +GL  F+N  AE+ARGA  P++QPVW RE   AR+PP ITC H EYE+  ++++ + 
Sbjct  167   SDGAGLKLFMNAWAEMARGAHKPSIQPVWNREILMARDPPHITCNHHEYEQIFSSNT-IK  225

Query  875   NIPLDNLVHRSFLFGPTEISVLRSSLPPHLRKCSTVEILTALVWRCRTIALGFHPDEEVR  696
                   LVH+SF F  ++I VLR  +P HLR C+T +++T+  W CRT AL    D+E+R
Sbjct  226   EEDTTTLVHQSFFFRTSDIVVLRLLVPFHLRHCTTFDLITSCFWCCRTKALQLEADDEIR  285

Query  695   MLLLINARFKFKDTPMP-SGYTGNAFAYPGAKTTAGKLRKNPLGYAVELVTSIKRCFSEE  519
             M+ ++NAR +F     P  GY GN FAYP A TTAGKL  N LGYAVELV  +K   +EE
Sbjct  286   MMCIVNARSRFNANNSPLVGYYGNCFAYPAAVTTAGKLCGNSLGYAVELVRKLKAEVTEE  345

Query  518   YMQSMVDLMVLKGRPPFHVAGSFIMSDLTRSKISDVDYGWGKPVFGGPAHGGAGDVPGVI  339
             YM S+ DLMV+K R  F    S ++SD+TR K+ +VD+GWG+ V+GG A  GAG  PG  
Sbjct  346   YMHSVADLMVIKERCLFTTIRSCVVSDVTRIKLREVDFGWGEAVYGGAAKSGAGPFPGA-  404

Query  338   TFHVPYENKKGENGTLIPICLPAFALDKF  252
              + +P++N +GE G ++ +CL   A+ +F
Sbjct  405   AYIIPHKNVEGEEGFILLVCLSFEAMKRF  433



>ref|XP_007147135.1| hypothetical protein PHAVU_006G098700g [Phaseolus vulgaris]
 gb|ESW19129.1| hypothetical protein PHAVU_006G098700g [Phaseolus vulgaris]
Length=457

 Score =   423 bits (1087),  Expect = 3e-140, Method: Compositional matrix adjust.
 Identities = 208/394 (53%), Positives = 278/394 (71%), Gaps = 8/394 (2%)
 Frame = -1

Query  1415  FYRNEPSMSGKDPVQVIRQALAKALVFFYPFAGRLREGPGRKLMVDCTGEGVMFIEADAD  1236
              Y+NE SM+ KDPV VIRQALA+ALVF+YPFAGRLREG GRKLMVDC GEGVMF+EADAD
Sbjct  51    IYQNESSMANKDPVIVIRQALARALVFYYPFAGRLREGRGRKLMVDCGGEGVMFVEADAD  110

Query  1235  ATLQHFAIGGELKPPFPCFDQLLYNVPGSAEILNSPLFLIQVTRLRCGGFIFTLRMNHTM  1056
              TL+ F  G  L+PPF      L +VP S +I   PL LIQVTRL+CGGF+ +   NH M
Sbjct  111   VTLEQF--GDNLQPPFIYSKAFLCDVPDSEDIKKLPLLLIQVTRLKCGGFVVSTGWNHVM  168

Query  1055  ADASGLVHFLNTIAEIARGAEAPAVQPVWQREFFSARNPPRITCTHFEYEEEPAADSMVT  876
             AD +GL  F++  AE+ARG + P++ P+W+RE   AR+PPRITC H EY++    D++ +
Sbjct  169   ADGAGLSQFMHAWAEMARGMKTPSISPLWRRELLMARDPPRITCNHREYDQ--IQDTLSS  226

Query  875   NIPLDNLVHRSFLFGPTEISVLRSSLPPHLRKCSTVEILTALVWRCRTIALGFHPDEEVR  696
             +    +LVHRSF FGP +++ LR  LP HLR+C+  +++TA +WRCRT AL    DE+VR
Sbjct  227   SD--HHLVHRSFFFGPAQMAALRRLLPHHLRQCTAFDLITACLWRCRTKALQTDADEDVR  284

Query  695   MLLLINARFKFKDTPMPSGYTGNAFAYPGAKTTAGKLRKNPLGYAVELVTSIKRCFSEEY  516
             M+ ++NAR +F+  P+P GY GNAFAYP A ++AGKL  +P  YAVEL+ ++K   ++EY
Sbjct  285   MMCIVNARNRFR-PPLPIGYYGNAFAYPAATSSAGKLCASPFAYAVELIHNVKGVVTDEY  343

Query  515   MQSMVDLMVLKGRPPFHVAGSFIMSDLTRSKISDVDYGWGKPVFGGPAHGGAGDVPGVIT  336
             M S+ DLMVLKGR       S ++SDLTR++  DVD+GWGK + G PA G  G   G  T
Sbjct  344   MHSVADLMVLKGRCMPTTVRSCLVSDLTRARFRDVDFGWGKALCGAPAKGSTGPFYGG-T  402

Query  335   FHVPYENKKGENGTLIPICLPAFALDKFVNELAN  234
               V Y+N KGE+G ++P+ LPA  + +F+ E+ +
Sbjct  403   HIVSYKNSKGEDGLVLPVWLPAKPMQRFLKEMDD  436



>gb|ABR16407.1| unknown [Picea sitchensis]
Length=448

 Score =   422 bits (1085),  Expect = 3e-140, Method: Compositional matrix adjust.
 Identities = 199/395 (50%), Positives = 276/395 (70%), Gaps = 6/395 (2%)
 Frame = -1

Query  1415  FYRNEPSMSGKDPVQVIRQALAKALVFFYPFAGRLREGPGRKLMVDCTGEGVMFIEADAD  1236
             FY+ +PS  G+DP +VIR+ LAKALVF+YPFAGRLR+ P  KL+VDCTGEGV+F+EADAD
Sbjct  47    FYQFDPSKKGEDPARVIREGLAKALVFYYPFAGRLRDAPAGKLVVDCTGEGVLFVEADAD  106

Query  1235  ATLQHFAIGGELKPPFPCFDQLLYNVPGSAEILNSPLFLIQVTRLRCGGFIFTLRMNHTM  1056
               L+ F   G+L+PPFPC++ LL++VP S  + NSPL LIQVTRLRCGGFIF LR+NHTM
Sbjct  107   VALEEF---GDLQPPFPCWEDLLHDVPASLTLTNSPLLLIQVTRLRCGGFIFALRLNHTM  163

Query  1055  ADASGLVHFLNTIAEIARGAEAPAVQPVWQREFFSARNPPRITCTHFEYEEEPAADSMVT  876
              DA GLV F+N + E+A+GA  P+V+PVW+RE    R  P +    +EY +    D  + 
Sbjct  164   CDAFGLVQFMNALGEMAKGASRPSVRPVWKREILRPRTNPAVKFPLYEYNQIEDKDGQM-  222

Query  875   NIPLDNLVHRSFLFGPTEISVLRSSLPPHLRKCSTVEILTALVWRCRTIALGFHPDEEVR  696
              +P++ + H SF FGP+E+  L+        K  T E+L+A +WR RT AL    ++EVR
Sbjct  223   -VPVNEMSHNSFFFGPSEMESLKRQAVGQGMKSRTFEVLSACLWRFRTRALQLPSEQEVR  281

Query  695   MLLLINARFKFKDTPMPSGYTGNAFAYPGAKTTAGKLRKNPLGYAVELVTSIKRCFSEEY  516
             ++  ++AR +F D P+P G+ GNA ++  AKTTAG+L KNPL +A++L+   K   ++EY
Sbjct  282   LIFPLDARTRF-DPPLPKGFYGNAISFACAKTTAGELAKNPLSFALKLINEAKTAVNDEY  340

Query  515   MQSMVDLMVLKGRPPFHVAGSFIMSDLTRSKISDVDYGWGKPVFGGPAHGGAGDVPGVIT  336
             M+S++DLM L+GRP F V GSF++SD+T+    DVD+GWG+  +GGPA GG G VPGV +
Sbjct  341   MRSVIDLMELEGRPHFTVVGSFLVSDVTKIGFGDVDFGWGRAAYGGPAKGGVGAVPGVSS  400

Query  335   FHVPYENKKGENGTLIPICLPAFALDKFVNELANT  231
             F +P  N  G  G L+P+CLP+ A+  F  E++  
Sbjct  401   FFIPLRNTSGVEGILVPVCLPSAAMKIFQAEISEA  435



>gb|ABR16595.1| unknown [Picea sitchensis]
Length=448

 Score =   422 bits (1084),  Expect = 6e-140, Method: Compositional matrix adjust.
 Identities = 198/395 (50%), Positives = 276/395 (70%), Gaps = 6/395 (2%)
 Frame = -1

Query  1415  FYRNEPSMSGKDPVQVIRQALAKALVFFYPFAGRLREGPGRKLMVDCTGEGVMFIEADAD  1236
             FY+ +PS  G+DP +VIR+ LAKALVF+YPFAGRLR+ P  KL+VDCTGEGV+F+EADAD
Sbjct  47    FYQFDPSKKGEDPARVIREGLAKALVFYYPFAGRLRDAPAGKLVVDCTGEGVLFVEADAD  106

Query  1235  ATLQHFAIGGELKPPFPCFDQLLYNVPGSAEILNSPLFLIQVTRLRCGGFIFTLRMNHTM  1056
               L+ F   G+L+PPFPC++ LL++VP S  + NSPL LIQVTRLRCGGFIF LR+NH+M
Sbjct  107   VALEEF---GDLQPPFPCWEDLLHDVPASLTLTNSPLLLIQVTRLRCGGFIFALRLNHSM  163

Query  1055  ADASGLVHFLNTIAEIARGAEAPAVQPVWQREFFSARNPPRITCTHFEYEEEPAADSMVT  876
              DA GLV F+N + E+A+GA  P+V+PVW+RE    R  P +    +EY +    D  + 
Sbjct  164   CDAVGLVQFMNALGEMAKGASRPSVRPVWKREILRPRTNPAVKFPLYEYNQIEDKDGQM-  222

Query  875   NIPLDNLVHRSFLFGPTEISVLRSSLPPHLRKCSTVEILTALVWRCRTIALGFHPDEEVR  696
              +P++ + H SF FGP+E+  L+        K  T E+L+A +WR RT AL    ++EVR
Sbjct  223   -VPVNEMSHNSFFFGPSEMESLKRQAVGQGMKSRTFEVLSACLWRFRTRALQLPSEQEVR  281

Query  695   MLLLINARFKFKDTPMPSGYTGNAFAYPGAKTTAGKLRKNPLGYAVELVTSIKRCFSEEY  516
             ++  ++AR +F D P+P G+ GNA ++  AKTTAG+L KNPL +A++L+   K   ++EY
Sbjct  282   LIFPLDARTRF-DPPLPKGFYGNAISFACAKTTAGELAKNPLSFALKLINEAKTAVNDEY  340

Query  515   MQSMVDLMVLKGRPPFHVAGSFIMSDLTRSKISDVDYGWGKPVFGGPAHGGAGDVPGVIT  336
             M+S++DLM L+GRP F V GSF++SD+T+    DVD+GWG+  +GGPA GG G VPGV +
Sbjct  341   MRSVIDLMELEGRPHFTVVGSFLVSDVTKIGFGDVDFGWGRAAYGGPAKGGVGAVPGVSS  400

Query  335   FHVPYENKKGENGTLIPICLPAFALDKFVNELANT  231
             F +P  N  G  G L+P+CLP+ A+  F  E++  
Sbjct  401   FFIPLRNTSGVEGILVPVCLPSAAMKIFQAEISEA  435



>ref|XP_007209120.1| hypothetical protein PRUPE_ppa005455mg [Prunus persica]
 gb|EMJ10319.1| hypothetical protein PRUPE_ppa005455mg [Prunus persica]
Length=460

 Score =   422 bits (1084),  Expect = 9e-140, Method: Compositional matrix adjust.
 Identities = 202/392 (52%), Positives = 271/392 (69%), Gaps = 9/392 (2%)
 Frame = -1

Query  1412  YRNEPSMSGKDPVQVIRQALAKALVFFYPFAGRLREGPGRKLMVDCTGEGVMFIEADADA  1233
             Y+N PSM G D V+VIR+AL++ALV++YP AGRLREGP RKLMV+C GEGV+FIEA+AD 
Sbjct  51    YKNNPSMKGNDAVEVIREALSRALVYYYPLAGRLREGPNRKLMVECNGEGVLFIEANADV  110

Query  1232  TLQHFAIGGELKPPFPCFDQLLYNVPGSAEILNSPLFLIQVTRLRCGGFIFTLRMNHTMA  1053
             TL    +G  + PP P  ++ LYNVPGS  IL  PL LIQVTRL CGGFI  LR+NHTM 
Sbjct  111   TLAQ--LGDTIAPPSPFLEEFLYNVPGSDGILGCPLLLIQVTRLSCGGFILALRLNHTMC  168

Query  1052  DASGLVHFLNTIAEIARGAEAPAVQPVWQREFFSARNPPRITCTHFEYEEEPAADSMVTN  873
             DA+GL+ FLN + E+A+GA+AP+  PVW+RE   AR+PPRITC H EYEE   A     +
Sbjct  169   DAAGLLQFLNAVGEMAQGAQAPSTTPVWERELLGARDPPRITCAHHEYEEGIDAQGSFPS  228

Query  872   IPLDNLVHRSFLFGPTEISVLRSSLPPHLRKCSTVEILTALVWRCRTIALGFHPDEEVRM  693
                 N+V RSF FG  EI  +R+ +PP L  C+T +++TA +W+CRT+AL  +P + VR+
Sbjct  229   TNKPNMVQRSFYFGSKEIKAIRNHIPPQLSTCTTFDLITACLWKCRTLALRMNPKQVVRL  288

Query  692   LLLINARFKFKDTPMPSGYTGNAFAYPGAKTTAGKLRKNPLGYAVELVTSIKRCFSEEYM  513
               L++AR K  +  +P GY GNA A+P A + A  +  NPLGYA+ELV   K   +EEYM
Sbjct  289   SCLVSARGKRHNVRLPLGYYGNAVAFPAAVSEAKDVCTNPLGYALELVMKAKATVNEEYM  348

Query  512   QSMVDLMVLKGR-PPFHVAGSFIMSDLTRSKISDVDYGWGKPVFGGPAHGGAGDVPGVIT  336
             +S+ DLM ++GR P + + G+FI+SD +R+   +V +GWGKPVFGGPA         +I+
Sbjct  349   RSVADLMEIRGRLPKYPLTGNFIVSDTSRAGFGEVSFGWGKPVFGGPAKA-----LDLIS  403

Query  335   FHVPYENKKGENGTLIPICLPAFALDKFVNEL  240
             F+V ++    E G L+PICLP   +++F  EL
Sbjct  404   FYVQHKCNN-EEGVLVPICLPLSDMERFQQEL  434



>ref|XP_004151856.1| PREDICTED: LOW QUALITY PROTEIN: benzyl alcohol O-benzoyltransferase-like 
[Cucumis sativus]
Length=444

 Score =   421 bits (1081),  Expect = 1e-139, Method: Compositional matrix adjust.
 Identities = 201/388 (52%), Positives = 270/388 (70%), Gaps = 8/388 (2%)
 Frame = -1

Query  1412  YRNEPSMSGKDPVQVIRQALAKALVFFYPFAGRLREGPGRKLMVDCTGEGVMFIEADADA  1233
             Y + PS+ G+DPV+VI++A+ KALVF+YP AGRLREGPGRKL V+CTGEG++F+EADAD 
Sbjct  53    YHHNPSLEGRDPVKVIKEAIGKALVFYYPLAGRLREGPGRKLFVECTGEGILFVEADADV  112

Query  1232  TLQHFAIGGELKPPFPCFD-QLLYNVPGSAEILNSPLFLIQVTRLRCGGFIFTLRMNHTM  1056
             +L+ F     L       +  +L+N   S  +LNSPL LIQVTRL+CGGFIF L +NH++
Sbjct  113   SLEQFR--DTLPYSLSSMEINILHNALNSDGVLNSPLLLIQVTRLKCGGFIFGLHLNHSV  170

Query  1055  ADASGLVHFLNTIAEIARGAEAPAVQPVWQREFFSARNPPRITCTHFEYEEEPAADSMVT  876
             AD  G+V F+   AEIARGA AP++ PVWQR   +AR+PPRIT  H+EY++    D+  T
Sbjct  171   ADGFGIVQFIKATAEIARGAFAPSILPVWQRALLTARDPPRITFRHYEYDQ--VVDTKST  228

Query  875   NIPLDNLVHRSFLFGPTEISVLRSSLPPHLRKCSTVEILTALVWRCRTIALGFHPDEEVR  696
              IP++N++ + F F   +IS LR +LP HL  CS+ EI  A VWR RTIAL F P+EEVR
Sbjct  229   LIPVNNMIDQVFFFSQLQISTLRKTLPAHLHDCSSFEIFAAYVWRLRTIALQFKPEEEVR  288

Query  695   MLLLINARFKFKDTPMPSGYTGNAFAYPGAKTTAGKLRKNPLGYAVELVTSIKRCFSEEY  516
              + ++N R K     +P GY GNA  +P   TT  KL  NPLGYA++L+   K   + EY
Sbjct  289   FVCVVNLRSKID---IPLGYYGNAIVFPAVITTVAKLCGNPLGYAIDLIRKAKAKATTEY  345

Query  515   MQSMVDLMVLKGRPPFHVAGSFIMSDLTRSKISDVDYGWGKPVFGGPAHGGAGDVPGVIT  336
             ++SMVDLMV+KGRP     GSFIMSD+TR    +VD+GW K +FGGP  GG+G + G+ +
Sbjct  346   IKSMVDLMVIKGRPCLTTVGSFIMSDVTRIGFENVDFGWEKAIFGGPITGGSGIIRGMTS  405

Query  335   FHVPYENKKGENGTLIPICLPAFALDKF  252
             F +P+ N+ GE GT+I +CLP  A+++F
Sbjct  406   FCIPFMNRNGEKGTVITLCLPPPAMERF  433



>ref|XP_010667725.1| PREDICTED: benzyl alcohol O-benzoyltransferase-like [Beta vulgaris 
subsp. vulgaris]
Length=475

 Score =   421 bits (1083),  Expect = 2e-139, Method: Compositional matrix adjust.
 Identities = 206/406 (51%), Positives = 283/406 (70%), Gaps = 11/406 (3%)
 Frame = -1

Query  1415  FYRNEPSMSG------KDPVQVIRQALAKALVFFYPFAGRLREGPGRKLMVDCTGEGVMF  1254
             FYRNE    G      +DPV+V+++A+AKALV +YP AGRLRE  GRKL V+C GEG++F
Sbjct  57    FYRNESHSRGSTHMGRRDPVRVLKEAVAKALVPYYPLAGRLRENSGRKLEVECNGEGIIF  116

Query  1253  IEADADATLQHFAIGGELKPPFPCFDQLLYNVPGSAEILNSPLFLIQVTRLRCGGFIFTL  1074
             IEADAD TL+ F  G  ++PPFP  ++LL++VPGS  IL +PL L+QVTRL+C GFI  L
Sbjct  117   IEADADVTLEDFGDGDIIQPPFP-LEELLFDVPGSTAILGTPLILMQVTRLKCSGFIVAL  175

Query  1073  RMNHTMADASGLVHFLNTIAEIARGAEAPAVQPVWQREFFSARNPPRITCTHFEYEEEPA  894
             R+NHTM    GLV F+N +AE+ARGA++P++QPVW+R    AR+PPR+T  H EY+    
Sbjct  176   RLNHTMTGLPGLVQFMNAVAELARGAQSPSIQPVWERHLLRARDPPRVTFEHEEYDT--I  233

Query  893   ADSMVTNIPLDNLVHRSFLFGPTEISVLRSSLPPHLRKCSTVEILTALVWRCRTIALGFH  714
             AD+  T IP +++VH+SF FGPTEI+ +R  +P + +K +T EIL+A VWRCRT AL   
Sbjct  234   ADTKGTVIPFEDMVHKSFFFGPTEIAAIRQLIPVN-QKATTFEILSAFVWRCRTSALQPE  292

Query  713   PDEEVRMLLLINARFKFKDTPMPSGYTGNAFAYPGAKTTAGKLRKNPLGYAVELVTSIKR  534
             P+E VRM+ +I+ +  F    +P G+ GN   +    +TA KL  NP+ YA+ELV + K 
Sbjct  293   PEEIVRMMCVISIQNLFNPPLLPPGFYGNTIVFSMVTSTAAKLCINPIEYALELVKNSKS  352

Query  533   -CFSEEYMQSMVDLMVLKGRPPFHVAGSFIMSDLTRSKISDVDYGWGKPVFGGPAHGGAG  357
                S+EY++S +D MV+KGRP F VA +F++SDLTR     +DYGWG+P +GG A  G G
Sbjct  353   TATSQEYVRSTIDYMVIKGRPHFTVARNFVVSDLTRVGFDKLDYGWGQPAYGGLAKAGVG  412

Query  356   DVPGVITFHVPYENKKGENGTLIPICLPAFALDKFVNELANTFLRA  219
              +PGV++ +VP++N+ GE G ++PICLP  A+D FV EL      A
Sbjct  413   AIPGVLSCYVPFKNRHGEKGIVVPICLPQSAMDLFVKELNRLLYHA  458



>ref|XP_006470570.1| PREDICTED: anthraniloyl-CoA:methanol acyltransferase-like [Citrus 
sinensis]
Length=456

 Score =   421 bits (1081),  Expect = 2e-139, Method: Compositional matrix adjust.
 Identities = 205/405 (51%), Positives = 276/405 (68%), Gaps = 17/405 (4%)
 Frame = -1

Query  1415  FYRNEPS--MSGKDPVQVIRQALAKALVFFYPFAGRLREGPGRKLMVDCTGEGVMFIEAD  1242
             FY+N+PS  M G+DPV+VIR+A++KALVF+YP AGRL+EG  RKLMV+C  EGV+FIEAD
Sbjct  50    FYKNDPSPSMQGRDPVKVIREAISKALVFYYPLAGRLKEGYNRKLMVECNAEGVLFIEAD  109

Query  1241  ADATLQHFAIGGELKPPFPCFDQLLYNVPGSAEILNSPLFLIQVTRLRCGGFIFTLRMNH  1062
             A+ TL+   +G +++PP P  +QL+Y+VPGS  IL  PL LIQVTRL CGGFIF +R NH
Sbjct  110   ANFTLEQ--LGDDIQPPCPYLNQLIYDVPGSEGILGCPLLLIQVTRLTCGGFIFAIRFNH  167

Query  1061  TMADASGLVHFLNTIAEIARGAEAPAVQPVWQREFFSARNPPRITCTHFEYEEEPAADSM  882
             TM DA GLV FL  I ++ARG  +P + P+WQR+  +ARNPP++TC H EY+E      +
Sbjct  168   TMCDAFGLVQFLKAIEDMARGERSPNLFPIWQRQILNARNPPQVTCIHHEYDE------I  221

Query  881   VTN-IPLDNLVHRSFLFGPTEISVLRSSLPPHLRKCSTVEILTALVWRCRTIALGFHPDE  705
              TN +P DN+ H+SF F    I  LR+ LP HL+ CST E+L A +W+CRTIAL   P+E
Sbjct  222   NTNEVPSDNMAHKSFFFSLKGIKALRNQLPFHLKDCSTFELLLAFLWKCRTIALKLQPEE  281

Query  704   EVRMLLLINARFKFKDTPMPSGYTGNAFAYPGAKTTAGKLRKNPLGYAVELVTSIKRCFS  525
               ++  ++N R K  +  +P GY GNAF +    + A +L KNP+GYAVELV   K   +
Sbjct  282   IAKVCCIVNVRGKSYEMDIPPGYCGNAFTFSAVCSKAEQLCKNPIGYAVELVKKAKAQMN  341

Query  524   EEYMQSMVDLMVLKGRP-PFHVAGSFIMSDLTRSKISDVDYGWGKPVFGGPAHGGAGDVP  348
             EEY++S  DLMV+KGR   F   G+FI+SDL    + DVD+GWGKP++ G A   A    
Sbjct  342   EEYIRSAADLMVIKGRRIKFSTRGNFIVSDLRNVGLGDVDFGWGKPIYAGTAGAVA----  397

Query  347   GVITFHVPYENKKGENGTLIPICLPAFALDKFVNELANTFLRAAL  213
              VI+F   Y+NK GE G L+PICLP  A+++   EL    ++ ++
Sbjct  398   -VISFFTKYQNKNGEPGILVPICLPQSAMERLQEELKGLMIQGSV  441



>ref|XP_011007948.1| PREDICTED: methanol O-anthraniloyltransferase-like [Populus euphratica]
Length=468

 Score =   421 bits (1082),  Expect = 2e-139, Method: Compositional matrix adjust.
 Identities = 204/396 (52%), Positives = 279/396 (70%), Gaps = 12/396 (3%)
 Frame = -1

Query  1415  FYRNEPSMSGKDPVQVIRQALAKALVFFYPFAGRLREGPGRKLMVDCTGEGVMFIEADAD  1236
             FYR+ PS+  +DPV+VI++AL KALVF+YPFAGR+ EGP  KL+VDCTGEG++F+EADAD
Sbjct  66    FYRSHPSLKREDPVKVIKEALGKALVFYYPFAGRIIEGPRSKLLVDCTGEGILFVEADAD  125

Query  1235  ATLQHFAIGGELKPPFPCFDQLLYNVPGSAEILNSPLFLIQVTRLRCGGFIFTLRMNHTM  1056
              T+    +G  + PPF   ++ L++VPGS+ IL  PL LIQVTRL CGGFIF +R+NHTM
Sbjct  126   VTIDQ--LGDSIHPPFSYIEEFLHDVPGSSGILGCPLLLIQVTRLACGGFIFAIRLNHTM  183

Query  1055  ADASGLVHFLNTIAEIARGAEAPAVQPVWQREFFSARNPPRITCTHFEYEEEPAADS---  885
             +D+ GL  FLNT+ E+A GA  P++ PVW+RE  +ARNPPR+TC H EYE+    ++   
Sbjct  184   SDSLGLSKFLNTVGELALGASTPSLLPVWEREILNARNPPRVTCVHHEYEQLTHTETSIV  243

Query  884   MVTNIPLDNLVHRSFLFGPTEISVLRSSLPPHLRKCSTVEILTALVWRCRTIALGFHPDE  705
             M       N+ HRSF FGP+E+  +R+ +PPHL+KCS  E+L + +WR RTIAL   P E
Sbjct  244   MSLQEHEKNIAHRSFFFGPSELKSIRTHIPPHLQKCSNFEVLASFLWRSRTIALQLDPKE  303

Query  704   EVRMLLLINARFKFKDTPMPSGYTGNAFAYPGAKTTAGKLRKNPLGYAVELVTSIKRCFS  525
              VR+ +++N R K +   +PSGY GNAFAYP A + AG L ++PLGYA+ELVT +K   +
Sbjct  304   VVRLSVIVNVRGK-QGLKVPSGYYGNAFAYPTAISKAGLLCQSPLGYALELVTRLKTQMN  362

Query  524   EEYMQSMVDLMVLKGRPPFHVAGSFIMSDLTRSKISDVDYGWGKPVFGGPAHGGAGDVPG  345
             EEY++S+ DL+VLKGRP +    SF+++D+TR  + D D+GWG  V+GGP     G  P 
Sbjct  363   EEYIKSVADLLVLKGRPHYTTVWSFLIADVTRVGLGDFDFGWGNSVYGGP----IGARP-  417

Query  344   VITFHVP-YENKKGENGTLIPICLPAFALDKFVNEL  240
               +FHV  ++N  GE G L+PI LP   +++F  EL
Sbjct  418   CTSFHVSGFKNSYGEEGILVPILLPLPIMNRFQQEL  453



>gb|KDP39567.1| hypothetical protein JCGZ_02587 [Jatropha curcas]
Length=444

 Score =   420 bits (1079),  Expect = 2e-139, Method: Compositional matrix adjust.
 Identities = 204/392 (52%), Positives = 272/392 (69%), Gaps = 14/392 (4%)
 Frame = -1

Query  1415  FYRNEPSMSGKDPVQVIRQALAKALVFFYPFAGRLREGPGRKLMVDCTGEGVMFIEADAD  1236
              YR  PSM  KDPVQV++QA+A+ LVF+YPFAGR+RE P RKL+V+CTGEG++F+EADAD
Sbjct  49    IYRYHPSMERKDPVQVLKQAIAETLVFYYPFAGRIRERPNRKLVVECTGEGILFVEADAD  108

Query  1235  ATLQHFAIGGELKPPFPCFDQLLYNVPGSAEILNSPLFLIQVTRLRCGGFIFTLRMNHTM  1056
               L  F  G  ++PPFPCF +LL++VPGS+ I N PL LIQVTRL+CGG I  +R+NHT+
Sbjct  109   VALDQF--GDAIRPPFPCFGELLFDVPGSSGIANCPLLLIQVTRLKCGGIILAIRLNHTI  166

Query  1055  ADASGLVHFLNTIAEIARGAEAPAVQPVWQREFFSARNPPRITCTHFEYEEEPAADSMVT  876
             +DA+G   F++T+AE+A GA +P++ P W R   +AR PPRITC H EY++    D    
Sbjct  167   SDATGYFQFISTVAEMACGARSPSIPPTWDRHLLNAREPPRITCIHHEYDD--LVDVEDH  224

Query  875   NIPLDNLVHRSFLFGPTEISVLRSSLPPHLRKCSTVEILTALVWRCRTIALGFHPDEEVR  696
               P  +  HRSF FGP EIS LR   P    + S+ +ILTA +WRCRTIAL   PDEE+R
Sbjct  225   KNPPGDKDHRSFFFGPAEISCLRRFAP---YRSSSFDILTACLWRCRTIALQPKPDEEMR  281

Query  695   MLLLINARFKFKDTPMPSGYTGNAFAYPGAKTTAGKLRKNPLGYAVELVTSIKRCFSEEY  516
             ++ ++NAR KF + P+P GY GN  AY  A   AG L  NP+GYA+ELV   K   +EEY
Sbjct  282   IICIVNARNKF-NPPIPKGYYGNCIAYSVAIARAGDLCGNPIGYALELVRKAKTNVTEEY  340

Query  515   MQSMVDLMVLKGRPPFHVAGSFIMSDLTRSKISDVDYGWGKPVFGGPAHGGAGDVPGVIT  336
             M+S+ DLMV+KGRP F +  SF++S   + +  +VD+GWG+ V+GGPA G       V +
Sbjct  341   MRSVADLMVVKGRPKFTMVRSFLVSGAAKMRFDEVDFGWGRAVYGGPAMG------HVAS  394

Query  335   FHVPYENKKGENGTLIPICLPAFALDKFVNEL  240
             FH+   NKKGE+G ++ +CLP  A+ +FV EL
Sbjct  395   FHIAGRNKKGEDGVIVTLCLPRLAMQRFVKEL  426



>ref|XP_002304071.1| hypothetical protein POPTR_0003s01420g [Populus trichocarpa]
 gb|EEE79050.1| hypothetical protein POPTR_0003s01420g [Populus trichocarpa]
Length=454

 Score =   420 bits (1080),  Expect = 3e-139, Method: Compositional matrix adjust.
 Identities = 205/399 (51%), Positives = 279/399 (70%), Gaps = 12/399 (3%)
 Frame = -1

Query  1415  FYRNEPSMSGKDPVQVIRQALAKALVFFYPFAGRLREGPGRKLMVDCTGEGVMFIEADAD  1236
             FYR+ PSM  +DPV+VI++AL KALVF+YPFAGR+ EGP  KL+VDCTGEG++F+EADA 
Sbjct  52    FYRSHPSMKREDPVKVIKEALGKALVFYYPFAGRIIEGPRSKLLVDCTGEGILFVEADAG  111

Query  1235  ATLQHFAIGGELKPPFPCFDQLLYNVPGSAEILNSPLFLIQVTRLRCGGFIFTLRMNHTM  1056
              T+    +G  + PPF   ++ L++VPGS+ IL  PL LIQVTRL CGGFIF +R+NHTM
Sbjct  112   VTIDQ--LGDSIHPPFSYIEEFLHDVPGSSGILGCPLLLIQVTRLACGGFIFAIRLNHTM  169

Query  1055  ADASGLVHFLNTIAEIARGAEAPAVQPVWQREFFSARNPPRITCTHFEYEEEPAADSMVT  876
             +D+ GL  FLNT+ E+A GA  P++ PVW+RE  +ARNPPR+TC H EYE+    ++ + 
Sbjct  170   SDSLGLSKFLNTVGELALGASTPSLLPVWEREILNARNPPRVTCVHHEYEQLTHTETSIV  229

Query  875   NIPLDN---LVHRSFLFGPTEISVLRSSLPPHLRKCSTVEILTALVWRCRTIALGFHPDE  705
                 ++   + HRSF FGP+E+  +R  +PPHL+KCS  E+L + +WR RTIAL   P+E
Sbjct  230   MTLQEHEKYMAHRSFFFGPSELKSIRKHIPPHLQKCSNFEVLASFLWRSRTIALQLDPEE  289

Query  704   EVRMLLLINARFKFKDTPMPSGYTGNAFAYPGAKTTAGKLRKNPLGYAVELVTSIKRCFS  525
              VR+ ++IN R K +   +PSGY GNAFAYP A + AG L ++PLGYA+ELV  +K   +
Sbjct  290   VVRLSVMINVRGK-QGLKVPSGYYGNAFAYPTAISKAGLLCQSPLGYALELVRRLKTQMN  348

Query  524   EEYMQSMVDLMVLKGRPPFHVAGSFIMSDLTRSKISDVDYGWGKPVFGGPAHGGAGDVPG  345
             EEY++S  DLMVLKGRP +    SF+++D TR  + D+D+GWGK V+GGP   GA   P 
Sbjct  349   EEYIKSAADLMVLKGRPHYTTVWSFLIADATRVGLGDIDFGWGKAVYGGPI--GA---PP  403

Query  344   VITFHVP-YENKKGENGTLIPICLPAFALDKFVNELANT  231
               +FHV   +N  GE G L+PI LP   +++F  EL + 
Sbjct  404   CTSFHVSGLKNSYGEEGILVPILLPLPIMNRFQQELLSN  442



>ref|XP_011041077.1| PREDICTED: benzyl alcohol O-benzoyltransferase-like isoform X1 
[Populus euphratica]
Length=467

 Score =   420 bits (1080),  Expect = 4e-139, Method: Compositional matrix adjust.
 Identities = 206/396 (52%), Positives = 272/396 (69%), Gaps = 13/396 (3%)
 Frame = -1

Query  1415  FYRNEPSMSGKDPVQVIRQALAKALVFFYPFAGRLREGPGRKLMVDCTGEGVMFIEADAD  1236
              Y + PSM GKDPV+VI++A+A+ALV++YPFAGR+R+GP  KL+VDCTGEGV+FIEADAD
Sbjct  48    LYAHNPSMQGKDPVKVIKEAIAQALVYYYPFAGRIRQGPDNKLIVDCTGEGVLFIEADAD  107

Query  1235  ATLQHFAIGGELKPPFPCFDQLLYNVPGSAEILNSPLFLIQVTRLRCGGFIFTLRMNHTM  1056
             AT++ F  G  +  PFPCF +LLYNVPGS  ILN+PL L Q+TRL+CGGFI   R+NH M
Sbjct  108   ATVEQF--GDPIPSPFPCFQELLYNVPGSDGILNTPLLLFQITRLKCGGFILGFRLNHPM  165

Query  1055  ADASGLVHFLNTIAEIARGAEAPAVQPVWQREFFSARNPPRITCTHFEY--EEEPAADSM  882
             +DA GLV  L+ I EI+RGA+AP++ PVWQRE   ARNPPR+TCTH EY    +   D  
Sbjct  166   SDAIGLVQLLSAIGEISRGAQAPSILPVWQRELLCARNPPRVTCTHNEYGDHHDLVVDPS  225

Query  881   VTNIP-----LDNLVHRSFLFGPTEISVLRSSLPPHLRKCSTVEILTALVWRCRTIALGF  717
               N+P      D   HR F+ GP E+S +R  +PPHL  CS  EI+TA +WRC  IA   
Sbjct  226   ELNVPEFRGSSDGAAHRCFIIGPKELSNIRKWIPPHLHPCSKFEIITACLWRCHAIASQA  285

Query  716   HPDEEVRMLLLINARFKFKDTPMPSGYTGNAFAYPGAKTTAGKLRKNPLGYAVELVTSIK  537
             +P+EE+R+ +L+NAR KF + P+P GY GN  A P A T+A KL  N LGYA+EL+   K
Sbjct  286   NPNEEMRICMLVNARSKF-NPPLPKGYYGNVLALPAAITSARKLCLNSLGYALELIRHAK  344

Query  536   RCFSEEYMQSMVDLM-VLKGRPPFHVAGSFIMSDLTRSKISDVDYGWGKPVFGGPAHGGA  360
                +EEY++S+ D + + KG P      S+++SDLT      VDYGWGKPV+ GP+    
Sbjct  345   NKITEEYIRSLADFIEITKGLP--RGLPSYVVSDLTSVGFDQVDYGWGKPVYTGPSKAMP  402

Query  359   GDVPGVITFHVPYENKKGENGTLIPICLPAFALDKF  252
              D+    T+++PY NKKGE G ++ I L A  +++F
Sbjct  403   DDINNSGTYYLPYRNKKGERGVMVLISLRAPVMERF  438



>ref|XP_003616154.1| Benzoyl coenzyme A benzyl alcohol benzoyl transferase [Medicago 
truncatula]
 gb|AES99112.1| benzyl alcohol O-benzoyltransferase [Medicago truncatula]
Length=460

 Score =   419 bits (1078),  Expect = 7e-139, Method: Compositional matrix adjust.
 Identities = 202/395 (51%), Positives = 269/395 (68%), Gaps = 4/395 (1%)
 Frame = -1

Query  1415  FYRNEPSMSGKDPVQVIRQALAKALVFFYPFAGRLREGPGRKLMVDCTGEGVMFIEADAD  1236
              YR EPSM+ KDP++V+R AL++ LV++YPFAGR+REG  RKLMVDCTGEGV+FIEA+AD
Sbjct  49    IYRREPSMAEKDPIKVLRHALSRTLVYYYPFAGRIREGARRKLMVDCTGEGVVFIEAEAD  108

Query  1235  ATLQHFAIGGELKPPFPCFDQLLYNVPGSAEILNSPLFLIQVTRLRCGGFIFTLRMNHTM  1056
              TL  F  G  L PPFPCF QLLY+VPGS  I++ P+ LIQVTRL+CGGFI  L +NHTM
Sbjct  109   VTLDQF--GDALHPPFPCFQQLLYDVPGSEHIIDRPIRLIQVTRLKCGGFILALSVNHTM  166

Query  1055  ADASGLVHFLNTIAEIARGAEAPAVQPVWQREFFSARNPPRITCTHFEYEEEPAADSMVT  876
              DA+GL  F+   AE+ARGA  P++QPVW RE   AR+PP ITC H EYE+  + ++ + 
Sbjct  167   GDAAGLRQFMTAWAEMARGANQPSIQPVWNREILMARDPPCITCNHREYEQILSPNTYIK  226

Query  875   NIPLDNLVHRSFLFGPTEISVLRSSLPPHLRKCSTVEILTALVWRCRTIALGFHPDEEVR  696
                   +VH+SF F P  I+ +R  +P HL  C+T ++++A  W CRT AL   PDEEVR
Sbjct  227   EEDTTIVVHQSFFFTPAHIAAIRCLVPIHLHHCTTFDLISACYWCCRTKALQIEPDEEVR  286

Query  695   MLLLINARFKFKDTP-MPSGYTGNAFAYPGAKTTAGKLRKNPLGYAVELVTSIKRCFSEE  519
             M+ ++NAR +F   P +  GY GN  A+  A TTA +L  N LGYAVEL+   K   +EE
Sbjct  287   MMCIVNARSRFSANPSLFIGYYGNCIAFSAAVTTAKELCGNQLGYAVELIRKAKTQVTEE  346

Query  518   YMQSMVDLMVLKGRPPFHVAGSFIMSDLTRSKISDVDYGWGKPVFGGPAHGGAGDVPGVI  339
             YM S+ D MV+K R  F    + ++SD TR+ +S+V++GWG+ ++GG   GG G   G  
Sbjct  347   YMHSLADCMVIKERCLFTTGRTCMVSDWTRANLSEVNFGWGETMYGGVVKGGIGSYLGG-  405

Query  338   TFHVPYENKKGENGTLIPICLPAFALDKFVNELAN  234
             T+ VP++N KGE G + PICLP   + +F  EL +
Sbjct  406   TYIVPHKNAKGEEGLIFPICLPPEDMKRFAKELDD  440



>ref|XP_007147134.1| hypothetical protein PHAVU_006G098600g [Phaseolus vulgaris]
 gb|ESW19128.1| hypothetical protein PHAVU_006G098600g [Phaseolus vulgaris]
Length=462

 Score =   419 bits (1078),  Expect = 7e-139, Method: Compositional matrix adjust.
 Identities = 214/398 (54%), Positives = 281/398 (71%), Gaps = 10/398 (3%)
 Frame = -1

Query  1412  YRNEPSMSGKDPVQVIRQALAKALVFFYPFAGRLREGPGRKLMVDCTGEGVMFIEADADA  1233
             Y  + SM+ KDPV+VIR+AL++ LVF+YPFAGRLREGP RKL+VDCTGEGVMFIE DAD 
Sbjct  58    YGKQASMAEKDPVEVIRKALSQTLVFYYPFAGRLREGPHRKLIVDCTGEGVMFIEGDADV  117

Query  1232  TLQHFAIGGELKPPFPCFDQLLYNVPGSAEILNSPLFLIQVTRLRCGGFIFTLRMNHTMA  1053
             TL  F  G  L+PPFPCFD+LLY+VPGS +I ++PL L+QVTRL+CGGFI  LR +HTM 
Sbjct  118   TLAEF--GDSLQPPFPCFDELLYDVPGSQQITDTPLLLVQVTRLKCGGFILALRFSHTMV  175

Query  1052  DASGLVHFLNTIAEIARGAEAPAVQPVWQREFFSARNPPRITCTHFEYEEEPAADSMVTN  873
             D  G   F+N  AE+ARGA  P++ PVW+RE   AR+PPRITC H EYE+    D++ ++
Sbjct  176   DGFGYQQFMNAWAEMARGATKPSIAPVWRRELLMARDPPRITCNHREYEQ--IQDTLPSS  233

Query  872   IPLDNLVHRSFLFGPTEISVLRSSLPPHLRKCSTVEILTALVWRCRTIALGFHPDEEVRM  693
                 NL+ RSF FG  +I+ LR S+P HL+ CST +++TA +WRCRT A+    +E+VRM
Sbjct  234   N--HNLIQRSFFFGRLDIAALRKSIPQHLQHCSTFDLITACLWRCRTKAMQIEANEDVRM  291

Query  692   LLLINARFKFKDTPMPSGYTGNAFAYPGAKTTAGKLRKNPLGYAVELVTSIKRCFSEEYM  513
             + ++NAR +F  + +P GY GNAFAYP A T+AGKL +NP GYAVEL+  +K    EEY+
Sbjct  292   MCIVNARGRFNPS-LPVGYYGNAFAYPAAVTSAGKLCQNPFGYAVELINKVKGEMKEEYL  350

Query  512   QSMVDLMVLKGRP-PFHVAGSFIMSDLTRSKISDVDYGWGKPVFGGPAHGGAGDVPGVIT  336
             QS+ DLMV+K R   F    S+I+S L R+    +D+GWG+ ++GG AH GAG  P V +
Sbjct  351   QSVADLMVMKERSLLFTTVRSYIVSYLARTNFRVIDFGWGEAIYGGVAHAGAGGFPAV-S  409

Query  335   FHVPYENKKGENGTLIPICLPAFALDKFVNELANTFLR  222
             +    +N KGE G    I LPA A+++F  E  N  LR
Sbjct  410   YFCSAKNGKGEEGMTFSIFLPAEAMERFTKEF-NDMLR  446



>ref|XP_007147137.1| hypothetical protein PHAVU_006G098900g [Phaseolus vulgaris]
 gb|ESW19131.1| hypothetical protein PHAVU_006G098900g [Phaseolus vulgaris]
Length=478

 Score =   420 bits (1079),  Expect = 7e-139, Method: Compositional matrix adjust.
 Identities = 203/396 (51%), Positives = 272/396 (69%), Gaps = 4/396 (1%)
 Frame = -1

Query  1415  FYRNEPSMSGKDPVQVIRQALAKALVFFYPFAGRLREGPGRKLMVDCTGEGVMFIEADAD  1236
              Y  + SM+ KDP +VIRQAL++ LVF+YP AGR+REGP RKL+VDCT EG MFIEADAD
Sbjct  51    IYGKQASMAEKDPAEVIRQALSQTLVFYYPLAGRVREGPHRKLVVDCTREGAMFIEADAD  110

Query  1235  ATLQHFAIGGELKPPFPCFDQLLYNVPGSAEILNSPLFLIQVTRLRCGGFIFTLRMNHTM  1056
              TL  F  G  L+PPFPCF +LLY+VP S +I ++P  L+QVTRL+CGGFI T  +NHT+
Sbjct  111   VTLAEF--GDSLQPPFPCFHELLYDVPDSQQITDTPPVLVQVTRLKCGGFILTSSINHTI  168

Query  1055  ADASGLVHFLNTIAEIARGAEAPAVQPVWQREFFSARNPPRITCTHFEYEEEPAADSMVT  876
              D +G+  F++T AE+ARG+  P++ PVW RE   AR+PPR+T  H EYE          
Sbjct  169   CDGTGVSQFMHTWAEMARGSTKPSIPPVWCRELLMARHPPRVTFNHREYEHVLDTSERTM  228

Query  875   NIPLDNLVHRSFLFGPTEISVLRSSLPPHLRKCSTVEILTALVWRCRTIALGFHPDEEVR  696
                  ++V RSF FGP++I+ +R  +PPHL+ C+T +I+TA +WRCRT AL     EEVR
Sbjct  229   TSTEHDMVQRSFFFGPSQIAAIRLLVPPHLQHCTTFDIITACLWRCRTKALQIEAHEEVR  288

Query  695   MLLLINARFKFKDTPMPSGYTGNAFAYPGAKTTAGKLRKNPLGYAVELVTSIKRCFSEEY  516
             M++++N R +  + P+P GY GNA A+P A +TAGKL +NP GYAVEL+   K   +EEY
Sbjct  289   MMVIVNGRARL-NPPLPVGYYGNAIAFPAAVSTAGKLCENPFGYAVELIKKAKSEVTEEY  347

Query  515   MQSMVDLMVLKGRPPFHVAGSFIMSDLTRSKISDVDYGWGKPVFGGPAHGGAGDVPGVIT  336
             M S+ DLMV+K R  F    S I+SDLTR +  +V++GWG+ V+ G A  G G   G  T
Sbjct  348   MHSVADLMVIKDRCMFTTIRSCIISDLTRGRFREVNFGWGEAVYSGVAKTGFGSFLGG-T  406

Query  335   FHVPYENKKGENGTLIPICLPAFALDKFVNELANTF  228
             + V ++N KGE G ++PI LPA A+++F  EL N F
Sbjct  407   YQVLHKNAKGEEGIVLPIWLPAQAMNRFAKELDNLF  442



>gb|KGN63331.1| hypothetical protein Csa_2G429040 [Cucumis sativus]
Length=442

 Score =   419 bits (1076),  Expect = 8e-139, Method: Compositional matrix adjust.
 Identities = 199/388 (51%), Positives = 270/388 (70%), Gaps = 8/388 (2%)
 Frame = -1

Query  1412  YRNEPSMSGKDPVQVIRQALAKALVFFYPFAGRLREGPGRKLMVDCTGEGVMFIEADADA  1233
             Y + PS+ G+DPV+VI++A+ KALVF+YP AGRLREGPGRKL V+CTGEG++F+EADAD 
Sbjct  53    YHHNPSLEGRDPVKVIKEAIGKALVFYYPLAGRLREGPGRKLFVECTGEGILFVEADADV  112

Query  1232  TLQHFAIGGELKPPFPCFD-QLLYNVPGSAEILNSPLFLIQVTRLRCGGFIFTLRMNHTM  1056
             +L+ F     L       +  +++N   S  +LNSPL LIQVTRL+CGGFIF L +NH++
Sbjct  113   SLEQFR--DTLPYSLSSMEINIIHNALNSDGVLNSPLLLIQVTRLKCGGFIFGLHLNHSV  170

Query  1055  ADASGLVHFLNTIAEIARGAEAPAVQPVWQREFFSARNPPRITCTHFEYEEEPAADSMVT  876
             AD  G+V F+   AEIARGA AP++ PVWQR   +AR+PPRIT  H+EY++    D+  T
Sbjct  171   ADGFGIVQFIKATAEIARGAFAPSILPVWQRALLTARDPPRITFRHYEYDQ--VVDTKST  228

Query  875   NIPLDNLVHRSFLFGPTEISVLRSSLPPHLRKCSTVEILTALVWRCRTIALGFHPDEEVR  696
              IP++N++ + F F   +IS LR +LP HL  CS+ E+  A VWR RTIAL F P+EEVR
Sbjct  229   LIPVNNMIDQVFFFSQLQISTLRKTLPAHLHDCSSFEVFAAYVWRLRTIALQFKPEEEVR  288

Query  695   MLLLINARFKFKDTPMPSGYTGNAFAYPGAKTTAGKLRKNPLGYAVELVTSIKRCFSEEY  516
              L ++N R K     +P GY GNA  +P   TT  KL  NPLGYA++L+   K   + EY
Sbjct  289   FLCVVNIRSKID---IPLGYYGNAIVFPAVITTVAKLCGNPLGYAIDLIRKAKAKATTEY  345

Query  515   MQSMVDLMVLKGRPPFHVAGSFIMSDLTRSKISDVDYGWGKPVFGGPAHGGAGDVPGVIT  336
             ++SMVD+MV+KGRP     GSFIMSD+TR    +VD+GW K +FGGP  GG+G + G+ +
Sbjct  346   IKSMVDIMVIKGRPCLTTVGSFIMSDVTRIGFENVDFGWEKAIFGGPITGGSGIIRGMTS  405

Query  335   FHVPYENKKGENGTLIPICLPAFALDKF  252
             F +P+ N+ GE GT+I +CLP  A+++F
Sbjct  406   FCIPFMNRNGEKGTVITLCLPPPAMERF  433



>ref|XP_006400294.1| hypothetical protein EUTSA_v10013454mg [Eutrema salsugineum]
 gb|ESQ41747.1| hypothetical protein EUTSA_v10013454mg [Eutrema salsugineum]
Length=468

 Score =   419 bits (1077),  Expect = 1e-138, Method: Compositional matrix adjust.
 Identities = 206/398 (52%), Positives = 278/398 (70%), Gaps = 9/398 (2%)
 Frame = -1

Query  1415  FYRNEPSMSGKDPVQVIRQALAKALVFFYPFAGRLREGPGRKLMVDCTGEGVMFIEADAD  1236
             FYRN P+ +  DPV VIR+ALA+ LV++YP AGRLREGP RKL VDC+GEGV+FIEADAD
Sbjct  57    FYRNNPT-AYSDPVAVIRRALAETLVYYYPLAGRLREGPNRKLAVDCSGEGVLFIEADAD  115

Query  1235  ATLQHFAIGGELKPPFPCFDQLLYNVPGSAEILNSPLFLIQVTRLRCGGFIFTLRMNHTM  1056
              TL  F     L+PPFPCF++LL+++ GS+E+LN+P+ LIQVTRL+CGGFIF +R+NH +
Sbjct  116   VTLVEFEKKDVLRPPFPCFEELLFDIEGSSEVLNAPMILIQVTRLKCGGFIFAVRINHAI  175

Query  1055  ADASGLVHFLNTIAEIARGAEAPAVQPVWQREFFSARNPPRITCTHFEYEEEPAADSMVT  876
             +DA+GL  FL TI E ARG+  P V PVW+R   SAR P  +T  H EY+E+   D+   
Sbjct  176   SDAAGLSLFLKTIGEFARGSHVPTVAPVWERHLLSARVPASVTHVHREYDEQ---DTESA  232

Query  875   NIPLDNLVHRSFLFGPTEISVLRSSLPPHLRKCST-VEILTALVWRCRTIALGFHPDEEV  699
              +    LV RSF FG  E+SV+R  LP +L   ST +E LTA +WR RT AL   P++E+
Sbjct  233   TVDGGALVSRSFFFGGAEMSVIRRLLPQNLANRSTDLETLTAFLWRYRTAALRTDPNKEM  292

Query  698   RMLLLINARFKFKDTPMPSGYTGNAFAYPGAKTTAGKLRKNPLGYAVELVTSIKRCFSEE  519
             R++ ++NAR KF++ P+P GY GNAFA+P A  T  +L + PL +A+ LV   K   +EE
Sbjct  293   RVIFIVNARSKFRNPPLPPGYYGNAFAFPVAIATVRELTEKPLEFALRLVKEAKWSVTEE  352

Query  518   YMQSMVDLMVLKGRPPFHVAGSFIMSDLTRSKISDVDYG-WGKPVFGGPAHGGAGDVPGV  342
             YM+S+ DLMV KGRP F + G++++SD+     +D+ +G WGKPV+GG    G  D PG 
Sbjct  353   YMRSLADLMVTKGRPRFSIDGAYLISDV--RNFADIQFGVWGKPVYGGIGTAGVVDFPGS  410

Query  341   ITFHVPYENKKGENGTLIPICLPAFALDKFVNELANTF  228
              +F+V +EN KGE G ++P+CLP  A+ +FV EL   F
Sbjct  411   -SFYVSFENSKGERGIVVPVCLPEKAMKRFVEELDGVF  447



>ref|XP_010941427.1| PREDICTED: benzyl alcohol O-benzoyltransferase-like, partial 
[Elaeis guineensis]
Length=412

 Score =   417 bits (1072),  Expect = 1e-138, Method: Compositional matrix adjust.
 Identities = 203/370 (55%), Positives = 268/370 (72%), Gaps = 6/370 (2%)
 Frame = -1

Query  1415  FYRNEPSMSGKDPVQVIRQALAKALVFFYPFAGRLREGPGRKLMVDCTGEGVMFIEADAD  1236
             FYRN+PS  G+DP +VI++AL K LV ++P AGRLRE PGRKL+V+CTGEGV+F+EA+AD
Sbjct  48    FYRNDPSKEGRDPARVIKEALGKVLVHYHPIAGRLREWPGRKLVVECTGEGVVFVEANAD  107

Query  1235  ATLQHFAIGGELKPPFPCFDQLLYNVPGSAEILNSPLFLIQVTRLRCGGFIFTLRMNHTM  1056
               L+ F  G    PPFPC ++LLY+       L+ PL  +QVTRL+CGGFIF LR+NHT+
Sbjct  108   VRLEEF--GNAPSPPFPCVEELLYDTESLGSDLDCPLLFVQVTRLKCGGFIFGLRINHTI  165

Query  1055  ADASGLVHFLNTIAEIARGAEAPAVQPVWQREFFSARNPPRITCTHFEYEEEPAADSMVT  876
              DA G+V FL  + E+ARGA AP V PVW+RE  +AR PPRIT  H EYE   A D M T
Sbjct  166   MDAPGVVQFLTALGEMARGAAAPTVPPVWERELLTARCPPRITHVHPEYEFSAATDVM-T  224

Query  875   NIPLDNLVHRSFLFGPTEISVLRSSLPPHLRKCST-VEILTALVWRCRTIALGFHPDEEV  699
              +PL ++V+RSF FGP EIS LR   PPHLR  S+  E++TA VWR RT ALG+ PD+EV
Sbjct  225   TVPLSDMVNRSFFFGPREISALRKYAPPHLRPTSSRFELITASVWRSRTAALGYDPDDEV  284

Query  698   RMLLLINARFKFKDTPMPSGYTGNAFAYPGAKTTAGKLRKNPLGYAVELVTSIKRCFSEE  519
             R+L ++NAR + +  P+PSGY GNA A+P A + AG+LR++PLGYA+E+V   K   ++E
Sbjct  285   RVLFVVNARGR-RSPPLPSGYYGNAMAFPVASSAAGRLRRSPLGYALEVVKKAKASVTDE  343

Query  518   YMQSMVDLMVLKGRPPFHVAGSFIMSDLTRSKISDVDYGWGKPVFGGPAHGGAGDVPGVI  339
             YMQS+ DLMVL+GRP F +A ++++SD+TR+    VD+GWG+ V+GGPA  G G   GV 
Sbjct  344   YMQSVADLMVLQGRPHFAMARTYLVSDVTRAGFEAVDFGWGEGVYGGPASAGIGGA-GVA  402

Query  338   TFHVPYENKK  309
             +F+  + N K
Sbjct  403   SFYTWHRNGK  412



>ref|XP_006446263.1| hypothetical protein CICLE_v10015199mg [Citrus clementina]
 gb|ESR59503.1| hypothetical protein CICLE_v10015199mg [Citrus clementina]
Length=456

 Score =   418 bits (1075),  Expect = 2e-138, Method: Compositional matrix adjust.
 Identities = 205/404 (51%), Positives = 274/404 (68%), Gaps = 17/404 (4%)
 Frame = -1

Query  1415  FYRNEPS--MSGKDPVQVIRQALAKALVFFYPFAGRLREGPGRKLMVDCTGEGVMFIEAD  1242
             FY+N+PS  M G+DPV+VIR+A++KALVF+YP AGRL+EG  RKLMV+C  EGV+FIEAD
Sbjct  50    FYKNDPSPSMQGRDPVKVIREAISKALVFYYPLAGRLKEGYNRKLMVECNAEGVLFIEAD  109

Query  1241  ADATLQHFAIGGELKPPFPCFDQLLYNVPGSAEILNSPLFLIQVTRLRCGGFIFTLRMNH  1062
             A+ TL+   +  +L+PP P  +QL+Y+VPGS  IL  PL LIQVTRL CGGFIF +R NH
Sbjct  110   ANFTLEQ--LRDDLQPPCPYLNQLIYDVPGSEGILGCPLLLIQVTRLTCGGFIFAIRFNH  167

Query  1061  TMADASGLVHFLNTIAEIARGAEAPAVQPVWQREFFSARNPPRITCTHFEYEEEPAADSM  882
             TM DA GLV FL  I ++ARG  +P + P+WQR+  +ARNPP++TC H EY      D++
Sbjct  168   TMCDAFGLVQFLKAIEDMARGERSPTLFPIWQRQILNARNPPQVTCIHHEY------DAI  221

Query  881   VTN-IPLDNLVHRSFLFGPTEISVLRSSLPPHLRKCSTVEILTALVWRCRTIALGFHPDE  705
              TN +P DN+ H+SF F    I  LR+ LP HL+ CST E+L A +W+CRTIAL   P+E
Sbjct  222   NTNEVPSDNMAHKSFFFSLKGIKALRNQLPFHLKDCSTFELLLAFLWKCRTIALKLQPEE  281

Query  704   EVRMLLLINARFKFKDTPMPSGYTGNAFAYPGAKTTAGKLRKNPLGYAVELVTSIKRCFS  525
               ++  ++N R K  +  +P GY GNAF +    + A +L KNP+GYAVELV   K   +
Sbjct  282   IAKVCCIVNVRGKRYEMDIPPGYYGNAFTFSAVCSKAEQLCKNPIGYAVELVKKAKAQMN  341

Query  524   EEYMQSMVDLMVLKGRP-PFHVAGSFIMSDLTRSKISDVDYGWGKPVFGGPAHGGAGDVP  348
             EEY++S  DLMV+KGR   F   G+FI+SDL    + DVD+GWGKP++ G A   A    
Sbjct  342   EEYIRSAADLMVIKGRRIKFSTRGNFIVSDLRNVGLGDVDFGWGKPIYAGTAGAVA----  397

Query  347   GVITFHVPYENKKGENGTLIPICLPAFALDKFVNELANTFLRAA  216
              VI+F   Y+NK GE G L+PICLP  A+++   EL    ++ +
Sbjct  398   -VISFFTKYQNKNGEPGILVPICLPQSAMERLQEELKGLMIQGS  440



>gb|KCW84614.1| hypothetical protein EUGRSUZ_B01445, partial [Eucalyptus grandis]
Length=392

 Score =   416 bits (1068),  Expect = 3e-138, Method: Compositional matrix adjust.
 Identities = 199/348 (57%), Positives = 255/348 (73%), Gaps = 7/348 (2%)
 Frame = -1

Query  1415  FYRNEPSMSGKDPVQVIRQALAKALVFFYPFAGRLREGPGRKLMVDCTGEGVMFIEADAD  1236
             FYR + +  G+DP + IR+ LA ALVF+YPFAGRLRE PGRKL+VDC  E V F+EA AD
Sbjct  50    FYRGDDT--GRDPARAIREGLANALVFYYPFAGRLREWPGRKLVVDCNEEAVAFVEASAD  107

Query  1235  ATLQHFAIGGELKPPFPCFDQLLYNVPGSAEILNSPLFLIQVTRLRCGGFIFTLRMNHTM  1056
              TL  F  G  L  PFPC ++LL+++PGS  +L+SPL LIQVTRL+CGGFIF + +NHTM
Sbjct  108   VTLDQF--GDALHSPFPCLEELLFDIPGSFSVLDSPLLLIQVTRLKCGGFIFAVHLNHTM  165

Query  1055  ADASGLVHFLNTIAEIARGAEAPAVQPVWQREFFSARNPPRITCTHFEYEEEPAADSMVT  876
             +DA GLV  L  + E+ARGA AP++ PVWQRE   AR+PPRITC H E+++      M+ 
Sbjct  166   SDAMGLVQLLKAVGEMARGANAPSILPVWQRELLDARDPPRITCNHHEFDQVADTKGMLN  225

Query  875   NIPLDNLVHRSFLFGPTEISVLRSSLPPHLRKCSTVEILTALVWRCRTIALGFHPDEEVR  696
               PLD++ HRSF+F P ++S+LR+ LP H R  ST EILTA VWRCRTIA    P+EEVR
Sbjct  226   --PLDDMDHRSFIFSPAQMSILRNGLPSHQRVSSTFEILTAFVWRCRTIAHQHDPEEEVR  283

Query  695   MLLLINARFKFKDTPMPSGYTGNAFAYPGAKTTAGKLRKNPLGYAVELVTSIKRCFSEEY  516
             +L ++NAR KF + P+P+GY GNAFA PGA T+AGKL +NPLGYA+ELV   K   +EEY
Sbjct  284   LLCIVNARSKF-NPPLPAGYYGNAFASPGAVTSAGKLCQNPLGYALELVKKAKAEVTEEY  342

Query  515   MQSMVDLMVLKGRPPFHVAGSFIMSDLTRSKISDVDYGWGKPVFGGPA  372
             M+S+ DLMV++GRP      SF++SD T+    DVD+GWGK ++GG A
Sbjct  343   MRSLADLMVIRGRPRGTEVRSFMVSDTTKVGFGDVDFGWGKAMYGGQA  390



>ref|XP_002298962.2| hypothetical protein POPTR_0001s45210g [Populus trichocarpa]
 gb|EEE83767.2| hypothetical protein POPTR_0001s45210g [Populus trichocarpa]
Length=469

 Score =   418 bits (1075),  Expect = 3e-138, Method: Compositional matrix adjust.
 Identities = 204/396 (52%), Positives = 272/396 (69%), Gaps = 13/396 (3%)
 Frame = -1

Query  1415  FYRNEPSMSGKDPVQVIRQALAKALVFFYPFAGRLREGPGRKLMVDCTGEGVMFIEADAD  1236
             FY + PSM GKDPV+VIR+ +A+ALV++YP+AGR+R+ P  KL+VDCTGEGV+FIEADAD
Sbjct  50    FYAHNPSMQGKDPVKVIREGIAQALVYYYPYAGRIRQEPENKLVVDCTGEGVLFIEADAD  109

Query  1235  ATLQHFAIGGELKPPFPCFDQLLYNVPGSAEILNSPLFLIQVTRLRCGGFIFTLRMNHTM  1056
              TL+ F  G  ++PPFPC ++LLYNVPGSA I+N+PL +IQ+TRL+CGGFI   R+NH M
Sbjct  110   GTLEQF--GDPIQPPFPCAEELLYNVPGSAGIINTPLLIIQITRLKCGGFILGFRLNHPM  167

Query  1055  ADASGLVHFLNTIAEIARGAEAPAVQPVWQREFFSARNPPRITCTHFEY--EEEPAADSM  882
             +DA GLV  L+ I EI+RGA+AP++ PVWQRE   ARNPPR+TCTH EY    +   D  
Sbjct  168   SDAIGLVQLLSAIGEISRGAQAPSILPVWQRELLCARNPPRVTCTHNEYGDHHDLVVDPS  227

Query  881   VTNIP-----LDNLVHRSFLFGPTEISVLRSSLPPHLRKCSTVEILTALVWRCRTIALGF  717
               N+P      D   HR F+ GP E+S +R  +P HL  CS  EI+TA +WRC  IA   
Sbjct  228   ELNVPEFRGSTDGAAHRCFIIGPKELSNIRKWIPRHLHPCSKFEIITACLWRCHAIASQA  287

Query  716   HPDEEVRMLLLINARFKFKDTPMPSGYTGNAFAYPGAKTTAGKLRKNPLGYAVELVTSIK  537
             +P+EE+R+ +L+NAR KF + P+P GY GN  A P A T+A KL  N LGYA+EL+   K
Sbjct  288   NPNEEMRICMLVNARSKF-NPPLPKGYYGNVLALPAAITSARKLCLNSLGYALELIRQAK  346

Query  536   RCFSEEYMQSMVDLM-VLKGRPPFHVAGSFIMSDLTRSKISDVDYGWGKPVFGGPAHGGA  360
                +EEY++S+ D + + KG P      S+++SDLT      VDYGWGKPV+ GP+    
Sbjct  347   NKITEEYIRSLADFIEITKGLP--KGLQSYVVSDLTSVGFDQVDYGWGKPVYTGPSKAMP  404

Query  359   GDVPGVITFHVPYENKKGENGTLIPICLPAFALDKF  252
              D+    T+++PY NKKGE G ++ I L A  + +F
Sbjct  405   DDINNSGTYYLPYRNKKGERGVMVLISLRAPVMARF  440



>ref|XP_010045974.1| PREDICTED: benzyl alcohol O-benzoyltransferase-like [Eucalyptus 
grandis]
Length=406

 Score =   415 bits (1067),  Expect = 5e-138, Method: Compositional matrix adjust.
 Identities = 199/348 (57%), Positives = 255/348 (73%), Gaps = 7/348 (2%)
 Frame = -1

Query  1415  FYRNEPSMSGKDPVQVIRQALAKALVFFYPFAGRLREGPGRKLMVDCTGEGVMFIEADAD  1236
             FYR + +  G+DP + IR+ LA ALVF+YPFAGRLRE PGRKL+VDC  E V F+EA AD
Sbjct  50    FYRGDDT--GRDPARAIREGLANALVFYYPFAGRLREWPGRKLVVDCNEEAVAFVEASAD  107

Query  1235  ATLQHFAIGGELKPPFPCFDQLLYNVPGSAEILNSPLFLIQVTRLRCGGFIFTLRMNHTM  1056
              TL  F  G  L  PFPC ++LL+++PGS  +L+SPL LIQVTRL+CGGFIF + +NHTM
Sbjct  108   VTLDQF--GDALHSPFPCLEELLFDIPGSFSVLDSPLLLIQVTRLKCGGFIFAVHLNHTM  165

Query  1055  ADASGLVHFLNTIAEIARGAEAPAVQPVWQREFFSARNPPRITCTHFEYEEEPAADSMVT  876
             +DA GLV  L  + E+ARGA AP++ PVWQRE   AR+PPRITC H E+++      M+ 
Sbjct  166   SDAMGLVQLLKAVGEMARGANAPSILPVWQRELLDARDPPRITCNHHEFDQVADTKGMLN  225

Query  875   NIPLDNLVHRSFLFGPTEISVLRSSLPPHLRKCSTVEILTALVWRCRTIALGFHPDEEVR  696
               PLD++ HRSF+F P ++S+LR+ LP H R  ST EILTA VWRCRTIA    P+EEVR
Sbjct  226   --PLDDMDHRSFIFSPAQMSILRNGLPSHQRVSSTFEILTAFVWRCRTIAHQHDPEEEVR  283

Query  695   MLLLINARFKFKDTPMPSGYTGNAFAYPGAKTTAGKLRKNPLGYAVELVTSIKRCFSEEY  516
             +L ++NAR KF + P+P+GY GNAFA PGA T+AGKL +NPLGYA+ELV   K   +EEY
Sbjct  284   LLCIVNARSKF-NPPLPAGYYGNAFASPGAVTSAGKLCQNPLGYALELVKKAKAEVTEEY  342

Query  515   MQSMVDLMVLKGRPPFHVAGSFIMSDLTRSKISDVDYGWGKPVFGGPA  372
             M+S+ DLMV++GRP      SF++SD T+    DVD+GWGK ++GG A
Sbjct  343   MRSLADLMVIRGRPRGTEVRSFMVSDTTKVGFGDVDFGWGKAMYGGQA  390



>ref|XP_008238035.1| PREDICTED: methanol O-anthraniloyltransferase-like [Prunus mume]
Length=460

 Score =   416 bits (1070),  Expect = 1e-137, Method: Compositional matrix adjust.
 Identities = 200/392 (51%), Positives = 269/392 (69%), Gaps = 9/392 (2%)
 Frame = -1

Query  1412  YRNEPSMSGKDPVQVIRQALAKALVFFYPFAGRLREGPGRKLMVDCTGEGVMFIEADADA  1233
             Y+N PSM G D V+VIR+AL++ALV++YP AGRLREGP RKLMV+C GEGV+F+EA+AD 
Sbjct  51    YKNNPSMKGNDAVEVIREALSRALVYYYPLAGRLREGPNRKLMVECNGEGVLFMEANADV  110

Query  1232  TLQHFAIGGELKPPFPCFDQLLYNVPGSAEILNSPLFLIQVTRLRCGGFIFTLRMNHTMA  1053
              L    +G  + PP P  ++ LYNVPGS  IL  PL LIQVTRL CGGFI  LR+NHTM 
Sbjct  111   RLAQ--LGDTIAPPSPFLEEFLYNVPGSDGILGCPLLLIQVTRLSCGGFILALRLNHTMC  168

Query  1052  DASGLVHFLNTIAEIARGAEAPAVQPVWQREFFSARNPPRITCTHFEYEEEPAADSMVTN  873
             D +GLV FLN I E+A+GA+AP+  PVW+RE   AR+PPRITC H EYEE   A     +
Sbjct  169   DGAGLVQFLNAIGEMAQGAQAPSTTPVWERELLGARDPPRITCVHHEYEEGIDAQGSFPS  228

Query  872   IPLDNLVHRSFLFGPTEISVLRSSLPPHLRKCSTVEILTALVWRCRTIALGFHPDEEVRM  693
                 N+V RSF FG  EI  +R+ +PP L  C+T +++TA +W+CRT+AL  +P + VR+
Sbjct  229   TNKPNMVQRSFYFGAKEIKAIRNHIPPQLSTCTTFDLITACLWKCRTLALRMNPKQVVRL  288

Query  692   LLLINARFKFKDTPMPSGYTGNAFAYPGAKTTAGKLRKNPLGYAVELVTSIKRCFSEEYM  513
               L++ R K  +  +P GY GNA A+P A + A  +  NPLGYA+ELV   K   +EEYM
Sbjct  289   SCLVSGRGKRHNVRLPLGYYGNAIAFPAAVSEAKAICTNPLGYALELVMKAKATVNEEYM  348

Query  512   QSMVDLMVLKGR-PPFHVAGSFIMSDLTRSKISDVDYGWGKPVFGGPAHGGAGDVPGVIT  336
             +S+ DLM ++GR P + + G+FI+SD +R+   +V +GWGKPVFGGPA         +I+
Sbjct  349   RSVADLMEIRGRLPKYPLTGNFIVSDNSRAGFGEVSFGWGKPVFGGPAKA-----LNLIS  403

Query  335   FHVPYENKKGENGTLIPICLPAFALDKFVNEL  240
             F+V ++    E+G L+PICLP   +++F  EL
Sbjct  404   FYVQHKCNN-EDGVLVPICLPLSDMERFQKEL  434



>ref|XP_008462821.1| PREDICTED: benzyl alcohol O-benzoyltransferase-like [Cucumis 
melo]
Length=462

 Score =   416 bits (1069),  Expect = 2e-137, Method: Compositional matrix adjust.
 Identities = 206/388 (53%), Positives = 268/388 (69%), Gaps = 8/388 (2%)
 Frame = -1

Query  1412  YRNEPSMSGKDPVQVIRQALAKALVFFYPFAGRLREGPGRKLMVDCTGEGVMFIEADADA  1233
             Y + PS+ G+DPV+VI++A+ KALVF+YP AGRLREGPGRKL V+CTGEG++FIEADAD 
Sbjct  53    YPHNPSLEGRDPVKVIKEAIGKALVFYYPLAGRLREGPGRKLFVECTGEGILFIEADADV  112

Query  1232  TLQHFAIGGELKPPFPCF-DQLLYNVPGSAEILNSPLFLIQVTRLRCGGFIFTLRMNHTM  1056
             +L+ F     L        + +++N   S E+LNSPL LIQVTRL+CGGFIF L  NHTM
Sbjct  113   SLEEF--WDTLPYSLSSMQNNIIHNALNSDEVLNSPLLLIQVTRLKCGGFIFGLCFNHTM  170

Query  1055  ADASGLVHFLNTIAEIARGAEAPAVQPVWQREFFSARNPPRITCTHFEYEEEPAADSMVT  876
             AD  G+V F+   AEIARGA AP++ PVWQR   +AR+PPRIT  H+EY++    D    
Sbjct  171   ADGFGIVQFMKATAEIARGAFAPSILPVWQRALLTARDPPRITFRHYEYDQ--VVDMKSG  228

Query  875   NIPLDNLVHRSFLFGPTEISVLRSSLPPHLRKCSTVEILTALVWRCRTIALGFHPDEEVR  696
              IP+++ + + F F   +IS LR +LP HL  C + E+LTA VWR RTIAL F P+EEVR
Sbjct  229   LIPVNSKIDQLFFFSQLQISTLRQTLPAHLHDCPSFEVLTAYVWRLRTIALQFKPEEEVR  288

Query  695   MLLLINARFKFKDTPMPSGYTGNAFAYPGAKTTAGKLRKNPLGYAVELVTSIKRCFSEEY  516
              L ++N R K     +P GY GNA   P   TTA KL  NPLGYAV+L+   K   + EY
Sbjct  289   FLCVMNLRSKID---IPLGYYGNAVVVPAVITTAAKLCGNPLGYAVDLIRKAKAKATMEY  345

Query  515   MQSMVDLMVLKGRPPFHVAGSFIMSDLTRSKISDVDYGWGKPVFGGPAHGGAGDVPGVIT  336
             ++S VDLMV+KGRP F V GSF+MSDLTR  + +VD+GWGK +FGGP   GA    G+++
Sbjct  346   IKSTVDLMVIKGRPYFTVVGSFMMSDLTRIGVENVDFGWGKAIFGGPTTTGARITRGLVS  405

Query  335   FHVPYENKKGENGTLIPICLPAFALDKF  252
             F VP+ N+ GE GT + +CLP  A+++F
Sbjct  406   FCVPFMNRNGEKGTALSLCLPPPAMERF  433



>ref|XP_009131598.1| PREDICTED: (Z)-3-hexen-1-ol acetyltransferase [Brassica rapa]
Length=472

 Score =   416 bits (1070),  Expect = 2e-137, Method: Compositional matrix adjust.
 Identities = 208/398 (52%), Positives = 272/398 (68%), Gaps = 6/398 (2%)
 Frame = -1

Query  1415  FYRNEPSMSGKDPVQVIRQALAKALVFFYPFAGRLREGPGRKLMVDCTGEGVMFIEADAD  1236
             FYR+ P++   DPV VIR+ALA+ LV++YP AGRLREGP RKL VDCTG+GV+FIEADAD
Sbjct  57    FYRHNPNVYS-DPVAVIRRALAQTLVYYYPLAGRLREGPNRKLAVDCTGQGVLFIEADAD  115

Query  1235  ATLQHFAIGGELKPPFPCFDQLLYNVPGSAEILNSPLFLIQVTRLRCGGFIFTLRMNHTM  1056
              TL  F     L PPFPCF++LL++V GS+E++N+PL LIQVTRL+CGGFIF +R+NH M
Sbjct  116   VTLAEFEEKDALSPPFPCFEELLFDVEGSSEVINAPLILIQVTRLKCGGFIFAIRLNHVM  175

Query  1055  ADASGLVHFLNTIAEIARGAEAPAVQPVWQREFFSARNPPRITCTHFEYEEEPAADSMVT  876
             ADA GL  F+ TI E ARG  AP + P W+R   SAR PPR+T TH EY+E  AAD+   
Sbjct  176   ADAGGLSLFIKTIGEFARGCHAPTIPPTWERHLLSARVPPRVTQTHREYDESAAADAEPV  235

Query  875   NIPLDNLVHRSFLFGPTEISVLRSSLPPHLRKCST-VEILTALVWRCRTIALGFHPDEEV  699
                 + LV +SF FG  E+S +R  LPP +   ST +E LTA +WR RT AL    ++E+
Sbjct  236   IGDGETLVSKSFFFGGAEMSAIRKLLPPDIANRSTGLETLTAFLWRQRTAALRPDANKEM  295

Query  698   RMLLLINARFKFKDTPMPSGYTGNAFAYPGAKTTAGKLRKNPLGYAVELVTSIKRCFSEE  519
             R++ ++NAR K K+  +P GY GNAFA+P A   A  L + PL +A+ LV   K   +EE
Sbjct  296   RVIFIVNARPKLKNPTLPRGYYGNAFAFPVAIANARDLTEKPLEFALRLVKEAKASVTEE  355

Query  518   YMQSMVDLMVLKGRPPFHVAGSFIMSDLTRSKISDVDYG-WGKPVFGGPAHGGAGDVPGV  342
             YM+S+ DLMV KGRP F   G++++SD+     +D+D G WGKPV+GG    G  D  G 
Sbjct  356   YMRSLADLMVTKGRPKFLADGAYLISDV--RNFADIDLGVWGKPVYGGIGKAGVVDSLGS  413

Query  341   ITFHVPYENKKGENGTLIPICLPAFALDKFVNELANTF  228
              +F+V  EN+KGE G L+P+CLP  A+ +FV EL   F
Sbjct  414   -SFYVSAENRKGERGILVPVCLPEKAMQRFVEELEAVF  450



>emb|CAA94432.1| unknown [Cucumis melo]
Length=455

 Score =   416 bits (1068),  Expect = 2e-137, Method: Compositional matrix adjust.
 Identities = 206/388 (53%), Positives = 268/388 (69%), Gaps = 8/388 (2%)
 Frame = -1

Query  1412  YRNEPSMSGKDPVQVIRQALAKALVFFYPFAGRLREGPGRKLMVDCTGEGVMFIEADADA  1233
             Y + PS+ G+DPV+VI++A+ KALVF+YP AGRLREGPGRKL V+CTGEG++FIEADAD 
Sbjct  46    YPHNPSLEGRDPVKVIKEAIGKALVFYYPLAGRLREGPGRKLFVECTGEGILFIEADADV  105

Query  1232  TLQHFAIGGELKPPFPCF-DQLLYNVPGSAEILNSPLFLIQVTRLRCGGFIFTLRMNHTM  1056
             +L+ F     L        + +++N   S E+LNSPL LIQVTRL+CGGFIF L  NHTM
Sbjct  106   SLEEF--WDTLPYSLSSMQNNIIHNALNSDEVLNSPLLLIQVTRLKCGGFIFGLCFNHTM  163

Query  1055  ADASGLVHFLNTIAEIARGAEAPAVQPVWQREFFSARNPPRITCTHFEYEEEPAADSMVT  876
             AD  G+V F+   AEIARGA AP++ PVWQR   +AR+PPRIT  H+EY++    D    
Sbjct  164   ADGFGIVQFMKATAEIARGAFAPSILPVWQRALLTARDPPRITFRHYEYDQ--VVDMKSG  221

Query  875   NIPLDNLVHRSFLFGPTEISVLRSSLPPHLRKCSTVEILTALVWRCRTIALGFHPDEEVR  696
              IP+++ + + F F   +IS LR +LP HL  C + E+LTA VWR RTIAL F P+EEVR
Sbjct  222   LIPVNSKIDQLFFFSQLQISTLRQTLPAHLHDCPSFEVLTAYVWRLRTIALQFKPEEEVR  281

Query  695   MLLLINARFKFKDTPMPSGYTGNAFAYPGAKTTAGKLRKNPLGYAVELVTSIKRCFSEEY  516
              L ++N R K     +P GY GNA   P   TTA KL  NPLGYAV+L+   K   + EY
Sbjct  282   FLCVMNLRSKID---IPLGYYGNAVVVPAVITTAAKLCGNPLGYAVDLIRKAKAKATMEY  338

Query  515   MQSMVDLMVLKGRPPFHVAGSFIMSDLTRSKISDVDYGWGKPVFGGPAHGGAGDVPGVIT  336
             ++S VDLMV+KGRP F V GSF+MSDLTR  + +VD+GWGK +FGGP   GA    G+++
Sbjct  339   IKSTVDLMVIKGRPYFTVVGSFMMSDLTRIGVENVDFGWGKAIFGGPTTTGARITRGLVS  398

Query  335   FHVPYENKKGENGTLIPICLPAFALDKF  252
             F VP+ N+ GE GT + +CLP  A+++F
Sbjct  399   FCVPFMNRNGEKGTALSLCLPPPAMERF  426



>ref|XP_008343918.1| PREDICTED: methanol O-anthraniloyltransferase-like [Malus domestica]
 gb|AAU14879.2| alcohol acyl transferase [Malus domestica]
 gb|AGW30200.1| alcohol acyl transferase [Malus domestica]
Length=455

 Score =   415 bits (1066),  Expect = 4e-137, Method: Compositional matrix adjust.
 Identities = 201/395 (51%), Positives = 278/395 (70%), Gaps = 12/395 (3%)
 Frame = -1

Query  1412  YRNEPSMS-GKDPVQVIRQALAKALVFFYPFAGRLREGPGRKLMVDCTGEGVMFIEADAD  1236
             Y++ PS++  ++PV+ IR+AL++ALV++YP AGRLREGP RKL+VDC GEG++F+EA AD
Sbjct  49    YKDNPSLNKNRNPVKAIREALSRALVYYYPLAGRLREGPNRKLVVDCNGEGILFVEASAD  108

Query  1235  ATLQHFAIGGELKPPFPCFDQLLYNVPGSAEILNSPLFLIQVTRLRCGGFIFTLRMNHTM  1056
              TL+   +G ++ PP P  ++ LYN PGS  I++ PL LIQVT L CGGFI  LR+NHTM
Sbjct  109   VTLEQ--LGDKILPPCPLLEEFLYNFPGSDGIIDCPLLLIQVTCLTCGGFILALRLNHTM  166

Query  1055  ADASGLVHFLNTIAEIARGAEAPAVQPVWQREFFSARNPPRITCTHFEYEEEPA-ADSMV  879
              DA+GL+ FL  IAE+ARGA AP++ PVW+RE   AR+PPRITC H EYE+    +D   
Sbjct  167   CDAAGLLLFLTAIAEMARGAHAPSILPVWERELLFARDPPRITCAHHEYEDVIGHSDGSY  226

Query  878   TNIPLDNLVHRSFLFGPTEISVLRSSLPPHL-RKCSTVEILTALVWRCRTIALGFHPDEE  702
              +    N+V RSF FG  E+ VLR  +PPHL   CST +++TA +W+CRT+AL  +P E 
Sbjct  227   ASSNQSNMVQRSFYFGAKEMRVLRKQIPPHLISTCSTFDLITACLWKCRTLALNINPKEA  286

Query  701   VRMLLLINARFKFKDTPMPSGYTGNAFAYPGAKTTAGKLRKNPLGYAVELVTSIKRCFSE  522
             VR+  ++NAR K  +  +P GY GNAFA+P A + A  L KNPLGYA+ELV   K   +E
Sbjct  287   VRVSCIVNARGKHNNVRLPLGYYGNAFAFPAAISKAEPLCKNPLGYALELVKKAKATMNE  346

Query  521   EYMQSMVDLMVLKGRPPFHVAGSF-IMSDLTRSKISDVDYGWGKPVFGGPAHGGAGDVPG  345
             EY++S+ DL+VL+GRP +   GS+ I+SD TR    DV++GWG+PVF GP          
Sbjct  347   EYLRSVADLLVLRGRPQYSSTGSYLIVSDNTRVGFGDVNFGWGQPVFAGPVKA-----LD  401

Query  344   VITFHVPYENKKGENGTLIPICLPAFALDKFVNEL  240
             +I+F+V ++N   E+G L+P+CLP+ A+++F  EL
Sbjct  402   LISFYVQHKNNT-EDGILVPMCLPSSAMERFQQEL  435



>dbj|BAK02525.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=470

 Score =   415 bits (1067),  Expect = 4e-137, Method: Compositional matrix adjust.
 Identities = 200/392 (51%), Positives = 275/392 (70%), Gaps = 10/392 (3%)
 Frame = -1

Query  1382  DPVQVIRQALAKALVFFYPFAGRLREGPGRKLMVDCTGEGVMFIEADADATLQHFAIGGE  1203
             DP  V+R A+A ALV +YP +GRLRE  GRKL VDCTGEGV+F+EADAD  L+ F  G +
Sbjct  62    DPAAVLRDAIAAALVHYYPLSGRLRELEGRKLAVDCTGEGVLFVEADADVRLEQF--GAD  119

Query  1202  LKPPFPCFDQLLYNVPGSAEILNSPLFLIQVTRLRCGGFIFTLRMNHTMADASGLVHFLN  1023
              +PPFPC D+L+++VPGS+ +L +PLFL QVTRL CGGF+F +RM HT+AD +GLV FL 
Sbjct  120   PQPPFPCLDELMFDVPGSSALLGTPLFLFQVTRLACGGFVFGVRMQHTIADGAGLVQFLC  179

Query  1022  TIAEIARGAEAPAVQPVWQREFFSA-RNPPRI--TCTHFEYEEEPAADSMVTNIPLDNLV  852
              + E+A GA AP V+PVW RE   A R+  R+  +  H EY+E P  D+  T +P+D++ 
Sbjct  180   AVEEMAGGAAAPTVRPVWGRELLEAPRDSDRLPRSFAHREYDEVP--DTNGTIVPVDSMA  237

Query  851   HRSFLFGPTEISVLRSSLPPHLRKCSTV-EILTALVWRCRTIALGFHPDEEVRMLLLINA  675
             HRSF FGP E++ +RS LPP LR+ +T  E L   +WRCRT+AL    +EE+RM+ ++N 
Sbjct  238   HRSFFFGPQEMAAIRSHLPPSLRRSATTFEALAGCLWRCRTVALAPGDEEEMRMICIVNL  297

Query  674   RFKFKDTPMPSGYTGNAFAYPGAKTTAGKLRKNPLGYAVELVTSIKRCFSEEYMQSMVDL  495
             R K   + +P GY GNAFA+P A +TAG L + P+GYAV LV   KR    EY+QS+  L
Sbjct  298   RGK--SSIVPRGYYGNAFAFPAAVSTAGNLCRKPVGYAVGLVRKAKREVDMEYLQSVARL  355

Query  494   MVLKGRPPFHVAGSFIMSDLTRSKISDVDYGWGKPVFGGPAHGGAGDVPGVITFHVPYEN  315
             MV + RP   V  ++++SD++++ I D D+GWGKPV+GGPA GG G +PG+ +F + + N
Sbjct  356   MVRRQRPGITVVRAYLVSDVSKTGIRDFDFGWGKPVYGGPAKGGVGTIPGIASFFIAFRN  415

Query  314   KKGENGTLIPICLPAFALDKFVNELANTFLRA  219
              KGE+G ++P+CLP  A+DKFV E+    + A
Sbjct  416   AKGEDGIVVPVCLPHAAMDKFVEEMGKLLMPA  447



>ref|XP_008391402.1| PREDICTED: methanol O-anthraniloyltransferase-like [Malus domestica]
Length=459

 Score =   414 bits (1065),  Expect = 6e-137, Method: Compositional matrix adjust.
 Identities = 201/401 (50%), Positives = 281/401 (70%), Gaps = 14/401 (3%)
 Frame = -1

Query  1412  YRNEPSMS-GKDPVQVIRQALAKALVFFYPFAGRLREGPGRKLMVDCTGEGVMFIEADAD  1236
             Y++ PS+   ++PV+ IR+AL++ALV++YP AGRLREGP RKLMVDC GEG++F+EA AD
Sbjct  49    YKDNPSLKENRNPVKAIREALSRALVYYYPLAGRLREGPNRKLMVDCNGEGILFVEASAD  108

Query  1235  ATLQHFAIGGELKPPFPCFDQLLYNVPGSAEILNSPLFLIQVTRLRCGGFIFTLRMNHTM  1056
              TL+   +G ++ PP P  ++ L N PGS  I+  PL L+QVTRL CGGFI  LR+NHTM
Sbjct  109   VTLEQ--LGDKILPPCPLLEEFLVNFPGSDGIIGCPLLLVQVTRLTCGGFILALRLNHTM  166

Query  1055  ADASGLVHFLNTIAEIARGAEAPAVQPVWQREFFSARNPPRITCTHFEYEE--EPAADSM  882
              DA GL+ FL  IAE+ARGA AP++ PVW+RE  SAR+PPRITC H EYE+  + +  S 
Sbjct  167   CDAPGLLQFLTAIAEMARGAHAPSILPVWERELLSARDPPRITCVHHEYEDVIDHSDGSY  226

Query  881   VTNIPLDNLVHRSFLFGPTEISVLRSSLPPHL-RKCSTVEILTALVWRCRTIALGFHPDE  705
              ++ P  N+V RSF FG  E+ +LR  +PPHL   CST +++TA +W+CRT+AL  +P +
Sbjct  227   ASSNP-SNMVQRSFYFGAKEMRILRKQIPPHLISTCSTFDLITACLWKCRTLALKINPKQ  285

Query  704   EVRMLLLINARFKFKDTPMPSGYTGNAFAYPGAKTTAGKLRKNPLGYAVELVTSIKRCFS  525
              VR+  ++NAR K  +  +P GY GNAFA+P A + A  L KNP+GYA+ELV   K   +
Sbjct  286   VVRVSCIVNARGKHHNVRLPLGYYGNAFAFPAAVSKAEPLCKNPMGYALELVKKAKATMN  345

Query  524   EEYMQSMVDLMVLKGRPPFHVAGSF-IMSDLTRSKISDVDYGWGKPVFGGPAHGGAGDVP  348
             EEY++S+ DL+VL+GRP +   GS+ I+SD TR+   DV++GWG+P+F GPA        
Sbjct  346   EEYLRSVADLLVLRGRPQYSSTGSYLIVSDNTRAGFGDVNFGWGQPIFAGPAKAL-----  400

Query  347   GVITFHVPYENKKGENGTLIPICLPAFALDKFVNELANTFL  225
              +I+F+V ++N   E+G L+P+CLP  A+++F  EL    L
Sbjct  401   DLISFYVQHKN-NSEDGILVPMCLPFSAMERFQQELERITL  440



>gb|AGW30203.1| alcohol acyl transferase [Malus domestica]
Length=455

 Score =   414 bits (1064),  Expect = 8e-137, Method: Compositional matrix adjust.
 Identities = 201/395 (51%), Positives = 279/395 (71%), Gaps = 12/395 (3%)
 Frame = -1

Query  1412  YRNEPSMS-GKDPVQVIRQALAKALVFFYPFAGRLREGPGRKLMVDCTGEGVMFIEADAD  1236
             Y++ PS++  ++PV+VIR+AL++ALV++YP AGRLREGP RKL+VDC GEG++FIEA AD
Sbjct  49    YKDNPSLNKNRNPVKVIREALSRALVYYYPLAGRLREGPNRKLVVDCNGEGILFIEASAD  108

Query  1235  ATLQHFAIGGELKPPFPCFDQLLYNVPGSAEILNSPLFLIQVTRLRCGGFIFTLRMNHTM  1056
              TL+   +G ++ PP P  ++ L+N PGS  I+  PL L+QVT L CGGFI  LR+NHTM
Sbjct  109   VTLEQ--LGDKILPPCPLLEEFLFNFPGSDGIIGCPLVLVQVTCLTCGGFILALRLNHTM  166

Query  1055  ADASGLVHFLNTIAEIARGAEAPAVQPVWQREFFSARNPPRITCTHFEYEEEPA-ADSMV  879
              DA+GL+ FL  IAE+ARGA AP++ PVW+RE   AR+PPRITC H EYE+    +D   
Sbjct  167   CDAAGLLLFLTAIAEMARGAHAPSILPVWERELLFARDPPRITCAHHEYEDVIGHSDGSY  226

Query  878   TNIPLDNLVHRSFLFGPTEISVLRSSLPPHL-RKCSTVEILTALVWRCRTIALGFHPDEE  702
              +    N+V RSF FG  E+ VLR  +PPHL   CST +++TA +W+CRT+AL  +P E 
Sbjct  227   ASSNQSNMVQRSFYFGAKEMRVLRKQIPPHLISTCSTFDLITACLWKCRTLALNINPKEA  286

Query  701   VRMLLLINARFKFKDTPMPSGYTGNAFAYPGAKTTAGKLRKNPLGYAVELVTSIKRCFSE  522
             VR+  ++NAR K  +  +P GY GNAFA+P A + A  L KNPLGYA+ELV   K   +E
Sbjct  287   VRVSCIVNARGKHNNVRLPLGYYGNAFAFPAAISKAEPLCKNPLGYALELVKKAKATMNE  346

Query  521   EYMQSMVDLMVLKGRPPFHVAGSF-IMSDLTRSKISDVDYGWGKPVFGGPAHGGAGDVPG  345
             EY++S+ DL+VL+GRP +   GS+ I+SD TR+   DV++GWG+PVF GP          
Sbjct  347   EYLRSVADLLVLRGRPQYSSTGSYLIVSDNTRAGFGDVNFGWGQPVFAGPVKAL-----D  401

Query  344   VITFHVPYENKKGENGTLIPICLPAFALDKFVNEL  240
             +I+F+V ++N   E+G L+P+CLP+ A+++F  EL
Sbjct  402   LISFYVQHKN-NAEDGILVPMCLPSSAMERFQQEL  435



>emb|CDX78752.1| BnaA03g06640D [Brassica napus]
Length=472

 Score =   414 bits (1064),  Expect = 1e-136, Method: Compositional matrix adjust.
 Identities = 206/398 (52%), Positives = 272/398 (68%), Gaps = 6/398 (2%)
 Frame = -1

Query  1415  FYRNEPSMSGKDPVQVIRQALAKALVFFYPFAGRLREGPGRKLMVDCTGEGVMFIEADAD  1236
             FYR+ P++   DPV VIR+ALA+ LV++YP AGRLREGP RKL VDCTG+GV+FIEADAD
Sbjct  57    FYRHNPNVYS-DPVAVIRRALAQTLVYYYPLAGRLREGPNRKLAVDCTGQGVLFIEADAD  115

Query  1235  ATLQHFAIGGELKPPFPCFDQLLYNVPGSAEILNSPLFLIQVTRLRCGGFIFTLRMNHTM  1056
              TL  F     L PPFPCF++LL+++ GS+E++N+PL LIQVTRL+CGGFIF +R+NH M
Sbjct  116   VTLAEFEEKDALSPPFPCFEELLFDIEGSSEVINAPLILIQVTRLKCGGFIFAIRLNHVM  175

Query  1055  ADASGLVHFLNTIAEIARGAEAPAVQPVWQREFFSARNPPRITCTHFEYEEEPAADSMVT  876
             ADA GL  F+ TI E ARG  AP + P W+R   SAR PPR+T TH EY+E  AAD+   
Sbjct  176   ADAGGLSLFIKTIGEFARGCHAPTIPPTWERHLLSARVPPRVTQTHREYDESAAADAEPV  235

Query  875   NIPLDNLVHRSFLFGPTEISVLRSSLPPHLRKCST-VEILTALVWRCRTIALGFHPDEEV  699
                 + LV +SF FG  E+S +R  LPP +   ST +E LTA +WR RT AL    ++E+
Sbjct  236   IGDGETLVSKSFFFGGAEMSAIRKLLPPDIANRSTGLETLTAFLWRQRTAALRPDANKEM  295

Query  698   RMLLLINARFKFKDTPMPSGYTGNAFAYPGAKTTAGKLRKNPLGYAVELVTSIKRCFSEE  519
             R++ ++NAR K K+  +P GY GNAFA+P A   A  L + PL +A+ LV   K   +EE
Sbjct  296   RVIFIVNARPKLKNPTLPRGYYGNAFAFPVAIANARDLTEKPLEFALRLVKEAKASVTEE  355

Query  518   YMQSMVDLMVLKGRPPFHVAGSFIMSDLTRSKISDVDYG-WGKPVFGGPAHGGAGDVPGV  342
             YM+S+ DLMV KGRP F   G++++SD+     +D+D G WGKPV+GG    G  D  G 
Sbjct  356   YMRSLADLMVTKGRPKFLADGAYLISDV--RNFADIDLGVWGKPVYGGIGKAGVMDSLGS  413

Query  341   ITFHVPYENKKGENGTLIPICLPAFALDKFVNELANTF  228
              +F+V  EN++GE G L+P+CLP  A+ +FV EL   F
Sbjct  414   -SFYVSAENREGERGILVPVCLPEKAMQRFVEELEAVF  450



>gb|AAS79797.1| alcohol acyl transferase [Malus domestica]
Length=459

 Score =   413 bits (1062),  Expect = 2e-136, Method: Compositional matrix adjust.
 Identities = 200/395 (51%), Positives = 279/395 (71%), Gaps = 12/395 (3%)
 Frame = -1

Query  1412  YRNEPSMSGK-DPVQVIRQALAKALVFFYPFAGRLREGPGRKLMVDCTGEGVMFIEADAD  1236
             Y++ PS++   +PV+VIR+AL++ALV++YP AGRL+EGP RKLMVDC GEG++F+EA AD
Sbjct  49    YKDNPSLNKNCNPVKVIREALSRALVYYYPLAGRLKEGPNRKLMVDCNGEGILFVEASAD  108

Query  1235  ATLQHFAIGGELKPPFPCFDQLLYNVPGSAEILNSPLFLIQVTRLRCGGFIFTLRMNHTM  1056
              TL+   +G ++ PP P  ++ L+N PGS  I+  PL L+QVT L CGGFI  LR+NHTM
Sbjct  109   VTLEQ--LGDKILPPCPLLEEFLFNFPGSDGIIGCPLLLVQVTCLTCGGFILALRVNHTM  166

Query  1055  ADASGLVHFLNTIAEIARGAEAPAVQPVWQREFFSARNPPRITCTHFEYEEE-PAADSMV  879
              DA GL+ FL  IAE+ARGA AP++ PVW+RE   +R+PPRITC H EYE+    +D + 
Sbjct  167   CDAPGLLLFLTAIAEMARGAHAPSILPVWERELLFSRDPPRITCAHHEYEDVIDHSDGLY  226

Query  878   TNIPLDNLVHRSFLFGPTEISVLRSSLPPHL-RKCSTVEILTALVWRCRTIALGFHPDEE  702
              +    N+V RSF FG  E+ VLR  +PPHL   CST +++TA +W+CRT+AL  +P E 
Sbjct  227   ASSNQSNMVQRSFYFGAKEMRVLRKQIPPHLISTCSTFDLITACLWKCRTLALNINPKEA  286

Query  701   VRMLLLINARFKFKDTPMPSGYTGNAFAYPGAKTTAGKLRKNPLGYAVELVTSIKRCFSE  522
             VR+  ++NAR K  +  +P GY GNAFA+P A + A  L KNPLGYA+ELV   K   +E
Sbjct  287   VRVSCIVNARGKHNNVRLPLGYYGNAFAFPAAISKAEPLCKNPLGYALELVKKAKATMNE  346

Query  521   EYMQSMVDLMVLKGRPPFHVAGSF-IMSDLTRSKISDVDYGWGKPVFGGPAHGGAGDVPG  345
             EY++S+ DL+VL+GRP +   GS+ I+SD TR+   DV++GWG+PVF GPA         
Sbjct  347   EYLRSVADLLVLRGRPQYSSTGSYLIVSDNTRAGFGDVNFGWGQPVFAGPAKA-----LD  401

Query  344   VITFHVPYENKKGENGTLIPICLPAFALDKFVNEL  240
             +I+F+V ++N   E+G L+P+CLP+ A+++F  EL
Sbjct  402   LISFYVQHKNNT-EDGILVPMCLPSSAMERFQQEL  435



>ref|NP_001275839.1| alcohol acyl transferase [Citrus sinensis]
 gb|ABW81204.1| alcohol acyl transferase [Citrus sinensis]
Length=456

 Score =   413 bits (1061),  Expect = 2e-136, Method: Compositional matrix adjust.
 Identities = 203/404 (50%), Positives = 272/404 (67%), Gaps = 17/404 (4%)
 Frame = -1

Query  1415  FYRNEPS--MSGKDPVQVIRQALAKALVFFYPFAGRLREGPGRKLMVDCTGEGVMFIEAD  1242
             FY+N+PS  M G+DPV+VIR+A++KALVF+YP AGRL+EG  RKLMV+C  EGV+FIEAD
Sbjct  50    FYKNDPSPSMQGRDPVKVIREAISKALVFYYPLAGRLKEGYNRKLMVECNAEGVLFIEAD  109

Query  1241  ADATLQHFAIGGELKPPFPCFDQLLYNVPGSAEILNSPLFLIQVTRLRCGGFIFTLRMNH  1062
             A+ TL+   +  +++PP P  +QL+Y+VPGS  IL  PL LIQVTRL CGGFIF +R NH
Sbjct  110   ANFTLEQ--LRDDVQPPCPYLNQLIYDVPGSEGILGCPLLLIQVTRLTCGGFIFAIRFNH  167

Query  1061  TMADASGLVHFLNTIAEIARGAEAPAVQPVWQREFFSARNPPRITCTHFEYEEEPAADSM  882
             TM DA GLV FL  I ++ARG  +P + P+WQR   +ARNPP++TC H EY+E      +
Sbjct  168   TMCDAFGLVQFLKAIEDMARGERSPTLFPIWQRLILNARNPPQVTCIHHEYDE------I  221

Query  881   VTN-IPLDNLVHRSFLFGPTEISVLRSSLPPHLRKCSTVEILTALVWRCRTIALGFHPDE  705
              TN +P DN+ H+SF F    I  LR+ LP  L+ CST E+L A +W+CRTIAL   P+E
Sbjct  222   NTNEVPSDNMAHKSFFFSLKGIKALRNQLPFQLKDCSTFELLLAFLWKCRTIALKLQPEE  281

Query  704   EVRMLLLINARFKFKDTPMPSGYTGNAFAYPGAKTTAGKLRKNPLGYAVELVTSIKRCFS  525
               ++  ++N R K  +  +P GY GNAF +    + A +L KNP+GYAVELV   K   +
Sbjct  282   IAKVCCIVNVRGKSYEMDIPPGYYGNAFTFSAVCSKAEQLCKNPIGYAVELVKKAKAQMN  341

Query  524   EEYMQSMVDLMVLKGRP-PFHVAGSFIMSDLTRSKISDVDYGWGKPVFGGPAHGGAGDVP  348
             EEY++S  DLMV+KGR   F   G+FI+SDL    + DVD+GWGKP++ G A   A    
Sbjct  342   EEYIRSAADLMVIKGRRIKFSTRGNFIVSDLRNVGLGDVDFGWGKPIYAGTAGAVA----  397

Query  347   GVITFHVPYENKKGENGTLIPICLPAFALDKFVNELANTFLRAA  216
              VI+F   Y+NK GE G L+PICLP  A+++   EL    ++ +
Sbjct  398   -VISFFTKYQNKNGEPGILVPICLPQSAMERLQEELKGLMIQGS  440



>ref|XP_004294711.1| PREDICTED: benzyl alcohol O-benzoyltransferase-like [Fragaria 
vesca subsp. vesca]
Length=461

 Score =   413 bits (1061),  Expect = 2e-136, Method: Compositional matrix adjust.
 Identities = 205/397 (52%), Positives = 278/397 (70%), Gaps = 21/397 (5%)
 Frame = -1

Query  1409  RNEPSMSG-KDPVQVI-RQALAKALVFFYPFAGRLREGPGRKLMVDCTGEGVMFIEADAD  1236
             +N PSMS  KDPV VI R+A+++ALV++YP AGRLREGP RKLMVDC GEGV+F+EA AD
Sbjct  55    KNNPSMSNRKDPVPVIIREAISRALVYYYPLAGRLREGPNRKLMVDCNGEGVLFVEAKAD  114

Query  1235  ATLQHFAIGGELKPPFPCFDQLLYNVPGSAEILNSPLFLIQVTRLRCGGFIFTLRMNHTM  1056
              TL+   +G  ++PP P  +  L +VPGS  IL  PL L QVT LRCGGFI  LR+NHTM
Sbjct  115   VTLEQ--LGDAIRPPCPFLEGFLCDVPGSDGILGYPLLLFQVTILRCGGFILALRLNHTM  172

Query  1055  ADASGLVHFLNTIAEIARGAEAPAVQPVWQREFFSARNPPRITCTHFEYEE-----EPAA  891
              DA GLV FLNT+ E+A+G +AP++ PVW+RE  +AR+PPRITCTH EYEE     +P++
Sbjct  173   CDAPGLVQFLNTVGEMAQGKDAPSIPPVWKREVLNARDPPRITCTHHEYEETIDYSDPSS  232

Query  890   DSMVTNIPLDNLVHRSFLFGPTEISVLRSSLPPHLRKCSTVEILTALVWRCRTIALGFHP  711
              +  T      +V +SF FGP E+  L+  LP HL  CST +++T+ +W+CRT AL  HP
Sbjct  233   AATAT------MVEQSFYFGPKEMKALKKHLPLHLSACSTFDLMTSCLWKCRTAALELHP  286

Query  710   DEEVRMLLLINARFKFKDTPMPSGYTGNAFAYPGAKTTAGKLRKNPLGYAVELVTSIKRC  531
              + VR+  L+NAR K  +  +P GY GNAFAYP A +   +L ++PLGYAVELV   K  
Sbjct  287   KQVVRVSCLVNARGKGNNLHLPLGYYGNAFAYPAAVSEVKQLCESPLGYAVELVMKAKAE  346

Query  530   FSEEYMQSMVDLMVLKGRPPFHVAGSFIMSDLTRSKISDVDYGWGKPVFGGPAHGGAGDV  351
              +EEYM+S+ DLMVL+GRPP+  AG+F++SD  R+ + +V+ GWGKPVF GP    +   
Sbjct  347   VNEEYMRSVADLMVLRGRPPYTSAGNFLVSDNRRTGLGEVNLGWGKPVFSGPPKALSN--  404

Query  350   PGVITFHVPYENKKGENGTLIPICLPAFALDKFVNEL  240
                I+F+V ++ +K E+G L+ +CLP +++ +F  EL
Sbjct  405   ---ISFYVQHKKEK-EDGILVSVCLPLWSMKRFQQEL  437



>sp|Q5H873.1|HLTT_LUPAL RecName: Full=13-hydroxylupanine O-tigloyltransferase; AltName: 
Full=(-)-13alpha-hydroxymultiflorine/(+)-13alpha-hydroxylupanine 
O-tigloyltransferase; Short=HMT/HLTase; AltName: Full=Quinolizidine 
alkaloid O-tigloyltransferase [Lupinus albus]
 dbj|BAD89275.1| (-)-13alpha-hydroxymultiflorine/(+)-13alpha- hydroxylupanine 
O-tigloyltransferase [Lupinus albus]
Length=453

 Score =   412 bits (1060),  Expect = 3e-136, Method: Compositional matrix adjust.
 Identities = 210/401 (52%), Positives = 269/401 (67%), Gaps = 18/401 (4%)
 Frame = -1

Query  1412  YRNEPSMSGKDPVQVIRQALAKALVFFYPFAGRLREGPGRKLMVDCTGEGVMFIEADADA  1233
             YRN PSM GKDPV++IR+AL+K LVF+YPFAGRLR GP  KLMVDCTGEGV+FIEADAD 
Sbjct  52    YRNNPSMEGKDPVEIIREALSKTLVFYYPFAGRLRNGPNGKLMVDCTGEGVIFIEADADV  111

Query  1232  TLQHFAIGGELKPPFPCFDQLLYNVPGSAEILNSPLFLIQVTRLRCGGFIFTLRMNHTMA  1053
             TL  F I  +L PPFPCFDQLLY+VPGS  IL+SPL LIQVTRL+CGGFIF +R+NH M 
Sbjct  112   TLDQFGI--DLHPPFPCFDQLLYDVPGSDGILDSPLLLIQVTRLKCGGFIFAVRLNHAMC  169

Query  1052  DASGLVHFLNTIAEIARGAEAPAVQPVWQREFFSARNPPRITCTHFEYEEEPAADSMVTN  873
             DA G+  F+  +AEIARG   P + PVW RE   ARNPP++T  H EY++ P  ++    
Sbjct  170   DAIGMSQFMKGLAEIARGEPKPFILPVWHRELLCARNPPKVTFIHNEYQKPPHDNNNNNF  229

Query  872   IPLDNLVHRSFLFGPTEISVLRSSLPPHLRKCSTVEILTALVWRCRTIALG-FHPDEEVR  696
             I    L H SF FGP E+  +R  LP H  K +T +ILTA +WRCRT+AL   +P+ E R
Sbjct  230   I----LQHSSFFFGPNELDAIRRLLPYHHSKSTTSDILTAFLWRCRTLALQPENPNHEFR  285

Query  695   MLLLINARF---KFKDTPMPSGYTGNAFAYPGAKTTAGKLRKNPLGYAVELVTSIKRCFS  525
             +L ++NAR+    F + P+P G+ GNAF  P A +T  KL  NPL YA+EL+   K   +
Sbjct  286   LLYILNARYGRCSF-NPPLPEGFYGNAFVSPAAISTGEKLCNNPLEYALELMKEAKSKGT  344

Query  524   EEYMQSMVDLMVLKGRPP--FHVAGSFIMSDLTRSKISDVDYGWGKPVFGGPAHGGAGDV  351
             EEY+ S+ DLMV+KGRP   ++  G   +SDLT+++  DVD+GWGK V+GG   G    +
Sbjct  345   EEYVHSVADLMVIKGRPSYFYNDVGYLEVSDLTKARFRDVDFGWGKAVYGGATQGYFSSI  404

Query  350   PGVITFHVPYENKKGENGTLIPICLPAFALDKFVNELANTF  228
                   +V Y N KG  G +    LP  A+++F  EL + F
Sbjct  405   -----LYVSYTNSKGVEGIMALTSLPTKAMERFEKELDDLF  440



>ref|XP_009368287.1| PREDICTED: methanol O-anthraniloyltransferase-like [Pyrus x bretschneideri]
Length=463

 Score =   412 bits (1060),  Expect = 3e-136, Method: Compositional matrix adjust.
 Identities = 199/395 (50%), Positives = 280/395 (71%), Gaps = 8/395 (2%)
 Frame = -1

Query  1412  YRNEPSMS-GKDPVQVIRQALAKALVFFYPFAGRLREGPGRKLMVDCTGEGVMFIEADAD  1236
             Y++ PS++  ++PVQVIR+AL++ALV++YP AGRLREGP +KL+VDC GEG++F+EA AD
Sbjct  49    YKDNPSVNKNRNPVQVIREALSRALVYYYPLAGRLREGPNKKLVVDCNGEGILFVEASAD  108

Query  1235  ATLQHFAIGGELKPPFPCFDQLLYNVPGSAEILNSPLFLIQVTRLRCGGFIFTLRMNHTM  1056
              TL+   +G ++ PP P  ++ L+N PGS  I+  PL L+QVT L CGGFI  LR+NHTM
Sbjct  109   VTLEQ--LGDKILPPCPLLEEFLFNFPGSDGIIGCPLLLVQVTCLTCGGFILALRLNHTM  166

Query  1055  ADASGLVHFLNTIAEIARGAEAPAVQPVWQREFFSARNPPRITCTHFEYEEE-PAADSMV  879
              DA GL+ FL  IAE+ARGA AP++ PVW+RE   AR+PPRITC H EYE+    +D   
Sbjct  167   CDAPGLLLFLKAIAEMARGAHAPSILPVWERELLFARDPPRITCAHHEYEDVIDHSDGSY  226

Query  878   TNIPLDNLVHRSFLFGPTEISVLRSSLPPHL-RKCSTVEILTALVWRCRTIALGFHPDEE  702
              +    N+V RSF FG  E+ VLR  +PPHL   CST +++TA +W+CRT+AL  +P + 
Sbjct  227   ASSNQSNMVQRSFYFGAKEMRVLRKQIPPHLISTCSTFDLITACLWKCRTLALRINPKQV  286

Query  701   VRMLLLINARFKFKDTPMPSGYTGNAFAYPGAKTTAGKLRKNPLGYAVELVTSIKRCFSE  522
             VR+  ++NAR K  +  +P GY GNAFA+P A + A  L KNPLGYA+ELV   K   +E
Sbjct  287   VRVSCMVNARGKHHNVRLPLGYYGNAFAFPAAVSKAESLCKNPLGYALELVKKAKATMNE  346

Query  521   EYMQSMVDLMVLKGRPPFHVAGS-FIMSDLTRSKISDVDYGWGKPVFGGPAHGGAGDVPG  345
             EY++S+ DL+VL+GRP +   GS F++SD+TR    DV++GWG+PVF GP    +  +  
Sbjct  347   EYLRSVADLLVLRGRPRYSSTGSNFLVSDITRVGFGDVNFGWGQPVFAGPTKAISAAL-D  405

Query  344   VITFHVPYENKKGENGTLIPICLPAFALDKFVNEL  240
             +I+F+V ++N   E+G L+P+CLP+ A+++F  EL
Sbjct  406   LISFYVQHKNNT-EDGILVPMCLPSSAMERFQQEL  439



>ref|XP_004156759.1| PREDICTED: benzyl alcohol O-benzoyltransferase-like [Cucumis 
sativus]
Length=455

 Score =   412 bits (1059),  Expect = 4e-136, Method: Compositional matrix adjust.
 Identities = 198/388 (51%), Positives = 266/388 (69%), Gaps = 8/388 (2%)
 Frame = -1

Query  1412  YRNEPSMSGKDPVQVIRQALAKALVFFYPFAGRLREGPGRKLMVDCTGEGVMFIEADADA  1233
             Y + PS+ G+DPV+VI++A+ KALVF+YP AGRLREGPGRKL V+CTGEG++F+EADAD 
Sbjct  53    YHHNPSLEGRDPVKVIKEAIGKALVFYYPLAGRLREGPGRKLFVECTGEGILFVEADADV  112

Query  1232  TLQHFAIGGELKPPFPCFD-QLLYNVPGSAEILNSPLFLIQVTRLRCGGFIFTLRMNHTM  1056
             +L+ F     L       +  +L+N   S  +LNSPL LIQVTRL+CGGFIF L +NH++
Sbjct  113   SLEQFR--DTLPYSLSSMEINILHNALNSDGVLNSPLLLIQVTRLKCGGFIFGLHLNHSV  170

Query  1055  ADASGLVHFLNTIAEIARGAEAPAVQPVWQREFFSARNPPRITCTHFEYEEEPAADSMVT  876
             AD  G+V F+   AEIARGA AP++ PVWQR   +AR+PPRIT  H+EY++    D+  T
Sbjct  171   ADGFGIVQFIKATAEIARGAFAPSILPVWQRALLTARDPPRITFRHYEYDQ--VVDTKST  228

Query  875   NIPLDNLVHRSFLFGPTEISVLRSSLPPHLRKCSTVEILTALVWRCRTIALGFHPDEEVR  696
              IP++N++ + F F   +IS L  +LP HL  CS+ E+  A VWR RTIAL F P+EEVR
Sbjct  229   LIPVNNMIDQLFFFSQHQISTLCQTLPAHLHDCSSFEVFAAYVWRLRTIALQFKPEEEVR  288

Query  695   MLLLINARFKFKDTPMPSGYTGNAFAYPGAKTTAGKLRKNPLGYAVELVTSIKRCFSEEY  516
              L ++N R K     +P GY GNA   P   TT  KL  NPLGYA++L+   K   + EY
Sbjct  289   FLCVVNIRSKID---IPLGYYGNAIVVPAVITTVAKLCGNPLGYAIDLIRKAKAKATTEY  345

Query  515   MQSMVDLMVLKGRPPFHVAGSFIMSDLTRSKISDVDYGWGKPVFGGPAHGGAGDVPGVIT  336
             ++SMVDLMV+KGRP     GSFIMSD+TR    +VD+GW K +FGGP  GG+G + G+ +
Sbjct  346   IKSMVDLMVIKGRPCLTTVGSFIMSDVTRIGFENVDFGWEKAIFGGPITGGSGIIRGMTS  405

Query  335   FHVPYENKKGENGTLIPICLPAFALDKF  252
             F +P+ N+ GE G ++ +CLP  A+ +F
Sbjct  406   FCIPFMNRNGEKGIVVSLCLPPPAMGRF  433



>gb|AGW30201.1| alcohol acyl transferase [Malus domestica]
Length=455

 Score =   412 bits (1058),  Expect = 5e-136, Method: Compositional matrix adjust.
 Identities = 199/394 (51%), Positives = 277/394 (70%), Gaps = 12/394 (3%)
 Frame = -1

Query  1412  YRNEPSMS-GKDPVQVIRQALAKALVFFYPFAGRLREGPGRKLMVDCTGEGVMFIEADAD  1236
             Y++ PS++  ++PV+ IR+AL++ALV++YP AGRLREGP RKL+VDC GEG++F+EA AD
Sbjct  49    YKDNPSLNKNRNPVKAIREALSRALVYYYPLAGRLREGPNRKLVVDCNGEGILFVEASAD  108

Query  1235  ATLQHFAIGGELKPPFPCFDQLLYNVPGSAEILNSPLFLIQVTRLRCGGFIFTLRMNHTM  1056
              TL+   +G ++ PP P  ++ LYN PGS  I++ PL LIQVT L CGGFI  LR+NHTM
Sbjct  109   VTLEQ--LGDKILPPCPLLEEFLYNFPGSDGIIDCPLLLIQVTCLTCGGFILALRLNHTM  166

Query  1055  ADASGLVHFLNTIAEIARGAEAPAVQPVWQREFFSARNPPRITCTHFEYEEE-PAADSMV  879
              DA GL+ FL  IAE+ARGA AP++ PVW+RE   ARNPPRITC H EYE+    +D   
Sbjct  167   CDAFGLLQFLTAIAEMARGAHAPSILPVWERELLFARNPPRITCAHHEYEDVIDHSDGSY  226

Query  878   TNIPLDNLVHRSFLFGPTEISVLRSSLPPHL-RKCSTVEILTALVWRCRTIALGFHPDEE  702
             T+    N+V RSF FG  E+ VLR  +P HL   CST +++TA +W+CRT+AL  +P + 
Sbjct  227   TSSNQSNMVQRSFYFGAKEMRVLRKQIPRHLISTCSTFDLITACLWKCRTLALKINPKQA  286

Query  701   VRMLLLINARFKFKDTPMPSGYTGNAFAYPGAKTTAGKLRKNPLGYAVELVTSIKRCFSE  522
             VR+   +NAR K  +  +P GY GNAFA+P A + A  L KNP+GYA+ELV   K   +E
Sbjct  287   VRVSCTVNARGKHHNVRLPLGYYGNAFAFPAAVSKAEPLCKNPMGYALELVKKAKATMNE  346

Query  521   EYMQSMVDLMVLKGRPPFHVAGSF-IMSDLTRSKISDVDYGWGKPVFGGPAHGGAGDVPG  345
             EY++S+ DL+VL+GRP +   GS+ I+SD TR+   DV++GWG+PVF GPA         
Sbjct  347   EYLRSVADLLVLRGRPQYSSTGSYLIVSDNTRAGFGDVNFGWGQPVFAGPAKA-----LD  401

Query  344   VITFHVPYENKKGENGTLIPICLPAFALDKFVNE  243
             +++F+V ++N   E+G L+P+CLP+ A+++F  E
Sbjct  402   LVSFYVQHKNNT-EDGILVPMCLPSSAMERFQQE  434



>gb|AGW30205.1| alcohol acyl transferase [Malus domestica]
Length=455

 Score =   411 bits (1057),  Expect = 7e-136, Method: Compositional matrix adjust.
 Identities = 201/395 (51%), Positives = 276/395 (70%), Gaps = 12/395 (3%)
 Frame = -1

Query  1412  YRNEPSMS-GKDPVQVIRQALAKALVFFYPFAGRLREGPGRKLMVDCTGEGVMFIEADAD  1236
             Y+  PS++  ++PV+VIR+AL++ALV++YP AGRLREGP +KL+VDC GEG++F+EA AD
Sbjct  49    YKANPSLNKNRNPVKVIREALSRALVYYYPLAGRLREGPNKKLVVDCNGEGILFVEASAD  108

Query  1235  ATLQHFAIGGELKPPFPCFDQLLYNVPGSAEILNSPLFLIQVTRLRCGGFIFTLRMNHTM  1056
              TL+   +G ++ PP P  ++ L+N PGS  I+  PL L+QVT L CGGFI  LR+NHTM
Sbjct  109   VTLEQ--LGDKILPPCPLLEEFLFNFPGSGGIIGCPLLLVQVTCLTCGGFILALRLNHTM  166

Query  1055  ADASGLVHFLNTIAEIARGAEAPAVQPVWQREFFSARNPPRITCTHFEYEEE-PAADSMV  879
              DASGL+ FL  IAE+ARGA AP++ PVW+RE   ARNPPRITC H EYE+    +D   
Sbjct  167   CDASGLLLFLTAIAEMARGAHAPSILPVWERELLFARNPPRITCAHHEYEDVIDHSDGSY  226

Query  878   TNIPLDNLVHRSFLFGPTEISVLRSSLPPHL-RKCSTVEILTALVWRCRTIALGFHPDEE  702
                   N+V RSF FG  E+ VLR  +PPHL   CST +++TA +W+CRT+AL  +P + 
Sbjct  227   AFSNQSNMVQRSFYFGAKEMRVLRKQIPPHLISTCSTFDLITACLWKCRTLALKINPKQA  286

Query  701   VRMLLLINARFKFKDTPMPSGYTGNAFAYPGAKTTAGKLRKNPLGYAVELVTSIKRCFSE  522
             VR+  ++NAR K  +  +P GY GNAFAYP A + A  L KNPLGYA+ELV   K   +E
Sbjct  287   VRVSCIVNARGKHHNVRLPLGYYGNAFAYPAAVSKAEPLCKNPLGYALELVKKAKATMNE  346

Query  521   EYMQSMVDLMVLKGRPPFHVAGSF-IMSDLTRSKISDVDYGWGKPVFGGPAHGGAGDVPG  345
             EY++S+ DLMVL+GRP +   G + I+SD TR+   DV++GWG+PVF GPA         
Sbjct  347   EYLRSVADLMVLRGRPQYSTTGCYLIVSDNTRAGFGDVNFGWGEPVFAGPAKA-----LD  401

Query  344   VITFHVPYENKKGENGTLIPICLPAFALDKFVNEL  240
             +I+F+V ++N   E+G L+P+CL + A+++F  EL
Sbjct  402   LISFYVQHKNNT-EDGILVPMCLSSSAMERFQQEL  435



>gb|ABN48480.1| quinolizidine alkaloid O-tigloyltransferase [Lupinus albus]
Length=453

 Score =   411 bits (1057),  Expect = 8e-136, Method: Compositional matrix adjust.
 Identities = 210/401 (52%), Positives = 268/401 (67%), Gaps = 18/401 (4%)
 Frame = -1

Query  1412  YRNEPSMSGKDPVQVIRQALAKALVFFYPFAGRLREGPGRKLMVDCTGEGVMFIEADADA  1233
             YRN PSM GKDPV +IR+AL+K LVF+YPFAGRLR GP  KLMVDCTGEGV+FIEADAD 
Sbjct  52    YRNNPSMEGKDPVAIIREALSKTLVFYYPFAGRLRNGPNGKLMVDCTGEGVIFIEADADV  111

Query  1232  TLQHFAIGGELKPPFPCFDQLLYNVPGSAEILNSPLFLIQVTRLRCGGFIFTLRMNHTMA  1053
             TL  F I  +L PPFPCFDQLLY+VPGS  IL+SPL LIQVTRL+CGGFIF +R+NH M 
Sbjct  112   TLDQFGI--DLHPPFPCFDQLLYDVPGSDGILDSPLLLIQVTRLKCGGFIFAVRLNHAMC  169

Query  1052  DASGLVHFLNTIAEIARGAEAPAVQPVWQREFFSARNPPRITCTHFEYEEEPAADSMVTN  873
             DA G+  F+  +AEIARG   P + PVW RE   ARNPP++T  H EY++ P  ++    
Sbjct  170   DAIGMSQFMKGLAEIARGEPKPFILPVWXRELLCARNPPKVTFIHNEYQKPPHDNNNNNF  229

Query  872   IPLDNLVHRSFLFGPTEISVLRSSLPPHLRKCSTVEILTALVWRCRTIALG-FHPDEEVR  696
             I    L H SF FGP E+  +R  LP H  K +T +ILTA +WRCRT+AL   +P+ E R
Sbjct  230   I----LQHSSFFFGPNELDAIRRLLPYHHSKSTTSDILTAFLWRCRTLALQPENPNHEFR  285

Query  695   MLLLINARF---KFKDTPMPSGYTGNAFAYPGAKTTAGKLRKNPLGYAVELVTSIKRCFS  525
             +L ++NAR+    F + P+P G+ GNAF  P A +T  KL  NPL YA+EL+   K   +
Sbjct  286   LLYILNARYGRCSF-NPPLPEGFYGNAFVSPAAISTGEKLCNNPLEYALELMKEAKSKGT  344

Query  524   EEYMQSMVDLMVLKGRPP--FHVAGSFIMSDLTRSKISDVDYGWGKPVFGGPAHGGAGDV  351
             EEY+ S+ DLMV+KGRP   ++  G   +SDLT+++  DVD+GWGK V+GG   G    +
Sbjct  345   EEYVHSVADLMVIKGRPSYFYNDVGYLEVSDLTKARFRDVDFGWGKAVYGGATQGYFSSI  404

Query  350   PGVITFHVPYENKKGENGTLIPICLPAFALDKFVNELANTF  228
                   +V Y N KG  G +    LP  A+++F  EL + F
Sbjct  405   -----LYVSYTNSKGVEGIMALTSLPTKAMERFEKELDDLF  440



>ref|XP_008384757.1| PREDICTED: methanol O-anthraniloyltransferase-like [Malus domestica]
Length=459

 Score =   411 bits (1056),  Expect = 1e-135, Method: Compositional matrix adjust.
 Identities = 201/395 (51%), Positives = 275/395 (70%), Gaps = 12/395 (3%)
 Frame = -1

Query  1412  YRNEPSMS-GKDPVQVIRQALAKALVFFYPFAGRLREGPGRKLMVDCTGEGVMFIEADAD  1236
             Y+  PS++  ++PV+VIR+AL++ALV++YP AGRLREGP +KL+VDC GEG++F+EA AD
Sbjct  49    YKANPSLNKNRNPVKVIREALSRALVYYYPLAGRLREGPNKKLVVDCNGEGILFVEASAD  108

Query  1235  ATLQHFAIGGELKPPFPCFDQLLYNVPGSAEILNSPLFLIQVTRLRCGGFIFTLRMNHTM  1056
              TL+   +G  + PP P  ++ L+N PGS  I+  PL L+QVT L CGGFI  LR+NHTM
Sbjct  109   VTLEQ--LGDXILPPCPLLEEFLFNFPGSDGIIGCPLLLVQVTCLTCGGFILALRLNHTM  166

Query  1055  ADASGLVHFLNTIAEIARGAEAPAVQPVWQREFFSARNPPRITCTHFEYEEE-PAADSMV  879
              DASGL+ FL  IAE+ARGA AP++ PVW+R  F ARNPPRITC H EYE+    +D   
Sbjct  167   CDASGLLLFLTAIAEMARGAHAPSILPVWERXLFFARNPPRITCAHHEYEDVIDHSDGSY  226

Query  878   TNIPLDNLVHRSFLFGPTEISVLRSSLPPHL-RKCSTVEILTALVWRCRTIALGFHPDEE  702
                   N+V RSF FG  E+ V R  +PPHL   CST +++TA +W+CRT+AL  +P + 
Sbjct  227   AFSNQSNMVQRSFYFGAKEMRVJRKQIPPHLISTCSTFDLITACLWKCRTLALKINPKQA  286

Query  701   VRMLLLINARFKFKDTPMPSGYTGNAFAYPGAKTTAGKLRKNPLGYAVELVTSIKRCFSE  522
             VR+  ++NAR K  +  +P GY GNAFAYP A + A  L KNPLGYA+ELV   K   +E
Sbjct  287   VRVSCIVNARGKHHNXRLPLGYYGNAFAYPAAVSKAEPLCKNPLGYALELVKKAKATMNE  346

Query  521   EYMQSMVDLMVLKGRPPFHVAGSF-IMSDLTRSKISDVDYGWGKPVFGGPAHGGAGDVPG  345
             EY++S+ DL VL+GRP +   GS+ I+SD TR+   DV++GWG+PVF GPA         
Sbjct  347   EYLRSVADLXVLRGRPQYSSTGSYLIVSDNTRAGFGDVNFGWGQPVFAGPAKAL-----D  401

Query  344   VITFHVPYENKKGENGTLIPICLPAFALDKFVNEL  240
             +I+F+V ++N   E+G L+P+CLP+ A+++F  EL
Sbjct  402   LISFYVQHKNNT-EDGILVPMCLPSSAMERFQQEL  435



>ref|XP_003626382.1| Benzoyl coenzyme A benzyl alcohol benzoyl transferase [Medicago 
truncatula]
 gb|AES82600.1| benzyl alcohol O-benzoyltransferase [Medicago truncatula]
Length=462

 Score =   410 bits (1055),  Expect = 2e-135, Method: Compositional matrix adjust.
 Identities = 201/395 (51%), Positives = 268/395 (68%), Gaps = 5/395 (1%)
 Frame = -1

Query  1412  YRNEPSMSGKDPVQVIRQALAKALVFFYPFAGRLREGPGRKLMVDCTGEGVMFIEADADA  1233
             +R+EPSM  KDPV+V++ AL++ LV++YP AGR+REG GRKLMVDCTGEGVMFIEA+AD 
Sbjct  51    FRHEPSMKEKDPVKVLKHALSRTLVYYYPGAGRIREGAGRKLMVDCTGEGVMFIEAEADI  110

Query  1232  TLQHFAIGGELKPPFPCFDQLLYNVPGSAEILNSPLFLIQVTRLRCGGFIFTLRMNHTMA  1053
             TL  F  G  L+PPFPCF ++L +VPGS  I++ P+ LIQVTRL+CGGFI  L +NHTM 
Sbjct  111   TLDQF--GDALQPPFPCFQEILCDVPGSEYIIDRPIRLIQVTRLKCGGFILALSLNHTMG  168

Query  1052  DASGLVHFLNTIAEIARGAEAPAVQPVWQREFFSARNPPRITCTHFEYEEEPAADSMVTN  873
             D SGL  F++  AEIARGA  P++QPVW RE   AR+PP ITC H EYE+    ++ +  
Sbjct  169   DGSGLRQFVSAWAEIARGANQPSIQPVWNREILMARDPPYITCNHREYEQILPPNTYIKE  228

Query  872   IPLDNLVHRSFLFGPTEISVLRSSLPPHLRKCSTVEILTALVWRCRTIALGFHPDEEVRM  693
                  +VH+SF F    I+ +R  +P HL +C+  +++TA  W CRT AL   PDE+VRM
Sbjct  229   EDTTIVVHQSFFFTSAHIAAIRRLVPLHLSRCTAYDLITACYWCCRTKALQVEPDEDVRM  288

Query  692   LLLINARFKFKDTPMPS--GYTGNAFAYPGAKTTAGKLRKNPLGYAVELVTSIKRCFSEE  519
             + ++NAR +F      S  GY GN  A+  A TTA +L  N LGYAVEL+   K   +E+
Sbjct  289   MCIVNARSRFSANNRSSLIGYYGNCIAFSAAVTTAKELCGNQLGYAVELIRKAKAQVTEK  348

Query  518   YMQSMVDLMVLKGRPPFHVAGSFIMSDLTRSKISDVDYGWGKPVFGGPAHGGAGDVPGVI  339
             YM S+ D MV+K R  F    + ++SD TR+K S+V++GWG+ V+GG A GG G   G  
Sbjct  349   YMHSLADFMVIKERCLFTKGRTCMVSDWTRAKFSEVNFGWGEAVYGGAAKGGIGSFLGG-  407

Query  338   TFHVPYENKKGENGTLIPICLPAFALDKFVNELAN  234
             TF V ++N KGE G ++PICLP   + +FV EL +
Sbjct  408   TFLVTHKNAKGEEGLILPICLPPEDMKRFVKELDD  442



>ref|XP_007208844.1| hypothetical protein PRUPE_ppa025565mg [Prunus persica]
 gb|EMJ10043.1| hypothetical protein PRUPE_ppa025565mg [Prunus persica]
Length=558

 Score =   414 bits (1064),  Expect = 2e-135, Method: Compositional matrix adjust.
 Identities = 201/392 (51%), Positives = 270/392 (69%), Gaps = 9/392 (2%)
 Frame = -1

Query  1412  YRNEPSMSGKDPVQVIRQALAKALVFFYPFAGRLREGPGRKLMVDCTGEGVMFIEADADA  1233
             Y+N PSM G D V+VIR+AL++ALV++YP AGRLREGP RKLMV+C GEGV+FIEA+AD 
Sbjct  52    YKNNPSMKGNDAVEVIREALSRALVYYYPLAGRLREGPNRKLMVECNGEGVLFIEANADV  111

Query  1232  TLQHFAIGGELKPPFPCFDQLLYNVPGSAEILNSPLFLIQVTRLRCGGFIFTLRMNHTMA  1053
             TL    +G  + PP P  ++ LYNVPGS  IL  PL LIQVTRL CGGFI  LR+NHTM 
Sbjct  112   TLAQ--LGDTIAPPSPFLEEFLYNVPGSDGILGCPLLLIQVTRLSCGGFILALRLNHTMF  169

Query  1052  DASGLVHFLNTIAEIARGAEAPAVQPVWQREFFSARNPPRITCTHFEYEEEPAADSMVTN  873
             DA+GL+ FLN + E+A+GA+AP+  PVW+RE   AR+ PRITC H EYEE   A     +
Sbjct  170   DAAGLLQFLNAVGEMAQGAQAPSTTPVWERELLGARDQPRITCVHHEYEEGIDAQGSFPS  229

Query  872   IPLDNLVHRSFLFGPTEISVLRSSLPPHLRKCSTVEILTALVWRCRTIALGFHPDEEVRM  693
                 N+V RSF FG  EI  +R+ +PP L  C+T +++TA +W+CRT+AL  +P + VR+
Sbjct  230   TNKPNMVQRSFYFGSKEIKAIRNHIPPQLSTCTTFDLITACLWKCRTLALRMNPKQVVRL  289

Query  692   LLLINARFKFKDTPMPSGYTGNAFAYPGAKTTAGKLRKNPLGYAVELVTSIKRCFSEEYM  513
               L++AR K  +  +P GY GNA A+P A + A  +  NPLGYA+ELV   K   +EEYM
Sbjct  290   SCLVSARGKRHNVRLPLGYYGNAVAFPAAVSEAKAVCTNPLGYALELVMKAKATVNEEYM  349

Query  512   QSMVDLMVLKGR-PPFHVAGSFIMSDLTRSKISDVDYGWGKPVFGGPAHGGAGDVPGVIT  336
             +S+ DLM ++GR P + + G+FI+SD +R+   +V +GWGKPVFGGPA         +I+
Sbjct  350   RSVADLMEIRGRLPKYPLTGNFIVSDTSRAGFGEVSFGWGKPVFGGPAKAL-----DLIS  404

Query  335   FHVPYENKKGENGTLIPICLPAFALDKFVNEL  240
             F+V ++    E G L+PICLP   +++F  EL
Sbjct  405   FYVQHKC-NNEEGVLVPICLPLSDMERFQQEL  435



>ref|XP_004305015.1| PREDICTED: benzyl alcohol O-benzoyltransferase-like [Fragaria 
vesca subsp. vesca]
Length=445

 Score =   410 bits (1053),  Expect = 3e-135, Method: Compositional matrix adjust.
 Identities = 202/397 (51%), Positives = 275/397 (69%), Gaps = 13/397 (3%)
 Frame = -1

Query  1412  YRNEP--SMSGKDPVQVIRQALAKALVFFYPFAGRLREGPGRKLMVDCTGEGVMFIEADA  1239
             Y+N+   SM  KDPV+VIR AL++ALV++YPFAGR+REG   KL VDC GEG++FIEADA
Sbjct  51    YKNDNPNSMKQKDPVEVIRDALSRALVYYYPFAGRVREGRNGKLFVDCNGEGILFIEADA  110

Query  1238  DATLQHFAIGGELKPPFPCFDQLLYNVPGSAEILNSPLFLIQVTRLRCGGFIFTLRMNHT  1059
             D +L+   +G  L+PP P  +  L++VPGS +IL +PL L+QVTRL CGGFIF LR+NHT
Sbjct  111   DVSLEQ--LGDSLQPPCPFLEDFLFDVPGSDDILGTPLLLVQVTRLTCGGFIFALRLNHT  168

Query  1058  MADASGLVHFLNTIAEIARGAEAPAVQPVWQREFFSARNPPRITCTHFEY--EEEPAADS  885
             M+DA GL  FL+ + E+ARGA  P +QPVW+RE   AR+PP++TCTH EY  E E    S
Sbjct  169   MSDAVGLGQFLHAVGEMARGATEPTIQPVWERELLDARDPPQVTCTHHEYGKETESHRGS  228

Query  884   MVTNIPLDNLVHRSFLFGPTEISVLRSSLPPHLRK-CSTVEILTALVWRCRTIALGFHPD  708
             ++  +   +LV R   FGP E+ V R+ L P+L   CST E++TA +W+CRT++L   P+
Sbjct  229   VIATMEQPDLVQRCVYFGPKELMVARAHLSPNLSSTCSTFELITACMWKCRTLSLELDPN  288

Query  707   EEVRMLLLINARFKFKDTPMPSGYTGNAFAYPGAKTTAGKLRKNPLGYAVELVTSIKRCF  528
             E VR+ L++NAR K  +  +P G+ GNA  +PG  TTA  L K PLGYAVELV   K   
Sbjct  289   EVVRISLVVNARGKKNNLTVPVGFYGNAIGFPGVVTTAEILCKQPLGYAVELVKEAKGKM  348

Query  527   SEEYMQSMVDLMVLKGRPPFHVAG-SFIMSDLTRSKISDVDYGWGKPVFGGPAHGGAGDV  351
             ++EY+QS  DLM ++G PP  +AG +FI+SD TR+ + +VD+GWG+PV  GPA       
Sbjct  349   NKEYIQSCADLMAIRGWPPLTLAGNNFILSDNTRTGVGEVDFGWGRPVVAGPAKS-----  403

Query  350   PGVITFHVPYENKKGENGTLIPICLPAFALDKFVNEL  240
               +I+F+V   N+K ++G L+PICLP   +D+F  EL
Sbjct  404   VNLISFYVRDNNQKEKHGILVPICLPFSCVDRFEQEL  440



>gb|AAR99826.1| alcohol acyl transferase [Malus domestica]
Length=470

 Score =   410 bits (1054),  Expect = 4e-135, Method: Compositional matrix adjust.
 Identities = 200/400 (50%), Positives = 277/400 (69%), Gaps = 12/400 (3%)
 Frame = -1

Query  1412  YRNEPSMSGK-DPVQVIRQALAKALVFFYPFAGRLREGPGRKLMVDCTGEGVMFIEADAD  1236
             Y++ PS++   +PV+VIR+AL++ALV++YP AGRL+EGP RKLMVDC GEG++F+EA AD
Sbjct  49    YKDNPSLNKNCNPVKVIREALSRALVYYYPLAGRLKEGPNRKLMVDCNGEGILFVEASAD  108

Query  1235  ATLQHFAIGGELKPPFPCFDQLLYNVPGSAEILNSPLFLIQVTRLRCGGFIFTLRMNHTM  1056
              TL+   +G ++ PP P  ++ L+N PGS  I+  PL L+QVT L CGGFI  LR NHTM
Sbjct  109   VTLEQ--LGDKILPPCPLLEEFLFNFPGSDGIIGCPLLLVQVTCLTCGGFILALRANHTM  166

Query  1055  ADASGLVHFLNTIAEIARGAEAPAVQPVWQREFFSARNPPRITCTHFEYEEEPA-ADSMV  879
              DA GL+ FL  IAE+ARGA AP++ PVW+RE   AR+PPRITC H EYE+    +D   
Sbjct  167   CDAPGLLLFLTAIAEMARGAHAPSILPVWERELLFARDPPRITCAHHEYEDVIGHSDGSY  226

Query  878   TNIPLDNLVHRSFLFGPTEISVLRSSLPPHL-RKCSTVEILTALVWRCRTIALGFHPDEE  702
              +    N+V RSF FG  E+ VLR  +PPHL   CST +++TA +W+CRT+AL  +P E 
Sbjct  227   ASSNQSNMVQRSFYFGAKEMRVLRKQIPPHLISTCSTFDLITACLWKCRTLALNINPKEA  286

Query  701   VRMLLLINARFKFKDTPMPSGYTGNAFAYPGAKTTAGKLRKNPLGYAVELVTSIKRCFSE  522
             VR+  ++NAR K  +  +P GY GNAFA+P A + A  L KNP+GYA+ELV   K   +E
Sbjct  287   VRVSCIVNARGKHNNVRLPLGYYGNAFAFPAAVSKAEPLCKNPMGYALELVKKAKATMNE  346

Query  521   EYMQSMVDLMVLKGRPPFHVAGSF-IMSDLTRSKISDVDYGWGKPVFGGPAHGGAGDVPG  345
             EY++S+ DL+VL+GRP +   GS+ I+SD TR+   DV++GWG+P+F GPA         
Sbjct  347   EYLRSVADLLVLRGRPQYSSTGSYLIVSDNTRAGFGDVNFGWGQPIFAGPAKA-----LD  401

Query  344   VITFHVPYENKKGENGTLIPICLPAFALDKFVNELANTFL  225
             +I+F+V ++N   E+G L+P+CLP  A+++F  EL    L
Sbjct  402   LISFYVQHKN-NSEDGILVPMCLPFSAMERFQQELERITL  440



>ref|XP_009368754.1| PREDICTED: methanol O-anthraniloyltransferase-like [Pyrus x bretschneideri]
Length=461

 Score =   409 bits (1051),  Expect = 8e-135, Method: Compositional matrix adjust.
 Identities = 195/395 (49%), Positives = 273/395 (69%), Gaps = 11/395 (3%)
 Frame = -1

Query  1412  YRNEPSMSGKDPVQVIRQALAKALVFFYPFAGRLREGPGRKLMVDCTGEGVMFIEADADA  1233
             Y + PS    DPVQVIR A++++LV++YP AGR+REGP +KLMVDC GEGV+FIEADAD 
Sbjct  52    YTSNPSSKEIDPVQVIRDAISRSLVYYYPLAGRVREGPNKKLMVDCNGEGVLFIEADADV  111

Query  1232  TLQHFAIGGELKPPFPCFDQLLYNVPGSAEILNSPLFLIQVTRLRCGGFIFTLRMNHTMA  1053
             TL+   +G  L+PP P  +  LY+VPG+ +I+ +PL ++QVTRL+CGGFIF +R+NHTM 
Sbjct  112   TLEQ--LGDTLQPPCPVLEDFLYDVPGTYDIVGTPLLIVQVTRLKCGGFIFAMRLNHTMF  169

Query  1052  DASGLVHFLNTIAEIARGAEAPAVQPVWQREFFSARNPPRITCTHFEY--EEEPAADSMV  879
             DA GL  FLN + EIARGA AP++ P+W+RE  +AR PP++T  H EY  E E  A S++
Sbjct  170   DAVGLAQFLNAVGEIARGAHAPSIPPIWERELLNAREPPQVTYVHHEYGDENESQAGSVI  229

Query  878   TNIPLDNLVHRSFLFGPTEISVLRSSLPPHLRK-CSTVEILTALVWRCRTIALGFHPDEE  702
              ++   +LV R F FGP EI   R  LPP+L   CST E++T  +W+CRTIAL  +P+E 
Sbjct  230   ASMDQPDLVQRCFYFGPKEIRAARKHLPPNLSNTCSTFELITGCLWKCRTIALAMNPNEA  289

Query  701   VRMLLLINARFKFKDTPMPSGYTGNAFAYPGAKTTAGKLRKNPLGYAVELVTSIKRCFSE  522
             VR+ L++NAR K  +  +P G+ GNA  +PG  +TA  L  +PL YAVELV   K   +E
Sbjct  290   VRVSLVVNARGKRNNLNVPLGFYGNAIGFPGVVSTAQLLCNSPLEYAVELVREAKNKMNE  349

Query  521   EYMQSMVDLMVLKGRPPFHVAG-SFIMSDLTRSKISDVDYGWGKPVFGGPAHGGAGDVPG  345
             +Y++S+ DL+ L+G PP  +AG +FI+SD TR+ + +VD+GWGKP+  GPA         
Sbjct  350   DYIKSVADLLTLRGWPPLTLAGNNFILSDNTRTGVGEVDFGWGKPIIAGPAKSV-----N  404

Query  344   VITFHVPYENKKGENGTLIPICLPAFALDKFVNEL  240
             +I+F+V   N++ + G L+P+CLP + + K   EL
Sbjct  405   LISFYVRDSNQEKDYGILVPMCLPFWCMKKIEQEL  439



>ref|XP_002517500.1| Taxadien-5-alpha-ol O-acetyltransferase, putative [Ricinus communis]
 gb|EEF45042.1| Taxadien-5-alpha-ol O-acetyltransferase, putative [Ricinus communis]
Length=458

 Score =   409 bits (1050),  Expect = 1e-134, Method: Compositional matrix adjust.
 Identities = 197/393 (50%), Positives = 270/393 (69%), Gaps = 9/393 (2%)
 Frame = -1

Query  1415  FYRNEPSMSGKDPVQVIRQALAKALVFFYPFAGRLREGPGRKLMVDCTGEGVMFIEADAD  1236
             FYR+ PSM G+DPV++IR+AL++ALVF+YPFAGRL EGP RKL+VDC GEG++FIEADAD
Sbjct  51    FYRSLPSMKGRDPVEIIRKALSEALVFYYPFAGRLIEGPNRKLIVDCNGEGILFIEADAD  110

Query  1235  ATLQHFAIGGELKPPFPCFDQLLYNVPGSAEILNSPLFLIQVTRLRCGGFIFTLRMNHTM  1056
              T++   +G  ++PP PC ++LLY+VPGS+ I+  PL LIQ+TRL CGGF+F +R+NH M
Sbjct  111   ITIEQ--LGDSMQPPCPCIEELLYDVPGSSGIIGCPLLLIQITRLACGGFVFAVRLNHVM  168

Query  1055  ADASGLVHFLNTIAEIARGAEAPAVQPVWQREFFSARNPPRITCTHFEYEE-EPAADSMV  879
             +D+ GL  F     EIA+GA  P++ PVWQRE  SARNPP++T    EYEE +   D  +
Sbjct  169   SDSVGLAKFFKATGEIAKGACMPSLFPVWQREILSARNPPQVTHKLEEYEEIKHTDDKSI  228

Query  878   TNIPLDNLVHRSFLFGPTEISVLRSSLPPHLRKCSTVEILTALVWRCRTIALGFHPDEEV  699
               +   ++V R+F FGP E+  LR  LP HLR CS+ E+L A +WRCRTIA    P+E V
Sbjct  229   LTLDSPDMVQRAFFFGPKEMRSLRRQLPSHLRNCSSFEMLAACLWRCRTIAFDIPPNEVV  288

Query  698   RMLLLINARFKFKDTPMPSGYTGNAFAYPGAKTTAGKLRKNPLGYAVELVTSIKRCFSEE  519
             R+  ++N R K K   +P GY GN+F +P   + A  L KNPLGYAVELV   K   SEE
Sbjct  289   RLSCIMNVRGK-KGLQLPDGYCGNSFIFPAVLSRAEHLCKNPLGYAVELVRKSKSKMSEE  347

Query  518   YMQSMVDLMVLKGRPPFHVAGSFIMSDLTRSKISDVDYGWGKPVFGGPAHGGAGDVPGVI  339
             Y++S +DLM +KGRP +  A + ++ D++   ++DVD+GWG PV+ GP     G  P + 
Sbjct  348   YIRSTIDLMEIKGRPHYVTAWNLLLVDMSHVGLADVDFGWGNPVYFGP----TGSFPNIS  403

Query  338   TFHVPYENKKGENGTLIPICLPAFALDKFVNEL  240
              F   ++N KGENG ++P+ LP   ++KF +E 
Sbjct  404   MFSR-FKNSKGENGFVVPMWLPRTVMEKFQDEF  435



>gb|AAS48090.1| alcohol acyl transferase [Pyrus communis]
Length=442

 Score =   407 bits (1047),  Expect = 2e-134, Method: Compositional matrix adjust.
 Identities = 195/395 (49%), Positives = 278/395 (70%), Gaps = 12/395 (3%)
 Frame = -1

Query  1412  YRNEPSMS-GKDPVQVIRQALAKALVFFYPFAGRLREGPGRKLMVDCTGEGVMFIEADAD  1236
             Y++ PS++  ++P++VI++AL++ALV++YP AGRLREGP RKLMV+C GEG++F+EA AD
Sbjct  49    YKDNPSLNKNRNPIKVIKEALSRALVYYYPLAGRLREGPNRKLMVNCNGEGILFVEASAD  108

Query  1235  ATLQHFAIGGELKPPFPCFDQLLYNVPGSAEILNSPLFLIQVTRLRCGGFIFTLRMNHTM  1056
              TL+   +G ++ PP P  ++ L+N PGS  I+  PL L+QVT L CGGFI  LR+NHTM
Sbjct  109   VTLEQ--LGDKILPPCPLLEEFLFNFPGSDGIIGCPLLLVQVTCLTCGGFILALRLNHTM  166

Query  1055  ADASGLVHFLNTIAEIARGAEAPAVQPVWQREFFSARNPPRITCTHFEYEEE-PAADSMV  879
              DA+GL+ FL  I E+ RGA+AP++ PVW+RE   AR+PPRITC H+EYE+    +D   
Sbjct  167   CDATGLLMFLTAITEMGRGADAPSILPVWERELLFARDPPRITCAHYEYEDVIDHSDGSY  226

Query  878   TNIPLDNLVHRSFLFGPTEISVLRSSLPPHL-RKCSTVEILTALVWRCRTIALGFHPDEE  702
                   N+V RSF FG  E+ VLR  +PPHL   CST +++TA +W+CRT+ L  +P + 
Sbjct  227   AFSNQSNMVQRSFYFGAKEMRVLRKQIPPHLISTCSTFDLITACLWKCRTLVLKINPKQA  286

Query  701   VRMLLLINARFKFKDTPMPSGYTGNAFAYPGAKTTAGKLRKNPLGYAVELVTSIKRCFSE  522
             VR+  ++NAR K  +  +P GY GNAFA+P A + A  L KNPLGYA+ELV   K   +E
Sbjct  287   VRVSCIVNARGKHNNVHIPLGYYGNAFAFPAAVSKAEPLCKNPLGYALELVKKAKATMNE  346

Query  521   EYMQSMVDLMVLKGRPPFHVAGSF-IMSDLTRSKISDVDYGWGKPVFGGPAHGGAGDVPG  345
             EY++S+ DL+VL+GRP +   GS+ I+SD TR+   DV++GWG+PVF GPA         
Sbjct  347   EYLRSVADLLVLRGRPQYSSTGSYLIVSDNTRAGFGDVNFGWGQPVFAGPAKA-----LD  401

Query  344   VITFHVPYENKKGENGTLIPICLPAFALDKFVNEL  240
             +I+F+V ++N   E+G L+P+CLP+ A+++F  EL
Sbjct  402   LISFYVQHKNNI-EDGILVPMCLPSSAMERFQQEL  435



>ref|XP_009130368.1| PREDICTED: (Z)-3-hexen-1-ol acetyltransferase-like [Brassica 
rapa]
Length=469

 Score =   408 bits (1049),  Expect = 2e-134, Method: Compositional matrix adjust.
 Identities = 204/400 (51%), Positives = 273/400 (68%), Gaps = 9/400 (2%)
 Frame = -1

Query  1415  FYRNEPSMSGK-DPVQVIRQALAKALVFFYPFAGRLREGPGRKLMVDCTGEGVMFIEADA  1239
             FYR  PS++   DPVQVIR AL + LV++YPFAGRL EGP RKL V+CTGEGV+FIEADA
Sbjct  59    FYR--PSLTSTLDPVQVIRTALGQTLVYYYPFAGRLLEGPNRKLAVNCTGEGVLFIEADA  116

Query  1238  DATLQHFAIGGELKPPFPCFDQLLYNVPGSAEILNSPLFLIQVTRLRCGGFIFTLRMNHT  1059
             D T         L PPFPC ++LL++V GS+E+L +PL L++VTRL+CGGFIF LR+NHT
Sbjct  117   DVTFAELEEADALLPPFPCLEELLFDVEGSSELLGTPLLLVEVTRLKCGGFIFALRINHT  176

Query  1058  MADASGLVHFLNTIAEIARGAEAPAVQPVWQREFFSARNPPRITCTHFEYEEEPAADSMV  879
             M D +GL  FL ++ E+A G  AP+V PVW+R+   A    R+T TH EY+E    +++V
Sbjct  177   MTDGAGLSLFLKSLCELACGLHAPSVPPVWERQLLIASTYARVTHTHREYDEYVEPEAVV  236

Query  878   TNIPLDNLVHRSFLFGPTEISVLRSSLPPHLRK-CSTVEILTALVWRCRTIALGFHPDEE  702
                  D LV RSF FGP EI+ +R  LPP L    ST + LT+ +WRCRT+A+   P+ E
Sbjct  237   VG---DCLVTRSFFFGPDEIAAIRRLLPPGLHNHNSTFDALTSFLWRCRTVAMSPDPNTE  293

Query  701   VRMLLLINARFKFKDTPMPSGYTGNAFAYPGAKTTAGKLRKNPLGYAVELVTSIKRCFSE  522
             +RM  ++N+R K ++ P+PSGY GN FA P A  TA  L + PL + + L+   K   +E
Sbjct  294   MRMTCIVNSRSKLRNPPIPSGYYGNVFAIPVAIATAKDLMEKPLEFPLRLIQEAKSSVTE  353

Query  521   EYMQSMVDLMVLKGRPPFHVAGSFIMSDLTRSKISDVDYG-WGKPVFGGPAHGGAGDVPG  345
             +Y++S+  LM  +GRP F  A ++I+SDL R  I  VD+G WGKPV+GG A  G    PG
Sbjct  354   DYIRSVTALMATRGRPKFVTAENYIVSDLRRFDIGKVDFGPWGKPVYGGTAKAGIATFPG  413

Query  344   VITFHVPYENKKGENGTLIPICLPAFALDKFVNELANTFL  225
             V +F+VP++NKKGENGT++ I LPA A++KFV EL   F+
Sbjct  414   V-SFYVPFKNKKGENGTVVAISLPALAMEKFVEELNGVFM  452



>gb|AJD18611.1| alcohol acyltransferase [Pyrus ussuriensis]
Length=459

 Score =   407 bits (1047),  Expect = 3e-134, Method: Compositional matrix adjust.
 Identities = 198/396 (50%), Positives = 279/396 (70%), Gaps = 12/396 (3%)
 Frame = -1

Query  1412  YRNEPSMS-GKDPVQVIRQALAKALVFFYPFAGRLREGPGRKLMVDCTGEGVMFIEADAD  1236
             Y++ PS++  ++PV+VIR+AL++ALV++YP AGRLREGP RKL+V+C GEG++F+EA A+
Sbjct  49    YKDNPSLNKNRNPVKVIREALSRALVYYYPLAGRLREGPNRKLVVNCNGEGILFVEASAN  108

Query  1235  ATLQHFAIGGELKPPFPCFDQLLYNVPGSAEILNSPLFLIQVTRLRCGGFIFTLRMNHTM  1056
              TL+   +G ++ PP P  ++ L+N PGS  I+  PL L+QVT L CGGFI  LR+NHTM
Sbjct  109   VTLEQ--LGDKILPPCPLLEEFLFNFPGSDGIIGCPLLLVQVTCLTCGGFILALRLNHTM  166

Query  1055  ADASGLVHFLNTIAEIARGAEAPAVQPVWQREFFSARNPPRITCTHFEYEEE-PAADSMV  879
              DA+GL+ FL  +AE+ARGA AP++ PVW+RE   AR+PPRITC H EYE+    +D   
Sbjct  167   CDATGLLLFLTAVAEMARGAHAPSILPVWERELLFARDPPRITCAHHEYEDVIDHSDDSY  226

Query  878   TNIPLDNLVHRSFLFGPTEISVLRSSLPPHL-RKCSTVEILTALVWRCRTIALGFHPDEE  702
             +     N+V RSF FG  E+ VLR  +PPHL   CST +++TA +W+CRT+AL  +P + 
Sbjct  227   SFSNQSNMVQRSFYFGAKEMRVLRKQIPPHLISTCSTFDLITACLWKCRTLALKINPKQV  286

Query  701   VRMLLLINARFKFKDTPMPSGYTGNAFAYPGAKTTAGKLRKNPLGYAVELVTSIKRCFSE  522
             VR+  ++NAR K  +  +P GY GNAFA+P A + A  L KNPLGYA+ELV   K   +E
Sbjct  287   VRVSCVVNARGKHHNVRLPLGYYGNAFAFPAAVSKAEPLCKNPLGYALELVKKAKATMNE  346

Query  521   EYMQSMVDLMVLKGRPPFHVAGSF-IMSDLTRSKISDVDYGWGKPVFGGPAHGGAGDVPG  345
             EY++S+ DL+VL+GRP +   GS+ I+SD TR    DV++GWG+PVF GPA         
Sbjct  347   EYLRSVADLLVLRGRPQYSSTGSYLIVSDNTRVGFGDVNFGWGQPVFAGPAKAL-----D  401

Query  344   VITFHVPYENKKGENGTLIPICLPAFALDKFVNELA  237
             +I+F+V ++N   E+G L+P+CLP+ A+ +F  ELA
Sbjct  402   LISFYVQHKNNT-EDGILVPMCLPSSAMKRFQQELA  436



>gb|KFK25971.1| hypothetical protein AALP_AA8G186800 [Arabis alpina]
Length=472

 Score =   408 bits (1048),  Expect = 4e-134, Method: Compositional matrix adjust.
 Identities = 204/398 (51%), Positives = 272/398 (68%), Gaps = 6/398 (2%)
 Frame = -1

Query  1415  FYRNEPSMSGKDPVQVIRQALAKALVFFYPFAGRLREGPGRKLMVDCTGEGVMFIEADAD  1236
             FYR+ P+ S  DPV VIR+ALA+ LV++YPFAGRLREGP RKL VDCTGEGV+FIEADAD
Sbjct  58    FYRHNPT-SYADPVTVIRRALAETLVYYYPFAGRLREGPNRKLAVDCTGEGVLFIEADAD  116

Query  1235  ATLQHFAIGGELKPPFPCFDQLLYNVPGSAEILNSPLFLIQVTRLRCGGFIFTLRMNHTM  1056
               L  F     L+PPFPCF++LL++V GS+E+LN+PL  IQVTRL+CGGFIF +R+NHTM
Sbjct  117   VALAEFEEKDALRPPFPCFEELLFDVEGSSEVLNAPLLFIQVTRLKCGGFIFAVRLNHTM  176

Query  1055  ADASGLVHFLNTIAEIARGAEAPAVQPVWQREFFSARNPPRITCTHFEYEEEPAADSMVT  876
              DA+G   FL  ++E A G   P++ PVW+R   SAR P R+T  H EY+E+ A D+  T
Sbjct  177   TDAAGQTGFLKMMSEFASGEHVPSISPVWERHLLSARVPLRVTQAHREYDEQVAVDTEST  236

Query  875   NIPLDNLVHRSFLFGPTEISVLRSSLPPHLRKCST-VEILTALVWRCRTIALGFHPDEEV  699
                 + +V RSF FG  E+S +R  LPP L   ST +E LT+ +WRCRT AL   P++E+
Sbjct  237   IGNREKMVGRSFFFGGAEMSAIRRLLPPDLANNSTNMETLTSFLWRCRTRALRPDPNKEM  296

Query  698   RMLLLINARFKFKDTPMPSGYTGNAFAYPGAKTTAGKLRKNPLGYAVELVTSIKRCFSEE  519
             R++ ++NAR K K+ P+P GY GN FA+P A  TA  L + PL +AV LV   K   ++E
Sbjct  297   RIIFIVNARSKLKNPPLPPGYYGNVFAFPVAIATARDLTEKPLEFAVRLVKEAKSSVTDE  356

Query  518   YMQSMVDLMVLKGRPPFHVAGSFIMSDLTRSKISDVDYG-WGKPVFGGPAHGGAGDVPGV  342
             YM+S+ DLMV KGRP F + G+ ++SD+     + +D+G WGKPV+GG    G  + P  
Sbjct  357   YMRSLADLMVTKGRPRFLMDGACLISDV--RIFAGIDFGVWGKPVYGGIGTAGMAEFPAA  414

Query  341   ITFHVPYENKKGENGTLIPICLPAFALDKFVNELANTF  228
              +F VP+ N+KGENG ++P  LP  A+ +FV  L   F
Sbjct  415   -SFCVPFMNRKGENGIVVPFRLPEKAMQRFVEVLDCVF  451



>ref|XP_004301775.1| PREDICTED: benzyl alcohol O-benzoyltransferase-like [Fragaria 
vesca subsp. vesca]
Length=444

 Score =   406 bits (1044),  Expect = 5e-134, Method: Compositional matrix adjust.
 Identities = 202/396 (51%), Positives = 271/396 (68%), Gaps = 12/396 (3%)
 Frame = -1

Query  1412  YRNE-PSMSGKDPVQVIRQALAKALVFFYPFAGRLREGPGRKLMVDCTGEGVMFIEADAD  1236
             Y+N+ PSM  KDPV+VIR AL +ALV++YPFAGR+R+G   KL+VDC GEG++FIEADAD
Sbjct  51    YKNDNPSMKQKDPVEVIRDALRRALVYYYPFAGRVRKGSNGKLLVDCNGEGIVFIEADAD  110

Query  1235  ATLQHFAIGGELKPPFPCFDQLLYNVPGSAEILNSPLFLIQVTRLRCGGFIFTLRMNHTM  1056
              TL+   +G  L+PP    +  L++VPGS +IL +PL L+QVTRLRCGGFIF LR+NHTM
Sbjct  111   VTLEQ--LGDSLQPPCSFLEDFLFDVPGSDDILGTPLLLLQVTRLRCGGFIFALRINHTM  168

Query  1055  ADASGLVHFLNTIAEIARGAEAPAVQPVWQREFFSARNPPRITCTHFEY--EEEPAADSM  882
             +DA  L  FLN + E+A+GA+ P VQPVW+R    AR+PP++TCTH EY  E E    S+
Sbjct  169   SDAVSLSQFLNAVGEMAQGADEPTVQPVWERGLLDARDPPQVTCTHHEYGKETESHRGSV  228

Query  881   VTNIPLDNLVHRSFLFGPTEISVLRSSLPPHLRK-CSTVEILTALVWRCRTIALGFHPDE  705
             V  +   +LV R   FGP E+   R+ L P L   CST E++TA +W+CRT++L   P E
Sbjct  229   VATMEQPDLVQRCVYFGPKELMATRAHLSPSLSSTCSTFELITACMWKCRTLSLELDPKE  288

Query  704   EVRMLLLINARFKFKDTPMPSGYTGNAFAYPGAKTTAGKLRKNPLGYAVELVTSIKRCFS  525
              VR+ L++NAR K  +  +P G+ GNA  +PG  TTA  L K PLGYAVELV   K   +
Sbjct  289   VVRISLVVNARGKKNNLTVPVGFYGNAIGFPGVVTTAEILCKQPLGYAVELVKEAKGKMN  348

Query  524   EEYMQSMVDLMVLKGRPPFHVAG-SFIMSDLTRSKISDVDYGWGKPVFGGPAHGGAGDVP  348
             +EY+QS  DLM ++G PP  +AG +FI+SD TR+ + +VD+GWG+PV  GPA        
Sbjct  349   KEYIQSCADLMAIRGWPPLTLAGNNFILSDNTRTGVGEVDFGWGRPVVAGPAKS-----V  403

Query  347   GVITFHVPYENKKGENGTLIPICLPAFALDKFVNEL  240
              +I+F+V   N+K + G L+PICLP   +D+F  EL
Sbjct  404   NLISFYVRDNNQKEKYGILVPICLPFSCVDRFEQEL  439



>ref|XP_010453955.1| PREDICTED: (Z)-3-hexen-1-ol acetyltransferase-like [Camelina 
sativa]
Length=461

 Score =   406 bits (1044),  Expect = 8e-134, Method: Compositional matrix adjust.
 Identities = 205/398 (52%), Positives = 274/398 (69%), Gaps = 7/398 (2%)
 Frame = -1

Query  1415  FYRNEPSMSGKDPVQVIRQALAKALVFFYPFAGRLREGPGRKLMVDCTGEGVMFIEADAD  1236
             FYR+ P  +  DPV VIR+ALA+ LV++YPFAGRLREGP RKL+VDCTGEGV+FIEADAD
Sbjct  48    FYRHNPK-AYSDPVAVIRRALAETLVYYYPFAGRLREGPNRKLVVDCTGEGVLFIEADAD  106

Query  1235  ATLQHFAIGGELKPPFPCFDQLLYNVPGSAEILNSPLFLIQVTRLRCGGFIFTLRMNHTM  1056
              T+  F     LKPPF CF++LL+ V GS+E+LNSPL L+QVTRL+CGGFIF +R+NH M
Sbjct  107   VTVLEFEEKDALKPPFRCFEELLFGVEGSSEVLNSPLMLMQVTRLKCGGFIFAVRINHVM  166

Query  1055  ADASGLVHFLNTIAEIARGAEAPAVQPVWQREFFSARNPPRITCTHFEYEEEPAADSMVT  876
             +DA GL  FL T+ +  RG  AP V PVW+R   SA  P R++  H EY++ P  D+   
Sbjct  167   SDAFGLSLFLKTMCDFVRGYHAPTVPPVWERHRLSATVPSRVSHAHREYDDMPVTDTEHG  226

Query  875   NIPLDNLVHRSFLFGPTEISVLRSSLPPHLRKCST-VEILTALVWRCRTIALGFHPDEEV  699
             +   DNLV RSF FG  E+S +R  LPP+L   ST +E LT+ +W  RT+A+   P++E+
Sbjct  227   S-KGDNLVDRSFFFGHREMSAIRRLLPPNLVNRSTDMETLTSFLWCYRTVAIQPDPNKEM  285

Query  698   RMLLLINARFKFKDTPMPSGYTGNAFAYPGAKTTAGKLRKNPLGYAVELVTSIKRCFSEE  519
             R++ ++NAR K K  P+  GY GNAFA+P A TTAG+L K PL +A+ L    K   +EE
Sbjct  286   RLIFIVNARSKLKTPPLSPGYYGNAFAFPVAITTAGELTKKPLDFALRLAKEAKSSVTEE  345

Query  518   YMQSMVDLMVLKGRPPFHVAGSFIMSDLTRSKISDVDYG-WGKPVFGGPAHGGAGDVPGV  342
             YM+S+ +LMV KGRP F   G++++SD+     SD+D+G WGKPV+GG       D PG 
Sbjct  346   YMRSLANLMVTKGRPSFSSDGAYLVSDV--RIFSDIDFGIWGKPVYGGIGTAKVTDFPGS  403

Query  341   ITFHVPYENKKGENGTLIPICLPAFALDKFVNELANTF  228
              +F+V  E + GE G ++P+CLP  A+ +FV EL + F
Sbjct  404   -SFYVSAEKRNGERGIIVPVCLPEKAMQRFVKELESVF  440



>ref|XP_009365780.1| PREDICTED: methanol O-anthraniloyltransferase-like [Pyrus x bretschneideri]
Length=461

 Score =   405 bits (1042),  Expect = 2e-133, Method: Compositional matrix adjust.
 Identities = 195/395 (49%), Positives = 274/395 (69%), Gaps = 11/395 (3%)
 Frame = -1

Query  1412  YRNEPSMSGKDPVQVIRQALAKALVFFYPFAGRLREGPGRKLMVDCTGEGVMFIEADADA  1233
             Y + PS    DPVQVIR AL+++LV++YP AGR+R+GP +KLMVDC GEGV+F EADAD 
Sbjct  52    YTSNPSSKEIDPVQVIRDALSRSLVYYYPLAGRVRKGPNKKLMVDCNGEGVLFREADADF  111

Query  1232  TLQHFAIGGELKPPFPCFDQLLYNVPGSAEILNSPLFLIQVTRLRCGGFIFTLRMNHTMA  1053
             TL+   +G  L+PP P  +  LY+VPG+++I+ +PL ++QVTRL+CGGFIF LR+NHTM 
Sbjct  112   TLEQ--LGDTLQPPCPLLEDFLYDVPGTSDIVGTPLLIVQVTRLKCGGFIFALRLNHTMF  169

Query  1052  DASGLVHFLNTIAEIARGAEAPAVQPVWQREFFSARNPPRITCTHFEY--EEEPAADSMV  879
             DA GL  FLN + EIARGA AP++ P+W+RE  +AR PP++T  H EY  E E  A S++
Sbjct  170   DAVGLAQFLNAVGEIARGAHAPSIPPIWERELLNAREPPQVTYMHHEYGDENESQAGSVI  229

Query  878   TNIPLDNLVHRSFLFGPTEISVLRSSLPPHLRK-CSTVEILTALVWRCRTIALGFHPDEE  702
              ++   +LV R F FGP EI   R  LPP+L K C+T E++T  +W+CRTIAL  +P+E 
Sbjct  230   ASMDQPDLVQRCFYFGPKEIRAARKHLPPNLSKTCTTFELITGCLWKCRTIALAMNPNEV  289

Query  701   VRMLLLINARFKFKDTPMPSGYTGNAFAYPGAKTTAGKLRKNPLGYAVELVTSIKRCFSE  522
             VR+ L++NAR K  +  +PSG+ GNA  +PG  +TA  L  +PL YAVELV   K   +E
Sbjct  290   VRVSLVVNARGKCNNLNVPSGFYGNAIGFPGVVSTAELLCNSPLEYAVELVREAKNKMNE  349

Query  521   EYMQSMVDLMVLKGRPPFHVAG-SFIMSDLTRSKISDVDYGWGKPVFGGPAHGGAGDVPG  345
             +Y++S+ DL+ L+G PP  +AG +FI+SD TR+ + +VD+GWGKP+  GPA         
Sbjct  350   DYIKSVADLLALRGWPPLTLAGNNFILSDNTRTGVGEVDFGWGKPIIAGPAKSV-----N  404

Query  344   VITFHVPYENKKGENGTLIPICLPAFALDKFVNEL  240
             +I+F+V   N++ +   L P+CLP + ++K   EL
Sbjct  405   LISFYVRDSNQEKDYKILAPMCLPFWCMEKIEQEL  439



>ref|XP_009365778.1| PREDICTED: methanol O-anthraniloyltransferase-like [Pyrus x bretschneideri]
Length=454

 Score =   405 bits (1040),  Expect = 3e-133, Method: Compositional matrix adjust.
 Identities = 200/393 (51%), Positives = 276/393 (70%), Gaps = 16/393 (4%)
 Frame = -1

Query  1412  YRNEPSMS-GKDPVQVIRQALAKALVFFYPFAGRLREGPGRKLMVDCTGEGVMFIEADAD  1236
             Y++ PS++  ++PV+VIR+AL++ALV++YP AGRLREGP RKLMVDC GEG++F+EA AD
Sbjct  49    YKDNPSLNENRNPVKVIREALSRALVYYYPLAGRLREGPNRKLMVDCNGEGILFVEASAD  108

Query  1235  ATLQHFAIGGELKPPFPCFDQLLYNVPGSAEILNSPLFLIQVTRLRCGGFIFTLRMNHTM  1056
              TL+   +G ++ PP P  D+ L+N PGS  I+  PL L+QVT L CGGFI  L +NHTM
Sbjct  109   VTLEQ--LGDKILPPCPLLDEFLFNFPGSDGIIGCPLLLVQVTCLTCGGFILALCLNHTM  166

Query  1055  ADASGLVHFLNTIAEIARGAEAPAVQPVWQREFFSARNPPRITCTHFEYEEEPAADSMVT  876
              DA+GL+ FL  +AE+A+GA AP++ PVW+REF  AR+PPRITC H EYE+    D    
Sbjct  167   CDAAGLLLFLTAVAEMAKGAHAPSILPVWEREFLFARDPPRITCAHHEYED--VIDHSNG  224

Query  875   NIP---LDNLVHRSFLFGPTEISVLRSSLPPHL-RKCSTVEILTALVWRCRTIALGFHPD  708
             + P     N+V +SF FG  E+ VLR  +PP L   CST +++TA +W+CRT+AL  +P 
Sbjct  225   SYPSSNQSNMVQQSFYFGAKEMRVLRKQIPPQLISTCSTFDLITACLWKCRTLALKINPK  284

Query  707   EEVRMLLLINARFKFKDTPMPSGYTGNAFAYPGAKTTAGKLRKNPLGYAVELVTSIKRCF  528
             + VR+  ++NAR K  +  +P GY GNAFA+P A + A  L KNPLGYA+ELV   K   
Sbjct  285   QAVRISCIVNARGKHHNVHLPLGYYGNAFAFPAAVSKAEPLCKNPLGYALELVKKAKATM  344

Query  527   SEEYMQSMVDLMVLKGRPPFHVAGS-FIMSDLTRSKISDVDYGWGKPVFGGPAHGGAGDV  351
             +EEY++S+ DLMVL+GRP +   GS FI+SD TR+   DVD+GWG+PVF GPA       
Sbjct  345   NEEYLRSVADLMVLRGRPQYSSTGSYFIVSDNTRAGFGDVDFGWGQPVFAGPAKAL----  400

Query  350   PGVITFHVPYENKKGENGTLIPICLPAFALDKF  252
               +I+F+V ++ K  E+G L+P+CLP  A+++F
Sbjct  401   -DLISFYVQHK-KDTEDGILVPMCLPFSAMERF  431



>ref|XP_008364483.1| PREDICTED: benzyl alcohol O-benzoyltransferase-like [Malus domestica]
Length=437

 Score =   404 bits (1038),  Expect = 3e-133, Method: Compositional matrix adjust.
 Identities = 199/395 (50%), Positives = 275/395 (70%), Gaps = 12/395 (3%)
 Frame = -1

Query  1412  YRNEPSMS-GKDPVQVIRQALAKALVFFYPFAGRLREGPGRKLMVDCTGEGVMFIEADAD  1236
             Y++ PS++  ++PV+VIR+AL++ALV++YP AGRLREGP RKLMVDC GEG++F+EA A+
Sbjct  27    YKDNPSLNKNRNPVKVIREALSRALVYYYPLAGRLREGPNRKLMVDCNGEGILFVEAFAN  86

Query  1235  ATLQHFAIGGELKPPFPCFDQLLYNVPGSAEILNSPLFLIQVTRLRCGGFIFTLRMNHTM  1056
              TL+   +G ++ PP P  ++ L+N P S  I+  PL L+QVT L CGGFI  LR+NHTM
Sbjct  87    VTLEQ--LGDKILPPCPLLEEFLFNFPSSNGIIGCPLLLVQVTCLICGGFILALRLNHTM  144

Query  1055  ADASGLVHFLNTIAEIARGAEAPAVQPVWQREFFSARNPPRITCTHFEYEEE-PAADSMV  879
              DA GL+ FL  IAE+ARGA AP++ PVW+RE   AR+PPRITC H EYE+    +D + 
Sbjct  145   CDAPGLLLFLTAIAEMARGAHAPSILPVWERELLFARDPPRITCAHHEYEDVIDHSDGLY  204

Query  878   TNIPLDNLVHRSFLFGPTEISVLRSSLPPHL-RKCSTVEILTALVWRCRTIALGFHPDEE  702
              +    N+V RSF FG  E+ VLR  +PPHL   CST +++TA +W+CRT+AL  +P + 
Sbjct  205   ASSNQSNMVQRSFYFGAKEMRVLRKQIPPHLISTCSTFDLITACLWKCRTLALKINPXQX  264

Query  701   VRMLLLINARFKFKDTPMPSGYTGNAFAYPGAKTTAGKLRKNPLGYAVELVTSIKRCFSE  522
             VR    +NAR K  +  +P GY GNAFA+P A + A  L KNP GYA+ELV   K   +E
Sbjct  265   VRXSCXVNARGKHHNVRLPLGYYGNAFAFPXAVSKAEPLCKNPXGYALELVKKAKATMNE  324

Query  521   EYMQSMVDLMVLKGRPPFHVAGS-FIMSDLTRSKISDVDYGWGKPVFGGPAHGGAGDVPG  345
             EY++S+ DL+VL+GRP +   GS FI+SD TR+   DV++GWG+PVF GPA         
Sbjct  325   EYLRSVADLLVLRGRPQYSSTGSYFIVSDTTRAGFGDVNFGWGQPVFAGPAKA-----LD  379

Query  344   VITFHVPYENKKGENGTLIPICLPAFALDKFVNEL  240
             +I+F+V ++N   E+G L+P+CLP  A+++F  EL
Sbjct  380   LISFYVQHKNNT-EDGILVPMCLPFSAMERFQEEL  413



>gb|KFK25975.1| hypothetical protein AALP_AA8G187200 [Arabis alpina]
Length=472

 Score =   405 bits (1041),  Expect = 4e-133, Method: Compositional matrix adjust.
 Identities = 204/400 (51%), Positives = 279/400 (70%), Gaps = 11/400 (3%)
 Frame = -1

Query  1412  YRNEPSMSGKDPVQVIRQALAKALVFFYPFAGRLREGPGRKLMVDCTGEGVMFIEADADA  1233
             YR+ PS +  DPV VIR+ALA+ LV++YPFAGRLREGP RKL VDCTGEGV+FIEADAD 
Sbjct  58    YRHNPS-AYSDPVGVIRRALAETLVYYYPFAGRLREGPNRKLTVDCTGEGVLFIEADADV  116

Query  1232  TLQHFAIGGELKPPFPCFDQLLYNVPGSAEILNSPLFLIQVTRLRCGGFIFTLRMNHTMA  1053
             TL  F     L+PPFPCFD+LL+++ GS+E+LN+PL LIQVTRL+CGGFIF +R+NHT+ 
Sbjct  117   TLVEFEEKDALQPPFPCFDELLFDLEGSSEVLNAPLLLIQVTRLKCGGFIFAVRVNHTIT  176

Query  1052  DASGLVHFLNTIAEIARGAEAPAVQPVWQREFFSARNPPRITCTHFEYEEEPAADSMVTN  873
             DA+GL  FL T++E + G  AP+V PVW+R F +AR P R+T  H EY+++ A D+   +
Sbjct  177   DAAGLSRFLKTMSEFSSGYHAPSVAPVWERHFLNARFPLRVTQAHREYDKQVAIDT--ES  234

Query  872   IPL---DNLVHRSFLFGPTEISVLRSSLPPHLRKCST-VEILTALVWRCRTIALGFHPDE  705
              P+   D LV  SF FG TE+S +R  LPP L   ST +E LT+ +WR RTIAL     +
Sbjct  235   APVGDGDTLVSHSFFFGATEMSAIRRLLPPDLANESTDLETLTSFLWRYRTIALLPDSYK  294

Query  704   EVRMLLLINARFKFKDTPMPSGYTGNAFAYPGAKTTAGKLRKNPLGYAVELVTSIKRCFS  525
             E+R++ ++NAR K ++ P+PSGY GNAFA+P A  TA  L + PL +A+ LV   K   +
Sbjct  295   EMRVIFIVNARSKLRNPPLPSGYYGNAFAFPVAIATARDLTEKPLEFAMGLVKEAKSSVT  354

Query  524   EEYMQSMVDLMVLKGRPPFHVAGSFIMSDLTRSKISDVDYG-WGKPVFGGPAHGGAGDVP  348
             EEYM+S+ DLMV KGRP F   G+ ++SD+     +++D+G WGKPV+GG    G    P
Sbjct  355   EEYMRSLADLMVTKGRPGFLTDGALLISDV--RNFAEIDFGIWGKPVYGGVPLAGVVGFP  412

Query  347   GVITFHVPYENKKGENGTLIPICLPAFALDKFVNELANTF  228
                +F+V   N++G+ G ++P+CLP  A+ +F  +L + F
Sbjct  413   AA-SFYVLRRNREGKKGIVVPLCLPKMAMQRFAEQLKDVF  451



>ref|XP_010420481.1| PREDICTED: (Z)-3-hexen-1-ol acetyltransferase-like [Camelina 
sativa]
Length=461

 Score =   404 bits (1039),  Expect = 4e-133, Method: Compositional matrix adjust.
 Identities = 204/398 (51%), Positives = 274/398 (69%), Gaps = 7/398 (2%)
 Frame = -1

Query  1415  FYRNEPSMSGKDPVQVIRQALAKALVFFYPFAGRLREGPGRKLMVDCTGEGVMFIEADAD  1236
             FYR+ P  +  DPV VIR+ALA+ LV++YPFAGRLREGP RKL VDCTGEGV+FIEA+AD
Sbjct  48    FYRHNPK-AYSDPVAVIRRALAETLVYYYPFAGRLREGPNRKLAVDCTGEGVLFIEANAD  106

Query  1235  ATLQHFAIGGELKPPFPCFDQLLYNVPGSAEILNSPLFLIQVTRLRCGGFIFTLRMNHTM  1056
              TL  F     LKPPFPCF++LL++V GS+E+LN+PL L+QVTRL+CG FIF +R+NH M
Sbjct  107   VTLVEFEEKDALKPPFPCFEELLFDVEGSSEVLNTPLMLMQVTRLKCGSFIFAVRINHAM  166

Query  1055  ADASGLVHFLNTIAEIARGAEAPAVQPVWQREFFSARNPPRITCTHFEYEEEPAADSMVT  876
             +DA GL  FL T+ + ARG  AP V PVW+R   SA  P R++  H EY+E     +  +
Sbjct  167   SDAVGLSLFLKTMCDFARGYHAPTVPPVWERHRLSATLPLRVSHAHREYDEMRVISTEHS  226

Query  875   NIPLDNLVHRSFLFGPTEISVLRSSLPPHLRKCST-VEILTALVWRCRTIALGFHPDEEV  699
                 D+LV RSF FG  E+S +R  LPP+L   ST +E LT+ +WR RT+A+   P++E+
Sbjct  227   G-KGDDLVDRSFFFGHREMSAIRRLLPPNLVNRSTDMETLTSFLWRYRTVAIQPDPNKEM  285

Query  698   RMLLLINARFKFKDTPMPSGYTGNAFAYPGAKTTAGKLRKNPLGYAVELVTSIKRCFSEE  519
             R++ ++NAR K K +P+  GY GNAFA+P A TTAG+L K PL +A+ LV   K   +EE
Sbjct  286   RLIFIVNARSKLKTSPLSPGYYGNAFAFPVAITTAGELTKKPLEFALRLVKEAKSSVTEE  345

Query  518   YMQSMVDLMVLKGRPPFHVAGSFIMSDLTRSKISDVDYG-WGKPVFGGPAHGGAGDVPGV  342
             YM+S+ +LMV KGRP F   G++++SD+     SD+D+G WGKPV+ G       D PG 
Sbjct  346   YMRSLANLMVTKGRPSFSSDGAYLVSDV--RIFSDIDFGIWGKPVYSGIGKARVTDFPGS  403

Query  341   ITFHVPYENKKGENGTLIPICLPAFALDKFVNELANTF  228
              +F+V  E + GE G ++P+CLP   + KFV EL + F
Sbjct  404   -SFYVSAEKRNGEIGIIVPVCLPEKTMQKFVKELESVF  440



>gb|AGW30202.1| alcohol acyl transferase, partial [Malus domestica]
Length=418

 Score =   402 bits (1034),  Expect = 6e-133, Method: Compositional matrix adjust.
 Identities = 197/395 (50%), Positives = 277/395 (70%), Gaps = 12/395 (3%)
 Frame = -1

Query  1412  YRNEPSMSGK-DPVQVIRQALAKALVFFYPFAGRLREGPGRKLMVDCTGEGVMFIEADAD  1236
             Y++ PS++   +PV+VIR+AL++ALV++YP AGRL+EGP RKLMVDC GEG++F+EA AD
Sbjct  12    YKDNPSLNKNCNPVKVIREALSRALVYYYPLAGRLKEGPNRKLMVDCNGEGILFVEASAD  71

Query  1235  ATLQHFAIGGELKPPFPCFDQLLYNVPGSAEILNSPLFLIQVTRLRCGGFIFTLRMNHTM  1056
              TL+   +G ++ PP P  ++ L+N PGS  I+  PL L+QVT L CGGFI  LR+NHTM
Sbjct  72    VTLEQ--LGDKILPPCPLLEEFLFNFPGSDGIIGCPLLLVQVTCLTCGGFILALRVNHTM  129

Query  1055  ADASGLVHFLNTIAEIARGAEAPAVQPVWQREFFSARNPPRITCTHFEYEEE-PAADSMV  879
              DA GL+ FL  IAE+ARGA AP++ PVW+RE   +R+PPRITC H EYE+    +D   
Sbjct  130   CDAPGLLLFLTAIAEMARGAHAPSILPVWERELLFSRDPPRITCVHHEYEDVIDHSDGSY  189

Query  878   TNIPLDNLVHRSFLFGPTEISVLRSSLPPH-LRKCSTVEILTALVWRCRTIALGFHPDEE  702
              +    N+V RSF FG  E+ VLR  +PPH +  CST +++TA + +CRT+AL  +P + 
Sbjct  190   ASSNQSNMVQRSFYFGAKEMRVLRKQIPPHVISTCSTFDLITACLSKCRTLALKINPKQA  249

Query  701   VRMLLLINARFKFKDTPMPSGYTGNAFAYPGAKTTAGKLRKNPLGYAVELVTSIKRCFSE  522
             VR+  ++NAR K  +  +P GY GNAFA+P A + A  L KNPLGYA+ELV   K   +E
Sbjct  250   VRVSCVVNARGKHHNVRLPLGYYGNAFAFPTAVSKAEPLCKNPLGYALELVKKAKATMNE  309

Query  521   EYMQSMVDLMVLKGRPPFHVAGSF-IMSDLTRSKISDVDYGWGKPVFGGPAHGGAGDVPG  345
             EY++S+ DL+VL+GRP +   GS+ I+SD TR+   DV++GWG+PVF GPA         
Sbjct  310   EYLRSVADLLVLRGRPQYSSTGSYLIVSDNTRAGFGDVNFGWGQPVFAGPAKA-----LD  364

Query  344   VITFHVPYENKKGENGTLIPICLPAFALDKFVNEL  240
             +I+F+V ++N   E+G L+P+CLP+ A+++F  EL
Sbjct  365   LISFYVQHKNNT-EDGILVPMCLPSSAMERFQQEL  398



>ref|XP_010492711.1| PREDICTED: (Z)-3-hexen-1-ol acetyltransferase-like [Camelina 
sativa]
Length=461

 Score =   403 bits (1036),  Expect = 1e-132, Method: Compositional matrix adjust.
 Identities = 203/398 (51%), Positives = 273/398 (69%), Gaps = 7/398 (2%)
 Frame = -1

Query  1415  FYRNEPSMSGKDPVQVIRQALAKALVFFYPFAGRLREGPGRKLMVDCTGEGVMFIEADAD  1236
             FYR+ P  +  DPV VIR+AL + LV++YPFAGRLREGP RKL+VDCTGEGV+FIEADAD
Sbjct  48    FYRHNPK-TYSDPVAVIRRALTETLVYYYPFAGRLREGPNRKLVVDCTGEGVLFIEADAD  106

Query  1235  ATLQHFAIGGELKPPFPCFDQLLYNVPGSAEILNSPLFLIQVTRLRCGGFIFTLRMNHTM  1056
              TL  F     LKPPFPCF++LL++V GS+E+LN+PL L+QVTRL+CGGFIF +R+NH M
Sbjct  107   VTLVEFEEKDALKPPFPCFEELLFDVEGSSEVLNTPLMLMQVTRLKCGGFIFAVRINHAM  166

Query  1055  ADASGLVHFLNTIAEIARGAEAPAVQPVWQREFFSARNPPRITCTHFEYEEEPAADSMVT  876
             +DA GL  FL T+ + ARG  AP V PVW+R   SA  P R++  H EY++ P   +   
Sbjct  167   SDAFGLSLFLKTMCDFARGYHAPTVPPVWERHRLSATVPFRVSHAHREYDDMPVI-ATEH  225

Query  875   NIPLDNLVHRSFLFGPTEISVLRSSLPPHLRKCST-VEILTALVWRCRTIALGFHPDEEV  699
             +    NLV RSF FG  E+S +R  LPP+L   ST +E LT+ +W  RT+A+   P++E+
Sbjct  226   DSKGGNLVDRSFFFGHREMSAIRRLLPPNLVNRSTDMETLTSFLWCYRTVAIQPDPNKEM  285

Query  698   RMLLLINARFKFKDTPMPSGYTGNAFAYPGAKTTAGKLRKNPLGYAVELVTSIKRCFSEE  519
             R++ ++NAR K K  P+  GY GNAFA+P A  TAG+L K PL + + L    K   +EE
Sbjct  286   RLIFIVNARSKLKTPPLSPGYYGNAFAFPVAIATAGELTKKPLEFGLRLAKEAKSSVTEE  345

Query  518   YMQSMVDLMVLKGRPPFHVAGSFIMSDLTRSKISDVDYG-WGKPVFGGPAHGGAGDVPGV  342
             YM+S+ +LMV K RP F + G++++SD+     SD+D+G WGKPV+GG    G  D PG 
Sbjct  346   YMRSLANLMVTKERPSFSLDGTYLVSDV--RIFSDIDFGIWGKPVYGGIGKAGVTDFPGS  403

Query  341   ITFHVPYENKKGENGTLIPICLPAFALDKFVNELANTF  228
              +F+V  EN+ GE G ++P+CLP  A+ +FV EL   F
Sbjct  404   -SFYVSAENRNGETGIIVPVCLPEKAMQRFVKELEGVF  440



>ref|XP_002300497.2| hypothetical protein POPTR_0001s45180g [Populus trichocarpa]
 gb|EEE85302.2| hypothetical protein POPTR_0001s45180g [Populus trichocarpa]
Length=465

 Score =   403 bits (1035),  Expect = 3e-132, Method: Compositional matrix adjust.
 Identities = 196/395 (50%), Positives = 266/395 (67%), Gaps = 12/395 (3%)
 Frame = -1

Query  1415  FYRNEPSMSGKDPVQVIRQALAKALVFFYPFAGRLREGPGRKLMVDCTGEGVMFIEADAD  1236
              Y + PSM GKDPV+VI++A+A+ALV++YPFAGR+R+GP  KL+VDCTGEGV+FIEADAD
Sbjct  50    LYAHNPSMQGKDPVKVIKEAIAQALVYYYPFAGRIRQGPDNKLIVDCTGEGVLFIEADAD  109

Query  1235  ATLQHFAIGGELKPPFPCFDQLLYNVPGSAEILNSPLFLIQVTRLRCGGFIFTLRMNHTM  1056
             AT++ F  G  +  PFPCF +LLYNVPGS EILN+PL L QVTRL+CGGF+  LR NH M
Sbjct  110   ATVEQF--GDPIPSPFPCFQELLYNVPGSEEILNTPLLLFQVTRLKCGGFVLGLRFNHLM  167

Query  1055  ADASGLVHFLNTIAEIARGAEAPAVQPVWQREFFSARNPPRITCTHFEY-EEEPAADSMV  879
             +D  G++   NTI E+ARGA+ P++ PVWQRE   ARNPPR+TC H EY ++ P A    
Sbjct  168   SDGLGMLQLFNTIGEMARGAQTPSILPVWQRELLCARNPPRVTCRHNEYGDDAPVAVDPT  227

Query  878   TNIP-----LDNLVHRSFLFGPTEISVLRSSLPPHLRKCSTVEILTALVWRCRTIALGFH  714
               +P     +  + HRSF+    E+S +R  +P HL  CS  E+++A +WRC  IA   +
Sbjct  228   AKVPEFRGEVHAVAHRSFVLNRKELSNIRRWVPSHLHPCSDFEVISACLWRCYAIASQAN  287

Query  713   PDEEVRMLLLINARFKFKDTPMPSGYTGNAFAYPGAKTTAGKLRKNPLGYAVELVTSIKR  534
             P+EE+RM +L+NAR KF + P+P GY GN  A P A T A KL  N LGYA+E++ + K 
Sbjct  288   PNEEMRMQMLVNARSKF-NPPLPKGYYGNVLALPAAVTNARKLCLNSLGYALEMIRNAKN  346

Query  533   CFSEEYMQSMVDLM-VLKGRPPFHVAGSFIMSDLTRSKISDVDYGWGKPVFGGPAHGGAG  357
               +EEYM+S+ DLM + KG+P      S+++SDLT      VDYGWG  ++ GP      
Sbjct  347   RITEEYMRSLADLMEITKGQP--IALQSYVVSDLTSFGFDQVDYGWGNTIYSGPPKAMPD  404

Query  356   DVPGVITFHVPYENKKGENGTLIPICLPAFALDKF  252
             ++    TF +PY  K GE G ++ + L A  +++F
Sbjct  405   EISIAGTFVLPYRFKNGERGVMVLVSLRAPVMERF  439



>ref|XP_003591040.1| Benzoyl coenzyme A benzyl alcohol benzoyl transferase [Medicago 
truncatula]
 gb|AES61291.1| benzyl alcohol O-benzoyltransferase [Medicago truncatula]
Length=452

 Score =   402 bits (1033),  Expect = 3e-132, Method: Compositional matrix adjust.
 Identities = 209/398 (53%), Positives = 267/398 (67%), Gaps = 12/398 (3%)
 Frame = -1

Query  1415  FYRNEPSMSGKDPVQVIRQALAKALVFFYPFAGRLREGPGR-KLMVDCTGEGVMFIEADA  1239
             FYRN+PSM+GKDPV+VIR A+A+ALVF+YP AGR++E     KLMVDC GEGVMFIEADA
Sbjct  57    FYRNKPSMAGKDPVEVIRNAIAQALVFYYPLAGRVKEADSSGKLMVDCNGEGVMFIEADA  116

Query  1238  DATLQHFAIGGELKPPFPCFDQLLYNVPGSAEILNSPLFLIQVTRLRCGGFIFTLRMNHT  1059
             D TL+ F   GELK PFPC  +LLY+      +LN+P+ LIQVTRL+CGGFIF LR NHT
Sbjct  117   DVTLEQF---GELKAPFPCLQELLYDAAAPEGVLNTPILLIQVTRLKCGGFIFALRFNHT  173

Query  1058  MADASGLVHFLNTIAEIARGAEAPAVQPVWQREFFSARNPPRITCTHFEYEE--EPAADS  885
             M D  G VHF+  + EIA+GA+ P +QP W RE  +AR+PP +T  H EYE+  +   D+
Sbjct  174   MVDGVGTVHFMLAVTEIAKGAKQPPIQPAWHRELLNARDPPHVTFNHREYEQLTDVQTDT  233

Query  884   MVTNIPLDNLVHRSFLFGPTEISVLRSSLPPHLRKCSTV-EILTALVWRCRTIALGFHPD  708
             ++T         RSF FGP EIS +R+ LP HL   ST  E+LT+ +WR  T AL  +P 
Sbjct  234   VLTATEFS---ERSFFFGPVEISAIRNLLPRHLDNASTTFEVLTSYIWRSHTKALKLNPT  290

Query  707   EEVRMLLLINARFKFKDTPMPSGYTGNAFAYPGAKTTAGKLRKNPLGYAVELVTSIKRCF  528
             EEVRM+ +++AR KF + P+P GY GN FA+P A  TA ++ +NPLG++VEL+       
Sbjct  291   EEVRMMCIVDARGKF-NPPIPVGYYGNCFAFPAAVATAAEICENPLGFSVELIKKASGEV  349

Query  527   SEEYMQSMVDLMVLKGRPPFHVAGSFIMSDLTRSKISDVDYGWGKPVFGGPAHGGAGDVP  348
             SEEYM S+ DLMV KGRP F V  S ++ D T     ++D+GWGK V+GG A  GAG  P
Sbjct  350   SEEYMHSVADLMVTKGRPLFTVVRSCLVLDTTYGGFRNLDFGWGKAVYGGLAKPGAGSFP  409

Query  347   GVITFHVPYENKKGENGTLIPICLPAFALDKFVNELAN  234
              V  FHVP +N KGE G  + I LP   +  F  EL +
Sbjct  410   SV-HFHVPGQNAKGEEGIFVLISLPTKVMTAFAKELDD  446



>ref|XP_009365763.1| PREDICTED: methanol O-anthraniloyltransferase-like [Pyrus x bretschneideri]
Length=451

 Score =   402 bits (1032),  Expect = 5e-132, Method: Compositional matrix adjust.
 Identities = 203/403 (50%), Positives = 267/403 (66%), Gaps = 13/403 (3%)
 Frame = -1

Query  1412  YRNEPSMSGKDPVQVIRQALAKALVFFYPFAGRLREGPGRKLMVDCTGEGVMFIEADADA  1233
             YRN+ +    DPV  IR AL++ALV++YP AGRLREGP +KLMVDC GEGV+FIEADAD 
Sbjct  52    YRNKENQG--DPVTAIRDALSRALVYYYPVAGRLREGPNKKLMVDCNGEGVLFIEADADF  109

Query  1232  TLQHFAIGGELKPPFPCFDQLLYNVPGSAEILNSPLFLIQVTRLRCGGFIFTLRMNHTMA  1053
             TL+   +G  ++PP P  D+LL+NVPGS  IL  P+ L+QVTRL+CGGFIF  R+NHTM 
Sbjct  110   TLEE--LGDTIRPPCPLLDELLFNVPGSDGILGCPILLVQVTRLKCGGFIFASRVNHTMF  167

Query  1052  DASGLVHFLNTIAEIARGAEAPAVQPVWQREFFSARNPPRITCTHFEYEE--EPAADSMV  879
             DA GL  FLN + E+A+G  +P++ PVW+RE   AR+ PRITCTH+EYE    P +  ++
Sbjct  168   DAVGLAQFLNAVGEMAQGTHSPSIPPVWERELLDARHSPRITCTHYEYEHISNPESSFLL  227

Query  878   TNIPLDNLVHRSFLFGPTEISVLRSSLPPHLRKCSTVEILTALVWRCRTIALGFHPDEEV  699
             T     +LV RSF FGP EI  +R  LP HL   S  E++TA VW+CRT++L  +P+E V
Sbjct  228   TKDE-GSLVQRSFYFGPQEIKAIREKLPGHLSTSSRFELITACVWKCRTLSLRLNPEEIV  286

Query  698   RMLLLINARFKFKDTPMPSGYTGNAFAYPGAKTTAGKLRKNPLGYAVELVTSIKRCFSEE  519
             R+   +NAR K     +P GY GNAFA P   +  G L +NPLGYAVELV  +K   SEE
Sbjct  287   RLSCAVNARGKHNTLCLPLGYYGNAFAIPTVVSKVGLLCENPLGYAVELVKKLKSKMSEE  346

Query  518   YMQSMVDLMVLKGRPPFHVAGS-FIMSDLTRSKISDVDYGWGKPVFGGPAHGGAGDVPGV  342
             YM+S+ DL V++GRPP  +A +  I+SD TR+   +V++GWGKP+F G A         +
Sbjct  347   YMKSLADLFVIRGRPPLPMAWNVLIVSDNTRTGFGEVNFGWGKPIFAGIAKS-----VNL  401

Query  341   ITFHVPYENKKGENGTLIPICLPAFALDKFVNELANTFLRAAL  213
             ITF+V   + K E G ++PICLP   ++ F  E     L   L
Sbjct  402   ITFYVQDNSLKEEYGVVVPICLPFSCMEAFEKEFKRMTLEPVL  444



>gb|AFK49108.1| unknown [Medicago truncatula]
Length=452

 Score =   402 bits (1032),  Expect = 5e-132, Method: Compositional matrix adjust.
 Identities = 209/398 (53%), Positives = 267/398 (67%), Gaps = 12/398 (3%)
 Frame = -1

Query  1415  FYRNEPSMSGKDPVQVIRQALAKALVFFYPFAGRLREGPGR-KLMVDCTGEGVMFIEADA  1239
             FYRN+PSM+GKDPV+VIR A+A+ALVF+YP AGR++E     KLMVDC GEGVMFIEADA
Sbjct  57    FYRNKPSMAGKDPVEVIRNAIAQALVFYYPLAGRVKEADSSGKLMVDCNGEGVMFIEADA  116

Query  1238  DATLQHFAIGGELKPPFPCFDQLLYNVPGSAEILNSPLFLIQVTRLRCGGFIFTLRMNHT  1059
             D TL+ F   GELK PFPC  +LLY+      +LN+P+ LIQVTRL+CGGFIF LR NHT
Sbjct  117   DVTLEQF---GELKAPFPCLQELLYDAAAPEGVLNTPILLIQVTRLKCGGFIFALRFNHT  173

Query  1058  MADASGLVHFLNTIAEIARGAEAPAVQPVWQREFFSARNPPRITCTHFEYEE--EPAADS  885
             M D  G VHF+  + EIA+GA+ P +QP W RE  +AR+PP +T  H EYE+  +   D+
Sbjct  174   MVDGVGTVHFMLAVTEIAKGAKQPPIQPAWHRELLNARDPPHVTFNHREYEQLTDVQTDT  233

Query  884   MVTNIPLDNLVHRSFLFGPTEISVLRSSLPPHLRKCSTV-EILTALVWRCRTIALGFHPD  708
             ++T         RSF FGP EIS +R+ LP HL   ST  E+LT+ +WR  T AL  +P 
Sbjct  234   VLTAAEFS---ERSFFFGPVEISAIRNLLPRHLDNASTTFEVLTSYIWRSHTKALKLNPT  290

Query  707   EEVRMLLLINARFKFKDTPMPSGYTGNAFAYPGAKTTAGKLRKNPLGYAVELVTSIKRCF  528
             EEVRM+ +++AR KF + P+P GY GN FA+P A  TA ++ +NPLG++VEL+       
Sbjct  291   EEVRMMCIVDARGKF-NPPIPVGYYGNCFAFPAAVATAAEICENPLGFSVELIKKASGEV  349

Query  527   SEEYMQSMVDLMVLKGRPPFHVAGSFIMSDLTRSKISDVDYGWGKPVFGGPAHGGAGDVP  348
             SEEYM S+ DLMV KGRP F V  S ++ D T     ++D+GWGK V+GG A  GAG  P
Sbjct  350   SEEYMHSVADLMVTKGRPLFTVVRSCLVLDTTYGGFRNLDFGWGKAVYGGLAKPGAGSFP  409

Query  347   GVITFHVPYENKKGENGTLIPICLPAFALDKFVNELAN  234
              V  FHVP +N KGE G  + I LP   +  F  EL +
Sbjct  410   SV-HFHVPGQNAKGEEGIFVLISLPTKVMAAFAKELDD  446



>ref|XP_010453953.1| PREDICTED: (Z)-3-hexen-1-ol acetyltransferase-like [Camelina 
sativa]
Length=447

 Score =   401 bits (1031),  Expect = 5e-132, Method: Compositional matrix adjust.
 Identities = 201/399 (50%), Positives = 275/399 (69%), Gaps = 8/399 (2%)
 Frame = -1

Query  1415  FYRNEPSMSGKDPVQVIRQALAKALVFFYPFAGRLREG-PGRKLMVDCTGEGVMFIEADA  1239
             FYR+ P  +  DPV VIR+ALA+ LV++YPFAGRLR+G P RKL VDCTGEGV+FIEADA
Sbjct  48    FYRHNPK-AYSDPVAVIRRALAETLVYYYPFAGRLRDGGPNRKLAVDCTGEGVLFIEADA  106

Query  1238  DATLQHFAIGGELKPPFPCFDQLLYNVPGSAEILNSPLFLIQVTRLRCGGFIFTLRMNHT  1059
             D TL  F     LKPPFPCF++LL++V GS+E+LN+PL L+QVTRL+CGGFIF +R+NH 
Sbjct  107   DVTLVEFEEKDALKPPFPCFEELLFDVKGSSEVLNTPLMLMQVTRLKCGGFIFAVRINHV  166

Query  1058  MADASGLVHFLNTIAEIARGAEAPAVQPVWQREFFSARNPPRITCTHFEYEEEPAADSMV  879
             M+DA+GL  FL T+ + ARG  AP V PVW+R   +AR P R++  H EY+E P   +  
Sbjct  167   MSDAAGLSLFLKTMCDFARGYHAPTVAPVWERHLLNARAPLRVSHAHREYDEMPVTGTD-  225

Query  878   TNIPLDNLVHRSFLFGPTEISVLRSSLPPHLRKCSTV-EILTALVWRCRTIALGFHPDEE  702
              +   DNLV RSF FG  E+S +R  LPP+L   STV E LT+ +WR RT+A+   P+++
Sbjct  226   NDSKEDNLVSRSFFFGHKEMSAIRRLLPPNLVNRSTVMETLTSFIWRYRTVAIQPDPNKD  285

Query  701   VRMLLLINARFKFKDTPMPSGYTGNAFAYPGAKTTAGKLRKNPLGYAVELVTSIKRCFSE  522
             +R++ +++AR K    P+  GY GNAFA+P A  TA +L K PL +A+ L    K   +E
Sbjct  286   MRLIFIVSARSKLTTPPLSPGYYGNAFAFPVAIATARELTKKPLEFALRLAKEAKYSVTE  345

Query  521   EYMQSMVDLMVLKGRPPFHVAGSFIMSDLTRSKISDVDYG-WGKPVFGGPAHGGAGDVPG  345
             EYM+S+ DLMV KGRP F   G++++SD+    ++++D+G WGKPV+GG    G  + PG
Sbjct  346   EYMRSLADLMVTKGRPRFSSDGAYLVSDV--RILANIDFGIWGKPVYGGIGRAGVVNFPG  403

Query  344   VITFHVPYENKKGENGTLIPICLPAFALDKFVNELANTF  228
               + +V  E + GE G ++P+CLP  A+ +FV EL   F
Sbjct  404   A-SCYVSAEKRNGERGIIVPVCLPEKAMQRFVKELEGVF  441



>ref|XP_010420482.1| PREDICTED: (Z)-3-hexen-1-ol acetyltransferase-like [Camelina 
sativa]
Length=447

 Score =   401 bits (1031),  Expect = 6e-132, Method: Compositional matrix adjust.
 Identities = 203/399 (51%), Positives = 273/399 (68%), Gaps = 8/399 (2%)
 Frame = -1

Query  1415  FYRNEPSMSGKDPVQVIRQALAKALVFFYPFAGRLREG-PGRKLMVDCTGEGVMFIEADA  1239
             FYR+ P  +  DPV VIR+ALA+ LV++YPFAGRLR+G P RKL VDCTGEGV+FIEADA
Sbjct  48    FYRHNPK-AYSDPVAVIRRALAETLVYYYPFAGRLRDGRPNRKLAVDCTGEGVLFIEADA  106

Query  1238  DATLQHFAIGGELKPPFPCFDQLLYNVPGSAEILNSPLFLIQVTRLRCGGFIFTLRMNHT  1059
             D TL  F     LKPPFPCF++LL++V GS+E+LN+PL L+QVTRL+CGGFIF +R+NH 
Sbjct  107   DVTLLEFEEKDALKPPFPCFEELLFDVKGSSEVLNTPLMLMQVTRLKCGGFIFAVRINHV  166

Query  1058  MADASGLVHFLNTIAEIARGAEAPAVQPVWQREFFSARNPPRITCTHFEYEEEPAADSMV  879
             M+DA+GL  FL T  + ARG  AP V PVW+R   +AR P R++  H EY+E P   +  
Sbjct  167   MSDAAGLSLFLKTTCDFARGYHAPTVAPVWERHLLNARAPLRVSHAHREYDEMPVTVTD-  225

Query  878   TNIPLDNLVHRSFLFGPTEISVLRSSLPPHLRKCST-VEILTALVWRCRTIALGFHPDEE  702
              +   DNLV RSF FG  E+S +R  LPP+L   ST +E LT+ +WR RT+A+   P++E
Sbjct  226   NDSKEDNLVSRSFFFGHKEMSAIRRLLPPNLVNRSTDMETLTSFIWRYRTVAIQPDPNKE  285

Query  701   VRMLLLINARFKFKDTPMPSGYTGNAFAYPGAKTTAGKLRKNPLGYAVELVTSIKRCFSE  522
             +R++ ++NAR K    P+  GY GNAFA+P A  TA +L K PL +A+ LV   K   +E
Sbjct  286   MRLIFIVNARSKLTTPPLSPGYYGNAFAFPVAIATARELAKKPLEFALRLVKEAKYSVTE  345

Query  521   EYMQSMVDLMVLKGRPPFHVAGSFIMSDLTRSKISDVDYG-WGKPVFGGPAHGGAGDVPG  345
             EYM+S+ DLMV KGRP F   G++++SD+     +++D+G WGKPV+GG    G  D PG
Sbjct  346   EYMRSLADLMVTKGRPRFSSDGAYLVSDV--RIFANIDFGIWGKPVYGGIGTAGVVDFPG  403

Query  344   VITFHVPYENKKGENGTLIPICLPAFALDKFVNELANTF  228
               + +V  E +  E G ++P+CLP  A+ +FV EL   F
Sbjct  404   A-SCYVSAEKRNCERGIIVPVCLPEKAMQRFVKELEGVF  441



>ref|XP_011041078.1| PREDICTED: benzyl alcohol O-benzoyltransferase-like isoform X2 
[Populus euphratica]
Length=463

 Score =   401 bits (1031),  Expect = 8e-132, Method: Compositional matrix adjust.
 Identities = 195/394 (49%), Positives = 263/394 (67%), Gaps = 10/394 (3%)
 Frame = -1

Query  1415  FYRNEPSMSGKDPVQVIRQALAKALVFFYPFAGRLREGPGRKLMVDCTGEGVMFIEADAD  1236
              Y + PSM GKDPV+VI++A+A+ALV++YPFAGR+R+GP  KL+VDCTGEGV+FIEADAD
Sbjct  48    LYAHNPSMQGKDPVKVIKEAIAQALVYYYPFAGRIRQGPDNKLIVDCTGEGVLFIEADAD  107

Query  1235  ATLQHFAIGGELKPPFPCFDQLLYNVPGSAEILNSPLFLIQVTRLRCGGFIFTLRMNHTM  1056
             AT++ F  G  +  PFPCF +LLYNVPGS  ILN+PL L QVTRL+CGGF+   R+NH M
Sbjct  108   ATVEQF--GDPIPSPFPCFQELLYNVPGSDGILNTPLLLFQVTRLKCGGFVLGFRLNHPM  165

Query  1055  ADASGLVHFLNTIAEIARGAEAPAVQPVWQREFFSARNPPRITCTHFEY-EEEPAADSMV  879
              DA G+V  LN I EIARGA+AP++ PVWQRE   ARNPPR+TC H EY  + P A    
Sbjct  166   TDALGIVQVLNAIGEIARGAQAPSILPVWQRELLCARNPPRVTCRHNEYGNDAPVAVDPT  225

Query  878   TNIP-----LDNLVHRSFLFGPTEISVLRSSLPPHLRKCSTVEILTALVWRCRTIALGFH  714
               +P     +  + HRSF+    E+S +R  +P HL  CS  E+++A +WRC  IA   +
Sbjct  226   AKVPEFHGQVHAVAHRSFVLNRKELSNIRRWIPSHLHPCSNFEVISACLWRCYAIASQAN  285

Query  713   PDEEVRMLLLINARFKFKDTPMPSGYTGNAFAYPGAKTTAGKLRKNPLGYAVELVTSIKR  534
             P+EE+RM +L+NAR KF + P+P GY GN  A P A T A KL  N LGYA+E++ + K 
Sbjct  286   PNEEMRMQMLVNARSKF-NPPLPKGYYGNVLALPAAVTNARKLCLNSLGYALEMIRNAKN  344

Query  533   CFSEEYMQSMVDLMVLKGRPPFHVAGSFIMSDLTRSKISDVDYGWGKPVFGGPAHGGAGD  354
               +EEYM+S+ DLM +    P  +  S+++SDLT      VDYGWG  ++ GP      +
Sbjct  345   RITEEYMRSLADLMEITKGQPIGLQ-SYVVSDLTSIGFDQVDYGWGNTIYTGPPKAMPDE  403

Query  353   VPGVITFHVPYENKKGENGTLIPICLPAFALDKF  252
             +    T+ +PY  K GE G ++ + L A  +++F
Sbjct  404   ISIAGTYFLPYRFKNGERGVMLLVSLRAPVMERF  437



>ref|XP_002298956.2| hypothetical protein POPTR_0001s45160g [Populus trichocarpa]
 gb|EEE83761.2| hypothetical protein POPTR_0001s45160g [Populus trichocarpa]
Length=465

 Score =   401 bits (1031),  Expect = 8e-132, Method: Compositional matrix adjust.
 Identities = 195/394 (49%), Positives = 263/394 (67%), Gaps = 10/394 (3%)
 Frame = -1

Query  1415  FYRNEPSMSGKDPVQVIRQALAKALVFFYPFAGRLREGPGRKLMVDCTGEGVMFIEADAD  1236
              Y + PSM GKDPV+VI++A+A+ALV++YPFAGR+R+GP  KL+VDCTGEGV+FIEADAD
Sbjct  50    LYAHNPSMQGKDPVKVIKEAIAQALVYYYPFAGRIRQGPDNKLIVDCTGEGVLFIEADAD  109

Query  1235  ATLQHFAIGGELKPPFPCFDQLLYNVPGSAEILNSPLFLIQVTRLRCGGFIFTLRMNHTM  1056
             AT++ F  G  +  PFPCF +LLYNVPGS  ILN+PL L QVTRL+CGGF+   R+NH M
Sbjct  110   ATVEQF--GDPIPSPFPCFQELLYNVPGSEGILNTPLLLFQVTRLKCGGFVLGFRLNHPM  167

Query  1055  ADASGLVHFLNTIAEIARGAEAPAVQPVWQREFFSARNPPRITCTHFEY-EEEPAADSMV  879
              DA G+V  LN I EIARGA+AP++ PVWQRE   ARNPPR+TC H EY  + P A    
Sbjct  168   TDALGIVQLLNAIGEIARGAQAPSILPVWQRELLCARNPPRVTCRHNEYGNDAPVAVDPT  227

Query  878   TNIP-----LDNLVHRSFLFGPTEISVLRSSLPPHLRKCSTVEILTALVWRCRTIALGFH  714
               +P     +  + HRSF+    E+S +R  +P HL  CS  E+++A +WRC  +A   +
Sbjct  228   AKVPEFHGQVHAVAHRSFVLNRKELSNIRRWIPSHLHPCSNFEVISACLWRCYAMASQAN  287

Query  713   PDEEVRMLLLINARFKFKDTPMPSGYTGNAFAYPGAKTTAGKLRKNPLGYAVELVTSIKR  534
             P+EE+RM +L+NAR KF + P+P GY GN  A P A T A KL  N LGYAVE++ + K 
Sbjct  288   PNEEMRMQMLVNARSKF-NPPLPKGYYGNVLALPAAVTNARKLCLNSLGYAVEMIRNAKN  346

Query  533   CFSEEYMQSMVDLMVLKGRPPFHVAGSFIMSDLTRSKISDVDYGWGKPVFGGPAHGGAGD  354
               +EEYM+S+ DLM +    P  +  S+++SDLT      VDYGWG  ++ GP      +
Sbjct  347   RITEEYMRSLADLMEITKGQPIGLQ-SYVVSDLTSIGFDQVDYGWGNTIYTGPPKAMPDE  405

Query  353   VPGVITFHVPYENKKGENGTLIPICLPAFALDKF  252
             +    T+ +PY  K GE G ++ + L A  +++F
Sbjct  406   ISIAGTYFLPYRFKNGERGVMLLVSLRAPVMERF  439



>ref|XP_009130369.1| PREDICTED: (Z)-3-hexen-1-ol acetyltransferase-like [Brassica 
rapa]
Length=451

 Score =   401 bits (1030),  Expect = 9e-132, Method: Compositional matrix adjust.
 Identities = 203/394 (52%), Positives = 271/394 (69%), Gaps = 9/394 (2%)
 Frame = -1

Query  1415  FYRNEPSM-SGKDPVQVIRQALAKALVFFYPFAGRLREGPGRKLMVDCTGEGVMFIEADA  1239
             FYR  P++ S  DPVQV+R+ALA+ LV++YPFAGRLREG  RKL VDCTGEGV+FIEADA
Sbjct  58    FYR--PNLTSNLDPVQVVRRALAQTLVYYYPFAGRLREGLNRKLSVDCTGEGVLFIEADA  115

Query  1238  DATLQHFAIGGELKPPFPCFDQLLYNVPGSAEILNSPLFLIQVTRLRCGGFIFTLRMNHT  1059
             D TL        L PPFPC ++LL++V GS+E+LN+PL L+QVTRL+C GFIF LR NHT
Sbjct  116   DVTLAKLEEADALLPPFPCLEELLFDVEGSSELLNTPLLLVQVTRLKCSGFIFALRFNHT  175

Query  1058  MADASGLVHFLNTIAEIARGAEAPAVQPVWQREFFSARNPPRITCTHFEYEEEPAADSMV  879
             M D +GL  FL ++ E+A G  AP+V PVW+RE   A    R+T TH EY+++   +++V
Sbjct  176   MTDGAGLSLFLKSLCELACGLHAPSVPPVWERESLIASASARVTHTHREYDDKVQPEAVV  235

Query  878   TNIPLDNLVHRSFLFGPTEISVLRSSLPPHLRKCSTVEILTALVWRCRTIALGFHPDEEV  699
                  D LV RSF FGP EIS +R  LP  L   +T E +T+ +WRCRTIAL   P+ E+
Sbjct  236   VG---DFLVSRSFFFGPEEISTIRGLLPADLHN-TTFEAMTSFLWRCRTIALSPDPNTEM  291

Query  698   RMLLLINARFKFKDTPMPSGYTGNAFAYPGAKTTAGKLRKNPLGYAVELVTSIKRCFSEE  519
             RM  ++N+R K  + P+PSGY GN FA P A  TA  L + PL + + L+   K+  +E+
Sbjct  292   RMTCIVNSRSKLSNPPIPSGYYGNVFAIPVAIATAKDLMEKPLEFPLRLIQEAKKSVTED  351

Query  518   YMQSMVDLMVLKGRPPFHVAGSFIMSDLTRSKISDVDYG-WGKPVFGGPAHGGAGDVPGV  342
             Y++SM+ LM  +GRP F  AG++I+SDL    +  VD+G WGKPV+GG A  G    PGV
Sbjct  352   YIRSMMALMATRGRPMFVAAGNYIVSDLRHFDLGKVDFGPWGKPVYGGTAKAGIAVFPGV  411

Query  341   ITFHVPYENKKGENGTLIPICLPAFALDKFVNEL  240
              +F+VP+ N+KG +GT++ I LP  A++KFV EL
Sbjct  412   -SFYVPFMNRKGVSGTVVAISLPVQAMEKFVEEL  444



>gb|KEH40976.1| benzyl alcohol O-benzoyltransferase [Medicago truncatula]
Length=417

 Score =   399 bits (1026),  Expect = 9e-132, Method: Compositional matrix adjust.
 Identities = 199/392 (51%), Positives = 263/392 (67%), Gaps = 47/392 (12%)
 Frame = -1

Query  1415  FYRNEPSMSGKDPVQVIRQALAKALVFFYPFAGRLREGPGRKLMVDCTGEGVMFIEADAD  1236
             FY   P M+ KDPV VIR+ALAK LVF+YPFAGRLREGPGRKLMVDCTGEGV+FIEADAD
Sbjct  48    FYNYVPVMAEKDPVDVIRKALAKTLVFYYPFAGRLREGPGRKLMVDCTGEGVLFIEADAD  107

Query  1235  ATLQHFAIGGELKPPFPCFDQLLYNVPGSAEILNSPLFLIQVTRLRCGGFIFTLRMNHTM  1056
              T++   +G  L PPF C D+LLY+V GS+++LN+PL LIQVTRL+CGGFIF LR+NHTM
Sbjct  108   VTIKD--LGDTLHPPFRCLDELLYDVLGSSDVLNTPLLLIQVTRLKCGGFIFALRLNHTM  165

Query  1055  ADASGLVHFLNTIAEIARGAEAPAVQPVWQREFFSARNPPRITCTHFEYEEEPAADSMVT  876
             +DA+GLV F+N + +I+RG   P++ PVW RE  +AR+PPR+TCTH EYE+ P  D+  T
Sbjct  166   SDAAGLVQFMNALGKISRGMNKPSISPVWHRELLNARDPPRVTCTHHEYEQVP--DTKGT  223

Query  875   NIPLDNLVHRSFLFGPTEISVLRSSLPPHLRKCSTVEILTALVWRCRTIALGFHPDEEVR  696
              I LD  + RSF FGPTE++ +R+ LPPH ++ S  EILTA +WRCRTIAL    + EV 
Sbjct  224   IISLDATILRSFFFGPTEVAAIRALLPPHQQEHSNFEILTAFLWRCRTIALQPDINGEVH  283

Query  695   MLLLINARFKFKDTPMPSGYTGNAFAYPGAKTTAGKLRKNPLGYAVELVTSIKRCFSEEY  516
                ++N   KF + P+P+G  GN+FA+P A TTA                          
Sbjct  284   ---IVNTHGKFINPPLPNGNYGNSFAFPAAVTTA--------------------------  314

Query  515   MQSMVDLMVLKGRPPFHVAGSFIMSDLTRSKISDVDYGWGKPVFGGPAHGGAGDVPGVIT  336
                      +K RP F V  S+++ D+  +   +VD+GWGKP +GGPA GG      V +
Sbjct  315   ---------VKSRPHFTVVRSYLVVDIKHAGFREVDFGWGKPCYGGPAKGGV-----VSS  360

Query  335   FHVPYENKKGENGTLIPICLPAFALDKFVNEL  240
              ++P++N KG  G +IP+CLP  A+++F+ EL
Sbjct  361   SYIPFKNAKGIEGLVIPVCLPTKAMERFIKEL  392



>ref|XP_007029780.1| Benzoyl coenzyme A: Benzyl alcohol benzoyl transferase [Theobroma 
cacao]
 gb|EOY10282.1| Benzoyl coenzyme A: Benzyl alcohol benzoyl transferase [Theobroma 
cacao]
Length=475

 Score =   401 bits (1031),  Expect = 1e-131, Method: Compositional matrix adjust.
 Identities = 202/393 (51%), Positives = 271/393 (69%), Gaps = 13/393 (3%)
 Frame = -1

Query  1415  FYRNEPSMSGKDPVQVIRQALAKALVFFYPFAGRLREGPGRKLMVDCTGEGVMFIEADAD  1236
             FYR +PSM GKDP  +I++AL KALVF+YP+AGRLREGP RKL+VDCTGEGV+FI+ADAD
Sbjct  73    FYRFKPSMQGKDPACIIKEALTKALVFYYPYAGRLREGPNRKLVVDCTGEGVLFIQADAD  132

Query  1235  ATLQHFAIGGELKPPFPCFDQLLYNVPGSAEILNSPLFLIQVTRLR-CGGFIFTLRMNHT  1059
              TL  F  G  L PPFPC+ +LLY VPGS EILN PL  IQ   L+     I   + NHT
Sbjct  133   VTLDQF--GDSLHPPFPCYKELLYEVPGSNEILNCPLLQIQDIFLQNMKTRIVRSKFNHT  190

Query  1058  MADASGLVHFLNTIAEIARGAEAPAVQPVWQREFFSARNPPRITCTHFEYEEEPAADSMV  879
             M+ A G + F+  + E+ARGA AP+  PV +R   +AR+ P ITC H EY+     + + 
Sbjct  191   MSKAVGQIQFMCAMGEMARGALAPSTPPVRERHLLNARHSPLITCVHDEYDNATLTNGI-  249

Query  878   TNIPLDNLVHRSFLFGPTEISVLRSSLPPHLRKCSTVEILTALVWRCRTIALGFHPDEEV  699
               +P DNL+HRSF FGPT+IS L   +P + R CST +I+ A +WRCRT AL   P+++V
Sbjct  250   -EMP-DNLLHRSFFFGPTQISALYRFVPHNFR-CSTFDIVAACLWRCRTKALKLGPNDDV  306

Query  698   RMLLLINARFKFKDTPMPSGYTGNAFAYPGAKTTAGKLRKNPLGYAVELVTSIKRCFSEE  519
             R + ++N R KF + P+PSG+ GN+  YP A TTAG+L +NP+ YA+ELV   K   +EE
Sbjct  307   RFICIVNGRSKF-NHPLPSGFYGNSLGYPVALTTAGQLCQNPMEYAIELVRQAKAKITEE  365

Query  518   YMQSMVDLMVLKGRPPFHVAGSFIMSDLTRSKISDVDYGWGKPVFGGPAHGGAGDVPGVI  339
             YM+S  DLMV++GRP  +    F++SDLTR+K  + D+GWG+  FG PA+GG       I
Sbjct  366   YMKSTADLMVIRGRPNVNTVRCFMVSDLTRAKFREADFGWGEAEFGEPAYGG-----DRI  420

Query  338   TFHVPYENKKGENGTLIPICLPAFALDKFVNEL  240
             +F++P +NK+GE G ++P+CLPA  ++ FV EL
Sbjct  421   SFYIPSKNKEGEGGIVVPVCLPAPVMECFVKEL  453



>ref|XP_009336751.1| PREDICTED: methanol O-anthraniloyltransferase-like [Pyrus x bretschneideri]
Length=459

 Score =   400 bits (1029),  Expect = 1e-131, Method: Compositional matrix adjust.
 Identities = 195/400 (49%), Positives = 274/400 (69%), Gaps = 12/400 (3%)
 Frame = -1

Query  1412  YRNEPSMS-GKDPVQVIRQALAKALVFFYPFAGRLREGPGRKLMVDCTGEGVMFIEADAD  1236
             Y++  S++  ++P++VIR+AL++ALV++YP AGRLREGP R LMVDC GEG++F+EA AD
Sbjct  49    YKDNSSLNENRNPIKVIREALSRALVYYYPLAGRLREGPNRMLMVDCNGEGILFVEASAD  108

Query  1235  ATLQHFAIGGELKPPFPCFDQLLYNVPGSAEILNSPLFLIQVTRLRCGGFIFTLRMNHTM  1056
              TL+   +G ++ PP P  ++ L+N PGS  I+  PL L+QVTRL CGGFI  LR+NHTM
Sbjct  109   VTLEQ--VGDKILPPCPLLEEFLFNFPGSDGIIGCPLLLVQVTRLTCGGFILALRLNHTM  166

Query  1055  ADASGLVHFLNTIAEIARGAEAPAVQPVWQREFFSARNPPRITCTHFEYEEE-PAADSMV  879
              DA G V FL  +AE+ARGA AP + PVW+RE   AR+PPRITC H EYE+    +D   
Sbjct  167   CDAPGFVQFLTAVAEMARGAHAPFILPVWERELLFARDPPRITCAHHEYEDVIDHSDGSY  226

Query  878   TNIPLDNLVHRSFLFGPTEISVLRSSLPPHL-RKCSTVEILTALVWRCRTIALGFHPDEE  702
              +    N+V RSF FG  E+ VLR  +PPHL   CST +++TA +W+CRT+A   +P + 
Sbjct  227   ASNNQSNMVQRSFYFGAKEMRVLRQQIPPHLISTCSTFDLITACLWKCRTLAFKINPKQV  286

Query  701   VRMLLLINARFKFKDTPMPSGYTGNAFAYPGAKTTAGKLRKNPLGYAVELVTSIKRCFSE  522
             VR+  ++NAR K  +  +P GY GNAFA+P A + A  L KNPLGYA+ELV   K   +E
Sbjct  287   VRVSCIVNARGKHNNVRLPLGYYGNAFAFPAAVSKAEPLCKNPLGYALELVKKAKATMNE  346

Query  521   EYMQSMVDLMVLKGRPPFHVAGS-FIMSDLTRSKISDVDYGWGKPVFGGPAHGGAGDVPG  345
             EY++S+ DL+VL+GRP +   GS F++SD+TR  + DV++GWG+PVF GPA         
Sbjct  347   EYLRSVADLLVLRGRPQYSSTGSNFLVSDITRVGVGDVNFGWGQPVFAGPAKA-----VD  401

Query  344   VITFHVPYENKKGENGTLIPICLPAFALDKFVNELANTFL  225
             +I+F++ ++N   E+G L+P+ LP  A+++F   L    L
Sbjct  402   LISFYIQHKNNI-EDGILVPMWLPFSAMERFQQGLERITL  440



>ref|XP_008677983.1| PREDICTED: benzyl alcohol O-benzoyltransferase-like [Zea mays]
 gb|AFW60397.1| hypothetical protein ZEAMMB73_418135 [Zea mays]
Length=478

 Score =   401 bits (1031),  Expect = 2e-131, Method: Compositional matrix adjust.
 Identities = 205/403 (51%), Positives = 272/403 (67%), Gaps = 12/403 (3%)
 Frame = -1

Query  1415  FYRNEPSMSGKDPVQVIRQALAKALVFFYPFAGRLREGPGRKLMVDCTGEGVMFIEADAD  1236
             FY  + SM GKDP  VIR ALAKALV +YP AGRLRE  GRKL VDCTGEGV+F EADAD
Sbjct  52    FYGRKESMRGKDPALVIRGALAKALVDYYPLAGRLRELQGRKLAVDCTGEGVLFTEADAD  111

Query  1235  ATLQHFAIG-GELKPPFPCFDQLLYNVPGSAEILNSPLFLIQVTRLRCGGFIFTLRMNHT  1059
               L  F  G G+L PPFPC  +L+++V GS+ IL+SPL L QVTRL CGGFI  LR+NHT
Sbjct  112   VRLDQFGGGQGQLLPPFPCLPELIFDVQGSSAILDSPLLLFQVTRLACGGFILGLRLNHT  171

Query  1058  MADASGLVHFLNTIAEIARGAEAPAVQPVWQREFFSARNPPRITCTHFEYEEEPAADSMV  879
             M D  G+V FL  +AE+ARGA+AP V+PVW+RE   AR+PPR    H E +E P A   +
Sbjct  172   MVDGQGVVQFLGAVAELARGAQAPTVRPVWRREVLEARDPPRPRFPHHELDETPDAKGAI  231

Query  878   TNIPLDNLVHRSFLFGPTEISVLRSSLPPHLRKCST-VEILTALVWRCRTIALGFHPDEE  702
                 LD  V R   FGP E++ +R+ LP HL+K +T  +++   +W+CRT+AL   P+EE
Sbjct  232   IGT-LDKTVQRCIFFGPHEVAAIRAQLPAHLQKSATRFDVVVGWLWKCRTVALAPDPNEE  290

Query  701   VRMLLLINARFKFK---DTPMPSGYTGNAFAYPGAKTTAGKLRKNPLGYAVELVTSIKRC  531
             +RM+  ++AR + +      +P GY GNAF  P A +TAG+L  NPL YAVELV   K+ 
Sbjct  291   MRMMFPVDARGRAQAVGAVGIPVGYYGNAFTTPVAISTAGELCSNPLSYAVELVKKAKQE  350

Query  530   FSEEYMQSMVDLMVLKGRP---PFHVAGSFIMSDLTRSKISDVDYGWGKPVFGGPAHG-G  363
                EYMQS  DLMVL+GR    P   A  F +SD+T++K +D+D+GWG+ V+GGPA G G
Sbjct  351   VDFEYMQSTADLMVLRGRRFVMPSETA--FGVSDVTKAKFADLDFGWGRAVYGGPAEGVG  408

Query  362   AGDVPGVITFHVPYENKKGENGTLIPICLPAFALDKFVNELAN  234
             +  +P  ++F +P++N  G++G  +P+ LP  A+D+ V E+A 
Sbjct  409   SPMLPWFVSFLLPFKNANGDDGIAVPMSLPQAAMDRIVVEIAK  451



>gb|EYU41397.1| hypothetical protein MIMGU_mgv1a024853mg, partial [Erythranthe 
guttata]
Length=433

 Score =   399 bits (1026),  Expect = 2e-131, Method: Compositional matrix adjust.
 Identities = 204/393 (52%), Positives = 267/393 (68%), Gaps = 20/393 (5%)
 Frame = -1

Query  1415  FYRNEPSMSGKDPVQVIRQALAKALVFFYPFAGRLREGPGRKLMVDCTGEGVMFIEADAD  1236
             FYR  PS+   DPV+VIR+A+AKALV +YPFAGRLRE   RKL V+CTGEGVMFIEADAD
Sbjct  45    FYRKNPSVEA-DPVEVIRKAIAKALVSYYPFAGRLREHAARKLAVECTGEGVMFIEADAD  103

Query  1235  ATLQHFAIGGELKPPFPCFDQLLYNVPGSAEILNSPLFLIQVTRLRCGGFIFTLRMNHTM  1056
               L+ F  G ELKPP PC ++LLY+VPGS  I+N+PL LIQVTRL+CGGFIF+LR NHTM
Sbjct  104   VALEQF--GDELKPPVPCLEELLYDVPGSGGIINAPLLLIQVTRLKCGGFIFSLRFNHTM  161

Query  1055  ADASGLVHFLNTIAEIARGAEAPAVQPVWQREFFSARNPPRITCTHFEYEEEPAADSMVT  876
             +D +G+  F++ + E+ARGA  P+  PVW+R   +      ++CTH E+++ P  D + T
Sbjct  162   SDGAGIAQFVSAVGELARGAGFPSTPPVWERHLLN------MSCTHHEHKDIP--DIIKT  213

Query  875   NIPLDNLVHRSFLFGPTEISVLRSSLPPHLRKCSTV-EILTALVWRCRTIALGFHPDEEV  699
                L+ +VHRSF FG  +IS LRS LPPHLR C+T  EI+TA +WRCRTIAL  HPDEEV
Sbjct  214   LTTLNKVVHRSFSFGTNQISALRSHLPPHLRHCTTTFEIVTACLWRCRTIALSLHPDEEV  273

Query  698   RMLLLINARFKFKDTPMPSGYTGNAFAYPGAKTTAGKLRKNPLGYAVELVTSIKRCFSEE  519
              +L  +++R +F + P+P GY GN   YP A TT+  L KNP  YAVEL+   K      
Sbjct  274   GILWAMDSRRRF-NPPIPDGYYGNCCIYPTATTTSEILSKNPYHYAVELLRKAK------  326

Query  518   YMQSMVDLMVLKGRPPFHVAGSFIMSDLTRSKISDVDYGWGKPVFGGPAHGGAGDVPGVI  339
              +++M D M++K    F   G + +SD       DVD+GWGK V+GG A G  G V  ++
Sbjct  327   -LEAMADPMIIKRLSRFSFVGGYAVSDARHLGFEDVDFGWGKAVYGGVAKGNIGFVRELL  385

Query  338   TFHVPYENKKGENGTLIPICLPAFALDKFVNEL  240
             + +VP +N KGENG ++ I LP  A++ F  EL
Sbjct  386   SLYVPCKNDKGENGIVVSIYLPENAMEVFTKEL  418



>ref|XP_010689158.1| PREDICTED: benzyl alcohol O-benzoyltransferase-like [Beta vulgaris 
subsp. vulgaris]
Length=443

 Score =   399 bits (1026),  Expect = 2e-131, Method: Compositional matrix adjust.
 Identities = 196/395 (50%), Positives = 274/395 (69%), Gaps = 16/395 (4%)
 Frame = -1

Query  1415  FYRNEPSMSGKDPVQVIRQALAKALVFFYPFAGRLREGPGRKLMVDCTGEGVMFIEADAD  1236
             FY+ +PSM G+DPV+V+++ LA+ALV FYP+AGRL EG  RKL VDCTGEGV+F+EADAD
Sbjct  54    FYKADPSMDGRDPVEVVKEGLARALVLFYPYAGRLVEGQARKLSVDCTGEGVVFVEADAD  113

Query  1235  ATLQHFAIGGELKPPFPCFDQLLYNVPGSAEILNSPLFLIQVTRLRCGGFIFTLRMNHTM  1056
             A L+ F  G E+ PPFP  D LLY++PG+  +L +PL + QVTRLRCGGF+  LR+NH +
Sbjct  114   ARLEDF--GDEIHPPFPLED-LLYDMPGTDAMLGTPLLIFQVTRLRCGGFVVALRVNHAI  170

Query  1055  ADASGLVHFLNTIAEIARGAEAPAVQPVWQREFFSARNPPRITCTHFEY---EEEPAADS  885
              D SG++ F+N + E+++G  AP++ PVW RE  +++  P ++  H EY   E+E  +D 
Sbjct  171   GDGSGVMQFMNAVGEMSKGFVAPSILPVWDRERLTSKRSPNVSFAHHEYDQHEDEHHSDG  230

Query  884   MVTNIPLDNLVHRSFLFGPTEISVLRSSLPPHLRKCSTVEILTALVWRCRTIALGFHPDE  705
                     NL+ +SFLFGPTE++ LR  + P +++ ST +IL+A +WRCRTIALG  P+E
Sbjct  231   ET------NLIQQSFLFGPTELAALRRHVSPGIKQYSTFDILSASLWRCRTIALGLDPEE  284

Query  704   EVRMLLLINARFKFKDTPMPSGYTGNAFAYPGAKTTAGKLRKNPLGYAVELVTSIKRCFS  525
             EVR+L  +NAR KF + P+  GY GNA A+P     AG + +N + Y +EL+   K   +
Sbjct  285   EVRLLFAVNARSKF-NPPLAKGYYGNACAFPAICAKAGDICQNKVEYILELIRKTKSEIN  343

Query  524   EEYMQSMVDLMVLKGRPPFHVAGSFIMSDLTRSKISDVDYGWGKPVFGGPAHGGAGDVPG  345
             EEYM+S++DLMV   RP F V  ++++SDL     +DVD+GWGKPVFGGP  G  G VP 
Sbjct  344   EEYMRSIMDLMVTNDRPHFTVRQTYVVSDLRHLGFADVDFGWGKPVFGGP--GSNGSVPD  401

Query  344   VITFHVPYENKKGENGTLIPICLPAFALDKFVNEL  240
               +F + ++NKKGE  T++PI LP   ++ FVNEL
Sbjct  402   A-SFFISFKNKKGETMTMVPISLPPPVMNVFVNEL  435



>ref|XP_009336752.1| PREDICTED: methanol O-anthraniloyltransferase-like [Pyrus x bretschneideri]
Length=459

 Score =   400 bits (1028),  Expect = 2e-131, Method: Compositional matrix adjust.
 Identities = 195/400 (49%), Positives = 274/400 (69%), Gaps = 12/400 (3%)
 Frame = -1

Query  1412  YRNEPSMS-GKDPVQVIRQALAKALVFFYPFAGRLREGPGRKLMVDCTGEGVMFIEADAD  1236
             Y++  S++  ++P++VIR+AL++ALV++YP AGRLREGP R LMVDC GEG++F+EA AD
Sbjct  49    YKDNSSLNENRNPIKVIREALSRALVYYYPLAGRLREGPNRMLMVDCNGEGILFVEASAD  108

Query  1235  ATLQHFAIGGELKPPFPCFDQLLYNVPGSAEILNSPLFLIQVTRLRCGGFIFTLRMNHTM  1056
              TL+   +G ++ PP P  ++ L+N PGS  I+  PL L+QVTRL CGGFI  LR+NHTM
Sbjct  109   VTLEQ--VGDKILPPCPLLEEFLFNFPGSDGIIGCPLLLVQVTRLTCGGFILALRLNHTM  166

Query  1055  ADASGLVHFLNTIAEIARGAEAPAVQPVWQREFFSARNPPRITCTHFEYEEE-PAADSMV  879
              DA G V FL  +AE+ARGA AP + PVW+RE   AR+PPRITC H EYE+    +D   
Sbjct  167   CDAPGFVQFLTAVAEMARGAHAPFILPVWERELLFARDPPRITCAHHEYEDVIDHSDGSY  226

Query  878   TNIPLDNLVHRSFLFGPTEISVLRSSLPPHL-RKCSTVEILTALVWRCRTIALGFHPDEE  702
              +    N+V RSF FG  E+ VLR  +PPHL   CST +++TA +W+CRT+A   +P + 
Sbjct  227   ASNNQSNMVQRSFYFGAKEMRVLRQQIPPHLISTCSTFDLITACLWKCRTLAFKINPKQV  286

Query  701   VRMLLLINARFKFKDTPMPSGYTGNAFAYPGAKTTAGKLRKNPLGYAVELVTSIKRCFSE  522
             VR+  ++NAR K  +  +P GY GNAFA+P A + A  L KNPLGYA+ELV   K   +E
Sbjct  287   VRVSCIVNARGKHNNVRLPLGYYGNAFAFPAAVSKAEPLCKNPLGYALELVKKAKATMNE  346

Query  521   EYMQSMVDLMVLKGRPPFHVAGS-FIMSDLTRSKISDVDYGWGKPVFGGPAHGGAGDVPG  345
             EY++S+ DL+VL+GRP +   GS F++SD+TR  + DV++GWG+PVF GPA         
Sbjct  347   EYLRSVADLLVLRGRPQYSSTGSNFLVSDITRVGVGDVNFGWGQPVFAGPAKA-----VD  401

Query  344   VITFHVPYENKKGENGTLIPICLPAFALDKFVNELANTFL  225
             +I+F++ ++N   E+G L+P+ LP  A+++   EL    L
Sbjct  402   LISFYIQHKNNI-EDGILVPMWLPFSAMERGQQELERITL  440



>ref|XP_010492712.1| PREDICTED: (Z)-3-hexen-1-ol acetyltransferase-like [Camelina 
sativa]
Length=447

 Score =   399 bits (1026),  Expect = 2e-131, Method: Compositional matrix adjust.
 Identities = 202/399 (51%), Positives = 274/399 (69%), Gaps = 8/399 (2%)
 Frame = -1

Query  1415  FYRNEPSMSGKDPVQVIRQALAKALVFFYPFAGRLREG-PGRKLMVDCTGEGVMFIEADA  1239
             FYR+ P+    DPV VIR++LA+ LV++YPFAGRLR+G P RKL VDCTGEGV+FIEADA
Sbjct  48    FYRHSPN-PYSDPVAVIRRSLAETLVYYYPFAGRLRDGGPNRKLAVDCTGEGVLFIEADA  106

Query  1238  DATLQHFAIGGELKPPFPCFDQLLYNVPGSAEILNSPLFLIQVTRLRCGGFIFTLRMNHT  1059
             D TL  F     LKPPFPCF++LL++V GS+E+LN+PL L+QVTRL+CGGFIF +R+NH 
Sbjct  107   DVTLVEFEEKDVLKPPFPCFEELLFDVNGSSEVLNAPLMLMQVTRLKCGGFIFAVRINHV  166

Query  1058  MADASGLVHFLNTIAEIARGAEAPAVQPVWQREFFSARNPPRITCTHFEYEEEPAADSMV  879
             M+DA+GL  FL T+ + ARG  AP V PVW+R   +AR P R++  H EY+E P   +  
Sbjct  167   MSDAAGLSLFLKTVCDFARGYHAPKVAPVWERHLLNARVPLRVSHAHREYDEIPVVGTD-  225

Query  878   TNIPLDNLVHRSFLFGPTEISVLRSSLPPHLRKCSTV-EILTALVWRCRTIALGFHPDEE  702
              +   DNLV RSF FG  E+S +R  LPP+L   STV E LT+ +WR RT+A+   P++E
Sbjct  226   NDSKEDNLVSRSFFFGHKEMSAIRRLLPPNLVNRSTVMETLTSFIWRYRTVAIQPDPNKE  285

Query  701   VRMLLLINARFKFKDTPMPSGYTGNAFAYPGAKTTAGKLRKNPLGYAVELVTSIKRCFSE  522
             +R++ +++AR K    P+  GY GNAFA+P A  TA +L K PL +A+ L    K   +E
Sbjct  286   MRLIFIVSARSKLTTPPLSPGYYGNAFAFPVAIATARELTKKPLEFALRLAKEAKYSVTE  345

Query  521   EYMQSMVDLMVLKGRPPFHVAGSFIMSDLTRSKISDVDYG-WGKPVFGGPAHGGAGDVPG  345
             EYM+S+ DLMV KGRP F   G++++SD+     +++D+G WGKPV+GG    G  D PG
Sbjct  346   EYMRSLADLMVTKGRPSFSSDGAYLVSDV--RIFANIDFGIWGKPVYGGIGTAGVVDFPG  403

Query  344   VITFHVPYENKKGENGTLIPICLPAFALDKFVNELANTF  228
               + +V  E + GE G ++P+CLP  A+ +FV EL   F
Sbjct  404   A-SCYVSAEKRNGERGIIVPVCLPEKAMQRFVKELEGVF  441



>ref|XP_004494963.1| PREDICTED: benzyl alcohol O-benzoyltransferase-like [Cicer arietinum]
Length=456

 Score =   399 bits (1026),  Expect = 3e-131, Method: Compositional matrix adjust.
 Identities = 196/393 (50%), Positives = 262/393 (67%), Gaps = 7/393 (2%)
 Frame = -1

Query  1412  YRNEPSMSGKDPVQVIRQALAKALVFFYPFAGRLREGPGRKLMVDCTGEGVMFIEADADA  1233
             YR+EPSM  KDPV+V++ +L++ LV++YPFAGR+REG  RKLMVDC GEGVMFIEA+AD 
Sbjct  50    YRHEPSMIEKDPVKVLKHSLSQTLVYYYPFAGRIREGDNRKLMVDCNGEGVMFIEAEADV  109

Query  1232  TLQHFAIGGELKPPFPCFDQLLYNVPGSAEILNSPLFLIQVTRLRCGGFIFTLRMNHTMA  1053
             TL  F  G  L+PPFPCF QLLY+ P   +I++ PL  IQVTR++CGGFI  L +NHTM 
Sbjct  110   TLDQF--GDTLQPPFPCFQQLLYDAPDIGQIIDCPLLHIQVTRIKCGGFILALTINHTMC  167

Query  1052  DASGLVHFLNTIAEIARGAEAPAVQPVWQREFFSARNPPRITCTHFEYEEEPAADSMVTN  873
             DASG   F+N  AE+A G+  P++QP+W REF   R PP I+  H EYE+     +    
Sbjct  168   DASGFKQFMNAWAEMAGGSHQPSIQPIWFREFLMGREPPHISFNHREYEQ--LLPNTTKE  225

Query  872   IPLDNLVHRSFLFGPTEISVLRSSLPPHLRKCSTVEILTALVWRCRTIALGFHPDEEVRM  693
                  +VH+SF F  + I+ +R  +P +LR+C+  +++TA  W C T A+   P+E+VR+
Sbjct  226   EDTTTIVHKSFFFTHSHIATIRRLVPLNLRQCTDFDLITACFWYCHTKAMQLEPNEDVRI  285

Query  692   LLLINARFKFKDTPMPS--GYTGNAFAYPGAKTTAGKLRKNPLGYAVELVTSIKRCFSEE  519
             + ++NAR  FK     S  GY GN FA+P A TTAGKL  N LGYAVEL+   K   +EE
Sbjct  286   MCVVNARSMFKKINRSSLVGYYGNCFAFPAAVTTAGKLCGNSLGYAVELIRKAKIEVTEE  345

Query  518   YMQSMVDLMVLKGRPPFHVAGSFIMSDLTRSKISDVDYGWGKPVFGGPAHGGAGDVPGVI  339
             YM S+ DLM +K R  F    S  +SD+ R K+S+V++GWG+ ++GG A GG G   GV 
Sbjct  346   YMNSVADLMDIKERCLFTTVRSCFVSDVARVKLSEVNFGWGEAMYGGVAKGGVGPFTGV-  404

Query  338   TFHVPYENKKGENGTLIPICLPAFALDKFVNEL  240
             TF VPY+N KGE   ++PI LP   + +F NEL
Sbjct  405   TFIVPYKNAKGEESLMLPISLPYEDMKRFSNEL  437



>ref|XP_008373467.1| PREDICTED: methanol O-anthraniloyltransferase-like [Malus domestica]
Length=459

 Score =   400 bits (1027),  Expect = 3e-131, Method: Compositional matrix adjust.
 Identities = 199/395 (50%), Positives = 274/395 (69%), Gaps = 12/395 (3%)
 Frame = -1

Query  1412  YRNEPSMSGK-DPVQVIRQALAKALVFFYPFAGRLREGPGRKLMVDCTGEGVMFIEADAD  1236
             Y++ PS++   +PV+VIR+AL++ALV++YP AGRLREGP RKLMVDC GEG++FIEA AD
Sbjct  49    YKDNPSLNKHHNPVKVIREALSRALVYYYPLAGRLREGPNRKLMVDCNGEGILFIEAFAD  108

Query  1235  ATLQHFAIGGELKPPFPCFDQLLYNVPGSAEILNSPLFLIQVTRLRCGGFIFTLRMNHTM  1056
              TL+   +G ++ P  P  ++ LYN PGS  I++ PL L+QVT L CGGFI  LR+NHTM
Sbjct  109   VTLEQ--LGEKILPHCPPLEEFLYNFPGSDRIISCPLLLVQVTCLICGGFILALRINHTM  166

Query  1055  ADASGLVHFLNTIAEIARGAEAPAVQPVWQREFFSARNPPRITCTHFEYEEE-PAADSMV  879
              DA GL+ FL  IAE+ARGA AP++ PVW+RE   AR+PPRITC H EYE+    ++   
Sbjct  167   CDAPGLLLFLTAIAEMARGAHAPSILPVWERELLFARDPPRITCVHHEYEDVIDHSNGSY  226

Query  878   TNIPLDNLVHRSFLFGPTEISVLRSSLPPHL-RKCSTVEILTALVWRCRTIALGFHPDEE  702
             T+    N+V RSF FG  E+ VLR  +PPHL   CST +++TA +W+CRT+AL  +P + 
Sbjct  227   TSSNQSNMVQRSFYFGAKEMRVLRKQIPPHLISTCSTFDLITACLWKCRTLALKINPKQA  286

Query  701   VRMLLLINARFKFKDTPMPSGYTGNAFAYPGAKTTAGKLRKNPLGYAVELVTSIKRCFSE  522
             VR   ++NAR K  +  +P GY GNAFA+P A + A  L KNPLGYA+ELV   K   +E
Sbjct  287   VRXSCIVNARGKHHNVRLPLGYYGNAFAFPXAVSKAEPLCKNPLGYALELVKKAKATMNE  346

Query  521   EYMQSMVDLMVLKGRPPFHVAGS-FIMSDLTRSKISDVDYGWGKPVFGGPAHGGAGDVPG  345
             EY++S+ DL+VL+GRP +    S FI+SD TR+   DV++GWG+PV  GPA         
Sbjct  347   EYLRSVADLLVLRGRPQYSSTXSYFIVSDTTRAGFGDVNFGWGRPVIAGPAKAL-----D  401

Query  344   VITFHVPYENKKGENGTLIPICLPAFALDKFVNEL  240
             +I+F++ ++N   + G L+P+CLP  A+++F  EL
Sbjct  402   LISFYIQHKNNTXD-GILVPMCLPFSAMERFQQEL  435



>ref|XP_006470742.1| PREDICTED: anthraniloyl-CoA:methanol acyltransferase-like [Citrus 
sinensis]
Length=447

 Score =   399 bits (1024),  Expect = 5e-131, Method: Compositional matrix adjust.
 Identities = 206/399 (52%), Positives = 269/399 (67%), Gaps = 14/399 (4%)
 Frame = -1

Query  1415  FYRNEPS--MSGKDPVQVIRQALAKALVFFYPFAGRLREGPGRKLMVDCTGEGVMFIEAD  1242
             FY+N PS  M GKDPV+VI++AL++ALV++YPFAGRLREG   KLMVDC GEGV+F EAD
Sbjct  51    FYKNNPSPSMKGKDPVKVIKEALSRALVYYYPFAGRLREGSDGKLMVDCNGEGVLFTEAD  110

Query  1241  ADATLQHFAIGGELKPPFPCFDQLLYNVPGSAEILNSPLFLIQVTRLRCGGFIFTLRMNH  1062
             AD +L       E+KPP P  D+LLY+VPGS   L  PL LIQVTRL CGGF+   R NH
Sbjct  111   ADFSLDQLG-DDEIKPPCPYLDELLYDVPGSEGTLGCPLLLIQVTRLICGGFVLAFRGNH  169

Query  1061  TMADASGLVHFLNTIAEIA-RGAEAPAVQPVWQREFFSARNPPRITCTHFEYEE-EPAAD  888
             TM DA G V FL  + E+A   A+AP++ P+WQREF +ARNPP+I+C H EY++ +P   
Sbjct  170   TMCDAFGFVQFLKAMEEMAWDNAKAPSLLPIWQREFLNARNPPQISCVHHEYDQIDPIKA  229

Query  887   SMVTNIPLDNLVHRSFLFGPTEISVLRSSLPPHLRKCSTVEILTALVWRCRTIALGFHPD  708
             ++ T  P ++L H+S  FGP EI  LR+ LPPHL+ C+T E+LTA +WRCRTIALG  P+
Sbjct  230   TLRTKNP-NDLDHKSLFFGPKEILSLRNQLPPHLKNCTTFELLTACIWRCRTIALGLDPN  288

Query  707   EEVRMLLLINARFKFKDTPMPSGYTGNAFAYPGAKTTAGKLRKNPLGYAVELVTSIKRCF  528
             E VR+    N R K  +  +P GY GNAF +P   +   +L  +PLGYAVELV   K   
Sbjct  289   EIVRVSFTFNIRGKRFNMQIPQGYYGNAFVFPAVCSRVDELCGSPLGYAVELVKEGKAKV  348

Query  527   SEEYMQSMVDLMVLKGRPPFHVAGS--FIMSDLTRSKISDVDYGWGKPVFGGPAHGGAGD  354
             SEEY++S+ DLMV +GRP     G   FI+SD TR+   ++D+GWGKP+F G A      
Sbjct  349   SEEYIRSVADLMVTRGRPVPTTMGDLYFIVSDTTRTGFEEIDFGWGKPMFAGIAGCAL--  406

Query  353   VPGVITFHVPYENKK-GENGTLIPICLPAFALDKFVNEL  240
                 I+F+V Y+ K  GE G ++PI LP  A+++F  E+
Sbjct  407   ---FISFYVNYQKKNDGECGIVVPIRLPFSAMERFQEEI  442



>emb|CDY43120.1| BnaA05g32660D [Brassica napus]
Length=451

 Score =   399 bits (1025),  Expect = 5e-131, Method: Compositional matrix adjust.
 Identities = 200/394 (51%), Positives = 270/394 (69%), Gaps = 9/394 (2%)
 Frame = -1

Query  1415  FYRNEPSM-SGKDPVQVIRQALAKALVFFYPFAGRLREGPGRKLMVDCTGEGVMFIEADA  1239
             FYR  P++ S  DPVQV+R+ALA+ LV++YPFAGRLREG  RKL VDCTGEGV+FIEADA
Sbjct  58    FYR--PNLTSNLDPVQVVRRALAQTLVYYYPFAGRLREGLNRKLSVDCTGEGVLFIEADA  115

Query  1238  DATLQHFAIGGELKPPFPCFDQLLYNVPGSAEILNSPLFLIQVTRLRCGGFIFTLRMNHT  1059
             D TL        L PPFPC ++LL++V GS+E+LN+PL L+QVTRL+C GFIF LR NHT
Sbjct  116   DVTLAKLEEADALLPPFPCLEELLFDVEGSSELLNTPLLLVQVTRLKCSGFIFALRFNHT  175

Query  1058  MADASGLVHFLNTIAEIARGAEAPAVQPVWQREFFSARNPPRITCTHFEYEEEPAADSMV  879
             M D +GL  FL ++ E+A G  AP+V P W+R+   A    R+T TH EY+++   +++V
Sbjct  176   MTDGAGLSLFLKSLCELACGLHAPSVPPAWERQLLIASASARVTHTHREYDDKVEPEAVV  235

Query  878   TNIPLDNLVHRSFLFGPTEISVLRSSLPPHLRKCSTVEILTALVWRCRTIALGFHPDEEV  699
                  D LV RSF FGP EIS +R  LP  L   +T E +T+ +WRCRT+AL   P+ E+
Sbjct  236   VG---DFLVSRSFFFGPEEISAIRRLLPTDLHN-TTFEAITSFLWRCRTVALSPDPNTEM  291

Query  698   RMLLLINARFKFKDTPMPSGYTGNAFAYPGAKTTAGKLRKNPLGYAVELVTSIKRCFSEE  519
             RM  ++N+R K  + P+PSGY GN FA P A  TA  L + PL + + L+   K+  +E+
Sbjct  292   RMTCIVNSRSKLSNPPIPSGYYGNVFAIPVAIATAKDLMEKPLEFPLRLIQEAKKSVTED  351

Query  518   YMQSMVDLMVLKGRPPFHVAGSFIMSDLTRSKISDVDYG-WGKPVFGGPAHGGAGDVPGV  342
             Y++SM  LM  +GRP F  AG++I+SDL    +  VD+G WGKPV+GG A  G    PGV
Sbjct  352   YIRSMTALMATRGRPMFVAAGNYIVSDLRHFDLGKVDFGPWGKPVYGGTAKAGIAVFPGV  411

Query  341   ITFHVPYENKKGENGTLIPICLPAFALDKFVNEL  240
              +F+VP++N+KG +GT++ I LP  A++KFV EL
Sbjct  412   -SFYVPFKNRKGVSGTVVAISLPVQAMEKFVEEL  444



>ref|XP_010689156.1| PREDICTED: benzyl alcohol O-benzoyltransferase-like [Beta vulgaris 
subsp. vulgaris]
Length=443

 Score =   398 bits (1023),  Expect = 8e-131, Method: Compositional matrix adjust.
 Identities = 196/392 (50%), Positives = 270/392 (69%), Gaps = 10/392 (3%)
 Frame = -1

Query  1415  FYRNEPSMSGKDPVQVIRQALAKALVFFYPFAGRLREGPGRKLMVDCTGEGVMFIEADAD  1236
             FYR +PSM GKDPV+V++ ALAKALVF+YP+AGRL EGP RKL VDCTGEG+ FIEADAD
Sbjct  54    FYRADPSMEGKDPVKVVKDALAKALVFYYPYAGRLVEGPTRKLSVDCTGEGLPFIEADAD  113

Query  1235  ATLQHFAIGGELKPPFPCFDQLLYNVPGSAEILNSPLFLIQVTRLRCGGFIFTLRMNHTM  1056
             A L+ F  G E+ PPFP  D LLY++PG+  +L +PL ++QVTRL+CGGFI  LR NH++
Sbjct  114   ARLEDF--GDEIHPPFPLED-LLYDIPGTDGMLGTPLIIVQVTRLKCGGFIIALRANHSV  170

Query  1055  ADASGLVHFLNTIAEIARGAEAPAVQPVWQREFFSARNPPRITCTHFEYEEEPAADSMVT  876
              D +G++ F+N + E+ RG++ P+V PVW RE   A   P+++  H EY++         
Sbjct  171   CDGTGVMQFMNAVGEMGRGSDTPSVLPVWDRERLIAGESPKVSFPHPEYDQHEVDHHSNG  230

Query  875   NIPLDNLVHRSFLFGPTEISVLRSSLPPHLRKCSTVEILTALVWRCRTIALGFHPDEEVR  696
                  NL+ +SFLFGPTE+  LR  +PPH+++ ST +IL+A +WRCRTIALG  P+EEVR
Sbjct  231   EA---NLLQQSFLFGPTELEALRRHIPPHIKQFSTFDILSACLWRCRTIALGLDPNEEVR  287

Query  695   MLLLINARFKFKDTPMPSGYTGNAFAYPGAKTTAGKLRKNPLGYAVELVTSIKRCFSEEY  516
             +   +NAR KF + P+  GY GNA A+P     AG++  N + Y + L+ + K   +EEY
Sbjct  288   LCFAVNARTKF-NPPLEKGYYGNACAFPAVCAKAGEICNNKVDYILGLIRNAKSEINEEY  346

Query  515   MQSMVDLMVLKGRPPFHVAGSFIMSDLTRSKISDVDYGWGKPVFGGPAHGGAGDVPGVIT  336
             M+S++DLM+ K RP F V  ++++SDL     +DVD GWGKPVFGGPA  G+  +P   +
Sbjct  347   MRSIMDLMITKDRPHFTVRQTYVVSDLRHLGFADVDIGWGKPVFGGPASNGS--IPDA-S  403

Query  335   FHVPYENKKGENGTLIPICLPAFALDKFVNEL  240
             F + ++NKKGE   ++PI L    +D FV EL
Sbjct  404   FFISFKNKKGETMIMVPISLSPPVMDVFVQEL  435



>ref|XP_008356442.1| PREDICTED: methanol O-anthraniloyltransferase-like [Malus domestica]
Length=460

 Score =   398 bits (1023),  Expect = 1e-130, Method: Compositional matrix adjust.
 Identities = 189/395 (48%), Positives = 269/395 (68%), Gaps = 11/395 (3%)
 Frame = -1

Query  1412  YRNEPSMSGKDPVQVIRQALAKALVFFYPFAGRLREGPGRKLMVDCTGEGVMFIEADADA  1233
             Y + PS    DPVQVIR AL+++LV++YP AGR+REGP +KLMVDC GEGV+FIEA+AD 
Sbjct  52    YTSNPSSKEIDPVQVIRDALSRSLVYYYPLAGRVREGPNKKLMVDCNGEGVLFIEAEADV  111

Query  1232  TLQHFAIGGELKPPFPCFDQLLYNVPGSAEILNSPLFLIQVTRLRCGGFIFTLRMNHTMA  1053
             TL+   +G  L+PP P  +  LY+VPG+ +I+ +PL  +QVTRL+CGGFIF +R+NHTM 
Sbjct  112   TLEQ--LGDTLQPPCPLLEDFLYDVPGTNDIVGTPLLJVQVTRLKCGGFIFAMRLNHTMF  169

Query  1052  DASGLVHFLNTIAEIARGAEAPAVQPVWQREFFSARNPPRITCTHFEY--EEEPAADSMV  879
             DA GL  FLN + EIARGA AP++ P+W+R   +AR PP++T  H EY  E E  A S++
Sbjct  170   DALGLAQFLNAVGEIARGAHAPSIPPIWERXLLNAREPPQVTYMHHEYGDENESQAGSVI  229

Query  878   TNIPLDNLVHRSFLFGPTEISVLRSSLPPHLRK-CSTVEILTALVWRCRTIALGFHPDEE  702
              ++   +L+ R F F P  I   R  LPP+L   CST E++T  +W+CRTIAL  +P+E 
Sbjct  230   ASVDQPDLIQRCFYFSPKGIRSARKHLPPNLSNTCSTFELITGCLWKCRTIALAMNPNEA  289

Query  701   VRMLLLINARFKFKDTPMPSGYTGNAFAYPGAKTTAGKLRKNPLGYAVELVTSIKRCFSE  522
             VR+ L++NAR K  +  +P G+ GNA  +P   +TA  L  +PL YAV+LV   K   +E
Sbjct  290   VRVSLVVNARGKRNNLNVPLGFYGNAIGFPSVXSTAELLCNSPLEYAVQLVREAKNKMNE  349

Query  521   EYMQSMVDLMVLKGRPPFHVAG-SFIMSDLTRSKISDVDYGWGKPVFGGPAHGGAGDVPG  345
             +Y++S+ DL+ L+G PP  +AG +FI+SD TR+ + +VD+GWGKP+  GPA         
Sbjct  350   DYIKSVADLLALRGWPPLTLAGNNFILSDNTRTGVGEVDFGWGKPIIAGPAKSV-----N  404

Query  344   VITFHVPYENKKGENGTLIPICLPAFALDKFVNEL  240
             +I+F+V   N++ + G L+P+CLP + ++K   EL
Sbjct  405   LISFYVRDSNQEKDYGILVPMCLPFWCMEKIEQEL  439



>ref|XP_006470748.1| PREDICTED: anthraniloyl-CoA:methanol acyltransferase-like [Citrus 
sinensis]
Length=463

 Score =   398 bits (1022),  Expect = 2e-130, Method: Compositional matrix adjust.
 Identities = 201/389 (52%), Positives = 262/389 (67%), Gaps = 11/389 (3%)
 Frame = -1

Query  1400  PSMSGKDPVQVIRQALAKALVFFYPFAGRLREGPGRKLMVDCTGEGVMFIEADADATLQH  1221
             P +  KDPV+VI++A+++ALV++YPFAGRL EGP RKLMVDC GEG++F+EA+A+  L+ 
Sbjct  60    PVLKEKDPVKVIKEAISEALVYYYPFAGRLIEGPNRKLMVDCNGEGILFLEAEANFKLEQ  119

Query  1220  FAIGGELKPPFPCFDQLLYNVPGSAEILNSPLFLIQVTRLRCGGFIFTLRMNHTMADASG  1041
               +GG ++PP P  +QL YNVPGS  IL  PL LIQVTRL CGGF   +R NHTM DASG
Sbjct  120   --LGGAIQPPCPYLEQLTYNVPGSEGILGCPLLLIQVTRLMCGGFTLAIRFNHTMCDASG  177

Query  1040  LVHFLNTIAEIARGAEAPAVQPVWQREFFSARNPPRITCTHFEYEE-EPAADSMVTNIPL  864
             LV F+ TI E+ARGA   ++ PVWQRE   ARNPP++T  H EYEE    +D+ +T  P 
Sbjct  178   LVQFVKTIEEMARGANTLSIFPVWQRERLCARNPPQVTSVHLEYEEINNNSDTFITTNP-  236

Query  863   DNLVHRSFLFGPTEISVLRSSLPPHLRKCSTVEILTALVWRCRTIALGFHPDEEVRMLLL  684
             + + H+SF FGP E+ VL++ LP HLR CST E+L A +WRCRTIAL   P + V+   L
Sbjct  237   NEMDHKSFYFGPKEVRVLKNQLPLHLRNCSTFELLAACMWRCRTIALQLDPKDTVQFSCL  296

Query  683   INARFKFKDTPMPSGYTGNAFAYPGAKTTAGKLRKNPLGYAVELVTSIKRCFSEEYMQSM  504
             + AR K     +PSGY GNA A+P   +  G L  NPLGYAV LV   K   SEE+++S 
Sbjct  297   VTARAKDYKMDIPSGYYGNAVAFPAVHSKVGALCNNPLGYAVALVKKAKAEMSEEHIRSA  356

Query  503   VDLMVLKGRPPFH-VAGSFIMSDLTRSKISDVDYGWGKPVFGGPAHGGAGDVPGVITFHV  327
              DLM +KGR P H + G++I+SDL++     +D GWGKPVF G A   +     + +F  
Sbjct  357   ADLMEVKGRRPRHAIKGNYIVSDLSKVGFDRIDLGWGKPVFAGIAGAKS-----IFSFLN  411

Query  326   PYENKKGENGTLIPICLPAFALDKFVNEL  240
              Y+ K GE GTLIPI LP  ++ +F  EL
Sbjct  412   RYQ-KDGETGTLIPIRLPRPSMKRFEEEL  439



>ref|XP_003536109.1| PREDICTED: benzyl alcohol O-benzoyltransferase-like [Glycine 
max]
Length=459

 Score =   398 bits (1022),  Expect = 2e-130, Method: Compositional matrix adjust.
 Identities = 209/395 (53%), Positives = 270/395 (68%), Gaps = 11/395 (3%)
 Frame = -1

Query  1415  FYRNEPSMSGKDPVQVIRQALAKALVFFYPFAGRLRE-GPGRKLMVDCTGEGVMFIEADA  1239
             FYRN+PS++GKDPVQ IR ALA+ALVF+YPFAGR++E G   KL+VDC  EGVMFIEADA
Sbjct  59    FYRNDPSLAGKDPVQAIRNALAEALVFYYPFAGRIKEEGSDGKLVVDCNEEGVMFIEADA  118

Query  1238  DATLQHFAIGGELKPPFPCFDQLLYNVPGSAEILNSPLFLIQVTRLRCGGFIFTLRMNHT  1059
             D TL  F  G  LKPPFPCF +LLY  PGS  I ++P+FLIQVTRL+CGGFI  +R NH 
Sbjct  119   DVTLDQF--GDALKPPFPCFQELLYQPPGSDGITDAPIFLIQVTRLKCGGFILAIRFNHV  176

Query  1058  MADASGLVHFLNTIAEIARGA-EAPAVQPVWQREFFSARNPPRITCTHFEYEEEPAADSM  882
             M D  GL+HF  T+A IARGA + P  QPVW RE   AR+PPR+T  H EYE+   ++  
Sbjct  177   MVDGVGLIHFTLTVAGIARGAMKEPPFQPVWSRELLFARDPPRVTFNHREYEQLTDSNDA  236

Query  881   VTNIPLDNLVHRSFLFGPTEISVLRSSLPPHL-RKCSTVEILTALVWRCRTIALGFHPDE  705
             V+     +   RSF FGPTE + +R+ LP  L ++ +T E+LT+ VWRCRT AL   P+E
Sbjct  237   VST----DFEQRSFFFGPTETASIRALLPRDLDQRATTFEVLTSYVWRCRTKALQIPPNE  292

Query  704   EVRMLLLINARFKFKDTPMPSGYTGNAFAYPGAKTTAGKLRKNPLGYAVELVTSIKRCFS  525
             +VRM+ +++AR KF D P P+G+ G+ FA+P A T AG L + PL YAV+L+   +   S
Sbjct  293   DVRMMCIVDARGKF-DPPFPAGFYGSCFAFPAAVTGAGDLCEKPLEYAVQLIQKARGEVS  351

Query  524   EEYMQSMVDLMVLKGRPPFHVAGSFIMSDLTRSKISDVDYGWGKPVFGGPAHGGAGDVPG  345
             EEY+ S+ DLM  +GRP F V  S ++ D T +   ++D+GWG  ++GG A  GAG  P 
Sbjct  352   EEYIDSVADLMASEGRPLFTVVRSCLVLDTTEAGFRNLDFGWGNALYGGMAVAGAGAFPA  411

Query  344   VITFHVPYENKKGENGTLIPICLPAFALDKFVNEL  240
             V  FHVP +N KGE G L+ ICLP+  +  F  EL
Sbjct  412   V-NFHVPSQNAKGEEGILVLICLPSQVMKAFAKEL  445



>ref|XP_002524024.1| 3'-N-debenzoyl-2'-deoxytaxol N-benzoyltransferase, putative [Ricinus 
communis]
 gb|EEF38392.1| 3'-N-debenzoyl-2'-deoxytaxol N-benzoyltransferase, putative [Ricinus 
communis]
Length=434

 Score =   396 bits (1018),  Expect = 3e-130, Method: Compositional matrix adjust.
 Identities = 188/388 (48%), Positives = 265/388 (68%), Gaps = 13/388 (3%)
 Frame = -1

Query  1397  SMSGKDPVQVIRQALAKALVFFYPFAGRLRE--GPGRKLMVDCTGEGVMFIEADADATLQ  1224
              +  +D ++VI++AL + LVF+YPFAGRLRE     RKL+V+CTGEG++F+EA AD +L 
Sbjct  37    DIDDQDGLRVIKKALEETLVFYYPFAGRLREVRNNNRKLVVECTGEGILFVEAFADVSLD  96

Query  1223  HFAIGGELKPPFPCFDQLLYNVPGSAEILNSPLFLIQVTRLRCGGFIFTLRMNHTMADAS  1044
              F     ++PPFPCFD+LL +VPGS+ I+N PL LIQ TRL+CGG I  +R+NHT++D  
Sbjct  97    QFG-DDAIRPPFPCFDELLSDVPGSSGIINCPLLLIQATRLKCGGIILAIRLNHTISDGG  155

Query  1043  GLVHFLNTIAEIARGAEAPAVQPVWQREFFSARNPPRITCTHFEYEEEPAADSMVTNIPL  864
             G   F +T++E+ARGA AP+V P+W R   +AR+PPRITC H EY +    +  V   PL
Sbjct  156   GFFQFWSTVSEMARGARAPSVLPIWDRHLLNARDPPRITCAHHEYVDLVDTEEQV---PL  212

Query  863   DNLVHRSFLFGPTEISVLRSSLPPHLRKCSTVEILTALVWRCRTIALGFHPDEEVRMLLL  684
              +  HRSF  GP EI+ LR   PPH   CS  EI+TA  WRCRTIAL  +P+EE+R++ +
Sbjct  213   ADKDHRSFFLGPAEIASLRRLAPPHFHNCSDYEIITASFWRCRTIALQPNPNEEMRVICI  272

Query  683   INARFKFKDTPMPSGYTGNAFAYPGAKTTAGKLRKNPLGYAVELVTSIKRCFSEEYMQSM  504
             +NAR KF + P+P GY GN  AY  A   A  L + P+GYA+ELV   K   +EEYM+S+
Sbjct  273   VNARNKF-NPPIPRGYYGNCIAYSAAVAKAEDLCQKPIGYALELVRKAKANVTEEYMRSV  331

Query  503   VDLMVLKGRPPFHVAGSFIMSDLTRSKISDVDYGWGKPVFGGPAHGGAGDVPGVITFHVP  324
              DLMV++ RP + +  +F++S + + ++ +VD+GWG+ ++GGPA G       V +FH+ 
Sbjct  332   ADLMVIRCRPWYTMVRTFLVSGVGKLRLDEVDFGWGRALYGGPAKG------NVASFHIA  385

Query  323   YENKKGENGTLIPICLPAFALDKFVNEL  240
             Y  K+GE+G L+ +CLP  A+ +FV EL
Sbjct  386   YRKKEGEDGVLVTLCLPKLAMQRFVKEL  413



>ref|XP_006470747.1| PREDICTED: anthraniloyl-CoA:methanol acyltransferase-like [Citrus 
sinensis]
Length=468

 Score =   397 bits (1021),  Expect = 3e-130, Method: Compositional matrix adjust.
 Identities = 197/416 (47%), Positives = 268/416 (64%), Gaps = 27/416 (6%)
 Frame = -1

Query  1415  FYRNEPS--MSGKDPVQVIRQALAKALVFFYPFAGRLREGPGRKLMVDCTGEGVMFIEAD  1242
             FY+N+PS  M G+DPV+VIR+A++KALVF+YP AGRL+EG  RKLMV+C  EGV+FIEAD
Sbjct  50    FYKNDPSPSMQGRDPVKVIREAISKALVFYYPLAGRLKEGYNRKLMVECNAEGVLFIEAD  109

Query  1241  ADATLQHFAIGGELKPPFPCFDQLLYNVPGSAEILNSPLFLIQVTRLRCGGFIFT-----  1077
             A+ TL+   +G +++PP P  +QL+Y+VPGS  IL  PL L+ ++    GGFIF      
Sbjct  110   ANFTLEQ--LGDDIQPPCPYLNQLIYDVPGSEGILGCPLLLVYISCFAIGGFIFVFIGDA  167

Query  1076  -------LRMNHTMADASGLVHFLNTIAEIARGAEAPAVQPVWQREFFSARNPPRITCTH  918
                    LR NHTM DA GLV FL  I ++ARG  +P + P+WQR+  +ARNPP++TC H
Sbjct  168   FDMQRIHLRFNHTMCDAFGLVQFLKAIEDMARGERSPTLFPIWQRQILNARNPPQVTCIH  227

Query  917   FEYEEEPAADSMVTNIPLDNLVHRSFLFGPTEISVLRSSLPPHLRKCSTVEILTALVWRC  738
              EY+E          +P DN+ H+SF F    I  LR+ LP HL+ CST E+L A +W+C
Sbjct  228   HEYDE-----VNTNEVPSDNMAHKSFYFSLKGIKALRNQLPFHLKDCSTFELLLAFLWKC  282

Query  737   RTIALGFHPDEEVRMLLLINARFKFKDTPMPSGYTGNAFAYPGAKTTAGKLRKNPLGYAV  558
             RTIAL   P+E  ++  ++N R K     +P GY GNAF +    + A +L KNP+GYAV
Sbjct  283   RTIALKLQPEEIAKVCCIVNVRGKRYKMDIPPGYYGNAFTFSAVCSKAEQLCKNPIGYAV  342

Query  557   ELVTSIKRCFSEEYMQSMVDLMVLKGRP-PFHVAGSFIMSDLTRSKISDVDYGWGKPVFG  381
             ELV   K   +EEY++S  DLMV+KGR   F   G+FI+SDL    + DVD+GWGKP++ 
Sbjct  343   ELVKKAKAQMNEEYIRSAADLMVIKGRRIKFSTRGNFIVSDLRNVGLGDVDFGWGKPIYA  402

Query  380   GPAHGGAGDVPGVITFHVPYENKKGENGTLIPICLPAFALDKFVNELANTFLRAAL  213
             G A   A     VI+F   Y+NK GE G L+PICLP  A+++   EL    ++ ++
Sbjct  403   GTAGAVA-----VISFFTKYQNKNGEPGILVPICLPQSAMERLQEELKGFMIQGSM  453



>emb|CDY50708.1| BnaC05g47750D [Brassica napus]
Length=467

 Score =   397 bits (1021),  Expect = 3e-130, Method: Compositional matrix adjust.
 Identities = 198/403 (49%), Positives = 272/403 (67%), Gaps = 9/403 (2%)
 Frame = -1

Query  1415  FYRNEPSMSGK-DPVQVIRQALAKALVFFYPFAGRLREGPGRKLMVDCTGEGVMFIEADA  1239
             FYR  P+++   DPVQVIR+AL + LV++YPFAGRL EGP +KL VDCTGEGV+FIEADA
Sbjct  59    FYR--PNLTCTLDPVQVIRRALGQTLVYYYPFAGRLWEGPNQKLAVDCTGEGVLFIEADA  116

Query  1238  DATLQHFAIGGELKPPFPCFDQLLYNVPGSAEILNSPLFLIQVTRLRCGGFIFTLRMNHT  1059
             D T         L PPFPC ++LL++V GS+E+LN+PL L+QVTRL+CGGFIF LR+NHT
Sbjct  117   DVTFAELEEADALLPPFPCLEELLFDVEGSSELLNTPLLLVQVTRLKCGGFIFALRINHT  176

Query  1058  MADASGLVHFLNTIAEIARGAEAPAVQPVWQREFFSARNPPRITCTHFEYEEEPAADSMV  879
             M D +GL  FL ++ E+A G  AP+V PVW R+   A    R+T  H EY++    +++V
Sbjct  177   MTDGAGLSLFLKSLCELACGLHAPSVPPVWGRQLLIASAYARVTHAHREYDDNVEPEAVV  236

Query  878   TNIPLDNLVHRSFLFGPTEISVLRSSLPPHLRKCSTVEILTALVWRCRTIALGFHPDEEV  699
                  D LV +SF FGP EI+ +   L PH    +T + LT+ +WRCRT+++   P+ E+
Sbjct  237   VG---DVLVTKSFFFGPDEIAAI-GRLLPHGLHSTTFDALTSFLWRCRTVSMSPDPNTEM  292

Query  698   RMLLLINARFKFKDTPMPSGYTGNAFAYPGAKTTAGKLRKNPLGYAVELVTSIKRCFSEE  519
             RM  ++N+R K ++ P+PSGY GN FA P A  TA  L + PL + + L+   K   +E+
Sbjct  293   RMTCIVNSRSKLRNPPIPSGYYGNVFAIPVAIATAKDLMEKPLEFPLRLIQEAKSSVTED  352

Query  518   YMQSMVDLMVLKGRPPFHVAGSFIMSDLTRSKISDVDYG-WGKPVFGGPAHGGAGDVPGV  342
             Y++S+  LM  +GRP F  A ++I+SDL R  I  VD+G WGKPV+GG A  G    PGV
Sbjct  353   YIRSVTALMATRGRPKFVTAENYIVSDLRRFDIGKVDFGPWGKPVYGGTAKAGIATFPGV  412

Query  341   ITFHVPYENKKGENGTLIPICLPAFALDKFVNELANTFLRAAL  213
              +F+VP++NKKGENGT++ I LPA A++KFV EL   F+  + 
Sbjct  413   -SFYVPFKNKKGENGTVVAISLPALAMEKFVEELNGVFMTGSF  454



>emb|CDY50709.1| BnaC05g47740D [Brassica napus]
Length=451

 Score =   397 bits (1019),  Expect = 4e-130, Method: Compositional matrix adjust.
 Identities = 199/394 (51%), Positives = 270/394 (69%), Gaps = 9/394 (2%)
 Frame = -1

Query  1415  FYRNEPSM-SGKDPVQVIRQALAKALVFFYPFAGRLREGPGRKLMVDCTGEGVMFIEADA  1239
             FYR  P++ S  DPVQV+R+ALA+ LV++YPFAGRLREG  RKL VDCTGEGV+FIEADA
Sbjct  58    FYR--PNLTSNLDPVQVVRRALAQTLVYYYPFAGRLREGLNRKLSVDCTGEGVLFIEADA  115

Query  1238  DATLQHFAIGGELKPPFPCFDQLLYNVPGSAEILNSPLFLIQVTRLRCGGFIFTLRMNHT  1059
             D TL        L PPFPC ++LL++V GS+E+LN+PL L+QVTRL+C GFIF LR NHT
Sbjct  116   DVTLAKLEEADALLPPFPCLEELLFDVEGSSELLNTPLLLVQVTRLKCSGFIFALRFNHT  175

Query  1058  MADASGLVHFLNTIAEIARGAEAPAVQPVWQREFFSARNPPRITCTHFEYEEEPAADSMV  879
             M D +GL  FL ++ E+A G  AP++ P W+R+   A    R+T TH EY+++   +++V
Sbjct  176   MTDGAGLSLFLKSLCELACGLHAPSLPPAWERQLLIASESARVTHTHREYDDKMEPEAVV  235

Query  878   TNIPLDNLVHRSFLFGPTEISVLRSSLPPHLRKCSTVEILTALVWRCRTIALGFHPDEEV  699
                  D LV RSF FGP EIS +R  LP  L   +T E +T+ +WRCRTIAL   P+ E+
Sbjct  236   VG---DFLVSRSFFFGPEEISAIRGLLPADLHN-TTFEAMTSFLWRCRTIALSPDPNTEM  291

Query  698   RMLLLINARFKFKDTPMPSGYTGNAFAYPGAKTTAGKLRKNPLGYAVELVTSIKRCFSEE  519
             RM  ++N+R K  + P+PSGY GN FA P A  TA  L + PL + + L+   K+  +E+
Sbjct  292   RMTCIVNSRSKLSNPPIPSGYYGNVFAIPVAIATAKDLMEKPLEFPLRLIQEAKKSVTED  351

Query  518   YMQSMVDLMVLKGRPPFHVAGSFIMSDLTRSKISDVDYG-WGKPVFGGPAHGGAGDVPGV  342
             Y++SM  LM  +GRP F  AG++I+SDL    +  VD+G WGKPV+GG A  G    PGV
Sbjct  352   YIRSMTALMATRGRPMFVAAGNYIVSDLRHFDLGKVDFGPWGKPVYGGTAKAGIAVFPGV  411

Query  341   ITFHVPYENKKGENGTLIPICLPAFALDKFVNEL  240
              +F+VP++++KG +GT++ I LP  A++KFV EL
Sbjct  412   -SFYVPFKSRKGVSGTVVAISLPVQAMEKFVEEL  444



>ref|XP_006446264.1| hypothetical protein CICLE_v10015163mg [Citrus clementina]
 gb|ESR59504.1| hypothetical protein CICLE_v10015163mg [Citrus clementina]
Length=464

 Score =   397 bits (1020),  Expect = 4e-130, Method: Compositional matrix adjust.
 Identities = 199/389 (51%), Positives = 262/389 (67%), Gaps = 10/389 (3%)
 Frame = -1

Query  1400  PSMSGKDPVQVIRQALAKALVFFYPFAGRLREGPGRKLMVDCTGEGVMFIEADADATLQH  1221
             P +  KDPV+VI++A+++ALV++YPFAGRL EGP RKLMVDC GEG++F+EA+A+  L+ 
Sbjct  60    PLLKEKDPVKVIKEAISEALVYYYPFAGRLIEGPNRKLMVDCNGEGILFLEAEANFKLEQ  119

Query  1220  FAIGGELKPPFPCFDQLLYNVPGSAEILNSPLFLIQVTRLRCGGFIFTLRMNHTMADASG  1041
               +GG ++PP P  +QL YNVPGS  IL  PL LIQVTRL CGGF   +R NHTM DASG
Sbjct  120   --LGGAIQPPCPYLEQLTYNVPGSEGILGCPLLLIQVTRLMCGGFTLAIRFNHTMCDASG  177

Query  1040  LVHFLNTIAEIARGAEAPAVQPVWQREFFSARNPPRITCTHFEYEE-EPAADSMVTNIPL  864
             LV F+ TI E+ARGA  P++ PVWQR+   ARNPP++T  H EYEE    +D+ +T  P 
Sbjct  178   LVQFMKTIEEMARGANTPSLFPVWQRKRLCARNPPQVTNVHLEYEEINNNSDTFITTNP-  236

Query  863   DNLVHRSFLFGPTEISVLRSSLPPHLRKCSTVEILTALVWRCRTIALGFHPDEEVRMLLL  684
             + + H+SF FGP E+ VL++ LP HLR CST E+L   +WRCRTIAL   P + V+   L
Sbjct  237   NEMDHKSFYFGPKEVRVLKNQLPLHLRNCSTFELLAGCMWRCRTIALQLDPKDTVQFSCL  296

Query  683   INARFKFKDTPMPSGYTGNAFAYPGAKTTAGKLRKNPLGYAVELVTSIKRCFSEEYMQSM  504
             ++AR K     +PSGY GNA A+P   +  G L  NPLGYAV LV   K   SEE+++S 
Sbjct  297   VSARAKDYKMDIPSGYYGNAVAFPAVHSKVGALCNNPLGYAVALVKKAKVEMSEEHIRSA  356

Query  503   VDLMVLKGRPPFH-VAGSFIMSDLTRSKISDVDYGWGKPVFGGPAHGGAGDVPGVITFHV  327
              DLM +KGR P H + G++I+SDL++     +D GWGKPVF G A   +     + +F  
Sbjct  357   ADLMEVKGRRPRHAIKGNYIVSDLSKVGFDRIDLGWGKPVFAGIAGAKS-----IFSFLN  411

Query  326   PYENKKGENGTLIPICLPAFALDKFVNEL  240
               + + GE GTLIPI LP  ++ KF  EL
Sbjct  412   RCQKEDGETGTLIPIRLPRPSMKKFEEEL  440



>emb|CBI25251.3| unnamed protein product [Vitis vinifera]
Length=443

 Score =   395 bits (1014),  Expect = 1e-129, Method: Compositional matrix adjust.
 Identities = 206/401 (51%), Positives = 261/401 (65%), Gaps = 37/401 (9%)
 Frame = -1

Query  1415  FYRNEPSMSGKDPVQVIRQALAKALVFFYPFAGRLREGPGRKLMVDCTGEGVMFIEADAD  1236
             FYRN P M GKDPV+VIR+AL KAL+++YPFAGRL EG  RKLMVDCTGEGV+FIEADAD
Sbjct  51    FYRNNPLMDGKDPVKVIREALGKALIYYYPFAGRLIEGDNRKLMVDCTGEGVLFIEADAD  110

Query  1235  ATLQHFAIGGELKPPFPCFDQLLYNVPGSAEILNSPLFLIQVTRLRCGGFIFTLRMNHTM  1056
              TL++  +G  ++P  PCF++LLY+VPGS  IL SPL LIQVTRLRCGGFIF LR+NHT+
Sbjct  111   TTLEN--LGDAIQPMCPCFEELLYDVPGSTRILGSPLILIQVTRLRCGGFIFALRLNHTL  168

Query  1055  ADASGLVHFLNTIAEIARGAEAPAVQPVWQREFFSARNPPRITCTHFEYEEEPAADSMVT  876
             +DA+GL+ FLNTI E+A+G                     ++T T             + 
Sbjct  169   SDAAGLIQFLNTIGEMAQGLS-------------------KVTNTK----------GTLM  199

Query  875   NIPLDNLVHRSFLFGPTEISVLRSSLPPHLRKCSTVEILTALVWRCRTIALGFHPDEEVR  696
              +  +NLVHRSF FG  EI  LR+ LP  L  CST E+L A VWRCRTIA    PDE V 
Sbjct  200   AMDENNLVHRSFFFGREEIRALRNRLPASLGACSTFEVLMACVWRCRTIAFAVDPDEVVG  259

Query  695   MLLLINARFKFKDTPMPSGYTGNAFAYPGAKTTAGKLRKNPLGYAVELVTSIKRCFSEEY  516
             +  +IN R K     +P GY GNAF  P + T AG L KNPL +A+ LV   K   S+EY
Sbjct  260   ISCIINMRGK-HGLELPPGYYGNAFVTPASITKAGMLCKNPLEFAIRLVKKAKAEMSQEY  318

Query  515   MQSMVDLMVLKGRPPFHVAGSFIMSDLTRSKISDVDYGWGKPVFGGPAHGGAGDVPGVIT  336
             ++S+ DLMV+KGRP F   G++I+SD+TR+ I +VD+GWGKPV+GG A         +I+
Sbjct  319   IKSVADLMVIKGRPLFTQPGNYIVSDVTRAGIGEVDFGWGKPVYGGVAKASP-----IIS  373

Query  335   FHVPYENKKGENGTLIPICLPAFALDKFVNELANTFLRAAL  213
             F + + N KGE G +IPICLP   +++F  EL      A L
Sbjct  374   FRMWFRNSKGEEGNVIPICLPPPVMERFEQELKRMTKEAEL  414



>ref|XP_008373476.1| PREDICTED: methanol O-anthraniloyltransferase-like [Malus domestica]
Length=460

 Score =   395 bits (1014),  Expect = 3e-129, Method: Compositional matrix adjust.
 Identities = 193/401 (48%), Positives = 274/401 (68%), Gaps = 13/401 (3%)
 Frame = -1

Query  1412  YRNEPSMS-GKDPVQVIRQALAKALVFFYPFAGRLREGPGRKLMVDCTGEGVMFIEADAD  1236
             Y++ PS++  ++PV+ IR+AL++ALV++YP AGRLREGP RKLMVDC GEG++F+EA A+
Sbjct  49    YKDNPSLNENRNPVKTIREALSRALVYYYPLAGRLREGPDRKLMVDCNGEGILFVEASAN  108

Query  1235  ATLQHFAIGGELKPPFPCFDQLLYNVPGSAEILNSPLFLIQVTRLRCGGFIFTLRMNHTM  1056
              TL+   +G +  PP P  ++ L+N  GS  I+  PL L+QVTRL CGGFI  LR+NHTM
Sbjct  109   VTLEQ--LGDKXLPPCPLLEEFLFNFLGSDGIIGCPLLLVQVTRLTCGGFILALRLNHTM  166

Query  1055  ADASGLVHFLNTIAEIARGA-EAPAVQPVWQREFFSARNPPRITCTHFEYEEE-PAADSM  882
              DA G + FL  +AE+ARG   AP++ P+W+RE   AR+PPRITC H EYE+    +D  
Sbjct  167   CDAPGFLQFLTAVAEMARGVIHAPSILPMWERELLFARDPPRITCAHHEYEDVIDHSDGS  226

Query  881   VTNIPLDNLVHRSFLFGPTEISVLRSSLPPHLRKC-STVEILTALVWRCRTIALGFHPDE  705
                    N+V RSF FG  E+ VLR  +PPHL    ST +++TA +W+CRT+AL  +P +
Sbjct  227   CAYSNQSNMVQRSFYFGAKEMRVLRKQIPPHLISTFSTFDLITACLWKCRTLALKINPKQ  286

Query  704   EVRMLLLINARFKFKDTPMPSGYTGNAFAYPGAKTTAGKLRKNPLGYAVELVTSIKRCFS  525
              VR+  ++NAR K  +  +P GY GNAFA+P A + A  L KNPLGYA+ELV   K   +
Sbjct  287   VVRVSCIVNARGKQNNVRLPLGYYGNAFAFPAAXSKAEPLCKNPLGYALELVKKAKATMN  346

Query  524   EEYMQSMVDLMVLKGRPPFHVAGS-FIMSDLTRSKISDVDYGWGKPVFGGPAHGGAGDVP  348
             EEY++S+ DL+VL+GRP +   GS F++SD+TR  + DV++GWG+P+F GPA        
Sbjct  347   EEYLRSVADLLVLRGRPQYSSTGSNFLVSDITRVGVGDVNFGWGQPIFAGPAKAM-----  401

Query  347   GVITFHVPYENKKGENGTLIPICLPAFALDKFVNELANTFL  225
              +I+F++ ++N   E+G L+P+CLP  A+++F  EL    L
Sbjct  402   DLISFYIQHKNNT-EDGILVPMCLPFSAMERFQQELERITL  441



>gb|AHC32224.2| alcohol acyl transferase 1 [Eriobotrya japonica]
Length=459

 Score =   394 bits (1013),  Expect = 4e-129, Method: Compositional matrix adjust.
 Identities = 195/395 (49%), Positives = 272/395 (69%), Gaps = 12/395 (3%)
 Frame = -1

Query  1412  YRNEPSMS-GKDPVQVIRQALAKALVFFYPFAGRLREGPGRKLMVDCTGEGVMFIEADAD  1236
             Y++ PS++  ++PV+VIR+A+++ALV++YP AGRLRE P RKL+VDC  EG++F+EA A+
Sbjct  49    YKDNPSLNENRNPVKVIREAVSRALVYYYPLAGRLREWPNRKLVVDCNSEGILFVEAFAN  108

Query  1235  ATLQHFAIGGELKPPFPCFDQLLYNVPGSAEILNSPLFLIQVTRLRCGGFIFTLRMNHTM  1056
              TL+   +G ++ PP P  ++ L+NVPGS  I+  PL L+QVT L CGGFI  LR+NHTM
Sbjct  109   VTLEQ--LGDKILPPCPLLEEFLFNVPGSDGIIGCPLLLVQVTCLTCGGFILALRLNHTM  166

Query  1055  ADASGLVHFLNTIAEIARGAEAPAVQPVWQREFFSARNPPRITCTHFEYEEE-PAADSMV  879
              DA GLV FL  IAE+A GA AP++ PVW+RE   AR+PPRITC H EYE+    +D   
Sbjct  167   CDAPGLVLFLTAIAEMASGAHAPSILPVWERELLFARDPPRITCAHHEYEDVIDHSDGSY  226

Query  878   TNIPLDNLVHRSFLFGPTEISVLRSSLPPHL-RKCSTVEILTALVWRCRTIALGFHPDEE  702
                   N+V RSF FG  E+ VLR  +PPHL   CST +++TA +W+C T+AL  +P + 
Sbjct  227   AXSNQSNMVQRSFYFGAKEMRVLRKQIPPHLISTCSTFDLITACLWKCHTLALKINPKQV  286

Query  701   VRMLLLINARFKFKDTPMPSGYTGNAFAYPGAKTTAGKLRKNPLGYAVELVTSIKRCFSE  522
             V++   +NAR K  +  +P GY GNAFA+P A + A  L KNPLGYA+ELV   K   +E
Sbjct  287   VQVSFTVNARGKHHNVRLPLGYYGNAFAFPAAVSKAEPLCKNPLGYALELVKKAKATMNE  346

Query  521   EYMQSMVDLMVLKGRPPFHVAGS-FIMSDLTRSKISDVDYGWGKPVFGGPAHGGAGDVPG  345
             EY++S+ DL+VL+GRP +   GS FI+SD TR+   DV++GWG+PVF GPA         
Sbjct  347   EYLRSVADLLVLRGRPQYLYTGSYFIVSDNTRAGFGDVNFGWGQPVFAGPAKAV-----D  401

Query  344   VITFHVPYENKKGENGTLIPICLPAFALDKFVNEL  240
             +  F+V ++N   E+G L+P+CLP+ A+++F  EL
Sbjct  402   LFRFYVQHKNNT-EDGILVPMCLPSSAMERFQQEL  435



>ref|XP_008368021.1| PREDICTED: methanol O-anthraniloyltransferase-like [Malus domestica]
Length=455

 Score =   394 bits (1012),  Expect = 4e-129, Method: Compositional matrix adjust.
 Identities = 194/395 (49%), Positives = 270/395 (68%), Gaps = 12/395 (3%)
 Frame = -1

Query  1412  YRNEPSMSGK-DPVQVIRQALAKALVFFYPFAGRLREGPGRKLMVDCTGEGVMFIEADAD  1236
             Y++ PS++   +PV+VIR+AL++ALV++YP AGRL+EGP  KL VDC GEG++F+EA AD
Sbjct  49    YKDNPSLNKNCNPVKVIREALSRALVYYYPLAGRLKEGPNXKLXVDCNGEGILFVEASAD  108

Query  1235  ATLQHFAIGGELKPPFPCFDQLLYNVPGSAEILNSPLFLIQVTRLRCGGFIFTLRMNHTM  1056
              TL+   +G  + PP P  ++ L+N PGS  I+  PL L+QVT L CGGFI  LR NHTM
Sbjct  109   VTLEQ--LGDXILPPCPLLEEFLFNFPGSDGIIGCPLLLVQVTCLTCGGFILALRXNHTM  166

Query  1055  ADASGLVHFLNTIAEIARGAEAPAVQPVWQREFFSARNPPRITCTHFEYEEE-PAADSMV  879
              DA GL+ FL  IAE+ARGA AP++ PVW+RE    R+PPRITC H EYE+    ++   
Sbjct  167   CDAPGLLLFLTAIAEMARGAHAPSILPVWERELLFXRDPPRITCVHHEYEDVIDHSBGSY  226

Query  878   TNIPLDNLVHRSFLFGPTEISVLRSSLPPH-LRKCSTVEILTALVWRCRTIALGFHPDEE  702
              +    N+V RSF FG  E+ VLR  +PPH +  CST +++TA + +CRT+AL  +P + 
Sbjct  227   ASSNQSNMVQRSFYFGAKEMRVLRKQIPPHXISTCSTFDLITACLXKCRTLALKINPKQA  286

Query  701   VRMLLLINARFKFKDTPMPSGYTGNAFAYPGAKTTAGKLRKNPLGYAVELVTSIKRCFSE  522
             VR+   +NAR K  +  +P GY GNAFA P A + A  L KNPLGYA+ELV   K   +E
Sbjct  287   VRVSCXVNARGKHHNVRLPLGYYGNAFAXPAAXSKAEPLCKNPLGYALELVKKAKATMNE  346

Query  521   EYMQSMVDLMVLKGRPPFHVAGSF-IMSDLTRSKISDVDYGWGKPVFGGPAHGGAGDVPG  345
             EY++S+ DL+VL+GRP +   GS+ I+SD TR+   DV++GWG+PVF GPA         
Sbjct  347   EYLRSVADLLVLRGRPQYSSTGSYLIVSDNTRAGFGDVNFGWGQPVFAGPAKA-----LD  401

Query  344   VITFHVPYENKKGENGTLIPICLPAFALDKFVNEL  240
             +I+F+V ++N   E+G L+P+CLP+ A+++F  EL
Sbjct  402   LISFYVQHKNNT-EDGILVPMCLPSSAMERFQQEL  435



>ref|XP_006446261.1| hypothetical protein CICLE_v10015234mg [Citrus clementina]
 gb|ESR59501.1| hypothetical protein CICLE_v10015234mg [Citrus clementina]
Length=447

 Score =   394 bits (1012),  Expect = 4e-129, Method: Compositional matrix adjust.
 Identities = 203/399 (51%), Positives = 266/399 (67%), Gaps = 14/399 (4%)
 Frame = -1

Query  1415  FYRNEPS--MSGKDPVQVIRQALAKALVFFYPFAGRLREGPGRKLMVDCTGEGVMFIEAD  1242
             FY+N PS  M GKDPV+VI++AL++ALV++YPFAGRLREG   KLMVDC GEGV+F EAD
Sbjct  51    FYKNNPSPSMKGKDPVKVIKEALSRALVYYYPFAGRLREGSDGKLMVDCNGEGVLFTEAD  110

Query  1241  ADATLQHFAIGGELKPPFPCFDQLLYNVPGSAEILNSPLFLIQVTRLRCGGFIFTLRMNH  1062
             AD +L       E+KPP P  D+LLY+VPGS   L  PL L QVTRL CGGF+   R+NH
Sbjct  111   ADFSLDQLG-DDEIKPPCPYLDELLYDVPGSEGTLGCPLLLFQVTRLICGGFVLAFRVNH  169

Query  1061  TMADASGLVHFLNTIAEIA-RGAEAPAVQPVWQREFFSARNPPRITCTHFEYEE-EPAAD  888
             TM DA G V FL  + E+A   A+AP++ P+WQRE  +ARNPP+I+C H EY++ +P   
Sbjct  170   TMCDAFGFVQFLKAMEEMAWDNAKAPSLLPIWQRELLNARNPPQISCVHHEYDQIDPIKA  229

Query  887   SMVTNIPLDNLVHRSFLFGPTEISVLRSSLPPHLRKCSTVEILTALVWRCRTIALGFHPD  708
             ++ T  P ++L H+S  FGP EI  LR+ LPPHL+ C+T E+LTA +WRCRTIALG  P+
Sbjct  230   TLRTKNP-NDLDHKSLFFGPKEILSLRNQLPPHLKNCTTFELLTACIWRCRTIALGLDPN  288

Query  707   EEVRMLLLINARFKFKDTPMPSGYTGNAFAYPGAKTTAGKLRKNPLGYAVELVTSIKRCF  528
             E VR+    N R K  +  +P GY GNAF +P   +    L  +PLGYAVELV   K   
Sbjct  289   EIVRVSFTFNIRGKRFNMQIPQGYYGNAFVFPAVCSRVDALCGSPLGYAVELVKEGKAKV  348

Query  527   SEEYMQSMVDLMVLKGRPPFHVAGS--FIMSDLTRSKISDVDYGWGKPVFGGPAHGGAGD  354
             SEEY++S+ DLMV +GRP     G   FI+SD TR+   ++D+GWGKP+F G A      
Sbjct  349   SEEYIRSVADLMVTRGRPVPTTMGDLYFIVSDTTRTGFEEIDFGWGKPMFAGIAGCAL--  406

Query  353   VPGVITFHVPYENKKG-ENGTLIPICLPAFALDKFVNEL  240
                 I+F+V Y+ K   E G ++PI LP  A+++F  E+
Sbjct  407   ---FISFYVNYQKKNDCERGIVVPIRLPFSAMERFQEEI  442



>gb|EYU41396.1| hypothetical protein MIMGU_mgv1a005907mg [Erythranthe guttata]
Length=465

 Score =   394 bits (1013),  Expect = 5e-129, Method: Compositional matrix adjust.
 Identities = 200/393 (51%), Positives = 264/393 (67%), Gaps = 20/393 (5%)
 Frame = -1

Query  1415  FYRNEPSMSGKDPVQVIRQALAKALVFFYPFAGRLREGPGRKLMVDCTGEGVMFIEADAD  1236
             FYR  PS+   DPV+VIR+A+AKALV +YPFAGRLRE   RKL V+C GEGVMFIEADAD
Sbjct  75    FYRKNPSVKS-DPVEVIRKAIAKALVSYYPFAGRLREHAARKLAVECNGEGVMFIEADAD  133

Query  1235  ATLQHFAIGGELKPPFPCFDQLLYNVPGSAEILNSPLFLIQVTRLRCGGFIFTLRMNHTM  1056
               L+ F  G EL+PP PCF++LLY+ PGS  I+N+P+ LIQVTRL+CGGFIF+LR NHTM
Sbjct  134   VALEQF--GDELQPPVPCFEELLYDAPGSGGIINAPILLIQVTRLKCGGFIFSLRFNHTM  191

Query  1055  ADASGLVHFLNTIAEIARGAEAPAVQPVWQREFFSARNPPRITCTHFEYEEEPAADSMVT  876
             +D +G+  F++ + E+ARGA  P+  PVW+R   +       +CTH E+++ P  D + T
Sbjct  192   SDGAGIAQFVSAVGELARGAGVPSTPPVWERHLLNT------SCTHHEHKDIP--DILKT  243

Query  875   NIPLDNLVHRSFLFGPTEISVLRSSLPPHLRKCSTV-EILTALVWRCRTIALGFHPDEEV  699
                L+ +V RSF FG  +IS LRS LPPHLR C+T  EILTA +WRCRTIAL  HPDEEV
Sbjct  244   LTTLNEVVRRSFSFGTDQISALRSHLPPHLRHCTTTFEILTACLWRCRTIALSPHPDEEV  303

Query  698   RMLLLINARFKFKDTPMPSGYTGNAFAYPGAKTTAGKLRKNPLGYAVELVTSIKRCFSEE  519
              +L  +++R +F + P+P GY GN   +P A TT+  L KNP  YAVEL+   K      
Sbjct  304   GILWAMDSRRRF-NPPIPDGYYGNCCIHPTAITTSESLSKNPYHYAVELLRKAK------  356

Query  518   YMQSMVDLMVLKGRPPFHVAGSFIMSDLTRSKISDVDYGWGKPVFGGPAHGGAGDVPGVI  339
              + +M D M++K    F   G + +SD       DVD+GWGK V+GG A G  G VP ++
Sbjct  357   -LDAMADPMMIKRLSRFSFVGGYAVSDARHLGFEDVDFGWGKAVYGGVAKGNIGFVPELL  415

Query  338   TFHVPYENKKGENGTLIPICLPAFALDKFVNEL  240
             + ++P +N KGENG ++ ICL   A++ F  EL
Sbjct  416   SLYLPCKNDKGENGIVVSICLSENAMEVFTKEL  448



>ref|XP_007209131.1| hypothetical protein PRUPE_ppa005625mg [Prunus persica]
 gb|EMJ10330.1| hypothetical protein PRUPE_ppa005625mg [Prunus persica]
Length=450

 Score =   394 bits (1011),  Expect = 6e-129, Method: Compositional matrix adjust.
 Identities = 198/399 (50%), Positives = 265/399 (66%), Gaps = 10/399 (3%)
 Frame = -1

Query  1412  YRNEPSMSGKDPVQVIRQALAKALVFFYPFAGRLREGPGRKLMVDCTGEGVMFIEADADA  1233
             Y+N PSM G D V VIR+AL++ALV++YP AGRLREGP RKLMV+C GEGV+FIEA+AD 
Sbjct  51    YKNNPSMKGNDAVMVIREALSRALVYYYPLAGRLREGPNRKLMVECNGEGVLFIEANADV  110

Query  1232  TLQHFAIGGELKPPFPCFDQLLYNVPGSAEILNSPLFLIQVTRLRCGGFIFTLRMNHTMA  1053
             TL+   +G  + PP P  ++ L N PGS  IL  PL L+QVTRL CGGFIF LR+NH M 
Sbjct  111   TLEQ--LGDRILPPCPVLEEFLSNPPGSDGILGCPLLLVQVTRLTCGGFIFGLRINHAMC  168

Query  1052  DASGLVHFLNTIAEIARGAEAPAVQPVWQREFFSARNPPRITCTHFEYEE-EPAADSMVT  876
             DA GL  FLN I E+A+GA++ +V PVW RE  +AR+PP +T  H+EY++   +  S + 
Sbjct  169   DAVGLAKFLNAIGEMAQGADSLSVPPVWARELLNARDPPTVTRWHYEYDQLLDSQGSFIA  228

Query  875   NIPLDNLVHRSFLFGPTEISVLRSSLPPHLRKCSTVEILTALVWRCRTIALGFHPDEEVR  696
              I   N+  RSF FGP +I  LR  LPPHL  CS+ E++TA VWRCRT++L  +P + VR
Sbjct  229   AIDQSNMAQRSFYFGPQQIRALRKHLPPHLSTCSSFELITACVWRCRTLSLRLNPKDTVR  288

Query  695   MLLLINARFK-FKDTPMPSGYTGNAFAYPGAKTTAGKLRKNPLGYAVELVTSIKRCFSEE  519
             +   +NAR K   D  +PSG+ GNAF+ P A +T   L  +PLGY VELV   K    +E
Sbjct  289   ISCAVNARGKSINDLCLPSGFYGNAFSIPTAVSTVELLCASPLGYGVELVRKSKAQMDKE  348

Query  518   YMQSMVDLMVLKGRPPFHVAGS-FIMSDLTRSKISDVDYGWGKPVFGGPAHGGAGDVPGV  342
             YMQS+ D  V++GRPP  +  + FI+SD   +   + D GWG+P+F G A   +     +
Sbjct  349   YMQSLADFFVIRGRPPLPMGWNVFIVSDNRHTGFGEFDVGWGRPLFAGLARAFS-----M  403

Query  341   ITFHVPYENKKGENGTLIPICLPAFALDKFVNELANTFL  225
             I+F+V   N++ E GTL+PICLP+ +L++F  EL    L
Sbjct  404   ISFYVRDNNQEEEFGTLVPICLPSTSLERFEEELKKMTL  442



>ref|XP_010689157.1| PREDICTED: benzyl alcohol O-benzoyltransferase-like [Beta vulgaris 
subsp. vulgaris]
Length=443

 Score =   393 bits (1009),  Expect = 9e-129, Method: Compositional matrix adjust.
 Identities = 195/392 (50%), Positives = 269/392 (69%), Gaps = 10/392 (3%)
 Frame = -1

Query  1415  FYRNEPSMSGKDPVQVIRQALAKALVFFYPFAGRLREGPGRKLMVDCTGEGVMFIEADAD  1236
             FYR +PSM  KDPV+V++ ALAKALVF+YP+AGRL EGP RKL VDCTGEGV FIEA+AD
Sbjct  54    FYRADPSMEEKDPVKVVKDALAKALVFYYPYAGRLVEGPTRKLSVDCTGEGVPFIEAEAD  113

Query  1235  ATLQHFAIGGELKPPFPCFDQLLYNVPGSAEILNSPLFLIQVTRLRCGGFIFTLRMNHTM  1056
             A L+ F  G E+ PPFP  D LLY++PG+  +L +PL ++QVTRL C GFI  LR NH M
Sbjct  114   ARLEDF--GDEIHPPFPLQD-LLYDMPGTDGMLGTPLLIVQVTRLLCDGFIVALRANHAM  170

Query  1055  ADASGLVHFLNTIAEIARGAEAPAVQPVWQREFFSARNPPRITCTHFEYEEEPAADSMVT  876
             +D +G++ F+N + E+ +G   P++ PVW RE  +A+  P ++  H EY++         
Sbjct  171   SDGTGVMQFMNVVGEMGKGFVTPSILPVWDRERLTAKRSPNVSFPHPEYDQHEIDHHSND  230

Query  875   NIPLDNLVHRSFLFGPTEISVLRSSLPPHLRKCSTVEILTALVWRCRTIALGFHPDEEVR  696
                  NL+ +SFLFGPTEI+ LR  + P +++ ST +IL+A +WRCRTIALG  P++EVR
Sbjct  231   EA---NLIQQSFLFGPTEIAALRRHISPRIKQFSTFDILSASLWRCRTIALGLDPEDEVR  287

Query  695   MLLLINARFKFKDTPMPSGYTGNAFAYPGAKTTAGKLRKNPLGYAVELVTSIKRCFSEEY  516
             +L  +NAR KF + P+  GY GNA A+P     AG + +N + Y +EL+ + K   +EEY
Sbjct  288   LLFAVNARSKF-NPPLAKGYYGNACAFPAICAKAGDICQNKVEYILELIRNAKSEINEEY  346

Query  515   MQSMVDLMVLKGRPPFHVAGSFIMSDLTRSKISDVDYGWGKPVFGGPAHGGAGDVPGVIT  336
             M+S++DLMV   RP F V  ++++SDL     +DVD+GWGKPVFGGPA  G+  VP   +
Sbjct  347   MRSIMDLMVTNDRPHFTVRQTYVVSDLRHLGFADVDFGWGKPVFGGPASNGS--VPDA-S  403

Query  335   FHVPYENKKGENGTLIPICLPAFALDKFVNEL  240
             F + ++NKKGE  T++PI LP   ++ FV EL
Sbjct  404   FFISFKNKKGETMTMVPISLPPVIMNVFVKEL  435



>gb|AEM43830.1| alcohol acyl transferase [Fragaria x ananassa]
Length=391

 Score =   391 bits (1004),  Expect = 1e-128, Method: Compositional matrix adjust.
 Identities = 200/397 (50%), Positives = 268/397 (68%), Gaps = 19/397 (5%)
 Frame = -1

Query  1412  YRNEPSMSGK--DPVQVIRQALAKALVFFYPFAGRLREGPGRKLMVDCTGEGVMFIEADA  1239
             Y+N  S+  K  DPV+VIR AL+KAL F+YP AGRLREGP +KLMVDCTGEG++F+EA+A
Sbjct  3     YKNNHSILSKPNDPVEVIRDALSKALQFYYPLAGRLREGPNKKLMVDCTGEGILFVEANA  62

Query  1238  DATLQHFAIGGELKPPFPCFDQLLYNVPGSAEILNSPLFLIQVTRLRCGGFIFTLRMNHT  1059
             + TL    +G  + PP P  D  L+NVPGS  IL SPL LIQVTRL CGGFIF LR+NHT
Sbjct  63    EVTLDE--LGDAILPPCPFLDGFLFNVPGSDGILGSPLCLIQVTRLSCGGFIFALRLNHT  120

Query  1058  MADASGLVHFLNTIAEIARGAEAPAVQPVWQREFFSARNPPRITCTHFEYEEEPAADSMV  879
             + DA GLV FLN + EIA+G  AP++ PVW+RE  SAR+PPRI+CTH E++     DS+ 
Sbjct  121   ICDALGLVQFLNAVGEIAQGKYAPSITPVWERELLSARDPPRISCTHEEFD-----DSID  175

Query  878   TNIP-LDNLVHRSFLFGPTEISVLRSSLPPHLRKC-STVEILTALVWRCRTIALGFHPDE  705
              + P     V + + FGP EI  LR  LPPHL  C ST E++TA VW+CRTI+L   P++
Sbjct  176   HSYPNYGATVQQCYCFGPKEIKSLREHLPPHLSTCSSTFELITACVWKCRTISLDMDPEQ  235

Query  704   EVRMLLLINARFKFKDTPMPSGYTGNAFAYPGAKTTAGKLRKNPLGYAVELVTSIKRCFS  525
              VR+  ++ A  K  +  +P GY GN F YP   +TA +L  +PLGYAVELV   K   S
Sbjct  236   IVRLSCVVTALGKHNNVCLPLGYYGNTFTYPAVVSTAERLCNSPLGYAVELVKKSKAKMS  295

Query  524   EEYMQSMVDLMVLKGRPPFHVAG--SFIMSDLTRSKISDVDYGWGKPVFGGPAHGGAGDV  351
             EEY++S +D + ++GRPPF + G   F++SD TR+ + ++D+G+GKPV+ G A       
Sbjct  296   EEYLRSAIDFVEVRGRPPFALEGMSDFLVSDNTRTGLGEIDFGFGKPVYAGVAKS-----  350

Query  350   PGVITFHVPYENKKGENGTLIPICLPAFALDKFVNEL  240
               +I+F+V   NK+ E   L+P+CLP  +++ F  EL
Sbjct  351   TDLISFYVRSTNKE-EREILVPVCLPILSMEIFQQEL  386



>gb|KGN63336.1| hypothetical protein Csa_2G430570 [Cucumis sativus]
Length=427

 Score =   391 bits (1005),  Expect = 2e-128, Method: Compositional matrix adjust.
 Identities = 192/382 (50%), Positives = 255/382 (67%), Gaps = 8/382 (2%)
 Frame = -1

Query  1370  VIRQALAKALVFFYPFAGRLREGPGRKLMVDCTGEGVMFIEADADATLQHFAIGGELKPP  1191
             VI++A+ KALVF+YP AGRLREGPGRKL V+CTGEG++FIEADAD +L+ F     L   
Sbjct  50    VIKEAIGKALVFYYPLAGRLREGPGRKLFVECTGEGILFIEADADVSLEQFR--DTLPYS  107

Query  1190  FPCFD-QLLYNVPGSAEILNSPLFLIQVTRLRCGGFIFTLRMNHTMADASGLVHFLNTIA  1014
                 +  +++N   S  +LNSPL LIQVTRL+CGGFIF L +NHTMAD  G+  F+   A
Sbjct  108   LSSMEINIIHNALNSDGVLNSPLLLIQVTRLKCGGFIFGLHLNHTMADGLGIAQFIKATA  167

Query  1013  EIARGAEAPAVQPVWQREFFSARNPPRITCTHFEYEEEPAADSMVTNIPLDNLVHRSFLF  834
             EIARGA AP++ PVWQR   +AR+PPRIT  H+EY++    D+  T IP++N++ + F F
Sbjct  168   EIARGAFAPSILPVWQRALLTARDPPRITFRHYEYDQ--VVDTKSTLIPVNNMIDQLFFF  225

Query  833   GPTEISVLRSSLPPHLRKCSTVEILTALVWRCRTIALGFHPDEEVRMLLLINARFKFKDT  654
                +IS L  +LP HL  CS+ E+  A VWR RTIAL F P+EEVR L ++N R K    
Sbjct  226   SQHQISTLCQTLPAHLHDCSSFEVFAAYVWRLRTIALQFKPEEEVRFLCVVNIRSKID--  283

Query  653   PMPSGYTGNAFAYPGAKTTAGKLRKNPLGYAVELVTSIKRCFSEEYMQSMVDLMVLKGRP  474
              +P GY GNA   P   TT  KL  NPLGYA++L+   K   + EY++S VDLMV+KGRP
Sbjct  284   -IPLGYYGNAVVVPAVITTVAKLCGNPLGYAIDLIRKAKAKATAEYIKSTVDLMVIKGRP  342

Query  473   PFHVAGSFIMSDLTRSKISDVDYGWGKPVFGGPAHGGAGDVPGVITFHVPYENKKGENGT  294
                  GSFIMSD+TR    +VD+GW K +FGGP  GG+G + G+ +  +P+ N+ GE G 
Sbjct  343   CLTTVGSFIMSDVTRIGFENVDFGWEKAIFGGPITGGSGIIRGMASSCIPFMNRNGEKGI  402

Query  293   LIPICLPAFALDKFVNELANTF  228
             +I +CLP  A+++F      +F
Sbjct  403   VITLCLPLPAMERFRENFHASF  424



>ref|XP_006368247.1| hypothetical protein POPTR_0001s00950g [Populus trichocarpa]
 gb|ERP64816.1| hypothetical protein POPTR_0001s00950g [Populus trichocarpa]
Length=462

 Score =   392 bits (1007),  Expect = 3e-128, Method: Compositional matrix adjust.
 Identities = 199/399 (50%), Positives = 264/399 (66%), Gaps = 15/399 (4%)
 Frame = -1

Query  1415  FYRNEPSMSGK----DPVQVIRQALAKALVFFYPFAGRLREGPGRKLMVDCTGE-GVMFI  1251
             F+RN     G     DPV+VIR ALA ALV +YP AGRL+EG  RKLMVDCTGE GV+FI
Sbjct  52    FFRNTNKKGGNGTYPDPVKVIRDALAHALVCYYPLAGRLKEGDSRKLMVDCTGELGVLFI  111

Query  1250  EADADATLQHFAIGGELKPPFPCFDQLLYNVPGSAEILNSPLFLIQVTRLRCGGFIFTLR  1071
             EADAD TL+H  +G  ++PP P  +  LY++PGS+ I+  PL LIQVTRL CGGFI   R
Sbjct  112   EADADITLEH--LGDAIQPPCPYLEHFLYDIPGSSGIIGCPLMLIQVTRLTCGGFIVAAR  169

Query  1070  MNHTMADASGLVHFLNTIAEIARGAEAPAVQPVWQREFFSARNPPRITCTHFEYEEEPAA  891
             +NHTM DA G+ +FLNTI EIARGA  P+ +PVW+RE  +AR+PPR+TC H EY+     
Sbjct  170   VNHTMTDALGIFYFLNTIGEIARGANEPSYRPVWKREILNARDPPRVTCVHHEYDTTVGT  229

Query  890   DSMVTNIPLDNLVHRSFLFGPTEISVLRSSLPPHLRKCSTVEILTALVWRCRTIALGFHP  711
             ++ +      +L+ +SF FG  EI  +R  LP HL+  ST E+L A +W+CRTIA+  +P
Sbjct  230   EATMDTHA--DLIDKSFFFGFQEIDCIRKHLPSHLQSSSTFEVLIACIWKCRTIAIEHNP  287

Query  710   DEEVRMLLLINARFKFKDTPMPSGYTGNAFAYPGAKTTAGKLRKNPLGYAVELVTSIKRC  531
             +E +R+  ++ A  K +   +P GY GNA+A P A + A  + KNPLGYA+ELV  IK  
Sbjct  288   NEMLRVSYMVGAGGK-RGIKLPPGYYGNAYAMPSAISKAELVCKNPLGYALELVRKIKTQ  346

Query  530   FSEEYMQSMVDLMVLKGRPPFHVAGSFIMSDLTRSKISDVDYGWGKPVFGGPAHGGAGDV  351
              SEEYM+S+ D MV+KGRP +  AG FI++D +R    ++D+GWGKPV+ G A       
Sbjct  347   MSEEYMRSVADYMVIKGRPHYSTAGHFIVADSSRVPFREIDFGWGKPVYAGVAKAAPN--  404

Query  350   PGVITFHVPYENKKGENGTLIPICLPAFALDKFVNELAN  234
                 +F V ++   GE+G LI + LP  A+DKF  ELA 
Sbjct  405   ---TSFCVRFKKSTGEDGILIQMSLPLQAMDKFQKELAK  440



>ref|XP_008355599.1| PREDICTED: methanol O-anthraniloyltransferase-like [Malus domestica]
Length=454

 Score =   392 bits (1006),  Expect = 3e-128, Method: Compositional matrix adjust.
 Identities = 197/394 (50%), Positives = 263/394 (67%), Gaps = 15/394 (4%)
 Frame = -1

Query  1412  YRNEPSM--SGKDPVQVIRQALAKALVFFYPFAGRLREGPGRKLMVDCTGEGVMFIEADA  1239
             Y+N P +     DPV+V+++AL+KALVF+YP AGRLREGP RKLMV+CTGEGV+FIEADA
Sbjct  52    YKNNPLIPKDRTDPVKVLKEALSKALVFYYPLAGRLREGPNRKLMVECTGEGVLFIEADA  111

Query  1238  DATLQHFAIGGELKPPFPCFDQLLYNVPGSAEILNSPLFLIQVTRLRCGGFIFTLRMNHT  1059
             D TL+   +G  L PP P  ++ L + PGS  IL  PL L+QVTRL+CGGFIF LR+NHT
Sbjct  112   DVTLEQ--LGDALVPPCPFLEEFLCDAPGSDGILGCPLLLVQVTRLKCGGFIFALRINHT  169

Query  1058  MADASGLVHFLNTIAEIARGAEAPAVQPVWQREFFSARNPPRITCTHFEYEEEPAADSMV  879
             M D  G+V FLN + E+A GA  P++ PVWQRE F ARNP RITCTH EYEE   +D  +
Sbjct  170   MCDGFGMVQFLNGVGEMAHGAHTPSIPPVWQRELFDARNPLRITCTHHEYEEAIDSDEGL  229

Query  878   TNI-PLDNLVHRSFLFGPTEISVLRSSLPPHLRKCSTVEILTALVWRCRTIALGFHPDEE  702
               +    N+V +SF FG  E++ +R  LP H    ST +++TA +W+CRT+AL  +  E 
Sbjct  230   FAVRDQQNMVQKSFYFGAEELNAIRKHLPAHHSPSSTFDLITACLWKCRTLALEMNQKEV  289

Query  701   VRMLLLINARFKFKDTPMPSGYTGNAFAYPGAKTTAGKLRKNPLGYAVELVTSIKRCFSE  522
             V +  +  AR    +  +P GY GNAFA P   +T   L KNP+GYA+ELV   K   S+
Sbjct  290   VYISCISTAR----NARLPLGYYGNAFALPSEVSTVESLCKNPIGYALELVKKXKAKMSD  345

Query  521   EYMQSMVDLMVLKGRPPFHVAGSFIMSDLTRSKISDVDYGWGKPVFGGPAHGGAGDVPGV  342
             EY++S+ DLMV++GRP F    +F++ D TR+   +VD+GWGKPVF GPA         +
Sbjct  346   EYIKSVADLMVMRGRPDFSSTRNFVVGDTTRAGFGEVDFGWGKPVFAGPAK-----CVNM  400

Query  341   ITFHVPYENKKGENGTLIPICLPAFALDKFVNEL  240
             I  +V ++NK+ ENG L+  CLP  A+++F  EL
Sbjct  401   INLYVRHKNKE-ENGILVLTCLPLSAVERFQQEL  433



>dbj|BAB78588.1| alcohol acetyltransferase [Cucumis melo]
Length=461

 Score =   392 bits (1006),  Expect = 4e-128, Method: Compositional matrix adjust.
 Identities = 201/388 (52%), Positives = 268/388 (69%), Gaps = 8/388 (2%)
 Frame = -1

Query  1412  YRNEPSMSGKDPVQVIRQALAKALVFFYPFAGRLREGPGRKLMVDCTGEGVMFIEADADA  1233
             Y + PS+ G+DPV+VI++A+ KALVF+YP AGRLREGPGRKL V+CTGEG++FIEADAD 
Sbjct  53    YPHNPSLEGRDPVKVIKEAIGKALVFYYPLAGRLREGPGRKLFVECTGEGILFIEADADV  112

Query  1232  TLQHFAIGGELKPPFPCF-DQLLYNVPGSAEILNSPLFLIQVTRLRCGGFIFTLRMNHTM  1056
             +L+ F     L        + +++N   S E+LNSPL LIQVTRL+CGGFIF L  NHTM
Sbjct  113   SLEEF--WDTLPYSLSSMQNNIIHNALNSDEVLNSPLLLIQVTRLKCGGFIFGLCFNHTM  170

Query  1055  ADASGLVHFLNTIAEIARGAEAPAVQPVWQREFFSARNPPRITCTHFEYEEEPAADSMVT  876
             AD  G+V F+   AEIARGA AP++ PVWQR   +AR+PPRIT  H+EY++    D+  T
Sbjct  171   ADGFGIVQFMKATAEIARGAFAPSILPVWQRALLTARDPPRITVRHYEYDQ--VVDTKST  228

Query  875   NIPLDNLVHRSFLFGPTEISVLRSSLPPHLRKCSTVEILTALVWRCRTIALGFHPDEEVR  696
              IP +N++ R F F   +IS LR +LP HL  CS+ E+L A VWR RTIA    P+EEVR
Sbjct  229   LIPANNMIDRLFFFTQRQISTLRQTLPAHLHDCSSFEVLAAYVWRLRTIAFQLKPEEEVR  288

Query  695   MLLLINARFKFKDTPMPSGYTGNAFAYPGAKTTAGKLRKNPLGYAVELVTSIKRCFSEEY  516
              L ++N R K     +P G+ GNA  +P   TT  KL  NPLGYAV+L+   K   ++EY
Sbjct  289   FLCVVNLRSKID---IPLGFYGNAIVFPAVITTIAKLCGNPLGYAVDLIRKAKAKATKEY  345

Query  515   MQSMVDLMVLKGRPPFHVAGSFIMSDLTRSKISDVDYGWGKPVFGGPAHGGAGDVPGVIT  336
             ++SMVD MV+KGRP F   G F+MSD+TR    +VD+GWGK +FGGP  GG G + G+I+
Sbjct  346   IKSMVDFMVIKGRPRFTEIGPFMMSDITRIGFENVDFGWGKAIFGGPIIGGCGIIRGMIS  405

Query  335   FHVPYENKKGENGTLIPICLPAFALDKF  252
             + + + N+ GE G ++P+CLP  A+++F
Sbjct  406   YSIAFMNRNGEKGIVVPLCLPPPAMERF  433



>gb|AAL77060.1|AF468022_1 putative acyltransferase [Cucumis melo]
Length=461

 Score =   391 bits (1005),  Expect = 7e-128, Method: Compositional matrix adjust.
 Identities = 199/388 (51%), Positives = 268/388 (69%), Gaps = 8/388 (2%)
 Frame = -1

Query  1412  YRNEPSMSGKDPVQVIRQALAKALVFFYPFAGRLREGPGRKLMVDCTGEGVMFIEADADA  1233
             Y + PS+ G+DPV+VI++A+AKALVF+YP AGRLREGPGRKL V+CTGEG++FIEADAD 
Sbjct  53    YHHNPSLEGRDPVKVIKEAIAKALVFYYPLAGRLREGPGRKLFVECTGEGILFIEADADV  112

Query  1232  TLQHFAIGGELKPPFPCFDQ-LLYNVPGSAEILNSPLFLIQVTRLRCGGFIFTLRMNHTM  1056
             +L+ F     L       +  +++N   S  +LNSPL LIQVTRL+CGGFIF +  +HTM
Sbjct  113   SLEQFR--DTLPYSLSSMENNIIHNSLNSDGVLNSPLLLIQVTRLKCGGFIFGIHFDHTM  170

Query  1055  ADASGLVHFLNTIAEIARGAEAPAVQPVWQREFFSARNPPRITCTHFEYEEEPAADSMVT  876
             AD  G+  F+  IAEIARGA AP++ PVWQR   +AR+PPRIT  H+EY++    D+  T
Sbjct  171   ADGFGIAQFMKAIAEIARGAFAPSILPVWQRALLTARDPPRITVRHYEYDQ--VVDTKST  228

Query  875   NIPLDNLVHRSFLFGPTEISVLRSSLPPHLRKCSTVEILTALVWRCRTIALGFHPDEEVR  696
              IP +N++ R F F   +IS LR +LP HL  CS+ E+L A VWR RTIA    P+EEVR
Sbjct  229   LIPANNMIDRLFFFTQRQISTLRQTLPAHLHDCSSFEVLAAYVWRLRTIAFQLKPEEEVR  288

Query  695   MLLLINARFKFKDTPMPSGYTGNAFAYPGAKTTAGKLRKNPLGYAVELVTSIKRCFSEEY  516
              L ++N R K     +P G+ GNA  +P   TT  KL  NPLGYAV+L+   K   ++EY
Sbjct  289   FLCVVNLRSKID---IPLGFYGNAIVFPAVITTVAKLCGNPLGYAVDLIRKAKAKATKEY  345

Query  515   MQSMVDLMVLKGRPPFHVAGSFIMSDLTRSKISDVDYGWGKPVFGGPAHGGAGDVPGVIT  336
             ++SMVD MV+KGRP F   G F+MSD+TR    +VD+GWGK +FGGP  GG G + G+I+
Sbjct  346   IKSMVDFMVIKGRPRFTEIGPFMMSDITRIGFENVDFGWGKAIFGGPIIGGCGIIRGMIS  405

Query  335   FHVPYENKKGENGTLIPICLPAFALDKF  252
             + + + N+ GE G ++P+CLP  A+++F
Sbjct  406   YSIAFMNRNGEKGIVVPLCLPPPAMERF  433



>ref|NP_001284403.1| benzyl alcohol O-benzoyltransferase-like [Cucumis melo]
 gb|ACA04742.1| alcohol acetyltransferase [Cucumis melo]
Length=461

 Score =   390 bits (1003),  Expect = 1e-127, Method: Compositional matrix adjust.
 Identities = 199/388 (51%), Positives = 268/388 (69%), Gaps = 8/388 (2%)
 Frame = -1

Query  1412  YRNEPSMSGKDPVQVIRQALAKALVFFYPFAGRLREGPGRKLMVDCTGEGVMFIEADADA  1233
             Y + PS+ G+DPV+VI++A+AKALVF+YP AGRLREGPGRKL V+CTGEG++FIEADAD 
Sbjct  53    YHHNPSLEGRDPVKVIKEAIAKALVFYYPLAGRLREGPGRKLFVECTGEGILFIEADADV  112

Query  1232  TLQHFAIGGELKPPFPCFDQ-LLYNVPGSAEILNSPLFLIQVTRLRCGGFIFTLRMNHTM  1056
             +L+ F     L       +  +++N   S  +LNSPL LIQVTRL+CGGFIF +  +HTM
Sbjct  113   SLEQFR--DTLPYSLSSMENNIIHNSLNSDGVLNSPLLLIQVTRLKCGGFIFGIHFDHTM  170

Query  1055  ADASGLVHFLNTIAEIARGAEAPAVQPVWQREFFSARNPPRITCTHFEYEEEPAADSMVT  876
             AD  G+  F+  IAEIARGA AP++ PVWQR   +AR+PPRIT  H+EY++    D+  T
Sbjct  171   ADGFGIAQFMKAIAEIARGAFAPSILPVWQRALLTARDPPRITVRHYEYDQ--VVDTKST  228

Query  875   NIPLDNLVHRSFLFGPTEISVLRSSLPPHLRKCSTVEILTALVWRCRTIALGFHPDEEVR  696
              IP +N++ R F F   +IS LR +LP HL  CS+ E+L A VWR RTIA    P+EEVR
Sbjct  229   LIPANNMIDRLFFFTQRQISTLRQTLPAHLHDCSSFEVLAAYVWRLRTIAFQLKPEEEVR  288

Query  695   MLLLINARFKFKDTPMPSGYTGNAFAYPGAKTTAGKLRKNPLGYAVELVTSIKRCFSEEY  516
              L ++N R K     +P G+ GNA  +P   TT  KL  NPLGYAV+L+   K   ++EY
Sbjct  289   FLCVVNLRSKID---IPLGFYGNAIVFPTVITTVAKLCGNPLGYAVDLIRKAKAKATKEY  345

Query  515   MQSMVDLMVLKGRPPFHVAGSFIMSDLTRSKISDVDYGWGKPVFGGPAHGGAGDVPGVIT  336
             ++SMVD MV+KGRP F   G F+MSD+TR    +VD+GWGK +FGGP  GG G + G+I+
Sbjct  346   IKSMVDFMVIKGRPRFTEIGPFMMSDITRIGFENVDFGWGKAIFGGPIIGGCGIIRGMIS  405

Query  335   FHVPYENKKGENGTLIPICLPAFALDKF  252
             + + + N+ GE G ++P+CLP  A+++F
Sbjct  406   YSIAFMNRNGEKGIVVPLCLPPPAMERF  433



>ref|XP_006368249.1| hypothetical protein POPTR_0001s00970g [Populus trichocarpa]
 gb|ERP64818.1| hypothetical protein POPTR_0001s00970g [Populus trichocarpa]
Length=459

 Score =   390 bits (1003),  Expect = 1e-127, Method: Compositional matrix adjust.
 Identities = 196/393 (50%), Positives = 264/393 (67%), Gaps = 13/393 (3%)
 Frame = -1

Query  1406  NEPSMSGKDPVQVIRQALAKALVFFYPFAGRLREGPGRKLMVDCTGEGVMFIEADADATL  1227
             + P M G+D V++IR ALA+ALV++YP AGRL+EGP  KL+VDCTGEGV+F+EADAD TL
Sbjct  56    SNPCMEGEDQVKIIRAALAEALVYYYPLAGRLKEGPDGKLLVDCTGEGVLFLEADADTTL  115

Query  1226  QHFAIGGELKPPFPCFDQLLYNVPGSAEILNSPLFLIQVTRLRCGGFIFTLRMNHTMADA  1047
             +   +   ++PP P  DQLLYNVPGS  I+  PL LIQVTRL CGGF+F +R +H +ADA
Sbjct  116   E--LLEDTIQPPCPYLDQLLYNVPGSTGIVGCPLLLIQVTRLMCGGFVFAIRWSHIIADA  173

Query  1046  SGLVHFLNTIAEIARGAEAPAVQPVWQREFFSARNPPRITCTHFEYEEEPAADSMVTNIP  867
              G+  FLNTIAE+  GA  P+  PVWQRE  +AR+PPR T  H E++E    D    N  
Sbjct  174   VGMSKFLNTIAEMVPGATKPSFLPVWQRELLNARDPPRATYEHHEFDEVNDTDFGTMN--  231

Query  866   LDN--LVHRSFLFGPTEISVLRSSLPPHLRKCSTVEILTALVWRCRTIALGFHPDEEVRM  693
              D+  +VH+SF FGP E+S +R  LPPHLR  S+  +LTA +W+CRTIA    P+E VR+
Sbjct  232   -DDTIIVHKSFFFGPREMSSIRKHLPPHLRASSSFLVLTACLWKCRTIATQLDPNEIVRV  290

Query  692   LLLINARFKFKDTPMPSGYTGNAFAYPGAKTTAGKLRKNPLGYAVELVTSIKRCFSEEYM  513
               ++ A  K +   +P+GY GNAF +P A + AG L KNPL Y +ELV  IK   SEEY 
Sbjct  291   SYMVTASGK-EGLKLPAGYYGNAFTFPVALSEAGLLCKNPLEYGLELVKEIKNRLSEEYT  349

Query  512   QSMVDLMVLKGRPPFHVAGSFIMSDLTRSKISDVDYGWGKPVFGGPAHGGAGDVPGVITF  333
             +S +DL+V+KG+  +     F+++D TR    ++D GWGKPV+GGPA G   DV    +F
Sbjct  350   RSAIDLLVIKGKKQYRTVRDFVIADTTRVPFGEIDLGWGKPVYGGPA-GAIKDV----SF  404

Query  332   HVPYENKKGENGTLIPICLPAFALDKFVNELAN  234
                ++N KGE+G ++ + LP   +++F  ELA 
Sbjct  405   FAKFKNGKGEDGIVVQVSLPWQIMERFQKELAK  437



>ref|XP_006377894.1| hypothetical protein POPTR_0011s15660g [Populus trichocarpa]
 gb|ERP55691.1| hypothetical protein POPTR_0011s15660g [Populus trichocarpa]
Length=465

 Score =   390 bits (1003),  Expect = 1e-127, Method: Compositional matrix adjust.
 Identities = 190/394 (48%), Positives = 263/394 (67%), Gaps = 10/394 (3%)
 Frame = -1

Query  1415  FYRNEPSMSGKDPVQVIRQALAKALVFFYPFAGRLREGPGRKLMVDCTGEGVMFIEADAD  1236
              Y + PSM GKDPV+VI++A+A+ LV++YPFAGR+R+G   KL+V+CTGEGV+FIEADAD
Sbjct  50    LYAHNPSMQGKDPVKVIKEAIAQTLVYYYPFAGRIRQGADNKLIVECTGEGVLFIEADAD  109

Query  1235  ATLQHFAIGGELKPPFPCFDQLLYNVPGSAEILNSPLFLIQVTRLRCGGFIFTLRMNHTM  1056
             AT++ F  G  +  PFPCF++LLYNVPGSA I N+PL   QVTRL+CGGF+   R+NH M
Sbjct  110   ATVEQF--GDPIPSPFPCFEELLYNVPGSAGIHNTPLLSFQVTRLKCGGFVLAYRLNHLM  167

Query  1055  ADASGLVHFLNTIAEIARGAEAPAVQPVWQREFFSARNPPRITCTHFEY-EEEPAADSMV  879
             +DA G+V  L+ I EIARGA+AP++ PVWQRE   ARNPPR+T  H EY  + P      
Sbjct  168   SDALGIVQLLSAIGEIARGAQAPSILPVWQRELLCARNPPRVTRRHSEYGNDGPVVVGPT  227

Query  878   TNIP-----LDNLVHRSFLFGPTEISVLRSSLPPHLRKCSTVEILTALVWRCRTIALGFH  714
             TN+P     + ++ HRSF+    E+S +R  +P HL  CS  E+++A +WRC  IA   +
Sbjct  228   TNVPEFHGEVYDVAHRSFVLNRKELSNIRRWIPSHLHPCSNFEVISACLWRCYAIASQAN  287

Query  713   PDEEVRMLLLINARFKFKDTPMPSGYTGNAFAYPGAKTTAGKLRKNPLGYAVELVTSIKR  534
             P+E++RM LL+NAR KF + P+P GY GN  A P A T A  L  N LGYA+EL+ + K 
Sbjct  288   PNEQMRMQLLVNARSKF-NPPLPKGYYGNVLALPAAVTNAKNLCLNSLGYAMELIRNAKN  346

Query  533   CFSEEYMQSMVDLMVLKGRPPFHVAGSFIMSDLTRSKISDVDYGWGKPVFGGPAHGGAGD  354
               +EEYM+S+ DL+ +    P  +  S+++SD+T      VD GW KPV+ GPA     +
Sbjct  347   AITEEYMRSLADLIEITKGQPIGLQ-SYVVSDITSIGFDQVDCGWDKPVYAGPAKAMPDE  405

Query  353   VPGVITFHVPYENKKGENGTLIPICLPAFALDKF  252
             +    T+ +PY  K GE G ++ + L A  +++F
Sbjct  406   ISIAGTYFLPYRFKNGERGVMLLVSLRAPVMERF  439



>ref|XP_011040637.1| PREDICTED: benzyl alcohol O-benzoyltransferase-like [Populus 
euphratica]
Length=465

 Score =   390 bits (1001),  Expect = 3e-127, Method: Compositional matrix adjust.
 Identities = 190/394 (48%), Positives = 263/394 (67%), Gaps = 10/394 (3%)
 Frame = -1

Query  1415  FYRNEPSMSGKDPVQVIRQALAKALVFFYPFAGRLREGPGRKLMVDCTGEGVMFIEADAD  1236
              Y + PSM GKDPV+VI++A+A+ LV++YPFAGR+R+GP  KL+V+CTGEGV+FIEADAD
Sbjct  50    LYAHNPSMQGKDPVKVIKEAIAQTLVYYYPFAGRIRQGPDNKLIVECTGEGVLFIEADAD  109

Query  1235  ATLQHFAIGGELKPPFPCFDQLLYNVPGSAEILNSPLFLIQVTRLRCGGFIFTLRMNHTM  1056
             AT++ F  G  +  PFPCF++LLYNVPGSA I N+PL   QVTRL CGGF+   R+NH M
Sbjct  110   ATVEQF--GDPIPSPFPCFEELLYNVPGSAGIHNTPLLCFQVTRLNCGGFVLAYRLNHLM  167

Query  1055  ADASGLVHFLNTIAEIARGAEAPAVQPVWQREFFSARNPPRITCTHFEY-EEEPAADSMV  879
             +DA G+V  L+ I EIARGA+AP++ PVWQRE   ARNPP +T  H EY  + P      
Sbjct  168   SDALGIVQLLSAIGEIARGAQAPSILPVWQRELLCARNPPHVTRRHSEYGNDGPVVVGPT  227

Query  878   TNIP-----LDNLVHRSFLFGPTEISVLRSSLPPHLRKCSTVEILTALVWRCRTIALGFH  714
             TN+P     + ++ HRSF+    E+S +R  +P HL  CS  E+++A +WRC  +A   +
Sbjct  228   TNVPEFHGKVYDVAHRSFVLNRKELSNIRRWIPSHLHPCSNFEVISACLWRCYAMASQAN  287

Query  713   PDEEVRMLLLINARFKFKDTPMPSGYTGNAFAYPGAKTTAGKLRKNPLGYAVELVTSIKR  534
             P+E++RM LL+NAR KF + P+P GY GN  A P A T A  L  N LGYA+EL+ + K 
Sbjct  288   PNEQMRMQLLVNARSKF-NPPLPKGYYGNVVALPAAVTNAKNLCLNSLGYAMELIRNAKN  346

Query  533   CFSEEYMQSMVDLMVLKGRPPFHVAGSFIMSDLTRSKISDVDYGWGKPVFGGPAHGGAGD  354
               +EEYM+S+ DL+ +    P  +  S+I+SD+TR     +D GW KPV+ GPA     +
Sbjct  347   AITEEYMRSLADLIEITKGQPIGLQ-SYIVSDITRMGFDQLDCGWDKPVYAGPAKAMPDE  405

Query  353   VPGVITFHVPYENKKGENGTLIPICLPAFALDKF  252
             +    T+ +PY  K GE G ++ + L A  +++F
Sbjct  406   ISIAGTYVLPYRFKNGERGVMLLVSLRAPVMERF  439



>ref|XP_008373466.1| PREDICTED: methanol O-anthraniloyltransferase-like [Malus domestica]
Length=460

 Score =   389 bits (999),  Expect = 4e-127, Method: Compositional matrix adjust.
 Identities = 189/396 (48%), Positives = 269/396 (68%), Gaps = 13/396 (3%)
 Frame = -1

Query  1412  YRNEPSMS-GKDPVQVIRQALAKALVFFYPFAGRLREGPGRKLMVDCTGEGVMFIEADAD  1236
             Y++ PS++  ++P++VIR+AL++ALV++YP AGRL EGP   LMVDC GEG++F+EA  D
Sbjct  49    YKDNPSLNENRNPIKVIREALSRALVYYYPLAGRLXEGPNXMLMVDCNGEGILFVEASXD  108

Query  1235  ATLQHFAIGGELKPPFPCFDQLLYNVPGSAEILNSPLFLIQVTRLRCGGFIFTLRMNHTM  1056
              TL+   +G ++ PP P  ++ L+N P S  I+  PL L+QVTRL CGGFI  LR+NHTM
Sbjct  109   VTLEQ--LGDKILPPCPLLEEFLFNFPXSDGIIGCPLLLVQVTRLXCGGFILALRLNHTM  166

Query  1055  ADASGLVHFLNTIAEIARGA-EAPAVQPVWQREFFSARNPPRITCTHFEYEEE-PAADSM  882
              DA G + FL  +AE+ARG   AP++ PVW+RE   AR+PPRI C H EYE+    +D  
Sbjct  167   CDAPGFLQFLTAVAEMARGVIHAPSIIPVWERELLFARDPPRIXCAHHEYEDVIDHSDGS  226

Query  881   VTNIPLDNLVHRSFLFGPTEISVLRSSLPPHL-RKCSTVEILTALVWRCRTIALGFHPDE  705
               +    N+V RSF FG   + VLR  +PPHL   CST +++ A +W+CRT+AL  +P +
Sbjct  227   YASSNQSNMVQRSFYFGAKXMRVLRKXIPPHLISTCSTFDLIXACLWKCRTLALKVNPKQ  286

Query  704   EVRMLLLINARFKFKDTPMPSGYTGNAFAYPGAKTTAGKLRKNPLGYAVELVTSIKRCFS  525
              VR+  ++NAR K  +  +P GY GNAFA+P A + A  L KNPLGYA+ELV   K   +
Sbjct  287   AVRVSCIVNARGKHHNVRLPLGYYGNAFAFPAAISKAELLCKNPLGYALELVKKAKATMN  346

Query  524   EEYMQSMVDLMVLKGRPPFHVAGS-FIMSDLTRSKISDVDYGWGKPVFGGPAHGGAGDVP  348
             EEY++S+ D +VL+GRP +   GS F++SDLTR  + DV++GWG+PVF GPA        
Sbjct  347   EEYLRSVADXLVLRGRPXYSSTGSNFLVSDLTRVGVGDVNFGWGQPVFAGPAKAM-----  401

Query  347   GVITFHVPYENKKGENGTLIPICLPAFALDKFVNEL  240
              +I+F++ ++N   E+G L+P+CLP  A+++F  EL
Sbjct  402   DLISFYIQHKNNT-EDGILVPMCLPFSAMERFQQEL  436



>ref|XP_009374321.1| PREDICTED: methanol O-anthraniloyltransferase-like [Pyrus x bretschneideri]
Length=454

 Score =   389 bits (998),  Expect = 5e-127, Method: Compositional matrix adjust.
 Identities = 198/394 (50%), Positives = 263/394 (67%), Gaps = 15/394 (4%)
 Frame = -1

Query  1412  YRNEPSM--SGKDPVQVIRQALAKALVFFYPFAGRLREGPGRKLMVDCTGEGVMFIEADA  1239
             Y+N P +     DPV+V+++AL+KALVF+YP AGRLREGP RKLMV+CTGEGV+FIEADA
Sbjct  52    YKNNPLIPKDRTDPVKVLKEALSKALVFYYPLAGRLREGPNRKLMVECTGEGVLFIEADA  111

Query  1238  DATLQHFAIGGELKPPFPCFDQLLYNVPGSAEILNSPLFLIQVTRLRCGGFIFTLRMNHT  1059
             + TL+   +G  + PP P  ++ L + P S  IL  PL L+QVTRL+CGGFIF LR+NHT
Sbjct  112   NVTLEQ--LGDAIVPPSPFLEEFLCDAPASDGILGCPLPLVQVTRLKCGGFIFALRVNHT  169

Query  1058  MADASGLVHFLNTIAEIARGAEAPAVQPVWQREFFSARNPPRITCTHFEYEEEPAADSMV  879
             M D SGLV FLN + E+A GA AP++ PVWQRE F ARNPPRITCTH EYEE   +D  +
Sbjct  170   MCDGSGLVRFLNAVGEMAHGAHAPSIPPVWQRELFDARNPPRITCTHHEYEESIDSDEGL  229

Query  878   TNIP-LDNLVHRSFLFGPTEISVLRSSLPPHLRKCSTVEILTALVWRCRTIALGFHPDEE  702
             T +    N+V +SF FG  E+  +R  LP      ST +++TA +W+CRT+A+  +  E 
Sbjct  230   TAVRGQRNMVQKSFYFGAEELKAIRKHLPAEHSPSSTFDLITACLWKCRTLAIEMNQKEV  289

Query  701   VRMLLLINARFKFKDTPMPSGYTGNAFAYPGAKTTAGKLRKNPLGYAVELVTSIKRCFSE  522
             V +  +  A    ++T +P GY GNAFA P   +T   LRKNP+GYA+ELV   K   S+
Sbjct  290   VCISCISGA----QNTRLPLGYYGNAFALPSEVSTVESLRKNPIGYALELVKQAKAKMSD  345

Query  521   EYMQSMVDLMVLKGRPPFHVAGSFIMSDLTRSKISDVDYGWGKPVFGGPAHGGAGDVPGV  342
             EY++S+ DLMV++GRP F  A +F++ D TR+   +VD+GWGKPVF GPA         +
Sbjct  346   EYIKSVADLMVMRGRPDFSSARNFVVGDTTRAGFGEVDFGWGKPVFAGPAK-----CVNM  400

Query  341   ITFHVPYENKKGENGTLIPICLPAFALDKFVNEL  240
             I  +V ++NK+ ENG L+  CLP  A      EL
Sbjct  401   INMYVRHKNKE-ENGILVLTCLPLSAGGGVQQEL  433



>ref|XP_004986631.1| PREDICTED: benzyl alcohol O-benzoyltransferase-like [Setaria 
italica]
Length=463

 Score =   389 bits (999),  Expect = 6e-127, Method: Compositional matrix adjust.
 Identities = 193/403 (48%), Positives = 264/403 (66%), Gaps = 10/403 (2%)
 Frame = -1

Query  1415  FYRNEPSMSGKDPVQVIRQALAKALVFFYPFAGRLREGPGRKLMVDCTGEGVMFIEADAD  1236
              YR   +M G+DPVQVIR A+A+ALV +YP AGRLRE  G KL VDCTGEGV+FIEADAD
Sbjct  51    LYRRNEAMVGRDPVQVIRDAVARALVHYYPLAGRLREVDGGKLAVDCTGEGVLFIEADAD  110

Query  1235  ATLQHFAIGGELKPPFPCFDQLLYNVPGSAEILNSPLFLIQVTRLRCGGFIFTLRMNHTM  1056
               L+H  +G  L PPFPC  +LL++VPGS  I+++PL L QVTRL CGGF+  +R+NHTM
Sbjct  111   VRLEH--LGEPLLPPFPCLQELLFDVPGSFAIVDAPLMLFQVTRLACGGFVLAVRVNHTM  168

Query  1055  ADASGLVHFLNTIAEIARGAEAPAVQPVWQREFFSARNPPRITCTHFEYEEEPAADSMVT  876
             AD  G+V F   +AE+ARGA AP V+PVW RE   AR+PP  +  H EY+E    D  VT
Sbjct  169   ADGLGMVQFGAAVAELARGALAPTVRPVWDRELLMARDPPLPSFAHREYDEAQGTDDTVT  228

Query  875   NIPLDNLVHRSFLFGPTEISVLRSSL-PPHLRKCSTV-EILTALVWRCRTIALGFHPDEE  702
             +  LD+LVHR   F P +++ LR  + PP LR  +T  ++L   +W+CRT+AL    + E
Sbjct  229   S--LDDLVHRCLFFTPRDVAALRDLVDPPQLRASATTFDVLAGCLWKCRTVALAPDANAE  286

Query  701   VRMLLLINA---RFKFKDTPMPSGYTGNAFAYPGAKTTAGKLRKNPLGYAVELVTSIKRC  531
             +RM+  +N    R       +P GY GNA   P A +TAG L  NPLGYA+ELV   K  
Sbjct  287   MRMMCAVNVRGIRTARGGGGIPRGYYGNAAVGPVAVSTAGALCANPLGYAIELVKKAKEE  346

Query  530   FSEEYMQSMVDLMVLKGRPPFHVAGSFIMSDLTRSKISDVDYGWGKPVFGGPAHGGAGDV  351
                EY++S+ DL+VL+GRPP     ++++SD+ ++  + +D+GWG+PV+GGPA  G GD+
Sbjct  347   VDMEYIRSVADLVVLRGRPPVSFVRTYVVSDVRKAPAARLDFGWGRPVYGGPAEVG-GDL  405

Query  350   PGVITFHVPYENKKGENGTLIPICLPAFALDKFVNELANTFLR  222
               V ++ V   + +GE G  +P+CLP  A+++F  E+     R
Sbjct  406   AWVASYFVSVTDARGEEGIAVPVCLPRPAMERFAEEMGKLLQR  448



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 3780637393212