BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c25620_g1_i3 len=1705 path=[1087:0-811 1899:812-823 1911:824-863
752:864-930 7194:931-972 8907:973-975 7238:976-1003 8923:1004-1013
7275:1014-1078 8954:1079-1090 8966:1091-1096 8972:1097-1100
8976:1101-1118 2198:1119-1150 2230:1151-1187 9017:1188-1191
2270:1192-1237 2316:1238-1280 9044:1281-1291 452:1292-1401
9109:1402-1409 655:1410-1410 656:1411-1416 662:1417-1448
9140:1449-1467 2541:1468-1530 2604:1531-1562 7478:1563-1704]

Length=1705
                                                                      Score     E

gb|AAT68601.1|  benzoyl coenzyme A: benzyl alcohol benzoyl transf...    596   0.0      Petunia x hybrida [garden petunia]
sp|Q8GT20.1|BEBT_TOBAC  RecName: Full=Benzyl alcohol O-benzoyltra...    591   0.0      Nicotiana tabacum [American tobacco]
ref|XP_004290447.1|  PREDICTED: benzyl alcohol O-benzoyltransfera...    591   0.0      
emb|CAA64636.1|  hsr201                                                 588   0.0      Nicotiana tabacum [American tobacco]
ref|XP_009803456.1|  PREDICTED: benzyl alcohol O-benzoyltransfera...    588   0.0      
ref|XP_009804829.1|  PREDICTED: benzyl alcohol O-benzoyltransferase     587   0.0      
ref|XP_009619718.1|  PREDICTED: benzyl alcohol O-benzoyltransferase     586   0.0      
emb|CDP21409.1|  unnamed protein product                                580   0.0      
ref|XP_004243496.2|  PREDICTED: benzyl alcohol O-benzoyltransferase     581   0.0      
gb|ACJ85557.1|  unknown                                                 579   0.0      Medicago truncatula
ref|XP_009372579.1|  PREDICTED: benzyl alcohol O-benzoyltransfera...    579   0.0      
ref|XP_008232530.1|  PREDICTED: benzyl alcohol O-benzoyltransferase     578   0.0      
ref|XP_002325454.2|  transferase family protein                         578   0.0      Populus trichocarpa [western balsam poplar]
gb|AJD25145.1|  benzoyl-CoA:benzyl alcohol O-benzoyltransferase         577   0.0      
ref|XP_004243495.1|  PREDICTED: benzyl alcohol O-benzoyltransfera...    577   0.0      
ref|XP_008359502.1|  PREDICTED: benzyl alcohol O-benzoyltransfera...    577   0.0      
ref|XP_008462816.1|  PREDICTED: benzyl alcohol O-benzoyltransfera...    576   0.0      
gb|AFK36385.1|  unknown                                                 576   0.0      
ref|XP_011085895.1|  PREDICTED: LOW QUALITY PROTEIN: benzyl alcoh...    576   0.0      
ref|XP_011012995.1|  PREDICTED: benzyl alcohol O-benzoyltransfera...    573   0.0      
gb|AAW51125.1|  putative alcohol acyl-transferases                      573   0.0      Cucumis melo [Oriental melon]
ref|XP_010275172.1|  PREDICTED: benzyl alcohol O-benzoyltransferase     568   0.0      
ref|XP_003518844.1|  PREDICTED: benzyl alcohol O-benzoyltransferase     567   0.0      
gb|KDP39568.1|  hypothetical protein JCGZ_02588                         566   0.0      
ref|XP_004151058.1|  PREDICTED: benzyl alcohol O-benzoyltransfera...    566   0.0      
ref|XP_009374085.1|  PREDICTED: benzyl alcohol O-benzoyltransfera...    565   0.0      
ref|XP_006484694.1|  PREDICTED: benzyl alcohol O-benzoyltransfera...    562   0.0      
ref|XP_006437408.1|  hypothetical protein CICLE_v10031489mg             562   0.0      
dbj|BAF49304.1|  putative acyltransferase                               562   0.0      Clitoria ternatea
ref|XP_002319767.1|  transferase family protein                         560   0.0      Populus trichocarpa [western balsam poplar]
ref|XP_007029788.1|  Benzoyl coenzyme A: Benzyl alcohol benzoyl t...    560   0.0      
emb|CDP18599.1|  unnamed protein product                                559   0.0      
ref|XP_003536235.1|  PREDICTED: benzyl alcohol O-benzoyltransfera...    556   0.0      
ref|XP_007145940.1|  hypothetical protein PHAVU_007G280800g             556   0.0      
gb|KHF99421.1|  Benzyl alcohol O-benzoyltransferase                     556   0.0      
ref|XP_004498016.1|  PREDICTED: benzyl alcohol O-benzoyltransfera...    556   0.0      
ref|XP_009388282.1|  PREDICTED: benzyl alcohol O-benzoyltransferase     552   0.0      
ref|XP_002264599.1|  PREDICTED: benzyl alcohol O-benzoyltransferase     551   0.0      Vitis vinifera
dbj|BAE72881.1|  benzoyl CoA benzoic acid benzoyltransferase            550   0.0      Glandularia x hybrida [garden verbena]
gb|EYU41389.1|  hypothetical protein MIMGU_mgv1a006154mg                546   0.0      
gb|EYU41386.1|  hypothetical protein MIMGU_mgv1a006089mg                545   0.0      
ref|XP_011009229.1|  PREDICTED: benzyl alcohol O-benzoyltransfera...    544   0.0      
ref|XP_002319766.1|  hypothetical protein POPTR_0013s07230g             540   0.0      Populus trichocarpa [western balsam poplar]
gb|EYU34530.1|  hypothetical protein MIMGU_mgv1a006233mg                538   0.0      
ref|XP_010672751.1|  PREDICTED: benzyl alcohol O-benzoyltransfera...    537   0.0      
gb|ABK96738.1|  unknown                                                 535   0.0      Populus trichocarpa x Populus deltoides
ref|XP_011085894.1|  PREDICTED: benzyl alcohol O-benzoyltransfera...    535   0.0      
ref|XP_007029777.1|  Benzoyl coenzyme A: Benzyl alcohol benzoyl t...    535   0.0      
ref|XP_010038484.1|  PREDICTED: benzyl alcohol O-benzoyltransfera...    533   0.0      
ref|XP_011098396.1|  PREDICTED: benzyl alcohol O-benzoyltransfera...    532   0.0      
gb|KEH40970.1|  benzyl alcohol O-benzoyltransferase                     530   0.0      
ref|XP_002319765.2|  hypothetical protein POPTR_0013s07220g             527   8e-180   Populus trichocarpa [western balsam poplar]
gb|KEH40969.1|  benzyl alcohol O-benzoyltransferase                     526   3e-179   
ref|XP_007029776.1|  Benzoyl coenzyme A: Benzyl alcohol benzoyl t...    528   8e-179   
sp|Q8GT21.1|BEBT_CLABR  RecName: Full=Benzyl alcohol O-benzoyltra...    524   2e-178   Clarkia breweri [fairy fans]
ref|XP_003521737.1|  PREDICTED: benzyl alcohol O-benzoyltransfera...    524   3e-178   
gb|EYU41395.1|  hypothetical protein MIMGU_mgv1a006288mg                522   9e-178   
ref|XP_003554685.1|  PREDICTED: benzyl alcohol O-benzoyltransfera...    523   9e-178   
ref|XP_011085899.1|  PREDICTED: benzyl alcohol O-benzoyltransfera...    521   2e-177   
ref|XP_003521736.1|  PREDICTED: benzyl alcohol O-benzoyltransfera...    521   4e-177   
ref|XP_007029787.1|  Benzoyl coenzyme A: Benzyl alcohol benzoyl t...    520   1e-176   
ref|XP_011046333.1|  PREDICTED: benzyl alcohol O-benzoyltransfera...    519   2e-176   
ref|XP_007029786.1|  Benzoyl coenzyme A: Benzyl alcohol benzoyl t...    521   2e-176   
ref|XP_010644575.1|  PREDICTED: methanol O-anthraniloyltransferas...    517   8e-176   
ref|XP_002270240.1|  PREDICTED: methanol O-anthraniloyltransferase      512   4e-174   Vitis vinifera
gb|KEH40971.1|  benzyl alcohol O-benzoyltransferase                     513   7e-174   
gb|KDP39576.1|  hypothetical protein JCGZ_02596                         512   9e-174   
ref|XP_007029789.1|  Benzoyl coenzyme A: Benzyl alcohol benzoyl t...    511   1e-173   
ref|XP_011046335.1|  PREDICTED: benzyl alcohol O-benzoyltransfera...    511   3e-173   
gb|KHN31434.1|  Benzyl alcohol O-benzoyltransferase                     511   3e-173   
ref|XP_006878638.1|  hypothetical protein AMTR_s00011p00264170          511   4e-173   
ref|XP_002265841.1|  PREDICTED: methanol O-anthraniloyltransferase      510   5e-173   Vitis vinifera
ref|XP_002271603.1|  PREDICTED: methanol O-anthraniloyltransferase      509   7e-173   Vitis vinifera
ref|XP_006370913.1|  hypothetical protein POPTR_0019s01680g             509   1e-172   
ref|XP_007029790.1|  Benzoyl coenzyme A: Benzyl alcohol benzoyl t...    509   2e-172   
ref|XP_002266114.1|  PREDICTED: methanol O-anthraniloyltransferas...    508   3e-172   Vitis vinifera
emb|CAN74729.1|  hypothetical protein VITISV_042062                     507   9e-172   Vitis vinifera
emb|CAN77583.1|  hypothetical protein VITISV_040970                     505   3e-171   Vitis vinifera
ref|XP_010040516.1|  PREDICTED: benzyl alcohol O-benzoyltransfera...    505   4e-171   
emb|CBI37442.3|  unnamed protein product                                505   9e-171   
ref|XP_007029781.1|  Benzoyl coenzyme A: Benzyl alcohol benzoyl t...    507   2e-170   
ref|XP_010040517.1|  PREDICTED: benzyl alcohol O-benzoyltransfera...    503   3e-170   
ref|XP_002266420.1|  PREDICTED: methanol O-anthraniloyltransferase      503   4e-170   Vitis vinifera
gb|ACT82248.1|  alcohol acyltransferase                                 503   6e-170   Vasconcellea cundinamarcensis
sp|Q3ZPN4.1|ACMAT_VITLA  RecName: Full=Methanol O-anthraniloyltra...    502   7e-170   Vitis labrusca [Concord grape]
ref|XP_002270962.1|  PREDICTED: methanol O-anthraniloyltransferas...    501   1e-169   Vitis vinifera
ref|XP_003549135.1|  PREDICTED: 13-hydroxylupanine O-tigloyltrans...    501   2e-169   
ref|XP_002265049.1|  PREDICTED: methanol O-anthraniloyltransferase      501   2e-169   Vitis vinifera
emb|CAN69948.1|  hypothetical protein VITISV_009219                     501   2e-169   Vitis vinifera
emb|CBI37443.3|  unnamed protein product                                500   2e-168   
ref|XP_011085897.1|  PREDICTED: benzyl alcohol O-benzoyltransfera...    498   2e-168   
emb|CAN72252.1|  hypothetical protein VITISV_017467                     498   3e-168   Vitis vinifera
ref|XP_004982683.1|  PREDICTED: benzyl alcohol O-benzoyltransfera...    498   6e-168   
ref|XP_008462818.1|  PREDICTED: benzyl alcohol O-benzoyltransfera...    497   6e-168   
ref|XP_006370914.1|  hypothetical protein POPTR_0019s01690g             497   8e-168   
emb|CAN68818.1|  hypothetical protein VITISV_012041                     496   1e-167   Vitis vinifera
ref|XP_009803457.1|  PREDICTED: benzyl alcohol O-benzoyltransfera...    495   1e-167   
ref|XP_008779984.1|  PREDICTED: benzyl alcohol O-benzoyltransfera...    496   2e-167   
ref|NP_001152518.1|  10-deacetylbaccatin III 10-O-acetyltransferase     495   4e-167   Zea mays [maize]
tpg|DAA49395.1|  TPA: 10-deacetylbaccatin III 10-O-acetyltransferase    495   4e-167   
ref|XP_002524018.1|  3'-N-debenzoyl-2'-deoxytaxol N-benzoyltransf...    494   7e-167   Ricinus communis
emb|CDP09539.1|  unnamed protein product                                493   1e-166   
ref|XP_002466979.1|  hypothetical protein SORBIDRAFT_01g017800          493   3e-166   Sorghum bicolor [broomcorn]
dbj|BAJ92444.1|  predicted protein                                      491   6e-165   
gb|ABX57719.1|  acyltransferase                                         489   6e-165   Vanda hybrid cultivar
ref|XP_008462820.1|  PREDICTED: benzyl alcohol O-benzoyltransfera...    489   7e-165   
ref|XP_004151857.1|  PREDICTED: benzyl alcohol O-benzoyltransfera...    489   1e-164   
ref|XP_006470741.1|  PREDICTED: anthraniloyl-CoA:methanol acyltra...    488   1e-164   
ref|XP_006446260.1|  hypothetical protein CICLE_v10015249mg             488   1e-164   
ref|XP_004156760.1|  PREDICTED: LOW QUALITY PROTEIN: benzyl alcoh...    488   2e-164   
ref|NP_197256.1|  HXXXD-type acyl-transferase family protein            488   2e-164   Arabidopsis thaliana [mouse-ear cress]
ref|XP_011007948.1|  PREDICTED: methanol O-anthraniloyltransferas...    488   2e-164   
gb|KDP39567.1|  hypothetical protein JCGZ_02587                         487   5e-164   
ref|XP_006470749.1|  PREDICTED: anthraniloyl-CoA:methanol acyltra...    486   7e-164   
ref|XP_008238035.1|  PREDICTED: methanol O-anthraniloyltransferas...    485   4e-163   
ref|XP_003574156.1|  PREDICTED: benzyl alcohol O-benzoyltransferase     484   6e-163   
ref|XP_006446267.1|  hypothetical protein CICLE_v10015194mg             484   7e-163   
ref|XP_007147134.1|  hypothetical protein PHAVU_006G098600g             484   8e-163   
ref|XP_009368287.1|  PREDICTED: methanol O-anthraniloyltransferas...    484   8e-163   
ref|XP_007209120.1|  hypothetical protein PRUPE_ppa005455mg             483   2e-162   
ref|XP_007147133.1|  hypothetical protein PHAVU_006G098500g             483   3e-162   
ref|XP_009131598.1|  PREDICTED: (Z)-3-hexen-1-ol acetyltransferase      483   4e-162   
ref|XP_007147136.1|  hypothetical protein PHAVU_006G098800g             483   4e-162   
ref|XP_002304071.1|  hypothetical protein POPTR_0003s01420g             481   8e-162   Populus trichocarpa [western balsam poplar]
ref|XP_003520833.1|  PREDICTED: benzyl alcohol O-benzoyltransfera...    481   8e-162   
gb|KHN31436.1|  Benzyl alcohol O-benzoyltransferase                     480   1e-161   
ref|XP_006470571.1|  PREDICTED: anthraniloyl-CoA:methanol acyltra...    481   2e-161   
ref|XP_008343918.1|  PREDICTED: methanol O-anthraniloyltransferas...    479   5e-161   
gb|AGW30203.1|  alcohol acyl transferase                                479   5e-161   
ref|XP_008384757.1|  PREDICTED: methanol O-anthraniloyltransferas...    479   7e-161   
gb|AGW30201.1|  alcohol acyl transferase                                478   2e-160   
emb|CDX78752.1|  BnaA03g06640D                                          478   2e-160   
gb|AAS48090.1|  alcohol acyl transferase                                477   3e-160   Pyrus communis
ref|XP_010941428.1|  PREDICTED: benzyl alcohol O-benzoyltransfera...    475   5e-160   
gb|AGW30205.1|  alcohol acyl transferase                                477   5e-160   
ref|XP_004151858.1|  PREDICTED: benzyl alcohol O-benzoyltransfera...    476   6e-160   
ref|XP_008391402.1|  PREDICTED: methanol O-anthraniloyltransferas...    476   9e-160   
ref|XP_008678444.1|  PREDICTED: benzyl alcohol O-benzoyltransfera...    476   1e-159   
ref|XP_009386561.1|  PREDICTED: benzyl alcohol O-benzoyltransfera...    476   1e-159   
ref|XP_004506306.1|  PREDICTED: 13-hydroxylupanine O-tigloyltrans...    475   3e-159   
ref|XP_004156786.1|  PREDICTED: benzyl alcohol O-benzoyltransfera...    478   5e-159   
ref|XP_007147132.1|  hypothetical protein PHAVU_006G098400g             475   9e-159   
gb|KCW84614.1|  hypothetical protein EUGRSUZ_B01445                     471   1e-158   
ref|XP_007208844.1|  hypothetical protein PRUPE_ppa025565mg             477   1e-158   
ref|XP_010045974.1|  PREDICTED: benzyl alcohol O-benzoyltransfera...    471   1e-158   
gb|AAR99826.1|  alcohol acyl transferase                                474   1e-158   Malus domestica [apple tree]
gb|AAS79797.1|  alcohol acyl transferase                                473   2e-158   Malus domestica [apple tree]
ref|XP_010941427.1|  PREDICTED: benzyl alcohol O-benzoyltransfera...    471   2e-158   
ref|XP_004294711.1|  PREDICTED: benzyl alcohol O-benzoyltransfera...    473   3e-158   
ref|NP_001064997.1|  Os10g0503300                                       473   3e-158   Oryza sativa Japonica Group [Japonica rice]
ref|XP_009365778.1|  PREDICTED: methanol O-anthraniloyltransferas...    471   1e-157   
gb|AAG13627.1|AC078840_18  putative hypersensitivity-related (hsr...    474   1e-157   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010453955.1|  PREDICTED: (Z)-3-hexen-1-ol acetyltransferas...    471   1e-157   
ref|XP_008373467.1|  PREDICTED: methanol O-anthraniloyltransferas...    470   2e-157   
ref|XP_010420481.1|  PREDICTED: (Z)-3-hexen-1-ol acetyltransferas...    470   3e-157   
gb|AJD18611.1|  alcohol acyltransferase                                 470   4e-157   
gb|AIC83790.1|  alcohol acyltransferase                                 469   4e-157   
gb|KFK25975.1|  hypothetical protein AALP_AA8G187200                    469   6e-157   
ref|XP_009336751.1|  PREDICTED: methanol O-anthraniloyltransferas...    469   6e-157   
ref|XP_010492711.1|  PREDICTED: (Z)-3-hexen-1-ol acetyltransferas...    469   9e-157   
ref|NP_001266678.1|  10-deacetylbaccatin III 10-O-acetyltransferase     469   9e-157   
ref|XP_009336752.1|  PREDICTED: methanol O-anthraniloyltransferas...    469   1e-156   
ref|XP_008373476.1|  PREDICTED: methanol O-anthraniloyltransferas...    468   1e-156   
ref|XP_007147135.1|  hypothetical protein PHAVU_006G098700g             468   2e-156   
gb|AFK34239.1|  unknown                                                 467   3e-156   
gb|KEH40977.1|  benzyl alcohol O-benzoyltransferase                     465   6e-156   
gb|KFK25971.1|  hypothetical protein AALP_AA8G186800                    467   8e-156   
ref|XP_006446263.1|  hypothetical protein CICLE_v10015199mg             466   9e-156   
ref|XP_006400294.1|  hypothetical protein EUTSA_v10013454mg             466   9e-156   
ref|XP_007147137.1|  hypothetical protein PHAVU_006G098900g             467   1e-155   
gb|ABR16595.1|  unknown                                                 465   1e-155   Picea sitchensis
ref|XP_010420482.1|  PREDICTED: (Z)-3-hexen-1-ol acetyltransferas...    465   1e-155   
gb|AES82607.2|  benzyl alcohol O-benzoyltransferase                     466   1e-155   
ref|XP_010110383.1|  Benzyl alcohol O-benzoyltransferase                466   2e-155   
ref|XP_009365763.1|  PREDICTED: methanol O-anthraniloyltransferas...    465   2e-155   
ref|XP_003626388.1|  Benzoyl coenzyme A benzyl alcohol benzoyl tr...    465   2e-155   
ref|XP_011041077.1|  PREDICTED: benzyl alcohol O-benzoyltransfera...    466   2e-155   
ref|XP_009368754.1|  PREDICTED: methanol O-anthraniloyltransferas...    465   2e-155   
ref|XP_007029780.1|  Benzoyl coenzyme A: Benzyl alcohol benzoyl t...    464   8e-155   
ref|XP_006470742.1|  PREDICTED: anthraniloyl-CoA:methanol acyltra...    463   8e-155   
ref|XP_002298962.2|  hypothetical protein POPTR_0001s45210g             464   8e-155   Populus trichocarpa [western balsam poplar]
gb|ABR16407.1|  unknown                                                 463   8e-155   Picea sitchensis
ref|XP_011009230.1|  PREDICTED: benzyl alcohol O-benzoyltransfera...    461   8e-155   
ref|XP_006470570.1|  PREDICTED: anthraniloyl-CoA:methanol acyltra...    463   1e-154   
ref|XP_003626383.1|  Benzoyl coenzyme A benzyl alcohol benzoyl tr...    465   1e-154   
ref|XP_010492712.1|  PREDICTED: (Z)-3-hexen-1-ol acetyltransferas...    462   1e-154   
ref|XP_010453953.1|  PREDICTED: (Z)-3-hexen-1-ol acetyltransferas...    462   3e-154   
ref|XP_006446261.1|  hypothetical protein CICLE_v10015234mg             462   3e-154   
gb|KEH40976.1|  benzyl alcohol O-benzoyltransferase                     460   4e-154   
gb|AHC32224.2|  alcohol acyl transferase 1                              461   8e-154   
ref|XP_009365780.1|  PREDICTED: methanol O-anthraniloyltransferas...    461   9e-154   
ref|XP_003626389.1|  Benzoyl coenzyme A benzyl alcohol benzoyl tr...    464   1e-153   
ref|XP_010667725.1|  PREDICTED: benzyl alcohol O-benzoyltransfera...    461   1e-153   
ref|XP_003616154.1|  Benzoyl coenzyme A benzyl alcohol benzoyl tr...    460   2e-153   
ref|NP_001275839.1|  alcohol acyl transferase                           460   2e-153   
sp|Q5H873.1|HLTT_LUPAL  RecName: Full=13-hydroxylupanine O-tigloy...    460   2e-153   Lupinus albus
ref|XP_002517500.1|  Taxadien-5-alpha-ol O-acetyltransferase, put...    460   3e-153   Ricinus communis
ref|XP_006470748.1|  PREDICTED: anthraniloyl-CoA:methanol acyltra...    460   3e-153   
ref|XP_004305015.1|  PREDICTED: benzyl alcohol O-benzoyltransfera...    459   4e-153   
ref|XP_006446264.1|  hypothetical protein CICLE_v10015163mg             459   6e-153   
gb|ABN48480.1|  quinolizidine alkaloid O-tigloyltransferase             458   1e-152   Lupinus albus
ref|XP_006368247.1|  hypothetical protein POPTR_0001s00950g             458   2e-152   
gb|AES82601.2|  benzyl alcohol O-benzoyltransferase                     459   2e-152   
ref|XP_008368021.1|  PREDICTED: methanol O-anthraniloyltransferas...    457   3e-152   
ref|XP_009130368.1|  PREDICTED: (Z)-3-hexen-1-ol acetyltransferas...    457   5e-152   
gb|EYU41397.1|  hypothetical protein MIMGU_mgv1a024853mg                455   7e-152   
emb|CBI25251.3|  unnamed protein product                                456   8e-152   
ref|XP_004301775.1|  PREDICTED: benzyl alcohol O-benzoyltransfera...    455   1e-151   
ref|XP_008364483.1|  PREDICTED: benzyl alcohol O-benzoyltransfera...    455   1e-151   
ref|XP_008355599.1|  PREDICTED: methanol O-anthraniloyltransferas...    455   2e-151   
ref|XP_010110389.1|  Benzyl alcohol O-benzoyltransferase                456   2e-151   
ref|XP_009374321.1|  PREDICTED: methanol O-anthraniloyltransferas...    454   4e-151   
ref|XP_002298956.2|  hypothetical protein POPTR_0001s45160g             454   5e-151   Populus trichocarpa [western balsam poplar]
ref|XP_011041078.1|  PREDICTED: benzyl alcohol O-benzoyltransfera...    454   6e-151   
ref|XP_008356442.1|  PREDICTED: methanol O-anthraniloyltransferas...    453   1e-150   
ref|XP_002300497.2|  hypothetical protein POPTR_0001s45180g             453   2e-150   Populus trichocarpa [western balsam poplar]
ref|XP_010689156.1|  PREDICTED: benzyl alcohol O-benzoyltransfera...    451   4e-150   
ref|XP_003536109.1|  PREDICTED: benzyl alcohol O-benzoyltransfera...    451   6e-150   
emb|CDY43120.1|  BnaA05g32660D                                          451   6e-150   
ref|XP_008373466.1|  PREDICTED: methanol O-anthraniloyltransferas...    451   1e-149   
ref|XP_004156759.1|  PREDICTED: benzyl alcohol O-benzoyltransfera...    451   1e-149   
ref|XP_004151856.1|  PREDICTED: LOW QUALITY PROTEIN: benzyl alcoh...    450   1e-149   
ref|XP_009130369.1|  PREDICTED: (Z)-3-hexen-1-ol acetyltransferas...    450   2e-149   
ref|XP_003626382.1|  Benzoyl coenzyme A benzyl alcohol benzoyl tr...    450   2e-149   
emb|CDY50708.1|  BnaC05g47750D                                          450   2e-149   
emb|CDY50709.1|  BnaC05g47740D                                          449   2e-149   
gb|ACV74416.1|  putative alcohol acyl transferase                       450   3e-149   Camellia sinensis [black tea]
gb|KHN04051.1|  Benzyl alcohol O-benzoyltransferase                     447   4e-149   
gb|KGN63331.1|  hypothetical protein Csa_2G429040                       448   6e-149   
ref|XP_011018694.1|  PREDICTED: methanol O-anthraniloyltransferas...    448   1e-148   
ref|XP_007209131.1|  hypothetical protein PRUPE_ppa005625mg             447   2e-148   
ref|XP_002884383.1|  chat-3-HEXEN-1-OL ACETYLTRANSFERASE                446   4e-148   
ref|XP_003626386.1|  Alcohol acetyltransferase                          446   6e-148   
gb|EYU41396.1|  hypothetical protein MIMGU_mgv1a005907mg                446   9e-148   
gb|AAL77060.1|AF468022_1  putative acyltransferase                      444   3e-147   Cucumis melo [Oriental melon]
ref|XP_006368249.1|  hypothetical protein POPTR_0001s00970g             444   3e-147   
ref|NP_001284403.1|  benzyl alcohol O-benzoyltransferase-like           444   5e-147   
gb|KCW72711.1|  hypothetical protein EUGRSUZ_E01163                     444   6e-147   
ref|XP_006376283.1|  hypothetical protein POPTR_0013s11650g             442   7e-147   
ref|XP_003516503.1|  PREDICTED: anthraniloyl-CoA:methanol acyltra...    442   1e-146   
ref|XP_010689157.1|  PREDICTED: benzyl alcohol O-benzoyltransfera...    442   2e-146   
ref|XP_006470747.1|  PREDICTED: anthraniloyl-CoA:methanol acyltra...    442   3e-146   
dbj|BAB78588.1|  alcohol acetyltransferase                              441   5e-146   Cucumis melo [Oriental melon]
gb|KHN43217.1|  Benzyl alcohol O-benzoyltransferase                     439   6e-146   
gb|KHN41759.1|  Benzyl alcohol O-benzoyltransferase                     441   7e-146   
ref|XP_008462821.1|  PREDICTED: benzyl alcohol O-benzoyltransfera...    440   2e-145   
ref|XP_002524024.1|  3'-N-debenzoyl-2'-deoxytaxol N-benzoyltransf...    439   2e-145   Ricinus communis
ref|XP_006377894.1|  hypothetical protein POPTR_0011s15660g             440   2e-145   
emb|CAA94432.1|  unknown                                                439   3e-145   Cucumis melo [Oriental melon]
ref|XP_004494963.1|  PREDICTED: benzyl alcohol O-benzoyltransfera...    438   5e-145   
ref|XP_006289628.1|  hypothetical protein CARUB_v10003180mg             438   6e-145   
ref|XP_011040637.1|  PREDICTED: benzyl alcohol O-benzoyltransfera...    437   1e-144   
ref|XP_010689158.1|  PREDICTED: benzyl alcohol O-benzoyltransfera...    436   5e-144   
dbj|BAK02525.1|  predicted protein                                      436   6e-144   
gb|AFK49108.1|  unknown                                                 435   8e-144   
ref|XP_008362881.1|  PREDICTED: methanol O-anthraniloyltransferas...    436   1e-143   
ref|XP_003591040.1|  Benzoyl coenzyme A benzyl alcohol benzoyl tr...    435   1e-143   
ref|XP_008677983.1|  PREDICTED: benzyl alcohol O-benzoyltransfera...    435   3e-143   
ref|NP_186998.1|  acetyl CoA:(Z)-3-hexen-1-ol acetyltransferase         433   5e-143   Arabidopsis thaliana [mouse-ear cress]
ref|XP_004986631.1|  PREDICTED: benzyl alcohol O-benzoyltransfera...    433   1e-142   
gb|AAM61186.1|  putative hypersensitivity-related gene                  432   1e-142   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010058386.1|  PREDICTED: methanol O-anthraniloyltransferas...    433   2e-142   
gb|AGW30202.1|  alcohol acyl transferase                                430   3e-142   
ref|XP_010058392.1|  PREDICTED: methanol O-anthraniloyltransferas...    432   4e-142   
gb|EPS68008.1|  hypothetical protein M569_06766                         429   1e-141   
ref|XP_010557037.1|  PREDICTED: (Z)-3-hexen-1-ol acetyltransferas...    428   7e-141   
gb|EAZ02323.1|  hypothetical protein OsI_24425                          427   1e-140   Oryza sativa Indica Group [Indian rice]
gb|KFK38057.1|  hypothetical protein AALP_AA3G064500                    435   1e-140   
ref|NP_001058545.2|  Os06g0710700                                       427   2e-140   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010058390.1|  PREDICTED: methanol O-anthraniloyltransferas...    427   2e-140   
ref|XP_010665210.1|  PREDICTED: methanol O-anthraniloyltransferas...    422   1e-139   
ref|XP_010489657.1|  PREDICTED: (Z)-3-hexen-1-ol acetyltransferas...    423   4e-139   
ref|XP_004239236.1|  PREDICTED: methanol O-anthraniloyltransferas...    422   1e-138   
ref|XP_009778012.1|  PREDICTED: methanol O-anthraniloyltransferas...    421   4e-138   
ref|XP_008238086.1|  PREDICTED: methanol O-anthraniloyltransferas...    422   1e-137   
gb|AAN85436.1|  acyltransferase 2                                       419   1e-137   Capsicum chinense [bonnet pepper]
gb|KCW72709.1|  hypothetical protein EUGRSUZ_E01161                     420   1e-137   
ref|XP_009589917.1|  PREDICTED: methanol O-anthraniloyltransferas...    418   3e-137   
gb|KFK38056.1|  hypothetical protein AALP_AA3G064500                    426   4e-137   
ref|XP_009759678.1|  PREDICTED: methanol O-anthraniloyltransferas...    417   6e-137   
ref|XP_010450554.1|  PREDICTED: (Z)-3-hexen-1-ol acetyltransferase      417   7e-137   
ref|XP_010558859.1|  PREDICTED: (Z)-3-hexen-1-ol acetyltransferas...    416   4e-136   
ref|XP_006297655.1|  hypothetical protein CARUB_v10013677mg             416   4e-136   
ref|XP_010665177.1|  PREDICTED: methanol O-anthraniloyltransferas...    413   4e-136   
ref|XP_006657332.1|  PREDICTED: benzyl alcohol O-benzoyltransfera...    415   5e-136   
ref|XP_002438993.1|  hypothetical protein SORBIDRAFT_10g029610          415   5e-136   
ref|XP_004966402.1|  PREDICTED: benzyl alcohol O-benzoyltransfera...    415   7e-136   
ref|XP_004986643.1|  PREDICTED: benzyl alcohol O-benzoyltransfera...    415   9e-136   
ref|XP_002298960.2|  hypothetical protein POPTR_0001s45190g             414   1e-135   
ref|XP_010558858.1|  PREDICTED: (Z)-3-hexen-1-ol acetyltransferas...    413   5e-135   
ref|XP_010557044.1|  PREDICTED: (Z)-3-hexen-1-ol acetyltransferas...    413   7e-135   
gb|KGN63336.1|  hypothetical protein Csa_2G430570                       411   1e-134   
gb|KCW72714.1|  hypothetical protein EUGRSUZ_E01167                     411   3e-134   
ref|XP_002873835.1|  transferase family protein                         409   4e-134   
ref|XP_006361592.1|  PREDICTED: anthraniloyl-CoA:methanol acyltra...    410   4e-134   
ref|XP_002437575.1|  hypothetical protein SORBIDRAFT_10g029620          410   7e-134   
ref|XP_002437572.1|  hypothetical protein SORBIDRAFT_10g029590          409   9e-134   
ref|XP_008645066.1|  PREDICTED: benzyl alcohol O-benzoyltransfera...    409   1e-133   
ref|XP_003575185.1|  PREDICTED: benzyl alcohol O-benzoyltransfera...    409   1e-133   
ref|XP_010557036.1|  PREDICTED: (Z)-3-hexen-1-ol acetyltransferas...    408   2e-133   
ref|XP_010058394.1|  PREDICTED: methanol O-anthraniloyltransferas...    411   4e-133   
ref|XP_002447250.1|  hypothetical protein SORBIDRAFT_06g031260          407   8e-133   
dbj|BAC58010.1|  alcohol acyltransferase                                405   6e-132   
ref|XP_011082158.1|  PREDICTED: methanol O-anthraniloyltransferas...    404   2e-131   
ref|XP_003563544.1|  PREDICTED: benzyl alcohol O-benzoyltransfera...    403   3e-131   
ref|XP_010521555.1|  PREDICTED: (Z)-3-hexen-1-ol acetyltransferas...    403   3e-131   
gb|EMT31153.1|  2-alpha-hydroxytaxane 2-O-benzoyltransferase            401   1e-130   
ref|XP_004966401.1|  PREDICTED: benzyl alcohol O-benzoyltransfera...    400   4e-130   
gb|AGK82816.1|  alcohol acyltransferase 2                               398   2e-129   
gb|AIW04708.1|  alcohol acyltransferase 1                               397   4e-129   
ref|XP_010058391.1|  PREDICTED: methanol O-anthraniloyltransferas...    398   5e-129   
ref|XP_010550256.1|  PREDICTED: LOW QUALITY PROTEIN: (Z)-3-hexen-...    397   9e-129   
ref|XP_004244681.1|  PREDICTED: methanol O-anthraniloyltransferase      395   2e-128   
gb|KDP39569.1|  hypothetical protein JCGZ_02589                         391   5e-128   
emb|CDP11061.1|  unnamed protein product                                394   1e-127   
emb|CAE04720.1|  OSJNBa0043L24.8                                        394   1e-127   
ref|XP_006351055.1|  PREDICTED: anthraniloyl-CoA:methanol acyltra...    393   2e-127   
gb|KCW72712.1|  hypothetical protein EUGRSUZ_E01165                     391   2e-127   
gb|EYU41390.1|  hypothetical protein MIMGU_mgv1a009242mg                389   4e-127   
emb|CAH67336.1|  OSIGBa0157A06.5                                        392   5e-127   
gb|EMT07181.1|  Taxadien-5-alpha-ol O-acetyltransferase                 391   1e-126   
gb|AEM43830.1|  alcohol acyl transferase                                388   4e-126   
ref|XP_008660766.1|  PREDICTED: benzyl alcohol O-benzoyltransfera...    390   1e-125   
ref|NP_001234496.1|  alcohol acyl transferase                           389   1e-125   
ref|XP_006408298.1|  hypothetical protein EUTSA_v10022248mg             387   3e-125   
ref|XP_003581404.1|  PREDICTED: benzyl alcohol O-benzoyltransfera...    388   3e-125   
ref|XP_010058393.1|  PREDICTED: methanol O-anthraniloyltransferas...    391   2e-124   
ref|XP_006350348.1|  PREDICTED: anthraniloyl-CoA:methanol acyltra...    384   8e-124   
gb|EAZ04276.1|  hypothetical protein OsI_26418                          383   1e-123   
gb|ACF07921.1|  alcohol acyl transferase                                384   1e-123   
emb|CDP17523.1|  unnamed protein product                                382   7e-123   
emb|CBI29212.3|  unnamed protein product                                379   9e-123   
ref|XP_006370717.1|  hypothetical protein POPTR_0001s45150g             376   2e-122   
ref|XP_006654215.1|  PREDICTED: benzyl alcohol O-benzoyltransfera...    378   2e-121   
gb|EYU41388.1|  hypothetical protein MIMGU_mgv1a021683mg                375   5e-121   
ref|XP_004960441.1|  PREDICTED: benzyl alcohol O-benzoyltransfera...    376   5e-121   
gb|AAT01406.1|  hypothetical protein                                    376   1e-120   
ref|NP_001148135.1|  taxadien-5-alpha-ol O-acetyltransferase            375   1e-120   
ref|XP_004151707.1|  PREDICTED: benzyl alcohol O-benzoyltransfera...    368   3e-120   
ref|XP_010549748.1|  PREDICTED: (Z)-3-hexen-1-ol acetyltransferas...    375   3e-120   
ref|NP_001059277.1|  Os07g0244200                                       374   4e-120   
ref|XP_002440560.1|  hypothetical protein SORBIDRAFT_09g003170          375   4e-120   
ref|NP_001059940.1|  Os07g0550600                                       373   1e-119   
ref|XP_006657816.1|  PREDICTED: benzyl alcohol O-benzoyltransfera...    373   2e-119   
dbj|BAJ88238.1|  predicted protein                                      372   2e-119   
ref|XP_010058385.1|  PREDICTED: methanol O-anthraniloyltransferas...    370   3e-119   
dbj|BAJ96970.1|  predicted protein                                      372   6e-119   
gb|ACR36326.1|  unknown                                                 370   1e-118   
ref|XP_010550257.1|  PREDICTED: (Z)-3-hexen-1-ol acetyltransferas...    370   5e-118   
ref|XP_007200171.1|  hypothetical protein PRUPE_ppa016489mg             362   2e-117   
ref|XP_008380361.1|  PREDICTED: LOW QUALITY PROTEIN: benzyl alcoh...    362   3e-117   
ref|XP_008348383.1|  PREDICTED: benzyl alcohol O-benzoyltransfera...    362   3e-117   
ref|XP_010436740.1|  PREDICTED: (Z)-3-hexen-1-ol acetyltransferas...    364   6e-117   
ref|XP_008670946.1|  PREDICTED: benzyl alcohol O-benzoyltransfera...    366   7e-117   
ref|XP_010527080.1|  PREDICTED: (Z)-3-hexen-1-ol acetyltransferas...    366   1e-116   
ref|XP_006657584.1|  PREDICTED: benzyl alcohol O-benzoyltransfera...    362   1e-115   
ref|XP_008662941.1|  PREDICTED: benzyl alcohol O-benzoyltransfera...    359   5e-114   
gb|EAY80579.1|  hypothetical protein OsI_35761                          358   1e-113   
ref|XP_010644207.1|  PREDICTED: methanol O-anthraniloyltransferas...    355   2e-113   
gb|KCW72707.1|  hypothetical protein EUGRSUZ_E01159                     353   1e-112   
gb|AAV32163.1|  hypothetical protein                                    353   1e-111   
ref|XP_008359513.1|  PREDICTED: benzyl alcohol O-benzoyltransfera...    347   1e-111   
ref|XP_008660975.1|  PREDICTED: benzyl alcohol O-benzoyltransfera...    353   2e-111   
gb|EEC75861.1|  hypothetical protein OsI_12874                          350   2e-110   
ref|XP_004517186.1|  PREDICTED: benzyl alcohol O-benzoyltransfera...    345   2e-110   
gb|AAS07101.1|  putative hypersensitivity-related protein               349   3e-110   
gb|EEE51952.1|  hypothetical protein OsJ_33591                          348   7e-110   
ref|XP_008660976.1|  PREDICTED: benzyl alcohol O-benzoyltransfera...    347   5e-109   
ref|XP_002461609.1|  hypothetical protein SORBIDRAFT_02g005330          344   2e-108   
gb|EEE63107.1|  hypothetical protein OsJ_17915                          340   5e-107   
gb|AAS55785.1|  putative benzyl alcohol benzoyl transferase             341   5e-107   
gb|EEE62279.1|  hypothetical protein OsJ_17067                          340   6e-107   
ref|XP_002524021.1|  transferase, putative                              333   8e-107   
ref|NP_001054603.1|  Os05g0141300                                       339   1e-106   
gb|EAY96502.1|  hypothetical protein OsI_18404                          339   1e-106   
ref|XP_010045975.1|  PREDICTED: benzyl alcohol O-benzoyltransfera...    335   3e-106   
gb|AGW30204.1|  truncated alcohol acyl transferase                      334   3e-106   
gb|KCW84616.1|  hypothetical protein EUGRSUZ_B01447                     333   5e-106   
emb|CDP21408.1|  unnamed protein product                                332   8e-106   
gb|EAY73940.1|  hypothetical protein OsI_01825                          337   2e-105   
ref|NP_001042981.1|  Os01g0350000                                       334   2e-104   
ref|XP_010231737.1|  PREDICTED: benzyl alcohol O-benzoyltransfera...    333   4e-104   
ref|XP_007029779.1|  Benzoyl coenzyme A: Benzyl alcohol benzoyl t...    325   2e-103   
ref|XP_002438731.1|  hypothetical protein SORBIDRAFT_10g025140          331   5e-103   
gb|EEE61303.1|  hypothetical protein OsJ_15395                          326   9e-102   
ref|XP_006446721.1|  hypothetical protein CICLE_v10017956mg             323   7e-101   
ref|XP_002444747.1|  hypothetical protein SORBIDRAFT_07g027100          323   2e-100   
gb|KDP39572.1|  hypothetical protein JCGZ_02592                         319   2e-100   
ref|XP_004983290.1|  PREDICTED: benzyl alcohol O-benzoyltransfera...    322   1e-99    
ref|XP_002464781.1|  hypothetical protein SORBIDRAFT_01g026670          322   2e-99    
ref|XP_006661593.1|  PREDICTED: benzyl alcohol O-benzoyltransfera...    320   2e-99    
ref|XP_008348656.1|  PREDICTED: benzyl alcohol O-benzoyltransfera...    320   4e-99    
ref|XP_002524020.1|  transferase, putative                              312   5e-99    
ref|XP_006664808.1|  PREDICTED: benzyl alcohol O-benzoyltransfera...    320   9e-99    
gb|ACU24193.1|  unknown                                                 315   2e-98    
ref|XP_003576099.1|  PREDICTED: benzyl alcohol O-benzoyltransfera...    317   4e-98    
gb|AAP51790.2|  Transferase family protein                              315   2e-97    
ref|NP_001148798.1|  transferase family protein                         314   1e-96    
ref|XP_004983466.1|  PREDICTED: benzyl alcohol O-benzoyltransfera...    312   4e-96    
tpg|DAA46610.1|  TPA: hypothetical protein ZEAMMB73_163572              311   9e-96    
emb|CAN68586.1|  hypothetical protein VITISV_027876                     308   9e-96    
gb|EAY77467.1|  hypothetical protein OsI_32511                          311   4e-95    
ref|XP_003576147.1|  PREDICTED: benzyl alcohol O-benzoyltransfera...    310   5e-95    
emb|CDM80509.1|  unnamed protein product                                309   5e-95    
gb|EMT02065.1|  hypothetical protein F775_43251                         308   6e-95    
ref|XP_004951311.1|  PREDICTED: benzyl alcohol O-benzoyltransfera...    309   7e-95    
ref|XP_002464832.1|  hypothetical protein SORBIDRAFT_01g027380          308   2e-94    
ref|XP_003577635.1|  PREDICTED: benzyl alcohol O-benzoyltransfera...    308   2e-94    
ref|XP_006653585.1|  PREDICTED: benzyl alcohol O-benzoyltransfera...    302   4e-94    
gb|KDP39574.1|  hypothetical protein JCGZ_02594                         300   7e-94    
ref|XP_004983468.1|  PREDICTED: benzyl alcohol O-benzoyltransfera...    306   1e-93    
gb|EMS47942.1|  Omega-hydroxypalmitate O-feruloyl transferase           306   2e-93    
gb|KDO44967.1|  hypothetical protein CISIN_1g0133461mg                  299   5e-93    
ref|XP_004983469.1|  PREDICTED: benzyl alcohol O-benzoyltransfera...    304   5e-93    
ref|XP_008373477.1|  PREDICTED: methanol O-anthraniloyltransferas...    298   1e-92    
dbj|BAC65990.1|  putative benzoyl coenzyme A                            303   2e-92    
ref|XP_006664809.1|  PREDICTED: benzyl alcohol O-benzoyltransfera...    303   2e-92    
gb|EAY94788.1|  hypothetical protein OsI_16567                          296   3e-92    
ref|XP_004983425.1|  PREDICTED: benzyl alcohol O-benzoyltransfera...    301   2e-91    
ref|XP_007217533.1|  hypothetical protein PRUPE_ppa023329mg             300   2e-91    
ref|XP_004983467.1|  PREDICTED: benzyl alcohol O-benzoyltransfera...    300   5e-91    
ref|XP_010109027.1|  Benzyl alcohol O-benzoyltransferase                299   5e-91    
ref|XP_009371837.1|  PREDICTED: benzyl alcohol O-benzoyltransferase     298   9e-91    
ref|XP_010108951.1|  Benzyl alcohol O-benzoyltransferase                292   2e-90    
gb|EYU26841.1|  hypothetical protein MIMGU_mgv1a011322mg                292   2e-90    
ref|XP_002272487.1|  PREDICTED: benzyl alcohol O-benzoyltransferase     297   3e-90    
gb|EMS57280.1|  Omega-hydroxypalmitate O-feruloyl transferase           297   3e-90    
emb|CAN74177.1|  hypothetical protein VITISV_029256                     297   3e-90    
ref|XP_003573843.1|  PREDICTED: benzyl alcohol O-benzoyltransfera...    297   4e-90    
gb|KDO54864.1|  hypothetical protein CISIN_1g041010mg                   290   8e-90    
gb|EAY77473.1|  hypothetical protein OsI_32516                          295   1e-89    
ref|XP_002464789.1|  hypothetical protein SORBIDRAFT_01g026760          295   3e-89    
ref|NP_001064288.1|  Os10g0195600                                       295   7e-89    
gb|EAY77933.1|  hypothetical protein OsI_32974                          293   2e-88    
gb|KGN63335.1|  hypothetical protein Csa_2G429070                       287   3e-88    
ref|XP_004514200.1|  PREDICTED: benzyl alcohol O-benzoyltransfera...    292   9e-88    
gb|EMT25787.1|  10-deacetylbaccatin III 10-O-acetyltransferase          285   3e-87    
ref|NP_001064111.1|  Os10g0133500                                       290   4e-87    
gb|EAY77618.1|  hypothetical protein OsI_32660                          289   9e-87    
ref|NP_001176004.1|  Os10g0106701                                       287   1e-86    
ref|XP_008659223.1|  PREDICTED: benzyl alcohol O-benzoyltransfera...    288   1e-86    
ref|XP_003563141.1|  PREDICTED: benzyl alcohol O-benzoyltransfera...    286   4e-86    
gb|ABB46590.2|  Transferase family protein                              287   6e-86    
gb|EAY77476.1|  hypothetical protein OsI_32518                          288   6e-86    
tpg|DAA49394.1|  TPA: hypothetical protein ZEAMMB73_141384              280   1e-85    
ref|XP_003626378.1|  Benzoyl coenzyme A benzyl alcohol benzoyl tr...    282   2e-85    
gb|KEH17123.1|  benzyl alcohol O-benzoyltransferase                     279   3e-85    
gb|AAG12486.2|AC037197_11  Putative hsr201 hypersensitivity-relat...    286   3e-85    
gb|KHN16174.1|  Benzyl alcohol O-benzoyltransferase                     279   6e-85    
gb|AAL75750.1|  Putative hsr201 hypersensitivity-related protein        282   9e-85    
ref|XP_006661592.1|  PREDICTED: benzyl alcohol O-benzoyltransfera...    283   1e-84    
gb|EMT01643.1|  10-deacetylbaccatin III 10-O-acetyltransferase          283   3e-84    
ref|XP_010667734.1|  PREDICTED: benzyl alcohol O-benzoyltransfera...    274   7e-84    
gb|EEE50698.1|  hypothetical protein OsJ_30968                          280   1e-83    
gb|ABR16860.1|  unknown                                                 279   2e-83    
ref|NP_001066733.1|  Os12g0458100                                       279   2e-83    
gb|EAZ20412.1|  hypothetical protein OsJ_36019                          275   7e-82    
ref|XP_002440561.1|  hypothetical protein SORBIDRAFT_09g003180          276   9e-82    
gb|EMT30746.1|  3'-N-debenzoyl-2'-deoxytaxol N-benzoyltransferase       271   4e-81    
gb|ABA98392.1|  Transferase family protein                              275   5e-81    
emb|CBI37444.3|  unnamed protein product                                264   9e-81    
ref|XP_006388975.1|  hypothetical protein POPTR_0065s002301g            267   1e-80    
gb|EMS66480.1|  Omega-hydroxypalmitate O-feruloyl transferase           272   3e-80    
gb|EMT16226.1|  10-deacetylbaccatin III 10-O-acetyltransferase          264   8e-80    
dbj|BAK02782.1|  predicted protein                                      269   2e-79    
gb|KEH15838.1|  benzyl alcohol O-benzoyltransferase                     260   7e-79    
gb|AIZ00468.1|  alcohol acyl transferase                                259   7e-79    
gb|EMT08739.1|  hypothetical protein F775_52254                         266   9e-79    
gb|AAG12478.2|AC037197_3  Putative hsr201 hypersensitivity-relate...    262   1e-78    
gb|EAZ20409.1|  hypothetical protein OsJ_36017                          263   2e-77    
ref|XP_003626385.1|  Benzoyl coenzyme A benzyl alcohol benzoyl tr...    259   2e-77    
ref|XP_006290244.1|  hypothetical protein CARUB_v100037961mg            258   3e-77    
gb|ABR16192.1|  unknown                                                 261   1e-76    
ref|NP_001176003.1|  Os10g0105900                                       261   2e-76    
gb|EAY77468.1|  hypothetical protein OsI_32512                          259   7e-76    
ref|XP_010665859.1|  PREDICTED: benzyl alcohol O-benzoyltransfera...    254   8e-76    
gb|AAG12484.2|AC037197_9  Putative hsr201 hypersensitivity-relate...    257   1e-74    
gb|AAG12479.2|AC037197_4  Putative hsr201 hypersensitivity-relate...    255   3e-74    
gb|EMT30544.1|  3'-N-debenzoyl-2'-deoxytaxol N-benzoyltransferase       257   4e-74    
ref|XP_004174118.1|  PREDICTED: benzyl alcohol O-benzoyltransfera...    246   7e-74    
emb|CDX70765.1|  BnaC03g08490D                                          249   1e-73    
ref|XP_007210147.1|  hypothetical protein PRUPE_ppa025118mg             249   2e-73    
ref|XP_003580168.1|  PREDICTED: omega-hydroxypalmitate O-feruloyl...    252   3e-73    
gb|ABA98379.1|  Transferase family protein, expressed                   252   3e-73    
gb|ADD62404.1|  fatty omega-hydroxyacid/fatty alcohol 0-hydroxyci...    251   3e-73    
ref|XP_004979328.1|  PREDICTED: omega-hydroxypalmitate O-feruloyl...    249   7e-72    
ref|XP_009612665.1|  PREDICTED: methanol O-anthraniloyltransferas...    243   1e-71    
ref|XP_004138033.1|  PREDICTED: omega-hydroxypalmitate O-feruloyl...    246   3e-71    
ref|XP_008804093.1|  PREDICTED: omega-hydroxypalmitate O-feruloyl...    246   3e-71    
ref|XP_008464403.1|  PREDICTED: omega-hydroxypalmitate O-feruloyl...    246   5e-71    
gb|KDP30452.1|  hypothetical protein JCGZ_17140                         241   6e-71    
ref|XP_006347627.1|  PREDICTED: omega-hydroxypalmitate O-feruloyl...    245   8e-71    
gb|EMT22321.1|  10-deacetylbaccatin III 10-O-acetyltransferase          243   8e-71    
ref|XP_010086996.1|  Omega-hydroxypalmitate O-feruloyl transferase      245   1e-70    
ref|XP_011073101.1|  PREDICTED: omega-hydroxypalmitate O-feruloyl...    244   2e-70    
ref|NP_001275190.1|  feruloyl transferase                               244   2e-70    
ref|XP_006658432.1|  PREDICTED: uncharacterized protein LOC102714479    247   3e-70    
ref|XP_004304535.1|  PREDICTED: omega-hydroxypalmitate O-feruloyl...    243   5e-70    
ref|XP_004304536.1|  PREDICTED: omega-hydroxypalmitate O-feruloyl...    243   5e-70    
ref|XP_011073100.1|  PREDICTED: omega-hydroxypalmitate O-feruloyl...    244   6e-70    



>gb|AAT68601.1| benzoyl coenzyme A: benzyl alcohol benzoyl transferase [Petunia 
x hybrida]
 gb|AAU06226.1| benzoyl-CoA:benzyl alcohol/phenylethanol benzoyltransferase [Petunia 
x hybrida]
Length=460

 Score =   596 bits (1537),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 295/440 (67%), Positives = 361/440 (82%), Gaps = 5/440 (1%)
 Frame = -1

Query  1534  SIAFTVTRQNPELVAPADPTPREIKYLSDIDDQQGLRFQIPVIHFYRNEPSMSGKDPVQV  1355
              + FTV RQ PEL+APA PTPRE K+LSDIDDQ+GLRFQIPVI+FYR + SM GKDPV+V
Sbjct  8     ELVFTVRRQEPELIAPAKPTPRETKFLSDIDDQEGLRFQIPVINFYRKDSSMGGKDPVEV  67

Query  1354  IRQALAKALVFFYPFAGRLREGPGRKLMVDCTGEGVMFIEADADATLQHFAVGGELKPPF  1175
             I++A+A+ LVF+YPFAGRLREG  RKLMVDCTGEGVMF+EA+AD TL+ F  G EL+PPF
Sbjct  68    IKKAIAETLVFYYPFAGRLREGNDRKLMVDCTGEGVMFVEANADVTLEEF--GDELQPPF  125

Query  1174  PCFDQLLYNVPGSAEILNCPLFLIQVTRLRCGGFIFALRLNHSMSDACGLVHFLNTIAEI  995
             PC ++LLY+VPGSA +L+CPL LIQVTRLRCGGFIFALRLNH+MSDA GLV F+  + E+
Sbjct  126   PCLEELLYDVPGSAGVLHCPLLLIQVTRLRCGGFIFALRLNHTMSDAPGLVQFMTAVGEM  185

Query  994   ARGAEAPSVYPVWQREFFDARNPPRITCTHFEYEEEPAADSMVTNIPLDNLVHRSFFFGP  815
             ARGA APS  PVW RE  +ARNPP++TCTH EYEE P  D+  T IPLD++VHRSFFFGP
Sbjct  186   ARGATAPSTLPVWCRELLNARNPPQVTCTHHEYEEVP--DTKGTLIPLDDMVHRSFFFGP  243

Query  814   TEISALRSSLPPHLLKCSRFEVVTACLWRCRTIAMEFDPNDEVRIFGTVNARPRLKNPPV  635
             TE+SALR  +PPHL  CS FEV+TA LWRCRTI+++ DP +EVR+   VNAR R  NP +
Sbjct  244   TEVSALRRFVPPHLHNCSTFEVLTAALWRCRTISIKPDPEEEVRVLCIVNARSRF-NPQL  302

Query  634   PNGYYGNAFVYPGAKSTAGKVSKSPLSHALELVTNIKSSFTEEYIKSVADLMILKGRPTF  455
             P+GYYGNAF +P A +TA K+ K+PL +ALELV   KS  TEEY+KSVADLM++KGRP F
Sbjct  303   PSGYYGNAFAFPVAVTTAEKLCKNPLGYALELVKKTKSDVTEEYMKSVADLMVIKGRPHF  362

Query  454   TLQGTFIVSDVTRVGFPEIDMGWGQSVFggpahggvggipGLITFYIPYEDNKGDHGILV  275
             T+  T++VSDVTR GF E+D GWG++V+GGPA GGVG IPG+ +FYIP+ + KG++GI+V
Sbjct  363   TVVRTYLVSDVTRAGFGEVDFGWGKAVYGGPAKGGVGAIPGVASFYIPFRNKKGENGIVV  422

Query  274   PMCLPAIAMGKFVKELENCL  215
             P+CLP  AM KFVKEL++ L
Sbjct  423   PICLPGFAMEKFVKELDSML  442



>sp|Q8GT20.1|BEBT_TOBAC RecName: Full=Benzyl alcohol O-benzoyltransferase; AltName: Full=Benzoyl 
coenzyme A:benzyl alcohol benzoyl transferase [Nicotiana 
tabacum]
 gb|AAN09798.1| benzoyl coenzyme A: benzyl alcohol benzoyl transferase [Nicotiana 
tabacum]
Length=460

 Score =   591 bits (1524),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 292/439 (67%), Positives = 358/439 (82%), Gaps = 5/439 (1%)
 Frame = -1

Query  1531  IAFTVTRQNPELVAPADPTPREIKYLSDIDDQQGLRFQIPVIHFYRNEPSMSGKDPVQVI  1352
             + FTV RQ PEL+APA PTPREIK+LSDIDDQ+GLRFQIPVI FY  + SM  KDPV+VI
Sbjct  9     LVFTVRRQKPELIAPAKPTPREIKFLSDIDDQEGLRFQIPVIQFYHKDSSMGRKDPVKVI  68

Query  1351  RQALAKALVFFYPFAGRLREGPGRKLMVDCTGEGVMFIEADADATLQHFAVGGELKPPFP  1172
             ++A+A+ LVF+YPFAGRLREG GRKLMVDCTGEG+MF+EADAD TL+ F  G EL+PPFP
Sbjct  69    KKAIAETLVFYYPFAGRLREGNGRKLMVDCTGEGIMFVEADADVTLEQF--GDELQPPFP  126

Query  1171  CFDQLLYNVPGSAEILNCPLFLIQVTRLRCGGFIFALRLNHSMSDACGLVHFLNTIAEIA  992
             C ++LLY+VP SA +LNCPL LIQVTRLRCGGFIFALRLNH+MSDA GLV F+  + E+A
Sbjct  127   CLEELLYDVPDSAGVLNCPLLLIQVTRLRCGGFIFALRLNHTMSDAPGLVQFMTAVGEMA  186

Query  991   RGAEAPSVYPVWQREFFDARNPPRITCTHFEYEEEPAADSMVTNIPLDNLVHRSFFFGPT  812
             RGA APS+ PVW RE  +ARNPP++TCTH EY+E    D+  T IPLD++VH+SFFFGP+
Sbjct  187   RGASAPSILPVWCRELLNARNPPQVTCTHHEYDE--VRDTKGTIIPLDDMVHKSFFFGPS  244

Query  811   EISALRSSLPPHLLKCSRFEVVTACLWRCRTIAMEFDPNDEVRIFGTVNARPRLKNPPVP  632
             E+SALR  +P HL KCS FE++TA LWRCRT++++ DP +EVR    VNAR R  NPP+P
Sbjct  245   EVSALRRFVPHHLRKCSTFELLTAVLWRCRTMSLKPDPEEEVRALCIVNARSRF-NPPLP  303

Query  631   NGYYGNAFVYPGAKSTAGKVSKSPLSHALELVTNIKSSFTEEYIKSVADLMILKGRPTFT  452
              GYYGNAF +P A +TA K+SK+PL +ALELV   KS  TEEY+KSVADLM+LKGRP FT
Sbjct  304   TGYYGNAFAFPVAVTTAAKLSKNPLGYALELVKKTKSDVTEEYMKSVADLMVLKGRPHFT  363

Query  451   LQGTFIVSDVTRVGFPEIDMGWGQSVFggpahggvggipGLITFYIPYEDNKGDHGILVP  272
             +  TF+VSDVTR GF E+D GWG++V+GGPA GGVG IPG+ +FYIP+++ KG++GI+VP
Sbjct  364   VVRTFLVSDVTRGGFGEVDFGWGKAVYGGPAKGGVGAIPGVASFYIPFKNKKGENGIVVP  423

Query  271   MCLPAIAMGKFVKELENCL  215
             +CLP  AM  FVKEL+  L
Sbjct  424   ICLPGFAMETFVKELDGML  442



>ref|XP_004290447.1| PREDICTED: benzyl alcohol O-benzoyltransferase-like [Fragaria 
vesca subsp. vesca]
Length=463

 Score =   591 bits (1523),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 293/447 (66%), Positives = 362/447 (81%), Gaps = 6/447 (1%)
 Frame = -1

Query  1549  MASQP-SIAFTVTRQNPELVAPADPTPREIKYLSDIDDQQGLRFQIPVIHFYRNEPSMSG  1373
             MAS P S+ F V R+ PELV+PA PTPRE+K+LSDIDDQ+GLRFQIPVI FYR +PSM G
Sbjct  1     MASPPTSLVFNVQRRQPELVSPAKPTPRELKHLSDIDDQEGLRFQIPVIQFYRYDPSMKG  60

Query  1372  KDPVQVIRQALAKALVFFYPFAGRLREGPGRKLMVDCTGEGVMFIEADADATLQHFAVGG  1193
             KD V+VIR+A+++ALVF+YPFAGRLREGPGRKLMVDCTGEG++FIEADAD TL+ F  G 
Sbjct  61    KDCVKVIREAISQALVFYYPFAGRLREGPGRKLMVDCTGEGILFIEADADVTLRQF--GD  118

Query  1192  ELKPPFPCFDQLLYNVPGSAEILNCPLFLIQVTRLRCGGFIFALRLNHSMSDACGLVHFL  1013
              L+PPFPC ++LLYNVPGS  +LN PL LIQVTRL+CGGFIFALRLNH+MSDA GLV F+
Sbjct  119   ALQPPFPCLEELLYNVPGSDGVLNSPLLLIQVTRLKCGGFIFALRLNHTMSDAAGLVQFM  178

Query  1012  NTIAEIARGAEAPSVYPVWQREFFDARNPPRITCTHFEYEEEPAADSMVTNIPLDNLVHR  833
               + E ARGA  PS+ PVW RE F+ARNPPR+TCTH EY++ P  D+  T IPLD++ HR
Sbjct  179   TAVGEAARGARVPSILPVWAREAFNARNPPRVTCTHHEYDDVP--DTHGTLIPLDDMAHR  236

Query  832   SFFFGPTEISALRSSLPPHLLKCSRFEVVTACLWRCRTIAME-FDPNDEVRIFGTVNARP  656
             SFFF PTEISA+R  LP HL KCS FE++TA LWRCRTIA+E  DP  EVR+   VNAR 
Sbjct  237   SFFFRPTEISAIRRFLPDHLRKCSTFEILTAALWRCRTIALEPKDPEQEVRVLCIVNARS  296

Query  655   RLKNPPVPNGYYGNAFVYPGAKSTAGKVSKSPLSHALELVTNIKSSFTEEYIKSVADLMI  476
             ++ NPP+P G+YGNAF +P A +TA K+ K+PL  ALELV + K+  TEEY++S+ADLM+
Sbjct  297   KIVNPPLPTGFYGNAFAFPVALTTAAKLCKNPLGFALELVKSAKADVTEEYMQSLADLMV  356

Query  475   LKGRPTFTLQGTFIVSDVTRVGFPEIDMGWGQSVFggpahggvggipGLITFYIPYEDNK  296
             ++GRP FT+ GT++VSDVTR GF ++D GWG++ +GGPA GGVG IPG+ +FYIP+ DN 
Sbjct  357   IRGRPHFTVVGTYLVSDVTRAGFGDVDFGWGKAAYGGPAKGGVGAIPGVASFYIPFRDNN  416

Query  295   GDHGILVPMCLPAIAMGKFVKELENCL  215
             G+ GI+VP+CLPA AM +FVKEL+  L
Sbjct  417   GEDGIVVPVCLPAPAMERFVKELDGML  443



>emb|CAA64636.1| hsr201 [Nicotiana tabacum]
Length=460

 Score =   588 bits (1517),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 290/439 (66%), Positives = 356/439 (81%), Gaps = 5/439 (1%)
 Frame = -1

Query  1531  IAFTVTRQNPELVAPADPTPREIKYLSDIDDQQGLRFQIPVIHFYRNEPSMSGKDPVQVI  1352
             + FTV RQ PEL+APA PTPRE K+LSDIDDQ+GLRFQIPVI FY  + SM  KDPV+VI
Sbjct  9     LVFTVRRQKPELIAPAKPTPRETKFLSDIDDQEGLRFQIPVIQFYHKDSSMGRKDPVKVI  68

Query  1351  RQALAKALVFFYPFAGRLREGPGRKLMVDCTGEGVMFIEADADATLQHFAVGGELKPPFP  1172
             ++A+A+ LVF+YPFAGRLREG GRKLMVDCTGEG+MF+EADAD TL+ F  G EL+PPFP
Sbjct  69    KKAIAETLVFYYPFAGRLREGNGRKLMVDCTGEGIMFVEADADVTLEQF--GDELQPPFP  126

Query  1171  CFDQLLYNVPGSAEILNCPLFLIQVTRLRCGGFIFALRLNHSMSDACGLVHFLNTIAEIA  992
             C ++LLY+VP SA +LNCPL LIQVTRLRCGGFIFALRLNH+MSDA GLV F+  + E+A
Sbjct  127   CLEELLYDVPDSAGVLNCPLLLIQVTRLRCGGFIFALRLNHTMSDAPGLVQFMTAVGEMA  186

Query  991   RGAEAPSVYPVWQREFFDARNPPRITCTHFEYEEEPAADSMVTNIPLDNLVHRSFFFGPT  812
             RG  APS+ PVW RE  +ARNPP++TCTH EY+E    D+  T IPLD++VH+SFFFGP+
Sbjct  187   RGGSAPSILPVWCRELLNARNPPQVTCTHHEYDE--VRDTKGTIIPLDDMVHKSFFFGPS  244

Query  811   EISALRSSLPPHLLKCSRFEVVTACLWRCRTIAMEFDPNDEVRIFGTVNARPRLKNPPVP  632
             E+SALR  +P HL KCS FE++TA LWRCRT++++ DP +EVR    VNAR R  NPP+P
Sbjct  245   EVSALRRFVPHHLRKCSTFELLTAVLWRCRTMSLKPDPEEEVRALCIVNARSRF-NPPLP  303

Query  631   NGYYGNAFVYPGAKSTAGKVSKSPLSHALELVTNIKSSFTEEYIKSVADLMILKGRPTFT  452
              GYYGNAF +P A +TA K+SK+PL +ALELV   KS  TEEY+KSVADLM+LKGRP FT
Sbjct  304   TGYYGNAFAFPVAVTTAAKLSKNPLGYALELVKKTKSDVTEEYMKSVADLMVLKGRPHFT  363

Query  451   LQGTFIVSDVTRVGFPEIDMGWGQSVFggpahggvggipGLITFYIPYEDNKGDHGILVP  272
             +  TF+VSDVTR GF E+D GWG++V+GGPA GGVG IPG+ +FYIP+++ KG++GI+VP
Sbjct  364   VVRTFLVSDVTRGGFGEVDFGWGKAVYGGPAKGGVGAIPGVASFYIPFKNKKGENGIVVP  423

Query  271   MCLPAIAMGKFVKELENCL  215
             +CLP  AM  FVKEL+  L
Sbjct  424   ICLPGFAMETFVKELDGML  442



>ref|XP_009803456.1| PREDICTED: benzyl alcohol O-benzoyltransferase-like isoform X1 
[Nicotiana sylvestris]
Length=462

 Score =   588 bits (1516),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 288/440 (65%), Positives = 358/440 (81%), Gaps = 5/440 (1%)
 Frame = -1

Query  1531  IAFTVTRQNPELVAPADPTPREIKYLSDIDDQQGLRFQIPVIHFYRNEPSMSGKDPVQVI  1352
             + FTV RQ PEL+AP  PTPRE K+LSDIDDQ+G+RFQIPVI FY    SM GKDPV VI
Sbjct  9     LVFTVRRQKPELIAPEKPTPRETKFLSDIDDQEGMRFQIPVIQFYSKNSSMEGKDPVNVI  68

Query  1351  RQALAKALVFFYPFAGRLREGPGRKLMVDCTGEGVMFIEADADATLQHFAVGGELKPPFP  1172
             ++A+A+ LVF+YPFAGRLREG GRKLMVDCTGEG+MF+EADAD TL+ F  G EL+PPFP
Sbjct  69    KKAIAETLVFYYPFAGRLREGTGRKLMVDCTGEGIMFVEADADVTLEEF--GDELQPPFP  126

Query  1171  CFDQLLYNVPGSAEILNCPLFLIQVTRLRCGGFIFALRLNHSMSDACGLVHFLNTIAEIA  992
             C D+LL++VP SA +LNCPL LIQVTRL CGGFIF+LRLNH+MSDA GLV F+  + E+A
Sbjct  127   CLDELLFDVPHSAGVLNCPLLLIQVTRLICGGFIFSLRLNHTMSDAPGLVQFMTAVGEMA  186

Query  991   RGAEAPSVYPVWQREFFDARNPPRITCTHFEYEEEPAADSMVTNIPLDNLVHRSFFFGPT  812
             RGA APSV PVW RE  +ARNPP++TCTH EY+E P  D+  T IPLD++VH+SFFFGP+
Sbjct  187   RGASAPSVLPVWCRELLNARNPPQVTCTHHEYDEVP--DTKDTIIPLDDMVHKSFFFGPS  244

Query  811   EISALRSSLPPHLLKCSRFEVVTACLWRCRTIAMEFDPNDEVRIFGTVNARPRLK-NPPV  635
             E+SALR  +P HL KCS FE++TA LWRCRT++++ DP +EVRI   VNAR   + NPP+
Sbjct  245   EVSALRRFVPYHLRKCSTFELLTAVLWRCRTMSLKPDPEEEVRILCIVNARSNARFNPPL  304

Query  634   PNGYYGNAFVYPGAKSTAGKVSKSPLSHALELVTNIKSSFTEEYIKSVADLMILKGRPTF  455
             P GYYGNAFV+P A +TA K+SK+PL++ALELV   K+  TEEY+KSVADLM+LKGRP F
Sbjct  305   PTGYYGNAFVFPVAVTTAAKLSKNPLAYALELVKKTKTDVTEEYMKSVADLMVLKGRPHF  364

Query  454   TLQGTFIVSDVTRVGFPEIDMGWGQSVFggpahggvggipGLITFYIPYEDNKGDHGILV  275
             T+  T++VSDVTR GF E+D GWG++V+GGPA GGVG IPG+ +FYIP+++ KG++GI+V
Sbjct  365   TVVRTYLVSDVTRAGFREVDFGWGKAVYGGPAKGGVGAIPGVASFYIPFKNKKGENGIVV  424

Query  274   PMCLPAIAMGKFVKELENCL  215
             P+CLP  AM  F+KEL+  L
Sbjct  425   PICLPGFAMETFIKELDGML  444



>ref|XP_009804829.1| PREDICTED: benzyl alcohol O-benzoyltransferase [Nicotiana sylvestris]
Length=460

 Score =   587 bits (1514),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 289/440 (66%), Positives = 356/440 (81%), Gaps = 5/440 (1%)
 Frame = -1

Query  1534  SIAFTVTRQNPELVAPADPTPREIKYLSDIDDQQGLRFQIPVIHFYRNEPSMSGKDPVQV  1355
              + FTV RQNPEL+APA PTPRE K+LSDIDDQ+GLRFQIPVI FY    SM GKDPV +
Sbjct  8     KLVFTVRRQNPELIAPAKPTPRETKFLSDIDDQEGLRFQIPVIQFYSKNSSMEGKDPVNI  67

Query  1354  IRQALAKALVFFYPFAGRLREGPGRKLMVDCTGEGVMFIEADADATLQHFAVGGELKPPF  1175
             I++A+A+ LVF+YPFAGRLREG GRKLMVDCTGEG+MF+EADAD TL+ F  G EL+PPF
Sbjct  68    IKKAIAETLVFYYPFAGRLREGNGRKLMVDCTGEGIMFVEADADVTLEEF--GDELQPPF  125

Query  1174  PCFDQLLYNVPGSAEILNCPLFLIQVTRLRCGGFIFALRLNHSMSDACGLVHFLNTIAEI  995
             PC ++LLY+VP SA +L+CPL LIQVTRLRCGGFIFALRLNH+MSDA GLV F+  + EI
Sbjct  126   PCLEELLYDVPNSAGVLHCPLLLIQVTRLRCGGFIFALRLNHTMSDAPGLVQFMTAVGEI  185

Query  994   ARGAEAPSVYPVWQREFFDARNPPRITCTHFEYEEEPAADSMVTNIPLDNLVHRSFFFGP  815
             A GA APSV PVW RE  +ARNPP++TCTH EY+E P  D+  T IPLD++VH+SFFFGP
Sbjct  186   ACGASAPSVLPVWCRELLNARNPPQVTCTHHEYDEVP--DTKGTIIPLDDMVHKSFFFGP  243

Query  814   TEISALRSSLPPHLLKCSRFEVVTACLWRCRTIAMEFDPNDEVRIFGTVNARPRLKNPPV  635
              E+SALR  +P HL KCS FE++TA LWRCRT++++ DP +EVR+   VNAR R  NPP+
Sbjct  244   AEVSALRRFVPHHLRKCSTFELLTAVLWRCRTMSLKPDPEEEVRVLCIVNARSRF-NPPL  302

Query  634   PNGYYGNAFVYPGAKSTAGKVSKSPLSHALELVTNIKSSFTEEYIKSVADLMILKGRPTF  455
             P GYYGNAF +P A +TA K+ K+PL +ALELV   K+  TEEY+KSVADLM+LKGRP F
Sbjct  303   PTGYYGNAFAFPVAVTTAAKLRKNPLGYALELVKKTKTDVTEEYMKSVADLMVLKGRPHF  362

Query  454   TLQGTFIVSDVTRVGFPEIDMGWGQSVFggpahggvggipGLITFYIPYEDNKGDHGILV  275
             T+  T++VSDVTR GF E+D GWG++V+GGPA GGVG IPG+ +FYIP+++ KG++GI+V
Sbjct  363   TVVRTYLVSDVTRGGFGEVDFGWGKAVYGGPAKGGVGAIPGVASFYIPFKNKKGENGIVV  422

Query  274   PMCLPAIAMGKFVKELENCL  215
             P+CLP  AM  F+KEL+  L
Sbjct  423   PICLPGFAMETFIKELDGML  442



>ref|XP_009619718.1| PREDICTED: benzyl alcohol O-benzoyltransferase [Nicotiana tomentosiformis]
Length=460

 Score =   586 bits (1510),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 289/439 (66%), Positives = 356/439 (81%), Gaps = 5/439 (1%)
 Frame = -1

Query  1531  IAFTVTRQNPELVAPADPTPREIKYLSDIDDQQGLRFQIPVIHFYRNEPSMSGKDPVQVI  1352
             + FTV RQ PEL+APA PTPRE K+LSD DDQ+GLRFQIPVI FY  + SM  KDPV+VI
Sbjct  9     LVFTVRRQKPELIAPAKPTPRETKFLSDTDDQEGLRFQIPVIQFYHKDSSMGRKDPVKVI  68

Query  1351  RQALAKALVFFYPFAGRLREGPGRKLMVDCTGEGVMFIEADADATLQHFAVGGELKPPFP  1172
             ++A+A+ LVF+YPFAGRLREG GRKLMVDCTGEG++F+EADAD TL+ F  G EL+PPFP
Sbjct  69    KKAIAETLVFYYPFAGRLREGNGRKLMVDCTGEGIIFVEADADVTLEQF--GDELQPPFP  126

Query  1171  CFDQLLYNVPGSAEILNCPLFLIQVTRLRCGGFIFALRLNHSMSDACGLVHFLNTIAEIA  992
             C ++LLY+VP SA +LNCPL LIQVTRLRCGGFIFALRLNH+MSDA GLV F+  + E+A
Sbjct  127   CLEELLYDVPDSAGVLNCPLLLIQVTRLRCGGFIFALRLNHTMSDAPGLVQFMTAVGEMA  186

Query  991   RGAEAPSVYPVWQREFFDARNPPRITCTHFEYEEEPAADSMVTNIPLDNLVHRSFFFGPT  812
             RGA APS+ PVW RE  +ARNPP++TCTH EY+E    D+  T IPLD++VH+SFFFGP+
Sbjct  187   RGASAPSILPVWCRELLNARNPPQVTCTHHEYDE--VRDTKGTIIPLDDMVHKSFFFGPS  244

Query  811   EISALRSSLPPHLLKCSRFEVVTACLWRCRTIAMEFDPNDEVRIFGTVNARPRLKNPPVP  632
             E+SALR  +P HL KCS FE++TA LWRCRT++++ DP +EVR    VNAR R  NPP+P
Sbjct  245   EVSALRRFVPHHLRKCSTFELLTAVLWRCRTMSLKPDPEEEVRALCIVNARSRF-NPPLP  303

Query  631   NGYYGNAFVYPGAKSTAGKVSKSPLSHALELVTNIKSSFTEEYIKSVADLMILKGRPTFT  452
              GYYGNAF +P A +TA K+SK+PL +ALELV   KS  TEEY+KSVADLM+LKGRP FT
Sbjct  304   TGYYGNAFAFPVAVTTAAKLSKNPLGYALELVKKTKSDVTEEYMKSVADLMVLKGRPHFT  363

Query  451   LQGTFIVSDVTRVGFPEIDMGWGQSVFggpahggvggipGLITFYIPYEDNKGDHGILVP  272
             +  TF+VSDVTR GF E+D GWG++V+GGPA GGVG IPG+ +FYIP+++ KG++GI+VP
Sbjct  364   VVRTFLVSDVTRGGFGEVDFGWGKAVYGGPAKGGVGAIPGVASFYIPFKNKKGENGIVVP  423

Query  271   MCLPAIAMGKFVKELENCL  215
             +CLP  AM  FVKEL+  L
Sbjct  424   ICLPGFAMETFVKELDGML  442



>emb|CDP21409.1| unnamed protein product [Coffea canephora]
Length=456

 Score =   580 bits (1496),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 292/443 (66%), Positives = 357/443 (81%), Gaps = 8/443 (2%)
 Frame = -1

Query  1534  SIAFTVTRQNPELVAPADPTPREIKYLSDIDDQQGLRFQIPVIHFYRNEPSMSGKDPVQV  1355
             S+ F VTRQ PELV PA  TPRE K LSDIDDQ+GLRFQIPVI FYR++     +DPV+V
Sbjct  5     SLTFRVTRQKPELVRPAKSTPRECKLLSDIDDQEGLRFQIPVIQFYRSDDGR--RDPVKV  62

Query  1354  IRQALAKALVFFYPFAGRLREGPGRKLMVDCTGEGVMFIEADADATLQHFAVGGELKPPF  1175
             IR+A+AKALVF+YPFAGRLRE  GRKL+VDCTGEGVMFIEADA+ TL+ F  G EL+PPF
Sbjct  63    IREAIAKALVFYYPFAGRLRECAGRKLVVDCTGEGVMFIEADAEVTLEQF--GEELQPPF  120

Query  1174  PCFDQLLYNVPGSAEILNCPLFLIQVTRLRCGGFIFALRLNHSMSDACGLVHFLNTIAEI  995
             PC ++LLY+VP SA +L+CPL LIQVTRLRCGGFIFALRLNH+MSDA GLV F+N + EI
Sbjct  121   PCLEELLYDVPESAGVLHCPLLLIQVTRLRCGGFIFALRLNHTMSDAAGLVQFMNAVGEI  180

Query  994   ARGAEAPSVYPVWQREFFDARNPPRITCTHFEYEEEPAADSMVTNIPLDNLVHRSFFFGP  815
             ARGA APSV PVWQRE  +AR+PPR+TCTH EY+E   AD+  T IPLD++VHRSFFFGP
Sbjct  181   ARGASAPSVLPVWQRELLNARDPPRVTCTHHEYDE--VADTKGTIIPLDDMVHRSFFFGP  238

Query  814   TEISALRSSLPPHL-LKCSRFEVVTACLWRCRTIAMEFDPNDEVRIFGTVNARPRLKNPP  638
             TE+SALR S+P  +  KCS FE++TACLWRCRTIA++ +PN+EVR+   VNAR +  +PP
Sbjct  239   TEVSALRKSIPLDISRKCSTFEILTACLWRCRTIALQPEPNEEVRVLCIVNARSKF-DPP  297

Query  637   VPNGYYGNAFVYPGAKSTAGKVSKSPLSHALELVTNIKSSFTEEYIKSVADLMILKGRPT  458
             +P GYYGNAF +P A +TAG++ K PL +ALELV   K   TE+Y+KSVADLM++KGRP 
Sbjct  298   LPQGYYGNAFAFPVALTTAGELCKRPLGYALELVNKSKCDVTEDYMKSVADLMVIKGRPH  357

Query  457   FTLQGTFIVSDVTRVGFPEIDMGWGQSVFggpahggvggipGLITFYIPYEDNKGDHGIL  278
             FT+  T++VSDVTR GF E+D GWG+  +GGPA GGVG IPG+ +FYIP+++  G+ GI+
Sbjct  358   FTVVRTYLVSDVTRAGFNEVDFGWGKPAYGGPAKGGVGAIPGVASFYIPFKNKNGEKGIV  417

Query  277   VPMCLPAIAMGKFVKELENCLMK  209
             VP+CLP  AM  FV+ELEN L K
Sbjct  418   VPICLPGFAMDAFVRELENLLSK  440



>ref|XP_004243496.2| PREDICTED: benzyl alcohol O-benzoyltransferase [Solanum lycopersicum]
Length=485

 Score =   581 bits (1498),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 286/468 (61%), Positives = 364/468 (78%), Gaps = 8/468 (2%)
 Frame = -1

Query  1609  TKTKNTRITLLYLIMALSPFMASQPSIAFTVTRQNPELVAPADPTPREIKYLSDIDDQQG  1430
             T T     + L+    +     S   + FTV RQN EL+APA PTPRE K+LSDIDDQ+G
Sbjct  3     TNTNPKSSSYLHFYSIMDSIKPSSSQLVFTVRRQNAELIAPAKPTPRETKFLSDIDDQEG  62

Query  1429  LRFQIPVIHFYRNEPSMS---GKDPVQVIRQALAKALVFFYPFAGRLREGPGRKLMVDCT  1259
             LRFQIPVI+FYR +  +S     DPV+VI++A+A+ LVF+YPFAGRLREG GRKLMVDCT
Sbjct  63    LRFQIPVINFYRKDSDISTGGNHDPVKVIKKAIAETLVFYYPFAGRLREGNGRKLMVDCT  122

Query  1258  GEGVMFIEADADATLQHFAVGGELKPPFPCFDQLLYNVPGSAEILNCPLFLIQVTRLRCG  1079
             GEGVMF+EADAD TL+ F  G EL+PPFPC ++LLY+VPGSAE+LN PL LIQVTRL+CG
Sbjct  123   GEGVMFVEADADVTLEQF--GDELQPPFPCLEELLYDVPGSAEVLNSPLLLIQVTRLKCG  180

Query  1078  GFIFALRLNHSMSDACGLVHFLNTIAEIARGAEAPSVYPVWQREFFDARNPPRITCTHFE  899
             GFIFA+RLNH+MSDA GLV F+  + E+ARGA  PS  PVW RE  ++R+PPR+TCTH E
Sbjct  181   GFIFAVRLNHTMSDAAGLVQFMTAVGEMARGASVPSTLPVWSRELLNSRDPPRVTCTHHE  240

Query  898   YEEEPAADSMVTNIPLDNLVHRSFFFGPTEISALRSSLPPHLLKCSRFEVVTACLWRCRT  719
             Y+E P  D+  T IPLD++VH+SFFFGP+++SALR  +PPHL K S FE++T+ LWRCRT
Sbjct  241   YDEVP--DTKGTIIPLDDMVHKSFFFGPSQVSALRRFIPPHLRKSSTFELLTSVLWRCRT  298

Query  718   IAMEFDPNDEVRIFGTVNARPRLKNPPVPNGYYGNAFVYPGAKSTAGKVSKSPLSHALEL  539
             I+++ DP +EVR+   VNAR +  NPP+PNG+YGNAF +P A +TA K+ K+PL +ALEL
Sbjct  299   ISLKPDPEEEVRVLCLVNARSKF-NPPLPNGFYGNAFAFPVAVTTAAKLCKNPLGYALEL  357

Query  538   VTNIKSSFTEEYIKSVADLMILKGRPTFTLQGTFIVSDVTRVGFPEIDMGWGQSVFggpa  359
             V   KS  TEEY+KSVADLM++KGRP FT+  T++VSDVTR GF E+D GWG++ +GGPA
Sbjct  358   VKKAKSDVTEEYMKSVADLMVMKGRPHFTVVRTYLVSDVTRAGFGEVDFGWGKAAYGGPA  417

Query  358   hggvggipGLITFYIPYEDNKGDHGILVPMCLPAIAMGKFVKELENCL  215
              GGVG IPG+ +FYIP+++  G++GI+VP+CLPA AM  FV+EL   L
Sbjct  418   KGGVGAIPGVASFYIPFKNKNGENGIVVPVCLPAFAMEIFVRELNGML  465



>gb|ACJ85557.1| unknown [Medicago truncatula]
Length=459

 Score =   579 bits (1492),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 280/440 (64%), Positives = 359/440 (82%), Gaps = 5/440 (1%)
 Frame = -1

Query  1534  SIAFTVTRQNPELVAPADPTPREIKYLSDIDDQQGLRFQIPVIHFYRNEPSMSGKDPVQV  1355
             S+ FTV R  PE V P+ PTP EIK LSDIDDQ+GLRFQIPVI FY+ +P+M+GKDPV +
Sbjct  4     SLLFTVKRSAPEFVRPSKPTPHEIKLLSDIDDQEGLRFQIPVIQFYKYDPNMAGKDPVDI  63

Query  1354  IRQALAKALVFFYPFAGRLREGPGRKLMVDCTGEGVMFIEADADATLQHFAVGGELKPPF  1175
             IR+A AK LVF+YPFAGRLREGPGRKLMVDCTGEGV+FIEADAD +L+ F  G  L+PPF
Sbjct  64    IRKASAKTLVFYYPFAGRLREGPGRKLMVDCTGEGVLFIEADADVSLKEF--GDALQPPF  121

Query  1174  PCFDQLLYNVPGSAEILNCPLFLIQVTRLRCGGFIFALRLNHSMSDACGLVHFLNTIAEI  995
             PC D+LL++VPGS+E+LNCPL +IQVTRL+CGGFIFALRLNH+MSDA GLV F++ + EI
Sbjct  122   PCLDELLFDVPGSSEVLNCPLLVIQVTRLKCGGFIFALRLNHTMSDAAGLVQFMSALGEI  181

Query  994   ARGAEAPSVYPVWQREFFDARNPPRITCTHFEYEEEPAADSMVTNIPLDNLVHRSFFFGP  815
             + G   PS+ PVW RE  ++R+PPR+TCTH EYE+ P  D+  T IPLD++ HRSFFFGP
Sbjct  182   SCGMNEPSILPVWHRELLNSRDPPRVTCTHREYEQVP--DTKGTIIPLDDMAHRSFFFGP  239

Query  814   TEISALRSSLPPHLLKCSRFEVVTACLWRCRTIAMEFDPNDEVRIFGTVNARPRLKNPPV  635
             TE++ +R+ LPPH  K S FE++TACLWRCRTIA++ D ++EVRI   VNAR +  NPP+
Sbjct  240   TEVAKIRALLPPHQQKQSNFEILTACLWRCRTIALQPDTDEEVRIICIVNARGKF-NPPL  298

Query  634   PNGYYGNAFVYPGAKSTAGKVSKSPLSHALELVTNIKSSFTEEYIKSVADLMILKGRPTF  455
             PNGYYGNAF +P A +TAGK+ ++PL +ALELV   KS  T+EY+ SVADLM++KGRP F
Sbjct  299   PNGYYGNAFAFPVAVTTAGKLMENPLGYALELVKKAKSDVTQEYMHSVADLMVIKGRPHF  358

Query  454   TLQGTFIVSDVTRVGFPEIDMGWGQSVFggpahggvggipGLITFYIPYEDNKGDHGILV  275
             T+  +++VSDVTR GF +++ GWG++V+GGPA GGVG IPG+ +FYIP+++ KG+ G+++
Sbjct  359   TVVRSYLVSDVTRAGFGDVEFGWGKAVYGGPAKGGVGAIPGVASFYIPFKNAKGEEGLVI  418

Query  274   PMCLPAIAMGKFVKELENCL  215
             P+CLPA AM KFVKEL++ L
Sbjct  419   PLCLPAQAMEKFVKELDSVL  438



>ref|XP_009372579.1| PREDICTED: benzyl alcohol O-benzoyltransferase-like [Pyrus x 
bretschneideri]
Length=461

 Score =   579 bits (1492),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 287/446 (64%), Positives = 355/446 (80%), Gaps = 6/446 (1%)
 Frame = -1

Query  1549  MASQP-SIAFTVTRQNPELVAPADPTPREIKYLSDIDDQQGLRFQIPVIHFYRNEPSMSG  1373
             MAS P S+ FTV R+ PELVAPA  TP E + LSDIDDQ+GLRFQIPVI FY+ +PSM G
Sbjct  1     MASSPISLVFTVQRRQPELVAPAKATPYEFRQLSDIDDQEGLRFQIPVIQFYKYDPSMQG  60

Query  1372  KDPVQVIRQALAKALVFFYPFAGRLREGPGRKLMVDCTGEGVMFIEADADATLQHFAVGG  1193
             +DPV V+R+A+A+ LVF+YPFAGRLREGP RKL V+CT EGVMFIEADAD TL+ F  G 
Sbjct  61    RDPVHVLREAIAQTLVFYYPFAGRLREGPDRKLTVECTAEGVMFIEADADVTLEQF--GD  118

Query  1192  ELKPPFPCFDQLLYNVPGSAEILNCPLFLIQVTRLRCGGFIFALRLNHSMSDACGLVHFL  1013
              L+PPFPC ++LLYNVPGS  +LNCPL LIQVTRL+CGGFI ALRLNH+MSDA GLV F+
Sbjct  119   ALQPPFPCLEELLYNVPGSDGVLNCPLLLIQVTRLQCGGFIVALRLNHTMSDAAGLVQFM  178

Query  1012  NTIAEIARGAEAPSVYPVWQREFFDARNPPRITCTHFEYEEEPAADSMVTNIPLDNLVHR  833
               + EIARGA +P+V PVWQR   +AR PPR+TCTH EYEE    D+  T IPLD++VHR
Sbjct  179   TALGEIARGAVSPTVQPVWQRALLNARYPPRVTCTHREYEE--VEDTKGTIIPLDDMVHR  236

Query  832   SFFFGPTEISALRSSLPPHLLKCSRFEVVTACLWRCRTIAMEFDPNDEVRIFGTVNARPR  653
             SFFF PTE+SA+R  +P  L KCS FEV+TACLWRCRTIA++ DPN+EVR+   VN+R +
Sbjct  237   SFFFRPTEVSAIRRFVPQFLSKCSTFEVLTACLWRCRTIALQKDPNEEVRVLCIVNSRSK  296

Query  652   LKNPPVPNGYYGNAFVYPGAKSTAGKVSKSPLSHALELVTNIKSSFTEEYIKSVADLMIL  473
               NPP+P GYYGNAF +P A +TAG++  +PL +ALELV   K+  TEEY++S+ADLM++
Sbjct  297   F-NPPLPVGYYGNAFAFPVAVTTAGRLCNNPLGYALELVRKAKADVTEEYMRSLADLMVI  355

Query  472   KGRPTFTLQGTFIVSDVTRVGFPEIDMGWGQSVFggpahggvggipGLITFYIPYEDNKG  293
             KGRP FT+  +++VSDVTR GF E+D GWG++ +GGPA GGVG IPG+ +FYIP+ DN+G
Sbjct  356   KGRPHFTVVNSYLVSDVTRAGFGEVDFGWGKAAYGGPAKGGVGAIPGVASFYIPFRDNRG  415

Query  292   DHGILVPMCLPAIAMGKFVKELENCL  215
             + GI+VP+CLPA AM  FVKEL+  L
Sbjct  416   EDGIVVPICLPAAAMEIFVKELDAML  441



>ref|XP_008232530.1| PREDICTED: benzyl alcohol O-benzoyltransferase [Prunus mume]
Length=461

 Score =   578 bits (1491),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 283/440 (64%), Positives = 349/440 (79%), Gaps = 5/440 (1%)
 Frame = -1

Query  1534  SIAFTVTRQNPELVAPADPTPREIKYLSDIDDQQGLRFQIPVIHFYRNEPSMSGKDPVQV  1355
             S+ FTV R+ PELVAPA  TP E + LSDIDDQ+GLRFQIPVI FYR +PSM G DPV V
Sbjct  7     SLVFTVRRRQPELVAPAKATPHEFQQLSDIDDQEGLRFQIPVIQFYRYDPSMQGSDPVTV  66

Query  1354  IRQALAKALVFFYPFAGRLREGPGRKLMVDCTGEGVMFIEADADATLQHFAVGGELKPPF  1175
             IR+A+A+ LVF+YPFAGRLREGP RKLMVDCT EG++FIEADAD TLQ F  G  L+PPF
Sbjct  67    IREAIAETLVFYYPFAGRLREGPARKLMVDCTAEGILFIEADADVTLQQF--GDALQPPF  124

Query  1174  PCFDQLLYNVPGSAEILNCPLFLIQVTRLRCGGFIFALRLNHSMSDACGLVHFLNTIAEI  995
             PC ++LLYNVPGS  +LNCPL LIQVTRL+CGGFIFALRLNH+MSDA GLV F+  + E+
Sbjct  125   PCLEELLYNVPGSDGVLNCPLLLIQVTRLKCGGFIFALRLNHTMSDAAGLVQFMMAVGEM  184

Query  994   ARGAEAPSVYPVWQREFFDARNPPRITCTHFEYEEEPAADSMVTNIPLDNLVHRSFFFGP  815
             ARGA  PS  PVW+RE   AR+PPR+TC H EY+E   AD+  T IPLD++ HRSFFF P
Sbjct  185   ARGARVPSFQPVWKRELLKARDPPRVTCAHHEYDE--VADTKGTIIPLDDMAHRSFFFRP  242

Query  814   TEISALRSSLPPHLLKCSRFEVVTACLWRCRTIAMEFDPNDEVRIFGTVNARPRLKNPPV  635
              E+SA+R  +P HL KCS FEV+TACLWRCRTIA++ DP +EVR+   VNAR +  NP +
Sbjct  243   IEMSAIRRFVPQHLSKCSTFEVLTACLWRCRTIALQPDPEEEVRVLCIVNARAKF-NPAL  301

Query  634   PNGYYGNAFVYPGAKSTAGKVSKSPLSHALELVTNIKSSFTEEYIKSVADLMILKGRPTF  455
             P GYYGNAF +P A +TAG++ ++PL +ALELV   K+  TEEY++S+ADLM+++GRP F
Sbjct  302   PLGYYGNAFAFPVALTTAGRLCQNPLGYALELVKQAKADVTEEYMRSLADLMVIRGRPHF  361

Query  454   TLQGTFIVSDVTRVGFPEIDMGWGQSVFggpahggvggipGLITFYIPYEDNKGDHGILV  275
             T+ GT++VSDVTR GF E+D GWG++ +GGPA GGVG IPG+ +FYIP++DN G  GI+V
Sbjct  362   TVVGTYLVSDVTRAGFGEVDFGWGKAAYGGPAKGGVGAIPGVASFYIPFKDNNGQDGIVV  421

Query  274   PMCLPAIAMGKFVKELENCL  215
             P+CLPA AM +F+KEL   L
Sbjct  422   PICLPAPAMERFIKELNTML  441



>ref|XP_002325454.2| transferase family protein [Populus trichocarpa]
 gb|EEE99835.2| transferase family protein [Populus trichocarpa]
Length=460

 Score =   578 bits (1491),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 283/461 (61%), Positives = 359/461 (78%), Gaps = 6/461 (1%)
 Frame = -1

Query  1549  MASQP-SIAFTVTRQNPELVAPADPTPREIKYLSDIDDQQGLRFQIPVIHFYRNEPSMSG  1373
             MAS P S+ F V R+ PEL+ PA PTP E K LSDIDDQ+GLRF IPV+ FYRN PSM G
Sbjct  1     MASSPASLLFKVHRREPELIKPAKPTPHEFKLLSDIDDQEGLRFHIPVMQFYRNNPSMQG  60

Query  1372  KDPVQVIRQALAKALVFFYPFAGRLREGPGRKLMVDCTGEGVMFIEADADATLQHFAVGG  1193
             KDPV++IR+ALAK LVF+YPFAGRLREGP RKLMV+CTGEG++FIEADAD TL+ F  G 
Sbjct  61    KDPVKIIREALAKTLVFYYPFAGRLREGPNRKLMVECTGEGILFIEADADVTLEQF--GD  118

Query  1192  ELKPPFPCFDQLLYNVPGSAEILNCPLFLIQVTRLRCGGFIFALRLNHSMSDACGLVHFL  1013
              L+PPFPC ++LL++VPGS+ +LNCPL LIQVTRL+CGGF+FALRLNH+MSDA GLV F+
Sbjct  119   ALQPPFPCLEELLFDVPGSSGVLNCPLLLIQVTRLKCGGFLFALRLNHTMSDAVGLVQFM  178

Query  1012  NTIAEIARGAEAPSVYPVWQREFFDARNPPRITCTHFEYEEEPAADSMVTNIPLDNLVHR  833
               + E+ARGA APSV  VW+R+  +A +PPR+TCTH EYEE   AD+  T IPLD++ HR
Sbjct  179   AAVGEMARGANAPSVPAVWERQVLNASDPPRVTCTHREYEE--VADTKGTIIPLDDMAHR  236

Query  832   SFFFGPTEISALRSSLPPHLLKCSRFEVVTACLWRCRTIAMEFDPNDEVRIFGTVNARPR  653
             SFFFGP+E+SALR  +PPHL  CS FE++TACLW+CRTIA++ DP +E+RI   VNAR +
Sbjct  237   SFFFGPSEMSALRKFVPPHLSHCSTFEILTACLWKCRTIALQPDPTEEMRILCIVNAREK  296

Query  652   LKNPPVPNGYYGNAFVYPGAKSTAGKVSKSPLSHALELVTNIKSSFTEEYIKSVADLMIL  473
               NPP+P GYYGN F +P A +TA ++SK+P  +ALELV   K+  TEEY++SV+ LM++
Sbjct  297   F-NPPLPRGYYGNGFAFPVAVATAEELSKNPFGYALELVRKAKADVTEEYMRSVSSLMVI  355

Query  472   KGRPTFTLQGTFIVSDVTRVGFPEIDMGWGQSVFggpahggvggipGLITFYIPYEDNKG  293
             KGRP FT+   ++VSD+ R GF E+D GWG +++GG A GGVG IPG+ +FYIP+ + KG
Sbjct  356   KGRPHFTVVRAYLVSDLRRAGFEEVDFGWGNAIYGGAAKGGVGAIPGVASFYIPFTNKKG  415

Query  292   DHGILVPMCLPAIAMGKFVKELENCLMK**TSSSQNSMHLI  170
             ++G++VP CLPA AM +FVKEL+  L    T SSQ     I
Sbjct  416   ENGVVVPFCLPAPAMERFVKELDGMLKDDQTVSSQTKSKFI  456



>gb|AJD25145.1| benzoyl-CoA:benzyl alcohol O-benzoyltransferase [Populus trichocarpa]
Length=460

 Score =   577 bits (1488),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 282/461 (61%), Positives = 359/461 (78%), Gaps = 6/461 (1%)
 Frame = -1

Query  1549  MASQP-SIAFTVTRQNPELVAPADPTPREIKYLSDIDDQQGLRFQIPVIHFYRNEPSMSG  1373
             MAS P S+ F V R+ PEL+ PA PTP E K LSDIDDQ+GLRF IPV+ FYRN PSM G
Sbjct  1     MASSPASLLFKVHRREPELIKPAKPTPHEFKLLSDIDDQEGLRFHIPVMQFYRNNPSMQG  60

Query  1372  KDPVQVIRQALAKALVFFYPFAGRLREGPGRKLMVDCTGEGVMFIEADADATLQHFAVGG  1193
             KDPV++IR+ALAK LVF+YPFAGRLREGP RKLMV+CTGEG++FIEADAD TL+ F  G 
Sbjct  61    KDPVKIIREALAKTLVFYYPFAGRLREGPNRKLMVECTGEGILFIEADADVTLEQF--GD  118

Query  1192  ELKPPFPCFDQLLYNVPGSAEILNCPLFLIQVTRLRCGGFIFALRLNHSMSDACGLVHFL  1013
              L+PPFPC ++LL++VPGS+ +LNCPL LIQVTRL+CGGF+FALRLNH+MSDA GLV F+
Sbjct  119   ALQPPFPCLEELLFDVPGSSGVLNCPLLLIQVTRLKCGGFLFALRLNHTMSDAVGLVQFM  178

Query  1012  NTIAEIARGAEAPSVYPVWQREFFDARNPPRITCTHFEYEEEPAADSMVTNIPLDNLVHR  833
               + E+ARGA APSV  VW+R+  +A +PPR+TCTH EYEE   AD+  T IPLD++ HR
Sbjct  179   AAVGEMARGANAPSVPAVWERQVLNASDPPRVTCTHREYEE--VADTKGTIIPLDDMAHR  236

Query  832   SFFFGPTEISALRSSLPPHLLKCSRFEVVTACLWRCRTIAMEFDPNDEVRIFGTVNARPR  653
             SFFFGP+E+SALR  +PPHL  CS FE++TACLW+CRTIA++ DP +E+RI   VNAR +
Sbjct  237   SFFFGPSEMSALRKFVPPHLSHCSTFEILTACLWKCRTIALQPDPTEEMRILCIVNAREK  296

Query  652   LKNPPVPNGYYGNAFVYPGAKSTAGKVSKSPLSHALELVTNIKSSFTEEYIKSVADLMIL  473
               NPP+P GYYGN F +P A +TA ++SK+P  +ALELV   K+  TEEY++SV+ LM++
Sbjct  297   F-NPPLPRGYYGNGFAFPVAVATAEELSKNPFGYALELVRKAKADVTEEYMRSVSSLMVI  355

Query  472   KGRPTFTLQGTFIVSDVTRVGFPEIDMGWGQSVFggpahggvggipGLITFYIPYEDNKG  293
             KGRP FT+   ++VSD+ R GF E+D GWG +++GG A GGVG IPG+ +FYIP+ + KG
Sbjct  356   KGRPHFTVVRAYLVSDLRRAGFEEVDFGWGNAIYGGAAKGGVGAIPGVASFYIPFTNKKG  415

Query  292   DHGILVPMCLPAIAMGKFVKELENCLMK**TSSSQNSMHLI  170
             ++G++VP CLPA AM +FVKEL+  L    T S+Q     I
Sbjct  416   ENGVVVPFCLPAPAMERFVKELDGMLKDDQTVSAQTKSKFI  456



>ref|XP_004243495.1| PREDICTED: benzyl alcohol O-benzoyltransferase-like [Solanum 
lycopersicum]
Length=471

 Score =   577 bits (1487),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 289/451 (64%), Positives = 357/451 (79%), Gaps = 13/451 (3%)
 Frame = -1

Query  1543  SQPSIAFTVTRQNPELVAPADPTPREIKYLSDIDDQQGLRFQIPVIHFYRNEP------S  1382
             S   + FTV RQ  EL+APA PTPRE K+LSDIDDQ+GLRFQIPVI+FYR +       S
Sbjct  7     SSSQLVFTVRRQKAELIAPAKPTPRESKFLSDIDDQEGLRFQIPVINFYRKDSYSDLDSS  66

Query  1381  MSGK--DPVQVIRQALAKALVFFYPFAGRLREGPGRKLMVDCTGEGVMFIEADADATLQH  1208
             M G   +PV+VI++A+A+ALVF+YPFAGRLREG GRKLMVDC+GEGVMF+EADAD TL+ 
Sbjct  67    MGGNYNEPVKVIKKAIAEALVFYYPFAGRLREGNGRKLMVDCSGEGVMFVEADADVTLEQ  126

Query  1207  FAVGGELKPPFPCFDQLLYNVPGSAEILNCPLFLIQVTRLRCGGFIFALRLNHSMSDACG  1028
             F  G ELKPPFPC ++LLY+VPGSA +LNCPL LIQVTRL+CG FIFA+RLNH+MSDA G
Sbjct  127   F--GDELKPPFPCLEELLYDVPGSAGVLNCPLLLIQVTRLKCGSFIFAVRLNHTMSDATG  184

Query  1027  LVHFLNTIAEIARGAEAPSVYPVWQREFFDARNPPRITCTHFEYEEEPAADSMVTNIPLD  848
             LV F+  + E+ARGA APS  PVW RE  +ARNPPR+TCTH EY+E P  D+  T IPLD
Sbjct  185   LVEFMTAVGEMARGASAPSTLPVWSRELLNARNPPRVTCTHHEYDEVP--DTNGTIIPLD  242

Query  847   NLVHRSFFFGPTEISALRSSLPPHLLKCSRFEVVTACLWRCRTIAMEFDPNDEVRIFGTV  668
             ++VH+SFFFGP+E+SALR  LPPHL KCS FE++T+ +WRCRTI+++ DP +EVR+   V
Sbjct  243   DMVHKSFFFGPSEVSALRRFLPPHLRKCSTFELLTSVIWRCRTISLKPDPAEEVRVLCLV  302

Query  667   NARPRLKNPPVPNGYYGNAFVYPGAKSTAGKVSKSPLSHALELVTNIKSSFTEEYIKSVA  488
             NAR +  NPP+PNG+YGNAF +P A +TA K+ K+PL +ALELV   KS  TEEY+KSVA
Sbjct  303   NARFKF-NPPLPNGFYGNAFAFPVAVATAEKLVKNPLGYALELVKKAKSDVTEEYMKSVA  361

Query  487   DLMILKGRPTFTLQGTFIVSDVTRVGFPEIDMGWGQSVFggpahggvggipGLITFYIPY  308
             DLM++ GRP F +  TF+VSDVTR GF E+D GWG+ V+GGPA GGVG  PG+ +FYIP+
Sbjct  362   DLMVINGRPHFAVVRTFLVSDVTRAGFGEVDFGWGKPVYGGPAKGGVGPFPGMASFYIPF  421

Query  307   EDNKGDHGILVPMCLPAIAMGKFVKELENCL  215
              +  G++GI+VPMCLPA AM  FVKE+E  L
Sbjct  422   RNKNGENGIVVPMCLPAFAMEIFVKEIERML  452



>ref|XP_008359502.1| PREDICTED: benzyl alcohol O-benzoyltransferase-like [Malus domestica]
Length=461

 Score =   577 bits (1486),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 286/446 (64%), Positives = 354/446 (79%), Gaps = 6/446 (1%)
 Frame = -1

Query  1549  MASQP-SIAFTVTRQNPELVAPADPTPREIKYLSDIDDQQGLRFQIPVIHFYRNEPSMSG  1373
             M S P S+ FTV R+ PELVAPA  TP E + LSDIDDQ+GLRFQIPVI FY+ +PSM G
Sbjct  1     MXSSPNSLVFTVRRRQPELVAPAKATPHEFRQLSDIDDQEGLRFQIPVIQFYKYDPSMQG  60

Query  1372  KDPVQVIRQALAKALVFFYPFAGRLREGPGRKLMVDCTGEGVMFIEADADATLQHFAVGG  1193
             +DPV V+R+A+A+ LVF+YPFAGRLREGP RKL V+CT EGVMFIEADAD TL+ F  G 
Sbjct  61    RDPVHVLREAIAQTLVFYYPFAGRLREGPNRKLTVECTAEGVMFIEADADVTLEQF--GD  118

Query  1192  ELKPPFPCFDQLLYNVPGSAEILNCPLFLIQVTRLRCGGFIFALRLNHSMSDACGLVHFL  1013
              L+PPFPC ++LLYNV GS  +LNCPL LIQVTRL+CGGFI ALRLNH+MSDA GLV F+
Sbjct  119   ALQPPFPCLEELLYNVRGSDGVLNCPLLLIQVTRLQCGGFIVALRLNHTMSDAAGLVQFM  178

Query  1012  NTIAEIARGAEAPSVYPVWQREFFDARNPPRITCTHFEYEEEPAADSMVTNIPLDNLVHR  833
               + EIARGA +P+V PVWQRE  +AR PPR+TCTH EYEE    D+  T IPLD++VHR
Sbjct  179   TALGEIARGAVSPTVQPVWQRELLNARYPPRVTCTHREYEE--VEDTKGTIIPLDDMVHR  236

Query  832   SFFFGPTEISALRSSLPPHLLKCSRFEVVTACLWRCRTIAMEFDPNDEVRIFGTVNARPR  653
             SFFF PTE+SA+R  +P  L KCS FEV+TACLWRCRTIA++ DPN+EVR+   VNAR +
Sbjct  237   SFFFRPTEVSAIRRFVPQFLSKCSTFEVLTACLWRCRTIALQKDPNEEVRVLCIVNARSK  296

Query  652   LKNPPVPNGYYGNAFVYPGAKSTAGKVSKSPLSHALELVTNIKSSFTEEYIKSVADLMIL  473
               NPP+P GYYGNAF +P A +TAG++  +PL +ALELV   K+  TEEY++S+ADLM++
Sbjct  297   F-NPPLPVGYYGNAFAFPVAVTTAGRLCNNPLGYALELVRKAKADVTEEYMRSLADLMVI  355

Query  472   KGRPTFTLQGTFIVSDVTRVGFPEIDMGWGQSVFggpahggvggipGLITFYIPYEDNKG  293
             KGRP FT+  ++++SDVTR GF E+D GWG++ +GGPA GGVG IPG+ +FYIP+ DN+G
Sbjct  356   KGRPHFTVVNSYLMSDVTRAGFGEVDFGWGKAAYGGPAKGGVGAIPGVASFYIPFRDNRG  415

Query  292   DHGILVPMCLPAIAMGKFVKELENCL  215
             + GI+VP+CLPA AM  FVKEL+  L
Sbjct  416   EDGIVVPICLPAAAMEIFVKELDTML  441



>ref|XP_008462816.1| PREDICTED: benzyl alcohol O-benzoyltransferase-like [Cucumis 
melo]
Length=459

 Score =   576 bits (1484),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 281/445 (63%), Positives = 360/445 (81%), Gaps = 7/445 (2%)
 Frame = -1

Query  1549  MASQPSIAFTVTRQNPELVAPADPTPREIKYLSDIDDQQGLRFQIPVIHFYRNEPSMSGK  1370
             MAS  S+ F V R  P+L+ P+DPTP E K LSDIDDQ+GLRFQIPVI FYR++P M+G 
Sbjct  1     MAS--SLVFQVQRSQPQLIPPSDPTPHEFKQLSDIDDQEGLRFQIPVIQFYRHDPRMAGT  58

Query  1369  DPVQVIRQALAKALVFFYPFAGRLREGPGRKLMVDCTGEGVMFIEADADATLQHFAVGGE  1190
             DP +VI++A+AKALVF+YPFAGRLREGPGRKL V+CTGEGVMFIEADAD +L+ F  G  
Sbjct  59    DPARVIKEAIAKALVFYYPFAGRLREGPGRKLFVECTGEGVMFIEADADVSLEQF--GDA  116

Query  1189  LKPPFPCFDQLLYNVPGSAEILNCPLFLIQVTRLRCGGFIFALRLNHSMSDACGLVHFLN  1010
             L+PPFPC ++LL++VP S+ +L+CPL LIQVTRL+CGGFIFALRLNH+MSDA GLV F+ 
Sbjct  117   LQPPFPCLEELLFDVPNSSGVLDCPLLLIQVTRLKCGGFIFALRLNHTMSDASGLVQFMM  176

Query  1009  TIAEIARGAEAPSVYPVWQREFFDARNPPRITCTHFEYEEEPAADSMVTNIPLDNLVHRS  830
              + E+ARGA APSV PVWQR   +AR+PP++TC H EY+E    D+  T IPLD++ HRS
Sbjct  177   AVGEMARGATAPSVRPVWQRALLNARDPPKVTCHHREYDE--VVDTKGTIIPLDDMAHRS  234

Query  829   FFFGPTEISALRSSLPPHLLKCSRFEVVTACLWRCRTIAMEFDPNDEVRIFGTVNARPRL  650
             FFFGP+EISA+R +LP HL +CS FEV+TACLWR RTI+++ DP +EVR+   VN+R + 
Sbjct  235   FFFGPSEISAIRKALPSHLRQCSSFEVLTACLWRFRTISLQPDPEEEVRVLCIVNSRSKF  294

Query  649   KNPPVPNGYYGNAFVYPGAKSTAGKVSKSPLSHALELVTNIKSSFTEEYIKSVADLMILK  470
              NPP+P GYYGNAF +P A +TAGK+ ++PL +ALELV   K+  TE+Y+KSVADLM++K
Sbjct  295   -NPPLPTGYYGNAFAFPVALTTAGKLCQNPLGYALELVRKAKADVTEDYMKSVADLMVIK  353

Query  469   GRPTFTLQGTFIVSDVTRVGFPEIDMGWGQSVFggpahggvggipGLITFYIPYEDNKGD  290
             GRP FT+  T++VSDVTR GF ++D GWG++++GGPA GGVG IPG+ +FYIP+++ KG+
Sbjct  354   GRPHFTVVRTYLVSDVTRAGFEDVDFGWGKAMYGGPAKGGVGAIPGVASFYIPFKNKKGE  413

Query  289   HGILVPMCLPAIAMGKFVKELENCL  215
              GILVP+CLPA AM +FVKEL+  L
Sbjct  414   RGILVPLCLPAPAMERFVKELDALL  438



>gb|AFK36385.1| unknown [Medicago truncatula]
Length=459

 Score =   576 bits (1484),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 279/440 (63%), Positives = 358/440 (81%), Gaps = 5/440 (1%)
 Frame = -1

Query  1534  SIAFTVTRQNPELVAPADPTPREIKYLSDIDDQQGLRFQIPVIHFYRNEPSMSGKDPVQV  1355
             S+ FTV R  PE V P+ PTP EIK LSDIDDQ+GLRFQIPVI FY+ +P+M+GKDPV +
Sbjct  4     SLLFTVKRSAPEFVRPSKPTPHEIKLLSDIDDQEGLRFQIPVIQFYKYDPNMAGKDPVDI  63

Query  1354  IRQALAKALVFFYPFAGRLREGPGRKLMVDCTGEGVMFIEADADATLQHFAVGGELKPPF  1175
             IR+A AK LVF+YPFAGRLREGPGRKLMVDCTGEGV+FIEADAD +L+ F  G  L+PPF
Sbjct  64    IRKASAKTLVFYYPFAGRLREGPGRKLMVDCTGEGVLFIEADADVSLKEF--GDALQPPF  121

Query  1174  PCFDQLLYNVPGSAEILNCPLFLIQVTRLRCGGFIFALRLNHSMSDACGLVHFLNTIAEI  995
             PC D+LL++VPGS+E+LNCPL +IQVTRL+CGGFIFALRLNH+MSDA GLV F++ + EI
Sbjct  122   PCLDELLFDVPGSSEVLNCPLLVIQVTRLKCGGFIFALRLNHTMSDAAGLVQFMSALGEI  181

Query  994   ARGAEAPSVYPVWQREFFDARNPPRITCTHFEYEEEPAADSMVTNIPLDNLVHRSFFFGP  815
             + G   PS+ PVW RE  ++R+PPR+TCTH EYE+ P  D+  T IPLD++ HRSFFFGP
Sbjct  182   SCGMNEPSILPVWHRELLNSRDPPRVTCTHREYEQVP--DTKGTIIPLDDMAHRSFFFGP  239

Query  814   TEISALRSSLPPHLLKCSRFEVVTACLWRCRTIAMEFDPNDEVRIFGTVNARPRLKNPPV  635
             TE++ +R+ LPPH  K S FE++TACLWRCRTIA++ D ++EVRI   VNAR +  NPP+
Sbjct  240   TEVAKIRALLPPHQQKQSNFEILTACLWRCRTIALQPDTDEEVRIICIVNARGKF-NPPL  298

Query  634   PNGYYGNAFVYPGAKSTAGKVSKSPLSHALELVTNIKSSFTEEYIKSVADLMILKGRPTF  455
             PNGYYGNAF +P A +TAGK+ ++PL +ALELV   KS  T+EY+ SVADLM++KGRP F
Sbjct  299   PNGYYGNAFAFPVAVTTAGKLMENPLGYALELVKKAKSDVTQEYMHSVADLMVIKGRPHF  358

Query  454   TLQGTFIVSDVTRVGFPEIDMGWGQSVFggpahggvggipGLITFYIPYEDNKGDHGILV  275
             T+  +++V DVTR GF +++ GWG++V+GGPA GGVG IPG+ +FYIP+++ KG+ G+++
Sbjct  359   TVVRSYLVFDVTRAGFGDVEFGWGKAVYGGPAKGGVGAIPGVASFYIPFKNAKGEEGLVI  418

Query  274   PMCLPAIAMGKFVKELENCL  215
             P+CLPA AM KFVKEL++ L
Sbjct  419   PLCLPAQAMEKFVKELDSVL  438



>ref|XP_011085895.1| PREDICTED: LOW QUALITY PROTEIN: benzyl alcohol O-benzoyltransferase-like 
[Sesamum indicum]
Length=466

 Score =   576 bits (1484),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 287/450 (64%), Positives = 354/450 (79%), Gaps = 6/450 (1%)
 Frame = -1

Query  1549  MASQPSIAFTVTRQNPELVAPADPTPREIKYLSDIDDQQGLRFQIPVIHFYRNEPSMSGK  1370
             MAS  ++ F VTRQNPEL+ PA PTP E+K LSDIDDQ+GLRFQIP+I FYR  P+M+ K
Sbjct  1     MASTNALTFKVTRQNPELIPPAKPTPHELKPLSDIDDQEGLRFQIPLIQFYRRNPAMNRK  60

Query  1369  DPVQVIRQALAKALVFFYPFAGRLREGPGRKLMVDCTGEGVMFIEADADATLQHFAVGGE  1190
             DPV VIR ALA+ALVF+YPFAGRLRE  GRKL+V+CTGEGV+FIEADAD TLQ F     
Sbjct  61    DPVMVIRDALARALVFYYPFAGRLREAAGRKLVVECTGEGVLFIEADADVTLQQFGDASS  120

Query  1189  ---LKPPFPCFDQLLYNVPGSAEILNCPLFLIQVTRLRCGGFIFALRLNHSMSDACGLVH  1019
                L+PPFPC ++LLY+VP SA ++NCPL LIQVTRLRCGGFIFALRLNH+MSDA GLV 
Sbjct  121   AVPLQPPFPCLEELLYDVPESAGVVNCPLLLIQVTRLRCGGFIFALRLNHTMSDAAGLVQ  180

Query  1018  FLNTIAEIARGAEAPSVYPVWQREFFDARNPPRITCTHFEYEEEPAADSMVTNIPLDNLV  839
             F+  + E+AR AE PSV PVWQR+  +AR+PPR++CT  EY++ P  D+  T IPLD++V
Sbjct  181   FMAAVGELARAAEMPSVLPVWQRDLLNARDPPRVSCTLHEYDDVP--DTRGTLIPLDDMV  238

Query  838   HRSFFFGPTEISALRSSLPPHLLKCSRFEVVTACLWRCRTIAMEFDPNDEVRIFGTVNAR  659
             HRSFFFG  EISALR  LP HL  CS FE++TACLWRCRTIA+  DPN+EVRI   VN+R
Sbjct  239   HRSFFFGTAEISALRRRLPSHLRSCSTFEILTACLWRCRTIAISPDPNEEVRILCIVNSR  298

Query  658   PRLKNPPVPNGYYGNAFVYPGAKSTAGKVSKSPLSHALELVTNIKSSFTEEYIKSVADLM  479
              R  NPP+P GYYGNAF +  A S+A K+S++PL +ALELV   K+  TEEY+KSVADLM
Sbjct  299   KRF-NPPLPAGYYGNAFAFAVAISSAEKLSRNPLGYALELVRKTKADVTEEYMKSVADLM  357

Query  478   ILKGRPTFTLQGTFIVSDVTRVGFPEIDMGWGQSVFggpahggvggipGLITFYIPYEDN  299
             +++GRP F +  T++VSDVT  GF ++D GWG++ +GGPA GGVG IPG+ +FYIP+ +N
Sbjct  358   VIRGRPHFAVVRTYLVSDVTHAGFGDVDFGWGKAAYGGPAKGGVGAIPGVASFYIPFTNN  417

Query  298   KGDHGILVPMCLPAIAMGKFVKELENCLMK  209
             KG++GI+VP+CL A AM  FVKELE  L +
Sbjct  418   KGENGIVVPICLAANAMEVFVKELEKMLKR  447



>ref|XP_011012995.1| PREDICTED: benzyl alcohol O-benzoyltransferase-like [Populus 
euphratica]
Length=459

 Score =   573 bits (1477),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 281/461 (61%), Positives = 360/461 (78%), Gaps = 7/461 (2%)
 Frame = -1

Query  1549  MASQP-SIAFTVTRQNPELVAPADPTPREIKYLSDIDDQQGLRFQIPVIHFYRNEPSMSG  1373
             MAS P S+ F V R+ PEL+ PA PTP E K LSDIDDQ+GLRF IPV+ FYRN PSM G
Sbjct  1     MASSPASLLFKVHRREPELIKPAKPTPHEFKLLSDIDDQEGLRFHIPVMQFYRNNPSMQG  60

Query  1372  KDPVQVIRQALAKALVFFYPFAGRLREGPGRKLMVDCTGEGVMFIEADADATLQHFAVGG  1193
             KDPV++IR+ALAK LVF+YPFAGRLREGP RKLMV+CTGEG++FIEADAD TL+ F  G 
Sbjct  61    KDPVKIIREALAKTLVFYYPFAGRLREGPNRKLMVECTGEGILFIEADADVTLEQF--GD  118

Query  1192  ELKPPFPCFDQLLYNVPGSAEILNCPLFLIQVTRLRCGGFIFALRLNHSMSDACGLVHFL  1013
              L+PPFPC ++LL++VPGS+ +LNCPL LIQVTRL+CGGF+FALRLNH+MSDA GLV F+
Sbjct  119   ALQPPFPCLEELLFDVPGSSGVLNCPLLLIQVTRLKCGGFLFALRLNHTMSDAVGLVQFM  178

Query  1012  NTIAEIARGAEAPSVYPVWQREFFDARNPPRITCTHFEYEEEPAADSMVTNIPLDNLVHR  833
               + E+ARGA  PSV  VW+R+  +A NPPR+TCTH EYEE   AD+  T IPLD++ HR
Sbjct  179   AAVGEMARGANVPSVPAVWERQVLNASNPPRVTCTHREYEE--VADTKGTIIPLDDMAHR  236

Query  832   SFFFGPTEISALRSSLPPHLLKCSRFEVVTACLWRCRTIAMEFDPNDEVRIFGTVNARPR  653
             SFFFGP+E+SALR  +PPHL  CS FE++TACLW+CRTIA++ DP +E+RI   VNAR +
Sbjct  237   SFFFGPSEMSALRKFVPPHLSHCSTFEILTACLWKCRTIALQPDPTEEMRIICIVNAREK  296

Query  652   LKNPPVPNGYYGNAFVYPGAKSTAGKVSKSPLSHALELVTNIKSSFTEEYIKSVADLMIL  473
               NPP+P GYYGN F +P A +TAG++S++P  +ALELV   K+  TEEY++SV+ LM++
Sbjct  297   F-NPPLPRGYYGNGFAFPVAVATAGELSRNPFGYALELVRKAKADVTEEYMRSVSSLMVI  355

Query  472   KGRPTFTLQGTFIVSDVTRVGFPEIDMGWGQSVFggpahggvggipGLITFYIPYEDNKG  293
             KGRP FT+   ++VSD+ R GF E+D GWG +++GG A GGVG IPG+ +FYIP+ +  G
Sbjct  356   KGRPHFTVVRAYLVSDLRRAGFEEVDFGWGNAIYGGAAKGGVGAIPGVASFYIPFTNKNG  415

Query  292   DHGILVPMCLPAIAMGKFVKELENCLMK**TSSSQNSMHLI  170
             ++G++VP CLPA AM +FVKEL+  ++K    S+Q    LI
Sbjct  416   ENGVVVPFCLPAPAMERFVKELDG-MLKDQPVSAQTKSKLI  455



>gb|AAW51125.1| putative alcohol acyl-transferases [Cucumis melo]
Length=459

 Score =   573 bits (1476),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 280/445 (63%), Positives = 359/445 (81%), Gaps = 7/445 (2%)
 Frame = -1

Query  1549  MASQPSIAFTVTRQNPELVAPADPTPREIKYLSDIDDQQGLRFQIPVIHFYRNEPSMSGK  1370
             MAS  S+ F V R  P+L+ P+DPTP E K LSDIDDQ+GLRFQIPVI FYR++P M+G 
Sbjct  1     MAS--SLVFQVQRSQPQLIPPSDPTPHEFKQLSDIDDQEGLRFQIPVIQFYRHDPRMAGT  58

Query  1369  DPVQVIRQALAKALVFFYPFAGRLREGPGRKLMVDCTGEGVMFIEADADATLQHFAVGGE  1190
             DP +VI++A+AKALVF+YPFAGRLREGPGRKL V+CTGEGVMFIEADAD +L+ F  G  
Sbjct  59    DPARVIKEAIAKALVFYYPFAGRLREGPGRKLFVECTGEGVMFIEADADVSLEQF--GDA  116

Query  1189  LKPPFPCFDQLLYNVPGSAEILNCPLFLIQVTRLRCGGFIFALRLNHSMSDACGLVHFLN  1010
             L+PPFPC ++ L++VP S+ +L+CPL LIQVTRL+CGGFIFALRLNH+MSDA GLV F+ 
Sbjct  117   LQPPFPCLEEPLFDVPNSSGVLDCPLLLIQVTRLKCGGFIFALRLNHTMSDASGLVQFMM  176

Query  1009  TIAEIARGAEAPSVYPVWQREFFDARNPPRITCTHFEYEEEPAADSMVTNIPLDNLVHRS  830
              + E+ARGA APSV PVWQR   +AR+PP++TC H EY+E    D+  T IPLD++ HRS
Sbjct  177   AVGEMARGATAPSVRPVWQRALLNARDPPKVTCHHREYDE--VVDTKGTIIPLDDMAHRS  234

Query  829   FFFGPTEISALRSSLPPHLLKCSRFEVVTACLWRCRTIAMEFDPNDEVRIFGTVNARPRL  650
             FFFGP+EISA+R +LP HL +CS FEV+TACLWR RTI+++ DP +EVR+   VN+R + 
Sbjct  235   FFFGPSEISAIRKALPSHLRQCSSFEVLTACLWRFRTISLQPDPEEEVRVLCIVNSRSKF  294

Query  649   KNPPVPNGYYGNAFVYPGAKSTAGKVSKSPLSHALELVTNIKSSFTEEYIKSVADLMILK  470
              NPP+P GYYGNAF +P A +TAGK+ ++PL +ALELV   K+  TE+Y+KSVADLM++K
Sbjct  295   -NPPLPTGYYGNAFAFPVALTTAGKLCQNPLGYALELVRKAKADVTEDYMKSVADLMVIK  353

Query  469   GRPTFTLQGTFIVSDVTRVGFPEIDMGWGQSVFggpahggvggipGLITFYIPYEDNKGD  290
             GRP FT+  T++VSDVTR GF ++D GWG++++GGPA GGVG IPG+ +FYIP+++ KG+
Sbjct  354   GRPHFTVVRTYLVSDVTRAGFEDVDFGWGKAMYGGPAKGGVGAIPGVASFYIPFKNKKGE  413

Query  289   HGILVPMCLPAIAMGKFVKELENCL  215
              GILVP+CLPA AM +FVKEL+  L
Sbjct  414   RGILVPLCLPAPAMERFVKELDALL  438



>ref|XP_010275172.1| PREDICTED: benzyl alcohol O-benzoyltransferase [Nelumbo nucifera]
Length=459

 Score =   568 bits (1465),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 282/445 (63%), Positives = 352/445 (79%), Gaps = 5/445 (1%)
 Frame = -1

Query  1549  MASQPSIAFTVTRQNPELVAPADPTPREIKYLSDIDDQQGLRFQIPVIHFYRNEPSMSGK  1370
             MA+  S+ FTV R+ PEL+APA PTP E K LSDIDDQ+GLRFQIPVI FYR +PSM G+
Sbjct  1     MATSSSLVFTVRRRQPELIAPAKPTPHEFKDLSDIDDQEGLRFQIPVIQFYRYDPSMEGR  60

Query  1369  DPVQVIRQALAKALVFFYPFAGRLREGPGRKLMVDCTGEGVMFIEADADATLQHFAVGGE  1190
             +P Q IRQA+AKALVF+YPFAGRLREGP RKL V+CTGEGVMFIEADAD  L+ F  G  
Sbjct  61    NPTQAIRQAIAKALVFYYPFAGRLREGPHRKLTVECTGEGVMFIEADADVRLEQF--GDA  118

Query  1189  LKPPFPCFDQLLYNVPGSAEILNCPLFLIQVTRLRCGGFIFALRLNHSMSDACGLVHFLN  1010
             L+PPFPC ++LL++VPGS  +LNCPL LIQVTRL CGGFIFALRLNH+MSDA GLV F+N
Sbjct  119   LQPPFPCLEELLFDVPGSGGVLNCPLLLIQVTRLMCGGFIFALRLNHTMSDAAGLVQFMN  178

Query  1009  TIAEIARGAEAPSVYPVWQREFFDARNPPRITCTHFEYEEEPAADSMVTNIPLDNLVHRS  830
              + E+ARGA APSV PVWQRE  +ARNPP ++C H EY+E    D+  T IPLD++VHRS
Sbjct  179   AVGEMARGAHAPSVPPVWQRELLNARNPPHVSCVHREYDE--VVDTRGTIIPLDDMVHRS  236

Query  829   FFFGPTEISALRSSLPPHLLKCSRFEVVTACLWRCRTIAMEFDPNDEVRIFGTVNARPRL  650
             FFFGPTEI ALR  +PPHL K S FEV+TACLWRCRT+A++ D ++ VR+   VNAR R 
Sbjct  237   FFFGPTEILALRRHVPPHLRKSSTFEVLTACLWRCRTVAIQPDSDEVVRMICIVNARDRF  296

Query  649   KNPPVPNGYYGNAFVYPGAKSTAGKVSKSPLSHALELVTNIKSSFTEEYIKSVADLMILK  470
             + PP+P GYYGNAF +P A STAGK+ ++P  +AL LV   KS  T+EY++S+ADLM+ +
Sbjct  297   Q-PPLPAGYYGNAFAFPVALSTAGKLCQNPFGYALGLVKKAKSDVTDEYMRSLADLMVTR  355

Query  469   GRPTFTLQGTFIVSDVTRVGFPEIDMGWGQSVFggpahggvggipGLITFYIPYEDNKGD  290
             GRP FT+  +++VSDVTR GF ++D GWG+  +GGPA GGVG IPG+ +FYIP+ ++KG+
Sbjct  356   GRPHFTVVRSYLVSDVTRAGFADVDFGWGKPAYGGPAKGGVGAIPGVASFYIPFRNSKGE  415

Query  289   HGILVPMCLPAIAMGKFVKELENCL  215
              GI++P+CLP  AM +FV EL++ L
Sbjct  416   DGIVLPICLPGPAMERFVWELQSML  440



>ref|XP_003518844.1| PREDICTED: benzyl alcohol O-benzoyltransferase [Glycine max]
Length=459

 Score =   567 bits (1461),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 279/440 (63%), Positives = 355/440 (81%), Gaps = 5/440 (1%)
 Frame = -1

Query  1534  SIAFTVTRQNPELVAPADPTPREIKYLSDIDDQQGLRFQIPVIHFYRNEPSMSGKDPVQV  1355
             S+ FTV R   EL+APA PTPRE+K LSDIDDQ GLRFQIPVI FYR++PSM+GKDPV V
Sbjct  4     SLVFTVRRSEAELIAPAKPTPREVKLLSDIDDQDGLRFQIPVIQFYRHDPSMAGKDPVDV  63

Query  1354  IRQALAKALVFFYPFAGRLREGPGRKLMVDCTGEGVMFIEADADATLQHFAVGGELKPPF  1175
             IR+A+AK LVF+YPFAGRLREG GRKLMVDCTGEGV+FIEADAD TL+ F  G  L+PPF
Sbjct  64    IRKAVAKTLVFYYPFAGRLREGLGRKLMVDCTGEGVLFIEADADVTLKQF--GDALQPPF  121

Query  1174  PCFDQLLYNVPGSAEILNCPLFLIQVTRLRCGGFIFALRLNHSMSDACGLVHFLNTIAEI  995
             PC+++LLY+VPGS  +LN PL LIQVTRL+CGGFI A+RLNH+MSDA GLV F++ + EI
Sbjct  122   PCWEELLYDVPGSQGVLNTPLLLIQVTRLKCGGFILAVRLNHTMSDAAGLVQFMSALGEI  181

Query  994   ARGAEAPSVYPVWQREFFDARNPPRITCTHFEYEEEPAADSMVTNIPLDNLVHRSFFFGP  815
             ARG + PS+ PVW+RE  +AR+PPR+TCTH EYE  P  D+  T IPLD++ HRSFFFGP
Sbjct  182   ARGRQEPSIPPVWRRELLNARDPPRVTCTHREYEHVP--DTKGTIIPLDHMAHRSFFFGP  239

Query  814   TEISALRSSLPPHLLKCSRFEVVTACLWRCRTIAMEFDPNDEVRIFGTVNARPRLKNPPV  635
             +E++A+RS +P    +CS FEV+TACLWRCRTIA++ D ++EVRI   VNAR +  +PP+
Sbjct  240   SEVAAIRSLIPQTDQRCSNFEVLTACLWRCRTIALQPDKDEEVRILCIVNARSKF-DPPL  298

Query  634   PNGYYGNAFVYPGAKSTAGKVSKSPLSHALELVTNIKSSFTEEYIKSVADLMILKGRPTF  455
             P+GYYGNAF +P A +TAGK+  +PL +ALELV   K+  TEEY+ SVADLM+ KGRP F
Sbjct  299   PSGYYGNAFAFPVAVTTAGKLCDNPLGYALELVRKAKADVTEEYMHSVADLMVTKGRPHF  358

Query  454   TLQGTFIVSDVTRVGFPEIDMGWGQSVFggpahggvggipGLITFYIPYEDNKGDHGILV  275
             T+  +++VSDVTR GF  I+ GWG++V+GGPA GGVG IPG+ +FYIP+++ KG+ G+++
Sbjct  359   TVVRSYLVSDVTRAGFGNIEFGWGKAVYGGPAKGGVGAIPGVASFYIPFKNAKGEEGLVI  418

Query  274   PMCLPAIAMGKFVKELENCL  215
             P+CLP+ AM +F KEL+  L
Sbjct  419   PVCLPSEAMERFQKELDCVL  438



>gb|KDP39568.1| hypothetical protein JCGZ_02588 [Jatropha curcas]
Length=459

 Score =   566 bits (1460),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 281/461 (61%), Positives = 358/461 (78%), Gaps = 6/461 (1%)
 Frame = -1

Query  1549  MASQPS-IAFTVTRQNPELVAPADPTPREIKYLSDIDDQQGLRFQIPVIHFYRNEPSMSG  1373
             MA  PS + F V R+ PEL+ P+ PTP E K LSDIDDQ GLRF IPVI FYR +PSM G
Sbjct  1     MAPPPSSLVFKVNRREPELLVPSKPTPHEFKLLSDIDDQDGLRFHIPVIQFYRYDPSMKG  60

Query  1372  KDPVQVIRQALAKALVFFYPFAGRLREGPGRKLMVDCTGEGVMFIEADADATLQHFAVGG  1193
             KDPV+VIR+A+ K LVF+YPFAGRLREGP RKLMV+CTGEGV+FIEADAD +L+ F  G 
Sbjct  61    KDPVKVIREAIGKTLVFYYPFAGRLREGPERKLMVECTGEGVLFIEADADVSLEDF--GD  118

Query  1192  ELKPPFPCFDQLLYNVPGSAEILNCPLFLIQVTRLRCGGFIFALRLNHSMSDACGLVHFL  1013
              L+PPFPC + LL++VPGS  +LN  L LIQVTRL CGGFIFALRLNH+MSDA GLV F+
Sbjct  119   ALQPPFPCLEDLLFDVPGSTSVLNSALLLIQVTRLSCGGFIFALRLNHTMSDAPGLVQFM  178

Query  1012  NTIAEIARGAEAPSVYPVWQREFFDARNPPRITCTHFEYEEEPAADSMVTNIPLDNLVHR  833
             + + EIARGA+APSV PVW+R   +ARNPPR+TCTH EY+E   AD+  T +PLD++ H+
Sbjct  179   SAVGEIARGAQAPSVLPVWERHLLNARNPPRVTCTHREYDE--VADTKGTIVPLDDMAHQ  236

Query  832   SFFFGPTEISALRSSLPPHLLKCSRFEVVTACLWRCRTIAMEFDPNDEVRIFGTVNARPR  653
             SFFFGP+EISALRS +PPHL  CS FE++TACLW+CRTIA++ +P +E+R+   VN R R
Sbjct  237   SFFFGPSEISALRSLVPPHLSNCSTFELLTACLWKCRTIALQPEPEEEMRMICIVNGRAR  296

Query  652   LKNPPVPNGYYGNAFVYPGAKSTAGKVSKSPLSHALELVTNIKSSFTEEYIKSVADLMIL  473
               NPP+P GYYGN FV+P A +TAG++++ PL  ALEL+  +K S  EEY++SVADLM++
Sbjct  297   F-NPPLPTGYYGNGFVFPVAVATAGELAQKPLGFALELIREVKRSVNEEYMRSVADLMVV  355

Query  472   KGRPTFTLQGTFIVSDVTRVGFPEIDMGWGQSVFggpahggvggipGLITFYIPYEDNKG  293
             KGRP FT+  +++VSDVT  GF E+D GWG++ +GGPA GGVG IPG+ +FYIP ++ KG
Sbjct  356   KGRPHFTVVRSYLVSDVTHAGFGEVDFGWGKAAYGGPAKGGVGAIPGVASFYIPSKNEKG  415

Query  292   DHGILVPMCLPAIAMGKFVKELENCLMK**TSSSQNSMHLI  170
             ++GI++P+ LPA AM  F+KEL+  L     SS+  S  +I
Sbjct  416   ENGIVLPIVLPAQAMEIFIKELKGMLQNQAISSATKSTFII  456



>ref|XP_004151058.1| PREDICTED: benzyl alcohol O-benzoyltransferase-like [Cucumis 
sativus]
 ref|XP_004164522.1| PREDICTED: benzyl alcohol O-benzoyltransferase-like [Cucumis 
sativus]
 gb|KGN63337.1| hypothetical protein Csa_2G431070 [Cucumis sativus]
Length=459

 Score =   566 bits (1458),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 276/445 (62%), Positives = 357/445 (80%), Gaps = 7/445 (2%)
 Frame = -1

Query  1549  MASQPSIAFTVTRQNPELVAPADPTPREIKYLSDIDDQQGLRFQIPVIHFYRNEPSMSGK  1370
             MAS  S+ F V R  P+L+ P+DPTP E K LSDIDDQ+GLRFQIPVI FYR++P M+G 
Sbjct  1     MAS--SLVFQVQRSQPQLIPPSDPTPHEFKQLSDIDDQEGLRFQIPVIQFYRHDPRMAGT  58

Query  1369  DPVQVIRQALAKALVFFYPFAGRLREGPGRKLMVDCTGEGVMFIEADADATLQHFAVGGE  1190
             DP +VI++A+AKALVF+YPFAGRLREGPGRKL V+CTGEGV+F EADAD +L+ F  G  
Sbjct  59    DPARVIKEAIAKALVFYYPFAGRLREGPGRKLFVECTGEGVLFTEADADVSLEQF--GDA  116

Query  1189  LKPPFPCFDQLLYNVPGSAEILNCPLFLIQVTRLRCGGFIFALRLNHSMSDACGLVHFLN  1010
             L+PPFPC ++LL++VP S+ +L+CPL LIQVTRL+CGGFI ALRLNH+MSDA GLV F+ 
Sbjct  117   LQPPFPCLEELLFDVPNSSGVLDCPLLLIQVTRLKCGGFILALRLNHTMSDASGLVQFMM  176

Query  1009  TIAEIARGAEAPSVYPVWQREFFDARNPPRITCTHFEYEEEPAADSMVTNIPLDNLVHRS  830
              + E+ARGA APSV PVWQR   +AR+PP++TC H EY+E    D+  T IPLD++ HRS
Sbjct  177   AVGEMARGATAPSVRPVWQRALLNARDPPKVTCHHREYDE--VVDTKGTIIPLDDMAHRS  234

Query  829   FFFGPTEISALRSSLPPHLLKCSRFEVVTACLWRCRTIAMEFDPNDEVRIFGTVNARPRL  650
             FFFGP+EI+A+R++LP HL +CS FEV+TACLWR RTI+++ DP +EVR+   VN+R + 
Sbjct  235   FFFGPSEIAAIRNALPSHLRQCSSFEVLTACLWRFRTISLQPDPEEEVRVLCIVNSRSKF  294

Query  649   KNPPVPNGYYGNAFVYPGAKSTAGKVSKSPLSHALELVTNIKSSFTEEYIKSVADLMILK  470
              NPP+P GYYGNAF +P A +TAGK+ ++PL +ALELV   K+  TEEY+KSVADLM++K
Sbjct  295   -NPPLPTGYYGNAFAFPVALTTAGKLCQNPLGYALELVRKAKADVTEEYMKSVADLMMIK  353

Query  469   GRPTFTLQGTFIVSDVTRVGFPEIDMGWGQSVFggpahggvggipGLITFYIPYEDNKGD  290
             GRP FT+  +++VSDVTR GF ++D GWG++ +GGPA GGVG IPG+ +FYIP+++ K +
Sbjct  354   GRPHFTVVRSYLVSDVTRAGFEDVDFGWGKATYGGPAKGGVGAIPGVASFYIPFKNKKEE  413

Query  289   HGILVPMCLPAIAMGKFVKELENCL  215
              GILVP+CLPA AM +FVKEL+  L
Sbjct  414   RGILVPLCLPAPAMERFVKELDALL  438



>ref|XP_009374085.1| PREDICTED: benzyl alcohol O-benzoyltransferase-like [Pyrus x 
bretschneideri]
Length=458

 Score =   565 bits (1457),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 281/446 (63%), Positives = 352/446 (79%), Gaps = 9/446 (2%)
 Frame = -1

Query  1549  MASQP-SIAFTVTRQNPELVAPADPTPREIKYLSDIDDQQGLRFQIPVIHFYRNEPSMSG  1373
             MAS P S+ FTV R+ PELVAPA  TP E + LSDIDDQ+GLRFQIPV+ FYR + SM G
Sbjct  1     MASPPTSLVFTVRRRQPELVAPAKATPYEFRQLSDIDDQEGLRFQIPVLQFYRYDLSMQG  60

Query  1372  KDPVQVIRQALAKALVFFYPFAGRLREGPGRKLMVDCTGEGVMFIEADADATLQHFAVGG  1193
             +DPV VIR+A+A+ LVF+YPFAGRL+EGP RKL V+CT EG+MFIEADAD TL+HF  G 
Sbjct  61    RDPVHVIREAIAQTLVFYYPFAGRLKEGPNRKLAVECTAEGIMFIEADADITLEHF--GD  118

Query  1192  ELKPPFPCFDQLLYNVPGSAEILNCPLFLIQVTRLRCGGFIFALRLNHSMSDACGLVHFL  1013
              L PPFPC ++LLYNVPGS  +LNCPL LIQVTRL+CGGF+FALRLNH+MSDA GLV F+
Sbjct  119   NLHPPFPCLEELLYNVPGSDGVLNCPLLLIQVTRLQCGGFVFALRLNHTMSDAAGLVQFM  178

Query  1012  NTIAEIARGAEAPSVYPVWQREFFDARNPPRITCTHFEYEEEPAADSMVTNIPLDNLVHR  833
               +AEIARGA   +  PVWQRE  +AR+PPR+TCTH EYEE    D+  T IPLD++VHR
Sbjct  179   TAVAEIARGA---TFQPVWQRELLNARDPPRVTCTHREYEE--VEDTYGTIIPLDDMVHR  233

Query  832   SFFFGPTEISALRSSLPPHLLKCSRFEVVTACLWRCRTIAMEFDPNDEVRIFGTVNARPR  653
             SFFF PTE+SA+R  +P +L KCS F V+TACLWRCRTIA++ DPN+EVR+   VNAR +
Sbjct  234   SFFFRPTEVSAIRRFVPQYLSKCSPFGVLTACLWRCRTIALQRDPNEEVRVLCIVNARSK  293

Query  652   LKNPPVPNGYYGNAFVYPGAKSTAGKVSKSPLSHALELVTNIKSSFTEEYIKSVADLMIL  473
               NPP+P GYYGN F +P A +TA ++  +PL +ALELV   K+  TEEY++S+ADLM++
Sbjct  294   F-NPPLPVGYYGNTFAFPVAVTTAWRLCNNPLGYALELVRKAKAHVTEEYMRSLADLMVI  352

Query  472   KGRPTFTLQGTFIVSDVTRVGFPEIDMGWGQSVFggpahggvggipGLITFYIPYEDNKG  293
             KGRP FT+  ++++SDVTR GF E+D GWG++ +GGP  GGVG IPG+ +FYIP+ DN G
Sbjct  353   KGRPHFTVVNSYLMSDVTRAGFGEVDFGWGKAAYGGPGEGGVGAIPGVASFYIPFRDNIG  412

Query  292   DHGILVPMCLPAIAMGKFVKELENCL  215
             + GI+VP+CLPA AM +F+KEL+  L
Sbjct  413   EDGIVVPVCLPAAAMERFIKELDAML  438



>ref|XP_006484694.1| PREDICTED: benzyl alcohol O-benzoyltransferase-like [Citrus sinensis]
Length=458

 Score =   562 bits (1449),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 276/440 (63%), Positives = 353/440 (80%), Gaps = 5/440 (1%)
 Frame = -1

Query  1534  SIAFTVTRQNPELVAPADPTPREIKYLSDIDDQQGLRFQIPVIHFYRNEPSMSGKDPVQV  1355
             S+ F V R+ PEL+APA PTPRE+K LSDIDDQ+GLRF IPVI FY+  P ++GKDPV+V
Sbjct  4     SLTFKVLRRAPELIAPAKPTPRELKPLSDIDDQEGLRFHIPVIQFYKYNPFVNGKDPVKV  63

Query  1354  IRQALAKALVFFYPFAGRLREGPGRKLMVDCTGEGVMFIEADADATLQHFAVGGELKPPF  1175
             IR+A+A+ LV +YPFAGRLREGP RKLMVDCTGEGV+FIEADAD TL+ F  G  L+PPF
Sbjct  64    IREAIAQTLVSYYPFAGRLREGPNRKLMVDCTGEGVLFIEADADVTLEQF--GDALQPPF  121

Query  1174  PCFDQLLYNVPGSAEILNCPLFLIQVTRLRCGGFIFALRLNHSMSDACGLVHFLNTIAEI  995
             P  ++LL++VPGSA +LNCPL LIQVTRL+CGGFIFALRLNH+M DA GLV F++ + E+
Sbjct  122   PGLEELLFDVPGSAGVLNCPLLLIQVTRLKCGGFIFALRLNHTMGDAAGLVQFMSAVGEL  181

Query  994   ARGAEAPSVYPVWQREFFDARNPPRITCTHFEYEEEPAADSMVTNIPLDNLVHRSFFFGP  815
             ARG  AP+V PVW+R   +AR+PPR+TCTH EY+E   AD+  T IPLD++ HRSFFFGP
Sbjct  182   ARGLRAPTVPPVWERHVLNARDPPRVTCTHHEYDE--VADTKNTIIPLDDMSHRSFFFGP  239

Query  814   TEISALRSSLPPHLLKCSRFEVVTACLWRCRTIAMEFDPNDEVRIFGTVNARPRLKNPPV  635
              E+SA+R  LP HL +CS FE++TACL+RCRTIA++ DPN+E+RI   VNAR ++ NPP+
Sbjct  240   QEVSAIRRILPQHLRRCSAFEILTACLFRCRTIALQPDPNEEMRIICIVNARSKI-NPPL  298

Query  634   PNGYYGNAFVYPGAKSTAGKVSKSPLSHALELVTNIKSSFTEEYIKSVADLMILKGRPTF  455
             P GYYGN F +P A +TA K+SK+PL  ALELV   K+   +EY++S+ADLM++KGRP F
Sbjct  299   PAGYYGNGFAFPVAITTAEKLSKNPLGFALELVRKAKNDVNDEYMRSLADLMVIKGRPHF  358

Query  454   TLQGTFIVSDVTRVGFPEIDMGWGQSVFggpahggvggipGLITFYIPYEDNKGDHGILV  275
              +  +++VSDVTR GF ++D GWG+ V+GGPA GGVG IPG+ +FYIP+ + KG+ GI+V
Sbjct  359   AVVRSYLVSDVTRAGFGDVDFGWGKPVYGGPAKGGVGAIPGVASFYIPFRNKKGEEGIVV  418

Query  274   PMCLPAIAMGKFVKELENCL  215
             P+CLPA AM +FV+ELE  L
Sbjct  419   PVCLPAPAMARFVEELEKTL  438



>ref|XP_006437408.1| hypothetical protein CICLE_v10031489mg [Citrus clementina]
 gb|ESR50648.1| hypothetical protein CICLE_v10031489mg [Citrus clementina]
Length=458

 Score =   562 bits (1449),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 276/440 (63%), Positives = 353/440 (80%), Gaps = 5/440 (1%)
 Frame = -1

Query  1534  SIAFTVTRQNPELVAPADPTPREIKYLSDIDDQQGLRFQIPVIHFYRNEPSMSGKDPVQV  1355
             S+ F V R+ PEL+APA PTPRE+K LSDIDDQ+GLRF IPVI FY+  P ++GKDPV+V
Sbjct  4     SLTFKVLRRAPELIAPAKPTPRELKPLSDIDDQEGLRFHIPVIQFYKYNPFVNGKDPVKV  63

Query  1354  IRQALAKALVFFYPFAGRLREGPGRKLMVDCTGEGVMFIEADADATLQHFAVGGELKPPF  1175
             IR+A+A+ LV +YPFAGRLREGP RKLMVDCTGEGV+FIEADAD TL+ F  G  L+PPF
Sbjct  64    IREAVAQTLVSYYPFAGRLREGPNRKLMVDCTGEGVLFIEADADVTLEQF--GDALQPPF  121

Query  1174  PCFDQLLYNVPGSAEILNCPLFLIQVTRLRCGGFIFALRLNHSMSDACGLVHFLNTIAEI  995
             P  ++LL++VPGSA +LNCPL LIQVTRL+CGGFIFALRLNH+M DA GLV F++ + E+
Sbjct  122   PGLEELLFDVPGSAGVLNCPLLLIQVTRLKCGGFIFALRLNHTMGDAAGLVQFMSAVGEL  181

Query  994   ARGAEAPSVYPVWQREFFDARNPPRITCTHFEYEEEPAADSMVTNIPLDNLVHRSFFFGP  815
             ARG  AP+V PVW+R   +AR+PPR+TCTH EY+E   AD+  T IPLD++ HRSFFFGP
Sbjct  182   ARGLRAPTVPPVWERHVLNARDPPRVTCTHHEYDE--VADTKNTIIPLDDMSHRSFFFGP  239

Query  814   TEISALRSSLPPHLLKCSRFEVVTACLWRCRTIAMEFDPNDEVRIFGTVNARPRLKNPPV  635
              E+SA+R  LP HL +CS FE++TACL+RCRTIA++ DPN+E+RI   VNAR ++ NPP+
Sbjct  240   QEVSAIRRILPQHLRRCSAFEILTACLFRCRTIALQPDPNEEMRIICIVNARSKI-NPPL  298

Query  634   PNGYYGNAFVYPGAKSTAGKVSKSPLSHALELVTNIKSSFTEEYIKSVADLMILKGRPTF  455
             P GYYGN F +P A +TA K+SK+PL  ALELV   K+   +EY++S+ADLM++KGRP F
Sbjct  299   PAGYYGNGFAFPVAITTAEKLSKNPLGFALELVRKAKNDVNDEYMRSLADLMVIKGRPHF  358

Query  454   TLQGTFIVSDVTRVGFPEIDMGWGQSVFggpahggvggipGLITFYIPYEDNKGDHGILV  275
              +  +++VSDVTR GF ++D GWG+ V+GGPA GGVG IPG+ +FYIP+ + KG+ GI+V
Sbjct  359   AVVRSYLVSDVTRAGFGDVDFGWGKPVYGGPAKGGVGAIPGVASFYIPFRNKKGEEGIVV  418

Query  274   PMCLPAIAMGKFVKELENCL  215
             P+CLPA AM +FV+ELE  L
Sbjct  419   PVCLPAPAMARFVEELEKTL  438



>dbj|BAF49304.1| putative acyltransferase [Clitoria ternatea]
Length=461

 Score =   562 bits (1449),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 279/444 (63%), Positives = 349/444 (79%), Gaps = 6/444 (1%)
 Frame = -1

Query  1543  SQPSIAFTVTRQNPELVAPADPTPREIKYLSDIDDQQGLRFQIPVIHFYRNEPSMSGKDP  1364
             S  S+ F V ++  EL+APA PTPRE+K LSDIDDQ+GLRFQIPVI FYR   +M+GKDP
Sbjct  6     SSSSLMFQVQKREAELIAPAKPTPREVKLLSDIDDQEGLRFQIPVIQFYRYNETMAGKDP  65

Query  1363  VQVIRQALAKALVFFYPFAGRLREGPGRKLMVDCTGEGVMFIEADADATLQHFAVGGELK  1184
             V+VIR+ALAK LVF+YPFAGRLREGPGRKLMVDCTGEGV+FIEA AD TLQ F  G  L+
Sbjct  66    VEVIRKALAKTLVFYYPFAGRLREGPGRKLMVDCTGEGVLFIEAHADVTLQQF--GDSLQ  123

Query  1183  PPFPCFDQLLYNVPGSAEILNCPLFLIQVTRLRCGGFIFALRLNHSMSDACGLVHFLNTI  1004
             PPFP  D LLYN+P S  +LN PL LIQVTRL+CGGFI ALRLNH+MSDA GLV F++ +
Sbjct  124   PPFPGLDHLLYNLPNSDGVLNSPLLLIQVTRLKCGGFILALRLNHTMSDAAGLVQFMSAV  183

Query  1003  AEIARGAEAPSVYPVWQREFFDARNPPRITCTHFEYEEEPAADSMVTNIPLDNLVHRSFF  824
              EIARG E PS+ PVW+RE  +ARNPP++TCTH EYE+ P  DS  T IPLD++ HRSFF
Sbjct  184   GEIARGMEEPSIPPVWRRELLNARNPPKVTCTHREYEQVP--DSKGTIIPLDDMAHRSFF  241

Query  823   FGPTEISALRSSLPPHLLK-CSRFEVVTACLWRCRTIAMEFDPNDEVRIFGTVNARPRLK  647
             FGP EISA+R  +P    + CS FE++TACLWRCRTIA++ D ++EVRI   VNAR +  
Sbjct  242   FGPAEISAIRRLIPAQQQRQCSNFEILTACLWRCRTIALQPDSDEEVRILCIVNARGKF-  300

Query  646   NPPVPNGYYGNAFVYPGAKSTAGKVSKSPLSHALELVTNIKSSFTEEYIKSVADLMILKG  467
             NPP+P GYYGNAF +P A +TAGK+  +PL +ALELV   K   +EEY+ S+ADLM+ KG
Sbjct  301   NPPLPAGYYGNAFAFPVAVTTAGKLCGNPLGYALELVRKAKGDVSEEYMHSLADLMVTKG  360

Query  466   RPTFTLQGTFIVSDVTRVGFPEIDMGWGQSVFggpahggvggipGLITFYIPYEDNKGDH  287
             RP FT+  +++VSDVTR GF ++D GWG+ V+GGPA GGVG IPG+ +FYIP+ ++KG+ 
Sbjct  361   RPHFTVVRSYLVSDVTRAGFGDVDFGWGKPVYGGPAKGGVGAIPGVASFYIPFRNSKGEE  420

Query  286   GILVPMCLPAIAMGKFVKELENCL  215
             G+++P+CLP+ AM +FV+EL+  L
Sbjct  421   GLVIPVCLPSQAMDRFVRELDTIL  444



>ref|XP_002319767.1| transferase family protein [Populus trichocarpa]
 gb|EEE95690.1| transferase family protein [Populus trichocarpa]
 gb|AJD25144.1| benzoyl-CoA:salicyl alcohol O-benzoyltransferase [Populus trichocarpa]
Length=459

 Score =   560 bits (1442),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 273/446 (61%), Positives = 348/446 (78%), Gaps = 6/446 (1%)
 Frame = -1

Query  1549  MASQP-SIAFTVTRQNPELVAPADPTPREIKYLSDIDDQQGLRFQIPVIHFYRNEPSMSG  1373
             MAS P S+ F V R+ PEL+ PA PTP E K LSDIDDQ+GLRF IPVI FYR+ PS+ G
Sbjct  1     MASSPASLVFKVHRREPELIKPAKPTPHEFKLLSDIDDQEGLRFHIPVIQFYRHNPSVQG  60

Query  1372  KDPVQVIRQALAKALVFFYPFAGRLREGPGRKLMVDCTGEGVMFIEADADATLQHFAVGG  1193
             KDPV+VIR+A+AK LVF+YPFAGRLREG  RKLMV+CTGEG++FIEADAD TL+ F  G 
Sbjct  61    KDPVKVIREAIAKTLVFYYPFAGRLREGQNRKLMVECTGEGILFIEADADVTLEQF--GD  118

Query  1192  ELKPPFPCFDQLLYNVPGSAEILNCPLFLIQVTRLRCGGFIFALRLNHSMSDACGLVHFL  1013
              L+PPFPC ++L+++VPGS+ +LNCPL LIQVTRL+CGGFIF LRLNH+MSDA G+V F+
Sbjct  119   ALQPPFPCLEELIFDVPGSSGVLNCPLLLIQVTRLKCGGFIFGLRLNHTMSDASGIVQFM  178

Query  1012  NTIAEIARGAEAPSVYPVWQREFFDARNPPRITCTHFEYEEEPAADSMVTNIPLDNLVHR  833
               + E+ARGA  PSV  VW+R   +ARNPPR+TC H EYEE   AD+  T IPLD++ HR
Sbjct  179   AAVGEMARGATTPSVPAVWERHVLNARNPPRVTCIHREYEE--VADTNGTIIPLDDMAHR  236

Query  832   SFFFGPTEISALRSSLPPHLLKCSRFEVVTACLWRCRTIAMEFDPNDEVRIFGTVNARPR  653
             SFFFGP+EISALR  +PPHL +CS FE++TACLW+CRTIA++ DP +E+RI   VNAR +
Sbjct  237   SFFFGPSEISALRKLIPPHLSRCSTFEILTACLWKCRTIALQPDPTEEMRIICIVNAREK  296

Query  652   LKNPPVPNGYYGNAFVYPGAKSTAGKVSKSPLSHALELVTNIKSSFTEEYIKSVADLMIL  473
               NPP+P GYYGN F +P A +TAG++S+ P  +ALELV   K+  TEEY++SVA LM+ 
Sbjct  297   F-NPPLPTGYYGNGFAFPVAVATAGELSEKPFGYALELVRKAKADVTEEYMRSVASLMVT  355

Query  472   KGRPTFTLQGTFIVSDVTRVGFPEIDMGWGQSVFggpahggvggipGLITFYIPYEDNKG  293
             KGRP FT+   ++VSD+   GF  +D GWG +++GG A GGVG IPG+ +F IP+++ KG
Sbjct  356   KGRPHFTVVRAYLVSDLRSAGFEVVDFGWGNAIYGGAAKGGVGAIPGVASFLIPFKNKKG  415

Query  292   DHGILVPMCLPAIAMGKFVKELENCL  215
             ++GI+VP CLPA AM +FV+EL+  L
Sbjct  416   ENGIVVPFCLPAPAMERFVEELDGML  441



>ref|XP_007029788.1| Benzoyl coenzyme A: Benzyl alcohol benzoyl transferase [Theobroma 
cacao]
 gb|EOY10290.1| Benzoyl coenzyme A: Benzyl alcohol benzoyl transferase [Theobroma 
cacao]
Length=454

 Score =   560 bits (1442),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 278/443 (63%), Positives = 344/443 (78%), Gaps = 8/443 (2%)
 Frame = -1

Query  1543  SQPSIAFTVTRQNPELVAPADPTPREIKYLSDIDDQQGLRFQIPVIHFYRNEPSMSGKDP  1364
             + PS+ F V RQ PEL+APA PTP E K LSDIDDQ+GLRFQIPVI FY+  PSM GKDP
Sbjct  2     ATPSLVFAVHRQEPELIAPAKPTPHEYKLLSDIDDQEGLRFQIPVIQFYQYSPSMQGKDP  61

Query  1363  VQVIRQALAKALVFFYPFAGRLREGPGRKLMVDCTGEGVMFIEADADATLQHFAVGGELK  1184
              +VIR+ALA+ LVF+YPFAGRLREGP RKLMVDCTGEGVMFIEADAD TL+ F  G  L+
Sbjct  62    ARVIREALAQTLVFYYPFAGRLREGPQRKLMVDCTGEGVMFIEADADVTLEQF--GDALQ  119

Query  1183  PPFPCFDQLLYNVPGSAEILNCPLFLIQVTRLRCGGFIFALRLNHSMSDACGLVHFLNTI  1004
             PPFPC + LL++VPGSA +LNCPL LIQVTRLRCGGFIFALRLNHSMSDA GL  F++ +
Sbjct  120   PPFPCLEDLLHDVPGSAGVLNCPLLLIQVTRLRCGGFIFALRLNHSMSDAAGLTQFMSAV  179

Query  1003  AEIARGAEAPSVYPVWQREFFDARNPPRITCTHFEYEEEPAADSMVTNIPLDNLVHRSFF  824
              E+ARG  APS+ PVW+R    AR+PPR+TC H EYEE        T +P D + HRSFF
Sbjct  180   GEMARGWLAPSIRPVWKRHLLGARDPPRVTCKHREYEEVEG-----TIVPFDEMAHRSFF  234

Query  823   FGPTEISALRSSLPPHLLKCSRFEVVTACLWRCRTIAMEFDPNDEVRIFGTVNARPRLKN  644
             FG  E+ ALR  +P HL KCSRFE++TACLWRCRTIA++ +  +EVRI   VN+R +  N
Sbjct  235   FGSAELLALRKLVPLHLRKCSRFELLTACLWRCRTIAIQANLEEEVRIICIVNSRSKF-N  293

Query  643   PPVPNGYYGNAFVYPGAKSTAGKVSKSPLSHALELVTNIKSSFTEEYIKSVADLMILKGR  464
             PP+P+GYYGNAF +P A + AGK+ ++PL +ALELV   K+  TEEY+KS+ADLM+++GR
Sbjct  294   PPLPSGYYGNAFAFPVAVAKAGKLRQNPLGYALELVKQAKADVTEEYMKSLADLMVIRGR  353

Query  463   PTFTLQGTFIVSDVTRVGFPEIDMGWGQSVFggpahggvggipGLITFYIPYEDNKGDHG  284
             P FT+  +++VSDVTR GF ++D GWG++V+GGPA GGVG IPGL +F IP ++ KG+ G
Sbjct  354   PHFTVVRSYLVSDVTRAGFGDVDFGWGKAVYGGPAKGGVGAIPGLASFLIPSKNKKGEDG  413

Query  283   ILVPMCLPAIAMGKFVKELENCL  215
             I++P+ LP  AM  FVKEL+  L
Sbjct  414   IVLPITLPPPAMEIFVKELDGML  436



>emb|CDP18599.1| unnamed protein product [Coffea canephora]
Length=460

 Score =   559 bits (1441),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 285/448 (64%), Positives = 353/448 (79%), Gaps = 9/448 (2%)
 Frame = -1

Query  1549  MASQPSIAFTVTRQNPELVAPADPTPREIKYLSDIDDQQGLRFQIPVIHFYRNEPSM--S  1376
             M S+ S+ F VTRQ PELV PA  TPRE K LSDIDDQ+GLRFQ+PVI FYR++     S
Sbjct  1     MGSK-SLTFRVTRQKPELVRPAKSTPRECKRLSDIDDQEGLRFQVPVIQFYRSDDDHLHS  59

Query  1375  GKDPVQVIRQALAKALVFFYPFAGRLREGPGRKLMVDCTGEGVMFIEADADATLQHFAVG  1196
              +DPV+VIR+A+AKALV +YPFAGRLRE  GRKL+ DCTGEGVMFIEADA+ TL+ F  G
Sbjct  60    RRDPVKVIREAIAKALVSYYPFAGRLRECAGRKLVADCTGEGVMFIEADAEVTLEQF--G  117

Query  1195  GELKPPFPCFDQLLYNVPGSAEILNCPLFLIQVTRLRCGGFIFALRLNHSMSDACGLVHF  1016
              EL+PPFPC ++LLY+VP SA +L+ PL LIQVTRLRCGGFIFA+RLNH+++D  GLV F
Sbjct  118   EELQPPFPCLEELLYDVPESAGVLHSPLLLIQVTRLRCGGFIFAVRLNHTIADGTGLVQF  177

Query  1015  LNTIAEIARGAEAPSVYPVWQREFFDARNPPRITCTHFEYEEEPAADSMVTNIPLDNLVH  836
             +N + EIARGA APSV PVWQRE  +AR+PPR+TC H EY+E P  D+  T IPLD++VH
Sbjct  178   MNAVGEIARGASAPSVLPVWQRERLNARDPPRVTCIHHEYDEVP--DTKGTIIPLDDMVH  235

Query  835   RSFFFGPTEISALRSSLPPHL-LKCSRFEVVTACLWRCRTIAMEFDPNDEVRIFGTVNAR  659
             RSFFFGPTE+SALR S+P  +  KCS FEV+TACLWRCRTIA++ +PN+EVR+   VNAR
Sbjct  236   RSFFFGPTEVSALRKSIPLDISRKCSTFEVLTACLWRCRTIALQPEPNEEVRVICVVNAR  295

Query  658   PRLKNPPVPNGYYGNAFVYPGAKSTAGKVSKSPLSHALELVTNIKSSFTEEYIKSVADLM  479
              +  +PP+P GYYGN F +P A +TAG++ K PL +ALELVT  K   TE+Y+KSVADLM
Sbjct  296   SKF-DPPLPQGYYGNGFAFPVALTTAGELCKRPLGYALELVTKAKGDVTEDYMKSVADLM  354

Query  478   ILKGRPTFTLQGTFIVSDVTRVGFPEIDMGWGQSVFggpahggvggipGLITFYIPYEDN  299
             ++KGRP FT   T++VSDVTR+GF E+D GWG+  +GGPA GGVG IPGL++FYIP  + 
Sbjct  355   VIKGRPHFTAVRTYVVSDVTRIGFNEVDFGWGRPEYGGPAKGGVGAIPGLLSFYIPVTNR  414

Query  298   KGDHGILVPMCLPAIAMGKFVKELENCL  215
              G+ G +VP+CLP  AM +FV+ELE  L
Sbjct  415   NGEKGRVVPICLPGFAMDRFVRELEKLL  442



>ref|XP_003536235.1| PREDICTED: benzyl alcohol O-benzoyltransferase-like [Glycine 
max]
Length=454

 Score =   556 bits (1434),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 278/443 (63%), Positives = 356/443 (80%), Gaps = 9/443 (2%)
 Frame = -1

Query  1534  SIAFTVTRQNPELVAPADPTPREIKYLSDIDDQQGLRFQIPVIHFYRNEPSMSGKDPVQV  1355
             S+ FTV R+ PEL+APA PTPRE+K LSDIDDQ GLRFQIPVI  YR++PSM+GKDPV+V
Sbjct  4     SLVFTVRRREPELIAPAKPTPREVKLLSDIDDQDGLRFQIPVIQIYRHDPSMAGKDPVEV  63

Query  1354  IRQALAKALVFFYPFAGRLREGPGRKLMVDCTGE-GVMFIEADADATLQHFAVGGELKPP  1178
             IR+ALA+ LVF+YPFAGRLREG  RKLMVDCTGE GV+FIEADAD TL+HF  G  L+PP
Sbjct  64    IRKALARTLVFYYPFAGRLREGRDRKLMVDCTGELGVLFIEADADVTLKHF--GDALQPP  121

Query  1177  FPCFDQLLYNVPGSAEILNCPLFLIQVTRLRCGGFIFALRLNHSMSDACGLVHFLNTIAE  998
             FPC+++LLY+VPGS  +LN PL LIQVTRL+CGGFI  LRLNH+MSDA GLV F++ + E
Sbjct  122   FPCWEELLYDVPGSQGVLNTPLLLIQVTRLKCGGFILTLRLNHTMSDAAGLVQFMSALGE  181

Query  997   IARGAEAPSVYPVWQREFFDARNPPRITCTHFEYEEEPAADSMVTNIPLDNLVHRSFFFG  818
             IARG   PSV PVW+RE  +AR+PPR+TCTH EYE+ P  D+  T IPLD++ HRSFFFG
Sbjct  182   IARGRHEPSVPPVWRRELLNARDPPRVTCTHREYEQVP--DTKGTIIPLDDMAHRSFFFG  239

Query  817   PTEISALRSSLPPHLLKC--SRFEVVTACLWRCRTIAMEFDPNDEVRIFGTVNARPRLKN  644
             P+E+SA+R  L P   +C  S FEV+TACLWRCRTIA++ D ++EVRI   VNAR +  +
Sbjct  240   PSEVSAIR-RLIPRADQCSSSNFEVLTACLWRCRTIALQPDKDEEVRILCIVNARAKF-D  297

Query  643   PPVPNGYYGNAFVYPGAKSTAGKVSKSPLSHALELVTNIKSSFTEEYIKSVADLMILKGR  464
             PP+P+GYYGNAF +P A +TAGK+ ++PL +A+ELV   K+  TEEY+ SVA+LM+ KGR
Sbjct  298   PPLPSGYYGNAFAFPAAVTTAGKLCENPLGYAVELVRKAKADVTEEYMHSVANLMVAKGR  357

Query  463   PTFTLQGTFIVSDVTRVGFPEIDMGWGQSVFggpahggvggipGLITFYIPYEDNKGDHG  284
             P FT+  +++VSDVTR GF  ++ GWG++V+GGPA GGVG IPG+ +FYIP+++ KG+ G
Sbjct  358   PHFTVVRSYVVSDVTRAGFGNVEFGWGKAVYGGPAKGGVGAIPGVASFYIPFKNAKGEEG  417

Query  283   ILVPMCLPAIAMGKFVKELENCL  215
             +++P+CLP+ AM +F KEL + L
Sbjct  418   LVIPVCLPSEAMERFQKELNSVL  440



>ref|XP_007145940.1| hypothetical protein PHAVU_007G280800g [Phaseolus vulgaris]
 gb|ESW17934.1| hypothetical protein PHAVU_007G280800g [Phaseolus vulgaris]
Length=458

 Score =   556 bits (1434),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 277/460 (60%), Positives = 359/460 (78%), Gaps = 8/460 (2%)
 Frame = -1

Query  1534  SIAFTVTRQNPELVAPADPTPREIKYLSDIDDQQGLRFQIPVIHFYRNEPSMSGKDPVQV  1355
             S+ FTV R+  ELVAPA  TPRE+K LSDIDDQ GLRFQIPVI FYR +PS +G+DPV V
Sbjct  4     SLVFTVQRREAELVAPAKATPREVKLLSDIDDQDGLRFQIPVIQFYRYDPSQAGRDPVAV  63

Query  1354  IRQALAKALVFFYPFAGRLREGPGRKLMVDCTGEGVMFIEADADATLQHFAVGGELKPPF  1175
             IR+ALAK LVF+YPFAGRLREGPGRKLMVDCTGEGV+FIEADAD TL HF  G  L+PPF
Sbjct  64    IREALAKTLVFYYPFAGRLREGPGRKLMVDCTGEGVLFIEADADVTLDHF--GHSLQPPF  121

Query  1174  PCFDQLLYNVPGSAEILNCPLFLIQVTRLRCGGFIFALRLNHSMSDACGLVHFLNTIAEI  995
             PC++ LLY++P S  +L+ PL LIQVTRL+CGGFIFALRLNH+MSDA GLV F+  + EI
Sbjct  122   PCWENLLYDLPSSQGVLHTPLLLIQVTRLKCGGFIFALRLNHTMSDAAGLVQFMKAVGEI  181

Query  994   ARGAEAPSVYPVWQREFFDARNPPRITCTHFEYEEEPAADSMVTNIPLDNLVHRSFFFGP  815
             ARG + P+V PVW+RE   AR+PPR+TC+H EY+  P  D+  T IPLD++ HRSFFFG 
Sbjct  182   ARGRQEPTVPPVWRRELLKARDPPRVTCSHREYDVVP--DTKGTIIPLDDMAHRSFFFGR  239

Query  814   TEISALRSSLPPHLLKCSRFEVVTACLWRCRTIAMEFDPNDEVRIFGTVNARPRLKNPPV  635
             +E+SA+R  L PH  +CS F+V+TACLWRCRT+A++ D ++EVRI   VNAR +  NPP+
Sbjct  240   SELSAIRRLLAPHQNQCSSFDVLTACLWRCRTLALQPDSDEEVRIICIVNARSKF-NPPL  298

Query  634   PNGYYGNAFVYPGAKSTAGKVSKSPLSHALELVTNIKSSFTEEYIKSVADLMILKGRPTF  455
             P GYYGN F +  A +TAGK+ ++PL +ALELV   K+  +EEY++S+ADLM+ +GRP F
Sbjct  299   PEGYYGNVFAFSVAVTTAGKLCENPLGYALELVRKAKAEVSEEYMQSLADLMVTRGRPHF  358

Query  454   TLQGTFIVSDVTRVGFPEIDMGWGQSVFggpahggvggipGLITFYIPYEDNKGDHGILV  275
             T+  +++VSDV R GF E+D GWG++V+GGPA GGVG IPG+ +FYIP+ ++KGD G+++
Sbjct  359   TVVRSYLVSDVRRAGFEEVDFGWGKAVYGGPAKGGVGAIPGVASFYIPFRNDKGDEGLVM  418

Query  274   PMCLPAIAMGKFVKELENCL---MK**TSSSQNSMHLIYM  164
             P+CLP+ AM +F KEL + L   ++   SS+ N + L ++
Sbjct  419   PVCLPSEAMLRFEKELHSVLNNHLQPTISSNSNRLLLSFL  458



>gb|KHF99421.1| Benzyl alcohol O-benzoyltransferase [Gossypium arboreum]
Length=454

 Score =   556 bits (1433),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 277/443 (63%), Positives = 345/443 (78%), Gaps = 8/443 (2%)
 Frame = -1

Query  1543  SQPSIAFTVTRQNPELVAPADPTPREIKYLSDIDDQQGLRFQIPVIHFYRNEPSMSGKDP  1364
             S  S+   V R  PEL+APA PTP E K LSDIDDQ+GLRFQIPVI FY+  PSM GKDP
Sbjct  4     SSTSLVLKVHRHEPELIAPAKPTPHEYKLLSDIDDQEGLRFQIPVIQFYKYNPSMQGKDP  63

Query  1363  VQVIRQALAKALVFFYPFAGRLREGPGRKLMVDCTGEGVMFIEADADATLQHFAVGGELK  1184
             V+VIR+ALA+ALVF+YPFAGRLREGP RKLMVDCTGEG+MFIEADAD TL+ F  G  L+
Sbjct  64    VRVIREALAQALVFYYPFAGRLREGPQRKLMVDCTGEGLMFIEADADVTLEQF--GDVLQ  121

Query  1183  PPFPCFDQLLYNVPGSAEILNCPLFLIQVTRLRCGGFIFALRLNHSMSDACGLVHFLNTI  1004
             PPFPC ++LLY+VPGS  +LNCP+ LIQVTRLRCGGFIFALRLNH+MSDA GL  F++ +
Sbjct  122   PPFPCLEELLYDVPGSTGVLNCPVILIQVTRLRCGGFIFALRLNHTMSDAAGLAQFMSAV  181

Query  1003  AEIARGAEAPSVYPVWQREFFDARNPPRITCTHFEYEEEPAADSMVTNIPLDNLVHRSFF  824
              E+ARG   PS+ PVW+R    AR+PPR+TC H EYEE        T +P D++VHRSFF
Sbjct  182   GEMARGWLTPSIPPVWERHLLAARDPPRVTCKHREYEEVEG-----TIVPYDDMVHRSFF  236

Query  823   FGPTEISALRSSLPPHLLKCSRFEVVTACLWRCRTIAMEFDPNDEVRIFGTVNARPRLKN  644
             FGPTE+SALR  +P HL KCS FE++TACLWRCRTIA++ +P +EVRI   VNAR R  N
Sbjct  237   FGPTEVSALRKLVPEHLRKCSTFELLTACLWRCRTIAIQANPEEEVRIICIVNARSRF-N  295

Query  643   PPVPNGYYGNAFVYPGAKSTAGKVSKSPLSHALELVTNIKSSFTEEYIKSVADLMILKGR  464
             PP+P+GYYGNAF +P A + AGK+ ++PL ++LELV   K+  TEEY+KS+ADLM++KGR
Sbjct  296   PPLPSGYYGNAFAFPVAVAQAGKLCQNPLEYSLELVKQAKNDVTEEYMKSLADLMVIKGR  355

Query  463   PTFTLQGTFIVSDVTRVGFPEIDMGWGQSVFggpahggvggipGLITFYIPYEDNKGDHG  284
             P FT+  +++VSDVT   F + D GWG++V+GGPA GGVG IPG+ +F IP ++ KG+ G
Sbjct  356   PHFTVIRSYLVSDVTHARFGDADFGWGKAVYGGPAKGGVGAIPGVASFLIPVKNKKGEAG  415

Query  283   ILVPMCLPAIAMGKFVKELENCL  215
             +++P+ LPA AM  FVKEL+  L
Sbjct  416   VVLPITLPARAMEIFVKELDGML  438



>ref|XP_004498016.1| PREDICTED: benzyl alcohol O-benzoyltransferase-like [Cicer arietinum]
Length=463

 Score =   556 bits (1433),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 273/443 (62%), Positives = 353/443 (80%), Gaps = 8/443 (2%)
 Frame = -1

Query  1534  SIAFTVTRQNPELVAPADPTPREIKYLSDIDDQQGLRFQIPVIHFYRNEPSMSGKDPVQV  1355
             S+ F V R  PELV P+ PTP E K LSDIDDQ GLRFQIPV+ FY  +P+M GKDPV V
Sbjct  4     SLVFKVKRHEPELVKPSKPTPNETKLLSDIDDQDGLRFQIPVVQFYNYDPNMKGKDPVDV  63

Query  1354  IRQALAKALVFFYPFAGRLREGPGRKLMVDCTGEGVMFIEADADATLQHFAVGGELKPPF  1175
             IR+ALAK LVF+YPFAGRLREG  RKLMVDC GEGV+FIEADAD +++ F  GG+L+PPF
Sbjct  64    IRKALAKTLVFYYPFAGRLREGNDRKLMVDCNGEGVLFIEADADVSVEEF--GGQLQPPF  121

Query  1174  PCFDQLLYNVPGSAEILNCPLFLIQVTRLRCGGFIFALRLNHSMSDACGLVHFLNTIAEI  995
             PC+DQLL++VPGS++++N PL LIQVTRL+CGGFIFALRLNH+MSDA GLV F+N + EI
Sbjct  122   PCWDQLLFDVPGSSQVINTPLLLIQVTRLKCGGFIFALRLNHTMSDAAGLVQFMNALGEI  181

Query  994   ARGAEAPSVYPVWQREFFDARNPPRITCTHFEYEEEPAADSMVTNIPLDNLVHRSFFFGP  815
             +RG   PS+ PVW RE  +AR+PPR+TCTH EYE+ P  D+  T I LD++ HRSFFFGP
Sbjct  182   SRGMNEPSIPPVWYRELLNARDPPRVTCTHREYEQIP--DTKGTIISLDDMDHRSFFFGP  239

Query  814   TEISALRSSLPP---HLLKCSRFEVVTACLWRCRTIAMEFDPNDEVRIFGTVNARPRLKN  644
             TE++A+R+ LPP      + S FE++TACLWRCRTIA++ D ++EVRI   VNAR +  N
Sbjct  240   TEVAAIRALLPPHQQQQHQHSNFEILTACLWRCRTIALQPDTDEEVRIICIVNARGKF-N  298

Query  643   PPVPNGYYGNAFVYPGAKSTAGKVSKSPLSHALELVTNIKSSFTEEYIKSVADLMILKGR  464
             PP+PNG+YGNAF +P A +TAGK+ ++PL +ALELV   K+  TEEY+ S+ADLM+  GR
Sbjct  299   PPLPNGFYGNAFAFPVAVTTAGKLIENPLGYALELVRKAKADVTEEYMHSIADLMVTNGR  358

Query  463   PTFTLQGTFIVSDVTRVGFPEIDMGWGQSVFggpahggvggipGLITFYIPYEDNKGDHG  284
             P FT+  +++VSDVTR GF E++ GWG++V+GGPA GGVG IPG+ +FYIP++++KG+ G
Sbjct  359   PHFTVVRSYLVSDVTRAGFGEVEFGWGKAVYGGPAKGGVGAIPGVASFYIPFKNDKGEEG  418

Query  283   ILVPMCLPAIAMGKFVKELENCL  215
             +++P+CLP  AM +FVKEL++ L
Sbjct  419   LVIPVCLPTQAMERFVKELDHVL  441



>ref|XP_009388282.1| PREDICTED: benzyl alcohol O-benzoyltransferase [Musa acuminata 
subsp. malaccensis]
Length=457

 Score =   552 bits (1423),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 274/456 (60%), Positives = 353/456 (77%), Gaps = 5/456 (1%)
 Frame = -1

Query  1537  PSIAFTVTRQNPELVAPADPTPREIKYLSDIDDQQGLRFQIPVIHFYRNEPSMSGKDPVQ  1358
             PS+ FTV RQ P LVAPA  TP E K LSDIDDQ GLRF IPVI FYRN+PSM G+D  +
Sbjct  3     PSLTFTVRRQKPVLVAPAGSTPHEFKRLSDIDDQDGLRFHIPVIQFYRNDPSMGGRDQAK  62

Query  1357  VIRQALAKALVFFYPFAGRLREGPGRKLMVDCTGEGVMFIEADADATLQHFAVGGELKPP  1178
             VIR+ALA+ALVF+YPFAGRLRE  GRKL+V+CTGEG++FIEADAD  L+ F  G EL+PP
Sbjct  63    VIREALARALVFYYPFAGRLREAAGRKLVVECTGEGILFIEADADVRLEQF--GDELQPP  120

Query  1177  FPCFDQLLYNVPGSAEILNCPLFLIQVTRLRCGGFIFALRLNHSMSDACGLVHFLNTIAE  998
             FPC ++L+YNVPGS  +L+CPL LIQVTRL CGGFIFA+RLNH+MSDA GLV F+N +AE
Sbjct  121   FPCLEELVYNVPGSDGVLDCPLLLIQVTRLLCGGFIFAIRLNHTMSDAPGLVQFMNAVAE  180

Query  997   IARGAEAPSVYPVWQREFFDARNPPRITCTHFEYEEEPAADSMVTNIPLDNLVHRSFFFG  818
             +ARGA APSV P+W RE  +AR+PPR TC H EY++ P  D+  T +PLD++VHRSFFFG
Sbjct  181   LARGAAAPSVPPLWSREILEARSPPRATCKHREYDDVP--DTRGTIVPLDDMVHRSFFFG  238

Query  817   PTEISALRSSLPPHLLKCSRFEVVTACLWRCRTIAMEFDPNDEVRIFGTVNARPRLKNPP  638
               E++ALR  +PPHL   S FE++TACLW+CRTIA+  D ++EVR+   VNAR +  +  
Sbjct  239   KREVAALRRRVPPHLRNSSTFEILTACLWKCRTIAISPDADEEVRMICIVNARGK-SDLG  297

Query  637   VPNGYYGNAFVYPGAKSTAGKVSKSPLSHALELVTNIKSSFTEEYIKSVADLMILKGRPT  458
             +P GYYGNAFV+P A S AGK+  +PL +AL+LV   KS  T+EY++SVADLM+L+GRP 
Sbjct  298   LPVGYYGNAFVFPVAVSKAGKLCANPLGYALDLVRKAKSDVTDEYVRSVADLMVLRGRPH  357

Query  457   FTLQGTFIVSDVTRVGFPEIDMGWGQSVFggpahggvggipGLITFYIPYEDNKGDHGIL  278
             FT+  +++VSDVT+ GF ++D GWG++ +GGPA GGVG IPG+ +FYIP+ + KG+ GI+
Sbjct  358   FTVVRSYLVSDVTKAGFGDVDFGWGKAAYGGPAKGGVGAIPGVASFYIPFRNGKGEDGIV  417

Query  277   VPMCLPAIAMGKFVKELENCLMK**TSSSQNSMHLI  170
             VP+CLP  AM KF  E+E+ + +   +   +S+ LI
Sbjct  418   VPVCLPGPAMEKFTMEMESLIEEPVAAEQHHSLTLI  453



>ref|XP_002264599.1| PREDICTED: benzyl alcohol O-benzoyltransferase [Vitis vinifera]
 emb|CBI26419.3| unnamed protein product [Vitis vinifera]
Length=459

 Score =   551 bits (1419),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 276/447 (62%), Positives = 350/447 (78%), Gaps = 6/447 (1%)
 Frame = -1

Query  1549  MASQPSIAFTVTRQNPELVAPADPTPREIKYLSDIDDQQGLRFQIPVIHFYRNEPSMSGK  1370
             MA  PS+ F+V R  PELVAPA PTP E K LSDIDDQ+GLRFQIPVI FY+  PSM G+
Sbjct  1     MAPPPSLVFSVRRSKPELVAPAKPTPHEFKPLSDIDDQEGLRFQIPVIQFYKKVPSMHGR  60

Query  1369  DPVQVIRQALAKALVFFYPFAGRLREGPGRKLMVDCTGEGVMFIEADADATLQHFAVGGE  1190
             DP +VI+ A+A+ALVF+YPFAGRLRE  GRKL+V+CTGEG++FIEADAD TL+ F  G  
Sbjct  61    DPAKVIKDAVARALVFYYPFAGRLREEAGRKLVVECTGEGIVFIEADADVTLEQF--GDA  118

Query  1189  LKPPFPCFDQLLYNVPGSAEILNCPLFLIQVTRLRCGGFIFALRLNHSMSDACGLVHFLN  1010
             L+PPFP  ++L+Y+ PGS  +LN PL LIQVTRL+CGGFIF LRLNH+MSDA GLV F++
Sbjct  119   LQPPFPGLEELIYDAPGSGGVLNSPLLLIQVTRLQCGGFIFGLRLNHTMSDAAGLVQFMS  178

Query  1009  TIAEIARGAEAPSVYPVWQREFFDARNPPRITCTHFEYEEEPAADSMVTNIPLDNLVHRS  830
              + E+ARGA APS+ PVW+R+  +AR+PPR+T TH EY+E   AD+  T IPLD++ HRS
Sbjct  179   AVGEMARGASAPSIPPVWRRDLLNARDPPRVTRTHHEYDE--VADTKGTIIPLDDMEHRS  236

Query  829   FFFGPTEISALRSSLPPHLLKCSRFEVVTACLWRCRTIAMEFDPNDEVRIFGTVNARPRL  650
             FFFGPTE +ALR  L PHL  CS FE++TACLWRCRTIA+  DP +EVR+   VNAR RL
Sbjct  237   FFFGPTEFAALRRLLSPHLRTCSTFELLTACLWRCRTIALRPDPEEEVRVLCIVNARSRL  296

Query  649   KNPPVPNGYYGNAFVYPGAKSTAGKVSKSPLSHALELVTNIKSSFTEEYIKSVADLMILK  470
             + PP+P GYYGN F +P A S+AGK+ ++PL +AL+LV   K+S  +EY+KSVADLM+  
Sbjct  297   Q-PPLPAGYYGNVFGFPVALSSAGKLCRNPLEYALDLVKGAKNSVDQEYMKSVADLMVST  355

Query  469   GRPTFTLQGTFIVSDVTRVGFPEIDMGWGQSVFggpahggvggipGLITFYIPYEDNKGD  290
             GR  FT+  +++VSD+TR GF ++D GWG++V+GG A GGVG IPG+ +FYIP+ ++KG+
Sbjct  356   GRRHFTVVRSYLVSDLTRAGFGDVDFGWGKAVYGGAAKGGVGAIPGVASFYIPFRNHKGE  415

Query  289   HGILVPMCLPAIAMGKFVKELENCLMK  209
              GI+VP CLPA AM  FVKEL N L+K
Sbjct  416   DGIVVPFCLPAAAMEIFVKEL-NSLLK  441



>dbj|BAE72881.1| benzoyl CoA benzoic acid benzoyltransferase [Verbena x hybrida]
Length=461

 Score =   550 bits (1418),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 272/441 (62%), Positives = 341/441 (77%), Gaps = 5/441 (1%)
 Frame = -1

Query  1531  IAFTVTRQNPELVAPADPTPREIKYLSDIDDQQGLRFQIPVIHFYRNEPSMSGKDPVQVI  1352
             + FTV R  PEL+APA PTPRE+K LSDIDDQ+GLRFQIPVI FYR++P M  K+P +VI
Sbjct  8     LTFTVRRNEPELIAPAKPTPRELKPLSDIDDQEGLRFQIPVIQFYRHDPKMRNKNPARVI  67

Query  1351  RQALAKALVFFYPFAGRLREGPGRKLMVDCTGEGVMFIEADADATLQHFAVGGELKPPFP  1172
             R+ALAK LVF+YPFAGRL+EGP +KLMVDC+GEGV+FIEA+AD TL  F  G  L+PPFP
Sbjct  68    REALAKVLVFYYPFAGRLKEGPAKKLMVDCSGEGVLFIEAEADVTLNQF--GDALQPPFP  125

Query  1171  CFDQLLYNVPGSAEILNCPLFLIQVTRLRCGGFIFALRLNHSMSDACGLVHFLNTIAEIA  992
             C ++LLY+VPGS  +L+ PL LIQVTRL CGGFIFALRLNH+MSDA GLV F+  + E+A
Sbjct  126   CLEELLYDVPGSGGVLDSPLLLIQVTRLLCGGFIFALRLNHTMSDAPGLVQFMTALGEMA  185

Query  991   RGAEAPSVYPVWQREFFDARNPPRITCTHFEYEEEPAADSMVTNIPLDNLVHRSFFFGPT  812
             +GA  PS+ PVWQRE   AR  P +TCTH EY+E    D+  T IPLD++ HRSFFFGPT
Sbjct  186   QGAPRPSILPVWQRELLFARVQPHVTCTHHEYDE--VKDTKGTIIPLDDMAHRSFFFGPT  243

Query  811   EISALRSSLPPHLLKCSRFEVVTACLWRCRTIAMEFDPNDEVRIFGTVNARPRLKNPPVP  632
             E++ALR  +P  L KCS FEV+TACLWRCRTIA++ DP +E+RI   VNAR +  NPP+P
Sbjct  244   EVAALRRFVPSSLQKCSTFEVLTACLWRCRTIALKPDPEEEMRIICIVNARAKF-NPPLP  302

Query  631   NGYYGNAFVYPGAKSTAGKVSKSPLSHALELVTNIKSSFTEEYIKSVADLMILKGRPTFT  452
              GYYGN F +P A S AG +S  PL HAL+LV   K++  +EY++S+ DLM++KGRP FT
Sbjct  303   KGYYGNGFAFPVAISRAGDLSTKPLGHALKLVMQAKNAVNDEYMRSLTDLMVIKGRPHFT  362

Query  451   LQGTFIVSDVTRVGFPEIDMGWGQSVFggpahggvggipGLITFYIPYEDNKGDHGILVP  272
             +  +++VSDVTR GF  +D GWG + +GGPA GGVG IPG+ +FYIP+ ++KG+ GI++P
Sbjct  363   VVRSYLVSDVTRAGFDAVDFGWGNAAYGGPAKGGVGAIPGVASFYIPFTNHKGETGIVLP  422

Query  271   MCLPAIAMGKFVKELENCLMK  209
             +CLP  AM  FVKEL N L K
Sbjct  423   ICLPNAAMETFVKELNNMLAK  443



>gb|EYU41389.1| hypothetical protein MIMGU_mgv1a006154mg [Erythranthe guttata]
Length=455

 Score =   546 bits (1407),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 278/437 (64%), Positives = 350/437 (80%), Gaps = 6/437 (1%)
 Frame = -1

Query  1534  SIAFTVTRQNPELVAPADPTPREIKYLSDIDDQQGLRFQIPVIHFYRNEPSMSGKDPVQV  1355
             ++ F VTRQNPEL+ PA PTP E K LSDIDDQ+GLRFQIPVI FYRN PS+   DPV+V
Sbjct  3     ALTFKVTRQNPELIPPAKPTPHEFKSLSDIDDQEGLRFQIPVIQFYRNIPSVQA-DPVKV  61

Query  1354  IRQALAKALVFFYPFAGRLREGPGRKLMVDCTGEGVMFIEADADATLQHFAVGGELKPPF  1175
             IR A+++ALVF+YPFAGRLRE   RKL+V+CTGEGVMFIEADAD  LQ F  G +L+PPF
Sbjct  62    IRAAISEALVFYYPFAGRLREVADRKLVVECTGEGVMFIEADADVALQQF--GDDLQPPF  119

Query  1174  PCFDQLLYNVPGSAEILNCPLFLIQVTRLRCGGFIFALRLNHSMSDACGLVHFLNTIAEI  995
             PC ++LLY+VPGS+ I+N PL LIQVTRLRCGGFI ALRLNH+MSDA GLV F+  + EI
Sbjct  120   PCLEELLYDVPGSSGIVNSPLLLIQVTRLRCGGFILALRLNHTMSDAFGLVQFMTAVGEI  179

Query  994   ARGAEAPSVYPVWQREFFDARNPPRITCTHFEYEEEPAADSMVTNIPLDNLVHRSFFFGP  815
             ARGA++PS+ PVW+R   +AR PPR+TCTH EY+E P  D+  T IPLD++VHRSFFFG 
Sbjct  180   ARGAKSPSIPPVWERHLLNARAPPRVTCTHREYDEVP--DTKGTIIPLDDMVHRSFFFGA  237

Query  814   TEISALRSSLPPHLLKCSRFEVVTACLWRCRTIAMEFDPNDEVRIFGTVNARPRLKNPPV  635
              EISALR  LPPHL +CS FE++TACLWRCRTIA+  +PN+EVR+   VN R R+ NPP+
Sbjct  238   AEISALRGRLPPHLRRCSTFELLTACLWRCRTIAISPEPNEEVRMLCIVNYRSRI-NPPL  296

Query  634   PNGYYGNAFVYPGAKSTAGKVSKSPLSHALELVTNIKSSFTEEYIKSVADLMILKGRPTF  455
             P GYYGNAF +P A + AG +S +P  +ALEL+   KS  TEEY++S+ADL++++GRP F
Sbjct  297   PKGYYGNAFAFPAAVAAAGDLSSNPFEYALELIRKTKSDVTEEYMRSLADLLVIRGRPHF  356

Query  454   TLQGTFIVSDVTRVGFPEIDMGWGQSVFggpahggvggipGLITFYIPYEDNKGDHGILV  275
             T+  +++VSD+TR G  ++D GWG++V GGPA GGVG IPG+ +FYIP+++ KG++GI+V
Sbjct  357   TVVRSYVVSDLTRAGIGDLDFGWGKAVSGGPAKGGVGAIPGVASFYIPFKNKKGENGIVV  416

Query  274   PMCLPAIAMGKFVKELE  224
             P+CLPA AM  FVKELE
Sbjct  417   PVCLPADAMEVFVKELE  433



>gb|EYU41386.1| hypothetical protein MIMGU_mgv1a006089mg [Erythranthe guttata]
Length=458

 Score =   545 bits (1405),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 276/437 (63%), Positives = 349/437 (80%), Gaps = 6/437 (1%)
 Frame = -1

Query  1534  SIAFTVTRQNPELVAPADPTPREIKYLSDIDDQQGLRFQIPVIHFYRNEPSMSGKDPVQV  1355
             ++ F VTR+NPEL+ PA PTP E K LSDIDDQ+GLRFQIPVI FYRN PS+   DPV+V
Sbjct  3     ALTFKVTRRNPELIPPAKPTPHEFKPLSDIDDQEGLRFQIPVIQFYRNIPSIQA-DPVKV  61

Query  1354  IRQALAKALVFFYPFAGRLREGPGRKLMVDCTGEGVMFIEADADATLQHFAVGGELKPPF  1175
             IR A+++ALVF+YPFAGRLRE   RKL+V+CTGEGVMFIEADAD  LQ F  G +L+PPF
Sbjct  62    IRAAISEALVFYYPFAGRLREVADRKLVVECTGEGVMFIEADADVALQQF--GDDLQPPF  119

Query  1174  PCFDQLLYNVPGSAEILNCPLFLIQVTRLRCGGFIFALRLNHSMSDACGLVHFLNTIAEI  995
             PC D+LLY+VPGS  ++NCPL LIQVTRLRCGGFIFALRLNH+MSDA GLV F++ + EI
Sbjct  120   PCLDELLYDVPGSCGVVNCPLLLIQVTRLRCGGFIFALRLNHTMSDAAGLVQFMSAVGEI  179

Query  994   ARGAEAPSVYPVWQREFFDARNPPRITCTHFEYEEEPAADSMVTNIPLDNLVHRSFFFGP  815
             ARGA++P   PVW+R   +AR PPR+TCTH EY++ P  D+  T IPLD++VHRSFFFG 
Sbjct  180   ARGAKSPLTPPVWERHLLNARAPPRVTCTHREYDDVP--DTKGTIIPLDDMVHRSFFFGA  237

Query  814   TEISALRSSLPPHLLKCSRFEVVTACLWRCRTIAMEFDPNDEVRIFGTVNARPRLKNPPV  635
              EISALR  L PHL +CS FE++TACLWRCRTIA+  DPN+EVR+   VN+R R  NPP+
Sbjct  238   AEISALRGRLSPHLRRCSTFELLTACLWRCRTIAISPDPNEEVRMLCIVNSRSRF-NPPL  296

Query  634   PNGYYGNAFVYPGAKSTAGKVSKSPLSHALELVTNIKSSFTEEYIKSVADLMILKGRPTF  455
             P GYYGNAF +P A + AG++S +P  +ALEL+   KS  TEEY++S+AD+M+++GRP F
Sbjct  297   PKGYYGNAFAFPVAVAAAGELSTNPFEYALELIRKTKSDVTEEYMRSLADMMVIRGRPHF  356

Query  454   TLQGTFIVSDVTRVGFPEIDMGWGQSVFggpahggvggipGLITFYIPYEDNKGDHGILV  275
             T+  +++VSDVT  GF ++D GWG++ +GGPA GGVG IPG+ +FYIP+++  G++GI+V
Sbjct  357   TVVRSYLVSDVTHAGFGDVDFGWGKAAYGGPAKGGVGAIPGVASFYIPFKNKNGENGIVV  416

Query  274   PMCLPAIAMGKFVKELE  224
             P+CLPA AM  FVKELE
Sbjct  417   PVCLPADAMEVFVKELE  433



>ref|XP_011009229.1| PREDICTED: benzyl alcohol O-benzoyltransferase-like [Populus 
euphratica]
Length=456

 Score =   544 bits (1402),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 263/457 (58%), Positives = 337/457 (74%), Gaps = 9/457 (2%)
 Frame = -1

Query  1549  MASQPS-IAFTVTRQNPELVAPADPTPREIKYLSDIDDQQGLRFQIPVIHFYRNEPSMSG  1373
             MAS PS + F V R+ PEL+ PA PTPRE K LSDIDDQ+GLRF IP+IHFYR+ PSM G
Sbjct  1     MASSPSSLVFKVHRREPELIKPAKPTPREFKLLSDIDDQEGLRFHIPLIHFYRHNPSMHG  60

Query  1372  KDPVQVIRQALAKALVFFYPFAGRLREGPGRKLMVDCTGEGVMFIEADADATLQHFAVGG  1193
             KDPV+VIR+A+AK LVF+YPFAGRLREG  RKLMV+CTGEG++FIEADAD TL+ F  G 
Sbjct  61    KDPVKVIREAIAKTLVFYYPFAGRLREGHNRKLMVECTGEGILFIEADADVTLEQF--GD  118

Query  1192  ELKPPFPCFDQLLYNVPGSAEILNCPLFLIQVTRLRCGGFIFALRLNHSMSDACGLVHFL  1013
              L+PPFPC ++LL++VPGS+ +LNCPL LIQV+RL+CGGF+FALRLNH+MSD  GL  F+
Sbjct  119   PLQPPFPCLEELLFDVPGSSGVLNCPLLLIQVSRLKCGGFLFALRLNHTMSDGPGLEQFM  178

Query  1012  NTIAEIARGAEAPSVYPVWQREFFDARNPPRITCTHFEYEEEPAADSMVTNIPLDNLVHR  833
               + E+ARGA APSV PVW+R   +A +PPR+TC H  YEE   A S  + +  D+LVHR
Sbjct  179   AAVGEMARGANAPSVPPVWERHVLNATDPPRVTCRHLAYEE--VAGSTSSILTHDHLVHR  236

Query  832   SFFFGPTEISALRSSLPPHLLKCSRFEVVTACLWRCRTIAMEFDPNDEVRIFGTVNARPR  653
             SFFF P++I+ALR  +PPHL  CS FE++TACLW CRTIA++  PN+E+RI   VNA  +
Sbjct  237   SFFFSPSDITALRRLVPPHLSHCSTFEILTACLWICRTIALQPHPNEEMRIICLVNASGK  296

Query  652   LKNPPVPNGYYGNAFVYPGAKSTAGKVSKSPLSHALELVTNIKSSFTEEYIKSVADLMIL  473
                P +P GYYGN F+   A +TAG++S+ P+ +ALELV   K+  TEEY++S A LM+ 
Sbjct  297   FNPPLLPRGYYGNGFLLLAAVATAGELSRKPIGYALELVRKAKADMTEEYMRSTASLMVS  356

Query  472   KGRPTFTLQGTFIVSDVTRVGFPEIDMGWGQSVFggpahggvggipGLITFYIPYEDNKG  293
             KGRP FT+ GT+IVSD+  VGF ++D GWG +++     G     P L +FYIP+ + KG
Sbjct  357   KGRPLFTVPGTYIVSDLRHVGFEKVDFGWGNAIY----GGTAKAAPELASFYIPFTNKKG  412

Query  292   DHGILVPMCLPAIAMGKFVKELENCLMK**TSSSQNS  182
             + GI+VP CLP+ A+ +F KELE  L     S   NS
Sbjct  413   EDGIVVPFCLPSPAVERFYKELEGMLKGQLVSGGSNS  449



>ref|XP_002319766.1| hypothetical protein POPTR_0013s07230g [Populus trichocarpa]
 gb|EEE95689.1| hypothetical protein POPTR_0013s07230g [Populus trichocarpa]
Length=456

 Score =   540 bits (1390),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 260/461 (56%), Positives = 338/461 (73%), Gaps = 9/461 (2%)
 Frame = -1

Query  1549  MASQPS-IAFTVTRQNPELVAPADPTPREIKYLSDIDDQQGLRFQIPVIHFYRNEPSMSG  1373
             M S PS + F V R+ PEL+ PA PTP E K LSDIDDQ+GLRF +P+I FYR+ PSM G
Sbjct  1     MVSSPSSLVFKVHRREPELIKPAKPTPHEFKLLSDIDDQEGLRFHVPIIQFYRHNPSMHG  60

Query  1372  KDPVQVIRQALAKALVFFYPFAGRLREGPGRKLMVDCTGEGVMFIEADADATLQHFAVGG  1193
             KDPV+VIR+A+AK LVF+YPFAGRLREG  RKLMV+CTGEG++FIEADAD TL+ F  G 
Sbjct  61    KDPVKVIREAIAKTLVFYYPFAGRLREGHNRKLMVECTGEGILFIEADADVTLEQF--GD  118

Query  1192  ELKPPFPCFDQLLYNVPGSAEILNCPLFLIQVTRLRCGGFIFALRLNHSMSDACGLVHFL  1013
              L+PPFPC ++LL++VPGS+ +LNCPL LIQV+RL+CGGF+FALR+NH+MSD  GLV F+
Sbjct  119   PLQPPFPCLEELLFDVPGSSGVLNCPLLLIQVSRLKCGGFLFALRINHTMSDGPGLVQFM  178

Query  1012  NTIAEIARGAEAPSVYPVWQREFFDARNPPRITCTHFEYEEEPAADSMVTNIPLDNLVHR  833
               + E+ARGA APSV PVW+R   +A +PPR+TC H  YEE   A S  + +  D+LVHR
Sbjct  179   AAVGEMARGANAPSVPPVWERHVLNATDPPRVTCRHRAYEE--VAGSKSSILTHDHLVHR  236

Query  832   SFFFGPTEISALRSSLPPHLLKCSRFEVVTACLWRCRTIAMEFDPNDEVRIFGTVNARPR  653
             SFFF P++I+ALR  +PPHL  CS FE++TACLW CRTIA++ DPN+E+R+   VNAR +
Sbjct  237   SFFFSPSDITALRRLVPPHLSHCSTFEILTACLWICRTIALQPDPNEEMRVICLVNAREK  296

Query  652   LKNPPVPNGYYGNAFVYPGAKSTAGKVSKSPLSHALELVTNIKSSFTEEYIKSVADLMIL  473
                P +P GYYGN F    A +TAG++SK P+ +ALELV  +K+  TEE+++S A LM+ 
Sbjct  297   FNPPLLPRGYYGNGFFLLAAVATAGELSKKPIGYALELVRKVKADMTEEHMRSTASLMVS  356

Query  472   KGRPTFTLQGTFIVSDVTRVGFPEIDMGWGQSVFggpahggvggipGLITFYIPYEDNKG  293
             KGRP FT+ GT+IVSD+ R G  + D GWG +++     G    IP L +FYIP+ + KG
Sbjct  357   KGRPLFTVPGTYIVSDLRRAGLEKADFGWGNAIY----GGTAKAIPELASFYIPFTNKKG  412

Query  292   DHGILVPMCLPAIAMGKFVKELENCLMK**TSSSQNSMHLI  170
             + GI+VP CLP+ A+ +F KELE  L     S   NS  ++
Sbjct  413   EDGIVVPFCLPSPAVERFYKELEGMLKGQLVSGGANSKLIV  453



>gb|EYU34530.1| hypothetical protein MIMGU_mgv1a006233mg [Erythranthe guttata]
Length=451

 Score =   538 bits (1386),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 271/437 (62%), Positives = 343/437 (78%), Gaps = 6/437 (1%)
 Frame = -1

Query  1534  SIAFTVTRQNPELVAPADPTPREIKYLSDIDDQQGLRFQIPVIHFYRNEPSMSGKDPVQV  1355
             ++ F VTRQNPEL+ PA PTP E K LSDIDDQ+GLRFQIPVI FYRN P +   DPV V
Sbjct  3     ALTFKVTRQNPELIPPAKPTPHEFKSLSDIDDQEGLRFQIPVIQFYRNIPFIQA-DPVHV  61

Query  1354  IRQALAKALVFFYPFAGRLREGPGRKLMVDCTGEGVMFIEADADATLQHFAVGGELKPPF  1175
             IR A+++ALVF+YPFAGRLRE   RKL+V+CTGEGVMFIEADAD +LQ F  G +L+PPF
Sbjct  62    IRAAISEALVFYYPFAGRLREVADRKLVVECTGEGVMFIEADADVSLQQF--GDDLQPPF  119

Query  1174  PCFDQLLYNVPGSAEILNCPLFLIQVTRLRCGGFIFALRLNHSMSDACGLVHFLNTIAEI  995
             PC ++LLY+VPGS+ I+N PL LIQ TRLRCGGFIFA+RLNH+MSDA GL+ F+  + EI
Sbjct  120   PCLEELLYDVPGSSGIVNTPLLLIQATRLRCGGFIFAVRLNHTMSDAFGLLQFMTAVGEI  179

Query  994   ARGAEAPSVYPVWQREFFDARNPPRITCTHFEYEEEPAADSMVTNIPLDNLVHRSFFFGP  815
             ARGA++PS  PVW+R   +AR PPR+TCTH EY+E P  D+  T IPLD++VHRSFFFG 
Sbjct  180   ARGAKSPSTPPVWERHLLNARAPPRVTCTHREYDEVP--DTKGTIIPLDDMVHRSFFFGA  237

Query  814   TEISALRSSLPPHLLKCSRFEVVTACLWRCRTIAMEFDPNDEVRIFGTVNARPRLKNPPV  635
              EISALR  LPPHL +CS FE++TACLWRCRTIA+  +PN+EVR+   VN R R  N  +
Sbjct  238   AEISALRGRLPPHLRRCSTFELLTACLWRCRTIAISPEPNEEVRMLCIVNYRSRF-NRLL  296

Query  634   PNGYYGNAFVYPGAKSTAGKVSKSPLSHALELVTNIKSSFTEEYIKSVADLMILKGRPTF  455
             P GYYGNAF  P A +TAG +S +P  +ALEL+   KS  TEEY++S+AD+M+++GRP F
Sbjct  297   PKGYYGNAFALPVAIATAGDLSTNPFEYALELIRKAKSEVTEEYMRSLADMMVIRGRPHF  356

Query  454   TLQGTFIVSDVTRVGFPEIDMGWGQSVFggpahggvggipGLITFYIPYEDNKGDHGILV  275
              +  +F+VSD+TR G  ++D G G++V+GGPA GGVG IPG+++FYIP+++ KG++GI+V
Sbjct  357   AVVRSFVVSDLTRAGIGDVDFGLGKAVYGGPAKGGVGAIPGVLSFYIPFKNKKGENGIVV  416

Query  274   PMCLPAIAMGKFVKELE  224
             P+ L A AM  FVKELE
Sbjct  417   PVFLAADAMEVFVKELE  433



>ref|XP_010672751.1| PREDICTED: benzyl alcohol O-benzoyltransferase-like [Beta vulgaris 
subsp. vulgaris]
Length=472

 Score =   537 bits (1383),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 273/457 (60%), Positives = 349/457 (76%), Gaps = 12/457 (3%)
 Frame = -1

Query  1567  MALSPFMASQPSIAFTVTRQNPELVAPADPTPREIKYLSDIDDQQGLRFQIPVIHFYRNE  1388
             MA S    ++ ++ F VTR+ PEL+ PA+PTP E K LSDIDDQ+GLRFQIPVI FYRN 
Sbjct  1     MAQSTAATTKTTLRFNVTRRAPELIPPAEPTPYEFKELSDIDDQEGLRFQIPVIQFYRNM  60

Query  1387  PSMSG------KDPVQVIRQALAKALVFFYPFAGRLREGPGRKLMVDCTGEGVMFIEADA  1226
                SG      +DP +VI++A+AKALV +YPFAGRLRE  GRKL+V+C G+G+MFIEA+A
Sbjct  61    DDHSGGSVLKGRDPARVIKEAVAKALVSYYPFAGRLREKAGRKLVVECNGKGIMFIEAEA  120

Query  1225  DATLQHFAVGGELKPPFPCFDQLLYNVPGSAEILNCPLFLIQVTRLRCGGFIFALRLNHS  1046
             D +L+ F  G  L+PPFPC ++LL++VP S  +L+ PL LIQVTRL+CGGFI ALRLNH+
Sbjct  121   DVSLEDF--GEALQPPFPCLEELLFDVPSSTTVLDSPLILIQVTRLKCGGFILALRLNHT  178

Query  1045  MSDACGLVHFLNTIAEIARGAEAPSVYPVWQREFFDARNPPRITCTHFEYEEEPAADSMV  866
             M+DA GLV F+N +AE+ARGA++PS+ PVW+R    ARNPPR+TC H EYEE   AD+  
Sbjct  179   MADAPGLVQFMNAVAELARGAQSPSIQPVWERHLLSARNPPRVTCEHREYEE--IADTKG  236

Query  865   TNIPLDNLVHRSFFFGPTEISALRSSLPPHLLKCSRFEVVTACLWRCRTIAMEFDPNDEV  686
             T IPLD++VH+SFFFGPTEI+ALR  +P HL K S FE++TACLWRCRTIA++ DP + V
Sbjct  237   TIIPLDDMVHKSFFFGPTEIAALRRFIPQHL-KSSTFEILTACLWRCRTIALQPDPEEIV  295

Query  685   RIFGTVNARPRLKNPPVPNGYYGNAFVYPGAKSTAGKVSKSPLSHALELVTNIKSSFTEE  506
             RI   VNAR  L NP +P+G+YGNAF +P A STAGK++ +P+ +AL L+   KS  T+E
Sbjct  296   RIMCIVNAR-SLFNPSLPSGFYGNAFAFPIALSTAGKLATNPIGYALGLIKKTKSDVTQE  354

Query  505   YIKSVADLMILKGRPTFTLQGTFIVSDVTRVGFPEIDMGWGQSVFggpahggvggipGLI  326
             Y+ S+ADLM+LKGRP FT+  TF+VSDVTR GF ++D GWG   +GGPA GGVG IPG+ 
Sbjct  355   YMASLADLMVLKGRPHFTVVRTFVVSDVTRAGFADLDYGWGPPAYGGPAKGGVGAIPGVA  414

Query  325   TFYIPYEDNKGDHGILVPMCLPAIAMGKFVKELENCL  215
             +FYIP+++  GD GI+VP+CLP  AM  FVKEL   L
Sbjct  415   SFYIPFKNGNGDKGIVVPLCLPGNAMEIFVKELNKLL  451



>gb|ABK96738.1| unknown [Populus trichocarpa x Populus deltoides]
Length=440

 Score =   535 bits (1379),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 260/446 (58%), Positives = 331/446 (74%), Gaps = 9/446 (2%)
 Frame = -1

Query  1549  MASQPS-IAFTVTRQNPELVAPADPTPREIKYLSDIDDQQGLRFQIPVIHFYRNEPSMSG  1373
             MAS PS + F V R+ PEL+ PA PTPRE K LSDIDDQ+GLRF IP+I FYR+ PSM G
Sbjct  1     MASSPSSLVFKVHRREPELIKPAKPTPREFKLLSDIDDQEGLRFHIPLIQFYRHNPSMHG  60

Query  1372  KDPVQVIRQALAKALVFFYPFAGRLREGPGRKLMVDCTGEGVMFIEADADATLQHFAVGG  1193
             KDPV+VIR+A+AK L+F+YPFAGRLREG  RKLMV+CTGEG++FIEADAD TL+ F  G 
Sbjct  61    KDPVKVIREAIAKTLLFYYPFAGRLREGHNRKLMVECTGEGILFIEADADVTLEQF--GD  118

Query  1192  ELKPPFPCFDQLLYNVPGSAEILNCPLFLIQVTRLRCGGFIFALRLNHSMSDACGLVHFL  1013
              L+PPFPC ++LL++VPGS+ +LNCPL LIQV+RL+CGGF+FALRLNH+MSD  GLV F+
Sbjct  119   PLQPPFPCLEELLFDVPGSSGVLNCPLLLIQVSRLKCGGFLFALRLNHTMSDGPGLVQFM  178

Query  1012  NTIAEIARGAEAPSVYPVWQREFFDARNPPRITCTHFEYEEEPAADSMVTNIPLDNLVHR  833
               + E+ARGA APSV PVW+R   +A +PPR++C H  YEE   A S  + I  D+LVHR
Sbjct  179   AAVGEMARGANAPSVPPVWERHVLNATDPPRVSCRHRAYEE--VAGSKSSIITHDHLVHR  236

Query  832   SFFFGPTEISALRSSLPPHLLKCSRFEVVTACLWRCRTIAMEFDPNDEVRIFGTVNARPR  653
             SFFF P+ I+ALR  +P HL  CS FE++TACLW CRTIA++ DPN+E+RI   VNAR +
Sbjct  237   SFFFSPSNITALRKLVPSHLGHCSSFEILTACLWICRTIALQPDPNEEMRIICLVNAREK  296

Query  652   LKNPPVPNGYYGNAFVYPGAKSTAGKVSKSPLSHALELVTNIKSSFTEEYIKSVADLMIL  473
                P +P GYYGN F      +TAG++SK P+ +ALELV   K+  TEEY++S A LM+ 
Sbjct  297   FNPPLLPRGYYGNGFGLLSEVATAGELSKRPIGYALELVKKAKAGMTEEYMRSTASLMVS  356

Query  472   KGRPTFTLQGTFIVSDVTRVGFPEIDMGWGQSVFggpahggvggipGLITFYIPYEDNKG  293
             KGRP FT+ GT+IVSD+ R GF ++D GWG +++     G    IP L +FYIP+ + KG
Sbjct  357   KGRPLFTVPGTYIVSDLRRAGFEKVDFGWGNAIY----GGTAKAIPELASFYIPFTNKKG  412

Query  292   DHGILVPMCLPAIAMGKFVKELENCL  215
             + G++V  CLPA AM +  KELE  L
Sbjct  413   EDGVVVQFCLPAPAMERLFKELEGML  438



>ref|XP_011085894.1| PREDICTED: benzyl alcohol O-benzoyltransferase-like [Sesamum 
indicum]
Length=444

 Score =   535 bits (1378),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 266/447 (60%), Positives = 334/447 (75%), Gaps = 22/447 (5%)
 Frame = -1

Query  1549  MASQPSIAFTVTRQNPELVAPADPTPREIKYLSDIDDQQGLRFQIPVIHFYRNEPSMSGK  1370
             MAS  ++ F VTRQNPEL+ PA PTP E+K LSDIDDQ+GLRFQIP+I FYR  P+M+ K
Sbjct  1     MASANALTFKVTRQNPELIPPAKPTPHELKPLSDIDDQEGLRFQIPLIQFYRRNPAMNRK  60

Query  1369  DPVQVIRQALAKALVFFYPFAGRLREGPGRKLMVDCTGEGVMFIEADADATLQHFAVGGE  1190
             DPV VIR ALA+ALVF+YPFAGRLRE  GRKL+V+CTGEGV+FIEADAD TLQ F     
Sbjct  61    DPVMVIRDALARALVFYYPFAGRLREAAGRKLVVECTGEGVLFIEADADVTLQQFG----  116

Query  1189  LKPPFPCFDQLLYNVPGSAEILNCPLFLIQVTRLRCGGFIFALRLNHSMSDACGLVHFLN  1010
                              S  ++NCPL LIQVTRLRCGGFIFALRLNH+MSDA G+V F+ 
Sbjct  117   ---------------DASGGVVNCPLLLIQVTRLRCGGFIFALRLNHTMSDADGIVQFMA  161

Query  1009  TIAEIARGAEAPSVYPVWQREFFDARNPPRITCTHFEYEEEPAADSMVTNIPLDNLVHRS  830
              + E+ARGAE PSV PVWQR+  +AR+PP + CTH EY++ P  D+  T IPLD++VHRS
Sbjct  162   AVGELARGAEMPSVLPVWQRDLLNARDPPHVCCTHHEYDDVP--DTKGTLIPLDDMVHRS  219

Query  829   FFFGPTEISALRSSLPPHLLKCSRFEVVTACLWRCRTIAMEFDPNDEVRIFGTVNARPRL  650
             FFFG  EIS+LR  LP HL  C+ FE++ AC+WRCRTIA+  DPN+EVR    VN+R R 
Sbjct  220   FFFGVAEISSLRRLLPSHLRSCTTFELLAACVWRCRTIAISPDPNEEVRFLCIVNSRKRF  279

Query  649   KNPPVPNGYYGNAFVYPGAKSTAGKVSKSPLSHALELVTNIKSSFTEEYIKSVADLMILK  470
              NPP+P GYYGNAF +P A STA K+SK+PL +ALELV   K+  TEEY+KSVADLM+++
Sbjct  280   -NPPLPAGYYGNAFAFPAAISTAEKLSKNPLGYALELVRKTKADVTEEYMKSVADLMVIR  338

Query  469   GRPTFTLQGTFIVSDVTRVGFPEIDMGWGQSVFggpahggvggipGLITFYIPYEDNKGD  290
             GRP FT+  T++VS+V   GF ++D GWG + +GGPA GG+  + G+++FY+  ++NKG+
Sbjct  339   GRPFFTVVRTYLVSNVIHAGFGDVDFGWGNAAYGGPAKGGIDPVLGVVSFYVASKNNKGE  398

Query  289   HGILVPMCLPAIAMGKFVKELENCLMK  209
             +GI+VP+CL A AM  FVKELE  L +
Sbjct  399   NGIVVPICLAANAMEVFVKELEKMLKR  425



>ref|XP_007029777.1| Benzoyl coenzyme A: Benzyl alcohol benzoyl transferase, putative 
[Theobroma cacao]
 gb|EOY10279.1| Benzoyl coenzyme A: Benzyl alcohol benzoyl transferase, putative 
[Theobroma cacao]
Length=471

 Score =   535 bits (1378),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 256/465 (55%), Positives = 334/465 (72%), Gaps = 10/465 (2%)
 Frame = -1

Query  1573  LIMALSPFMASQP-SIAFTVTRQNPELVAPADPTPREIKYLSDIDDQQGLRFQIPVIHFY  1397
             ++M+ +  M  QP S+ FTV R  PELV PA PTPRE+K LSDIDDQ+ LR QIP+I FY
Sbjct  9     ILMSTTSTMVPQPTSLVFTVRRCEPELVKPARPTPRELKLLSDIDDQECLRTQIPIIQFY  68

Query  1396  RNEPSMSGKDPVQVIRQALAKALVFFYPFAGRLREGPGRKLMVDCTGEGVMFIEADADAT  1217
             +  PSM GKDP +VIR+AL K LVF+YPFAGRLREGP  KLMVDCTG+GV+FIEADAD  
Sbjct  69    KYNPSMQGKDPAKVIREALGKTLVFYYPFAGRLREGPNGKLMVDCTGDGVLFIEADADVK  128

Query  1216  LQHFAVGGELKPPFPCFDQLLYNVPGSAEILNCPLFLIQVTRLRCGGFIFALRLNHSMSD  1037
             L+ F  G  L+PPFPC DQLLY+VPGS EILNCPL LIQVT ++CGG IFALRLNH+M+D
Sbjct  129   LEQF--GEALQPPFPCLDQLLYDVPGSGEILNCPLLLIQVTTMKCGGIIFALRLNHTMAD  186

Query  1036  ACGLVHFLNTIAEIARGAEAPSVYPVWQREFFDARNPPRITCTHFEYEEEPAADSMVTNI  857
               GL  F++ +AE+A+GA +PS+ PVW+R     R PP++TCTH EY++     S     
Sbjct  187   GAGLFQFISAMAEMAQGAISPSILPVWERHLLSCRTPPQVTCTHHEYDKVDDIKSCTNFT  246

Query  856   PLDNLVHRSFFFGPTEISALRSSLPPHLLKCSRFEVVTACLWRCRTIAMEFDPNDEVRIF  677
             PL+N+VHRSFFF P++I+A+R  +P HL  CS FEV+TACLWR RT+A++FDP+++VR+ 
Sbjct  247   PLENMVHRSFFFNPSDITAIRRFVPSHLRHCSTFEVLTACLWRYRTLALQFDPDEQVRLL  306

Query  676   GTVNARPRLKNPPVPNGYYGNAFVYPGAKSTAGKVSKSPLSHALELVTNIKSSFTEEYIK  497
               VN R +  NPP+P GYYGNA VYP A +TAGK+ ++PL +A+ELV   K S TEEY+K
Sbjct  307   CIVNVRSKF-NPPLPKGYYGNAIVYPVAVTTAGKLCQNPLGYAIELVKQTKKSVTEEYVK  365

Query  496   SVADLMILKGRPTFTLQGTFIVSDVTRVGFPEIDMGWGQSVFggpahggvggipGLITFY  317
             SVAD +  KGRP  +L   ++VSD     F ++D GWG++++      G      + +F 
Sbjct  366   SVADFLATKGRPPVSLVRVYLVSDARHAKFSDVDFGWGKAMY------GGPAKGVVASFQ  419

Query  316   IPYEDNKGDHGILVPMCLPAIAMGKFVKELENCLMK**TSSSQNS  182
             IP+ + KG++G++VP+ LPA AM +FV+EL   L      S  NS
Sbjct  420   IPHRNKKGENGLVVPIYLPASAMERFVRELNRMLKDHPAGSRSNS  464



>ref|XP_010038484.1| PREDICTED: benzyl alcohol O-benzoyltransferase-like [Eucalyptus 
grandis]
 ref|XP_010038489.1| PREDICTED: benzyl alcohol O-benzoyltransferase-like [Eucalyptus 
grandis]
 gb|KCW84617.1| hypothetical protein EUGRSUZ_B01448 [Eucalyptus grandis]
Length=458

 Score =   533 bits (1373),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 271/461 (59%), Positives = 349/461 (76%), Gaps = 8/461 (2%)
 Frame = -1

Query  1549  MASQPSIAFTVTRQNPELVAPADPTPREIKYLSDIDDQQGLRFQIPVIHFYRNEPSMSGK  1370
             MA Q S+ F V R   ELV PA PTPRE K LSD+DDQ+GLRFQIP IHFY  +   SG+
Sbjct  1     MAPQDSLVFKVRRCEAELVRPARPTPREHKRLSDVDDQEGLRFQIPAIHFYPGD--GSGR  58

Query  1369  DPVQVIRQALAKALVFFYPFAGRLREGPG-RKLMVDCTGEGVMFIEADADATLQHFAVGG  1193
             DP + IR+ LA+ALVF+YPFAGRLRE PG RKL+VDC  EGV+F+EADAD TL  F  G 
Sbjct  59    DPARAIREGLARALVFYYPFAGRLRELPGSRKLVVDCNEEGVLFVEADADVTLDQF--GD  116

Query  1192  ELKPPFPCFDQLLYNVPGSAEILNCPLFLIQVTRLRCGGFIFALRLNHSMSDACGLVHFL  1013
              L+PPFPC ++L+++VPGS+ +L+ P+ LIQVTRL+CGGFIFA+RLNH+MSDA GLV F+
Sbjct  117   ALQPPFPCLEELIFDVPGSSAVLDAPVLLIQVTRLKCGGFIFAVRLNHAMSDAAGLVQFM  176

Query  1012  NTIAEIARGAEAPSVYPVWQREFFDARNPPRITCTHFEYEEEPAADSMVTNIPLDNLVHR  833
               + E+A+GA+APSV PVWQRE  DAR+PPRITCTH EYE+    D+  T IPLD++ HR
Sbjct  177   TAVGEMAKGADAPSVLPVWQRELLDARDPPRITCTHREYEQ--VEDTKGTLIPLDDMEHR  234

Query  832   SFFFGPTEISALRSSLPPHLLKCSRFEVVTACLWRCRTIAMEFDPNDEVRIFGTVNARPR  653
             SFFFG  ++SALRS +PPH    S FEV+TACLWRCRTIA++ DP +EVR+    NAR +
Sbjct  235   SFFFGAAQMSALRSRVPPHQRASSTFEVLTACLWRCRTIAIQPDPEEEVRVLCIGNARTK  294

Query  652   LKNPPVPNGYYGNAFVYPGAKSTAGKVSKSPLSHALELVTNIKSSFTEEYIKSVADLMIL  473
               NPP+P GYYGNAF +P A + A K+ ++PL +ALELV   K+  TEEY++S+ADLM+L
Sbjct  295   F-NPPLPAGYYGNAFAFPVAVTRADKLCQNPLGYALELVKKAKADVTEEYMRSLADLMVL  353

Query  472   KGRPTFTLQGTFIVSDVTRVGFPEIDMGWGQSVFggpahggvggipGLITFYIPYEDNKG  293
             +GRP FT+  +F+VSD T+ GF  +D GWG+ V+GGPA GGVG IPG+ +FYIP+ + +G
Sbjct  354   RGRPHFTVVRSFLVSDTTKAGFGNVDFGWGKPVYGGPAKGGVGAIPGVASFYIPFRNREG  413

Query  292   DHGILVPMCLPAIAMGKFVKELENCLMK**TSSSQNSMHLI  170
             ++GI+VP+CLPA AM  FV+EL+  L     S++ N    +
Sbjct  414   ENGIVVPVCLPAPAMRIFVQELDALLKDPPPSTTTNKSTFV  454



>ref|XP_011098396.1| PREDICTED: benzyl alcohol O-benzoyltransferase-like [Sesamum 
indicum]
Length=460

 Score =   532 bits (1371),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 262/442 (59%), Positives = 336/442 (76%), Gaps = 7/442 (2%)
 Frame = -1

Query  1549  MASQPSIAFTVTRQNPELVAPADPTPREIKYLSDIDDQQGLRFQIPVIHFYRNEPSMSGK  1370
             MAS+ ++ F VTRQ+PEL+ PA PTP E+K LSDIDDQ+ LRFQ+P I FYR  P+M GK
Sbjct  1     MASKHTLTFKVTRQDPELIPPAKPTPHELKPLSDIDDQESLRFQVPAIQFYRRNPAMDGK  60

Query  1369  DPVQVIRQALAKALVFFYPFAGRLREGPGRKLMVDCTGEGVMFIEADADATLQHFAVGGE  1190
             DPV VIR A+++ALVF+YP AGRLRE  GRKL+V+CTGEGV+FIEA AD TLQ F  G  
Sbjct  61    DPVMVIRDAVSRALVFYYPLAGRLREAAGRKLVVECTGEGVLFIEAVADVTLQQF--GDA  118

Query  1189  LKPPFPCFDQLLYNVPGSAEILNCPLFLIQVTRLRCGGFIFALRLNHSMSDACGLVHFLN  1010
             L PPFPC ++LLY+VPGS  ++NCPL LIQVTRL+CGGFIFA+RLNH+MSDA GL  F++
Sbjct  119   LLPPFPCLEELLYDVPGSGGVVNCPLLLIQVTRLKCGGFIFAIRLNHTMSDAVGLAQFMS  178

Query  1009  TIAEIARGAEAPSVYPVWQREFFDARNPPRITCTHFEYEEEPAADSMVTNIPLDNLVHRS  830
              + E+ARGA+ PSV PVW+R+   AR+PP I+CTH EY++    D   T IP D++V+RS
Sbjct  179   AVGELARGAKIPSVQPVWRRDLLSARDPPYISCTHREYDD--VLDIKGTLIPPDDMVYRS  236

Query  829   FFFGPTEISALRSSLPPHLLKCSRFEVVTACLWRCRTIAMEFDPNDEVRIFGTVNARPRL  650
             FFFG TEISALR  LPPHL  CS FE++TACLWRCRTIA+  DP  EVR+   VN+R R 
Sbjct  237   FFFGATEISALRERLPPHLRHCSTFELLTACLWRCRTIAITPDPKKEVRVLCAVNSRKRF  296

Query  649   KNPPVPNGYYGNAFVYPGAKSTAGKVSKSPLSHALELVTNIKSSFTEEYIKSVADLMILK  470
              NPP+P GYYGN  V   A +TA  ++K PL++ALELV   K+S TEEY+KS+ADLM+++
Sbjct  297   -NPPLPTGYYGNVLVLGVAIATAENLTKRPLAYALELVRKAKASITEEYMKSLADLMVIR  355

Query  469   GRPTF-TLQGTFIVSDVTRVGFPEIDMGWGQSVFggpahggvggipGLITFYIPYEDNKG  293
             GRP F  +Q  ++V+DV   GF ++D GWG++V+ G     +G IPG+ + YIP+++N G
Sbjct  356   GRPHFPMVQTYYLVNDVRHAGFRDVDFGWGKAVY-GGPAISIGAIPGVTSLYIPFKNNNG  414

Query  292   DHGILVPMCLPAIAMGKFVKEL  227
             ++ I+VP+CL A AM  FVKEL
Sbjct  415   ENEIVVPICLAAKAMEVFVKEL  436



>gb|KEH40970.1| benzyl alcohol O-benzoyltransferase [Medicago truncatula]
Length=436

 Score =   530 bits (1366),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 264/440 (60%), Positives = 339/440 (77%), Gaps = 28/440 (6%)
 Frame = -1

Query  1534  SIAFTVTRQNPELVAPADPTPREIKYLSDIDDQQGLRFQIPVIHFYRNEPSMSGKDPVQV  1355
             S+ FTV R  PE V P+ PTP EIK LSDIDDQ+GLRFQIPVI FY+ +P+M        
Sbjct  4     SLLFTVKRSAPEFVRPSKPTPHEIKLLSDIDDQEGLRFQIPVIQFYKYDPNM--------  55

Query  1354  IRQALAKALVFFYPFAGRLREGPGRKLMVDCTGEGVMFIEADADATLQHFAVGGELKPPF  1175
                            AGRLREGPGRKLMVDCTGEGV+FIEADAD +L+ F  G  L+PPF
Sbjct  56    ---------------AGRLREGPGRKLMVDCTGEGVLFIEADADVSLKEF--GDALQPPF  98

Query  1174  PCFDQLLYNVPGSAEILNCPLFLIQVTRLRCGGFIFALRLNHSMSDACGLVHFLNTIAEI  995
             PC D+LL++VPGS+E+LNCPL +IQVTRL+CGGFIFALRLNH+MSDA GLV F++ + EI
Sbjct  99    PCLDELLFDVPGSSEVLNCPLLVIQVTRLKCGGFIFALRLNHTMSDAAGLVQFMSALGEI  158

Query  994   ARGAEAPSVYPVWQREFFDARNPPRITCTHFEYEEEPAADSMVTNIPLDNLVHRSFFFGP  815
             + G   PS+ PVW RE  ++R+PPR+TCTH EYE+ P  D+  T IPLD++ HRSFFFGP
Sbjct  159   SCGMNEPSILPVWHRELLNSRDPPRVTCTHREYEQVP--DTKGTIIPLDDMAHRSFFFGP  216

Query  814   TEISALRSSLPPHLLKCSRFEVVTACLWRCRTIAMEFDPNDEVRIFGTVNARPRLKNPPV  635
             TE++ +R+ LPPH  K S FE++TACLWRCRTIA++ D ++EVRI   VNAR +  NPP+
Sbjct  217   TEVAKIRALLPPHQQKQSNFEILTACLWRCRTIALQPDTDEEVRIICIVNARGKF-NPPL  275

Query  634   PNGYYGNAFVYPGAKSTAGKVSKSPLSHALELVTNIKSSFTEEYIKSVADLMILKGRPTF  455
             PNGYYGNAF +P A +TAGK+ ++PL +ALELV   KS  T+EY+ SVADLM++KGRP F
Sbjct  276   PNGYYGNAFAFPVAVTTAGKLMENPLGYALELVKKAKSDVTQEYMHSVADLMVIKGRPHF  335

Query  454   TLQGTFIVSDVTRVGFPEIDMGWGQSVFggpahggvggipGLITFYIPYEDNKGDHGILV  275
             T+  +++VSDVTR GF +++ GWG++V+GGPA GGVG IPG+ +FYIP+++ KG+ G+++
Sbjct  336   TVVRSYLVSDVTRAGFGDVEFGWGKAVYGGPAKGGVGAIPGVASFYIPFKNAKGEEGLVI  395

Query  274   PMCLPAIAMGKFVKELENCL  215
             P+CLPA AM KFVKEL++ L
Sbjct  396   PLCLPAQAMEKFVKELDSVL  415



>ref|XP_002319765.2| hypothetical protein POPTR_0013s07220g [Populus trichocarpa]
 gb|EEE95688.2| hypothetical protein POPTR_0013s07220g [Populus trichocarpa]
Length=440

 Score =   527 bits (1357),  Expect = 8e-180, Method: Compositional matrix adjust.
 Identities = 255/446 (57%), Positives = 329/446 (74%), Gaps = 9/446 (2%)
 Frame = -1

Query  1549  MASQPS-IAFTVTRQNPELVAPADPTPREIKYLSDIDDQQGLRFQIPVIHFYRNEPSMSG  1373
             MAS PS + F V R+ PEL+ PA PTP E K LSDIDDQ+GLR+ IP I FYR+ PS+ G
Sbjct  1     MASSPSSLVFKVHRREPELIKPAKPTPHEFKLLSDIDDQEGLRYHIPFIQFYRHNPSLQG  60

Query  1372  KDPVQVIRQALAKALVFFYPFAGRLREGPGRKLMVDCTGEGVMFIEADADATLQHFAVGG  1193
             KDPV+VIR+A+AK LVF+YPFAGRL  G  RKLMV+CTGEG++FIEADAD TL+ F  G 
Sbjct  61    KDPVKVIREAIAKTLVFYYPFAGRLMAGHNRKLMVECTGEGILFIEADADVTLEQF--GD  118

Query  1192  ELKPPFPCFDQLLYNVPGSAEILNCPLFLIQVTRLRCGGFIFALRLNHSMSDACGLVHFL  1013
              L+PPFPC ++LL++VPGS+ +LNCPL LIQV+RL+CGGF+F+LRLNH+MSD  GLV F+
Sbjct  119   PLQPPFPCLEELLFDVPGSSGVLNCPLLLIQVSRLKCGGFLFSLRLNHTMSDGPGLVQFM  178

Query  1012  NTIAEIARGAEAPSVYPVWQREFFDARNPPRITCTHFEYEEEPAADSMVTNIPLDNLVHR  833
               + E+ARGA APSV PVW+R   +A +PPR++C H  YEE   A S  + +  D+LVHR
Sbjct  179   AAVGEMARGASAPSVPPVWERHVLNATDPPRVSCRHRAYEE--VAGSKSSILTHDHLVHR  236

Query  832   SFFFGPTEISALRSSLPPHLLKCSRFEVVTACLWRCRTIAMEFDPNDEVRIFGTVNARPR  653
             SFFF P++I+ALR  +PPHL  CS FE++TACLW CR IA++ DPN+E+RI   VNAR +
Sbjct  237   SFFFSPSDITALRKLVPPHLGYCSSFEILTACLWICRAIALQPDPNEEMRIICLVNAREK  296

Query  652   LKNPPVPNGYYGNAFVYPGAKSTAGKVSKSPLSHALELVTNIKSSFTEEYIKSVADLMIL  473
                P +P GYYGN F    A +TAG++SK P+ +ALELV   K+  TEEY++S A LM+ 
Sbjct  297   FNPPLLPRGYYGNGFGLLAAVATAGELSKRPIGYALELVKKAKAGMTEEYMRSTASLMVS  356

Query  472   KGRPTFTLQGTFIVSDVTRVGFPEIDMGWGQSVFggpahggvggipGLITFYIPYEDNKG  293
             KGRP FT+ GT+IVSD+ R GF ++D GWG +++     G    IP L +FYIP+ + KG
Sbjct  357   KGRPLFTVPGTYIVSDLRRAGFEKVDFGWGNALY----GGTAKAIPELASFYIPFTNKKG  412

Query  292   DHGILVPMCLPAIAMGKFVKELENCL  215
             + G++V  CLPA AM +  KELE  L
Sbjct  413   EDGVVVQFCLPAPAMERLFKELEGML  438



>gb|KEH40969.1| benzyl alcohol O-benzoyltransferase [Medicago truncatula]
Length=458

 Score =   526 bits (1355),  Expect = 3e-179, Method: Compositional matrix adjust.
 Identities = 251/442 (57%), Positives = 333/442 (75%), Gaps = 5/442 (1%)
 Frame = -1

Query  1534  SIAFTVTRQNPELVAPADPTPREIKYLSDIDDQQGLRFQIPVIHFYRNEPSMSGKDPVQV  1355
             ++ FTV R+ PEL+ P+ PTP E K LSDIDDQ  LR+Q+P I FY+ +P+M+GKDPV +
Sbjct  4     ALVFTVKRREPELITPSKPTPHETKLLSDIDDQDSLRWQVPGIQFYKYDPNMAGKDPVDI  63

Query  1354  IRQALAKALVFFYPFAGRLREGPGRKLMVDCTGEGVMFIEADADATLQHFAVGGELKPPF  1175
             IR+ALAK LVF+YPFAGRLREGPGRKLMVDCTGEGV+FIEADAD +L+ F  G +L PPF
Sbjct  64    IRKALAKTLVFYYPFAGRLREGPGRKLMVDCTGEGVLFIEADADVSLKEF--GEDLHPPF  121

Query  1174  PCFDQLLYNVPGSAEILNCPLFLIQVTRLRCGGFIFALRLNHSMSDACGLVHFLNTIAEI  995
             PC D+LLY+VPGS+++LN PL LIQVTRL+CGGFIFA R+NH+MSD  G++ FLN + EI
Sbjct  122   PCIDELLYDVPGSSDMLNTPLLLIQVTRLKCGGFIFAFRMNHTMSDGSGMLQFLNALGEI  181

Query  994   ARGAEAPSVYPVWQREFFDARNPPRITCTHFEYEEEPAADSMVTNIPLDNLVHRSFFFGP  815
             +RG   PS+ PVW RE  +AR+PP +TCTH EY+ EP  D+  T  PLD++VHR+FF GP
Sbjct  182   SRGMSKPSISPVWSRELLNARDPPIVTCTHREYDPEP--DNKGTMFPLDDMVHRTFFIGP  239

Query  814   TEISALRSSLPPH-LLKCSRFEVVTACLWRCRTIAMEFDPNDEVRIFGTVNARPRLKNPP  638
             TE++A+RS LP H L K S FEV+ A  WRCRTIA++ D N+EVR+   V+AR +     
Sbjct  240   TEVAAIRSLLPTHQLQKYSNFEVIAAYFWRCRTIALQLDSNEEVRMICLVDARNKSVYKQ  299

Query  637   VPNGYYGNAFVYPGAKSTAGKVSKSPLSHALELVTNIKSSFTEEYIKSVADLMILKGRPT  458
             +P GYYGNA  +P A +TAGK+ ++PL +AL LV   K++  +EY+ SVADLM++KGRP 
Sbjct  300   LPKGYYGNAIAFPVAVTTAGKLIENPLEYALNLVKKAKANVNKEYMHSVADLMVIKGRPP  359

Query  457   FTLQGTFIVSDVTRVGFPEIDMGWGQSVFggpahggvggipGLITFYIPYEDNKGDHGIL  278
              T  G ++VSD+TR G  +++ GWG++++GG A GG   IPG   F+IP+++ KG+ G++
Sbjct  360   LTTAGLYLVSDITRAGLGDVEFGWGKALYGGMAKGGDVAIPGQAVFHIPFKNAKGEEGLV  419

Query  277   VPMCLPAIAMGKFVKELENCLM  212
             +P  LPA  M + VKE  + LM
Sbjct  420   IPFFLPAQVMERLVKEFHSLLM  441



>ref|XP_007029776.1| Benzoyl coenzyme A: Benzyl alcohol benzoyl transferase [Theobroma 
cacao]
 gb|EOY10278.1| Benzoyl coenzyme A: Benzyl alcohol benzoyl transferase [Theobroma 
cacao]
Length=540

 Score =   528 bits (1360),  Expect = 8e-179, Method: Compositional matrix adjust.
 Identities = 252/440 (57%), Positives = 325/440 (74%), Gaps = 11/440 (3%)
 Frame = -1

Query  1534  SIAFTVTRQNPELVAPADPTPREIKYLSDIDDQQGLRFQIPVIHFYRNEPSMSGKDPVQV  1355
             S+AF V R  PELV PA PTPRE K LSDIDD++G RF+ PVI FYR  PSM G+DP +V
Sbjct  103   SLAFKVRRCEPELVVPAKPTPREYKPLSDIDDREGHRFEYPVIQFYRYSPSMQGRDPARV  162

Query  1354  IRQALAKALVFFYPFAGRLREGPGRKLMVDCTGEGVMFIEADADATLQHFAVGGELKPPF  1175
             IR ALAK LVF+YP+AGRLREGP RKL VDCTGEGV+F E DAD TL+ F  G EL+PPF
Sbjct  163   IRDALAKTLVFYYPYAGRLREGPNRKLTVDCTGEGVLFSEGDADVTLEQF--GEELQPPF  220

Query  1174  PCFDQLLYNVPGSAEILNCPLFLIQVTRLRCGGFIFALRLNHSMSDACGLVHFLNTIAEI  995
             PC ++LLY+VPG   +LNCPL LIQVTRL+CGGFIFALR NH+MSDA GLV F++ + E+
Sbjct  221   PCMEELLYDVPGYGGVLNCPLLLIQVTRLKCGGFIFALRHNHTMSDAIGLVQFMSAMGEM  280

Query  994   ARGAEAPSVYPVWQREFFDARNPPRITCTHFEYEEEPAADSMVTNIPLDNLVHRSFFFGP  815
             ARGA AP++ PVW+R   +ARNPPRITCTH E+E+    ++ +    LDN+VHRSFFFGP
Sbjct  281   ARGALAPTISPVWERHLLNARNPPRITCTHHEFEQVIHTNANIIT-QLDNMVHRSFFFGP  339

Query  814   TEISALRSSLPPHLLKCSRFEVVTACLWRCRTIAMEFDPNDEVRIFGTVNARPRLKNPPV  635
              ++SALR   PPH  +CS F+++ ACLWRC TIA++ DPN++V I   VNAR +  NPP+
Sbjct  340   KQVSALRRFAPPH-RRCSTFDIIAACLWRCHTIALQLDPNEDVGIICVVNARSKF-NPPL  397

Query  634   PNGYYGNAFVYPGAKSTAGKVSKSPLSHALELVTNIKSSFTEEYIKSVADLMILKGRPTF  455
             P GYYGNA  YP   +T GK+ ++PL +A+ELV   K+  TEEY+KS AD ++ +GRP  
Sbjct  398   PLGYYGNAIAYPATLTTVGKLCQNPLWYAIELVKQTKAKVTEEYMKSTADFLVTRGRPAL  457

Query  454   TLQGTFIVSDVTRVGFPEIDMGWGQSVFggpahggvggipGLITFYIPYEDNKGDHGILV  275
             +L  +F+VSDVTR  F ++D GWG++ + G A    G      +  +P+ + KG+ GI++
Sbjct  458   SLTRSFLVSDVTRAKFEDVDFGWGKAAYAGQAKIMDG------SHLLPFTNKKGEDGIIM  511

Query  274   PMCLPAIAMGKFVKELENCL  215
             P+CLPA  M +FVKEL++ L
Sbjct  512   PICLPATLMERFVKELDSML  531



>sp|Q8GT21.1|BEBT_CLABR RecName: Full=Benzyl alcohol O-benzoyltransferase; AltName: Full=Benzoyl 
coenzyme A:benzyl alcohol benzoyl transferase [Clarkia 
breweri]
 gb|AAN09796.1| benzoyl coenzyme A: benzyl alcohol benzoyl transferase [Clarkia 
breweri]
Length=456

 Score =   524 bits (1349),  Expect = 2e-178, Method: Compositional matrix adjust.
 Identities = 266/447 (60%), Positives = 336/447 (75%), Gaps = 9/447 (2%)
 Frame = -1

Query  1549  MASQPSIAFTVTRQNPELVAPADPTPREIKYLSDIDDQQGLRFQIPVIHFYR-NEPSMSG  1373
             MA   S++F V R+ PEL+ PA  TP E K LSD++DQ+GLRFQIPVI FY+ N  SM  
Sbjct  1     MAHDQSLSFEVCRRKPELIRPAKQTPHEFKKLSDVEDQEGLRFQIPVIQFYKHNNESMQE  60

Query  1372  KDPVQVIRQALAKALVFFYPFAGRLREGPGRKLMVDCTGEGVMFIEADADATLQHFAVGG  1193
             +DPVQVIR+ +A+ALV++YPFAGRLRE  GRKL+V+CTGEGVMFIEADAD TL+ F  G 
Sbjct  61    RDPVQVIREGIARALVYYYPFAGRLREVDGRKLVVECTGEGVMFIEADADVTLEQF--GD  118

Query  1192  ELKPPFPCFDQLLYNVPGSAEILNCPLFLIQVTRLRCGGFIFALRLNHSMSDACGLVHFL  1013
              L+PPFPCFDQLL++VPGS  IL+ PL LIQVTRL+CG FIFALRLNH+M+DA G+V F+
Sbjct  119   ALQPPFPCFDQLLFDVPGSGGILDSPLLLIQVTRLKCGSFIFALRLNHTMADAAGIVLFM  178

Query  1012  NTIAEIARGAEAPSVYPVWQREFFDARNPPRITCTHFEYEEEPAADSMVTNIPLDNLVHR  833
               + E+ARGA  PS  PVW R   +AR PP++T  H EYEE     ++ T  P D+L HR
Sbjct  179   KAVGEMARGAATPSTLPVWDRHILNARVPPQVTFNHREYEE--VKGTIFT--PFDDLAHR  234

Query  832   SFFFGPTEISALRSSLPPHLLKCSR-FEVVTACLWRCRTIAMEFDPNDEVRIFGTVNARP  656
             SFFFG TEISA+R  +PPHL  CS   EV+TACLWRCRT+A++ +P++EVR+   VNAR 
Sbjct  235   SFFFGSTEISAMRKQIPPHLRSCSTTIEVLTACLWRCRTLAIKPNPDEEVRMICIVNARS  294

Query  655   RLKNPPVPNGYYGNAFVYPGAKSTAGKVSKSPLSHALELVTNIKSSFTEEYIKSVADLMI  476
             +  NPP+P+GYYGNAF  P A +TAGK+  +PL  ALEL+   K   TEEY+ SVADLM+
Sbjct  295   KF-NPPLPDGYYGNAFAIPAAVTTAGKLCNNPLGFALELIRKAKREVTEEYMHSVADLMV  353

Query  475   LKGRPTFTLQGTFIVSDVTRVGFPEIDMGWGQSVFggpahggvggipGLITFYIPYEDNK  296
               GRP FT+  T++VSDVTR GF E+D GWG++V+GGPA GGVG IPG+ +FYIP  + +
Sbjct  354   ATGRPHFTVVNTYLVSDVTRAGFGEVDFGWGEAVYGGPAKGGVGVIPGVTSFYIPLRNRQ  413

Query  295   GDHGILVPMCLPAIAMGKFVKELENCL  215
             G+ GI++P+CLP+ AM  F + L N L
Sbjct  414   GEKGIVLPICLPSAAMEIFAEALNNTL  440



>ref|XP_003521737.1| PREDICTED: benzyl alcohol O-benzoyltransferase-like [Glycine 
max]
Length=475

 Score =   524 bits (1350),  Expect = 3e-178, Method: Compositional matrix adjust.
 Identities = 262/446 (59%), Positives = 338/446 (76%), Gaps = 8/446 (2%)
 Frame = -1

Query  1543  SQPSIAFTVTRQNPELVAPADPTPREIKYLSDIDDQQGLRFQIPVIHFYRNEPSMSGKDP  1364
             S PS+ FTV R  PELVAPA PTPRE+K LSDIDDQQGLRFQIP I FY NEPSM+GKDP
Sbjct  4     SSPSLVFTVQRCQPELVAPAKPTPREVKPLSDIDDQQGLRFQIPFILFYGNEPSMAGKDP  63

Query  1363  VQVIRQALAKALVFFYPFAGRLREGPGRKLMVDCTGEGVMFIEADADATLQHFAVGGELK  1184
              +VIR+ALA+ LVF+YPFAGR+REGPGRKL+VDCTGEG+MFIEADADATL    +G  L+
Sbjct  64    AKVIREALAQTLVFYYPFAGRIREGPGRKLVVDCTGEGLMFIEADADATLDQ--LGDTLQ  121

Query  1183  PPFPCFDQLLYNVPGSAEILNCPLFLIQVTRLRCGGFIFALRLNHSMSDACGLVHFLNTI  1004
             PPFPCF+QLLY+VPGS  +++CPL L QVTR +CGGF  A+RLNH+MSD  G+  F+NT+
Sbjct  122   PPFPCFEQLLYDVPGSEGVIDCPLMLFQVTRFKCGGFALAVRLNHTMSDGAGIALFMNTL  181

Query  1003  AEIARGAEAPSVYPVWQREFFDARNPPRITCTHFEYEEEPAADSMVTNIPL--DNLVHRS  830
             AE+A+GA  PSV PVW+RE   AR+PP ITC H EYE+ P  ++M   IP   + +V RS
Sbjct  182   AEMAQGATEPSVPPVWRRELLQARDPPHITCNHREYEQIP--NNMEGIIPSYENKMVLRS  239

Query  829   FFFGPTEISALRSSLPPHLLKCSRFEVVTACLWRCRTIAMEFDPNDEVRIFGTVNARPRL  650
             FFFG ++I+ALR  +P +L KC+ F+++TAC WRCRT A+E D +++VR+   VNAR R 
Sbjct  240   FFFGASDIAALRRLVPHYLRKCTSFDLITACFWRCRTKALEIDADEDVRMMVIVNARARF  299

Query  649   KNPPVPNGYYGNAFVYPGAKSTAGKVSKSPLSHALELVTNIKSSFTEEYIKSVADLMILK  470
              NPP+P GYYGNAF YP A +TAGK+ ++P  +A+EL+  +K   TEEY+ SVADLM+  
Sbjct  300   -NPPLPAGYYGNAFAYPAAVTTAGKLCENPFGYAVELINKLKGEVTEEYMHSVADLMVTN  358

Query  469   GRPTFTLQGTFIVSDVTRVGFPEIDMGWGQSVFggpahggvggipGLITFYIPYEDNKGD  290
             GR  FT   +FIVSD+   GF +ID GWG++++GG A GG G  P +  + + +++ KG+
Sbjct  359   GRCLFTTVRSFIVSDLRHFGFKQIDFGWGRALYGGVAKGGAGPFPAVF-YLMAHKNAKGE  417

Query  289   HGILVPMCLPAIAMGKFVKELENCLM  212
              GIL+P+ LPA AM KF  EL++ L+
Sbjct  418   EGILLPIWLPAKAMDKFANELDHMLI  443



>gb|EYU41395.1| hypothetical protein MIMGU_mgv1a006288mg [Erythranthe guttata]
Length=449

 Score =   522 bits (1344),  Expect = 9e-178, Method: Compositional matrix adjust.
 Identities = 264/446 (59%), Positives = 336/446 (75%), Gaps = 15/446 (3%)
 Frame = -1

Query  1549  MASQPSIAFTVTRQNPELVAPADPTPREIKYLSDIDDQQGLRFQIPVIHFYRNEPSMSGK  1370
             + ++P I F VTR+ PEL+ PA PTP E K LSDIDDQ+GLRF +P+I FYRN PS+   
Sbjct  3     LITKPLI-FNVTRRIPELILPAKPTPHEFKPLSDIDDQEGLRFHVPLIQFYRNIPSIEA-  60

Query  1369  DPVQVIRQALAKALVFFYPFAGRLREGPGRKLMVDCTGEGVMFIEADADATLQHFAVGGE  1190
             DPV+VIR+A+AKALV +YPFAGRLRE   RKL+V+CTGEGVMFIEADAD  L+ F  G E
Sbjct  61    DPVEVIRKAIAKALVPYYPFAGRLREQAARKLVVECTGEGVMFIEADADVALEQF--GDE  118

Query  1189  LKPPFPCFDQLLYNVPGSAEILNCPLFLIQVTRLRCGGFIFALRLNHSMSDACGLVHFLN  1010
             ++PP PC D+LLY+VPGS  I+NCPL LIQVTRL+ GGFIF+LR NH+MSD  G+  F++
Sbjct  119   IRPPVPCLDELLYDVPGSGGIINCPLLLIQVTRLKYGGFIFSLRFNHTMSDGTGIAEFMS  178

Query  1009  TIAEIARGAEAPSVYPVWQREFFDARNPPRITCTHFEYEEEPAADSMVTNIPL---DNLV  839
              + E ARGAEAPS+ P+W+R    ARNPPR+TCTH EY      D +V NIP+    ++V
Sbjct  179   AVGEFARGAEAPSIQPIWERHILSARNPPRVTCTHHEY------DDVVNNIPIILDGDMV  232

Query  838   HRSFFFGPTEISALRSSLPPHLLK-CSRFEVVTACLWRCRTIAMEFDPNDEVRIFGTVNA  662
             HRSFFFG  EISAL   LPPHL + C++FE++TACLWRCRTIA+  DPN+EVRI   +N 
Sbjct  233   HRSFFFGAPEISALDGRLPPHLHRNCTKFELLTACLWRCRTIALSPDPNEEVRILCVINC  292

Query  661   RPRLKNPPVPNGYYGNAFVYPGAKSTAGKVSKSPLSHALELVTNIKSSFTEEYIKSVADL  482
             R R  NPP+P GYYGNAFV   A +TA  +SK+P  +A+ELV   K+  TEE++KSVADL
Sbjct  293   RKRF-NPPLPAGYYGNAFVLAAAIATAESLSKNPFHYAVELVMKAKTKATEEHVKSVADL  351

Query  481   MILKGRPTFTLQGTFIVSDVTRVGFPEIDMGWGQSVFggpahggvggipGLITFYIPYED  302
             M+++GRP F L G + VSDV  +GF ++D GWG+ V+GGPA G VG +P L ++YIP+++
Sbjct  352   MVIRGRPHFMLVGNYAVSDVRHLGFGDVDFGWGKPVYGGPAKGEVGVVPELSSYYIPFKN  411

Query  301   NKGDHGILVPMCLPAIAMGKFVKELE  224
              KG++GI+VP+ L   AM  FVKELE
Sbjct  412   KKGENGIIVPISLQKNAMDVFVKELE  437



>ref|XP_003554685.1| PREDICTED: benzyl alcohol O-benzoyltransferase-like [Glycine 
max]
 gb|KHN43218.1| Benzyl alcohol O-benzoyltransferase [Glycine soja]
Length=464

 Score =   523 bits (1346),  Expect = 9e-178, Method: Compositional matrix adjust.
 Identities = 262/448 (58%), Positives = 328/448 (73%), Gaps = 8/448 (2%)
 Frame = -1

Query  1546  ASQPSIAFTVTRQNPELVAPADPTPREIKYLSDIDDQQGLRFQIPVIHFYRNEPSMSGKD  1367
             +S PS+ FTV R  PELVAPA PTP ++K LSDIDDQ G RFQ+P+I  Y N+PSM+GKD
Sbjct  3     SSSPSLMFTVRRCQPELVAPATPTPHQLKPLSDIDDQDGFRFQVPIIQIYHNQPSMAGKD  62

Query  1366  PVQVIRQALAKALVFFYPFAGRLREGPGRKLMVDCTGEGVMFIEADADATLQHFAVGGE-  1190
             PV+VIRQALAK LVF+YPFAGRLREGP RKLMVDCTGEGVMFIEADAD TL  F  GGE 
Sbjct  63    PVEVIRQALAKTLVFYYPFAGRLREGPDRKLMVDCTGEGVMFIEADADVTLYQF--GGEA  120

Query  1189  LKPPFPCFDQLLYNVPGSAEILNCPLFLIQVTRLRCGGFIFALRLNHSMSDACGLVHFLN  1010
             L+PPFPCF +LLYNVP + EI N PL LIQVTRLRCGGFI A R+NH+MSD  GL  F+N
Sbjct  121   LQPPFPCFQELLYNVPETEEITNTPLLLIQVTRLRCGGFILATRMNHTMSDGAGLSQFMN  180

Query  1009  TIAEIARGAEAPSVYPVWQREFFDARNPPRITCTHFEYEEEPAADSMVTNIPLD---NLV  839
             T AE+ARG ++PS+ PVW+RE   AR+PPRITC H EYE  P           D   N+V
Sbjct  181   TWAEMARGVKSPSIVPVWRRELLMARDPPRITCNHREYEHVPDTKEGTITSSYDNDNNMV  240

Query  838   HRSFFFGPTEISALRSSLPPHLLKCSRFEVVTACLWRCRTIAMEFDPNDEVRIFGTVNAR  659
             HRSFF GP EI+ALR  +P +L  C+ F+++TACLWRCRT A++ + +++VR+   VNAR
Sbjct  241   HRSFFLGPVEIAALRRLIPHNLKYCTTFDIITACLWRCRTKALQIEADEDVRMMCIVNAR  300

Query  658   PRLKNPPVPNGYYGNAFVYPGAKSTAGKVSKSPLSHALELVTNIKSSFTEEYIKSVADLM  479
              R  NPP+P GYYGN F YP A +TAGK+  +P  +A+EL+  +K   TEEY+ SVADL+
Sbjct  301   ARF-NPPLPVGYYGNVFAYPAAITTAGKLCGNPFGYAVELINKVKREVTEEYMHSVADLL  359

Query  478   ILKGRPTFTLQGTFIVSDVTRVGFPEIDMGWGQSVFggpahggvggipGLITFYIPYEDN  299
             ++KGR  F    ++IVSD++R  F  +D GWG +VFGGPA  G G  PG ++++ P ++ 
Sbjct  360   VIKGRCLFNTVRSYIVSDLSRAKFRNVDFGWGDAVFGGPAKCGAGAFPG-VSYFTPGKNA  418

Query  298   KGDHGILVPMCLPAIAMGKFVKELENCL  215
             KG+ GI+  + LP  AM +F KEL + L
Sbjct  419   KGEEGIIFAIGLPDEAMERFAKELNDML  446



>ref|XP_011085899.1| PREDICTED: benzyl alcohol O-benzoyltransferase-like [Sesamum 
indicum]
Length=464

 Score =   521 bits (1343),  Expect = 2e-177, Method: Compositional matrix adjust.
 Identities = 274/448 (61%), Positives = 332/448 (74%), Gaps = 6/448 (1%)
 Frame = -1

Query  1549  MASQPSIAFTVTRQNPELVAPADPTPREIKYLSDIDDQQGLRFQIPVIHFYRNEPSMSGK  1370
             MAS  ++ F VTR+N EL+ PA PTP E K LSDIDDQ+GLRFQ+P+I F+   P+M  K
Sbjct  1     MASPNALTFKVTRKNTELIPPAKPTPHEFKPLSDIDDQEGLRFQLPLIAFFPKNPAMDRK  60

Query  1369  DPVQVIRQALAKALVFFYPFAGRLREGPGRKLMVDCTGEGVMFIEADADATLQHFAVGGE  1190
             DPV+V R ALAKALVF+YPFAGRLRE  GRKL+V+CTGEG +FIEADAD  LQ F  G  
Sbjct  61    DPVKVFRDALAKALVFYYPFAGRLRETAGRKLVVECTGEGALFIEADADVGLQQF--GDT  118

Query  1189  LKPPFPCFDQLLYNVPGSAEILNCPLFLIQVTRLRCGGFIFALRLNHSMSDACGLVHFLN  1010
             L+PPFPC ++LLY+VPGS  ++NCPL LIQVTRL+CGGFIFA R NH+MSD  GL  F +
Sbjct  119   LQPPFPCLEELLYDVPGSGGMVNCPLLLIQVTRLKCGGFIFAFRANHTMSDGFGLFQFAS  178

Query  1009  TIAEIARGAEAPSVYPVWQREFFDARNPPRITCTHFEYEEEPAADSMVTNIPLDNLVHRS  830
             T+AE+ARGAE PSV PVWQR    AR+PP ++  H EYE  P  D+  T IPL+N+V RS
Sbjct  179   TMAELARGAEIPSVLPVWQRHLVSARDPPHVSYMHDEYENIP--DAKETLIPLENMVQRS  236

Query  829   FFFGPTEISALRSSLPPHLLKCSRFEVVTACLWRCRTIAMEFDPNDEVRIFGTVNARPRL  650
             FFFGP EISALR  L PHL +C+ FE++ AC+WRCRTIA+  DPN+EVRI   VN R RL
Sbjct  237   FFFGPGEISALRRHLSPHLRRCTTFELLAACIWRCRTIAISPDPNEEVRILCFVNGR-RL  295

Query  649   KNPPVPNGYYGNAFVYPGAKSTAGKVSKSPLSHALELVTNIKSSFTEEYIKSVADLMILK  470
              NP +P GYYGN    P A STA  + K PL+ ALELV   KS  TE+YIKSVA+LMI++
Sbjct  296   FNPLLPAGYYGNVVATPLAISTAENLCKQPLNFALELVMKAKSKVTEDYIKSVANLMIIR  355

Query  469   GRPTFTLQ-GTFIVSDVTRVGFPEIDMGWGQSVFggpahggvggipGLITFYIPYEDNKG  293
             GRP F +   T+IVSD+T V    +D GWG  VFGGPA GG G IPGL++F+IP ++ KG
Sbjct  356   GRPHFAVDMRTYIVSDLTHVASDNLDYGWGAPVFGGPAKGGAGVIPGLLSFHIPIKNIKG  415

Query  292   DHGILVPMCLPAIAMGKFVKELENCLMK  209
             + G LVP+CLPA AM  FVKELE  + +
Sbjct  416   ERGKLVPICLPANAMEVFVKELETMVKR  443



>ref|XP_003521736.1| PREDICTED: benzyl alcohol O-benzoyltransferase-like [Glycine 
max]
Length=464

 Score =   521 bits (1342),  Expect = 4e-177, Method: Compositional matrix adjust.
 Identities = 252/443 (57%), Positives = 327/443 (74%), Gaps = 2/443 (0%)
 Frame = -1

Query  1543  SQPSIAFTVTRQNPELVAPADPTPREIKYLSDIDDQQGLRFQIPVIHFYRNEPSMSGKDP  1364
             S P++ FTV R+  EL+APA PTPRE+K LSDIDDQ+GLRFQIP I FY N    S KDP
Sbjct  6     SSPTLVFTVRRRQAELIAPAKPTPREVKKLSDIDDQEGLRFQIPFIQFYGNNKESSMKDP  65

Query  1363  VQVIRQALAKALVFFYPFAGRLREGPGRKLMVDCTGEGVMFIEADADATLQHFAVGGELK  1184
             V+VIR+AL K LVF+YPFAGRLREGPGRKLMVDC GEGV+FIEADAD TL  F     L 
Sbjct  66    VEVIRKALTKTLVFYYPFAGRLREGPGRKLMVDCNGEGVLFIEADADVTLHQFGPSYLLH  125

Query  1183  PPFPCFDQLLYNVPGSAEILNCPLFLIQVTRLRCGGFIFALRLNHSMSDACGLVHFLNTI  1004
             PPFPC ++LL++VPGS  + NCPL LIQVTRL+CGGFIFALRLNHSMSD  G+  F+  +
Sbjct  126   PPFPCLEELLHDVPGSRGVTNCPLLLIQVTRLKCGGFIFALRLNHSMSDGFGIAKFMKAL  185

Query  1003  AEIARGAEAPSVYPVWQREFFDARNPPRITCTHFEYEEEPAADSMVTNIPLDNLVHRSFF  824
             AEIA GA  PS+ PVW RE  +ARNPPRI+ TH EYE E  A   +  IPL+++V R FF
Sbjct  186   AEIACGATEPSLTPVWCRELLNARNPPRISRTHHEYEVENKAKGTMM-IPLNDVVQRCFF  244

Query  823   FGPTEISALRSSLPPHLLKCSRFEVVTACLWRCRTIAMEFDPNDEVRIFGTVNARPRLKN  644
             FGP E+++LRS +P HL +C+ FEV+TAC+WRCR  A++ DP D+VR   T+N   ++ N
Sbjct  245   FGPREVASLRSLVPKHLGRCTTFEVITACMWRCRIRALQLDPEDDVRFIYTININAKV-N  303

Query  643   PPVPNGYYGNAFVYPGAKSTAGKVSKSPLSHALELVTNIKSSFTEEYIKSVADLMILKGR  464
             PP+P GYYGN FV   A +T+ ++ ++P  +ALELV N KS+  EEY++S +DL+++KGR
Sbjct  304   PPLPKGYYGNGFVLSAAVTTSRRLCENPFGYALELVKNAKSNVDEEYVRSTSDLIVVKGR  363

Query  463   PTFTLQGTFIVSDVTRVGFPEIDMGWGQSVFggpahggvggipGLITFYIPYEDNKGDHG  284
             P      +++VS+ TR+G  E+D GWG+ ++GGPA GG+   P + + Y+  +++KG+H 
Sbjct  364   PHQATTRSYLVSNTTRIGLDEVDFGWGKPIYGGPATGGITSFPQMTSVYVSCKNHKGEHV  423

Query  283   ILVPMCLPAIAMGKFVKELENCL  215
             I+VP+ LPA AM +F  ELE  L
Sbjct  424   IVVPISLPAKAMERFATELEGML  446



>ref|XP_007029787.1| Benzoyl coenzyme A: Benzyl alcohol benzoyl transferase isoform 
2, partial [Theobroma cacao]
 gb|EOY10289.1| Benzoyl coenzyme A: Benzyl alcohol benzoyl transferase isoform 
2, partial [Theobroma cacao]
Length=485

 Score =   520 bits (1340),  Expect = 1e-176, Method: Compositional matrix adjust.
 Identities = 264/454 (58%), Positives = 331/454 (73%), Gaps = 16/454 (4%)
 Frame = -1

Query  1576  YLIMALSPFMASQPSIAFTVTRQNPELVAPADPTPREIKYLSDIDDQQGLRFQIPVIHFY  1397
             +  MAL P      S+ FTV R  PELV PA PTPRE K LSDIDDQ G RFQI  +HFY
Sbjct  11    FFAMALLP----PTSLVFTVRRHEPELVVPAKPTPRECKLLSDIDDQDGHRFQIRGLHFY  66

Query  1396  RNEPSMSGKDPVQVIRQALAKALVFFYPFAGRLREGPGRKLMVDCTGEGVMFIEADADAT  1217
             R +PSM GKDP  +I++AL KALVF+YP+AGRLREGP RKL+VDCTGEGV+FI+ADAD T
Sbjct  67    RFKPSMQGKDPACIIKEALTKALVFYYPYAGRLREGPNRKLVVDCTGEGVLFIQADADVT  126

Query  1216  LQHFAVGGELKPPFPCFDQLLYNVPGSAEILNCPLFLIQVTRLRCGGFIFALRLNHSMSD  1037
             L  F  G  L PPFPC+ +LLY VPGS E+LNCPL  IQVTRL+CGGFIFA R NH+MSD
Sbjct  127   LDQF--GDSLHPPFPCYKELLYEVPGSNELLNCPLLQIQVTRLKCGGFIFAHRFNHTMSD  184

Query  1036  ACGLVHFLNTIAEIARGAEAPSVYPVWQREFFDARNPPRITCTHFEYEEEPAADSMVTNI  857
             A GL+ F+  + E+ARGA APS  PVW+R   +AR+ P ITC H EY+     + +   +
Sbjct  185   AAGLIQFMCAMGEMARGALAPSTPPVWERHLLNARHSPLITCVHDEYDNATLTNGI--EM  242

Query  856   PLDNLVHRSFFFGPTEISALRSSLPPHLLKCSRFEVVTACLWRCRTIAMEFDPNDEVRIF  677
             P DNL+HRSFFFGPT+ISALR  + PH L+CS F++VTACLWRCRT AM+  PND+VR  
Sbjct  243   P-DNLLHRSFFFGPTQISALRRFV-PHNLRCSTFDIVTACLWRCRTKAMKLGPNDDVRFI  300

Query  676   GTVNARPRLKNPPVPNGYYGNAFVYPGAKSTAGKVSKSPLSHALELVTNIKSSFTEEYIK  497
               VNAR +  NPP+P+G+YGNA  YP A +TAG++ ++P+ + +ELV   K+  TEEY+K
Sbjct  301   CIVNARSKF-NPPLPSGFYGNALGYPVALTTAGQLCQNPMEYGIELVRQAKAKITEEYMK  359

Query  496   SVADLMILKGRPTFTLQGTFIVSDVTRVGFPEIDMGWGQSVFggpahggvggipGLITFY  317
             S ADLM+++GRP       F+VSD+TR  F E+D GWG++ FGGPA+GG       I+FY
Sbjct  360   STADLMVIRGRPNVNTVRCFMVSDLTRAKFREVDFGWGEAEFGGPAYGGDR-----ISFY  414

Query  316   IPYEDNKGDHGILVPMCLPAIAMGKFVKELENCL  215
             IP ++ +G+ GI+VP+CLPA  M  FVKEL+  L
Sbjct  415   IPSKNKEGEGGIVVPVCLPAPVMESFVKELDGIL  448



>ref|XP_011046333.1| PREDICTED: benzyl alcohol O-benzoyltransferase-like [Populus 
euphratica]
Length=452

 Score =   519 bits (1336),  Expect = 2e-176, Method: Compositional matrix adjust.
 Identities = 245/444 (55%), Positives = 327/444 (74%), Gaps = 12/444 (3%)
 Frame = -1

Query  1549  MASQPS-IAFTVTRQNPELVAPADPTPREIKYLSDIDDQQGLRFQIPVIHFYRNEPSMSG  1373
             MA+ P+ + F V+R+ P L+ P++PTP E+K LSDIDDQ GLR QIP+I+FY  +PSM  
Sbjct  1     MATPPTPLVFEVSRREPVLITPSEPTPHELKPLSDIDDQDGLRVQIPLIYFYPYDPSMQR  60

Query  1372  KDPVQVIRQALAKALVFFYPFAGRLREGPGRKLMVDCTGEGVMFIEADADATLQHFAVGG  1193
             +DPV+VI++ALAK LVF+YPFAGRLREGP RKL+V+CTGEG++FIEADAD TL+ F  G 
Sbjct  61    RDPVEVIKKALAKTLVFYYPFAGRLREGPKRKLLVECTGEGILFIEADADVTLEQF--GD  118

Query  1192  ELKPPFPCFDQLLYNVPGSAEILNCPLFLIQVTRLRCGGFIFALRLNHSMSDACGLVHFL  1013
             EL PP PC ++LLY+VPGS+ ++NCPL LIQVTRL+CGG +FA+RLNH+MSD  GL  FL
Sbjct  119   ELYPPIPCLEELLYDVPGSSGMINCPLLLIQVTRLKCGGIVFAIRLNHTMSDGTGLNQFL  178

Query  1012  NTIAEIARGAEAPSVYPVWQREFFDARNPPRITCTHFEYEEEPAADSMVTNIPLDNLVHR  833
             + + E+  GA+ PS+ PVW+R   +ARNPP++TC H EY++    D    NIPL    HR
Sbjct  179   SAMCEMVHGAQTPSIQPVWERHVLNARNPPQVTCLHHEYDQ--LVDDTTDNIPLTKKTHR  236

Query  832   SFFFGPTEISALRSSLPPHLLKCSRFEVVTACLWRCRTIAMEFDPNDEVRIFGTVNARPR  653
             SFFFGP  ISA+R   P HL  CS F+V+TA LWRCRTIA++ +PNDE+RI  TVNAR R
Sbjct  237   SFFFGPANISAIRGFAPLHLRHCSTFDVLTAFLWRCRTIALQPNPNDEMRILCTVNARNR  296

Query  652   LKNPPVPNGYYGNAFVYPGAKSTAGKVSKSPLSHALELVTNIKSSFTEEYIKSVADLMIL  473
               NPP+P GYYGN   Y  A + AG++S++ L   LELV   K++ TEEY++SVADL+++
Sbjct  297   F-NPPLPRGYYGNCMAYSVAMAKAGEISRNSLGFTLELVRKAKANVTEEYMRSVADLLVI  355

Query  472   KGRPTFTLQGTFIVSDVTRVGFPEIDMGWGQSVFggpahggvggipGLITFYIPYEDNKG  293
             KGRP +T+  +++VSDVTR  F E+++GWG+  +             + +F IPY   KG
Sbjct  356   KGRPWYTMVRSYLVSDVTRAMFAEMNLGWGKPKY------AGPAKGNVASFQIPYRTKKG  409

Query  292   DHGILVPMCLPAIAMGKFVKELEN  221
             + G+LV +CLP +AM +FVKEL++
Sbjct  410   EDGVLVTLCLPTLAMERFVKELDS  433



>ref|XP_007029786.1| Benzoyl coenzyme A: Benzyl alcohol benzoyl transferase isoform 
1 [Theobroma cacao]
 gb|EOY10288.1| Benzoyl coenzyme A: Benzyl alcohol benzoyl transferase isoform 
1 [Theobroma cacao]
Length=525

 Score =   521 bits (1343),  Expect = 2e-176, Method: Compositional matrix adjust.
 Identities = 264/454 (58%), Positives = 331/454 (73%), Gaps = 16/454 (4%)
 Frame = -1

Query  1576  YLIMALSPFMASQPSIAFTVTRQNPELVAPADPTPREIKYLSDIDDQQGLRFQIPVIHFY  1397
             +  MAL P      S+ FTV R  PELV PA PTPRE K LSDIDDQ G RFQI  +HFY
Sbjct  19    FFAMALLP----PTSLVFTVRRHEPELVVPAKPTPRECKLLSDIDDQDGHRFQIRGLHFY  74

Query  1396  RNEPSMSGKDPVQVIRQALAKALVFFYPFAGRLREGPGRKLMVDCTGEGVMFIEADADAT  1217
             R +PSM GKDP  +I++AL KALVF+YP+AGRLREGP RKL+VDCTGEGV+FI+ADAD T
Sbjct  75    RFKPSMQGKDPACIIKEALTKALVFYYPYAGRLREGPNRKLVVDCTGEGVLFIQADADVT  134

Query  1216  LQHFAVGGELKPPFPCFDQLLYNVPGSAEILNCPLFLIQVTRLRCGGFIFALRLNHSMSD  1037
             L  F  G  L PPFPC+ +LLY VPGS E+LNCPL  IQVTRL+CGGFIFA R NH+MSD
Sbjct  135   LDQF--GDSLHPPFPCYKELLYEVPGSNELLNCPLLQIQVTRLKCGGFIFAHRFNHTMSD  192

Query  1036  ACGLVHFLNTIAEIARGAEAPSVYPVWQREFFDARNPPRITCTHFEYEEEPAADSMVTNI  857
             A GL+ F+  + E+ARGA APS  PVW+R   +AR+ P ITC H EY+     + +   +
Sbjct  193   AAGLIQFMCAMGEMARGALAPSTPPVWERHLLNARHSPLITCVHDEYDNATLTNGI--EM  250

Query  856   PLDNLVHRSFFFGPTEISALRSSLPPHLLKCSRFEVVTACLWRCRTIAMEFDPNDEVRIF  677
             P DNL+HRSFFFGPT+ISALR  + PH L+CS F++VTACLWRCRT AM+  PND+VR  
Sbjct  251   P-DNLLHRSFFFGPTQISALRRFV-PHNLRCSTFDIVTACLWRCRTKAMKLGPNDDVRFI  308

Query  676   GTVNARPRLKNPPVPNGYYGNAFVYPGAKSTAGKVSKSPLSHALELVTNIKSSFTEEYIK  497
               VNAR +  NPP+P+G+YGNA  YP A +TAG++ ++P+ + +ELV   K+  TEEY+K
Sbjct  309   CIVNARSKF-NPPLPSGFYGNALGYPVALTTAGQLCQNPMEYGIELVRQAKAKITEEYMK  367

Query  496   SVADLMILKGRPTFTLQGTFIVSDVTRVGFPEIDMGWGQSVFggpahggvggipGLITFY  317
             S ADLM+++GRP       F+VSD+TR  F E+D GWG++ FGGPA+GG       I+FY
Sbjct  368   STADLMVIRGRPNVNTVRCFMVSDLTRAKFREVDFGWGEAEFGGPAYGGDR-----ISFY  422

Query  316   IPYEDNKGDHGILVPMCLPAIAMGKFVKELENCL  215
             IP ++ +G+ GI+VP+CLPA  M  FVKEL+  L
Sbjct  423   IPSKNKEGEGGIVVPVCLPAPVMESFVKELDGIL  456



>ref|XP_010644575.1| PREDICTED: methanol O-anthraniloyltransferase-like [Vitis vinifera]
Length=445

 Score =   517 bits (1331),  Expect = 8e-176, Method: Compositional matrix adjust.
 Identities = 250/442 (57%), Positives = 324/442 (73%), Gaps = 8/442 (2%)
 Frame = -1

Query  1549  MASQPSIAFTVTRQNPELVAPADPTPREIKYLSDIDDQQGLRFQIPVIHFYRNEPSMSGK  1370
             MA    ++F+VTR +P LVAPA PT RE+K LSDIDDQ GLRFQ  +I FYRN P M GK
Sbjct  1     MAMVSPLSFSVTRCDPRLVAPAKPTRRELKQLSDIDDQGGLRFQASMIFFYRNSPLMDGK  60

Query  1369  DPVQVIRQALAKALVFFYPFAGRLREGPGRKLMVDCTGEGVMFIEADADATLQHFAVGGE  1190
             DPV+VIR+ALAKALV++YPFAGRL EG  RKL+VDCTGEGV+FIEADAD TL+H  +G  
Sbjct  61    DPVKVIREALAKALVYYYPFAGRLVEGSNRKLLVDCTGEGVLFIEADADTTLEH--LGDA  118

Query  1189  LKPPFPCFDQLLYNVPGSAEILNCPLFLIQVTRLRCGGFIFALRLNHSMSDACGLVHFLN  1010
             ++P  PCF++LLY+VPGS EIL CPL LIQVTRLRCGGF+ ALRLNH+MSD+ GLV FLN
Sbjct  119   IQPHCPCFEELLYDVPGSGEILGCPLLLIQVTRLRCGGFVLALRLNHTMSDSPGLVQFLN  178

Query  1009  TIAEIARGAEAPSVYPVWQREFFDARNPPRITCTHFEYEEEPAADSMVTNIPLDNLVHRS  830
              ++E+ARGA+ P V PVW+RE  +ARNPPRITC H EYEE       +  +   N VHRS
Sbjct  179   AVSEMARGADVPPVLPVWERELLNARNPPRITCMHHEYEEVHDTRGTLGVMDDHNTVHRS  238

Query  829   FFFGPTEISALRSSLPPHLLKCSRFEVVTACLWRCRTIAMEFDPNDEVRIFGTVNARPRL  650
             FFFGP EI ALR  +P  L  CS FEV+TAC+WRCRT+A   DP++ VR+    N R + 
Sbjct  239   FFFGPKEIKALRKRIPQTLGPCSTFEVLTACVWRCRTVAFGVDPDETVRVSCLNNVRGK-  297

Query  649   KNPPVPNGYYGNAFVYPGAKSTAGKVSKSPLSHALELVTNIKSSFTEEYIKSVADLMILK  470
             +   +P+GYYGNAF  P   + AG++  +PL +A+ LV   K+  +EEYI+SVA+ M++K
Sbjct  298   RGLQLPSGYYGNAFANPAVVTKAGELCNNPLGYAVNLVKKAKAEMSEEYIRSVANFMVIK  357

Query  469   GRPTFTLQGTFIVSDVTRVGFPEIDMGWGQSVFggpahggvggipGLITFYIPYEDNKGD  290
             GRP++T  G FI+SD TRVGF EID GWG+ ++     GG+     +I+F + + ++KG+
Sbjct  358   GRPSYTRTGNFIISDNTRVGFQEIDFGWGKPLY-----GGLAKAMSIISFCLRFRNSKGE  412

Query  289   HGILVPMCLPAIAMGKFVKELE  224
              G++VP+CLP   M +F +E++
Sbjct  413   EGVVVPICLPLQVMERFGQEVK  434



>ref|XP_002270240.1| PREDICTED: methanol O-anthraniloyltransferase [Vitis vinifera]
Length=445

 Score =   512 bits (1319),  Expect = 4e-174, Method: Compositional matrix adjust.
 Identities = 243/443 (55%), Positives = 326/443 (74%), Gaps = 8/443 (2%)
 Frame = -1

Query  1549  MASQPSIAFTVTRQNPELVAPADPTPREIKYLSDIDDQQGLRFQIPVIHFYRNEPSMSGK  1370
             MA +  I+F+VTR  P LVAPA PTPRE+K LSDIDDQ+GLRFQ+P+I FY N   M GK
Sbjct  1     MAMESPISFSVTRGEPRLVAPAKPTPRELKELSDIDDQEGLRFQVPIIFFYGNSSLMDGK  60

Query  1369  DPVQVIRQALAKALVFFYPFAGRLREGPGRKLMVDCTGEGVMFIEADADATLQHFAVGGE  1190
             DP +VIR+ALAKAL+++YPFAGRL EG  RKL+VDCTGEGV+F+EADAD TL++  +G  
Sbjct  61    DPAKVIREALAKALIYYYPFAGRLVEGSNRKLLVDCTGEGVLFVEADADTTLEY--LGDA  118

Query  1189  LKPPFPCFDQLLYNVPGSAEILNCPLFLIQVTRLRCGGFIFALRLNHSMSDACGLVHFLN  1010
             ++PP PCF++LLY+VPGS  IL CPL L QVTRLRCGGF+ ALRLNH+MSD+ GL+ FLN
Sbjct  119   IQPPCPCFEELLYDVPGSGGILGCPLLLFQVTRLRCGGFVLALRLNHTMSDSFGLLQFLN  178

Query  1009  TIAEIARGAEAPSVYPVWQREFFDARNPPRITCTHFEYEEEPAADSMVTNIPLDNLVHRS  830
              ++EIA+GAE PSV PVWQRE  +ARNPP ITC H+E+EE       +  +  DN VHRS
Sbjct  179   AVSEIAQGAEVPSVLPVWQRELLNARNPPCITCRHYEFEEVHDTKGTLGVMDDDNTVHRS  238

Query  829   FFFGPTEISALRSSLPPHLLKCSRFEVVTACLWRCRTIAMEFDPNDEVRIFGTVNARPRL  650
             FFFGP EI +L+  +P  L  C+ +E + AC+WRCRT+A   DPN+ VR    ++ R + 
Sbjct  239   FFFGPKEIRSLKMRIPQALGPCTTYEALAACVWRCRTVAFGVDPNEFVRFSSAMSMRGK-  297

Query  649   KNPPVPNGYYGNAFVYPGAKSTAGKVSKSPLSHALELVTNIKSSFTEEYIKSVADLMILK  470
             +   +P+GYYGNAF YP A +  G++ K+PL +A+ELV  +K+  +EEYIKS+A LM++K
Sbjct  298   RGLQLPSGYYGNAFAYPAAIAKVGELCKNPLGYAVELVKKVKAEMSEEYIKSLAALMVIK  357

Query  469   GRPTFTLQGTFIVSDVTRVGFPEIDMGWGQSVFggpahggvggipGLITFYIPYEDNKGD  290
             GRP +T  G FI+SD TRV F ++D GWG+ ++     GG+     LI+F++ + ++KG+
Sbjct  358   GRPLYTRTGFFIISDNTRVDFQDVDFGWGKPLY-----GGLAKASSLISFFLRFRNSKGE  412

Query  289   HGILVPMCLPAIAMGKFVKELEN  221
              GI+VP+ LP   M +F +E++ 
Sbjct  413   EGIVVPIQLPLPVMERFEQEVKR  435



>gb|KEH40971.1| benzyl alcohol O-benzoyltransferase [Medicago truncatula]
Length=461

 Score =   513 bits (1320),  Expect = 7e-174, Method: Compositional matrix adjust.
 Identities = 250/441 (57%), Positives = 331/441 (75%), Gaps = 5/441 (1%)
 Frame = -1

Query  1534  SIAFTVTRQNPELVAPADPTPREIKYLSDIDDQQGLRFQIPVIHFYRNEPSMSGKDPVQV  1355
             S+ F V R   E V P+ PTP EIK LSDIDDQ+GLR+Q  +I FY+ +P+M+GKDPV +
Sbjct  4     SLVFKVKRCATEFVRPSKPTPHEIKLLSDIDDQEGLRYQTRLIQFYKYDPNMAGKDPVDI  63

Query  1354  IRQALAKALVFFYPFAGRLREGPGRKLMVDCTGEGVMFIEADADATLQHFAVGGELKPPF  1175
             IR+ALAK LVF+YPFAGRLREGP RKLMVDC  EG++FIEADAD TL+ F  G +L PPF
Sbjct  64    IRKALAKTLVFYYPFAGRLREGPSRKLMVDCNDEGILFIEADADVTLEQF--GEDLHPPF  121

Query  1174  PCFDQLLYNVPGSAEILNCPLFLIQVTRLRCGGFIFALRLNHSMSDACGLVHFLNTIAEI  995
             PC D+LLY+VPGS+ +LN PL LIQVTRL+CGGFIFALRLNH++SD+ GL  FL+ + EI
Sbjct  122   PCIDELLYDVPGSSVVLNTPLLLIQVTRLKCGGFIFALRLNHTISDSSGLFKFLSALGEI  181

Query  994   ARGAEAPSVYPVWQREFFDARNPPRITCTHFEYEEEPAADSMVTNIPLDNLVHRSFFFGP  815
             +RG   PS+ PVW RE  +ARNPPRITCTH EYEE P     V  IPLD++VH +FFFGP
Sbjct  182   SRGMNEPSISPVWCRELLNARNPPRITCTHHEYEEVPRNKGTV--IPLDDMVHHTFFFGP  239

Query  814   TEISALRSSLPPH-LLKCSRFEVVTACLWRCRTIAMEFDPNDEVRIFGTVNARPRLKNPP  638
             TE++A+RS LP H L + + FE+++A  WRCRTIA++ D N+EVR    V+ R +  N  
Sbjct  240   TEVAAIRSLLPVHPLQQHTDFEIISAFCWRCRTIALQLDTNEEVRFICVVDGRSKSVNLQ  299

Query  637   VPNGYYGNAFVYPGAKSTAGKVSKSPLSHALELVTNIKSSFTEEYIKSVADLMILKGRPT  458
             +P GYYGNA       +TAGK+ ++PL++AL LV   K++ T+EY+ S+ADLM++KGRP 
Sbjct  300   LPKGYYGNALANSAMVTTAGKLIENPLAYALNLVKKAKANVTQEYMHSIADLMVIKGRPH  359

Query  457   FTLQGTFIVSDVTRVGFPEIDMGWGQSVFggpahggvggipGLITFYIPYEDNKGDHGIL  278
             F +  +++VSDVTR GF ++D GWG+ ++GGPA G  G IPGL +F+IP+++ KG+ G++
Sbjct  360   FNVVKSYLVSDVTRGGFEKVDYGWGKPIYGGPARGADGDIPGLASFHIPFKNAKGEEGLV  419

Query  277   VPMCLPAIAMGKFVKELENCL  215
             +P   P   M +FVKE+++ L
Sbjct  420   IPFYFPNQVMERFVKEMDSVL  440



>gb|KDP39576.1| hypothetical protein JCGZ_02596 [Jatropha curcas]
Length=454

 Score =   512 bits (1318),  Expect = 9e-174, Method: Compositional matrix adjust.
 Identities = 247/442 (56%), Positives = 324/442 (73%), Gaps = 10/442 (2%)
 Frame = -1

Query  1537  PSIAFTVTRQNPELVAPADPTPREIKYLSDIDDQQGLRFQIPVIHFYRNEPSMSGKDPVQ  1358
             P+  F V R  PEL+ P+ P P E+K LSDIDDQ+GLRF IPVI  YR++PSM GKDPVQ
Sbjct  4     PAPIFEVQRCEPELITPSKPPPHELKPLSDIDDQEGLRFHIPVIQIYRHDPSMEGKDPVQ  63

Query  1357  VIRQALAKALVFFYPFAGRLREGPGRKLMVDCTGEGVMFIEADADATLQHFAVGGELKPP  1178
             VIR A+AKALVF+YPFAGRLREG  RKL++DC GEGV+FIEADA+ +L     G  L+PP
Sbjct  64    VIRNAIAKALVFYYPFAGRLREGANRKLIMDCNGEGVLFIEADANVSLDQ--SGDALQPP  121

Query  1177  FPCFDQLLYNVPGSAEILNCPLFLIQVTRLRCGGFIFALRLNHSMSDACGLVHFLNTIAE  998
             FP  D+LL++VPGS+ ILNCP+ LIQVTR +CGGF FA+R NH+MSD  GL  FL+ IAE
Sbjct  122   FPFLDELLFDVPGSSGILNCPVVLIQVTRFKCGGFTFAIRFNHTMSDGPGLAQFLSAIAE  181

Query  997   IARGAEAPSVYPVWQREFFDARNPPRITCTHFEYEEEPAADSMVTNIPLDNLVHRSFFFG  818
             +ARG ++PS++PVW+R   DARNPPR+TC H EY+     +      PLD++VHR+ F G
Sbjct  182   MARGRQSPSIFPVWERHVLDARNPPRVTCIHREYDH--IENGQGIPFPLDDIVHRAIFIG  239

Query  817   PTEISALRSS-LPPHLLKCSRFEVVTACLWRCRTIAMEFDPNDEVRIFGTVNARPRLKNP  641
             P+ +S LRS  +PPHL +C+  E++TACLW+CRTIA++ D   E+R+    NAR +   P
Sbjct  240   PSALSTLRSRYIPPHLSRCTDVEILTACLWKCRTIALQPDAGQEMRMILLNNAR-KFNPP  298

Query  640   PVPNGYYGNAFVYPGAKSTAGKVSKSPLSHALELVTNIKSSFTEEYIKSVADLMILKGRP  461
              +P GYYGN FV   A +TAG++SKSP+ + LEL+   K  F  EYI+SVADL+++KGRP
Sbjct  299   LLPEGYYGNGFVLSTAVATAGEISKSPIGYGLELIRKGKMEFDREYIQSVADLLVIKGRP  358

Query  460   TFTLQGTFIVSDVTRVGFPEIDMGWGQSVFggpahggvggipGLITFYIPYEDNKGDHGI  281
              FT +GT++VSDV    F E+D GWG +++GGPA           +FY+P+E  KG++GI
Sbjct  359   HFTAEGTYVVSDVRHARFKEVDFGWGNAIYGGPAKAIPIAA----SFYVPFESKKGENGI  414

Query  280   LVPMCLPAIAMGKFVKELENCL  215
             ++P+CLPA AM +FVKEL+N L
Sbjct  415   VIPICLPAQAMERFVKELKNLL  436



>ref|XP_007029789.1| Benzoyl coenzyme A: Benzyl alcohol benzoyl transferase [Theobroma 
cacao]
 gb|EOY10291.1| Benzoyl coenzyme A: Benzyl alcohol benzoyl transferase [Theobroma 
cacao]
Length=452

 Score =   511 bits (1317),  Expect = 1e-173, Method: Compositional matrix adjust.
 Identities = 260/441 (59%), Positives = 329/441 (75%), Gaps = 14/441 (3%)
 Frame = -1

Query  1534  SIAFTVTRQNPELVAPADPTPREIKYLSDIDDQQGLRFQIPVIHFYRNEPSMSGKDPVQV  1355
             S+ FTV R  PELVAPA PTP E K LSDIDDQ+ L FQ+PVI FYR+ PSM GKDPV++
Sbjct  7     SLTFTVRRCEPELVAPAKPTPHECKLLSDIDDQESLHFQVPVIQFYRHNPSMQGKDPVKI  66

Query  1354  IRQALAKALVFFYPFAGRLREGPGRKLMVDCTGEGVMFIEADADATLQHFAVGGELKPPF  1175
             IR+ALAKALVF+YPFAGRLREGP RKLMVDCTGEGV+FIEADAD TL+ F  G EL PPF
Sbjct  67    IREALAKALVFYYPFAGRLREGPNRKLMVDCTGEGVLFIEADADVTLEQF--GDELHPPF  124

Query  1174  PCFDQLLYNVPGSAEILNCPLFLIQVTRLRCGGFIFALRLNHSMSDACGLVHFLNTIAEI  995
             PC D+LLY+VPGS  +LNCPL LIQ+TR++CGGFIFA+RLNH MSD  GL   ++ + E+
Sbjct  125   PCLDELLYDVPGSEGMLNCPLLLIQITRMKCGGFIFAVRLNHVMSDGAGLKQLVSAVGEM  184

Query  994   ARGAEAPSVYPVWQREFFDARNPPRITCTHFEYEEEPAADSMVTNIPLDNLVHRSFFFGP  815
             ARG   PS+ PVW+R   DA +PPR+  TH EY+E    + ++T  P DN+V R+FFFGP
Sbjct  185   ARGMVTPSIPPVWERHLLDAGDPPRVMFTHHEYDE---VEGIIT--PPDNMVQRAFFFGP  239

Query  814   TEISALRSSLPPHLLKCSRFEVVTACLWRCRTIAMEFDPNDEVRIFGTVNARPRLKNPPV  635
              EIS+LR  LP HL +CS+FE++TACLWRCRT A+  DP+DEVR+    N R +  NPP+
Sbjct  240   NEISSLRRLLPRHLRQCSKFELLTACLWRCRTAAINPDPDDEVRMMCIANTRSKF-NPPL  298

Query  634   PNGYYGNAFVYPGAKSTAGKVSKSPLSHALELVTNIKSSFTEEYIKSVADLMILKGRPT-  458
             P+GYYGNAFV+P AK+TA K+ ++PL +A+ELV   K+  TEEY+KSV+ LM+++ +   
Sbjct  299   PSGYYGNAFVFPAAKTTARKLFRNPLGYAVELVKQAKARVTEEYVKSVSSLMVIRDKQLH  358

Query  457   FTLQGTFIVSDVTRVGFPEIDMGWGQSVFggpahggvggipGLITFYIPYEDNKGDHGIL  278
             F +  +F++SDVT  GF ++D GWG++VFGGPA          I+F I  +D  G+ G L
Sbjct  359   FPVVRSFLISDVTSFGFGDVDYGWGKAVFGGPAKAVGP-----ISFLIQSKDKNGEVGTL  413

Query  277   VPMCLPAIAMGKFVKELENCL  215
             V +CLPA AM  F KEL+N L
Sbjct  414   VSICLPAPAMESFAKELDNIL  434



>ref|XP_011046335.1| PREDICTED: benzyl alcohol O-benzoyltransferase-like [Populus 
euphratica]
Length=452

 Score =   511 bits (1315),  Expect = 3e-173, Method: Compositional matrix adjust.
 Identities = 238/444 (54%), Positives = 324/444 (73%), Gaps = 12/444 (3%)
 Frame = -1

Query  1549  MASQPS-IAFTVTRQNPELVAPADPTPREIKYLSDIDDQQGLRFQIPVIHFYRNEPSMSG  1373
             MA+ P+ + F V+R+ P L+ P++PTP E+K LSDIDDQ GLR QIP+I FY  +PSM  
Sbjct  1     MATSPTPLVFKVSRREPVLITPSEPTPHELKPLSDIDDQDGLRVQIPLILFYTYDPSMQR  60

Query  1372  KDPVQVIRQALAKALVFFYPFAGRLREGPGRKLMVDCTGEGVMFIEADADATLQHFAVGG  1193
             +DPV+VI++ALAK LVF+YPFAGRLREGP RKL+V+CTGEG++FIEADAD TL+ F  G 
Sbjct  61    RDPVKVIKEALAKTLVFYYPFAGRLREGPKRKLLVECTGEGILFIEADADVTLEQF--GD  118

Query  1192  ELKPPFPCFDQLLYNVPGSAEILNCPLFLIQVTRLRCGGFIFALRLNHSMSDACGLVHFL  1013
              L PP PC ++LL++VPGS+ ++NCPL L+QVTRL+CGG +FA+RLNH+MSD  G+  FL
Sbjct  119   ALYPPIPCLEELLFDVPGSSGMINCPLLLVQVTRLKCGGIVFAIRLNHTMSDGTGINQFL  178

Query  1012  NTIAEIARGAEAPSVYPVWQREFFDARNPPRITCTHFEYEEEPAADSMVTNIPLDNLVHR  833
             + + E+  GA+ PS+ PVW+R   +ARNPP++TC H EY++    D    N+PL    HR
Sbjct  179   SAMCEMVHGAQTPSIQPVWERHVLNARNPPQVTCLHHEYDQ--LVDDTTDNVPLTKKTHR  236

Query  832   SFFFGPTEISALRSSLPPHLLKCSRFEVVTACLWRCRTIAMEFDPNDEVRIFGTVNARPR  653
             SFFFGP  ISA+R   P HL  CS F+V+TA LWRCRTIA++ +PNDE+R+   VNAR R
Sbjct  237   SFFFGPANISAIRGFAPLHLRHCSTFDVLTAFLWRCRTIALQPNPNDEMRMLCIVNARNR  296

Query  652   LKNPPVPNGYYGNAFVYPGAKSTAGKVSKSPLSHALELVTNIKSSFTEEYIKSVADLMIL  473
               NPP+P GYYGN   Y   ++TAG++S++ L   LELV   K++ TEEY++SVADL+++
Sbjct  297   F-NPPLPRGYYGNCIAYSVVRATAGEISRNSLGFTLELVRKAKANVTEEYMRSVADLLVI  355

Query  472   KGRPTFTLQGTFIVSDVTRVGFPEIDMGWGQSVFggpahggvggipGLITFYIPYEDNKG  293
             KGRP +T+  +++VSDVTR  F E+++GWG+  +             + +F IPY   KG
Sbjct  356   KGRPCYTMVRSYLVSDVTRAMFAEMNLGWGKPKY------AGPAKGNVASFQIPYRTKKG  409

Query  292   DHGILVPMCLPAIAMGKFVKELEN  221
             + G+LV +CLP  AM +FVKEL++
Sbjct  410   EDGVLVTLCLPTPAMERFVKELDS  433



>gb|KHN31434.1| Benzyl alcohol O-benzoyltransferase [Glycine soja]
Length=471

 Score =   511 bits (1316),  Expect = 3e-173, Method: Compositional matrix adjust.
 Identities = 259/446 (58%), Positives = 334/446 (75%), Gaps = 12/446 (3%)
 Frame = -1

Query  1543  SQPSIAFTVTRQNPELVAPADPTPREIKYLSDIDDQQGLRFQIPVIHFYRNEPSMSGKDP  1364
             S PS+ FTV R  PELVAPA PTPRE+K LSDIDDQQGLRFQIP I FY NEPSM+GKDP
Sbjct  4     SSPSLVFTVQRCQPELVAPAKPTPREVKPLSDIDDQQGLRFQIPFILFYGNEPSMAGKDP  63

Query  1363  VQVIRQALAKALVFFYPFAGRLREGPGRKLMVDCTGEGVMFIEADADATLQHFAVGGELK  1184
              +VIR+ALA+ LVF+YPFAGR+REGPGRKL+VDCTGEGVMFIEADADATL    +G  L+
Sbjct  64    AKVIREALAQTLVFYYPFAGRIREGPGRKLVVDCTGEGVMFIEADADATLDQ--LGDTLQ  121

Query  1183  PPFPCFDQLLYNVPGSAEILNCPLFLIQVTRLRCGGFIFALRLNHSMSDACGLVHFLNTI  1004
             PPFPCF+QLLY+VPGS  +++CPL L QVTR +CGGF  A+RLNH+MSD  G+  F+NT+
Sbjct  122   PPFPCFEQLLYDVPGSEGVIDCPLMLFQVTRFKCGGFALAVRLNHTMSDGAGIALFMNTL  181

Query  1003  AEIARGAEAPSVYPVWQREFFDARNPPRITCTHFEYEEEPAADSMVTNIPL--DNLVHRS  830
             AE+A+GA  PSV PVW+RE   AR+PP ITC H EYE+ P  ++M   IP   + +V RS
Sbjct  182   AEMAQGATEPSVPPVWRRELLQARDPPHITCNHREYEQIP--NNMEGIIPSYENKMVLRS  239

Query  829   FFFGPTEISALRSSLPPHLLKCSRFEVVTACLWRCRTIAMEFDPNDEVRIFGTVNARPRL  650
             FFFG ++I+ALR  +P +  KC+ F+++TAC WRCRT A+E D +++VR+   VNAR R 
Sbjct  240   FFFGASDIAALRRLVPHYHRKCTSFDLITACFWRCRTKALEIDADEDVRMMVIVNARARF  299

Query  649   KNPPVPNGYYGNAFVYPGAKSTAGKVSKSPLSHALELVTNIKSSFTEEYIKSVADLMILK  470
              NPP+P GYYG    YP A +TAGK+ ++P  +A+EL+  +K   TEEY+ SVADLM+  
Sbjct  300   -NPPLPAGYYG----YPAAVTTAGKLCENPFGYAVELINKLKGEVTEEYMHSVADLMVTN  354

Query  469   GRPTFTLQGTFIVSDVTRVGFPEIDMGWGQSVFggpahggvggipGLITFYIPYEDNKGD  290
             GR  FT   +FIVSD+   GF +ID GWG++++GG A GG G  P +  + + +++ KG+
Sbjct  355   GRCLFTTVRSFIVSDLRHFGFKQIDFGWGRALYGGVAKGGAGPFPAVF-YLMAHKNAKGE  413

Query  289   HGILVPMCLPAIAMGKFVKELENCLM  212
              GIL+P+ LPA AM KF  EL++ L+
Sbjct  414   EGILLPIWLPAKAMDKFANELDHMLI  439



>ref|XP_006878638.1| hypothetical protein AMTR_s00011p00264170 [Amborella trichopoda]
 gb|ERM94783.1| hypothetical protein AMTR_s00011p00264170 [Amborella trichopoda]
Length=476

 Score =   511 bits (1316),  Expect = 4e-173, Method: Compositional matrix adjust.
 Identities = 247/442 (56%), Positives = 334/442 (76%), Gaps = 6/442 (1%)
 Frame = -1

Query  1549  MASQPSIAFTVTRQNPELVAPADPTPREIKYLSDIDDQQGLRFQIPVIHFYRNEPSMSGK  1370
             MA++ ++ F+VT   P LV P+ PTP EIK LSDIDDQ+G RFQIPV+ FYR +P M G+
Sbjct  1     MATK-TLEFSVTVSEPVLVTPSRPTPYEIKPLSDIDDQEGFRFQIPVVQFYRKDPQMDGR  59

Query  1369  DPVQVIRQALAKALVFFYPFAGRLREGPGRKLMVDCTGEGVMFIEADADATLQHFAVGGE  1190
             DP +V+R AL++ALV++YPFAGRLREG  RKL V+C+GEGV+F+E DAD +L+ F  G  
Sbjct  60    DPARVVRDALSEALVYYYPFAGRLREGENRKLSVECSGEGVLFVEGDADVSLEEF--GDA  117

Query  1189  LKPPFPCFDQLLYNVPGSAEILNCPLFLIQVTRLRCGGFIFALRLNHSMSDACGLVHFLN  1010
             L+PPFPC+++LL +VPGS  ++ CPL  IQVTRLRCGGFIFALRLNH+MSDA GLV F+N
Sbjct  118   LQPPFPCWEKLLIHVPGSDGVIGCPLLFIQVTRLRCGGFIFALRLNHTMSDASGLVQFMN  177

Query  1009  TIAEIARGAEAPSVYPVWQREFFDARNPPRITCTHFEYEEEPAADSMVTNIPLDNLVHRS  830
              + E+ARG   PS++PVWQR   +ARNPP +T  H EY++ P  D+  T +PLD++ HRS
Sbjct  178   GVGELARGLPRPSIFPVWQRHLLNARNPPCVTYAHREYDQVP--DTNNTLMPLDDMAHRS  235

Query  829   FFFGPTEISALRSSLPPHLLKCSRFEVVTACLWRCRTIAMEFDPNDEVRIFGTVNARPRL  650
             FFFGP+E +ALRS LPPHL K S F+++ ACLW+CRT A+  + +++VR+   VNAR + 
Sbjct  236   FFFGPSEAAALRSQLPPHLAKASTFDLLAACLWKCRTTALTMNNDEDVRLVCIVNARSKF  295

Query  649   KNPPVPNGYYGNAFVYPGAKSTAGKVSKSPLSHALELVTNIKSSFTEEYIKSVADLMILK  470
             + PP+P GYYGNAF  P A S AG + ++P  +A+ELV   K   T+EY++SVADLM+ K
Sbjct  296   R-PPLPQGYYGNAFALPIAVSKAGSLRRNPFGYAVELVRKAKEEVTDEYMRSVADLMVTK  354

Query  469   GRPTFTLQGTFIVSDVTRVGFPEIDMGWGQSVFggpahggvggipGLITFYIPYEDNKGD  290
             GRP FT+  TF+VSD+ R GF E+D GWG++V+GG A GGVG IPG+ +F+I +++  G 
Sbjct  355   GRPHFTVVNTFLVSDIRRAGFGEVDFGWGKAVYGGAAKGGVGAIPGVASFFIAFKNGDGV  414

Query  289   HGILVPMCLPAIAMGKFVKELE  224
              G ++P+CLP  AM +F +E++
Sbjct  415   DGTVIPICLPEAAMPRFTREVK  436



>ref|XP_002265841.1| PREDICTED: methanol O-anthraniloyltransferase [Vitis vinifera]
 emb|CBI37446.3| unnamed protein product [Vitis vinifera]
Length=451

 Score =   510 bits (1313),  Expect = 5e-173, Method: Compositional matrix adjust.
 Identities = 254/443 (57%), Positives = 324/443 (73%), Gaps = 9/443 (2%)
 Frame = -1

Query  1549  MASQPS-IAFTVTRQNPELVAPADPTPREIKYLSDIDDQQGLRFQIPVIHFYRNEPSMSG  1373
             MAS  S + F+V R  PE V P +PTPRE+K LSDIDDQ+GLRFQIPVI FY N P M G
Sbjct  1     MASSWSPLVFSVKRCAPEFVRPTNPTPREVKQLSDIDDQEGLRFQIPVIMFYPNNPLMKG  60

Query  1372  KDPVQVIRQALAKALVFFYPFAGRLREGPGRKLMVDCTGEGVMFIEADADATLQHFAVGG  1193
             KDPV+VIR+AL KALV++YPFAGRL EG  RKLMVDCTGEGV+FIEADAD TL++  +G 
Sbjct  61    KDPVKVIREALGKALVYYYPFAGRLIEGDNRKLMVDCTGEGVLFIEADADTTLEN--LGD  118

Query  1192  ELKPPFPCFDQLLYNVPGSAEILNCPLFLIQVTRLRCGGFIFALRLNHSMSDACGLVHFL  1013
              ++P  PCF++LLY+VPGS  IL  PL LIQVTRLRCGGFIFALRLNH+MSDA GL+ FL
Sbjct  119   AIQPMCPCFEELLYDVPGSGGILGSPLILIQVTRLRCGGFIFALRLNHTMSDALGLIQFL  178

Query  1012  NTIAEIARGAEAPSVYPVWQREFFDARNPPRITCTHFEYEEEPAADSMVTNIPLDNLVHR  833
             N I+E+A+G   PS+ P+W+RE  +ARNPPRIT  H EYEE       +  +  +NLVHR
Sbjct  179   NAISEMAQGLSVPSLLPIWERELLNARNPPRITRIHHEYEEVTNNKGTLMAMDENNLVHR  238

Query  832   SFFFGPTEISALRSSLPPHLLKCSRFEVVTACLWRCRTIAMEFDPNDEVRIFGTVNARPR  653
             SFFFGP EI ALR+ LP  L  CS FEV+TA +WRCRTIA   DP++ VRI   +N R +
Sbjct  239   SFFFGPKEIRALRNRLPASLGACSTFEVLTAYVWRCRTIAFAVDPDEVVRISCLINMRGK  298

Query  652   LKNPPVPNGYYGNAFVYPGAKSTAGKVSKSPLSHALELVTNIKSSFTEEYIKSVADLMIL  473
              +   +P GYYGNAFVYP + + AG + K+PL +A+ L+   K+  ++EYIKSVADLM++
Sbjct  299   -RGFDLPPGYYGNAFVYPASITKAGMLCKNPLEYAIRLLKKAKAEMSQEYIKSVADLMVI  357

Query  472   KGRPTFTLQGTFIVSDVTRVGFPEIDMGWGQSVFggpahggvggipGLITFYIPYEDNKG  293
             KGRP+FT  G + VSDVTR GF E++ GWG+ V+     GG+     +I+F   + ++KG
Sbjct  358   KGRPSFTQPGNYFVSDVTRAGFGEVNFGWGKPVY-----GGLARALSIISFCTRFRNSKG  412

Query  292   DHGILVPMCLPAIAMGKFVKELE  224
             + G ++P+CLP   M +F +EL+
Sbjct  413   EEGNVIPICLPPPVMERFEQELK  435



>ref|XP_002271603.1| PREDICTED: methanol O-anthraniloyltransferase [Vitis vinifera]
Length=449

 Score =   509 bits (1312),  Expect = 7e-173, Method: Compositional matrix adjust.
 Identities = 255/445 (57%), Positives = 325/445 (73%), Gaps = 13/445 (3%)
 Frame = -1

Query  1549  MASQPS-IAFTVTRQNPELVAPADPTPREIKYLSDIDDQQGLRFQIPVIHFYRNEPSMSG  1373
             MAS  S + F+V R +P++V PA+PTPRE+K LSDIDDQ+GLRFQIPVI FYRN P M G
Sbjct  1     MASSSSPLVFSVNRCDPQIVRPANPTPREVKQLSDIDDQEGLRFQIPVIMFYRNNPLMDG  60

Query  1372  KDPVQVIRQALAKALVFFYPFAGRLREGPGRKLMVDCTGEGVMFIEADADATLQHFAVGG  1193
             KDPV+VIR+AL KAL+++YPFAGRL EG  RKLMVDCTGEGV+FIEADAD TL++  +G 
Sbjct  61    KDPVKVIREALGKALIYYYPFAGRLIEGDNRKLMVDCTGEGVLFIEADADTTLEN--LGD  118

Query  1192  ELKPPFPCFDQLLYNVPGSAEILNCPLFLIQVTRLRCGGFIFALRLNHSMSDACGLVHFL  1013
              ++P  PCF++LLY+VPGS  IL  PL LIQVTRLRCGGFIFALRLNH++SDA GL+ FL
Sbjct  119   AIQPMCPCFEELLYDVPGSTRILGSPLILIQVTRLRCGGFIFALRLNHTLSDAAGLIQFL  178

Query  1012  NTIAEIARGAEAPSVYPVWQREFFDARNPPRITCTHFEYEEEPAADSMVTNIPLDNLVHR  833
             NTI E+A+G   PS+ P+WQRE  +ARNPP+IT  H EYE+       +  +  +NLVHR
Sbjct  179   NTIGEMAQGLSVPSLLPIWQRELLNARNPPQITRIHHEYEKVTNTKGTLMAMDENNLVHR  238

Query  832   SFFFGPTEISALRSSLPPHLLKCSRFEVVTACLWRCRTIAMEFDPNDEVRIFGTVNARPR  653
             SFFFG  EI ALR+ LP  L  CS FEV+ AC+WRCRTIA   DP++ V I   +N R +
Sbjct  239   SFFFGREEIRALRNRLPASLGACSTFEVLMACVWRCRTIAFAVDPDEVVGISCIINMRGK  298

Query  652   --LKNPPVPNGYYGNAFVYPGAKSTAGKVSKSPLSHALELVTNIKSSFTEEYIKSVADLM  479
               L+ PP   GYYGNAFV P + + AG + K+PL  A+ LV   K+  ++EYIKSVADLM
Sbjct  299   HGLELPP---GYYGNAFVTPASITKAGMLCKNPLEFAIRLVKKAKAEMSQEYIKSVADLM  355

Query  478   ILKGRPTFTLQGTFIVSDVTRVGFPEIDMGWGQSVFggpahggvggipGLITFYIPYEDN  299
             ++KGRP FT  G +IVSDVTR G  E+D GWG+ V+     GGV     +I+F + + ++
Sbjct  356   VIKGRPLFTQPGNYIVSDVTRAGIGEVDFGWGKPVY-----GGVAKASPIISFRMWFRNS  410

Query  298   KGDHGILVPMCLPAIAMGKFVKELE  224
             KG+ G ++P+CLP   M +F +EL+
Sbjct  411   KGEEGNVIPICLPPPVMERFEQELK  435



>ref|XP_006370913.1| hypothetical protein POPTR_0019s01680g [Populus trichocarpa]
 gb|ERP48710.1| hypothetical protein POPTR_0019s01680g [Populus trichocarpa]
Length=452

 Score =   509 bits (1311),  Expect = 1e-172, Method: Compositional matrix adjust.
 Identities = 240/444 (54%), Positives = 325/444 (73%), Gaps = 12/444 (3%)
 Frame = -1

Query  1549  MASQPS-IAFTVTRQNPELVAPADPTPREIKYLSDIDDQQGLRFQIPVIHFYRNEPSMSG  1373
             MA+ P+ + F V+R+ P L+ P++PTP E+K LSDIDDQ GLR QIP+I+FY  +PSM  
Sbjct  1     MATPPTPLVFKVSRREPVLITPSEPTPHELKPLSDIDDQDGLRVQIPLIYFYPYDPSMQR  60

Query  1372  KDPVQVIRQALAKALVFFYPFAGRLREGPGRKLMVDCTGEGVMFIEADADATLQHFAVGG  1193
             +DPV+VI++ALAK LVF+YPFAGRLREGP RKL+V+CTGEG++FIEADAD TL+ F  G 
Sbjct  61    RDPVEVIKEALAKTLVFYYPFAGRLREGPKRKLLVECTGEGILFIEADADVTLEQF--GN  118

Query  1192  ELKPPFPCFDQLLYNVPGSAEILNCPLFLIQVTRLRCGGFIFALRLNHSMSDACGLVHFL  1013
              L PP PC ++LL++VPGS+ ++NCPL LIQVTRL+CGG +FA+RLNH+MSD  GL  FL
Sbjct  119   ALYPPIPCLEELLFDVPGSSGMINCPLLLIQVTRLKCGGIVFAIRLNHTMSDGTGLNQFL  178

Query  1012  NTIAEIARGAEAPSVYPVWQREFFDARNPPRITCTHFEYEEEPAADSMVTNIPLDNLVHR  833
             + + E+  GA+ PS+ PVW+R+  +ARNPP++TC H EY++    D    N+PL    HR
Sbjct  179   SAMCEMVHGAQTPSIQPVWERDVLNARNPPQVTCLHHEYDQ--LVDDTTDNVPLTKKTHR  236

Query  832   SFFFGPTEISALRSSLPPHLLKCSRFEVVTACLWRCRTIAMEFDPNDEVRIFGTVNARPR  653
             SFFFG   ISA+R   P HL  CS F+V+TA LWRCRTIA++ +PNDE+RI   VNAR R
Sbjct  237   SFFFGAANISAIRGFAPLHLRHCSTFDVLTAFLWRCRTIALQPNPNDEMRILCIVNARNR  296

Query  652   LKNPPVPNGYYGNAFVYPGAKSTAGKVSKSPLSHALELVTNIKSSFTEEYIKSVADLMIL  473
               NPP+P GYYGN   Y  A +TAG++S++ L   LELV   K++ TEEY++SVADL+++
Sbjct  297   F-NPPLPRGYYGNCIAYSVAMATAGEISRNSLGFTLELVRKAKANVTEEYMRSVADLLVI  355

Query  472   KGRPTFTLQGTFIVSDVTRVGFPEIDMGWGQSVFggpahggvggipGLITFYIPYEDNKG  293
             KGRP +T+  +++VSDVTR  F E+++GWG+  +             + +F IPY   KG
Sbjct  356   KGRPWYTMVRSYLVSDVTRAMFAEMNLGWGKPKY------AGPAKGNVASFQIPYRTKKG  409

Query  292   DHGILVPMCLPAIAMGKFVKELEN  221
             + G+L+ +CLP  AM +FVKEL++
Sbjct  410   EDGVLMTLCLPTPAMERFVKELDS  433



>ref|XP_007029790.1| Benzoyl coenzyme A: Benzyl alcohol benzoyl transferase [Theobroma 
cacao]
 gb|EOY10292.1| Benzoyl coenzyme A: Benzyl alcohol benzoyl transferase [Theobroma 
cacao]
Length=457

 Score =   509 bits (1310),  Expect = 2e-172, Method: Compositional matrix adjust.
 Identities = 252/441 (57%), Positives = 318/441 (72%), Gaps = 9/441 (2%)
 Frame = -1

Query  1534  SIAFTVTRQNPELVAPADPTPREIKYLSDIDDQQGLRFQIPVIHFYRNEPSMSGKDPVQV  1355
             S+ FTV R  PELV PA PTP E K LSDIDDQ+  RFQ+PVI FYR  P M GKDP  +
Sbjct  7     SLVFTVRRCEPELVGPAKPTPNECKRLSDIDDQESFRFQVPVIQFYRYNPCMQGKDPAMI  66

Query  1354  IRQALAKALVFFYPFAGRLREGPGRKLMVDCTGEGVMFIEADADATLQHFAVGGELKPPF  1175
             +R+ALA+ALVF+YP AGRLREGP RKLMVDC GEG +F+EADAD TL+ F  G  L+PPF
Sbjct  67    VREALAQALVFYYPLAGRLREGPNRKLMVDCNGEGALFVEADADVTLEQF--GDALQPPF  124

Query  1174  PCFDQLLYNVPGSAEILNCPLFLIQVTRLRCGGFIFALRLNHSMSDACGLVHFLNTIAEI  995
             PC  +LLY+ P S  +LN PL  IQVTRLRCGGFIFA+ LNH MSDA G++ F+  +AEI
Sbjct  125   PCLHELLYDTPSSEGMLNSPLLFIQVTRLRCGGFIFAISLNHVMSDASGMIQFMFAMAEI  184

Query  994   ARGAEAPSVYPVWQREFFDARNPPRITCTHFEYEEEPAADSMVTNIPLDNLVHRSFFFGP  815
             A GA AP + PVW+R   DAR+PPR   TH EY++  AA    +  P +N VHRSFFFGP
Sbjct  185   AHGA-APLIPPVWERHLLDARDPPRAAFTHHEYDQVEAA----SITPSENTVHRSFFFGP  239

Query  814   TEISALRSSLPPHLLKCSRFEVVTACLWRCRTIAMEFDPNDEVRIFGTVNARPRLKNPPV  635
              E+S LR  LP HL KCSRFE++ ACLWRCRTIA++ DP +EVR+   VN R R  NPP+
Sbjct  240   NEVSTLRRLLPEHLCKCSRFELLAACLWRCRTIAIKPDPEEEVRMLSMVNVR-RKFNPPL  298

Query  634   PNGYYGNAFVYPGAKSTAGKVSKSPLSHALELVTNIKSSFTEEYIKSVADLMILKGRPTF  455
             P+GYYGNA  +P A +TA K+ ++PL +A++LV   K S TEEY+KSVA LM++KGRP +
Sbjct  299   PSGYYGNAVAFPAAITTARKLCQNPLGYAVKLVKQAKESVTEEYVKSVAALMVIKGRPHY  358

Query  454   TLQGTFIVSDVTRVGFPEIDMGWGQSVFggpahggvggipGL-ITFYIPYEDNKGDHGIL  278
                 + ++SD+TR GF E+D GWG++V+GG    G+G       +F I  ++ KG+ GI 
Sbjct  359   PTVRSCLISDLTRAGFGEVDFGWGKAVYGGLPKAGLGATLHAPSSFLIAVKNKKGEAGIA  418

Query  277   VPMCLPAIAMGKFVKELENCL  215
             +P+CLPA AM +F KEL++ L
Sbjct  419   MPICLPAPAMERFAKELDSLL  439



>ref|XP_002266114.1| PREDICTED: methanol O-anthraniloyltransferase isoform X1 [Vitis 
vinifera]
Length=451

 Score =   508 bits (1308),  Expect = 3e-172, Method: Compositional matrix adjust.
 Identities = 251/443 (57%), Positives = 325/443 (73%), Gaps = 9/443 (2%)
 Frame = -1

Query  1549  MASQPS-IAFTVTRQNPELVAPADPTPREIKYLSDIDDQQGLRFQIPVIHFYRNEPSMSG  1373
             MAS  S + F+V R +PE V P +PTPRE+K LSDIDDQ+GLRFQ+PVI FY N P M G
Sbjct  1     MASSSSPLVFSVKRHDPEFVRPTNPTPREVKQLSDIDDQEGLRFQVPVIMFYPNNPLMKG  60

Query  1372  KDPVQVIRQALAKALVFFYPFAGRLREGPGRKLMVDCTGEGVMFIEADADATLQHFAVGG  1193
             KDPV+VIR+AL KALV++YPFAGRL EG  RKLMVDCTGEGV+FIEADAD+TL++  +G 
Sbjct  61    KDPVKVIREALGKALVYYYPFAGRLIEGHNRKLMVDCTGEGVLFIEADADSTLEN--LGD  118

Query  1192  ELKPPFPCFDQLLYNVPGSAEILNCPLFLIQVTRLRCGGFIFALRLNHSMSDACGLVHFL  1013
              ++P  PCF++LLY+VPGS  IL  PL LIQVTRLRCGGFIFALRLNH+MSD  GLV FL
Sbjct  119   AIQPMCPCFEELLYDVPGSGGILGSPLILIQVTRLRCGGFIFALRLNHTMSDGPGLVQFL  178

Query  1012  NTIAEIARGAEAPSVYPVWQREFFDARNPPRITCTHFEYEEEPAADSMVTNIPLDNLVHR  833
             + I+E+A+G   PS+ P+WQRE  +ARNPPRIT  H EY+E   A   +  +  +NLVHR
Sbjct  179   DAISEMAQGLSVPSLLPIWQRELLNARNPPRITRIHHEYQEVTNAKGTLMTMDENNLVHR  238

Query  832   SFFFGPTEISALRSSLPPHLLKCSRFEVVTACLWRCRTIAMEFDPNDEVRIFGTVNARPR  653
             SFFFGP EI ALR+ LP  L  CS FEV+ A +WRCRTIA   DP++ VRI   +N R +
Sbjct  239   SFFFGPKEIRALRNRLPASLGACSTFEVLIAYVWRCRTIAFAVDPDEVVRISCLINMRGK  298

Query  652   LKNPPVPNGYYGNAFVYPGAKSTAGKVSKSPLSHALELVTNIKSSFTEEYIKSVADLMIL  473
              +   +P GYYGNAFVYP + + AG + K+PL +A+ L+   K+  ++EY+KSVADLM++
Sbjct  299   -RGFDLPPGYYGNAFVYPASITKAGMLCKNPLEYAIRLLKKAKAEMSQEYVKSVADLMVI  357

Query  472   KGRPTFTLQGTFIVSDVTRVGFPEIDMGWGQSVFggpahggvggipGLITFYIPYEDNKG  293
             KGRP+FT  G +++SD+TR GF EID GWG+ V+GG A          I+F + + ++KG
Sbjct  358   KGRPSFTQPGNYLISDLTRAGFGEIDFGWGKPVYGGIARALSN-----ISFCMRFRNSKG  412

Query  292   DHGILVPMCLPAIAMGKFVKELE  224
             + G ++P+CLP     +F +EL+
Sbjct  413   EEGNVIPICLPPPVTERFEQELK  435



>emb|CAN74729.1| hypothetical protein VITISV_042062 [Vitis vinifera]
Length=451

 Score =   507 bits (1305),  Expect = 9e-172, Method: Compositional matrix adjust.
 Identities = 253/443 (57%), Positives = 323/443 (73%), Gaps = 9/443 (2%)
 Frame = -1

Query  1549  MASQPS-IAFTVTRQNPELVAPADPTPREIKYLSDIDDQQGLRFQIPVIHFYRNEPSMSG  1373
             MAS  S + F+V R  PE V P + TPRE+K LSDIDDQ+GLRFQIPVI FY N P M G
Sbjct  1     MASSWSPLVFSVKRCAPEFVRPTNLTPREVKQLSDIDDQEGLRFQIPVIMFYPNNPLMKG  60

Query  1372  KDPVQVIRQALAKALVFFYPFAGRLREGPGRKLMVDCTGEGVMFIEADADATLQHFAVGG  1193
             KDPV+VIR+AL KALV++YPFAGRL EG  RKLMVDCTGEGV+FIEADAD TL++  +G 
Sbjct  61    KDPVKVIREALGKALVYYYPFAGRLIEGDNRKLMVDCTGEGVLFIEADADTTLEN--LGD  118

Query  1192  ELKPPFPCFDQLLYNVPGSAEILNCPLFLIQVTRLRCGGFIFALRLNHSMSDACGLVHFL  1013
              ++P  PCF++LLY+VPGS  IL  PL LIQVTRLRCGGFIFALRLNH+MSDA GL+ FL
Sbjct  119   AIQPMCPCFEELLYDVPGSGGILGSPLILIQVTRLRCGGFIFALRLNHTMSDALGLIQFL  178

Query  1012  NTIAEIARGAEAPSVYPVWQREFFDARNPPRITCTHFEYEEEPAADSMVTNIPLDNLVHR  833
             N I+E+A+G   PS+ P+W+RE  +ARNPPRIT  H EYEE       +  +  +NLVHR
Sbjct  179   NAISEMAQGLSVPSLLPIWERELLNARNPPRITRIHHEYEEVTNNKGTLMAMDENNLVHR  238

Query  832   SFFFGPTEISALRSSLPPHLLKCSRFEVVTACLWRCRTIAMEFDPNDEVRIFGTVNARPR  653
             SFFFGP EI ALR+ LP  L  CS FEV+TA +WRCRTIA   DP++ VRI   +N R +
Sbjct  239   SFFFGPKEIRALRNRLPASLGACSTFEVLTAYVWRCRTIAFAVDPDEVVRISCLINMRGK  298

Query  652   LKNPPVPNGYYGNAFVYPGAKSTAGKVSKSPLSHALELVTNIKSSFTEEYIKSVADLMIL  473
              +   +P GYYGNAFVYP + + AG + K+PL +A+ L+   K+  ++EYIKSVADLM++
Sbjct  299   -RGFDLPPGYYGNAFVYPASITKAGMLCKNPLEYAIRLLKKAKAEMSQEYIKSVADLMVI  357

Query  472   KGRPTFTLQGTFIVSDVTRVGFPEIDMGWGQSVFggpahggvggipGLITFYIPYEDNKG  293
             KGRP+FT  G + VSDVTR GF E++ GWG+ V+     GG+     +I+F   + ++KG
Sbjct  358   KGRPSFTQPGNYFVSDVTRAGFGEVNFGWGKPVY-----GGLARALSIISFCTRFRNSKG  412

Query  292   DHGILVPMCLPAIAMGKFVKELE  224
             + G ++P+CLP   M +F +EL+
Sbjct  413   EEGNVIPICLPPPVMERFEQELK  435



>emb|CAN77583.1| hypothetical protein VITISV_040970 [Vitis vinifera]
Length=451

 Score =   505 bits (1301),  Expect = 3e-171, Method: Compositional matrix adjust.
 Identities = 251/443 (57%), Positives = 321/443 (72%), Gaps = 9/443 (2%)
 Frame = -1

Query  1549  MASQPS-IAFTVTRQNPELVAPADPTPREIKYLSDIDDQQGLRFQIPVIHFYRNEPSMSG  1373
             MAS  S + F+V R +PE V P +PTPRE+K LSDIDDQ+GLRFQ+PVI FY N P M G
Sbjct  1     MASSSSPLVFSVKRXDPEFVRPTNPTPREVKQLSDIDDQEGLRFQVPVIMFYPNNPLMKG  60

Query  1372  KDPVQVIRQALAKALVFFYPFAGRLREGPGRKLMVDCTGEGVMFIEADADATLQHFAVGG  1193
             KDPV+VIR+AL KALV++YPFAGRL EG  RKLMVDCTGEGV+FIEADAD+TL++  +G 
Sbjct  61    KDPVKVIREALGKALVYYYPFAGRLIEGXNRKLMVDCTGEGVLFIEADADSTLEN--LGD  118

Query  1192  ELKPPFPCFDQLLYNVPGSAEILNCPLFLIQVTRLRCGGFIFALRLNHSMSDACGLVHFL  1013
              ++P  PCF++LLY+VPGS  IL  PL LIQVTRLRCGGFIFALRLNH+MSD  GLV FL
Sbjct  119   AIQPMCPCFEELLYDVPGSGGILGSPLILIQVTRLRCGGFIFALRLNHTMSDGPGLVQFL  178

Query  1012  NTIAEIARGAEAPSVYPVWQREFFDARNPPRITCTHFEYEEEPAADSMVTNIPLDNLVHR  833
             + I+E+A+G   PS+ P+WQRE  +ARNPPRIT  H EYEE       +  +  +NLVHR
Sbjct  179   DAISEMAQGLSVPSLLPIWQRELLNARNPPRITLIHHEYEEVTNTKGTLMTMDENNLVHR  238

Query  832   SFFFGPTEISALRSSLPPHLLKCSRFEVVTACLWRCRTIAMEFDPNDEVRIFGTVNARPR  653
             SFFFGP EI ALR+ LP  L  CS FEV+ A +WRCRTIA   DP++ VRI    N R +
Sbjct  239   SFFFGPKEIRALRNRLPASLGACSTFEVLIAYVWRCRTIAFAVDPDEVVRISCLTNMRGK  298

Query  652   LKNPPVPNGYYGNAFVYPGAKSTAGKVSKSPLSHALELVTNIKSSFTEEYIKSVADLMIL  473
              +   +P GYYGNAFVYP + + AG + K+PL +A+ L+   K+  ++EY+KSVADLM++
Sbjct  299   -RGFDLPPGYYGNAFVYPASITKAGMLCKNPLEYAIRLLKKAKAEMSQEYVKSVADLMVI  357

Query  472   KGRPTFTLQGTFIVSDVTRVGFPEIDMGWGQSVFggpahggvggipGLITFYIPYEDNKG  293
             KGRP FT  G +I+SD+TR GF E D GWG+ V+GG A          I+F + + ++KG
Sbjct  358   KGRPLFTQPGNYIISDLTRAGFGEXDFGWGKPVYGGXARALSX-----ISFCMRFRNSKG  412

Query  292   DHGILVPMCLPAIAMGKFVKELE  224
             + G ++P+CLP     +F +EL+
Sbjct  413   EEGNVIPICLPPPVXERFEQELK  435



>ref|XP_010040516.1| PREDICTED: benzyl alcohol O-benzoyltransferase-like isoform X1 
[Eucalyptus grandis]
 gb|KCW45153.1| hypothetical protein EUGRSUZ_L01233 [Eucalyptus grandis]
Length=458

 Score =   505 bits (1301),  Expect = 4e-171, Method: Compositional matrix adjust.
 Identities = 253/441 (57%), Positives = 325/441 (74%), Gaps = 7/441 (2%)
 Frame = -1

Query  1549  MASQPSIAFTVTRQNPELVAPADPTPREIKYLSDIDDQQGLRFQIPVIHFYRNEPSMSGK  1370
             MA Q S+ F V R   ELV PA PTPRE K LSDIDD++GLRF IPVI FYR + +  G+
Sbjct  1     MAPQDSLIFKVRRCEAELVRPAKPTPREYKRLSDIDDREGLRFLIPVIQFYRGDDT--GR  58

Query  1369  DPVQVIRQALAKALVFFYPFAGRLREGPGRKLMVDCTGEGVMFIEADADATLQHFAVGGE  1190
             DP + IR+ LA ALVF+YPFAGRLRE PGRKL+VDC  EGV F+EA AD TL  F  G  
Sbjct  59    DPARAIREGLANALVFYYPFAGRLREWPGRKLVVDCNEEGVAFVEASADVTLDQF--GDA  116

Query  1189  LKPPFPCFDQLLYNVPGSAEILNCPLFLIQVTRLRCGGFIFALRLNHSMSDACGLVHFLN  1010
             L PPFPC ++LL+++PGS  +L+ PL LIQVTRL+CGGFIFA+ LNH+MSDA GLV  L 
Sbjct  117   LHPPFPCLEELLFDIPGSFSVLDSPLLLIQVTRLKCGGFIFAVHLNHTMSDATGLVQLLK  176

Query  1009  TIAEIARGAEAPSVYPVWQREFFDARNPPRITCTHFEYEEEPAADSMVTNIPLDNLVHRS  830
              + E+ARGA APS+ PVWQRE  DAR+PPRITC H E+++   AD+  T  PLD++ HRS
Sbjct  177   AVGEMARGANAPSILPVWQRELLDARDPPRITCNHHEFDQ--VADTKGTLNPLDDMDHRS  234

Query  829   FFFGPTEISALRSSLPPHLLKCSRFEVVTACLWRCRTIAMEFDPNDEVRIFGTVNARPRL  650
             F F P ++S LR+ LPPH    S FE++TA +WRCRTIA + DP +EVR+   VNAR + 
Sbjct  235   FIFSPAQMSILRNGLPPHQRVSSTFEILTAFVWRCRTIAHQHDPEEEVRLLCIVNARSKF  294

Query  649   KNPPVPNGYYGNAFVYPGAKSTAGKVSKSPLSHALELVTNIKSSFTEEYIKSVADLMILK  470
              NPP+P GYYGNAF  PGA ++AGK+ ++PL +ALELV   K+  TEEY++S+ADLM+++
Sbjct  295   -NPPLPAGYYGNAFASPGAVTSAGKLCQNPLGYALELVKKAKAEATEEYMRSLADLMVIR  353

Query  469   GRPTFTLQGTFIVSDVTRVGFPEIDMGWGQSVFggpahggvggipGLITFYIPYEDNKGD  290
             GRP  T   +F+VSD T+VGF ++D GWG++++GG A G VG  PGL +FYI   + +G+
Sbjct  354   GRPRGTEVRSFMVSDTTKVGFGDVDFGWGKAMYGGQATGAVGANPGLASFYILSRNYQGE  413

Query  289   HGILVPMCLPAIAMGKFVKEL  227
               I+V +CLPA  M +FV+EL
Sbjct  414   TSIIVTVCLPAPVMQRFVQEL  434



>emb|CBI37442.3| unnamed protein product [Vitis vinifera]
Length=475

 Score =   505 bits (1301),  Expect = 9e-171, Method: Compositional matrix adjust.
 Identities = 248/449 (55%), Positives = 322/449 (72%), Gaps = 8/449 (2%)
 Frame = -1

Query  1570  IMALSPFMASQPSIAFTVTRQNPELVAPADPTPREIKYLSDIDDQQGLRFQIPVIHFYRN  1391
             I+A     +S   + F+V R+ PE V P +PTPRE+K LSD+DDQ+GLRFQIPVI FY N
Sbjct  19    ILAWKDMASSSSPLVFSVKRRAPEFVRPTNPTPREVKQLSDLDDQEGLRFQIPVIMFYPN  78

Query  1390  EPSMSGKDPVQVIRQALAKALVFFYPFAGRLREGPGRKLMVDCTGEGVMFIEADADATLQ  1211
              P M GKDP +VI++AL KALV++YPFAGRL EG  RKLMVDCTGEGV+FIEADAD TL+
Sbjct  79    NPLMKGKDPAKVIKEALGKALVYYYPFAGRLIEGDNRKLMVDCTGEGVLFIEADADTTLE  138

Query  1210  HFAVGGELKPPFPCFDQLLYNVPGSAEILNCPLFLIQVTRLRCGGFIFALRLNHSMSDAC  1031
             +  +G  ++P  PCF++LLY+VPGS  IL  PL LIQVTRLRCGGFIFALRLNH+MSD  
Sbjct  139   N--LGDAIQPMCPCFEELLYDVPGSGGILGSPLILIQVTRLRCGGFIFALRLNHTMSDGP  196

Query  1030  GLVHFLNTIAEIARGAEAPSVYPVWQREFFDARNPPRITCTHFEYEEEPAADSMVTNIPL  851
             GLV FL+ I+E+A+G   PS+ P+WQRE  +ARNPPRIT  H EYEE       +  +  
Sbjct  197   GLVQFLDAISEMAQGLSVPSLLPIWQRELLNARNPPRITRIHHEYEEVTNTKGTLMTMDE  256

Query  850   DNLVHRSFFFGPTEISALRSSLPPHLLKCSRFEVVTACLWRCRTIAMEFDPNDEVRIFGT  671
             +NLVHRSFFFGP EI ALR+ LP  L  CS FEV+ A +WRCRTIA   DP++ VRI   
Sbjct  257   NNLVHRSFFFGPKEIRALRNRLPASLGACSTFEVLIAYVWRCRTIAFAVDPDEVVRISCL  316

Query  670   VNARPRLKNPPVPNGYYGNAFVYPGAKSTAGKVSKSPLSHALELVTNIKSSFTEEYIKSV  491
             +N R + +   +P GYYGNAFVYP + + AG + K+PL +A+ L+   K+  ++EY+KSV
Sbjct  317   INMRGK-RGFDLPPGYYGNAFVYPASITKAGMLCKNPLEYAIRLLKKAKAEMSQEYVKSV  375

Query  490   ADLMILKGRPTFTLQGTFIVSDVTRVGFPEIDMGWGQSVFggpahggvggipGLITFYIP  311
             AD M++KGRP+FT  G +++SDVTR G  EID GWG+ V+GG A          I+F + 
Sbjct  376   ADHMVIKGRPSFTQPGNYLISDVTRAGIGEIDFGWGKPVYGGVARALSN-----ISFCMR  430

Query  310   YEDNKGDHGILVPMCLPAIAMGKFVKELE  224
             + ++KG+ G ++P+CLP   M +F +EL+
Sbjct  431   FRNSKGEEGNVIPICLPPPVMERFEQELK  459



>ref|XP_007029781.1| Benzoyl coenzyme A: Benzyl alcohol benzoyl transferase [Theobroma 
cacao]
 gb|EOY10283.1| Benzoyl coenzyme A: Benzyl alcohol benzoyl transferase [Theobroma 
cacao]
Length=562

 Score =   507 bits (1306),  Expect = 2e-170, Method: Compositional matrix adjust.
 Identities = 250/435 (57%), Positives = 315/435 (72%), Gaps = 12/435 (3%)
 Frame = -1

Query  1519  VTRQNPELVAPADPTPREIKYLSDIDDQQGLRFQIPVIHFYRNEPSMSGKDPVQVIRQAL  1340
             V R  PELV PA PTPRE K LSDIDDQ G RFQI  +HFYR +PSM GKDP  +I++AL
Sbjct  122   VRRHEPELVVPAKPTPRECKLLSDIDDQDGHRFQIRGLHFYRFKPSMQGKDPACIIKEAL  181

Query  1339  AKALVFFYPFAGRLREGPGRKLMVDCTGEGVMFIEADADATLQHFAVGGELKPPFPCFDQ  1160
              KALVF+YP+AGRLREGP RKL+VDCTGEGV+FI+ADAD TL  F  G  L PPFPC+ +
Sbjct  182   TKALVFYYPYAGRLREGPNRKLVVDCTGEGVLFIQADADVTLDQF--GDSLHPPFPCYKE  239

Query  1159  LLYNVPGSAEILNCPLFLIQVTRLRCGGFIFALRLNHSMSDACGLVHFLNTIAEIARGAE  980
             LLY VPGS EILNCPL  IQVTRL+CGGFI A R NH+M+DA G   F+  + E+ARGA 
Sbjct  240   LLYEVPGSNEILNCPLLQIQVTRLKCGGFILAHRFNHTMNDAVGQSQFMCAMGEMARGAL  299

Query  979   APSVYPVWQREFFDARNPPRITCTHFEYEEEPAADSMVTNIPLDNLVHRSFFFGPTEISA  800
             APS  PVW+R   +AR+ P ITC H EY+     + +   IP DNL+HRSFFFGPT+ISA
Sbjct  300   APSTPPVWERHLLNARHSPLITCVHDEYDNATLTNGI--EIP-DNLLHRSFFFGPTQISA  356

Query  799   LRSSLPPHLLKCSRFEVVTACLWRCRTIAMEFDPNDEVRIFGTVNARPRLKNPPVPNGYY  620
             LR  + PH L+CS F++VTACLWRCRT A++  PND+VR    VN R +  NPP+P+G+Y
Sbjct  357   LRRFV-PHNLRCSTFDIVTACLWRCRTKALKLGPNDDVRFICIVNVRSKF-NPPLPSGFY  414

Query  619   GNAFVYPGAKSTAGKVSKSPLSHALELVTNIKSSFTEEYIKSVADLMILKGRPTFTLQGT  440
             GNA  YP A +TAG++ ++P+ +A++LV   K+  TEEY+KS ADLM+++GRP       
Sbjct  415   GNALGYPAALTTAGQLCQNPMEYAIQLVRQAKAKITEEYMKSTADLMVIRGRPNVNTVRC  474

Query  439   FIVSDVTRVGFPEIDMGWGQSVFggpahggvggipGLITFYIPYEDNKGDHGILVPMCLP  260
             F+VSD+TR  F E+D GWG++ F     GG      +I+FYIP ++ +G+ GI+VP+CLP
Sbjct  475   FMVSDLTRAKFREVDFGWGEAEF-----GGPAYGGDIISFYIPSKNKEGEGGIVVPVCLP  529

Query  259   AIAMGKFVKELENCL  215
             A  M  FVKEL+  L
Sbjct  530   APVMESFVKELDGIL  544



>ref|XP_010040517.1| PREDICTED: benzyl alcohol O-benzoyltransferase-like isoform X2 
[Eucalyptus grandis]
Length=461

 Score =   503 bits (1296),  Expect = 3e-170, Method: Compositional matrix adjust.
 Identities = 251/439 (57%), Positives = 323/439 (74%), Gaps = 7/439 (2%)
 Frame = -1

Query  1543  SQPSIAFTVTRQNPELVAPADPTPREIKYLSDIDDQQGLRFQIPVIHFYRNEPSMSGKDP  1364
             S  S+ F V R   ELV PA PTPRE K LSDIDD++GLRF IPVI FYR + +  G+DP
Sbjct  6     SSDSLIFKVRRCEAELVRPAKPTPREYKRLSDIDDREGLRFLIPVIQFYRGDDT--GRDP  63

Query  1363  VQVIRQALAKALVFFYPFAGRLREGPGRKLMVDCTGEGVMFIEADADATLQHFAVGGELK  1184
              + IR+ LA ALVF+YPFAGRLRE PGRKL+VDC  EGV F+EA AD TL  F  G  L 
Sbjct  64    ARAIREGLANALVFYYPFAGRLREWPGRKLVVDCNEEGVAFVEASADVTLDQF--GDALH  121

Query  1183  PPFPCFDQLLYNVPGSAEILNCPLFLIQVTRLRCGGFIFALRLNHSMSDACGLVHFLNTI  1004
             PPFPC ++LL+++PGS  +L+ PL LIQVTRL+CGGFIFA+ LNH+MSDA GLV  L  +
Sbjct  122   PPFPCLEELLFDIPGSFSVLDSPLLLIQVTRLKCGGFIFAVHLNHTMSDATGLVQLLKAV  181

Query  1003  AEIARGAEAPSVYPVWQREFFDARNPPRITCTHFEYEEEPAADSMVTNIPLDNLVHRSFF  824
              E+ARGA APS+ PVWQRE  DAR+PPRITC H E+++   AD+  T  PLD++ HRSF 
Sbjct  182   GEMARGANAPSILPVWQRELLDARDPPRITCNHHEFDQ--VADTKGTLNPLDDMDHRSFI  239

Query  823   FGPTEISALRSSLPPHLLKCSRFEVVTACLWRCRTIAMEFDPNDEVRIFGTVNARPRLKN  644
             F P ++S LR+ LPPH    S FE++TA +WRCRTIA + DP +EVR+   VNAR +  N
Sbjct  240   FSPAQMSILRNGLPPHQRVSSTFEILTAFVWRCRTIAHQHDPEEEVRLLCIVNARSKF-N  298

Query  643   PPVPNGYYGNAFVYPGAKSTAGKVSKSPLSHALELVTNIKSSFTEEYIKSVADLMILKGR  464
             PP+P GYYGNAF  PGA ++AGK+ ++PL +ALELV   K+  TEEY++S+ADLM+++GR
Sbjct  299   PPLPAGYYGNAFASPGAVTSAGKLCQNPLGYALELVKKAKAEATEEYMRSLADLMVIRGR  358

Query  463   PTFTLQGTFIVSDVTRVGFPEIDMGWGQSVFggpahggvggipGLITFYIPYEDNKGDHG  284
             P  T   +F+VSD T+VGF ++D GWG++++GG A G VG  PGL +FYI   + +G+  
Sbjct  359   PRGTEVRSFMVSDTTKVGFGDVDFGWGKAMYGGQATGAVGANPGLASFYILSRNYQGETS  418

Query  283   ILVPMCLPAIAMGKFVKEL  227
             I+V +CLPA  M +FV+EL
Sbjct  419   IIVTVCLPAPVMQRFVQEL  437



>ref|XP_002266420.1| PREDICTED: methanol O-anthraniloyltransferase [Vitis vinifera]
Length=451

 Score =   503 bits (1294),  Expect = 4e-170, Method: Compositional matrix adjust.
 Identities = 249/443 (56%), Positives = 321/443 (72%), Gaps = 9/443 (2%)
 Frame = -1

Query  1549  MASQPS-IAFTVTRQNPELVAPADPTPREIKYLSDIDDQQGLRFQIPVIHFYRNEPSMSG  1373
             MAS  S + F+V R+ PE V P +PTPRE+K LSD+DDQ+GLRFQIPVI FY N P M G
Sbjct  1     MASSSSPLVFSVKRRAPEFVRPTNPTPREVKQLSDLDDQEGLRFQIPVIMFYPNNPLMKG  60

Query  1372  KDPVQVIRQALAKALVFFYPFAGRLREGPGRKLMVDCTGEGVMFIEADADATLQHFAVGG  1193
             KDP +VI++AL KALV++YPFAGRL EG  RKLMVDCTGEGV+FIEADAD TL++  +G 
Sbjct  61    KDPAKVIKEALGKALVYYYPFAGRLIEGDNRKLMVDCTGEGVLFIEADADTTLEN--LGD  118

Query  1192  ELKPPFPCFDQLLYNVPGSAEILNCPLFLIQVTRLRCGGFIFALRLNHSMSDACGLVHFL  1013
              ++P  PCF++LLY+VPGS  IL  PL LIQVTRLRCGGFIFALRLNH+MSD  GLV FL
Sbjct  119   AIQPMCPCFEELLYDVPGSGGILGSPLILIQVTRLRCGGFIFALRLNHTMSDGPGLVQFL  178

Query  1012  NTIAEIARGAEAPSVYPVWQREFFDARNPPRITCTHFEYEEEPAADSMVTNIPLDNLVHR  833
             + I+E+A+G   PS+ P+WQRE  +ARNPPRIT  H EYEE       +  +  +NLVHR
Sbjct  179   DAISEMAQGLSVPSLLPIWQRELLNARNPPRITRIHHEYEEVTNTKGTLMTMDENNLVHR  238

Query  832   SFFFGPTEISALRSSLPPHLLKCSRFEVVTACLWRCRTIAMEFDPNDEVRIFGTVNARPR  653
             SFFFGP EI ALR+ LP  L  CS FEV+ A +WRCRTIA   DP++ VRI   +N R +
Sbjct  239   SFFFGPKEIRALRNRLPASLGACSTFEVLIAYVWRCRTIAFAVDPDEVVRISCLINMRGK  298

Query  652   LKNPPVPNGYYGNAFVYPGAKSTAGKVSKSPLSHALELVTNIKSSFTEEYIKSVADLMIL  473
              +   +P GYYGNAFVYP + + AG + K+PL +A+ L+   K+  ++EY+KSVAD M++
Sbjct  299   -RGFDLPPGYYGNAFVYPASITKAGMLCKNPLEYAIRLLKKAKAEMSQEYVKSVADHMVI  357

Query  472   KGRPTFTLQGTFIVSDVTRVGFPEIDMGWGQSVFggpahggvggipGLITFYIPYEDNKG  293
             KGRP+FT  G +++SDVTR G  EID GWG+ V+GG A          I+F + + ++KG
Sbjct  358   KGRPSFTQPGNYLISDVTRAGIGEIDFGWGKPVYGGVARALSN-----ISFCMRFRNSKG  412

Query  292   DHGILVPMCLPAIAMGKFVKELE  224
             + G ++P+CLP   M +F +EL+
Sbjct  413   EEGNVIPICLPPPVMERFEQELK  435



>gb|ACT82248.1| alcohol acyltransferase [Vasconcellea cundinamarcensis]
Length=463

 Score =   503 bits (1294),  Expect = 6e-170, Method: Compositional matrix adjust.
 Identities = 248/442 (56%), Positives = 327/442 (74%), Gaps = 7/442 (2%)
 Frame = -1

Query  1534  SIAFTVTRQNPELVAPADPTPREIKYLSDIDDQQGLRFQIPVIHFYRNEPSMSGKDPVQV  1355
             S+ F V R  PEL+ PA PTPREIK LSDIDDQ GLRFQ+P+I FY+N  SM GK+P ++
Sbjct  7     SLMFNVRRHEPELITPAKPTPREIKLLSDIDDQDGLRFQVPIIQFYKNNSSMQGKNPAKI  66

Query  1354  IRQALAKALVFFYPFAGRLREGPGRKLMVDCTGEGVMFIEADADATLQHFAVGGELKPPF  1175
             I+ ALA+ LV +YP AGRLREG GRKLMV+CTGEG++FIEADAD TL  F  G +L PPF
Sbjct  67    IKSALAETLVHYYPLAGRLREGFGRKLMVECTGEGILFIEADADVTLHEF--GDDLPPPF  124

Query  1174  PCFDQLLYNVPGSAEILNCPLFLIQVTRLRCGGFIFALRLNHSMSDACGLVHFLNTIAEI  995
             PC  +LLY+VPGS+ I++ PL LIQVTRL+CGGFIFALRLNH+MSDA GLV F+  + E+
Sbjct  125   PCLVELLYDVPGSSGIIDTPLLLIQVTRLKCGGFIFALRLNHTMSDASGLVQFMTAVGEM  184

Query  994   ARGAEAPSVYPVWQREFFDARNPPRITCTHFEYEEEPAADSMVTNIPLDNLVHRSFFFGP  815
             ARG  + S+ PVW+R   +AR+PPR+T  H EY++    D+  T IPLD++VHRSFFFGP
Sbjct  185   ARGQRSLSIQPVWERHLLNARDPPRVTHIHHEYDD--LEDTKGTIIPLDDMVHRSFFFGP  242

Query  814   TEISALRSSLPPHLLKCSRFEVVTACLWRCRTIAMEFDPNDEVRIFGTVNARPRLKNPPV  635
             +E++A+R  +P H  + +  EV+TA LWRC TIA++ DP +E+R+   VN+R +L NPP+
Sbjct  243   SEMAAIRRLVPAHFHRSTTSEVLTAYLWRCYTIALQPDPEEEMRVICVVNSRTKL-NPPL  301

Query  634   PNGYYGNAFVYPGAKSTAGKVSKSPLSHALELVTNIKSSFTEEYIKSVADLMILKGRPTF  455
             P G+YGN   +P A S A K+ ++P  + L+LV   K   TEEY++S ADLM +KGRP F
Sbjct  302   PTGFYGNGIAFPAAISQAKKICENPFGYTLQLVKQTKVDVTEEYMRSAADLMAMKGRPHF  361

Query  454   TLQGTFIVSDVTRVGFPEIDMGWG--QSVFggpahggvggipGLITFYIPYEDNKGDHGI  281
             T+   ++VSDVTR GF  +D GWG  + V+GGPA GGVG IPG+ +F++P+++ KG+ GI
Sbjct  362   TVVRRYMVSDVTRAGFGLVDFGWGRPEPVYGGPAKGGVGPIPGVTSFFVPFKNRKGEKGI  421

Query  280   LVPMCLPAIAMGKFVKELENCL  215
             +VP CLP  AM +F K +   L
Sbjct  422   VVPTCLPTPAMERFAKLMNEIL  443



>sp|Q3ZPN4.1|ACMAT_VITLA RecName: Full=Methanol O-anthraniloyltransferase; AltName: Full=Anthraniloyl-CoA:methanol 
acyltransferase; AltName: Full=Benzyl 
alcohol O-benzoyltransferase [Vitis labrusca]
 gb|AAW22989.1| anthraniloyal-CoA: methanol anthraniloyal transferase [Vitis 
labrusca]
Length=449

 Score =   502 bits (1292),  Expect = 7e-170, Method: Compositional matrix adjust.
 Identities = 254/448 (57%), Positives = 321/448 (72%), Gaps = 9/448 (2%)
 Frame = -1

Query  1549  MASQPS-IAFTVTRQNPELVAPADPTPREIKYLSDIDDQQGLRFQIPVIHFYRNEPSMSG  1373
             MAS  S + F+V R  P++V PA+PTPRE+K LSDIDDQ+G RFQIPVI FYRN P M G
Sbjct  1     MASPSSPLVFSVNRCVPQIVRPANPTPREVKQLSDIDDQEGRRFQIPVIMFYRNNPLMEG  60

Query  1372  KDPVQVIRQALAKALVFFYPFAGRLREGPGRKLMVDCTGEGVMFIEADADATLQHFAVGG  1193
             KDPV+VIR+AL KALV++YPFAGRL EG  RKLMVDCTGEGV+FIEADAD TL++  +G 
Sbjct  61    KDPVKVIREALGKALVYYYPFAGRLIEGDNRKLMVDCTGEGVLFIEADADTTLEN--LGD  118

Query  1192  ELKPPFPCFDQLLYNVPGSAEILNCPLFLIQVTRLRCGGFIFALRLNHSMSDACGLVHFL  1013
              ++P  PCF++LLY+VPGS  IL  PL LIQVTRLRCGGFIFALRLNH+MSDA GL+ FL
Sbjct  119   AIQPMCPCFEELLYDVPGSTTILGSPLILIQVTRLRCGGFIFALRLNHTMSDAAGLIQFL  178

Query  1012  NTIAEIARGAEAPSVYPVWQREFFDARNPPRITCTHFEYEEEPAADSMVTNIPLDNLVHR  833
             +TI E+A+G   PS+ P+WQRE  +ARNPPRIT  H EYE+       +  +  ++LVHR
Sbjct  179   DTIGEMAQGLSVPSLLPIWQRELLNARNPPRITRIHHEYEKVTNTKGTLMAMDENSLVHR  238

Query  832   SFFFGPTEISALRSSLPPHLLKCSRFEVVTACLWRCRTIAMEFDPNDEVRIFGTVNARPR  653
             SFFFG  EI ALR+ LP  L  CS FEV+ AC+WRCRTIA   DP++ VRI   +N R +
Sbjct  239   SFFFGREEIRALRNRLPASLGACSTFEVLMACVWRCRTIAFAVDPDEVVRISCIINMRGK  298

Query  652   LKNPPVPNGYYGNAFVYPGAKSTAGKVSKSPLSHALELVTNIKSSFTEEYIKSVADLMIL  473
                  +P GYYGNAFV P + + AG + K+PL  A+ LV   K+  ++EYIKSVADLM++
Sbjct  299   -HGFELPPGYYGNAFVTPASITKAGMLCKNPLEFAIRLVKKAKAEMSQEYIKSVADLMVI  357

Query  472   KGRPTFTLQGTFIVSDVTRVGFPEIDMGWGQSVFggpahggvggipGLITFYIPYEDNKG  293
             KGRP FT  G F VSDVTR G  E+D GWG+ V+     GGV     +I+F + + ++KG
Sbjct  358   KGRPLFTQPGNFTVSDVTRAGLGEVDFGWGKPVY-----GGVARACPIISFRMLFRNSKG  412

Query  292   DHGILVPMCLPAIAMGKFVKELENCLMK  209
             + G ++P+ LP   M +F +EL+    K
Sbjct  413   EEGSVIPIWLPPPVMERFEQELKRMTKK  440



>ref|XP_002270962.1| PREDICTED: methanol O-anthraniloyltransferase isoform X1 [Vitis 
vinifera]
 emb|CBI37440.3| unnamed protein product [Vitis vinifera]
Length=451

 Score =   501 bits (1291),  Expect = 1e-169, Method: Compositional matrix adjust.
 Identities = 247/443 (56%), Positives = 322/443 (73%), Gaps = 9/443 (2%)
 Frame = -1

Query  1549  MASQPS-IAFTVTRQNPELVAPADPTPREIKYLSDIDDQQGLRFQIPVIHFYRNEPSMSG  1373
             MAS  S + F+V R  PE V P +PTPRE+K LSD+DDQ+GLRFQ+PVI FY N P M G
Sbjct  1     MASSSSPLVFSVKRCAPEFVRPTNPTPREVKQLSDLDDQEGLRFQVPVIMFYPNNPLMKG  60

Query  1372  KDPVQVIRQALAKALVFFYPFAGRLREGPGRKLMVDCTGEGVMFIEADADATLQHFAVGG  1193
             KDP +VI++AL KALV++YPFAGRL EG  RKLMVDCTGEGV+FIEADAD TL++  +G 
Sbjct  61    KDPAKVIKEALGKALVYYYPFAGRLIEGDNRKLMVDCTGEGVLFIEADADTTLEN--LGD  118

Query  1192  ELKPPFPCFDQLLYNVPGSAEILNCPLFLIQVTRLRCGGFIFALRLNHSMSDACGLVHFL  1013
              ++P  PC++++LY+VPGS EIL  PL LIQVTRLRCGGFIFALRLNH+MSD  GLV FL
Sbjct  119   SIQPMCPCYEEILYDVPGSGEILGSPLILIQVTRLRCGGFIFALRLNHTMSDGPGLVQFL  178

Query  1012  NTIAEIARGAEAPSVYPVWQREFFDARNPPRITCTHFEYEEEPAADSMVTNIPLDNLVHR  833
             + I+E+A+G   PS+ P+WQRE  +ARNPPRIT  H EYEE       +  +  +NLVHR
Sbjct  179   DAISEMAQGLSVPSLLPIWQRELLNARNPPRITRIHHEYEEVTNTRGTLMTMDENNLVHR  238

Query  832   SFFFGPTEISALRSSLPPHLLKCSRFEVVTACLWRCRTIAMEFDPNDEVRIFGTVNARPR  653
             SFFFG  EI ALR+ LP  L  CS FEV+ A +WRCRTIA   DP++ VRI   +N R +
Sbjct  239   SFFFGLKEIRALRNRLPASLGACSTFEVLIAYVWRCRTIAFAVDPDEVVRISCLINMRGK  298

Query  652   LKNPPVPNGYYGNAFVYPGAKSTAGKVSKSPLSHALELVTNIKSSFTEEYIKSVADLMIL  473
              +   +P GYYGNAFVYP + + AG + K+PL +A+ L+   K+  ++EY+KSVADLM++
Sbjct  299   -RGFDLPPGYYGNAFVYPASITKAGMLCKNPLEYAIRLLKKAKAEMSQEYVKSVADLMVI  357

Query  472   KGRPTFTLQGTFIVSDVTRVGFPEIDMGWGQSVFggpahggvggipGLITFYIPYEDNKG  293
             KGRP+FT  G +++SD+TR GF EID GWG+ V+GG A          I+F + + ++KG
Sbjct  358   KGRPSFTQPGNYLISDLTRAGFGEIDFGWGKPVYGGIARALSN-----ISFCMRFRNSKG  412

Query  292   DHGILVPMCLPAIAMGKFVKELE  224
             + G ++P+CLP   M +F +EL+
Sbjct  413   EEGNVIPICLPPPVMERFEQELK  435



>ref|XP_003549135.1| PREDICTED: 13-hydroxylupanine O-tigloyltransferase-like [Glycine 
max]
 gb|KHN31562.1| 13-hydroxylupanine O-tigloyltransferase [Glycine soja]
Length=455

 Score =   501 bits (1290),  Expect = 2e-169, Method: Compositional matrix adjust.
 Identities = 257/446 (58%), Positives = 330/446 (74%), Gaps = 14/446 (3%)
 Frame = -1

Query  1534  SIAFTVTRQNPELVAPADPTPREIKYLSDIDDQQGLRFQIPVIHFYRNEPSMSGKDPVQV  1355
             S+ F V R  PELVAPA+PTP E+K LSDIDDQ GLR+Q+P++ F+  +PSM GKDPV+V
Sbjct  7     SLGFIVRRHPPELVAPANPTPHEVKLLSDIDDQNGLRYQLPLVLFFPYQPSMEGKDPVEV  66

Query  1354  IRQALAKALVFFYPFAGRLREGPGRKLMVDCTGEGVMFIEADADATLQHFAVGGELKPPF  1175
             IR+AL+K LVF+YPFAGRLREGP  KLMVDC GEGVMFIEADAD T++ F  G    PPF
Sbjct  67    IREALSKTLVFYYPFAGRLREGPDGKLMVDCNGEGVMFIEADADVTIEQF--GNNFMPPF  124

Query  1174  PCFDQLLYNVPGSAEILNCPLFLIQVTRLRCGGFIFALRLNHSMSDACGLVHFLNTIAEI  995
             PCFD+LLYNVPGS  +++ PL LIQVTRL+CGGFIFALR+NH+M D  G+  FL  ++EI
Sbjct  125   PCFDELLYNVPGSDGMIDTPLLLIQVTRLKCGGFIFALRMNHTMCDGSGICQFLKALSEI  184

Query  994   ARGAEAPSVYPVWQREFFDARNPPRITCTHFEYEEEPAADSMVTNIPLDNLVHRSFFFGP  815
             A GA  PS+ P W RE   AR PPRITC H EY++ P  DS    IP      RSFFFGP
Sbjct  185   AHGAPKPSILPGWHREILCAREPPRITCIHQEYQQLP-PDSRSIFIPH----QRSFFFGP  239

Query  814   TEISALRSSLPPHL-LKCSRFEVVTACLWRCRTIAMEF-DPNDEVRIFGTVNAR---PRL  650
              EI++LR+ LP HL  K + FEV+TACLWRCRT ++++ +PN EVR+   VNAR    R 
Sbjct  240   KEIASLRALLPHHLATKSTSFEVITACLWRCRTASLKWQNPNQEVRLLCIVNARFGNCRF  299

Query  649   KNPPVPNGYYGNAFVYPGAKSTAGKVSKSPLSHALELVTNIKSSFTEEYIKSVADLMILK  470
              NPP+P+G+YGNAFV+P A +T GK+    L +A+ELV   K    EEY+ SVADLM +K
Sbjct  300   -NPPLPDGFYGNAFVFPAAVTTVGKLLGRSLGYAVELVKKAKDEADEEYVHSVADLMAIK  358

Query  469   GRPTFTLQGTFIVSDVTRVGFPEIDMGWGQSVFggpahggvggipGLITFYIPYEDNKGD  290
             GRP FT  G+F+VSD+T+ G  ++++GWG++++ G A GG+G IPG ++FY+PY ++KG+
Sbjct  359   GRPCFTKLGSFMVSDLTKSGLIDVNLGWGKALYSGVAKGGLGDIPG-VSFYVPYTNSKGE  417

Query  289   HGILVPMCLPAIAMGKFVKELENCLM  212
              G ++P+CLP  AM +F KEL + LM
Sbjct  418   RGRVIPICLPEDAMERFEKELHDTLM  443



>ref|XP_002265049.1| PREDICTED: methanol O-anthraniloyltransferase [Vitis vinifera]
Length=451

 Score =   501 bits (1289),  Expect = 2e-169, Method: Compositional matrix adjust.
 Identities = 247/444 (56%), Positives = 321/444 (72%), Gaps = 9/444 (2%)
 Frame = -1

Query  1549  MASQPS-IAFTVTRQNPELVAPADPTPREIKYLSDIDDQQGLRFQIPVIHFYRNEPSMSG  1373
             MAS  S + F+V R +PE V P +PTPRE+K LSDIDDQ+GLRFQIPVI FY N P M G
Sbjct  1     MASSSSPLVFSVKRCDPEFVRPTNPTPRELKQLSDIDDQEGLRFQIPVIMFYPNNPLMKG  60

Query  1372  KDPVQVIRQALAKALVFFYPFAGRLREGPGRKLMVDCTGEGVMFIEADADATLQHFAVGG  1193
             KDPV+VIR+AL KALV++YPFAGRL EG  RKLMVDCTGEGV+FIEADAD TL++  +G 
Sbjct  61    KDPVKVIREALGKALVYYYPFAGRLIEGDNRKLMVDCTGEGVLFIEADADTTLEN--LGD  118

Query  1192  ELKPPFPCFDQLLYNVPGSAEILNCPLFLIQVTRLRCGGFIFALRLNHSMSDACGLVHFL  1013
              ++P  PCF++LLY+VPGS  IL  P+ LIQVTRLRCGGFIFALRLNH+MS   GLV FL
Sbjct  119   AIQPMCPCFEELLYDVPGSGGILGSPVVLIQVTRLRCGGFIFALRLNHTMSGIPGLVQFL  178

Query  1012  NTIAEIARGAEAPSVYPVWQREFFDARNPPRITCTHFEYEEEPAADSMVTNIPLDNLVHR  833
             N I+E+A+G   PS+ P+WQRE  +ARNPPRITC H EYEE       +  +  +NLVHR
Sbjct  179   NAISEMAQGLSVPSLLPIWQRELLNARNPPRITCIHHEYEEVTNTKGTLMAMDENNLVHR  238

Query  832   SFFFGPTEISALRSSLPPHLLKCSRFEVVTACLWRCRTIAMEFDPNDEVRIFGTVNARPR  653
             SFFFGP EI ALR+ LP  L   + FEV+TAC+WRCRTIA   DP++ VRI  +++ R +
Sbjct  239   SFFFGPKEIRALRNRLPASLGASTTFEVLTACVWRCRTIAFAVDPDEVVRIICSISMRGK  298

Query  652   LKNPPVPNGYYGNAFVYPGAKSTAGKVSKSPLSHALELVTNIKSSFTEEYIKSVADLMIL  473
              +   +P GYYGNA V P + + AG + K+PL +A+ LV   K+  ++EY+KSVADLM++
Sbjct  299   -RGFELPPGYYGNAVVTPASITKAGMLCKNPLEYAVRLVKKAKAEMSQEYVKSVADLMVI  357

Query  472   KGRPTFTLQGTFIVSDVTRVGFPEIDMGWGQSVFggpahggvggipGLITFYIPYEDNKG  293
             KGRP+F   G ++V+DVTR G  EID GWG+ V+      G+     +I+F   + ++KG
Sbjct  358   KGRPSFMHPGNYMVADVTRDGSGEIDFGWGKPVY-----SGLARAISIISFCARFRNSKG  412

Query  292   DHGILVPMCLPAIAMGKFVKELEN  221
             + G ++P+CLP   M +F +E++ 
Sbjct  413   EEGNVIPICLPPPVMERFEQEIKK  436



>emb|CAN69948.1| hypothetical protein VITISV_009219 [Vitis vinifera]
Length=451

 Score =   501 bits (1289),  Expect = 2e-169, Method: Compositional matrix adjust.
 Identities = 247/443 (56%), Positives = 322/443 (73%), Gaps = 9/443 (2%)
 Frame = -1

Query  1549  MASQPS-IAFTVTRQNPELVAPADPTPREIKYLSDIDDQQGLRFQIPVIHFYRNEPSMSG  1373
             MAS  S + F+V R  PE V P +PTPRE+K LSD+DDQ+GLRFQ+PVI FY N P M G
Sbjct  1     MASSSSPLVFSVKRCAPEFVRPTNPTPREVKQLSDLDDQEGLRFQVPVIMFYPNNPLMKG  60

Query  1372  KDPVQVIRQALAKALVFFYPFAGRLREGPGRKLMVDCTGEGVMFIEADADATLQHFAVGG  1193
             KDP +VI++AL KALV++YPFAGRL EG  RKLMVDCTGEGV+FIEADAD TL++  +G 
Sbjct  61    KDPAKVIKEALGKALVYYYPFAGRLIEGDNRKLMVDCTGEGVLFIEADADTTLEN--LGD  118

Query  1192  ELKPPFPCFDQLLYNVPGSAEILNCPLFLIQVTRLRCGGFIFALRLNHSMSDACGLVHFL  1013
              ++P  PC++++LY+VPGS EIL  PL LIQVTRLRCGGFIFALRLNH+MSD  GLV FL
Sbjct  119   SIQPMCPCYEEILYDVPGSGEILGSPLILIQVTRLRCGGFIFALRLNHTMSDGPGLVQFL  178

Query  1012  NTIAEIARGAEAPSVYPVWQREFFDARNPPRITCTHFEYEEEPAADSMVTNIPLDNLVHR  833
             + I+E+A+G   PS+ P+WQRE  +ARNPPRIT  H EYEE       +  +  +NLVHR
Sbjct  179   DAISEMAQGLSVPSLLPIWQRELLNARNPPRITRIHHEYEEVTNTRGTLMTMDENNLVHR  238

Query  832   SFFFGPTEISALRSSLPPHLLKCSRFEVVTACLWRCRTIAMEFDPNDEVRIFGTVNARPR  653
             SFFFG  EI ALR+ LP  L  CS FEV+ A +WRCRTIA   DP++ VRI   +N R +
Sbjct  239   SFFFGLKEIRALRNRLPASLGACSTFEVLIAYVWRCRTIAFAVDPDEVVRISCLINMRGK  298

Query  652   LKNPPVPNGYYGNAFVYPGAKSTAGKVSKSPLSHALELVTNIKSSFTEEYIKSVADLMIL  473
              +   +P GYYGNAFVYP + + AG + K+PL +A+ L+   K+  ++EY+KSVADLM++
Sbjct  299   -RGFDLPPGYYGNAFVYPASITKAGMLCKNPLEYAIRLLKKAKAEMSQEYVKSVADLMVI  357

Query  472   KGRPTFTLQGTFIVSDVTRVGFPEIDMGWGQSVFggpahggvggipGLITFYIPYEDNKG  293
             KGRP+FT  G +++SD+TR GF EID GWG+ V+GG A          I+F + + ++KG
Sbjct  358   KGRPSFTQPGNYLISDLTRAGFGEIDFGWGKPVYGGIARALSN-----ISFCMRFRNSKG  412

Query  292   DHGILVPMCLPAIAMGKFVKELE  224
             + G ++P+CLP   M +F +EL+
Sbjct  413   EEGNVIPICLPPPVMERFEEELK  435



>emb|CBI37443.3| unnamed protein product [Vitis vinifera]
Length=492

 Score =   500 bits (1287),  Expect = 2e-168, Method: Compositional matrix adjust.
 Identities = 247/444 (56%), Positives = 321/444 (72%), Gaps = 9/444 (2%)
 Frame = -1

Query  1549  MASQPS-IAFTVTRQNPELVAPADPTPREIKYLSDIDDQQGLRFQIPVIHFYRNEPSMSG  1373
             MAS  S + F+V R +PE V P +PTPRE+K LSDIDDQ+GLRFQIPVI FY N P M G
Sbjct  1     MASSSSPLVFSVKRCDPEFVRPTNPTPRELKQLSDIDDQEGLRFQIPVIMFYPNNPLMKG  60

Query  1372  KDPVQVIRQALAKALVFFYPFAGRLREGPGRKLMVDCTGEGVMFIEADADATLQHFAVGG  1193
             KDPV+VIR+AL KALV++YPFAGRL EG  RKLMVDCTGEGV+FIEADAD TL++  +G 
Sbjct  61    KDPVKVIREALGKALVYYYPFAGRLIEGDNRKLMVDCTGEGVLFIEADADTTLEN--LGD  118

Query  1192  ELKPPFPCFDQLLYNVPGSAEILNCPLFLIQVTRLRCGGFIFALRLNHSMSDACGLVHFL  1013
              ++P  PCF++LLY+VPGS  IL  P+ LIQVTRLRCGGFIFALRLNH+MS   GLV FL
Sbjct  119   AIQPMCPCFEELLYDVPGSGGILGSPVVLIQVTRLRCGGFIFALRLNHTMSGIPGLVQFL  178

Query  1012  NTIAEIARGAEAPSVYPVWQREFFDARNPPRITCTHFEYEEEPAADSMVTNIPLDNLVHR  833
             N I+E+A+G   PS+ P+WQRE  +ARNPPRITC H EYEE       +  +  +NLVHR
Sbjct  179   NAISEMAQGLSVPSLLPIWQRELLNARNPPRITCIHHEYEEVTNTKGTLMAMDENNLVHR  238

Query  832   SFFFGPTEISALRSSLPPHLLKCSRFEVVTACLWRCRTIAMEFDPNDEVRIFGTVNARPR  653
             SFFFGP EI ALR+ LP  L   + FEV+TAC+WRCRTIA   DP++ VRI  +++ R +
Sbjct  239   SFFFGPKEIRALRNRLPASLGASTTFEVLTACVWRCRTIAFAVDPDEVVRIICSISMRGK  298

Query  652   LKNPPVPNGYYGNAFVYPGAKSTAGKVSKSPLSHALELVTNIKSSFTEEYIKSVADLMIL  473
              +   +P GYYGNA V P + + AG + K+PL +A+ LV   K+  ++EY+KSVADLM++
Sbjct  299   -RGFELPPGYYGNAVVTPASITKAGMLCKNPLEYAVRLVKKAKAEMSQEYVKSVADLMVI  357

Query  472   KGRPTFTLQGTFIVSDVTRVGFPEIDMGWGQSVFggpahggvggipGLITFYIPYEDNKG  293
             KGRP+F   G ++V+DVTR G  EID GWG+ V+      G+     +I+F   + ++KG
Sbjct  358   KGRPSFMHPGNYMVADVTRDGSGEIDFGWGKPVY-----SGLARAISIISFCARFRNSKG  412

Query  292   DHGILVPMCLPAIAMGKFVKELEN  221
             + G ++P+CLP   M +F +E++ 
Sbjct  413   EEGNVIPICLPPPVMERFEQEIKK  436



>ref|XP_011085897.1| PREDICTED: benzyl alcohol O-benzoyltransferase-like [Sesamum 
indicum]
Length=465

 Score =   498 bits (1283),  Expect = 2e-168, Method: Compositional matrix adjust.
 Identities = 262/450 (58%), Positives = 323/450 (72%), Gaps = 8/450 (2%)
 Frame = -1

Query  1549  MASQPSIAFTVTRQNPELVAPADPTPREIKYLSDIDDQQGLRFQIPVIHFYRNEPSMSGK  1370
             MAS  ++ F VTR+N EL+ PA PTP E K LSDIDDQ+  RF +P+I F+   P+M  K
Sbjct  1     MASPNALTFKVTRKNTELIPPAKPTPHEFKTLSDIDDQEAFRFHLPLIAFFPKNPAMDIK  60

Query  1369  DPVQVIRQALAKALVFFYPFAGRLREGPGRKLMVDCTGEGVMFIEADADATLQHFAVGGE  1190
             DPV+V R ALAKALVF+YP AGRLRE  GRKL+V+CTGEG +FIEADAD  LQ F  G  
Sbjct  61    DPVKVFRDALAKALVFYYPLAGRLRETAGRKLVVECTGEGALFIEADADVRLQQF--GDT  118

Query  1189  LKPPFPCFDQLLYNVPGSAEILNCPLFLIQVTRLRCGGFIFALRLNHSMSDACGLVHFLN  1010
             L+PPFPC ++LLY+VPGS  ++NCPL LIQ TRL+CGGFI ALR+NH+M D  GL+ F +
Sbjct  119   LQPPFPCLEELLYDVPGSGGVVNCPLLLIQATRLKCGGFILALRVNHTMCDGFGLILFAS  178

Query  1009  TIAEIARGAEAPSVYPVWQREFFDARNPPRITCTHFEYEEEPAADSMVTNIPLDNLVHRS  830
             T+AE+ARGAE PSV PVWQR    AR+PP ++  H EYE  P  D+  T IP +N+V RS
Sbjct  179   TMAELARGAEIPSVLPVWQRHLLSARDPPHVSYMHDEYENIP--DTQGTLIPFENMVERS  236

Query  829   FFFGPTEISALRSSLPPHLL--KCSRFEVVTACLWRCRTIAMEFDPNDEVRIFGTVNARP  656
             FFFGP EISALR   PP +   +C+ FE++ A +WRCRTIA+  DPN+EVRI   VN R 
Sbjct  237   FFFGPGEISALRHQSPPFVTSSRCTTFELLAAYIWRCRTIAISPDPNEEVRILCFVNGR-  295

Query  655   RLKNPPVPNGYYGNAFVYPGAKSTAGKVSKSPLSHALELVTNIKSSFTEEYIKSVADLMI  476
             +L NPP+P GYYGN    P A STAG + K PL  ALELV   KS  TE+YIKSVADLM+
Sbjct  296   KLFNPPLPAGYYGNVVATPLAISTAGNLCKQPLDFALELVMKAKSKVTEDYIKSVADLMV  355

Query  475   LKGRPTFTLQ-GTFIVSDVTRVGFPEIDMGWGQSVFggpahggvggipGLITFYIPYEDN  299
             ++GRP F     T++VSDV  +G   +++G G  VF GPA  GVG IPGL +  IP+++N
Sbjct  356   IRGRPHFAFDMRTYVVSDVAYLGSENLEIGGGSPVFCGPAKAGVGVIPGLGSLNIPFKNN  415

Query  298   KGDHGILVPMCLPAIAMGKFVKELENCLMK  209
             KG+ G LVP+CLPA AM  FVKELE  + K
Sbjct  416   KGEKGKLVPICLPANAMEVFVKELETIVKK  445



>emb|CAN72252.1| hypothetical protein VITISV_017467 [Vitis vinifera]
Length=451

 Score =   498 bits (1281),  Expect = 3e-168, Method: Compositional matrix adjust.
 Identities = 247/444 (56%), Positives = 320/444 (72%), Gaps = 9/444 (2%)
 Frame = -1

Query  1549  MASQPS-IAFTVTRQNPELVAPADPTPREIKYLSDIDDQQGLRFQIPVIHFYRNEPSMSG  1373
             MAS  S + F+V R +PE V P +PTPRE+K LSDIDDQ+GLRFQIPVI FY N P M G
Sbjct  1     MASSSSPLVFSVKRCDPEFVRPTNPTPRELKQLSDIDDQEGLRFQIPVIMFYPNNPLMKG  60

Query  1372  KDPVQVIRQALAKALVFFYPFAGRLREGPGRKLMVDCTGEGVMFIEADADATLQHFAVGG  1193
             KDPV+VIR+AL KALV++YPFAGRL EG  RKLMVDCTGEGV+FIEADAD TL++  +G 
Sbjct  61    KDPVKVIREALGKALVYYYPFAGRLIEGDNRKLMVDCTGEGVLFIEADADTTLEN--LGD  118

Query  1192  ELKPPFPCFDQLLYNVPGSAEILNCPLFLIQVTRLRCGGFIFALRLNHSMSDACGLVHFL  1013
              ++P  PCF++LLY+VPGS  IL  P+ LIQVTRLRCGGFIFALRLNH+MS   GLV FL
Sbjct  119   AIQPMCPCFEELLYDVPGSGGILGSPVVLIQVTRLRCGGFIFALRLNHTMSGIPGLVQFL  178

Query  1012  NTIAEIARGAEAPSVYPVWQREFFDARNPPRITCTHFEYEEEPAADSMVTNIPLDNLVHR  833
             N I+E+A+G   PS+ P+WQRE  +ARNPPRITC H EYEE       +  +  +NLVHR
Sbjct  179   NAISEMAQGLSVPSLLPIWQRELLNARNPPRITCIHHEYEEVTNTKGTLMAMDENNLVHR  238

Query  832   SFFFGPTEISALRSSLPPHLLKCSRFEVVTACLWRCRTIAMEFDPNDEVRIFGTVNARPR  653
             SFFFGP EI ALR+ LP  L   + FEV+TA +WRCRTIA   DP++ VRI  +++ R +
Sbjct  239   SFFFGPKEIRALRNRLPASLGASTTFEVLTAXVWRCRTIAFAVDPDEVVRIICSISMRGK  298

Query  652   LKNPPVPNGYYGNAFVYPGAKSTAGKVSKSPLSHALELVTNIKSSFTEEYIKSVADLMIL  473
              +   +P GYYGNA V P + + AG + K+PL +A+ LV   K+  ++EY+KSVADLM++
Sbjct  299   -RGFELPPGYYGNAVVTPASITKAGMLCKNPLEYAVRLVKKAKAEMSQEYVKSVADLMVI  357

Query  472   KGRPTFTLQGTFIVSDVTRVGFPEIDMGWGQSVFggpahggvggipGLITFYIPYEDNKG  293
             KGRP+F   G ++V+DVTR G  EID GWG+ V+      G+     +I+F   + ++KG
Sbjct  358   KGRPSFMHPGNYMVADVTRDGSGEIDFGWGKPVY-----SGLARAISIISFCARFRNSKG  412

Query  292   DHGILVPMCLPAIAMGKFVKELEN  221
             + G ++P+CLP   M KF +E++ 
Sbjct  413   EEGNVIPICLPPPVMEKFEQEIKK  436



>ref|XP_004982683.1| PREDICTED: benzyl alcohol O-benzoyltransferase-like [Setaria 
italica]
Length=463

 Score =   498 bits (1281),  Expect = 6e-168, Method: Compositional matrix adjust.
 Identities = 254/443 (57%), Positives = 323/443 (73%), Gaps = 7/443 (2%)
 Frame = -1

Query  1534  SIAFTVTRQNPELVAPADPTPREIKYLSDIDDQQGLRFQIPVIHFYRNEPSMSGKDPVQV  1355
             S+ FTV R+  ELV+PA PTPRE+K LSDIDDQ GLRF IPVI F+R    M  +DP  V
Sbjct  4     SLKFTVRRKPAELVSPASPTPRELKRLSDIDDQDGLRFHIPVIQFHRRSALMGARDPAPV  63

Query  1354  IRQALAKALVFFYPFAGRLREGPGRKLMVDCTGEGVMFIEADADATLQHFAVGGELKPPF  1175
             IR A+A+ALV +YPFAGRLRE  GRKL VDCTGEGV+FIEADAD  L HF  G  L+PPF
Sbjct  64    IRGAIARALVHYYPFAGRLRELEGRKLAVDCTGEGVLFIEADADVRLDHF--GDALQPPF  121

Query  1174  PCFDQLLYNVPGSAEILNCPLFLIQVTRLRCGGFIFALRLNHSMSDACGLVHFLNTIAEI  995
             PC D+L+++VPGS+E+L  PL L QVTRL CGGFI  +RL+H+M+DA GLV FL  +AE+
Sbjct  122   PCLDELIFDVPGSSEVLGSPLLLFQVTRLACGGFILGVRLHHTMADAQGLVQFLGAVAEL  181

Query  994   ARGAEAPSVYPVWQREFFDARNPPRITCTHFEYEEEPAADSMVTNIPLDNLVHRSFFFGP  815
             ARGA APSV PVW RE  +AR+PPR    H EY+  P  D+  T IPLD++VHRSFFFG 
Sbjct  182   ARGAAAPSVRPVWGRELLEARDPPRPAFAHREYDVVP--DTKGTIIPLDDMVHRSFFFGR  239

Query  814   TEISALRSSLPPHLL-KCSRFEVVTACLWRCRTIAMEFDPNDEVRIFGTVNAR--PRLKN  644
              E++A+R+ LPPHL  + S F+++T  LWRCRT+A+  D ++E+R+   VNAR       
Sbjct  240   REVAAVRAHLPPHLRSRASTFDLLTGLLWRCRTVALAPDADEEMRMICIVNARGGKSGGG  299

Query  643   PPVPNGYYGNAFVYPGAKSTAGKVSKSPLSHALELVTNIKSSFTEEYIKSVADLMILKGR  464
               +P GYYGNAF +P A +TAG ++  PL HA+ELV   K     EY++SVADLM+L+GR
Sbjct  300   AAIPEGYYGNAFAFPVAVATAGDLAARPLGHAVELVKRAKGEVGAEYMRSVADLMVLRGR  359

Query  463   PTFTLQGTFIVSDVTRVGFPEIDMGWGQSVFggpahggvggipGLITFYIPYEDNKGDHG  284
             P FT+   ++ SDVT+ GF ++D GWG+ V+GGPA GGVG IPG+ +F IP+++ KG+ G
Sbjct  360   PHFTVVRAYLASDVTKAGFGDLDFGWGKPVYGGPAKGGVGAIPGVASFLIPFKNAKGEDG  419

Query  283   ILVPMCLPAIAMGKFVKELENCL  215
             I+VPMCLP  AM  FV+EL   L
Sbjct  420   IVVPMCLPGPAMETFVRELGKLL  442



>ref|XP_008462818.1| PREDICTED: benzyl alcohol O-benzoyltransferase-like [Cucumis 
melo]
Length=461

 Score =   497 bits (1280),  Expect = 6e-168, Method: Compositional matrix adjust.
 Identities = 243/442 (55%), Positives = 321/442 (73%), Gaps = 6/442 (1%)
 Frame = -1

Query  1549  MASQPSIAFTVTRQNPELVAPADPTPREIKYLSDIDDQQGLRFQIPVIHFYRNEPSMSGK  1370
             ++S  +  F V R  PE VAPA PTP E K LSDIDDQ+  RF +P++ FY N P M G 
Sbjct  3     ISSHNNFVFEVRRCQPEFVAPAKPTPYEFKQLSDIDDQECFRFHVPLLFFYANNPRMEGS  62

Query  1369  DPVQVIRQALAKALVFFYPFAGRLREGPGRKLMVDCTGEGVMFIEADADATLQHFAVGGE  1190
             DPV+VI++A+++ LVF+YPFAGRLREGPG+KL V+CT EG++FIEADA+  LQ F  G  
Sbjct  63    DPVKVIKKAISETLVFYYPFAGRLREGPGKKLFVECTAEGILFIEADANVDLQQF--GDA  120

Query  1189  LKPPFPCFDQLLYNVPGSAEILNCPLFLIQVTRLRCGGFIFALRLNHSMSDACGLVHFLN  1010
             ++PPF   D +LYNVP S  I+N PL L+QVTRLRCGGFIFA+RLNH+M+D  GL+ F+N
Sbjct  121   VQPPFAFLDDVLYNVPNSDGIINSPLLLVQVTRLRCGGFIFAIRLNHTMTDGFGLMQFMN  180

Query  1009  TIAEIARGAEAPSVYPVWQREFFDARNPPRITCTHFEYEEEPAADSMVTNIPLDNLVHRS  830
              + E+A G  APSV PVWQR   +AR+PPR+T  H EY++    D+   NIPL+ + HRS
Sbjct  181   AVCEMACGDTAPSVLPVWQRTLLNARDPPRVTHRHHEYDQ--VVDTKQINIPLNEMAHRS  238

Query  829   FFFGPTEISALRSSLPPHLLKCSRFEVVTACLWRCRTIAMEFDPNDEVRIFGTVNARPRL  650
              FFGPTEIS LR +LP HL  CS F+++TACLWR RTIA++ +PNDE+R+    N R + 
Sbjct  239   VFFGPTEISTLRKTLPIHLRHCSSFDLITACLWRIRTIALQPNPNDEMRLLCVANLRSKS  298

Query  649   KNPPVPNGYYGNAFVYPGAKSTAGKVSKSPLSHALELVTNIKSSFTEEYIKSVADLMILK  470
             K   +P+GYYGN+F  P A +TAG + ++PLS+A+EL+   K+  TEEY+KSVAD M++ 
Sbjct  299   KY--LPSGYYGNSFALPAAVATAGNLCQNPLSYAVELIRKAKAKMTEEYMKSVADFMVIN  356

Query  469   GRPTFTLQGTFIVSDVTRVGFPEIDMGWGQSVFggpahggvggipGLITFYIPYEDNKGD  290
             GRP  T   ++ VSDVT+  F ++D GWG+ +FGGPA GGV  +PGL +FYI Y++ KG+
Sbjct  357   GRPNLTAVRSYAVSDVTKTDFEKLDFGWGKPIFGGPAMGGVATVPGLTSFYISYKNKKGE  416

Query  289   HGILVPMCLPAIAMGKFVKELE  224
              GI+VP  LP  AM +FV EL+
Sbjct  417   QGIVVPFSLPVQAMERFVVELD  438



>ref|XP_006370914.1| hypothetical protein POPTR_0019s01690g [Populus trichocarpa]
 gb|ERP48711.1| hypothetical protein POPTR_0019s01690g [Populus trichocarpa]
Length=451

 Score =   497 bits (1279),  Expect = 8e-168, Method: Compositional matrix adjust.
 Identities = 237/444 (53%), Positives = 322/444 (73%), Gaps = 13/444 (3%)
 Frame = -1

Query  1549  MASQPS-IAFTVTRQNPELVAPADPTPREIKYLSDIDDQQGLRFQIPVIHFYRNEPSMSG  1373
             MA+ P+ + F V+R+ P L+ P++PTP E+K LSDIDDQ GLR  IP+I FY  + SM  
Sbjct  1     MATPPTPLVFKVSRREPVLITPSEPTPHELKPLSDIDDQDGLRVHIPLILFYPYDHSMQR  60

Query  1372  KDPVQVIRQALAKALVFFYPFAGRLREGPGRKLMVDCTGEGVMFIEADADATLQHFAVGG  1193
             +DPVQVI++ALAK LVF+YPFAGRLREGP RKL+V+CTGEG++FIEA+AD TL+ F  G 
Sbjct  61    RDPVQVIKEALAKTLVFYYPFAGRLREGPKRKLLVECTGEGILFIEANADVTLEQF--GD  118

Query  1192  ELKPPFPCFDQLLYNVPGSAEILNCPLFLIQVTRLRCGGFIFALRLNHSMSDACGLVHFL  1013
              L PP PC ++LL++VPGS+ ++NCPL LIQVTRL+CGG +FA+RLNH+MSD  G+  FL
Sbjct  119   ALWPPIPCLEELLFDVPGSSGMINCPLLLIQVTRLKCGGIVFAIRLNHTMSDGTGINQFL  178

Query  1012  NTIAEIARGAEAPSVYPVWQREFFDARNPPRITCTHFEYEEEPAADSMVTNIPLDNLVHR  833
             + + E+  GA+ PS+ PVW+R   +ARNPP++TC H EY++    D+   N+PL    HR
Sbjct  179   SAMCEMVHGAQTPSIQPVWERHVLNARNPPQVTCLHHEYDQ--LVDT-TDNVPLTKKTHR  235

Query  832   SFFFGPTEISALRSSLPPHLLKCSRFEVVTACLWRCRTIAMEFDPNDEVRIFGTVNARPR  653
             SFFFG   ISA+R   P HL  CS F+V+TA LWRCRTIA++ +PND++RI  TVNAR R
Sbjct  236   SFFFGHAHISAIRGFAPLHLRHCSTFDVLTAFLWRCRTIALQPNPNDQMRILCTVNARNR  295

Query  652   LKNPPVPNGYYGNAFVYPGAKSTAGKVSKSPLSHALELVTNIKSSFTEEYIKSVADLMIL  473
               NPP+P GYYGN   Y  A +TAG++S++ L   LELV   K++ TEEY++SVADL+++
Sbjct  296   F-NPPLPRGYYGNCMAYSVAMATAGEISRNSLGFTLELVRKAKANVTEEYMRSVADLLVI  354

Query  472   KGRPTFTLQGTFIVSDVTRVGFPEIDMGWGQSVFggpahggvggipGLITFYIPYEDNKG  293
             KGRP +T+  +++VSDVTR  F E+++GWG+  +             + +F IPY   KG
Sbjct  355   KGRPWYTMVRSYLVSDVTRAMFAEMNLGWGKPKY------AGPAKGNVASFQIPYRTKKG  408

Query  292   DHGILVPMCLPAIAMGKFVKELEN  221
             + G+LV +CLP  AM +F KEL++
Sbjct  409   EDGVLVTLCLPTPAMERFAKELDS  432



>emb|CAN68818.1| hypothetical protein VITISV_012041 [Vitis vinifera]
Length=451

 Score =   496 bits (1277),  Expect = 1e-167, Method: Compositional matrix adjust.
 Identities = 245/443 (55%), Positives = 319/443 (72%), Gaps = 9/443 (2%)
 Frame = -1

Query  1549  MASQPS-IAFTVTRQNPELVAPADPTPREIKYLSDIDDQQGLRFQIPVIHFYRNEPSMSG  1373
             MAS  S + F V R  PE V P +PTPRE+K LSD+DDQ+GLRFQ+PVI FY N P M G
Sbjct  1     MASSSSPLVFXVKRCAPEFVRPTNPTPREVKQLSDLDDQEGLRFQVPVIMFYPNNPLMKG  60

Query  1372  KDPVQVIRQALAKALVFFYPFAGRLREGPGRKLMVDCTGEGVMFIEADADATLQHFAVGG  1193
             KDP +VI++AL KALV++YPFAGRL EG  RKLMVDCTGEGV+FIEADAD TL++  +G 
Sbjct  61    KDPAKVIKEALGKALVYYYPFAGRLIEGDNRKLMVDCTGEGVLFIEADADTTLEN--LGD  118

Query  1192  ELKPPFPCFDQLLYNVPGSAEILNCPLFLIQVTRLRCGGFIFALRLNHSMSDACGLVHFL  1013
              ++P  PC++++LY+VPGS EIL  PL LIQVTRLRCGGFIFALRLNH+MSD  GLV FL
Sbjct  119   SIQPMCPCYEEILYDVPGSGEILGSPLILIQVTRLRCGGFIFALRLNHTMSDGPGLVQFL  178

Query  1012  NTIAEIARGAEAPSVYPVWQREFFDARNPPRITCTHFEYEEEPAADSMVTNIPLDNLVHR  833
             + I+E+ +G   PS+ P+WQRE  +ARN PRIT  H EYEE       +  +  +NLVHR
Sbjct  179   DAISEMXQGLSVPSLLPIWQRELLNARNXPRITRIHHEYEEVTNTXGTLMTMDENNLVHR  238

Query  832   SFFFGPTEISALRSSLPPHLLKCSRFEVVTACLWRCRTIAMEFDPNDEVRIFGTVNARPR  653
             SFFFG  EI ALR+ LP  L  CS FEV+ A +WRCRTIA   DP++ VRI   +N R +
Sbjct  239   SFFFGXKEIRALRNRLPASLGACSTFEVLIAYVWRCRTIAFAVDPDEVVRISCLINMRGK  298

Query  652   LKNPPVPNGYYGNAFVYPGAKSTAGKVSKSPLSHALELVTNIKSSFTEEYIKSVADLMIL  473
              +   +P GYYGNAFVYP + + AG + K+PL +A+ L+   K+  ++EY+KSVADLM++
Sbjct  299   -RGFDLPPGYYGNAFVYPASITKAGMLCKNPLEYAIRLLKKAKAEMSQEYVKSVADLMVI  357

Query  472   KGRPTFTLQGTFIVSDVTRVGFPEIDMGWGQSVFggpahggvggipGLITFYIPYEDNKG  293
             KGRP+FT  G +++SD+TR GF EID GWG+ V+GG A          I+F + + ++KG
Sbjct  358   KGRPSFTQPGNYLISDLTRAGFGEIDFGWGKPVYGGIARALSN-----ISFCMRFRNSKG  412

Query  292   DHGILVPMCLPAIAMGKFVKELE  224
             + G ++P+CLP   M +F +EL+
Sbjct  413   EEGNVIPICLPPPVMERFEQELK  435



>ref|XP_009803457.1| PREDICTED: benzyl alcohol O-benzoyltransferase-like isoform X2 
[Nicotiana sylvestris]
Length=415

 Score =   495 bits (1274),  Expect = 1e-167, Method: Compositional matrix adjust.
 Identities = 256/440 (58%), Positives = 319/440 (73%), Gaps = 52/440 (12%)
 Frame = -1

Query  1531  IAFTVTRQNPELVAPADPTPREIKYLSDIDDQQGLRFQIPVIHFYRNEPSMSGKDPVQVI  1352
             + FTV RQ PEL+AP  PTPRE K+LSDIDDQ                            
Sbjct  9     LVFTVRRQKPELIAPEKPTPRETKFLSDIDDQ----------------------------  40

Query  1351  RQALAKALVFFYPFAGRLREGPGRKLMVDCTGEGVMFIEADADATLQHFAVGGELKPPFP  1172
                                EG GRKLMVDCTGEG+MF+EADAD TL+ F  G EL+PPFP
Sbjct  41    -------------------EGTGRKLMVDCTGEGIMFVEADADVTLEEF--GDELQPPFP  79

Query  1171  CFDQLLYNVPGSAEILNCPLFLIQVTRLRCGGFIFALRLNHSMSDACGLVHFLNTIAEIA  992
             C D+LL++VP SA +LNCPL LIQVTRL CGGFIF+LRLNH+MSDA GLV F+  + E+A
Sbjct  80    CLDELLFDVPHSAGVLNCPLLLIQVTRLICGGFIFSLRLNHTMSDAPGLVQFMTAVGEMA  139

Query  991   RGAEAPSVYPVWQREFFDARNPPRITCTHFEYEEEPAADSMVTNIPLDNLVHRSFFFGPT  812
             RGA APSV PVW RE  +ARNPP++TCTH EY+E P  D+  T IPLD++VH+SFFFGP+
Sbjct  140   RGASAPSVLPVWCRELLNARNPPQVTCTHHEYDEVP--DTKDTIIPLDDMVHKSFFFGPS  197

Query  811   EISALRSSLPPHLLKCSRFEVVTACLWRCRTIAMEFDPNDEVRIFGTVNARPRLK-NPPV  635
             E+SALR  +P HL KCS FE++TA LWRCRT++++ DP +EVRI   VNAR   + NPP+
Sbjct  198   EVSALRRFVPYHLRKCSTFELLTAVLWRCRTMSLKPDPEEEVRILCIVNARSNARFNPPL  257

Query  634   PNGYYGNAFVYPGAKSTAGKVSKSPLSHALELVTNIKSSFTEEYIKSVADLMILKGRPTF  455
             P GYYGNAFV+P A +TA K+SK+PL++ALELV   K+  TEEY+KSVADLM+LKGRP F
Sbjct  258   PTGYYGNAFVFPVAVTTAAKLSKNPLAYALELVKKTKTDVTEEYMKSVADLMVLKGRPHF  317

Query  454   TLQGTFIVSDVTRVGFPEIDMGWGQSVFggpahggvggipGLITFYIPYEDNKGDHGILV  275
             T+  T++VSDVTR GF E+D GWG++V+GGPA GGVG IPG+ +FYIP+++ KG++GI+V
Sbjct  318   TVVRTYLVSDVTRAGFREVDFGWGKAVYGGPAKGGVGAIPGVASFYIPFKNKKGENGIVV  377

Query  274   PMCLPAIAMGKFVKELENCL  215
             P+CLP  AM  F+KEL+  L
Sbjct  378   PICLPGFAMETFIKELDGML  397



>ref|XP_008779984.1| PREDICTED: benzyl alcohol O-benzoyltransferase-like [Phoenix 
dactylifera]
Length=460

 Score =   496 bits (1276),  Expect = 2e-167, Method: Compositional matrix adjust.
 Identities = 255/444 (57%), Positives = 326/444 (73%), Gaps = 8/444 (2%)
 Frame = -1

Query  1549  MASQPSIAFTVTRQNPELVAPADPTPREIKYLSDIDDQQGLRFQIPVIHFYRNEPSMSGK  1370
             MAS  S++FTV R+ P LVAPA  TP E K LSDIDDQ+GLRF    IHFYRN+PS  G+
Sbjct  1     MAS--SLSFTVCRREPVLVAPAKSTPHEFKPLSDIDDQEGLRFYSSGIHFYRNDPSKEGR  58

Query  1369  DPVQVIRQALAKALVFFYPFAGRLREGPGRKLMVDCTGEGVMFIEADADATLQHFAVGGE  1190
             DP  VI++ L + LV +YP AGRLRE PGRKL+V+CTGEGV+F+EADAD  L+ F  G  
Sbjct  59    DPATVIKETLGEVLVHYYPIAGRLREWPGRKLVVECTGEGVVFVEADADVRLEDF--GHA  116

Query  1189  LKPPFPCFDQLLYNVPGSAEILNCPLFLIQVTRLRCGGFIFALRLNHSMSDACGLVHFLN  1010
               PPFPC ++LLY+      IL+ PL  IQVTRL+CGGFIF LR+NH+  DA G+V FL 
Sbjct  117   PSPPFPCVEELLYDTESFGSILDRPLLFIQVTRLKCGGFIFGLRINHTFVDAPGVVQFLT  176

Query  1009  TIAEIARGAEAPSVYPVWQREFFDARNPPRITCTHFEYEEEPAADSMVTNIPLDNLVHRS  830
              + E+ARGA AP++ PVW+RE  +AR+PPRIT  H EYE     D + T+ P D +V+RS
Sbjct  177   GLGEMARGAAAPTLTPVWERELLNARSPPRITHAHPEYECLAGTDVLTTSPPAD-MVNRS  235

Query  829   FFFGPTEISALRSSLPPHLLK-CSRFEVVTACLWRCRTIAMEFDPNDEVRIFGTVNARPR  653
             FFFGP EISA+R   PPHL    SRF+++TA +WR RT A+ +DP+DEVR+   VNAR R
Sbjct  236   FFFGPKEISAMRKHAPPHLRSTSSRFDLITASVWRSRTAALGYDPDDEVRVLFVVNARGR  295

Query  652   LKNPPVPNGYYGNAFVYPGAKSTAGKVSKSPLSHALELVTNIKSSFTEEYIKSVADLMIL  473
              +NPP+P+GYYGNA  +P A S AG++S+SPL +ALELV   K+S T+EY++SVADLM+L
Sbjct  296   -RNPPLPSGYYGNALAFPVASSAAGRLSRSPLGYALELVRKAKASVTDEYMQSVADLMVL  354

Query  472   KGRPTFTLQGTFIVSDVTRVGFPEIDMGWGQSVFggpahggvggipGLITFYIPYEDNKG  293
             +GRP F +  T++VSDVTR GF  +D GWG+ V+GGPA  GVG +PG+ +FY  +  NKG
Sbjct  355   RGRPHFAMARTYLVSDVTRAGFEAVDFGWGEGVYGGPASAGVGAVPGVASFYT-WHRNKG  413

Query  292   DHGILVPMCLPAIAMGKFVKELEN  221
             + GILVPMCLP  AM +F  E+E+
Sbjct  414   EEGILVPMCLPGPAMERFQMEMES  437



>ref|NP_001152518.1| 10-deacetylbaccatin III 10-O-acetyltransferase [Zea mays]
 gb|ACG48011.1| 10-deacetylbaccatin III 10-O-acetyltransferase [Zea mays]
Length=462

 Score =   495 bits (1275),  Expect = 4e-167, Method: Compositional matrix adjust.
 Identities = 252/446 (57%), Positives = 327/446 (73%), Gaps = 7/446 (2%)
 Frame = -1

Query  1549  MASQPSIAFTVTRQNPELVAPADPTPREIKYLSDIDDQQGLRFQIPVIHFYRNEPSMSGK  1370
             MAS  S+ FTV R+   LVAPA PTPRE+K LSDIDDQ GLRF IPVI FYR    M G+
Sbjct  1     MAS--SLKFTVRRRPAALVAPASPTPRELKRLSDIDDQDGLRFHIPVIQFYRRNALMGGR  58

Query  1369  DPVQVIRQALAKALVFFYPFAGRLREGPGRKLMVDCTGEGVMFIEADADATLQHFAVGGE  1190
             DP  V+R A+A+ALV +YPFAGRLRE  GRKL V+CTGEGV+FIEAD D  L HF  G  
Sbjct  59    DPAPVVRDAVARALVHYYPFAGRLRELEGRKLAVECTGEGVLFIEADTDVRLDHF--GDA  116

Query  1189  LKPPFPCFDQLLYNVPGSAEILNCPLFLIQVTRLRCGGFIFALRLNHSMSDACGLVHFLN  1010
             L+PPFPC ++L+++VPGS+E+L  PL L QVTRL CGGFI  +RL+H+M+DA GLV FL+
Sbjct  117   LQPPFPCLEELIFDVPGSSEVLGSPLLLFQVTRLACGGFILGVRLHHTMADAQGLVQFLD  176

Query  1009  TIAEIARGAEAPSVYPVWQREFFDARNPPRITCTHFEYEEEPAADSMVTNIPLDNLVHRS  830
              +AE+ARGA AP+V PVW RE  +AR+PPR    H EY+E P  D+  T IPLD++VHRS
Sbjct  177   AVAELARGAAAPTVRPVWGRELLEARDPPRPAFAHREYDEVP--DTKGTIIPLDDMVHRS  234

Query  829   FFFGPTEISALRSSLPPHLL-KCSRFEVVTACLWRCRTIAMEFDPNDEVRIFGTVNARPR  653
             FFFG  E++A+R++LPP L  + SRF+++T  LW+CRT A+  D ++ +R+   VNAR  
Sbjct  235   FFFGRREVAAVRANLPPGLRSRASRFDLLTGLLWKCRTAALAPDADEVMRMICIVNARGG  294

Query  652   LKNPPVPNGYYGNAFVYPGAKSTAGKVSKSPLSHALELVTNIKSSFTEEYIKSVADLMIL  473
                  +P GYYGNAF +P A +TAG ++  PL +A+ELV   K     EY++SVADLM+L
Sbjct  295   KSGAAIPEGYYGNAFAFPVAVATAGDLAARPLGYAVELVKRAKGEVDVEYMRSVADLMVL  354

Query  472   KGRPTFTLQGTFIVSDVTRVGFPEIDMGWGQSVFggpahggvggipGLITFYIPYEDNKG  293
             +GRP FT+   ++ SDVT+ GF ++D GWG+ V+GGPA GGVG IPG+ +F IP+++ KG
Sbjct  355   RGRPHFTVVRAYLASDVTKAGFGDLDFGWGKPVYGGPAKGGVGAIPGVASFLIPFKNAKG  414

Query  292   DHGILVPMCLPAIAMGKFVKELENCL  215
             + GI+VPMCLP  AM  FVKE++  L
Sbjct  415   EDGIVVPMCLPGPAMETFVKEMDKLL  440



>tpg|DAA49395.1| TPA: 10-deacetylbaccatin III 10-O-acetyltransferase [Zea mays]
Length=462

 Score =   495 bits (1275),  Expect = 4e-167, Method: Compositional matrix adjust.
 Identities = 252/446 (57%), Positives = 327/446 (73%), Gaps = 7/446 (2%)
 Frame = -1

Query  1549  MASQPSIAFTVTRQNPELVAPADPTPREIKYLSDIDDQQGLRFQIPVIHFYRNEPSMSGK  1370
             MAS  S+ FTV R+   LVAPA PTPRE+K LSDIDDQ GLRF IPVI FYR    M G+
Sbjct  1     MAS--SLKFTVRRRPAALVAPASPTPRELKRLSDIDDQDGLRFHIPVIQFYRRSALMGGR  58

Query  1369  DPVQVIRQALAKALVFFYPFAGRLREGPGRKLMVDCTGEGVMFIEADADATLQHFAVGGE  1190
             DP  V+R A+A+ALV +YPFAGRLRE  GRKL V+CTGEGV+FIEAD D  L HF  G  
Sbjct  59    DPAPVVRDAVARALVHYYPFAGRLRELEGRKLAVECTGEGVLFIEADTDVRLDHF--GDA  116

Query  1189  LKPPFPCFDQLLYNVPGSAEILNCPLFLIQVTRLRCGGFIFALRLNHSMSDACGLVHFLN  1010
             L+PPFPC ++L+++VPGS+E+L  PL L QVTRL CGGFI  +RL+H+M+DA GLV FL+
Sbjct  117   LQPPFPCLEELIFDVPGSSEVLGSPLLLFQVTRLACGGFILGVRLHHTMADAQGLVQFLD  176

Query  1009  TIAEIARGAEAPSVYPVWQREFFDARNPPRITCTHFEYEEEPAADSMVTNIPLDNLVHRS  830
              +AE+ARGA AP+V PVW RE  +AR+PPR    H EY+E P  D+  T IPLD++VHRS
Sbjct  177   AVAELARGAAAPTVRPVWGRELLEARDPPRPAFAHREYDEVP--DTKGTIIPLDDMVHRS  234

Query  829   FFFGPTEISALRSSLPPHLL-KCSRFEVVTACLWRCRTIAMEFDPNDEVRIFGTVNARPR  653
             FFFG  E++A+R++LPP L  + SRF+++T  LW+CRT A+  D ++ +R+   VNAR  
Sbjct  235   FFFGRREVAAVRANLPPGLRSRASRFDLLTGLLWKCRTAALAPDADEVMRMICIVNARGG  294

Query  652   LKNPPVPNGYYGNAFVYPGAKSTAGKVSKSPLSHALELVTNIKSSFTEEYIKSVADLMIL  473
                  +P GYYGNAF +P A +TAG ++  PL +A+ELV   K     EY++SVADLM+L
Sbjct  295   KSGAAIPEGYYGNAFAFPVAVATAGDLAARPLGYAVELVKRAKGEVDVEYMRSVADLMVL  354

Query  472   KGRPTFTLQGTFIVSDVTRVGFPEIDMGWGQSVFggpahggvggipGLITFYIPYEDNKG  293
             +GRP FT+   ++ SDVT+ GF ++D GWG+ V+GGPA GGVG IPG+ +F IP+++ KG
Sbjct  355   RGRPHFTVVRAYLASDVTKAGFGDLDFGWGKPVYGGPAKGGVGAIPGVASFLIPFKNAKG  414

Query  292   DHGILVPMCLPAIAMGKFVKELENCL  215
             + GI+VPMCLP  AM  FVKE++  L
Sbjct  415   EDGIVVPMCLPGPAMETFVKEMDKLL  440



>ref|XP_002524018.1| 3'-N-debenzoyl-2'-deoxytaxol N-benzoyltransferase, putative [Ricinus 
communis]
 gb|EEF38386.1| 3'-N-debenzoyl-2'-deoxytaxol N-benzoyltransferase, putative [Ricinus 
communis]
Length=455

 Score =   494 bits (1273),  Expect = 7e-167, Method: Compositional matrix adjust.
 Identities = 246/453 (54%), Positives = 327/453 (72%), Gaps = 9/453 (2%)
 Frame = -1

Query  1534  SIAFTVTRQNPELVAPADPTPREIKYLSDIDDQQGLRFQIPVIHFYRNEPSMSGKDPVQV  1355
             SI F V R+ PEL+ PA PTP E K LSDIDDQ+GLRF IPV+  Y+++PSM GKDPV+V
Sbjct  7     SIRFQVHRREPELIVPAKPTPYEFKPLSDIDDQEGLRFHIPVVQIYKHDPSMQGKDPVKV  66

Query  1354  IRQALAKALVFFYPFAGRLREGPGRKLMVDCTGEGVMFIEADADATLQHFAVGGELKPPF  1175
             I++ALAKALVF+YPFAGRLRE P RKL+V+CT EGV+FIEADAD TL+       L+PP 
Sbjct  67    IKEALAKALVFYYPFAGRLREWPNRKLVVECTSEGVLFIEADADVTLEQ--CRDALQPPL  124

Query  1174  PCFDQLLYNVPGSAEILNCPLFLIQVTRLRCGGFIFALRLNHSMSDACGLVHFLNTIAEI  995
             P  D+LL++VPGS+ ++NCPL LIQVTR +CGGFIF LRLNH+MSD  GLV F+  + E+
Sbjct  125   PLLDELLFDVPGSSGVINCPLLLIQVTRFKCGGFIFTLRLNHTMSDGFGLVQFMTAVGEM  184

Query  994   ARGAEAPSVYPVWQREFFDARNPPRITCTHFEYEEEPAADSMVTNIPLDNLVHRSFFFGP  815
             ARG + PS++PVW+R+  DARNPP  TCTH EY E    +  V   PLD+L   +FFFGP
Sbjct  185   ARGKQTPSIFPVWERQVLDARNPPITTCTHPEYNEN---NRTVVPFPLDDLAEEAFFFGP  241

Query  814   TEISALRSSLPPHLLKCSRFEVVTACLWRCRTIAMEFDPNDEVRIFGTVNARPRLKNPPV  635
             TEISALR      L +CS FE++TACLW+CRTIA++ +P  E+R+    NAR +   P +
Sbjct  242   TEISALRRHASSRLCRCSTFEILTACLWKCRTIALQPNPTQEIRMICLTNARDKFDPPLI  301

Query  634   PNGYYGNAFVYPGAKSTAGKVSKSPLSHALELVTNIKSSFTEEYIKSVADLMILKGRPTF  455
             P GYYGN FV   A +TAG++ K P+++A+EL+   K++ T EY++SVAD +++KGRP F
Sbjct  302   PKGYYGNGFVLSTAVTTAGELLKEPMNYAIELIKRTKANMTREYVQSVADTLVIKGRPVF  361

Query  454   TLQGTFIVSDVTRVGFPEIDMGWGQSVFggpahggvggipGLITFYIPYEDNKGDHGILV  275
              L+GT+I+SDV    F E+D GWG++ +     G V  IP L +F +P+E+ KG++G ++
Sbjct  362   PLEGTYIISDVRHAKFTEVDFGWGRAKY----GGPVKAIPMLSSFCVPFENKKGENGFIL  417

Query  274   PMCLPAIAMGKFVKELENCLMK**TSSSQNSMH  176
             P+CLPA AM +F KEL+  L      S+  S+H
Sbjct  418   PICLPAQAMKRFAKELKILLQDKPVDSAVRSLH  450



>emb|CDP09539.1| unnamed protein product [Coffea canephora]
Length=437

 Score =   493 bits (1270),  Expect = 1e-166, Method: Compositional matrix adjust.
 Identities = 251/449 (56%), Positives = 319/449 (71%), Gaps = 42/449 (9%)
 Frame = -1

Query  1546  ASQPSIAFTVTRQNPELVAPADPTPREIKYLSDIDDQQGLRFQIPVIHFYRNE------P  1385
             AS  S+ F VTRQ PELV PA  TPRE K LSDIDDQ+ LR QIP I FYRN        
Sbjct  6     ASSKSLTFRVTRQKPELVRPAKSTPRECKLLSDIDDQEALRIQIPFIQFYRNRDDPGINE  65

Query  1384  SMSGKDPVQVIRQALAKALVFFYPFAGRLREGPGRKLMVDCTGEGVMFIEADADATLQHF  1205
             S    DPV+VIR+A+AKALVF+YP A RLREGPGRKLMV+CTGEGV+FIEADAD TL+ F
Sbjct  66    SRRRSDPVKVIREAIAKALVFYYPLAARLREGPGRKLMVECTGEGVLFIEADADVTLEQF  125

Query  1204  AVGGELKPPFPCFDQLLYNVPGSAEILNCPLFLIQVTRLRCGGFIFALRLNHSMSDACGL  1025
               G  ++PPFPC ++LLY+VP S  IL+CP+ LIQVTRLRCGGFIFALR+NH+++D  G+
Sbjct  126   --GDAIQPPFPCLEELLYDVPHSGGILHCPIVLIQVTRLRCGGFIFALRMNHTIADGVGI  183

Query  1024  VHFLNTIAEIARGAEAPSVYPVWQREFFDARNPPRITCTHFEYEEEPAADSMVTNIPLDN  845
               F+N + EIAR A APS+ PVWQRE   AR+PPR+TC+H EY+E    D+  T +PLD+
Sbjct  184   AQFMNAVGEIARAASAPSIQPVWQRELLYARDPPRVTCSHHEYDEV-VVDTKGTIVPLDD  242

Query  844   LVHRSFFFGPTEISALRSSLPPHLL-KCSRFEVVTACLWRCRTIAMEFDPNDEVRIFGTV  668
             +VHRSFFFGP E+SALR S+P  L  +CS F+++TA LWRC+TIA+++DPN+EVR+   V
Sbjct  243   MVHRSFFFGPAEVSALRKSIPLDLSHRCSTFDILTAFLWRCQTIALQYDPNEEVRVICIV  302

Query  667   NARPRLKNPPVPNGYYGNAFVYPGAKSTAGKVSKSPLSHALELVTNIKSSFTEEYIKSVA  488
             NAR +  NPP+P GYYGNA  YP A +TAG++ + P+ +A+ELVT  K   TE+Y+KSVA
Sbjct  303   NARFKF-NPPLPQGYYGNAIAYPTALTTAGELCEKPVGYAVELVTKAKRVVTEDYMKSVA  361

Query  487   DLMILKGRPTFTLQGTFIVSDVTRVGFPEIDMGWGQSVFggpahggvggipGLITFYIPY  308
             DLMI                         +D GWG+ V+GGPA G       +  F+IP+
Sbjct  362   DLMI-------------------------VDFGWGKPVYGGPAQGT------VACFHIPF  390

Query  307   EDNKGDHGILVPMCLPAIAMGKFVKELEN  221
             ++ KG+ G +VP+ LP +AM +FV ELEN
Sbjct  391   KNKKGETGRVVPIFLPGLAMDRFVNELEN  419



>ref|XP_002466979.1| hypothetical protein SORBIDRAFT_01g017800 [Sorghum bicolor]
 gb|EER93977.1| hypothetical protein SORBIDRAFT_01g017800 [Sorghum bicolor]
Length=465

 Score =   493 bits (1270),  Expect = 3e-166, Method: Compositional matrix adjust.
 Identities = 252/446 (57%), Positives = 327/446 (73%), Gaps = 7/446 (2%)
 Frame = -1

Query  1549  MASQPSIAFTVTRQNPELVAPADPTPREIKYLSDIDDQQGLRFQIPVIHFYRNEPSMSGK  1370
             MAS  S+ FTV R+   LVAPA PTPRE+K LSDIDDQ GLRF IPVI FYR    M G+
Sbjct  1     MAS--SLKFTVRRRPAVLVAPASPTPRELKRLSDIDDQDGLRFHIPVIQFYRRSALMGGR  58

Query  1369  DPVQVIRQALAKALVFFYPFAGRLREGPGRKLMVDCTGEGVMFIEADADATLQHFAVGGE  1190
             DP  VIR A+A+ALV +YPFAGRLRE   RKL V+CTGEGV+FIEADAD  L HF  G  
Sbjct  59    DPAPVIRDAVARALVHYYPFAGRLRELQARKLAVECTGEGVLFIEADADVRLDHF--GDA  116

Query  1189  LKPPFPCFDQLLYNVPGSAEILNCPLFLIQVTRLRCGGFIFALRLNHSMSDACGLVHFLN  1010
             L+PPFPC D+L+++VPGS+++L  PL L QVTRL CGGFI  +RL+H+M+DA GLV FL 
Sbjct  117   LQPPFPCLDELIFDVPGSSQVLGSPLLLFQVTRLACGGFILGVRLHHTMADAQGLVQFLG  176

Query  1009  TIAEIARGAEAPSVYPVWQREFFDARNPPRITCTHFEYEEEPAADSMVTNIPLDNLVHRS  830
              +AE+ARGA AP+V PVW RE  +AR+PPR    H EY+E P  D+  T IPLD++VHRS
Sbjct  177   AVAELARGAAAPTVRPVWCRELLEARDPPRPAFAHREYDEVP--DTKGTLIPLDDMVHRS  234

Query  829   FFFGPTEISALRSSLPPHL-LKCSRFEVVTACLWRCRTIAMEFDPNDEVRIFGTVNARPR  653
             FFFG  E++A+R++LPP L  + S F+++T  LW+CRT A+  D ++ +R+   VNAR  
Sbjct  235   FFFGRQELAAIRANLPPALRARASTFDLLTGLLWKCRTAALAPDADEVMRMICIVNARGG  294

Query  652   LKNPPVPNGYYGNAFVYPGAKSTAGKVSKSPLSHALELVTNIKSSFTEEYIKSVADLMIL  473
                  +P GYYGNAF +P A +TAG+++ SPL +A+ELV   K     EY++SVADLM+L
Sbjct  295   KSGIAIPEGYYGNAFAFPVAVATAGELAASPLGYAVELVKRAKGEVNVEYMRSVADLMVL  354

Query  472   KGRPTFTLQGTFIVSDVTRVGFPEIDMGWGQSVFggpahggvggipGLITFYIPYEDNKG  293
             +GRP FT    ++ SDVT+ GF ++D GWG+ V+GGPA GGVG IPG+ +F+IP+++ KG
Sbjct  355   RGRPHFTAVRAYLASDVTKAGFGDLDFGWGKPVYGGPAKGGVGAIPGVASFFIPFKNAKG  414

Query  292   DHGILVPMCLPAIAMGKFVKELENCL  215
             + GI+VPMCLP +AM  FV+E+   L
Sbjct  415   EDGIVVPMCLPGLAMETFVQEMGKLL  440



>dbj|BAJ92444.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=482

 Score =   491 bits (1263),  Expect = 6e-165, Method: Compositional matrix adjust.
 Identities = 252/450 (56%), Positives = 329/450 (73%), Gaps = 8/450 (2%)
 Frame = -1

Query  1552  FMASQP-SIAFTVTRQNPELVAPADPTPREIKYLSDIDDQQGLRFQIPVIHFYRNEPSMS  1376
              MAS   S+ FTV+R+  ELV PA PTPRE+K LSDIDDQ GLRF IPVI FYR + SM 
Sbjct  19    LMASTAASLRFTVSRKAAELVTPAGPTPRELKRLSDIDDQDGLRFHIPVIQFYRRDASMG  78

Query  1375  GKDPVQVIRQALAKALVFFYPFAGRLREGPGRKLMVDCTGEGVMFIEADADATLQHFAVG  1196
             G+DP  V+R A+A+ALV +YPFAGRLRE  GRKL VDCTGEGV+FIEADA+  L+HF  G
Sbjct  79    GRDPAAVVRDAVARALVHYYPFAGRLRELEGRKLAVDCTGEGVLFIEADANVRLEHF--G  136

Query  1195  GELKPPFPCFDQLLYNVPGSAEILNCPLFLIQVTRLRCGGFIFALRLNHSMSDACGLVHF  1016
               L+PPFP  ++L+++VPGS+E+L  PL L QVTRL CGGFI A+RL H+MSDA GLV F
Sbjct  137   DALQPPFPGLEELVFDVPGSSEVLGTPLLLFQVTRLACGGFILAVRLMHTMSDAQGLVQF  196

Query  1015  LNTIAEIARGAEAPSVYPVWQREFFDARNPPRITCTHFEYEEEPAADSMVTNIPLDNLVH  836
             L  +AE+ARGA APSV PVW+RE  +ARNPPR    H EY+E P  D+  T +PLD++ H
Sbjct  197   LAAVAELARGAAAPSVRPVWERELLEARNPPRPGFAHREYDEVP--DTKGTIVPLDDMAH  254

Query  835   RSFFFGPTEISALRSSLPPHL-LKCSRFEVVTACLWRCRTIAMEFDPNDEVRIFGTVNAR  659
             RSFFFG  E++A+RS L P L  + + FEV+T  LW+CRT+A+  D ++ +R+   VNAR
Sbjct  255   RSFFFGAKEVAAIRSHLAPGLRRRATTFEVLTGSLWKCRTVALAPDADEVMRMICIVNAR  314

Query  658   PRLKN--PPVPNGYYGNAFVYPGAKSTAGKVSKSPLSHALELVTNIKSSFTEEYIKSVAD  485
                +     +P GYYGNAF +P A S +G +  +PLS+A++LV   KS    EY++SVAD
Sbjct  315   GGKQGGASAIPTGYYGNAFAFPVAVSASGDLCANPLSYAVKLVKEAKSEVNVEYMRSVAD  374

Query  484   LMILKGRPTFTLQGTFIVSDVTRVGFPEIDMGWGQSVFggpahggvggipGLITFYIPYE  305
             LM+ +GRP FT+   ++ SDVT+ GF ++D GWG+ V+GGPA GGVG IPG+ +F IP++
Sbjct  375   LMVQRGRPHFTVVRAYLASDVTKAGFGDLDFGWGRPVYGGPAKGGVGAIPGVASFLIPFK  434

Query  304   DNKGDHGILVPMCLPAIAMGKFVKELENCL  215
             + KG+ GI++PMCLP  AM +FV+E+   L
Sbjct  435   NAKGEDGIVIPMCLPGPAMDRFVEEMGKLL  464



>gb|ABX57719.1| acyltransferase [Vanda hybrid cultivar]
Length=447

 Score =   489 bits (1259),  Expect = 6e-165, Method: Compositional matrix adjust.
 Identities = 253/447 (57%), Positives = 329/447 (74%), Gaps = 8/447 (2%)
 Frame = -1

Query  1549  MASQPSIAFTVTRQNPELVAPADPTPREIKYLSDIDDQQGLRFQIPVIHFYRNEPSMSGK  1370
             MAS  ++ F+V R+ P+LVAPA PTPRE+K LSDIDDQ+GLRFQIPVI FYR+EP+M+G+
Sbjct  1     MASS-TLHFSVRRRPPQLVAPASPTPRELKRLSDIDDQEGLRFQIPVIQFYRHEPAMAGQ  59

Query  1369  DPVQVIRQALAKALVFFYPFAGRLREGPGRKLMVDCTGEGVMFIEADADATLQHFAVGGE  1190
             +P  VIR ALA+ LVF+YPFAGRLREG G+KL VDCTGEGV+FIEA+AD  L+ F  G  
Sbjct  60    NPASVIRDALARTLVFYYPFAGRLREGAGKKLFVDCTGEGVLFIEAEADVKLKDF--GDA  117

Query  1189  LKPPFPCFDQLLYNVPGSAEILNCPLFLIQVTRLRCGGFIFALRLNHSMSDACGLVHFLN  1010
             L PPFPC ++LL++V GS+ +LN PL LIQVT L CGGFI ALRLNH+MSDA GLV  + 
Sbjct  118   LHPPFPCLEELLFDVDGSSAVLNTPLLLIQVTLLSCGGFILALRLNHTMSDAPGLVQLMT  177

Query  1009  TIAEIARGAEAPSVYPVWQREFFDARNPPRITCTHFEYEEEPAADSMVTNIPLDNLVHRS  830
              + E+ARG+ +PSV PVW+RE  +AR  P     H EYE+ P  +  +T  PLDN  HRS
Sbjct  178   AVGELARGSSSPSVIPVWRRELLEARPSPAPFFPHPEYEQVPDTEGTIT--PLDNTAHRS  235

Query  829   FFFGPTEISALRSSLPPHLLKCSR-FEVVTACLWRCRTIAME-FDPNDEVRIFGTVNARP  656
             F FGP EIS LRS LP  L   S  F+++TAC+WR RT A++  DP +  RI   VN R 
Sbjct  236   FIFGPREISILRSRLPSQLRGASSTFDILTACVWRSRTRALQPADPKENFRIICIVNIRG  295

Query  655   RLKNPPVPNGYYGNAFVYPGAKSTAGKVSKSPLSHALELVTNIKSSFTEEYIKSVADLMI  476
             R+ NPP+P+G+YGNAF  P A +TAG++   PL +A+ELV   KS  + +Y+ SVAD M+
Sbjct  296   RI-NPPLPSGFYGNAFGLPVAIATAGELCSRPLDYAVELVKRAKSQVSGDYLHSVADYMV  354

Query  475   LKGRPTFTLQGTFIVSDVTRVGFPEIDMGWGQSVFggpahggvggipGLITFYIPYEDNK  296
             +KGRP FT+  T+++SD+TR GF ++D GWG+ V+GGPA GGVG  PG+  F+IP+ +  
Sbjct  355   MKGRPHFTVVRTYVISDLTRAGFGDVDFGWGKPVYGGPAKGGVGVSPGVFNFFIPFVNAS  414

Query  295   GDHGILVPMCLPAIAMGKFVKELENCL  215
             G+ GI+VP+CLP  AM +FV E+++ L
Sbjct  415   GEKGIVVPICLPPPAMRRFVAEIQSLL  441



>ref|XP_008462820.1| PREDICTED: benzyl alcohol O-benzoyltransferase-like [Cucumis 
melo]
Length=446

 Score =   489 bits (1258),  Expect = 7e-165, Method: Compositional matrix adjust.
 Identities = 239/445 (54%), Positives = 317/445 (71%), Gaps = 4/445 (1%)
 Frame = -1

Query  1549  MASQPSIAFTVTRQNPELVAPADPTPREIKYLSDIDDQQGLRFQIPVIHFYRNEPSMSGK  1370
             M+   S+ F V R  PEL+ P  PTP E K LSDIDDQQ  R Q+P+IHFY   P+M G+
Sbjct  4     MSKATSLVFKVERCEPELIVPTKPTPHEWKQLSDIDDQQSFRIQVPLIHFYPQNPNMEGR  63

Query  1369  DPVQVIRQALAKALVFFYPFAGRLREGPGRKLMVDCTGEGVMFIEADADATLQHFAVGGE  1190
             DPV+VI++A++K LVF+YPFAGR+RE  G+KL V+CTGEGV+FIEA+AD +LQ F     
Sbjct  64    DPVKVIKEAVSKTLVFYYPFAGRVRERFGKKLFVECTGEGVLFIEANADVSLQQFQDSSS  123

Query  1189  LKPPFPCFDQLLYNVPGSAEILNCPLFLIQVTRLRCGGFIFALRLNHSMSDACGLVHFLN  1010
             L+PPFPC DQLLY+VP S  IL+ PL LIQVTRL+CGGFIFA+R NH+++D  G+  FL 
Sbjct  124   LQPPFPCMDQLLYDVPDSDGILDSPLLLIQVTRLKCGGFIFAVRFNHTITDGIGMAQFLK  183

Query  1009  TIAEIARGAEAPSVYPVWQREFFDARNPPRITCTHFEYEEEPAADSMVTNIPLDNLVHRS  830
              IAE+ARGA APSV PVW+R   ++R+PPR+TC H EY+E    D   T I LDN+V  S
Sbjct  184   AIAEMARGALAPSVLPVWKRALLNSRDPPRVTCLHHEYDE--VNDVNDTTITLDNMVQHS  241

Query  829   FFFGPTEISALRSSLPPHLLKCSRFEVVTACLWRCRTIAMEFDPNDEVRIFGTVNARPRL  650
             FFFG TEIS +R +LP H       E++   +WR RTIA++  P +EVR+   VN R + 
Sbjct  242   FFFGLTEISIIRKTLPTHFHNYPSAELLMIFIWRLRTIALQLSPEEEVRLLCLVNLRTKF  301

Query  649   KNPPVPNGYYGNAFVYPGAKSTAGKVSKSPLSHALELVTNIKSSFTEEYIKSVADLMILK  470
                P+  GYYGNAF +P A +TA K+S++ L +A+ELV N K+  TEEY+KS+ D M +K
Sbjct  302   NYLPL--GYYGNAFAFPAAVTTAAKLSQNSLGYAIELVENSKAKVTEEYVKSMVDFMTVK  359

Query  469   GRPTFTLQGTFIVSDVTRVGFPEIDMGWGQSVFggpahggvggipGLITFYIPYEDNKGD  290
             GRP FT+ G+F+++D+T  GF ++D GW +++F GPA G VG +PGLI+F IP +   G+
Sbjct  360   GRPHFTVVGSFLMADLTEAGFEDVDFGWEKAIFAGPAIGKVGLVPGLISFCIPSKTRHGE  419

Query  289   HGILVPMCLPAIAMGKFVKELENCL  215
              GI+VP+CLPA AM +  +EL+  L
Sbjct  420   KGIVVPLCLPAPAMERLAEELDALL  444



>ref|XP_004151857.1| PREDICTED: benzyl alcohol O-benzoyltransferase-like [Cucumis 
sativus]
 gb|KGN63330.1| hypothetical protein Csa_2G429030 [Cucumis sativus]
Length=461

 Score =   489 bits (1259),  Expect = 1e-164, Method: Compositional matrix adjust.
 Identities = 240/442 (54%), Positives = 319/442 (72%), Gaps = 6/442 (1%)
 Frame = -1

Query  1549  MASQPSIAFTVTRQNPELVAPADPTPREIKYLSDIDDQQGLRFQIPVIHFYRNEPSMSGK  1370
             ++S  +  F V R  PELVAPA PTP E K LSDIDDQ+  RFQ+P++  Y + P M G 
Sbjct  3     ISSHNNFVFQVRRCEPELVAPAKPTPYEFKQLSDIDDQEAFRFQVPLLFLYAHNPRMEGS  62

Query  1369  DPVQVIRQALAKALVFFYPFAGRLREGPGRKLMVDCTGEGVMFIEADADATLQHFAVGGE  1190
             DPV+VI++A++  LVF+YPFAGRLREGPG+KL V+CT EG++FIEADA+  LQ F  G  
Sbjct  63    DPVKVIKKAISDTLVFYYPFAGRLREGPGKKLFVECTAEGILFIEADANVALQQF--GDA  120

Query  1189  LKPPFPCFDQLLYNVPGSAEILNCPLFLIQVTRLRCGGFIFALRLNHSMSDACGLVHFLN  1010
             ++PPF   D +LYNVP S  I+N PL L+QVTRLRCGGFIFA+R+NH+M+DA GL+ F+ 
Sbjct  121   VQPPFAFLDDVLYNVPSSDGIINSPLLLVQVTRLRCGGFIFAIRVNHTMTDAFGLMQFMT  180

Query  1009  TIAEIARGAEAPSVYPVWQREFFDARNPPRITCTHFEYEEEPAADSMVTNIPLDNLVHRS  830
              + E+A G  APSV PVWQR   +AR+PP +T  H EY++    D+   NI L+ + H S
Sbjct  181   AVREMACGDTAPSVLPVWQRSLLNARDPPTVTHRHHEYDQ--VVDTKQINISLNEMAHGS  238

Query  829   FFFGPTEISALRSSLPPHLLKCSRFEVVTACLWRCRTIAMEFDPNDEVRIFGTVNARPRL  650
              FFGPTEIS LR +LP HL  CS F+++TACLWR RTIA++ +PNDE+R+   VN R + 
Sbjct  239   VFFGPTEISTLRKTLPIHLRYCSSFDLITACLWRTRTIALQPNPNDEMRLLCVVNLRSKS  298

Query  649   KNPPVPNGYYGNAFVYPGAKSTAGKVSKSPLSHALELVTNIKSSFTEEYIKSVADLMILK  470
             K   +P+GYYGNAF  P A +TAG + ++PLS+A+EL+   K+  TEEY+KSVADLM++ 
Sbjct  299   KY--LPSGYYGNAFALPAAVATAGNLCQNPLSYAVELIRKAKAEMTEEYMKSVADLMVIN  356

Query  469   GRPTFTLQGTFIVSDVTRVGFPEIDMGWGQSVFggpahggvggipGLITFYIPYEDNKGD  290
             GRP  T   ++ VSDVT+    +ID GWG+++FGGPA GGV  +PGL +FYI +++ KG+
Sbjct  357   GRPNLTAVRSYAVSDVTKTDLEKIDFGWGEAIFGGPAMGGVATVPGLTSFYISFKNKKGE  416

Query  289   HGILVPMCLPAIAMGKFVKELE  224
              G +VP  LP  AM +FV EL+
Sbjct  417   QGTVVPFSLPVEAMERFVVELD  438



>ref|XP_006470741.1| PREDICTED: anthraniloyl-CoA:methanol acyltransferase-like [Citrus 
sinensis]
Length=445

 Score =   488 bits (1257),  Expect = 1e-164, Method: Compositional matrix adjust.
 Identities = 241/452 (53%), Positives = 322/452 (71%), Gaps = 12/452 (3%)
 Frame = -1

Query  1549  MASQPSIAFTVTRQNPELVAPADPTPREIKYLSDIDDQQGLRFQIPVIHFYRNEPS--MS  1376
             M+S+    F+V R+ PEL+ PA PT R IK LS +DDQQ LRFQIP+I FY+N+PS  M 
Sbjct  1     MSSKLRQLFSVIRKTPELIGPARPTARVIKQLSSLDDQQCLRFQIPMIFFYKNDPSPAME  60

Query  1375  GKDPVQVIRQALAKALVFFYPFAGRLREGPGRKLMVDCTGEGVMFIEADADATLQHFAVG  1196
             GKDPV+VIR+AL+KAL F+YP AGRL+E   RKLMVDC GEGV+F EA+A+ TL+   VG
Sbjct  61    GKDPVKVIREALSKALTFYYPLAGRLKEVSNRKLMVDCNGEGVLFTEAEANITLEQLEVG  120

Query  1195  GELKPPFPCFDQLLYNVPGSAEILNCPLFLIQVTRLRCGGFIFALRLNHSMSDACGLVHF  1016
               ++PP P   +LLYNVPGS  IL CPL LIQVTRL CGGFI ALRLNH+M DA  L+ F
Sbjct  121   DAVRPPCPYLHELLYNVPGSEGILGCPLLLIQVTRLACGGFILALRLNHTMCDAFALLQF  180

Query  1015  LNTIAEIARGAEAPSVYPVWQREFFDARNPPRITCTHFEYEEEPAADSMVTNIPLDNLV-  839
             +  I ++A+GA  PS+ PVW+RE    R PP+ITCTH EY+++   DS +   P D+++ 
Sbjct  181   MKAIEDMAKGANEPSLLPVWERELLSPRIPPKITCTHHEYDDQ--TDSTLAMNPNDHIIN  238

Query  838   HRSFFFGPTEISALRSSLPPHLLK-CSRFEVVTACLWRCRTIAMEFDPNDEVRIFGTVNA  662
             H+SF+FGP EI+ALR+ LP HL   CS FE++TAC+WRCRTIA++ DP++ VR+   VN 
Sbjct  239   HKSFYFGPKEITALRNQLPQHLRDGCSTFELLTACIWRCRTIALQIDPDEIVRVTCCVNI  298

Query  661   RPRLKNPPVPNGYYGNAFVYPGAKSTAGKVSKSPLSHALELVTNIKSSFTEEYIKSVADL  482
             R    N  +PNGYYGNA   P A STAG +SK  L +A++LV  +K++ +EEY++S+ D 
Sbjct  299   RGTKYNMMLPNGYYGNAIATPTACSTAGDLSKYSLGYAVDLVKKVKATASEEYVRSLIDF  358

Query  481   MILKGRPTFTLQGTFIVSDVTRVGFPEIDMGWGQSVFggpahggvggipGLITFYIPYED  302
             M +KGRP   ++G+F+VSD+TR GF EID GWG+ V+      G       ++FYI Y++
Sbjct  359   MEIKGRPMPAVKGSFVVSDITRGGFEEIDFGWGKPVY-----AGPPEAVLFMSFYIRYQN  413

Query  301   -NKGDHGILVPMCLPAIAMGKFVKELENCLMK  209
              + G++G LVP+CLP  AM KF +EL+   ++
Sbjct  414   KDSGEYGTLVPICLPLRAMKKFEEELKKMTLQ  445



>ref|XP_006446260.1| hypothetical protein CICLE_v10015249mg [Citrus clementina]
 gb|ESR59500.1| hypothetical protein CICLE_v10015249mg [Citrus clementina]
Length=445

 Score =   488 bits (1256),  Expect = 1e-164, Method: Compositional matrix adjust.
 Identities = 241/452 (53%), Positives = 320/452 (71%), Gaps = 12/452 (3%)
 Frame = -1

Query  1549  MASQPSIAFTVTRQNPELVAPADPTPREIKYLSDIDDQQGLRFQIPVIHFYRNEPS--MS  1376
             M+S+    F+V R+ PEL+ PA PT R IK LS +DDQQ LRFQIP+I FY+N+PS  M 
Sbjct  1     MSSKLRQLFSVIRKTPELIGPARPTARVIKQLSSLDDQQCLRFQIPMIFFYKNDPSPAME  60

Query  1375  GKDPVQVIRQALAKALVFFYPFAGRLREGPGRKLMVDCTGEGVMFIEADADATLQHFAVG  1196
             GKDPV+VIR+AL+KAL F+YP AGRL+E   RKLMVDC GEGV+F EA+ + TL+   VG
Sbjct  61    GKDPVKVIREALSKALTFYYPLAGRLKEVSNRKLMVDCNGEGVLFTEAEGNITLEQLEVG  120

Query  1195  GELKPPFPCFDQLLYNVPGSAEILNCPLFLIQVTRLRCGGFIFALRLNHSMSDACGLVHF  1016
               ++PP P   +LLYNVPGS  IL CPL LIQVTRL CGGFI ALRLNH+M DA  L+ F
Sbjct  121   DAVRPPCPYLHELLYNVPGSDGILGCPLLLIQVTRLACGGFILALRLNHTMCDAFALLQF  180

Query  1015  LNTIAEIARGAEAPSVYPVWQREFFDARNPPRITCTHFEYEEEPAADSMVTNIPLDNLV-  839
             +  I ++A+GA  PS+ PVW+RE    R PP+ITC H EY+++   DS +   P D+++ 
Sbjct  181   MKAIEDMAKGANEPSLLPVWERELLSPRIPPKITCAHHEYDDQ--TDSTLAMNPNDHIIK  238

Query  838   HRSFFFGPTEISALRSSLPPHLLK-CSRFEVVTACLWRCRTIAMEFDPNDEVRIFGTVNA  662
             H+SF+FGP EI+ALR+ LP HL   CS FE++TAC+WRCRTIA++ DP++ VR+   VN 
Sbjct  239   HKSFYFGPKEITALRNQLPQHLRDGCSTFELLTACIWRCRTIALQIDPDEIVRVTCCVNI  298

Query  661   RPRLKNPPVPNGYYGNAFVYPGAKSTAGKVSKSPLSHALELVTNIKSSFTEEYIKSVADL  482
             R    N  +PNGYYGNA   P A STAG +SK  L +AL+LV  +K++ +EEY++S+ D 
Sbjct  299   RGTKYNMKLPNGYYGNAIATPTACSTAGDLSKYSLGYALDLVKKVKATASEEYVRSLIDF  358

Query  481   MILKGRPTFTLQGTFIVSDVTRVGFPEIDMGWGQSVFggpahggvggipGLITFYIPYED  302
             M +KGRP   ++G+F+VSD+TR GF EID GWG+ V+      G       ++FYI Y++
Sbjct  359   MEIKGRPMPAVKGSFVVSDITRGGFEEIDFGWGKPVY-----AGPPEAVLFMSFYIKYQN  413

Query  301   N-KGDHGILVPMCLPAIAMGKFVKELENCLMK  209
             N  G++G LVP+CLP  AM KF +EL+   ++
Sbjct  414   NDSGEYGTLVPICLPLRAMKKFEEELKKMTLQ  445



>ref|XP_004156760.1| PREDICTED: LOW QUALITY PROTEIN: benzyl alcohol O-benzoyltransferase-like 
[Cucumis sativus]
Length=461

 Score =   488 bits (1257),  Expect = 2e-164, Method: Compositional matrix adjust.
 Identities = 240/442 (54%), Positives = 319/442 (72%), Gaps = 6/442 (1%)
 Frame = -1

Query  1549  MASQPSIAFTVTRQNPELVAPADPTPREIKYLSDIDDQQGLRFQIPVIHFYRNEPSMSGK  1370
             ++S  +  F V R  PELVAPA PTP E K LSDIDDQ+  RFQ+P++  Y + P M G 
Sbjct  3     ISSHNNFVFQVRRCEPELVAPAKPTPYEFKQLSDIDDQEAFRFQVPLLFLYAHNPRMEGS  62

Query  1369  DPVQVIRQALAKALVFFYPFAGRLREGPGRKLMVDCTGEGVMFIEADADATLQHFAVGGE  1190
             DPV+VI++A++  LVF+YPFAGRLREGPG+KL V+CT EG++FIEADA+  LQ F  G  
Sbjct  63    DPVKVIKKAISDTLVFYYPFAGRLREGPGKKLFVECTAEGILFIEADANVALQQF--GDA  120

Query  1189  LKPPFPCFDQLLYNVPGSAEILNCPLFLIQVTRLRCGGFIFALRLNHSMSDACGLVHFLN  1010
             ++PPF   D +LYNVP S  I+N PL L+QVTRLRCGGFIFA+R+NH+M+DA GL+ F+ 
Sbjct  121   VQPPFAFLDDVLYNVPSSDGIINSPLLLVQVTRLRCGGFIFAIRVNHTMTDAFGLMQFMT  180

Query  1009  TIAEIARGAEAPSVYPVWQREFFDARNPPRITCTHFEYEEEPAADSMVTNIPLDNLVHRS  830
              + E+A G  APSV PVWQR   +AR+PP +T  H EY++    D+   NI L+ + H S
Sbjct  181   AVREMACGDTAPSVLPVWQRSLLNARDPPTVTHRHHEYDQ--VVDTKQINISLNEMAHGS  238

Query  829   FFFGPTEISALRSSLPPHLLKCSRFEVVTACLWRCRTIAMEFDPNDEVRIFGTVNARPRL  650
              FFGPTEIS LR +LP HL  CS F+++TACLWR RTIA++ +PNDE+R+   VN R + 
Sbjct  239   VFFGPTEISTLRKTLPIHLRYCSSFDLITACLWRTRTIALQPNPNDEMRLLCVVNLRSKS  298

Query  649   KNPPVPNGYYGNAFVYPGAKSTAGKVSKSPLSHALELVTNIKSSFTEEYIKSVADLMILK  470
             K   +P+GYYGNAF  P A +TAG + ++PLS+A+EL+   K+  TEEY+KSVADLM++ 
Sbjct  299   KY--LPSGYYGNAFALPAAVATAGNLCQNPLSYAVELIRKAKAEMTEEYMKSVADLMVIN  356

Query  469   GRPTFTLQGTFIVSDVTRVGFPEIDMGWGQSVFggpahggvggipGLITFYIPYEDNKGD  290
             GRP  T   ++ VSDVT+    +ID GWG+++FGGPA GGV  +PGL +FYI +++ KG+
Sbjct  357   GRPNLTAVRSYAVSDVTKTDLEKIDFGWGEAIFGGPAMGGVATVPGLTSFYISFKNXKGE  416

Query  289   HGILVPMCLPAIAMGKFVKELE  224
              G +VP  LP  AM +FV EL+
Sbjct  417   QGTVVPFSLPVEAMERFVVELD  438



>ref|NP_197256.1| HXXXD-type acyl-transferase family protein [Arabidopsis thaliana]
 emb|CAC01898.1| putative protein [Arabidopsis thaliana]
 gb|ACF37204.1| At5g17540 [Arabidopsis thaliana]
 gb|AED92441.1| HXXXD-type acyl-transferase family protein [Arabidopsis thaliana]
Length=461

 Score =   488 bits (1257),  Expect = 2e-164, Method: Compositional matrix adjust.
 Identities = 253/439 (58%), Positives = 324/439 (74%), Gaps = 7/439 (2%)
 Frame = -1

Query  1534  SIAFTVTRQNPELVAPADPTPREIKYLSDIDDQQGLRFQIPVIHFYRNEPSMSGKDPVQV  1355
             S+ F + RQ PELV+PA PTPRE+K LSDIDDQ+GLRF IP I FYR+ P+ +  DPV V
Sbjct  4     SLTFKIYRQKPELVSPAKPTPRELKPLSDIDDQEGLRFHIPTIFFYRHNPT-TNSDPVAV  62

Query  1354  IRQALAKALVFFYPFAGRLREGPGRKLMVDCTGEGVMFIEADADATLQHFAVGGELKPPF  1175
             IR+ALA+ LV++YPFAGRLREGP RKL VDCTGEGV+FIEADAD TL  F     LKPPF
Sbjct  63    IRRALAETLVYYYPFAGRLREGPNRKLAVDCTGEGVLFIEADADVTLVEFEEKDALKPPF  122

Query  1174  PCFDQLLYNVPGSAEILNCPLFLIQVTRLRCGGFIFALRLNHSMSDACGLVHFLNTIAEI  995
             PCF++LL+NV GS E+LN PL L+QVTRL+CGGFIFA+R+NH+MSDA GL  FL T+ E 
Sbjct  123   PCFEELLFNVEGSCEMLNTPLMLMQVTRLKCGGFIFAVRINHAMSDAGGLTLFLKTMCEF  182

Query  994   ARGAEAPSVYPVWQREFFDARNPPRITCTHFEYEEEPAADSMVTNIPLDNLVHRSFFFGP  815
              RG  AP+V PVW+R    AR   R+T  H EY+E PA  + + +   DNLV RS FFGP
Sbjct  183   VRGYHAPTVAPVWERHLLSARVLLRVTHAHREYDEMPAIGTELGS-RRDNLVGRSLFFGP  241

Query  814   TEISALRSSLPPHLLKCS-RFEVVTACLWRCRTIAMEFDPNDEVRIFGTVNARPRLKNPP  638
              E+SA+R  LPP+L+  S   E++T+ LWR RTIA+  D + E+R+   VNAR +LKNPP
Sbjct  242   CEMSAIRRLLPPNLVNSSTNMEMLTSFLWRYRTIALRPDQDKEMRLILIVNARSKLKNPP  301

Query  637   VPNGYYGNAFVYPGAKSTAGKVSKSPLSHALELVTNIKSSFTEEYIKSVADLMILKGRPT  458
             +P GYYGNAF +P A +TA +++K PL  AL L+   KSS TEEY++S+ADLM++KGRP+
Sbjct  302   LPRGYYGNAFAFPVAIATANELTKKPLEFALRLIKEAKSSVTEEYMRSLADLMVIKGRPS  361

Query  457   FTLQGTFIVSDVTRVGFPEIDMG-WGQSVFggpahggvggipGLITFYIPYEDNKGDHGI  281
             F+  G ++VSDV R+ F +ID G WG+ V+GG    GV  +PG  +FY+ +E   G+ GI
Sbjct  362   FSSDGAYLVSDV-RI-FADIDFGIWGKPVYGGIGTAGVEDLPG-ASFYVSFEKRNGEIGI  418

Query  280   LVPMCLPAIAMGKFVKELE  224
             +VP+CLP  AM +FV+ELE
Sbjct  419   VVPVCLPEKAMQRFVEELE  437



>ref|XP_011007948.1| PREDICTED: methanol O-anthraniloyltransferase-like [Populus euphratica]
Length=468

 Score =   488 bits (1257),  Expect = 2e-164, Method: Compositional matrix adjust.
 Identities = 237/439 (54%), Positives = 317/439 (72%), Gaps = 12/439 (3%)
 Frame = -1

Query  1531  IAFTVTRQNPELVAPADPTPREIKYLSDIDDQQGLRFQIPVIHFYRNEPSMSGKDPVQVI  1352
             + F+V R+ P+L+ P+ PTP EIK LSDIDDQQGLRF  P + FYR+ PS+  +DPV+VI
Sbjct  23    LRFSVKRREPQLIVPSKPTPHEIKQLSDIDDQQGLRFHFPFVMFYRSHPSLKREDPVKVI  82

Query  1351  RQALAKALVFFYPFAGRLREGPGRKLMVDCTGEGVMFIEADADATLQHFAVGGELKPPFP  1172
             ++AL KALVF+YPFAGR+ EGP  KL+VDCTGEG++F+EADAD T+    +G  + PPF 
Sbjct  83    KEALGKALVFYYPFAGRIIEGPRSKLLVDCTGEGILFVEADADVTIDQ--LGDSIHPPFS  140

Query  1171  CFDQLLYNVPGSAEILNCPLFLIQVTRLRCGGFIFALRLNHSMSDACGLVHFLNTIAEIA  992
               ++ L++VPGS+ IL CPL LIQVTRL CGGFIFA+RLNH+MSD+ GL  FLNT+ E+A
Sbjct  141   YIEEFLHDVPGSSGILGCPLLLIQVTRLACGGFIFAIRLNHTMSDSLGLSKFLNTVGELA  200

Query  991   RGAEAPSVYPVWQREFFDARNPPRITCTHFEYEEEPAADS---MVTNIPLDNLVHRSFFF  821
              GA  PS+ PVW+RE  +ARNPPR+TC H EYE+    ++   M       N+ HRSFFF
Sbjct  201   LGASTPSLLPVWEREILNARNPPRVTCVHHEYEQLTHTETSIVMSLQEHEKNIAHRSFFF  260

Query  820   GPTEISALRSSLPPHLLKCSRFEVVTACLWRCRTIAMEFDPNDEVRIFGTVNARPRLKNP  641
             GP+E+ ++R+ +PPHL KCS FEV+ + LWR RTIA++ DP + VR+   VN R + +  
Sbjct  261   GPSELKSIRTHIPPHLQKCSNFEVLASFLWRSRTIALQLDPKEVVRLSVIVNVRGK-QGL  319

Query  640   PVPNGYYGNAFVYPGAKSTAGKVSKSPLSHALELVTNIKSSFTEEYIKSVADLMILKGRP  461
              VP+GYYGNAF YP A S AG + +SPL +ALELVT +K+   EEYIKSVADL++LKGRP
Sbjct  320   KVPSGYYGNAFAYPTAISKAGLLCQSPLGYALELVTRLKTQMNEEYIKSVADLLVLKGRP  379

Query  460   TFTLQGTFIVSDVTRVGFPEIDMGWGQSVFggpahggvggipGLITFYIP-YEDNKGDHG  284
              +T   +F+++DVTRVG  + D GWG SV+     GG  G     +F++  ++++ G+ G
Sbjct  380   HYTTVWSFLIADVTRVGLGDFDFGWGNSVY-----GGPIGARPCTSFHVSGFKNSYGEEG  434

Query  283   ILVPMCLPAIAMGKFVKEL  227
             ILVP+ LP   M +F +EL
Sbjct  435   ILVPILLPLPIMNRFQQEL  453



>gb|KDP39567.1| hypothetical protein JCGZ_02587 [Jatropha curcas]
Length=444

 Score =   487 bits (1253),  Expect = 5e-164, Method: Compositional matrix adjust.
 Identities = 235/441 (53%), Positives = 315/441 (71%), Gaps = 14/441 (3%)
 Frame = -1

Query  1537  PSIAFTVTRQNPELVAPADPTPREIKYLSDIDDQQGLRFQIPVIHFYRNEPSMSGKDPVQ  1358
             P + F V R+ PEL+APA PTPRE K LSDIDDQ GLR Q+P+IH YR  PSM  KDPVQ
Sbjct  4     PPLVFKVNRREPELIAPAKPTPREFKSLSDIDDQDGLRTQLPLIHIYRYHPSMERKDPVQ  63

Query  1357  VIRQALAKALVFFYPFAGRLREGPGRKLMVDCTGEGVMFIEADADATLQHFAVGGELKPP  1178
             V++QA+A+ LVF+YPFAGR+RE P RKL+V+CTGEG++F+EADAD  L  F  G  ++PP
Sbjct  64    VLKQAIAETLVFYYPFAGRIRERPNRKLVVECTGEGILFVEADADVALDQF--GDAIRPP  121

Query  1177  FPCFDQLLYNVPGSAEILNCPLFLIQVTRLRCGGFIFALRLNHSMSDACGLVHFLNTIAE  998
             FPCF +LL++VPGS+ I NCPL LIQVTRL+CGG I A+RLNH++SDA G   F++T+AE
Sbjct  122   FPCFGELLFDVPGSSGIANCPLLLIQVTRLKCGGIILAIRLNHTISDATGYFQFISTVAE  181

Query  997   IARGAEAPSVYPVWQREFFDARNPPRITCTHFEYEEEPAADSMVTNIPLDNLVHRSFFFG  818
             +A GA +PS+ P W R   +AR PPRITC H EY++    D      P  +  HRSFFFG
Sbjct  182   MACGARSPSIPPTWDRHLLNAREPPRITCIHHEYDD--LVDVEDHKNPPGDKDHRSFFFG  239

Query  817   PTEISALRSSLPPHLLKCSRFEVVTACLWRCRTIAMEFDPNDEVRIFGTVNARPRLKNPP  638
             P EIS LR   P    + S F+++TACLWRCRTIA++  P++E+RI   VNAR +  NPP
Sbjct  240   PAEISCLRRFAP---YRSSSFDILTACLWRCRTIALQPKPDEEMRIICIVNARNKF-NPP  295

Query  637   VPNGYYGNAFVYPGAKSTAGKVSKSPLSHALELVTNIKSSFTEEYIKSVADLMILKGRPT  458
             +P GYYGN   Y  A + AG +  +P+ +ALELV   K++ TEEY++SVADLM++KGRP 
Sbjct  296   IPKGYYGNCIAYSVAIARAGDLCGNPIGYALELVRKAKTNVTEEYMRSVADLMVVKGRPK  355

Query  457   FTLQGTFIVSDVTRVGFPEIDMGWGQSVFggpahggvggipGLITFYIPYEDNKGDHGIL  278
             FT+  +F+VS   ++ F E+D GWG++V+      G   +  + +F+I   + KG+ G++
Sbjct  356   FTMVRSFLVSGAAKMRFDEVDFGWGRAVY------GGPAMGHVASFHIAGRNKKGEDGVI  409

Query  277   VPMCLPAIAMGKFVKELENCL  215
             V +CLP +AM +FVKEL++ L
Sbjct  410   VTLCLPRLAMQRFVKELDSLL  430



>ref|XP_006470749.1| PREDICTED: anthraniloyl-CoA:methanol acyltransferase-like [Citrus 
sinensis]
Length=445

 Score =   486 bits (1252),  Expect = 7e-164, Method: Compositional matrix adjust.
 Identities = 238/452 (53%), Positives = 323/452 (71%), Gaps = 12/452 (3%)
 Frame = -1

Query  1549  MASQPSIAFTVTRQNPELVAPADPTPREIKYLSDIDDQQGLRFQIPVIHFYRNEPS--MS  1376
             M+S+    F+V R+ PEL+ PA PT R IK LS +DDQQ LRFQIP+I FY+N+PS  M 
Sbjct  1     MSSKLRQLFSVIRKTPELIGPARPTARVIKQLSSLDDQQCLRFQIPMIFFYKNDPSPAME  60

Query  1375  GKDPVQVIRQALAKALVFFYPFAGRLREGPGRKLMVDCTGEGVMFIEADADATLQHFAVG  1196
             GKDPV+VIR+AL+KAL F+YP AGRL+E   RKLMVDC GEGV+F EA+A+ TL+   VG
Sbjct  61    GKDPVKVIREALSKALTFYYPLAGRLKEVSNRKLMVDCNGEGVLFTEAEANITLEQLEVG  120

Query  1195  GELKPPFPCFDQLLYNVPGSAEILNCPLFLIQVTRLRCGGFIFALRLNHSMSDACGLVHF  1016
               ++PP P   +LLYNVPGS  IL CPL LIQVTRL CGGFI ALRLNH+M DA  L+ F
Sbjct  121   DAVRPPCPYLHELLYNVPGSEGILGCPLLLIQVTRLACGGFILALRLNHTMCDAFALLQF  180

Query  1015  LNTIAEIARGAEAPSVYPVWQREFFDARNPPRITCTHFEYEEEPAADSMVTNIPLDNLV-  839
             +  I ++A+GA  PS+ PVW+RE    R PP+ITCTH EY+++   DS +   P D+++ 
Sbjct  181   MKAIEDMAKGANEPSLLPVWERELLSPRIPPKITCTHHEYDDQ--TDSTLAMNPNDHIIN  238

Query  838   HRSFFFGPTEISALRSSLPPHLLK-CSRFEVVTACLWRCRTIAMEFDPNDEVRIFGTVNA  662
             H+SF+FGP EI+ALR+ LP HL   CS FE++TAC+WRCRT+A++ DP++ VR+   VN 
Sbjct  239   HKSFYFGPKEITALRNQLPQHLRDGCSTFELLTACIWRCRTMALQIDPDEIVRVTCCVNI  298

Query  661   RPRLKNPPVPNGYYGNAFVYPGAKSTAGKVSKSPLSHALELVTNIKSSFTEEYIKSVADL  482
             R    N  +PNGYYGNA   P A STAG +SK  L++A++LV  +K++ +EEY++S+ D 
Sbjct  299   RGTKYNMMLPNGYYGNAIATPTACSTAGDLSKYSLAYAVDLVKKVKATASEEYVRSLIDF  358

Query  481   MILKGRPTFTLQGTFIVSDVTRVGFPEIDMGWGQSVFggpahggvggipGLITFYIPYED  302
             M ++GRP   ++G+F+VSD+TR GF E+D GWG+ V+      G       ++FYI Y++
Sbjct  359   MEIRGRPMPAVKGSFVVSDITRGGFEEVDFGWGKPVY-----AGPPEAVLFMSFYIKYQN  413

Query  301   -NKGDHGILVPMCLPAIAMGKFVKELENCLMK  209
              + G++G LVP+CLP  AM KF +EL+   ++
Sbjct  414   KDSGEYGTLVPICLPLRAMEKFEEELKKMTLQ  445



>ref|XP_008238035.1| PREDICTED: methanol O-anthraniloyltransferase-like [Prunus mume]
Length=460

 Score =   485 bits (1248),  Expect = 4e-163, Method: Compositional matrix adjust.
 Identities = 238/443 (54%), Positives = 303/443 (68%), Gaps = 9/443 (2%)
 Frame = -1

Query  1549  MASQPSIAFTVTRQNPELVAPADPTPREIKYLSDIDDQQGLRFQIPVIHFYRNEPSMSGK  1370
             M S  ++ F V R  PEL+ PA PTP E K LS+IDDQ+ LRFQ+PVI  Y+N PSM G 
Sbjct  1     MISPSALLFQVNRLKPELITPAKPTPHETKLLSNIDDQESLRFQVPVIMSYKNNPSMKGN  60

Query  1369  DPVQVIRQALAKALVFFYPFAGRLREGPGRKLMVDCTGEGVMFIEADADATLQHFAVGGE  1190
             D V+VIR+AL++ALV++YP AGRLREGP RKLMV+C GEGV+F+EA+AD  L     G  
Sbjct  61    DAVEVIREALSRALVYYYPLAGRLREGPNRKLMVECNGEGVLFMEANADVRLAQL--GDT  118

Query  1189  LKPPFPCFDQLLYNVPGSAEILNCPLFLIQVTRLRCGGFIFALRLNHSMSDACGLVHFLN  1010
             + PP P  ++ LYNVPGS  IL CPL LIQVTRL CGGFI ALRLNH+M D  GLV FLN
Sbjct  119   IAPPSPFLEEFLYNVPGSDGILGCPLLLIQVTRLSCGGFILALRLNHTMCDGAGLVQFLN  178

Query  1009  TIAEIARGAEAPSVYPVWQREFFDARNPPRITCTHFEYEEEPAADSMVTNIPLDNLVHRS  830
              I E+A+GA+APS  PVW+RE   AR+PPRITC H EYEE   A     +    N+V RS
Sbjct  179   AIGEMAQGAQAPSTTPVWERELLGARDPPRITCVHHEYEEGIDAQGSFPSTNKPNMVQRS  238

Query  829   FFFGPTEISALRSSLPPHLLKCSRFEVVTACLWRCRTIAMEFDPNDEVRIFGTVNARPRL  650
             F+FG  EI A+R+ +PP L  C+ F+++TACLW+CRT+A+  +P   VR+   V+ R + 
Sbjct  239   FYFGAKEIKAIRNHIPPQLSTCTTFDLITACLWKCRTLALRMNPKQVVRLSCLVSGRGKR  298

Query  649   KNPPVPNGYYGNAFVYPGAKSTAGKVSKSPLSHALELVTNIKSSFTEEYIKSVADLMILK  470
              N  +P GYYGNA  +P A S A  +  +PL +ALELV   K++  EEY++SVADLM ++
Sbjct  299   HNVRLPLGYYGNAIAFPAAVSEAKAICTNPLGYALELVMKAKATVNEEYMRSVADLMEIR  358

Query  469   GR-PTFTLQGTFIVSDVTRVGFPEIDMGWGQSVFggpahggvggipGLITFYIPYEDNKG  293
             GR P + L G FIVSD +R GF E+  GWG+ VF     GG      LI+FY+ ++ N  
Sbjct  359   GRLPKYPLTGNFIVSDNSRAGFGEVSFGWGKPVF-----GGPAKALNLISFYVQHKCNNE  413

Query  292   DHGILVPMCLPAIAMGKFVKELE  224
             D G+LVP+CLP   M +F KELE
Sbjct  414   D-GVLVPICLPLSDMERFQKELE  435



>ref|XP_003574156.1| PREDICTED: benzyl alcohol O-benzoyltransferase [Brachypodium 
distachyon]
Length=463

 Score =   484 bits (1247),  Expect = 6e-163, Method: Compositional matrix adjust.
 Identities = 246/448 (55%), Positives = 323/448 (72%), Gaps = 8/448 (2%)
 Frame = -1

Query  1546  ASQPSIAFTVTRQNPELVAPADPTPREIKYLSDIDDQQGLRFQIPVIHFYRNEPSMSGKD  1367
              S  ++ FTV R+  ELVAPA PTPRE+K LSDIDDQ GLRF IPVI FYR + SM+G++
Sbjct  3     GSTEALRFTVRRKAAELVAPAGPTPRELKRLSDIDDQDGLRFHIPVIQFYRRQASMAGRN  62

Query  1366  PVQVIRQALAKALVFFYPFAGRLREGPGRKLMVDCTGEGVMFIEADADATLQHFAVGGEL  1187
             P  V+R+A+++ALV +YPFAGRLRE   RKL VDCTGEGV+F EADAD  L+HF  G  L
Sbjct  63    PAAVVREAVSRALVPYYPFAGRLRELEARKLAVDCTGEGVLFTEADADVRLEHF--GDAL  120

Query  1186  KPPFPCFDQLLYNVPGSAEILNCPLFLIQVTRLRCGGFIFALRLNHSMSDACGLVHFLNT  1007
             +PPFP  D+L+++VPGS+++L  PL L QVTRL CGGFI  +RL H+M+DA GLV FL  
Sbjct  121   QPPFPGLDELIFDVPGSSQVLGTPLLLFQVTRLACGGFILGVRLMHTMADAQGLVQFLGA  180

Query  1006  IAEIARGAEAPSVYPVWQREFFDARNPPRITCTHFEYEEEPAADSMVTNIPLDNLVHRSF  827
             +AE+ARG   P+V PVW+R   +AR+PPR    H EY+E P  D+  T +PLD++ HRS 
Sbjct  181   VAEMARGMATPTVKPVWERSLLEARDPPRPGYAHREYDEVP--DTNGTIVPLDDMAHRSL  238

Query  826   FFGPTEISALRSSLPPHLL-KCSRFEVVTACLWRCRTIAMEFDPNDEVRIFGTVNARPRL  650
             FFG  E++A+RS LPP L  + + FEV+T CLWRCRT A+  D ++E+R+   VNAR   
Sbjct  239   FFGAGEVAAIRSHLPPPLRSRATTFEVLTGCLWRCRTSALAPDADEEMRMICIVNARGNA  298

Query  649   K---NPPVPNGYYGNAFVYPGAKSTAGKVSKSPLSHALELVTNIKSSFTEEYIKSVADLM  479
                    +P+GYYGNAF +P A + AG++   PL+HA+ELV   KS    EY++SVADLM
Sbjct  299   NKNGKSAIPSGYYGNAFAFPVAVARAGELCARPLAHAVELVRRAKSEVDVEYMRSVADLM  358

Query  478   ILKGRPTFTLQGTFIVSDVTRVGFPEIDMGWGQSVFggpahggvggipGLITFYIPYEDN  299
             + +GRP FT+   ++ SDVT+ GF ++D GWG+ V+GGPA GGVG IPG+ +F IP+++ 
Sbjct  359   VQRGRPHFTVVRAYLASDVTKAGFGDLDFGWGRPVYGGPAKGGVGAIPGVASFLIPFKNG  418

Query  298   KGDHGILVPMCLPAIAMGKFVKELENCL  215
             KG+ GI+VPMCLP  AM KFV E+   L
Sbjct  419   KGEDGIVVPMCLPGPAMDKFVVEMARLL  446



>ref|XP_006446267.1| hypothetical protein CICLE_v10015194mg [Citrus clementina]
 gb|ESR59507.1| hypothetical protein CICLE_v10015194mg [Citrus clementina]
Length=456

 Score =   484 bits (1246),  Expect = 7e-163, Method: Compositional matrix adjust.
 Identities = 230/452 (51%), Positives = 321/452 (71%), Gaps = 19/452 (4%)
 Frame = -1

Query  1549  MASQPSIAFTVTRQNPELVAPADPTPREIKYLSDIDDQQGLRFQIPVIHFYRNEPS--MS  1376
             M S+ S   +VTRQ PEL+ PA PTPRE+K LSDIDDQ+ LRF +PVI FY+N+PS  M 
Sbjct  1     MVSKFSQVLSVTRQAPELIVPARPTPREVKQLSDIDDQESLRFHVPVIFFYKNDPSPSMQ  60

Query  1375  GKDPVQVIRQALAKALVFFYPFAGRLREGPGRKLMVDCTGEGVMFIEADADATLQHFAVG  1196
             G+DPV+VIR+A++KALVF+YP AGRL+EG  R+LMV+C  EGV+FIEADA+ TL+   +G
Sbjct  61    GRDPVKVIREAISKALVFYYPLAGRLKEGYNRRLMVECNAEGVLFIEADANFTLEQ--LG  118

Query  1195  GELKPPFPCFDQLLYNVPGSAEILNCPLFLIQVTRLRCGGFIFALRLNHSMSDACGLVHF  1016
              +++PP P  +QLLY+VPGS  IL CPLFLIQVTRL CGGFIFALR+NH+M D  GLV F
Sbjct  119   DDIQPPCPYLNQLLYDVPGSEGILGCPLFLIQVTRLTCGGFIFALRMNHTMCDGSGLVQF  178

Query  1015  LNTIAEIARGAEAPSVYPVWQREFFDARNPPRITCTHFEYEEEPAADSMVTN--IPLDNL  842
             L  I ++ RG  +P+++P+WQR   +ARNPPR+TC H EY+E       + N  +P DN+
Sbjct  179   LKGIEDMVRGKCSPTLFPIWQRHILNARNPPRVTCIHHEYDE-------INNNEVPSDNM  231

Query  841   VHRSFFFGPTEISALRSSLPPHLLKCSRFEVVTACLWRCRTIAMEFDPNDEVRIFGTVNA  662
              H+SF+FG  E  ALR+ LP HL  CS F+++TA +W+CRTIA++ +P +  R+   +NA
Sbjct  232   AHKSFYFGAKETKALRNQLPFHLKDCSTFDLLTAFIWKCRTIALKLEPEEIARVSCIINA  291

Query  661   RPRLKNPPVPNGYYGNAFVYPGAKSTAGKVSKSPLSHALELVTNIKSSFTEEYIKSVADL  482
             R +     +P+GYYGNAF +P   S A  + K+P+ +A+ELV   K+   +EYI+SVADL
Sbjct  292   RGKRYKTDIPSGYYGNAFAFPAVCSKAEHLCKNPIGYAVELVKKAKAQMNDEYIRSVADL  351

Query  481   MILKGRP-TFTLQGTFIVSDVTRVGFPEIDMGWGQSVFggpahggvggipGLITFYIPYE  305
             M++KGR   F  +G FIVSD++ +GF E+D+GWG+ ++      G  G   LI+F++ ++
Sbjct  352   MVIKGRRIKFPTRGNFIVSDLSNLGFGEVDLGWGKPIY-----AGTAGAVELISFFVKHQ  406

Query  304   DNKGDHGILVPMCLPAIAMGKFVKELENCLMK  209
             +  G+ GI VP+CLP   M +F +E    +++
Sbjct  407   NKNGEPGIFVPICLPQSVMERFQEEQRRMMIQ  438



>ref|XP_007147134.1| hypothetical protein PHAVU_006G098600g [Phaseolus vulgaris]
 gb|ESW19128.1| hypothetical protein PHAVU_006G098600g [Phaseolus vulgaris]
Length=462

 Score =   484 bits (1246),  Expect = 8e-163, Method: Compositional matrix adjust.
 Identities = 242/438 (55%), Positives = 318/438 (73%), Gaps = 9/438 (2%)
 Frame = -1

Query  1525  FTVTRQNPELVAPADPTPREIKYLSDIDDQQGLRFQIPVIHFYRNEPSMSGKDPVQVIRQ  1346
             FTV R  P+LVAPA PTP E+K LSDIDDQ+ LRFQ+P+I  Y  + SM+ KDPV+VIR+
Sbjct  16    FTVRRSQPQLVAPAIPTPHELKLLSDIDDQEALRFQVPMIQIYGKQASMAEKDPVEVIRK  75

Query  1345  ALAKALVFFYPFAGRLREGPGRKLMVDCTGEGVMFIEADADATLQHFAVGGELKPPFPCF  1166
             AL++ LVF+YPFAGRLREGP RKL+VDCTGEGVMFIE DAD TL  F  G  L+PPFPCF
Sbjct  76    ALSQTLVFYYPFAGRLREGPHRKLIVDCTGEGVMFIEGDADVTLAEF--GDSLQPPFPCF  133

Query  1165  DQLLYNVPGSAEILNCPLFLIQVTRLRCGGFIFALRLNHSMSDACGLVHFLNTIAEIARG  986
             D+LLY+VPGS +I + PL L+QVTRL+CGGFI ALR +H+M D  G   F+N  AE+ARG
Sbjct  134   DELLYDVPGSQQITDTPLLLVQVTRLKCGGFILALRFSHTMVDGFGYQQFMNAWAEMARG  193

Query  985   AEAPSVYPVWQREFFDARNPPRITCTHFEYEEEPAADSMVTNIPLDNLVHRSFFFGPTEI  806
             A  PS+ PVW+RE   AR+PPRITC H EYE+    D++ ++    NL+ RSFFFG  +I
Sbjct  194   ATKPSIAPVWRRELLMARDPPRITCNHREYEQ--IQDTLPSSN--HNLIQRSFFFGRLDI  249

Query  805   SALRSSLPPHLLKCSRFEVVTACLWRCRTIAMEFDPNDEVRIFGTVNARPRLKNPPVPNG  626
             +ALR S+P HL  CS F+++TACLWRCRT AM+ + N++VR+   VNAR R  NP +P G
Sbjct  250   AALRKSIPQHLQHCSTFDLITACLWRCRTKAMQIEANEDVRMMCIVNARGRF-NPSLPVG  308

Query  625   YYGNAFVYPGAKSTAGKVSKSPLSHALELVTNIKSSFTEEYIKSVADLMILKGRP-TFTL  449
             YYGNAF YP A ++AGK+ ++P  +A+EL+  +K    EEY++SVADLM++K R   FT 
Sbjct  309   YYGNAFAYPAAVTSAGKLCQNPFGYAVELINKVKGEMKEEYLQSVADLMVMKERSLLFTT  368

Query  448   QGTFIVSDVTRVGFPEIDMGWGQSVFggpahggvggipGLITFYIPYEDNKGDHGILVPM  269
               ++IVS + R  F  ID GWG++++GG AH G GG P  ++++   ++ KG+ G+   +
Sbjct  369   VRSYIVSYLARTNFRVIDFGWGEAIYGGVAHAGAGGFPA-VSYFCSAKNGKGEEGMTFSI  427

Query  268   CLPAIAMGKFVKELENCL  215
              LPA AM +F KE  + L
Sbjct  428   FLPAEAMERFTKEFNDML  445



>ref|XP_009368287.1| PREDICTED: methanol O-anthraniloyltransferase-like [Pyrus x bretschneideri]
Length=463

 Score =   484 bits (1246),  Expect = 8e-163, Method: Compositional matrix adjust.
 Identities = 233/442 (53%), Positives = 317/442 (72%), Gaps = 8/442 (2%)
 Frame = -1

Query  1537  PSIAFTVTRQNPELVAPADPTPREIKYLSDIDDQQGLRFQIPVIHFYRNEPSMS-GKDPV  1361
             P   F V +  PEL+ PA PTP+E K+LSDIDDQ+G RFQ+P+I  Y++ PS++  ++PV
Sbjct  3     PPSVFQVKQLQPELITPAKPTPQETKFLSDIDDQEGFRFQVPIIMCYKDNPSVNKNRNPV  62

Query  1360  QVIRQALAKALVFFYPFAGRLREGPGRKLMVDCTGEGVMFIEADADATLQHFAVGGELKP  1181
             QVIR+AL++ALV++YP AGRLREGP +KL+VDC GEG++F+EA AD TL+   +G ++ P
Sbjct  63    QVIREALSRALVYYYPLAGRLREGPNKKLVVDCNGEGILFVEASADVTLEQ--LGDKILP  120

Query  1180  PFPCFDQLLYNVPGSAEILNCPLFLIQVTRLRCGGFIFALRLNHSMSDACGLVHFLNTIA  1001
             P P  ++ L+N PGS  I+ CPL L+QVT L CGGFI ALRLNH+M DA GL+ FL  IA
Sbjct  121   PCPLLEEFLFNFPGSDGIIGCPLLLVQVTCLTCGGFILALRLNHTMCDAPGLLLFLKAIA  180

Query  1000  EIARGAEAPSVYPVWQREFFDARNPPRITCTHFEYEEE-PAADSMVTNIPLDNLVHRSFF  824
             E+ARGA APS+ PVW+RE   AR+PPRITC H EYE+    +D    +    N+V RSF+
Sbjct  181   EMARGAHAPSILPVWERELLFARDPPRITCAHHEYEDVIDHSDGSYASSNQSNMVQRSFY  240

Query  823   FGPTEISALRSSLPPHLLK-CSRFEVVTACLWRCRTIAMEFDPNDEVRIFGTVNARPRLK  647
             FG  E+  LR  +PPHL+  CS F+++TACLW+CRT+A+  +P   VR+   VNAR +  
Sbjct  241   FGAKEMRVLRKQIPPHLISTCSTFDLITACLWKCRTLALRINPKQVVRVSCMVNARGKHH  300

Query  646   NPPVPNGYYGNAFVYPGAKSTAGKVSKSPLSHALELVTNIKSSFTEEYIKSVADLMILKG  467
             N  +P GYYGNAF +P A S A  + K+PL +ALELV   K++  EEY++SVADL++L+G
Sbjct  301   NVRLPLGYYGNAFAFPAAVSKAESLCKNPLGYALELVKKAKATMNEEYLRSVADLLVLRG  360

Query  466   RPTFTLQGT-FIVSDVTRVGFPEIDMGWGQSVFggpahggvggipGLITFYIPYEDNKGD  290
             RP ++  G+ F+VSD+TRVGF +++ GWGQ VF       +     LI+FY+ +++N  D
Sbjct  361   RPRYSSTGSNFLVSDITRVGFGDVNFGWGQPVF-AGPTKAISAALDLISFYVQHKNNTED  419

Query  289   HGILVPMCLPAIAMGKFVKELE  224
              GILVPMCLP+ AM +F +ELE
Sbjct  420   -GILVPMCLPSSAMERFQQELE  440



>ref|XP_007209120.1| hypothetical protein PRUPE_ppa005455mg [Prunus persica]
 gb|EMJ10319.1| hypothetical protein PRUPE_ppa005455mg [Prunus persica]
Length=460

 Score =   483 bits (1244),  Expect = 2e-162, Method: Compositional matrix adjust.
 Identities = 237/443 (53%), Positives = 304/443 (69%), Gaps = 9/443 (2%)
 Frame = -1

Query  1549  MASQPSIAFTVTRQNPELVAPADPTPREIKYLSDIDDQQGLRFQIPVIHFYRNEPSMSGK  1370
             M S  ++ F V R   EL+ PA PTP E K LS+IDDQ+ LRFQ+ VI  Y+N PSM G 
Sbjct  1     MISPSALLFQVNRLKAELITPAKPTPHETKLLSNIDDQESLRFQVSVIMSYKNNPSMKGN  60

Query  1369  DPVQVIRQALAKALVFFYPFAGRLREGPGRKLMVDCTGEGVMFIEADADATLQHFAVGGE  1190
             D V+VIR+AL++ALV++YP AGRLREGP RKLMV+C GEGV+FIEA+AD TL     G  
Sbjct  61    DAVEVIREALSRALVYYYPLAGRLREGPNRKLMVECNGEGVLFIEANADVTLAQL--GDT  118

Query  1189  LKPPFPCFDQLLYNVPGSAEILNCPLFLIQVTRLRCGGFIFALRLNHSMSDACGLVHFLN  1010
             + PP P  ++ LYNVPGS  IL CPL LIQVTRL CGGFI ALRLNH+M DA GL+ FLN
Sbjct  119   IAPPSPFLEEFLYNVPGSDGILGCPLLLIQVTRLSCGGFILALRLNHTMCDAAGLLQFLN  178

Query  1009  TIAEIARGAEAPSVYPVWQREFFDARNPPRITCTHFEYEEEPAADSMVTNIPLDNLVHRS  830
              + E+A+GA+APS  PVW+RE   AR+PPRITC H EYEE   A     +    N+V RS
Sbjct  179   AVGEMAQGAQAPSTTPVWERELLGARDPPRITCAHHEYEEGIDAQGSFPSTNKPNMVQRS  238

Query  829   FFFGPTEISALRSSLPPHLLKCSRFEVVTACLWRCRTIAMEFDPNDEVRIFGTVNARPRL  650
             F+FG  EI A+R+ +PP L  C+ F+++TACLW+CRT+A+  +P   VR+   V+AR + 
Sbjct  239   FYFGSKEIKAIRNHIPPQLSTCTTFDLITACLWKCRTLALRMNPKQVVRLSCLVSARGKR  298

Query  649   KNPPVPNGYYGNAFVYPGAKSTAGKVSKSPLSHALELVTNIKSSFTEEYIKSVADLMILK  470
              N  +P GYYGNA  +P A S A  V  +PL +ALELV   K++  EEY++SVADLM ++
Sbjct  299   HNVRLPLGYYGNAVAFPAAVSEAKDVCTNPLGYALELVMKAKATVNEEYMRSVADLMEIR  358

Query  469   GR-PTFTLQGTFIVSDVTRVGFPEIDMGWGQSVFggpahggvggipGLITFYIPYEDNKG  293
             GR P + L G FIVSD +R GF E+  GWG+ VF     GG      LI+FY+ ++ N  
Sbjct  359   GRLPKYPLTGNFIVSDTSRAGFGEVSFGWGKPVF-----GGPAKALDLISFYVQHKCNN-  412

Query  292   DHGILVPMCLPAIAMGKFVKELE  224
             + G+LVP+CLP   M +F +ELE
Sbjct  413   EEGVLVPICLPLSDMERFQQELE  435



>ref|XP_007147133.1| hypothetical protein PHAVU_006G098500g [Phaseolus vulgaris]
 gb|ESW19127.1| hypothetical protein PHAVU_006G098500g [Phaseolus vulgaris]
Length=463

 Score =   483 bits (1243),  Expect = 3e-162, Method: Compositional matrix adjust.
 Identities = 244/438 (56%), Positives = 316/438 (72%), Gaps = 9/438 (2%)
 Frame = -1

Query  1525  FTVTRQNPELVAPADPTPREIKYLSDIDDQQGLRFQIPVIHFYRNEPSMSGKDPVQVIRQ  1346
             FTV R  P+LVAPA PTP E+K LSDIDDQ+ LRF IP+I  YR + SM+ KDPV+VIR+
Sbjct  16    FTVRRSQPQLVAPAIPTPHELKLLSDIDDQEALRFHIPMIQIYRKQASMAEKDPVEVIRK  75

Query  1345  ALAKALVFFYPFAGRLREGPGRKLMVDCTGEGVMFIEADADATLQHFAVGGELKPPFPCF  1166
             AL++ LVF+YPFAGRLREGP RKLMVDCTGEGVMF+E DAD TL  F  G  L+PPFPCF
Sbjct  76    ALSQTLVFYYPFAGRLREGPQRKLMVDCTGEGVMFMEGDADVTLAEF--GDSLQPPFPCF  133

Query  1165  DQLLYNVPGSAEILNCPLFLIQVTRLRCGGFIFALRLNHSMSDACGLVHFLNTIAEIARG  986
             D+LLY+VPGS +I N PL L+QVTRL+CGGFI AL+ NH+M DA G   F+N  AE+ARG
Sbjct  134   DELLYDVPGSQQITNTPLLLVQVTRLKCGGFILALQFNHTMVDAFGCQQFMNAWAEMARG  193

Query  985   AEAPSVYPVWQREFFDARNPPRITCTHFEYEEEPAADSMVTNIPLDNLVHRSFFFGPTEI  806
             A  PS+ PVW+RE   AR+PPRIT  H EYE+    D + ++    NL+ RSFFFG  +I
Sbjct  194   ATKPSIAPVWRRELLMARDPPRITRNHREYEQ--IQDILPSSN--HNLIQRSFFFGRLDI  249

Query  805   SALRSSLPPHLLKCSRFEVVTACLWRCRTIAMEFDPNDEVRIFGTVNARPRLKNPPVPNG  626
             +ALR  +P HL  CS F+++ ACLWRCRT AM+ + N++VR+   VNAR R  NPP+P G
Sbjct  250   AALRKFIPQHLQHCSTFDLIAACLWRCRTKAMQIEANEDVRMMCIVNARGRF-NPPLPVG  308

Query  625   YYGNAFVYPGAKSTAGKVSKSPLSHALELVTNIKSSFTEEYIKSVADLMILKGRP-TFTL  449
             YYGNAF YP A ++AGK+ ++P  +A+EL+  +K    EEY++SVADLM++K R   FT 
Sbjct  309   YYGNAFAYPAAVTSAGKLCQNPFGYAVELINKVKGEMKEEYLQSVADLMVMKERSLLFTT  368

Query  448   QGTFIVSDVTRVGFPEIDMGWGQSVFggpahggvggipGLITFYIPYEDNKGDHGILVPM  269
               + IVS + +V F  +D GWG++V+GG A  G G  PG  +++   ++ KG+ GI+ P+
Sbjct  369   VRSCIVSYLVQVKFRAMDFGWGEAVYGGVAEAGAGSFPG-ASYFCSAKNGKGEEGIIFPI  427

Query  268   CLPAIAMGKFVKELENCL  215
              LPA AM +F KE  + L
Sbjct  428   SLPAEAMERFAKEFNHML  445



>ref|XP_009131598.1| PREDICTED: (Z)-3-hexen-1-ol acetyltransferase [Brassica rapa]
Length=472

 Score =   483 bits (1243),  Expect = 4e-162, Method: Compositional matrix adjust.
 Identities = 245/439 (56%), Positives = 313/439 (71%), Gaps = 6/439 (1%)
 Frame = -1

Query  1534  SIAFTVTRQNPELVAPADPTPREIKYLSDIDDQQGLRFQIPVIHFYRNEPSMSGKDPVQV  1355
             S+ F V R+ PELV+PA PTPRE+K LSDIDDQ+GLRF IP I FYR+ P++   DPV V
Sbjct  13    SLTFKVNRREPELVSPAKPTPRELKLLSDIDDQEGLRFHIPSIFFYRHNPNVY-SDPVAV  71

Query  1354  IRQALAKALVFFYPFAGRLREGPGRKLMVDCTGEGVMFIEADADATLQHFAVGGELKPPF  1175
             IR+ALA+ LV++YP AGRLREGP RKL VDCTG+GV+FIEADAD TL  F     L PPF
Sbjct  72    IRRALAQTLVYYYPLAGRLREGPNRKLAVDCTGQGVLFIEADADVTLAEFEEKDALSPPF  131

Query  1174  PCFDQLLYNVPGSAEILNCPLFLIQVTRLRCGGFIFALRLNHSMSDACGLVHFLNTIAEI  995
             PCF++LL++V GS+E++N PL LIQVTRL+CGGFIFA+RLNH M+DA GL  F+ TI E 
Sbjct  132   PCFEELLFDVEGSSEVINAPLILIQVTRLKCGGFIFAIRLNHVMADAGGLSLFIKTIGEF  191

Query  994   ARGAEAPSVYPVWQREFFDARNPPRITCTHFEYEEEPAADSMVTNIPLDNLVHRSFFFGP  815
             ARG  AP++ P W+R    AR PPR+T TH EY+E  AAD+       + LV +SFFFG 
Sbjct  192   ARGCHAPTIPPTWERHLLSARVPPRVTQTHREYDESAAADAEPVIGDGETLVSKSFFFGG  251

Query  814   TEISALRSSLPPHLL-KCSRFEVVTACLWRCRTIAMEFDPNDEVRIFGTVNARPRLKNPP  638
              E+SA+R  LPP +  + +  E +TA LWR RT A+  D N E+R+   VNARP+LKNP 
Sbjct  252   AEMSAIRKLLPPDIANRSTGLETLTAFLWRQRTAALRPDANKEMRVIFIVNARPKLKNPT  311

Query  637   VPNGYYGNAFVYPGAKSTAGKVSKSPLSHALELVTNIKSSFTEEYIKSVADLMILKGRPT  458
             +P GYYGNAF +P A + A  +++ PL  AL LV   K+S TEEY++S+ADLM+ KGRP 
Sbjct  312   LPRGYYGNAFAFPVAIANARDLTEKPLEFALRLVKEAKASVTEEYMRSLADLMVTKGRPK  371

Query  457   FTLQGTFIVSDVTRVGFPEIDMG-WGQSVFggpahggvggipGLITFYIPYEDNKGDHGI  281
             F   G +++SDV    F +ID+G WG+ V+GG    GV    G  +FY+  E+ KG+ GI
Sbjct  372   FLADGAYLISDVR--NFADIDLGVWGKPVYGGIGKAGVVDSLG-SSFYVSAENRKGERGI  428

Query  280   LVPMCLPAIAMGKFVKELE  224
             LVP+CLP  AM +FV+ELE
Sbjct  429   LVPVCLPEKAMQRFVEELE  447



>ref|XP_007147136.1| hypothetical protein PHAVU_006G098800g [Phaseolus vulgaris]
 gb|ESW19130.1| hypothetical protein PHAVU_006G098800g [Phaseolus vulgaris]
Length=460

 Score =   483 bits (1242),  Expect = 4e-162, Method: Compositional matrix adjust.
 Identities = 237/435 (54%), Positives = 315/435 (72%), Gaps = 9/435 (2%)
 Frame = -1

Query  1525  FTVTRQNPELVAPADPTPREIKYLSDIDDQQGLRFQIPVIHFYRNEPSMSGKDPVQVIRQ  1346
             FTV R  P+LVAPA PTP E+K LSDIDDQ+ LRF  P I  Y  + SM+ KDPV+VIR+
Sbjct  15    FTVRRCEPQLVAPAIPTPHELKLLSDIDDQEALRFHSPAIQIYGKQASMAEKDPVEVIRK  74

Query  1345  ALAKALVFFYPFAGRLREGPGRKLMVDCTGEGVMFIEADADATLQHFAVGGELKPPFPCF  1166
             AL++ LVF+YP AGR+REGP RKLMV+CTGEG MFIEADAD TL  F  G  L+PPFPCF
Sbjct  75    ALSQTLVFYYPLAGRVREGPHRKLMVECTGEGAMFIEADADVTLHEF--GDSLQPPFPCF  132

Query  1165  DQLLYNVPGSAEILNCPLFLIQVTRLRCGGFIFALRLNHSMSDACGLVHFLNTIAEIARG  986
              +LLY+VPGS +I N PL L+QVTRL+CGGFI A  +NH+M D  G+  F+NT A++ARG
Sbjct  133   HELLYHVPGSQQITNTPLLLVQVTRLKCGGFILAFSINHTMCDGTGISQFMNTWAKMARG  192

Query  985   AEAPSVYPVWQREFFDARNPPRITCTHFEYEEEPAADSMVTNIPLDNLVHRSFFFGPTEI  806
             +  PS+ PVW RE   AR+PPRITC H EYE  P  D++ +    +N+V RSFFFGP++I
Sbjct  193   STKPSIPPVWCRELLMARHPPRITCNHREYEHVP--DTITST---ENMVQRSFFFGPSQI  247

Query  805   SALRSSLPPHLLKCSRFEVVTACLWRCRTIAMEFDPNDEVRIFGTVNARPRLKNPPVPNG  626
             +A+R  +P HL  C+ F+++TAC WRCRT A++ + + EVR+   VN R R  NPP+P G
Sbjct  248   AAIRLLVPTHLQHCTTFDIITACFWRCRTKALQIEADKEVRMIVIVNGRARF-NPPLPVG  306

Query  625   YYGNAFVYPGAKSTAGKVSKSPLSHALELVTNIKSSFTEEYIKSVADLMILKGRPTFTLQ  446
             YYGNA  +P A +TAGK+ ++P  +A+EL+  +K   TEEY+ SVADLM++K R  FT  
Sbjct  307   YYGNAIAFPAAVTTAGKLCENPFGYAVELIKKVKGVVTEEYMHSVADLMVIKDRCMFTTV  366

Query  445   GTFIVSDVTRVGFPEIDMGWGQSVFggpahggvggipGLITFYIPYEDNKGDHGILVPMC  266
              + ++SD+TR  F E++ GWG++V+GG A  G+G   G  T  + +++ KG+ GI++P+ 
Sbjct  367   RSCLISDLTRGRFREVNFGWGEAVYGGVAQAGIGSFLGG-TCQMLHKNAKGEEGIVLPIW  425

Query  265   LPAIAMGKFVKELEN  221
             LPA AM +F KELEN
Sbjct  426   LPAKAMNRFAKELEN  440



>ref|XP_002304071.1| hypothetical protein POPTR_0003s01420g [Populus trichocarpa]
 gb|EEE79050.1| hypothetical protein POPTR_0003s01420g [Populus trichocarpa]
Length=454

 Score =   481 bits (1239),  Expect = 8e-162, Method: Compositional matrix adjust.
 Identities = 233/439 (53%), Positives = 316/439 (72%), Gaps = 12/439 (3%)
 Frame = -1

Query  1531  IAFTVTRQNPELVAPADPTPREIKYLSDIDDQQGLRFQIPVIHFYRNEPSMSGKDPVQVI  1352
             + F+V R+ P+L+ P+ PTP EIK LSDIDDQQGLRF +P + FYR+ PSM  +DPV+VI
Sbjct  9     LRFSVKRREPQLIVPSKPTPHEIKQLSDIDDQQGLRFHLPFVMFYRSHPSMKREDPVKVI  68

Query  1351  RQALAKALVFFYPFAGRLREGPGRKLMVDCTGEGVMFIEADADATLQHFAVGGELKPPFP  1172
             ++AL KALVF+YPFAGR+ EGP  KL+VDCTGEG++F+EADA  T+    +G  + PPF 
Sbjct  69    KEALGKALVFYYPFAGRIIEGPRSKLLVDCTGEGILFVEADAGVTIDQ--LGDSIHPPFS  126

Query  1171  CFDQLLYNVPGSAEILNCPLFLIQVTRLRCGGFIFALRLNHSMSDACGLVHFLNTIAEIA  992
               ++ L++VPGS+ IL CPL LIQVTRL CGGFIFA+RLNH+MSD+ GL  FLNT+ E+A
Sbjct  127   YIEEFLHDVPGSSGILGCPLLLIQVTRLACGGFIFAIRLNHTMSDSLGLSKFLNTVGELA  186

Query  991   RGAEAPSVYPVWQREFFDARNPPRITCTHFEYEEEPAADSMVTNIPLDN---LVHRSFFF  821
              GA  PS+ PVW+RE  +ARNPPR+TC H EYE+    ++ +     ++   + HRSFFF
Sbjct  187   LGASTPSLLPVWEREILNARNPPRVTCVHHEYEQLTHTETSIVMTLQEHEKYMAHRSFFF  246

Query  820   GPTEISALRSSLPPHLLKCSRFEVVTACLWRCRTIAMEFDPNDEVRIFGTVNARPRLKNP  641
             GP+E+ ++R  +PPHL KCS FEV+ + LWR RTIA++ DP + VR+   +N R + +  
Sbjct  247   GPSELKSIRKHIPPHLQKCSNFEVLASFLWRSRTIALQLDPEEVVRLSVMINVRGK-QGL  305

Query  640   PVPNGYYGNAFVYPGAKSTAGKVSKSPLSHALELVTNIKSSFTEEYIKSVADLMILKGRP  461
              VP+GYYGNAF YP A S AG + +SPL +ALELV  +K+   EEYIKS ADLM+LKGRP
Sbjct  306   KVPSGYYGNAFAYPTAISKAGLLCQSPLGYALELVRRLKTQMNEEYIKSAADLMVLKGRP  365

Query  460   TFTLQGTFIVSDVTRVGFPEIDMGWGQSVFggpahggvggipGLITFYIP-YEDNKGDHG  284
              +T   +F+++D TRVG  +ID GWG++V+     GG  G P   +F++   +++ G+ G
Sbjct  366   HYTTVWSFLIADATRVGLGDIDFGWGKAVY-----GGPIGAPPCTSFHVSGLKNSYGEEG  420

Query  283   ILVPMCLPAIAMGKFVKEL  227
             ILVP+ LP   M +F +EL
Sbjct  421   ILVPILLPLPIMNRFQQEL  439



>ref|XP_003520833.1| PREDICTED: benzyl alcohol O-benzoyltransferase-like [Glycine 
max]
Length=452

 Score =   481 bits (1239),  Expect = 8e-162, Method: Compositional matrix adjust.
 Identities = 249/437 (57%), Positives = 321/437 (73%), Gaps = 9/437 (2%)
 Frame = -1

Query  1525  FTVTRQNPELVAPADPTPREIKYLSDIDDQQGLRFQIPVIHFYRNEPSMSGKDPVQVIRQ  1346
             FTV R  PELVAPA PTP E+K LSDIDDQ+GLRF IP+I  YRN+PSM+ KDPVQVIR+
Sbjct  14    FTVRRLQPELVAPAIPTPHELKPLSDIDDQEGLRFHIPMIQVYRNQPSMAEKDPVQVIRK  73

Query  1345  ALAKALVFFYPFAGRLREGPGRKLMVDCTGEGVMFIEADADATLQHFAVGGELKPPFPCF  1166
             ALAK LVF+YPFAGRLRE P  KLMVDCTGEGV+FIEADAD TL    +G  L+PPFPCF
Sbjct  74    ALAKTLVFYYPFAGRLRERPDHKLMVDCTGEGVLFIEADADVTLDQ--LGDALQPPFPCF  131

Query  1165  DQLLYNVPGSAEILNCPLFLIQVTRLRCGGFIFALRLNHSMSDACGLVHFLNTIAEIARG  986
             +QLLYNVP S EI + PL LIQVTRL+CGGFI ALRLNH+MSDA GLV FLN  AE+A G
Sbjct  132   EQLLYNVPDSEEITDTPLLLIQVTRLKCGGFIQALRLNHTMSDAAGLVQFLNAWAEMAGG  191

Query  985   AEAPSVYPVWQREFFDARNPPRITCTHFEYEEEPAADSMVTNIPL--DNLVHRSFFFGPT  812
             A++PS+ PVW+RE   AR+PPRITC H EY E    +    ++ L  D++V RSFFFGP+
Sbjct  192   AKSPSIAPVWRRELLMARDPPRITCKHHEYMEFVDTEIEEGSLTLHDDDMVLRSFFFGPS  251

Query  811   EISALRSSLPPHLLKCSRFEVVTACLWRCRTIAMEFDPNDEVRIFGTVNARPRLKNPPVP  632
             +I++LR  +P +   C+ F+++TACLWRC T A++ D + +VR+   VNAR +  NPP+P
Sbjct  252   QIASLRRLVPHY---CATFDLITACLWRCHTKALKIDADKDVRMMVAVNARAKF-NPPLP  307

Query  631   NGYYGNAFVYPGAKSTAGKVSKSPLSHALELVTNIKSSFTEEYIKSVADLMILKGRPTFT  452
              GYYGNA  YP A +TAGK+  +P  +A+EL+  +K   T+EY+ SVADL+ +KGR    
Sbjct  308   VGYYGNAIAYPAAVTTAGKLCGNPFGYAVELINKVKGKATQEYMHSVADLLAIKGRYIPR  367

Query  451   LQGTFIVSDVTRVGFPEIDMGWGQSVFggpahggvggipGLITFYIPYEDNKGDHGILVP  272
             +  +  VSD+      +ID GWG +++ GPA GG+G  PG +TF  P+++ KG+ G+++P
Sbjct  368   MVRSLTVSDLRGFDPRQIDFGWGHALYAGPAQGGLGPFPG-VTFITPFKNAKGEDGLVLP  426

Query  271   MCLPAIAMGKFVKELEN  221
             + LP  AM +F KEL+ 
Sbjct  427   IWLPTEAMNRFSKELDG  443



>gb|KHN31436.1| Benzyl alcohol O-benzoyltransferase [Glycine soja]
Length=440

 Score =   480 bits (1236),  Expect = 1e-161, Method: Compositional matrix adjust.
 Identities = 249/437 (57%), Positives = 321/437 (73%), Gaps = 9/437 (2%)
 Frame = -1

Query  1525  FTVTRQNPELVAPADPTPREIKYLSDIDDQQGLRFQIPVIHFYRNEPSMSGKDPVQVIRQ  1346
             FTV R  PELVAPA PTP E+K LSDIDDQ+GLRF IP+I  YRN+PSM+ KDPVQVIR+
Sbjct  2     FTVRRLQPELVAPAIPTPHELKPLSDIDDQEGLRFHIPMIQVYRNQPSMAEKDPVQVIRK  61

Query  1345  ALAKALVFFYPFAGRLREGPGRKLMVDCTGEGVMFIEADADATLQHFAVGGELKPPFPCF  1166
             ALAK LVF+YPFAGRLRE P  KLMVDCTGEGV+FIEADAD TL    +G  L+PPFPCF
Sbjct  62    ALAKTLVFYYPFAGRLRERPDHKLMVDCTGEGVLFIEADADVTLDQ--LGDALQPPFPCF  119

Query  1165  DQLLYNVPGSAEILNCPLFLIQVTRLRCGGFIFALRLNHSMSDACGLVHFLNTIAEIARG  986
             +QLLYNVP S EI + PL LIQVTRL+CGGFI ALRLNH+MSDA GLV FLN  AE+A G
Sbjct  120   EQLLYNVPDSEEITDTPLLLIQVTRLKCGGFIQALRLNHTMSDAAGLVQFLNAWAEMAGG  179

Query  985   AEAPSVYPVWQREFFDARNPPRITCTHFEYEEEPAADSMVTNIPL--DNLVHRSFFFGPT  812
             A++PS+ PVW+RE   AR+PPRITC H EY E    +    ++ L  D++V RSFFFGP+
Sbjct  180   AKSPSIAPVWRRELLMARDPPRITCKHHEYMEFVDTEIEEGSLTLHDDDMVLRSFFFGPS  239

Query  811   EISALRSSLPPHLLKCSRFEVVTACLWRCRTIAMEFDPNDEVRIFGTVNARPRLKNPPVP  632
             +I++LR  +P +   C+ F+++TACLWRC T A++ D + +VR+   VNAR +  NPP+P
Sbjct  240   QIASLRRLVPHY---CATFDLITACLWRCHTKALKIDADKDVRMMVAVNARAKF-NPPLP  295

Query  631   NGYYGNAFVYPGAKSTAGKVSKSPLSHALELVTNIKSSFTEEYIKSVADLMILKGRPTFT  452
              GYYGNA  YP A +TAGK+  +P  +A+EL+  +K   T+EY+ SVADL+ +KGR    
Sbjct  296   VGYYGNAIAYPAAVTTAGKLCGNPFGYAVELINKVKGKATQEYMHSVADLLAIKGRYIPR  355

Query  451   LQGTFIVSDVTRVGFPEIDMGWGQSVFggpahggvggipGLITFYIPYEDNKGDHGILVP  272
             +  +  VSD+      +ID GWG +++ GPA GG+G  PG +TF  P+++ KG+ G+++P
Sbjct  356   MVRSLTVSDLRGFDPRQIDFGWGHALYAGPAQGGLGPFPG-VTFITPFKNAKGEDGLVLP  414

Query  271   MCLPAIAMGKFVKELEN  221
             + LP  AM +F KEL+ 
Sbjct  415   IWLPTEAMNRFSKELDG  431



>ref|XP_006470571.1| PREDICTED: anthraniloyl-CoA:methanol acyltransferase-like [Citrus 
sinensis]
Length=456

 Score =   481 bits (1237),  Expect = 2e-161, Method: Compositional matrix adjust.
 Identities = 227/450 (50%), Positives = 321/450 (71%), Gaps = 15/450 (3%)
 Frame = -1

Query  1549  MASQPSIAFTVTRQNPELVAPADPTPREIKYLSDIDDQQGLRFQIPVIHFYRNEPS--MS  1376
             M S+ S   +VTRQ PEL+ PA PTPRE+K LSDIDDQ+ LRF++PVI FY+N+PS  M 
Sbjct  1     MVSKFSQVLSVTRQAPELIVPARPTPREVKQLSDIDDQESLRFRVPVIFFYKNDPSPSMQ  60

Query  1375  GKDPVQVIRQALAKALVFFYPFAGRLREGPGRKLMVDCTGEGVMFIEADADATLQHFAVG  1196
             G+DPV+VIR+A++KALVF+YP AGRL+EG  RKLMV+C  EGV+FIEADA+ TL+   +G
Sbjct  61    GRDPVKVIREAISKALVFYYPLAGRLKEGYNRKLMVECNAEGVLFIEADANFTLEQ--LG  118

Query  1195  GELKPPFPCFDQLLYNVPGSAEILNCPLFLIQVTRLRCGGFIFALRLNHSMSDACGLVHF  1016
              +++PP P  +QLLY+VPGS  IL CPLFLIQ+TRL CGGFIFALR+NH+M D  GLV F
Sbjct  119   DDIQPPCPYLNQLLYDVPGSEGILGCPLFLIQMTRLTCGGFIFALRMNHTMCDGFGLVQF  178

Query  1015  LNTIAEIARGAEAPSVYPVWQREFFDARNPPRITCTHFEYEEEPAADSMVTNIPLDNLVH  836
             L  I ++ RG  +P+++P+WQR   +ARNPPR+TC H EY+E    +     +P DN+ H
Sbjct  179   LKAIEDMVRGKCSPTLFPIWQRHILNARNPPRVTCIHHEYDEINNNE-----VPSDNMAH  233

Query  835   RSFFFGPTEISALRSSLPPHLLKCSRFEVVTACLWRCRTIAMEFDPNDEVRIFGTVNARP  656
             +SF+FG  E  ALR+ LP HL  CS F+++TA +W+CRTIA++ +P +  ++   +N R 
Sbjct  234   KSFYFGAKETKALRNQLPFHLKDCSTFDLLTAFIWKCRTIALKLEPEEIAQVSCIINVRG  293

Query  655   RLKNPPVPNGYYGNAFVYPGAKSTAGKVSKSPLSHALELVTNIKSSFTEEYIKSVADLMI  476
             +     +P+GYYGNAF +P   S A ++ K+P+ +A+ELV   K+   +EYI+SVADLM+
Sbjct  294   KRYKTDIPSGYYGNAFAFPAVCSKAEQLCKNPIGYAVELVKKAKAQMNDEYIRSVADLMV  353

Query  475   LKGRP-TFTLQGTFIVSDVTRVGFPEIDMGWGQSVFggpahggvggipGLITFYIPYEDN  299
             +KGR   F  +G FIVSD++ +GF E+D+GWG+ ++      G  G   LI+F++ +++ 
Sbjct  354   IKGRRIKFPTRGNFIVSDLSNLGFGEVDLGWGKPIY-----AGTAGAVELISFFVKHQNK  408

Query  298   KGDHGILVPMCLPAIAMGKFVKELENCLMK  209
              G+ G  VP+CLP   M +F +EL   +++
Sbjct  409   NGEPGNFVPICLPQSVMERFQEELRRMMIQ  438



>ref|XP_008343918.1| PREDICTED: methanol O-anthraniloyltransferase-like [Malus domestica]
 gb|AAU14879.2| alcohol acyl transferase [Malus domestica]
 gb|AGW30200.1| alcohol acyl transferase [Malus domestica]
Length=455

 Score =   479 bits (1234),  Expect = 5e-161, Method: Compositional matrix adjust.
 Identities = 233/438 (53%), Positives = 313/438 (71%), Gaps = 12/438 (3%)
 Frame = -1

Query  1525  FTVTRQNPELVAPADPTPREIKYLSDIDDQQGLRFQIPVIHFYRNEPSMS-GKDPVQVIR  1349
               V R  PEL+ PA  TP+E K+LSDIDDQ+ LR QIP+I  Y++ PS++  ++PV+ IR
Sbjct  7     LQVKRLQPELITPAKSTPQETKFLSDIDDQESLRVQIPIIMCYKDNPSLNKNRNPVKAIR  66

Query  1348  QALAKALVFFYPFAGRLREGPGRKLMVDCTGEGVMFIEADADATLQHFAVGGELKPPFPC  1169
             +AL++ALV++YP AGRLREGP RKL+VDC GEG++F+EA AD TL+   +G ++ PP P 
Sbjct  67    EALSRALVYYYPLAGRLREGPNRKLVVDCNGEGILFVEASADVTLEQ--LGDKILPPCPL  124

Query  1168  FDQLLYNVPGSAEILNCPLFLIQVTRLRCGGFIFALRLNHSMSDACGLVHFLNTIAEIAR  989
              ++ LYN PGS  I++CPL LIQVT L CGGFI ALRLNH+M DA GL+ FL  IAE+AR
Sbjct  125   LEEFLYNFPGSDGIIDCPLLLIQVTCLTCGGFILALRLNHTMCDAAGLLLFLTAIAEMAR  184

Query  988   GAEAPSVYPVWQREFFDARNPPRITCTHFEYEEEPA-ADSMVTNIPLDNLVHRSFFFGPT  812
             GA APS+ PVW+RE   AR+PPRITC H EYE+    +D    +    N+V RSF+FG  
Sbjct  185   GAHAPSILPVWERELLFARDPPRITCAHHEYEDVIGHSDGSYASSNQSNMVQRSFYFGAK  244

Query  811   EISALRSSLPPHLLK-CSRFEVVTACLWRCRTIAMEFDPNDEVRIFGTVNARPRLKNPPV  635
             E+  LR  +PPHL+  CS F+++TACLW+CRT+A+  +P + VR+   VNAR +  N  +
Sbjct  245   EMRVLRKQIPPHLISTCSTFDLITACLWKCRTLALNINPKEAVRVSCIVNARGKHNNVRL  304

Query  634   PNGYYGNAFVYPGAKSTAGKVSKSPLSHALELVTNIKSSFTEEYIKSVADLMILKGRPTF  455
             P GYYGNAF +P A S A  + K+PL +ALELV   K++  EEY++SVADL++L+GRP +
Sbjct  305   PLGYYGNAFAFPAAISKAEPLCKNPLGYALELVKKAKATMNEEYLRSVADLLVLRGRPQY  364

Query  454   TLQGTF-IVSDVTRVGFPEIDMGWGQSVFggpahggvggipGLITFYIPYEDNKGDHGIL  278
             +  G++ IVSD TRVGF +++ GWGQ VF      G      LI+FY+ +++N  D GIL
Sbjct  365   SSTGSYLIVSDNTRVGFGDVNFGWGQPVF-----AGPVKALDLISFYVQHKNNTED-GIL  418

Query  277   VPMCLPAIAMGKFVKELE  224
             VPMCLP+ AM +F +ELE
Sbjct  419   VPMCLPSSAMERFQQELE  436



>gb|AGW30203.1| alcohol acyl transferase [Malus domestica]
Length=455

 Score =   479 bits (1234),  Expect = 5e-161, Method: Compositional matrix adjust.
 Identities = 234/442 (53%), Positives = 315/442 (71%), Gaps = 12/442 (3%)
 Frame = -1

Query  1537  PSIAFTVTRQNPELVAPADPTPREIKYLSDIDDQQGLRFQIPVIHFYRNEPSMS-GKDPV  1361
             P     V R  PEL+ PA PTP+E K+LSDIDDQ+ LRFQ+P+I  Y++ PS++  ++PV
Sbjct  3     PLAVLHVKRLQPELITPAKPTPQETKFLSDIDDQEFLRFQVPIIMCYKDNPSLNKNRNPV  62

Query  1360  QVIRQALAKALVFFYPFAGRLREGPGRKLMVDCTGEGVMFIEADADATLQHFAVGGELKP  1181
             +VIR+AL++ALV++YP AGRLREGP RKL+VDC GEG++FIEA AD TL+   +G ++ P
Sbjct  63    KVIREALSRALVYYYPLAGRLREGPNRKLVVDCNGEGILFIEASADVTLEQ--LGDKILP  120

Query  1180  PFPCFDQLLYNVPGSAEILNCPLFLIQVTRLRCGGFIFALRLNHSMSDACGLVHFLNTIA  1001
             P P  ++ L+N PGS  I+ CPL L+QVT L CGGFI ALRLNH+M DA GL+ FL  IA
Sbjct  121   PCPLLEEFLFNFPGSDGIIGCPLVLVQVTCLTCGGFILALRLNHTMCDAAGLLLFLTAIA  180

Query  1000  EIARGAEAPSVYPVWQREFFDARNPPRITCTHFEYEEEPA-ADSMVTNIPLDNLVHRSFF  824
             E+ARGA APS+ PVW+RE   AR+PPRITC H EYE+    +D    +    N+V RSF+
Sbjct  181   EMARGAHAPSILPVWERELLFARDPPRITCAHHEYEDVIGHSDGSYASSNQSNMVQRSFY  240

Query  823   FGPTEISALRSSLPPHLLK-CSRFEVVTACLWRCRTIAMEFDPNDEVRIFGTVNARPRLK  647
             FG  E+  LR  +PPHL+  CS F+++TACLW+CRT+A+  +P + VR+   VNAR +  
Sbjct  241   FGAKEMRVLRKQIPPHLISTCSTFDLITACLWKCRTLALNINPKEAVRVSCIVNARGKHN  300

Query  646   NPPVPNGYYGNAFVYPGAKSTAGKVSKSPLSHALELVTNIKSSFTEEYIKSVADLMILKG  467
             N  +P GYYGNAF +P A S A  + K+PL +ALELV   K++  EEY++SVADL++L+G
Sbjct  301   NVRLPLGYYGNAFAFPAAISKAEPLCKNPLGYALELVKKAKATMNEEYLRSVADLLVLRG  360

Query  466   RPTFTLQGTF-IVSDVTRVGFPEIDMGWGQSVFggpahggvggipGLITFYIPYEDNKGD  290
             RP ++  G++ IVSD TR GF +++ GWGQ VF      G      LI+FY+ +++N  D
Sbjct  361   RPQYSSTGSYLIVSDNTRAGFGDVNFGWGQPVF-----AGPVKALDLISFYVQHKNNAED  415

Query  289   HGILVPMCLPAIAMGKFVKELE  224
              GILVPMCLP+ AM +F +ELE
Sbjct  416   -GILVPMCLPSSAMERFQQELE  436



>ref|XP_008384757.1| PREDICTED: methanol O-anthraniloyltransferase-like [Malus domestica]
Length=459

 Score =   479 bits (1233),  Expect = 7e-161, Method: Compositional matrix adjust.
 Identities = 236/442 (53%), Positives = 312/442 (71%), Gaps = 13/442 (3%)
 Frame = -1

Query  1537  PSIAFTVTRQNPELVAPADPTPREIKYLSDIDDQQGLRFQIPVIHFYRNEPSMS-GKDPV  1361
             PSI   V R  PEL+ PA PTP+E K+LSDIDDQ+ LRFQ+PVI  Y+  PS++  ++PV
Sbjct  4     PSI-LQVKRLQPELITPAKPTPQETKFLSDIDDQESLRFQVPVIMCYKANPSLNKNRNPV  62

Query  1360  QVIRQALAKALVFFYPFAGRLREGPGRKLMVDCTGEGVMFIEADADATLQHFAVGGELKP  1181
             +VIR+AL++ALV++YP AGRLREGP +KL+VDC GEG++F+EA AD TL+   +G  + P
Sbjct  63    KVIREALSRALVYYYPLAGRLREGPNKKLVVDCNGEGILFVEASADVTLEQ--LGDXILP  120

Query  1180  PFPCFDQLLYNVPGSAEILNCPLFLIQVTRLRCGGFIFALRLNHSMSDACGLVHFLNTIA  1001
             P P  ++ L+N PGS  I+ CPL L+QVT L CGGFI ALRLNH+M DA GL+ FL  IA
Sbjct  121   PCPLLEEFLFNFPGSDGIIGCPLLLVQVTCLTCGGFILALRLNHTMCDASGLLLFLTAIA  180

Query  1000  EIARGAEAPSVYPVWQREFFDARNPPRITCTHFEYEEE-PAADSMVTNIPLDNLVHRSFF  824
             E+ARGA APS+ PVW+R  F ARNPPRITC H EYE+    +D         N+V RSF+
Sbjct  181   EMARGAHAPSILPVWERXLFFARNPPRITCAHHEYEDVIDHSDGSYAFSNQSNMVQRSFY  240

Query  823   FGPTEISALRSSLPPHLLK-CSRFEVVTACLWRCRTIAMEFDPNDEVRIFGTVNARPRLK  647
             FG  E+   R  +PPHL+  CS F+++TACLW+CRT+A++ +P   VR+   VNAR +  
Sbjct  241   FGAKEMRVJRKQIPPHLISTCSTFDLITACLWKCRTLALKINPKQAVRVSCIVNARGKHH  300

Query  646   NPPVPNGYYGNAFVYPGAKSTAGKVSKSPLSHALELVTNIKSSFTEEYIKSVADLMILKG  467
             N  +P GYYGNAF YP A S A  + K+PL +ALELV   K++  EEY++SVADL +L+G
Sbjct  301   NXRLPLGYYGNAFAYPAAVSKAEPLCKNPLGYALELVKKAKATMNEEYLRSVADLXVLRG  360

Query  466   RPTFTLQGTF-IVSDVTRVGFPEIDMGWGQSVFggpahggvggipGLITFYIPYEDNKGD  290
             RP ++  G++ IVSD TR GF +++ GWGQ VF      G      LI+FY+ +++N  D
Sbjct  361   RPQYSSTGSYLIVSDNTRAGFGDVNFGWGQPVF-----AGPAKALDLISFYVQHKNNTED  415

Query  289   HGILVPMCLPAIAMGKFVKELE  224
              GILVPMCLP+ AM +F +ELE
Sbjct  416   -GILVPMCLPSSAMERFQQELE  436



>gb|AGW30201.1| alcohol acyl transferase [Malus domestica]
Length=455

 Score =   478 bits (1230),  Expect = 2e-160, Method: Compositional matrix adjust.
 Identities = 231/438 (53%), Positives = 312/438 (71%), Gaps = 12/438 (3%)
 Frame = -1

Query  1525  FTVTRQNPELVAPADPTPREIKYLSDIDDQQGLRFQIPVIHFYRNEPSMS-GKDPVQVIR  1349
               V R  PEL+ PA  TP+E K+LSDIDDQ+ LR QIP+I  Y++ PS++  ++PV+ IR
Sbjct  7     LQVKRLQPELITPAKSTPQETKFLSDIDDQESLRVQIPIIMCYKDNPSLNKNRNPVKAIR  66

Query  1348  QALAKALVFFYPFAGRLREGPGRKLMVDCTGEGVMFIEADADATLQHFAVGGELKPPFPC  1169
             +AL++ALV++YP AGRLREGP RKL+VDC GEG++F+EA AD TL+   +G ++ PP P 
Sbjct  67    EALSRALVYYYPLAGRLREGPNRKLVVDCNGEGILFVEASADVTLEQ--LGDKILPPCPL  124

Query  1168  FDQLLYNVPGSAEILNCPLFLIQVTRLRCGGFIFALRLNHSMSDACGLVHFLNTIAEIAR  989
              ++ LYN PGS  I++CPL LIQVT L CGGFI ALRLNH+M DA GL+ FL  IAE+AR
Sbjct  125   LEEFLYNFPGSDGIIDCPLLLIQVTCLTCGGFILALRLNHTMCDAFGLLQFLTAIAEMAR  184

Query  988   GAEAPSVYPVWQREFFDARNPPRITCTHFEYEEE-PAADSMVTNIPLDNLVHRSFFFGPT  812
             GA APS+ PVW+RE   ARNPPRITC H EYE+    +D   T+    N+V RSF+FG  
Sbjct  185   GAHAPSILPVWERELLFARNPPRITCAHHEYEDVIDHSDGSYTSSNQSNMVQRSFYFGAK  244

Query  811   EISALRSSLPPHLLK-CSRFEVVTACLWRCRTIAMEFDPNDEVRIFGTVNARPRLKNPPV  635
             E+  LR  +P HL+  CS F+++TACLW+CRT+A++ +P   VR+  TVNAR +  N  +
Sbjct  245   EMRVLRKQIPRHLISTCSTFDLITACLWKCRTLALKINPKQAVRVSCTVNARGKHHNVRL  304

Query  634   PNGYYGNAFVYPGAKSTAGKVSKSPLSHALELVTNIKSSFTEEYIKSVADLMILKGRPTF  455
             P GYYGNAF +P A S A  + K+P+ +ALELV   K++  EEY++SVADL++L+GRP +
Sbjct  305   PLGYYGNAFAFPAAVSKAEPLCKNPMGYALELVKKAKATMNEEYLRSVADLLVLRGRPQY  364

Query  454   TLQGTF-IVSDVTRVGFPEIDMGWGQSVFggpahggvggipGLITFYIPYEDNKGDHGIL  278
             +  G++ IVSD TR GF +++ GWGQ VF      G      L++FY+ +++N  D GIL
Sbjct  365   SSTGSYLIVSDNTRAGFGDVNFGWGQPVF-----AGPAKALDLVSFYVQHKNNTED-GIL  418

Query  277   VPMCLPAIAMGKFVKELE  224
             VPMCLP+ AM +F +E E
Sbjct  419   VPMCLPSSAMERFQQEFE  436



>emb|CDX78752.1| BnaA03g06640D [Brassica napus]
Length=472

 Score =   478 bits (1231),  Expect = 2e-160, Method: Compositional matrix adjust.
 Identities = 242/439 (55%), Positives = 312/439 (71%), Gaps = 6/439 (1%)
 Frame = -1

Query  1534  SIAFTVTRQNPELVAPADPTPREIKYLSDIDDQQGLRFQIPVIHFYRNEPSMSGKDPVQV  1355
             S+ F V R+ PELV+PA PTPRE+K LSDIDDQ+GLRF IP   FYR+ P++   DPV V
Sbjct  13    SLTFKVNRREPELVSPAKPTPRELKLLSDIDDQEGLRFHIPSFFFYRHNPNVY-SDPVAV  71

Query  1354  IRQALAKALVFFYPFAGRLREGPGRKLMVDCTGEGVMFIEADADATLQHFAVGGELKPPF  1175
             IR+ALA+ LV++YP AGRLREGP RKL VDCTG+GV+FIEADAD TL  F     L PPF
Sbjct  72    IRRALAQTLVYYYPLAGRLREGPNRKLAVDCTGQGVLFIEADADVTLAEFEEKDALSPPF  131

Query  1174  PCFDQLLYNVPGSAEILNCPLFLIQVTRLRCGGFIFALRLNHSMSDACGLVHFLNTIAEI  995
             PCF++LL+++ GS+E++N PL LIQVTRL+CGGFIFA+RLNH M+DA GL  F+ TI E 
Sbjct  132   PCFEELLFDIEGSSEVINAPLILIQVTRLKCGGFIFAIRLNHVMADAGGLSLFIKTIGEF  191

Query  994   ARGAEAPSVYPVWQREFFDARNPPRITCTHFEYEEEPAADSMVTNIPLDNLVHRSFFFGP  815
             ARG  AP++ P W+R    AR PPR+T TH EY+E  AAD+       + LV +SFFFG 
Sbjct  192   ARGCHAPTIPPTWERHLLSARVPPRVTQTHREYDESAAADAEPVIGDGETLVSKSFFFGG  251

Query  814   TEISALRSSLPPHLL-KCSRFEVVTACLWRCRTIAMEFDPNDEVRIFGTVNARPRLKNPP  638
              E+SA+R  LPP +  + +  E +TA LWR RT A+  D N E+R+   VNARP+LKNP 
Sbjct  252   AEMSAIRKLLPPDIANRSTGLETLTAFLWRQRTAALRPDANKEMRVIFIVNARPKLKNPT  311

Query  637   VPNGYYGNAFVYPGAKSTAGKVSKSPLSHALELVTNIKSSFTEEYIKSVADLMILKGRPT  458
             +P GYYGNAF +P A + A  +++ PL  AL LV   K+S TEEY++S+ADLM+ KGRP 
Sbjct  312   LPRGYYGNAFAFPVAIANARDLTEKPLEFALRLVKEAKASVTEEYMRSLADLMVTKGRPK  371

Query  457   FTLQGTFIVSDVTRVGFPEIDMG-WGQSVFggpahggvggipGLITFYIPYEDNKGDHGI  281
             F   G +++SDV    F +ID+G WG+ V+GG    GV    G  +FY+  E+ +G+ GI
Sbjct  372   FLADGAYLISDVR--NFADIDLGVWGKPVYGGIGKAGVMDSLG-SSFYVSAENREGERGI  428

Query  280   LVPMCLPAIAMGKFVKELE  224
             LVP+CLP  AM +FV+ELE
Sbjct  429   LVPVCLPEKAMQRFVEELE  447



>gb|AAS48090.1| alcohol acyl transferase [Pyrus communis]
Length=442

 Score =   477 bits (1228),  Expect = 3e-160, Method: Compositional matrix adjust.
 Identities = 229/438 (52%), Positives = 313/438 (71%), Gaps = 12/438 (3%)
 Frame = -1

Query  1525  FTVTRQNPELVAPADPTPREIKYLSDIDDQQGLRFQIPVIHFYRNEPSMS-GKDPVQVIR  1349
               V R  PEL+ PA PTP+E K+LSDIDDQ+GLRFQ+PVI  Y++ PS++  ++P++VI+
Sbjct  7     LQVKRLQPELITPAKPTPQETKFLSDIDDQEGLRFQLPVIMCYKDNPSLNKNRNPIKVIK  66

Query  1348  QALAKALVFFYPFAGRLREGPGRKLMVDCTGEGVMFIEADADATLQHFAVGGELKPPFPC  1169
             +AL++ALV++YP AGRLREGP RKLMV+C GEG++F+EA AD TL+   +G ++ PP P 
Sbjct  67    EALSRALVYYYPLAGRLREGPNRKLMVNCNGEGILFVEASADVTLEQ--LGDKILPPCPL  124

Query  1168  FDQLLYNVPGSAEILNCPLFLIQVTRLRCGGFIFALRLNHSMSDACGLVHFLNTIAEIAR  989
              ++ L+N PGS  I+ CPL L+QVT L CGGFI ALRLNH+M DA GL+ FL  I E+ R
Sbjct  125   LEEFLFNFPGSDGIIGCPLLLVQVTCLTCGGFILALRLNHTMCDATGLLMFLTAITEMGR  184

Query  988   GAEAPSVYPVWQREFFDARNPPRITCTHFEYEEE-PAADSMVTNIPLDNLVHRSFFFGPT  812
             GA+APS+ PVW+RE   AR+PPRITC H+EYE+    +D         N+V RSF+FG  
Sbjct  185   GADAPSILPVWERELLFARDPPRITCAHYEYEDVIDHSDGSYAFSNQSNMVQRSFYFGAK  244

Query  811   EISALRSSLPPHLLK-CSRFEVVTACLWRCRTIAMEFDPNDEVRIFGTVNARPRLKNPPV  635
             E+  LR  +PPHL+  CS F+++TACLW+CRT+ ++ +P   VR+   VNAR +  N  +
Sbjct  245   EMRVLRKQIPPHLISTCSTFDLITACLWKCRTLVLKINPKQAVRVSCIVNARGKHNNVHI  304

Query  634   PNGYYGNAFVYPGAKSTAGKVSKSPLSHALELVTNIKSSFTEEYIKSVADLMILKGRPTF  455
             P GYYGNAF +P A S A  + K+PL +ALELV   K++  EEY++SVADL++L+GRP +
Sbjct  305   PLGYYGNAFAFPAAVSKAEPLCKNPLGYALELVKKAKATMNEEYLRSVADLLVLRGRPQY  364

Query  454   TLQGTF-IVSDVTRVGFPEIDMGWGQSVFggpahggvggipGLITFYIPYEDNKGDHGIL  278
             +  G++ IVSD TR GF +++ GWGQ VF      G      LI+FY+ +++N  D GIL
Sbjct  365   SSTGSYLIVSDNTRAGFGDVNFGWGQPVF-----AGPAKALDLISFYVQHKNNIED-GIL  418

Query  277   VPMCLPAIAMGKFVKELE  224
             VPMCLP+ AM +F +ELE
Sbjct  419   VPMCLPSSAMERFQQELE  436



>ref|XP_010941428.1| PREDICTED: benzyl alcohol O-benzoyltransferase-like, partial 
[Elaeis guineensis]
Length=414

 Score =   475 bits (1223),  Expect = 5e-160, Method: Compositional matrix adjust.
 Identities = 241/420 (57%), Positives = 311/420 (74%), Gaps = 7/420 (2%)
 Frame = -1

Query  1549  MASQPSIAFTVTRQNPELVAPADPTPREIKYLSDIDDQQGLRFQIPVIHFYRNEPSMSGK  1370
             MAS  S+ FTV+R+ P LVAPA PTPRE K LSDIDDQ+GLRF     HFY N+PS  G+
Sbjct  1     MAS--SLTFTVSRREPVLVAPAKPTPREFKPLSDIDDQEGLRFYSSGFHFYCNDPSKEGR  58

Query  1369  DPVQVIRQALAKALVFFYPFAGRLREGPGRKLMVDCTGEGVMFIEADADATLQHFAVGGE  1190
             DP +VI++AL K LV +YP AGRLRE PGRKL+V+CTGEGV+F+EADAD  L+ F  G  
Sbjct  59    DPARVIKEALGKVLVHYYPIAGRLREWPGRKLVVECTGEGVVFVEADADVRLEEF--GDA  116

Query  1189  LKPPFPCFDQLLYNVPGSAEILNCPLFLIQVTRLRCGGFIFALRLNHSMSDACGLVHFLN  1010
               PPFPC ++LLY+      +L+CPL  +QVTRL+CGGFIF LR+NH++ DA G+V FL 
Sbjct  117   PSPPFPCVEKLLYDADSLGSVLDCPLLFVQVTRLKCGGFIFGLRINHTIMDAPGVVQFLT  176

Query  1009  TIAEIARGAEAPSVYPVWQREFFDARNPPRITCTHFEYEEEPAADSMVTNIPLDNLVHRS  830
              + E+ARGA AP+V PVW+RE   AR PPRIT  H EYE   A D M T +P  ++V+RS
Sbjct  177   ALGEMARGAAAPTVPPVWERELLTARFPPRITHVHPEYEFSAATDVM-TTVPRSDMVNRS  235

Query  829   FFFGPTEISALRSSLPPHLL-KCSRFEVVTACLWRCRTIAMEFDPNDEVRIFGTVNARPR  653
             FFFGP EISALR   PPHL    SRFE++TA +WR RT A+ +DP+DEVR+   VNAR R
Sbjct  236   FFFGPKEISALRKYAPPHLRPTSSRFELITASVWRSRTAALGYDPDDEVRVLFVVNARGR  295

Query  652   LKNPPVPNGYYGNAFVYPGAKSTAGKVSKSPLSHALELVTNIKSSFTEEYIKSVADLMIL  473
              ++PP+P+GYYGNA  +P A S AG++ +SPL +ALE+V   K+S T+EY++SVADLM++
Sbjct  296   -RSPPLPSGYYGNALAFPVASSAAGRLMRSPLGYALEVVKKAKASVTDEYMQSVADLMVV  354

Query  472   KGRPTFTLQGTFIVSDVTRVGFPEIDMGWGQSVFggpahggvggipGLITFYIPYEDNKG  293
             +GRP F +  T++VSDVTR GF  +D GWG+ V+GGPA  GVG +PG+ +FY  + ++KG
Sbjct  355   RGRPHFAMARTYLVSDVTRAGFEAVDFGWGEGVYGGPASAGVGAVPGVASFYTWHRNDKG  414



>gb|AGW30205.1| alcohol acyl transferase [Malus domestica]
Length=455

 Score =   477 bits (1227),  Expect = 5e-160, Method: Compositional matrix adjust.
 Identities = 234/442 (53%), Positives = 313/442 (71%), Gaps = 13/442 (3%)
 Frame = -1

Query  1537  PSIAFTVTRQNPELVAPADPTPREIKYLSDIDDQQGLRFQIPVIHFYRNEPSMS-GKDPV  1361
             PS+   V R  PEL+ PA PTP+E K+LS+IDDQ+ LRFQ+PVI  Y+  PS++  ++PV
Sbjct  4     PSV-LQVKRLQPELITPAKPTPQETKFLSEIDDQESLRFQVPVIMCYKANPSLNKNRNPV  62

Query  1360  QVIRQALAKALVFFYPFAGRLREGPGRKLMVDCTGEGVMFIEADADATLQHFAVGGELKP  1181
             +VIR+AL++ALV++YP AGRLREGP +KL+VDC GEG++F+EA AD TL+   +G ++ P
Sbjct  63    KVIREALSRALVYYYPLAGRLREGPNKKLVVDCNGEGILFVEASADVTLEQ--LGDKILP  120

Query  1180  PFPCFDQLLYNVPGSAEILNCPLFLIQVTRLRCGGFIFALRLNHSMSDACGLVHFLNTIA  1001
             P P  ++ L+N PGS  I+ CPL L+QVT L CGGFI ALRLNH+M DA GL+ FL  IA
Sbjct  121   PCPLLEEFLFNFPGSGGIIGCPLLLVQVTCLTCGGFILALRLNHTMCDASGLLLFLTAIA  180

Query  1000  EIARGAEAPSVYPVWQREFFDARNPPRITCTHFEYEEE-PAADSMVTNIPLDNLVHRSFF  824
             E+ARGA APS+ PVW+RE   ARNPPRITC H EYE+    +D         N+V RSF+
Sbjct  181   EMARGAHAPSILPVWERELLFARNPPRITCAHHEYEDVIDHSDGSYAFSNQSNMVQRSFY  240

Query  823   FGPTEISALRSSLPPHLLK-CSRFEVVTACLWRCRTIAMEFDPNDEVRIFGTVNARPRLK  647
             FG  E+  LR  +PPHL+  CS F+++TACLW+CRT+A++ +P   VR+   VNAR +  
Sbjct  241   FGAKEMRVLRKQIPPHLISTCSTFDLITACLWKCRTLALKINPKQAVRVSCIVNARGKHH  300

Query  646   NPPVPNGYYGNAFVYPGAKSTAGKVSKSPLSHALELVTNIKSSFTEEYIKSVADLMILKG  467
             N  +P GYYGNAF YP A S A  + K+PL +ALELV   K++  EEY++SVADLM+L+G
Sbjct  301   NVRLPLGYYGNAFAYPAAVSKAEPLCKNPLGYALELVKKAKATMNEEYLRSVADLMVLRG  360

Query  466   RPTFTLQGTF-IVSDVTRVGFPEIDMGWGQSVFggpahggvggipGLITFYIPYEDNKGD  290
             RP ++  G + IVSD TR GF +++ GWG+ VF      G      LI+FY+ +++N  D
Sbjct  361   RPQYSTTGCYLIVSDNTRAGFGDVNFGWGEPVF-----AGPAKALDLISFYVQHKNNTED  415

Query  289   HGILVPMCLPAIAMGKFVKELE  224
              GILVPMCL + AM +F +ELE
Sbjct  416   -GILVPMCLSSSAMERFQQELE  436



>ref|XP_004151858.1| PREDICTED: benzyl alcohol O-benzoyltransferase-like [Cucumis 
sativus]
 gb|KGN63328.1| hypothetical protein Csa_2G429010 [Cucumis sativus]
Length=444

 Score =   476 bits (1226),  Expect = 6e-160, Method: Compositional matrix adjust.
 Identities = 239/440 (54%), Positives = 316/440 (72%), Gaps = 4/440 (1%)
 Frame = -1

Query  1534  SIAFTVTRQNPELVAPADPTPREIKYLSDIDDQQGLRFQIPVIHFYRNEPSMSGKDPVQV  1355
             S+AF V R  PEL+ P  PTP E K LSDIDDQQ  RFQ+P+IHFY   P+M G+DPV V
Sbjct  7     SLAFKVERCEPELIVPTKPTPHEWKQLSDIDDQQSFRFQVPMIHFYPQNPNMEGRDPVTV  66

Query  1354  IRQALAKALVFFYPFAGRLREGPGRKLMVDCTGEGVMFIEADADATLQHFAVGGELKPPF  1175
             I++A+AK LVF+YPFAGR+RE  G+KL V+CTGEGV+FIEA+AD +LQ F     L+PPF
Sbjct  67    IKEAVAKTLVFYYPFAGRVREKFGKKLFVECTGEGVLFIEANADVSLQQFQDSSSLQPPF  126

Query  1174  PCFDQLLYNVPGSAEILNCPLFLIQVTRLRCGGFIFALRLNHSMSDACGLVHFLNTIAEI  995
             PC DQLLY+VP S  IL+ PL LIQVTRL+CGGFIFA+R NH+++D  G+  FL  IAE+
Sbjct  127   PCMDQLLYDVPDSDGILDSPLLLIQVTRLKCGGFIFAVRFNHTITDGIGMAQFLKAIAEM  186

Query  994   ARGAEAPSVYPVWQREFFDARNPPRITCTHFEYEEEPAADSMVTNIPLDNLVHRSFFFGP  815
             ARGA APS+ PVW+R   ++R+PPR+TC H EY+E    D   T I LDN+V  SFFFGP
Sbjct  187   ARGALAPSILPVWKRALLNSRDPPRVTCLHHEYDE--VNDINDTTITLDNMVQHSFFFGP  244

Query  814   TEISALRSSLPPHLLKCSRFEVVTACLWRCRTIAMEFDPNDEVRIFGTVNARPRLKNPPV  635
             TEIS +  +LP H       E++   +WR RTIA++  P +EVR+   VN R +    P+
Sbjct  245   TEISIIHRTLPTHFHNYPSAELLMIFIWRLRTIALQLSPEEEVRLLCVVNLRTKFNYLPL  304

Query  634   PNGYYGNAFVYPGAKSTAGKVSKSPLSHALELVTNIKSSFTEEYIKSVADLMILKGRPTF  455
               G+YGNAF  P A +TA K+S++ L +A+ELV N K+  TEEY+KS+ DLM +KGRP F
Sbjct  305   --GFYGNAFALPAALTTAAKLSQNSLDYAIELVENAKAKVTEEYVKSMVDLMTVKGRPHF  362

Query  454   TLQGTFIVSDVTRVGFPEIDMGWGQSVFggpahggvggipGLITFYIPYEDNKGDHGILV  275
             T+ G+F+++D+T  GF ++D GW ++++ GPA G VG +PGLI+F IP +   G+ GI+V
Sbjct  363   TVVGSFLMADLTEAGFEDVDFGWEKAIYAGPATGKVGLVPGLISFCIPSKMRNGEKGIVV  422

Query  274   PMCLPAIAMGKFVKELENCL  215
             P+ LPA AM + V+EL+  L
Sbjct  423   PLYLPAPAMERLVEELDALL  442



>ref|XP_008391402.1| PREDICTED: methanol O-anthraniloyltransferase-like [Malus domestica]
Length=459

 Score =   476 bits (1226),  Expect = 9e-160, Method: Compositional matrix adjust.
 Identities = 232/443 (52%), Positives = 312/443 (70%), Gaps = 14/443 (3%)
 Frame = -1

Query  1537  PSIAFTVTRQNPELVAPADPTPREIKYLSDIDDQQGLRFQIPVIHFYRNEPSMS-GKDPV  1361
             P     V R  PEL+ P   TPRE K+LSDIDDQ+ LRF +PVI  Y++ PS+   ++PV
Sbjct  3     PPSVLQVKRLQPELITPVKSTPRETKFLSDIDDQESLRFHVPVIMCYKDNPSLKENRNPV  62

Query  1360  QVIRQALAKALVFFYPFAGRLREGPGRKLMVDCTGEGVMFIEADADATLQHFAVGGELKP  1181
             + IR+AL++ALV++YP AGRLREGP RKLMVDC GEG++F+EA AD TL+   +G ++ P
Sbjct  63    KAIREALSRALVYYYPLAGRLREGPNRKLMVDCNGEGILFVEASADVTLEQ--LGDKILP  120

Query  1180  PFPCFDQLLYNVPGSAEILNCPLFLIQVTRLRCGGFIFALRLNHSMSDACGLVHFLNTIA  1001
             P P  ++ L N PGS  I+ CPL L+QVTRL CGGFI ALRLNH+M DA GL+ FL  IA
Sbjct  121   PCPLLEEFLVNFPGSDGIIGCPLLLVQVTRLTCGGFILALRLNHTMCDAPGLLQFLTAIA  180

Query  1000  EIARGAEAPSVYPVWQREFFDARNPPRITCTHFEYEE--EPAADSMVTNIPLDNLVHRSF  827
             E+ARGA APS+ PVW+RE   AR+PPRITC H EYE+  + +  S  ++ P  N+V RSF
Sbjct  181   EMARGAHAPSILPVWERELLSARDPPRITCVHHEYEDVIDHSDGSYASSNP-SNMVQRSF  239

Query  826   FFGPTEISALRSSLPPHLLK-CSRFEVVTACLWRCRTIAMEFDPNDEVRIFGTVNARPRL  650
             +FG  E+  LR  +PPHL+  CS F+++TACLW+CRT+A++ +P   VR+   VNAR + 
Sbjct  240   YFGAKEMRILRKQIPPHLISTCSTFDLITACLWKCRTLALKINPKQVVRVSCIVNARGKH  299

Query  649   KNPPVPNGYYGNAFVYPGAKSTAGKVSKSPLSHALELVTNIKSSFTEEYIKSVADLMILK  470
              N  +P GYYGNAF +P A S A  + K+P+ +ALELV   K++  EEY++SVADL++L+
Sbjct  300   HNVRLPLGYYGNAFAFPAAVSKAEPLCKNPMGYALELVKKAKATMNEEYLRSVADLLVLR  359

Query  469   GRPTFTLQGTF-IVSDVTRVGFPEIDMGWGQSVFggpahggvggipGLITFYIPYEDNKG  293
             GRP ++  G++ IVSD TR GF +++ GWGQ +F      G      LI+FY+ +++N  
Sbjct  360   GRPQYSSTGSYLIVSDNTRAGFGDVNFGWGQPIF-----AGPAKALDLISFYVQHKNNSE  414

Query  292   DHGILVPMCLPAIAMGKFVKELE  224
             D GILVPMCLP  AM +F +ELE
Sbjct  415   D-GILVPMCLPFSAMERFQQELE  436



>ref|XP_008678444.1| PREDICTED: benzyl alcohol O-benzoyltransferase-like [Zea mays]
 gb|AFW61772.1| 10-deacetylbaccatin III 10-O-acetyltransferase [Zea mays]
Length=459

 Score =   476 bits (1225),  Expect = 1e-159, Method: Compositional matrix adjust.
 Identities = 241/442 (55%), Positives = 314/442 (71%), Gaps = 7/442 (2%)
 Frame = -1

Query  1549  MASQPSIAFTVTRQNPELVAPADPTPREIKYLSDIDDQQGLRFQIPVIHFYRNEPSMSGK  1370
             MAS  S+ FTV R    LVAPA  TPRE+K LSDIDDQ GLR  +P+I FYR    M G+
Sbjct  1     MAS--SLKFTVRRGPAVLVAPASATPRELKRLSDIDDQDGLRLHVPIIQFYRQNALMGGR  58

Query  1369  DPVQVIRQALAKALVFFYPFAGRLREGPGRKLMVDCTGEGVMFIEADADATLQHFAVGGE  1190
             +P  VIR A+A+ALV +YPFAGRLRE  GRKL VDCTGEGV+FIEA+AD  L HF  G E
Sbjct  59    EPAPVIRDAIARALVPYYPFAGRLRELEGRKLAVDCTGEGVLFIEAEADVRLDHF--GDE  116

Query  1189  LKPPFPCFDQLLYNVPGSAEILNCPLFLIQVTRLRCGGFIFALRLNHSMSDACGLVHFLN  1010
             L+PPFPC ++L+++VPGS+E+L  PL L QVTRL CGGFI  +RL+H+M+DA GLV FL 
Sbjct  117   LQPPFPCLEELIFDVPGSSEVLGSPLLLFQVTRLACGGFILGVRLHHTMADAQGLVQFLG  176

Query  1009  TIAEIARGAEAPSVYPVWQREFFDARNPPRITCTHFEYEEEPAADSMVTNIPLDNLVHRS  830
              +AE+ARGA  P+V PVW RE  +AR+PPR    H EY+E P  D+  + IPLD++VHRS
Sbjct  177   AVAELARGAAGPTVRPVWGRELLEARDPPRPAFAHREYDEVP--DTKGSIIPLDDMVHRS  234

Query  829   FFFGPTEISALRSSLPPHLL-KCSRFEVVTACLWRCRTIAMEFDPNDEVRIFGTVNARPR  653
             FFFG  E++A+R++LPP L  + S+F+++T  LW+CRT A+  D ++ +R+   V A   
Sbjct  235   FFFGRHEVAAIRANLPPDLRSRASKFDLLTGLLWKCRTAALALDADEVMRMICVVTAHGG  294

Query  652   LKNPPVPNGYYGNAFVYPGAKSTAGKVSKSPLSHALELVTNIKSSFTEEYIKSVADLMIL  473
                  +P GYYGNAF  P A +TAG +   PL +A+ELV   K     EY++SVADLM+L
Sbjct  295   KSGVAIPKGYYGNAFALPAAVATAGDLVAKPLGYAVELVKRAKGEVNVEYMRSVADLMVL  354

Query  472   KGRPTFTLQGTFIVSDVTRVGFPEIDMGWGQSVFggpahggvggipGLITFYIPYEDNKG  293
             +GRP FT+   ++ SD+T+ GF  +D GWG  V+GGPA+ GVG  PG+ TF +P ++ KG
Sbjct  355   RGRPHFTVVRAYLASDLTKAGFSNLDFGWGNPVYGGPANVGVGTSPGMATFLVPCKNAKG  414

Query  292   DHGILVPMCLPAIAMGKFVKEL  227
             + GI+VPMCLP  AM  FVKE+
Sbjct  415   EDGIIVPMCLPGPAMETFVKEM  436



>ref|XP_009386561.1| PREDICTED: benzyl alcohol O-benzoyltransferase-like [Musa acuminata 
subsp. malaccensis]
Length=460

 Score =   476 bits (1225),  Expect = 1e-159, Method: Compositional matrix adjust.
 Identities = 239/457 (52%), Positives = 312/457 (68%), Gaps = 20/457 (4%)
 Frame = -1

Query  1549  MASQPSIAFTVTRQNPELVAPADPTPREIKYLSDIDDQQGLRFQIPVIHFYRNE-PSMSG  1373
             MA+     FTV RQ P LV P++PTP E K LSDIDDQ GLR  IPVI FYRN  PS+S 
Sbjct  1     MAAPSPPTFTVRRQEPVLVPPSEPTPHEFKRLSDIDDQDGLRTHIPVIQFYRNSVPSIST  60

Query  1372  -------KDPVQVIRQALAKALVFFYPFAGRLREGPGRKLMVDCTGEGVMFIEADADATL  1214
                    +DP +VIR+AL +ALV +YP AGRLRE PGRKL+V+CTGEGV+F+EADAD +L
Sbjct  61    TGTGGGHRDPAKVIREALGRALVSYYPLAGRLREAPGRKLVVECTGEGVLFVEADADISL  120

Query  1213  QHFAVGGELKPPFPCFDQLLYNVPGSAEILNCPLFLIQVTRLRCGGFIFALRLNHSMSDA  1034
             + F  G  L PP P   +LL++VPGS  IL+CPL L+QVTRL CGGF+ ALRLNH+M+D 
Sbjct  121   EQF--GEALHPPLPFLGELLHDVPGSGGILHCPLVLMQVTRLLCGGFVVALRLNHTMADG  178

Query  1033  CGLVHFLNTIAEIARGAEAPSVYPVWQREFFDARNPPRITCTHFEYEEEPAADS---MVT  863
              GL  F+N + E+ARGA APSV PVW RE  +AR PPRITC H EY+  P +D+     T
Sbjct  179   AGLGQFMNAVGELARGAAAPSVSPVWARELLEARIPPRITCVHREYDPVPPSDARGPATT  238

Query  862   NIPLDNLVHRSFFFGPTEISALRSSLPPHLLKCSRFEVVTACLWRCRTIAMEFDPNDEVR  683
              +PLD++VHRSFFFG  +++ALR  +PPHL   S F+++TACLWRCRTIA+     +EVR
Sbjct  239   IVPLDDMVHRSFFFGRADVAALRRCVPPHLRDRSTFDILTACLWRCRTIAISPGDEEEVR  298

Query  682   IFGTVNARP-RLKNPPVPNGYYGNAFVYPGAKSTAGKVSKSPLSHALELVTNIKSSFTEE  506
             +   VNAR  R     +P GYYGNA  Y  A STAG++   P+ +ALELV   KS  TEE
Sbjct  299   VLFIVNARAKRFAGLGLPAGYYGNAIAYATAISTAGELCARPVGYALELVKEAKSMVTEE  358

Query  505   YIKSVADLMILKGRPTFTLQGTFIVSDVTRVGFPEIDMGWGQSVFggpahggvggipGLI  326
             Y++SV DLM+L+GRP + ++G+++VSD TR G   +D GWG+ ++      G      + 
Sbjct  359   YMRSVVDLMVLRGRPHYKVRGSYLVSDATRSGLELVDYGWGKPLY------GGPAWGRVA  412

Query  325   TFYIPYEDNKGDHGILVPMCLPAIAMGKFVKELENCL  215
             +F+  + ++KG+ G++VP  LP   M KF  EL+  +
Sbjct  413   SFHFRFRNSKGEEGVVVPHYLPRTTMDKFAMELQKLI  449



>ref|XP_004506306.1| PREDICTED: 13-hydroxylupanine O-tigloyltransferase-like [Cicer 
arietinum]
Length=450

 Score =   475 bits (1222),  Expect = 3e-159, Method: Compositional matrix adjust.
 Identities = 235/441 (53%), Positives = 314/441 (71%), Gaps = 12/441 (3%)
 Frame = -1

Query  1534  SIAFTVTRQNPELVAPADPTPREIKYLSDIDDQQGLRFQIPVIHFYRNEPSMSGKDPVQV  1355
             S+ F V R   ELV P++PTP E+K LS+IDDQ G R+ +P+I  YR  PSM GKDPVQV
Sbjct  7     SMVFKVKRHKHELVKPSNPTPNELKLLSNIDDQLGFRYHVPLIFLYRYNPSMLGKDPVQV  66

Query  1354  IRQALAKALVFFYPFAGRLREGPGRKLMVDCTGEGVMFIEADADATLQHFAVGGELKPPF  1175
             IR+AL+K LVF+YPFAGRL E    KLMV+C GEGVMFIEADAD TL  F       PPF
Sbjct  67    IREALSKTLVFYYPFAGRLMECSNGKLMVNCNGEGVMFIEADADVTLDDF--DNNFVPPF  124

Query  1174  PCFDQLLYNVPGSAEILNCPLFLIQVTRLRCGGFIFALRLNHSMSDACGLVHFLNTIAEI  995
             PCFD+LLYNVPGS  I++ PL LIQVTRL+CGGFIF+LR+NH+MSD  G+  FL  ++E+
Sbjct  125   PCFDELLYNVPGSDGIIDSPLLLIQVTRLKCGGFIFSLRMNHTMSDGSGISQFLKALSEL  184

Query  994   ARGAEAPSVYPVWQREFFDARNPPRITCTHFEYEEEPAADSMVTNIPLDNLVHRSFFFGP  815
             A  A+ PS+ P+W RE   AR PP++TC H EY++ P            N +H SFFFGP
Sbjct  185   ANEAKEPSILPMWCRELLCAREPPKVTCIHREYQQLPPDTK-------SNFIHHSFFFGP  237

Query  814   TEISALRSSLPPHLLKCSRFEVVTACLWRCRTIAMEF-DPNDEVRIFGTVNARPRLKNPP  638
              EI+A+R+ LP HL K + F+++TACLWRCRT A+++ + N+E+R+   VNAR RL NPP
Sbjct  238   KEIAAIRALLPHHLSKSTSFKILTACLWRCRTKALQWKNSNEEIRLLCIVNARCRL-NPP  296

Query  637   VPNGYYGNAFVYPGAKSTAGKVSKSPLSHALELVTNIKSSFTEEYIKSVADLMILKGRPT  458
             +P G+YGN  V+P A +T GK+   PL +A+ELV N K+  TEEY+ S+ DLM   GRP 
Sbjct  297   LPEGFYGNTVVFPAAVTTVGKLCGRPLGYAVELVKNAKNEATEEYVHSMIDLMETNGRPC  356

Query  457   FTLQGTFIVSDVTRVGFPEIDMGWGQSVFggpahggvggipGLITFYIPYEDNKGDHGIL  278
             FT  G+F+VS++++    ++D GWG++++GG A  G+G IPG ++ Y+ + ++KG+ G +
Sbjct  357   FTRSGSFVVSNISKASLKDLDFGWGKALYGGVAKAGLGDIPG-VSVYMHFTNSKGEQGRV  415

Query  277   VPMCLPAIAMGKFVKELENCL  215
             VP+CLP  AM +  KEL+N L
Sbjct  416   VPICLPINAMERLEKELDNIL  436



>ref|XP_004156786.1| PREDICTED: benzyl alcohol O-benzoyltransferase-like [Cucumis 
sativus]
Length=557

 Score =   478 bits (1230),  Expect = 5e-159, Method: Compositional matrix adjust.
 Identities = 241/446 (54%), Positives = 320/446 (72%), Gaps = 5/446 (1%)
 Frame = -1

Query  1549  MASQP-SIAFTVTRQNPELVAPADPTPREIKYLSDIDDQQGLRFQIPVIHFYRNEPSMSG  1373
             M+S+  S+AF V R  PEL+ P  PTP E K LSDIDDQQ  RFQ+P+IHFY   P+M G
Sbjct  1     MSSEATSLAFKVERCEPELIVPTKPTPHEWKQLSDIDDQQSFRFQVPMIHFYPQNPNMEG  60

Query  1372  KDPVQVIRQALAKALVFFYPFAGRLREGPGRKLMVDCTGEGVMFIEADADATLQHFAVGG  1193
             +DPV VI++A+AK LVF+YPFAGR+RE  G+KL V+CTGEGV+FIEA+AD +LQ F    
Sbjct  61    RDPVTVIKEAVAKTLVFYYPFAGRVREKFGKKLFVECTGEGVLFIEANADVSLQQFQDSS  120

Query  1192  ELKPPFPCFDQLLYNVPGSAEILNCPLFLIQVTRLRCGGFIFALRLNHSMSDACGLVHFL  1013
              L+PPFPC DQLLY+VP S  IL+ PL LIQVTRL+CGGFIFA+R NH+++D  G+  FL
Sbjct  121   SLQPPFPCMDQLLYDVPDSDGILDSPLLLIQVTRLKCGGFIFAVRFNHTITDGIGMAQFL  180

Query  1012  NTIAEIARGAEAPSVYPVWQREFFDARNPPRITCTHFEYEEEPAADSMVTNIPLDNLVHR  833
               IAE+ARGA APS+ PVW+R   ++R+PPR+TC H EY+E    D   T I LDN+V  
Sbjct  181   KAIAEMARGALAPSILPVWKRALLNSRDPPRVTCLHHEYDE--VNDINDTTITLDNMVQH  238

Query  832   SFFFGPTEISALRSSLPPHLLKCSRFEVVTACLWRCRTIAMEFDPNDEVRIFGTVNARPR  653
             SFFFGPTEIS +  +LP H       E++   +WR RTIA++  P +EVR+   VN R +
Sbjct  239   SFFFGPTEISIIHRTLPTHFHNYPSAELLMIFIWRLRTIALQLSPEEEVRLLCVVNLRTK  298

Query  652   LKNPPVPNGYYGNAFVYPGAKSTAGKVSKSPLSHALELVTNIKSSFTEEYIKSVADLMIL  473
                 P+  G+YGNAF  P A +TA K+S++ L +A+ELV N K+  TEEY+KS+ DLM +
Sbjct  299   FNYLPL--GFYGNAFALPAALTTAAKLSQNSLDYAIELVENAKAKVTEEYVKSMVDLMTV  356

Query  472   KGRPTFTLQGTFIVSDVTRVGFPEIDMGWGQSVFggpahggvggipGLITFYIPYEDNKG  293
             KGRP FT+ G+F+++D+T  GF ++D GW ++++ GPA G VG +PGLI+F IP +   G
Sbjct  357   KGRPHFTVVGSFLMADLTEAGFEDVDFGWEKAIYAGPATGKVGLVPGLISFCIPSKMRNG  416

Query  292   DHGILVPMCLPAIAMGKFVKELENCL  215
             + GI+VP+ LPA AM + V+EL+  L
Sbjct  417   EKGIVVPLYLPAPAMERLVEELDALL  442



>ref|XP_007147132.1| hypothetical protein PHAVU_006G098400g [Phaseolus vulgaris]
 gb|ESW19126.1| hypothetical protein PHAVU_006G098400g [Phaseolus vulgaris]
Length=485

 Score =   475 bits (1222),  Expect = 9e-159, Method: Compositional matrix adjust.
 Identities = 241/438 (55%), Positives = 314/438 (72%), Gaps = 9/438 (2%)
 Frame = -1

Query  1525  FTVTRQNPELVAPADPTPREIKYLSDIDDQQGLRFQIPVIHFYRNEPSMSGKDPVQVIRQ  1346
             FTV R  P+LVAPA PTP E+K LSDIDDQ+ LRF IP+I  Y  + SM+ KDPV+VIRQ
Sbjct  54    FTVRRCEPQLVAPAIPTPHELKLLSDIDDQEALRFHIPMIQIYGKQESMAEKDPVEVIRQ  113

Query  1345  ALAKALVFFYPFAGRLREGPGRKLMVDCTGEGVMFIEADADATLQHFAVGGELKPPFPCF  1166
             AL++ LVF+YPFAGRLREGP RKLMVDCTGEG MFIEADAD TL  F  G  L+PPFPCF
Sbjct  114   ALSQTLVFYYPFAGRLREGPQRKLMVDCTGEGAMFIEADADVTLAEF--GDSLQPPFPCF  171

Query  1165  DQLLYNVPGSAEILNCPLFLIQVTRLRCGGFIFALRLNHSMSDACGLVHFLNTIAEIARG  986
              +L+Y+VP S +I   PL L+QVTRL+CGGFI ALR +H+M+D  G   F+N   E+ARG
Sbjct  172   HELMYDVPCSQQITETPLLLVQVTRLKCGGFILALRFSHTMADGFGYQQFMNAWVEMARG  231

Query  985   AEAPSVYPVWQREFFDARNPPRITCTHFEYEEEPAADSMVTNIPLDNLVHRSFFFGPTEI  806
             A  PS+ PVW+RE   AR+PPRIT  H EYE+    D++ ++    NL+ RSFFFG  +I
Sbjct  232   ATKPSIAPVWRRELLMARDPPRITRNHPEYEQ--IQDTLPSSN--HNLIQRSFFFGRLDI  287

Query  805   SALRSSLPPHLLKCSRFEVVTACLWRCRTIAMEFDPNDEVRIFGTVNARPRLKNPPVPNG  626
             +ALR S+P HL  CS F+++TACLWRCRT AM+ + N++VR+   VNAR R  NPP+P G
Sbjct  288   AALRKSIPQHLQHCSTFDLITACLWRCRTKAMQIEANEDVRMMCIVNARGRF-NPPLPVG  346

Query  625   YYGNAFVYPGAKSTAGKVSKSPLSHALELVTNIKSSFTEEYIKSVADLMILKGRP-TFTL  449
             YYGNAF YP A ++AGK+ ++P  +A+EL+  +K    EEY++SVADLM++K R   FT 
Sbjct  347   YYGNAFAYPAAVTSAGKLCQNPFGYAVELINKVKGEMKEEYLQSVADLMVMKERSLLFTT  406

Query  448   QGTFIVSDVTRVGFPEIDMGWGQSVFggpahggvggipGLITFYIPYEDNKGDHGILVPM  269
               + IVS + +V F  +D GWG++V+GG A  G G  PG  +++   ++ KG+ GI+ P+
Sbjct  407   VRSCIVSYLVQVKFRAMDFGWGEAVYGGVAEAGAGSFPG-ASYFCSAKNGKGEEGIIFPI  465

Query  268   CLPAIAMGKFVKELENCL  215
              LPA AM +F KE  + L
Sbjct  466   SLPAEAMERFTKEFNHML  483



>gb|KCW84614.1| hypothetical protein EUGRSUZ_B01445, partial [Eucalyptus grandis]
Length=392

 Score =   471 bits (1212),  Expect = 1e-158, Method: Compositional matrix adjust.
 Identities = 224/393 (57%), Positives = 289/393 (74%), Gaps = 7/393 (2%)
 Frame = -1

Query  1549  MASQPSIAFTVTRQNPELVAPADPTPREIKYLSDIDDQQGLRFQIPVIHFYRNEPSMSGK  1370
             MA Q S++F V R   ELV PA PTPRE K LSDIDD++GLRF IPVI FYR + +  G+
Sbjct  1     MAPQDSLSFKVRRCEAELVRPAKPTPREYKRLSDIDDREGLRFLIPVIQFYRGDDT--GR  58

Query  1369  DPVQVIRQALAKALVFFYPFAGRLREGPGRKLMVDCTGEGVMFIEADADATLQHFAVGGE  1190
             DP + IR+ LA ALVF+YPFAGRLRE PGRKL+VDC  E V F+EA AD TL  F  G  
Sbjct  59    DPARAIREGLANALVFYYPFAGRLREWPGRKLVVDCNEEAVAFVEASADVTLDQF--GDA  116

Query  1189  LKPPFPCFDQLLYNVPGSAEILNCPLFLIQVTRLRCGGFIFALRLNHSMSDACGLVHFLN  1010
             L  PFPC ++LL+++PGS  +L+ PL LIQVTRL+CGGFIFA+ LNH+MSDA GLV  L 
Sbjct  117   LHSPFPCLEELLFDIPGSFSVLDSPLLLIQVTRLKCGGFIFAVHLNHTMSDAMGLVQLLK  176

Query  1009  TIAEIARGAEAPSVYPVWQREFFDARNPPRITCTHFEYEEEPAADSMVTNIPLDNLVHRS  830
              + E+ARGA APS+ PVWQRE  DAR+PPRITC H E+++      M+   PLD++ HRS
Sbjct  177   AVGEMARGANAPSILPVWQRELLDARDPPRITCNHHEFDQVADTKGMLN--PLDDMDHRS  234

Query  829   FFFGPTEISALRSSLPPHLLKCSRFEVVTACLWRCRTIAMEFDPNDEVRIFGTVNARPRL  650
             F F P ++S LR+ LP H    S FE++TA +WRCRTIA + DP +EVR+   VNAR + 
Sbjct  235   FIFSPAQMSILRNGLPSHQRVSSTFEILTAFVWRCRTIAHQHDPEEEVRLLCIVNARSKF  294

Query  649   KNPPVPNGYYGNAFVYPGAKSTAGKVSKSPLSHALELVTNIKSSFTEEYIKSVADLMILK  470
              NPP+P GYYGNAF  PGA ++AGK+ ++PL +ALELV   K+  TEEY++S+ADLM+++
Sbjct  295   -NPPLPAGYYGNAFASPGAVTSAGKLCQNPLGYALELVKKAKAEVTEEYMRSLADLMVIR  353

Query  469   GRPTFTLQGTFIVSDVTRVGFPEIDMGWGQSVF  371
             GRP  T   +F+VSD T+VGF ++D GWG++++
Sbjct  354   GRPRGTEVRSFMVSDTTKVGFGDVDFGWGKAMY  386



>ref|XP_007208844.1| hypothetical protein PRUPE_ppa025565mg [Prunus persica]
 gb|EMJ10043.1| hypothetical protein PRUPE_ppa025565mg [Prunus persica]
Length=558

 Score =   477 bits (1228),  Expect = 1e-158, Method: Compositional matrix adjust.
 Identities = 235/438 (54%), Positives = 304/438 (69%), Gaps = 9/438 (2%)
 Frame = -1

Query  1534  SIAFTVTRQNPELVAPADPTPREIKYLSDIDDQQGLRFQIPVIHFYRNEPSMSGKDPVQV  1355
             +++  V R  PEL+ PA PTP E K LS+IDDQ+ LRFQ+PVI  Y+N PSM G D V+V
Sbjct  7     NLSTRVNRLKPELITPAKPTPHETKLLSNIDDQESLRFQVPVIMSYKNNPSMKGNDAVEV  66

Query  1354  IRQALAKALVFFYPFAGRLREGPGRKLMVDCTGEGVMFIEADADATLQHFAVGGELKPPF  1175
             IR+AL++ALV++YP AGRLREGP RKLMV+C GEGV+FIEA+AD TL    +G  + PP 
Sbjct  67    IREALSRALVYYYPLAGRLREGPNRKLMVECNGEGVLFIEANADVTLAQ--LGDTIAPPS  124

Query  1174  PCFDQLLYNVPGSAEILNCPLFLIQVTRLRCGGFIFALRLNHSMSDACGLVHFLNTIAEI  995
             P  ++ LYNVPGS  IL CPL LIQVTRL CGGFI ALRLNH+M DA GL+ FLN + E+
Sbjct  125   PFLEEFLYNVPGSDGILGCPLLLIQVTRLSCGGFILALRLNHTMFDAAGLLQFLNAVGEM  184

Query  994   ARGAEAPSVYPVWQREFFDARNPPRITCTHFEYEEEPAADSMVTNIPLDNLVHRSFFFGP  815
             A+GA+APS  PVW+RE   AR+ PRITC H EYEE   A     +    N+V RSF+FG 
Sbjct  185   AQGAQAPSTTPVWERELLGARDQPRITCVHHEYEEGIDAQGSFPSTNKPNMVQRSFYFGS  244

Query  814   TEISALRSSLPPHLLKCSRFEVVTACLWRCRTIAMEFDPNDEVRIFGTVNARPRLKNPPV  635
              EI A+R+ +PP L  C+ F+++TACLW+CRT+A+  +P   VR+   V+AR +  N  +
Sbjct  245   KEIKAIRNHIPPQLSTCTTFDLITACLWKCRTLALRMNPKQVVRLSCLVSARGKRHNVRL  304

Query  634   PNGYYGNAFVYPGAKSTAGKVSKSPLSHALELVTNIKSSFTEEYIKSVADLMILKGR-PT  458
             P GYYGNA  +P A S A  V  +PL +ALELV   K++  EEY++SVADLM ++GR P 
Sbjct  305   PLGYYGNAVAFPAAVSEAKAVCTNPLGYALELVMKAKATVNEEYMRSVADLMEIRGRLPK  364

Query  457   FTLQGTFIVSDVTRVGFPEIDMGWGQSVFggpahggvggipGLITFYIPYEDNKGDHGIL  278
             + L G FIVSD +R GF E+  GWG+ VF     GG      LI+FY+ ++ N  + G+L
Sbjct  365   YPLTGNFIVSDTSRAGFGEVSFGWGKPVF-----GGPAKALDLISFYVQHKCNN-EEGVL  418

Query  277   VPMCLPAIAMGKFVKELE  224
             VP+CLP   M +F +ELE
Sbjct  419   VPICLPLSDMERFQQELE  436



>ref|XP_010045974.1| PREDICTED: benzyl alcohol O-benzoyltransferase-like [Eucalyptus 
grandis]
Length=406

 Score =   471 bits (1213),  Expect = 1e-158, Method: Compositional matrix adjust.
 Identities = 224/393 (57%), Positives = 289/393 (74%), Gaps = 7/393 (2%)
 Frame = -1

Query  1549  MASQPSIAFTVTRQNPELVAPADPTPREIKYLSDIDDQQGLRFQIPVIHFYRNEPSMSGK  1370
             MA Q S++F V R   ELV PA PTPRE K LSDIDD++GLRF IPVI FYR + +  G+
Sbjct  1     MAPQDSLSFKVRRCEAELVRPAKPTPREYKRLSDIDDREGLRFLIPVIQFYRGDDT--GR  58

Query  1369  DPVQVIRQALAKALVFFYPFAGRLREGPGRKLMVDCTGEGVMFIEADADATLQHFAVGGE  1190
             DP + IR+ LA ALVF+YPFAGRLRE PGRKL+VDC  E V F+EA AD TL  F  G  
Sbjct  59    DPARAIREGLANALVFYYPFAGRLREWPGRKLVVDCNEEAVAFVEASADVTLDQF--GDA  116

Query  1189  LKPPFPCFDQLLYNVPGSAEILNCPLFLIQVTRLRCGGFIFALRLNHSMSDACGLVHFLN  1010
             L  PFPC ++LL+++PGS  +L+ PL LIQVTRL+CGGFIFA+ LNH+MSDA GLV  L 
Sbjct  117   LHSPFPCLEELLFDIPGSFSVLDSPLLLIQVTRLKCGGFIFAVHLNHTMSDAMGLVQLLK  176

Query  1009  TIAEIARGAEAPSVYPVWQREFFDARNPPRITCTHFEYEEEPAADSMVTNIPLDNLVHRS  830
              + E+ARGA APS+ PVWQRE  DAR+PPRITC H E+++      M+   PLD++ HRS
Sbjct  177   AVGEMARGANAPSILPVWQRELLDARDPPRITCNHHEFDQVADTKGMLN--PLDDMDHRS  234

Query  829   FFFGPTEISALRSSLPPHLLKCSRFEVVTACLWRCRTIAMEFDPNDEVRIFGTVNARPRL  650
             F F P ++S LR+ LP H    S FE++TA +WRCRTIA + DP +EVR+   VNAR + 
Sbjct  235   FIFSPAQMSILRNGLPSHQRVSSTFEILTAFVWRCRTIAHQHDPEEEVRLLCIVNARSKF  294

Query  649   KNPPVPNGYYGNAFVYPGAKSTAGKVSKSPLSHALELVTNIKSSFTEEYIKSVADLMILK  470
              NPP+P GYYGNAF  PGA ++AGK+ ++PL +ALELV   K+  TEEY++S+ADLM+++
Sbjct  295   -NPPLPAGYYGNAFASPGAVTSAGKLCQNPLGYALELVKKAKAEVTEEYMRSLADLMVIR  353

Query  469   GRPTFTLQGTFIVSDVTRVGFPEIDMGWGQSVF  371
             GRP  T   +F+VSD T+VGF ++D GWG++++
Sbjct  354   GRPRGTEVRSFMVSDTTKVGFGDVDFGWGKAMY  386



>gb|AAR99826.1| alcohol acyl transferase [Malus domestica]
Length=470

 Score =   474 bits (1219),  Expect = 1e-158, Method: Compositional matrix adjust.
 Identities = 231/442 (52%), Positives = 312/442 (71%), Gaps = 12/442 (3%)
 Frame = -1

Query  1537  PSIAFTVTRQNPELVAPADPTPREIKYLSDIDDQQGLRFQIPVIHFYRNEPSMSGK-DPV  1361
             P     V R   EL+ PA PTP+E K+LSDIDDQ+GLRFQ+PVI  Y++ PS++   +PV
Sbjct  3     PLSVLQVRRLQLELITPAKPTPQETKFLSDIDDQEGLRFQVPVIMCYKDNPSLNKNCNPV  62

Query  1360  QVIRQALAKALVFFYPFAGRLREGPGRKLMVDCTGEGVMFIEADADATLQHFAVGGELKP  1181
             +VIR+AL++ALV++YP AGRL+EGP RKLMVDC GEG++F+EA AD TL+   +G ++ P
Sbjct  63    KVIREALSRALVYYYPLAGRLKEGPNRKLMVDCNGEGILFVEASADVTLEQ--LGDKILP  120

Query  1180  PFPCFDQLLYNVPGSAEILNCPLFLIQVTRLRCGGFIFALRLNHSMSDACGLVHFLNTIA  1001
             P P  ++ L+N PGS  I+ CPL L+QVT L CGGFI ALR NH+M DA GL+ FL  IA
Sbjct  121   PCPLLEEFLFNFPGSDGIIGCPLLLVQVTCLTCGGFILALRANHTMCDAPGLLLFLTAIA  180

Query  1000  EIARGAEAPSVYPVWQREFFDARNPPRITCTHFEYEEEPA-ADSMVTNIPLDNLVHRSFF  824
             E+ARGA APS+ PVW+RE   AR+PPRITC H EYE+    +D    +    N+V RSF+
Sbjct  181   EMARGAHAPSILPVWERELLFARDPPRITCAHHEYEDVIGHSDGSYASSNQSNMVQRSFY  240

Query  823   FGPTEISALRSSLPPHLLK-CSRFEVVTACLWRCRTIAMEFDPNDEVRIFGTVNARPRLK  647
             FG  E+  LR  +PPHL+  CS F+++TACLW+CRT+A+  +P + VR+   VNAR +  
Sbjct  241   FGAKEMRVLRKQIPPHLISTCSTFDLITACLWKCRTLALNINPKEAVRVSCIVNARGKHN  300

Query  646   NPPVPNGYYGNAFVYPGAKSTAGKVSKSPLSHALELVTNIKSSFTEEYIKSVADLMILKG  467
             N  +P GYYGNAF +P A S A  + K+P+ +ALELV   K++  EEY++SVADL++L+G
Sbjct  301   NVRLPLGYYGNAFAFPAAVSKAEPLCKNPMGYALELVKKAKATMNEEYLRSVADLLVLRG  360

Query  466   RPTFTLQGTF-IVSDVTRVGFPEIDMGWGQSVFggpahggvggipGLITFYIPYEDNKGD  290
             RP ++  G++ IVSD TR GF +++ GWGQ +F      G      LI+FY+ +++N  D
Sbjct  361   RPQYSSTGSYLIVSDNTRAGFGDVNFGWGQPIF-----AGPAKALDLISFYVQHKNNSED  415

Query  289   HGILVPMCLPAIAMGKFVKELE  224
              GILVPMCLP  AM +F +ELE
Sbjct  416   -GILVPMCLPFSAMERFQQELE  436



>gb|AAS79797.1| alcohol acyl transferase [Malus domestica]
Length=459

 Score =   473 bits (1218),  Expect = 2e-158, Method: Compositional matrix adjust.
 Identities = 231/442 (52%), Positives = 314/442 (71%), Gaps = 12/442 (3%)
 Frame = -1

Query  1537  PSIAFTVTRQNPELVAPADPTPREIKYLSDIDDQQGLRFQIPVIHFYRNEPSMSGK-DPV  1361
             P     V R   EL+ PA PT +E K+LSDIDDQ+GLRFQ+PVI  Y++ PS++   +PV
Sbjct  3     PFSVLQVKRLQLELITPAKPTLQEAKFLSDIDDQEGLRFQVPVIMCYKDNPSLNKNCNPV  62

Query  1360  QVIRQALAKALVFFYPFAGRLREGPGRKLMVDCTGEGVMFIEADADATLQHFAVGGELKP  1181
             +VIR+AL++ALV++YP AGRL+EGP RKLMVDC GEG++F+EA AD TL+   +G ++ P
Sbjct  63    KVIREALSRALVYYYPLAGRLKEGPNRKLMVDCNGEGILFVEASADVTLEQ--LGDKILP  120

Query  1180  PFPCFDQLLYNVPGSAEILNCPLFLIQVTRLRCGGFIFALRLNHSMSDACGLVHFLNTIA  1001
             P P  ++ L+N PGS  I+ CPL L+QVT L CGGFI ALR+NH+M DA GL+ FL  IA
Sbjct  121   PCPLLEEFLFNFPGSDGIIGCPLLLVQVTCLTCGGFILALRVNHTMCDAPGLLLFLTAIA  180

Query  1000  EIARGAEAPSVYPVWQREFFDARNPPRITCTHFEYEEE-PAADSMVTNIPLDNLVHRSFF  824
             E+ARGA APS+ PVW+RE   +R+PPRITC H EYE+    +D +  +    N+V RSF+
Sbjct  181   EMARGAHAPSILPVWERELLFSRDPPRITCAHHEYEDVIDHSDGLYASSNQSNMVQRSFY  240

Query  823   FGPTEISALRSSLPPHLLK-CSRFEVVTACLWRCRTIAMEFDPNDEVRIFGTVNARPRLK  647
             FG  E+  LR  +PPHL+  CS F+++TACLW+CRT+A+  +P + VR+   VNAR +  
Sbjct  241   FGAKEMRVLRKQIPPHLISTCSTFDLITACLWKCRTLALNINPKEAVRVSCIVNARGKHN  300

Query  646   NPPVPNGYYGNAFVYPGAKSTAGKVSKSPLSHALELVTNIKSSFTEEYIKSVADLMILKG  467
             N  +P GYYGNAF +P A S A  + K+PL +ALELV   K++  EEY++SVADL++L+G
Sbjct  301   NVRLPLGYYGNAFAFPAAISKAEPLCKNPLGYALELVKKAKATMNEEYLRSVADLLVLRG  360

Query  466   RPTFTLQGTF-IVSDVTRVGFPEIDMGWGQSVFggpahggvggipGLITFYIPYEDNKGD  290
             RP ++  G++ IVSD TR GF +++ GWGQ VF      G      LI+FY+ +++N  D
Sbjct  361   RPQYSSTGSYLIVSDNTRAGFGDVNFGWGQPVF-----AGPAKALDLISFYVQHKNNTED  415

Query  289   HGILVPMCLPAIAMGKFVKELE  224
              GILVPMCLP+ AM +F +ELE
Sbjct  416   -GILVPMCLPSSAMERFQQELE  436



>ref|XP_010941427.1| PREDICTED: benzyl alcohol O-benzoyltransferase-like, partial 
[Elaeis guineensis]
Length=412

 Score =   471 bits (1212),  Expect = 2e-158, Method: Compositional matrix adjust.
 Identities = 229/394 (58%), Positives = 293/394 (74%), Gaps = 7/394 (2%)
 Frame = -1

Query  1549  MASQPSIAFTVTRQNPELVAPADPTPREIKYLSDIDDQQGLRFQIPVIHFYRNEPSMSGK  1370
             MAS  S+ FTV+R+ P LVAPA PTP E K LSDIDDQ+GLRF    IHFYRN+PS  G+
Sbjct  1     MAS--SLIFTVSRREPVLVAPAKPTPHEFKPLSDIDDQEGLRFYSSGIHFYRNDPSKEGR  58

Query  1369  DPVQVIRQALAKALVFFYPFAGRLREGPGRKLMVDCTGEGVMFIEADADATLQHFAVGGE  1190
             DP +VI++AL K LV ++P AGRLRE PGRKL+V+CTGEGV+F+EA+AD  L+ F  G  
Sbjct  59    DPARVIKEALGKVLVHYHPIAGRLREWPGRKLVVECTGEGVVFVEANADVRLEEF--GNA  116

Query  1189  LKPPFPCFDQLLYNVPGSAEILNCPLFLIQVTRLRCGGFIFALRLNHSMSDACGLVHFLN  1010
               PPFPC ++LLY+       L+CPL  +QVTRL+CGGFIF LR+NH++ DA G+V FL 
Sbjct  117   PSPPFPCVEELLYDTESLGSDLDCPLLFVQVTRLKCGGFIFGLRINHTIMDAPGVVQFLT  176

Query  1009  TIAEIARGAEAPSVYPVWQREFFDARNPPRITCTHFEYEEEPAADSMVTNIPLDNLVHRS  830
              + E+ARGA AP+V PVW+RE   AR PPRIT  H EYE   A D M T +PL ++V+RS
Sbjct  177   ALGEMARGAAAPTVPPVWERELLTARCPPRITHVHPEYEFSAATDVM-TTVPLSDMVNRS  235

Query  829   FFFGPTEISALRSSLPPHLL-KCSRFEVVTACLWRCRTIAMEFDPNDEVRIFGTVNARPR  653
             FFFGP EISALR   PPHL    SRFE++TA +WR RT A+ +DP+DEVR+   VNAR R
Sbjct  236   FFFGPREISALRKYAPPHLRPTSSRFELITASVWRSRTAALGYDPDDEVRVLFVVNARGR  295

Query  652   LKNPPVPNGYYGNAFVYPGAKSTAGKVSKSPLSHALELVTNIKSSFTEEYIKSVADLMIL  473
              ++PP+P+GYYGNA  +P A S AG++ +SPL +ALE+V   K+S T+EY++SVADLM+L
Sbjct  296   -RSPPLPSGYYGNAMAFPVASSAAGRLRRSPLGYALEVVKKAKASVTDEYMQSVADLMVL  354

Query  472   KGRPTFTLQGTFIVSDVTRVGFPEIDMGWGQSVF  371
             +GRP F +  T++VSDVTR GF  +D GWG+ V+
Sbjct  355   QGRPHFAMARTYLVSDVTRAGFEAVDFGWGEGVY  388



>ref|XP_004294711.1| PREDICTED: benzyl alcohol O-benzoyltransferase-like [Fragaria 
vesca subsp. vesca]
Length=461

 Score =   473 bits (1216),  Expect = 3e-158, Method: Compositional matrix adjust.
 Identities = 243/450 (54%), Positives = 311/450 (69%), Gaps = 21/450 (5%)
 Frame = -1

Query  1549  MASQPSIAFTVTRQNPELVAPADPTPREIKYLSDIDDQQGLRFQIPVIHFYRNEPSMSG-  1373
             M+   S  F V R  P+LV PA PTPREIK LSDIDDQ+GLRFQIPVI   +N PSMS  
Sbjct  4     MSLPSSPVFQVYRMQPQLVTPARPTPREIKMLSDIDDQEGLRFQIPVIIACKNNPSMSNR  63

Query  1372  KDPVQVI-RQALAKALVFFYPFAGRLREGPGRKLMVDCTGEGVMFIEADADATLQHFAVG  1196
             KDPV VI R+A+++ALV++YP AGRLREGP RKLMVDC GEGV+F+EA AD TL+    G
Sbjct  64    KDPVPVIIREAISRALVYYYPLAGRLREGPNRKLMVDCNGEGVLFVEAKADVTLEQL--G  121

Query  1195  GELKPPFPCFDQLLYNVPGSAEILNCPLFLIQVTRLRCGGFIFALRLNHSMSDACGLVHF  1016
               ++PP P  +  L +VPGS  IL  PL L QVT LRCGGFI ALRLNH+M DA GLV F
Sbjct  122   DAIRPPCPFLEGFLCDVPGSDGILGYPLLLFQVTILRCGGFILALRLNHTMCDAPGLVQF  181

Query  1015  LNTIAEIARGAEAPSVYPVWQREFFDARNPPRITCTHFEYEE-----EPAADSMVTNIPL  851
             LNT+ E+A+G +APS+ PVW+RE  +AR+PPRITCTH EYEE     +P++ +  T    
Sbjct  182   LNTVGEMAQGKDAPSIPPVWKREVLNARDPPRITCTHHEYEETIDYSDPSSAATAT----  237

Query  850   DNLVHRSFFFGPTEISALRSSLPPHLLKCSRFEVVTACLWRCRTIAMEFDPNDEVRIFGT  671
               +V +SF+FGP E+ AL+  LP HL  CS F+++T+CLW+CRT A+E  P   VR+   
Sbjct  238   --MVEQSFYFGPKEMKALKKHLPLHLSACSTFDLMTSCLWKCRTAALELHPKQVVRVSCL  295

Query  670   VNARPRLKNPPVPNGYYGNAFVYPGAKSTAGKVSKSPLSHALELVTNIKSSFTEEYIKSV  491
             VNAR +  N  +P GYYGNAF YP A S   ++ +SPL +A+ELV   K+   EEY++SV
Sbjct  296   VNARGKGNNLHLPLGYYGNAFAYPAAVSEVKQLCESPLGYAVELVMKAKAEVNEEYMRSV  355

Query  490   ADLMILKGRPTFTLQGTFIVSDVTRVGFPEIDMGWGQSVFggpahggvggipGLITFYIP  311
             ADLM+L+GRP +T  G F+VSD  R G  E+++GWG+ VF GP           I+FY+ 
Sbjct  356   ADLMVLRGRPPYTSAGNFLVSDNRRTGLGEVNLGWGKPVFSGPPKALSN-----ISFYVQ  410

Query  310   YEDNKGDHGILVPMCLPAIAMGKFVKELEN  221
             ++  K D GILV +CLP  +M +F +ELE 
Sbjct  411   HKKEKED-GILVSVCLPLWSMKRFQQELEK  439



>ref|NP_001064997.1| Os10g0503300 [Oryza sativa Japonica Group]
 dbj|BAF26911.1| Os10g0503300 [Oryza sativa Japonica Group]
 gb|EAY79120.1| hypothetical protein OsI_34226 [Oryza sativa Indica Group]
 gb|EAZ16606.1| hypothetical protein OsJ_32078 [Oryza sativa Japonica Group]
Length=475

 Score =   473 bits (1217),  Expect = 3e-158, Method: Compositional matrix adjust.
 Identities = 256/453 (57%), Positives = 331/453 (73%), Gaps = 12/453 (3%)
 Frame = -1

Query  1546  ASQPSIAFTVTRQNPELVAPADPTPREIKYLSDIDDQQGLRFQIPVIHFYRNEPSMSGKD  1367
             ++  ++ FTV R+  ELVAPA PTPRE+K LSDIDDQ GLRF IPVI FYR   +M G+D
Sbjct  4     STAAALKFTVRRKPAELVAPAGPTPRELKKLSDIDDQDGLRFHIPVIQFYRRSAAMGGRD  63

Query  1366  PVQVIRQALAKALVFFYPFAGRLREGPGRKLMVDCTGEGVMFIEADADATLQHFAVGGEL  1187
             P  VIR A+A+ALV +YPFAGRLRE  GRKL VDCTGEGV+FIEADAD  L+HF  GG L
Sbjct  64    PAPVIRAAVARALVSYYPFAGRLRELEGRKLAVDCTGEGVLFIEADADVRLEHF--GGAL  121

Query  1186  KPPFPCFDQLLYNVPGSAEILNCPLFLIQVTRLRCGGFIFALRLNHSMSDACGLVHFLNT  1007
             +PPFPC ++L+++VPGS+E+L  PL L QVTRL CGGFI A+RL+H+M+DA GLV FL  
Sbjct  122   QPPFPCLEELVFDVPGSSEVLGSPLLLFQVTRLACGGFILAVRLHHTMADAQGLVQFLGA  181

Query  1006  IAEIAR--GAEAPSVYPVWQREFFDARNPPRITCTHFEYEEEPAADSMVTNIPLDNLVHR  833
             +AE+AR   A APSV PVW RE  +AR+PPR    H EY+E P  D+  T IPLD++ HR
Sbjct  182   VAEMARGGAAAAPSVAPVWGREMLEARSPPRPAFAHREYDEVP--DTKGTIIPLDDMAHR  239

Query  832   SFFFGPTEISALRSSLPPHLL-KCSRFEVVTACLWRCRTIAMEFDPNDEVRIFGTVNARP  656
             SFFFG  E++A+RS L P +  + + FEV+T CLWRCRT A+  D ++ +R+   VNAR 
Sbjct  240   SFFFGAREVAAVRSHLAPGIRERATTFEVLTGCLWRCRTAALAPDDDEVMRMICIVNARG  299

Query  655   RLKNPP----VPNGYYGNAFVYPGAKSTAGKVSKSPLSHALELVTNIKSSFTEEYIKSVA  488
               K+      +P GYYGNAF +P A +TAG++   PL +A+ELV   K   + EY++SVA
Sbjct  300   GGKSGGGAGMIPEGYYGNAFAFPVAVATAGELRARPLGYAVELVRAAKGEVSVEYMRSVA  359

Query  487   DLMILKGRPTFTLQGTFIVSDVTRVGFPEIDMGWGQSVFggpahggvggipGLITFYIPY  308
             DLM+ +GRP FT+   ++VSDVT+ GF ++D GWG+  +GGPA GGVG IPG+ +F IP+
Sbjct  360   DLMVQRGRPHFTVVRAYLVSDVTKAGFGDLDFGWGKPAYGGPAKGGVGAIPGVASFLIPF  419

Query  307   EDNKGDHGILVPMCLPAIAMGKFVKELENCLMK  209
             ++ KG+ GI+VPMCLP  AM KFV+E+   LMK
Sbjct  420   KNAKGEDGIVVPMCLPGPAMDKFVEEMGK-LMK  451



>ref|XP_009365778.1| PREDICTED: methanol O-anthraniloyltransferase-like [Pyrus x bretschneideri]
Length=454

 Score =   471 bits (1212),  Expect = 1e-157, Method: Compositional matrix adjust.
 Identities = 234/439 (53%), Positives = 309/439 (70%), Gaps = 16/439 (4%)
 Frame = -1

Query  1537  PSIAFTVTRQNPELVAPADPTPREIKYLSDIDDQQGLRFQIPVIHFYRNEPSMS-GKDPV  1361
             P     V R  PEL+ PA PTP+E K+LSDIDDQ+GLRFQ+PVI  Y++ PS++  ++PV
Sbjct  3     PPSVLQVKRLQPELITPAKPTPQETKFLSDIDDQEGLRFQVPVIMCYKDNPSLNENRNPV  62

Query  1360  QVIRQALAKALVFFYPFAGRLREGPGRKLMVDCTGEGVMFIEADADATLQHFAVGGELKP  1181
             +VIR+AL++ALV++YP AGRLREGP RKLMVDC GEG++F+EA AD TL+   +G ++ P
Sbjct  63    KVIREALSRALVYYYPLAGRLREGPNRKLMVDCNGEGILFVEASADVTLEQ--LGDKILP  120

Query  1180  PFPCFDQLLYNVPGSAEILNCPLFLIQVTRLRCGGFIFALRLNHSMSDACGLVHFLNTIA  1001
             P P  D+ L+N PGS  I+ CPL L+QVT L CGGFI AL LNH+M DA GL+ FL  +A
Sbjct  121   PCPLLDEFLFNFPGSDGIIGCPLLLVQVTCLTCGGFILALCLNHTMCDAAGLLLFLTAVA  180

Query  1000  EIARGAEAPSVYPVWQREFFDARNPPRITCTHFEYEEEPAADSMVTNIP---LDNLVHRS  830
             E+A+GA APS+ PVW+REF  AR+PPRITC H EYE+    D    + P     N+V +S
Sbjct  181   EMAKGAHAPSILPVWEREFLFARDPPRITCAHHEYED--VIDHSNGSYPSSNQSNMVQQS  238

Query  829   FFFGPTEISALRSSLPPHLLK-CSRFEVVTACLWRCRTIAMEFDPNDEVRIFGTVNARPR  653
             F+FG  E+  LR  +PP L+  CS F+++TACLW+CRT+A++ +P   VRI   VNAR +
Sbjct  239   FYFGAKEMRVLRKQIPPQLISTCSTFDLITACLWKCRTLALKINPKQAVRISCIVNARGK  298

Query  652   LKNPPVPNGYYGNAFVYPGAKSTAGKVSKSPLSHALELVTNIKSSFTEEYIKSVADLMIL  473
               N  +P GYYGNAF +P A S A  + K+PL +ALELV   K++  EEY++SVADLM+L
Sbjct  299   HHNVHLPLGYYGNAFAFPAAVSKAEPLCKNPLGYALELVKKAKATMNEEYLRSVADLMVL  358

Query  472   KGRPTFTLQGT-FIVSDVTRVGFPEIDMGWGQSVFggpahggvggipGLITFYIPYEDNK  296
             +GRP ++  G+ FIVSD TR GF ++D GWGQ VF      G      LI+FY+ ++ + 
Sbjct  359   RGRPQYSSTGSYFIVSDNTRAGFGDVDFGWGQPVF-----AGPAKALDLISFYVQHKKDT  413

Query  295   GDHGILVPMCLPAIAMGKF  239
              D GILVPMCLP  AM +F
Sbjct  414   ED-GILVPMCLPFSAMERF  431



>gb|AAG13627.1|AC078840_18 putative hypersensitivity-related (hsr)protein [Oryza sativa 
Japonica Group]
 gb|ABB47848.2| benzoyl-CoA:benzyl alcohol/phenylethanol benzoyltransferase, 
putative, expressed [Oryza sativa Japonica Group]
Length=553

 Score =   474 bits (1221),  Expect = 1e-157, Method: Compositional matrix adjust.
 Identities = 256/453 (57%), Positives = 331/453 (73%), Gaps = 12/453 (3%)
 Frame = -1

Query  1546  ASQPSIAFTVTRQNPELVAPADPTPREIKYLSDIDDQQGLRFQIPVIHFYRNEPSMSGKD  1367
             ++  ++ FTV R+  ELVAPA PTPRE+K LSDIDDQ GLRF IPVI FYR   +M G+D
Sbjct  4     STAAALKFTVRRKPAELVAPAGPTPRELKKLSDIDDQDGLRFHIPVIQFYRRSAAMGGRD  63

Query  1366  PVQVIRQALAKALVFFYPFAGRLREGPGRKLMVDCTGEGVMFIEADADATLQHFAVGGEL  1187
             P  VIR A+A+ALV +YPFAGRLRE  GRKL VDCTGEGV+FIEADAD  L+HF  GG L
Sbjct  64    PAPVIRAAVARALVSYYPFAGRLRELEGRKLAVDCTGEGVLFIEADADVRLEHF--GGAL  121

Query  1186  KPPFPCFDQLLYNVPGSAEILNCPLFLIQVTRLRCGGFIFALRLNHSMSDACGLVHFLNT  1007
             +PPFPC ++L+++VPGS+E+L  PL L QVTRL CGGFI A+RL+H+M+DA GLV FL  
Sbjct  122   QPPFPCLEELVFDVPGSSEVLGSPLLLFQVTRLACGGFILAVRLHHTMADAQGLVQFLGA  181

Query  1006  IAEIAR--GAEAPSVYPVWQREFFDARNPPRITCTHFEYEEEPAADSMVTNIPLDNLVHR  833
             +AE+AR   A APSV PVW RE  +AR+PPR    H EY+E P  D+  T IPLD++ HR
Sbjct  182   VAEMARGGAAAAPSVAPVWGREMLEARSPPRPAFAHREYDEVP--DTKGTIIPLDDMAHR  239

Query  832   SFFFGPTEISALRSSLPPHLL-KCSRFEVVTACLWRCRTIAMEFDPNDEVRIFGTVNARP  656
             SFFFG  E++A+RS L P +  + + FEV+T CLWRCRT A+  D ++ +R+   VNAR 
Sbjct  240   SFFFGAREVAAVRSHLAPGIRERATTFEVLTGCLWRCRTAALAPDDDEVMRMICIVNARG  299

Query  655   RLKNPP----VPNGYYGNAFVYPGAKSTAGKVSKSPLSHALELVTNIKSSFTEEYIKSVA  488
               K+      +P GYYGNAF +P A +TAG++   PL +A+ELV   K   + EY++SVA
Sbjct  300   GGKSGGGAGMIPEGYYGNAFAFPVAVATAGELRARPLGYAVELVRAAKGEVSVEYMRSVA  359

Query  487   DLMILKGRPTFTLQGTFIVSDVTRVGFPEIDMGWGQSVFggpahggvggipGLITFYIPY  308
             DLM+ +GRP FT+   ++VSDVT+ GF ++D GWG+  +GGPA GGVG IPG+ +F IP+
Sbjct  360   DLMVQRGRPHFTVVRAYLVSDVTKAGFGDLDFGWGKPAYGGPAKGGVGAIPGVASFLIPF  419

Query  307   EDNKGDHGILVPMCLPAIAMGKFVKELENCLMK  209
             ++ KG+ GI+VPMCLP  AM KFV+E+   LMK
Sbjct  420   KNAKGEDGIVVPMCLPGPAMDKFVEEMGK-LMK  451



>ref|XP_010453955.1| PREDICTED: (Z)-3-hexen-1-ol acetyltransferase-like [Camelina 
sativa]
Length=461

 Score =   471 bits (1212),  Expect = 1e-157, Method: Compositional matrix adjust.
 Identities = 245/442 (55%), Positives = 318/442 (72%), Gaps = 7/442 (2%)
 Frame = -1

Query  1534  SIAFTVTRQNPELVAPADPTPREIKYLSDIDDQQGLRFQIPVIHFYRNEPSMSGKDPVQV  1355
             S+ F V RQ PELV+PA+PTPRE+K LSDIDDQ+GLRF IP I FYR+ P  +  DPV V
Sbjct  4     SLTFKVHRQKPELVSPANPTPRELKLLSDIDDQEGLRFHIPTIFFYRHNPK-AYSDPVAV  62

Query  1354  IRQALAKALVFFYPFAGRLREGPGRKLMVDCTGEGVMFIEADADATLQHFAVGGELKPPF  1175
             IR+ALA+ LV++YPFAGRLREGP RKL+VDCTGEGV+FIEADAD T+  F     LKPPF
Sbjct  63    IRRALAETLVYYYPFAGRLREGPNRKLVVDCTGEGVLFIEADADVTVLEFEEKDALKPPF  122

Query  1174  PCFDQLLYNVPGSAEILNCPLFLIQVTRLRCGGFIFALRLNHSMSDACGLVHFLNTIAEI  995
              CF++LL+ V GS+E+LN PL L+QVTRL+CGGFIFA+R+NH MSDA GL  FL T+ + 
Sbjct  123   RCFEELLFGVEGSSEVLNSPLMLMQVTRLKCGGFIFAVRINHVMSDAFGLSLFLKTMCDF  182

Query  994   ARGAEAPSVYPVWQREFFDARNPPRITCTHFEYEEEPAADSMVTNIPLDNLVHRSFFFGP  815
              RG  AP+V PVW+R    A  P R++  H EY++ P  D+   +   DNLV RSFFFG 
Sbjct  183   VRGYHAPTVPPVWERHRLSATVPSRVSHAHREYDDMPVTDTEHGS-KGDNLVDRSFFFGH  241

Query  814   TEISALRSSLPPHLL-KCSRFEVVTACLWRCRTIAMEFDPNDEVRIFGTVNARPRLKNPP  638
              E+SA+R  LPP+L+ + +  E +T+ LW  RT+A++ DPN E+R+   VNAR +LK PP
Sbjct  242   REMSAIRRLLPPNLVNRSTDMETLTSFLWCYRTVAIQPDPNKEMRLIFIVNARSKLKTPP  301

Query  637   VPNGYYGNAFVYPGAKSTAGKVSKSPLSHALELVTNIKSSFTEEYIKSVADLMILKGRPT  458
             +  GYYGNAF +P A +TAG+++K PL  AL L    KSS TEEY++S+A+LM+ KGRP+
Sbjct  302   LSPGYYGNAFAFPVAITTAGELTKKPLDFALRLAKEAKSSVTEEYMRSLANLMVTKGRPS  361

Query  457   FTLQGTFIVSDVTRVGFPEIDMG-WGQSVFggpahggvggipGLITFYIPYEDNKGDHGI  281
             F+  G ++VSDV R+ F +ID G WG+ V+GG     V   PG  +FY+  E   G+ GI
Sbjct  362   FSSDGAYLVSDV-RI-FSDIDFGIWGKPVYGGIGTAKVTDFPG-SSFYVSAEKRNGERGI  418

Query  280   LVPMCLPAIAMGKFVKELENCL  215
             +VP+CLP  AM +FVKELE+  
Sbjct  419   IVPVCLPEKAMQRFVKELESVF  440



>ref|XP_008373467.1| PREDICTED: methanol O-anthraniloyltransferase-like [Malus domestica]
Length=459

 Score =   470 bits (1210),  Expect = 2e-157, Method: Compositional matrix adjust.
 Identities = 234/442 (53%), Positives = 312/442 (71%), Gaps = 12/442 (3%)
 Frame = -1

Query  1537  PSIAFTVTRQNPELVAPADPTPREIKYLSDIDDQQGLRFQIPVIHFYRNEPSMSGK-DPV  1361
             PS    V R  PEL+ PA PTP E K+LSD+DDQ+GLRFQ+P+I  Y++ PS++   +PV
Sbjct  3     PSSVIQVKRLQPELITPAKPTPHETKFLSDMDDQEGLRFQVPIIMCYKDNPSLNKHHNPV  62

Query  1360  QVIRQALAKALVFFYPFAGRLREGPGRKLMVDCTGEGVMFIEADADATLQHFAVGGELKP  1181
             +VIR+AL++ALV++YP AGRLREGP RKLMVDC GEG++FIEA AD TL+   +G ++ P
Sbjct  63    KVIREALSRALVYYYPLAGRLREGPNRKLMVDCNGEGILFIEAFADVTLEQ--LGEKILP  120

Query  1180  PFPCFDQLLYNVPGSAEILNCPLFLIQVTRLRCGGFIFALRLNHSMSDACGLVHFLNTIA  1001
               P  ++ LYN PGS  I++CPL L+QVT L CGGFI ALR+NH+M DA GL+ FL  IA
Sbjct  121   HCPPLEEFLYNFPGSDRIISCPLLLVQVTCLICGGFILALRINHTMCDAPGLLLFLTAIA  180

Query  1000  EIARGAEAPSVYPVWQREFFDARNPPRITCTHFEYEEE-PAADSMVTNIPLDNLVHRSFF  824
             E+ARGA APS+ PVW+RE   AR+PPRITC H EYE+    ++   T+    N+V RSF+
Sbjct  181   EMARGAHAPSILPVWERELLFARDPPRITCVHHEYEDVIDHSNGSYTSSNQSNMVQRSFY  240

Query  823   FGPTEISALRSSLPPHLLK-CSRFEVVTACLWRCRTIAMEFDPNDEVRIFGTVNARPRLK  647
             FG  E+  LR  +PPHL+  CS F+++TACLW+CRT+A++ +P   VR    VNAR +  
Sbjct  241   FGAKEMRVLRKQIPPHLISTCSTFDLITACLWKCRTLALKINPKQAVRXSCIVNARGKHH  300

Query  646   NPPVPNGYYGNAFVYPGAKSTAGKVSKSPLSHALELVTNIKSSFTEEYIKSVADLMILKG  467
             N  +P GYYGNAF +P A S A  + K+PL +ALELV   K++  EEY++SVADL++L+G
Sbjct  301   NVRLPLGYYGNAFAFPXAVSKAEPLCKNPLGYALELVKKAKATMNEEYLRSVADLLVLRG  360

Query  466   RPTFTLQGT-FIVSDVTRVGFPEIDMGWGQSVFggpahggvggipGLITFYIPYEDNKGD  290
             RP ++   + FIVSD TR GF +++ GWG+ V       G      LI+FYI +++N  D
Sbjct  361   RPQYSSTXSYFIVSDTTRAGFGDVNFGWGRPVI-----AGPAKALDLISFYIQHKNNTXD  415

Query  289   HGILVPMCLPAIAMGKFVKELE  224
              GILVPMCLP  AM +F +ELE
Sbjct  416   -GILVPMCLPFSAMERFQQELE  436



>ref|XP_010420481.1| PREDICTED: (Z)-3-hexen-1-ol acetyltransferase-like [Camelina 
sativa]
Length=461

 Score =   470 bits (1210),  Expect = 3e-157, Method: Compositional matrix adjust.
 Identities = 244/442 (55%), Positives = 317/442 (72%), Gaps = 7/442 (2%)
 Frame = -1

Query  1534  SIAFTVTRQNPELVAPADPTPREIKYLSDIDDQQGLRFQIPVIHFYRNEPSMSGKDPVQV  1355
             S+ F V RQ PELV+PA+PTPRE+K LSDIDDQ+GLRF IP I FYR+ P  +  DPV V
Sbjct  4     SLTFKVHRQKPELVSPANPTPRELKLLSDIDDQEGLRFHIPTIFFYRHNPK-AYSDPVAV  62

Query  1354  IRQALAKALVFFYPFAGRLREGPGRKLMVDCTGEGVMFIEADADATLQHFAVGGELKPPF  1175
             IR+ALA+ LV++YPFAGRLREGP RKL VDCTGEGV+FIEA+AD TL  F     LKPPF
Sbjct  63    IRRALAETLVYYYPFAGRLREGPNRKLAVDCTGEGVLFIEANADVTLVEFEEKDALKPPF  122

Query  1174  PCFDQLLYNVPGSAEILNCPLFLIQVTRLRCGGFIFALRLNHSMSDACGLVHFLNTIAEI  995
             PCF++LL++V GS+E+LN PL L+QVTRL+CG FIFA+R+NH+MSDA GL  FL T+ + 
Sbjct  123   PCFEELLFDVEGSSEVLNTPLMLMQVTRLKCGSFIFAVRINHAMSDAVGLSLFLKTMCDF  182

Query  994   ARGAEAPSVYPVWQREFFDARNPPRITCTHFEYEEEPAADSMVTNIPLDNLVHRSFFFGP  815
             ARG  AP+V PVW+R    A  P R++  H EY+E     +  +    D+LV RSFFFG 
Sbjct  183   ARGYHAPTVPPVWERHRLSATLPLRVSHAHREYDEMRVISTEHSG-KGDDLVDRSFFFGH  241

Query  814   TEISALRSSLPPHLL-KCSRFEVVTACLWRCRTIAMEFDPNDEVRIFGTVNARPRLKNPP  638
              E+SA+R  LPP+L+ + +  E +T+ LWR RT+A++ DPN E+R+   VNAR +LK  P
Sbjct  242   REMSAIRRLLPPNLVNRSTDMETLTSFLWRYRTVAIQPDPNKEMRLIFIVNARSKLKTSP  301

Query  637   VPNGYYGNAFVYPGAKSTAGKVSKSPLSHALELVTNIKSSFTEEYIKSVADLMILKGRPT  458
             +  GYYGNAF +P A +TAG+++K PL  AL LV   KSS TEEY++S+A+LM+ KGRP+
Sbjct  302   LSPGYYGNAFAFPVAITTAGELTKKPLEFALRLVKEAKSSVTEEYMRSLANLMVTKGRPS  361

Query  457   FTLQGTFIVSDVTRVGFPEIDMG-WGQSVFggpahggvggipGLITFYIPYEDNKGDHGI  281
             F+  G ++VSDV R+ F +ID G WG+ V+ G     V   PG  +FY+  E   G+ GI
Sbjct  362   FSSDGAYLVSDV-RI-FSDIDFGIWGKPVYSGIGKARVTDFPG-SSFYVSAEKRNGEIGI  418

Query  280   LVPMCLPAIAMGKFVKELENCL  215
             +VP+CLP   M KFVKELE+  
Sbjct  419   IVPVCLPEKTMQKFVKELESVF  440



>gb|AJD18611.1| alcohol acyltransferase [Pyrus ussuriensis]
Length=459

 Score =   470 bits (1209),  Expect = 4e-157, Method: Compositional matrix adjust.
 Identities = 229/441 (52%), Positives = 313/441 (71%), Gaps = 12/441 (3%)
 Frame = -1

Query  1537  PSIAFTVTRQNPELVAPADPTPREIKYLSDIDDQQGLRFQIPVIHFYRNEPSMS-GKDPV  1361
             P     V R  PEL+ PA  TP+E K+LSDIDDQ+ LRF +PVI  Y++ PS++  ++PV
Sbjct  3     PLSVLQVKRLQPELITPAKSTPQETKFLSDIDDQEFLRFHVPVIMCYKDNPSLNKNRNPV  62

Query  1360  QVIRQALAKALVFFYPFAGRLREGPGRKLMVDCTGEGVMFIEADADATLQHFAVGGELKP  1181
             +VIR+AL++ALV++YP AGRLREGP RKL+V+C GEG++F+EA A+ TL+   +G ++ P
Sbjct  63    KVIREALSRALVYYYPLAGRLREGPNRKLVVNCNGEGILFVEASANVTLEQ--LGDKILP  120

Query  1180  PFPCFDQLLYNVPGSAEILNCPLFLIQVTRLRCGGFIFALRLNHSMSDACGLVHFLNTIA  1001
             P P  ++ L+N PGS  I+ CPL L+QVT L CGGFI ALRLNH+M DA GL+ FL  +A
Sbjct  121   PCPLLEEFLFNFPGSDGIIGCPLLLVQVTCLTCGGFILALRLNHTMCDATGLLLFLTAVA  180

Query  1000  EIARGAEAPSVYPVWQREFFDARNPPRITCTHFEYEEE-PAADSMVTNIPLDNLVHRSFF  824
             E+ARGA APS+ PVW+RE   AR+PPRITC H EYE+    +D   +     N+V RSF+
Sbjct  181   EMARGAHAPSILPVWERELLFARDPPRITCAHHEYEDVIDHSDDSYSFSNQSNMVQRSFY  240

Query  823   FGPTEISALRSSLPPHLLK-CSRFEVVTACLWRCRTIAMEFDPNDEVRIFGTVNARPRLK  647
             FG  E+  LR  +PPHL+  CS F+++TACLW+CRT+A++ +P   VR+   VNAR +  
Sbjct  241   FGAKEMRVLRKQIPPHLISTCSTFDLITACLWKCRTLALKINPKQVVRVSCVVNARGKHH  300

Query  646   NPPVPNGYYGNAFVYPGAKSTAGKVSKSPLSHALELVTNIKSSFTEEYIKSVADLMILKG  467
             N  +P GYYGNAF +P A S A  + K+PL +ALELV   K++  EEY++SVADL++L+G
Sbjct  301   NVRLPLGYYGNAFAFPAAVSKAEPLCKNPLGYALELVKKAKATMNEEYLRSVADLLVLRG  360

Query  466   RPTFTLQGTF-IVSDVTRVGFPEIDMGWGQSVFggpahggvggipGLITFYIPYEDNKGD  290
             RP ++  G++ IVSD TRVGF +++ GWGQ VF      G      LI+FY+ +++N  D
Sbjct  361   RPQYSSTGSYLIVSDNTRVGFGDVNFGWGQPVF-----AGPAKALDLISFYVQHKNNTED  415

Query  289   HGILVPMCLPAIAMGKFVKEL  227
              GILVPMCLP+ AM +F +EL
Sbjct  416   -GILVPMCLPSSAMKRFQQEL  435



>gb|AIC83790.1| alcohol acyltransferase [Actinidia deliciosa]
Length=456

 Score =   469 bits (1208),  Expect = 4e-157, Method: Compositional matrix adjust.
 Identities = 247/444 (56%), Positives = 303/444 (68%), Gaps = 19/444 (4%)
 Frame = -1

Query  1537  PSIAFTVTRQNPELVAPADPTPREIKYLSDIDDQQGLRFQIPVIHFYRNEPSMSGKDPVQ  1358
             PS+ FTV R+ P LV P+ PTPRE+K LSDIDDQ+GLRFQ+PVI FY+ + S  G+DPV+
Sbjct  6     PSLVFTVRRKEPILVLPSKPTPRELKQLSDIDDQEGLRFQVPVIMFYKRKLSTEGEDPVK  65

Query  1357  VIRQALAKALVFFYPFAGRLREGPGRKLMVDCTGEGVMFIEADADATLQHFAVGGELKPP  1178
             VIR+ALA+AL F+YPFAGRL EGP RKLMVDCT EGV+FIEADAD  L      G+   P
Sbjct  66    VIREALAEALAFYYPFAGRLIEGPNRKLMVDCTSEGVLFIEADADIELNQLI--GDTIDP  123

Query  1177  FPCFDQLLYNVPGSAEILNCPLFLIQVTRLRCGGFIFALRLNHSMSDACGLVHFLNTIAE  998
                 D+LL++VPGS  IL CPL LIQVTR RCGG+ FA+RLNH+MSD  GLV FL TIAE
Sbjct  124   GTYLDELLHDVPGSEGILGCPLLLIQVTRFRCGGWAFAIRLNHTMSDTLGLVQFLTTIAE  183

Query  997   IARGAE-APSVYPVWQREFFDARNPPRITCTHFEYEEEPAADSMVTNIPLDN---LVHRS  830
               RGAE APSV PVWQREF  AR PP I   H EYE+      ++   P DN   + H+S
Sbjct  184   FTRGAEGAPSVPPVWQREFLAARQPPFIPFQHHEYEQ------VIDTTPDDNKKSMTHKS  237

Query  829   FFFGPTEISALRSSLP-PHLLKCSRFEVVTACLWRCRTIAMEFDPNDEVRIFGTVNARPR  653
             FFFGP EI A+RS LP  H    S F+V+TACLWRCRT A+  DP   VRI    + R +
Sbjct  238   FFFGPKEIRAIRSHLPLHHRSTSSTFDVLTACLWRCRTCALVLDPKKTVRISCAASGRGK  297

Query  652   LKNPPVPNGYYGNAFVYPGAKSTAGKVSKSPLSHALELVTNIKSSFTEEYIKSVADLMIL  473
               +  VP GYYGN   +P     AG +S SPL +A+E V   K+  T EY++SVADLM+ 
Sbjct  298   -HDLHVPRGYYGNVSAFPATVLRAGMISTSPLEYAMEGVKKAKARMTGEYLRSVADLMVT  356

Query  472   KGRPTFTLQGTFIVSDVTRVGFPEIDMGWGQSVFggpahggvggipGLITFYIPYEDNKG  293
             KGRP +T+ G +IVSD+TRVG   ID GWG+ V+     GG      LI+FY  ++DNKG
Sbjct  357   KGRPLYTVVGNYIVSDMTRVGLDTIDFGWGKPVY-----GGPARAFPLISFYGRFKDNKG  411

Query  292   DHGILVPMCLPAIAMGKFVKELEN  221
             + GI+V +CLP  AM +F +EL+ 
Sbjct  412   EDGIVVLICLPEAAMKRFQEELKK  435



>gb|KFK25975.1| hypothetical protein AALP_AA8G187200 [Arabis alpina]
Length=472

 Score =   469 bits (1208),  Expect = 6e-157, Method: Compositional matrix adjust.
 Identities = 242/443 (55%), Positives = 317/443 (72%), Gaps = 7/443 (2%)
 Frame = -1

Query  1534  SIAFTVTRQNPELVAPADPTPREIKYLSDIDDQQGLRFQIPVIHFYRNEPSMSGKDPVQV  1355
             S+ F V R+ PELV+PA PTPRE+K LSDIDDQ+GLRF IP I  YR+ PS +  DPV V
Sbjct  13    SLTFKVHRRQPELVSPAKPTPRELKLLSDIDDQEGLRFHIPTIFVYRHNPS-AYSDPVGV  71

Query  1354  IRQALAKALVFFYPFAGRLREGPGRKLMVDCTGEGVMFIEADADATLQHFAVGGELKPPF  1175
             IR+ALA+ LV++YPFAGRLREGP RKL VDCTGEGV+FIEADAD TL  F     L+PPF
Sbjct  72    IRRALAETLVYYYPFAGRLREGPNRKLTVDCTGEGVLFIEADADVTLVEFEEKDALQPPF  131

Query  1174  PCFDQLLYNVPGSAEILNCPLFLIQVTRLRCGGFIFALRLNHSMSDACGLVHFLNTIAEI  995
             PCFD+LL+++ GS+E+LN PL LIQVTRL+CGGFIFA+R+NH+++DA GL  FL T++E 
Sbjct  132   PCFDELLFDLEGSSEVLNAPLLLIQVTRLKCGGFIFAVRVNHTITDAAGLSRFLKTMSEF  191

Query  994   ARGAEAPSVYPVWQREFFDARNPPRITCTHFEYEEEPAADSMVTNI-PLDNLVHRSFFFG  818
             + G  APSV PVW+R F +AR P R+T  H EY+++ A D+    +   D LV  SFFFG
Sbjct  192   SSGYHAPSVAPVWERHFLNARFPLRVTQAHREYDKQVAIDTESAPVGDGDTLVSHSFFFG  251

Query  817   PTEISALRSSLPPHLL-KCSRFEVVTACLWRCRTIAMEFDPNDEVRIFGTVNARPRLKNP  641
              TE+SA+R  LPP L  + +  E +T+ LWR RTIA+  D   E+R+   VNAR +L+NP
Sbjct  252   ATEMSAIRRLLPPDLANESTDLETLTSFLWRYRTIALLPDSYKEMRVIFIVNARSKLRNP  311

Query  640   PVPNGYYGNAFVYPGAKSTAGKVSKSPLSHALELVTNIKSSFTEEYIKSVADLMILKGRP  461
             P+P+GYYGNAF +P A +TA  +++ PL  A+ LV   KSS TEEY++S+ADLM+ KGRP
Sbjct  312   PLPSGYYGNAFAFPVAIATARDLTEKPLEFAMGLVKEAKSSVTEEYMRSLADLMVTKGRP  371

Query  460   TFTLQGTFIVSDVTRVGFPEIDMG-WGQSVFggpahggvggipGLITFYIPYEDNKGDHG  284
              F   G  ++SDV    F EID G WG+ V+GG    GV G P   +FY+   + +G  G
Sbjct  372   GFLTDGALLISDVR--NFAEIDFGIWGKPVYGGVPLAGVVGFPA-ASFYVLRRNREGKKG  428

Query  283   ILVPMCLPAIAMGKFVKELENCL  215
             I+VP+CLP +AM +F ++L++  
Sbjct  429   IVVPLCLPKMAMQRFAEQLKDVF  451



>ref|XP_009336751.1| PREDICTED: methanol O-anthraniloyltransferase-like [Pyrus x bretschneideri]
Length=459

 Score =   469 bits (1207),  Expect = 6e-157, Method: Compositional matrix adjust.
 Identities = 229/440 (52%), Positives = 310/440 (70%), Gaps = 12/440 (3%)
 Frame = -1

Query  1531  IAFTVTRQNPELVAPADPTPREIKYLSDIDDQQGLRFQIPVIHFYRNEPSMS-GKDPVQV  1355
             +   V R  PEL+ PA PTP+E K+LSD+DDQ+GLRFQ+P+I  Y++  S++  ++P++V
Sbjct  5     LVLQVKRLQPELITPAKPTPQETKFLSDVDDQEGLRFQLPIIMCYKDNSSLNENRNPIKV  64

Query  1354  IRQALAKALVFFYPFAGRLREGPGRKLMVDCTGEGVMFIEADADATLQHFAVGGELKPPF  1175
             IR+AL++ALV++YP AGRLREGP R LMVDC GEG++F+EA AD TL+   VG ++ PP 
Sbjct  65    IREALSRALVYYYPLAGRLREGPNRMLMVDCNGEGILFVEASADVTLEQ--VGDKILPPC  122

Query  1174  PCFDQLLYNVPGSAEILNCPLFLIQVTRLRCGGFIFALRLNHSMSDACGLVHFLNTIAEI  995
             P  ++ L+N PGS  I+ CPL L+QVTRL CGGFI ALRLNH+M DA G V FL  +AE+
Sbjct  123   PLLEEFLFNFPGSDGIIGCPLLLVQVTRLTCGGFILALRLNHTMCDAPGFVQFLTAVAEM  182

Query  994   ARGAEAPSVYPVWQREFFDARNPPRITCTHFEYEEE-PAADSMVTNIPLDNLVHRSFFFG  818
             ARGA AP + PVW+RE   AR+PPRITC H EYE+    +D    +    N+V RSF+FG
Sbjct  183   ARGAHAPFILPVWERELLFARDPPRITCAHHEYEDVIDHSDGSYASNNQSNMVQRSFYFG  242

Query  817   PTEISALRSSLPPHLLK-CSRFEVVTACLWRCRTIAMEFDPNDEVRIFGTVNARPRLKNP  641
               E+  LR  +PPHL+  CS F+++TACLW+CRT+A + +P   VR+   VNAR +  N 
Sbjct  243   AKEMRVLRQQIPPHLISTCSTFDLITACLWKCRTLAFKINPKQVVRVSCIVNARGKHNNV  302

Query  640   PVPNGYYGNAFVYPGAKSTAGKVSKSPLSHALELVTNIKSSFTEEYIKSVADLMILKGRP  461
              +P GYYGNAF +P A S A  + K+PL +ALELV   K++  EEY++SVADL++L+GRP
Sbjct  303   RLPLGYYGNAFAFPAAVSKAEPLCKNPLGYALELVKKAKATMNEEYLRSVADLLVLRGRP  362

Query  460   TFTLQGT-FIVSDVTRVGFPEIDMGWGQSVFggpahggvggipGLITFYIPYEDNKGDHG  284
              ++  G+ F+VSD+TRVG  +++ GWGQ VF      G      LI+FYI +++N  D G
Sbjct  363   QYSSTGSNFLVSDITRVGVGDVNFGWGQPVF-----AGPAKAVDLISFYIQHKNNIED-G  416

Query  283   ILVPMCLPAIAMGKFVKELE  224
             ILVPM LP  AM +F + LE
Sbjct  417   ILVPMWLPFSAMERFQQGLE  436



>ref|XP_010492711.1| PREDICTED: (Z)-3-hexen-1-ol acetyltransferase-like [Camelina 
sativa]
Length=461

 Score =   469 bits (1206),  Expect = 9e-157, Method: Compositional matrix adjust.
 Identities = 246/442 (56%), Positives = 320/442 (72%), Gaps = 7/442 (2%)
 Frame = -1

Query  1534  SIAFTVTRQNPELVAPADPTPREIKYLSDIDDQQGLRFQIPVIHFYRNEPSMSGKDPVQV  1355
             S+ F V RQ PELV+PA+PTPRE+K LSDIDDQ+GLRF IP I FYR+ P  +  DPV V
Sbjct  4     SLTFKVHRQKPELVSPANPTPRELKLLSDIDDQEGLRFHIPTIFFYRHNPK-TYSDPVAV  62

Query  1354  IRQALAKALVFFYPFAGRLREGPGRKLMVDCTGEGVMFIEADADATLQHFAVGGELKPPF  1175
             IR+AL + LV++YPFAGRLREGP RKL+VDCTGEGV+FIEADAD TL  F     LKPPF
Sbjct  63    IRRALTETLVYYYPFAGRLREGPNRKLVVDCTGEGVLFIEADADVTLVEFEEKDALKPPF  122

Query  1174  PCFDQLLYNVPGSAEILNCPLFLIQVTRLRCGGFIFALRLNHSMSDACGLVHFLNTIAEI  995
             PCF++LL++V GS+E+LN PL L+QVTRL+CGGFIFA+R+NH+MSDA GL  FL T+ + 
Sbjct  123   PCFEELLFDVEGSSEVLNTPLMLMQVTRLKCGGFIFAVRINHAMSDAFGLSLFLKTMCDF  182

Query  994   ARGAEAPSVYPVWQREFFDARNPPRITCTHFEYEEEPAADSMVTNIPLDNLVHRSFFFGP  815
             ARG  AP+V PVW+R    A  P R++  H EY++ P   +   +    NLV RSFFFG 
Sbjct  183   ARGYHAPTVPPVWERHRLSATVPFRVSHAHREYDDMPVI-ATEHDSKGGNLVDRSFFFGH  241

Query  814   TEISALRSSLPPHLL-KCSRFEVVTACLWRCRTIAMEFDPNDEVRIFGTVNARPRLKNPP  638
              E+SA+R  LPP+L+ + +  E +T+ LW  RT+A++ DPN E+R+   VNAR +LK PP
Sbjct  242   REMSAIRRLLPPNLVNRSTDMETLTSFLWCYRTVAIQPDPNKEMRLIFIVNARSKLKTPP  301

Query  637   VPNGYYGNAFVYPGAKSTAGKVSKSPLSHALELVTNIKSSFTEEYIKSVADLMILKGRPT  458
             +  GYYGNAF +P A +TAG+++K PL   L L    KSS TEEY++S+A+LM+ K RP+
Sbjct  302   LSPGYYGNAFAFPVAIATAGELTKKPLEFGLRLAKEAKSSVTEEYMRSLANLMVTKERPS  361

Query  457   FTLQGTFIVSDVTRVGFPEIDMG-WGQSVFggpahggvggipGLITFYIPYEDNKGDHGI  281
             F+L GT++VSDV R+ F +ID G WG+ V+GG    GV   PG  +FY+  E+  G+ GI
Sbjct  362   FSLDGTYLVSDV-RI-FSDIDFGIWGKPVYGGIGKAGVTDFPG-SSFYVSAENRNGETGI  418

Query  280   LVPMCLPAIAMGKFVKELENCL  215
             +VP+CLP  AM +FVKELE   
Sbjct  419   IVPVCLPEKAMQRFVKELEGVF  440



>ref|NP_001266678.1| 10-deacetylbaccatin III 10-O-acetyltransferase [Zea mays]
 gb|ACG41596.1| 10-deacetylbaccatin III 10-O-acetyltransferase [Zea mays]
Length=458

 Score =   469 bits (1206),  Expect = 9e-157, Method: Compositional matrix adjust.
 Identities = 241/446 (54%), Positives = 314/446 (70%), Gaps = 8/446 (2%)
 Frame = -1

Query  1549  MASQPSIAFTVTRQNPELVAPADPTPREIKYLSDIDDQQGLRFQIPVIHFYRNEPSMSGK  1370
             MAS  S+ FTV R    LV PA  TPRE+K LSDIDDQ GLR  +P+I FYR    M G+
Sbjct  1     MAS--SVKFTVRRGPAVLVTPASATPRELKRLSDIDDQDGLRLHVPIIQFYRQNALMGGR  58

Query  1369  DPVQVIRQALAKALVFFYPFAGRLREGPGRKLMVDCTGEGVMFIEADADATLQHFAVGGE  1190
             +P  VIR A+A+ALV +YPFAGRLRE  GRKL VDCTGEGV+FIEA+AD  L HF  G E
Sbjct  59    EPAPVIRDAIARALVPYYPFAGRLRELEGRKLAVDCTGEGVLFIEAEADVRLDHF--GDE  116

Query  1189  LKPPFPCFDQLLYNVPGSAEILNCPLFLIQVTRLRCGGFIFALRLNHSMSDACGLVHFLN  1010
             L+PPFPC ++L+++VP S+E+L  PL L QVTRL CGGFI  +RL+H+M+DA GLV FL 
Sbjct  117   LQPPFPCLEELIFDVPDSSEVLGSPLLLFQVTRLACGGFILGVRLHHTMADAQGLVQFLG  176

Query  1009  TIAEIARGAEAPSVYPVWQREFFDARNPPRITCTHFEYEEEPAADSMVTNIPLDNLVHRS  830
              +AE+ARGA AP+V PVW RE  +AR+PPR    H EY+E P  D+  + IPLD++VHRS
Sbjct  177   AVAELARGAAAPTVRPVWGRELLEARDPPRPAFAHREYDEVP--DTKGSIIPLDDMVHRS  234

Query  829   FFFGPTEISALRSSLPPHLL-KCSRFEVVTACLWRCRTIAMEFDPNDEVRIFGTVNARPR  653
             FF G  E++A+R++LPP L  + S+F+++T  LW+CRT A+  D ++ +R+   V A   
Sbjct  235   FF-GRQEVAAIRANLPPDLRSRASKFDLLTGLLWKCRTAALALDADEVMRMICVVTAHGG  293

Query  652   LKNPPVPNGYYGNAFVYPGAKSTAGKVSKSPLSHALELVTNIKSSFTEEYIKSVADLMIL  473
               +  +P GYYGNAF  P A +TAG +   PL +A+ELV   K     EY++SVADLM+L
Sbjct  294   KSSVTIPKGYYGNAFALPAAVATAGDLVAKPLGYAVELVKRAKGEVNVEYMRSVADLMVL  353

Query  472   KGRPTFTLQGTFIVSDVTRVGFPEIDMGWGQSVFggpahggvggipGLITFYIPYEDNKG  293
             +GRP FT+   ++ SD+T+ GF  +D GWG  V+GGPA+ GVG  PGL TF +P ++ KG
Sbjct  354   RGRPHFTVVRAYLASDLTKAGFGNLDFGWGNPVYGGPANVGVGTSPGLATFLVPCKNAKG  413

Query  292   DHGILVPMCLPAIAMGKFVKELENCL  215
             + GI+VPMCLP  AM  FVKE+   L
Sbjct  414   EDGIIVPMCLPGPAMETFVKEMGTLL  439



>ref|XP_009336752.1| PREDICTED: methanol O-anthraniloyltransferase-like [Pyrus x bretschneideri]
Length=459

 Score =   469 bits (1206),  Expect = 1e-156, Method: Compositional matrix adjust.
 Identities = 229/440 (52%), Positives = 310/440 (70%), Gaps = 12/440 (3%)
 Frame = -1

Query  1531  IAFTVTRQNPELVAPADPTPREIKYLSDIDDQQGLRFQIPVIHFYRNEPSMS-GKDPVQV  1355
             +   V R  PEL+ PA PTP+E K+LSD+DDQ+GLRFQ+P+I  Y++  S++  ++P++V
Sbjct  5     LVLQVKRLQPELITPAKPTPQETKFLSDVDDQEGLRFQLPIIMCYKDNSSLNENRNPIKV  64

Query  1354  IRQALAKALVFFYPFAGRLREGPGRKLMVDCTGEGVMFIEADADATLQHFAVGGELKPPF  1175
             IR+AL++ALV++YP AGRLREGP R LMVDC GEG++F+EA AD TL+   VG ++ PP 
Sbjct  65    IREALSRALVYYYPLAGRLREGPNRMLMVDCNGEGILFVEASADVTLEQ--VGDKILPPC  122

Query  1174  PCFDQLLYNVPGSAEILNCPLFLIQVTRLRCGGFIFALRLNHSMSDACGLVHFLNTIAEI  995
             P  ++ L+N PGS  I+ CPL L+QVTRL CGGFI ALRLNH+M DA G V FL  +AE+
Sbjct  123   PLLEEFLFNFPGSDGIIGCPLLLVQVTRLTCGGFILALRLNHTMCDAPGFVQFLTAVAEM  182

Query  994   ARGAEAPSVYPVWQREFFDARNPPRITCTHFEYEEE-PAADSMVTNIPLDNLVHRSFFFG  818
             ARGA AP + PVW+RE   AR+PPRITC H EYE+    +D    +    N+V RSF+FG
Sbjct  183   ARGAHAPFILPVWERELLFARDPPRITCAHHEYEDVIDHSDGSYASNNQSNMVQRSFYFG  242

Query  817   PTEISALRSSLPPHLLK-CSRFEVVTACLWRCRTIAMEFDPNDEVRIFGTVNARPRLKNP  641
               E+  LR  +PPHL+  CS F+++TACLW+CRT+A + +P   VR+   VNAR +  N 
Sbjct  243   AKEMRVLRQQIPPHLISTCSTFDLITACLWKCRTLAFKINPKQVVRVSCIVNARGKHNNV  302

Query  640   PVPNGYYGNAFVYPGAKSTAGKVSKSPLSHALELVTNIKSSFTEEYIKSVADLMILKGRP  461
              +P GYYGNAF +P A S A  + K+PL +ALELV   K++  EEY++SVADL++L+GRP
Sbjct  303   RLPLGYYGNAFAFPAAVSKAEPLCKNPLGYALELVKKAKATMNEEYLRSVADLLVLRGRP  362

Query  460   TFTLQGT-FIVSDVTRVGFPEIDMGWGQSVFggpahggvggipGLITFYIPYEDNKGDHG  284
              ++  G+ F+VSD+TRVG  +++ GWGQ VF      G      LI+FYI +++N  D G
Sbjct  363   QYSSTGSNFLVSDITRVGVGDVNFGWGQPVF-----AGPAKAVDLISFYIQHKNNIED-G  416

Query  283   ILVPMCLPAIAMGKFVKELE  224
             ILVPM LP  AM +  +ELE
Sbjct  417   ILVPMWLPFSAMERGQQELE  436



>ref|XP_008373476.1| PREDICTED: methanol O-anthraniloyltransferase-like [Malus domestica]
Length=460

 Score =   468 bits (1205),  Expect = 1e-156, Method: Compositional matrix adjust.
 Identities = 229/443 (52%), Positives = 311/443 (70%), Gaps = 13/443 (3%)
 Frame = -1

Query  1537  PSIAFTVTRQNPELVAPADPTPREIKYLSDIDDQQGLRFQIPVIHFYRNEPSMS-GKDPV  1361
             PS    V R  PEL+ PA PTPRE K+LSDIDDQ+G+RFQ+P+I  Y++ PS++  ++PV
Sbjct  3     PSSVLQVKRLQPELIIPAKPTPRETKFLSDIDDQEGMRFQLPIIMCYKDNPSLNENRNPV  62

Query  1360  QVIRQALAKALVFFYPFAGRLREGPGRKLMVDCTGEGVMFIEADADATLQHFAVGGELKP  1181
             + IR+AL++ALV++YP AGRLREGP RKLMVDC GEG++F+EA A+ TL+   +G +  P
Sbjct  63    KTIREALSRALVYYYPLAGRLREGPDRKLMVDCNGEGILFVEASANVTLEQ--LGDKXLP  120

Query  1180  PFPCFDQLLYNVPGSAEILNCPLFLIQVTRLRCGGFIFALRLNHSMSDACGLVHFLNTIA  1001
             P P  ++ L+N  GS  I+ CPL L+QVTRL CGGFI ALRLNH+M DA G + FL  +A
Sbjct  121   PCPLLEEFLFNFLGSDGIIGCPLLLVQVTRLTCGGFILALRLNHTMCDAPGFLQFLTAVA  180

Query  1000  EIARGA-EAPSVYPVWQREFFDARNPPRITCTHFEYEEE-PAADSMVTNIPLDNLVHRSF  827
             E+ARG   APS+ P+W+RE   AR+PPRITC H EYE+    +D         N+V RSF
Sbjct  181   EMARGVIHAPSILPMWERELLFARDPPRITCAHHEYEDVIDHSDGSCAYSNQSNMVQRSF  240

Query  826   FFGPTEISALRSSLPPHLLKC-SRFEVVTACLWRCRTIAMEFDPNDEVRIFGTVNARPRL  650
             +FG  E+  LR  +PPHL+   S F+++TACLW+CRT+A++ +P   VR+   VNAR + 
Sbjct  241   YFGAKEMRVLRKQIPPHLISTFSTFDLITACLWKCRTLALKINPKQVVRVSCIVNARGKQ  300

Query  649   KNPPVPNGYYGNAFVYPGAKSTAGKVSKSPLSHALELVTNIKSSFTEEYIKSVADLMILK  470
              N  +P GYYGNAF +P A S A  + K+PL +ALELV   K++  EEY++SVADL++L+
Sbjct  301   NNVRLPLGYYGNAFAFPAAXSKAEPLCKNPLGYALELVKKAKATMNEEYLRSVADLLVLR  360

Query  469   GRPTFTLQGT-FIVSDVTRVGFPEIDMGWGQSVFggpahggvggipGLITFYIPYEDNKG  293
             GRP ++  G+ F+VSD+TRVG  +++ GWGQ +F      G      LI+FYI +++N  
Sbjct  361   GRPQYSSTGSNFLVSDITRVGVGDVNFGWGQPIF-----AGPAKAMDLISFYIQHKNNTE  415

Query  292   DHGILVPMCLPAIAMGKFVKELE  224
             D GILVPMCLP  AM +F +ELE
Sbjct  416   D-GILVPMCLPFSAMERFQQELE  437



>ref|XP_007147135.1| hypothetical protein PHAVU_006G098700g [Phaseolus vulgaris]
 gb|ESW19129.1| hypothetical protein PHAVU_006G098700g [Phaseolus vulgaris]
Length=457

 Score =   468 bits (1203),  Expect = 2e-156, Method: Compositional matrix adjust.
 Identities = 240/446 (54%), Positives = 321/446 (72%), Gaps = 9/446 (2%)
 Frame = -1

Query  1549  MAS-QPSIAFTVTRQNPELVAPADPTPREIKYLSDIDDQQGLRFQIPVIHFYRNEPSMSG  1373
             MAS  PS++FT+ +  PELVAPA PTP E K LSDIDDQ  LRF   +I  Y+NE SM+ 
Sbjct  1     MASPSPSLSFTMRKCQPELVAPAIPTPDETKLLSDIDDQSYLRFHYSIIQIYQNESSMAN  60

Query  1372  KDPVQVIRQALAKALVFFYPFAGRLREGPGRKLMVDCTGEGVMFIEADADATLQHFAVGG  1193
             KDPV VIRQALA+ALVF+YPFAGRLREG GRKLMVDC GEGVMF+EADAD TL+ F  G 
Sbjct  61    KDPVIVIRQALARALVFYYPFAGRLREGRGRKLMVDCGGEGVMFVEADADVTLEQF--GD  118

Query  1192  ELKPPFPCFDQLLYNVPGSAEILNCPLFLIQVTRLRCGGFIFALRLNHSMSDACGLVHFL  1013
              L+PPF      L +VP S +I   PL LIQVTRL+CGGF+ +   NH M+D  GL  F+
Sbjct  119   NLQPPFIYSKAFLCDVPDSEDIKKLPLLLIQVTRLKCGGFVVSTGWNHVMADGAGLSQFM  178

Query  1012  NTIAEIARGAEAPSVYPVWQREFFDARNPPRITCTHFEYEEEPAADSMVTNIPLDNLVHR  833
             +  AE+ARG + PS+ P+W+RE   AR+PPRITC H EY++    D++ ++    +LVHR
Sbjct  179   HAWAEMARGMKTPSISPLWRRELLMARDPPRITCNHREYDQ--IQDTLSSSD--HHLVHR  234

Query  832   SFFFGPTEISALRSSLPPHLLKCSRFEVVTACLWRCRTIAMEFDPNDEVRIFGTVNARPR  653
             SFFFGP +++ALR  LP HL +C+ F+++TACLWRCRT A++ D +++VR+   VNAR R
Sbjct  235   SFFFGPAQMAALRRLLPHHLRQCTAFDLITACLWRCRTKALQTDADEDVRMMCIVNARNR  294

Query  652   LKNPPVPNGYYGNAFVYPGAKSTAGKVSKSPLSHALELVTNIKSSFTEEYIKSVADLMIL  473
              + PP+P GYYGNAF YP A S+AGK+  SP ++A+EL+ N+K   T+EY+ SVADLM+L
Sbjct  295   FR-PPLPIGYYGNAFAYPAATSSAGKLCASPFAYAVELIHNVKGVVTDEYMHSVADLMVL  353

Query  472   KGRPTFTLQGTFIVSDVTRVGFPEIDMGWGQSVFggpahggvggipGLITFYIPYEDNKG  293
             KGR   T   + +VSD+TR  F ++D GWG+++ G PA G  G   G  T  + Y+++KG
Sbjct  354   KGRCMPTTVRSCLVSDLTRARFRDVDFGWGKALCGAPAKGSTGPFYG-GTHIVSYKNSKG  412

Query  292   DHGILVPMCLPAIAMGKFVKELENCL  215
             + G+++P+ LPA  M +F+KE+++ L
Sbjct  413   EDGLVLPVWLPAKPMQRFLKEMDDML  438



>gb|AFK34239.1| unknown [Medicago truncatula]
Length=445

 Score =   467 bits (1202),  Expect = 3e-156, Method: Compositional matrix adjust.
 Identities = 239/449 (53%), Positives = 317/449 (71%), Gaps = 8/449 (2%)
 Frame = -1

Query  1549  MASQPSIAFTVTRQNPELVAPADPTPREIKYLSDIDDQQGLRFQIPVIHFYRNEPSMSGK  1370
             M S P + FTV R  PELV PA PTPRE+K LSDIDDQ+GLRF IP++  YR+EPSM  K
Sbjct  1     MTSAP-LLFTVRRSQPELVPPAAPTPREVKLLSDIDDQEGLRFNIPMMFIYRHEPSMKEK  59

Query  1369  DPVQVIRQALAKALVFFYPFAGRLREGPGRKLMVDCTGEGVMFIEADADATLQHFAVGGE  1190
             DPV+V+R AL++ALV++YPFAGR+REG GRKLMVDCTGEGVMF+EA+AD TL  F  G  
Sbjct  60    DPVKVLRHALSQALVYYYPFAGRIREGAGRKLMVDCTGEGVMFVEAEADVTLDEF--GDA  117

Query  1189  LKPPFPCFDQLLYNVPGSAEILNCPLFLIQVTRLRCGGFIFALRLNHSMSDACGLVHFLN  1010
             L PP PCF++LLY+VPGS  I++ P+ LIQVTRL+CG FI  + LNH+MSD  GL  F+N
Sbjct  118   LHPPLPCFEELLYDVPGSELIIDRPIRLIQVTRLKCGSFILVVYLNHTMSDGAGLKLFMN  177

Query  1009  TIAEIARGAEAPSVYPVWQREFFDARNPPRITCTHFEYEEEPAADSMVTNIPLDNLVHRS  830
               AE+ARGA  PS+ PVW RE   AR+PP ITC H EYE+  ++++ +       LVH+S
Sbjct  178   AWAEMARGAHKPSIQPVWNREILMARDPPHITCNHHEYEQIFSSNT-IKEEDTTTLVHQS  236

Query  829   FFFGPTEISALRSSLPPHLLKCSRFEVVTACLWRCRTIAMEFDPNDEVRIFGTVNARPRL  650
             FFF  ++I  LR  +P HL  C+ F+++T+C W CRT A++ + +DE+R+   VNAR R 
Sbjct  237   FFFRTSDIVVLRLLVPFHLRHCTTFDLITSCFWCCRTKALQLEADDEIRMMCIVNARSRF  296

Query  649   --KNPPVPNGYYGNAFVYPGAKSTAGKVSKSPLSHALELVTNIKSSFTEEYIKSVADLMI  476
                N P+  GYYGN F YP A +TAGK+  + L +A+ELV  +K+  TEEY+ SVADLM+
Sbjct  297   NANNSPLV-GYYGNCFAYPAAVTTAGKLCGNSLGYAVELVRKLKAEVTEEYMHSVADLMV  355

Query  475   LKGRPTFTLQGTFIVSDVTRVGFPEIDMGWGQSVFggpahggvggipGLITFYIPYEDNK  296
             +K R  FT   + +VSDVTR+   E+D GWG++V+GG A  G G  PG   + IP+++ +
Sbjct  356   IKERCLFTTIRSCVVSDVTRIKLREVDFGWGEAVYGGAAKSGAGPFPG-AAYIIPHKNVE  414

Query  295   GDHGILVPMCLPAIAMGKFVKELENCLMK  209
             G+ G ++ +CL   AM +F KEL+  L K
Sbjct  415   GEEGFILLVCLSFEAMKRFAKELDEMLGK  443



>gb|KEH40977.1| benzyl alcohol O-benzoyltransferase [Medicago truncatula]
Length=425

 Score =   465 bits (1197),  Expect = 6e-156, Method: Compositional matrix adjust.
 Identities = 233/440 (53%), Positives = 311/440 (71%), Gaps = 39/440 (9%)
 Frame = -1

Query  1534  SIAFTVTRQNPELVAPADPTPREIKYLSDIDDQQGLRFQIPVIHFYRNEPSMSGKDPVQV  1355
             S+ F V R++PEL+ P+ PT  E K LSDIDDQ  LR+Q+P+I FY ++P+M+GKDPV V
Sbjct  4     SLVFKVKRRDPELITPSKPTLHETKLLSDIDDQDSLRWQVPLIQFYNHDPNMAGKDPVDV  63

Query  1354  IRQALAKALVFFYPFAGRLREGPGRKLMVDCTGEGVMFIEADADATLQHFAVGGELKPPF  1175
             IR+ALAK LVF+YPFAGRLREGPGRKLMVDCTGEGV+FIEADAD TL+ F  G  L PPF
Sbjct  64    IRKALAKTLVFYYPFAGRLREGPGRKLMVDCTGEGVLFIEADADVTLKEF--GDALHPPF  121

Query  1174  PCFDQLLYNVPGSAEILNCPLFLIQVTRLRCGGFIFALRLNHSMSDACGLVHFLNTIAEI  995
             PC D+LLY VPGS++++N PL LIQVTRL+CGGFIFA+R+NH++SDA G++ FL+ + EI
Sbjct  122   PCLDELLYYVPGSSDVINTPLMLIQVTRLKCGGFIFAIRMNHTLSDASGMLQFLSALGEI  181

Query  994   ARGAEAPSVYPVWQREFFDARNPPRITCTHFEYEEEPAADSMVTNIPLDNLVHRSFFFGP  815
             +RG   PS+ PVW RE  +AR+PPR+T  H EY+ EP  D+  T  PLD++VHR+FF   
Sbjct  182   SRGMSKPSISPVWSRELLNARDPPRVTYNHREYDPEP--DNKGTMFPLDDMVHRTFF---  236

Query  814   TEISALRSSLPPHLLKCSRFEVVTACLWRCRTIAMEFDPNDEVRIFGTVNARPRLKNPPV  635
                                             IA + D N+EVRI    +AR +  +  +
Sbjct  237   --------------------------------IAFQLDSNEEVRIICIADARSKSVDQQL  264

Query  634   PNGYYGNAFVYPGAKSTAGKVSKSPLSHALELVTNIKSSFTEEYIKSVADLMILKGRPTF  455
             P GYYGNA V+P A +TAGK+ ++PL++AL LV   K+S  +EY+ SVADLM++KGRP  
Sbjct  265   PYGYYGNAIVFPVAVTTAGKLIENPLAYALNLVKKAKASVNKEYMHSVADLMVIKGRPPL  324

Query  454   TLQGTFIVSDVTRVGFPEIDMGWGQSVFggpahggvggipGLITFYIPYEDNKGDHGILV  275
             T  G ++VSDVTR GF ++D GWG++V+GGPA GG G +PG   F+IP+ ++KG+ G+++
Sbjct  325   TTAGLYLVSDVTRAGFRDVDFGWGKAVYGGPAKGGDGALPGQAVFHIPFTNDKGEKGLVI  384

Query  274   PMCLPAIAMGKFVKELENCL  215
             P+ LP   M + VKEL++ L
Sbjct  385   PVFLPTQVMERLVKELDSVL  404



>gb|KFK25971.1| hypothetical protein AALP_AA8G186800 [Arabis alpina]
Length=472

 Score =   467 bits (1201),  Expect = 8e-156, Method: Compositional matrix adjust.
 Identities = 243/447 (54%), Positives = 313/447 (70%), Gaps = 6/447 (1%)
 Frame = -1

Query  1558  SPFMASQPSIAFTVTRQNPELVAPADPTPREIKYLSDIDDQQGLRFQIPVIHFYRNEPSM  1379
             SP   +  S+ F V R+ PELV+PA PTPRE+K LSDIDDQ+GLRF IP I FYR+ P+ 
Sbjct  6     SPPAVTTGSLTFKVHRRQPELVSPAKPTPRELKLLSDIDDQEGLRFHIPSIFFYRHNPT-  64

Query  1378  SGKDPVQVIRQALAKALVFFYPFAGRLREGPGRKLMVDCTGEGVMFIEADADATLQHFAV  1199
             S  DPV VIR+ALA+ LV++YPFAGRLREGP RKL VDCTGEGV+FIEADAD  L  F  
Sbjct  65    SYADPVTVIRRALAETLVYYYPFAGRLREGPNRKLAVDCTGEGVLFIEADADVALAEFEE  124

Query  1198  GGELKPPFPCFDQLLYNVPGSAEILNCPLFLIQVTRLRCGGFIFALRLNHSMSDACGLVH  1019
                L+PPFPCF++LL++V GS+E+LN PL  IQVTRL+CGGFIFA+RLNH+M+DA G   
Sbjct  125   KDALRPPFPCFEELLFDVEGSSEVLNAPLLFIQVTRLKCGGFIFAVRLNHTMTDAAGQTG  184

Query  1018  FLNTIAEIARGAEAPSVYPVWQREFFDARNPPRITCTHFEYEEEPAADSMVTNIPLDNLV  839
             FL  ++E A G   PS+ PVW+R    AR P R+T  H EY+E+ A D+  T    + +V
Sbjct  185   FLKMMSEFASGEHVPSISPVWERHLLSARVPLRVTQAHREYDEQVAVDTESTIGNREKMV  244

Query  838   HRSFFFGPTEISALRSSLPPHLLKCS-RFEVVTACLWRCRTIAMEFDPNDEVRIFGTVNA  662
              RSFFFG  E+SA+R  LPP L   S   E +T+ LWRCRT A+  DPN E+RI   VNA
Sbjct  245   GRSFFFGGAEMSAIRRLLPPDLANNSTNMETLTSFLWRCRTRALRPDPNKEMRIIFIVNA  304

Query  661   RPRLKNPPVPNGYYGNAFVYPGAKSTAGKVSKSPLSHALELVTNIKSSFTEEYIKSVADL  482
             R +LKNPP+P GYYGN F +P A +TA  +++ PL  A+ LV   KSS T+EY++S+ADL
Sbjct  305   RSKLKNPPLPPGYYGNVFAFPVAIATARDLTEKPLEFAVRLVKEAKSSVTDEYMRSLADL  364

Query  481   MILKGRPTFTLQGTFIVSDVTRVGFPEIDMG-WGQSVFggpahggvggipGLITFYIPYE  305
             M+ KGRP F + G  ++SDV R+ F  ID G WG+ V+GG    G+   P   +F +P+ 
Sbjct  365   MVTKGRPRFLMDGACLISDV-RI-FAGIDFGVWGKPVYGGIGTAGMAEFPA-ASFCVPFM  421

Query  304   DNKGDHGILVPMCLPAIAMGKFVKELE  224
             + KG++GI+VP  LP  AM +FV+ L+
Sbjct  422   NRKGENGIVVPFRLPEKAMQRFVEVLD  448



>ref|XP_006446263.1| hypothetical protein CICLE_v10015199mg [Citrus clementina]
 gb|ESR59503.1| hypothetical protein CICLE_v10015199mg [Citrus clementina]
Length=456

 Score =   466 bits (1199),  Expect = 9e-156, Method: Compositional matrix adjust.
 Identities = 225/446 (50%), Positives = 311/446 (70%), Gaps = 17/446 (4%)
 Frame = -1

Query  1534  SIAFTVTRQNPELVAPADPTPREIKYLSDIDDQQGLRFQIPVIHFYRNEPS--MSGKDPV  1361
             S    VTR+ PEL+ P  PTPRE+K +SDIDDQ+ LRFQIP++ FY+N+PS  M G+DPV
Sbjct  6     SQGLLVTRKAPELIVPERPTPREVKQISDIDDQESLRFQIPLLFFYKNDPSPSMQGRDPV  65

Query  1360  QVIRQALAKALVFFYPFAGRLREGPGRKLMVDCTGEGVMFIEADADATLQHFAVGGELKP  1181
             +VIR+A++KALVF+YP AGRL+EG  RKLMV+C  EGV+FIEADA+ TL+      +L+P
Sbjct  66    KVIREAISKALVFYYPLAGRLKEGYNRKLMVECNAEGVLFIEADANFTLEQLR--DDLQP  123

Query  1180  PFPCFDQLLYNVPGSAEILNCPLFLIQVTRLRCGGFIFALRLNHSMSDACGLVHFLNTIA  1001
             P P  +QL+Y+VPGS  IL CPL LIQVTRL CGGFIFA+R NH+M DA GLV FL  I 
Sbjct  124   PCPYLNQLIYDVPGSEGILGCPLLLIQVTRLTCGGFIFAIRFNHTMCDAFGLVQFLKAIE  183

Query  1000  EIARGAEAPSVYPVWQREFFDARNPPRITCTHFEYEEEPAADSMVTN-IPLDNLVHRSFF  824
             ++ARG  +P+++P+WQR+  +ARNPP++TC H EY      D++ TN +P DN+ H+SFF
Sbjct  184   DMARGERSPTLFPIWQRQILNARNPPQVTCIHHEY------DAINTNEVPSDNMAHKSFF  237

Query  823   FGPTEISALRSSLPPHLLKCSRFEVVTACLWRCRTIAMEFDPNDEVRIFGTVNARPRLKN  644
             F    I ALR+ LP HL  CS FE++ A LW+CRTIA++  P +  ++   VN R +   
Sbjct  238   FSLKGIKALRNQLPFHLKDCSTFELLLAFLWKCRTIALKLQPEEIAKVCCIVNVRGKRYE  297

Query  643   PPVPNGYYGNAFVYPGAKSTAGKVSKSPLSHALELVTNIKSSFTEEYIKSVADLMILKGR  464
               +P GYYGNAF +    S A ++ K+P+ +A+ELV   K+   EEYI+S ADLM++KGR
Sbjct  298   MDIPPGYYGNAFTFSAVCSKAEQLCKNPIGYAVELVKKAKAQMNEEYIRSAADLMVIKGR  357

Query  463   P-TFTLQGTFIVSDVTRVGFPEIDMGWGQSVFggpahggvggipGLITFYIPYEDNKGDH  287
                F+ +G FIVSD+  VG  ++D GWG+ ++      G  G   +I+F+  Y++  G+ 
Sbjct  358   RIKFSTRGNFIVSDLRNVGLGDVDFGWGKPIY-----AGTAGAVAVISFFTKYQNKNGEP  412

Query  286   GILVPMCLPAIAMGKFVKELENCLMK  209
             GILVP+CLP  AM +  +EL+  +++
Sbjct  413   GILVPICLPQSAMERLQEELKGLMIQ  438



>ref|XP_006400294.1| hypothetical protein EUTSA_v10013454mg [Eutrema salsugineum]
 gb|ESQ41747.1| hypothetical protein EUTSA_v10013454mg [Eutrema salsugineum]
Length=468

 Score =   466 bits (1200),  Expect = 9e-156, Method: Compositional matrix adjust.
 Identities = 237/445 (53%), Positives = 313/445 (70%), Gaps = 9/445 (2%)
 Frame = -1

Query  1543  SQPSIAFTVTRQNPELVAPADPTPREIKYLSDIDDQQGLRFQIPVIHFYRNEPSMSGKDP  1364
             +  S+ F V R+ PELV PA  TPRE+K LSDIDDQ+GLRF IP I FYRN P+ +  DP
Sbjct  10    TSDSLMFKVHRREPELVTPAKATPRELKLLSDIDDQEGLRFHIPSIFFYRNNPT-AYSDP  68

Query  1363  VQVIRQALAKALVFFYPFAGRLREGPGRKLMVDCTGEGVMFIEADADATLQHFAVGGELK  1184
             V VIR+ALA+ LV++YP AGRLREGP RKL VDC+GEGV+FIEADAD TL  F     L+
Sbjct  69    VAVIRRALAETLVYYYPLAGRLREGPNRKLAVDCSGEGVLFIEADADVTLVEFEKKDVLR  128

Query  1183  PPFPCFDQLLYNVPGSAEILNCPLFLIQVTRLRCGGFIFALRLNHSMSDACGLVHFLNTI  1004
             PPFPCF++LL+++ GS+E+LN P+ LIQVTRL+CGGFIFA+R+NH++SDA GL  FL TI
Sbjct  129   PPFPCFEELLFDIEGSSEVLNAPMILIQVTRLKCGGFIFAVRINHAISDAAGLSLFLKTI  188

Query  1003  AEIARGAEAPSVYPVWQREFFDARNPPRITCTHFEYEEEPAADSMVTNIPLDNLVHRSFF  824
              E ARG+  P+V PVW+R    AR P  +T  H EY+E+   D+    +    LV RSFF
Sbjct  189   GEFARGSHVPTVAPVWERHLLSARVPASVTHVHREYDEQ---DTESATVDGGALVSRSFF  245

Query  823   FGPTEISALRSSLPPHLL-KCSRFEVVTACLWRCRTIAMEFDPNDEVRIFGTVNARPRLK  647
             FG  E+S +R  LP +L  + +  E +TA LWR RT A+  DPN E+R+   VNAR + +
Sbjct  246   FGGAEMSVIRRLLPQNLANRSTDLETLTAFLWRYRTAALRTDPNKEMRVIFIVNARSKFR  305

Query  646   NPPVPNGYYGNAFVYPGAKSTAGKVSKSPLSHALELVTNIKSSFTEEYIKSVADLMILKG  467
             NPP+P GYYGNAF +P A +T  ++++ PL  AL LV   K S TEEY++S+ADLM+ KG
Sbjct  306   NPPLPPGYYGNAFAFPVAIATVRELTEKPLEFALRLVKEAKWSVTEEYMRSLADLMVTKG  365

Query  466   RPTFTLQGTFIVSDVTRVGFPEIDMG-WGQSVFggpahggvggipGLITFYIPYEDNKGD  290
             RP F++ G +++SDV    F +I  G WG+ V+GG    GV   PG  +FY+ +E++KG+
Sbjct  366   RPRFSIDGAYLISDVR--NFADIQFGVWGKPVYGGIGTAGVVDFPG-SSFYVSFENSKGE  422

Query  289   HGILVPMCLPAIAMGKFVKELENCL  215
              GI+VP+CLP  AM +FV+EL+   
Sbjct  423   RGIVVPVCLPEKAMKRFVEELDGVF  447



>ref|XP_007147137.1| hypothetical protein PHAVU_006G098900g [Phaseolus vulgaris]
 gb|ESW19131.1| hypothetical protein PHAVU_006G098900g [Phaseolus vulgaris]
Length=478

 Score =   467 bits (1201),  Expect = 1e-155, Method: Compositional matrix adjust.
 Identities = 233/444 (52%), Positives = 311/444 (70%), Gaps = 5/444 (1%)
 Frame = -1

Query  1549  MASQPS-IAFTVTRQNPELVAPADPTPREIKYLSDIDDQQGLRFQIPVIHFYRNEPSMSG  1373
             MAS  S + FTV R  P+LV PA PTP E+K LSDIDDQ+GLR+  P I  Y  + SM+ 
Sbjct  1     MASSSSPLRFTVRRCQPQLVPPAIPTPHELKLLSDIDDQEGLRYHTPGIQIYGKQASMAE  60

Query  1372  KDPVQVIRQALAKALVFFYPFAGRLREGPGRKLMVDCTGEGVMFIEADADATLQHFAVGG  1193
             KDP +VIRQAL++ LVF+YP AGR+REGP RKL+VDCT EG MFIEADAD TL  F  G 
Sbjct  61    KDPAEVIRQALSQTLVFYYPLAGRVREGPHRKLVVDCTREGAMFIEADADVTLAEF--GD  118

Query  1192  ELKPPFPCFDQLLYNVPGSAEILNCPLFLIQVTRLRCGGFIFALRLNHSMSDACGLVHFL  1013
              L+PPFPCF +LLY+VP S +I + P  L+QVTRL+CGGFI    +NH++ D  G+  F+
Sbjct  119   SLQPPFPCFHELLYDVPDSQQITDTPPVLVQVTRLKCGGFILTSSINHTICDGTGVSQFM  178

Query  1012  NTIAEIARGAEAPSVYPVWQREFFDARNPPRITCTHFEYEEEPAADSMVTNIPLDNLVHR  833
             +T AE+ARG+  PS+ PVW RE   AR+PPR+T  H EYE               ++V R
Sbjct  179   HTWAEMARGSTKPSIPPVWCRELLMARHPPRVTFNHREYEHVLDTSERTMTSTEHDMVQR  238

Query  832   SFFFGPTEISALRSSLPPHLLKCSRFEVVTACLWRCRTIAMEFDPNDEVRIFGTVNARPR  653
             SFFFGP++I+A+R  +PPHL  C+ F+++TACLWRCRT A++ + ++EVR+   VN R R
Sbjct  239   SFFFGPSQIAAIRLLVPPHLQHCTTFDIITACLWRCRTKALQIEAHEEVRMMVIVNGRAR  298

Query  652   LKNPPVPNGYYGNAFVYPGAKSTAGKVSKSPLSHALELVTNIKSSFTEEYIKSVADLMIL  473
             L NPP+P GYYGNA  +P A STAGK+ ++P  +A+EL+   KS  TEEY+ SVADLM++
Sbjct  299   L-NPPLPVGYYGNAIAFPAAVSTAGKLCENPFGYAVELIKKAKSEVTEEYMHSVADLMVI  357

Query  472   KGRPTFTLQGTFIVSDVTRVGFPEIDMGWGQSVFggpahggvggipGLITFYIPYEDNKG  293
             K R  FT   + I+SD+TR  F E++ GWG++V+ G A  G G   G  T+ + +++ KG
Sbjct  358   KDRCMFTTIRSCIISDLTRGRFREVNFGWGEAVYSGVAKTGFGSFLGG-TYQVLHKNAKG  416

Query  292   DHGILVPMCLPAIAMGKFVKELEN  221
             + GI++P+ LPA AM +F KEL+N
Sbjct  417   EEGIVLPIWLPAQAMNRFAKELDN  440



>gb|ABR16595.1| unknown [Picea sitchensis]
Length=448

 Score =   465 bits (1197),  Expect = 1e-155, Method: Compositional matrix adjust.
 Identities = 233/442 (53%), Positives = 318/442 (72%), Gaps = 6/442 (1%)
 Frame = -1

Query  1534  SIAFTVTRQNPELVAPADPTPREIKYLSDIDDQQGLRFQIPVIHFYRNEPSMSGKDPVQV  1355
             ++ F VTR+   LVAP+ PTP+E  YLS+IDDQ GLRF IPV+ FY+ +PS  G+DP +V
Sbjct  3     TLQFKVTRKPAVLVAPSRPTPKEFLYLSNIDDQAGLRFHIPVVQFYQFDPSKKGEDPARV  62

Query  1354  IRQALAKALVFFYPFAGRLREGPGRKLMVDCTGEGVMFIEADADATLQHFAVGGELKPPF  1175
             IR+ LAKALVF+YPFAGRLR+ P  KL+VDCTGEGV+F+EADAD  L+ F   G+L+PPF
Sbjct  63    IREGLAKALVFYYPFAGRLRDAPAGKLVVDCTGEGVLFVEADADVALEEF---GDLQPPF  119

Query  1174  PCFDQLLYNVPGSAEILNCPLFLIQVTRLRCGGFIFALRLNHSMSDACGLVHFLNTIAEI  995
             PC++ LL++VP S  + N PL LIQVTRLRCGGFIFALRLNHSM DA GLV F+N + E+
Sbjct  120   PCWEDLLHDVPASLTLTNSPLLLIQVTRLRCGGFIFALRLNHSMCDAVGLVQFMNALGEM  179

Query  994   ARGAEAPSVYPVWQREFFDARNPPRITCTHFEYEEEPAADSMVTNIPLDNLVHRSFFFGP  815
             A+GA  PSV PVW+RE    R  P +    +EY +    D  +  +P++ + H SFFFGP
Sbjct  180   AKGASRPSVRPVWKREILRPRTNPAVKFPLYEYNQIEDKDGQM--VPVNEMSHNSFFFGP  237

Query  814   TEISALRSSLPPHLLKCSRFEVVTACLWRCRTIAMEFDPNDEVRIFGTVNARPRLKNPPV  635
             +E+ +L+       +K   FEV++ACLWR RT A++     EVR+   ++AR R  +PP+
Sbjct  238   SEMESLKRQAVGQGMKSRTFEVLSACLWRFRTRALQLPSEQEVRLIFPLDARTRF-DPPL  296

Query  634   PNGYYGNAFVYPGAKSTAGKVSKSPLSHALELVTNIKSSFTEEYIKSVADLMILKGRPTF  455
             P G+YGNA  +  AK+TAG+++K+PLS AL+L+   K++  +EY++SV DLM L+GRP F
Sbjct  297   PKGFYGNAISFACAKTTAGELAKNPLSFALKLINEAKTAVNDEYMRSVIDLMELEGRPHF  356

Query  454   TLQGTFIVSDVTRVGFPEIDMGWGQSVFggpahggvggipGLITFYIPYEDNKGDHGILV  275
             T+ G+F+VSDVT++GF ++D GWG++ +GGPA GGVG +PG+ +F+IP  +  G  GILV
Sbjct  357   TVVGSFLVSDVTKIGFGDVDFGWGRAAYGGPAKGGVGAVPGVSSFFIPLRNTSGVEGILV  416

Query  274   PMCLPAIAMGKFVKELENCLMK  209
             P+CLP+ AM  F  E+     K
Sbjct  417   PVCLPSAAMKIFQAEISEATEK  438



>ref|XP_010420482.1| PREDICTED: (Z)-3-hexen-1-ol acetyltransferase-like [Camelina 
sativa]
Length=447

 Score =   465 bits (1197),  Expect = 1e-155, Method: Compositional matrix adjust.
 Identities = 247/440 (56%), Positives = 314/440 (71%), Gaps = 8/440 (2%)
 Frame = -1

Query  1534  SIAFTVTRQNPELVAPADPTPREIKYLSDIDDQQGLRFQIPVIHFYRNEPSMSGKDPVQV  1355
             S+ F V RQ PELV+PA PTPRE+K LSDIDDQQGLRF IP I FYR+ P  +  DPV V
Sbjct  4     SLTFKVHRQKPELVSPAKPTPRELKLLSDIDDQQGLRFHIPTIFFYRHNPK-AYSDPVAV  62

Query  1354  IRQALAKALVFFYPFAGRLREG-PGRKLMVDCTGEGVMFIEADADATLQHFAVGGELKPP  1178
             IR+ALA+ LV++YPFAGRLR+G P RKL VDCTGEGV+FIEADAD TL  F     LKPP
Sbjct  63    IRRALAETLVYYYPFAGRLRDGRPNRKLAVDCTGEGVLFIEADADVTLLEFEEKDALKPP  122

Query  1177  FPCFDQLLYNVPGSAEILNCPLFLIQVTRLRCGGFIFALRLNHSMSDACGLVHFLNTIAE  998
             FPCF++LL++V GS+E+LN PL L+QVTRL+CGGFIFA+R+NH MSDA GL  FL T  +
Sbjct  123   FPCFEELLFDVKGSSEVLNTPLMLMQVTRLKCGGFIFAVRINHVMSDAAGLSLFLKTTCD  182

Query  997   IARGAEAPSVYPVWQREFFDARNPPRITCTHFEYEEEPAADSMVTNIPLDNLVHRSFFFG  818
              ARG  AP+V PVW+R   +AR P R++  H EY+E P   +   +   DNLV RSFFFG
Sbjct  183   FARGYHAPTVAPVWERHLLNARAPLRVSHAHREYDEMPVTVTD-NDSKEDNLVSRSFFFG  241

Query  817   PTEISALRSSLPPHLL-KCSRFEVVTACLWRCRTIAMEFDPNDEVRIFGTVNARPRLKNP  641
               E+SA+R  LPP+L+ + +  E +T+ +WR RT+A++ DPN E+R+   VNAR +L  P
Sbjct  242   HKEMSAIRRLLPPNLVNRSTDMETLTSFIWRYRTVAIQPDPNKEMRLIFIVNARSKLTTP  301

Query  640   PVPNGYYGNAFVYPGAKSTAGKVSKSPLSHALELVTNIKSSFTEEYIKSVADLMILKGRP  461
             P+  GYYGNAF +P A +TA +++K PL  AL LV   K S TEEY++S+ADLM+ KGRP
Sbjct  302   PLSPGYYGNAFAFPVAIATARELAKKPLEFALRLVKEAKYSVTEEYMRSLADLMVTKGRP  361

Query  460   TFTLQGTFIVSDVTRVGFPEIDMG-WGQSVFggpahggvggipGLITFYIPYEDNKGDHG  284
              F+  G ++VSDV R+ F  ID G WG+ V+GG    GV   PG  + Y+  E    + G
Sbjct  362   RFSSDGAYLVSDV-RI-FANIDFGIWGKPVYGGIGTAGVVDFPG-ASCYVSAEKRNCERG  418

Query  283   ILVPMCLPAIAMGKFVKELE  224
             I+VP+CLP  AM +FVKELE
Sbjct  419   IIVPVCLPEKAMQRFVKELE  438



>gb|AES82607.2| benzyl alcohol O-benzoyltransferase [Medicago truncatula]
Length=459

 Score =   466 bits (1198),  Expect = 1e-155, Method: Compositional matrix adjust.
 Identities = 239/447 (53%), Positives = 319/447 (71%), Gaps = 8/447 (2%)
 Frame = -1

Query  1549  MASQPSIAFTVTRQNPELVAPADPTPREIKYLSDIDDQQGLRFQIPVIHFYRNEPSMSGK  1370
             M S P + FTV R  PELV PA PTP E+K LSDIDDQ+GLRF IP+I  Y +EPSM+ K
Sbjct  1     MTSSP-LLFTVRRCQPELVPPAAPTPCEVKLLSDIDDQEGLRFNIPMIFIYHHEPSMAEK  59

Query  1369  DPVQVIRQALAKALVFFYPFAGRLREGPGRKLMVDCTGEGVMFIEADADATLQHFAVGGE  1190
             DPV+V+R AL++ALV++YPFAGR+REG  RKLMVDCTGEGVMFIEA+AD TL  F  G  
Sbjct  60    DPVKVLRHALSQALVYYYPFAGRIREGASRKLMVDCTGEGVMFIEAEADVTLDQF--GDA  117

Query  1189  LKPPFPCFDQLLYNVPGSAEILNCPLFLIQVTRLRCGGFIFALRLNHSMSDACGLVHFLN  1010
             L PPFPCF QLLY+V GS +I++ P+ LIQVTRL+CGGFI A+  NH+M DA GL  F+N
Sbjct  118   LHPPFPCFHQLLYDVRGSEQIMDRPIRLIQVTRLKCGGFIVAMNWNHTMGDAAGLRQFMN  177

Query  1009  TIAEIARGAEAPSVYPVWQREFFDARNPPRITCTHFEYEEEPAADSMVTNIPLDNLVHRS  830
               AE+ARGA  PS+ PVW RE   AR+PPRITC HFEYE+  + ++ +      +LVH+S
Sbjct  178   AWAEMARGAYRPSIQPVWNREILMARDPPRITCNHFEYEQILSPNT-IKEKDTASLVHQS  236

Query  829   FFFGPTEISALRSSLPPHLLKCSRFEVVTACLWRCRTIAMEFDPNDEVRIFGTVNARPR-  653
             FFF  ++I+ LR  +P HL +C+ F+++ +C W CRT A++ + ++EVR+    NAR R 
Sbjct  237   FFFRASDIATLRLLVPFHLRQCTTFDLIASCFWCCRTKALQLEADEEVRMMCIANARSRF  296

Query  652   -LKNPPVPNGYYGNAFVYPGAKSTAGKVSKSPLSHALELVTNIKSSFTEEYIKSVADLMI  476
              + N P+  GYYGN F YP A +TA K+  +P  +A+ELV  +K+  TEEY+ SVADLM+
Sbjct  297   NVNNSPLV-GYYGNCFAYPAAVTTARKLCGNPFGYAVELVRKLKAEVTEEYMHSVADLMV  355

Query  475   LKGRPTFTLQGTFIVSDVTRVGFPEIDMGWGQSVFggpahggvggipGLITFYIPYEDNK  296
             +K R  FT   + I+SD+TR    E++ GWG+ V+GG A GG G  PG  T+ +PY++ K
Sbjct  356   IKERCLFTTVRSCIISDLTRARLSEVNFGWGEGVYGGVAKGGAGPFPG-ATYIVPYKNIK  414

Query  295   GDHGILVPMCLPAIAMGKFVKELENCL  215
             G+  +++P+CLP+  M +F KEL+  L
Sbjct  415   GEETLMLPICLPSEDMKRFAKELDEML  441



>ref|XP_010110383.1| Benzyl alcohol O-benzoyltransferase [Morus notabilis]
 gb|EXC26215.1| Benzyl alcohol O-benzoyltransferase [Morus notabilis]
Length=465

 Score =   466 bits (1198),  Expect = 2e-155, Method: Compositional matrix adjust.
 Identities = 241/456 (53%), Positives = 308/456 (68%), Gaps = 24/456 (5%)
 Frame = -1

Query  1567  MALSPFMASQPSIAFTVTRQNPELVAPADPTPREIKYLSDIDDQQGLRFQIPVIHFYR--  1394
             MALSP      S+   V R  PELV P+ PTP+EIK LSDIDDQ+GLRF +P I FY+  
Sbjct  1     MALSPC----SSLTIKVDRYEPELVKPSKPTPKEIKLLSDIDDQEGLRFHVPFIFFYKKN  56

Query  1393  NEPSMS-GKDPVQVIRQALAKALVFFYPFAGRLREGPGRKLMVDCTGEGVMFIEADADAT  1217
             N PS+  GKDP +VIR+AL +ALV++YPFAGRLREG  RKLMVDCTGEGV+F+ A AD  
Sbjct  57    NHPSVKLGKDPNRVIREALGRALVYYYPFAGRLREGSNRKLMVDCTGEGVLFVAAKADVG  116

Query  1216  LQHFAVGGELKPPFPCFDQLLYNVPGSAEILNCPLFLIQVTRLRCGGFIFALRLNHSMSD  1037
                  +G  ++PP P  D+ LYNVPGS  IL CPL LIQVT+L+C GF+ A+R+NH+M D
Sbjct  117   YDR--LGDAIRPPCPFLDKFLYNVPGSDGILGCPLLLIQVTQLKCEGFVLAVRVNHTMCD  174

Query  1036  ACGLVHFLNTIAEIARGAEAPSVYPVWQREFFDARNPPRITCTHFEYEEEPAADSMVTNI  857
             A GLV FLNTIAE+ARG   PS+ PVWQRE  +ARNPPRI   H E+ E P  +S   N+
Sbjct  175   AFGLVQFLNTIAEMARGINIPSILPVWQREILNARNPPRIAYPHQEFHEVP-TNSKGPNM  233

Query  856   PLD--NLVHRSFFFGPTEISALRSSLPPHLLKCSRFEVVTACLWRCRTIAMEFDPNDEVR  683
              +D  ++V RSFFF   +I  ++  LP HL  CSRFE++TACLW+CRTIA+E DP + V 
Sbjct  234   IMDPNDVVQRSFFFSSNQIRNMKKQLPIHLQNCSRFELITACLWKCRTIALELDPKETVI  293

Query  682   I--FGTVNARPRLKNPPVPNGYYGNAFVYPGAKSTAGKVSKSPLSHALELVTNIKSSFTE  509
             +    ++      KN  +P GYYGNAF YP     A  + +S L H +ELV   K+   E
Sbjct  294   VSCITSLRGNNNAKNLSLPLGYYGNAFAYPAVVLKAKVLCESSLGHVVELVKKAKAEMNE  353

Query  508   EYIKSVADLMILKGRPTFTLQGTFIVSDVTRVGFPEIDMGWGQSVFggpahggvggipGL  329
             +YI+SVADLM+ +GRP + + G +IVSD TRVGF +ID GWG  VF     GG      L
Sbjct  354   DYIRSVADLMVTRGRPLYAVSGNYIVSDNTRVGFGDIDFGWGLPVF-----GGPAKALSL  408

Query  328   ITFYIPYEDNKGDHGILVPMCLPAI-AMGKFVKELE  224
             I+FY+ YE+     G++VP+CLP + AM +F +EL+
Sbjct  409   ISFYVAYEEK----GVVVPICLPTVRAMDRFEQELK  440



>ref|XP_009365763.1| PREDICTED: methanol O-anthraniloyltransferase-like [Pyrus x bretschneideri]
Length=451

 Score =   465 bits (1196),  Expect = 2e-155, Method: Compositional matrix adjust.
 Identities = 228/440 (52%), Positives = 303/440 (69%), Gaps = 13/440 (3%)
 Frame = -1

Query  1534  SIAFTVTRQNPELVAPADPTPREIKYLSDIDDQQGLRFQIPVIHFYRNEPSMSGKDPVQV  1355
             S+AF V R  P+L+ PA PTPRE K LSD+DDQQG RF  P+I  YRN+ +    DPV  
Sbjct  7     SLAFQVNRSEPQLIKPAKPTPRETKRLSDVDDQQGTRFHFPLILSYRNKENQG--DPVTA  64

Query  1354  IRQALAKALVFFYPFAGRLREGPGRKLMVDCTGEGVMFIEADADATLQHFAVGGELKPPF  1175
             IR AL++ALV++YP AGRLREGP +KLMVDC GEGV+FIEADAD TL+   +G  ++PP 
Sbjct  65    IRDALSRALVYYYPVAGRLREGPNKKLMVDCNGEGVLFIEADADFTLEE--LGDTIRPPC  122

Query  1174  PCFDQLLYNVPGSAEILNCPLFLIQVTRLRCGGFIFALRLNHSMSDACGLVHFLNTIAEI  995
             P  D+LL+NVPGS  IL CP+ L+QVTRL+CGGFIFA R+NH+M DA GL  FLN + E+
Sbjct  123   PLLDELLFNVPGSDGILGCPILLVQVTRLKCGGFIFASRVNHTMFDAVGLAQFLNAVGEM  182

Query  994   ARGAEAPSVYPVWQREFFDARNPPRITCTHFEYEE--EPAADSMVTNIPLDNLVHRSFFF  821
             A+G  +PS+ PVW+RE  DAR+ PRITCTH+EYE    P +  ++T     +LV RSF+F
Sbjct  183   AQGTHSPSIPPVWERELLDARHSPRITCTHYEYEHISNPESSFLLTKDE-GSLVQRSFYF  241

Query  820   GPTEISALRSSLPPHLLKCSRFEVVTACLWRCRTIAMEFDPNDEVRIFGTVNARPRLKNP  641
             GP EI A+R  LP HL   SRFE++TAC+W+CRT+++  +P + VR+   VNAR +    
Sbjct  242   GPQEIKAIREKLPGHLSTSSRFELITACVWKCRTLSLRLNPEEIVRLSCAVNARGKHNTL  301

Query  640   PVPNGYYGNAFVYPGAKSTAGKVSKSPLSHALELVTNIKSSFTEEYIKSVADLMILKGRP  461
              +P GYYGNAF  P   S  G + ++PL +A+ELV  +KS  +EEY+KS+ADL +++GRP
Sbjct  302   CLPLGYYGNAFAIPTVVSKVGLLCENPLGYAVELVKKLKSKMSEEYMKSLADLFVIRGRP  361

Query  460   TFTLQ-GTFIVSDVTRVGFPEIDMGWGQSVFggpahggvggipGLITFYIPYEDNKGDHG  284
                +     IVSD TR GF E++ GWG+ +F      G+     LITFY+     K ++G
Sbjct  362   PLPMAWNVLIVSDNTRTGFGEVNFGWGKPIF-----AGIAKSVNLITFYVQDNSLKEEYG  416

Query  283   ILVPMCLPAIAMGKFVKELE  224
             ++VP+CLP   M  F KE +
Sbjct  417   VVVPICLPFSCMEAFEKEFK  436



>ref|XP_003626388.1| Benzoyl coenzyme A benzyl alcohol benzoyl transferase [Medicago 
truncatula]
 gb|AES82606.1| benzyl alcohol O-benzoyltransferase [Medicago truncatula]
Length=459

 Score =   465 bits (1197),  Expect = 2e-155, Method: Compositional matrix adjust.
 Identities = 233/445 (52%), Positives = 316/445 (71%), Gaps = 7/445 (2%)
 Frame = -1

Query  1543  SQPSIAFTVTRQNPELVAPADPTPREIKYLSDIDDQQGLRFQIPVIHFYRNEPSMSGKDP  1364
             +  S+ FTV R  PELV PA PTPRE+K LSDIDDQ+G+RF  PVI  YR++PSM  KDP
Sbjct  2     TSSSLMFTVRRCQPELVPPAAPTPREVKLLSDIDDQEGMRFNSPVIFIYRHKPSMVEKDP  61

Query  1363  VQVIRQALAKALVFFYPFAGRLREGPGRKLMVDCTGEGVMFIEADADATLQHFAVGGELK  1184
             ++V+R AL++ LV++YP AGR+REG GRKLMVDCTGEGVMFIEA+AD TL  F  G  L 
Sbjct  62    LKVLRHALSRTLVYYYPLAGRIREGAGRKLMVDCTGEGVMFIEAEADVTLDQF--GDALH  119

Query  1183  PPFPCFDQLLYNVPGSAEILNCPLFLIQVTRLRCGGFIFALRLNHSMSDACGLVHFLNTI  1004
             PPFPCF QLLY+VPGS +I++ P+  IQVTRL+CGGFI A+  NH++ DA GL  F+   
Sbjct  120   PPFPCFQQLLYDVPGSTQIIDRPIRQIQVTRLKCGGFIVAMNWNHTLGDAAGLRQFMTAW  179

Query  1003  AEIARGAEAPSVYPVWQREFFDARNPPRITCTHFEYEEEPAADSMVTNIPLDNLVHRSFF  824
             AE+ARGA  PS+ PVW RE   AR+PPRITC H EY++  + ++ +      +LVHRSFF
Sbjct  180   AEMARGAHRPSIQPVWNREILMARDPPRITCNHLEYKQIFSPNT-IKEEDTASLVHRSFF  238

Query  823   FGPTEISALRSSLPPHLLKCSRFEVVTACLWRCRTIAMEFDPNDEVRIFGTVNARPR--L  650
             F  ++I+ALR  +P HL +C+ F+++ +C W CRT A++ + + EVR+   VNAR R  +
Sbjct  239   FRASDIAALRLLVPFHLRQCTTFDLIASCFWCCRTKALQLEADKEVRMMCVVNARSRFNI  298

Query  649   KNPPVPNGYYGNAFVYPGAKSTAGKVSKSPLSHALELVTNIKSSFTEEYIKSVADLMILK  470
              N P+  GYYGN F YP A +TAGK+  +P  +A+ELV  +K+  TEEY+ SVADLM++K
Sbjct  299   NNSPLV-GYYGNCFAYPAAVTTAGKLCGNPFGYAVELVRKLKAEVTEEYMHSVADLMVIK  357

Query  469   GRPTFTLQGTFIVSDVTRVGFPEIDMGWGQSVFggpahggvggipGLITFYIPYEDNKGD  290
              R  FT   + ++SD+TR    E++ GWG+ V+GG A GG G  PG  T+ +PY++  G+
Sbjct  358   ERCLFTTVRSCVISDLTRARLSEVNFGWGEGVYGGVAKGGAGTFPG-STYIVPYKNINGE  416

Query  289   HGILVPMCLPAIAMGKFVKELENCL  215
               +++P+CLP+  M +F KEL+  L
Sbjct  417   ETLMLPICLPSEDMKRFAKELDEML  441



>ref|XP_011041077.1| PREDICTED: benzyl alcohol O-benzoyltransferase-like isoform X1 
[Populus euphratica]
Length=467

 Score =   466 bits (1198),  Expect = 2e-155, Method: Compositional matrix adjust.
 Identities = 235/445 (53%), Positives = 305/445 (69%), Gaps = 13/445 (3%)
 Frame = -1

Query  1534  SIAFTVTRQNPELVAPADPTPREIKYLSDIDDQQGLRFQIPVIHFYRNEPSMSGKDPVQV  1355
             SI+F V R+ PELVAPA  TP E + LSDID Q  L+FQ P  + Y + PSM GKDPV+V
Sbjct  4     SISFAVRRREPELVAPAKATPHEFRQLSDIDRQLYLQFQSPHYNLYAHNPSMQGKDPVKV  63

Query  1354  IRQALAKALVFFYPFAGRLREGPGRKLMVDCTGEGVMFIEADADATLQHFAVGGELKPPF  1175
             I++A+A+ALV++YPFAGR+R+GP  KL+VDCTGEGV+FIEADADAT++ F  G  +  PF
Sbjct  64    IKEAIAQALVYYYPFAGRIRQGPDNKLIVDCTGEGVLFIEADADATVEQF--GDPIPSPF  121

Query  1174  PCFDQLLYNVPGSAEILNCPLFLIQVTRLRCGGFIFALRLNHSMSDACGLVHFLNTIAEI  995
             PCF +LLYNVPGS  ILN PL L Q+TRL+CGGFI   RLNH MSDA GLV  L+ I EI
Sbjct  122   PCFQELLYNVPGSDGILNTPLLLFQITRLKCGGFILGFRLNHPMSDAIGLVQLLSAIGEI  181

Query  994   ARGAEAPSVYPVWQREFFDARNPPRITCTHFEY--EEEPAADSMVTNIP-----LDNLVH  836
             +RGA+APS+ PVWQRE   ARNPPR+TCTH EY    +   D    N+P      D   H
Sbjct  182   SRGAQAPSILPVWQRELLCARNPPRVTCTHNEYGDHHDLVVDPSELNVPEFRGSSDGAAH  241

Query  835   RSFFFGPTEISALRSSLPPHLLKCSRFEVVTACLWRCRTIAMEFDPNDEVRIFGTVNARP  656
             R F  GP E+S +R  +PPHL  CS+FE++TACLWRC  IA + +PN+E+RI   VNAR 
Sbjct  242   RCFIIGPKELSNIRKWIPPHLHPCSKFEIITACLWRCHAIASQANPNEEMRICMLVNARS  301

Query  655   RLKNPPVPNGYYGNAFVYPGAKSTAGKVSKSPLSHALELVTNIKSSFTEEYIKSVADLM-  479
             +  NPP+P GYYGN    P A ++A K+  + L +ALEL+ + K+  TEEYI+S+AD + 
Sbjct  302   KF-NPPLPKGYYGNVLALPAAITSARKLCLNSLGYALELIRHAKNKITEEYIRSLADFIE  360

Query  478   ILKGRPTFTLQGTFIVSDVTRVGFPEIDMGWGQSVFggpahggvggipGLITFYIPYEDN  299
             I KG P      +++VSD+T VGF ++D GWG+ V+ GP+      I    T+Y+PY + 
Sbjct  361   ITKGLPRGL--PSYVVSDLTSVGFDQVDYGWGKPVYTGPSKAMPDDINNSGTYYLPYRNK  418

Query  298   KGDHGILVPMCLPAIAMGKFVKELE  224
             KG+ G++V + L A  M +F    E
Sbjct  419   KGERGVMVLISLRAPVMERFAMLFE  443



>ref|XP_009368754.1| PREDICTED: methanol O-anthraniloyltransferase-like [Pyrus x bretschneideri]
Length=461

 Score =   465 bits (1197),  Expect = 2e-155, Method: Compositional matrix adjust.
 Identities = 235/447 (53%), Positives = 302/447 (68%), Gaps = 12/447 (3%)
 Frame = -1

Query  1549  MASQP-SIAFTVTRQNPELVAPADPTPREIKYLSDIDDQQGLRFQIPVIHFYRNEPSMSG  1373
             M S P S+ F V R  PELV PA PTP E K LSDID+Q+ LR Q P I  Y + PS   
Sbjct  1     MGSSPISLLFQVKRLVPELVTPASPTPCEQKILSDIDNQEALRCQTPFIWSYTSNPSSKE  60

Query  1372  KDPVQVIRQALAKALVFFYPFAGRLREGPGRKLMVDCTGEGVMFIEADADATLQHFAVGG  1193
              DPVQVIR A++++LV++YP AGR+REGP +KLMVDC GEGV+FIEADAD TL+    G 
Sbjct  61    IDPVQVIRDAISRSLVYYYPLAGRVREGPNKKLMVDCNGEGVLFIEADADVTLEQL--GD  118

Query  1192  ELKPPFPCFDQLLYNVPGSAEILNCPLFLIQVTRLRCGGFIFALRLNHSMSDACGLVHFL  1013
              L+PP P  +  LY+VPG+ +I+  PL ++QVTRL+CGGFIFA+RLNH+M DA GL  FL
Sbjct  119   TLQPPCPVLEDFLYDVPGTYDIVGTPLLIVQVTRLKCGGFIFAMRLNHTMFDAVGLAQFL  178

Query  1012  NTIAEIARGAEAPSVYPVWQREFFDARNPPRITCTHFEY--EEEPAADSMVTNIPLDNLV  839
             N + EIARGA APS+ P+W+RE  +AR PP++T  H EY  E E  A S++ ++   +LV
Sbjct  179   NAVGEIARGAHAPSIPPIWERELLNAREPPQVTYVHHEYGDENESQAGSVIASMDQPDLV  238

Query  838   HRSFFFGPTEISALRSSLPPHLLK-CSRFEVVTACLWRCRTIAMEFDPNDEVRIFGTVNA  662
              R F+FGP EI A R  LPP+L   CS FE++T CLW+CRTIA+  +PN+ VR+   VNA
Sbjct  239   QRCFYFGPKEIRAARKHLPPNLSNTCSTFELITGCLWKCRTIALAMNPNEAVRVSLVVNA  298

Query  661   RPRLKNPPVPNGYYGNAFVYPGAKSTAGKVSKSPLSHALELVTNIKSSFTEEYIKSVADL  482
             R +  N  VP G+YGNA  +PG  STA  +  SPL +A+ELV   K+   E+YIKSVADL
Sbjct  299   RGKRNNLNVPLGFYGNAIGFPGVVSTAQLLCNSPLEYAVELVREAKNKMNEDYIKSVADL  358

Query  481   MILKGRPTFTLQG-TFIVSDVTRVGFPEIDMGWGQSVFggpahggvggipGLITFYIPYE  305
             + L+G P  TL G  FI+SD TR G  E+D GWG+ +       G      LI+FY+   
Sbjct  359   LTLRGWPPLTLAGNNFILSDNTRTGVGEVDFGWGKPII-----AGPAKSVNLISFYVRDS  413

Query  304   DNKGDHGILVPMCLPAIAMGKFVKELE  224
             + + D+GILVPMCLP   M K  +EL+
Sbjct  414   NQEKDYGILVPMCLPFWCMKKIEQELK  440



>ref|XP_007029780.1| Benzoyl coenzyme A: Benzyl alcohol benzoyl transferase [Theobroma 
cacao]
 gb|EOY10282.1| Benzoyl coenzyme A: Benzyl alcohol benzoyl transferase [Theobroma 
cacao]
Length=475

 Score =   464 bits (1195),  Expect = 8e-155, Method: Compositional matrix adjust.
 Identities = 245/455 (54%), Positives = 313/455 (69%), Gaps = 17/455 (4%)
 Frame = -1

Query  1576  YLIMALSPFMASQPSIAFTVTRQNPELVAPADPTPREIKYLSDIDDQQGLRFQIPVIHFY  1397
             +  MAL P      S+ FTV R  PELV PA PTPRE K LSDIDDQ G RFQI  +HFY
Sbjct  19    FFAMALLP----PTSLVFTVRRHEPELVVPAKPTPRECKLLSDIDDQDGHRFQIRGLHFY  74

Query  1396  RNEPSMSGKDPVQVIRQALAKALVFFYPFAGRLREGPGRKLMVDCTGEGVMFIEADADAT  1217
             R +PSM GKDP  +I++AL KALVF+YP+AGRLREGP RKL+VDCTGEGV+FI+ADAD T
Sbjct  75    RFKPSMQGKDPACIIKEALTKALVFYYPYAGRLREGPNRKLVVDCTGEGVLFIQADADVT  134

Query  1216  LQHFAVGGELKPPFPCFDQLLYNVPGSAEILNCPLFLIQVTRLR-CGGFIFALRLNHSMS  1040
             L  F  G  L PPFPC+ +LLY VPGS EILNCPL  IQ   L+     I   + NH+MS
Sbjct  135   LDQF--GDSLHPPFPCYKELLYEVPGSNEILNCPLLQIQDIFLQNMKTRIVRSKFNHTMS  192

Query  1039  DACGLVHFLNTIAEIARGAEAPSVYPVWQREFFDARNPPRITCTHFEYEEEPAADSMVTN  860
              A G + F+  + E+ARGA APS  PV +R   +AR+ P ITC H EY+     + +   
Sbjct  193   KAVGQIQFMCAMGEMARGALAPSTPPVRERHLLNARHSPLITCVHDEYDNATLTNGI--E  250

Query  859   IPLDNLVHRSFFFGPTEISALRSSLPPHLLKCSRFEVVTACLWRCRTIAMEFDPNDEVRI  680
             +P DNL+HRSFFFGPT+ISAL   + PH  +CS F++V ACLWRCRT A++  PND+VR 
Sbjct  251   MP-DNLLHRSFFFGPTQISALYRFV-PHNFRCSTFDIVAACLWRCRTKALKLGPNDDVRF  308

Query  679   FGTVNARPRLKNPPVPNGYYGNAFVYPGAKSTAGKVSKSPLSHALELVTNIKSSFTEEYI  500
                VN R +  N P+P+G+YGN+  YP A +TAG++ ++P+ +A+ELV   K+  TEEY+
Sbjct  309   ICIVNGRSKF-NHPLPSGFYGNSLGYPVALTTAGQLCQNPMEYAIELVRQAKAKITEEYM  367

Query  499   KSVADLMILKGRPTFTLQGTFIVSDVTRVGFPEIDMGWGQSVFggpahggvggipGLITF  320
             KS ADLM+++GRP       F+VSD+TR  F E D GWG++ FG PA+GG       I+F
Sbjct  368   KSTADLMVIRGRPNVNTVRCFMVSDLTRAKFREADFGWGEAEFGEPAYGGDR-----ISF  422

Query  319   YIPYEDNKGDHGILVPMCLPAIAMGKFVKELENCL  215
             YIP ++ +G+ GI+VP+CLPA  M  FVKEL+  L
Sbjct  423   YIPSKNKEGEGGIVVPVCLPAPVMECFVKELDGIL  457



>ref|XP_006470742.1| PREDICTED: anthraniloyl-CoA:methanol acyltransferase-like [Citrus 
sinensis]
Length=447

 Score =   463 bits (1192),  Expect = 8e-155, Method: Compositional matrix adjust.
 Identities = 239/444 (54%), Positives = 310/444 (70%), Gaps = 15/444 (3%)
 Frame = -1

Query  1528  AFTVTRQNPELVAPADP-TPREIKYLSDIDDQQGLRFQIPVIHFYRNEPS--MSGKDPVQ  1358
              F+V R+ PEL+ PA      E+K LSDIDDQQGL FQ+P+I FY+N PS  M GKDPV+
Sbjct  8     GFSVKRRAPELIGPALALKSHEVKQLSDIDDQQGLWFQVPLIFFYKNNPSPSMKGKDPVK  67

Query  1357  VIRQALAKALVFFYPFAGRLREGPGRKLMVDCTGEGVMFIEADADATLQHFAVGGELKPP  1178
             VI++AL++ALV++YPFAGRLREG   KLMVDC GEGV+F EADAD +L       E+KPP
Sbjct  68    VIKEALSRALVYYYPFAGRLREGSDGKLMVDCNGEGVLFTEADADFSLDQLG-DDEIKPP  126

Query  1177  FPCFDQLLYNVPGSAEILNCPLFLIQVTRLRCGGFIFALRLNHSMSDACGLVHFLNTIAE  998
              P  D+LLY+VPGS   L CPL LIQVTRL CGGF+ A R NH+M DA G V FL  + E
Sbjct  127   CPYLDELLYDVPGSEGTLGCPLLLIQVTRLICGGFVLAFRGNHTMCDAFGFVQFLKAMEE  186

Query  997   IA-RGAEAPSVYPVWQREFFDARNPPRITCTHFEYEE-EPAADSMVTNIPLDNLVHRSFF  824
             +A   A+APS+ P+WQREF +ARNPP+I+C H EY++ +P   ++ T  P ++L H+S F
Sbjct  187   MAWDNAKAPSLLPIWQREFLNARNPPQISCVHHEYDQIDPIKATLRTKNP-NDLDHKSLF  245

Query  823   FGPTEISALRSSLPPHLLKCSRFEVVTACLWRCRTIAMEFDPNDEVRIFGTVNARPRLKN  644
             FGP EI +LR+ LPPHL  C+ FE++TAC+WRCRTIA+  DPN+ VR+  T N R +  N
Sbjct  246   FGPKEILSLRNQLPPHLKNCTTFELLTACIWRCRTIALGLDPNEIVRVSFTFNIRGKRFN  305

Query  643   PPVPNGYYGNAFVYPGAKSTAGKVSKSPLSHALELVTNIKSSFTEEYIKSVADLMILKGR  464
               +P GYYGNAFV+P   S   ++  SPL +A+ELV   K+  +EEYI+SVADLM+ +GR
Sbjct  306   MQIPQGYYGNAFVFPAVCSRVDELCGSPLGYAVELVKEGKAKVSEEYIRSVADLMVTRGR  365

Query  463   PTFTLQGT--FIVSDVTRVGFPEIDMGWGQSVFggpahggvggipGLITFYIPYE-DNKG  293
             P  T  G   FIVSD TR GF EID GWG+ +F      G+ G    I+FY+ Y+  N G
Sbjct  366   PVPTTMGDLYFIVSDTTRTGFEEIDFGWGKPMF-----AGIAGCALFISFYVNYQKKNDG  420

Query  292   DHGILVPMCLPAIAMGKFVKELEN  221
             + GI+VP+ LP  AM +F +E++ 
Sbjct  421   ECGIVVPIRLPFSAMERFQEEIKK  444



>ref|XP_002298962.2| hypothetical protein POPTR_0001s45210g [Populus trichocarpa]
 gb|EEE83767.2| hypothetical protein POPTR_0001s45210g [Populus trichocarpa]
Length=469

 Score =   464 bits (1194),  Expect = 8e-155, Method: Compositional matrix adjust.
 Identities = 237/450 (53%), Positives = 308/450 (68%), Gaps = 13/450 (3%)
 Frame = -1

Query  1549  MASQPSIAFTVTRQNPELVAPADPTPREIKYLSDIDDQQGLRFQIPVIHFYRNEPSMSGK  1370
             M +  S+AF V R  PELVAPA  TP E K LSDID Q  L+FQ P  +FY + PSM GK
Sbjct  1     MPTPTSLAFNVRRCEPELVAPAKATPHESKPLSDIDRQLYLQFQSPHYNFYAHNPSMQGK  60

Query  1369  DPVQVIRQALAKALVFFYPFAGRLREGPGRKLMVDCTGEGVMFIEADADATLQHFAVGGE  1190
             DPV+VIR+ +A+ALV++YP+AGR+R+ P  KL+VDCTGEGV+FIEADAD TL+ F  G  
Sbjct  61    DPVKVIREGIAQALVYYYPYAGRIRQEPENKLVVDCTGEGVLFIEADADGTLEQF--GDP  118

Query  1189  LKPPFPCFDQLLYNVPGSAEILNCPLFLIQVTRLRCGGFIFALRLNHSMSDACGLVHFLN  1010
             ++PPFPC ++LLYNVPGSA I+N PL +IQ+TRL+CGGFI   RLNH MSDA GLV  L+
Sbjct  119   IQPPFPCAEELLYNVPGSAGIINTPLLIIQITRLKCGGFILGFRLNHPMSDAIGLVQLLS  178

Query  1009  TIAEIARGAEAPSVYPVWQREFFDARNPPRITCTHFEY--EEEPAADSMVTNIP-----L  851
              I EI+RGA+APS+ PVWQRE   ARNPPR+TCTH EY    +   D    N+P      
Sbjct  179   AIGEISRGAQAPSILPVWQRELLCARNPPRVTCTHNEYGDHHDLVVDPSELNVPEFRGST  238

Query  850   DNLVHRSFFFGPTEISALRSSLPPHLLKCSRFEVVTACLWRCRTIAMEFDPNDEVRIFGT  671
             D   HR F  GP E+S +R  +P HL  CS+FE++TACLWRC  IA + +PN+E+RI   
Sbjct  239   DGAAHRCFIIGPKELSNIRKWIPRHLHPCSKFEIITACLWRCHAIASQANPNEEMRICML  298

Query  670   VNARPRLKNPPVPNGYYGNAFVYPGAKSTAGKVSKSPLSHALELVTNIKSSFTEEYIKSV  491
             VNAR +  NPP+P GYYGN    P A ++A K+  + L +ALEL+   K+  TEEYI+S+
Sbjct  299   VNARSKF-NPPLPKGYYGNVLALPAAITSARKLCLNSLGYALELIRQAKNKITEEYIRSL  357

Query  490   ADLM-ILKGRPTFTLQGTFIVSDVTRVGFPEIDMGWGQSVFggpahggvggipGLITFYI  314
             AD + I KG P   LQ +++VSD+T VGF ++D GWG+ V+ GP+      I    T+Y+
Sbjct  358   ADFIEITKGLPK-GLQ-SYVVSDLTSVGFDQVDYGWGKPVYTGPSKAMPDDINNSGTYYL  415

Query  313   PYEDNKGDHGILVPMCLPAIAMGKFVKELE  224
             PY + KG+ G++V + L A  M +F    E
Sbjct  416   PYRNKKGERGVMVLISLRAPVMARFAMLFE  445



>gb|ABR16407.1| unknown [Picea sitchensis]
Length=448

 Score =   463 bits (1192),  Expect = 8e-155, Method: Compositional matrix adjust.
 Identities = 232/442 (52%), Positives = 318/442 (72%), Gaps = 6/442 (1%)
 Frame = -1

Query  1534  SIAFTVTRQNPELVAPADPTPREIKYLSDIDDQQGLRFQIPVIHFYRNEPSMSGKDPVQV  1355
             ++ F VTR+   LVAP+ PTP+E  YLS+IDDQ GLRF IPV+ FY+ +PS  G+DP +V
Sbjct  3     TLQFKVTRKPAVLVAPSRPTPKEFLYLSNIDDQAGLRFHIPVVQFYQFDPSKKGEDPARV  62

Query  1354  IRQALAKALVFFYPFAGRLREGPGRKLMVDCTGEGVMFIEADADATLQHFAVGGELKPPF  1175
             IR+ LAKALVF+YPFAGRLR+ P  KL+VDCTGEGV+F+EADAD  L+ F   G+L+PPF
Sbjct  63    IREGLAKALVFYYPFAGRLRDAPAGKLVVDCTGEGVLFVEADADVALEEF---GDLQPPF  119

Query  1174  PCFDQLLYNVPGSAEILNCPLFLIQVTRLRCGGFIFALRLNHSMSDACGLVHFLNTIAEI  995
             PC++ LL++VP S  + N PL LIQVTRLRCGGFIFALRLNH+M DA GLV F+N + E+
Sbjct  120   PCWEDLLHDVPASLTLTNSPLLLIQVTRLRCGGFIFALRLNHTMCDAFGLVQFMNALGEM  179

Query  994   ARGAEAPSVYPVWQREFFDARNPPRITCTHFEYEEEPAADSMVTNIPLDNLVHRSFFFGP  815
             A+GA  PSV PVW+RE    R  P +    +EY +    D  +  +P++ + H SFFFGP
Sbjct  180   AKGASRPSVRPVWKREILRPRTNPAVKFPLYEYNQIEDKDGQM--VPVNEMSHNSFFFGP  237

Query  814   TEISALRSSLPPHLLKCSRFEVVTACLWRCRTIAMEFDPNDEVRIFGTVNARPRLKNPPV  635
             +E+ +L+       +K   FEV++ACLWR RT A++     EVR+   ++AR R  +PP+
Sbjct  238   SEMESLKRQAVGQGMKSRTFEVLSACLWRFRTRALQLPSEQEVRLIFPLDARTRF-DPPL  296

Query  634   PNGYYGNAFVYPGAKSTAGKVSKSPLSHALELVTNIKSSFTEEYIKSVADLMILKGRPTF  455
             P G+YGNA  +  AK+TAG+++K+PLS AL+L+   K++  +EY++SV DLM L+GRP F
Sbjct  297   PKGFYGNAISFACAKTTAGELAKNPLSFALKLINEAKTAVNDEYMRSVIDLMELEGRPHF  356

Query  454   TLQGTFIVSDVTRVGFPEIDMGWGQSVFggpahggvggipGLITFYIPYEDNKGDHGILV  275
             T+ G+F+VSDVT++GF ++D GWG++ +GGPA GGVG +PG+ +F+IP  +  G  GILV
Sbjct  357   TVVGSFLVSDVTKIGFGDVDFGWGRAAYGGPAKGGVGAVPGVSSFFIPLRNTSGVEGILV  416

Query  274   PMCLPAIAMGKFVKELENCLMK  209
             P+CLP+ AM  F  E+     K
Sbjct  417   PVCLPSAAMKIFQAEISEATEK  438



>ref|XP_011009230.1| PREDICTED: benzyl alcohol O-benzoyltransferase-like [Populus 
euphratica]
Length=399

 Score =   461 bits (1187),  Expect = 8e-155, Method: Compositional matrix adjust.
 Identities = 226/405 (56%), Positives = 294/405 (73%), Gaps = 8/405 (2%)
 Frame = -1

Query  1381  MSGKDPVQVIRQALAKALVFFYPFAGRLREGPGRKLMVDCTGEGVMFIEADADATLQHFA  1202
             M GKDPV+VIR+A+AK LVF+YPFAGRLREG  RKLMV+CTGEG++FIEADAD TL+ F 
Sbjct  1     MHGKDPVKVIREAIAKTLVFYYPFAGRLREGHNRKLMVECTGEGILFIEADADVTLEQF-  59

Query  1201  VGGELKPPFPCFDQLLYNVPGSAEILNCPLFLIQVTRLRCGGFIFALRLNHSMSDACGLV  1022
              G  L+PPFPC ++LL++VPGS+ +LNCPL LIQV+RL+CGGF+FALRLNH+MSD  GL 
Sbjct  60    -GDPLQPPFPCLEELLFDVPGSSGVLNCPLLLIQVSRLKCGGFLFALRLNHTMSDGPGLE  118

Query  1021  HFLNTIAEIARGAEAPSVYPVWQREFFDARNPPRITCTHFEYEEEPAADSMVTNIPLDNL  842
              F+  + E+ARGA APSV PVW+R    A +PPR+TC H  YEE   A S  + +  D+L
Sbjct  119   QFMAAVGEMARGANAPSVPPVWERHVLKATDPPRVTCRHLAYEE--VAGSTSSILTHDHL  176

Query  841   VHRSFFFGPTEISALRSSLPPHLLKCSRFEVVTACLWRCRTIAMEFDPNDEVRIFGTVNA  662
             VHRSFFF P++I+ALR  +PPHL  CS FE++TACLW CRTIA++  PN+E+RI   VNA
Sbjct  177   VHRSFFFSPSDITALRRLVPPHLSHCSTFEILTACLWICRTIALQPHPNEEMRIICLVNA  236

Query  661   RPRLKNPPVPNGYYGNAFVYPGAKSTAGKVSKSPLSHALELVTNIKSSFTEEYIKSVADL  482
             R +   P +P GYYGN F+   A +TAG++SK P+ +ALELV   K++ TEE ++S A L
Sbjct  237   RGKFNPPLLPRGYYGNGFLLLAAVATAGELSKKPIGYALELVRKAKAAMTEECMRSTASL  296

Query  481   MILKGRPTFTLQGTFIVSDVTRVGFPEIDMGWGQSVFggpahggvggipGLITFYIPYED  302
             M+ KGRP FT+ GT+IVSD+  VGF ++D GWG +++GG A           +FYIP+ +
Sbjct  297   MVSKGRPLFTVPGTYIVSDLRHVGFEKVDFGWGNAIYGGTAKAAPEPA----SFYIPFTN  352

Query  301   NKGDHGILVPMCLPAIAMGKFVKELENCLMK**TSSSQNSMHLIY  167
              KG+ GILV  CLP+ A+ +F K LE  L     SS  NS  ++Y
Sbjct  353   KKGEDGILVLFCLPSPAVERFYKGLEGMLKGQLVSSGANSKLIVY  397



>ref|XP_006470570.1| PREDICTED: anthraniloyl-CoA:methanol acyltransferase-like [Citrus 
sinensis]
Length=456

 Score =   463 bits (1192),  Expect = 1e-154, Method: Compositional matrix adjust.
 Identities = 224/446 (50%), Positives = 312/446 (70%), Gaps = 17/446 (4%)
 Frame = -1

Query  1534  SIAFTVTRQNPELVAPADPTPREIKYLSDIDDQQGLRFQIPVIHFYRNEPS--MSGKDPV  1361
             S    VTR+ PEL+ P  PTPRE+K +SDIDDQ+ LRFQIP++ FY+N+PS  M G+DPV
Sbjct  6     SRGLLVTRKAPELIVPERPTPREVKQISDIDDQESLRFQIPLLFFYKNDPSPSMQGRDPV  65

Query  1360  QVIRQALAKALVFFYPFAGRLREGPGRKLMVDCTGEGVMFIEADADATLQHFAVGGELKP  1181
             +VIR+A++KALVF+YP AGRL+EG  RKLMV+C  EGV+FIEADA+ TL+   +G +++P
Sbjct  66    KVIREAISKALVFYYPLAGRLKEGYNRKLMVECNAEGVLFIEADANFTLEQ--LGDDIQP  123

Query  1180  PFPCFDQLLYNVPGSAEILNCPLFLIQVTRLRCGGFIFALRLNHSMSDACGLVHFLNTIA  1001
             P P  +QL+Y+VPGS  IL CPL LIQVTRL CGGFIFA+R NH+M DA GLV FL  I 
Sbjct  124   PCPYLNQLIYDVPGSEGILGCPLLLIQVTRLTCGGFIFAIRFNHTMCDAFGLVQFLKAIE  183

Query  1000  EIARGAEAPSVYPVWQREFFDARNPPRITCTHFEYEEEPAADSMVTN-IPLDNLVHRSFF  824
             ++ARG  +P+++P+WQR+  +ARNPP++TC H EY+E      + TN +P DN+ H+SFF
Sbjct  184   DMARGERSPNLFPIWQRQILNARNPPQVTCIHHEYDE------INTNEVPSDNMAHKSFF  237

Query  823   FGPTEISALRSSLPPHLLKCSRFEVVTACLWRCRTIAMEFDPNDEVRIFGTVNARPRLKN  644
             F    I ALR+ LP HL  CS FE++ A LW+CRTIA++  P +  ++   VN R +   
Sbjct  238   FSLKGIKALRNQLPFHLKDCSTFELLLAFLWKCRTIALKLQPEEIAKVCCIVNVRGKSYE  297

Query  643   PPVPNGYYGNAFVYPGAKSTAGKVSKSPLSHALELVTNIKSSFTEEYIKSVADLMILKGR  464
               +P GY GNAF +    S A ++ K+P+ +A+ELV   K+   EEYI+S ADLM++KGR
Sbjct  298   MDIPPGYCGNAFTFSAVCSKAEQLCKNPIGYAVELVKKAKAQMNEEYIRSAADLMVIKGR  357

Query  463   P-TFTLQGTFIVSDVTRVGFPEIDMGWGQSVFggpahggvggipGLITFYIPYEDNKGDH  287
                F+ +G FIVSD+  VG  ++D GWG+ ++      G  G   +I+F+  Y++  G+ 
Sbjct  358   RIKFSTRGNFIVSDLRNVGLGDVDFGWGKPIY-----AGTAGAVAVISFFTKYQNKNGEP  412

Query  286   GILVPMCLPAIAMGKFVKELENCLMK  209
             GILVP+CLP  AM +  +EL+  +++
Sbjct  413   GILVPICLPQSAMERLQEELKGLMIQ  438



>ref|XP_003626383.1| Benzoyl coenzyme A benzyl alcohol benzoyl transferase [Medicago 
truncatula]
Length=510

 Score =   465 bits (1197),  Expect = 1e-154, Method: Compositional matrix adjust.
 Identities = 237/444 (53%), Positives = 315/444 (71%), Gaps = 8/444 (2%)
 Frame = -1

Query  1549  MASQPSIAFTVTRQNPELVAPADPTPREIKYLSDIDDQQGLRFQIPVIHFYRNEPSMSGK  1370
             M S P + FTV R  PELV PA PTPRE+K LSDIDDQ+GLRF IP++  YR+EPSM  K
Sbjct  1     MTSAP-LLFTVRRSQPELVPPAAPTPREVKLLSDIDDQEGLRFNIPMMFIYRHEPSMKEK  59

Query  1369  DPVQVIRQALAKALVFFYPFAGRLREGPGRKLMVDCTGEGVMFIEADADATLQHFAVGGE  1190
             DPV+V+R AL++ALV++YPFAGR+REG GRKLMVDCTGEGVMF+EA+AD TL  F  G  
Sbjct  60    DPVKVLRHALSQALVYYYPFAGRIREGAGRKLMVDCTGEGVMFVEAEADVTLDEF--GDA  117

Query  1189  LKPPFPCFDQLLYNVPGSAEILNCPLFLIQVTRLRCGGFIFALRLNHSMSDACGLVHFLN  1010
             L PP PCF++LLY+VPGS  I++ P+ LIQVTRL+CG FI  + LNH+MSD  GL  F+N
Sbjct  118   LHPPLPCFEELLYDVPGSELIIDRPIRLIQVTRLKCGSFILVVYLNHTMSDGAGLKLFMN  177

Query  1009  TIAEIARGAEAPSVYPVWQREFFDARNPPRITCTHFEYEEEPAADSMVTNIPLDNLVHRS  830
               AE+ARGA  PS+ PVW RE   AR+PP ITC H EYE+  ++++ +       LVH+S
Sbjct  178   AWAEMARGAHKPSIQPVWNREILMARDPPHITCNHHEYEQIFSSNT-IKEEDTTTLVHQS  236

Query  829   FFFGPTEISALRSSLPPHLLKCSRFEVVTACLWRCRTIAMEFDPNDEVRIFGTVNARPRL  650
             FFF  ++I  LR  +P HL  C+ F+++T+C W CRT A++ + +DE+R+   VNAR R 
Sbjct  237   FFFRTSDIVVLRLLVPFHLRHCTTFDLITSCFWCCRTKALQLEADDEIRMMCIVNARSRF  296

Query  649   --KNPPVPNGYYGNAFVYPGAKSTAGKVSKSPLSHALELVTNIKSSFTEEYIKSVADLMI  476
                N P+  GYYGN F YP A +TAGK+  + L +A+ELV  +K+  TEEY+ SVADLM+
Sbjct  297   NANNSPLV-GYYGNCFAYPAAVTTAGKLCGNSLGYAVELVRKLKAEVTEEYMHSVADLMV  355

Query  475   LKGRPTFTLQGTFIVSDVTRVGFPEIDMGWGQSVFggpahggvggipGLITFYIPYEDNK  296
             +K R  FT   + +VSDVTR+   E+D GWG++V+GG A  G G  PG   + IP+++ +
Sbjct  356   IKERCLFTTIRSCVVSDVTRIKLREVDFGWGEAVYGGAAKSGAGPFPG-AAYIIPHKNVE  414

Query  295   GDHGILVPMCLPAIAMGKFVKELE  224
             G+ G ++ +CL   AM +F KEL+
Sbjct  415   GEEGFILLVCLSFEAMKRFAKELD  438



>ref|XP_010492712.1| PREDICTED: (Z)-3-hexen-1-ol acetyltransferase-like [Camelina 
sativa]
Length=447

 Score =   462 bits (1190),  Expect = 1e-154, Method: Compositional matrix adjust.
 Identities = 245/443 (55%), Positives = 315/443 (71%), Gaps = 8/443 (2%)
 Frame = -1

Query  1534  SIAFTVTRQNPELVAPADPTPREIKYLSDIDDQQGLRFQIPVIHFYRNEPSMSGKDPVQV  1355
             S+ F V RQ PELV+PA PTPRE+K LSDIDDQQGLRF IP I FYR+ P+    DPV V
Sbjct  4     SLTFKVHRQKPELVSPAKPTPRELKLLSDIDDQQGLRFHIPTIFFYRHSPN-PYSDPVAV  62

Query  1354  IRQALAKALVFFYPFAGRLREG-PGRKLMVDCTGEGVMFIEADADATLQHFAVGGELKPP  1178
             IR++LA+ LV++YPFAGRLR+G P RKL VDCTGEGV+FIEADAD TL  F     LKPP
Sbjct  63    IRRSLAETLVYYYPFAGRLRDGGPNRKLAVDCTGEGVLFIEADADVTLVEFEEKDVLKPP  122

Query  1177  FPCFDQLLYNVPGSAEILNCPLFLIQVTRLRCGGFIFALRLNHSMSDACGLVHFLNTIAE  998
             FPCF++LL++V GS+E+LN PL L+QVTRL+CGGFIFA+R+NH MSDA GL  FL T+ +
Sbjct  123   FPCFEELLFDVNGSSEVLNAPLMLMQVTRLKCGGFIFAVRINHVMSDAAGLSLFLKTVCD  182

Query  997   IARGAEAPSVYPVWQREFFDARNPPRITCTHFEYEEEPAADSMVTNIPLDNLVHRSFFFG  818
              ARG  AP V PVW+R   +AR P R++  H EY+E P   +   +   DNLV RSFFFG
Sbjct  183   FARGYHAPKVAPVWERHLLNARVPLRVSHAHREYDEIPVVGTD-NDSKEDNLVSRSFFFG  241

Query  817   PTEISALRSSLPPHLL-KCSRFEVVTACLWRCRTIAMEFDPNDEVRIFGTVNARPRLKNP  641
               E+SA+R  LPP+L+ + +  E +T+ +WR RT+A++ DPN E+R+   V+AR +L  P
Sbjct  242   HKEMSAIRRLLPPNLVNRSTVMETLTSFIWRYRTVAIQPDPNKEMRLIFIVSARSKLTTP  301

Query  640   PVPNGYYGNAFVYPGAKSTAGKVSKSPLSHALELVTNIKSSFTEEYIKSVADLMILKGRP  461
             P+  GYYGNAF +P A +TA +++K PL  AL L    K S TEEY++S+ADLM+ KGRP
Sbjct  302   PLSPGYYGNAFAFPVAIATARELTKKPLEFALRLAKEAKYSVTEEYMRSLADLMVTKGRP  361

Query  460   TFTLQGTFIVSDVTRVGFPEIDMG-WGQSVFggpahggvggipGLITFYIPYEDNKGDHG  284
             +F+  G ++VSDV R+ F  ID G WG+ V+GG    GV   PG  + Y+  E   G+ G
Sbjct  362   SFSSDGAYLVSDV-RI-FANIDFGIWGKPVYGGIGTAGVVDFPG-ASCYVSAEKRNGERG  418

Query  283   ILVPMCLPAIAMGKFVKELENCL  215
             I+VP+CLP  AM +FVKELE   
Sbjct  419   IIVPVCLPEKAMQRFVKELEGVF  441



>ref|XP_010453953.1| PREDICTED: (Z)-3-hexen-1-ol acetyltransferase-like [Camelina 
sativa]
Length=447

 Score =   462 bits (1188),  Expect = 3e-154, Method: Compositional matrix adjust.
 Identities = 243/443 (55%), Positives = 312/443 (70%), Gaps = 8/443 (2%)
 Frame = -1

Query  1534  SIAFTVTRQNPELVAPADPTPREIKYLSDIDDQQGLRFQIPVIHFYRNEPSMSGKDPVQV  1355
             S+ F V RQ PELV PA PTPRE+K LSDIDDQQGLRF IP I FYR+ P  +  DPV V
Sbjct  4     SLTFKVHRQKPELVFPAKPTPRELKLLSDIDDQQGLRFHIPTIFFYRHNPK-AYSDPVAV  62

Query  1354  IRQALAKALVFFYPFAGRLREG-PGRKLMVDCTGEGVMFIEADADATLQHFAVGGELKPP  1178
             IR+ALA+ LV++YPFAGRLR+G P RKL VDCTGEGV+FIEADAD TL  F     LKPP
Sbjct  63    IRRALAETLVYYYPFAGRLRDGGPNRKLAVDCTGEGVLFIEADADVTLVEFEEKDALKPP  122

Query  1177  FPCFDQLLYNVPGSAEILNCPLFLIQVTRLRCGGFIFALRLNHSMSDACGLVHFLNTIAE  998
             FPCF++LL++V GS+E+LN PL L+QVTRL+CGGFIFA+R+NH MSDA GL  FL T+ +
Sbjct  123   FPCFEELLFDVKGSSEVLNTPLMLMQVTRLKCGGFIFAVRINHVMSDAAGLSLFLKTMCD  182

Query  997   IARGAEAPSVYPVWQREFFDARNPPRITCTHFEYEEEPAADSMVTNIPLDNLVHRSFFFG  818
              ARG  AP+V PVW+R   +AR P R++  H EY+E P   +   +   DNLV RSFFFG
Sbjct  183   FARGYHAPTVAPVWERHLLNARAPLRVSHAHREYDEMPVTGTD-NDSKEDNLVSRSFFFG  241

Query  817   PTEISALRSSLPPHLL-KCSRFEVVTACLWRCRTIAMEFDPNDEVRIFGTVNARPRLKNP  641
               E+SA+R  LPP+L+ + +  E +T+ +WR RT+A++ DPN ++R+   V+AR +L  P
Sbjct  242   HKEMSAIRRLLPPNLVNRSTVMETLTSFIWRYRTVAIQPDPNKDMRLIFIVSARSKLTTP  301

Query  640   PVPNGYYGNAFVYPGAKSTAGKVSKSPLSHALELVTNIKSSFTEEYIKSVADLMILKGRP  461
             P+  GYYGNAF +P A +TA +++K PL  AL L    K S TEEY++S+ADLM+ KGRP
Sbjct  302   PLSPGYYGNAFAFPVAIATARELTKKPLEFALRLAKEAKYSVTEEYMRSLADLMVTKGRP  361

Query  460   TFTLQGTFIVSDVTRVGFPEIDMG-WGQSVFggpahggvggipGLITFYIPYEDNKGDHG  284
              F+  G ++VSDV  +    ID G WG+ V+GG    GV   PG  + Y+  E   G+ G
Sbjct  362   RFSSDGAYLVSDVRILA--NIDFGIWGKPVYGGIGRAGVVNFPG-ASCYVSAEKRNGERG  418

Query  283   ILVPMCLPAIAMGKFVKELENCL  215
             I+VP+CLP  AM +FVKELE   
Sbjct  419   IIVPVCLPEKAMQRFVKELEGVF  441



>ref|XP_006446261.1| hypothetical protein CICLE_v10015234mg [Citrus clementina]
 gb|ESR59501.1| hypothetical protein CICLE_v10015234mg [Citrus clementina]
Length=447

 Score =   462 bits (1188),  Expect = 3e-154, Method: Compositional matrix adjust.
 Identities = 237/443 (53%), Positives = 308/443 (70%), Gaps = 15/443 (3%)
 Frame = -1

Query  1525  FTVTRQNPELVAPA-DPTPREIKYLSDIDDQQGLRFQIPVIHFYRNEPS--MSGKDPVQV  1355
             F+V R+ PEL+ PA  P   E+K LSDIDDQQGL FQ+P+I FY+N PS  M GKDPV+V
Sbjct  9     FSVKRRAPELIGPALAPKSHEVKQLSDIDDQQGLWFQVPLIFFYKNNPSPSMKGKDPVKV  68

Query  1354  IRQALAKALVFFYPFAGRLREGPGRKLMVDCTGEGVMFIEADADATLQHFAVGGELKPPF  1175
             I++AL++ALV++YPFAGRLREG   KLMVDC GEGV+F EADAD +L       E+KPP 
Sbjct  69    IKEALSRALVYYYPFAGRLREGSDGKLMVDCNGEGVLFTEADADFSLDQLG-DDEIKPPC  127

Query  1174  PCFDQLLYNVPGSAEILNCPLFLIQVTRLRCGGFIFALRLNHSMSDACGLVHFLNTIAEI  995
             P  D+LLY+VPGS   L CPL L QVTRL CGGF+ A R+NH+M DA G V FL  + E+
Sbjct  128   PYLDELLYDVPGSEGTLGCPLLLFQVTRLICGGFVLAFRVNHTMCDAFGFVQFLKAMEEM  187

Query  994   A-RGAEAPSVYPVWQREFFDARNPPRITCTHFEYEE-EPAADSMVTNIPLDNLVHRSFFF  821
             A   A+APS+ P+WQRE  +ARNPP+I+C H EY++ +P   ++ T  P ++L H+S FF
Sbjct  188   AWDNAKAPSLLPIWQRELLNARNPPQISCVHHEYDQIDPIKATLRTKNP-NDLDHKSLFF  246

Query  820   GPTEISALRSSLPPHLLKCSRFEVVTACLWRCRTIAMEFDPNDEVRIFGTVNARPRLKNP  641
             GP EI +LR+ LPPHL  C+ FE++TAC+WRCRTIA+  DPN+ VR+  T N R +  N 
Sbjct  247   GPKEILSLRNQLPPHLKNCTTFELLTACIWRCRTIALGLDPNEIVRVSFTFNIRGKRFNM  306

Query  640   PVPNGYYGNAFVYPGAKSTAGKVSKSPLSHALELVTNIKSSFTEEYIKSVADLMILKGRP  461
              +P GYYGNAFV+P   S    +  SPL +A+ELV   K+  +EEYI+SVADLM+ +GRP
Sbjct  307   QIPQGYYGNAFVFPAVCSRVDALCGSPLGYAVELVKEGKAKVSEEYIRSVADLMVTRGRP  366

Query  460   TFTLQGT--FIVSDVTRVGFPEIDMGWGQSVFggpahggvggipGLITFYIPYE-DNKGD  290
               T  G   FIVSD TR GF EID GWG+ +F      G+ G    I+FY+ Y+  N  +
Sbjct  367   VPTTMGDLYFIVSDTTRTGFEEIDFGWGKPMF-----AGIAGCALFISFYVNYQKKNDCE  421

Query  289   HGILVPMCLPAIAMGKFVKELEN  221
              GI+VP+ LP  AM +F +E++ 
Sbjct  422   RGIVVPIRLPFSAMERFQEEIKK  444



>gb|KEH40976.1| benzyl alcohol O-benzoyltransferase [Medicago truncatula]
Length=417

 Score =   460 bits (1184),  Expect = 4e-154, Method: Compositional matrix adjust.
 Identities = 238/440 (54%), Positives = 302/440 (69%), Gaps = 47/440 (11%)
 Frame = -1

Query  1534  SIAFTVTRQNPELVAPADPTPREIKYLSDIDDQQGLRFQIPVIHFYRNEPSMSGKDPVQV  1355
             S+ F V R  PE V P+ PTP EIK LSDIDDQ+GLR+Q+PVI FY   P M+ KDPV V
Sbjct  4     SLVFKVKRCAPEFVRPSKPTPHEIKLLSDIDDQEGLRYQMPVIQFYNYVPVMAEKDPVDV  63

Query  1354  IRQALAKALVFFYPFAGRLREGPGRKLMVDCTGEGVMFIEADADATLQHFAVGGELKPPF  1175
             IR+ALAK LVF+YPFAGRLREGPGRKLMVDCTGEGV+FIEADAD T++   +G  L PPF
Sbjct  64    IRKALAKTLVFYYPFAGRLREGPGRKLMVDCTGEGVLFIEADADVTIKD--LGDTLHPPF  121

Query  1174  PCFDQLLYNVPGSAEILNCPLFLIQVTRLRCGGFIFALRLNHSMSDACGLVHFLNTIAEI  995
              C D+LLY+V GS+++LN PL LIQVTRL+CGGFIFALRLNH+MSDA GLV F+N + +I
Sbjct  122   RCLDELLYDVLGSSDVLNTPLLLIQVTRLKCGGFIFALRLNHTMSDAAGLVQFMNALGKI  181

Query  994   ARGAEAPSVYPVWQREFFDARNPPRITCTHFEYEEEPAADSMVTNIPLDNLVHRSFFFGP  815
             +RG   PS+ PVW RE  +AR+PPR+TCTH EYE+ P  D+  T I LD  + RSFFFGP
Sbjct  182   SRGMNKPSISPVWHRELLNARDPPRVTCTHHEYEQVP--DTKGTIISLDATILRSFFFGP  239

Query  814   TEISALRSSLPPHLLKCSRFEVVTACLWRCRTIAMEFDPNDEVRIFGTVNARPRLKNPPV  635
             TE++A+R+ LPPH  + S FE++TA LWRCRTIA++ D N EV I   VN   +  NPP+
Sbjct  240   TEVAAIRALLPPHQQEHSNFEILTAFLWRCRTIALQPDINGEVHI---VNTHGKFINPPL  296

Query  634   PNGYYGNAFVYPGAKSTAGKVSKSPLSHALELVTNIKSSFTEEYIKSVADLMILKGRPTF  455
             PNG YGN+F +P A +TA                                   +K RP F
Sbjct  297   PNGNYGNSFAFPAAVTTA-----------------------------------VKSRPHF  321

Query  454   TLQGTFIVSDVTRVGFPEIDMGWGQSVFggpahggvggipGLITFYIPYEDNKGDHGILV  275
             T+  +++V D+   GF E+D GWG+  +GGPA GGV       + YIP+++ KG  G+++
Sbjct  322   TVVRSYLVVDIKHAGFREVDFGWGKPCYGGPAKGGVVS-----SSYIPFKNAKGIEGLVI  376

Query  274   PMCLPAIAMGKFVKELENCL  215
             P+CLP  AM +F+KEL+  L
Sbjct  377   PVCLPTKAMERFIKELDGVL  396



>gb|AHC32224.2| alcohol acyl transferase 1 [Eriobotrya japonica]
Length=459

 Score =   461 bits (1186),  Expect = 8e-154, Method: Compositional matrix adjust.
 Identities = 228/442 (52%), Positives = 307/442 (69%), Gaps = 12/442 (3%)
 Frame = -1

Query  1537  PSIAFTVTRQNPELVAPADPTPREIKYLSDIDDQQGLRFQIPVIHFYRNEPSMS-GKDPV  1361
             P     V R  PE + PA P P+E K+LSDIDDQ+GLRF +PVI  Y++ PS++  ++PV
Sbjct  3     PLSVLQVKRLQPEFITPAKPMPQETKFLSDIDDQEGLRFHVPVIMCYKDNPSLNENRNPV  62

Query  1360  QVIRQALAKALVFFYPFAGRLREGPGRKLMVDCTGEGVMFIEADADATLQHFAVGGELKP  1181
             +VIR+A+++ALV++YP AGRLRE P RKL+VDC  EG++F+EA A+ TL+   +G ++ P
Sbjct  63    KVIREAVSRALVYYYPLAGRLREWPNRKLVVDCNSEGILFVEAFANVTLEQ--LGDKILP  120

Query  1180  PFPCFDQLLYNVPGSAEILNCPLFLIQVTRLRCGGFIFALRLNHSMSDACGLVHFLNTIA  1001
             P P  ++ L+NVPGS  I+ CPL L+QVT L CGGFI ALRLNH+M DA GLV FL  IA
Sbjct  121   PCPLLEEFLFNVPGSDGIIGCPLLLVQVTCLTCGGFILALRLNHTMCDAPGLVLFLTAIA  180

Query  1000  EIARGAEAPSVYPVWQREFFDARNPPRITCTHFEYEEE-PAADSMVTNIPLDNLVHRSFF  824
             E+A GA APS+ PVW+RE   AR+PPRITC H EYE+    +D         N+V RSF+
Sbjct  181   EMASGAHAPSILPVWERELLFARDPPRITCAHHEYEDVIDHSDGSYAXSNQSNMVQRSFY  240

Query  823   FGPTEISALRSSLPPHLLK-CSRFEVVTACLWRCRTIAMEFDPNDEVRIFGTVNARPRLK  647
             FG  E+  LR  +PPHL+  CS F+++TACLW+C T+A++ +P   V++  TVNAR +  
Sbjct  241   FGAKEMRVLRKQIPPHLISTCSTFDLITACLWKCHTLALKINPKQVVQVSFTVNARGKHH  300

Query  646   NPPVPNGYYGNAFVYPGAKSTAGKVSKSPLSHALELVTNIKSSFTEEYIKSVADLMILKG  467
             N  +P GYYGNAF +P A S A  + K+PL +ALELV   K++  EEY++SVADL++L+G
Sbjct  301   NVRLPLGYYGNAFAFPAAVSKAEPLCKNPLGYALELVKKAKATMNEEYLRSVADLLVLRG  360

Query  466   RPTFTLQGT-FIVSDVTRVGFPEIDMGWGQSVFggpahggvggipGLITFYIPYEDNKGD  290
             RP +   G+ FIVSD TR GF +++ GWGQ VF      G      L  FY+ +++N  D
Sbjct  361   RPQYLYTGSYFIVSDNTRAGFGDVNFGWGQPVF-----AGPAKAVDLFRFYVQHKNNTED  415

Query  289   HGILVPMCLPAIAMGKFVKELE  224
              GILVPMCLP+ AM +F +ELE
Sbjct  416   -GILVPMCLPSSAMERFQQELE  436



>ref|XP_009365780.1| PREDICTED: methanol O-anthraniloyltransferase-like [Pyrus x bretschneideri]
Length=461

 Score =   461 bits (1186),  Expect = 9e-154, Method: Compositional matrix adjust.
 Identities = 233/452 (52%), Positives = 305/452 (67%), Gaps = 12/452 (3%)
 Frame = -1

Query  1549  MASQP-SIAFTVTRQNPELVAPADPTPREIKYLSDIDDQQGLRFQIPVIHFYRNEPSMSG  1373
             M S P S+ F V R  PELV PA PTP E K LS+ID+Q+ LR Q+P I  Y + PS   
Sbjct  1     MGSSPISLLFQVKRLEPELVTPASPTPCEQKILSEIDNQEALRCQVPFIWSYTSNPSSKE  60

Query  1372  KDPVQVIRQALAKALVFFYPFAGRLREGPGRKLMVDCTGEGVMFIEADADATLQHFAVGG  1193
              DPVQVIR AL+++LV++YP AGR+R+GP +KLMVDC GEGV+F EADAD TL+    G 
Sbjct  61    IDPVQVIRDALSRSLVYYYPLAGRVRKGPNKKLMVDCNGEGVLFREADADFTLEQL--GD  118

Query  1192  ELKPPFPCFDQLLYNVPGSAEILNCPLFLIQVTRLRCGGFIFALRLNHSMSDACGLVHFL  1013
              L+PP P  +  LY+VPG+++I+  PL ++QVTRL+CGGFIFALRLNH+M DA GL  FL
Sbjct  119   TLQPPCPLLEDFLYDVPGTSDIVGTPLLIVQVTRLKCGGFIFALRLNHTMFDAVGLAQFL  178

Query  1012  NTIAEIARGAEAPSVYPVWQREFFDARNPPRITCTHFEY--EEEPAADSMVTNIPLDNLV  839
             N + EIARGA APS+ P+W+RE  +AR PP++T  H EY  E E  A S++ ++   +LV
Sbjct  179   NAVGEIARGAHAPSIPPIWERELLNAREPPQVTYMHHEYGDENESQAGSVIASMDQPDLV  238

Query  838   HRSFFFGPTEISALRSSLPPHLLK-CSRFEVVTACLWRCRTIAMEFDPNDEVRIFGTVNA  662
              R F+FGP EI A R  LPP+L K C+ FE++T CLW+CRTIA+  +PN+ VR+   VNA
Sbjct  239   QRCFYFGPKEIRAARKHLPPNLSKTCTTFELITGCLWKCRTIALAMNPNEVVRVSLVVNA  298

Query  661   RPRLKNPPVPNGYYGNAFVYPGAKSTAGKVSKSPLSHALELVTNIKSSFTEEYIKSVADL  482
             R +  N  VP+G+YGNA  +PG  STA  +  SPL +A+ELV   K+   E+YIKSVADL
Sbjct  299   RGKCNNLNVPSGFYGNAIGFPGVVSTAELLCNSPLEYAVELVREAKNKMNEDYIKSVADL  358

Query  481   MILKGRPTFTLQG-TFIVSDVTRVGFPEIDMGWGQSVFggpahggvggipGLITFYIPYE  305
             + L+G P  TL G  FI+SD TR G  E+D GWG+ +       G      LI+FY+   
Sbjct  359   LALRGWPPLTLAGNNFILSDNTRTGVGEVDFGWGKPII-----AGPAKSVNLISFYVRDS  413

Query  304   DNKGDHGILVPMCLPAIAMGKFVKELENCLMK  209
             + + D+ IL PMCLP   M K  +EL+   M+
Sbjct  414   NQEKDYKILAPMCLPFWCMEKIEQELKRITME  445



>ref|XP_003626389.1| Benzoyl coenzyme A benzyl alcohol benzoyl transferase [Medicago 
truncatula]
Length=560

 Score =   464 bits (1195),  Expect = 1e-153, Method: Compositional matrix adjust.
 Identities = 239/447 (53%), Positives = 319/447 (71%), Gaps = 8/447 (2%)
 Frame = -1

Query  1549  MASQPSIAFTVTRQNPELVAPADPTPREIKYLSDIDDQQGLRFQIPVIHFYRNEPSMSGK  1370
             M S P + FTV R  PELV PA PTP E+K LSDIDDQ+GLRF IP+I  Y +EPSM+ K
Sbjct  1     MTSSP-LLFTVRRCQPELVPPAAPTPCEVKLLSDIDDQEGLRFNIPMIFIYHHEPSMAEK  59

Query  1369  DPVQVIRQALAKALVFFYPFAGRLREGPGRKLMVDCTGEGVMFIEADADATLQHFAVGGE  1190
             DPV+V+R AL++ALV++YPFAGR+REG  RKLMVDCTGEGVMFIEA+AD TL  F  G  
Sbjct  60    DPVKVLRHALSQALVYYYPFAGRIREGASRKLMVDCTGEGVMFIEAEADVTLDQF--GDA  117

Query  1189  LKPPFPCFDQLLYNVPGSAEILNCPLFLIQVTRLRCGGFIFALRLNHSMSDACGLVHFLN  1010
             L PPFPCF QLLY+V GS +I++ P+ LIQVTRL+CGGFI A+  NH+M DA GL  F+N
Sbjct  118   LHPPFPCFHQLLYDVRGSEQIMDRPIRLIQVTRLKCGGFIVAMNWNHTMGDAAGLRQFMN  177

Query  1009  TIAEIARGAEAPSVYPVWQREFFDARNPPRITCTHFEYEEEPAADSMVTNIPLDNLVHRS  830
               AE+ARGA  PS+ PVW RE   AR+PPRITC HFEYE+  + ++ +      +LVH+S
Sbjct  178   AWAEMARGAYRPSIQPVWNREILMARDPPRITCNHFEYEQILSPNT-IKEKDTASLVHQS  236

Query  829   FFFGPTEISALRSSLPPHLLKCSRFEVVTACLWRCRTIAMEFDPNDEVRIFGTVNARPR-  653
             FFF  ++I+ LR  +P HL +C+ F+++ +C W CRT A++ + ++EVR+    NAR R 
Sbjct  237   FFFRASDIATLRLLVPFHLRQCTTFDLIASCFWCCRTKALQLEADEEVRMMCIANARSRF  296

Query  652   -LKNPPVPNGYYGNAFVYPGAKSTAGKVSKSPLSHALELVTNIKSSFTEEYIKSVADLMI  476
              + N P+  GYYGN F YP A +TA K+  +P  +A+ELV  +K+  TEEY+ SVADLM+
Sbjct  297   NVNNSPLV-GYYGNCFAYPAAVTTARKLCGNPFGYAVELVRKLKAEVTEEYMHSVADLMV  355

Query  475   LKGRPTFTLQGTFIVSDVTRVGFPEIDMGWGQSVFggpahggvggipGLITFYIPYEDNK  296
             +K R  FT   + I+SD+TR    E++ GWG+ V+GG A GG G  PG  T+ +PY++ K
Sbjct  356   IKERCLFTTVRSCIISDLTRARLSEVNFGWGEGVYGGVAKGGAGPFPG-ATYIVPYKNIK  414

Query  295   GDHGILVPMCLPAIAMGKFVKELENCL  215
             G+  +++P+CLP+  M +F KEL+  L
Sbjct  415   GEETLMLPICLPSEDMKRFAKELDEML  441



>ref|XP_010667725.1| PREDICTED: benzyl alcohol O-benzoyltransferase-like [Beta vulgaris 
subsp. vulgaris]
Length=475

 Score =   461 bits (1186),  Expect = 1e-153, Method: Compositional matrix adjust.
 Identities = 234/447 (52%), Positives = 322/447 (72%), Gaps = 11/447 (2%)
 Frame = -1

Query  1534  SIAFTVTRQNPELVAPADPTPREIKYLSDIDDQQGLRFQIPVIHFYRNEPSMSG------  1373
             S+ F VTR+ PEL+ PA+PTP E K LSDIDDQ+ LR+QIP I FYRNE    G      
Sbjct  13    SLVFMVTRRTPELIRPAEPTPYEFKELSDIDDQESLRYQIPFIQFYRNESHSRGSTHMGR  72

Query  1372  KDPVQVIRQALAKALVFFYPFAGRLREGPGRKLMVDCTGEGVMFIEADADATLQHFAVGG  1193
             +DPV+V+++A+AKALV +YP AGRLRE  GRKL V+C GEG++FIEADAD TL+ F  G 
Sbjct  73    RDPVRVLKEAVAKALVPYYPLAGRLRENSGRKLEVECNGEGIIFIEADADVTLEDFGDGD  132

Query  1192  ELKPPFPCFDQLLYNVPGSAEILNCPLFLIQVTRLRCGGFIFALRLNHSMSDACGLVHFL  1013
              ++PPFP  ++LL++VPGS  IL  PL L+QVTRL+C GFI ALRLNH+M+   GLV F+
Sbjct  133   IIQPPFP-LEELLFDVPGSTAILGTPLILMQVTRLKCSGFIVALRLNHTMTGLPGLVQFM  191

Query  1012  NTIAEIARGAEAPSVYPVWQREFFDARNPPRITCTHFEYEEEPAADSMVTNIPLDNLVHR  833
             N +AE+ARGA++PS+ PVW+R    AR+PPR+T  H EY+    AD+  T IP +++VH+
Sbjct  192   NAVAELARGAQSPSIQPVWERHLLRARDPPRVTFEHEEYDT--IADTKGTVIPFEDMVHK  249

Query  832   SFFFGPTEISALRSSLPPHLLKCSRFEVVTACLWRCRTIAMEFDPNDEVRIFGTVNARPR  653
             SFFFGPTEI+A+R  +P +  K + FE+++A +WRCRT A++ +P + VR+   ++ +  
Sbjct  250   SFFFGPTEIAAIRQLIPVN-QKATTFEILSAFVWRCRTSALQPEPEEIVRMMCVISIQNL  308

Query  652   LKNPPVPNGYYGNAFVYPGAKSTAGKVSKSPLSHALELVTNIKSSFT-EEYIKSVADLMI  476
                P +P G+YGN  V+    STA K+  +P+ +ALELV N KS+ T +EY++S  D M+
Sbjct  309   FNPPLLPPGFYGNTIVFSMVTSTAAKLCINPIEYALELVKNSKSTATSQEYVRSTIDYMV  368

Query  475   LKGRPTFTLQGTFIVSDVTRVGFPEIDMGWGQSVFggpahggvggipGLITFYIPYEDNK  296
             +KGRP FT+   F+VSD+TRVGF ++D GWGQ  +GG A  GVG IPG+++ Y+P+++  
Sbjct  369   IKGRPHFTVARNFVVSDLTRVGFDKLDYGWGQPAYGGLAKAGVGAIPGVLSCYVPFKNRH  428

Query  295   GDHGILVPMCLPAIAMGKFVKELENCL  215
             G+ GI+VP+CLP  AM  FVKEL   L
Sbjct  429   GEKGIVVPICLPQSAMDLFVKELNRLL  455



>ref|XP_003616154.1| Benzoyl coenzyme A benzyl alcohol benzoyl transferase [Medicago 
truncatula]
 gb|AES99112.1| benzyl alcohol O-benzoyltransferase [Medicago truncatula]
Length=460

 Score =   460 bits (1184),  Expect = 2e-153, Method: Compositional matrix adjust.
 Identities = 230/446 (52%), Positives = 311/446 (70%), Gaps = 5/446 (1%)
 Frame = -1

Query  1549  MASQPSIAFTVTRQNPELVAPADPTPREIKYLSDIDDQQGLRFQIPVIHFYRNEPSMSGK  1370
             M S P + FTV R  PELV P  PTPRE+K LSDIDDQ+GLRF +PVI  YR EPSM+ K
Sbjct  1     MTSSP-LLFTVRRCQPELVPPVAPTPREVKLLSDIDDQEGLRFNVPVIFIYRREPSMAEK  59

Query  1369  DPVQVIRQALAKALVFFYPFAGRLREGPGRKLMVDCTGEGVMFIEADADATLQHFAVGGE  1190
             DP++V+R AL++ LV++YPFAGR+REG  RKLMVDCTGEGV+FIEA+AD TL  F  G  
Sbjct  60    DPIKVLRHALSRTLVYYYPFAGRIREGARRKLMVDCTGEGVVFIEAEADVTLDQF--GDA  117

Query  1189  LKPPFPCFDQLLYNVPGSAEILNCPLFLIQVTRLRCGGFIFALRLNHSMSDACGLVHFLN  1010
             L PPFPCF QLLY+VPGS  I++ P+ LIQVTRL+CGGFI AL +NH+M DA GL  F+ 
Sbjct  118   LHPPFPCFQQLLYDVPGSEHIIDRPIRLIQVTRLKCGGFILALSVNHTMGDAAGLRQFMT  177

Query  1009  TIAEIARGAEAPSVYPVWQREFFDARNPPRITCTHFEYEEEPAADSMVTNIPLDNLVHRS  830
               AE+ARGA  PS+ PVW RE   AR+PP ITC H EYE+  + ++ +       +VH+S
Sbjct  178   AWAEMARGANQPSIQPVWNREILMARDPPCITCNHREYEQILSPNTYIKEEDTTIVVHQS  237

Query  829   FFFGPTEISALRSSLPPHLLKCSRFEVVTACLWRCRTIAMEFDPNDEVRIFGTVNARPRL  650
             FFF P  I+A+R  +P HL  C+ F++++AC W CRT A++ +P++EVR+   VNAR R 
Sbjct  238   FFFTPAHIAAIRCLVPIHLHHCTTFDLISACYWCCRTKALQIEPDEEVRMMCIVNARSRF  297

Query  649   K-NPPVPNGYYGNAFVYPGAKSTAGKVSKSPLSHALELVTNIKSSFTEEYIKSVADLMIL  473
               NP +  GYYGN   +  A +TA ++  + L +A+EL+   K+  TEEY+ S+AD M++
Sbjct  298   SANPSLFIGYYGNCIAFSAAVTTAKELCGNQLGYAVELIRKAKTQVTEEYMHSLADCMVI  357

Query  472   KGRPTFTLQGTFIVSDVTRVGFPEIDMGWGQSVFggpahggvggipGLITFYIPYEDNKG  293
             K R  FT   T +VSD TR    E++ GWG++++GG   GG+G   G  T+ +P+++ KG
Sbjct  358   KERCLFTTGRTCMVSDWTRANLSEVNFGWGETMYGGVVKGGIGSYLGG-TYIVPHKNAKG  416

Query  292   DHGILVPMCLPAIAMGKFVKELENCL  215
             + G++ P+CLP   M +F KEL++ L
Sbjct  417   EEGLIFPICLPPEDMKRFAKELDDML  442



>ref|NP_001275839.1| alcohol acyl transferase [Citrus sinensis]
 gb|ABW81204.1| alcohol acyl transferase [Citrus sinensis]
Length=456

 Score =   460 bits (1184),  Expect = 2e-153, Method: Compositional matrix adjust.
 Identities = 223/446 (50%), Positives = 309/446 (69%), Gaps = 17/446 (4%)
 Frame = -1

Query  1534  SIAFTVTRQNPELVAPADPTPREIKYLSDIDDQQGLRFQIPVIHFYRNEPS--MSGKDPV  1361
             S    VTR+ PEL+ P  PTPRE+K +SDIDDQ+ LRFQIP++ FY+N+PS  M G+DPV
Sbjct  6     SQGLLVTRKAPELIVPERPTPREVKQISDIDDQESLRFQIPLLFFYKNDPSPSMQGRDPV  65

Query  1360  QVIRQALAKALVFFYPFAGRLREGPGRKLMVDCTGEGVMFIEADADATLQHFAVGGELKP  1181
             +VIR+A++KALVF+YP AGRL+EG  RKLMV+C  EGV+FIEADA+ TL+      +++P
Sbjct  66    KVIREAISKALVFYYPLAGRLKEGYNRKLMVECNAEGVLFIEADANFTLEQLR--DDVQP  123

Query  1180  PFPCFDQLLYNVPGSAEILNCPLFLIQVTRLRCGGFIFALRLNHSMSDACGLVHFLNTIA  1001
             P P  +QL+Y+VPGS  IL CPL LIQVTRL CGGFIFA+R NH+M DA GLV FL  I 
Sbjct  124   PCPYLNQLIYDVPGSEGILGCPLLLIQVTRLTCGGFIFAIRFNHTMCDAFGLVQFLKAIE  183

Query  1000  EIARGAEAPSVYPVWQREFFDARNPPRITCTHFEYEEEPAADSMVTN-IPLDNLVHRSFF  824
             ++ARG  +P+++P+WQR   +ARNPP++TC H EY+E      + TN +P DN+ H+SFF
Sbjct  184   DMARGERSPTLFPIWQRLILNARNPPQVTCIHHEYDE------INTNEVPSDNMAHKSFF  237

Query  823   FGPTEISALRSSLPPHLLKCSRFEVVTACLWRCRTIAMEFDPNDEVRIFGTVNARPRLKN  644
             F    I ALR+ LP  L  CS FE++ A LW+CRTIA++  P +  ++   VN R +   
Sbjct  238   FSLKGIKALRNQLPFQLKDCSTFELLLAFLWKCRTIALKLQPEEIAKVCCIVNVRGKSYE  297

Query  643   PPVPNGYYGNAFVYPGAKSTAGKVSKSPLSHALELVTNIKSSFTEEYIKSVADLMILKGR  464
               +P GYYGNAF +    S A ++ K+P+ +A+ELV   K+   EEYI+S ADLM++KGR
Sbjct  298   MDIPPGYYGNAFTFSAVCSKAEQLCKNPIGYAVELVKKAKAQMNEEYIRSAADLMVIKGR  357

Query  463   P-TFTLQGTFIVSDVTRVGFPEIDMGWGQSVFggpahggvggipGLITFYIPYEDNKGDH  287
                F+ +G FIVSD+  VG  ++D GWG+ ++      G  G   +I+F+  Y++  G+ 
Sbjct  358   RIKFSTRGNFIVSDLRNVGLGDVDFGWGKPIY-----AGTAGAVAVISFFTKYQNKNGEP  412

Query  286   GILVPMCLPAIAMGKFVKELENCLMK  209
             GILVP+CLP  AM +  +EL+  +++
Sbjct  413   GILVPICLPQSAMERLQEELKGLMIQ  438



>sp|Q5H873.1|HLTT_LUPAL RecName: Full=13-hydroxylupanine O-tigloyltransferase; AltName: 
Full=(-)-13alpha-hydroxymultiflorine/(+)-13alpha-hydroxylupanine 
O-tigloyltransferase; Short=HMT/HLTase; AltName: Full=Quinolizidine 
alkaloid O-tigloyltransferase [Lupinus albus]
 dbj|BAD89275.1| (-)-13alpha-hydroxymultiflorine/(+)-13alpha- hydroxylupanine 
O-tigloyltransferase [Lupinus albus]
Length=453

 Score =   460 bits (1183),  Expect = 2e-153, Method: Compositional matrix adjust.
 Identities = 241/449 (54%), Positives = 305/449 (68%), Gaps = 17/449 (4%)
 Frame = -1

Query  1549  MASQP-SIAFTVTRQNPELVAPADPTPREIKYLSDIDDQQGLRFQIPVIHFYRNEPSMSG  1373
             MA Q  S+ F V R   ELV PA PTP+E K LSDIDDQ  LR   P++  YRN PSM G
Sbjct  1     MAPQTQSLVFKVRRNPQELVTPAKPTPKEFKLLSDIDDQTSLRSLTPLVTIYRNNPSMEG  60

Query  1372  KDPVQVIRQALAKALVFFYPFAGRLREGPGRKLMVDCTGEGVMFIEADADATLQHFAVGG  1193
             KDPV++IR+AL+K LVF+YPFAGRLR GP  KLMVDCTGEGV+FIEADAD TL  F +  
Sbjct  61    KDPVEIIREALSKTLVFYYPFAGRLRNGPNGKLMVDCTGEGVIFIEADADVTLDQFGI--  118

Query  1192  ELKPPFPCFDQLLYNVPGSAEILNCPLFLIQVTRLRCGGFIFALRLNHSMSDACGLVHFL  1013
             +L PPFPCFDQLLY+VPGS  IL+ PL LIQVTRL+CGGFIFA+RLNH+M DA G+  F+
Sbjct  119   DLHPPFPCFDQLLYDVPGSDGILDSPLLLIQVTRLKCGGFIFAVRLNHAMCDAIGMSQFM  178

Query  1012  NTIAEIARGAEAPSVYPVWQREFFDARNPPRITCTHFEYEEEPAADSMVTNIPLDNLVHR  833
               +AEIARG   P + PVW RE   ARNPP++T  H EY++ P  ++    I    L H 
Sbjct  179   KGLAEIARGEPKPFILPVWHRELLCARNPPKVTFIHNEYQKPPHDNNNNNFI----LQHS  234

Query  832   SFFFGPTEISALRSSLPPHLLKCSRFEVVTACLWRCRTIAME-FDPNDEVRIFGTVNAR-  659
             SFFFGP E+ A+R  LP H  K +  +++TA LWRCRT+A++  +PN E R+   +NAR 
Sbjct  235   SFFFGPNELDAIRRLLPYHHSKSTTSDILTAFLWRCRTLALQPENPNHEFRLLYILNARY  294

Query  658   PRLK-NPPVPNGYYGNAFVYPGAKSTAGKVSKSPLSHALELVTNIKSSFTEEYIKSVADL  482
              R   NPP+P G+YGNAFV P A ST  K+  +PL +ALEL+   KS  TEEY+ SVADL
Sbjct  295   GRCSFNPPLPEGFYGNAFVSPAAISTGEKLCNNPLEYALELMKEAKSKGTEEYVHSVADL  354

Query  481   MILKGRPTFTLQ--GTFIVSDVTRVGFPEIDMGWGQSVFggpahggvggipGLITFYIPY  308
             M++KGRP++     G   VSD+T+  F ++D GWG++V+GG   G           Y+ Y
Sbjct  355   MVIKGRPSYFYNDVGYLEVSDLTKARFRDVDFGWGKAVYGGATQGYFSS-----ILYVSY  409

Query  307   EDNKGDHGILVPMCLPAIAMGKFVKELEN  221
              ++KG  GI+    LP  AM +F KEL++
Sbjct  410   TNSKGVEGIMALTSLPTKAMERFEKELDD  438



>ref|XP_002517500.1| Taxadien-5-alpha-ol O-acetyltransferase, putative [Ricinus communis]
 gb|EEF45042.1| Taxadien-5-alpha-ol O-acetyltransferase, putative [Ricinus communis]
Length=458

 Score =   460 bits (1183),  Expect = 3e-153, Method: Compositional matrix adjust.
 Identities = 226/448 (50%), Positives = 305/448 (68%), Gaps = 14/448 (3%)
 Frame = -1

Query  1567  MALSPFMASQPSIAFTVTRQNPELVAPADPTPREIKYLSDIDDQQGLRFQIPVIHFYRNE  1388
             MAL P     P   F V R  PEL+ PA PTPRE+K +SDIDDQ+GLRFQI  + FYR+ 
Sbjct  1     MALPP-----PPFTFAVRRSPPELIVPARPTPRELKKVSDIDDQEGLRFQISFVMFYRSL  55

Query  1387  PSMSGKDPVQVIRQALAKALVFFYPFAGRLREGPGRKLMVDCTGEGVMFIEADADATLQH  1208
             PSM G+DPV++IR+AL++ALVF+YPFAGRL EGP RKL+VDC GEG++FIEADAD T++ 
Sbjct  56    PSMKGRDPVEIIRKALSEALVFYYPFAGRLIEGPNRKLIVDCNGEGILFIEADADITIEQ  115

Query  1207  FAVGGELKPPFPCFDQLLYNVPGSAEILNCPLFLIQVTRLRCGGFIFALRLNHSMSDACG  1028
               +G  ++PP PC ++LLY+VPGS+ I+ CPL LIQ+TRL CGGF+FA+RLNH MSD+ G
Sbjct  116   --LGDSMQPPCPCIEELLYDVPGSSGIIGCPLLLIQITRLACGGFVFAVRLNHVMSDSVG  173

Query  1027  LVHFLNTIAEIARGAEAPSVYPVWQREFFDARNPPRITCTHFEYEE-EPAADSMVTNIPL  851
             L  F     EIA+GA  PS++PVWQRE   ARNPP++T    EYEE +   D  +  +  
Sbjct  174   LAKFFKATGEIAKGACMPSLFPVWQREILSARNPPQVTHKLEEYEEIKHTDDKSILTLDS  233

Query  850   DNLVHRSFFFGPTEISALRSSLPPHLLKCSRFEVVTACLWRCRTIAMEFDPNDEVRIFGT  671
              ++V R+FFFGP E+ +LR  LP HL  CS FE++ ACLWRCRTIA +  PN+ VR+   
Sbjct  234   PDMVQRAFFFGPKEMRSLRRQLPSHLRNCSSFEMLAACLWRCRTIAFDIPPNEVVRLSCI  293

Query  670   VNARPRLKNPPVPNGYYGNAFVYPGAKSTAGKVSKSPLSHALELVTNIKSSFTEEYIKSV  491
             +N R + K   +P+GY GN+F++P   S A  + K+PL +A+ELV   KS  +EEYI+S 
Sbjct  294   MNVRGK-KGLQLPDGYCGNSFIFPAVLSRAEHLCKNPLGYAVELVRKSKSKMSEEYIRST  352

Query  490   ADLMILKGRPTFTLQGTFIVSDVTRVGFPEIDMGWGQSVFggpahggvggipGLITFYIP  311
              DLM +KGRP +      ++ D++ VG  ++D GWG  V+ GP           I+ +  
Sbjct  353   IDLMEIKGRPHYVTAWNLLLVDMSHVGLADVDFGWGNPVYFGPTGSFPN-----ISMFSR  407

Query  310   YEDNKGDHGILVPMCLPAIAMGKFVKEL  227
             ++++KG++G +VPM LP   M KF  E 
Sbjct  408   FKNSKGENGFVVPMWLPRTVMEKFQDEF  435



>ref|XP_006470748.1| PREDICTED: anthraniloyl-CoA:methanol acyltransferase-like [Citrus 
sinensis]
Length=463

 Score =   460 bits (1183),  Expect = 3e-153, Method: Compositional matrix adjust.
 Identities = 226/452 (50%), Positives = 310/452 (69%), Gaps = 16/452 (4%)
 Frame = -1

Query  1549  MASQPSIAFTVTRQNPELVAPADPTPREIKYLSDIDDQQGLRFQIPVIHFYRNE-----P  1385
             MA + S+  +VTRQ PEL+ PA PTPRE+K LSDIDDQ+  RF IPVI  Y+N      P
Sbjct  1     MAPKFSLVLSVTRQAPELIVPARPTPRELKQLSDIDDQESFRFHIPVIFLYKNNSASSPP  60

Query  1384  SMSGKDPVQVIRQALAKALVFFYPFAGRLREGPGRKLMVDCTGEGVMFIEADADATLQHF  1205
              +  KDPV+VI++A+++ALV++YPFAGRL EGP RKLMVDC GEG++F+EA+A+  L+  
Sbjct  61    VLKEKDPVKVIKEAISEALVYYYPFAGRLIEGPNRKLMVDCNGEGILFLEAEANFKLEQ-  119

Query  1204  AVGGELKPPFPCFDQLLYNVPGSAEILNCPLFLIQVTRLRCGGFIFALRLNHSMSDACGL  1025
              +GG ++PP P  +QL YNVPGS  IL CPL LIQVTRL CGGF  A+R NH+M DA GL
Sbjct  120   -LGGAIQPPCPYLEQLTYNVPGSEGILGCPLLLIQVTRLMCGGFTLAIRFNHTMCDASGL  178

Query  1024  VHFLNTIAEIARGAEAPSVYPVWQREFFDARNPPRITCTHFEYEE-EPAADSMVTNIPLD  848
             V F+ TI E+ARGA   S++PVWQRE   ARNPP++T  H EYEE    +D+ +T  P +
Sbjct  179   VQFVKTIEEMARGANTLSIFPVWQRERLCARNPPQVTSVHLEYEEINNNSDTFITTNP-N  237

Query  847   NLVHRSFFFGPTEISALRSSLPPHLLKCSRFEVVTACLWRCRTIAMEFDPNDEVRIFGTV  668
              + H+SF+FGP E+  L++ LP HL  CS FE++ AC+WRCRTIA++ DP D V+    V
Sbjct  238   EMDHKSFYFGPKEVRVLKNQLPLHLRNCSTFELLAACMWRCRTIALQLDPKDTVQFSCLV  297

Query  667   NARPRLKNPPVPNGYYGNAFVYPGAKSTAGKVSKSPLSHALELVTNIKSSFTEEYIKSVA  488
              AR +     +P+GYYGNA  +P   S  G +  +PL +A+ LV   K+  +EE+I+S A
Sbjct  298   TARAKDYKMDIPSGYYGNAVAFPAVHSKVGALCNNPLGYAVALVKKAKAEMSEEHIRSAA  357

Query  487   DLMILKG-RPTFTLQGTFIVSDVTRVGFPEIDMGWGQSVFggpahggvggipGLITFYIP  311
             DLM +KG RP   ++G +IVSD+++VGF  ID+GWG+ VF      G+ G   + +F   
Sbjct  358   DLMEVKGRRPRHAIKGNYIVSDLSKVGFDRIDLGWGKPVF-----AGIAGAKSIFSFLNR  412

Query  310   YEDNKGDHGILVPMCLPAIAMGKFVKELENCL  215
             Y+ + G+ G L+P+ LP  +M +F +EL+  +
Sbjct  413   YQKD-GETGTLIPIRLPRPSMKRFEEELKRMI  443



>ref|XP_004305015.1| PREDICTED: benzyl alcohol O-benzoyltransferase-like [Fragaria 
vesca subsp. vesca]
Length=445

 Score =   459 bits (1180),  Expect = 4e-153, Method: Compositional matrix adjust.
 Identities = 231/451 (51%), Positives = 305/451 (68%), Gaps = 13/451 (3%)
 Frame = -1

Query  1549  MASQPSIAFTVTRQNPELVAPADPTPREIKYLSDIDDQQGLRFQIPVIHFYRNEP--SMS  1376
             M S  S+ F + RQ PEL+ PA PTP+E + LS+ID Q+GLRFQ P I  Y+N+   SM 
Sbjct  1     MDSLSSLTFQIKRQQPELLTPAKPTPQEKRLLSEIDIQEGLRFQTPFILSYKNDNPNSMK  60

Query  1375  GKDPVQVIRQALAKALVFFYPFAGRLREGPGRKLMVDCTGEGVMFIEADADATLQHFAVG  1196
              KDPV+VIR AL++ALV++YPFAGR+REG   KL VDC GEG++FIEADAD +L+   +G
Sbjct  61    QKDPVEVIRDALSRALVYYYPFAGRVREGRNGKLFVDCNGEGILFIEADADVSLEQ--LG  118

Query  1195  GELKPPFPCFDQLLYNVPGSAEILNCPLFLIQVTRLRCGGFIFALRLNHSMSDACGLVHF  1016
               L+PP P  +  L++VPGS +IL  PL L+QVTRL CGGFIFALRLNH+MSDA GL  F
Sbjct  119   DSLQPPCPFLEDFLFDVPGSDDILGTPLLLVQVTRLTCGGFIFALRLNHTMSDAVGLGQF  178

Query  1015  LNTIAEIARGAEAPSVYPVWQREFFDARNPPRITCTHFEY--EEEPAADSMVTNIPLDNL  842
             L+ + E+ARGA  P++ PVW+RE  DAR+PP++TCTH EY  E E    S++  +   +L
Sbjct  179   LHAVGEMARGATEPTIQPVWERELLDARDPPQVTCTHHEYGKETESHRGSVIATMEQPDL  238

Query  841   VHRSFFFGPTEISALRSSLPPHLLK-CSRFEVVTACLWRCRTIAMEFDPNDEVRIFGTVN  665
             V R  +FGP E+   R+ L P+L   CS FE++TAC+W+CRT+++E DPN+ VRI   VN
Sbjct  239   VQRCVYFGPKELMVARAHLSPNLSSTCSTFELITACMWKCRTLSLELDPNEVVRISLVVN  298

Query  664   ARPRLKNPPVPNGYYGNAFVYPGAKSTAGKVSKSPLSHALELVTNIKSSFTEEYIKSVAD  485
             AR +  N  VP G+YGNA  +PG  +TA  + K PL +A+ELV   K    +EYI+S AD
Sbjct  299   ARGKKNNLTVPVGFYGNAIGFPGVVTTAEILCKQPLGYAVELVKEAKGKMNKEYIQSCAD  358

Query  484   LMILKGRPTFTLQG-TFIVSDVTRVGFPEIDMGWGQSVFggpahggvggipGLITFYIPY  308
             LM ++G P  TL G  FI+SD TR G  E+D GWG+ V       G      LI+FY+  
Sbjct  359   LMAIRGWPPLTLAGNNFILSDNTRTGVGEVDFGWGRPVV-----AGPAKSVNLISFYVRD  413

Query  307   EDNKGDHGILVPMCLPAIAMGKFVKELENCL  215
              + K  HGILVP+CLP   + +F +EL + L
Sbjct  414   NNQKEKHGILVPICLPFSCVDRFEQELRSLL  444



>ref|XP_006446264.1| hypothetical protein CICLE_v10015163mg [Citrus clementina]
 gb|ESR59504.1| hypothetical protein CICLE_v10015163mg [Citrus clementina]
Length=464

 Score =   459 bits (1181),  Expect = 6e-153, Method: Compositional matrix adjust.
 Identities = 225/449 (50%), Positives = 307/449 (68%), Gaps = 15/449 (3%)
 Frame = -1

Query  1549  MASQPSIAFTVTRQNPELVAPADPTPREIKYLSDIDDQQGLRFQIPVIHFYRNE-----P  1385
             MA + S+  +VTRQ PEL+ PA PTPRE+K LSDIDDQ+  RF IPVI  Y+N      P
Sbjct  1     MAPKFSLVLSVTRQAPELIVPARPTPRELKQLSDIDDQESFRFHIPVIFLYKNNSASSPP  60

Query  1384  SMSGKDPVQVIRQALAKALVFFYPFAGRLREGPGRKLMVDCTGEGVMFIEADADATLQHF  1205
              +  KDPV+VI++A+++ALV++YPFAGRL EGP RKLMVDC GEG++F+EA+A+  L+  
Sbjct  61    LLKEKDPVKVIKEAISEALVYYYPFAGRLIEGPNRKLMVDCNGEGILFLEAEANFKLEQ-  119

Query  1204  AVGGELKPPFPCFDQLLYNVPGSAEILNCPLFLIQVTRLRCGGFIFALRLNHSMSDACGL  1025
              +GG ++PP P  +QL YNVPGS  IL CPL LIQVTRL CGGF  A+R NH+M DA GL
Sbjct  120   -LGGAIQPPCPYLEQLTYNVPGSEGILGCPLLLIQVTRLMCGGFTLAIRFNHTMCDASGL  178

Query  1024  VHFLNTIAEIARGAEAPSVYPVWQREFFDARNPPRITCTHFEYEE-EPAADSMVTNIPLD  848
             V F+ TI E+ARGA  PS++PVWQR+   ARNPP++T  H EYEE    +D+ +T  P +
Sbjct  179   VQFMKTIEEMARGANTPSLFPVWQRKRLCARNPPQVTNVHLEYEEINNNSDTFITTNP-N  237

Query  847   NLVHRSFFFGPTEISALRSSLPPHLLKCSRFEVVTACLWRCRTIAMEFDPNDEVRIFGTV  668
              + H+SF+FGP E+  L++ LP HL  CS FE++  C+WRCRTIA++ DP D V+    V
Sbjct  238   EMDHKSFYFGPKEVRVLKNQLPLHLRNCSTFELLAGCMWRCRTIALQLDPKDTVQFSCLV  297

Query  667   NARPRLKNPPVPNGYYGNAFVYPGAKSTAGKVSKSPLSHALELVTNIKSSFTEEYIKSVA  488
             +AR +     +P+GYYGNA  +P   S  G +  +PL +A+ LV   K   +EE+I+S A
Sbjct  298   SARAKDYKMDIPSGYYGNAVAFPAVHSKVGALCNNPLGYAVALVKKAKVEMSEEHIRSAA  357

Query  487   DLMILKG-RPTFTLQGTFIVSDVTRVGFPEIDMGWGQSVFggpahggvggipGLITFYIP  311
             DLM +KG RP   ++G +IVSD+++VGF  ID+GWG+ VF      G+ G   + +F   
Sbjct  358   DLMEVKGRRPRHAIKGNYIVSDLSKVGFDRIDLGWGKPVF-----AGIAGAKSIFSFLNR  412

Query  310   YEDNKGDHGILVPMCLPAIAMGKFVKELE  224
              +   G+ G L+P+ LP  +M KF +EL+
Sbjct  413   CQKEDGETGTLIPIRLPRPSMKKFEEELK  441



>gb|ABN48480.1| quinolizidine alkaloid O-tigloyltransferase [Lupinus albus]
Length=453

 Score =   458 bits (1178),  Expect = 1e-152, Method: Compositional matrix adjust.
 Identities = 241/449 (54%), Positives = 304/449 (68%), Gaps = 17/449 (4%)
 Frame = -1

Query  1549  MASQP-SIAFTVTRQNPELVAPADPTPREIKYLSDIDDQQGLRFQIPVIHFYRNEPSMSG  1373
             MA Q  S+ F V R   ELV PA PTP+E K LSDIDDQ  LR   P++  YRN PSM G
Sbjct  1     MAPQTQSLVFKVRRNPQELVTPAKPTPKEFKLLSDIDDQTSLRSLTPLVTIYRNNPSMEG  60

Query  1372  KDPVQVIRQALAKALVFFYPFAGRLREGPGRKLMVDCTGEGVMFIEADADATLQHFAVGG  1193
             KDPV +IR+AL+K LVF+YPFAGRLR GP  KLMVDCTGEGV+FIEADAD TL  F +  
Sbjct  61    KDPVAIIREALSKTLVFYYPFAGRLRNGPNGKLMVDCTGEGVIFIEADADVTLDQFGI--  118

Query  1192  ELKPPFPCFDQLLYNVPGSAEILNCPLFLIQVTRLRCGGFIFALRLNHSMSDACGLVHFL  1013
             +L PPFPCFDQLLY+VPGS  IL+ PL LIQVTRL+CGGFIFA+RLNH+M DA G+  F+
Sbjct  119   DLHPPFPCFDQLLYDVPGSDGILDSPLLLIQVTRLKCGGFIFAVRLNHAMCDAIGMSQFM  178

Query  1012  NTIAEIARGAEAPSVYPVWQREFFDARNPPRITCTHFEYEEEPAADSMVTNIPLDNLVHR  833
               +AEIARG   P + PVW RE   ARNPP++T  H EY++ P  ++    I    L H 
Sbjct  179   KGLAEIARGEPKPFILPVWXRELLCARNPPKVTFIHNEYQKPPHDNNNNNFI----LQHS  234

Query  832   SFFFGPTEISALRSSLPPHLLKCSRFEVVTACLWRCRTIAME-FDPNDEVRIFGTVNAR-  659
             SFFFGP E+ A+R  LP H  K +  +++TA LWRCRT+A++  +PN E R+   +NAR 
Sbjct  235   SFFFGPNELDAIRRLLPYHHSKSTTSDILTAFLWRCRTLALQPENPNHEFRLLYILNARY  294

Query  658   PRLK-NPPVPNGYYGNAFVYPGAKSTAGKVSKSPLSHALELVTNIKSSFTEEYIKSVADL  482
              R   NPP+P G+YGNAFV P A ST  K+  +PL +ALEL+   KS  TEEY+ SVADL
Sbjct  295   GRCSFNPPLPEGFYGNAFVSPAAISTGEKLCNNPLEYALELMKEAKSKGTEEYVHSVADL  354

Query  481   MILKGRPTFTLQ--GTFIVSDVTRVGFPEIDMGWGQSVFggpahggvggipGLITFYIPY  308
             M++KGRP++     G   VSD+T+  F ++D GWG++V+GG   G           Y+ Y
Sbjct  355   MVIKGRPSYFYNDVGYLEVSDLTKARFRDVDFGWGKAVYGGATQGYFSS-----ILYVSY  409

Query  307   EDNKGDHGILVPMCLPAIAMGKFVKELEN  221
              ++KG  GI+    LP  AM +F KEL++
Sbjct  410   TNSKGVEGIMALTSLPTKAMERFEKELDD  438



>ref|XP_006368247.1| hypothetical protein POPTR_0001s00950g [Populus trichocarpa]
 gb|ERP64816.1| hypothetical protein POPTR_0001s00950g [Populus trichocarpa]
Length=462

 Score =   458 bits (1178),  Expect = 2e-152, Method: Compositional matrix adjust.
 Identities = 230/446 (52%), Positives = 304/446 (68%), Gaps = 15/446 (3%)
 Frame = -1

Query  1549  MASQPSIAFTVTRQNPELVAPADPTPREIKYLSDIDDQQGLRFQIPVIHFYRNEPSMSGK  1370
             + +  +++FTV RQ P L+ PA PTP E+K LSD+DDQ+GLRF +P I F+RN     G 
Sbjct  3     LTTNLNVSFTVKRQEPRLILPAKPTPSEVKQLSDLDDQEGLRFHMPFIAFFRNTNKKGGN  62

Query  1369  ----DPVQVIRQALAKALVFFYPFAGRLREGPGRKLMVDCTGE-GVMFIEADADATLQHF  1205
                 DPV+VIR ALA ALV +YP AGRL+EG  RKLMVDCTGE GV+FIEADAD TL+H 
Sbjct  63    GTYPDPVKVIRDALAHALVCYYPLAGRLKEGDSRKLMVDCTGELGVLFIEADADITLEH-  121

Query  1204  AVGGELKPPFPCFDQLLYNVPGSAEILNCPLFLIQVTRLRCGGFIFALRLNHSMSDACGL  1025
              +G  ++PP P  +  LY++PGS+ I+ CPL LIQVTRL CGGFI A R+NH+M+DA G+
Sbjct  122   -LGDAIQPPCPYLEHFLYDIPGSSGIIGCPLMLIQVTRLTCGGFIVAARVNHTMTDALGI  180

Query  1024  VHFLNTIAEIARGAEAPSVYPVWQREFFDARNPPRITCTHFEYEEEPAADSMVTNIPLDN  845
              +FLNTI EIARGA  PS  PVW+RE  +AR+PPR+TC H EY+     ++ +      +
Sbjct  181   FYFLNTIGEIARGANEPSYRPVWKREILNARDPPRVTCVHHEYDTTVGTEATMDTHA--D  238

Query  844   LVHRSFFFGPTEISALRSSLPPHLLKCSRFEVVTACLWRCRTIAMEFDPNDEVRIFGTVN  665
             L+ +SFFFG  EI  +R  LP HL   S FEV+ AC+W+CRTIA+E +PN+ +R+   V 
Sbjct  239   LIDKSFFFGFQEIDCIRKHLPSHLQSSSTFEVLIACIWKCRTIAIEHNPNEMLRVSYMVG  298

Query  664   ARPRLKNPPVPNGYYGNAFVYPGAKSTAGKVSKSPLSHALELVTNIKSSFTEEYIKSVAD  485
             A  + +   +P GYYGNA+  P A S A  V K+PL +ALELV  IK+  +EEY++SVAD
Sbjct  299   AGGK-RGIKLPPGYYGNAYAMPSAISKAELVCKNPLGYALELVRKIKTQMSEEYMRSVAD  357

Query  484   LMILKGRPTFTLQGTFIVSDVTRVGFPEIDMGWGQSVFggpahggvggipGLITFYIPYE  305
              M++KGRP ++  G FIV+D +RV F EID GWG+ V+ G A           +F + ++
Sbjct  358   YMVIKGRPHYSTAGHFIVADSSRVPFREIDFGWGKPVYAGVAKAAPNT-----SFCVRFK  412

Query  304   DNKGDHGILVPMCLPAIAMGKFVKEL  227
              + G+ GIL+ M LP  AM KF KEL
Sbjct  413   KSTGEDGILIQMSLPLQAMDKFQKEL  438



>gb|AES82601.2| benzyl alcohol O-benzoyltransferase [Medicago truncatula]
Length=502

 Score =   459 bits (1181),  Expect = 2e-152, Method: Compositional matrix adjust.
 Identities = 234/439 (53%), Positives = 311/439 (71%), Gaps = 8/439 (2%)
 Frame = -1

Query  1549  MASQPSIAFTVTRQNPELVAPADPTPREIKYLSDIDDQQGLRFQIPVIHFYRNEPSMSGK  1370
             M S P + FTV R  PELV PA PTPRE+K LSDIDDQ+GLRF IP++  YR+EPSM  K
Sbjct  1     MTSAP-LLFTVRRSQPELVPPAAPTPREVKLLSDIDDQEGLRFNIPMMFIYRHEPSMKEK  59

Query  1369  DPVQVIRQALAKALVFFYPFAGRLREGPGRKLMVDCTGEGVMFIEADADATLQHFAVGGE  1190
             DPV+V+R AL++ALV++YPFAGR+REG GRKLMVDCTGEGVMF+EA+AD TL  F  G  
Sbjct  60    DPVKVLRHALSQALVYYYPFAGRIREGAGRKLMVDCTGEGVMFVEAEADVTLDEF--GDA  117

Query  1189  LKPPFPCFDQLLYNVPGSAEILNCPLFLIQVTRLRCGGFIFALRLNHSMSDACGLVHFLN  1010
             L PP PCF++LLY+VPGS  I++ P+ LIQVTRL+CG FI  + LNH+MSD  GL  F+N
Sbjct  118   LHPPLPCFEELLYDVPGSELIIDRPIRLIQVTRLKCGSFILVVYLNHTMSDGAGLKLFMN  177

Query  1009  TIAEIARGAEAPSVYPVWQREFFDARNPPRITCTHFEYEEEPAADSMVTNIPLDNLVHRS  830
               AE+ARGA  PS+ PVW RE   AR+PP ITC H EYE+  ++++ +       LVH+S
Sbjct  178   AWAEMARGAHKPSIQPVWNREILMARDPPHITCNHHEYEQIFSSNT-IKEEDTTTLVHQS  236

Query  829   FFFGPTEISALRSSLPPHLLKCSRFEVVTACLWRCRTIAMEFDPNDEVRIFGTVNARPRL  650
             FFF  ++I  LR  +P HL  C+ F+++T+C W CRT A++ + +DE+R+   VNAR R 
Sbjct  237   FFFRTSDIVVLRLLVPFHLRHCTTFDLITSCFWCCRTKALQLEADDEIRMMCIVNARSRF  296

Query  649   --KNPPVPNGYYGNAFVYPGAKSTAGKVSKSPLSHALELVTNIKSSFTEEYIKSVADLMI  476
                N P+  GYYGN F YP A +TAGK+  + L +A+ELV  +K+  TEEY+ SVADLM+
Sbjct  297   NANNSPLV-GYYGNCFAYPAAVTTAGKLCGNSLGYAVELVRKLKAEVTEEYMHSVADLMV  355

Query  475   LKGRPTFTLQGTFIVSDVTRVGFPEIDMGWGQSVFggpahggvggipGLITFYIPYEDNK  296
             +K R  FT   + +VSDVTR+   E+D GWG++V+GG A  G G  PG   + IP+++ +
Sbjct  356   IKERCLFTTIRSCVVSDVTRIKLREVDFGWGEAVYGGAAKSGAGPFPG-AAYIIPHKNVE  414

Query  295   GDHGILVPMCLPAIAMGKF  239
             G+ G ++ +CL   AM +F
Sbjct  415   GEEGFILLVCLSFEAMKRF  433



>ref|XP_008368021.1| PREDICTED: methanol O-anthraniloyltransferase-like [Malus domestica]
Length=455

 Score =   457 bits (1176),  Expect = 3e-152, Method: Compositional matrix adjust.
 Identities = 226/442 (51%), Positives = 305/442 (69%), Gaps = 12/442 (3%)
 Frame = -1

Query  1537  PSIAFTVTRQNPELVAPADPTPREIKYLSDIDDQQGLRFQIPVIHFYRNEPSMSGK-DPV  1361
             P     V R   EL+ PA PT +E K+LSDIDDQ+GLRFQ+PVI  Y++ PS++   +PV
Sbjct  3     PXSVLQVKRLQLELITPAKPTXQETKFLSDIDDQEGLRFQVPVIMCYKDNPSLNKNCNPV  62

Query  1360  QVIRQALAKALVFFYPFAGRLREGPGRKLMVDCTGEGVMFIEADADATLQHFAVGGELKP  1181
             +VIR+AL++ALV++YP AGRL+EGP  KL VDC GEG++F+EA AD TL+   +G  + P
Sbjct  63    KVIREALSRALVYYYPLAGRLKEGPNXKLXVDCNGEGILFVEASADVTLEQ--LGDXILP  120

Query  1180  PFPCFDQLLYNVPGSAEILNCPLFLIQVTRLRCGGFIFALRLNHSMSDACGLVHFLNTIA  1001
             P P  ++ L+N PGS  I+ CPL L+QVT L CGGFI ALR NH+M DA GL+ FL  IA
Sbjct  121   PCPLLEEFLFNFPGSDGIIGCPLLLVQVTCLTCGGFILALRXNHTMCDAPGLLLFLTAIA  180

Query  1000  EIARGAEAPSVYPVWQREFFDARNPPRITCTHFEYEEE-PAADSMVTNIPLDNLVHRSFF  824
             E+ARGA APS+ PVW+RE    R+PPRITC H EYE+    ++    +    N+V RSF+
Sbjct  181   EMARGAHAPSILPVWERELLFXRDPPRITCVHHEYEDVIDHSBGSYASSNQSNMVQRSFY  240

Query  823   FGPTEISALRSSLPPHLLK-CSRFEVVTACLWRCRTIAMEFDPNDEVRIFGTVNARPRLK  647
             FG  E+  LR  +PPH +  CS F+++TACL +CRT+A++ +P   VR+   VNAR +  
Sbjct  241   FGAKEMRVLRKQIPPHXISTCSTFDLITACLXKCRTLALKINPKQAVRVSCXVNARGKHH  300

Query  646   NPPVPNGYYGNAFVYPGAKSTAGKVSKSPLSHALELVTNIKSSFTEEYIKSVADLMILKG  467
             N  +P GYYGNAF  P A S A  + K+PL +ALELV   K++  EEY++SVADL++L+G
Sbjct  301   NVRLPLGYYGNAFAXPAAXSKAEPLCKNPLGYALELVKKAKATMNEEYLRSVADLLVLRG  360

Query  466   RPTFTLQGTF-IVSDVTRVGFPEIDMGWGQSVFggpahggvggipGLITFYIPYEDNKGD  290
             RP ++  G++ IVSD TR GF +++ GWGQ VF      G      LI+FY+ +++N  D
Sbjct  361   RPQYSSTGSYLIVSDNTRAGFGDVNFGWGQPVF-----AGPAKALDLISFYVQHKNNTED  415

Query  289   HGILVPMCLPAIAMGKFVKELE  224
              GILVPMCLP+ AM +F +ELE
Sbjct  416   -GILVPMCLPSSAMERFQQELE  436



>ref|XP_009130368.1| PREDICTED: (Z)-3-hexen-1-ol acetyltransferase-like [Brassica 
rapa]
Length=469

 Score =   457 bits (1175),  Expect = 5e-152, Method: Compositional matrix adjust.
 Identities = 236/451 (52%), Positives = 311/451 (69%), Gaps = 9/451 (2%)
 Frame = -1

Query  1555  PFMASQPSIAFTVTRQNPELVAPADPTPREIKYLSDIDDQQGLRFQIPVIHFYRNEPSMS  1376
             P   + P ++F V R+ PEL+ PA  TPRE+K LSDIDDQQGLRFQIP + FYR  PS++
Sbjct  8     PLSTTTPRLSFKVHRRKPELITPAKLTPRELKLLSDIDDQQGLRFQIPFMFFYR--PSLT  65

Query  1375  GK-DPVQVIRQALAKALVFFYPFAGRLREGPGRKLMVDCTGEGVMFIEADADATLQHFAV  1199
                DPVQVIR AL + LV++YPFAGRL EGP RKL V+CTGEGV+FIEADAD T      
Sbjct  66    STLDPVQVIRTALGQTLVYYYPFAGRLLEGPNRKLAVNCTGEGVLFIEADADVTFAELEE  125

Query  1198  GGELKPPFPCFDQLLYNVPGSAEILNCPLFLIQVTRLRCGGFIFALRLNHSMSDACGLVH  1019
                L PPFPC ++LL++V GS+E+L  PL L++VTRL+CGGFIFALR+NH+M+D  GL  
Sbjct  126   ADALLPPFPCLEELLFDVEGSSELLGTPLLLVEVTRLKCGGFIFALRINHTMTDGAGLSL  185

Query  1018  FLNTIAEIARGAEAPSVYPVWQREFFDARNPPRITCTHFEYEEEPAADSMVTNIPLDNLV  839
             FL ++ E+A G  APSV PVW+R+   A    R+T TH EY+E    +++V     D LV
Sbjct  186   FLKSLCELACGLHAPSVPPVWERQLLIASTYARVTHTHREYDEYVEPEAVVVG---DCLV  242

Query  838   HRSFFFGPTEISALRSSLPPHLLK-CSRFEVVTACLWRCRTIAMEFDPNDEVRIFGTVNA  662
              RSFFFGP EI+A+R  LPP L    S F+ +T+ LWRCRT+AM  DPN E+R+   VN+
Sbjct  243   TRSFFFGPDEIAAIRRLLPPGLHNHNSTFDALTSFLWRCRTVAMSPDPNTEMRMTCIVNS  302

Query  661   RPRLKNPPVPNGYYGNAFVYPGAKSTAGKVSKSPLSHALELVTNIKSSFTEEYIKSVADL  482
             R +L+NPP+P+GYYGN F  P A +TA  + + PL   L L+   KSS TE+YI+SV  L
Sbjct  303   RSKLRNPPIPSGYYGNVFAIPVAIATAKDLMEKPLEFPLRLIQEAKSSVTEDYIRSVTAL  362

Query  481   MILKGRPTFTLQGTFIVSDVTRVGFPEIDMG-WGQSVFggpahggvggipGLITFYIPYE  305
             M  +GRP F     +IVSD+ R    ++D G WG+ V+GG A  G+   PG ++FY+P++
Sbjct  363   MATRGRPKFVTAENYIVSDLRRFDIGKVDFGPWGKPVYGGTAKAGIATFPG-VSFYVPFK  421

Query  304   DNKGDHGILVPMCLPAIAMGKFVKELENCLM  212
             + KG++G +V + LPA+AM KFV+EL    M
Sbjct  422   NKKGENGTVVAISLPALAMEKFVEELNGVFM  452



>gb|EYU41397.1| hypothetical protein MIMGU_mgv1a024853mg, partial [Erythranthe 
guttata]
Length=433

 Score =   455 bits (1171),  Expect = 7e-152, Method: Compositional matrix adjust.
 Identities = 232/443 (52%), Positives = 313/443 (71%), Gaps = 20/443 (5%)
 Frame = -1

Query  1534  SIAFTVTRQNPELVAPADPTPREIKYLSDIDDQQGLRFQIPVIHFYRNEPSMSGKDPVQV  1355
             ++ F VTRQNPEL+ PA PTP E K LSD D+ +GLRFQ+P+I FYR  PS+   DPV+V
Sbjct  1     ALTFKVTRQNPELIPPAKPTPHEFKPLSDFDNYEGLRFQVPIIQFYRKNPSVEA-DPVEV  59

Query  1354  IRQALAKALVFFYPFAGRLREGPGRKLMVDCTGEGVMFIEADADATLQHFAVGGELKPPF  1175
             IR+A+AKALV +YPFAGRLRE   RKL V+CTGEGVMFIEADAD  L+ F  G ELKPP 
Sbjct  60    IRKAIAKALVSYYPFAGRLREHAARKLAVECTGEGVMFIEADADVALEQF--GDELKPPV  117

Query  1174  PCFDQLLYNVPGSAEILNCPLFLIQVTRLRCGGFIFALRLNHSMSDACGLVHFLNTIAEI  995
             PC ++LLY+VPGS  I+N PL LIQVTRL+CGGFIF+LR NH+MSD  G+  F++ + E+
Sbjct  118   PCLEELLYDVPGSGGIINAPLLLIQVTRLKCGGFIFSLRFNHTMSDGAGIAQFVSAVGEL  177

Query  994   ARGAEAPSVYPVWQREFFDARNPPRITCTHFEYEEEPAADSMVTNIPLDNLVHRSFFFGP  815
             ARGA  PS  PVW+R   +      ++CTH E+++ P  D + T   L+ +VHRSF FG 
Sbjct  178   ARGAGFPSTPPVWERHLLN------MSCTHHEHKDIP--DIIKTLTTLNKVVHRSFSFGT  229

Query  814   TEISALRSSLPPHLLKC-SRFEVVTACLWRCRTIAMEFDPNDEVRIFGTVNARPRLKNPP  638
              +ISALRS LPPHL  C + FE+VTACLWRCRTIA+   P++EV I   +++R R  NPP
Sbjct  230   NQISALRSHLPPHLRHCTTTFEIVTACLWRCRTIALSLHPDEEVGILWAMDSRRRF-NPP  288

Query  637   VPNGYYGNAFVYPGAKSTAGKVSKSPLSHALELVTNIKSSFTEEYIKSVADLMILKGRPT  458
             +P+GYYGN  +YP A +T+  +SK+P  +A+EL+   K       ++++AD MI+K    
Sbjct  289   IPDGYYGNCCIYPTATTTSEILSKNPYHYAVELLRKAK-------LEAMADPMIIKRLSR  341

Query  457   FTLQGTFIVSDVTRVGFPEIDMGWGQSVFggpahggvggipGLITFYIPYEDNKGDHGIL  278
             F+  G + VSD   +GF ++D GWG++V+GG A G +G +  L++ Y+P +++KG++GI+
Sbjct  342   FSFVGGYAVSDARHLGFEDVDFGWGKAVYGGVAKGNIGFVRELLSLYVPCKNDKGENGIV  401

Query  277   VPMCLPAIAMGKFVKELENCLMK  209
             V + LP  AM  F KELE  + K
Sbjct  402   VSIYLPENAMEVFTKELEMLVEK  424



>emb|CBI25251.3| unnamed protein product [Vitis vinifera]
Length=443

 Score =   456 bits (1172),  Expect = 8e-152, Method: Compositional matrix adjust.
 Identities = 239/445 (54%), Positives = 306/445 (69%), Gaps = 42/445 (9%)
 Frame = -1

Query  1549  MASQPS-IAFTVTRQNPELVAPADPTPREIKYLSDIDDQQGLRFQIPVIHFYRNEPSMSG  1373
             MAS  S + F+V R +P++V PA+PTPRE+K LSDIDDQ+GLRFQIPVI FYRN P M G
Sbjct  1     MASSSSPLVFSVNRCDPQIVRPANPTPREVKQLSDIDDQEGLRFQIPVIMFYRNNPLMDG  60

Query  1372  KDPVQVIRQALAKALVFFYPFAGRLREGPGRKLMVDCTGEGVMFIEADADATLQHFAVGG  1193
             KDPV+VIR+AL KAL+++YPFAGRL EG  RKLMVDCTGEGV+FIEADAD TL++  +G 
Sbjct  61    KDPVKVIREALGKALIYYYPFAGRLIEGDNRKLMVDCTGEGVLFIEADADTTLEN--LGD  118

Query  1192  ELKPPFPCFDQLLYNVPGSAEILNCPLFLIQVTRLRCGGFIFALRLNHSMSDACGLVHFL  1013
              ++P  PCF++LLY+VPGS  IL  PL LIQVTRLRCGGFIFALRLNH++SDA GL+ FL
Sbjct  119   AIQPMCPCFEELLYDVPGSTRILGSPLILIQVTRLRCGGFIFALRLNHTLSDAAGLIQFL  178

Query  1012  NTIAEIARGAEAPSVYPVWQREFFDARNPPRITCTHFEYEEEPAADSMVTNIPLDNLVHR  833
             NTI E+A+G                     ++T T             +  +  +NLVHR
Sbjct  179   NTIGEMAQGLS-------------------KVTNTK----------GTLMAMDENNLVHR  209

Query  832   SFFFGPTEISALRSSLPPHLLKCSRFEVVTACLWRCRTIAMEFDPNDEVRIFGTVNARPR  653
             SFFFG  EI ALR+ LP  L  CS FEV+ AC+WRCRTIA   DP++ V I   +N R +
Sbjct  210   SFFFGREEIRALRNRLPASLGACSTFEVLMACVWRCRTIAFAVDPDEVVGISCIINMRGK  269

Query  652   --LKNPPVPNGYYGNAFVYPGAKSTAGKVSKSPLSHALELVTNIKSSFTEEYIKSVADLM  479
               L+ PP   GYYGNAFV P + + AG + K+PL  A+ LV   K+  ++EYIKSVADLM
Sbjct  270   HGLELPP---GYYGNAFVTPASITKAGMLCKNPLEFAIRLVKKAKAEMSQEYIKSVADLM  326

Query  478   ILKGRPTFTLQGTFIVSDVTRVGFPEIDMGWGQSVFggpahggvggipGLITFYIPYEDN  299
             ++KGRP FT  G +IVSDVTR G  E+D GWG+ V+     GGV     +I+F + + ++
Sbjct  327   VIKGRPLFTQPGNYIVSDVTRAGIGEVDFGWGKPVY-----GGVAKASPIISFRMWFRNS  381

Query  298   KGDHGILVPMCLPAIAMGKFVKELE  224
             KG+ G ++P+CLP   M +F +EL+
Sbjct  382   KGEEGNVIPICLPPPVMERFEQELK  406



>ref|XP_004301775.1| PREDICTED: benzyl alcohol O-benzoyltransferase-like [Fragaria 
vesca subsp. vesca]
Length=444

 Score =   455 bits (1171),  Expect = 1e-151, Method: Compositional matrix adjust.
 Identities = 231/450 (51%), Positives = 304/450 (68%), Gaps = 12/450 (3%)
 Frame = -1

Query  1549  MASQPSIAFTVTRQNPELVAPADPTPREIKYLSDIDDQQGLRFQIPVIHFYRNE-PSMSG  1373
             M S  S+ F + RQ PEL+ PA PTP+E K LS+ID Q+GLRFQ P I  Y+N+ PSM  
Sbjct  1     MGSLCSLTFQIKRQLPELLTPAKPTPQEKKLLSEIDIQEGLRFQTPFILSYKNDNPSMKQ  60

Query  1372  KDPVQVIRQALAKALVFFYPFAGRLREGPGRKLMVDCTGEGVMFIEADADATLQHFAVGG  1193
             KDPV+VIR AL +ALV++YPFAGR+R+G   KL+VDC GEG++FIEADAD TL+   +G 
Sbjct  61    KDPVEVIRDALRRALVYYYPFAGRVRKGSNGKLLVDCNGEGIVFIEADADVTLEQ--LGD  118

Query  1192  ELKPPFPCFDQLLYNVPGSAEILNCPLFLIQVTRLRCGGFIFALRLNHSMSDACGLVHFL  1013
              L+PP    +  L++VPGS +IL  PL L+QVTRLRCGGFIFALR+NH+MSDA  L  FL
Sbjct  119   SLQPPCSFLEDFLFDVPGSDDILGTPLLLLQVTRLRCGGFIFALRINHTMSDAVSLSQFL  178

Query  1012  NTIAEIARGAEAPSVYPVWQREFFDARNPPRITCTHFEY--EEEPAADSMVTNIPLDNLV  839
             N + E+A+GA+ P+V PVW+R   DAR+PP++TCTH EY  E E    S+V  +   +LV
Sbjct  179   NAVGEMAQGADEPTVQPVWERGLLDARDPPQVTCTHHEYGKETESHRGSVVATMEQPDLV  238

Query  838   HRSFFFGPTEISALRSSLPPHLLK-CSRFEVVTACLWRCRTIAMEFDPNDEVRIFGTVNA  662
              R  +FGP E+ A R+ L P L   CS FE++TAC+W+CRT+++E DP + VRI   VNA
Sbjct  239   QRCVYFGPKELMATRAHLSPSLSSTCSTFELITACMWKCRTLSLELDPKEVVRISLVVNA  298

Query  661   RPRLKNPPVPNGYYGNAFVYPGAKSTAGKVSKSPLSHALELVTNIKSSFTEEYIKSVADL  482
             R +  N  VP G+YGNA  +PG  +TA  + K PL +A+ELV   K    +EYI+S ADL
Sbjct  299   RGKKNNLTVPVGFYGNAIGFPGVVTTAEILCKQPLGYAVELVKEAKGKMNKEYIQSCADL  358

Query  481   MILKGRPTFTLQG-TFIVSDVTRVGFPEIDMGWGQSVFggpahggvggipGLITFYIPYE  305
             M ++G P  TL G  FI+SD TR G  E+D GWG+ V       G      LI+FY+   
Sbjct  359   MAIRGWPPLTLAGNNFILSDNTRTGVGEVDFGWGRPVV-----AGPAKSVNLISFYVRDN  413

Query  304   DNKGDHGILVPMCLPAIAMGKFVKELENCL  215
             + K  +GILVP+CLP   + +F +EL + L
Sbjct  414   NQKEKYGILVPICLPFSCVDRFEQELRSLL  443



>ref|XP_008364483.1| PREDICTED: benzyl alcohol O-benzoyltransferase-like [Malus domestica]
Length=437

 Score =   455 bits (1170),  Expect = 1e-151, Method: Compositional matrix adjust.
 Identities = 223/421 (53%), Positives = 302/421 (72%), Gaps = 12/421 (3%)
 Frame = -1

Query  1474  PREIKYLSDIDDQQGLRFQIPVIHFYRNEPSMS-GKDPVQVIRQALAKALVFFYPFAGRL  1298
             P+E K+LSDIDDQ+GLRFQ+P+I  Y++ PS++  ++PV+VIR+AL++ALV++YP AGRL
Sbjct  2     PQETKFLSDIDDQEGLRFQVPIIMCYKDNPSLNKNRNPVKVIREALSRALVYYYPLAGRL  61

Query  1297  REGPGRKLMVDCTGEGVMFIEADADATLQHFAVGGELKPPFPCFDQLLYNVPGSAEILNC  1118
             REGP RKLMVDC GEG++F+EA A+ TL+   +G ++ PP P  ++ L+N P S  I+ C
Sbjct  62    REGPNRKLMVDCNGEGILFVEAFANVTLEQ--LGDKILPPCPLLEEFLFNFPSSNGIIGC  119

Query  1117  PLFLIQVTRLRCGGFIFALRLNHSMSDACGLVHFLNTIAEIARGAEAPSVYPVWQREFFD  938
             PL L+QVT L CGGFI ALRLNH+M DA GL+ FL  IAE+ARGA APS+ PVW+RE   
Sbjct  120   PLLLVQVTCLICGGFILALRLNHTMCDAPGLLLFLTAIAEMARGAHAPSILPVWERELLF  179

Query  937   ARNPPRITCTHFEYEEE-PAADSMVTNIPLDNLVHRSFFFGPTEISALRSSLPPHLLK-C  764
             AR+PPRITC H EYE+    +D +  +    N+V RSF+FG  E+  LR  +PPHL+  C
Sbjct  180   ARDPPRITCAHHEYEDVIDHSDGLYASSNQSNMVQRSFYFGAKEMRVLRKQIPPHLISTC  239

Query  763   SRFEVVTACLWRCRTIAMEFDPNDEVRIFGTVNARPRLKNPPVPNGYYGNAFVYPGAKST  584
             S F+++TACLW+CRT+A++ +P   VR    VNAR +  N  +P GYYGNAF +P A S 
Sbjct  240   STFDLITACLWKCRTLALKINPXQXVRXSCXVNARGKHHNVRLPLGYYGNAFAFPXAVSK  299

Query  583   AGKVSKSPLSHALELVTNIKSSFTEEYIKSVADLMILKGRPTFTLQGT-FIVSDVTRVGF  407
             A  + K+P  +ALELV   K++  EEY++SVADL++L+GRP ++  G+ FIVSD TR GF
Sbjct  300   AEPLCKNPXGYALELVKKAKATMNEEYLRSVADLLVLRGRPQYSSTGSYFIVSDTTRAGF  359

Query  406   PEIDMGWGQSVFggpahggvggipGLITFYIPYEDNKGDHGILVPMCLPAIAMGKFVKEL  227
              +++ GWGQ VF      G      LI+FY+ +++N  D GILVPMCLP  AM +F +EL
Sbjct  360   GDVNFGWGQPVF-----AGPAKALDLISFYVQHKNNTED-GILVPMCLPFSAMERFQEEL  413

Query  226   E  224
             E
Sbjct  414   E  414



>ref|XP_008355599.1| PREDICTED: methanol O-anthraniloyltransferase-like [Malus domestica]
Length=454

 Score =   455 bits (1170),  Expect = 2e-151, Method: Compositional matrix adjust.
 Identities = 232/446 (52%), Positives = 300/446 (67%), Gaps = 16/446 (4%)
 Frame = -1

Query  1549  MASQP-SIAFTVTRQNPELVAPADPTPREIKYLSDIDDQQGLRFQIPVIHFYRNEPSM--  1379
             M S P S    V R   +LV PA PTP E K LSDIDDQ+GLRFQ PV+  Y+N P +  
Sbjct  1     MTSLPCSRVLQVNRLXSQLVTPAKPTPHETKLLSDIDDQEGLRFQTPVLMSYKNNPLIPK  60

Query  1378  SGKDPVQVIRQALAKALVFFYPFAGRLREGPGRKLMVDCTGEGVMFIEADADATLQHFAV  1199
                DPV+V+++AL+KALVF+YP AGRLREGP RKLMV+CTGEGV+FIEADAD TL+   +
Sbjct  61    DRTDPVKVLKEALSKALVFYYPLAGRLREGPNRKLMVECTGEGVLFIEADADVTLEQ--L  118

Query  1198  GGELKPPFPCFDQLLYNVPGSAEILNCPLFLIQVTRLRCGGFIFALRLNHSMSDACGLVH  1019
             G  L PP P  ++ L + PGS  IL CPL L+QVTRL+CGGFIFALR+NH+M D  G+V 
Sbjct  119   GDALVPPCPFLEEFLCDAPGSDGILGCPLLLVQVTRLKCGGFIFALRINHTMCDGFGMVQ  178

Query  1018  FLNTIAEIARGAEAPSVYPVWQREFFDARNPPRITCTHFEYEEEPAADSMVTNI-PLDNL  842
             FLN + E+A GA  PS+ PVWQRE FDARNP RITCTH EYEE   +D  +  +    N+
Sbjct  179   FLNGVGEMAHGAHTPSIPPVWQRELFDARNPLRITCTHHEYEEAIDSDEGLFAVRDQQNM  238

Query  841   VHRSFFFGPTEISALRSSLPPHLLKCSRFEVVTACLWRCRTIAMEFDPNDEVRIFGTVNA  662
             V +SF+FG  E++A+R  LP H    S F+++TACLW+CRT+A+E +  + V I     A
Sbjct  239   VQKSFYFGAEELNAIRKHLPAHHSPSSTFDLITACLWKCRTLALEMNQKEVVYISCISTA  298

Query  661   RPRLKNPPVPNGYYGNAFVYPGAKSTAGKVSKSPLSHALELVTNIKSSFTEEYIKSVADL  482
             R    N  +P GYYGNAF  P   ST   + K+P+ +ALELV   K+  ++EYIKSVADL
Sbjct  299   R----NARLPLGYYGNAFALPSEVSTVESLCKNPIGYALELVKKXKAKMSDEYIKSVADL  354

Query  481   MILKGRPTFTLQGTFIVSDVTRVGFPEIDMGWGQSVFggpahggvggipGLITFYIPYED  302
             M+++GRP F+    F+V D TR GF E+D GWG+ VF      G      +I  Y+ ++ 
Sbjct  355   MVMRGRPDFSSTRNFVVGDTTRAGFGEVDFGWGKPVF-----AGPAKCVNMINLYVRHK-  408

Query  301   NKGDHGILVPMCLPAIAMGKFVKELE  224
             NK ++GILV  CLP  A+ +F +EL+
Sbjct  409   NKEENGILVLTCLPLSAVERFQQELK  434



>ref|XP_010110389.1| Benzyl alcohol O-benzoyltransferase [Morus notabilis]
 gb|EXC26221.1| Benzyl alcohol O-benzoyltransferase [Morus notabilis]
Length=493

 Score =   456 bits (1174),  Expect = 2e-151, Method: Compositional matrix adjust.
 Identities = 242/463 (52%), Positives = 309/463 (67%), Gaps = 29/463 (6%)
 Frame = -1

Query  1567  MALSPFMASQPSIAFTVTRQNPELVAPADPTPREIKYLSDIDDQQGLRFQIPVIHFYRNE  1388
             MALSP      S+   V R  P LV P+ PTP+EIK LSDIDDQ+GLRF +PVI FY+N 
Sbjct  1     MALSPC----SSLTIKVDRYEPVLVKPSKPTPKEIKLLSDIDDQEGLRFHVPVIFFYKNN  56

Query  1387  --PSMS-GKDPVQVIRQALAKALVFFYPFAGRLREGPGRKLMVDCTGEGVMFIEADADAT  1217
               PS+  G+DP +VIR+AL +ALV++YPFAGRLREG   KLMVDCTGEGV+F+ A AD  
Sbjct  57    NNPSVKLGQDPNRVIREALGRALVYYYPFAGRLREGSNGKLMVDCTGEGVLFVAAKADVG  116

Query  1216  LQHFAVGGELKPPFPCFDQLLYNVPGSAEILNCPLFLIQVTRLRCGGFIFALRLNHSMSD  1037
                  +G  ++PP P  DQ LYNVPGS  IL CPL LIQVT+L+C GF+ A+R+NH+M D
Sbjct  117   FDQ--LGDAIRPPSPFLDQFLYNVPGSDGILGCPLLLIQVTQLKCEGFVLAVRVNHTMCD  174

Query  1036  ACGLVHFLNTIAEIARGAEAPSVYPVWQREFFDARNPPRITCTHFEYEEEPAADSMVTNI  857
             A GLV FLNTIAE+ARG   PS+ PVWQRE  +ARNPPRI   H E+ E P  +S   N+
Sbjct  175   AFGLVQFLNTIAEMARGINIPSIPPVWQREILNARNPPRINYPHQEFHEVP-TNSKGPNM  233

Query  856   PLD--NLVHRSFFFGPTEISALRSSLPPHLLKCSRFEVVTACLWRCRTIAMEFDPND---  692
              +D  ++V  SFFF   +I  ++  LP HL  CSRF+++TACLW+CRTIA+E DP +   
Sbjct  234   IMDPNDVVQSSFFFSSNQIRNMKKRLPKHLQNCSRFDLITACLWKCRTIALELDPKEIVL  293

Query  691   ---EVRIFGTVNARPRLKNPPVPNGYYGNAFVYPGAKSTAGKVSKSPLSHALELVTNIKS  521
                 VR+ G  NA    KN  +P GYYGNAF YP        + +S L H +ELV   K+
Sbjct  294   VSCIVRLRGNNNA----KNLSLPLGYYGNAFAYPAVVLKPRVLCESSLGHVVELVKKAKA  349

Query  520   SFTEEYIKSVADLMILKGRPTFTLQGTFIVSDVTRVGFPEIDMGWGQSVFggpahggvgg  341
               +E+YIKSVADLM+ +GRP   + G + VSD TRVG+ EID GWG  VF     GG   
Sbjct  350   EMSEDYIKSVADLMVTRGRPLHAVSGNYFVSDNTRVGYGEIDFGWGLPVF-----GGPAK  404

Query  340   ipGLITFYIPYEDNKGDHGILVPMCLPAI-AMGKFVKELENCL  215
                 I+FY+ YE+ KG+ G++VP+CLP + AM +F +EL+  +
Sbjct  405   ALSFISFYVEYEE-KGEKGVVVPICLPTVRAMDRFEQELKKMI  446



>ref|XP_009374321.1| PREDICTED: methanol O-anthraniloyltransferase-like [Pyrus x bretschneideri]
Length=454

 Score =   454 bits (1168),  Expect = 4e-151, Method: Compositional matrix adjust.
 Identities = 233/451 (52%), Positives = 301/451 (67%), Gaps = 16/451 (4%)
 Frame = -1

Query  1549  MASQP-SIAFTVTRQNPELVAPADPTPREIKYLSDIDDQQGLRFQIPVIHFYRNEPSM--  1379
             M S P S+   V R  P+LV PA PTP E K LSDIDDQ+GLRFQ PV+  Y+N P +  
Sbjct  1     MTSLPCSLVLRVNRLAPQLVKPAKPTPHETKLLSDIDDQEGLRFQTPVLMSYKNNPLIPK  60

Query  1378  SGKDPVQVIRQALAKALVFFYPFAGRLREGPGRKLMVDCTGEGVMFIEADADATLQHFAV  1199
                DPV+V+++AL+KALVF+YP AGRLREGP RKLMV+CTGEGV+FIEADA+ TL+    
Sbjct  61    DRTDPVKVLKEALSKALVFYYPLAGRLREGPNRKLMVECTGEGVLFIEADANVTLEQL--  118

Query  1198  GGELKPPFPCFDQLLYNVPGSAEILNCPLFLIQVTRLRCGGFIFALRLNHSMSDACGLVH  1019
             G  + PP P  ++ L + P S  IL CPL L+QVTRL+CGGFIFALR+NH+M D  GLV 
Sbjct  119   GDAIVPPSPFLEEFLCDAPASDGILGCPLPLVQVTRLKCGGFIFALRVNHTMCDGSGLVR  178

Query  1018  FLNTIAEIARGAEAPSVYPVWQREFFDARNPPRITCTHFEYEEEPAADSMVTNI-PLDNL  842
             FLN + E+A GA APS+ PVWQRE FDARNPPRITCTH EYEE   +D  +T +    N+
Sbjct  179   FLNAVGEMAHGAHAPSIPPVWQRELFDARNPPRITCTHHEYEESIDSDEGLTAVRGQRNM  238

Query  841   VHRSFFFGPTEISALRSSLPPHLLKCSRFEVVTACLWRCRTIAMEFDPNDEVRIFGTVNA  662
             V +SF+FG  E+ A+R  LP      S F+++TACLW+CRT+A+E +  + V I     A
Sbjct  239   VQKSFYFGAEELKAIRKHLPAEHSPSSTFDLITACLWKCRTLAIEMNQKEVVCISCISGA  298

Query  661   RPRLKNPPVPNGYYGNAFVYPGAKSTAGKVSKSPLSHALELVTNIKSSFTEEYIKSVADL  482
                 +N  +P GYYGNAF  P   ST   + K+P+ +ALELV   K+  ++EYIKSVADL
Sbjct  299   ----QNTRLPLGYYGNAFALPSEVSTVESLRKNPIGYALELVKQAKAKMSDEYIKSVADL  354

Query  481   MILKGRPTFTLQGTFIVSDVTRVGFPEIDMGWGQSVFggpahggvggipGLITFYIPYED  302
             M+++GRP F+    F+V D TR GF E+D GWG+ VF      G      +I  Y+ ++ 
Sbjct  355   MVMRGRPDFSSARNFVVGDTTRAGFGEVDFGWGKPVF-----AGPAKCVNMINMYVRHK-  408

Query  301   NKGDHGILVPMCLPAIAMGKFVKELENCLMK  209
             NK ++GILV  CLP  A G   +EL+   M+
Sbjct  409   NKEENGILVLTCLPLSAGGGVQQELKRMTME  439



>ref|XP_002298956.2| hypothetical protein POPTR_0001s45160g [Populus trichocarpa]
 gb|EEE83761.2| hypothetical protein POPTR_0001s45160g [Populus trichocarpa]
Length=465

 Score =   454 bits (1169),  Expect = 5e-151, Method: Compositional matrix adjust.
 Identities = 228/449 (51%), Positives = 306/449 (68%), Gaps = 12/449 (3%)
 Frame = -1

Query  1549  MASQPSIAFTVTRQNPELVAPADPTPREIKYLSDIDDQQGLRFQIPVIHFYRNEPSMSGK  1370
             MA+ PS++F V R  PEL+APA  TP E + LSDID Q  L+FQ P  + Y + PSM GK
Sbjct  1     MATPPSLSFAVRRCEPELIAPAKATPHEFRQLSDIDRQLYLQFQSPHYNLYAHNPSMQGK  60

Query  1369  DPVQVIRQALAKALVFFYPFAGRLREGPGRKLMVDCTGEGVMFIEADADATLQHFAVGGE  1190
             DPV+VI++A+A+ALV++YPFAGR+R+GP  KL+VDCTGEGV+FIEADADAT++ F  G  
Sbjct  61    DPVKVIKEAIAQALVYYYPFAGRIRQGPDNKLIVDCTGEGVLFIEADADATVEQF--GDP  118

Query  1189  LKPPFPCFDQLLYNVPGSAEILNCPLFLIQVTRLRCGGFIFALRLNHSMSDACGLVHFLN  1010
             +  PFPCF +LLYNVPGS  ILN PL L QVTRL+CGGF+   RLNH M+DA G+V  LN
Sbjct  119   IPSPFPCFQELLYNVPGSEGILNTPLLLFQVTRLKCGGFVLGFRLNHPMTDALGIVQLLN  178

Query  1009  TIAEIARGAEAPSVYPVWQREFFDARNPPRITCTHFEY-EEEPAADSMVTNIP-----LD  848
              I EIARGA+APS+ PVWQRE   ARNPPR+TC H EY  + P A      +P     + 
Sbjct  179   AIGEIARGAQAPSILPVWQRELLCARNPPRVTCRHNEYGNDAPVAVDPTAKVPEFHGQVH  238

Query  847   NLVHRSFFFGPTEISALRSSLPPHLLKCSRFEVVTACLWRCRTIAMEFDPNDEVRIFGTV  668
              + HRSF     E+S +R  +P HL  CS FEV++ACLWRC  +A + +PN+E+R+   V
Sbjct  239   AVAHRSFVLNRKELSNIRRWIPSHLHPCSNFEVISACLWRCYAMASQANPNEEMRMQMLV  298

Query  667   NARPRLKNPPVPNGYYGNAFVYPGAKSTAGKVSKSPLSHALELVTNIKSSFTEEYIKSVA  488
             NAR +  NPP+P GYYGN    P A + A K+  + L +A+E++ N K+  TEEY++S+A
Sbjct  299   NARSKF-NPPLPKGYYGNVLALPAAVTNARKLCLNSLGYAVEMIRNAKNRITEEYMRSLA  357

Query  487   DLM-ILKGRPTFTLQGTFIVSDVTRVGFPEIDMGWGQSVFggpahggvggipGLITFYIP  311
             DLM I KG+P   LQ +++VSD+T +GF ++D GWG +++ GP       I    T+++P
Sbjct  358   DLMEITKGQP-IGLQ-SYVVSDLTSIGFDQVDYGWGNTIYTGPPKAMPDEISIAGTYFLP  415

Query  310   YEDNKGDHGILVPMCLPAIAMGKFVKELE  224
             Y    G+ G+++ + L A  M +F   LE
Sbjct  416   YRFKNGERGVMLLVSLRAPVMERFAILLE  444



>ref|XP_011041078.1| PREDICTED: benzyl alcohol O-benzoyltransferase-like isoform X2 
[Populus euphratica]
Length=463

 Score =   454 bits (1168),  Expect = 6e-151, Method: Compositional matrix adjust.
 Identities = 229/444 (52%), Positives = 303/444 (68%), Gaps = 12/444 (3%)
 Frame = -1

Query  1534  SIAFTVTRQNPELVAPADPTPREIKYLSDIDDQQGLRFQIPVIHFYRNEPSMSGKDPVQV  1355
             SI+F V R+ PELVAPA  TP E + LSDID Q  L+FQ P  + Y + PSM GKDPV+V
Sbjct  4     SISFAVRRREPELVAPAKATPHEFRQLSDIDRQLYLQFQSPHYNLYAHNPSMQGKDPVKV  63

Query  1354  IRQALAKALVFFYPFAGRLREGPGRKLMVDCTGEGVMFIEADADATLQHFAVGGELKPPF  1175
             I++A+A+ALV++YPFAGR+R+GP  KL+VDCTGEGV+FIEADADAT++ F  G  +  PF
Sbjct  64    IKEAIAQALVYYYPFAGRIRQGPDNKLIVDCTGEGVLFIEADADATVEQF--GDPIPSPF  121

Query  1174  PCFDQLLYNVPGSAEILNCPLFLIQVTRLRCGGFIFALRLNHSMSDACGLVHFLNTIAEI  995
             PCF +LLYNVPGS  ILN PL L QVTRL+CGGF+   RLNH M+DA G+V  LN I EI
Sbjct  122   PCFQELLYNVPGSDGILNTPLLLFQVTRLKCGGFVLGFRLNHPMTDALGIVQVLNAIGEI  181

Query  994   ARGAEAPSVYPVWQREFFDARNPPRITCTHFEY-EEEPAADSMVTNIP-----LDNLVHR  833
             ARGA+APS+ PVWQRE   ARNPPR+TC H EY  + P A      +P     +  + HR
Sbjct  182   ARGAQAPSILPVWQRELLCARNPPRVTCRHNEYGNDAPVAVDPTAKVPEFHGQVHAVAHR  241

Query  832   SFFFGPTEISALRSSLPPHLLKCSRFEVVTACLWRCRTIAMEFDPNDEVRIFGTVNARPR  653
             SF     E+S +R  +P HL  CS FEV++ACLWRC  IA + +PN+E+R+   VNAR +
Sbjct  242   SFVLNRKELSNIRRWIPSHLHPCSNFEVISACLWRCYAIASQANPNEEMRMQMLVNARSK  301

Query  652   LKNPPVPNGYYGNAFVYPGAKSTAGKVSKSPLSHALELVTNIKSSFTEEYIKSVADLM-I  476
               NPP+P GYYGN    P A + A K+  + L +ALE++ N K+  TEEY++S+ADLM I
Sbjct  302   F-NPPLPKGYYGNVLALPAAVTNARKLCLNSLGYALEMIRNAKNRITEEYMRSLADLMEI  360

Query  475   LKGRPTFTLQGTFIVSDVTRVGFPEIDMGWGQSVFggpahggvggipGLITFYIPYEDNK  296
              KG+P   LQ +++VSD+T +GF ++D GWG +++ GP       I    T+++PY    
Sbjct  361   TKGQP-IGLQ-SYVVSDLTSIGFDQVDYGWGNTIYTGPPKAMPDEISIAGTYFLPYRFKN  418

Query  295   GDHGILVPMCLPAIAMGKFVKELE  224
             G+ G+++ + L A  M +F   LE
Sbjct  419   GERGVMLLVSLRAPVMERFAILLE  442



>ref|XP_008356442.1| PREDICTED: methanol O-anthraniloyltransferase-like [Malus domestica]
Length=460

 Score =   453 bits (1165),  Expect = 1e-150, Method: Compositional matrix adjust.
 Identities = 228/452 (50%), Positives = 299/452 (66%), Gaps = 12/452 (3%)
 Frame = -1

Query  1549  MASQP-SIAFTVTRQNPELVAPADPTPREIKYLSDIDDQQGLRFQIPVIHFYRNEPSMSG  1373
             M S P S+ F V R  PELV PA PTP E K LS+ID+Q+ LR Q P I  Y + PS   
Sbjct  1     MGSSPISLLFQVKRLEPELVTPASPTPCEQKILSEIDNQEALRCQTPFIWSYTSNPSSKE  60

Query  1372  KDPVQVIRQALAKALVFFYPFAGRLREGPGRKLMVDCTGEGVMFIEADADATLQHFAVGG  1193
              DPVQVIR AL+++LV++YP AGR+REGP +KLMVDC GEGV+FIEA+AD TL+    G 
Sbjct  61    IDPVQVIRDALSRSLVYYYPLAGRVREGPNKKLMVDCNGEGVLFIEAEADVTLEQL--GD  118

Query  1192  ELKPPFPCFDQLLYNVPGSAEILNCPLFLIQVTRLRCGGFIFALRLNHSMSDACGLVHFL  1013
              L+PP P  +  LY+VPG+ +I+  PL  +QVTRL+CGGFIFA+RLNH+M DA GL  FL
Sbjct  119   TLQPPCPLLEDFLYDVPGTNDIVGTPLLJVQVTRLKCGGFIFAMRLNHTMFDALGLAQFL  178

Query  1012  NTIAEIARGAEAPSVYPVWQREFFDARNPPRITCTHFEY--EEEPAADSMVTNIPLDNLV  839
             N + EIARGA APS+ P+W+R   +AR PP++T  H EY  E E  A S++ ++   +L+
Sbjct  179   NAVGEIARGAHAPSIPPIWERXLLNAREPPQVTYMHHEYGDENESQAGSVIASVDQPDLI  238

Query  838   HRSFFFGPTEISALRSSLPPHLLK-CSRFEVVTACLWRCRTIAMEFDPNDEVRIFGTVNA  662
              R F+F P  I + R  LPP+L   CS FE++T CLW+CRTIA+  +PN+ VR+   VNA
Sbjct  239   QRCFYFSPKGIRSARKHLPPNLSNTCSTFELITGCLWKCRTIALAMNPNEAVRVSLVVNA  298

Query  661   RPRLKNPPVPNGYYGNAFVYPGAKSTAGKVSKSPLSHALELVTNIKSSFTEEYIKSVADL  482
             R +  N  VP G+YGNA  +P   STA  +  SPL +A++LV   K+   E+YIKSVADL
Sbjct  299   RGKRNNLNVPLGFYGNAIGFPSVXSTAELLCNSPLEYAVQLVREAKNKMNEDYIKSVADL  358

Query  481   MILKGRPTFTLQG-TFIVSDVTRVGFPEIDMGWGQSVFggpahggvggipGLITFYIPYE  305
             + L+G P  TL G  FI+SD TR G  E+D GWG+ +       G      LI+FY+   
Sbjct  359   LALRGWPPLTLAGNNFILSDNTRTGVGEVDFGWGKPII-----AGPAKSVNLISFYVRDS  413

Query  304   DNKGDHGILVPMCLPAIAMGKFVKELENCLMK  209
             + + D+GILVPMCLP   M K  +EL+   M+
Sbjct  414   NQEKDYGILVPMCLPFWCMEKIEQELKRITME  445



>ref|XP_002300497.2| hypothetical protein POPTR_0001s45180g [Populus trichocarpa]
 gb|EEE85302.2| hypothetical protein POPTR_0001s45180g [Populus trichocarpa]
Length=465

 Score =   453 bits (1165),  Expect = 2e-150, Method: Compositional matrix adjust.
 Identities = 231/449 (51%), Positives = 303/449 (67%), Gaps = 12/449 (3%)
 Frame = -1

Query  1549  MASQPSIAFTVTRQNPELVAPADPTPREIKYLSDIDDQQGLRFQIPVIHFYRNEPSMSGK  1370
             MA+  SI+F V R  PELVAPA  TP E + LSDID Q  L+FQ P  + Y + PSM GK
Sbjct  1     MATPTSISFAVRRCEPELVAPAKATPHEFRQLSDIDRQLYLQFQSPGYNLYAHNPSMQGK  60

Query  1369  DPVQVIRQALAKALVFFYPFAGRLREGPGRKLMVDCTGEGVMFIEADADATLQHFAVGGE  1190
             DPV+VI++A+A+ALV++YPFAGR+R+GP  KL+VDCTGEGV+FIEADADAT++ F  G  
Sbjct  61    DPVKVIKEAIAQALVYYYPFAGRIRQGPDNKLIVDCTGEGVLFIEADADATVEQF--GDP  118

Query  1189  LKPPFPCFDQLLYNVPGSAEILNCPLFLIQVTRLRCGGFIFALRLNHSMSDACGLVHFLN  1010
             +  PFPCF +LLYNVPGS EILN PL L QVTRL+CGGF+  LR NH MSD  G++   N
Sbjct  119   IPSPFPCFQELLYNVPGSEEILNTPLLLFQVTRLKCGGFVLGLRFNHLMSDGLGMLQLFN  178

Query  1009  TIAEIARGAEAPSVYPVWQREFFDARNPPRITCTHFEY-EEEPAADSMVTNIP-----LD  848
             TI E+ARGA+ PS+ PVWQRE   ARNPPR+TC H EY ++ P A      +P     + 
Sbjct  179   TIGEMARGAQTPSILPVWQRELLCARNPPRVTCRHNEYGDDAPVAVDPTAKVPEFRGEVH  238

Query  847   NLVHRSFFFGPTEISALRSSLPPHLLKCSRFEVVTACLWRCRTIAMEFDPNDEVRIFGTV  668
              + HRSF     E+S +R  +P HL  CS FEV++ACLWRC  IA + +PN+E+R+   V
Sbjct  239   AVAHRSFVLNRKELSNIRRWVPSHLHPCSDFEVISACLWRCYAIASQANPNEEMRMQMLV  298

Query  667   NARPRLKNPPVPNGYYGNAFVYPGAKSTAGKVSKSPLSHALELVTNIKSSFTEEYIKSVA  488
             NAR +  NPP+P GYYGN    P A + A K+  + L +ALE++ N K+  TEEY++S+A
Sbjct  299   NARSKF-NPPLPKGYYGNVLALPAAVTNARKLCLNSLGYALEMIRNAKNRITEEYMRSLA  357

Query  487   DLM-ILKGRPTFTLQGTFIVSDVTRVGFPEIDMGWGQSVFggpahggvggipGLITFYIP  311
             DLM I KG+P   LQ +++VSD+T  GF ++D GWG +++ GP       I    TF +P
Sbjct  358   DLMEITKGQP-IALQ-SYVVSDLTSFGFDQVDYGWGNTIYSGPPKAMPDEISIAGTFVLP  415

Query  310   YEDNKGDHGILVPMCLPAIAMGKFVKELE  224
             Y    G+ G++V + L A  M +F   LE
Sbjct  416   YRFKNGERGVMVLVSLRAPVMERFAILLE  444



>ref|XP_010689156.1| PREDICTED: benzyl alcohol O-benzoyltransferase-like [Beta vulgaris 
subsp. vulgaris]
Length=443

 Score =   451 bits (1161),  Expect = 4e-150, Method: Compositional matrix adjust.
 Identities = 226/439 (51%), Positives = 305/439 (69%), Gaps = 10/439 (2%)
 Frame = -1

Query  1531  IAFTVTRQNPELVAPADPTPREIKYLSDIDDQQGLRFQIPVIHFYRNEPSMSGKDPVQVI  1352
             +   VTR  PELV PA PTP+E+K LSDIDDQ+GLRFQ+P I FYR +PSM GKDPV+V+
Sbjct  11    LVLNVTRGKPELVRPAQPTPQELKPLSDIDDQEGLRFQMPAIMFYRADPSMEGKDPVKVV  70

Query  1351  RQALAKALVFFYPFAGRLREGPGRKLMVDCTGEGVMFIEADADATLQHFAVGGELKPPFP  1172
             + ALAKALVF+YP+AGRL EGP RKL VDCTGEG+ FIEADADA L+ F  G E+ PPFP
Sbjct  71    KDALAKALVFYYPYAGRLVEGPTRKLSVDCTGEGLPFIEADADARLEDF--GDEIHPPFP  128

Query  1171  CFDQLLYNVPGSAEILNCPLFLIQVTRLRCGGFIFALRLNHSMSDACGLVHFLNTIAEIA  992
               D LLY++PG+  +L  PL ++QVTRL+CGGFI ALR NHS+ D  G++ F+N + E+ 
Sbjct  129   LED-LLYDIPGTDGMLGTPLIIVQVTRLKCGGFIIALRANHSVCDGTGVMQFMNAVGEMG  187

Query  991   RGAEAPSVYPVWQREFFDARNPPRITCTHFEYEEEPAADSMVTNIPLDNLVHRSFFFGPT  812
             RG++ PSV PVW RE   A   P+++  H EY++              NL+ +SF FGPT
Sbjct  188   RGSDTPSVLPVWDRERLIAGESPKVSFPHPEYDQHEVDHHSNGEA---NLLQQSFLFGPT  244

Query  811   EISALRSSLPPHLLKCSRFEVVTACLWRCRTIAMEFDPNDEVRIFGTVNARPRLKNPPVP  632
             E+ ALR  +PPH+ + S F++++ACLWRCRTIA+  DPN+EVR+   VNAR +  NPP+ 
Sbjct  245   ELEALRRHIPPHIKQFSTFDILSACLWRCRTIALGLDPNEEVRLCFAVNARTKF-NPPLE  303

Query  631   NGYYGNAFVYPGAKSTAGKVSKSPLSHALELVTNIKSSFTEEYIKSVADLMILKGRPTFT  452
              GYYGNA  +P   + AG++  + + + L L+ N KS   EEY++S+ DLMI K RP FT
Sbjct  304   KGYYGNACAFPAVCAKAGEICNNKVDYILGLIRNAKSEINEEYMRSIMDLMITKDRPHFT  363

Query  451   LQGTFIVSDVTRVGFPEIDMGWGQSVFggpahggvggipGLITFYIPYEDNKGDHGILVP  272
             ++ T++VSD+  +GF ++D+GWG+ VFGGPA  G        +F+I +++ KG+  I+VP
Sbjct  364   VRQTYVVSDLRHLGFADVDIGWGKPVFGGPASNGSIPDA---SFFISFKNKKGETMIMVP  420

Query  271   MCLPAIAMGKFVKELENCL  215
             + L    M  FV+EL   L
Sbjct  421   ISLSPPVMDVFVQELREML  439



>ref|XP_003536109.1| PREDICTED: benzyl alcohol O-benzoyltransferase-like [Glycine 
max]
Length=459

 Score =   451 bits (1161),  Expect = 6e-150, Method: Compositional matrix adjust.
 Identities = 233/445 (52%), Positives = 308/445 (69%), Gaps = 11/445 (2%)
 Frame = -1

Query  1546  ASQPSIAFTVTRQNPELVAPADPTPREIKYLSDIDDQQGLRFQIPVIHFYRNEPSMSGKD  1367
             +S   + F+V R  PELVAPA PTPREIK LS+ID Q GLR QIP+I FYRN+PS++GKD
Sbjct  11    SSSSPLVFSVRRSEPELVAPAKPTPREIKILSEIDSQAGLRTQIPIIQFYRNDPSLAGKD  70

Query  1366  PVQVIRQALAKALVFFYPFAGRLR-EGPGRKLMVDCTGEGVMFIEADADATLQHFAVGGE  1190
             PVQ IR ALA+ALVF+YPFAGR++ EG   KL+VDC  EGVMFIEADAD TL  F  G  
Sbjct  71    PVQAIRNALAEALVFYYPFAGRIKEEGSDGKLVVDCNEEGVMFIEADADVTLDQF--GDA  128

Query  1189  LKPPFPCFDQLLYNVPGSAEILNCPLFLIQVTRLRCGGFIFALRLNHSMSDACGLVHFLN  1010
             LKPPFPCF +LLY  PGS  I + P+FLIQVTRL+CGGFI A+R NH M D  GL+HF  
Sbjct  129   LKPPFPCFQELLYQPPGSDGITDAPIFLIQVTRLKCGGFILAIRFNHVMVDGVGLIHFTL  188

Query  1009  TIAEIARGA-EAPSVYPVWQREFFDARNPPRITCTHFEYEEEPAADSMVTNIPLDNLVHR  833
             T+A IARGA + P   PVW RE   AR+PPR+T  H EYE+   ++  V+     +   R
Sbjct  189   TVAGIARGAMKEPPFQPVWSRELLFARDPPRVTFNHREYEQLTDSNDAVST----DFEQR  244

Query  832   SFFFGPTEISALRSSLPPHL-LKCSRFEVVTACLWRCRTIAMEFDPNDEVRIFGTVNARP  656
             SFFFGPTE +++R+ LP  L  + + FEV+T+ +WRCRT A++  PN++VR+   V+AR 
Sbjct  245   SFFFGPTETASIRALLPRDLDQRATTFEVLTSYVWRCRTKALQIPPNEDVRMMCIVDARG  304

Query  655   RLKNPPVPNGYYGNAFVYPGAKSTAGKVSKSPLSHALELVTNIKSSFTEEYIKSVADLMI  476
             +  +PP P G+YG+ F +P A + AG + + PL +A++L+   +   +EEYI SVADLM 
Sbjct  305   KF-DPPFPAGFYGSCFAFPAAVTGAGDLCEKPLEYAVQLIQKARGEVSEEYIDSVADLMA  363

Query  475   LKGRPTFTLQGTFIVSDVTRVGFPEIDMGWGQSVFggpahggvggipGLITFYIPYEDNK  296
              +GRP FT+  + +V D T  GF  +D GWG +++GG A  G G  P  + F++P ++ K
Sbjct  364   SEGRPLFTVVRSCLVLDTTEAGFRNLDFGWGNALYGGMAVAGAGAFPA-VNFHVPSQNAK  422

Query  295   GDHGILVPMCLPAIAMGKFVKELEN  221
             G+ GILV +CLP+  M  F KEL++
Sbjct  423   GEEGILVLICLPSQVMKAFAKELDH  447



>emb|CDY43120.1| BnaA05g32660D [Brassica napus]
Length=451

 Score =   451 bits (1160),  Expect = 6e-150, Method: Compositional matrix adjust.
 Identities = 235/441 (53%), Positives = 306/441 (69%), Gaps = 9/441 (2%)
 Frame = -1

Query  1531  IAFTVTRQNPELVAPADPTPREIKYLSDIDDQQGLRFQIPVIHFYRNEPSM-SGKDPVQV  1355
             ++F V R+ PELV PA PTPRE+K LSDIDDQQGLRFQIPVI FYR  P++ S  DPVQV
Sbjct  15    LSFKVHRRQPELVTPAKPTPRELKPLSDIDDQQGLRFQIPVIFFYR--PNLTSNLDPVQV  72

Query  1354  IRQALAKALVFFYPFAGRLREGPGRKLMVDCTGEGVMFIEADADATLQHFAVGGELKPPF  1175
             +R+ALA+ LV++YPFAGRLREG  RKL VDCTGEGV+FIEADAD TL        L PPF
Sbjct  73    VRRALAQTLVYYYPFAGRLREGLNRKLSVDCTGEGVLFIEADADVTLAKLEEADALLPPF  132

Query  1174  PCFDQLLYNVPGSAEILNCPLFLIQVTRLRCGGFIFALRLNHSMSDACGLVHFLNTIAEI  995
             PC ++LL++V GS+E+LN PL L+QVTRL+C GFIFALR NH+M+D  GL  FL ++ E+
Sbjct  133   PCLEELLFDVEGSSELLNTPLLLVQVTRLKCSGFIFALRFNHTMTDGAGLSLFLKSLCEL  192

Query  994   ARGAEAPSVYPVWQREFFDARNPPRITCTHFEYEEEPAADSMVTNIPLDNLVHRSFFFGP  815
             A G  APSV P W+R+   A    R+T TH EY+++   +++V     D LV RSFFFGP
Sbjct  193   ACGLHAPSVPPAWERQLLIASASARVTHTHREYDDKVEPEAVVVG---DFLVSRSFFFGP  249

Query  814   TEISALRSSLPPHLLKCSRFEVVTACLWRCRTIAMEFDPNDEVRIFGTVNARPRLKNPPV  635
              EISA+R  LP  L   + FE +T+ LWRCRT+A+  DPN E+R+   VN+R +L NPP+
Sbjct  250   EEISAIRRLLPTDLHNTT-FEAITSFLWRCRTVALSPDPNTEMRMTCIVNSRSKLSNPPI  308

Query  634   PNGYYGNAFVYPGAKSTAGKVSKSPLSHALELVTNIKSSFTEEYIKSVADLMILKGRPTF  455
             P+GYYGN F  P A +TA  + + PL   L L+   K S TE+YI+S+  LM  +GRP F
Sbjct  309   PSGYYGNVFAIPVAIATAKDLMEKPLEFPLRLIQEAKKSVTEDYIRSMTALMATRGRPMF  368

Query  454   TLQGTFIVSDVTRVGFPEIDMG-WGQSVFggpahggvggipGLITFYIPYEDNKGDHGIL  278
                G +IVSD+      ++D G WG+ V+GG A  G+   PG ++FY+P+++ KG  G +
Sbjct  369   VAAGNYIVSDLRHFDLGKVDFGPWGKPVYGGTAKAGIAVFPG-VSFYVPFKNRKGVSGTV  427

Query  277   VPMCLPAIAMGKFVKELENCL  215
             V + LP  AM KFV+EL+  L
Sbjct  428   VAISLPVQAMEKFVEELDGVL  448



>ref|XP_008373466.1| PREDICTED: methanol O-anthraniloyltransferase-like [Malus domestica]
Length=460

 Score =   451 bits (1159),  Expect = 1e-149, Method: Compositional matrix adjust.
 Identities = 222/439 (51%), Positives = 302/439 (69%), Gaps = 13/439 (3%)
 Frame = -1

Query  1525  FTVTRQNPELVAPADPTPREIKYLSDIDDQQGLRFQIPVIHFYRNEPSMS-GKDPVQVIR  1349
               V R  PEL+ P   TP E K+LSDIDDQ+GLRFQ+PVI  Y++ PS++  ++P++VIR
Sbjct  7     LQVKRLQPELIXPXKSTPXETKFLSDIDDQEGLRFQLPVIMCYKDNPSLNENRNPIKVIR  66

Query  1348  QALAKALVFFYPFAGRLREGPGRKLMVDCTGEGVMFIEADADATLQHFAVGGELKPPFPC  1169
             +AL++ALV++YP AGRL EGP   LMVDC GEG++F+EA  D TL+   +G ++ PP P 
Sbjct  67    EALSRALVYYYPLAGRLXEGPNXMLMVDCNGEGILFVEASXDVTLEQ--LGDKILPPCPL  124

Query  1168  FDQLLYNVPGSAEILNCPLFLIQVTRLRCGGFIFALRLNHSMSDACGLVHFLNTIAEIAR  989
              ++ L+N P S  I+ CPL L+QVTRL CGGFI ALRLNH+M DA G + FL  +AE+AR
Sbjct  125   LEEFLFNFPXSDGIIGCPLLLVQVTRLXCGGFILALRLNHTMCDAPGFLQFLTAVAEMAR  184

Query  988   GA-EAPSVYPVWQREFFDARNPPRITCTHFEYEEE-PAADSMVTNIPLDNLVHRSFFFGP  815
             G   APS+ PVW+RE   AR+PPRI C H EYE+    +D    +    N+V RSF+FG 
Sbjct  185   GVIHAPSIIPVWERELLFARDPPRIXCAHHEYEDVIDHSDGSYASSNQSNMVQRSFYFGA  244

Query  814   TEISALRSSLPPHLLK-CSRFEVVTACLWRCRTIAMEFDPNDEVRIFGTVNARPRLKNPP  638
               +  LR  +PPHL+  CS F+++ ACLW+CRT+A++ +P   VR+   VNAR +  N  
Sbjct  245   KXMRVLRKXIPPHLISTCSTFDLIXACLWKCRTLALKVNPKQAVRVSCIVNARGKHHNVR  304

Query  637   VPNGYYGNAFVYPGAKSTAGKVSKSPLSHALELVTNIKSSFTEEYIKSVADLMILKGRPT  458
             +P GYYGNAF +P A S A  + K+PL +ALELV   K++  EEY++SVAD ++L+GRP 
Sbjct  305   LPLGYYGNAFAFPAAISKAELLCKNPLGYALELVKKAKATMNEEYLRSVADXLVLRGRPX  364

Query  457   FTLQGT-FIVSDVTRVGFPEIDMGWGQSVFggpahggvggipGLITFYIPYEDNKGDHGI  281
             ++  G+ F+VSD+TRVG  +++ GWGQ VF      G      LI+FYI +++N  D GI
Sbjct  365   YSSTGSNFLVSDLTRVGVGDVNFGWGQPVF-----AGPAKAMDLISFYIQHKNNTED-GI  418

Query  280   LVPMCLPAIAMGKFVKELE  224
             LVPMCLP  AM +F +ELE
Sbjct  419   LVPMCLPFSAMERFQQELE  437



>ref|XP_004156759.1| PREDICTED: benzyl alcohol O-benzoyltransferase-like [Cucumis 
sativus]
Length=455

 Score =   451 bits (1159),  Expect = 1e-149, Method: Compositional matrix adjust.
 Identities = 224/431 (52%), Positives = 302/431 (70%), Gaps = 8/431 (2%)
 Frame = -1

Query  1528  AFTVTRQNPELVAPADPTPREIKYLSDIDDQQGLRFQIPVIHFYRNEPSMSGKDPVQVIR  1349
             +F V +  PEL+APA+PTP E K LSD+DDQQ LRFQ+P+++ Y + PS+ G+DPV+VI+
Sbjct  10    SFQVRKCQPELIAPANPTPYEFKQLSDVDDQQILRFQVPLVNIYHHNPSLEGRDPVKVIK  69

Query  1348  QALAKALVFFYPFAGRLREGPGRKLMVDCTGEGVMFIEADADATLQHFAVGGELKPPFPC  1169
             +A+ KALVF+YP AGRLREGPGRKL V+CTGEG++F+EADAD +L+ F     L      
Sbjct  70    EAIGKALVFYYPLAGRLREGPGRKLFVECTGEGILFVEADADVSLEQFR--DTLPYSLSS  127

Query  1168  FD-QLLYNVPGSAEILNCPLFLIQVTRLRCGGFIFALRLNHSMSDACGLVHFLNTIAEIA  992
              +  +L+N   S  +LN PL LIQVTRL+CGGFIF L LNHS++D  G+V F+   AEIA
Sbjct  128   MEINILHNALNSDGVLNSPLLLIQVTRLKCGGFIFGLHLNHSVADGFGIVQFIKATAEIA  187

Query  991   RGAEAPSVYPVWQREFFDARNPPRITCTHFEYEEEPAADSMVTNIPLDNLVHRSFFFGPT  812
             RGA APS+ PVWQR    AR+PPRIT  H+EY++    D+  T IP++N++ + FFF   
Sbjct  188   RGAFAPSILPVWQRALLTARDPPRITFRHYEYDQ--VVDTKSTLIPVNNMIDQLFFFSQH  245

Query  811   EISALRSSLPPHLLKCSRFEVVTACLWRCRTIAMEFDPNDEVRIFGTVNARPRLKNPPVP  632
             +IS L  +LP HL  CS FEV  A +WR RTIA++F P +EVR    VN R ++    +P
Sbjct  246   QISTLCQTLPAHLHDCSSFEVFAAYVWRLRTIALQFKPEEEVRFLCVVNIRSKID---IP  302

Query  631   NGYYGNAFVYPGAKSTAGKVSKSPLSHALELVTNIKSSFTEEYIKSVADLMILKGRPTFT  452
              GYYGNA V P   +T  K+  +PL +A++L+   K+  T EYIKS+ DLM++KGRP  T
Sbjct  303   LGYYGNAIVVPAVITTVAKLCGNPLGYAIDLIRKAKAKATTEYIKSMVDLMVIKGRPCLT  362

Query  451   LQGTFIVSDVTRVGFPEIDMGWGQSVFggpahggvggipGLITFYIPYEDNKGDHGILVP  272
               G+FI+SDVTR+GF  +D GW +++FGGP  GG G I G+ +F IP+ +  G+ GI+V 
Sbjct  363   TVGSFIMSDVTRIGFENVDFGWEKAIFGGPITGGSGIIRGMTSFCIPFMNRNGEKGIVVS  422

Query  271   MCLPAIAMGKF  239
             +CLP  AMG+F
Sbjct  423   LCLPPPAMGRF  433



>ref|XP_004151856.1| PREDICTED: LOW QUALITY PROTEIN: benzyl alcohol O-benzoyltransferase-like 
[Cucumis sativus]
Length=444

 Score =   450 bits (1157),  Expect = 1e-149, Method: Compositional matrix adjust.
 Identities = 221/431 (51%), Positives = 302/431 (70%), Gaps = 8/431 (2%)
 Frame = -1

Query  1528  AFTVTRQNPELVAPADPTPREIKYLSDIDDQQGLRFQIPVIHFYRNEPSMSGKDPVQVIR  1349
             +F V +  PEL+APA+PTP E K LSD+DDQQ LRFQ+P+++ Y + PS+ G+DPV+VI+
Sbjct  10    SFQVRKFQPELIAPANPTPYEFKQLSDVDDQQILRFQVPLVNIYHHNPSLEGRDPVKVIK  69

Query  1348  QALAKALVFFYPFAGRLREGPGRKLMVDCTGEGVMFIEADADATLQHFAVGGELKPPFPC  1169
             +A+ KALVF+YP AGRLREGPGRKL V+CTGEG++F+EADAD +L+ F     L      
Sbjct  70    EAIGKALVFYYPLAGRLREGPGRKLFVECTGEGILFVEADADVSLEQFR--DTLPYSLSS  127

Query  1168  FD-QLLYNVPGSAEILNCPLFLIQVTRLRCGGFIFALRLNHSMSDACGLVHFLNTIAEIA  992
              +  +L+N   S  +LN PL LIQVTRL+CGGFIF L LNHS++D  G+V F+   AEIA
Sbjct  128   MEINILHNALNSDGVLNSPLLLIQVTRLKCGGFIFGLHLNHSVADGFGIVQFIKATAEIA  187

Query  991   RGAEAPSVYPVWQREFFDARNPPRITCTHFEYEEEPAADSMVTNIPLDNLVHRSFFFGPT  812
             RGA APS+ PVWQR    AR+PPRIT  H+EY++    D+  T IP++N++ + FFF   
Sbjct  188   RGAFAPSILPVWQRALLTARDPPRITFRHYEYDQ--VVDTKSTLIPVNNMIDQVFFFSQL  245

Query  811   EISALRSSLPPHLLKCSRFEVVTACLWRCRTIAMEFDPNDEVRIFGTVNARPRLKNPPVP  632
             +IS LR +LP HL  CS FE+  A +WR RTIA++F P +EVR    VN R ++    +P
Sbjct  246   QISTLRKTLPAHLHDCSSFEIFAAYVWRLRTIALQFKPEEEVRFVCVVNLRSKID---IP  302

Query  631   NGYYGNAFVYPGAKSTAGKVSKSPLSHALELVTNIKSSFTEEYIKSVADLMILKGRPTFT  452
              GYYGNA V+P   +T  K+  +PL +A++L+   K+  T EYIKS+ DLM++KGRP  T
Sbjct  303   LGYYGNAIVFPAVITTVAKLCGNPLGYAIDLIRKAKAKATTEYIKSMVDLMVIKGRPCLT  362

Query  451   LQGTFIVSDVTRVGFPEIDMGWGQSVFggpahggvggipGLITFYIPYEDNKGDHGILVP  272
               G+FI+SDVTR+GF  +D GW +++FGGP  GG G I G+ +F IP+ +  G+ G ++ 
Sbjct  363   TVGSFIMSDVTRIGFENVDFGWEKAIFGGPITGGSGIIRGMTSFCIPFMNRNGEKGTVIT  422

Query  271   MCLPAIAMGKF  239
             +CLP  AM +F
Sbjct  423   LCLPPPAMERF  433



>ref|XP_009130369.1| PREDICTED: (Z)-3-hexen-1-ol acetyltransferase-like [Brassica 
rapa]
Length=451

 Score =   450 bits (1157),  Expect = 2e-149, Method: Compositional matrix adjust.
 Identities = 237/441 (54%), Positives = 305/441 (69%), Gaps = 9/441 (2%)
 Frame = -1

Query  1531  IAFTVTRQNPELVAPADPTPREIKYLSDIDDQQGLRFQIPVIHFYRNEPSM-SGKDPVQV  1355
             ++F V R+ PELV PA PTPRE+K LSDIDDQQGLRFQIPVI FYR  P++ S  DPVQV
Sbjct  15    LSFKVHRRQPELVTPAKPTPRELKPLSDIDDQQGLRFQIPVIFFYR--PNLTSNLDPVQV  72

Query  1354  IRQALAKALVFFYPFAGRLREGPGRKLMVDCTGEGVMFIEADADATLQHFAVGGELKPPF  1175
             +R+ALA+ LV++YPFAGRLREG  RKL VDCTGEGV+FIEADAD TL        L PPF
Sbjct  73    VRRALAQTLVYYYPFAGRLREGLNRKLSVDCTGEGVLFIEADADVTLAKLEEADALLPPF  132

Query  1174  PCFDQLLYNVPGSAEILNCPLFLIQVTRLRCGGFIFALRLNHSMSDACGLVHFLNTIAEI  995
             PC ++LL++V GS+E+LN PL L+QVTRL+C GFIFALR NH+M+D  GL  FL ++ E+
Sbjct  133   PCLEELLFDVEGSSELLNTPLLLVQVTRLKCSGFIFALRFNHTMTDGAGLSLFLKSLCEL  192

Query  994   ARGAEAPSVYPVWQREFFDARNPPRITCTHFEYEEEPAADSMVTNIPLDNLVHRSFFFGP  815
             A G  APSV PVW+RE   A    R+T TH EY+++   +++V     D LV RSFFFGP
Sbjct  193   ACGLHAPSVPPVWERESLIASASARVTHTHREYDDKVQPEAVVVG---DFLVSRSFFFGP  249

Query  814   TEISALRSSLPPHLLKCSRFEVVTACLWRCRTIAMEFDPNDEVRIFGTVNARPRLKNPPV  635
              EIS +R  LP  L   + FE +T+ LWRCRTIA+  DPN E+R+   VN+R +L NPP+
Sbjct  250   EEISTIRGLLPADLHNTT-FEAMTSFLWRCRTIALSPDPNTEMRMTCIVNSRSKLSNPPI  308

Query  634   PNGYYGNAFVYPGAKSTAGKVSKSPLSHALELVTNIKSSFTEEYIKSVADLMILKGRPTF  455
             P+GYYGN F  P A +TA  + + PL   L L+   K S TE+YI+S+  LM  +GRP F
Sbjct  309   PSGYYGNVFAIPVAIATAKDLMEKPLEFPLRLIQEAKKSVTEDYIRSMMALMATRGRPMF  368

Query  454   TLQGTFIVSDVTRVGFPEIDMG-WGQSVFggpahggvggipGLITFYIPYEDNKGDHGIL  278
                G +IVSD+      ++D G WG+ V+GG A  G+   PG ++FY+P+ + KG  G +
Sbjct  369   VAAGNYIVSDLRHFDLGKVDFGPWGKPVYGGTAKAGIAVFPG-VSFYVPFMNRKGVSGTV  427

Query  277   VPMCLPAIAMGKFVKELENCL  215
             V + LP  AM KFV+EL+  L
Sbjct  428   VAISLPVQAMEKFVEELDGVL  448



>ref|XP_003626382.1| Benzoyl coenzyme A benzyl alcohol benzoyl transferase [Medicago 
truncatula]
 gb|AES82600.1| benzyl alcohol O-benzoyltransferase [Medicago truncatula]
Length=462

 Score =   450 bits (1157),  Expect = 2e-149, Method: Compositional matrix adjust.
 Identities = 227/447 (51%), Positives = 310/447 (69%), Gaps = 5/447 (1%)
 Frame = -1

Query  1549  MASQPSIAFTVTRQNPELVAPADPTPREIKYLSDIDDQQGLRFQIPVIHFYRNEPSMSGK  1370
             M S   + FTV R  PELV PA PTP E+K LSDIDDQ+GLRF +PVI  +R+EPSM  K
Sbjct  1     MTSSSPLLFTVRRSQPELVLPAAPTPHEVKLLSDIDDQEGLRFNLPVIFVFRHEPSMKEK  60

Query  1369  DPVQVIRQALAKALVFFYPFAGRLREGPGRKLMVDCTGEGVMFIEADADATLQHFAVGGE  1190
             DPV+V++ AL++ LV++YP AGR+REG GRKLMVDCTGEGVMFIEA+AD TL  F  G  
Sbjct  61    DPVKVLKHALSRTLVYYYPGAGRIREGAGRKLMVDCTGEGVMFIEAEADITLDQF--GDA  118

Query  1189  LKPPFPCFDQLLYNVPGSAEILNCPLFLIQVTRLRCGGFIFALRLNHSMSDACGLVHFLN  1010
             L+PPFPCF ++L +VPGS  I++ P+ LIQVTRL+CGGFI AL LNH+M D  GL  F++
Sbjct  119   LQPPFPCFQEILCDVPGSEYIIDRPIRLIQVTRLKCGGFILALSLNHTMGDGSGLRQFVS  178

Query  1009  TIAEIARGAEAPSVYPVWQREFFDARNPPRITCTHFEYEEEPAADSMVTNIPLDNLVHRS  830
               AEIARGA  PS+ PVW RE   AR+PP ITC H EYE+    ++ +       +VH+S
Sbjct  179   AWAEIARGANQPSIQPVWNREILMARDPPYITCNHREYEQILPPNTYIKEEDTTIVVHQS  238

Query  829   FFFGPTEISALRSSLPPHLLKCSRFEVVTACLWRCRTIAMEFDPNDEVRIFGTVNARPRL  650
             FFF    I+A+R  +P HL +C+ ++++TAC W CRT A++ +P+++VR+   VNAR R 
Sbjct  239   FFFTSAHIAAIRRLVPLHLSRCTAYDLITACYWCCRTKALQVEPDEDVRMMCIVNARSRF  298

Query  649   --KNPPVPNGYYGNAFVYPGAKSTAGKVSKSPLSHALELVTNIKSSFTEEYIKSVADLMI  476
                N     GYYGN   +  A +TA ++  + L +A+EL+   K+  TE+Y+ S+AD M+
Sbjct  299   SANNRSSLIGYYGNCIAFSAAVTTAKELCGNQLGYAVELIRKAKAQVTEKYMHSLADFMV  358

Query  475   LKGRPTFTLQGTFIVSDVTRVGFPEIDMGWGQSVFggpahggvggipGLITFYIPYEDNK  296
             +K R  FT   T +VSD TR  F E++ GWG++V+GG A GG+G   G  TF + +++ K
Sbjct  359   IKERCLFTKGRTCMVSDWTRAKFSEVNFGWGEAVYGGAAKGGIGSFLGG-TFLVTHKNAK  417

Query  295   GDHGILVPMCLPAIAMGKFVKELENCL  215
             G+ G+++P+CLP   M +FVKEL++ L
Sbjct  418   GEEGLILPICLPPEDMKRFVKELDDML  444



>emb|CDY50708.1| BnaC05g47750D [Brassica napus]
Length=467

 Score =   450 bits (1158),  Expect = 2e-149, Method: Compositional matrix adjust.
 Identities = 233/450 (52%), Positives = 310/450 (69%), Gaps = 9/450 (2%)
 Frame = -1

Query  1555  PFMASQPSIAFTVTRQNPELVAPADPTPREIKYLSDIDDQQGLRFQIPVIHFYRNEPSMS  1376
             P   + P ++F V R+ PELV PA PTP E+K LSDIDDQQGLRFQIP I FYR  P+++
Sbjct  8     PLSTTTPRLSFKVHRRKPELVTPAKPTPLELKPLSDIDDQQGLRFQIPFIFFYR--PNLT  65

Query  1375  GK-DPVQVIRQALAKALVFFYPFAGRLREGPGRKLMVDCTGEGVMFIEADADATLQHFAV  1199
                DPVQVIR+AL + LV++YPFAGRL EGP +KL VDCTGEGV+FIEADAD T      
Sbjct  66    CTLDPVQVIRRALGQTLVYYYPFAGRLWEGPNQKLAVDCTGEGVLFIEADADVTFAELEE  125

Query  1198  GGELKPPFPCFDQLLYNVPGSAEILNCPLFLIQVTRLRCGGFIFALRLNHSMSDACGLVH  1019
                L PPFPC ++LL++V GS+E+LN PL L+QVTRL+CGGFIFALR+NH+M+D  GL  
Sbjct  126   ADALLPPFPCLEELLFDVEGSSELLNTPLLLVQVTRLKCGGFIFALRINHTMTDGAGLSL  185

Query  1018  FLNTIAEIARGAEAPSVYPVWQREFFDARNPPRITCTHFEYEEEPAADSMVTNIPLDNLV  839
             FL ++ E+A G  APSV PVW R+   A    R+T  H EY++    +++V     D LV
Sbjct  186   FLKSLCELACGLHAPSVPPVWGRQLLIASAYARVTHAHREYDDNVEPEAVVVG---DVLV  242

Query  838   HRSFFFGPTEISALRSSLPPHLLKCSRFEVVTACLWRCRTIAMEFDPNDEVRIFGTVNAR  659
              +SFFFGP EI+A+   L PH L  + F+ +T+ LWRCRT++M  DPN E+R+   VN+R
Sbjct  243   TKSFFFGPDEIAAI-GRLLPHGLHSTTFDALTSFLWRCRTVSMSPDPNTEMRMTCIVNSR  301

Query  658   PRLKNPPVPNGYYGNAFVYPGAKSTAGKVSKSPLSHALELVTNIKSSFTEEYIKSVADLM  479
              +L+NPP+P+GYYGN F  P A +TA  + + PL   L L+   KSS TE+YI+SV  LM
Sbjct  302   SKLRNPPIPSGYYGNVFAIPVAIATAKDLMEKPLEFPLRLIQEAKSSVTEDYIRSVTALM  361

Query  478   ILKGRPTFTLQGTFIVSDVTRVGFPEIDMG-WGQSVFggpahggvggipGLITFYIPYED  302
               +GRP F     +IVSD+ R    ++D G WG+ V+GG A  G+   PG ++FY+P+++
Sbjct  362   ATRGRPKFVTAENYIVSDLRRFDIGKVDFGPWGKPVYGGTAKAGIATFPG-VSFYVPFKN  420

Query  301   NKGDHGILVPMCLPAIAMGKFVKELENCLM  212
              KG++G +V + LPA+AM KFV+EL    M
Sbjct  421   KKGENGTVVAISLPALAMEKFVEELNGVFM  450



>emb|CDY50709.1| BnaC05g47740D [Brassica napus]
Length=451

 Score =   449 bits (1156),  Expect = 2e-149, Method: Compositional matrix adjust.
 Identities = 235/441 (53%), Positives = 305/441 (69%), Gaps = 9/441 (2%)
 Frame = -1

Query  1531  IAFTVTRQNPELVAPADPTPREIKYLSDIDDQQGLRFQIPVIHFYRNEPSM-SGKDPVQV  1355
             ++F V R+ PELV PA PTPRE+K LSDIDDQQGLRFQIPVI FYR  P++ S  DPVQV
Sbjct  15    LSFKVHRRQPELVTPAKPTPRELKPLSDIDDQQGLRFQIPVIFFYR--PNLTSNLDPVQV  72

Query  1354  IRQALAKALVFFYPFAGRLREGPGRKLMVDCTGEGVMFIEADADATLQHFAVGGELKPPF  1175
             +R+ALA+ LV++YPFAGRLREG  RKL VDCTGEGV+FIEADAD TL        L PPF
Sbjct  73    VRRALAQTLVYYYPFAGRLREGLNRKLSVDCTGEGVLFIEADADVTLAKLEEADALLPPF  132

Query  1174  PCFDQLLYNVPGSAEILNCPLFLIQVTRLRCGGFIFALRLNHSMSDACGLVHFLNTIAEI  995
             PC ++LL++V GS+E+LN PL L+QVTRL+C GFIFALR NH+M+D  GL  FL ++ E+
Sbjct  133   PCLEELLFDVEGSSELLNTPLLLVQVTRLKCSGFIFALRFNHTMTDGAGLSLFLKSLCEL  192

Query  994   ARGAEAPSVYPVWQREFFDARNPPRITCTHFEYEEEPAADSMVTNIPLDNLVHRSFFFGP  815
             A G  APS+ P W+R+   A    R+T TH EY+++   +++V     D LV RSFFFGP
Sbjct  193   ACGLHAPSLPPAWERQLLIASESARVTHTHREYDDKMEPEAVVVG---DFLVSRSFFFGP  249

Query  814   TEISALRSSLPPHLLKCSRFEVVTACLWRCRTIAMEFDPNDEVRIFGTVNARPRLKNPPV  635
              EISA+R  LP  L   + FE +T+ LWRCRTIA+  DPN E+R+   VN+R +L NPP+
Sbjct  250   EEISAIRGLLPADLHNTT-FEAMTSFLWRCRTIALSPDPNTEMRMTCIVNSRSKLSNPPI  308

Query  634   PNGYYGNAFVYPGAKSTAGKVSKSPLSHALELVTNIKSSFTEEYIKSVADLMILKGRPTF  455
             P+GYYGN F  P A +TA  + + PL   L L+   K S TE+YI+S+  LM  +GRP F
Sbjct  309   PSGYYGNVFAIPVAIATAKDLMEKPLEFPLRLIQEAKKSVTEDYIRSMTALMATRGRPMF  368

Query  454   TLQGTFIVSDVTRVGFPEIDMG-WGQSVFggpahggvggipGLITFYIPYEDNKGDHGIL  278
                G +IVSD+      ++D G WG+ V+GG A  G+   PG ++FY+P++  KG  G +
Sbjct  369   VAAGNYIVSDLRHFDLGKVDFGPWGKPVYGGTAKAGIAVFPG-VSFYVPFKSRKGVSGTV  427

Query  277   VPMCLPAIAMGKFVKELENCL  215
             V + LP  AM KFV+EL+  L
Sbjct  428   VAISLPVQAMEKFVEELDGVL  448



>gb|ACV74416.1| putative alcohol acyl transferase [Camellia sinensis]
Length=464

 Score =   450 bits (1157),  Expect = 3e-149, Method: Compositional matrix adjust.
 Identities = 235/450 (52%), Positives = 305/450 (68%), Gaps = 16/450 (4%)
 Frame = -1

Query  1531  IAFTVTRQNPELVAPADPTPREIKYLSDIDDQQGLRFQIPVIHFYRNEPSMSGKDPVQVI  1352
             +AF V RQ+P+ V P+ PTP E+K LSDIDDQ+GLRFQ+PVI FY+N PSM GKDP  VI
Sbjct  8     LAFIVRRQDPKPVVPSKPTPHELKQLSDIDDQEGLRFQLPVIMFYKNNPSMEGKDPASVI  67

Query  1351  RQALAKALVFFYPFAGRLREGPGRKLMVDCTGEGVMFIEADADATLQHFAVGGELKPPFP  1172
             R+ALAKALVF+YPFAGRL EGP RKL VDCT EGV+FIEADA+  +    +G  ++P  P
Sbjct  68    REALAKALVFYYPFAGRLVEGPNRKLSVDCTAEGVLFIEADANVEIDW--LGDAVRPGCP  125

Query  1171  CFDQLLYNVPGSAEILNCPLFLIQVTRLRCGGFIFALRLNHSMSDACGLVHFLNTIAEIA  992
               ++LLY+VPGS  I+ CPL LIQVTR  CGGF FA+RLNHSMSDA GL+ FLNTI E A
Sbjct  126   YLEELLYDVPGSDGIVGCPLLLIQVTRFSCGGFTFAIRLNHSMSDASGLIQFLNTITEFA  185

Query  991   RGAE---APSVYPVWQREFFDARNPPRITCTHFEYEE-EPAADSMVTNIPLDNLVHRSFF  824
             + ++    P V P+WQR    AR PP ITC H EY++    A +  T       ++RSFF
Sbjct  186   QQSQTKITPPVPPIWQRHLLSARQPPSITCPHHEYDQALAGASTTTTTANETTTINRSFF  245

Query  823   FGPTEISALRSSLP--PHLLKCSRFEVVTACLWRCRTIAMEFDPNDEVRIFGTVNARPRL  650
             FGP EI A+R+ LP   H    S FE++TAC+W+CRT A+   P++ VR+   VN R   
Sbjct  246   FGPKEIRAIRNHLPHHHHSTTASTFELLTACIWQCRTRALCLAPDEIVRVSCIVNGRGNK  305

Query  649   KNPPVPNGYYGNAFVYPGAKSTAGKVSKSPLSHALELVTNIKSSFTEEYIKSVADLMILK  470
                 +P GYYGN   YP A + AG +S  PL +ALELV   K+  +EEY +SVADLM++K
Sbjct  306   HGLNLPPGYYGNVITYPTAMTKAGMLSMPPLGYALELVRKAKAQVSEEYFRSVADLMVIK  365

Query  469   GRPTFTLQGT--FIVSDVTRVGFPEIDMGWGQSVFggpahggvggipGLITFYIPYEDNK  296
             GRP++TL+    +IVSD TR GF ++D GWG+ VF     GGV     LI+ +  ++D +
Sbjct  366   GRPSYTLEANKDYIVSDTTRAGFDKVDFGWGKPVF-----GGVPRAISLISVFARFKDIR  420

Query  295   -GDHGILVPMCLPAIAMGKFVKELENCLMK  209
              G+ GI+VP+CLP   M +F +EL+  + +
Sbjct  421   GGEDGIVVPICLPESVMDRFEQELKKMIQE  450



>gb|KHN04051.1| Benzyl alcohol O-benzoyltransferase [Glycine soja]
Length=403

 Score =   447 bits (1150),  Expect = 4e-149, Method: Compositional matrix adjust.
 Identities = 216/386 (56%), Positives = 285/386 (74%), Gaps = 2/386 (1%)
 Frame = -1

Query  1372  KDPVQVIRQALAKALVFFYPFAGRLREGPGRKLMVDCTGEGVMFIEADADATLQHFAVGG  1193
             KDPV+VIR+AL K LVF+YPFAGRLREGPGRKLMVDC GEGV+FIEADAD TL  F    
Sbjct  2     KDPVEVIRKALTKTLVFYYPFAGRLREGPGRKLMVDCNGEGVLFIEADADVTLHQFGPSY  61

Query  1192  ELKPPFPCFDQLLYNVPGSAEILNCPLFLIQVTRLRCGGFIFALRLNHSMSDACGLVHFL  1013
              L PPFPC ++LL++VPGS  + NCPL LIQVTRL+CGGFIFALRLNHSMSD  G+  F+
Sbjct  62    LLHPPFPCLEELLHDVPGSRGVTNCPLLLIQVTRLKCGGFIFALRLNHSMSDGFGIAKFM  121

Query  1012  NTIAEIARGAEAPSVYPVWQREFFDARNPPRITCTHFEYEEEPAADSMVTNIPLDNLVHR  833
               +AEIA GA  PS+ PVW RE  +ARNPPRI+ TH EYE E  A   +  IPL+++V R
Sbjct  122   KALAEIACGATEPSLTPVWCRELLNARNPPRISRTHHEYEVENKAKGTMM-IPLNDVVQR  180

Query  832   SFFFGPTEISALRSSLPPHLLKCSRFEVVTACLWRCRTIAMEFDPNDEVRIFGTVNARPR  653
              FFFGP E+++LRS +P HL +C+ FEV+TAC+WRCR  A++ DP D+VR   T+N   +
Sbjct  181   CFFFGPREVASLRSLVPKHLGRCTTFEVITACMWRCRIRALQLDPEDDVRFIYTININAK  240

Query  652   LKNPPVPNGYYGNAFVYPGAKSTAGKVSKSPLSHALELVTNIKSSFTEEYIKSVADLMIL  473
             + NPP+P GYYGN FV   A +T+ ++ ++P  +ALELV N KS+  EEY++S +DL+++
Sbjct  241   V-NPPLPKGYYGNGFVLSAAVTTSRRLCENPFGYALELVKNAKSNVDEEYVRSTSDLIVV  299

Query  472   KGRPTFTLQGTFIVSDVTRVGFPEIDMGWGQSVFggpahggvggipGLITFYIPYEDNKG  293
             KGRP      +++VS+ TR+G  E+D GWG+ ++GGPA GG+   P + + Y+  +++KG
Sbjct  300   KGRPHQATTRSYLVSNTTRIGLDEVDFGWGKPIYGGPATGGMTSFPQMTSVYVSCKNHKG  359

Query  292   DHGILVPMCLPAIAMGKFVKELENCL  215
             +H I+VP+ LPA AM +F  ELE  L
Sbjct  360   EHVIVVPISLPAKAMERFATELEGML  385



>gb|KGN63331.1| hypothetical protein Csa_2G429040 [Cucumis sativus]
Length=442

 Score =   448 bits (1152),  Expect = 6e-149, Method: Compositional matrix adjust.
 Identities = 220/431 (51%), Positives = 302/431 (70%), Gaps = 8/431 (2%)
 Frame = -1

Query  1528  AFTVTRQNPELVAPADPTPREIKYLSDIDDQQGLRFQIPVIHFYRNEPSMSGKDPVQVIR  1349
             +F V +  PEL+APA+PTP E K LSD+DDQQ LRFQ+P+++ Y + PS+ G+DPV+VI+
Sbjct  10    SFQVRKCQPELIAPANPTPYEFKQLSDVDDQQILRFQVPLVNIYHHNPSLEGRDPVKVIK  69

Query  1348  QALAKALVFFYPFAGRLREGPGRKLMVDCTGEGVMFIEADADATLQHFAVGGELKPPFPC  1169
             +A+ KALVF+YP AGRLREGPGRKL V+CTGEG++F+EADAD +L+ F     L      
Sbjct  70    EAIGKALVFYYPLAGRLREGPGRKLFVECTGEGILFVEADADVSLEQFR--DTLPYSLSS  127

Query  1168  FD-QLLYNVPGSAEILNCPLFLIQVTRLRCGGFIFALRLNHSMSDACGLVHFLNTIAEIA  992
              +  +++N   S  +LN PL LIQVTRL+CGGFIF L LNHS++D  G+V F+   AEIA
Sbjct  128   MEINIIHNALNSDGVLNSPLLLIQVTRLKCGGFIFGLHLNHSVADGFGIVQFIKATAEIA  187

Query  991   RGAEAPSVYPVWQREFFDARNPPRITCTHFEYEEEPAADSMVTNIPLDNLVHRSFFFGPT  812
             RGA APS+ PVWQR    AR+PPRIT  H+EY++    D+  T IP++N++ + FFF   
Sbjct  188   RGAFAPSILPVWQRALLTARDPPRITFRHYEYDQ--VVDTKSTLIPVNNMIDQVFFFSQL  245

Query  811   EISALRSSLPPHLLKCSRFEVVTACLWRCRTIAMEFDPNDEVRIFGTVNARPRLKNPPVP  632
             +IS LR +LP HL  CS FEV  A +WR RTIA++F P +EVR    VN R ++    +P
Sbjct  246   QISTLRKTLPAHLHDCSSFEVFAAYVWRLRTIALQFKPEEEVRFLCVVNIRSKID---IP  302

Query  631   NGYYGNAFVYPGAKSTAGKVSKSPLSHALELVTNIKSSFTEEYIKSVADLMILKGRPTFT  452
              GYYGNA V+P   +T  K+  +PL +A++L+   K+  T EYIKS+ D+M++KGRP  T
Sbjct  303   LGYYGNAIVFPAVITTVAKLCGNPLGYAIDLIRKAKAKATTEYIKSMVDIMVIKGRPCLT  362

Query  451   LQGTFIVSDVTRVGFPEIDMGWGQSVFggpahggvggipGLITFYIPYEDNKGDHGILVP  272
               G+FI+SDVTR+GF  +D GW +++FGGP  GG G I G+ +F IP+ +  G+ G ++ 
Sbjct  363   TVGSFIMSDVTRIGFENVDFGWEKAIFGGPITGGSGIIRGMTSFCIPFMNRNGEKGTVIT  422

Query  271   MCLPAIAMGKF  239
             +CLP  AM +F
Sbjct  423   LCLPPPAMERF  433



>ref|XP_011018694.1| PREDICTED: methanol O-anthraniloyltransferase-like [Populus euphratica]
Length=461

 Score =   448 bits (1152),  Expect = 1e-148, Method: Compositional matrix adjust.
 Identities = 231/449 (51%), Positives = 305/449 (68%), Gaps = 23/449 (5%)
 Frame = -1

Query  1543  SQPS--IAFTVTRQNPELVAPADPTPREIKYLSDIDDQQGLRFQIPVIHFYRNEPSMSGK  1370
             +QPS   +FTV RQ P L+ PA PTP E+K LSD+DDQ+GLRF +P I F+RN     G 
Sbjct  2     AQPSSQASFTVRRQEPRLILPAKPTPSEVKQLSDLDDQEGLRFHMPFIAFFRNTNKKGGN  61

Query  1369  ----DPVQVIRQALAKALVFFYPFAGRLREGPGRKLMVDCTGE-GVMFIEADADATLQHF  1205
                 DPV+VIR ALA ALV++YP AGRL+EG  RKLMVDCTGE GV+FIEA AD TL+H 
Sbjct  62    ETYPDPVKVIRDALAHALVYYYPLAGRLKEGDSRKLMVDCTGELGVLFIEAVADITLEH-  120

Query  1204  AVGGELKPPFPCFDQLLYNVPGSAEILNCPLFLIQVTRLRCGGFIFALRLNHSMSDACGL  1025
              +G  ++PP P  +  LY++PGS+ I+ CPL LIQVTRL CGGFI A R+NH+++DA G+
Sbjct  121   -LGDAIQPPCPYLEHFLYDIPGSSGIIGCPLMLIQVTRLTCGGFIVATRVNHTITDALGI  179

Query  1024  VHFLNTIAEIARGAEAPSVYPVWQREFFDARNPPRITCTHFEYEEEPAADSMVTNIPLD-  848
              +FLNTI EIARGA  PS  PVW+RE  +AR+PPR+TC H EY+      ++ T   +D 
Sbjct  180   FYFLNTIGEIARGANEPSYRPVWKREILNARDPPRVTCVHREYDT-----TVGTGATMDT  234

Query  847   --NLVHRSFFFGPTEISALRSSLPPHLLKCSRFEVVTACLWRCRTIAMEFDPNDEVRIFG  674
               +L+ +SFFFG  EI+ +R  LP HL   S FEV+ AC+W+CRTIA E  PN+ +R+  
Sbjct  235   HADLIDKSFFFGFQEINCIRKHLPSHLQSSSTFEVLIACIWKCRTIATEHKPNEMLRVSY  294

Query  673   TVNARPRLKNPPVPNGYYGNAFVYPGAKSTAGKVSKSPLSHALELVTNIKSSFTEEYIKS  494
              V A  + +   +P GYYGNA+  P A S A  V K+PL +ALELV  IK+  +EEY++S
Sbjct  295   MVGAGGK-RGIKLPPGYYGNAYAMPSAISKAELVCKNPLGYALELVRKIKTQMSEEYMRS  353

Query  493   VADLMILKGRPTFTLQGTFIVSDVTRVGFPEIDMGWGQSVFggpahggvggipGLITFYI  314
             VAD M++KGRP ++  G FIV+D +RV F EID GWG+ V+ G A           +F +
Sbjct  354   VADYMVIKGRPHYSTAGHFIVADSSRVPFREIDFGWGKPVYAGVAKAAPNT-----SFCV  408

Query  313   PYEDNKGDHGILVPMCLPAIAMGKFVKEL  227
              ++ + G+ GIL+ + LP  AM +F KEL
Sbjct  409   RFKKSTGEDGILIQVSLPLQAMDRFEKEL  437



>ref|XP_007209131.1| hypothetical protein PRUPE_ppa005625mg [Prunus persica]
 gb|EMJ10330.1| hypothetical protein PRUPE_ppa005625mg [Prunus persica]
Length=450

 Score =   447 bits (1150),  Expect = 2e-148, Method: Compositional matrix adjust.
 Identities = 223/450 (50%), Positives = 301/450 (67%), Gaps = 10/450 (2%)
 Frame = -1

Query  1549  MASQPSIAFTVTRQNPELVAPADPTPREIKYLSDIDDQQGLRFQIPVIHFYRNEPSMSGK  1370
             M S   + F V R  PEL+ PA PTP E K LSDIDDQ GLRF  PVI  Y+N PSM G 
Sbjct  1     MGSLCPLLFPVNRFEPELITPAKPTPIETKQLSDIDDQDGLRFHFPVIISYKNNPSMKGN  60

Query  1369  DPVQVIRQALAKALVFFYPFAGRLREGPGRKLMVDCTGEGVMFIEADADATLQHFAVGGE  1190
             D V VIR+AL++ALV++YP AGRLREGP RKLMV+C GEGV+FIEA+AD TL+   +G  
Sbjct  61    DAVMVIREALSRALVYYYPLAGRLREGPNRKLMVECNGEGVLFIEANADVTLEQ--LGDR  118

Query  1189  LKPPFPCFDQLLYNVPGSAEILNCPLFLIQVTRLRCGGFIFALRLNHSMSDACGLVHFLN  1010
             + PP P  ++ L N PGS  IL CPL L+QVTRL CGGFIF LR+NH+M DA GL  FLN
Sbjct  119   ILPPCPVLEEFLSNPPGSDGILGCPLLLVQVTRLTCGGFIFGLRINHAMCDAVGLAKFLN  178

Query  1009  TIAEIARGAEAPSVYPVWQREFFDARNPPRITCTHFEYEE-EPAADSMVTNIPLDNLVHR  833
              I E+A+GA++ SV PVW RE  +AR+PP +T  H+EY++   +  S +  I   N+  R
Sbjct  179   AIGEMAQGADSLSVPPVWARELLNARDPPTVTRWHYEYDQLLDSQGSFIAAIDQSNMAQR  238

Query  832   SFFFGPTEISALRSSLPPHLLKCSRFEVVTACLWRCRTIAMEFDPNDEVRIFGTVNARPR  653
             SF+FGP +I ALR  LPPHL  CS FE++TAC+WRCRT+++  +P D VRI   VNAR +
Sbjct  239   SFYFGPQQIRALRKHLPPHLSTCSSFELITACVWRCRTLSLRLNPKDTVRISCAVNARGK  298

Query  652   -LKNPPVPNGYYGNAFVYPGAKSTAGKVSKSPLSHALELVTNIKSSFTEEYIKSVADLMI  476
              + +  +P+G+YGNAF  P A ST   +  SPL + +ELV   K+   +EY++S+AD  +
Sbjct  299   SINDLCLPSGFYGNAFSIPTAVSTVELLCASPLGYGVELVRKSKAQMDKEYMQSLADFFV  358

Query  475   LKGRPTFTL-QGTFIVSDVTRVGFPEIDMGWGQSVFggpahggvggipGLITFYIPYEDN  299
             ++GRP   +    FIVSD    GF E D+GWG+ +F      G+     +I+FY+   + 
Sbjct  359   IRGRPPLPMGWNVFIVSDNRHTGFGEFDVGWGRPLF-----AGLARAFSMISFYVRDNNQ  413

Query  298   KGDHGILVPMCLPAIAMGKFVKELENCLMK  209
             + + G LVP+CLP+ ++ +F +EL+   ++
Sbjct  414   EEEFGTLVPICLPSTSLERFEEELKKMTLE  443



>ref|XP_002884383.1| chat-3-HEXEN-1-OL ACETYLTRANSFERASE [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH60642.1| chat-3-HEXEN-1-OL ACETYLTRANSFERASE [Arabidopsis lyrata subsp. 
lyrata]
Length=453

 Score =   446 bits (1148),  Expect = 4e-148, Method: Compositional matrix adjust.
 Identities = 233/449 (52%), Positives = 307/449 (68%), Gaps = 10/449 (2%)
 Frame = -1

Query  1546  ASQPSIAFTVTRQNPELVAPADPTPREIKYLSDIDDQQGLRFQIPVIHFYRNEPSMSGK-  1370
             ++   ++F V RQ PEL+ PA PTPRE+K LSDIDDQQGLRFQIPVI FYR  P++S   
Sbjct  10    STTTGLSFKVHRQQPELITPAKPTPRELKPLSDIDDQQGLRFQIPVIFFYR--PNLSSDL  67

Query  1369  DPVQVIRQALAKALVFFYPFAGRLREGPGRKLMVDCTGEGVMFIEADADATLQHFAVGGE  1190
             +PVQVI++ALA ALV++YPFAGRLRE   RKL VDCTGEGV+FIEA+AD +L        
Sbjct  68    NPVQVIKKALADALVYYYPFAGRLRELSNRKLAVDCTGEGVLFIEAEADVSLTELEEADA  127

Query  1189  LKPPFPCFDQLLYNVPGSAEILNCPLFLIQVTRLRCGGFIFALRLNHSMSDACGLVHFLN  1010
             L PPFPC D+LL++V GS+++LN PL L+QVTRL+C GFIFALR NH+M+D  GL  FL 
Sbjct  128   LLPPFPCLDELLFDVEGSSDVLNTPLLLVQVTRLKCRGFIFALRFNHTMTDGAGLSLFLK  187

Query  1009  TIAEIARGAEAPSVYPVWQREFFD-ARNPPRITCTHFEYEEEPAADSMVTNIPLDNLVHR  833
             ++ E+A    APSV PVW R     + +  R+T TH EYE++ A D++ T    D  V R
Sbjct  188   SLCELAYRLHAPSVPPVWDRHLLTVSASEARVTHTHREYEDQVAIDAVDTG---DPFVSR  244

Query  832   SFFFGPTEISALRSSLPPHLLKCSRFEVVTACLWRCRTIAMEFDPNDEVRIFGTVNARPR  653
             SFFF   EISA+R  LPP L   S FE +++ LWRCRTIA+  DPN E+R+   +N+R +
Sbjct  245   SFFFSAEEISAIRKLLPPDLHNTS-FEALSSFLWRCRTIALNPDPNTEMRLTCIINSRSK  303

Query  652   LKNPPVPNGYYGNAFVYPGAKSTAGKVSKSPLSHALELVTNIKSSFTEEYIKSVADLMIL  473
             L NPP+  GYYGN FV P A +TA  + + PL  AL L+   KSS TE+Y++SV  LM  
Sbjct  304   LSNPPLSRGYYGNVFVIPAAIATARDLMEKPLEFALRLIQETKSSVTEDYVRSVTALMAT  363

Query  472   KGRPTFTLQGTFIVSDVTRVGFPEIDMG-WGQSVFggpahggvggipGLITFYIPYEDNK  296
             +GRP F   G +I+SD+      ++D G WG+ V+GG A  G+   PG ++FY+P+++ K
Sbjct  364   RGRPMFVAAGNYIISDLRHFDLGKVDFGPWGKPVYGGTAKAGIALFPG-VSFYVPFKNKK  422

Query  295   GDHGILVPMCLPAIAMGKFVKELENCLMK  209
             G+ G +V + LP  AM +FV EL   L+K
Sbjct  423   GETGTVVAISLPVRAMERFVAELNGVLIK  451



>ref|XP_003626386.1| Alcohol acetyltransferase [Medicago truncatula]
 gb|AES82604.1| benzyl alcohol O-benzoyltransferase [Medicago truncatula]
Length=462

 Score =   446 bits (1148),  Expect = 6e-148, Method: Compositional matrix adjust.
 Identities = 223/445 (50%), Positives = 311/445 (70%), Gaps = 5/445 (1%)
 Frame = -1

Query  1549  MASQPSIAFTVTRQNPELVAPADPTPREIKYLSDIDDQQGLRFQIPVIHFYRNEPSMSGK  1370
             M S   +  TV R  PELV PA PTPRE+K LSDIDDQ+ LRF +P+I  YR+EPSM  K
Sbjct  1     MTSSSPLLLTVRRCQPELVPPAAPTPREVKLLSDIDDQECLRFNMPIIFIYRHEPSMVKK  60

Query  1369  DPVQVIRQALAKALVFFYPFAGRLREGPGRKLMVDCTG-EGVMFIEADADATLQHFAVGG  1193
             DPV+V++ AL+K LV++YP AGR+REG   KLMVDCTG EGVMFIEA+AD TL  F  G 
Sbjct  61    DPVKVLKCALSKTLVYYYPLAGRIREGARDKLMVDCTGGEGVMFIEAEADVTLNEF--GD  118

Query  1192  ELKPPFPCFDQLLYNVPGSAEILNCPLFLIQVTRLRCGGFIFALRLNHSMSDACGLVHFL  1013
              L PPFPCF +L+Y+VP + +I++ P+ LIQ+TRL+CGGFI  +  NH++ DA GL  F+
Sbjct  119   ALHPPFPCFQELIYDVPSTKQIIDHPILLIQITRLKCGGFIVGVNWNHAIGDATGLKQFM  178

Query  1012  NTIAEIARGAEAPSVYPVWQREFFDARNPPRITCTHFEYEEEPAADSMVTNIPLDNLVHR  833
             N  AE+ARGA  PS+ PVW+RE   AR+PPRITC H EYE+   ++          +VH+
Sbjct  179   NVWAEMARGAHQPSIQPVWRREILMARDPPRITCNHREYEQILTSNINKEEDAATTIVHQ  238

Query  832   SFFFGPTEISALRSSLPPHLLKCSRFEVVTACLWRCRTIAMEFDPNDEVRIFGTVNARPR  653
             SFFF  + I+A+R  +P HL +CS F+++TAC W CRT A++ +P++EVR+   VNAR R
Sbjct  239   SFFFTLSHIAAIRHLIPFHLRQCSTFDLITACFWCCRTKALQLEPDEEVRMMCIVNARSR  298

Query  652   LKNPPVP-NGYYGNAFVYPGAKSTAGKVSKSPLSHALELVTNIKSSFTEEYIKSVADLMI  476
              +    P  GYYGN F +P A +TAGK+  +PL +A+EL+   K+  TEEY+ S+ADLM+
Sbjct  299   FRADHSPLVGYYGNCFAFPAAVTTAGKLCGNPLGYAVELIRKAKAQVTEEYMHSLADLMV  358

Query  475   LKGRPTFTLQGTFIVSDVTRVGFPEIDMGWGQSVFggpahggvggipGLITFYIPYEDNK  296
             +K R  FT   + +VSD+TR  + E++ GWG++V+GG   GG G +PG  T+ IP+++ +
Sbjct  359   IKERCLFTTVRSCVVSDLTRAKYAEVNFGWGEAVYGGVVKGGAGPLPG-ATYIIPHKNAE  417

Query  295   GDHGILVPMCLPAIAMGKFVKELEN  221
             G+ G+++ + L +  M +F +EL+ 
Sbjct  418   GEEGLILLIFLTSEVMKRFAEELDK  442



>gb|EYU41396.1| hypothetical protein MIMGU_mgv1a005907mg [Erythranthe guttata]
Length=465

 Score =   446 bits (1147),  Expect = 9e-148, Method: Compositional matrix adjust.
 Identities = 234/466 (50%), Positives = 317/466 (68%), Gaps = 28/466 (6%)
 Frame = -1

Query  1594  TRITLLYLIMALSPFMAS--QPS------IAFTVTRQNPELVAPADPTPREIKYLSDIDD  1439
             T+ TL Y     + F     QPS      + F VTRQNPEL+ PA PTP E K LSD D+
Sbjct  3     TKYTLFYKRTLSARFSTRIYQPSNTLTRALTFKVTRQNPELIPPAKPTPHEFKPLSDFDN  62

Query  1438  QQGLRFQIPVIHFYRNEPSMSGKDPVQVIRQALAKALVFFYPFAGRLREGPGRKLMVDCT  1259
              +GLRFQ+PVI FYR  PS+   DPV+VIR+A+AKALV +YPFAGRLRE   RKL V+C 
Sbjct  63    HEGLRFQVPVIQFYRKNPSVKS-DPVEVIRKAIAKALVSYYPFAGRLREHAARKLAVECN  121

Query  1258  GEGVMFIEADADATLQHFAVGGELKPPFPCFDQLLYNVPGSAEILNCPLFLIQVTRLRCG  1079
             GEGVMFIEADAD  L+ F  G EL+PP PCF++LLY+ PGS  I+N P+ LIQVTRL+CG
Sbjct  122   GEGVMFIEADADVALEQF--GDELQPPVPCFEELLYDAPGSGGIINAPILLIQVTRLKCG  179

Query  1078  GFIFALRLNHSMSDACGLVHFLNTIAEIARGAEAPSVYPVWQREFFDARNPPRITCTHFE  899
             GFIF+LR NH+MSD  G+  F++ + E+ARGA  PS  PVW+R   +       +CTH E
Sbjct  180   GFIFSLRFNHTMSDGAGIAQFVSAVGELARGAGVPSTPPVWERHLLNT------SCTHHE  233

Query  898   YEEEPAADSMVTNIPLDNLVHRSFFFGPTEISALRSSLPPHLLKC-SRFEVVTACLWRCR  722
             +++ P  D + T   L+ +V RSF FG  +ISALRS LPPHL  C + FE++TACLWRCR
Sbjct  234   HKDIP--DILKTLTTLNEVVRRSFSFGTDQISALRSHLPPHLRHCTTTFEILTACLWRCR  291

Query  721   TIAMEFDPNDEVRIFGTVNARPRLKNPPVPNGYYGNAFVYPGAKSTAGKVSKSPLSHALE  542
             TIA+   P++EV I   +++R R  NPP+P+GYYGN  ++P A +T+  +SK+P  +A+E
Sbjct  292   TIALSPHPDEEVGILWAMDSRRRF-NPPIPDGYYGNCCIHPTAITTSESLSKNPYHYAVE  350

Query  541   LVTNIKSSFTEEYIKSVADLMILKGRPTFTLQGTFIVSDVTRVGFPEIDMGWGQSVFggp  362
             L+   K       + ++AD M++K    F+  G + VSD   +GF ++D GWG++V+GG 
Sbjct  351   LLRKAK-------LDAMADPMMIKRLSRFSFVGGYAVSDARHLGFEDVDFGWGKAVYGGV  403

Query  361   ahggvggipGLITFYIPYEDNKGDHGILVPMCLPAIAMGKFVKELE  224
             A G +G +P L++ Y+P +++KG++GI+V +CL   AM  F KELE
Sbjct  404   AKGNIGFVPELLSLYLPCKNDKGENGIVVSICLSENAMEVFTKELE  449



>gb|AAL77060.1|AF468022_1 putative acyltransferase [Cucumis melo]
Length=461

 Score =   444 bits (1143),  Expect = 3e-147, Method: Compositional matrix adjust.
 Identities = 220/435 (51%), Positives = 304/435 (70%), Gaps = 16/435 (4%)
 Frame = -1

Query  1528  AFTVTRQNPELVAPADPTPREIKYLSDIDDQQGLRFQIPVIHFYRNEPSMSGKDPVQVIR  1349
             +F V +  PEL+APA+PTP E K LSD+DDQQ LRFQ+P+++ Y + PS+ G+DPV+VI+
Sbjct  10    SFQVRKCQPELIAPANPTPYEFKQLSDVDDQQSLRFQLPLVNIYHHNPSLEGRDPVKVIK  69

Query  1348  QALAKALVFFYPFAGRLREGPGRKLMVDCTGEGVMFIEADADATLQHFAVGGELKPPFP-  1172
             +A+AKALVF+YP AGRLREGPGRKL V+CTGEG++FIEADAD +L+ F      +   P 
Sbjct  70    EAIAKALVFYYPLAGRLREGPGRKLFVECTGEGILFIEADADVSLEQF------RDTLPY  123

Query  1171  ----CFDQLLYNVPGSAEILNCPLFLIQVTRLRCGGFIFALRLNHSMSDACGLVHFLNTI  1004
                   + +++N   S  +LN PL LIQVTRL+CGGFIF +  +H+M+D  G+  F+  I
Sbjct  124   SLSSMENNIIHNSLNSDGVLNSPLLLIQVTRLKCGGFIFGIHFDHTMADGFGIAQFMKAI  183

Query  1003  AEIARGAEAPSVYPVWQREFFDARNPPRITCTHFEYEEEPAADSMVTNIPLDNLVHRSFF  824
             AEIARGA APS+ PVWQR    AR+PPRIT  H+EY++    D+  T IP +N++ R FF
Sbjct  184   AEIARGAFAPSILPVWQRALLTARDPPRITVRHYEYDQ--VVDTKSTLIPANNMIDRLFF  241

Query  823   FGPTEISALRSSLPPHLLKCSRFEVVTACLWRCRTIAMEFDPNDEVRIFGTVNARPRLKN  644
             F   +IS LR +LP HL  CS FEV+ A +WR RTIA +  P +EVR    VN R ++  
Sbjct  242   FTQRQISTLRQTLPAHLHDCSSFEVLAAYVWRLRTIAFQLKPEEEVRFLCVVNLRSKID-  300

Query  643   PPVPNGYYGNAFVYPGAKSTAGKVSKSPLSHALELVTNIKSSFTEEYIKSVADLMILKGR  464
               +P G+YGNA V+P   +T  K+  +PL +A++L+   K+  T+EYIKS+ D M++KGR
Sbjct  301   --IPLGFYGNAIVFPAVITTVAKLCGNPLGYAVDLIRKAKAKATKEYIKSMVDFMVIKGR  358

Query  463   PTFTLQGTFIVSDVTRVGFPEIDMGWGQSVFggpahggvggipGLITFYIPYEDNKGDHG  284
             P FT  G F++SD+TR+GF  +D GWG+++FGGP  GG G I G+I++ I + +  G+ G
Sbjct  359   PRFTEIGPFMMSDITRIGFENVDFGWGKAIFGGPIIGGCGIIRGMISYSIAFMNRNGEKG  418

Query  283   ILVPMCLPAIAMGKF  239
             I+VP+CLP  AM +F
Sbjct  419   IVVPLCLPPPAMERF  433



>ref|XP_006368249.1| hypothetical protein POPTR_0001s00970g [Populus trichocarpa]
 gb|ERP64818.1| hypothetical protein POPTR_0001s00970g [Populus trichocarpa]
Length=459

 Score =   444 bits (1143),  Expect = 3e-147, Method: Compositional matrix adjust.
 Identities = 227/443 (51%), Positives = 302/443 (68%), Gaps = 15/443 (3%)
 Frame = -1

Query  1543  SQPSIAFTVTRQNPELVAPADPTPREIKYLSDIDDQQGLRFQIPVIHFY--RNEPSMSGK  1370
             S   ++F V  ++PELV PA P P E K LSD+DDQ+ LR+QIP I FY   + P M G+
Sbjct  4     SSSLVSFKVRHRDPELVVPAKPVPYEQKQLSDVDDQEALRYQIPFIMFYDSNSNPCMEGE  63

Query  1369  DPVQVIRQALAKALVFFYPFAGRLREGPGRKLMVDCTGEGVMFIEADADATLQHFAVGGE  1190
             D V++IR ALA+ALV++YP AGRL+EGP  KL+VDCTGEGV+F+EADAD TL+       
Sbjct  64    DQVKIIRAALAEALVYYYPLAGRLKEGPDGKLLVDCTGEGVLFLEADADTTLELLE--DT  121

Query  1189  LKPPFPCFDQLLYNVPGSAEILNCPLFLIQVTRLRCGGFIFALRLNHSMSDACGLVHFLN  1010
             ++PP P  DQLLYNVPGS  I+ CPL LIQVTRL CGGF+FA+R +H ++DA G+  FLN
Sbjct  122   IQPPCPYLDQLLYNVPGSTGIVGCPLLLIQVTRLMCGGFVFAIRWSHIIADAVGMSKFLN  181

Query  1009  TIAEIARGAEAPSVYPVWQREFFDARNPPRITCTHFEYEEEPAADSMVTNIPLDN--LVH  836
             TIAE+  GA  PS  PVWQRE  +AR+PPR T  H E++E    D    N   D+  +VH
Sbjct  182   TIAEMVPGATKPSFLPVWQRELLNARDPPRATYEHHEFDEVNDTDFGTMN---DDTIIVH  238

Query  835   RSFFFGPTEISALRSSLPPHLLKCSRFEVVTACLWRCRTIAMEFDPNDEVRIFGTVNARP  656
             +SFFFGP E+S++R  LPPHL   S F V+TACLW+CRTIA + DPN+ VR+   V A  
Sbjct  239   KSFFFGPREMSSIRKHLPPHLRASSSFLVLTACLWKCRTIATQLDPNEIVRVSYMVTASG  298

Query  655   RLKNPPVPNGYYGNAFVYPGAKSTAGKVSKSPLSHALELVTNIKSSFTEEYIKSVADLMI  476
             + +   +P GYYGNAF +P A S AG + K+PL + LELV  IK+  +EEY +S  DL++
Sbjct  299   K-EGLKLPAGYYGNAFTFPVALSEAGLLCKNPLEYGLELVKEIKNRLSEEYTRSAIDLLV  357

Query  475   LKGRPTFTLQGTFIVSDVTRVGFPEIDMGWGQSVFggpahggvggipGLITFYIPYEDNK  296
             +KG+  +     F+++D TRV F EID+GWG+ V+GGPA          ++F+  +++ K
Sbjct  358   IKGKKQYRTVRDFVIADTTRVPFGEIDLGWGKPVYGGPAGAIKD-----VSFFAKFKNGK  412

Query  295   GDHGILVPMCLPAIAMGKFVKEL  227
             G+ GI+V + LP   M +F KEL
Sbjct  413   GEDGIVVQVSLPWQIMERFQKEL  435



>ref|NP_001284403.1| benzyl alcohol O-benzoyltransferase-like [Cucumis melo]
 gb|ACA04742.1| alcohol acetyltransferase [Cucumis melo]
Length=461

 Score =   444 bits (1141),  Expect = 5e-147, Method: Compositional matrix adjust.
 Identities = 220/435 (51%), Positives = 304/435 (70%), Gaps = 16/435 (4%)
 Frame = -1

Query  1528  AFTVTRQNPELVAPADPTPREIKYLSDIDDQQGLRFQIPVIHFYRNEPSMSGKDPVQVIR  1349
             +F V +  PEL+APA+PTP E K LSD+DDQQ LRFQ+P+++ Y + PS+ G+DPV+VI+
Sbjct  10    SFQVRKCQPELIAPANPTPYEFKQLSDVDDQQSLRFQLPLVNIYHHNPSLEGRDPVKVIK  69

Query  1348  QALAKALVFFYPFAGRLREGPGRKLMVDCTGEGVMFIEADADATLQHFAVGGELKPPFP-  1172
             +A+AKALVF+YP AGRLREGPGRKL V+CTGEG++FIEADAD +L+ F      +   P 
Sbjct  70    EAIAKALVFYYPLAGRLREGPGRKLFVECTGEGILFIEADADVSLEQF------RDTLPY  123

Query  1171  ----CFDQLLYNVPGSAEILNCPLFLIQVTRLRCGGFIFALRLNHSMSDACGLVHFLNTI  1004
                   + +++N   S  +LN PL LIQVTRL+CGGFIF +  +H+M+D  G+  F+  I
Sbjct  124   SLSSMENNIIHNSLNSDGVLNSPLLLIQVTRLKCGGFIFGIHFDHTMADGFGIAQFMKAI  183

Query  1003  AEIARGAEAPSVYPVWQREFFDARNPPRITCTHFEYEEEPAADSMVTNIPLDNLVHRSFF  824
             AEIARGA APS+ PVWQR    AR+PPRIT  H+EY++    D+  T IP +N++ R FF
Sbjct  184   AEIARGAFAPSILPVWQRALLTARDPPRITVRHYEYDQ--VVDTKSTLIPANNMIDRLFF  241

Query  823   FGPTEISALRSSLPPHLLKCSRFEVVTACLWRCRTIAMEFDPNDEVRIFGTVNARPRLKN  644
             F   +IS LR +LP HL  CS FEV+ A +WR RTIA +  P +EVR    VN R ++  
Sbjct  242   FTQRQISTLRQTLPAHLHDCSSFEVLAAYVWRLRTIAFQLKPEEEVRFLCVVNLRSKID-  300

Query  643   PPVPNGYYGNAFVYPGAKSTAGKVSKSPLSHALELVTNIKSSFTEEYIKSVADLMILKGR  464
               +P G+YGNA V+P   +T  K+  +PL +A++L+   K+  T+EYIKS+ D M++KGR
Sbjct  301   --IPLGFYGNAIVFPTVITTVAKLCGNPLGYAVDLIRKAKAKATKEYIKSMVDFMVIKGR  358

Query  463   PTFTLQGTFIVSDVTRVGFPEIDMGWGQSVFggpahggvggipGLITFYIPYEDNKGDHG  284
             P FT  G F++SD+TR+GF  +D GWG+++FGGP  GG G I G+I++ I + +  G+ G
Sbjct  359   PRFTEIGPFMMSDITRIGFENVDFGWGKAIFGGPIIGGCGIIRGMISYSIAFMNRNGEKG  418

Query  283   ILVPMCLPAIAMGKF  239
             I+VP+CLP  AM +F
Sbjct  419   IVVPLCLPPPAMERF  433



>gb|KCW72711.1| hypothetical protein EUGRSUZ_E01163 [Eucalyptus grandis]
Length=464

 Score =   444 bits (1141),  Expect = 6e-147, Method: Compositional matrix adjust.
 Identities = 221/443 (50%), Positives = 309/443 (70%), Gaps = 14/443 (3%)
 Frame = -1

Query  1543  SQPSIAFTVTRQNPELVAPADPTPREIKYLSDIDDQQGLRFQIPVIHFYRNEPSMSGK-D  1367
             S P++  +V R  PEL++P+  TPRE+K LSD+DDQ+GLRFQIP + FY N P + G+ D
Sbjct  7     SSPAL-LSVNRHKPELISPSQATPRELKPLSDLDDQEGLRFQIPFLFFYPNSPPIRGRED  65

Query  1366  PVQVIRQALAKALVFFYPFAGRLREGPGRKLMVDCTGEGVMFIEADADATLQHFAVGGEL  1187
             P +V+++AL KALV++YP AGR+REGP RKL+VDCTGEG++F++ADAD +L+    G  +
Sbjct  66    PARVVKEALRKALVYYYPLAGRIREGPNRKLVVDCTGEGILFVKADADFSLEEL--GDSM  123

Query  1186  KPPFPCFDQLLYNVPGSAEILNCPLFLIQVTRLRCGGFIFALRLNHSMSDACGLVHFLNT  1007
             +PP    D++L +V GS  I+ CPL L+QVTRL+CGGFI  +RLNH++SD+ GL  FL  
Sbjct  124   RPPCGFVDEVLCDVAGSGGIIGCPLLLVQVTRLKCGGFILGIRLNHAISDSLGLRQFLKA  183

Query  1006  IAEIARGAEAPSVYPVWQREFFDARNPPRITCTHFEYEE--EPAADSMVTNIPLDNLVHR  833
              AE+ARGA  PS  PVW+RE   AR+PPR TC H E+E+  + A  + VT  P  N+VHR
Sbjct  184   AAELARGAHVPSWLPVWEREILCARDPPRATCRHPEFEDVVDDARRAAVTLDP-KNMVHR  242

Query  832   SFFFGPTEISALRSSLPPHLL-KCSRFEVVTACLWRCRTIAMEFDPNDEVRIFGTVNARP  656
             SFFFGP E+++++  LP HL+ + S +E++TACLW+CRTIA+E +P+D VR+   +NAR 
Sbjct  243   SFFFGPREVASIKKGLPHHLVSRSSTYELLTACLWKCRTIALEIEPDDAVRLSSVINARG  302

Query  655   RLKNPPVPNGYYGNAFVYPGAKSTAGKVSKSPLSHALELVTNIKSSFTEEYIKSVADLMI  476
             + +   VP GYYGN  VY      AG +  SPL +A++LV   K   +EEY++S  D+++
Sbjct  303   K-QGLGVPRGYYGNTSVYATVLLKAGHLCNSPLGYAVDLVKKSKEMVSEEYVRSSIDVLV  361

Query  475   LKGRPTFTLQGTFIVSDVTRVGFPEIDMGWGQSVFggpahggvggipGLITFYIPYEDNK  296
             LKGRP +T    ++V+D T+VGF E D GWG+  +     GGV G   LI+F + Y   K
Sbjct  362   LKGRPKYTTVWNYVVADATKVGFEEADFGWGKPAY-----GGVAGAFPLISFNVKYRTRK  416

Query  295   GDHGILVPMCLPAIAMGKFVKEL  227
             G+ GI+VP+ LP  AM +F +EL
Sbjct  417   GEEGIVVPIMLPERAMRRFQEEL  439



>ref|XP_006376283.1| hypothetical protein POPTR_0013s11650g [Populus trichocarpa]
 gb|ERP54080.1| hypothetical protein POPTR_0013s11650g [Populus trichocarpa]
Length=424

 Score =   442 bits (1137),  Expect = 7e-147, Method: Compositional matrix adjust.
 Identities = 221/441 (50%), Positives = 299/441 (68%), Gaps = 24/441 (5%)
 Frame = -1

Query  1546  ASQPSIAFTVTRQNPELVAPADPTPREIKYLSDIDDQQGLRFQIPVIHFYRNEPSMSGKD  1367
              + P + F+V R  P+++ PA PT  ++K LSDIDDQ+GLRFQ+P I FYR+ PSM  KD
Sbjct  4     TTSPLLKFSVRRCKPQIIVPAKPTLHDLKELSDIDDQEGLRFQLPFIFFYRSHPSMEDKD  63

Query  1366  PVQVIRQALAKALVFFYPFAGRLREGPGRKLMVDCTGEGVMFIEADADATLQHFAVGGEL  1187
             PV +IR+A+ KALVF+YPFAG                  ++FIEADAD ++   A    +
Sbjct  64    PVNIIREAIGKALVFYYPFAG------------------ILFIEADADVSMNQLA--DTI  103

Query  1186  KPPFPCFDQLLYNVPGSAEILNCPLFLIQVTRLRCGGFIFALRLNHSMSDACGLVHFLNT  1007
             +PP+P  D+LLY+VPGS+ IL CPL LIQVTRL CGGF+FA+RL+H MSD+ GL +FLN 
Sbjct  104   QPPYPYIDELLYDVPGSSFILGCPLLLIQVTRLTCGGFVFAIRLSHPMSDSFGLANFLNA  163

Query  1006  IAEIARGAEAPSVYPVWQREFFDARNPPRITCTHFEYEEEPAADSMVTNIPLDNLVHRSF  827
             + E ARGA APS+ PVWQRE  +ARNPPR+TC H EY+      S++T    +N+VHRSF
Sbjct  164   VGEFARGASAPSLLPVWQREILNARNPPRVTCVHHEYDGNSTNISIMTMHQDNNMVHRSF  223

Query  826   FFGPTEISALRSSLPPHLLKCSRFEVVTACLWRCRTIAMEFDPNDEVRIFGTVNARPRLK  647
             FFGP E+ ++R  +PP   KCS FEV+ + LWR RTIA++ DPN+ VR+  T + R +  
Sbjct  224   FFGPKELKSIRKHIPPPHKKCSNFEVIVSFLWRSRTIALQLDPNEVVRLSCTNSIRGKPG  283

Query  646   NPPVPNGYYGNAFVYPGAKSTAGKVSKSPLSHALELVTNIKSSFTEEYIKSVADLMILKG  467
                +P GYYGNAF +P A S AG + +SPL +ALELV   K+   EEYIKSVADLM+LKG
Sbjct  284   KLQLPLGYYGNAFAFPTAISKAGLLCQSPLGYALELVRRQKTQMNEEYIKSVADLMVLKG  343

Query  466   RPTFTLQGTFIVSDVTRVGFPEIDMGWGQSVFggpahggvggipGLITFYIPYEDNKGDH  287
             RP  T    FIV+DV+R G  ++D GWG+ ++     G  G IP +I+    ++++KG+ 
Sbjct  344   RPHITSIWNFIVADVSRAGLGDVDFGWGKPIY----GGPTGAIPYIISILGRFKNSKGED  399

Query  286   GILVPMCLPAIAMGKFVKELE  224
             GI++P+ LP   MG+   ++E
Sbjct  400   GIVIPIWLPQPIMGRVQNKIE  420



>ref|XP_003516503.1| PREDICTED: anthraniloyl-CoA:methanol acyltransferase-like [Glycine 
max]
Length=452

 Score =   442 bits (1138),  Expect = 1e-146, Method: Compositional matrix adjust.
 Identities = 224/442 (51%), Positives = 296/442 (67%), Gaps = 12/442 (3%)
 Frame = -1

Query  1552  FMASQPSIAFTVTRQNPELVAPADPTPREIKYLSDIDDQQGLRFQIPVIHFYRNEPSMSG  1373
              M+S+ S  F+V    PELV PA PTPRE+K LSDIDDQ+GLRFQ  VI FY+    M G
Sbjct  1     MMSSRTS--FSVVHGEPELVVPAGPTPRELKNLSDIDDQEGLRFQHQVIMFYQKSHVMEG  58

Query  1372  KDPVQVIRQALAKALVFFYPFAGRLREGPGRKLMVDCTGEGVMFIEADADATLQHFAVGG  1193
             K P  VI+  LA+ALV +YP AGRLRE P RKL VDC+GEG++F+EA+A  +L+   +G 
Sbjct  59    KHPATVIKYGLAEALVHYYPLAGRLREWPNRKLTVDCSGEGILFVEAEAHVSLKE--LGN  116

Query  1192  ELKPPFPCFDQLLYNVPGSAEILNCPLFLIQVTRLRCGGFIFALRLNHSMSDACGLVHFL  1013
              + PP P   +LL +VPGS  IL CPL L QVTRL CGGF FA R+NH++ D+ GLV FL
Sbjct  117   SILPPCPHMKELLLDVPGSQGILGCPLLLFQVTRLTCGGFAFAARMNHTICDSLGLVQFL  176

Query  1012  NTIAEIARGAEAPSVYPVWQREFFDARNPPRITCTHFEYEEEPAADSMVTNIPLDNLVHR  833
               + EIARG    S +PVWQRE F+AR+PPRIT  H EY+E     +  T +  D + H 
Sbjct  177   TMVGEIARGVSI-SQFPVWQRELFNARDPPRITYAHHEYDETKHCSNKDT-MDFDQMAHE  234

Query  832   SFFFGPTEISALRSSLPPHLLKCSRFEVVTACLWRCRTIAMEFDPNDEVRIFGTVNARPR  653
             SFFFGP EI+ LRS LP HL KCS FE+++ACLW+CRT A+  +PN+ V +   + AR +
Sbjct  235   SFFFGPKEIATLRSHLPQHLRKCSTFEILSACLWKCRTKALGLEPNEIVGLSPFITARGK  294

Query  652   LKNPPVPNGYYGNAFVYPGAKSTAGKVSKSPLSHALELVTNIKSSFTEEYIKSVADLMIL  473
             +    VPNGYYGNAF +P A S AG + +SPL +AL L+   K+    EY+KSVADLM+L
Sbjct  295   V-GLHVPNGYYGNAFAFPMALSKAGLLCQSPLEYALGLIKKAKAQMGLEYVKSVADLMVL  353

Query  472   KGRPTFTLQGTFIVSDVTRVGFPEIDMGWGQSVFggpahggvggipGLITFYIPYEDNKG  293
             KGRP +  +  +++ D T VGF ++D GWG  ++     GG  G    ++FY  + +N+G
Sbjct  354   KGRPKYKTKENYLIGDTTHVGFYDVDFGWGSPIY-----GGPAGAIPFVSFYGRFRNNEG  408

Query  292   DHGILVPMCLPAIAMGKFVKEL  227
             + G++VP+ LP   M +F+ EL
Sbjct  409   EDGVVVPILLPHHVMKRFLFEL  430



>ref|XP_010689157.1| PREDICTED: benzyl alcohol O-benzoyltransferase-like [Beta vulgaris 
subsp. vulgaris]
Length=443

 Score =   442 bits (1136),  Expect = 2e-146, Method: Compositional matrix adjust.
 Identities = 222/439 (51%), Positives = 298/439 (68%), Gaps = 10/439 (2%)
 Frame = -1

Query  1531  IAFTVTRQNPELVAPADPTPREIKYLSDIDDQQGLRFQIPVIHFYRNEPSMSGKDPVQVI  1352
             I   VTR  PELV PA+PTPRE+K LSDIDDQ+GLRF +P I FYR +PSM  KDPV+V+
Sbjct  11    IVLNVTRGKPELVCPAEPTPRELKPLSDIDDQEGLRFHMPAIMFYRADPSMEEKDPVKVV  70

Query  1351  RQALAKALVFFYPFAGRLREGPGRKLMVDCTGEGVMFIEADADATLQHFAVGGELKPPFP  1172
             + ALAKALVF+YP+AGRL EGP RKL VDCTGEGV FIEA+ADA L+ F  G E+ PPFP
Sbjct  71    KDALAKALVFYYPYAGRLVEGPTRKLSVDCTGEGVPFIEAEADARLEDF--GDEIHPPFP  128

Query  1171  CFDQLLYNVPGSAEILNCPLFLIQVTRLRCGGFIFALRLNHSMSDACGLVHFLNTIAEIA  992
               D LLY++PG+  +L  PL ++QVTRL C GFI ALR NH+MSD  G++ F+N + E+ 
Sbjct  129   LQD-LLYDMPGTDGMLGTPLLIVQVTRLLCDGFIVALRANHAMSDGTGVMQFMNVVGEMG  187

Query  991   RGAEAPSVYPVWQREFFDARNPPRITCTHFEYEEEPAADSMVTNIPLDNLVHRSFFFGPT  812
             +G   PS+ PVW RE   A+  P ++  H EY++              NL+ +SF FGPT
Sbjct  188   KGFVTPSILPVWDRERLTAKRSPNVSFPHPEYDQHEIDHHSNDEA---NLIQQSFLFGPT  244

Query  811   EISALRSSLPPHLLKCSRFEVVTACLWRCRTIAMEFDPNDEVRIFGTVNARPRLKNPPVP  632
             EI+ALR  + P + + S F++++A LWRCRTIA+  DP DEVR+   VNAR +  NPP+ 
Sbjct  245   EIAALRRHISPRIKQFSTFDILSASLWRCRTIALGLDPEDEVRLLFAVNARSKF-NPPLA  303

Query  631   NGYYGNAFVYPGAKSTAGKVSKSPLSHALELVTNIKSSFTEEYIKSVADLMILKGRPTFT  452
              GYYGNA  +P   + AG + ++ + + LEL+ N KS   EEY++S+ DLM+   RP FT
Sbjct  304   KGYYGNACAFPAICAKAGDICQNKVEYILELIRNAKSEINEEYMRSIMDLMVTNDRPHFT  363

Query  451   LQGTFIVSDVTRVGFPEIDMGWGQSVFggpahggvggipGLITFYIPYEDNKGDHGILVP  272
             ++ T++VSD+  +GF ++D GWG+ VFGGPA  G        +F+I +++ KG+   +VP
Sbjct  364   VRQTYVVSDLRHLGFADVDFGWGKPVFGGPASNGSVPDA---SFFISFKNKKGETMTMVP  420

Query  271   MCLPAIAMGKFVKELENCL  215
             + LP + M  FVKEL   L
Sbjct  421   ISLPPVIMNVFVKELREML  439



>ref|XP_006470747.1| PREDICTED: anthraniloyl-CoA:methanol acyltransferase-like [Citrus 
sinensis]
Length=468

 Score =   442 bits (1137),  Expect = 3e-146, Method: Compositional matrix adjust.
 Identities = 215/457 (47%), Positives = 305/457 (67%), Gaps = 27/457 (6%)
 Frame = -1

Query  1534  SIAFTVTRQNPELVAPADPTPREIKYLSDIDDQQGLRFQIPVIHFYRNEPS--MSGKDPV  1361
             S    VTR+ PEL+ P  PTPRE+K +SDIDDQ+ LRFQIP++ FY+N+PS  M G+DPV
Sbjct  6     SQGLLVTRKAPELIVPERPTPREVKQISDIDDQESLRFQIPLLFFYKNDPSPSMQGRDPV  65

Query  1360  QVIRQALAKALVFFYPFAGRLREGPGRKLMVDCTGEGVMFIEADADATLQHFAVGGELKP  1181
             +VIR+A++KALVF+YP AGRL+EG  RKLMV+C  EGV+FIEADA+ TL+   +G +++P
Sbjct  66    KVIREAISKALVFYYPLAGRLKEGYNRKLMVECNAEGVLFIEADANFTLEQ--LGDDIQP  123

Query  1180  PFPCFDQLLYNVPGSAEILNCPLFLIQVTRLRCGGFIFA------------LRLNHSMSD  1037
             P P  +QL+Y+VPGS  IL CPL L+ ++    GGFIF             LR NH+M D
Sbjct  124   PCPYLNQLIYDVPGSEGILGCPLLLVYISCFAIGGFIFVFIGDAFDMQRIHLRFNHTMCD  183

Query  1036  ACGLVHFLNTIAEIARGAEAPSVYPVWQREFFDARNPPRITCTHFEYEEEPAADSMVTNI  857
             A GLV FL  I ++ARG  +P+++P+WQR+  +ARNPP++TC H EY+E          +
Sbjct  184   AFGLVQFLKAIEDMARGERSPTLFPIWQRQILNARNPPQVTCIHHEYDE-----VNTNEV  238

Query  856   PLDNLVHRSFFFGPTEISALRSSLPPHLLKCSRFEVVTACLWRCRTIAMEFDPNDEVRIF  677
             P DN+ H+SF+F    I ALR+ LP HL  CS FE++ A LW+CRTIA++  P +  ++ 
Sbjct  239   PSDNMAHKSFYFSLKGIKALRNQLPFHLKDCSTFELLLAFLWKCRTIALKLQPEEIAKVC  298

Query  676   GTVNARPRLKNPPVPNGYYGNAFVYPGAKSTAGKVSKSPLSHALELVTNIKSSFTEEYIK  497
               VN R +     +P GYYGNAF +    S A ++ K+P+ +A+ELV   K+   EEYI+
Sbjct  299   CIVNVRGKRYKMDIPPGYYGNAFTFSAVCSKAEQLCKNPIGYAVELVKKAKAQMNEEYIR  358

Query  496   SVADLMILKGRP-TFTLQGTFIVSDVTRVGFPEIDMGWGQSVFggpahggvggipGLITF  320
             S ADLM++KGR   F+ +G FIVSD+  VG  ++D GWG+ ++      G  G   +I+F
Sbjct  359   SAADLMVIKGRRIKFSTRGNFIVSDLRNVGLGDVDFGWGKPIY-----AGTAGAVAVISF  413

Query  319   YIPYEDNKGDHGILVPMCLPAIAMGKFVKELENCLMK  209
             +  Y++  G+ GILVP+CLP  AM +  +EL+  +++
Sbjct  414   FTKYQNKNGEPGILVPICLPQSAMERLQEELKGFMIQ  450



>dbj|BAB78588.1| alcohol acetyltransferase [Cucumis melo]
Length=461

 Score =   441 bits (1135),  Expect = 5e-146, Method: Compositional matrix adjust.
 Identities = 221/431 (51%), Positives = 301/431 (70%), Gaps = 8/431 (2%)
 Frame = -1

Query  1528  AFTVTRQNPELVAPADPTPREIKYLSDIDDQQGLRFQIPVIHFYRNEPSMSGKDPVQVIR  1349
             +F V +  PEL+APA+PTP E K LSD+DDQQ LR Q+P ++ Y + PS+ G+DPV+VI+
Sbjct  10    SFHVRKCQPELIAPANPTPYEFKQLSDVDDQQSLRLQLPFVNIYPHNPSLEGRDPVKVIK  69

Query  1348  QALAKALVFFYPFAGRLREGPGRKLMVDCTGEGVMFIEADADATLQHFAVGGELKPPFPC  1169
             +A+ KALVF+YP AGRLREGPGRKL V+CTGEG++FIEADAD +L+ F     L      
Sbjct  70    EAIGKALVFYYPLAGRLREGPGRKLFVECTGEGILFIEADADVSLEEF--WDTLPYSLSS  127

Query  1168  F-DQLLYNVPGSAEILNCPLFLIQVTRLRCGGFIFALRLNHSMSDACGLVHFLNTIAEIA  992
               + +++N   S E+LN PL LIQVTRL+CGGFIF L  NH+M+D  G+V F+   AEIA
Sbjct  128   MQNNIIHNALNSDEVLNSPLLLIQVTRLKCGGFIFGLCFNHTMADGFGIVQFMKATAEIA  187

Query  991   RGAEAPSVYPVWQREFFDARNPPRITCTHFEYEEEPAADSMVTNIPLDNLVHRSFFFGPT  812
             RGA APS+ PVWQR    AR+PPRIT  H+EY++    D+  T IP +N++ R FFF   
Sbjct  188   RGAFAPSILPVWQRALLTARDPPRITVRHYEYDQ--VVDTKSTLIPANNMIDRLFFFTQR  245

Query  811   EISALRSSLPPHLLKCSRFEVVTACLWRCRTIAMEFDPNDEVRIFGTVNARPRLKNPPVP  632
             +IS LR +LP HL  CS FEV+ A +WR RTIA +  P +EVR    VN R ++    +P
Sbjct  246   QISTLRQTLPAHLHDCSSFEVLAAYVWRLRTIAFQLKPEEEVRFLCVVNLRSKID---IP  302

Query  631   NGYYGNAFVYPGAKSTAGKVSKSPLSHALELVTNIKSSFTEEYIKSVADLMILKGRPTFT  452
              G+YGNA V+P   +T  K+  +PL +A++L+   K+  T+EYIKS+ D M++KGRP FT
Sbjct  303   LGFYGNAIVFPAVITTIAKLCGNPLGYAVDLIRKAKAKATKEYIKSMVDFMVIKGRPRFT  362

Query  451   LQGTFIVSDVTRVGFPEIDMGWGQSVFggpahggvggipGLITFYIPYEDNKGDHGILVP  272
               G F++SD+TR+GF  +D GWG+++FGGP  GG G I G+I++ I + +  G+ GI+VP
Sbjct  363   EIGPFMMSDITRIGFENVDFGWGKAIFGGPIIGGCGIIRGMISYSIAFMNRNGEKGIVVP  422

Query  271   MCLPAIAMGKF  239
             +CLP  AM +F
Sbjct  423   LCLPPPAMERF  433



>gb|KHN43217.1| Benzyl alcohol O-benzoyltransferase [Glycine soja]
Length=408

 Score =   439 bits (1129),  Expect = 6e-146, Method: Compositional matrix adjust.
 Identities = 221/391 (57%), Positives = 288/391 (74%), Gaps = 9/391 (2%)
 Frame = -1

Query  1381  MSGKDPVQVIRQALAKALVFFYPFAGRLREGPGRKLMVDCTGEGVMFIEADADATLQHFA  1202
             M+GKDPV+VIRQALAK LVF+YPFAGRLREGP RKLMVDCTGEGVMFIEADAD TL  F 
Sbjct  1     MAGKDPVEVIRQALAKTLVFYYPFAGRLREGPDRKLMVDCTGEGVMFIEADADVTLYQF-  59

Query  1201  VGGE-LKPPFPCFDQLLYNVPGSAEILNCPLFLIQVTRLRCGGFIFALRLNHSMSDACGL  1025
              GGE L+PPFPCF +LLYNVP + EI N PL LIQVTRL+C GFI A R NH++ DA G+
Sbjct  60    -GGEALQPPFPCFQELLYNVPETEEITNTPLLLIQVTRLKCDGFILAFRFNHTIGDAGGI  118

Query  1024  VHFLNTIAEIARG-AEAPSVYPVWQREFFDARNPPRITCTHFEYEEEPAADSMVTNIPLD  848
               F+N  +E+AR  A  PS+ PVW+RE   AR+PPRITC+H EY++    D+++T    D
Sbjct  119   SQFMNAWSEMARSHATKPSIAPVWRRELLRARDPPRITCSHREYDQ--LEDTIITP-SND  175

Query  847   NLVHRSFFFGPTEISALRSSLPPHLLKCSRFEVVTACLWRCRTIAMEFDPNDEVRIFGTV  668
             N+V RSFFFGPTEI+A+R  +P HL +CS F+++TAC WRCRT A++  P++EVR+   +
Sbjct  176   NMVQRSFFFGPTEIAAIRRLVPHHLRQCSTFDLITACFWRCRTKALQMKPDEEVRMMCII  235

Query  667   NARPRLKNPPVPNGYYGNAFVYPGAKSTAGKVSKSPLSHALELVTNIKSSFTEEYIKSVA  488
             NAR R  NPP+P GYYGNA   P A +TAGK+  +P  +A+EL+  +K   TEEY+ SVA
Sbjct  236   NARARF-NPPLPVGYYGNAVALPAAVTTAGKLCGNPFGYAVELINKLKREVTEEYMHSVA  294

Query  487   DLMILKGRPTFTLQGTFIVSDVTRVGFPEIDMGWGQSVFggpahggvggipGLITFYIPY  308
              LM++K R +FT   + I+SD+TR  F E+D GWG +V+GG A  G G  P   T+++ Y
Sbjct  295   YLMVIKERCSFTSVRSCIISDLTRARFREVDFGWGDAVYGGVAQAGAGTFPA-ATYHVSY  353

Query  307   EDNKGDHGILVPMCLPAIAMGKFVKELENCL  215
             ++ KG+ GI++P+ LP  +M +F KEL++ L
Sbjct  354   KNAKGEEGIVLPILLPTESMNRFAKELDHML  384



>gb|KHN41759.1| Benzyl alcohol O-benzoyltransferase [Glycine soja]
Length=469

 Score =   441 bits (1134),  Expect = 7e-146, Method: Compositional matrix adjust.
 Identities = 224/442 (51%), Positives = 296/442 (67%), Gaps = 12/442 (3%)
 Frame = -1

Query  1552  FMASQPSIAFTVTRQNPELVAPADPTPREIKYLSDIDDQQGLRFQIPVIHFYRNEPSMSG  1373
              M+S+ S  F+V    PELV PA PTPRE+K LSDIDDQ+GLRFQ  VI FY+    M G
Sbjct  1     MMSSRTS--FSVVHGEPELVVPAGPTPRELKNLSDIDDQEGLRFQHQVIMFYQKSHVMEG  58

Query  1372  KDPVQVIRQALAKALVFFYPFAGRLREGPGRKLMVDCTGEGVMFIEADADATLQHFAVGG  1193
             K P  VI+  LA+ALV +YP AGRLRE P RKL VDC+GEG++F+EA+A  +L+   +G 
Sbjct  59    KHPATVIKYGLAEALVHYYPLAGRLREWPNRKLTVDCSGEGILFVEAEAHVSLKE--LGN  116

Query  1192  ELKPPFPCFDQLLYNVPGSAEILNCPLFLIQVTRLRCGGFIFALRLNHSMSDACGLVHFL  1013
              + PP P   +LL +VPGS  IL CPL L QVTRL CGGF FA R+NH++ D+ GLV FL
Sbjct  117   SILPPCPHMKELLLDVPGSQGILGCPLLLFQVTRLTCGGFAFAARMNHTICDSLGLVQFL  176

Query  1012  NTIAEIARGAEAPSVYPVWQREFFDARNPPRITCTHFEYEEEPAADSMVTNIPLDNLVHR  833
               + EIARG    S +PVWQRE F+AR+PPRIT  H EY+E     +  T +  D + H 
Sbjct  177   TMVGEIARGVSI-SQFPVWQRELFNARDPPRITYAHHEYDETKHCSNKDT-MDFDQMAHE  234

Query  832   SFFFGPTEISALRSSLPPHLLKCSRFEVVTACLWRCRTIAMEFDPNDEVRIFGTVNARPR  653
             SFFFGP EI+ LRS LP HL KCS FE+++ACLW+CRT A+  +PN+ V +   + AR +
Sbjct  235   SFFFGPKEIATLRSHLPQHLRKCSTFEILSACLWKCRTKALGLEPNEIVGLSPFITARGK  294

Query  652   LKNPPVPNGYYGNAFVYPGAKSTAGKVSKSPLSHALELVTNIKSSFTEEYIKSVADLMIL  473
             +    VPNGYYGNAF +P A S AG + +SPL +AL L+   K+    EY+KSVADLM+L
Sbjct  295   V-GLHVPNGYYGNAFAFPMALSKAGLLCQSPLEYALGLIKKAKAQMGLEYVKSVADLMVL  353

Query  472   KGRPTFTLQGTFIVSDVTRVGFPEIDMGWGQSVFggpahggvggipGLITFYIPYEDNKG  293
             KGRP +  +  +++ D T VGF ++D GWG  ++     GG  G    ++FY  + +N+G
Sbjct  354   KGRPKYKTKENYLIGDTTHVGFYDVDFGWGSPIY-----GGPAGAIPFVSFYGRFRNNEG  408

Query  292   DHGILVPMCLPAIAMGKFVKEL  227
             + G++VP+ LP   M +F+ EL
Sbjct  409   EDGVVVPILLPHHVMKRFLFEL  430



>ref|XP_008462821.1| PREDICTED: benzyl alcohol O-benzoyltransferase-like [Cucumis 
melo]
Length=462

 Score =   440 bits (1131),  Expect = 2e-145, Method: Compositional matrix adjust.
 Identities = 215/431 (50%), Positives = 296/431 (69%), Gaps = 8/431 (2%)
 Frame = -1

Query  1528  AFTVTRQNPELVAPADPTPREIKYLSDIDDQQGLRFQIPVIHFYRNEPSMSGKDPVQVIR  1349
             +F V +  PEL+APA+PTP E K LSD+DDQQ LR Q+P ++ Y + PS+ G+DPV+VI+
Sbjct  10    SFHVRKCQPELIAPANPTPYEFKQLSDVDDQQSLRLQLPFVNIYPHNPSLEGRDPVKVIK  69

Query  1348  QALAKALVFFYPFAGRLREGPGRKLMVDCTGEGVMFIEADADATLQHFAVGGELKPPFPC  1169
             +A+ KALVF+YP AGRLREGPGRKL V+CTGEG++FIEADAD +L+ F     L      
Sbjct  70    EAIGKALVFYYPLAGRLREGPGRKLFVECTGEGILFIEADADVSLEEF--WDTLPYSLSS  127

Query  1168  F-DQLLYNVPGSAEILNCPLFLIQVTRLRCGGFIFALRLNHSMSDACGLVHFLNTIAEIA  992
               + +++N   S E+LN PL LIQVTRL+CGGFIF L  NH+M+D  G+V F+   AEIA
Sbjct  128   MQNNIIHNALNSDEVLNSPLLLIQVTRLKCGGFIFGLCFNHTMADGFGIVQFMKATAEIA  187

Query  991   RGAEAPSVYPVWQREFFDARNPPRITCTHFEYEEEPAADSMVTNIPLDNLVHRSFFFGPT  812
             RGA APS+ PVWQR    AR+PPRIT  H+EY++    D     IP+++ + + FFF   
Sbjct  188   RGAFAPSILPVWQRALLTARDPPRITFRHYEYDQ--VVDMKSGLIPVNSKIDQLFFFSQL  245

Query  811   EISALRSSLPPHLLKCSRFEVVTACLWRCRTIAMEFDPNDEVRIFGTVNARPRLKNPPVP  632
             +IS LR +LP HL  C  FEV+TA +WR RTIA++F P +EVR    +N R ++    +P
Sbjct  246   QISTLRQTLPAHLHDCPSFEVLTAYVWRLRTIALQFKPEEEVRFLCVMNLRSKID---IP  302

Query  631   NGYYGNAFVYPGAKSTAGKVSKSPLSHALELVTNIKSSFTEEYIKSVADLMILKGRPTFT  452
              GYYGNA V P   +TA K+  +PL +A++L+   K+  T EYIKS  DLM++KGRP FT
Sbjct  303   LGYYGNAVVVPAVITTAAKLCGNPLGYAVDLIRKAKAKATMEYIKSTVDLMVIKGRPYFT  362

Query  451   LQGTFIVSDVTRVGFPEIDMGWGQSVFggpahggvggipGLITFYIPYEDNKGDHGILVP  272
             + G+F++SD+TR+G   +D GWG+++FGGP   G     GL++F +P+ +  G+ G  + 
Sbjct  363   VVGSFMMSDLTRIGVENVDFGWGKAIFGGPTTTGARITRGLVSFCVPFMNRNGEKGTALS  422

Query  271   MCLPAIAMGKF  239
             +CLP  AM +F
Sbjct  423   LCLPPPAMERF  433



>ref|XP_002524024.1| 3'-N-debenzoyl-2'-deoxytaxol N-benzoyltransferase, putative [Ricinus 
communis]
 gb|EEF38392.1| 3'-N-debenzoyl-2'-deoxytaxol N-benzoyltransferase, putative [Ricinus 
communis]
Length=434

 Score =   439 bits (1128),  Expect = 2e-145, Method: Compositional matrix adjust.
 Identities = 218/450 (48%), Positives = 298/450 (66%), Gaps = 38/450 (8%)
 Frame = -1

Query  1549  MASQ---PSIAFTVTRQNPELVAPADPTPREIKYLSDIDDQQGLRFQIPVIHFYRNEPSM  1379
             MA+Q   P++ F V R  PEL+ PA PTP E K LSDIDDQ GLR               
Sbjct  1     MAAQEPIPALVFNVYRHEPELIRPAKPTPHEFKPLSDIDDQDGLR---------------  45

Query  1378  SGKDPVQVIRQALAKALVFFYPFAGRLRE--GPGRKLMVDCTGEGVMFIEADADATLQHF  1205
                    VI++AL + LVF+YPFAGRLRE     RKL+V+CTGEG++F+EA AD +L  F
Sbjct  46    -------VIKKALEETLVFYYPFAGRLREVRNNNRKLVVECTGEGILFVEAFADVSLDQF  98

Query  1204  AVGGELKPPFPCFDQLLYNVPGSAEILNCPLFLIQVTRLRCGGFIFALRLNHSMSDACGL  1025
                  ++PPFPCFD+LL +VPGS+ I+NCPL LIQ TRL+CGG I A+RLNH++SD  G 
Sbjct  99    G-DDAIRPPFPCFDELLSDVPGSSGIINCPLLLIQATRLKCGGIILAIRLNHTISDGGGF  157

Query  1024  VHFLNTIAEIARGAEAPSVYPVWQREFFDARNPPRITCTHFEYEEEPAADSMVTNIPLDN  845
               F +T++E+ARGA APSV P+W R   +AR+PPRITC H EY +    +  V   PL +
Sbjct  158   FQFWSTVSEMARGARAPSVLPIWDRHLLNARDPPRITCAHHEYVDLVDTEEQV---PLAD  214

Query  844   LVHRSFFFGPTEISALRSSLPPHLLKCSRFEVVTACLWRCRTIAMEFDPNDEVRIFGTVN  665
               HRSFF GP EI++LR   PPH   CS +E++TA  WRCRTIA++ +PN+E+R+   VN
Sbjct  215   KDHRSFFLGPAEIASLRRLAPPHFHNCSDYEIITASFWRCRTIALQPNPNEEMRVICIVN  274

Query  664   ARPRLKNPPVPNGYYGNAFVYPGAKSTAGKVSKSPLSHALELVTNIKSSFTEEYIKSVAD  485
             AR +  NPP+P GYYGN   Y  A + A  + + P+ +ALELV   K++ TEEY++SVAD
Sbjct  275   ARNKF-NPPIPRGYYGNCIAYSAAVAKAEDLCQKPIGYALELVRKAKANVTEEYMRSVAD  333

Query  484   LMILKGRPTFTLQGTFIVSDVTRVGFPEIDMGWGQSVFggpahggvggipGLITFYIPYE  305
             LM+++ RP +T+  TF+VS V ++   E+D GWG++++      G      + +F+I Y 
Sbjct  334   LMVIRCRPWYTMVRTFLVSGVGKLRLDEVDFGWGRALY------GGPAKGNVASFHIAYR  387

Query  304   DNKGDHGILVPMCLPAIAMGKFVKELENCL  215
               +G+ G+LV +CLP +AM +FVKEL++ L
Sbjct  388   KKEGEDGVLVTLCLPKLAMQRFVKELDSML  417



>ref|XP_006377894.1| hypothetical protein POPTR_0011s15660g [Populus trichocarpa]
 gb|ERP55691.1| hypothetical protein POPTR_0011s15660g [Populus trichocarpa]
Length=465

 Score =   440 bits (1131),  Expect = 2e-145, Method: Compositional matrix adjust.
 Identities = 224/449 (50%), Positives = 306/449 (68%), Gaps = 12/449 (3%)
 Frame = -1

Query  1549  MASQPSIAFTVTRQNPELVAPADPTPREIKYLSDIDDQQGLRFQIPVIHFYRNEPSMSGK  1370
             MA+   ++F V R+ PELVAPA  TP E++ LSDID Q  L+FQ P  + Y + PSM GK
Sbjct  1     MAASTPLSFAVRRREPELVAPAKATPHELRQLSDIDRQLYLQFQSPNYNLYAHNPSMQGK  60

Query  1369  DPVQVIRQALAKALVFFYPFAGRLREGPGRKLMVDCTGEGVMFIEADADATLQHFAVGGE  1190
             DPV+VI++A+A+ LV++YPFAGR+R+G   KL+V+CTGEGV+FIEADADAT++ F  G  
Sbjct  61    DPVKVIKEAIAQTLVYYYPFAGRIRQGADNKLIVECTGEGVLFIEADADATVEQF--GDP  118

Query  1189  LKPPFPCFDQLLYNVPGSAEILNCPLFLIQVTRLRCGGFIFALRLNHSMSDACGLVHFLN  1010
             +  PFPCF++LLYNVPGSA I N PL   QVTRL+CGGF+ A RLNH MSDA G+V  L+
Sbjct  119   IPSPFPCFEELLYNVPGSAGIHNTPLLSFQVTRLKCGGFVLAYRLNHLMSDALGIVQLLS  178

Query  1009  TIAEIARGAEAPSVYPVWQREFFDARNPPRITCTHFEY-EEEPAADSMVTNIP-----LD  848
              I EIARGA+APS+ PVWQRE   ARNPPR+T  H EY  + P      TN+P     + 
Sbjct  179   AIGEIARGAQAPSILPVWQRELLCARNPPRVTRRHSEYGNDGPVVVGPTTNVPEFHGEVY  238

Query  847   NLVHRSFFFGPTEISALRSSLPPHLLKCSRFEVVTACLWRCRTIAMEFDPNDEVRIFGTV  668
             ++ HRSF     E+S +R  +P HL  CS FEV++ACLWRC  IA + +PN+++R+   V
Sbjct  239   DVAHRSFVLNRKELSNIRRWIPSHLHPCSNFEVISACLWRCYAIASQANPNEQMRMQLLV  298

Query  667   NARPRLKNPPVPNGYYGNAFVYPGAKSTAGKVSKSPLSHALELVTNIKSSFTEEYIKSVA  488
             NAR +  NPP+P GYYGN    P A + A  +  + L +A+EL+ N K++ TEEY++S+A
Sbjct  299   NARSKF-NPPLPKGYYGNVLALPAAVTNAKNLCLNSLGYAMELIRNAKNAITEEYMRSLA  357

Query  487   DLM-ILKGRPTFTLQGTFIVSDVTRVGFPEIDMGWGQSVFggpahggvggipGLITFYIP  311
             DL+ I KG+P   LQ +++VSD+T +GF ++D GW + V+ GPA      I    T+++P
Sbjct  358   DLIEITKGQP-IGLQ-SYVVSDITSIGFDQVDCGWDKPVYAGPAKAMPDEISIAGTYFLP  415

Query  310   YEDNKGDHGILVPMCLPAIAMGKFVKELE  224
             Y    G+ G+++ + L A  M +F   LE
Sbjct  416   YRFKNGERGVMLLVSLRAPVMERFAVLLE  444



>emb|CAA94432.1| unknown [Cucumis melo]
Length=455

 Score =   439 bits (1129),  Expect = 3e-145, Method: Compositional matrix adjust.
 Identities = 215/431 (50%), Positives = 296/431 (69%), Gaps = 8/431 (2%)
 Frame = -1

Query  1528  AFTVTRQNPELVAPADPTPREIKYLSDIDDQQGLRFQIPVIHFYRNEPSMSGKDPVQVIR  1349
             +F V +  PEL+APA+PTP E K LSD+DDQQ LR Q+P ++ Y + PS+ G+DPV+VI+
Sbjct  3     SFHVRKCQPELIAPANPTPYEFKQLSDVDDQQSLRLQLPFVNIYPHNPSLEGRDPVKVIK  62

Query  1348  QALAKALVFFYPFAGRLREGPGRKLMVDCTGEGVMFIEADADATLQHFAVGGELKPPFPC  1169
             +A+ KALVF+YP AGRLREGPGRKL V+CTGEG++FIEADAD +L+ F     L      
Sbjct  63    EAIGKALVFYYPLAGRLREGPGRKLFVECTGEGILFIEADADVSLEEF--WDTLPYSLSS  120

Query  1168  F-DQLLYNVPGSAEILNCPLFLIQVTRLRCGGFIFALRLNHSMSDACGLVHFLNTIAEIA  992
               + +++N   S E+LN PL LIQVTRL+CGGFIF L  NH+M+D  G+V F+   AEIA
Sbjct  121   MQNNIIHNALNSDEVLNSPLLLIQVTRLKCGGFIFGLCFNHTMADGFGIVQFMKATAEIA  180

Query  991   RGAEAPSVYPVWQREFFDARNPPRITCTHFEYEEEPAADSMVTNIPLDNLVHRSFFFGPT  812
             RGA APS+ PVWQR    AR+PPRIT  H+EY++    D     IP+++ + + FFF   
Sbjct  181   RGAFAPSILPVWQRALLTARDPPRITFRHYEYDQ--VVDMKSGLIPVNSKIDQLFFFSQL  238

Query  811   EISALRSSLPPHLLKCSRFEVVTACLWRCRTIAMEFDPNDEVRIFGTVNARPRLKNPPVP  632
             +IS LR +LP HL  C  FEV+TA +WR RTIA++F P +EVR    +N R ++    +P
Sbjct  239   QISTLRQTLPAHLHDCPSFEVLTAYVWRLRTIALQFKPEEEVRFLCVMNLRSKID---IP  295

Query  631   NGYYGNAFVYPGAKSTAGKVSKSPLSHALELVTNIKSSFTEEYIKSVADLMILKGRPTFT  452
              GYYGNA V P   +TA K+  +PL +A++L+   K+  T EYIKS  DLM++KGRP FT
Sbjct  296   LGYYGNAVVVPAVITTAAKLCGNPLGYAVDLIRKAKAKATMEYIKSTVDLMVIKGRPYFT  355

Query  451   LQGTFIVSDVTRVGFPEIDMGWGQSVFggpahggvggipGLITFYIPYEDNKGDHGILVP  272
             + G+F++SD+TR+G   +D GWG+++FGGP   G     GL++F +P+ +  G+ G  + 
Sbjct  356   VVGSFMMSDLTRIGVENVDFGWGKAIFGGPTTTGARITRGLVSFCVPFMNRNGEKGTALS  415

Query  271   MCLPAIAMGKF  239
             +CLP  AM +F
Sbjct  416   LCLPPPAMERF  426



>ref|XP_004494963.1| PREDICTED: benzyl alcohol O-benzoyltransferase-like [Cicer arietinum]
Length=456

 Score =   438 bits (1127),  Expect = 5e-145, Method: Compositional matrix adjust.
 Identities = 227/464 (49%), Positives = 308/464 (66%), Gaps = 13/464 (3%)
 Frame = -1

Query  1543  SQPSIAFTVTRQNPELVAPADPTPREIKYLSDIDDQQGLRFQIPVIHFYRNEPSMSGKDP  1364
             S  ++ FTV R   ELV+P  PTPREIK LS+IDDQ+GLRF IP+I  YR+EPSM  KDP
Sbjct  2     SSSTLTFTVRRCQSELVSPIAPTPREIKLLSNIDDQEGLRFNIPLIFIYRHEPSMIEKDP  61

Query  1363  VQVIRQALAKALVFFYPFAGRLREGPGRKLMVDCTGEGVMFIEADADATLQHFAVGGELK  1184
             V+V++ +L++ LV++YPFAGR+REG  RKLMVDC GEGVMFIEA+AD TL  F  G  L+
Sbjct  62    VKVLKHSLSQTLVYYYPFAGRIREGDNRKLMVDCNGEGVMFIEAEADVTLDQF--GDTLQ  119

Query  1183  PPFPCFDQLLYNVPGSAEILNCPLFLIQVTRLRCGGFIFALRLNHSMSDACGLVHFLNTI  1004
             PPFPCF QLLY+ P   +I++CPL  IQVTR++CGGFI AL +NH+M DA G   F+N  
Sbjct  120   PPFPCFQQLLYDAPDIGQIIDCPLLHIQVTRIKCGGFILALTINHTMCDASGFKQFMNAW  179

Query  1003  AEIARGAEAPSVYPVWQREFFDARNPPRITCTHFEYEEEPAADSMVTNIPLDNLVHRSFF  824
             AE+A G+  PS+ P+W REF   R PP I+  H EYE+     +         +VH+SFF
Sbjct  180   AEMAGGSHQPSIQPIWFREFLMGREPPHISFNHREYEQ--LLPNTTKEEDTTTIVHKSFF  237

Query  823   FGPTEISALRSSLPPHLLKCSRFEVVTACLWRCRTIAMEFDPNDEVRIFGTVNARPRLK-  647
             F  + I+ +R  +P +L +C+ F+++TAC W C T AM+ +PN++VRI   VNAR   K 
Sbjct  238   FTHSHIATIRRLVPLNLRQCTDFDLITACFWYCHTKAMQLEPNEDVRIMCVVNARSMFKK  297

Query  646   -NPPVPNGYYGNAFVYPGAKSTAGKVSKSPLSHALELVTNIKSSFTEEYIKSVADLMILK  470
              N     GYYGN F +P A +TAGK+  + L +A+EL+   K   TEEY+ SVADLM +K
Sbjct  298   INRSSLVGYYGNCFAFPAAVTTAGKLCGNSLGYAVELIRKAKIEVTEEYMNSVADLMDIK  357

Query  469   GRPTFTLQGTFIVSDVTRVGFPEIDMGWGQSVFggpahggvggipGLITFYIPYEDNKGD  290
              R  FT   +  VSDV RV   E++ GWG++++GG A GGVG   G +TF +PY++ KG+
Sbjct  358   ERCLFTTVRSCFVSDVARVKLSEVNFGWGEAMYGGVAKGGVGPFTG-VTFIVPYKNAKGE  416

Query  289   HGILVPMCLPAIAMGKFVKELENCLMK**TSSSQNS-MHLIYMW  161
               +++P+ LP   M +F  EL+  +      S+QN  +  +Y W
Sbjct  417   ESLMLPISLPYEDMKRFSNELDEMI-----GSNQNHPITNLYNW  455



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 4862288125142