BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c25618_g3_i3 len=1704 path=[24897:0-950 25846:951-1209
15239:1210-1340 @15370@!:1341-1667 2150:1668-1703]

Length=1704
                                                                      Score     E

ref|XP_009779589.1|  PREDICTED: protease Do-like 8, chloroplastic       432   1e-142   
ref|XP_009598417.1|  PREDICTED: protease Do-like 8, chloroplastic       431   8e-142   
gb|KDO72539.1|  hypothetical protein CISIN_1g019504mg                   365   1e-140   
ref|XP_004233360.1|  PREDICTED: protease Do-like 8, chloroplastic       425   1e-139   
ref|XP_006357113.1|  PREDICTED: protease Do-like 8, chloroplastic...    425   1e-139   
ref|XP_010661062.1|  PREDICTED: protease Do-like 8, chloroplastic...    421   1e-139   
ref|XP_002278099.2|  PREDICTED: protease Do-like 8, chloroplastic...    421   2e-138   Vitis vinifera
ref|XP_007032515.1|  Trypsin family protein with PDZ domain             417   1e-136   
gb|KDP27141.1|  hypothetical protein JCGZ_19840                         415   3e-136   
ref|XP_002524371.1|  Protease degQ precursor, putative                  414   2e-135   Ricinus communis
ref|XP_008459309.1|  PREDICTED: protease Do-like 8, chloroplastic       409   3e-133   
ref|XP_006593673.1|  PREDICTED: protease Do-like 8, chloroplastic...    408   4e-133   
ref|XP_003543778.1|  PREDICTED: protease Do-like 8, chloroplastic...    408   4e-133   
ref|XP_011012611.1|  PREDICTED: protease Do-like 8, chloroplastic       400   2e-132   
ref|XP_006405593.1|  hypothetical protein EUTSA_v10027761mg             406   2e-132   
ref|XP_010258373.1|  PREDICTED: protease Do-like 8, chloroplastic...    402   4e-132   
ref|XP_010435840.1|  PREDICTED: protease Do-like 8, chloroplastic...    405   4e-132   
ref|XP_010435839.1|  PREDICTED: protease Do-like 8, chloroplastic...    405   6e-132   
ref|XP_010258372.1|  PREDICTED: protease Do-like 8, chloroplastic...    402   7e-132   
ref|XP_006431119.1|  hypothetical protein CICLE_v10012082mg             400   9e-132   
ref|XP_004148708.1|  PREDICTED: protease Do-like 8, chloroplastic...    404   1e-131   
gb|KGN52454.1|  hypothetical protein Csa_5G636470                       404   1e-131   
ref|XP_009376265.1|  PREDICTED: protease Do-like 8, chloroplastic...    400   2e-131   
ref|XP_010441096.1|  PREDICTED: protease Do-like 8, chloroplastic       404   2e-131   
ref|XP_010450763.1|  PREDICTED: protease Do-like 8, chloroplastic       404   2e-131   
ref|XP_007215337.1|  hypothetical protein PRUPE_ppa005314mg             403   4e-131   
ref|XP_010258371.1|  PREDICTED: protease Do-like 8, chloroplastic...    402   5e-131   
ref|XP_008357762.1|  PREDICTED: protease Do-like 8, chloroplastic       402   8e-131   
ref|NP_568575.1|  protease DEG 8                                        401   1e-130   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009376263.1|  PREDICTED: protease Do-like 8, chloroplastic...    402   2e-130   
ref|XP_010258370.1|  PREDICTED: protease Do-like 8, chloroplastic...    401   2e-130   
pdb|4IC6|A  Chain A, Crystal Structure Of Deg8                          398   2e-130   
ref|XP_008230760.1|  PREDICTED: LOW QUALITY PROTEIN: protease Do-...    402   2e-130   
gb|KFK33190.1|  hypothetical protein AALP_AA6G341700                    401   2e-130   
ref|XP_011098617.1|  PREDICTED: protease Do-like 8, chloroplastic       404   3e-130   
ref|XP_006283717.1|  hypothetical protein CARUB_v10004787mg             400   4e-130   
ref|XP_002870753.1|  hypothetical protein ARALYDRAFT_494007             400   5e-130   
ref|XP_010693232.1|  PREDICTED: protease Do-like 8, chloroplastic...    400   5e-130   
ref|XP_010693233.1|  PREDICTED: protease Do-like 8, chloroplastic...    400   5e-130   
ref|XP_007151224.1|  hypothetical protein PHAVU_004G028200g             400   6e-130   
ref|XP_009124853.1|  PREDICTED: protease Do-like 8, chloroplastic       399   7e-130   
ref|XP_002305987.2|  hypothetical protein POPTR_0004s13440g             400   9e-130   Populus trichocarpa [western balsam poplar]
ref|XP_006384343.1|  hypothetical protein POPTR_0004s13440g             399   1e-129   
ref|XP_010937127.1|  PREDICTED: protease Do-like 8, chloroplastic...    397   2e-129   
gb|AFK34777.1|  unknown                                                 398   3e-129   
emb|CDY30272.1|  BnaC04g31830D                                          397   6e-129   
ref|XP_010937121.1|  PREDICTED: protease Do-like 8, chloroplastic...    397   1e-128   
ref|XP_008784276.1|  PREDICTED: protease Do-like 8, chloroplastic...    394   2e-128   
ref|XP_010029298.1|  PREDICTED: protease Do-like 8, chloroplastic       396   2e-128   
ref|XP_004306149.1|  PREDICTED: protease Do-like 8, chloroplastic...    395   2e-128   
ref|XP_004489389.1|  PREDICTED: protease Do-like 8, chloroplastic...    394   1e-127   
ref|XP_008784256.1|  PREDICTED: protease Do-like 8, chloroplastic...    394   2e-127   
ref|XP_010552938.1|  PREDICTED: protease Do-like 8, chloroplastic       392   9e-127   
ref|XP_009381428.1|  PREDICTED: protease Do-like 8, chloroplastic...    389   8e-126   
ref|XP_006482566.1|  PREDICTED: protease Do-like 8, chloroplastic...    389   1e-125   
emb|CDP02226.1|  unnamed protein product                                387   8e-125   
ref|XP_002446612.1|  hypothetical protein SORBIDRAFT_06g018930          385   2e-124   Sorghum bicolor [broomcorn]
tpg|DAA37462.1|  TPA: hypothetical protein ZEAMMB73_701443              383   7e-124   
gb|ACL52595.1|  unknown                                                 383   1e-123   Zea mays [maize]
gb|KEH25002.1|  trypsin-like serine protease                            383   2e-123   
emb|CAD40980.2|  OSJNBa0072F16.5                                        382   2e-123   Oryza sativa Japonica Group [Japonica rice]
ref|XP_004975851.1|  PREDICTED: protease Do-like 8, chloroplastic...    382   4e-123   
ref|NP_001173969.1|  Os04g0459900                                       382   4e-123   
emb|CBW45783.1|  ORW1943Ba0077G13.11                                    381   1e-122   
ref|XP_006652369.1|  PREDICTED: protease Do-like 8, chloroplastic...    378   3e-122   
ref|XP_003579902.2|  PREDICTED: protease Do-like 8, chloroplastic       374   4e-120   
gb|EPS68932.1|  hypothetical protein M569_05835                         370   2e-119   
ref|XP_006827214.1|  hypothetical protein AMTR_s00010p00259680          372   5e-119   
dbj|BAJ93901.1|  predicted protein                                      369   3e-118   
gb|EMS64886.1|  Protease Do-like 8, chloroplastic                       368   1e-117   
ref|XP_004166387.1|  PREDICTED: protease Do-like 8, chloroplastic...    366   2e-117   
gb|EMT20257.1|  Protease Do-like 8, chloroplastic                       370   3e-117   
ref|NP_974863.1|  protease DEG 8                                        365   1e-116   Arabidopsis thaliana [mouse-ear cress]
ref|XP_001758182.1|  predicted protein                                  335   1e-105   
gb|KHN13227.1|  Protease Do-like 8, chloroplastic                       337   3e-105   
ref|XP_009381431.1|  PREDICTED: protease Do-like 8, chloroplastic...    327   5e-102   
ref|XP_002983147.1|  hypothetical protein SELMODRAFT_422439             322   1e-100   
ref|XP_002965905.1|  hypothetical protein SELMODRAFT_407040             320   2e-100   
ref|XP_005645556.1|  trypsin-like serine protease                       282   3e-84    
ref|XP_002955471.1|  trypsin family                                     265   3e-79    
ref|XP_005845406.1|  hypothetical protein CHLNCDRAFT_25936              262   2e-77    
ref|XP_001689569.1|  DegP-type protease                                 263   2e-77    Chlamydomonas reinhardtii
gb|EPS73282.1|  hypothetical protein M569_01469                         254   2e-74    
ref|XP_011085829.1|  PREDICTED: protease Do-like 1, chloroplastic       253   1e-73    
ref|XP_008458762.1|  PREDICTED: protease Do-like 1, chloroplastic...    248   1e-73    
ref|XP_002503307.1|  predicted protein                                  249   2e-73    Micromonas commoda
ref|XP_001773228.1|  predicted protein                                  249   2e-73    
ref|XP_008230601.1|  PREDICTED: protease Do-like 1, chloroplastic       251   4e-73    
ref|XP_004142804.1|  PREDICTED: protease Do-like 1, chloroplastic...    251   5e-73    
ref|XP_004156682.1|  PREDICTED: protease Do-like 1, chloroplastic...    251   6e-73    
ref|XP_007215368.1|  hypothetical protein PRUPE_ppa005605mg             251   1e-72    
ref|XP_008341723.1|  PREDICTED: protease Do-like 1, chloroplastic       250   2e-72    
ref|XP_009375106.1|  PREDICTED: protease Do-like 1, chloroplastic       249   3e-72    
emb|CAN72708.1|  hypothetical protein VITISV_043787                     245   3e-72    Vitis vinifera
ref|XP_004304622.1|  PREDICTED: protease Do-like 1, chloroplastic...    249   3e-72    
ref|XP_006338559.1|  PREDICTED: protease Do-like 1, chloroplastic...    249   3e-72    
ref|XP_008458761.1|  PREDICTED: protease Do-like 1, chloroplastic...    248   5e-72    
gb|KHG20811.1|  Protease Do-like 1, chloroplastic                       248   6e-72    
ref|XP_009614636.1|  PREDICTED: protease Do-like 1, chloroplastic       248   6e-72    
ref|XP_004232295.1|  PREDICTED: protease Do-like 1, chloroplastic       248   8e-72    
ref|XP_004489277.1|  PREDICTED: protease Do-like 1, chloroplastic...    248   8e-72    
ref|XP_009769548.1|  PREDICTED: protease Do-like 1, chloroplastic       248   8e-72    
ref|XP_011098475.1|  PREDICTED: protease Do-like 1, chloroplastic       247   1e-71    
ref|XP_010029180.1|  PREDICTED: protease Do-like 1, chloroplastic       246   6e-71    
gb|ACZ74706.1|  serine-type peptidase                                   245   8e-71    Phaseolus vulgaris [French bean]
ref|XP_010243028.1|  PREDICTED: protease Do-like 1, chloroplastic...    246   8e-71    
ref|XP_010243027.1|  PREDICTED: protease Do-like 1, chloroplastic...    246   9e-71    
emb|CBI18180.3|  unnamed protein product                                245   1e-70    
ref|XP_007151040.1|  hypothetical protein PHAVU_004G013600g             245   1e-70    
ref|XP_002267510.3|  PREDICTED: protease Do-like 1, chloroplastic       245   1e-70    Vitis vinifera
ref|XP_008357876.1|  PREDICTED: protease Do-like 1, chloroplastic       246   2e-70    
ref|XP_010528252.1|  PREDICTED: protease Do-like 1, chloroplastic...    246   2e-70    
ref|XP_002300036.2|  hypothetical protein POPTR_0001s34960g             244   2e-70    Populus trichocarpa [western balsam poplar]
ref|XP_009402518.1|  PREDICTED: protease Do-like 1, chloroplastic       244   2e-70    
gb|KDP45341.1|  hypothetical protein JCGZ_09590                         244   3e-70    
ref|XP_011047314.1|  PREDICTED: protease Do-like 1, chloroplastic       244   3e-70    
ref|XP_007031474.1|  DegP protease 1 isoform 2                          244   3e-70    
ref|XP_011010443.1|  PREDICTED: protease Do-like 1, chloroplastic       243   3e-70    
ref|XP_001417771.1|  predicted protein                                  241   5e-70    Ostreococcus lucimarinus CCE9901
ref|XP_007031473.1|  DegP protease 1 isoform 1                          244   7e-70    
ref|XP_006844985.1|  hypothetical protein AMTR_s00058p00188880          243   1e-69    
ref|XP_006470331.1|  PREDICTED: protease Do-like 1, chloroplastic...    242   2e-69    
ref|XP_010667674.1|  PREDICTED: protease Do-like 1, chloroplastic       242   2e-69    
gb|EMS49623.1|  Protease Do-like 1, chloroplastic                       237   4e-69    
ref|XP_010528253.1|  PREDICTED: protease Do-like 1, chloroplastic...    242   4e-69    
ref|NP_001289236.1|  protease Do-like 1, chloroplastic                  241   4e-69    
ref|XP_010925542.1|  PREDICTED: protease Do-like 1, chloroplastic       242   4e-69    
ref|XP_006395390.1|  hypothetical protein EUTSA_v10004246mg             241   5e-69    
ref|XP_003524545.1|  PREDICTED: protease Do-like 1, chloroplastic...    240   5e-69    
gb|KHN27431.1|  Protease Do-like 1, chloroplastic                       240   5e-69    
ref|XP_002524640.1|  Protease degQ precursor, putative                  241   6e-69    Ricinus communis
gb|AFW81178.1|  hypothetical protein ZEAMMB73_402948                    240   7e-69    
ref|XP_001765751.1|  predicted protein                                  236   7e-69    
ref|XP_002992168.1|  hypothetical protein SELMODRAFT_134817             239   8e-69    
ref|XP_002977281.1|  hypothetical protein SELMODRAFT_176144             240   9e-69    
ref|XP_008806894.1|  PREDICTED: protease Do-like 1, chloroplastic       241   2e-68    
gb|EYU34714.1|  hypothetical protein MIMGU_mgv1a006761mg                239   2e-68    
ref|XP_003618288.1|  Serine-type peptidase                              238   4e-68    
pdb|3QO6|A  Chain A, Crystal Structure Analysis Of The Plant Prot...    235   5e-68    
ref|XP_001775937.1|  predicted protein                                  235   6e-68    
ref|XP_006291165.1|  hypothetical protein CARUB_v10017283mg             237   8e-68    
ref|XP_010502800.1|  PREDICTED: protease Do-like 1, chloroplastic       238   9e-68    
ref|NP_001056360.1|  Os05g0568900                                       237   9e-68    Oryza sativa Japonica Group [Japonica rice]
gb|EEE64736.1|  hypothetical protein OsJ_19592                          237   9e-68    Oryza sativa Japonica Group [Japonica rice]
ref|WP_013247542.1|  2-alkenal reductase                                235   1e-67    
ref|XP_010514501.1|  PREDICTED: protease Do-like 1, chloroplastic       237   1e-67    
ref|XP_010924255.1|  PREDICTED: protease Do-like 1, chloroplastic       239   1e-67    
emb|CDP02112.1|  unnamed protein product                                238   1e-67    
ref|XP_010425574.1|  PREDICTED: protease Do-like 1, chloroplastic       237   1e-67    
gb|EEC79717.1|  hypothetical protein OsI_21033                          237   1e-67    Oryza sativa Indica Group [Indian rice]
ref|NP_001242692.1|  uncharacterized protein LOC100783304               236   2e-67    
ref|XP_004961178.1|  PREDICTED: protease Do-like 1, chloroplastic...    236   3e-67    
ref|WP_007334055.1|  2-alkenal reductase                                234   4e-67    
dbj|BAJ87184.1|  predicted protein                                      235   4e-67    
ref|WP_011120947.1|  2-alkenal reductase                                234   4e-67    
emb|CDY58511.1|  BnaCnng33260D                                          236   4e-67    
ref|WP_007327787.1|  2-alkenal reductase                                234   4e-67    
gb|EMT27614.1|  Protease Do-like 1, chloroplastic                       233   5e-67    
ref|WP_007339036.1|  2-alkenal reductase                                234   5e-67    
ref|XP_010108775.1|  Protease Do-like 1                                 236   6e-67    
ref|NP_189431.2|  DegP protease 1                                       235   6e-67    Arabidopsis thaliana [mouse-ear cress]
ref|XP_009151909.1|  PREDICTED: protease Do-like 1, chloroplastic       235   6e-67    
ref|XP_002441538.1|  hypothetical protein SORBIDRAFT_09g028940          235   7e-67    Sorghum bicolor [broomcorn]
ref|XP_002877082.1|  hypothetical protein ARALYDRAFT_484581             234   9e-67    
ref|XP_010231009.1|  PREDICTED: protease Do-like 1, chloroplastic       234   1e-66    
gb|AAC39436.1|  DegP protease precursor                                 234   2e-66    Arabidopsis thaliana [mouse-ear cress]
ref|XP_005712448.1|  unnamed protein product                            233   6e-66    
gb|KFK33710.1|  hypothetical protein AALP_AA5G050200                    231   8e-66    
ref|NP_001130694.1|  uncharacterized protein LOC100191797               232   1e-65    Zea mays [maize]
ref|XP_002973741.1|  hypothetical protein SELMODRAFT_149210             228   2e-65    
ref|WP_027328573.1|  2-alkenal reductase                                228   2e-65    
ref|XP_006655603.1|  PREDICTED: protease Do-like 1, chloroplastic...    232   2e-65    
ref|WP_008655508.1|  2-alkenal reductase                                229   2e-65    
ref|WP_008664459.1|  2-alkenal reductase                                229   3e-65    
gb|EKD89775.1|  hypothetical protein ACD_32C00151G0002                  228   4e-65    
ref|XP_002508768.1|  predicted protein                                  226   8e-65    Micromonas commoda
gb|AFW79240.1|  hypothetical protein ZEAMMB73_880102                    233   3e-64    
ref|WP_013110274.1|  2-alkenal reductase                                226   3e-64    
ref|WP_028874564.1|  2-alkenal reductase                                225   4e-64    
ref|XP_005763775.1|  hypothetical protein EMIHUDRAFT_67415              226   1e-63    
ref|WP_024460910.1|  2-alkenal reductase                                222   4e-63    
ref|WP_034728571.1|  hypothetical protein                               222   4e-63    
gb|EQC48376.1|  trypsin                                                 222   6e-63    
ref|WP_012831703.1|  HtrA2 peptidase                                    224   1e-62    
emb|CBJ29300.1|  Serine type protease, similar to Protease Do-lik...    222   2e-62    
ref|WP_012486196.1|  2-alkenal reductase                                220   2e-62    
ref|WP_007294861.1|  2-alkenal reductase                                221   3e-62    
ref|WP_007292741.1|  2-alkenal reductase                                221   3e-62    
ref|WP_038206276.1|  2-alkenal reductase                                219   4e-62    
ref|WP_020559912.1|  hypothetical protein                               220   5e-62    
ref|XP_002505610.1|  predicted protein                                  221   1e-61    Micromonas commoda
ref|WP_010130959.1|  2-alkenal reductase                                218   2e-61    
ref|XP_010105634.1|  Protease Do-like 8                                 216   2e-61    
ref|WP_035275807.1|  2-alkenal reductase                                218   2e-61    
ref|WP_019561833.1|  hypothetical protein                               218   2e-61    
ref|XP_005539130.1|  DegP protease precursor                            221   3e-61    
ref|XP_005853635.1|  hypothetical protein NGA_0428900                   220   4e-61    
ref|XP_003077970.1|  DegP protease precursor (ISS)                      220   5e-61    
gb|ETX09290.1|  2-alkenal reductase                                     217   5e-61    
ref|WP_020736955.1|  serine protease                                    217   8e-61    
ref|WP_014243018.1|  protease                                           216   1e-60    
ref|XP_005847403.1|  hypothetical protein CHLNCDRAFT_35559              216   1e-60    
emb|CEG60598.1|  DegP protease (Do-like, S2-serine-like)                216   1e-60    
ref|WP_023405839.1|  hypothetical protein                               216   2e-60    
emb|CEF96987.1|  Peptidase S1C                                          220   2e-60    
emb|CEF98004.1|  Peptidase S1C                                          215   2e-60    
ref|XP_009034040.1|  hypothetical protein AURANDRAFT_20884              214   2e-60    
ref|WP_026154707.1|  2-alkenal reductase                                215   2e-60    
ref|WP_020412424.1|  2-alkenal reductase                                215   2e-60    
ref|WP_002709789.1|  2-alkenal reductase                                216   2e-60    
ref|WP_028374385.1|  peptidase                                          214   4e-60    
ref|XP_009042752.1|  hypothetical protein AURANDRAFT_35147              214   5e-60    
ref|WP_015405342.1|  DegP2 peptidase                                    214   5e-60    
ref|WP_019014410.1|  2-alkenal reductase                                214   1e-59    
ref|XP_003079375.1|  Serine protease (ISS)                              216   1e-59    
emb|CAJ71979.1|  strongly similar to serine protease                    213   2e-59    Candidatus Kuenenia stuttgartiensis
gb|EKD38540.1|  hypothetical protein ACD_75C00700G0003                  213   2e-59    
gb|EYF01971.1|  DegP protease                                           214   3e-59    
gb|KFM26732.1|  Protease Do-like 1, chloroplastic                       213   3e-59    
ref|WP_009151581.1|  2-alkenal reductase                                213   3e-59    
emb|CEE12129.1|  Putative serine protease HtrA                          212   4e-59    
ref|WP_012236787.1|  serine protease                                    213   4e-59    
ref|WP_012827283.1|  peptidase S1 and S6 chymotrypsin/Hap               212   5e-59    
ref|WP_010960979.1|  2-alkenal reductase                                212   5e-59    
ref|WP_027443639.1|  2-alkenal reductase                                211   5e-59    
ref|WP_007639839.1|  2-alkenal reductase                                211   7e-59    
ref|WP_028382216.1|  peptidase                                          211   1e-58    
ref|WP_023409640.1|  hypothetical protein                               211   1e-58    
ref|XP_005703573.1|  serine-type peptidase (DEGP1)                      213   1e-58    
ref|WP_009549554.1|  2-alkenal reductase                                211   2e-58    
ref|WP_034934742.1|  2-alkenal reductase                                210   2e-58    
ref|WP_025385943.1|  peptidase                                          210   2e-58    
ref|WP_002809304.1|  2-alkenal reductase                                210   2e-58    
ref|WP_009575009.1|  2-alkenal reductase                                210   2e-58    
gb|EXI68651.1|  Periplasmic serine endoprotease DegP precursor          210   2e-58    
ref|WP_026609053.1|  2-alkenal reductase                                210   3e-58    
ref|WP_035216646.1|  2-alkenal reductase                                210   3e-58    
ref|XP_002952663.1|  trypsin family                                     209   3e-58    
ref|XP_001416558.1|  predicted protein                                  208   3e-58    Ostreococcus lucimarinus CCE9901
ref|WP_006973648.1|  hypothetical protein                               210   4e-58    
ref|XP_002185764.1|  predicted protein                                  212   4e-58    Phaeodactylum tricornutum CCAP 1055/1
ref|WP_036500556.1|  2-alkenal reductase                                209   5e-58    
ref|WP_011712250.1|  2-alkenal reductase                                209   5e-58    
ref|WP_013220653.1|  2-alkenal reductase                                209   6e-58    
ref|WP_014429493.1|  2-alkenal reductase                                209   6e-58    
ref|WP_013763684.1|  2-alkenal reductase                                209   8e-58    
ref|WP_009023167.1|  2-alkenal reductase                                208   9e-58    
ref|WP_027474142.1|  2-alkenal reductase                                207   1e-57    
ref|WP_015724997.1|  2-alkenal reductase                                208   1e-57    
ref|WP_022951449.1|  2-alkenal reductase                                208   2e-57    
ref|WP_013629199.1|  2-alkenal reductase                                209   2e-57    
ref|WP_019572296.1|  hypothetical protein                               208   2e-57    
ref|XP_005836091.1|  hypothetical protein GUITHDRAFT_68171              209   2e-57    
ref|WP_035229109.1|  2-alkenal reductase                                207   2e-57    
ref|WP_022980985.1|  2-alkenal reductase                                207   3e-57    
gb|AHB86036.1|  Pwb2                                                    207   3e-57    
gb|KHE91289.1|  serine protease                                         207   3e-57    
emb|CEK11072.1|  DegP protease (Do-like, S2-serine-like)                207   3e-57    
ref|WP_010653102.1|  peptidase                                          207   3e-57    
ref|WP_002649813.1|  2-alkenal reductase                                207   3e-57    
ref|WP_014148337.1|  2-alkenal reductase                                207   3e-57    
ref|XP_005647016.1|  trypsin-like serine protease                       206   4e-57    
ref|WP_034408289.1|  2-alkenal reductase                                207   4e-57    
gb|ETW98417.1|  2-alkenal reductase                                     207   4e-57    
ref|WP_007235673.1|  2-alkenal reductase                                206   4e-57    
ref|XP_002505905.1|  predicted protein                                  206   6e-57    Micromonas commoda
ref|WP_037299724.1|  2-alkenal reductase                                206   7e-57    
ref|WP_026129969.1|  2-alkenal reductase                                206   8e-57    
ref|XP_007512705.1|  predicted protein                                  212   1e-56    
ref|WP_018301877.1|  hypothetical protein                               206   1e-56    
ref|XP_001756080.1|  predicted protein                                  204   2e-56    
ref|WP_009857811.1|  2-alkenal reductase                                205   2e-56    
ref|WP_013163114.1|  2-alkenal reductase                                205   2e-56    
gb|AFK36529.1|  unknown                                                 205   2e-56    
ref|WP_027270982.1|  peptidase                                          204   2e-56    
ref|WP_020534120.1|  hypothetical protein                               205   2e-56    
ref|WP_007227186.1|  2-alkenal reductase                                204   3e-56    
ref|WP_012044919.1|  2-alkenal reductase                                204   3e-56    
ref|WP_028389047.1|  peptidase                                          204   4e-56    
ref|XP_005703453.1|  serine-type peptidase (DEGP1)                      204   5e-56    
ref|WP_012178212.1|  protease Do                                        203   5e-56    
ref|WP_020208314.1|  hypothetical protein                               203   5e-56    
ref|WP_023660135.1|  Trypsin-like serine protease, typically peri...    203   6e-56    
ref|WP_027949062.1|  2-alkenal reductase                                203   7e-56    
ref|WP_012082528.1|  2-alkenal reductase                                203   7e-56    
emb|CDM64695.1|  trypsin-like serine protease with C-terminal PDZ...    204   9e-56    
gb|KFM22725.1|  Protease Do-like 1, chloroplastic                       202   1e-55    
ref|WP_027282466.1|  2-alkenal reductase                                202   2e-55    
gb|KEO91090.1|  2-alkenal reductase                                     201   3e-55    
gb|AIA16101.1|  Trypsin-like peptidase domain protein                   202   3e-55    
ref|WP_031567896.1|  peptidase                                          201   4e-55    
ref|WP_007427382.1|  2-alkenal reductase                                201   4e-55    
ref|WP_009470294.1|  2-alkenal reductase                                201   5e-55    
ref|WP_034957320.1|  2-alkenal reductase                                201   5e-55    
ref|WP_012468279.1|  2-alkenal reductase                                201   5e-55    
ref|XP_009034039.1|  hypothetical protein AURANDRAFT_70822              213   5e-55    
ref|WP_012978903.1|  peptidase                                          201   5e-55    
ref|WP_012703101.1|  2-alkenal reductase                                201   5e-55    
ref|XP_003062695.1|  predicted protein                                  201   5e-55    
ref|WP_021224322.1|  hypothetical protein                               201   6e-55    
ref|WP_003632507.1|  peptidase                                          201   6e-55    
ref|WP_009020582.1|  2-alkenal reductase                                201   6e-55    
ref|WP_020569670.1|  hypothetical protein                               201   6e-55    
ref|XP_010105635.1|  Protease Do-like 8                                 194   6e-55    
ref|WP_039801589.1|  2-alkenal reductase                                201   6e-55    
ref|WP_035516066.1|  2-alkenal reductase                                200   8e-55    
gb|EQC44761.1|  trypsin                                                 200   1e-54    
ref|WP_002652431.1|  2-alkenal reductase                                201   1e-54    
ref|WP_009026412.1|  2-alkenal reductase                                200   2e-54    
gb|KDO66189.1|  hypothetical protein CISIN_1g0130143mg                  194   2e-54    
ref|WP_034732453.1|  hypothetical protein                               200   2e-54    
emb|CEE13864.1|  Putative serine protease HtrA                          199   2e-54    
ref|WP_007002272.1|  2-alkenal reductase                                199   3e-54    
ref|WP_031432108.1|  2-alkenal reductase                                199   3e-54    
ref|WP_006610552.1|  2-alkenal reductase                                199   4e-54    
gb|KER38216.1|  2-alkenal reductase                                     198   4e-54    
ref|WP_008243409.1|  2-alkenal reductase                                199   4e-54    
ref|WP_028584100.1|  2-alkenal reductase                                199   4e-54    
ref|XP_002291911.1|  predicted protein                                  202   4e-54    
ref|WP_011479380.1|  2-alkenal reductase                                199   4e-54    
dbj|BAN68305.1|  putative serine protease PepD                          199   4e-54    
ref|WP_009277333.1|  2-alkenal reductase                                197   6e-54    
ref|WP_020820460.1|  MULTISPECIES: hypothetical protein                 198   7e-54    
ref|WP_028386159.1|  peptidase                                          197   8e-54    
ref|WP_024973314.1|  2-alkenal reductase                                198   1e-53    
ref|XP_008368458.1|  PREDICTED: protease Do-like 1, chloroplastic       192   1e-53    
ref|WP_029158346.1|  2-alkenal reductase                                197   1e-53    
ref|WP_009238718.1|  MULTISPECIES: 2-alkenal reductase                  197   1e-53    
gb|KFJ93226.1|  2-alkenal reductase                                     197   2e-53    
ref|WP_008964801.1|  2-alkenal reductase                                197   2e-53    
ref|WP_020886756.1|  PDZ/DHR/GLGF domain protein                        197   2e-53    
ref|WP_034908473.1|  2-alkenal reductase                                197   2e-53    
ref|XP_002962675.1|  hypothetical protein SELMODRAFT_78227              193   3e-53    
ref|WP_007254798.1|  2-alkenal reductase                                196   4e-53    
ref|WP_018577457.1|  peptidase                                          196   4e-53    
ref|WP_028462052.1|  2-alkenal reductase                                196   5e-53    
ref|WP_020484439.1|  hypothetical protein                               196   6e-53    
ref|WP_003052339.1|  2-alkenal reductase                                196   6e-53    
ref|WP_026602432.1|  2-alkenal reductase                                196   7e-53    
gb|AAB61311.1|  htrA-like protein                                       196   8e-53    
gb|KGG83063.1|  2-alkenal reductase                                     195   8e-53    
gb|KGG86099.1|  2-alkenal reductase                                     194   9e-53    
gb|EJK49893.1|  hypothetical protein THAOC_31183                        198   9e-53    
ref|WP_015435143.1|  2-alkenal reductase                                195   1e-52    
ref|WP_006869823.1|  peptidase                                          194   1e-52    
ref|WP_034359724.1|  2-alkenal reductase                                195   1e-52    
ref|XP_005848239.1|  hypothetical protein CHLNCDRAFT_35065              196   1e-52    
ref|WP_034383486.1|  2-alkenal reductase                                195   1e-52    
ref|WP_034414705.1|  2-alkenal reductase                                194   2e-52    
ref|WP_024849881.1|  2-alkenal reductase                                194   2e-52    
emb|CEG56414.1|  conserved exported protein of unknown function         193   2e-52    
ref|WP_022535847.1|  2-alkenal reductase                                194   3e-52    
gb|EXI81163.1|  Periplasmic serine endoprotease DegP precursor          194   3e-52    
ref|WP_013647690.1|  2-alkenal reductase                                194   3e-52    
ref|WP_013964898.1|  2-alkenal reductase                                194   3e-52    
gb|EYU34079.1|  hypothetical protein MIMGU_mgv1a0098121mg               188   3e-52    
ref|XP_005828136.1|  hypothetical protein GUITHDRAFT_88532              196   5e-52    
ref|WP_034085941.1|  2-alkenal reductase                                193   5e-52    
ref|WP_021268545.1|  trypsin-like peptidase domain protein              192   8e-52    
ref|WP_039337603.1|  2-alkenal reductase                                192   1e-51    
gb|KHS42965.1|  peptidase S1 and S6, chymotrypsin/Hap                   192   1e-51    
ref|WP_008249608.1|  2-alkenal reductase                                192   1e-51    
ref|WP_028895589.1|  2-alkenal reductase                                192   1e-51    
ref|WP_033158534.1|  2-alkenal reductase                                192   1e-51    
ref|WP_011567077.1|  protease Do                                        189   1e-51    
ref|WP_011417649.1|  2-alkenal reductase                                192   2e-51    
ref|XP_005646623.1|  trypsin-like serine protease                       191   2e-51    
ref|WP_028385208.1|  peptidase                                          190   3e-51    
gb|AHI98676.1|  Peptidase S1, chymotrypsin:PDZ/DHR/GLGF domain pr...    191   4e-51    
ref|WP_007192872.1|  2-alkenal reductase                                191   4e-51    
ref|WP_012814270.1|  peptidase S1 and S6, chymotrypsin/Hap              191   4e-51    
ref|WP_008103908.1|  Trypsin domain protein                             191   4e-51    
ref|WP_014271634.1|  peptidase A2                                       192   5e-51    
ref|WP_011413793.1|  2-alkenal reductase                                189   5e-51    
ref|WP_013651404.1|  2-alkenal reductase                                190   5e-51    
ref|XP_009034736.1|  hypothetical protein AURANDRAFT_2617               188   6e-51    
ref|WP_024267257.1|  HtrA protease/chaperone protein                    191   7e-51    
ref|XP_003063724.1|  predicted protein                                  191   7e-51    
ref|WP_032968635.1|  2-alkenal reductase                                187   1e-50    
ref|WP_011540696.1|  2-alkenal reductase                                189   2e-50    
ref|WP_023171264.1|  2-alkenal reductase                                190   2e-50    
ref|WP_011369130.1|  2-alkenal reductase                                189   2e-50    
gb|EHL21429.1|  putative trypsin-like serine protease                   188   2e-50    
ref|WP_020084952.1|  2-alkenal reductase                                189   2e-50    
ref|WP_015012968.1|  2-alkenal reductase                                189   2e-50    
ref|WP_035897702.1|  2-alkenal reductase                                185   2e-50    
ref|WP_028998736.1|  2-alkenal reductase                                188   3e-50    
ref|WP_035887071.1|  peptidase                                          187   3e-50    
ref|XP_007514299.1|  predicted protein                                  191   3e-50    
ref|WP_014454681.1|  peptidase S1                                       189   4e-50    
ref|WP_012317797.1|  MULTISPECIES: 2-alkenal reductase                  188   4e-50    
ref|WP_003461587.1|  2-alkenal reductase                                188   4e-50    
ref|WP_012332851.1|  2-alkenal reductase                                188   4e-50    
ref|WP_028917713.1|  2-alkenal reductase                                188   4e-50    
gb|ERS83023.1|  2-alkenal reductase                                     187   4e-50    
ref|WP_026190596.1|  2-alkenal reductase                                188   5e-50    
ref|WP_026605342.1|  2-alkenal reductase                                188   5e-50    
ref|WP_018526786.1|  hypothetical protein                               188   5e-50    
ref|WP_034695159.1|  2-alkenal reductase                                188   5e-50    
emb|CBX33362.1|  putative DegP2 peptidase                               187   6e-50    
ref|WP_029039042.1|  MULTISPECIES: 2-alkenal reductase                  187   7e-50    
gb|ABF73023.1|  plastid DegP serine-type peptidase precursor            190   7e-50    
ref|WP_011786799.1|  MULTISPECIES: 2-alkenal reductase                  187   7e-50    
ref|WP_023011423.1|  2-alkenal reductase                                187   7e-50    
ref|WP_032731989.1|  2-alkenal reductase                                187   8e-50    
ref|WP_032289795.1|  2-alkenal reductase                                187   8e-50    
ref|WP_036354256.1|  2-alkenal reductase                                187   8e-50    
ref|WP_012213879.1|  2-alkenal reductase                                187   8e-50    
gb|KDT01334.1|  trypsin family protein                                  186   8e-50    
ref|WP_036036202.1|  2-alkenal reductase                                187   9e-50    
ref|WP_023093178.1|  hypothetical protein                               187   9e-50    
ref|WP_028179341.1|  MULTISPECIES: 2-alkenal reductase                  187   1e-49    
ref|WP_036009668.1|  2-alkenal reductase                                187   1e-49    
ref|WP_033990325.1|  2-alkenal reductase                                187   1e-49    
ref|WP_023899362.1|  MULTISPECIES: trypsin                              187   1e-49    
ref|WP_006412086.1|  MULTISPECIES: 2-alkenal reductase                  187   1e-49    
gb|EYD70935.1|  serine protease, putative                               186   1e-49    
ref|WP_018317252.1|  peptidase                                          186   1e-49    
ref|WP_028920101.1|  2-alkenal reductase                                187   1e-49    
ref|WP_024014929.1|  2-alkenal reductase                                187   1e-49    
ref|WP_013984523.1|  2-alkenal reductase                                187   1e-49    
ref|WP_021567590.1|  MULTISPECIES: hypothetical protein                 187   1e-49    
ref|WP_032174376.1|  2-alkenal reductase                                187   1e-49    
ref|WP_025297756.1|  2-alkenal reductase                                187   1e-49    
ref|WP_031755015.1|  2-alkenal reductase                                187   2e-49    
ref|WP_027539432.1|  2-alkenal reductase                                186   2e-49    
ref|WP_004637115.1|  MULTISPECIES: 2-alkenal reductase                  186   2e-49    
ref|WP_003116645.1|  MULTISPECIES: 2-alkenal reductase                  186   2e-49    
gb|EJY58361.1|  hypothetical protein PACIG1_5892                        187   2e-49    
ref|WP_017927029.1|  hypothetical protein                               186   2e-49    
ref|WP_024436741.1|  2-alkenal reductase                                186   2e-49    
ref|XP_001701757.1|  DegP-type protease                                 190   2e-49    
ref|WP_027575707.1|  2-alkenal reductase                                186   2e-49    
ref|WP_004837773.1|  hypothetical protein                               186   2e-49    
gb|EKA41121.1|  2-alkenal reductase                                     185   2e-49    
ref|WP_019400019.1|  2-alkenal reductase                                186   2e-49    
ref|WP_028914931.1|  2-alkenal reductase                                186   2e-49    
ref|WP_009521696.1|  2-alkenal reductase                                186   2e-49    
gb|ESN09853.1|  hypothetical protein L371_04833                         185   2e-49    
ref|WP_005134233.1|  hypothetical protein                               186   2e-49    
ref|WP_004740204.1|  hypothetical protein                               186   2e-49    
ref|WP_033871651.1|  2-alkenal reductase                                186   2e-49    
ref|WP_018987771.1|  hypothetical protein                               186   3e-49    
ref|WP_000221973.1|  MULTISPECIES: 2-alkenal reductase                  186   3e-49    
ref|WP_000128323.1|  2-alkenal reductase                                186   3e-49    
ref|WP_004963463.1|  MULTISPECIES: hypothetical protein                 186   3e-49    
ref|WP_004733149.1|  hypothetical protein                               186   3e-49    
gb|AIQ88759.1|  2-alkenal reductase                                     186   3e-49    
ref|WP_002072799.1|  MULTISPECIES: 2-alkenal reductase                  186   3e-49    
ref|WP_034024254.1|  2-alkenal reductase                                186   3e-49    
ref|WP_027895905.1|  2-alkenal reductase                                186   3e-49    
ref|WP_032738449.1|  2-alkenal reductase                                186   4e-49    
ref|WP_023101533.1|  hypothetical protein                               186   4e-49    
ref|WP_001513918.1|  trypsin family protein                             186   4e-49    
ref|WP_012761372.1|  MULTISPECIES: 2-alkenal reductase                  186   4e-49    
ref|WP_023280943.1|  hypothetical protein                               185   4e-49    
ref|WP_003847784.1|  MULTISPECIES: 2-alkenal reductase                  185   4e-49    
ref|WP_015065602.1|  2-alkenal reductase                                185   4e-49    
ref|WP_000323730.1|  MULTISPECIES: 2-alkenal reductase                  185   4e-49    
ref|WP_023304016.1|  hypothetical protein                               185   4e-49    
gb|AIA45145.1|  2-alkenal reductase                                     185   4e-49    
ref|WP_032732007.1|  2-alkenal reductase                                185   4e-49    
ref|WP_032445087.1|  2-alkenal reductase                                185   4e-49    
ref|WP_033986168.1|  2-alkenal reductase                                185   4e-49    
ref|WP_028161729.1|  2-alkenal reductase                                185   4e-49    
emb|CED73348.1|  Protease Do-like 1, chloroplastic                      186   5e-49    
ref|WP_006221855.1|  2-alkenal reductase                                185   5e-49    
ref|WP_032629948.1|  MULTISPECIES: 2-alkenal reductase                  185   5e-49    
ref|WP_033847089.1|  2-alkenal reductase                                185   5e-49    
ref|WP_028134530.1|  2-alkenal reductase                                185   5e-49    
ref|WP_009491061.1|  2-alkenal reductase                                185   5e-49    
ref|WP_033986636.1|  2-alkenal reductase                                185   5e-49    
gb|KDX28837.1|  trypsin family protein                                  184   5e-49    
ref|WP_025032099.1|  2-alkenal reductase                                185   5e-49    
gb|KGY64834.1|  2-alkenal reductase                                     185   5e-49    
ref|WP_028351053.1|  2-alkenal reductase                                184   5e-49    
ref|WP_013313337.1|  peptidase S1                                       186   6e-49    
ref|WP_005036482.1|  2-alkenal reductase                                184   6e-49    
ref|WP_014624213.1|  peptidase S1                                       186   6e-49    
ref|WP_016239827.1|  hypothetical protein                               185   7e-49    
ref|WP_014236594.1|  2-alkenal reductase                                185   7e-49    
ref|WP_032230770.1|  2-alkenal reductase                                185   8e-49    
ref|WP_001514945.1|  hypothetical protein                               185   8e-49    
ref|WP_016156528.1|  MULTISPECIES: hypothetical protein                 184   8e-49    
ref|WP_033936165.1|  2-alkenal reductase                                184   8e-49    
ref|WP_024342216.1|  2-alkenal reductase                                184   8e-49    
ref|WP_037549958.1|  peptidase S1                                       186   8e-49    
ref|WP_033959556.1|  2-alkenal reductase                                184   8e-49    
ref|WP_007569313.1|  2-alkenal reductase                                184   8e-49    
ref|WP_000323729.1|  MULTISPECIES: 2-alkenal reductase                  184   9e-49    
ref|WP_031494134.1|  2-alkenal reductase                                184   9e-49    
ref|WP_032287291.1|  2-alkenal reductase                                184   9e-49    
ref|WP_023352868.1|  hypothetical protein                               184   9e-49    
ref|WP_034067034.1|  2-alkenal reductase                                184   9e-49    
ref|WP_032174635.1|  2-alkenal reductase                                184   1e-48    
ref|WP_010685855.1|  2-alkenal reductase                                184   1e-48    
ref|WP_008389329.1|  2-alkenal reductase                                184   1e-48    
ref|WP_019905129.1|  2-alkenal reductase                                184   1e-48    
ref|WP_032238621.1|  2-alkenal reductase                                184   1e-48    
ref|WP_034050553.1|  2-alkenal reductase                                184   1e-48    



>ref|XP_009779589.1| PREDICTED: protease Do-like 8, chloroplastic [Nicotiana sylvestris]
Length=469

 Score =   432 bits (1112),  Expect = 1e-142, Method: Compositional matrix adjust.
 Identities = 214/236 (91%), Positives = 230/236 (97%), Gaps = 0/236 (0%)
 Frame = -2

Query  1211  LQKNFEGKLVGADRSKDLAVLKVEASEDLLRPTKIGESSSLRVGQKCLAIGNPFGFDHTL  1032
             +QKNFEGKL+GADR+KDLAVLKVEAS DLLRP ++GES+SLRVGQ+CLAIGNPFGFDHTL
Sbjct  219   VQKNFEGKLIGADRAKDLAVLKVEASADLLRPIRVGESASLRVGQQCLAIGNPFGFDHTL  278

Query  1031  TVGVISGLNRDIYSQTGVTISGGIQTDAAINPGNSGGPLLDSKGNLIGINTAIFTQTGTS  852
             TVGVISGLNRDIYSQTGVTISGGIQTDAAINPGNSGGPLLDSKGNLIGINTAIFTQTGTS
Sbjct  279   TVGVISGLNRDIYSQTGVTISGGIQTDAAINPGNSGGPLLDSKGNLIGINTAIFTQTGTS  338

Query  851   AGVGFAIPSSTVLRIVPQLIQSGKVVRAGLNIDIAPDAIANQLNVRNGALVLLVPGNSLA  672
             AGVGFAIPSSTVLRIVPQLIQSGKVVRAGLNI+IAPD IANQLNVRNGAL+L VPGNSLA
Sbjct  339   AGVGFAIPSSTVLRIVPQLIQSGKVVRAGLNIEIAPDLIANQLNVRNGALILQVPGNSLA  398

Query  671   AKAGILPTTRGFAGNIVLGDIIEAVDNKPVRNKADLYKVLDDYSVGDKVQLKIRRG  504
             AKAG+LPTTRGFAGNIVLGDIIEAVD KPVR+KADLYK LD+Y++GD+V+LKIRRG
Sbjct  399   AKAGLLPTTRGFAGNIVLGDIIEAVDGKPVRSKADLYKALDNYNIGDEVRLKIRRG  454


 Score =   186 bits (473),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 92/111 (83%), Positives = 98/111 (88%), Gaps = 0/111 (0%)
 Frame = -3

Query  1675  LQAYALGDPSVTVEQVTPPTFPSGPLSPSEERIVQLFENNTYSVVNIFDVTLRPRLNVGG  1496
             L A ALGDPSVTVEQVTP TFPS  L PSEER+V+LFE NTY VVNIFDVTLRP LNV G
Sbjct  108   LSALALGDPSVTVEQVTPSTFPSAALFPSEERVVELFEKNTYCVVNIFDVTLRPTLNVTG  167

Query  1495  AVEIPEGNGSGVVWDGEGNIVTNYHVIGNSLSRNPTRGEVVARVNILAPDG  1343
             AVEIPEGNGSGV+WD EG+IVTNYHVIGNSLSRNP+ GEVVARVNILA +G
Sbjct  168   AVEIPEGNGSGVIWDNEGHIVTNYHVIGNSLSRNPSHGEVVARVNILAAEG  218



>ref|XP_009598417.1| PREDICTED: protease Do-like 8, chloroplastic [Nicotiana tomentosiformis]
Length=469

 Score =   431 bits (1107),  Expect = 8e-142, Method: Compositional matrix adjust.
 Identities = 212/236 (90%), Positives = 230/236 (97%), Gaps = 0/236 (0%)
 Frame = -2

Query  1211  LQKNFEGKLVGADRSKDLAVLKVEASEDLLRPTKIGESSSLRVGQKCLAIGNPFGFDHTL  1032
             +QKNFEGKL+GADR+KDLAVLKVE SEDLLRP ++GES+SLRVGQ+CLAIGNPFGFDHTL
Sbjct  219   VQKNFEGKLIGADRAKDLAVLKVETSEDLLRPIRVGESASLRVGQQCLAIGNPFGFDHTL  278

Query  1031  TVGVISGLNRDIYSQTGVTISGGIQTDAAINPGNSGGPLLDSKGNLIGINTAIFTQTGTS  852
             TVGVISGLNRDIYSQTGVTISGGIQTDAAINPGNSGGPLLDSKGNLIGINTAIFTQTGTS
Sbjct  279   TVGVISGLNRDIYSQTGVTISGGIQTDAAINPGNSGGPLLDSKGNLIGINTAIFTQTGTS  338

Query  851   AGVGFAIPSSTVLRIVPQLIQSGKVVRAGLNIDIAPDAIANQLNVRNGALVLLVPGNSLA  672
             AGVGFAIPSSTVLRIVPQLIQSGKVVRAGLNI+IAPD IANQLNVRNGAL+L VPGNSLA
Sbjct  339   AGVGFAIPSSTVLRIVPQLIQSGKVVRAGLNIEIAPDLIANQLNVRNGALILQVPGNSLA  398

Query  671   AKAGILPTTRGFAGNIVLGDIIEAVDNKPVRNKADLYKVLDDYSVGDKVQLKIRRG  504
             AK G+LPTTRGFAGNIVLGDIIEAV++KPVR+KADLYK LD+Y++GD+V+LKIRRG
Sbjct  399   AKVGLLPTTRGFAGNIVLGDIIEAVNDKPVRSKADLYKALDNYNIGDEVRLKIRRG  454


 Score =   187 bits (475),  Expect = 6e-49, Method: Compositional matrix adjust.
 Identities = 92/111 (83%), Positives = 99/111 (89%), Gaps = 0/111 (0%)
 Frame = -3

Query  1675  LQAYALGDPSVTVEQVTPPTFPSGPLSPSEERIVQLFENNTYSVVNIFDVTLRPRLNVGG  1496
             L A ALGDPSVTVEQVTP TFPS  L PSEER+V+LFE NTY VVNIFDVTLRP LNV G
Sbjct  108   LSALALGDPSVTVEQVTPSTFPSAALFPSEERVVELFEKNTYCVVNIFDVTLRPTLNVTG  167

Query  1495  AVEIPEGNGSGVVWDGEGNIVTNYHVIGNSLSRNPTRGEVVARVNILAPDG  1343
             AVEIPEGNGSGV+WD EG+IVTNYHVIGNSLSRNP+RG+VVARVNILA +G
Sbjct  168   AVEIPEGNGSGVIWDNEGHIVTNYHVIGNSLSRNPSRGQVVARVNILAAEG  218



>gb|KDO72539.1| hypothetical protein CISIN_1g019504mg [Citrus sinensis]
Length=340

 Score =   365 bits (938),  Expect(2) = 1e-140, Method: Compositional matrix adjust.
 Identities = 184/210 (88%), Positives = 199/210 (95%), Gaps = 0/210 (0%)
 Frame = -2

Query  1211  LQKNFEGKLVGADRSKDLAVLKVEASEDLLRPTKIGESSSLRVGQKCLAIGNPFGFDHTL  1032
             +QKNFEGKLVGADR+KDLAVLK+EASEDLL+P  +G+SS L+VGQ+CLAIGNPFGFDHTL
Sbjct  102   VQKNFEGKLVGADRAKDLAVLKIEASEDLLKPINVGQSSFLKVGQQCLAIGNPFGFDHTL  161

Query  1031  TVGVISGLNRDIYSQTGVTISGGIQTDAAINPGNSGGPLLDSKGNLIGINTAIFTQTGTS  852
             TVGVISGLNRDI+SQ GVTI GGIQTDAAINPGNSGGPLLDSKGNLIGINTAI TQTGTS
Sbjct  162   TVGVISGLNRDIFSQAGVTIGGGIQTDAAINPGNSGGPLLDSKGNLIGINTAIITQTGTS  221

Query  851   AGVGFAIPSSTVLRIVPQLIQSGKVVRAGLNIDIAPDAIANQLNVRNGALVLLVPGNSLA  672
             AGVGFAIPSSTVL+IVPQLIQ GKVVRAGLN+DIAPD +A+QLNV NGALVL VPGNSLA
Sbjct  222   AGVGFAIPSSTVLKIVPQLIQYGKVVRAGLNVDIAPDLVASQLNVGNGALVLQVPGNSLA  281

Query  671   AKAGILPTTRGFAGNIVLGDIIEAVDNKPV  582
             AKAGILPTTRGFAGNI+LGDII AV+NKPV
Sbjct  282   AKAGILPTTRGFAGNIILGDIIVAVNNKPV  311


 Score =   164 bits (414),  Expect(2) = 1e-140, Method: Compositional matrix adjust.
 Identities = 78/106 (74%), Positives = 91/106 (86%), Gaps = 0/106 (0%)
 Frame = -3

Query  1645  VTVEQVTPPTFPSGPLSPSEERIVQLFENNTYSVVNIFDVTLRPRLNVGGAVEIPEGNGS  1466
             +T+++VTPP FPSG L P+EERI QLFE NTYSVVNIFDVTLRP LNV G VEIPEGNGS
Sbjct  1     MTLKEVTPPVFPSGQLLPNEERIAQLFEKNTYSVVNIFDVTLRPTLNVTGLVEIPEGNGS  60

Query  1465  GVVWDGEGNIVTNYHVIGNSLSRNPTRGEVVARVNILAPDG*EERL  1328
             GVVWDG+G+IVTN+HVIG++LSR P  G+VVARVNILA DG ++  
Sbjct  61    GVVWDGKGHIVTNFHVIGSALSRKPAEGQVVARVNILASDGVQKNF  106



>ref|XP_004233360.1| PREDICTED: protease Do-like 8, chloroplastic [Solanum lycopersicum]
Length=465

 Score =   425 bits (1093),  Expect = 1e-139, Method: Compositional matrix adjust.
 Identities = 211/236 (89%), Positives = 230/236 (97%), Gaps = 0/236 (0%)
 Frame = -2

Query  1211  LQKNFEGKLVGADRSKDLAVLKVEASEDLLRPTKIGESSSLRVGQKCLAIGNPFGFDHTL  1032
             +QKNFEG L+GADR+KDLAVLKV ASEDLLRP ++GESSSLRVGQ+CLAIGNPFGFDHTL
Sbjct  215   VQKNFEGILIGADRAKDLAVLKVGASEDLLRPIRVGESSSLRVGQQCLAIGNPFGFDHTL  274

Query  1031  TVGVISGLNRDIYSQTGVTISGGIQTDAAINPGNSGGPLLDSKGNLIGINTAIFTQTGTS  852
             TVGVISGLNRDIYSQTGVTI GGIQTDAAINPGNSGGPLLDSKGNLIGINTAIFTQTGTS
Sbjct  275   TVGVISGLNRDIYSQTGVTIGGGIQTDAAINPGNSGGPLLDSKGNLIGINTAIFTQTGTS  334

Query  851   AGVGFAIPSSTVLRIVPQLIQSGKVVRAGLNIDIAPDAIANQLNVRNGALVLLVPGNSLA  672
             AGVGFAIPSSTVLR+VPQLIQSGKV+RAGLNI+IAPD IANQLNVRNGALVLLVPGNS A
Sbjct  335   AGVGFAIPSSTVLRVVPQLIQSGKVLRAGLNIEIAPDLIANQLNVRNGALVLLVPGNSPA  394

Query  671   AKAGILPTTRGFAGNIVLGDIIEAVDNKPVRNKADLYKVLDDYSVGDKVQLKIRRG  504
             AKAG+LPTTRGFAGNIVLGDIIEAVD+KPV++KADLYK+LD+Y++GD+V+LKIRRG
Sbjct  395   AKAGLLPTTRGFAGNIVLGDIIEAVDDKPVKSKADLYKILDNYNIGDEVRLKIRRG  450


 Score =   182 bits (462),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 90/111 (81%), Positives = 96/111 (86%), Gaps = 0/111 (0%)
 Frame = -3

Query  1675  LQAYALGDPSVTVEQVTPPTFPSGPLSPSEERIVQLFENNTYSVVNIFDVTLRPRLNVGG  1496
             L A ALGDPSVTVEQVTP  FPS  L P EER+V+LFE NTY VVNIFDVTLRP LNV G
Sbjct  104   LSALALGDPSVTVEQVTPTIFPSAALFPLEERVVELFEKNTYCVVNIFDVTLRPTLNVTG  163

Query  1495  AVEIPEGNGSGVVWDGEGNIVTNYHVIGNSLSRNPTRGEVVARVNILAPDG  1343
              VEIPEGNGSGV+WD EG+IVTNYHVIGNSLSRNP+RG+VVARVNILA DG
Sbjct  164   MVEIPEGNGSGVIWDKEGHIVTNYHVIGNSLSRNPSRGQVVARVNILAADG  214



>ref|XP_006357113.1| PREDICTED: protease Do-like 8, chloroplastic-like [Solanum tuberosum]
Length=460

 Score =   425 bits (1092),  Expect = 1e-139, Method: Compositional matrix adjust.
 Identities = 210/236 (89%), Positives = 229/236 (97%), Gaps = 0/236 (0%)
 Frame = -2

Query  1211  LQKNFEGKLVGADRSKDLAVLKVEASEDLLRPTKIGESSSLRVGQKCLAIGNPFGFDHTL  1032
             +QKNFEG L+GADR+KDLAVLKVEASEDLLRP ++GESSSLRVGQ+CLAIGNPFGFDHTL
Sbjct  210   VQKNFEGILIGADRAKDLAVLKVEASEDLLRPIRVGESSSLRVGQQCLAIGNPFGFDHTL  269

Query  1031  TVGVISGLNRDIYSQTGVTISGGIQTDAAINPGNSGGPLLDSKGNLIGINTAIFTQTGTS  852
             TVGVISGLNRDIYSQTGVTI GGIQTDAAINPGNSGGPLLDSKGNLIGINTAIFTQTGTS
Sbjct  270   TVGVISGLNRDIYSQTGVTIGGGIQTDAAINPGNSGGPLLDSKGNLIGINTAIFTQTGTS  329

Query  851   AGVGFAIPSSTVLRIVPQLIQSGKVVRAGLNIDIAPDAIANQLNVRNGALVLLVPGNSLA  672
             AGVGFAIPSSTVLR+VPQLIQ+GKV+RAGLNI+IAPD IANQLNVRNGALVLLVPGNS A
Sbjct  330   AGVGFAIPSSTVLRVVPQLIQAGKVLRAGLNIEIAPDLIANQLNVRNGALVLLVPGNSPA  389

Query  671   AKAGILPTTRGFAGNIVLGDIIEAVDNKPVRNKADLYKVLDDYSVGDKVQLKIRRG  504
             AK G+LPTTRGFAGNIVLGDIIEAVD+KPVR+KA+LYK LD+Y++GD+V+LKIRRG
Sbjct  390   AKVGLLPTTRGFAGNIVLGDIIEAVDDKPVRSKAELYKALDNYNIGDEVRLKIRRG  445


 Score =   186 bits (472),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 91/111 (82%), Positives = 98/111 (88%), Gaps = 0/111 (0%)
 Frame = -3

Query  1675  LQAYALGDPSVTVEQVTPPTFPSGPLSPSEERIVQLFENNTYSVVNIFDVTLRPRLNVGG  1496
             L A ALGDPSVTVEQVTP TFPS  L PSEER+V+LFE NTY VVNIFDVTLRP LNV G
Sbjct  99    LSALALGDPSVTVEQVTPSTFPSAELFPSEERVVELFEKNTYCVVNIFDVTLRPTLNVTG  158

Query  1495  AVEIPEGNGSGVVWDGEGNIVTNYHVIGNSLSRNPTRGEVVARVNILAPDG  1343
              VEIPEGNGSG++WD EG+IVTNYHVIGNSLSRNP+RG+VVARVNILA DG
Sbjct  159   MVEIPEGNGSGIIWDKEGHIVTNYHVIGNSLSRNPSRGQVVARVNILAADG  209



>ref|XP_010661062.1| PREDICTED: protease Do-like 8, chloroplastic isoform X2 [Vitis 
vinifera]
Length=372

 Score =   421 bits (1083),  Expect = 1e-139, Method: Compositional matrix adjust.
 Identities = 209/236 (89%), Positives = 226/236 (96%), Gaps = 0/236 (0%)
 Frame = -2

Query  1211  LQKNFEGKLVGADRSKDLAVLKVEASEDLLRPTKIGESSSLRVGQKCLAIGNPFGFDHTL  1032
             +QKNFEGKL+GADR+KDLAVLK+EASEDLLRP K+G+SS LRVGQ+CLAIGNPFGFDHTL
Sbjct  122   VQKNFEGKLIGADRTKDLAVLKIEASEDLLRPMKVGQSSYLRVGQQCLAIGNPFGFDHTL  181

Query  1031  TVGVISGLNRDIYSQTGVTISGGIQTDAAINPGNSGGPLLDSKGNLIGINTAIFTQTGTS  852
             TVGVISGLNRDI+SQTGVTI GGIQTDAAINPGNSGGPLLDSKGNLIGINTAIFTQTGTS
Sbjct  182   TVGVISGLNRDIFSQTGVTIGGGIQTDAAINPGNSGGPLLDSKGNLIGINTAIFTQTGTS  241

Query  851   AGVGFAIPSSTVLRIVPQLIQSGKVVRAGLNIDIAPDAIANQLNVRNGALVLLVPGNSLA  672
             AGVGFAIPSSTVL+IVPQLIQ GKVVRAGLN DIAPD +ANQLNVRNGALVLLVPG+SLA
Sbjct  242   AGVGFAIPSSTVLKIVPQLIQYGKVVRAGLNADIAPDLVANQLNVRNGALVLLVPGDSLA  301

Query  671   AKAGILPTTRGFAGNIVLGDIIEAVDNKPVRNKADLYKVLDDYSVGDKVQLKIRRG  504
             AKAG+LPTTRGFAGNI+LGDII AVDNKPVR+KA+LYK LDDY+VGDKV  KI+RG
Sbjct  302   AKAGLLPTTRGFAGNIMLGDIIVAVDNKPVRSKAELYKALDDYNVGDKVLFKIQRG  357


 Score =   184 bits (466),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 90/111 (81%), Positives = 100/111 (90%), Gaps = 0/111 (0%)
 Frame = -3

Query  1675  LQAYALGDPSVTVEQVTPPTFPSGPLSPSEERIVQLFENNTYSVVNIFDVTLRPRLNVGG  1496
             L A+ALGDPSVT+E+VTPP  PSGPL P+EERIVQLFE NTYSVVNIFDVTLRP+LNV G
Sbjct  11    LSAHALGDPSVTIEEVTPPVSPSGPLFPTEERIVQLFERNTYSVVNIFDVTLRPQLNVTG  70

Query  1495  AVEIPEGNGSGVVWDGEGNIVTNYHVIGNSLSRNPTRGEVVARVNILAPDG  1343
             AVE+PEGNGSGVVWD +G+IVTNYHVIGN+LSRN   G+VVARVNILA DG
Sbjct  71    AVEVPEGNGSGVVWDEQGHIVTNYHVIGNALSRNSKPGQVVARVNILASDG  121



>ref|XP_002278099.2| PREDICTED: protease Do-like 8, chloroplastic isoform X1 [Vitis 
vinifera]
 ref|XP_010661061.1| PREDICTED: protease Do-like 8, chloroplastic isoform X1 [Vitis 
vinifera]
 emb|CBI22201.3| unnamed protein product [Vitis vinifera]
Length=449

 Score =   421 bits (1083),  Expect = 2e-138, Method: Compositional matrix adjust.
 Identities = 209/236 (89%), Positives = 226/236 (96%), Gaps = 0/236 (0%)
 Frame = -2

Query  1211  LQKNFEGKLVGADRSKDLAVLKVEASEDLLRPTKIGESSSLRVGQKCLAIGNPFGFDHTL  1032
             +QKNFEGKL+GADR+KDLAVLK+EASEDLLRP K+G+SS LRVGQ+CLAIGNPFGFDHTL
Sbjct  199   VQKNFEGKLIGADRTKDLAVLKIEASEDLLRPMKVGQSSYLRVGQQCLAIGNPFGFDHTL  258

Query  1031  TVGVISGLNRDIYSQTGVTISGGIQTDAAINPGNSGGPLLDSKGNLIGINTAIFTQTGTS  852
             TVGVISGLNRDI+SQTGVTI GGIQTDAAINPGNSGGPLLDSKGNLIGINTAIFTQTGTS
Sbjct  259   TVGVISGLNRDIFSQTGVTIGGGIQTDAAINPGNSGGPLLDSKGNLIGINTAIFTQTGTS  318

Query  851   AGVGFAIPSSTVLRIVPQLIQSGKVVRAGLNIDIAPDAIANQLNVRNGALVLLVPGNSLA  672
             AGVGFAIPSSTVL+IVPQLIQ GKVVRAGLN DIAPD +ANQLNVRNGALVLLVPG+SLA
Sbjct  319   AGVGFAIPSSTVLKIVPQLIQYGKVVRAGLNADIAPDLVANQLNVRNGALVLLVPGDSLA  378

Query  671   AKAGILPTTRGFAGNIVLGDIIEAVDNKPVRNKADLYKVLDDYSVGDKVQLKIRRG  504
             AKAG+LPTTRGFAGNI+LGDII AVDNKPVR+KA+LYK LDDY+VGDKV  KI+RG
Sbjct  379   AKAGLLPTTRGFAGNIMLGDIIVAVDNKPVRSKAELYKALDDYNVGDKVLFKIQRG  434


 Score =   184 bits (467),  Expect = 6e-48, Method: Compositional matrix adjust.
 Identities = 90/111 (81%), Positives = 100/111 (90%), Gaps = 0/111 (0%)
 Frame = -3

Query  1675  LQAYALGDPSVTVEQVTPPTFPSGPLSPSEERIVQLFENNTYSVVNIFDVTLRPRLNVGG  1496
             L A+ALGDPSVT+E+VTPP  PSGPL P+EERIVQLFE NTYSVVNIFDVTLRP+LNV G
Sbjct  88    LSAHALGDPSVTIEEVTPPVSPSGPLFPTEERIVQLFERNTYSVVNIFDVTLRPQLNVTG  147

Query  1495  AVEIPEGNGSGVVWDGEGNIVTNYHVIGNSLSRNPTRGEVVARVNILAPDG  1343
             AVE+PEGNGSGVVWD +G+IVTNYHVIGN+LSRN   G+VVARVNILA DG
Sbjct  148   AVEVPEGNGSGVVWDEQGHIVTNYHVIGNALSRNSKPGQVVARVNILASDG  198



>ref|XP_007032515.1| Trypsin family protein with PDZ domain [Theobroma cacao]
 gb|EOY03441.1| Trypsin family protein with PDZ domain [Theobroma cacao]
Length=456

 Score =   417 bits (1072),  Expect = 1e-136, Method: Compositional matrix adjust.
 Identities = 206/236 (87%), Positives = 225/236 (95%), Gaps = 0/236 (0%)
 Frame = -2

Query  1211  LQKNFEGKLVGADRSKDLAVLKVEASEDLLRPTKIGESSSLRVGQKCLAIGNPFGFDHTL  1032
             +QKNFEGKL+GADR+KDLAVLKVEASEDLLRP K+G+SS+LRVGQ+CLAIGNPFGFDHTL
Sbjct  206   VQKNFEGKLIGADRTKDLAVLKVEASEDLLRPIKVGQSSTLRVGQQCLAIGNPFGFDHTL  265

Query  1031  TVGVISGLNRDIYSQTGVTISGGIQTDAAINPGNSGGPLLDSKGNLIGINTAIFTQTGTS  852
             TVGVISGLNRDI+SQTGVTI GGIQTDAAINPGNSGGPLLDSKGNLIGINTAIFTQTGTS
Sbjct  266   TVGVISGLNRDIFSQTGVTIGGGIQTDAAINPGNSGGPLLDSKGNLIGINTAIFTQTGTS  325

Query  851   AGVGFAIPSSTVLRIVPQLIQSGKVVRAGLNIDIAPDAIANQLNVRNGALVLLVPGNSLA  672
             AGVGFAIPSSTVL+IVPQLIQ GK VRAGLNI+IAP+ IANQLNVR GAL+L VPGNSLA
Sbjct  326   AGVGFAIPSSTVLKIVPQLIQFGKAVRAGLNIEIAPELIANQLNVRKGALILQVPGNSLA  385

Query  671   AKAGILPTTRGFAGNIVLGDIIEAVDNKPVRNKADLYKVLDDYSVGDKVQLKIRRG  504
             AKAG+LPTTRGFAGNI+LGDII AV+NKPV+NK +LYK LDDY+VGDKV LKI+RG
Sbjct  386   AKAGLLPTTRGFAGNIILGDIILAVNNKPVKNKGELYKALDDYNVGDKVTLKIQRG  441


 Score =   181 bits (460),  Expect = 6e-47, Method: Compositional matrix adjust.
 Identities = 89/111 (80%), Positives = 98/111 (88%), Gaps = 0/111 (0%)
 Frame = -3

Query  1675  LQAYALGDPSVTVEQVTPPTFPSGPLSPSEERIVQLFENNTYSVVNIFDVTLRPRLNVGG  1496
             L A ALGDP+V VE VTPP FPSG L PSE+R VQLFE NTYSVVNIFD+TLRP+LNV G
Sbjct  95    LSAQALGDPTVRVEDVTPPVFPSGALFPSEDRTVQLFEKNTYSVVNIFDITLRPQLNVTG  154

Query  1495  AVEIPEGNGSGVVWDGEGNIVTNYHVIGNSLSRNPTRGEVVARVNILAPDG  1343
             AVEIPEGNGSGVVWD +G+IVTNYHVIGNSLSRNP+ G+VVARVNILA +G
Sbjct  155   AVEIPEGNGSGVVWDEQGHIVTNYHVIGNSLSRNPSPGQVVARVNILASEG  205



>gb|KDP27141.1| hypothetical protein JCGZ_19840 [Jatropha curcas]
Length=427

 Score =   415 bits (1066),  Expect = 3e-136, Method: Compositional matrix adjust.
 Identities = 207/236 (88%), Positives = 223/236 (94%), Gaps = 0/236 (0%)
 Frame = -2

Query  1211  LQKNFEGKLVGADRSKDLAVLKVEASEDLLRPTKIGESSSLRVGQKCLAIGNPFGFDHTL  1032
             +QKNFEGKL+GADR+KDLAVLKVEA EDLLRP K+G+S+SL+VGQ+CLAIGNPFGFDHTL
Sbjct  177   VQKNFEGKLIGADRAKDLAVLKVEAPEDLLRPIKVGQSASLKVGQQCLAIGNPFGFDHTL  236

Query  1031  TVGVISGLNRDIYSQTGVTISGGIQTDAAINPGNSGGPLLDSKGNLIGINTAIFTQTGTS  852
             TVGVISGLNRDI+SQTGVTI GGIQTDAAINPGNSGGPLLDSKGNLIGINTAIFTQTGTS
Sbjct  237   TVGVISGLNRDIFSQTGVTIGGGIQTDAAINPGNSGGPLLDSKGNLIGINTAIFTQTGTS  296

Query  851   AGVGFAIPSSTVLRIVPQLIQSGKVVRAGLNIDIAPDAIANQLNVRNGALVLLVPGNSLA  672
             AGVGFAIPSSTVL+IVPQLI+ GKVVRAGLN++IAPD IANQLNVRNGAL+L VPGNSL 
Sbjct  297   AGVGFAIPSSTVLKIVPQLIKFGKVVRAGLNVEIAPDLIANQLNVRNGALILQVPGNSLP  356

Query  671   AKAGILPTTRGFAGNIVLGDIIEAVDNKPVRNKADLYKVLDDYSVGDKVQLKIRRG  504
             AKAG+LPTTRGFAG IVLGDII AVDNKPV+NKA LYKVLDDYSVGD V LKI RG
Sbjct  357   AKAGLLPTTRGFAGKIVLGDIIVAVDNKPVKNKAALYKVLDDYSVGDTVMLKILRG  412


 Score =   185 bits (469),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 90/118 (76%), Positives = 103/118 (87%), Gaps = 0/118 (0%)
 Frame = -3

Query  1696  LCTQFITLQAYALGDPSVTVEQVTPPTFPSGPLSPSEERIVQLFENNTYSVVNIFDVTLR  1517
             + T+ + +   ALGDPSVTVE+VTPP FPSG L P+EERIVQLFE NTY+VVNIFDVTLR
Sbjct  59    VTTRRMLISTQALGDPSVTVEEVTPPVFPSGALFPTEERIVQLFEKNTYTVVNIFDVTLR  118

Query  1516  PRLNVGGAVEIPEGNGSGVVWDGEGNIVTNYHVIGNSLSRNPTRGEVVARVNILAPDG  1343
             P+LNV G VEIPEGNGSGVVWDG G+IVTNYHVIGN+LSRNP+ G+VVARVNILA +G
Sbjct  119   PQLNVTGVVEIPEGNGSGVVWDGWGHIVTNYHVIGNALSRNPSSGQVVARVNILASEG  176



>ref|XP_002524371.1| Protease degQ precursor, putative [Ricinus communis]
 gb|EEF37982.1| Protease degQ precursor, putative [Ricinus communis]
Length=453

 Score =   414 bits (1064),  Expect = 2e-135, Method: Compositional matrix adjust.
 Identities = 204/236 (86%), Positives = 226/236 (96%), Gaps = 0/236 (0%)
 Frame = -2

Query  1211  LQKNFEGKLVGADRSKDLAVLKVEASEDLLRPTKIGESSSLRVGQKCLAIGNPFGFDHTL  1032
             +QKNFEGKL+GADR+KDLAVLKVEAS+DLL+P K+G+SSSLRVGQ+CLAIGNPFGFDHTL
Sbjct  203   VQKNFEGKLIGADRAKDLAVLKVEASDDLLKPIKVGQSSSLRVGQQCLAIGNPFGFDHTL  262

Query  1031  TVGVISGLNRDIYSQTGVTISGGIQTDAAINPGNSGGPLLDSKGNLIGINTAIFTQTGTS  852
             TVGVISGLNRDI+SQTGVTI GGIQTDAAINPGNSGGPLLDSKG+LIGINTAIFTQTGTS
Sbjct  263   TVGVISGLNRDIFSQTGVTIGGGIQTDAAINPGNSGGPLLDSKGSLIGINTAIFTQTGTS  322

Query  851   AGVGFAIPSSTVLRIVPQLIQSGKVVRAGLNIDIAPDAIANQLNVRNGALVLLVPGNSLA  672
             AGVGFAIPSSTVL+IVPQLIQ GKVVRA LN++IAPD IANQLNVRNGAL+L VPGNSLA
Sbjct  323   AGVGFAIPSSTVLKIVPQLIQFGKVVRAALNVEIAPDLIANQLNVRNGALILQVPGNSLA  382

Query  671   AKAGILPTTRGFAGNIVLGDIIEAVDNKPVRNKADLYKVLDDYSVGDKVQLKIRRG  504
             AKAG+LPTTRGFAGNIVLGD+I AVDN PV++KA+LYK+LDDY+VGD V LKI+RG
Sbjct  383   AKAGLLPTTRGFAGNIVLGDVILAVDNMPVKSKAELYKLLDDYNVGDTVMLKIQRG  438


 Score =   181 bits (458),  Expect = 9e-47, Method: Compositional matrix adjust.
 Identities = 89/111 (80%), Positives = 98/111 (88%), Gaps = 0/111 (0%)
 Frame = -3

Query  1675  LQAYALGDPSVTVEQVTPPTFPSGPLSPSEERIVQLFENNTYSVVNIFDVTLRPRLNVGG  1496
             L A ALGDPSVTVE+VTPP   SG L P+EERIVQLFE NTYSVVNIFDVTLRP+LN+ G
Sbjct  92    LSAQALGDPSVTVEEVTPPVSLSGALFPTEERIVQLFEKNTYSVVNIFDVTLRPQLNITG  151

Query  1495  AVEIPEGNGSGVVWDGEGNIVTNYHVIGNSLSRNPTRGEVVARVNILAPDG  1343
              VEIPEGNGSGVVWDG+G+IVTNYHVIGN+LSRNP  G+VVARVNILA +G
Sbjct  152   VVEIPEGNGSGVVWDGQGHIVTNYHVIGNALSRNPGSGQVVARVNILASEG  202



>ref|XP_008459309.1| PREDICTED: protease Do-like 8, chloroplastic [Cucumis melo]
Length=461

 Score =   409 bits (1050),  Expect = 3e-133, Method: Compositional matrix adjust.
 Identities = 199/236 (84%), Positives = 224/236 (95%), Gaps = 0/236 (0%)
 Frame = -2

Query  1211  LQKNFEGKLVGADRSKDLAVLKVEASEDLLRPTKIGESSSLRVGQKCLAIGNPFGFDHTL  1032
             +QKNFEGKL+GADR+KDLAVLKV+AS DLLRP K+G+SSSL+VGQ+CLAIGNPFGFDHTL
Sbjct  212   IQKNFEGKLIGADRTKDLAVLKVDASNDLLRPIKVGQSSSLKVGQQCLAIGNPFGFDHTL  271

Query  1031  TVGVISGLNRDIYSQTGVTISGGIQTDAAINPGNSGGPLLDSKGNLIGINTAIFTQTGTS  852
             TVGVISGLNRDI+SQTGVTI GGIQTDAAINPGNSGGPLLDSKGNLIGINTAIFTQTGTS
Sbjct  272   TVGVISGLNRDIFSQTGVTIGGGIQTDAAINPGNSGGPLLDSKGNLIGINTAIFTQTGTS  331

Query  851   AGVGFAIPSSTVLRIVPQLIQSGKVVRAGLNIDIAPDAIANQLNVRNGALVLLVPGNSLA  672
             AGVGFAIPSSTV++IVPQLIQ G+VVRAG+N+D APD IANQLNVR+GAL+L VP NS A
Sbjct  332   AGVGFAIPSSTVVKIVPQLIQFGRVVRAGINVDFAPDLIANQLNVRDGALILQVPANSPA  391

Query  671   AKAGILPTTRGFAGNIVLGDIIEAVDNKPVRNKADLYKVLDDYSVGDKVQLKIRRG  504
             AKAG+LPTTRGFAGNIVLGDII A+DNKPV+NKA+LYK+LD+Y+ GDK+ LKI+RG
Sbjct  392   AKAGLLPTTRGFAGNIVLGDIIAAIDNKPVKNKAELYKLLDEYNAGDKIILKIKRG  447


 Score =   172 bits (436),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 83/109 (76%), Positives = 95/109 (87%), Gaps = 0/109 (0%)
 Frame = -3

Query  1669  AYALGDPSVTVEQVTPPTFPSGPLSPSEERIVQLFENNTYSVVNIFDVTLRPRLNVGGAV  1490
             A ALGDPSVT+++VTP   PSG L P+EERI QLFE NTYSVVNIFDVTLRP+LNV G V
Sbjct  103   AQALGDPSVTIDEVTPTISPSGSLFPTEERIAQLFEKNTYSVVNIFDVTLRPQLNVTGMV  162

Query  1489  EIPEGNGSGVVWDGEGNIVTNYHVIGNSLSRNPTRGEVVARVNILAPDG  1343
             EIPEGNGSGVVWD +G+IVTNYHVI ++L+RNP+ G+VVARVNILA DG
Sbjct  163   EIPEGNGSGVVWDDQGHIVTNYHVIASALARNPSAGQVVARVNILASDG  211



>ref|XP_006593673.1| PREDICTED: protease Do-like 8, chloroplastic-like isoform X2 
[Glycine max]
Length=459

 Score =   408 bits (1048),  Expect = 4e-133, Method: Compositional matrix adjust.
 Identities = 205/236 (87%), Positives = 222/236 (94%), Gaps = 0/236 (0%)
 Frame = -2

Query  1211  LQKNFEGKLVGADRSKDLAVLKVEASEDLLRPTKIGESSSLRVGQKCLAIGNPFGFDHTL  1032
             LQKNFEG+L+GADR KDLAVLKVEA +D+LRP K+G+SSSL+VGQ+CLAIGNPFGFDHTL
Sbjct  209   LQKNFEGRLIGADRLKDLAVLKVEAPKDILRPIKVGQSSSLKVGQQCLAIGNPFGFDHTL  268

Query  1031  TVGVISGLNRDIYSQTGVTISGGIQTDAAINPGNSGGPLLDSKGNLIGINTAIFTQTGTS  852
             TVGVISGLNRDI SQTGVTI GG+QTDAAINPGNSGGPLLDSKG+LIGINTAIFT+TGTS
Sbjct  269   TVGVISGLNRDISSQTGVTIGGGVQTDAAINPGNSGGPLLDSKGSLIGINTAIFTRTGTS  328

Query  851   AGVGFAIPSSTVLRIVPQLIQSGKVVRAGLNIDIAPDAIANQLNVRNGALVLLVPGNSLA  672
             AGVGFAIPSSTVLRIVPQLIQ GKVVRAGLN+DIAPD IANQLNVRNGALVLLVP NSLA
Sbjct  329   AGVGFAIPSSTVLRIVPQLIQFGKVVRAGLNVDIAPDLIANQLNVRNGALVLLVPANSLA  388

Query  671   AKAGILPTTRGFAGNIVLGDIIEAVDNKPVRNKADLYKVLDDYSVGDKVQLKIRRG  504
             AKAG+ PTTRGFAGNIVLGDII AVDNKPV++KADL K LDDY+VGDKV L I+RG
Sbjct  389   AKAGLNPTTRGFAGNIVLGDIIVAVDNKPVKSKADLLKALDDYNVGDKVVLMIQRG  444


 Score =   183 bits (465),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 92/118 (78%), Positives = 100/118 (85%), Gaps = 1/118 (1%)
 Frame = -3

Query  1696  LCTQFITLQAYALGDPSVTVEQVTPPTFPSGPLSPSEERIVQLFENNTYSVVNIFDVTLR  1517
             LC+    L A ALGDPSV +E+VTPP F SGPL P E+RIVQLFE NTYSVVNIFDVTLR
Sbjct  92    LCSSRF-LSALALGDPSVKLEEVTPPVFSSGPLFPIEDRIVQLFERNTYSVVNIFDVTLR  150

Query  1516  PRLNVGGAVEIPEGNGSGVVWDGEGNIVTNYHVIGNSLSRNPTRGEVVARVNILAPDG  1343
             P+LNV G VEIPEGNGSGVVWD EG+IVTNYHVIGN+LSRNP  GEVVARVNILA +G
Sbjct  151   PQLNVTGVVEIPEGNGSGVVWDEEGHIVTNYHVIGNALSRNPNSGEVVARVNILASEG  208



>ref|XP_003543778.1| PREDICTED: protease Do-like 8, chloroplastic-like isoform X1 
[Glycine max]
Length=458

 Score =   408 bits (1048),  Expect = 4e-133, Method: Compositional matrix adjust.
 Identities = 205/236 (87%), Positives = 222/236 (94%), Gaps = 0/236 (0%)
 Frame = -2

Query  1211  LQKNFEGKLVGADRSKDLAVLKVEASEDLLRPTKIGESSSLRVGQKCLAIGNPFGFDHTL  1032
             LQKNFEG+L+GADR KDLAVLKVEA +D+LRP K+G+SSSL+VGQ+CLAIGNPFGFDHTL
Sbjct  208   LQKNFEGRLIGADRLKDLAVLKVEAPKDILRPIKVGQSSSLKVGQQCLAIGNPFGFDHTL  267

Query  1031  TVGVISGLNRDIYSQTGVTISGGIQTDAAINPGNSGGPLLDSKGNLIGINTAIFTQTGTS  852
             TVGVISGLNRDI SQTGVTI GG+QTDAAINPGNSGGPLLDSKG+LIGINTAIFT+TGTS
Sbjct  268   TVGVISGLNRDISSQTGVTIGGGVQTDAAINPGNSGGPLLDSKGSLIGINTAIFTRTGTS  327

Query  851   AGVGFAIPSSTVLRIVPQLIQSGKVVRAGLNIDIAPDAIANQLNVRNGALVLLVPGNSLA  672
             AGVGFAIPSSTVLRIVPQLIQ GKVVRAGLN+DIAPD IANQLNVRNGALVLLVP NSLA
Sbjct  328   AGVGFAIPSSTVLRIVPQLIQFGKVVRAGLNVDIAPDLIANQLNVRNGALVLLVPANSLA  387

Query  671   AKAGILPTTRGFAGNIVLGDIIEAVDNKPVRNKADLYKVLDDYSVGDKVQLKIRRG  504
             AKAG+ PTTRGFAGNIVLGDII AVDNKPV++KADL K LDDY+VGDKV L I+RG
Sbjct  388   AKAGLNPTTRGFAGNIVLGDIIVAVDNKPVKSKADLLKALDDYNVGDKVVLMIQRG  443


 Score =   183 bits (464),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 92/118 (78%), Positives = 100/118 (85%), Gaps = 1/118 (1%)
 Frame = -3

Query  1696  LCTQFITLQAYALGDPSVTVEQVTPPTFPSGPLSPSEERIVQLFENNTYSVVNIFDVTLR  1517
             LC+    L A ALGDPSV +E+VTPP F SGPL P E+RIVQLFE NTYSVVNIFDVTLR
Sbjct  91    LCSSRF-LSALALGDPSVKLEEVTPPVFSSGPLFPIEDRIVQLFERNTYSVVNIFDVTLR  149

Query  1516  PRLNVGGAVEIPEGNGSGVVWDGEGNIVTNYHVIGNSLSRNPTRGEVVARVNILAPDG  1343
             P+LNV G VEIPEGNGSGVVWD EG+IVTNYHVIGN+LSRNP  GEVVARVNILA +G
Sbjct  150   PQLNVTGVVEIPEGNGSGVVWDEEGHIVTNYHVIGNALSRNPNSGEVVARVNILASEG  207



>ref|XP_011012611.1| PREDICTED: protease Do-like 8, chloroplastic [Populus euphratica]
Length=301

 Score =   400 bits (1029),  Expect = 2e-132, Method: Compositional matrix adjust.
 Identities = 205/236 (87%), Positives = 220/236 (93%), Gaps = 0/236 (0%)
 Frame = -2

Query  1211  LQKNFEGKLVGADRSKDLAVLKVEASEDLLRPTKIGESSSLRVGQKCLAIGNPFGFDHTL  1032
             LQKNFEGKLVGADR+KDLAVLKVEASEDLL+P K+G+SSSLRVGQ+CLAIGNPFGFDHTL
Sbjct  52    LQKNFEGKLVGADRTKDLAVLKVEASEDLLKPIKVGQSSSLRVGQQCLAIGNPFGFDHTL  111

Query  1031  TVGVISGLNRDIYSQTGVTISGGIQTDAAINPGNSGGPLLDSKGNLIGINTAIFTQTGTS  852
             TVGVISGLNRDI SQTGVTI GGIQTDAAINPGNSGGPLLDSKGNLIGINTAIFT+TGTS
Sbjct  112   TVGVISGLNRDISSQTGVTIGGGIQTDAAINPGNSGGPLLDSKGNLIGINTAIFTRTGTS  171

Query  851   AGVGFAIPSSTVLRIVPQLIQSGKVVRAGLNIDIAPDAIANQLNVRNGALVLLVPGNSLA  672
             AGVGFAIPSSTVL+I  QLIQ  KVVRAGLN+DIAPD IANQLNVRNGAL+L VPGNSLA
Sbjct  172   AGVGFAIPSSTVLKIALQLIQFSKVVRAGLNVDIAPDLIANQLNVRNGALILQVPGNSLA  231

Query  671   AKAGILPTTRGFAGNIVLGDIIEAVDNKPVRNKADLYKVLDDYSVGDKVQLKIRRG  504
             AKAG++PTTRGFAGNIVLGDII  VDNK V+NKA L KVLDDY+VGD+V L I+RG
Sbjct  232   AKAGLVPTTRGFAGNIVLGDIIVGVDNKTVKNKAGLDKVLDDYNVGDRVLLIIQRG  287


 Score = 87.4 bits (215),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 41/50 (82%), Positives = 47/50 (94%), Gaps = 0/50 (0%)
 Frame = -3

Query  1492  VEIPEGNGSGVVWDGEGNIVTNYHVIGNSLSRNPTRGEVVARVNILAPDG  1343
             VEIPEGNGSGVVWD +G+IVTNYHVIGN+LSRNP+ G+VVARVNILA +G
Sbjct  2     VEIPEGNGSGVVWDEQGHIVTNYHVIGNALSRNPSPGQVVARVNILASEG  51



>ref|XP_006405593.1| hypothetical protein EUTSA_v10027761mg [Eutrema salsugineum]
 gb|ESQ47046.1| hypothetical protein EUTSA_v10027761mg [Eutrema salsugineum]
Length=453

 Score =   406 bits (1044),  Expect = 2e-132, Method: Compositional matrix adjust.
 Identities = 198/236 (84%), Positives = 226/236 (96%), Gaps = 0/236 (0%)
 Frame = -2

Query  1211  LQKNFEGKLVGADRSKDLAVLKVEASEDLLRPTKIGESSSLRVGQKCLAIGNPFGFDHTL  1032
             +QKNFEGKLVGADR+KDLAVLKVEA E LL+P ++G+S+SL+VGQ+CLAIGNPFGFDHTL
Sbjct  203   VQKNFEGKLVGADRTKDLAVLKVEAPEALLKPIRVGQSNSLKVGQQCLAIGNPFGFDHTL  262

Query  1031  TVGVISGLNRDIYSQTGVTISGGIQTDAAINPGNSGGPLLDSKGNLIGINTAIFTQTGTS  852
             TVGVISGLNRDI+SQTGVTI GGIQTDAAINPGNSGGPLLDSKGNL+GINTAIFTQTGTS
Sbjct  263   TVGVISGLNRDIFSQTGVTIGGGIQTDAAINPGNSGGPLLDSKGNLVGINTAIFTQTGTS  322

Query  851   AGVGFAIPSSTVLRIVPQLIQSGKVVRAGLNIDIAPDAIANQLNVRNGALVLLVPGNSLA  672
             AGVGFAIPSSTV++IVPQLIQ  KV+RAG+NI++APD++ANQLNVRNGALVL VPGNSLA
Sbjct  323   AGVGFAIPSSTVMKIVPQLIQFSKVLRAGINIELAPDSVANQLNVRNGALVLQVPGNSLA  382

Query  671   AKAGILPTTRGFAGNIVLGDIIEAVDNKPVRNKADLYKVLDDYSVGDKVQLKIRRG  504
              KAG+LPT+RGFAGNIVLGDII AVD+KPVRNKA+L K+LD+YSVGD+V+LKI+RG
Sbjct  383   EKAGLLPTSRGFAGNIVLGDIIVAVDDKPVRNKAELMKILDEYSVGDEVKLKIKRG  438


 Score =   169 bits (427),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 85/112 (76%), Positives = 95/112 (85%), Gaps = 1/112 (1%)
 Frame = -3

Query  1675  LQAYALGDPSVT-VEQVTPPTFPSGPLSPSEERIVQLFENNTYSVVNIFDVTLRPRLNVG  1499
             L A ALGDPSVT +E V+P  FP+GPL P+E RIVQLFENNTYSVVNIFDVTLRP+L + 
Sbjct  91    LSALALGDPSVTTLEDVSPSVFPAGPLFPTEGRIVQLFENNTYSVVNIFDVTLRPQLKMT  150

Query  1498  GAVEIPEGNGSGVVWDGEGNIVTNYHVIGNSLSRNPTRGEVVARVNILAPDG  1343
             G VEIPEGNGSGVVWD +G IVTNYHVIGN+LSRNP+ G+VV RVNIL  DG
Sbjct  151   GVVEIPEGNGSGVVWDEQGYIVTNYHVIGNALSRNPSPGDVVGRVNILTYDG  202



>ref|XP_010258373.1| PREDICTED: protease Do-like 8, chloroplastic isoform X4 [Nelumbo 
nucifera]
Length=352

 Score =   402 bits (1032),  Expect = 4e-132, Method: Compositional matrix adjust.
 Identities = 198/236 (84%), Positives = 223/236 (94%), Gaps = 0/236 (0%)
 Frame = -2

Query  1211  LQKNFEGKLVGADRSKDLAVLKVEASEDLLRPTKIGESSSLRVGQKCLAIGNPFGFDHTL  1032
             +QKNFEGKL+GADR+KDLAVLKVEA EDLLRP  +G+S+SL+VGQ+CLAIGNPFGFDHTL
Sbjct  102   VQKNFEGKLIGADRAKDLAVLKVEAPEDLLRPIIVGQSNSLKVGQQCLAIGNPFGFDHTL  161

Query  1031  TVGVISGLNRDIYSQTGVTISGGIQTDAAINPGNSGGPLLDSKGNLIGINTAIFTQTGTS  852
             TVGVISGLNRDI+SQTGVTI GGIQTDAAINPGNSGGPLLDSKGNLIGINTAIFTQTGTS
Sbjct  162   TVGVISGLNRDIFSQTGVTIGGGIQTDAAINPGNSGGPLLDSKGNLIGINTAIFTQTGTS  221

Query  851   AGVGFAIPSSTVLRIVPQLIQSGKVVRAGLNIDIAPDAIANQLNVRNGALVLLVPGNSLA  672
             AGVGFAIPSSTVL+I+PQLIQ GKV+RAGLN+++APD IANQLNVRNG LVL VP NSLA
Sbjct  222   AGVGFAIPSSTVLQIIPQLIQLGKVIRAGLNVEVAPDLIANQLNVRNGVLVLQVPANSLA  281

Query  671   AKAGILPTTRGFAGNIVLGDIIEAVDNKPVRNKADLYKVLDDYSVGDKVQLKIRRG  504
             AKAG+LPTTRGFAGNI++GDII AV++ PVRNKA+L KVLD+Y+VGDKV LK++RG
Sbjct  282   AKAGLLPTTRGFAGNIIIGDIIVAVNSIPVRNKAELSKVLDNYNVGDKVLLKVQRG  337


 Score =   161 bits (408),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 77/101 (76%), Positives = 90/101 (89%), Gaps = 0/101 (0%)
 Frame = -3

Query  1645  VTVEQVTPPTFPSGPLSPSEERIVQLFENNTYSVVNIFDVTLRPRLNVGGAVEIPEGNGS  1466
             +T+E+VTPP F SG L PSEERIV+LFE NT+SVVNIFDVTLRP+LNV G VE+PEGNGS
Sbjct  1     MTIEEVTPPIFSSGMLFPSEERIVKLFEKNTFSVVNIFDVTLRPQLNVTGVVEVPEGNGS  60

Query  1465  GVVWDGEGNIVTNYHVIGNSLSRNPTRGEVVARVNILAPDG  1343
             GVVWD +G+IVTNYHV+GN+LSRNP  G+VVARVNILA +G
Sbjct  61    GVVWDKQGHIVTNYHVVGNALSRNPNPGQVVARVNILASEG  101



>ref|XP_010435840.1| PREDICTED: protease Do-like 8, chloroplastic isoform X2 [Camelina 
sativa]
Length=439

 Score =   405 bits (1040),  Expect = 4e-132, Method: Compositional matrix adjust.
 Identities = 200/236 (85%), Positives = 224/236 (95%), Gaps = 0/236 (0%)
 Frame = -2

Query  1211  LQKNFEGKLVGADRSKDLAVLKVEASEDLLRPTKIGESSSLRVGQKCLAIGNPFGFDHTL  1032
             +QKNFEGKLVGADR+KDLAVLKVEA E LL+P K+G+S+SL+VGQ+CLAIGNPFGFDHTL
Sbjct  189   VQKNFEGKLVGADRAKDLAVLKVEAPEILLKPIKVGQSNSLKVGQQCLAIGNPFGFDHTL  248

Query  1031  TVGVISGLNRDIYSQTGVTISGGIQTDAAINPGNSGGPLLDSKGNLIGINTAIFTQTGTS  852
             TVGVISGLNRDI+SQTGVTI GGIQTDAAINPGNSGGPLLDSKGNLIGINTAIFTQTGTS
Sbjct  249   TVGVISGLNRDIFSQTGVTIGGGIQTDAAINPGNSGGPLLDSKGNLIGINTAIFTQTGTS  308

Query  851   AGVGFAIPSSTVLRIVPQLIQSGKVVRAGLNIDIAPDAIANQLNVRNGALVLLVPGNSLA  672
             AGVGFAIPSSTVL+IVPQLIQ  KV+RAG+NI++APD +ANQLNVRNGALVL VPGNSLA
Sbjct  309   AGVGFAIPSSTVLKIVPQLIQFSKVLRAGINIELAPDPVANQLNVRNGALVLQVPGNSLA  368

Query  671   AKAGILPTTRGFAGNIVLGDIIEAVDNKPVRNKADLYKVLDDYSVGDKVQLKIRRG  504
              KAG+ PT+RGFAGNIVLGD+I AVD+KPV+NKA+L KVLD+YSVGDKV+LKI+RG
Sbjct  369   EKAGLHPTSRGFAGNIVLGDVIVAVDDKPVKNKAELMKVLDEYSVGDKVKLKIKRG  424


 Score =   143 bits (360),  Expect = 9e-34, Method: Compositional matrix adjust.
 Identities = 75/109 (69%), Positives = 83/109 (76%), Gaps = 14/109 (13%)
 Frame = -3

Query  1669  AYALGDPSVTVEQVTPPTFPSGPLSPSEERIVQLFENNTYSVVNIFDVTLRPRLNVGGAV  1490
             A ALGDPSVT  +              + RIVQLFE NTYSVVNIFDVTLRP+L + G V
Sbjct  94    ALALGDPSVTTVE--------------DGRIVQLFEKNTYSVVNIFDVTLRPQLKMTGVV  139

Query  1489  EIPEGNGSGVVWDGEGNIVTNYHVIGNSLSRNPTRGEVVARVNILAPDG  1343
             EIPEGNGSGVVW+GEG IVTNYHVIGN+LSRNP+ G+VV RVNILA DG
Sbjct  140   EIPEGNGSGVVWNGEGYIVTNYHVIGNALSRNPSPGDVVGRVNILASDG  188



>ref|XP_010435839.1| PREDICTED: protease Do-like 8, chloroplastic isoform X1 [Camelina 
sativa]
Length=454

 Score =   405 bits (1040),  Expect = 6e-132, Method: Compositional matrix adjust.
 Identities = 200/236 (85%), Positives = 224/236 (95%), Gaps = 0/236 (0%)
 Frame = -2

Query  1211  LQKNFEGKLVGADRSKDLAVLKVEASEDLLRPTKIGESSSLRVGQKCLAIGNPFGFDHTL  1032
             +QKNFEGKLVGADR+KDLAVLKVEA E LL+P K+G+S+SL+VGQ+CLAIGNPFGFDHTL
Sbjct  204   VQKNFEGKLVGADRAKDLAVLKVEAPEILLKPIKVGQSNSLKVGQQCLAIGNPFGFDHTL  263

Query  1031  TVGVISGLNRDIYSQTGVTISGGIQTDAAINPGNSGGPLLDSKGNLIGINTAIFTQTGTS  852
             TVGVISGLNRDI+SQTGVTI GGIQTDAAINPGNSGGPLLDSKGNLIGINTAIFTQTGTS
Sbjct  264   TVGVISGLNRDIFSQTGVTIGGGIQTDAAINPGNSGGPLLDSKGNLIGINTAIFTQTGTS  323

Query  851   AGVGFAIPSSTVLRIVPQLIQSGKVVRAGLNIDIAPDAIANQLNVRNGALVLLVPGNSLA  672
             AGVGFAIPSSTVL+IVPQLIQ  KV+RAG+NI++APD +ANQLNVRNGALVL VPGNSLA
Sbjct  324   AGVGFAIPSSTVLKIVPQLIQFSKVLRAGINIELAPDPVANQLNVRNGALVLQVPGNSLA  383

Query  671   AKAGILPTTRGFAGNIVLGDIIEAVDNKPVRNKADLYKVLDDYSVGDKVQLKIRRG  504
              KAG+ PT+RGFAGNIVLGD+I AVD+KPV+NKA+L KVLD+YSVGDKV+LKI+RG
Sbjct  384   EKAGLHPTSRGFAGNIVLGDVIVAVDDKPVKNKAELMKVLDEYSVGDKVKLKIKRG  439


 Score =   174 bits (440),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 87/110 (79%), Positives = 96/110 (87%), Gaps = 1/110 (1%)
 Frame = -3

Query  1669  AYALGDPSVT-VEQVTPPTFPSGPLSPSEERIVQLFENNTYSVVNIFDVTLRPRLNVGGA  1493
             A ALGDPSVT VE V+PP FP+GPL P+E RIVQLFE NTYSVVNIFDVTLRP+L + G 
Sbjct  94    ALALGDPSVTTVEDVSPPVFPAGPLFPTEGRIVQLFEKNTYSVVNIFDVTLRPQLKMTGV  153

Query  1492  VEIPEGNGSGVVWDGEGNIVTNYHVIGNSLSRNPTRGEVVARVNILAPDG  1343
             VEIPEGNGSGVVW+GEG IVTNYHVIGN+LSRNP+ G+VV RVNILA DG
Sbjct  154   VEIPEGNGSGVVWNGEGYIVTNYHVIGNALSRNPSPGDVVGRVNILASDG  203



>ref|XP_010258372.1| PREDICTED: protease Do-like 8, chloroplastic isoform X3 [Nelumbo 
nucifera]
Length=379

 Score =   402 bits (1033),  Expect = 7e-132, Method: Compositional matrix adjust.
 Identities = 198/236 (84%), Positives = 223/236 (94%), Gaps = 0/236 (0%)
 Frame = -2

Query  1211  LQKNFEGKLVGADRSKDLAVLKVEASEDLLRPTKIGESSSLRVGQKCLAIGNPFGFDHTL  1032
             +QKNFEGKL+GADR+KDLAVLKVEA EDLLRP  +G+S+SL+VGQ+CLAIGNPFGFDHTL
Sbjct  129   VQKNFEGKLIGADRAKDLAVLKVEAPEDLLRPIIVGQSNSLKVGQQCLAIGNPFGFDHTL  188

Query  1031  TVGVISGLNRDIYSQTGVTISGGIQTDAAINPGNSGGPLLDSKGNLIGINTAIFTQTGTS  852
             TVGVISGLNRDI+SQTGVTI GGIQTDAAINPGNSGGPLLDSKGNLIGINTAIFTQTGTS
Sbjct  189   TVGVISGLNRDIFSQTGVTIGGGIQTDAAINPGNSGGPLLDSKGNLIGINTAIFTQTGTS  248

Query  851   AGVGFAIPSSTVLRIVPQLIQSGKVVRAGLNIDIAPDAIANQLNVRNGALVLLVPGNSLA  672
             AGVGFAIPSSTVL+I+PQLIQ GKV+RAGLN+++APD IANQLNVRNG LVL VP NSLA
Sbjct  249   AGVGFAIPSSTVLQIIPQLIQLGKVIRAGLNVEVAPDLIANQLNVRNGVLVLQVPANSLA  308

Query  671   AKAGILPTTRGFAGNIVLGDIIEAVDNKPVRNKADLYKVLDDYSVGDKVQLKIRRG  504
             AKAG+LPTTRGFAGNI++GDII AV++ PVRNKA+L KVLD+Y+VGDKV LK++RG
Sbjct  309   AKAGLLPTTRGFAGNIIIGDIIVAVNSIPVRNKAELSKVLDNYNVGDKVLLKVQRG  364


 Score =   176 bits (447),  Expect = 6e-46, Method: Compositional matrix adjust.
 Identities = 84/111 (76%), Positives = 98/111 (88%), Gaps = 0/111 (0%)
 Frame = -3

Query  1675  LQAYALGDPSVTVEQVTPPTFPSGPLSPSEERIVQLFENNTYSVVNIFDVTLRPRLNVGG  1496
               A+ALGDPS+T+E+VTPP F SG L PSEERIV+LFE NT+SVVNIFDVTLRP+LNV G
Sbjct  18    FSAHALGDPSMTIEEVTPPIFSSGMLFPSEERIVKLFEKNTFSVVNIFDVTLRPQLNVTG  77

Query  1495  AVEIPEGNGSGVVWDGEGNIVTNYHVIGNSLSRNPTRGEVVARVNILAPDG  1343
              VE+PEGNGSGVVWD +G+IVTNYHV+GN+LSRNP  G+VVARVNILA +G
Sbjct  78    VVEVPEGNGSGVVWDKQGHIVTNYHVVGNALSRNPNPGQVVARVNILASEG  128



>ref|XP_006431119.1| hypothetical protein CICLE_v10012082mg [Citrus clementina]
 gb|ESR44359.1| hypothetical protein CICLE_v10012082mg [Citrus clementina]
Length=352

 Score =   400 bits (1029),  Expect = 9e-132, Method: Compositional matrix adjust.
 Identities = 201/236 (85%), Positives = 222/236 (94%), Gaps = 0/236 (0%)
 Frame = -2

Query  1211  LQKNFEGKLVGADRSKDLAVLKVEASEDLLRPTKIGESSSLRVGQKCLAIGNPFGFDHTL  1032
             +QKNFEGKLVGADR+KDLAVLK+EASEDLL+P  +G+SS L+VGQ+CLAIGNPFGFDHTL
Sbjct  102   VQKNFEGKLVGADRAKDLAVLKIEASEDLLKPINVGQSSFLKVGQQCLAIGNPFGFDHTL  161

Query  1031  TVGVISGLNRDIYSQTGVTISGGIQTDAAINPGNSGGPLLDSKGNLIGINTAIFTQTGTS  852
             TVGVISGLNRDI+SQ GVTI GGIQTDAAINPGNSGGPLLDSKGNLIGINTAI TQTGTS
Sbjct  162   TVGVISGLNRDIFSQAGVTIGGGIQTDAAINPGNSGGPLLDSKGNLIGINTAIITQTGTS  221

Query  851   AGVGFAIPSSTVLRIVPQLIQSGKVVRAGLNIDIAPDAIANQLNVRNGALVLLVPGNSLA  672
             AGVGFAIPSSTVL+IVPQLIQ GKVVRAGL +DIAPD +A+QLNV NGALVL VPGNSLA
Sbjct  222   AGVGFAIPSSTVLKIVPQLIQYGKVVRAGLIVDIAPDLVASQLNVGNGALVLQVPGNSLA  281

Query  671   AKAGILPTTRGFAGNIVLGDIIEAVDNKPVRNKADLYKVLDDYSVGDKVQLKIRRG  504
             AKAGILPTTRGFAGNI+LGDII AV+NKPV++KA+L KVLDDY+VGD+V LKI+RG
Sbjct  282   AKAGILPTTRGFAGNIILGDIIVAVNNKPVKSKAELEKVLDDYNVGDRVMLKIQRG  337


 Score =   164 bits (416),  Expect = 8e-42, Method: Compositional matrix adjust.
 Identities = 78/101 (77%), Positives = 90/101 (89%), Gaps = 0/101 (0%)
 Frame = -3

Query  1645  VTVEQVTPPTFPSGPLSPSEERIVQLFENNTYSVVNIFDVTLRPRLNVGGAVEIPEGNGS  1466
             +T+++VTPP FPSG L P+EERI QLFE NTYSVVNIFDVTLRP LNV G VEIPEGNGS
Sbjct  1     MTLKEVTPPVFPSGQLLPNEERIAQLFEKNTYSVVNIFDVTLRPTLNVTGLVEIPEGNGS  60

Query  1465  GVVWDGEGNIVTNYHVIGNSLSRNPTRGEVVARVNILAPDG  1343
             GVVWDG+G+IVTN+HVIG++LSR P +G+VVARVNILA DG
Sbjct  61    GVVWDGKGHIVTNFHVIGSALSRKPAQGQVVARVNILASDG  101



>ref|XP_004148708.1| PREDICTED: protease Do-like 8, chloroplastic-like [Cucumis sativus]
Length=461

 Score =   404 bits (1039),  Expect = 1e-131, Method: Compositional matrix adjust.
 Identities = 197/236 (83%), Positives = 222/236 (94%), Gaps = 0/236 (0%)
 Frame = -2

Query  1211  LQKNFEGKLVGADRSKDLAVLKVEASEDLLRPTKIGESSSLRVGQKCLAIGNPFGFDHTL  1032
             +QKNFEGKL+GADR+KDLAVLKV+AS DLLRP K+G+SSSL+VGQ+CLAIGNPFGFDHTL
Sbjct  212   IQKNFEGKLIGADRTKDLAVLKVDASNDLLRPIKVGQSSSLKVGQQCLAIGNPFGFDHTL  271

Query  1031  TVGVISGLNRDIYSQTGVTISGGIQTDAAINPGNSGGPLLDSKGNLIGINTAIFTQTGTS  852
             TVGVISGLNRDI+SQTGVTI GGIQTDAAINPGNSGGPLLDSKGNLIGINTAIFTQTG S
Sbjct  272   TVGVISGLNRDIFSQTGVTIGGGIQTDAAINPGNSGGPLLDSKGNLIGINTAIFTQTGIS  331

Query  851   AGVGFAIPSSTVLRIVPQLIQSGKVVRAGLNIDIAPDAIANQLNVRNGALVLLVPGNSLA  672
             AGVGFAIPSSTV++IVPQLIQ G+VVRAG+N+D APD I NQLNVR+GAL+L VP NS A
Sbjct  332   AGVGFAIPSSTVVKIVPQLIQFGRVVRAGINVDFAPDLITNQLNVRDGALILQVPANSPA  391

Query  671   AKAGILPTTRGFAGNIVLGDIIEAVDNKPVRNKADLYKVLDDYSVGDKVQLKIRRG  504
             AKAG+LPTTRGFAGNIVLGDII A+DNKPV+NKA+LYK++D+Y+ GDKV LKI+RG
Sbjct  392   AKAGLLPTTRGFAGNIVLGDIIAAIDNKPVKNKAELYKLMDEYNAGDKVILKIKRG  447


 Score =   172 bits (436),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 83/109 (76%), Positives = 95/109 (87%), Gaps = 0/109 (0%)
 Frame = -3

Query  1669  AYALGDPSVTVEQVTPPTFPSGPLSPSEERIVQLFENNTYSVVNIFDVTLRPRLNVGGAV  1490
             A ALGDPSVT+++VTP   PSG L P+EERI QLFE NTYSVVNIFDVTLRP+LNV G V
Sbjct  103   AQALGDPSVTIDEVTPTISPSGSLFPTEERIAQLFEKNTYSVVNIFDVTLRPQLNVTGMV  162

Query  1489  EIPEGNGSGVVWDGEGNIVTNYHVIGNSLSRNPTRGEVVARVNILAPDG  1343
             EIPEGNGSGVVWD +G+IVTNYHVI ++L+RNP+ G+VVARVNILA DG
Sbjct  163   EIPEGNGSGVVWDDQGHIVTNYHVIASALARNPSAGQVVARVNILASDG  211



>gb|KGN52454.1| hypothetical protein Csa_5G636470 [Cucumis sativus]
Length=461

 Score =   404 bits (1038),  Expect = 1e-131, Method: Compositional matrix adjust.
 Identities = 197/236 (83%), Positives = 222/236 (94%), Gaps = 0/236 (0%)
 Frame = -2

Query  1211  LQKNFEGKLVGADRSKDLAVLKVEASEDLLRPTKIGESSSLRVGQKCLAIGNPFGFDHTL  1032
             +QKNFEGKL+GADR+KDLAVLKV+AS DLLRP K+G+SSSL+VGQ+CLAIGNPFGFDHTL
Sbjct  212   IQKNFEGKLIGADRTKDLAVLKVDASNDLLRPIKVGQSSSLKVGQQCLAIGNPFGFDHTL  271

Query  1031  TVGVISGLNRDIYSQTGVTISGGIQTDAAINPGNSGGPLLDSKGNLIGINTAIFTQTGTS  852
             TVGVISGLNRDI+SQTGVTI GGIQTDAAINPGNSGGPLLDSKGNLIGINTAIFTQTG S
Sbjct  272   TVGVISGLNRDIFSQTGVTIGGGIQTDAAINPGNSGGPLLDSKGNLIGINTAIFTQTGIS  331

Query  851   AGVGFAIPSSTVLRIVPQLIQSGKVVRAGLNIDIAPDAIANQLNVRNGALVLLVPGNSLA  672
             AGVGFAIPSSTV++IVPQLIQ G+VVRAG+N+D APD I NQLNVR+GAL+L VP NS A
Sbjct  332   AGVGFAIPSSTVVKIVPQLIQFGRVVRAGINVDFAPDLITNQLNVRDGALILQVPANSPA  391

Query  671   AKAGILPTTRGFAGNIVLGDIIEAVDNKPVRNKADLYKVLDDYSVGDKVQLKIRRG  504
             AKAG+LPTTRGFAGNIVLGDII A+DNKPV+NKA+LYK++D+Y+ GDKV LKI+RG
Sbjct  392   AKAGLLPTTRGFAGNIVLGDIIAAIDNKPVKNKAELYKLMDEYNAGDKVILKIKRG  447


 Score =   171 bits (433),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 83/109 (76%), Positives = 95/109 (87%), Gaps = 0/109 (0%)
 Frame = -3

Query  1669  AYALGDPSVTVEQVTPPTFPSGPLSPSEERIVQLFENNTYSVVNIFDVTLRPRLNVGGAV  1490
             A ALGDPSVT+++VTP   PSG L P+EERI QLFE NTYSVVNIFDVTLRP+LNV G V
Sbjct  103   AQALGDPSVTIDEVTPTISPSGSLFPTEERIAQLFEKNTYSVVNIFDVTLRPQLNVTGMV  162

Query  1489  EIPEGNGSGVVWDGEGNIVTNYHVIGNSLSRNPTRGEVVARVNILAPDG  1343
             EIPEGNGSGVVWD +G+IVTNYHVI ++L+RNP+ G+VVARVNILA DG
Sbjct  163   EIPEGNGSGVVWDDQGHIVTNYHVIASALARNPSAGQVVARVNILASDG  211



>ref|XP_009376265.1| PREDICTED: protease Do-like 8, chloroplastic isoform X2 [Pyrus 
x bretschneideri]
Length=372

 Score =   400 bits (1029),  Expect = 2e-131, Method: Compositional matrix adjust.
 Identities = 198/235 (84%), Positives = 222/235 (94%), Gaps = 0/235 (0%)
 Frame = -2

Query  1211  LQKNFEGKLVGADRSKDLAVLKVEASEDLLRPTKIGESSSLRVGQKCLAIGNPFGFDHTL  1032
             LQKNFEGKL+GADR+KDLAVLKVEASEDLL+P  +G+SSSLRVGQ+CLAIGNPFGFDHTL
Sbjct  122   LQKNFEGKLIGADRAKDLAVLKVEASEDLLKPISVGQSSSLRVGQQCLAIGNPFGFDHTL  181

Query  1031  TVGVISGLNRDIYSQTGVTISGGIQTDAAINPGNSGGPLLDSKGNLIGINTAIFTQTGTS  852
             TVGVISGLNRDI+SQ GVTISGGIQTDAAINPGNSGGPLLDSKGNLIGINTAIFTQTGTS
Sbjct  182   TVGVISGLNRDIFSQAGVTISGGIQTDAAINPGNSGGPLLDSKGNLIGINTAIFTQTGTS  241

Query  851   AGVGFAIPSSTVLRIVPQLIQSGKVVRAGLNIDIAPDAIANQLNVRNGALVLLVPGNSLA  672
             AGVGFAIPSSTVL+IVPQLIQ GKVVRAGLN++IAP+ +ANQLNVR GALVL VP NS+A
Sbjct  242   AGVGFAIPSSTVLKIVPQLIQYGKVVRAGLNVEIAPELVANQLNVRYGALVLQVPKNSVA  301

Query  671   AKAGILPTTRGFAGNIVLGDIIEAVDNKPVRNKADLYKVLDDYSVGDKVQLKIRR  507
             AKAG++PTTRGFAGNIVLGDII AVD+KPV++KA+  +V D+Y+VGD+V LKI+R
Sbjct  302   AKAGLIPTTRGFAGNIVLGDIIVAVDDKPVKSKAEFNRVFDEYNVGDQVILKIQR  356


 Score =   188 bits (477),  Expect = 4e-50, Method: Compositional matrix adjust.
 Identities = 92/119 (77%), Positives = 103/119 (87%), Gaps = 0/119 (0%)
 Frame = -3

Query  1699  SLCTQFITLQAYALGDPSVTVEQVTPPTFPSGPLSPSEERIVQLFENNTYSVVNIFDVTL  1520
             SLC     L A ALGDPSVT+E+VTPP F SGPL P+EERIV+LFE NTYSVVNIFDVTL
Sbjct  3     SLCDPSRYLSALALGDPSVTIEEVTPPVFTSGPLFPTEERIVELFEKNTYSVVNIFDVTL  62

Query  1519  RPRLNVGGAVEIPEGNGSGVVWDGEGNIVTNYHVIGNSLSRNPTRGEVVARVNILAPDG  1343
             RP+LN+ G VE+PEGNGSGVVWDG+G+IVTNYHVIGN+LSRNP  GEVVARVNILA +G
Sbjct  63    RPQLNITGVVEVPEGNGSGVVWDGQGHIVTNYHVIGNALSRNPGLGEVVARVNILALEG  121



>ref|XP_010441096.1| PREDICTED: protease Do-like 8, chloroplastic [Camelina sativa]
Length=454

 Score =   404 bits (1037),  Expect = 2e-131, Method: Compositional matrix adjust.
 Identities = 199/236 (84%), Positives = 224/236 (95%), Gaps = 0/236 (0%)
 Frame = -2

Query  1211  LQKNFEGKLVGADRSKDLAVLKVEASEDLLRPTKIGESSSLRVGQKCLAIGNPFGFDHTL  1032
             +QKNFEGKLVGADR+KDLAVLKVEA E LL+P K+G+S+SL+VGQ+CLAIGNPFGFDHTL
Sbjct  204   VQKNFEGKLVGADRAKDLAVLKVEAPEILLKPIKVGQSNSLKVGQQCLAIGNPFGFDHTL  263

Query  1031  TVGVISGLNRDIYSQTGVTISGGIQTDAAINPGNSGGPLLDSKGNLIGINTAIFTQTGTS  852
             TVGVISGLNRDI+SQTGVTI GGIQTDAAINPGNSGGPLLDSKGNLIGINTAIFTQTGTS
Sbjct  264   TVGVISGLNRDIFSQTGVTIGGGIQTDAAINPGNSGGPLLDSKGNLIGINTAIFTQTGTS  323

Query  851   AGVGFAIPSSTVLRIVPQLIQSGKVVRAGLNIDIAPDAIANQLNVRNGALVLLVPGNSLA  672
             AGVGFAIPSSTVL+IVPQLIQ  KV+RAG+NI++APD +ANQLNVRNGALVL VPGNSLA
Sbjct  324   AGVGFAIPSSTVLKIVPQLIQFSKVLRAGINIELAPDPVANQLNVRNGALVLQVPGNSLA  383

Query  671   AKAGILPTTRGFAGNIVLGDIIEAVDNKPVRNKADLYKVLDDYSVGDKVQLKIRRG  504
              KAG+ PT+RGFAGNIVLGD+I AVD+KPV+NKA+L K+LD+YSVGDKV+LKI+RG
Sbjct  384   EKAGLHPTSRGFAGNIVLGDVIVAVDDKPVKNKAELMKILDEYSVGDKVKLKIKRG  439


 Score =   172 bits (436),  Expect = 9e-44, Method: Compositional matrix adjust.
 Identities = 86/110 (78%), Positives = 95/110 (86%), Gaps = 1/110 (1%)
 Frame = -3

Query  1669  AYALGDPSVT-VEQVTPPTFPSGPLSPSEERIVQLFENNTYSVVNIFDVTLRPRLNVGGA  1493
             A A GDPSVT VE V+PP FP+GPL P+E RIVQLFE NTYSVVNIFDVTLRP+L + G 
Sbjct  94    ALAFGDPSVTTVEDVSPPVFPAGPLFPTEGRIVQLFEKNTYSVVNIFDVTLRPQLKMTGV  153

Query  1492  VEIPEGNGSGVVWDGEGNIVTNYHVIGNSLSRNPTRGEVVARVNILAPDG  1343
             VEIPEGNGSGVVW+GEG IVTNYHVIGN+LSRNP+ G+VV RVNILA DG
Sbjct  154   VEIPEGNGSGVVWNGEGYIVTNYHVIGNALSRNPSPGDVVGRVNILASDG  203



>ref|XP_010450763.1| PREDICTED: protease Do-like 8, chloroplastic [Camelina sativa]
Length=454

 Score =   404 bits (1037),  Expect = 2e-131, Method: Compositional matrix adjust.
 Identities = 199/236 (84%), Positives = 224/236 (95%), Gaps = 0/236 (0%)
 Frame = -2

Query  1211  LQKNFEGKLVGADRSKDLAVLKVEASEDLLRPTKIGESSSLRVGQKCLAIGNPFGFDHTL  1032
             +QKNFEGKLVGADR+KDLAVLKVEA E LL+P K+G+S+SL+VGQ+CLAIGNPFGFDHTL
Sbjct  204   VQKNFEGKLVGADRAKDLAVLKVEAPEILLKPIKVGQSNSLKVGQQCLAIGNPFGFDHTL  263

Query  1031  TVGVISGLNRDIYSQTGVTISGGIQTDAAINPGNSGGPLLDSKGNLIGINTAIFTQTGTS  852
             TVGVISGLNRDI+SQTGVTI GGIQTDAAINPGNSGGPLLDSKGNLIGINTAIFTQTGTS
Sbjct  264   TVGVISGLNRDIFSQTGVTIGGGIQTDAAINPGNSGGPLLDSKGNLIGINTAIFTQTGTS  323

Query  851   AGVGFAIPSSTVLRIVPQLIQSGKVVRAGLNIDIAPDAIANQLNVRNGALVLLVPGNSLA  672
             AGVGFAIPSSTVL+IVPQLIQ  KV+RAG+NI++APD +ANQLNVRNGALVL VPGNSLA
Sbjct  324   AGVGFAIPSSTVLKIVPQLIQFSKVLRAGINIELAPDPVANQLNVRNGALVLQVPGNSLA  383

Query  671   AKAGILPTTRGFAGNIVLGDIIEAVDNKPVRNKADLYKVLDDYSVGDKVQLKIRRG  504
              KAG+ PT+RGFAGNIVLGD+I AVD+KPV+NKA+L K+LD+YSVGDKV+LKI+RG
Sbjct  384   EKAGLHPTSRGFAGNIVLGDVIVAVDDKPVKNKAELTKILDEYSVGDKVKLKIKRG  439


 Score =   173 bits (438),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 86/110 (78%), Positives = 96/110 (87%), Gaps = 1/110 (1%)
 Frame = -3

Query  1669  AYALGDPSV-TVEQVTPPTFPSGPLSPSEERIVQLFENNTYSVVNIFDVTLRPRLNVGGA  1493
             A ALGDPS+ TVE V+PP FP+GPL P+E RIVQLFE NTYSVVNIFDVTLRP+L + G 
Sbjct  94    ALALGDPSIATVEDVSPPVFPAGPLFPTEGRIVQLFEKNTYSVVNIFDVTLRPQLKMTGV  153

Query  1492  VEIPEGNGSGVVWDGEGNIVTNYHVIGNSLSRNPTRGEVVARVNILAPDG  1343
             VEIPEGNGSGVVW+GEG IVTNYHVIGN+LSRNP+ G+VV RVNILA DG
Sbjct  154   VEIPEGNGSGVVWNGEGYIVTNYHVIGNALSRNPSPGDVVGRVNILASDG  203



>ref|XP_007215337.1| hypothetical protein PRUPE_ppa005314mg [Prunus persica]
 gb|EMJ16536.1| hypothetical protein PRUPE_ppa005314mg [Prunus persica]
Length=467

 Score =   403 bits (1036),  Expect = 4e-131, Method: Compositional matrix adjust.
 Identities = 201/235 (86%), Positives = 221/235 (94%), Gaps = 0/235 (0%)
 Frame = -2

Query  1211  LQKNFEGKLVGADRSKDLAVLKVEASEDLLRPTKIGESSSLRVGQKCLAIGNPFGFDHTL  1032
             +QKNFEGKL+GADR+KDLAVLKVEASEDLL+P  +G SSSLRVGQ+CLAIGNPFGFDHTL
Sbjct  217   VQKNFEGKLIGADRAKDLAVLKVEASEDLLKPISVGHSSSLRVGQQCLAIGNPFGFDHTL  276

Query  1031  TVGVISGLNRDIYSQTGVTISGGIQTDAAINPGNSGGPLLDSKGNLIGINTAIFTQTGTS  852
             TVGVISGLNRDI+SQ GVTISGGIQTDAAINPGNSGGPLLDSKGNLIGINTAIFTQTGTS
Sbjct  277   TVGVISGLNRDIFSQAGVTISGGIQTDAAINPGNSGGPLLDSKGNLIGINTAIFTQTGTS  336

Query  851   AGVGFAIPSSTVLRIVPQLIQSGKVVRAGLNIDIAPDAIANQLNVRNGALVLLVPGNSLA  672
             AGVGFAIPSSTVL+IVPQLIQ GKVVRAGLN++IAP+ +ANQLNVR GALVL VP NS A
Sbjct  337   AGVGFAIPSSTVLKIVPQLIQFGKVVRAGLNLEIAPELVANQLNVRYGALVLQVPANSAA  396

Query  671   AKAGILPTTRGFAGNIVLGDIIEAVDNKPVRNKADLYKVLDDYSVGDKVQLKIRR  507
             AKAGILPTTRGFAGNIVLGDII AVD+KPV++KA+  +VLD+Y+VGDKV LKI+R
Sbjct  397   AKAGILPTTRGFAGNIVLGDIIVAVDDKPVKSKAEFNRVLDEYNVGDKVTLKIQR  451


 Score =   185 bits (469),  Expect = 4e-48, Method: Compositional matrix adjust.
 Identities = 91/118 (77%), Positives = 101/118 (86%), Gaps = 0/118 (0%)
 Frame = -3

Query  1696  LCTQFITLQAYALGDPSVTVEQVTPPTFPSGPLSPSEERIVQLFENNTYSVVNIFDVTLR  1517
             LC     L A ALGDP+VT+E+VTPP F SGPL P EERIVQLFE NTYSVVNIFDVTLR
Sbjct  99    LCDPSRYLSAQALGDPTVTIEEVTPPVFTSGPLFPIEERIVQLFEKNTYSVVNIFDVTLR  158

Query  1516  PRLNVGGAVEIPEGNGSGVVWDGEGNIVTNYHVIGNSLSRNPTRGEVVARVNILAPDG  1343
             P+LN+ G VE+PEGNGSGVVWDG+G+IVTNYHVIGN+LSRNP  GEVVARVNILA +G
Sbjct  159   PQLNITGVVEVPEGNGSGVVWDGQGHIVTNYHVIGNALSRNPGLGEVVARVNILALEG  216



>ref|XP_010258371.1| PREDICTED: protease Do-like 8, chloroplastic isoform X2 [Nelumbo 
nucifera]
Length=431

 Score =   402 bits (1032),  Expect = 5e-131, Method: Compositional matrix adjust.
 Identities = 198/236 (84%), Positives = 223/236 (94%), Gaps = 0/236 (0%)
 Frame = -2

Query  1211  LQKNFEGKLVGADRSKDLAVLKVEASEDLLRPTKIGESSSLRVGQKCLAIGNPFGFDHTL  1032
             +QKNFEGKL+GADR+KDLAVLKVEA EDLLRP  +G+S+SL+VGQ+CLAIGNPFGFDHTL
Sbjct  181   VQKNFEGKLIGADRAKDLAVLKVEAPEDLLRPIIVGQSNSLKVGQQCLAIGNPFGFDHTL  240

Query  1031  TVGVISGLNRDIYSQTGVTISGGIQTDAAINPGNSGGPLLDSKGNLIGINTAIFTQTGTS  852
             TVGVISGLNRDI+SQTGVTI GGIQTDAAINPGNSGGPLLDSKGNLIGINTAIFTQTGTS
Sbjct  241   TVGVISGLNRDIFSQTGVTIGGGIQTDAAINPGNSGGPLLDSKGNLIGINTAIFTQTGTS  300

Query  851   AGVGFAIPSSTVLRIVPQLIQSGKVVRAGLNIDIAPDAIANQLNVRNGALVLLVPGNSLA  672
             AGVGFAIPSSTVL+I+PQLIQ GKV+RAGLN+++APD IANQLNVRNG LVL VP NSLA
Sbjct  301   AGVGFAIPSSTVLQIIPQLIQLGKVIRAGLNVEVAPDLIANQLNVRNGVLVLQVPANSLA  360

Query  671   AKAGILPTTRGFAGNIVLGDIIEAVDNKPVRNKADLYKVLDDYSVGDKVQLKIRRG  504
             AKAG+LPTTRGFAGNI++GDII AV++ PVRNKA+L KVLD+Y+VGDKV LK++RG
Sbjct  361   AKAGLLPTTRGFAGNIIIGDIIVAVNSIPVRNKAELSKVLDNYNVGDKVLLKVQRG  416


 Score =   176 bits (446),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 84/111 (76%), Positives = 98/111 (88%), Gaps = 0/111 (0%)
 Frame = -3

Query  1675  LQAYALGDPSVTVEQVTPPTFPSGPLSPSEERIVQLFENNTYSVVNIFDVTLRPRLNVGG  1496
               A+ALGDPS+T+E+VTPP F SG L PSEERIV+LFE NT+SVVNIFDVTLRP+LNV G
Sbjct  70    FSAHALGDPSMTIEEVTPPIFSSGMLFPSEERIVKLFEKNTFSVVNIFDVTLRPQLNVTG  129

Query  1495  AVEIPEGNGSGVVWDGEGNIVTNYHVIGNSLSRNPTRGEVVARVNILAPDG  1343
              VE+PEGNGSGVVWD +G+IVTNYHV+GN+LSRNP  G+VVARVNILA +G
Sbjct  130   VVEVPEGNGSGVVWDKQGHIVTNYHVVGNALSRNPNPGQVVARVNILASEG  180



>ref|XP_008357762.1| PREDICTED: protease Do-like 8, chloroplastic [Malus domestica]
Length=466

 Score =   402 bits (1034),  Expect = 8e-131, Method: Compositional matrix adjust.
 Identities = 199/235 (85%), Positives = 222/235 (94%), Gaps = 0/235 (0%)
 Frame = -2

Query  1211  LQKNFEGKLVGADRSKDLAVLKVEASEDLLRPTKIGESSSLRVGQKCLAIGNPFGFDHTL  1032
             LQKNFEGKL+GADR+KDLAVLKVEASEDLL+P  +G+SSSLRVGQ+CLAIGNPFGFDHTL
Sbjct  216   LQKNFEGKLIGADRAKDLAVLKVEASEDLLKPISVGQSSSLRVGQQCLAIGNPFGFDHTL  275

Query  1031  TVGVISGLNRDIYSQTGVTISGGIQTDAAINPGNSGGPLLDSKGNLIGINTAIFTQTGTS  852
             TVGVISGLNRDI+SQ GVTISGGIQTDAAINPGNSGGPLLDSKGNLIGINTAIFTQTGTS
Sbjct  276   TVGVISGLNRDIFSQAGVTISGGIQTDAAINPGNSGGPLLDSKGNLIGINTAIFTQTGTS  335

Query  851   AGVGFAIPSSTVLRIVPQLIQSGKVVRAGLNIDIAPDAIANQLNVRNGALVLLVPGNSLA  672
             AGVGFAIPSSTVL+IVPQLIQ GKVVRAGLN++IAP+ +ANQLNVR GALVL VP NS+A
Sbjct  336   AGVGFAIPSSTVLKIVPQLIQYGKVVRAGLNVEIAPELVANQLNVRYGALVLQVPKNSVA  395

Query  671   AKAGILPTTRGFAGNIVLGDIIEAVDNKPVRNKADLYKVLDDYSVGDKVQLKIRR  507
             AKAG+LPTTRGFAGNIVLGDII AVD+KPV++KA+  +V D+Y+VGD+V LKI+R
Sbjct  396   AKAGLLPTTRGFAGNIVLGDIIVAVDDKPVKSKAEFNRVFDEYNVGDQVILKIQR  450


 Score =   182 bits (462),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 90/119 (76%), Positives = 100/119 (84%), Gaps = 0/119 (0%)
 Frame = -3

Query  1699  SLCTQFITLQAYALGDPSVTVEQVTPPTFPSGPLSPSEERIVQLFENNTYSVVNIFDVTL  1520
             SLC     L A ALGD SVT+E VTPP F SGPL P+EERIV+LFE NTY VVNIFDVTL
Sbjct  97    SLCDPSRYLSALALGDXSVTIEXVTPPVFTSGPLFPTEERIVELFEXNTYXVVNIFDVTL  156

Query  1519  RPRLNVGGAVEIPEGNGSGVVWDGEGNIVTNYHVIGNSLSRNPTRGEVVARVNILAPDG  1343
             RP+LN+ G VE+PEGNGSGVVWDG+G+IVTNYHVIGN+LSRNP  GEVVARVNILA +G
Sbjct  157   RPQLNITGVVEVPEGNGSGVVWDGQGHIVTNYHVIGNALSRNPGLGEVVARVNILALEG  215



>ref|NP_568575.1| protease DEG 8 [Arabidopsis thaliana]
 sp|Q9LU10.1|DEGP8_ARATH RecName: Full=Protease Do-like 8, chloroplastic; Flags: Precursor 
[Arabidopsis thaliana]
 dbj|BAA98101.1| unnamed protein product [Arabidopsis thaliana]
 gb|AAL08237.1| AT5g39830/K13H13_10 [Arabidopsis thaliana]
 gb|AAL90980.1| AT5g39830/K13H13_10 [Arabidopsis thaliana]
 gb|AED94480.1| protease DEG 8 [Arabidopsis thaliana]
Length=448

 Score =   401 bits (1031),  Expect = 1e-130, Method: Compositional matrix adjust.
 Identities = 198/236 (84%), Positives = 222/236 (94%), Gaps = 0/236 (0%)
 Frame = -2

Query  1211  LQKNFEGKLVGADRSKDLAVLKVEASEDLLRPTKIGESSSLRVGQKCLAIGNPFGFDHTL  1032
             +QKNFEGKLVGADR+KDLAVLKV+A E LL+P K+G+S+SL+VGQ+CLAIGNPFGFDHTL
Sbjct  198   VQKNFEGKLVGADRAKDLAVLKVDAPETLLKPIKVGQSNSLKVGQQCLAIGNPFGFDHTL  257

Query  1031  TVGVISGLNRDIYSQTGVTISGGIQTDAAINPGNSGGPLLDSKGNLIGINTAIFTQTGTS  852
             TVGVISGLNRDI+SQTGVTI GGIQTDAAINPGNSGGPLLDSKGNLIGINTAIFTQTGTS
Sbjct  258   TVGVISGLNRDIFSQTGVTIGGGIQTDAAINPGNSGGPLLDSKGNLIGINTAIFTQTGTS  317

Query  851   AGVGFAIPSSTVLRIVPQLIQSGKVVRAGLNIDIAPDAIANQLNVRNGALVLLVPGNSLA  672
             AGVGFAIPSSTVL+IVPQLIQ  KV+RAG+NI++APD +ANQLNVRNGALVL VPG SLA
Sbjct  318   AGVGFAIPSSTVLKIVPQLIQFSKVLRAGINIELAPDPVANQLNVRNGALVLQVPGKSLA  377

Query  671   AKAGILPTTRGFAGNIVLGDIIEAVDNKPVRNKADLYKVLDDYSVGDKVQLKIRRG  504
              KAG+ PT+RGFAGNIVLGDII AVD+KPV+NKA+L K+LD+YSVGDKV LKI+RG
Sbjct  378   EKAGLHPTSRGFAGNIVLGDIIVAVDDKPVKNKAELMKILDEYSVGDKVTLKIKRG  433


 Score =   174 bits (440),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 87/112 (78%), Positives = 96/112 (86%), Gaps = 1/112 (1%)
 Frame = -3

Query  1675  LQAYALGDPSV-TVEQVTPPTFPSGPLSPSEERIVQLFENNTYSVVNIFDVTLRPRLNVG  1499
             L A ALGDPSV TVE V+P  FP+GPL P+E RIVQLFE NTYSVVNIFDVTLRP+L + 
Sbjct  86    LSALALGDPSVATVEDVSPTVFPAGPLFPTEGRIVQLFEKNTYSVVNIFDVTLRPQLKMT  145

Query  1498  GAVEIPEGNGSGVVWDGEGNIVTNYHVIGNSLSRNPTRGEVVARVNILAPDG  1343
             G VEIPEGNGSGVVWDG+G IVTNYHVIGN+LSRNP+ G+VV RVNILA DG
Sbjct  146   GVVEIPEGNGSGVVWDGQGYIVTNYHVIGNALSRNPSPGDVVGRVNILASDG  197



>ref|XP_009376263.1| PREDICTED: protease Do-like 8, chloroplastic isoform X1 [Pyrus 
x bretschneideri]
Length=466

 Score =   402 bits (1032),  Expect = 2e-130, Method: Compositional matrix adjust.
 Identities = 198/235 (84%), Positives = 222/235 (94%), Gaps = 0/235 (0%)
 Frame = -2

Query  1211  LQKNFEGKLVGADRSKDLAVLKVEASEDLLRPTKIGESSSLRVGQKCLAIGNPFGFDHTL  1032
             LQKNFEGKL+GADR+KDLAVLKVEASEDLL+P  +G+SSSLRVGQ+CLAIGNPFGFDHTL
Sbjct  216   LQKNFEGKLIGADRAKDLAVLKVEASEDLLKPISVGQSSSLRVGQQCLAIGNPFGFDHTL  275

Query  1031  TVGVISGLNRDIYSQTGVTISGGIQTDAAINPGNSGGPLLDSKGNLIGINTAIFTQTGTS  852
             TVGVISGLNRDI+SQ GVTISGGIQTDAAINPGNSGGPLLDSKGNLIGINTAIFTQTGTS
Sbjct  276   TVGVISGLNRDIFSQAGVTISGGIQTDAAINPGNSGGPLLDSKGNLIGINTAIFTQTGTS  335

Query  851   AGVGFAIPSSTVLRIVPQLIQSGKVVRAGLNIDIAPDAIANQLNVRNGALVLLVPGNSLA  672
             AGVGFAIPSSTVL+IVPQLIQ GKVVRAGLN++IAP+ +ANQLNVR GALVL VP NS+A
Sbjct  336   AGVGFAIPSSTVLKIVPQLIQYGKVVRAGLNVEIAPELVANQLNVRYGALVLQVPKNSVA  395

Query  671   AKAGILPTTRGFAGNIVLGDIIEAVDNKPVRNKADLYKVLDDYSVGDKVQLKIRR  507
             AKAG++PTTRGFAGNIVLGDII AVD+KPV++KA+  +V D+Y+VGD+V LKI+R
Sbjct  396   AKAGLIPTTRGFAGNIVLGDIIVAVDDKPVKSKAEFNRVFDEYNVGDQVILKIQR  450


 Score =   188 bits (478),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 92/119 (77%), Positives = 103/119 (87%), Gaps = 0/119 (0%)
 Frame = -3

Query  1699  SLCTQFITLQAYALGDPSVTVEQVTPPTFPSGPLSPSEERIVQLFENNTYSVVNIFDVTL  1520
             SLC     L A ALGDPSVT+E+VTPP F SGPL P+EERIV+LFE NTYSVVNIFDVTL
Sbjct  97    SLCDPSRYLSALALGDPSVTIEEVTPPVFTSGPLFPTEERIVELFEKNTYSVVNIFDVTL  156

Query  1519  RPRLNVGGAVEIPEGNGSGVVWDGEGNIVTNYHVIGNSLSRNPTRGEVVARVNILAPDG  1343
             RP+LN+ G VE+PEGNGSGVVWDG+G+IVTNYHVIGN+LSRNP  GEVVARVNILA +G
Sbjct  157   RPQLNITGVVEVPEGNGSGVVWDGQGHIVTNYHVIGNALSRNPGLGEVVARVNILALEG  215



>ref|XP_010258370.1| PREDICTED: protease Do-like 8, chloroplastic isoform X1 [Nelumbo 
nucifera]
Length=459

 Score =   401 bits (1031),  Expect = 2e-130, Method: Compositional matrix adjust.
 Identities = 198/236 (84%), Positives = 223/236 (94%), Gaps = 0/236 (0%)
 Frame = -2

Query  1211  LQKNFEGKLVGADRSKDLAVLKVEASEDLLRPTKIGESSSLRVGQKCLAIGNPFGFDHTL  1032
             +QKNFEGKL+GADR+KDLAVLKVEA EDLLRP  +G+S+SL+VGQ+CLAIGNPFGFDHTL
Sbjct  209   VQKNFEGKLIGADRAKDLAVLKVEAPEDLLRPIIVGQSNSLKVGQQCLAIGNPFGFDHTL  268

Query  1031  TVGVISGLNRDIYSQTGVTISGGIQTDAAINPGNSGGPLLDSKGNLIGINTAIFTQTGTS  852
             TVGVISGLNRDI+SQTGVTI GGIQTDAAINPGNSGGPLLDSKGNLIGINTAIFTQTGTS
Sbjct  269   TVGVISGLNRDIFSQTGVTIGGGIQTDAAINPGNSGGPLLDSKGNLIGINTAIFTQTGTS  328

Query  851   AGVGFAIPSSTVLRIVPQLIQSGKVVRAGLNIDIAPDAIANQLNVRNGALVLLVPGNSLA  672
             AGVGFAIPSSTVL+I+PQLIQ GKV+RAGLN+++APD IANQLNVRNG LVL VP NSLA
Sbjct  329   AGVGFAIPSSTVLQIIPQLIQLGKVIRAGLNVEVAPDLIANQLNVRNGVLVLQVPANSLA  388

Query  671   AKAGILPTTRGFAGNIVLGDIIEAVDNKPVRNKADLYKVLDDYSVGDKVQLKIRRG  504
             AKAG+LPTTRGFAGNI++GDII AV++ PVRNKA+L KVLD+Y+VGDKV LK++RG
Sbjct  389   AKAGLLPTTRGFAGNIIIGDIIVAVNSIPVRNKAELSKVLDNYNVGDKVLLKVQRG  444


 Score =   176 bits (447),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 84/111 (76%), Positives = 98/111 (88%), Gaps = 0/111 (0%)
 Frame = -3

Query  1675  LQAYALGDPSVTVEQVTPPTFPSGPLSPSEERIVQLFENNTYSVVNIFDVTLRPRLNVGG  1496
               A+ALGDPS+T+E+VTPP F SG L PSEERIV+LFE NT+SVVNIFDVTLRP+LNV G
Sbjct  98    FSAHALGDPSMTIEEVTPPIFSSGMLFPSEERIVKLFEKNTFSVVNIFDVTLRPQLNVTG  157

Query  1495  AVEIPEGNGSGVVWDGEGNIVTNYHVIGNSLSRNPTRGEVVARVNILAPDG  1343
              VE+PEGNGSGVVWD +G+IVTNYHV+GN+LSRNP  G+VVARVNILA +G
Sbjct  158   VVEVPEGNGSGVVWDKQGHIVTNYHVVGNALSRNPNPGQVVARVNILASEG  208



>pdb|4IC6|A Chain A, Crystal Structure Of Deg8
 pdb|4IC6|B Chain B, Crystal Structure Of Deg8
 pdb|4IC6|C Chain C, Crystal Structure Of Deg8
Length=368

 Score =   398 bits (1023),  Expect = 2e-130, Method: Compositional matrix adjust.
 Identities = 197/236 (83%), Positives = 222/236 (94%), Gaps = 0/236 (0%)
 Frame = -2

Query  1211  LQKNFEGKLVGADRSKDLAVLKVEASEDLLRPTKIGESSSLRVGQKCLAIGNPFGFDHTL  1032
             +QKNFEGKLVGADR+KDLAVLKV+A E LL+P K+G+S+SL+VGQ+CLAIGNPFGFDHTL
Sbjct  110   VQKNFEGKLVGADRAKDLAVLKVDAPETLLKPIKVGQSNSLKVGQQCLAIGNPFGFDHTL  169

Query  1031  TVGVISGLNRDIYSQTGVTISGGIQTDAAINPGNSGGPLLDSKGNLIGINTAIFTQTGTS  852
             TVGVISGLNRDI+SQTGVTI GGIQTDAAINPGN+GGPLLDSKGNLIGINTAIFTQTGTS
Sbjct  170   TVGVISGLNRDIFSQTGVTIGGGIQTDAAINPGNAGGPLLDSKGNLIGINTAIFTQTGTS  229

Query  851   AGVGFAIPSSTVLRIVPQLIQSGKVVRAGLNIDIAPDAIANQLNVRNGALVLLVPGNSLA  672
             AGVGFAIPSSTVL+IVPQLIQ  KV+RAG+NI++APD +ANQLNVRNGALVL VPG SLA
Sbjct  230   AGVGFAIPSSTVLKIVPQLIQFSKVLRAGINIELAPDPVANQLNVRNGALVLQVPGKSLA  289

Query  671   AKAGILPTTRGFAGNIVLGDIIEAVDNKPVRNKADLYKVLDDYSVGDKVQLKIRRG  504
              KAG+ PT+RGFAGNIVLGDII AVD+KPV+NKA+L K+LD+YSVGDKV LKI+RG
Sbjct  290   EKAGLHPTSRGFAGNIVLGDIIVAVDDKPVKNKAELMKILDEYSVGDKVTLKIKRG  345


 Score =   169 bits (427),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 84/109 (77%), Positives = 93/109 (85%), Gaps = 1/109 (1%)
 Frame = -3

Query  1666  YALGDPSV-TVEQVTPPTFPSGPLSPSEERIVQLFENNTYSVVNIFDVTLRPRLNVGGAV  1490
               LGDPSV TVE V+P  FP+GPL P+E RIVQLFE NTYSVVNIFDVTLRP+L + G V
Sbjct  1     MGLGDPSVATVEDVSPTVFPAGPLFPTEGRIVQLFEKNTYSVVNIFDVTLRPQLKMTGVV  60

Query  1489  EIPEGNGSGVVWDGEGNIVTNYHVIGNSLSRNPTRGEVVARVNILAPDG  1343
             EIPEGNGSGVVWDG+G IVTNYHVIGN+LSRNP+ G+VV RVNILA DG
Sbjct  61    EIPEGNGSGVVWDGQGYIVTNYHVIGNALSRNPSPGDVVGRVNILASDG  109



>ref|XP_008230760.1| PREDICTED: LOW QUALITY PROTEIN: protease Do-like 8, chloroplastic 
[Prunus mume]
Length=466

 Score =   402 bits (1032),  Expect = 2e-130, Method: Compositional matrix adjust.
 Identities = 200/235 (85%), Positives = 222/235 (94%), Gaps = 0/235 (0%)
 Frame = -2

Query  1211  LQKNFEGKLVGADRSKDLAVLKVEASEDLLRPTKIGESSSLRVGQKCLAIGNPFGFDHTL  1032
             +QKNFEGKL+GADR+KDLAVLKVEASEDLL+P  +G+SSSLRVGQ+CLAIGNPFGFDHTL
Sbjct  216   VQKNFEGKLIGADRAKDLAVLKVEASEDLLKPISVGQSSSLRVGQQCLAIGNPFGFDHTL  275

Query  1031  TVGVISGLNRDIYSQTGVTISGGIQTDAAINPGNSGGPLLDSKGNLIGINTAIFTQTGTS  852
             TVGVISGLN DI+SQ GVTISGGIQTDAAINPGNSGGPLLDSKGNLIGINTAIFTQTGTS
Sbjct  276   TVGVISGLNXDIFSQAGVTISGGIQTDAAINPGNSGGPLLDSKGNLIGINTAIFTQTGTS  335

Query  851   AGVGFAIPSSTVLRIVPQLIQSGKVVRAGLNIDIAPDAIANQLNVRNGALVLLVPGNSLA  672
             AGVGFAIPSSTVL+IVPQLIQ GKVVRAGLN++IAP+ +ANQLNVR GALVL VP NS+A
Sbjct  336   AGVGFAIPSSTVLKIVPQLIQFGKVVRAGLNLEIAPELVANQLNVRYGALVLQVPANSVA  395

Query  671   AKAGILPTTRGFAGNIVLGDIIEAVDNKPVRNKADLYKVLDDYSVGDKVQLKIRR  507
             AKAGILPTTRGFAGNIVLGDII AVD+KPV++KA+  +VLD+Y+VGDKV LKI+R
Sbjct  396   AKAGILPTTRGFAGNIVLGDIIVAVDDKPVKSKAEFNRVLDEYNVGDKVTLKIQR  450


 Score =   186 bits (471),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 91/118 (77%), Positives = 102/118 (86%), Gaps = 0/118 (0%)
 Frame = -3

Query  1696  LCTQFITLQAYALGDPSVTVEQVTPPTFPSGPLSPSEERIVQLFENNTYSVVNIFDVTLR  1517
             LC     L A ALGDP+VT+E+VTPP F SGPL P+EERIVQLFE NTYSVVNIFDVTLR
Sbjct  98    LCDPSRYLSAQALGDPTVTIEEVTPPVFTSGPLFPTEERIVQLFEKNTYSVVNIFDVTLR  157

Query  1516  PRLNVGGAVEIPEGNGSGVVWDGEGNIVTNYHVIGNSLSRNPTRGEVVARVNILAPDG  1343
             P+LN+ G VE+PEGNGSGVVWDG+G+IVTNYHVIGN+LSRNP  GEVVARVNILA +G
Sbjct  158   PQLNITGVVEVPEGNGSGVVWDGQGHIVTNYHVIGNALSRNPGIGEVVARVNILALEG  215



>gb|KFK33190.1| hypothetical protein AALP_AA6G341700 [Arabis alpina]
Length=453

 Score =   401 bits (1030),  Expect = 2e-130, Method: Compositional matrix adjust.
 Identities = 196/236 (83%), Positives = 223/236 (94%), Gaps = 0/236 (0%)
 Frame = -2

Query  1211  LQKNFEGKLVGADRSKDLAVLKVEASEDLLRPTKIGESSSLRVGQKCLAIGNPFGFDHTL  1032
             +QKNFEGKLVGADR+KDLAVLKVEA E LL+P K+G+S+SL+VGQ+CLAIGNPFGFDHTL
Sbjct  203   VQKNFEGKLVGADRAKDLAVLKVEAPETLLKPIKLGQSNSLKVGQQCLAIGNPFGFDHTL  262

Query  1031  TVGVISGLNRDIYSQTGVTISGGIQTDAAINPGNSGGPLLDSKGNLIGINTAIFTQTGTS  852
             TVGVISGLNRDI+SQTGVTI GGIQTDAAINPGNSGGPLLDSKGNLIGINTAIFTQTGTS
Sbjct  263   TVGVISGLNRDIFSQTGVTIGGGIQTDAAINPGNSGGPLLDSKGNLIGINTAIFTQTGTS  322

Query  851   AGVGFAIPSSTVLRIVPQLIQSGKVVRAGLNIDIAPDAIANQLNVRNGALVLLVPGNSLA  672
             AGVGFAIPSSTVL+IVPQLIQ  KV+RAG+NI++APD++ANQLNVRNGALVL VP NSLA
Sbjct  323   AGVGFAIPSSTVLKIVPQLIQFSKVLRAGINIELAPDSVANQLNVRNGALVLQVPRNSLA  382

Query  671   AKAGILPTTRGFAGNIVLGDIIEAVDNKPVRNKADLYKVLDDYSVGDKVQLKIRRG  504
              KAG+ PT+RG+AGNI+LGD+I AVD+KPV+NKA+L K+LD+YSVGDKV LKI+RG
Sbjct  383   EKAGLRPTSRGYAGNIILGDVIVAVDDKPVKNKAELMKILDEYSVGDKVNLKIKRG  438


 Score =   176 bits (447),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 89/112 (79%), Positives = 98/112 (88%), Gaps = 1/112 (1%)
 Frame = -3

Query  1675  LQAYALGDPSV-TVEQVTPPTFPSGPLSPSEERIVQLFENNTYSVVNIFDVTLRPRLNVG  1499
             L A ALGDPSV TVE V+PP FP+GPL P+E RIVQLFENNTYSVVNIFDVTLRP+L + 
Sbjct  91    LSALALGDPSVATVEVVSPPVFPAGPLFPTEGRIVQLFENNTYSVVNIFDVTLRPQLKMT  150

Query  1498  GAVEIPEGNGSGVVWDGEGNIVTNYHVIGNSLSRNPTRGEVVARVNILAPDG  1343
             G VEIPEGNGSGVVW+GEG IVTNYHVIGN+LSRNP+ G+VV RVNILA DG
Sbjct  151   GVVEIPEGNGSGVVWNGEGYIVTNYHVIGNALSRNPSPGDVVGRVNILASDG  202



>ref|XP_011098617.1| PREDICTED: protease Do-like 8, chloroplastic [Sesamum indicum]
Length=546

 Score =   404 bits (1037),  Expect = 3e-130, Method: Compositional matrix adjust.
 Identities = 200/236 (85%), Positives = 223/236 (94%), Gaps = 0/236 (0%)
 Frame = -2

Query  1211  LQKNFEGKLVGADRSKDLAVLKVEASEDLLRPTKIGESSSLRVGQKCLAIGNPFGFDHTL  1032
             +QKNFEGKL+GADR+KDLAVLKVEA ++LLRP K+G SSSL+VGQ+CLAIGNPFGFDHTL
Sbjct  296   VQKNFEGKLIGADRAKDLAVLKVEAPKELLRPIKVGPSSSLKVGQQCLAIGNPFGFDHTL  355

Query  1031  TVGVISGLNRDIYSQTGVTISGGIQTDAAINPGNSGGPLLDSKGNLIGINTAIFTQTGTS  852
             TVGVISGLNRDI S+TGVTI GGIQTDAAINPGNSGGPLLDSKGNLIGINTAIFTQTGTS
Sbjct  356   TVGVISGLNRDINSRTGVTIGGGIQTDAAINPGNSGGPLLDSKGNLIGINTAIFTQTGTS  415

Query  851   AGVGFAIPSSTVLRIVPQLIQSGKVVRAGLNIDIAPDAIANQLNVRNGALVLLVPGNSLA  672
             AGVGFAIPSSTV++IVPQLIQ GKVVRAGLN++IAPD IANQLNVRNGAL+L VPG+SLA
Sbjct  416   AGVGFAIPSSTVVKIVPQLIQFGKVVRAGLNLEIAPDLIANQLNVRNGALILQVPGDSLA  475

Query  671   AKAGILPTTRGFAGNIVLGDIIEAVDNKPVRNKADLYKVLDDYSVGDKVQLKIRRG  504
             AKAG+LPTTRGFAGNIVLGDII AVD+KP RN+ +LYK+ D+Y+VGDKV LKI+RG
Sbjct  476   AKAGLLPTTRGFAGNIVLGDIILAVDDKPARNREELYKIFDEYNVGDKVLLKIQRG  531


 Score =   182 bits (462),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 88/109 (81%), Positives = 98/109 (90%), Gaps = 0/109 (0%)
 Frame = -3

Query  1669  AYALGDPSVTVEQVTPPTFPSGPLSPSEERIVQLFENNTYSVVNIFDVTLRPRLNVGGAV  1490
             AYALGDPSVTVEQVTP   P G L PSEERIV+LFE NTYSVVNIFDVTLRP+LN+ GAV
Sbjct  187   AYALGDPSVTVEQVTPQVLPPGALFPSEERIVKLFEKNTYSVVNIFDVTLRPQLNITGAV  246

Query  1489  EIPEGNGSGVVWDGEGNIVTNYHVIGNSLSRNPTRGEVVARVNILAPDG  1343
             E+PEGNGSGVVWD +G+IVTNYHVIGNSLSRNP+ G++VARVNILA +G
Sbjct  247   EVPEGNGSGVVWDEQGHIVTNYHVIGNSLSRNPSTGQIVARVNILASEG  295



>ref|XP_006283717.1| hypothetical protein CARUB_v10004787mg [Capsella rubella]
 gb|EOA16615.1| hypothetical protein CARUB_v10004787mg [Capsella rubella]
Length=453

 Score =   400 bits (1028),  Expect = 4e-130, Method: Compositional matrix adjust.
 Identities = 197/236 (83%), Positives = 222/236 (94%), Gaps = 0/236 (0%)
 Frame = -2

Query  1211  LQKNFEGKLVGADRSKDLAVLKVEASEDLLRPTKIGESSSLRVGQKCLAIGNPFGFDHTL  1032
             +QKNFEGKLVGADR+KDLAVLKVEA E LL+P  IG+S+SL+VGQ+CLAIGNPFGFDHTL
Sbjct  203   VQKNFEGKLVGADRAKDLAVLKVEAPEILLKPINIGQSNSLKVGQQCLAIGNPFGFDHTL  262

Query  1031  TVGVISGLNRDIYSQTGVTISGGIQTDAAINPGNSGGPLLDSKGNLIGINTAIFTQTGTS  852
             TVGVISGLNRDI+SQTGVTI GGIQTDAAINPGNSGGPLLDSKGNLIGINTAIFTQTGTS
Sbjct  263   TVGVISGLNRDIFSQTGVTIGGGIQTDAAINPGNSGGPLLDSKGNLIGINTAIFTQTGTS  322

Query  851   AGVGFAIPSSTVLRIVPQLIQSGKVVRAGLNIDIAPDAIANQLNVRNGALVLLVPGNSLA  672
             AGVGFAIPSSTV++IVPQLIQ  KV+RAG+NI++APD +ANQLNVRNGALVL VP NSLA
Sbjct  323   AGVGFAIPSSTVMKIVPQLIQFSKVLRAGINIELAPDPVANQLNVRNGALVLQVPANSLA  382

Query  671   AKAGILPTTRGFAGNIVLGDIIEAVDNKPVRNKADLYKVLDDYSVGDKVQLKIRRG  504
              KAG+ PT+RGFAGNIVLGD+I AVD+KPV+NKA+L K+LD+YSVGDKV+LKI+RG
Sbjct  383   EKAGLHPTSRGFAGNIVLGDVIVAVDDKPVKNKAELMKILDEYSVGDKVKLKIKRG  438


 Score =   175 bits (443),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 86/112 (77%), Positives = 97/112 (87%), Gaps = 1/112 (1%)
 Frame = -3

Query  1675  LQAYALGDPSV-TVEQVTPPTFPSGPLSPSEERIVQLFENNTYSVVNIFDVTLRPRLNVG  1499
             L A ALGDPS+ TVE V+PP FP+GPL P+E RIVQLFE NTYSVVNIFDVTLRP+L + 
Sbjct  91    LSALALGDPSIATVEDVSPPVFPAGPLFPTEGRIVQLFEKNTYSVVNIFDVTLRPQLKMT  150

Query  1498  GAVEIPEGNGSGVVWDGEGNIVTNYHVIGNSLSRNPTRGEVVARVNILAPDG  1343
             G VEIPEGNGSGVVWDG+G IVTNYHVIGN+L+RNP+ G+VV RVNILA DG
Sbjct  151   GVVEIPEGNGSGVVWDGQGYIVTNYHVIGNALARNPSPGDVVGRVNILASDG  202



>ref|XP_002870753.1| hypothetical protein ARALYDRAFT_494007 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH47012.1| hypothetical protein ARALYDRAFT_494007 [Arabidopsis lyrata subsp. 
lyrata]
Length=448

 Score =   400 bits (1027),  Expect = 5e-130, Method: Compositional matrix adjust.
 Identities = 198/236 (84%), Positives = 222/236 (94%), Gaps = 0/236 (0%)
 Frame = -2

Query  1211  LQKNFEGKLVGADRSKDLAVLKVEASEDLLRPTKIGESSSLRVGQKCLAIGNPFGFDHTL  1032
             +QKNFEGKLVGADR+KDLAVLKV+A E LL+P K+G+S+SL+VGQ+CLAIGNPFGFDHTL
Sbjct  198   VQKNFEGKLVGADRAKDLAVLKVDAPETLLKPIKVGQSNSLKVGQQCLAIGNPFGFDHTL  257

Query  1031  TVGVISGLNRDIYSQTGVTISGGIQTDAAINPGNSGGPLLDSKGNLIGINTAIFTQTGTS  852
             TVGVISGLNRDI+SQTGVTI GGIQTDAAINPGNSGGPLLDSKGNLIGINTAI TQTGTS
Sbjct  258   TVGVISGLNRDIFSQTGVTIGGGIQTDAAINPGNSGGPLLDSKGNLIGINTAIVTQTGTS  317

Query  851   AGVGFAIPSSTVLRIVPQLIQSGKVVRAGLNIDIAPDAIANQLNVRNGALVLLVPGNSLA  672
             AGVGFAIPSSTVL+IVPQLIQ  KV+RAG+NI++APD +ANQLNVRNGALVL VPGNSLA
Sbjct  318   AGVGFAIPSSTVLKIVPQLIQFNKVLRAGINIELAPDPVANQLNVRNGALVLQVPGNSLA  377

Query  671   AKAGILPTTRGFAGNIVLGDIIEAVDNKPVRNKADLYKVLDDYSVGDKVQLKIRRG  504
              KAG+ PT+RGFAGNIVLGDII AVD+KPV+NKA+L K+LD+YSVGDKV LKI+RG
Sbjct  378   EKAGLHPTSRGFAGNIVLGDIIVAVDDKPVKNKAELMKILDEYSVGDKVNLKIKRG  433


 Score =   176 bits (446),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 88/112 (79%), Positives = 97/112 (87%), Gaps = 1/112 (1%)
 Frame = -3

Query  1675  LQAYALGDPSV-TVEQVTPPTFPSGPLSPSEERIVQLFENNTYSVVNIFDVTLRPRLNVG  1499
             L A ALGDPSV TVE V+PP FP+GPL P+E RIVQLFE NTYSVVNIFDVTLRP+L + 
Sbjct  86    LSALALGDPSVATVEDVSPPVFPAGPLFPTEGRIVQLFEKNTYSVVNIFDVTLRPQLKMT  145

Query  1498  GAVEIPEGNGSGVVWDGEGNIVTNYHVIGNSLSRNPTRGEVVARVNILAPDG  1343
             G VEIPEGNGSGVVWDG+G IVTNYHVIGN+LSRNP+ G+VV RVNILA DG
Sbjct  146   GVVEIPEGNGSGVVWDGQGYIVTNYHVIGNALSRNPSPGDVVGRVNILASDG  197



>ref|XP_010693232.1| PREDICTED: protease Do-like 8, chloroplastic isoform X1 [Beta 
vulgaris subsp. vulgaris]
Length=457

 Score =   400 bits (1028),  Expect = 5e-130, Method: Compositional matrix adjust.
 Identities = 201/235 (86%), Positives = 219/235 (93%), Gaps = 0/235 (0%)
 Frame = -2

Query  1211  LQKNFEGKLVGADRSKDLAVLKVEASEDLLRPTKIGESSSLRVGQKCLAIGNPFGFDHTL  1032
             +QK+FEG LVGADR+KDLAVLKVEA+ DLL+P  +G SSSL+VGQ+CLAIGNPFGFDHTL
Sbjct  207   VQKSFEGTLVGADRAKDLAVLKVEAAADLLKPINVGPSSSLKVGQQCLAIGNPFGFDHTL  266

Query  1031  TVGVISGLNRDIYSQTGVTISGGIQTDAAINPGNSGGPLLDSKGNLIGINTAIFTQTGTS  852
             TVGVISGLNRDI+SQTGVTI GGIQTDAAINPGNSGGPLLDSKGNLIGINTAIFTQTGTS
Sbjct  267   TVGVISGLNRDIFSQTGVTIGGGIQTDAAINPGNSGGPLLDSKGNLIGINTAIFTQTGTS  326

Query  851   AGVGFAIPSSTVLRIVPQLIQSGKVVRAGLNIDIAPDAIANQLNVRNGALVLLVPGNSLA  672
             AGVGFAIPSST+L+I+PQLIQ GKVVRAGLNID APD IA+QLNVRNGALVL VP NSLA
Sbjct  327   AGVGFAIPSSTLLKIIPQLIQFGKVVRAGLNIDFAPDLIASQLNVRNGALVLQVPQNSLA  386

Query  671   AKAGILPTTRGFAGNIVLGDIIEAVDNKPVRNKADLYKVLDDYSVGDKVQLKIRR  507
             AKAG+ PTTRGFAGNI+LGDII AVDNKPVR+KADL +VLDDYSVGD+V LKI R
Sbjct  387   AKAGLRPTTRGFAGNIILGDIIAAVDNKPVRSKADLMRVLDDYSVGDEVILKIMR  441


 Score =   181 bits (460),  Expect = 5e-47, Method: Compositional matrix adjust.
 Identities = 87/111 (78%), Positives = 99/111 (89%), Gaps = 0/111 (0%)
 Frame = -3

Query  1675  LQAYALGDPSVTVEQVTPPTFPSGPLSPSEERIVQLFENNTYSVVNIFDVTLRPRLNVGG  1496
             L AYALGDPSVT+E+VTPP FPSGPL  SEER+V+LFE NTYSVVNIFDVTLRP+L+  G
Sbjct  96    LPAYALGDPSVTIEEVTPPVFPSGPLLSSEERVVRLFEKNTYSVVNIFDVTLRPQLSTSG  155

Query  1495  AVEIPEGNGSGVVWDGEGNIVTNYHVIGNSLSRNPTRGEVVARVNILAPDG  1343
              VE+PEGNGSGVVWDG+G+IVTNYHVIGNSLSR  + G++VARVNILA DG
Sbjct  156   VVEVPEGNGSGVVWDGQGHIVTNYHVIGNSLSRKLSPGQLVARVNILASDG  206



>ref|XP_010693233.1| PREDICTED: protease Do-like 8, chloroplastic isoform X2 [Beta 
vulgaris subsp. vulgaris]
Length=456

 Score =   400 bits (1028),  Expect = 5e-130, Method: Compositional matrix adjust.
 Identities = 201/235 (86%), Positives = 219/235 (93%), Gaps = 0/235 (0%)
 Frame = -2

Query  1211  LQKNFEGKLVGADRSKDLAVLKVEASEDLLRPTKIGESSSLRVGQKCLAIGNPFGFDHTL  1032
             +QK+FEG LVGADR+KDLAVLKVEA+ DLL+P  +G SSSL+VGQ+CLAIGNPFGFDHTL
Sbjct  206   VQKSFEGTLVGADRAKDLAVLKVEAAADLLKPINVGPSSSLKVGQQCLAIGNPFGFDHTL  265

Query  1031  TVGVISGLNRDIYSQTGVTISGGIQTDAAINPGNSGGPLLDSKGNLIGINTAIFTQTGTS  852
             TVGVISGLNRDI+SQTGVTI GGIQTDAAINPGNSGGPLLDSKGNLIGINTAIFTQTGTS
Sbjct  266   TVGVISGLNRDIFSQTGVTIGGGIQTDAAINPGNSGGPLLDSKGNLIGINTAIFTQTGTS  325

Query  851   AGVGFAIPSSTVLRIVPQLIQSGKVVRAGLNIDIAPDAIANQLNVRNGALVLLVPGNSLA  672
             AGVGFAIPSST+L+I+PQLIQ GKVVRAGLNID APD IA+QLNVRNGALVL VP NSLA
Sbjct  326   AGVGFAIPSSTLLKIIPQLIQFGKVVRAGLNIDFAPDLIASQLNVRNGALVLQVPQNSLA  385

Query  671   AKAGILPTTRGFAGNIVLGDIIEAVDNKPVRNKADLYKVLDDYSVGDKVQLKIRR  507
             AKAG+ PTTRGFAGNI+LGDII AVDNKPVR+KADL +VLDDYSVGD+V LKI R
Sbjct  386   AKAGLRPTTRGFAGNIILGDIIAAVDNKPVRSKADLMRVLDDYSVGDEVILKIMR  440


 Score =   181 bits (460),  Expect = 5e-47, Method: Compositional matrix adjust.
 Identities = 87/111 (78%), Positives = 99/111 (89%), Gaps = 0/111 (0%)
 Frame = -3

Query  1675  LQAYALGDPSVTVEQVTPPTFPSGPLSPSEERIVQLFENNTYSVVNIFDVTLRPRLNVGG  1496
             L AYALGDPSVT+E+VTPP FPSGPL  SEER+V+LFE NTYSVVNIFDVTLRP+L+  G
Sbjct  95    LPAYALGDPSVTIEEVTPPVFPSGPLLSSEERVVRLFEKNTYSVVNIFDVTLRPQLSTSG  154

Query  1495  AVEIPEGNGSGVVWDGEGNIVTNYHVIGNSLSRNPTRGEVVARVNILAPDG  1343
              VE+PEGNGSGVVWDG+G+IVTNYHVIGNSLSR  + G++VARVNILA DG
Sbjct  155   VVEVPEGNGSGVVWDGQGHIVTNYHVIGNSLSRKLSPGQLVARVNILASDG  205



>ref|XP_007151224.1| hypothetical protein PHAVU_004G028200g [Phaseolus vulgaris]
 gb|ESW23218.1| hypothetical protein PHAVU_004G028200g [Phaseolus vulgaris]
Length=458

 Score =   400 bits (1027),  Expect = 6e-130, Method: Compositional matrix adjust.
 Identities = 199/236 (84%), Positives = 220/236 (93%), Gaps = 0/236 (0%)
 Frame = -2

Query  1211  LQKNFEGKLVGADRSKDLAVLKVEASEDLLRPTKIGESSSLRVGQKCLAIGNPFGFDHTL  1032
             LQKNFEG L+GADR KDLAVLKV+A +D+LRP K+G+SSSL+VGQ+CLAIGNPFGFDHTL
Sbjct  208   LQKNFEGILIGADRLKDLAVLKVDAPKDILRPIKVGQSSSLKVGQQCLAIGNPFGFDHTL  267

Query  1031  TVGVISGLNRDIYSQTGVTISGGIQTDAAINPGNSGGPLLDSKGNLIGINTAIFTQTGTS  852
             T G+ISGLNRDI+SQTGVTI GG+QTDAAINPGNSGGPLLDSKG+LIGINTAIFTQTGTS
Sbjct  268   TAGIISGLNRDIFSQTGVTIGGGVQTDAAINPGNSGGPLLDSKGSLIGINTAIFTQTGTS  327

Query  851   AGVGFAIPSSTVLRIVPQLIQSGKVVRAGLNIDIAPDAIANQLNVRNGALVLLVPGNSLA  672
             AGVGFAIPSSTVLRI+PQLI+ GKVVR GLN+DIAPD IANQLNVRNGALVLLVP NSLA
Sbjct  328   AGVGFAIPSSTVLRIIPQLIRFGKVVRGGLNVDIAPDLIANQLNVRNGALVLLVPANSLA  387

Query  671   AKAGILPTTRGFAGNIVLGDIIEAVDNKPVRNKADLYKVLDDYSVGDKVQLKIRRG  504
             AKAG+ PTTRGFAGNIVLGDII AVDNKPV++KA+L K LDDY+VGDKV L I+RG
Sbjct  388   AKAGLNPTTRGFAGNIVLGDIIVAVDNKPVKSKAELLKALDDYNVGDKVVLMIQRG  443


 Score =   184 bits (466),  Expect = 7e-48, Method: Compositional matrix adjust.
 Identities = 90/111 (81%), Positives = 98/111 (88%), Gaps = 0/111 (0%)
 Frame = -3

Query  1675  LQAYALGDPSVTVEQVTPPTFPSGPLSPSEERIVQLFENNTYSVVNIFDVTLRPRLNVGG  1496
             L A ALGDPSVT+E+VTPP F SGPL P E+RIVQLFE NTYSVVNIFDVTLRP+LN+ G
Sbjct  97    LSALALGDPSVTLEEVTPPVFSSGPLFPIEDRIVQLFERNTYSVVNIFDVTLRPQLNITG  156

Query  1495  AVEIPEGNGSGVVWDGEGNIVTNYHVIGNSLSRNPTRGEVVARVNILAPDG  1343
              VEIPEGNGSGVVWD EG+IVTNYHVIGN+LSRNP  GEVVARVNILA +G
Sbjct  157   VVEIPEGNGSGVVWDEEGHIVTNYHVIGNALSRNPKAGEVVARVNILASEG  207



>ref|XP_009124853.1| PREDICTED: protease Do-like 8, chloroplastic [Brassica rapa]
 emb|CDX74425.1| BnaA04g09640D [Brassica napus]
Length=451

 Score =   399 bits (1026),  Expect = 7e-130, Method: Compositional matrix adjust.
 Identities = 197/236 (83%), Positives = 224/236 (95%), Gaps = 0/236 (0%)
 Frame = -2

Query  1211  LQKNFEGKLVGADRSKDLAVLKVEASEDLLRPTKIGESSSLRVGQKCLAIGNPFGFDHTL  1032
             +QKNFEGKLVGADR+KDLAVLKVEA E LL+P ++G+S+SL+VGQ+CLAIGNPFGFDHTL
Sbjct  201   VQKNFEGKLVGADRAKDLAVLKVEAPETLLKPIRVGQSNSLKVGQQCLAIGNPFGFDHTL  260

Query  1031  TVGVISGLNRDIYSQTGVTISGGIQTDAAINPGNSGGPLLDSKGNLIGINTAIFTQTGTS  852
             TVGVISGLNRDI+SQTGVTI GGIQTDAAINPGNSGGPLLDSKGNLIGINTAI+TQTGTS
Sbjct  261   TVGVISGLNRDIFSQTGVTIGGGIQTDAAINPGNSGGPLLDSKGNLIGINTAIYTQTGTS  320

Query  851   AGVGFAIPSSTVLRIVPQLIQSGKVVRAGLNIDIAPDAIANQLNVRNGALVLLVPGNSLA  672
             AGVGFAIPSSTVL+IVPQLIQ  KV+RAG+NI++APD +ANQLNVRNGALVL VPG+SLA
Sbjct  321   AGVGFAIPSSTVLKIVPQLIQFSKVLRAGINIELAPDQVANQLNVRNGALVLQVPGDSLA  380

Query  671   AKAGILPTTRGFAGNIVLGDIIEAVDNKPVRNKADLYKVLDDYSVGDKVQLKIRRG  504
             AKAG+ PT+RGFAGNIVLGDII AVD+KPV++KA+L KVLD+YSVGDKV+L I+RG
Sbjct  381   AKAGLRPTSRGFAGNIVLGDIIVAVDDKPVKSKAELMKVLDEYSVGDKVKLAIKRG  436


 Score =   168 bits (426),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 88/119 (74%), Positives = 96/119 (81%), Gaps = 2/119 (2%)
 Frame = -3

Query  1693  CTQFITLQAYALGDPSV-TVEQVTPPT-FPSGPLSPSEERIVQLFENNTYSVVNIFDVTL  1520
             C     L A ALGDPSV TVE V PP  FP+GPL P+E RIVQLFE NTYSVVNIFDVTL
Sbjct  82    CNPSRYLSALALGDPSVATVEDVIPPVVFPAGPLFPTEGRIVQLFEKNTYSVVNIFDVTL  141

Query  1519  RPRLNVGGAVEIPEGNGSGVVWDGEGNIVTNYHVIGNSLSRNPTRGEVVARVNILAPDG  1343
             RP+L + G VEIPEGNGSGVVWD +G IVTNYHVIGN+LSRNP+ G+VV RVNILA DG
Sbjct  142   RPQLKMTGVVEIPEGNGSGVVWDEQGYIVTNYHVIGNALSRNPSPGDVVGRVNILASDG  200



>ref|XP_002305987.2| hypothetical protein POPTR_0004s13440g [Populus trichocarpa]
 gb|EEE86498.2| hypothetical protein POPTR_0004s13440g [Populus trichocarpa]
Length=465

 Score =   400 bits (1027),  Expect = 9e-130, Method: Compositional matrix adjust.
 Identities = 204/236 (86%), Positives = 220/236 (93%), Gaps = 0/236 (0%)
 Frame = -2

Query  1211  LQKNFEGKLVGADRSKDLAVLKVEASEDLLRPTKIGESSSLRVGQKCLAIGNPFGFDHTL  1032
             LQKNFEGKLVGADR+KDLAVLKVEASEDLL+P K+G+SSSLRVGQ+CLAIGNPFGFDHTL
Sbjct  216   LQKNFEGKLVGADRAKDLAVLKVEASEDLLKPIKVGQSSSLRVGQQCLAIGNPFGFDHTL  275

Query  1031  TVGVISGLNRDIYSQTGVTISGGIQTDAAINPGNSGGPLLDSKGNLIGINTAIFTQTGTS  852
             TVGVISGLNRDI SQTGVTI GGIQTDAAINPGNSGGPLLDSKGNLIGINTAIFT+TGTS
Sbjct  276   TVGVISGLNRDISSQTGVTIGGGIQTDAAINPGNSGGPLLDSKGNLIGINTAIFTRTGTS  335

Query  851   AGVGFAIPSSTVLRIVPQLIQSGKVVRAGLNIDIAPDAIANQLNVRNGALVLLVPGNSLA  672
             AGVGFAIPSSTVL+I  QLIQ  KVVRAGLN+DIAPD IANQLNVRNGAL+L VPGNSLA
Sbjct  336   AGVGFAIPSSTVLKIALQLIQFSKVVRAGLNVDIAPDLIANQLNVRNGALILQVPGNSLA  395

Query  671   AKAGILPTTRGFAGNIVLGDIIEAVDNKPVRNKADLYKVLDDYSVGDKVQLKIRRG  504
             AKAG++PTTRGFAGNIVLGD+I  VDNK V+NKA L KVLDDY+VGD+V L I+RG
Sbjct  396   AKAGLVPTTRGFAGNIVLGDVIVGVDNKTVKNKAGLDKVLDDYNVGDRVLLIIQRG  451


 Score =   179 bits (455),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 89/111 (80%), Positives = 97/111 (87%), Gaps = 0/111 (0%)
 Frame = -3

Query  1675  LQAYALGDPSVTVEQVTPPTFPSGPLSPSEERIVQLFENNTYSVVNIFDVTLRPRLNVGG  1496
             L A ALGDPSVT+EQVTPP   SG L P EERIVQLFE NTYSVVNIFDVTLRP+LNV G
Sbjct  105   LSAQALGDPSVTIEQVTPPVLTSGALFPVEERIVQLFEKNTYSVVNIFDVTLRPQLNVTG  164

Query  1495  AVEIPEGNGSGVVWDGEGNIVTNYHVIGNSLSRNPTRGEVVARVNILAPDG  1343
              VEIPEGNGSGVVWD +G+IVTNYHVIGN+LSRNP+ G+VVARVNILA +G
Sbjct  165   MVEIPEGNGSGVVWDEQGHIVTNYHVIGNALSRNPSPGQVVARVNILASEG  215



>ref|XP_006384343.1| hypothetical protein POPTR_0004s13440g [Populus trichocarpa]
 gb|ERP62140.1| hypothetical protein POPTR_0004s13440g [Populus trichocarpa]
Length=467

 Score =   399 bits (1026),  Expect = 1e-129, Method: Compositional matrix adjust.
 Identities = 204/236 (86%), Positives = 220/236 (93%), Gaps = 0/236 (0%)
 Frame = -2

Query  1211  LQKNFEGKLVGADRSKDLAVLKVEASEDLLRPTKIGESSSLRVGQKCLAIGNPFGFDHTL  1032
             LQKNFEGKLVGADR+KDLAVLKVEASEDLL+P K+G+SSSLRVGQ+CLAIGNPFGFDHTL
Sbjct  218   LQKNFEGKLVGADRAKDLAVLKVEASEDLLKPIKVGQSSSLRVGQQCLAIGNPFGFDHTL  277

Query  1031  TVGVISGLNRDIYSQTGVTISGGIQTDAAINPGNSGGPLLDSKGNLIGINTAIFTQTGTS  852
             TVGVISGLNRDI SQTGVTI GGIQTDAAINPGNSGGPLLDSKGNLIGINTAIFT+TGTS
Sbjct  278   TVGVISGLNRDISSQTGVTIGGGIQTDAAINPGNSGGPLLDSKGNLIGINTAIFTRTGTS  337

Query  851   AGVGFAIPSSTVLRIVPQLIQSGKVVRAGLNIDIAPDAIANQLNVRNGALVLLVPGNSLA  672
             AGVGFAIPSSTVL+I  QLIQ  KVVRAGLN+DIAPD IANQLNVRNGAL+L VPGNSLA
Sbjct  338   AGVGFAIPSSTVLKIALQLIQFSKVVRAGLNVDIAPDLIANQLNVRNGALILQVPGNSLA  397

Query  671   AKAGILPTTRGFAGNIVLGDIIEAVDNKPVRNKADLYKVLDDYSVGDKVQLKIRRG  504
             AKAG++PTTRGFAGNIVLGD+I  VDNK V+NKA L KVLDDY+VGD+V L I+RG
Sbjct  398   AKAGLVPTTRGFAGNIVLGDVIVGVDNKTVKNKAGLDKVLDDYNVGDRVLLIIQRG  453


 Score =   179 bits (455),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 89/111 (80%), Positives = 97/111 (87%), Gaps = 0/111 (0%)
 Frame = -3

Query  1675  LQAYALGDPSVTVEQVTPPTFPSGPLSPSEERIVQLFENNTYSVVNIFDVTLRPRLNVGG  1496
             L A ALGDPSVT+EQVTPP   SG L P EERIVQLFE NTYSVVNIFDVTLRP+LNV G
Sbjct  107   LSAQALGDPSVTIEQVTPPVLTSGALFPVEERIVQLFEKNTYSVVNIFDVTLRPQLNVTG  166

Query  1495  AVEIPEGNGSGVVWDGEGNIVTNYHVIGNSLSRNPTRGEVVARVNILAPDG  1343
              VEIPEGNGSGVVWD +G+IVTNYHVIGN+LSRNP+ G+VVARVNILA +G
Sbjct  167   MVEIPEGNGSGVVWDEQGHIVTNYHVIGNALSRNPSPGQVVARVNILASEG  217



>ref|XP_010937127.1| PREDICTED: protease Do-like 8, chloroplastic isoform X2 [Elaeis 
guineensis]
Length=412

 Score =   397 bits (1020),  Expect = 2e-129, Method: Compositional matrix adjust.
 Identities = 196/236 (83%), Positives = 223/236 (94%), Gaps = 0/236 (0%)
 Frame = -2

Query  1211  LQKNFEGKLVGADRSKDLAVLKVEASEDLLRPTKIGESSSLRVGQKCLAIGNPFGFDHTL  1032
             +QKNFEGKL+GADR+KDLAVLKVEAS DLL+P K+G+SS+L+VGQ+CLAIGNPFGFDHTL
Sbjct  162   VQKNFEGKLIGADRAKDLAVLKVEASADLLKPIKVGQSSALKVGQQCLAIGNPFGFDHTL  221

Query  1031  TVGVISGLNRDIYSQTGVTISGGIQTDAAINPGNSGGPLLDSKGNLIGINTAIFTQTGTS  852
             TVGVISGL+RDI+SQTGVTI GGIQTDAAINPGNSGGPLL+SKGNLIGINTAIFTQTGTS
Sbjct  222   TVGVISGLDRDIFSQTGVTIGGGIQTDAAINPGNSGGPLLNSKGNLIGINTAIFTQTGTS  281

Query  851   AGVGFAIPSSTVLRIVPQLIQSGKVVRAGLNIDIAPDAIANQLNVRNGALVLLVPGNSLA  672
             AGVGFAIPSSTVL+IVPQLIQ GKVVRAGLN++IA D + NQLNVR GALVL V GNS+A
Sbjct  282   AGVGFAIPSSTVLKIVPQLIQFGKVVRAGLNVEIASDLVTNQLNVRKGALVLQVMGNSVA  341

Query  671   AKAGILPTTRGFAGNIVLGDIIEAVDNKPVRNKADLYKVLDDYSVGDKVQLKIRRG  504
             AKAG+LPTTRGFAGNI+LGD+I AVD+KP+R+KADL K+LDDY+VGDKV LK++RG
Sbjct  342   AKAGLLPTTRGFAGNIILGDVIVAVDDKPIRSKADLSKILDDYNVGDKVVLKVQRG  397


 Score =   179 bits (454),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 89/122 (73%), Positives = 102/122 (84%), Gaps = 3/122 (2%)
 Frame = -3

Query  1699  SLCTQFIT---LQAYALGDPSVTVEQVTPPTFPSGPLSPSEERIVQLFENNTYSVVNIFD  1529
             ++C  F +     A ALGD SVTV+ VTP  FPSGPL PSEERIV+LFE NTYSVVNIFD
Sbjct  40    AICLCFHSSRYFTAVALGDSSVTVDDVTPRIFPSGPLFPSEERIVELFETNTYSVVNIFD  99

Query  1528  VTLRPRLNVGGAVEIPEGNGSGVVWDGEGNIVTNYHVIGNSLSRNPTRGEVVARVNILAP  1349
             VTLRP+LNV G VE+PEGNGSGVVWD +G+IVTNYHV+GN+LSRNP+ G+VVARVNILA 
Sbjct  100   VTLRPQLNVTGVVEVPEGNGSGVVWDNDGHIVTNYHVVGNALSRNPSPGQVVARVNILAS  159

Query  1348  DG  1343
             DG
Sbjct  160   DG  161



>gb|AFK34777.1| unknown [Lotus japonicus]
Length=460

 Score =   398 bits (1023),  Expect = 3e-129, Method: Compositional matrix adjust.
 Identities = 198/236 (84%), Positives = 219/236 (93%), Gaps = 0/236 (0%)
 Frame = -2

Query  1211  LQKNFEGKLVGADRSKDLAVLKVEASEDLLRPTKIGESSSLRVGQKCLAIGNPFGFDHTL  1032
             +QKNFE  +VGADR KDLAVLKVEA ED+LRP K+G+SSSL+VGQ+CLAIGNPFGFDHTL
Sbjct  210   VQKNFEATVVGADRLKDLAVLKVEAPEDILRPIKVGQSSSLKVGQQCLAIGNPFGFDHTL  269

Query  1031  TVGVISGLNRDIYSQTGVTISGGIQTDAAINPGNSGGPLLDSKGNLIGINTAIFTQTGTS  852
             TVGVISGLNRDI+SQTGVTI GGIQTDAA+NPGNSGGPLL+SKG+LIGINTAIFTQTGTS
Sbjct  270   TVGVISGLNRDIFSQTGVTIGGGIQTDAAVNPGNSGGPLLNSKGSLIGINTAIFTQTGTS  329

Query  851   AGVGFAIPSSTVLRIVPQLIQSGKVVRAGLNIDIAPDAIANQLNVRNGALVLLVPGNSLA  672
             AGVGFAIPSSTVLRIVPQLIQ GKVVR GLN+DIAPD +ANQLNVRNGAL+L VP NS A
Sbjct  330   AGVGFAIPSSTVLRIVPQLIQYGKVVRGGLNVDIAPDLVANQLNVRNGALILQVPANSPA  389

Query  671   AKAGILPTTRGFAGNIVLGDIIEAVDNKPVRNKADLYKVLDDYSVGDKVQLKIRRG  504
             AKAG++PTTRGFAGNIVLGDII AVDNKPV++KA+L K LDDY+VGDKV L I+RG
Sbjct  390   AKAGLIPTTRGFAGNIVLGDIIVAVDNKPVKSKAELLKALDDYNVGDKVILLIQRG  445


 Score =   186 bits (471),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 90/111 (81%), Positives = 99/111 (89%), Gaps = 0/111 (0%)
 Frame = -3

Query  1675  LQAYALGDPSVTVEQVTPPTFPSGPLSPSEERIVQLFENNTYSVVNIFDVTLRPRLNVGG  1496
             L A ALGDPSVT+EQV PP FPSGPL P+E+R+VQLFE NTYSVVNIFDVTLRP+LNV G
Sbjct  99    LSALALGDPSVTLEQVIPPVFPSGPLFPAEDRVVQLFERNTYSVVNIFDVTLRPQLNVTG  158

Query  1495  AVEIPEGNGSGVVWDGEGNIVTNYHVIGNSLSRNPTRGEVVARVNILAPDG  1343
              VEIPE NGSGVVWD EG+IVTNYHVIGN+LSRNP+ G+VVARVNILA DG
Sbjct  159   VVEIPERNGSGVVWDDEGHIVTNYHVIGNALSRNPSSGQVVARVNILASDG  209



>emb|CDY30272.1| BnaC04g31830D [Brassica napus]
Length=450

 Score =   397 bits (1020),  Expect = 6e-129, Method: Compositional matrix adjust.
 Identities = 196/236 (83%), Positives = 223/236 (94%), Gaps = 0/236 (0%)
 Frame = -2

Query  1211  LQKNFEGKLVGADRSKDLAVLKVEASEDLLRPTKIGESSSLRVGQKCLAIGNPFGFDHTL  1032
             +QKNFEGKLVGADR+KDLAVLKVEA E LL+P ++G+S+SL+VGQ+CLAIGNPFGFDHTL
Sbjct  201   VQKNFEGKLVGADRAKDLAVLKVEAPETLLKPIRVGQSNSLKVGQQCLAIGNPFGFDHTL  260

Query  1031  TVGVISGLNRDIYSQTGVTISGGIQTDAAINPGNSGGPLLDSKGNLIGINTAIFTQTGTS  852
             TVGVISGLNRDI+SQTGVTI GGIQTDAAINPGNSGGPLLDSKGNLIGINTAI+TQTGTS
Sbjct  261   TVGVISGLNRDIFSQTGVTIGGGIQTDAAINPGNSGGPLLDSKGNLIGINTAIYTQTGTS  320

Query  851   AGVGFAIPSSTVLRIVPQLIQSGKVVRAGLNIDIAPDAIANQLNVRNGALVLLVPGNSLA  672
             AGVGFAIPSSTVL+IVPQLIQ  KV+RAG+NI++APD +ANQLNVRNGALVL VPG+SLA
Sbjct  321   AGVGFAIPSSTVLKIVPQLIQFSKVLRAGINIELAPDQVANQLNVRNGALVLQVPGDSLA  380

Query  671   AKAGILPTTRGFAGNIVLGDIIEAVDNKPVRNKADLYKVLDDYSVGDKVQLKIRRG  504
             AK G+ PT+RGFAGNIVLGDII AVD+KPV++KA+L KVLD+YSVGDKV+L I+RG
Sbjct  381   AKTGLRPTSRGFAGNIVLGDIIVAVDDKPVKSKAELMKVLDEYSVGDKVKLAIKRG  436


 Score =   166 bits (421),  Expect = 8e-42, Method: Compositional matrix adjust.
 Identities = 87/119 (73%), Positives = 95/119 (80%), Gaps = 2/119 (2%)
 Frame = -3

Query  1693  CTQFITLQAYALGDPSV-TVEQVTPPT-FPSGPLSPSEERIVQLFENNTYSVVNIFDVTL  1520
             C     L A ALGDPSV TVE V+PP  FP+GPL P+E RIVQLFE NTYSVVNIFDVTL
Sbjct  82    CNPSRYLSALALGDPSVATVEDVSPPVVFPAGPLFPTEGRIVQLFEKNTYSVVNIFDVTL  141

Query  1519  RPRLNVGGAVEIPEGNGSGVVWDGEGNIVTNYHVIGNSLSRNPTRGEVVARVNILAPDG  1343
             RP+L + G VEIPEGNGSGVVWD +G IVTNYHVIGN+LSRNP  G+VV RVNIL  DG
Sbjct  142   RPQLKMTGVVEIPEGNGSGVVWDEQGYIVTNYHVIGNALSRNPIPGDVVGRVNILTSDG  200



>ref|XP_010937121.1| PREDICTED: protease Do-like 8, chloroplastic isoform X1 [Elaeis 
guineensis]
 ref|XP_010937123.1| PREDICTED: protease Do-like 8, chloroplastic isoform X1 [Elaeis 
guineensis]
 ref|XP_010937124.1| PREDICTED: protease Do-like 8, chloroplastic isoform X1 [Elaeis 
guineensis]
 ref|XP_010937125.1| PREDICTED: protease Do-like 8, chloroplastic isoform X1 [Elaeis 
guineensis]
 ref|XP_010937126.1| PREDICTED: protease Do-like 8, chloroplastic isoform X1 [Elaeis 
guineensis]
Length=460

 Score =   397 bits (1019),  Expect = 1e-128, Method: Compositional matrix adjust.
 Identities = 196/236 (83%), Positives = 223/236 (94%), Gaps = 0/236 (0%)
 Frame = -2

Query  1211  LQKNFEGKLVGADRSKDLAVLKVEASEDLLRPTKIGESSSLRVGQKCLAIGNPFGFDHTL  1032
             +QKNFEGKL+GADR+KDLAVLKVEAS DLL+P K+G+SS+L+VGQ+CLAIGNPFGFDHTL
Sbjct  210   VQKNFEGKLIGADRAKDLAVLKVEASADLLKPIKVGQSSALKVGQQCLAIGNPFGFDHTL  269

Query  1031  TVGVISGLNRDIYSQTGVTISGGIQTDAAINPGNSGGPLLDSKGNLIGINTAIFTQTGTS  852
             TVGVISGL+RDI+SQTGVTI GGIQTDAAINPGNSGGPLL+SKGNLIGINTAIFTQTGTS
Sbjct  270   TVGVISGLDRDIFSQTGVTIGGGIQTDAAINPGNSGGPLLNSKGNLIGINTAIFTQTGTS  329

Query  851   AGVGFAIPSSTVLRIVPQLIQSGKVVRAGLNIDIAPDAIANQLNVRNGALVLLVPGNSLA  672
             AGVGFAIPSSTVL+IVPQLIQ GKVVRAGLN++IA D + NQLNVR GALVL V GNS+A
Sbjct  330   AGVGFAIPSSTVLKIVPQLIQFGKVVRAGLNVEIASDLVTNQLNVRKGALVLQVMGNSVA  389

Query  671   AKAGILPTTRGFAGNIVLGDIIEAVDNKPVRNKADLYKVLDDYSVGDKVQLKIRRG  504
             AKAG+LPTTRGFAGNI+LGD+I AVD+KP+R+KADL K+LDDY+VGDKV LK++RG
Sbjct  390   AKAGLLPTTRGFAGNIILGDVIVAVDDKPIRSKADLSKILDDYNVGDKVVLKVQRG  445


 Score =   179 bits (453),  Expect = 6e-46, Method: Compositional matrix adjust.
 Identities = 89/122 (73%), Positives = 102/122 (84%), Gaps = 3/122 (2%)
 Frame = -3

Query  1699  SLCTQFIT---LQAYALGDPSVTVEQVTPPTFPSGPLSPSEERIVQLFENNTYSVVNIFD  1529
             ++C  F +     A ALGD SVTV+ VTP  FPSGPL PSEERIV+LFE NTYSVVNIFD
Sbjct  88    AICLCFHSSRYFTAVALGDSSVTVDDVTPRIFPSGPLFPSEERIVELFETNTYSVVNIFD  147

Query  1528  VTLRPRLNVGGAVEIPEGNGSGVVWDGEGNIVTNYHVIGNSLSRNPTRGEVVARVNILAP  1349
             VTLRP+LNV G VE+PEGNGSGVVWD +G+IVTNYHV+GN+LSRNP+ G+VVARVNILA 
Sbjct  148   VTLRPQLNVTGVVEVPEGNGSGVVWDNDGHIVTNYHVVGNALSRNPSPGQVVARVNILAS  207

Query  1348  DG  1343
             DG
Sbjct  208   DG  209



>ref|XP_008784276.1| PREDICTED: protease Do-like 8, chloroplastic isoform X2 [Phoenix 
dactylifera]
Length=413

 Score =   394 bits (1013),  Expect = 2e-128, Method: Compositional matrix adjust.
 Identities = 195/236 (83%), Positives = 222/236 (94%), Gaps = 0/236 (0%)
 Frame = -2

Query  1211  LQKNFEGKLVGADRSKDLAVLKVEASEDLLRPTKIGESSSLRVGQKCLAIGNPFGFDHTL  1032
             +QKNFEGKL+GADR+KDLAVLKVEAS DLL+  K+G+SS+L+VGQ+CLAIGNPFGFDHTL
Sbjct  162   VQKNFEGKLIGADRAKDLAVLKVEASADLLKSIKVGQSSALKVGQQCLAIGNPFGFDHTL  221

Query  1031  TVGVISGLNRDIYSQTGVTISGGIQTDAAINPGNSGGPLLDSKGNLIGINTAIFTQTGTS  852
             TVGVISGLNRDI+SQTGVTI GGIQTDAAINPGNSGGPLLDSKGNLIGINTAIFTQTGTS
Sbjct  222   TVGVISGLNRDIFSQTGVTIGGGIQTDAAINPGNSGGPLLDSKGNLIGINTAIFTQTGTS  281

Query  851   AGVGFAIPSSTVLRIVPQLIQSGKVVRAGLNIDIAPDAIANQLNVRNGALVLLVPGNSLA  672
             AGVGFAIPSSTVL+IVPQLIQ GKVVRAGLN++IA + +ANQLNV+ GALVL V GNS+A
Sbjct  282   AGVGFAIPSSTVLKIVPQLIQFGKVVRAGLNVEIASNLVANQLNVQKGALVLQVMGNSVA  341

Query  671   AKAGILPTTRGFAGNIVLGDIIEAVDNKPVRNKADLYKVLDDYSVGDKVQLKIRRG  504
             AK G+LPTTRGFAGNI+LGD+I AVD+KP+R+KADL K+LDDY+VGDKV LK++RG
Sbjct  342   AKVGLLPTTRGFAGNIILGDVIVAVDDKPIRSKADLSKILDDYNVGDKVVLKVQRG  397


 Score =   179 bits (453),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 88/122 (72%), Positives = 102/122 (84%), Gaps = 3/122 (2%)
 Frame = -3

Query  1699  SLCTQFIT---LQAYALGDPSVTVEQVTPPTFPSGPLSPSEERIVQLFENNTYSVVNIFD  1529
             ++C  F +     A ALGDPSVTV+ VTP   PSGPL PSEERIV+LFE NTYSVVNIFD
Sbjct  40    AICLCFHSSRYFTAVALGDPSVTVQDVTPRILPSGPLFPSEERIVELFERNTYSVVNIFD  99

Query  1528  VTLRPRLNVGGAVEIPEGNGSGVVWDGEGNIVTNYHVIGNSLSRNPTRGEVVARVNILAP  1349
             VTLRP+LNV G VE+PEGNGSGVVWD +G+IVTNYHV+GN+LS+NP+ G+VVARVNILA 
Sbjct  100   VTLRPQLNVTGVVEVPEGNGSGVVWDNDGHIVTNYHVVGNALSKNPSPGQVVARVNILAS  159

Query  1348  DG  1343
             DG
Sbjct  160   DG  161



>ref|XP_010029298.1| PREDICTED: protease Do-like 8, chloroplastic [Eucalyptus grandis]
 gb|KCW56193.1| hypothetical protein EUGRSUZ_I01939 [Eucalyptus grandis]
 gb|KCW56194.1| hypothetical protein EUGRSUZ_I01939 [Eucalyptus grandis]
Length=468

 Score =   396 bits (1018),  Expect = 2e-128, Method: Compositional matrix adjust.
 Identities = 195/235 (83%), Positives = 223/235 (95%), Gaps = 0/235 (0%)
 Frame = -2

Query  1211  LQKNFEGKLVGADRSKDLAVLKVEASEDLLRPTKIGESSSLRVGQKCLAIGNPFGFDHTL  1032
             +QKNFEG+LVGADR+KDLAVLKVEAS+DLL+P K+G+S+SL+VGQ+CLAIGNPFGFDHTL
Sbjct  218   VQKNFEGQLVGADRAKDLAVLKVEASKDLLKPVKVGQSNSLKVGQQCLAIGNPFGFDHTL  277

Query  1031  TVGVISGLNRDIYSQTGVTISGGIQTDAAINPGNSGGPLLDSKGNLIGINTAIFTQTGTS  852
             TVGVISGLNR+I+SQTGVTI GGIQTDAAINPGNSGGPLLD+KGNLIGINTAIFTQTGTS
Sbjct  278   TVGVISGLNREIFSQTGVTIGGGIQTDAAINPGNSGGPLLDAKGNLIGINTAIFTQTGTS  337

Query  851   AGVGFAIPSSTVLRIVPQLIQSGKVVRAGLNIDIAPDAIANQLNVRNGALVLLVPGNSLA  672
             AGVGFAIPSSTVL+IVPQLI+ GK VRAGLN+DIAP+ +ANQLNVR+GAL+L VP N +A
Sbjct  338   AGVGFAIPSSTVLKIVPQLIEFGKAVRAGLNVDIAPELVANQLNVRSGALILKVPVNGIA  397

Query  671   AKAGILPTTRGFAGNIVLGDIIEAVDNKPVRNKADLYKVLDDYSVGDKVQLKIRR  507
             AK G+LPTTRGFAGNIVLGDII AVD+KPV++KA+L KVLDDY+VGDKV LKI+R
Sbjct  398   AKVGLLPTTRGFAGNIVLGDIIVAVDSKPVKSKAELEKVLDDYTVGDKVTLKIQR  452


 Score =   175 bits (443),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 86/111 (77%), Positives = 97/111 (87%), Gaps = 0/111 (0%)
 Frame = -3

Query  1675  LQAYALGDPSVTVEQVTPPTFPSGPLSPSEERIVQLFENNTYSVVNIFDVTLRPRLNVGG  1496
             L A ALGDPSVT+E+VTPP FPSG L P+EERI  LFE NT+SVVNIFDVTLRP+LN+ G
Sbjct  107   LSAKALGDPSVTLEEVTPPVFPSGSLFPAEERIANLFEINTFSVVNIFDVTLRPQLNITG  166

Query  1495  AVEIPEGNGSGVVWDGEGNIVTNYHVIGNSLSRNPTRGEVVARVNILAPDG  1343
             AVEIPEGNGSGVVWD +G+IVTNYHVIG++LSRN   G+VVARVNILA DG
Sbjct  167   AVEIPEGNGSGVVWDEQGHIVTNYHVIGSALSRNAKLGQVVARVNILASDG  217



>ref|XP_004306149.1| PREDICTED: protease Do-like 8, chloroplastic-like [Fragaria vesca 
subsp. vesca]
Length=431

 Score =   395 bits (1014),  Expect = 2e-128, Method: Compositional matrix adjust.
 Identities = 198/235 (84%), Positives = 219/235 (93%), Gaps = 0/235 (0%)
 Frame = -2

Query  1211  LQKNFEGKLVGADRSKDLAVLKVEASEDLLRPTKIGESSSLRVGQKCLAIGNPFGFDHTL  1032
             +QKNFEG LVGADR+KDLAVLKVEASEDLLRP  +GESSSLRVGQ+CLAIGNPFGFDHTL
Sbjct  181   VQKNFEGTLVGADRAKDLAVLKVEASEDLLRPIVVGESSSLRVGQQCLAIGNPFGFDHTL  240

Query  1031  TVGVISGLNRDIYSQTGVTISGGIQTDAAINPGNSGGPLLDSKGNLIGINTAIFTQTGTS  852
             TVGVISGLNRDI+SQ GVTI+GGIQTDAAINPGNSGGPLLDSKGNLIGINTAIFTQ+GTS
Sbjct  241   TVGVISGLNRDIFSQAGVTINGGIQTDAAINPGNSGGPLLDSKGNLIGINTAIFTQSGTS  300

Query  851   AGVGFAIPSSTVLRIVPQLIQSGKVVRAGLNIDIAPDAIANQLNVRNGALVLLVPGNSLA  672
             AGVGFAI SSTVL+IVPQLIQ GKVVRAGLN+DIAPD IANQLNVR GAL+L VP NS+A
Sbjct  301   AGVGFAIQSSTVLKIVPQLIQFGKVVRAGLNVDIAPDLIANQLNVRYGALILQVPKNSVA  360

Query  671   AKAGILPTTRGFAGNIVLGDIIEAVDNKPVRNKADLYKVLDDYSVGDKVQLKIRR  507
             AKAG+LPTTRGFAGNIVLGD+I  V+NKPV+N+A+L  VLD++SVG+KV L I+R
Sbjct  361   AKAGLLPTTRGFAGNIVLGDVIVGVNNKPVKNQAELNSVLDEFSVGEKVILNIQR  415


 Score =   179 bits (454),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 87/111 (78%), Positives = 98/111 (88%), Gaps = 0/111 (0%)
 Frame = -3

Query  1675  LQAYALGDPSVTVEQVTPPTFPSGPLSPSEERIVQLFENNTYSVVNIFDVTLRPRLNVGG  1496
             L A ALGDPSVT+E+VTPP F SG L P+EERIV+LFE NTYSVVNIFDVTLRP+LNV G
Sbjct  70    LSALALGDPSVTIEEVTPPVFASGALFPTEERIVELFEKNTYSVVNIFDVTLRPQLNVTG  129

Query  1495  AVEIPEGNGSGVVWDGEGNIVTNYHVIGNSLSRNPTRGEVVARVNILAPDG  1343
              VE+PEGNGSGVVWD +G+IVTNYHVIGN+LSRNP  G+VVARVNILA +G
Sbjct  130   VVEVPEGNGSGVVWDKQGHIVTNYHVIGNALSRNPGLGDVVARVNILALEG  180



>ref|XP_004489389.1| PREDICTED: protease Do-like 8, chloroplastic-like isoform X1 
[Cicer arietinum]
 ref|XP_004489390.1| PREDICTED: protease Do-like 8, chloroplastic-like isoform X2 
[Cicer arietinum]
Length=453

 Score =   394 bits (1012),  Expect = 1e-127, Method: Compositional matrix adjust.
 Identities = 197/236 (83%), Positives = 219/236 (93%), Gaps = 0/236 (0%)
 Frame = -2

Query  1211  LQKNFEGKLVGADRSKDLAVLKVEASEDLLRPTKIGESSSLRVGQKCLAIGNPFGFDHTL  1032
             +QKNFEG L+GADR KDLAVLKVEA +D+L+P K+GESS L+VGQ+CLAIGNPFGFDHTL
Sbjct  203   VQKNFEGTLIGADRLKDLAVLKVEAPKDILKPIKVGESSFLKVGQQCLAIGNPFGFDHTL  262

Query  1031  TVGVISGLNRDIYSQTGVTISGGIQTDAAINPGNSGGPLLDSKGNLIGINTAIFTQTGTS  852
             TVGVISGLNRDI+S+TGVTI GGIQTDAAINPGNSGGPLL+SKG+LIGINTAIFTQTGTS
Sbjct  263   TVGVISGLNRDIFSKTGVTIGGGIQTDAAINPGNSGGPLLNSKGSLIGINTAIFTQTGTS  322

Query  851   AGVGFAIPSSTVLRIVPQLIQSGKVVRAGLNIDIAPDAIANQLNVRNGALVLLVPGNSLA  672
             AGVGFAIPSSTVLRIVPQLIQ GKVVRAGLN+DIAPD IANQLNVRNGAL+L VP NSLA
Sbjct  323   AGVGFAIPSSTVLRIVPQLIQFGKVVRAGLNVDIAPDLIANQLNVRNGALILQVPKNSLA  382

Query  671   AKAGILPTTRGFAGNIVLGDIIEAVDNKPVRNKADLYKVLDDYSVGDKVQLKIRRG  504
             AK G++ TTRGFAGNIVLGDII AV+NKPV++K +L KVLD+YSVGDKV L I+RG
Sbjct  383   AKVGLISTTRGFAGNIVLGDIIIAVNNKPVKSKEELLKVLDEYSVGDKVMLLIQRG  438


 Score =   182 bits (462),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 88/111 (79%), Positives = 99/111 (89%), Gaps = 0/111 (0%)
 Frame = -3

Query  1675  LQAYALGDPSVTVEQVTPPTFPSGPLSPSEERIVQLFENNTYSVVNIFDVTLRPRLNVGG  1496
             L A ALGDPSVT+E+VTPP F S PL P+E+RIVQLFE NTYSVVNIFDVTLRP+LNV G
Sbjct  92    LSALALGDPSVTLEEVTPPVFSSAPLFPAEDRIVQLFERNTYSVVNIFDVTLRPQLNVTG  151

Query  1495  AVEIPEGNGSGVVWDGEGNIVTNYHVIGNSLSRNPTRGEVVARVNILAPDG  1343
              VEIPEGNGSGVVWD EG+IVTNYHVIGN+LSRNP+ G+VVAR+NILA +G
Sbjct  152   VVEIPEGNGSGVVWDEEGHIVTNYHVIGNALSRNPSTGQVVARINILASEG  202



>ref|XP_008784256.1| PREDICTED: protease Do-like 8, chloroplastic isoform X1 [Phoenix 
dactylifera]
 ref|XP_008784264.1| PREDICTED: protease Do-like 8, chloroplastic isoform X1 [Phoenix 
dactylifera]
 ref|XP_008784269.1| PREDICTED: protease Do-like 8, chloroplastic isoform X1 [Phoenix 
dactylifera]
Length=461

 Score =   394 bits (1011),  Expect = 2e-127, Method: Compositional matrix adjust.
 Identities = 195/236 (83%), Positives = 222/236 (94%), Gaps = 0/236 (0%)
 Frame = -2

Query  1211  LQKNFEGKLVGADRSKDLAVLKVEASEDLLRPTKIGESSSLRVGQKCLAIGNPFGFDHTL  1032
             +QKNFEGKL+GADR+KDLAVLKVEAS DLL+  K+G+SS+L+VGQ+CLAIGNPFGFDHTL
Sbjct  210   VQKNFEGKLIGADRAKDLAVLKVEASADLLKSIKVGQSSALKVGQQCLAIGNPFGFDHTL  269

Query  1031  TVGVISGLNRDIYSQTGVTISGGIQTDAAINPGNSGGPLLDSKGNLIGINTAIFTQTGTS  852
             TVGVISGLNRDI+SQTGVTI GGIQTDAAINPGNSGGPLLDSKGNLIGINTAIFTQTGTS
Sbjct  270   TVGVISGLNRDIFSQTGVTIGGGIQTDAAINPGNSGGPLLDSKGNLIGINTAIFTQTGTS  329

Query  851   AGVGFAIPSSTVLRIVPQLIQSGKVVRAGLNIDIAPDAIANQLNVRNGALVLLVPGNSLA  672
             AGVGFAIPSSTVL+IVPQLIQ GKVVRAGLN++IA + +ANQLNV+ GALVL V GNS+A
Sbjct  330   AGVGFAIPSSTVLKIVPQLIQFGKVVRAGLNVEIASNLVANQLNVQKGALVLQVMGNSVA  389

Query  671   AKAGILPTTRGFAGNIVLGDIIEAVDNKPVRNKADLYKVLDDYSVGDKVQLKIRRG  504
             AK G+LPTTRGFAGNI+LGD+I AVD+KP+R+KADL K+LDDY+VGDKV LK++RG
Sbjct  390   AKVGLLPTTRGFAGNIILGDVIVAVDDKPIRSKADLSKILDDYNVGDKVVLKVQRG  445


 Score =   178 bits (451),  Expect = 9e-46, Method: Compositional matrix adjust.
 Identities = 88/122 (72%), Positives = 102/122 (84%), Gaps = 3/122 (2%)
 Frame = -3

Query  1699  SLCTQFIT---LQAYALGDPSVTVEQVTPPTFPSGPLSPSEERIVQLFENNTYSVVNIFD  1529
             ++C  F +     A ALGDPSVTV+ VTP   PSGPL PSEERIV+LFE NTYSVVNIFD
Sbjct  88    AICLCFHSSRYFTAVALGDPSVTVQDVTPRILPSGPLFPSEERIVELFERNTYSVVNIFD  147

Query  1528  VTLRPRLNVGGAVEIPEGNGSGVVWDGEGNIVTNYHVIGNSLSRNPTRGEVVARVNILAP  1349
             VTLRP+LNV G VE+PEGNGSGVVWD +G+IVTNYHV+GN+LS+NP+ G+VVARVNILA 
Sbjct  148   VTLRPQLNVTGVVEVPEGNGSGVVWDNDGHIVTNYHVVGNALSKNPSPGQVVARVNILAS  207

Query  1348  DG  1343
             DG
Sbjct  208   DG  209



>ref|XP_010552938.1| PREDICTED: protease Do-like 8, chloroplastic [Tarenaya hassleriana]
Length=452

 Score =   392 bits (1006),  Expect = 9e-127, Method: Compositional matrix adjust.
 Identities = 194/236 (82%), Positives = 221/236 (94%), Gaps = 0/236 (0%)
 Frame = -2

Query  1211  LQKNFEGKLVGADRSKDLAVLKVEASEDLLRPTKIGESSSLRVGQKCLAIGNPFGFDHTL  1032
             +QKNF GKLVGADR+KDLAVLKVEA ED+L+P K+G+S++L+VGQ+CLAIGNPFGFDHTL
Sbjct  202   VQKNFVGKLVGADRAKDLAVLKVEAPEDILKPIKVGKSNALKVGQECLAIGNPFGFDHTL  261

Query  1031  TVGVISGLNRDIYSQTGVTISGGIQTDAAINPGNSGGPLLDSKGNLIGINTAIFTQTGTS  852
             TVGVISGLNRDI+SQ GVTI GGIQTDAAINPGNSGGPLLDSKGNLIGINTAIFTQTGTS
Sbjct  262   TVGVISGLNRDIFSQAGVTIGGGIQTDAAINPGNSGGPLLDSKGNLIGINTAIFTQTGTS  321

Query  851   AGVGFAIPSSTVLRIVPQLIQSGKVVRAGLNIDIAPDAIANQLNVRNGALVLLVPGNSLA  672
             AGVGFAIPSSTVL IVPQLIQ  KV RAG+N++IAPD +ANQLNVRNGALVL V GNSLA
Sbjct  322   AGVGFAIPSSTVLNIVPQLIQFSKVRRAGINVEIAPDLVANQLNVRNGALVLQVLGNSLA  381

Query  671   AKAGILPTTRGFAGNIVLGDIIEAVDNKPVRNKADLYKVLDDYSVGDKVQLKIRRG  504
             AKAGIL T+RGFAGNIVLGDII A+DNKPV+NKA++ ++LD+Y+VGD+V+LKI+RG
Sbjct  382   AKAGILATSRGFAGNIVLGDIIVAIDNKPVKNKAEMTRILDEYNVGDRVELKIQRG  437


 Score =   186 bits (471),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 91/109 (83%), Positives = 97/109 (89%), Gaps = 0/109 (0%)
 Frame = -3

Query  1669  AYALGDPSVTVEQVTPPTFPSGPLSPSEERIVQLFENNTYSVVNIFDVTLRPRLNVGGAV  1490
             A ALGDPSVTVE V+PP FPSGPL P+EERIVQLFE NTYSVVNIFDVTLRP+L + G V
Sbjct  93    AQALGDPSVTVEDVSPPVFPSGPLFPTEERIVQLFEKNTYSVVNIFDVTLRPQLKMTGVV  152

Query  1489  EIPEGNGSGVVWDGEGNIVTNYHVIGNSLSRNPTRGEVVARVNILAPDG  1343
             EIPEGNGSGVVWDG G+IVTNYHVIGN+LSRNP  GEVVARVNILA DG
Sbjct  153   EIPEGNGSGVVWDGRGHIVTNYHVIGNALSRNPKPGEVVARVNILASDG  201



>ref|XP_009381428.1| PREDICTED: protease Do-like 8, chloroplastic isoform X1 [Musa 
acuminata subsp. malaccensis]
 ref|XP_009381429.1| PREDICTED: protease Do-like 8, chloroplastic isoform X1 [Musa 
acuminata subsp. malaccensis]
 ref|XP_009381430.1| PREDICTED: protease Do-like 8, chloroplastic isoform X1 [Musa 
acuminata subsp. malaccensis]
Length=454

 Score =   389 bits (999),  Expect = 8e-126, Method: Compositional matrix adjust.
 Identities = 193/236 (82%), Positives = 218/236 (92%), Gaps = 0/236 (0%)
 Frame = -2

Query  1211  LQKNFEGKLVGADRSKDLAVLKVEASEDLLRPTKIGESSSLRVGQKCLAIGNPFGFDHTL  1032
             +QK FEG+L+GA+R+KDLAVLKV+AS DLL+P  +G+SS LRVGQ+CLAIGNPFGFDHTL
Sbjct  204   VQKTFEGRLIGANRAKDLAVLKVDASADLLKPINVGQSSVLRVGQQCLAIGNPFGFDHTL  263

Query  1031  TVGVISGLNRDIYSQTGVTISGGIQTDAAINPGNSGGPLLDSKGNLIGINTAIFTQTGTS  852
             TVGVISGLNRDI S+TGVTI GGIQTDAAINPGNSGGPLLDSKGN+IGINTAIFT TG S
Sbjct  264   TVGVISGLNRDIVSKTGVTIGGGIQTDAAINPGNSGGPLLDSKGNMIGINTAIFTNTGAS  323

Query  851   AGVGFAIPSSTVLRIVPQLIQSGKVVRAGLNIDIAPDAIANQLNVRNGALVLLVPGNSLA  672
             AGVGFAIPSSTVLRIVPQLIQ GKVVRAGLN++IAPD +ANQLNVRNGALVL +P NS+A
Sbjct  324   AGVGFAIPSSTVLRIVPQLIQFGKVVRAGLNMEIAPDLVANQLNVRNGALVLQIPENSVA  383

Query  671   AKAGILPTTRGFAGNIVLGDIIEAVDNKPVRNKADLYKVLDDYSVGDKVQLKIRRG  504
             AKAG+LPTTRG AGNIVLGD+I AVDNKPVR+KADL K+LD+Y+VG+ V LKI+RG
Sbjct  384   AKAGLLPTTRGLAGNIVLGDVIVAVDNKPVRSKADLLKILDEYNVGNTVLLKIQRG  439


 Score =   159 bits (403),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 78/109 (72%), Positives = 89/109 (82%), Gaps = 0/109 (0%)
 Frame = -3

Query  1669  AYALGDPSVTVEQVTPPTFPSGPLSPSEERIVQLFENNTYSVVNIFDVTLRPRLNVGGAV  1490
             A AL +PS+T E VTP  F SGPL PSEER V++FE NTYSVVNIFDVTLRPRLN  G V
Sbjct  95    ALALEEPSITTEDVTPRVFLSGPLFPSEERTVEIFEKNTYSVVNIFDVTLRPRLNATGVV  154

Query  1489  EIPEGNGSGVVWDGEGNIVTNYHVIGNSLSRNPTRGEVVARVNILAPDG  1343
             E+PEGNGSGVVWD  G+IVTNYHV+GN+LS+NP   +VVARVNIL  +G
Sbjct  155   EVPEGNGSGVVWDKFGHIVTNYHVVGNALSKNPNPDQVVARVNILVAEG  203



>ref|XP_006482566.1| PREDICTED: protease Do-like 8, chloroplastic-like [Citrus sinensis]
Length=462

 Score =   389 bits (999),  Expect = 1e-125, Method: Compositional matrix adjust.
 Identities = 197/240 (82%), Positives = 219/240 (91%), Gaps = 4/240 (2%)
 Frame = -2

Query  1211  LQKNFEGKLVGADR----SKDLAVLKVEASEDLLRPTKIGESSSLRVGQKCLAIGNPFGF  1044
             +QKNFEGKLVGAD     ++ L V  +EASEDLL+P  +G+SS L+VGQ+CLAIGNPFGF
Sbjct  208   VQKNFEGKLVGADLQYCVNQPLFVCLIEASEDLLKPINVGQSSFLKVGQQCLAIGNPFGF  267

Query  1043  DHTLTVGVISGLNRDIYSQTGVTISGGIQTDAAINPGNSGGPLLDSKGNLIGINTAIFTQ  864
             DHTLTVGVISGLNRDI+SQ GVTI GGIQTDAAINPGNSGGPLLDSKGNLIGINTAI TQ
Sbjct  268   DHTLTVGVISGLNRDIFSQAGVTIGGGIQTDAAINPGNSGGPLLDSKGNLIGINTAIITQ  327

Query  863   TGTSAGVGFAIPSSTVLRIVPQLIQSGKVVRAGLNIDIAPDAIANQLNVRNGALVLLVPG  684
             TGTSAGVGFAIPSSTVL+IVPQLIQ GKVVRAGLN+DIAPD +A+QLNVRNGALVL VPG
Sbjct  328   TGTSAGVGFAIPSSTVLKIVPQLIQYGKVVRAGLNVDIAPDLVASQLNVRNGALVLQVPG  387

Query  683   NSLAAKAGILPTTRGFAGNIVLGDIIEAVDNKPVRNKADLYKVLDDYSVGDKVQLKIRRG  504
             NSLAAKAGILPTTRGFAGNI+LGDII AV+NKPV++KA+L KVLDDY+VGD+V LKI+RG
Sbjct  388   NSLAAKAGILPTTRGFAGNIILGDIIVAVNNKPVKSKAELEKVLDDYNVGDRVMLKIQRG  447


 Score =   177 bits (448),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 86/111 (77%), Positives = 96/111 (86%), Gaps = 0/111 (0%)
 Frame = -3

Query  1675  LQAYALGDPSVTVEQVTPPTFPSGPLSPSEERIVQLFENNTYSVVNIFDVTLRPRLNVGG  1496
             L A ALGDPS+T+E+VTP  FPSG L P+EERI QLFE NTYSVVNIFDVTLRP LNV G
Sbjct  97    LSAQALGDPSMTLEEVTPSVFPSGQLLPNEERIAQLFEKNTYSVVNIFDVTLRPTLNVTG  156

Query  1495  AVEIPEGNGSGVVWDGEGNIVTNYHVIGNSLSRNPTRGEVVARVNILAPDG  1343
              VEIPEGNGSGVVWDG+G+IVTN+HVIG++LSR P  G+VVARVNILA DG
Sbjct  157   LVEIPEGNGSGVVWDGKGHIVTNFHVIGSALSRKPAEGQVVARVNILASDG  207



>emb|CDP02226.1| unnamed protein product [Coffea canephora]
Length=471

 Score =   387 bits (994),  Expect = 8e-125, Method: Compositional matrix adjust.
 Identities = 196/242 (81%), Positives = 219/242 (90%), Gaps = 6/242 (2%)
 Frame = -2

Query  1211  LQKNFEGKLVGADRSKDLAVLKVEASEDLLRPTKIGESSSLRVGQKCLAIGNPFGFDHTL  1032
             +QKNFEG+L+GADR+KDLAVLKVEAS DLLRP K+G SSSL+VGQ+CLAIGNPFGFDHTL
Sbjct  216   VQKNFEGRLIGADRAKDLAVLKVEASADLLRPIKVGPSSSLKVGQQCLAIGNPFGFDHTL  275

Query  1031  TVGVISGLNRDIYSQTGVTISGGIQTDAAINPGNSGGPLLDSKGNLIGINTAIFTQTG--  858
             TVGVISGLNRDI+SQTGVTI  GIQTDAAINPGNSGGPLLDSKG LIGINTAIFTQTG  
Sbjct  276   TVGVISGLNRDIFSQTGVTIGDGIQTDAAINPGNSGGPLLDSKGRLIGINTAIFTQTGIF  335

Query  857   ----TSAGVGFAIPSSTVLRIVPQLIQSGKVVRAGLNIDIAPDAIANQLNVRNGALVLLV  690
                 TSAGVGFAIP+STV +IVPQLIQ GKVVRAGLNI+ APD +ANQLNVRNGAL+L V
Sbjct  336   LLSRTSAGVGFAIPASTVSKIVPQLIQRGKVVRAGLNIEFAPDPVANQLNVRNGALILQV  395

Query  689   PGNSLAAKAGILPTTRGFAGNIVLGDIIEAVDNKPVRNKADLYKVLDDYSVGDKVQLKIR  510
             P NSLAAKAG++ T+RGFAGNI+LGDII AVD KPVR+K++L KVLDDY+VGD+V L+IR
Sbjct  396   PQNSLAAKAGLVSTSRGFAGNIILGDIIVAVDKKPVRSKSELNKVLDDYNVGDEVLLQIR  455

Query  509   RG  504
             RG
Sbjct  456   RG  457


 Score =   197 bits (500),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 95/111 (86%), Positives = 102/111 (92%), Gaps = 0/111 (0%)
 Frame = -3

Query  1675  LQAYALGDPSVTVEQVTPPTFPSGPLSPSEERIVQLFENNTYSVVNIFDVTLRPRLNVGG  1496
               AYALGDPSVTVEQVTPP FPSGPL PSEERIVQLFE NTYSVVNIFDVTLRP+LN+ G
Sbjct  105   FSAYALGDPSVTVEQVTPPVFPSGPLFPSEERIVQLFEKNTYSVVNIFDVTLRPQLNLSG  164

Query  1495  AVEIPEGNGSGVVWDGEGNIVTNYHVIGNSLSRNPTRGEVVARVNILAPDG  1343
              VE+PEGNGSGVVWDG G+IVTNYHVIGNSLSRNP+RG+VVARVNILA +G
Sbjct  165   VVEVPEGNGSGVVWDGLGHIVTNYHVIGNSLSRNPSRGQVVARVNILASEG  215



>ref|XP_002446612.1| hypothetical protein SORBIDRAFT_06g018930 [Sorghum bicolor]
 gb|EES10940.1| hypothetical protein SORBIDRAFT_06g018930 [Sorghum bicolor]
Length=446

 Score =   385 bits (990),  Expect = 2e-124, Method: Compositional matrix adjust.
 Identities = 193/236 (82%), Positives = 212/236 (90%), Gaps = 0/236 (0%)
 Frame = -2

Query  1211  LQKNFEGKLVGADRSKDLAVLKVEASEDLLRPTKIGESSSLRVGQKCLAIGNPFGFDHTL  1032
             +QKNFEGKLVGADR+KDLAVLKV+A  DLL+P  +G+SS+LRVGQ+CLAIGNPFGFDHTL
Sbjct  196   IQKNFEGKLVGADRAKDLAVLKVDAPTDLLKPIIVGQSSALRVGQQCLAIGNPFGFDHTL  255

Query  1031  TVGVISGLNRDIYSQTGVTISGGIQTDAAINPGNSGGPLLDSKGNLIGINTAIFTQTGTS  852
             TVGVISGLNRDI+SQ GVTI GGIQTDAAINPGNSGGPLLDSKG++IGINTAIFTQTGTS
Sbjct  256   TVGVISGLNRDIFSQAGVTIGGGIQTDAAINPGNSGGPLLDSKGHMIGINTAIFTQTGTS  315

Query  851   AGVGFAIPSSTVLRIVPQLIQSGKVVRAGLNIDIAPDAIANQLNVRNGALVLLVPGNSLA  672
             AGVGFAIPSSTVL+I PQLIQ GKV RAGLN+D APD IA QLNVRNGAL+L VPG S A
Sbjct  316   AGVGFAIPSSTVLKIAPQLIQFGKVRRAGLNVDFAPDPIAYQLNVRNGALILKVPGGSAA  375

Query  671   AKAGILPTTRGFAGNIVLGDIIEAVDNKPVRNKADLYKVLDDYSVGDKVQLKIRRG  504
             AKAG+ PT RGFAGNIVLGDII AVD KPV+ K+DL +VLDDY VGD+V L IRRG
Sbjct  376   AKAGLAPTGRGFAGNIVLGDIIVAVDGKPVKGKSDLLRVLDDYGVGDQVTLTIRRG  431


 Score =   167 bits (423),  Expect = 5e-42, Method: Compositional matrix adjust.
 Identities = 80/109 (73%), Positives = 92/109 (84%), Gaps = 0/109 (0%)
 Frame = -3

Query  1669  AYALGDPSVTVEQVTPPTFPSGPLSPSEERIVQLFENNTYSVVNIFDVTLRPRLNVGGAV  1490
             A ALGD SV +E VTP  FPSGPL P+E+RI +LFE NTYSVVNIFD TLRP+LNV G V
Sbjct  87    ALALGDTSVKIEDVTPKIFPSGPLFPTEKRIAELFETNTYSVVNIFDATLRPQLNVTGVV  146

Query  1489  EIPEGNGSGVVWDGEGNIVTNYHVIGNSLSRNPTRGEVVARVNILAPDG  1343
             EIPEGNGSGVVWD  G+IVTNYHV+G++LS+NP  G+VVARVNILA +G
Sbjct  147   EIPEGNGSGVVWDDSGHIVTNYHVVGSALSKNPKPGDVVARVNILAAEG  195



>tpg|DAA37462.1| TPA: hypothetical protein ZEAMMB73_701443 [Zea mays]
Length=431

 Score =   383 bits (984),  Expect = 7e-124, Method: Compositional matrix adjust.
 Identities = 191/236 (81%), Positives = 211/236 (89%), Gaps = 0/236 (0%)
 Frame = -2

Query  1211  LQKNFEGKLVGADRSKDLAVLKVEASEDLLRPTKIGESSSLRVGQKCLAIGNPFGFDHTL  1032
             +QKNFEGKLVGADR+KDLAVLKV+A  DLL+P  +G+SS+LRVGQ+CLAIGNPFGFDHTL
Sbjct  181   IQKNFEGKLVGADRAKDLAVLKVDAPTDLLKPINVGQSSALRVGQQCLAIGNPFGFDHTL  240

Query  1031  TVGVISGLNRDIYSQTGVTISGGIQTDAAINPGNSGGPLLDSKGNLIGINTAIFTQTGTS  852
             TVGVISGLNRDI SQ GVTI GGIQTDAAINPGNSGGPLLDSKG++IGIN AIFTQTGTS
Sbjct  241   TVGVISGLNRDILSQAGVTIGGGIQTDAAINPGNSGGPLLDSKGHMIGINAAIFTQTGTS  300

Query  851   AGVGFAIPSSTVLRIVPQLIQSGKVVRAGLNIDIAPDAIANQLNVRNGALVLLVPGNSLA  672
             AGVGFAIPSSTVL+I PQLIQ GKV RAGLN+D APD IA QLNVRNGAL+L VPG S A
Sbjct  301   AGVGFAIPSSTVLKIAPQLIQFGKVRRAGLNVDFAPDPIAYQLNVRNGALILKVPGGSAA  360

Query  671   AKAGILPTTRGFAGNIVLGDIIEAVDNKPVRNKADLYKVLDDYSVGDKVQLKIRRG  504
             AKAG+ PT+RGFAGNIVLGDI+ AVD KPV+ K+DL +VLDDY VGD+V L IRRG
Sbjct  361   AKAGLAPTSRGFAGNIVLGDIVVAVDGKPVKGKSDLLRVLDDYGVGDQVSLTIRRG  416


 Score =   166 bits (419),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 79/109 (72%), Positives = 93/109 (85%), Gaps = 0/109 (0%)
 Frame = -3

Query  1669  AYALGDPSVTVEQVTPPTFPSGPLSPSEERIVQLFENNTYSVVNIFDVTLRPRLNVGGAV  1490
             A+ALGD SV +E VTP  FPSGPL P+E+RI +LFE NTYSVVNIFD TLRP+LNV G V
Sbjct  72    AFALGDTSVKIEDVTPKIFPSGPLFPTEKRIAELFEINTYSVVNIFDATLRPQLNVTGVV  131

Query  1489  EIPEGNGSGVVWDGEGNIVTNYHVIGNSLSRNPTRGEVVARVNILAPDG  1343
             EIPEGNGSGVVWD  G+I+TNYHV+G++LS+NP  G+VVARVNILA +G
Sbjct  132   EIPEGNGSGVVWDDFGHIITNYHVVGSALSKNPKPGDVVARVNILAAEG  180



>gb|ACL52595.1| unknown [Zea mays]
 tpg|DAA37464.1| TPA: LOW QUALITY PROTEIN: hypothetical protein ZEAMMB73_701443 
[Zea mays]
Length=446

 Score =   383 bits (984),  Expect = 1e-123, Method: Compositional matrix adjust.
 Identities = 191/236 (81%), Positives = 211/236 (89%), Gaps = 0/236 (0%)
 Frame = -2

Query  1211  LQKNFEGKLVGADRSKDLAVLKVEASEDLLRPTKIGESSSLRVGQKCLAIGNPFGFDHTL  1032
             +QKNFEGKLVGADR+KDLAVLKV+A  DLL+P  +G+SS+LRVGQ+CLAIGNPFGFDHTL
Sbjct  196   IQKNFEGKLVGADRAKDLAVLKVDAPTDLLKPINVGQSSALRVGQQCLAIGNPFGFDHTL  255

Query  1031  TVGVISGLNRDIYSQTGVTISGGIQTDAAINPGNSGGPLLDSKGNLIGINTAIFTQTGTS  852
             TVGVISGLNRDI SQ GVTI GGIQTDAAINPGNSGGPLLDSKG++IGIN AIFTQTGTS
Sbjct  256   TVGVISGLNRDILSQAGVTIGGGIQTDAAINPGNSGGPLLDSKGHMIGINAAIFTQTGTS  315

Query  851   AGVGFAIPSSTVLRIVPQLIQSGKVVRAGLNIDIAPDAIANQLNVRNGALVLLVPGNSLA  672
             AGVGFAIPSSTVL+I PQLIQ GKV RAGLN+D APD IA QLNVRNGAL+L VPG S A
Sbjct  316   AGVGFAIPSSTVLKIAPQLIQFGKVRRAGLNVDFAPDPIAYQLNVRNGALILKVPGGSAA  375

Query  671   AKAGILPTTRGFAGNIVLGDIIEAVDNKPVRNKADLYKVLDDYSVGDKVQLKIRRG  504
             AKAG+ PT+RGFAGNIVLGDI+ AVD KPV+ K+DL +VLDDY VGD+V L IRRG
Sbjct  376   AKAGLAPTSRGFAGNIVLGDIVVAVDGKPVKGKSDLLRVLDDYGVGDQVSLTIRRG  431


 Score =   165 bits (418),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 79/109 (72%), Positives = 93/109 (85%), Gaps = 0/109 (0%)
 Frame = -3

Query  1669  AYALGDPSVTVEQVTPPTFPSGPLSPSEERIVQLFENNTYSVVNIFDVTLRPRLNVGGAV  1490
             A+ALGD SV +E VTP  FPSGPL P+E+RI +LFE NTYSVVNIFD TLRP+LNV G V
Sbjct  87    AFALGDTSVKIEDVTPKIFPSGPLFPTEKRIAELFEINTYSVVNIFDATLRPQLNVTGVV  146

Query  1489  EIPEGNGSGVVWDGEGNIVTNYHVIGNSLSRNPTRGEVVARVNILAPDG  1343
             EIPEGNGSGVVWD  G+I+TNYHV+G++LS+NP  G+VVARVNILA +G
Sbjct  147   EIPEGNGSGVVWDDFGHIITNYHVVGSALSKNPKPGDVVARVNILAAEG  195



>gb|KEH25002.1| trypsin-like serine protease [Medicago truncatula]
Length=458

 Score =   383 bits (984),  Expect = 2e-123, Method: Compositional matrix adjust.
 Identities = 192/234 (82%), Positives = 214/234 (91%), Gaps = 0/234 (0%)
 Frame = -2

Query  1205  KNFEGKLVGADRSKDLAVLKVEASEDLLRPTKIGESSSLRVGQKCLAIGNPFGFDHTLTV  1026
             KNFEG L+GADR KDLAVLKV+A +++L+P  +GESSSL+VGQ+CLAIGNPFGFDHTLTV
Sbjct  210   KNFEGILIGADRLKDLAVLKVDAPKEILKPINVGESSSLKVGQQCLAIGNPFGFDHTLTV  269

Query  1025  GVISGLNRDIYSQTGVTISGGIQTDAAINPGNSGGPLLDSKGNLIGINTAIFTQTGTSAG  846
             GVISGLNRDI+S+TGVTI GGIQTDAAINPGNSGGPLL+SKG+LIGIN AIFTQTGTSAG
Sbjct  270   GVISGLNRDIFSKTGVTIGGGIQTDAAINPGNSGGPLLNSKGSLIGINAAIFTQTGTSAG  329

Query  845   VGFAIPSSTVLRIVPQLIQSGKVVRAGLNIDIAPDAIANQLNVRNGALVLLVPGNSLAAK  666
             VGFAIPSSTV RIVPQLIQ GKVVRAGLN+DIAPD IANQLNVRNGAL+L VP NSLAAK
Sbjct  330   VGFAIPSSTVRRIVPQLIQFGKVVRAGLNVDIAPDLIANQLNVRNGALILTVPKNSLAAK  389

Query  665   AGILPTTRGFAGNIVLGDIIEAVDNKPVRNKADLYKVLDDYSVGDKVQLKIRRG  504
              G+ PTTRGFAGNIVLGDII AVDNKPV++K +L KVLD+Y+VG KV L I+RG
Sbjct  390   LGLNPTTRGFAGNIVLGDIIIAVDNKPVKSKGELLKVLDEYNVGTKVMLLIQRG  443


 Score =   179 bits (453),  Expect = 5e-46, Method: Compositional matrix adjust.
 Identities = 86/111 (77%), Positives = 99/111 (89%), Gaps = 0/111 (0%)
 Frame = -3

Query  1675  LQAYALGDPSVTVEQVTPPTFPSGPLSPSEERIVQLFENNTYSVVNIFDVTLRPRLNVGG  1496
             L A ALGD SVT+E+VTPP F + PL P+E+RIVQLFE+NTYSVVNIFDVTLRP+LNV G
Sbjct  97    LSALALGDTSVTIEEVTPPVFSTEPLFPAEDRIVQLFESNTYSVVNIFDVTLRPQLNVTG  156

Query  1495  AVEIPEGNGSGVVWDGEGNIVTNYHVIGNSLSRNPTRGEVVARVNILAPDG  1343
              VEIPEGNGSGVVWD EG+IVTNYHVIGN+LSRNP+ G+VVAR+NILA +G
Sbjct  157   VVEIPEGNGSGVVWDEEGHIVTNYHVIGNALSRNPSSGQVVARINILASEG  207



>emb|CAD40980.2| OSJNBa0072F16.5 [Oryza sativa Japonica Group]
 emb|CAH67080.1| OSIGBa0097P08.10 [Oryza sativa Indica Group]
 emb|CAH67448.1| H0219H12.5 [Oryza sativa Indica Group]
 gb|EEC77403.1| hypothetical protein OsI_16165 [Oryza sativa Indica Group]
 gb|EEE61125.1| hypothetical protein OsJ_15052 [Oryza sativa Japonica Group]
Length=420

 Score =   382 bits (980),  Expect = 2e-123, Method: Compositional matrix adjust.
 Identities = 188/236 (80%), Positives = 212/236 (90%), Gaps = 0/236 (0%)
 Frame = -2

Query  1211  LQKNFEGKLVGADRSKDLAVLKVEASEDLLRPTKIGESSSLRVGQKCLAIGNPFGFDHTL  1032
             +QKNFEGKLVGADRSKDLAVLKV+A  DLL+P  +G+SS+LRVGQ+CLAIGNPFGFDH L
Sbjct  170   IQKNFEGKLVGADRSKDLAVLKVDAPTDLLKPINVGQSSALRVGQQCLAIGNPFGFDHAL  229

Query  1031  TVGVISGLNRDIYSQTGVTISGGIQTDAAINPGNSGGPLLDSKGNLIGINTAIFTQTGTS  852
             TVGVISGLNRDI+SQ GVTI GGIQTDAAINPGNSGGPLLDSKG++IGINTAIFTQTGTS
Sbjct  230   TVGVISGLNRDIFSQAGVTIGGGIQTDAAINPGNSGGPLLDSKGHMIGINTAIFTQTGTS  289

Query  851   AGVGFAIPSSTVLRIVPQLIQSGKVVRAGLNIDIAPDAIANQLNVRNGALVLLVPGNSLA  672
             AGVGFAIPSSTVL+I PQLIQ GKV RAGLN++ APD IA QLNVR G+L+L VPG S A
Sbjct  290   AGVGFAIPSSTVLKIAPQLIQFGKVRRAGLNVEFAPDPIAYQLNVRTGSLILQVPGGSAA  349

Query  671   AKAGILPTTRGFAGNIVLGDIIEAVDNKPVRNKADLYKVLDDYSVGDKVQLKIRRG  504
             AKAG++PT+RGFAGNIVLGD+I AVD KP++ K+DL +VLDDY VGDKV L I+RG
Sbjct  350   AKAGLVPTSRGFAGNIVLGDVIVAVDGKPIKGKSDLSRVLDDYGVGDKVSLTIQRG  405


 Score =   172 bits (436),  Expect = 5e-44, Method: Compositional matrix adjust.
 Identities = 82/111 (74%), Positives = 92/111 (83%), Gaps = 0/111 (0%)
 Frame = -3

Query  1675  LQAYALGDPSVTVEQVTPPTFPSGPLSPSEERIVQLFENNTYSVVNIFDVTLRPRLNVGG  1496
               A ALGDPSV ++ VTP  FPSGPL P+E+RI +LFE NTYSVVNIFD TLRP+LNV G
Sbjct  59    FSALALGDPSVKIDDVTPKIFPSGPLFPTEKRIAELFETNTYSVVNIFDATLRPQLNVTG  118

Query  1495  AVEIPEGNGSGVVWDGEGNIVTNYHVIGNSLSRNPTRGEVVARVNILAPDG  1343
              VEIPEGNGSGVVWD  G+IVTNYHV+GN+LS+ P  GEVVARVNILA DG
Sbjct  119   VVEIPEGNGSGVVWDDSGHIVTNYHVVGNALSKKPKPGEVVARVNILAADG  169



>ref|XP_004975851.1| PREDICTED: protease Do-like 8, chloroplastic-like [Setaria italica]
Length=446

 Score =   382 bits (981),  Expect = 4e-123, Method: Compositional matrix adjust.
 Identities = 188/236 (80%), Positives = 213/236 (90%), Gaps = 0/236 (0%)
 Frame = -2

Query  1211  LQKNFEGKLVGADRSKDLAVLKVEASEDLLRPTKIGESSSLRVGQKCLAIGNPFGFDHTL  1032
             +QK+F+GKLVGADR+KD+AVLKV+A  DLL+P  +G+SS+LRVGQ+CLAIGNPFGFDHTL
Sbjct  196   IQKSFDGKLVGADRAKDIAVLKVDAPTDLLKPINVGQSSALRVGQQCLAIGNPFGFDHTL  255

Query  1031  TVGVISGLNRDIYSQTGVTISGGIQTDAAINPGNSGGPLLDSKGNLIGINTAIFTQTGTS  852
             TVGVISGLNRDI+SQ GVTI GG+QTDAAINPGNSGGPLLDSKG++IGINTAIFTQTGTS
Sbjct  256   TVGVISGLNRDIFSQAGVTIGGGVQTDAAINPGNSGGPLLDSKGHMIGINTAIFTQTGTS  315

Query  851   AGVGFAIPSSTVLRIVPQLIQSGKVVRAGLNIDIAPDAIANQLNVRNGALVLLVPGNSLA  672
             AGVGFAIPSSTVL+I PQLIQ GKV RAGLN+D APD IA QLNVRNGAL+L VPG S A
Sbjct  316   AGVGFAIPSSTVLKIAPQLIQFGKVRRAGLNLDFAPDPIAYQLNVRNGALILQVPGGSAA  375

Query  671   AKAGILPTTRGFAGNIVLGDIIEAVDNKPVRNKADLYKVLDDYSVGDKVQLKIRRG  504
             AKAG+ PT+RGFAGNIVLGDII AVD KPV+ K+DL +VLDDY VGD+V L +RRG
Sbjct  376   AKAGLAPTSRGFAGNIVLGDIIIAVDGKPVKGKSDLLRVLDDYGVGDQVTLTVRRG  431


 Score =   171 bits (432),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 81/111 (73%), Positives = 94/111 (85%), Gaps = 0/111 (0%)
 Frame = -3

Query  1675  LQAYALGDPSVTVEQVTPPTFPSGPLSPSEERIVQLFENNTYSVVNIFDVTLRPRLNVGG  1496
             L A ALG+PSV +E VTP  FPSGPL P+E+RI +LFE NTYSVVNIFD TLRP+LNV G
Sbjct  85    LSALALGEPSVKIEDVTPKIFPSGPLFPTEKRIAELFETNTYSVVNIFDATLRPQLNVTG  144

Query  1495  AVEIPEGNGSGVVWDGEGNIVTNYHVIGNSLSRNPTRGEVVARVNILAPDG  1343
              VEIPEGNGSGVVWD  G++VTNYHV+G++LS+NP  GEVVARVNILA +G
Sbjct  145   IVEIPEGNGSGVVWDDSGHVVTNYHVVGSALSKNPKPGEVVARVNILAAEG  195



>ref|NP_001173969.1| Os04g0459900 [Oryza sativa Japonica Group]
 dbj|BAG89706.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAH92697.1| Os04g0459900 [Oryza sativa Japonica Group]
Length=445

 Score =   382 bits (981),  Expect = 4e-123, Method: Compositional matrix adjust.
 Identities = 188/236 (80%), Positives = 212/236 (90%), Gaps = 0/236 (0%)
 Frame = -2

Query  1211  LQKNFEGKLVGADRSKDLAVLKVEASEDLLRPTKIGESSSLRVGQKCLAIGNPFGFDHTL  1032
             +QKNFEGKLVGADRSKDLAVLKV+A  DLL+P  +G+SS+LRVGQ+CLAIGNPFGFDH L
Sbjct  195   IQKNFEGKLVGADRSKDLAVLKVDAPTDLLKPINVGQSSALRVGQQCLAIGNPFGFDHAL  254

Query  1031  TVGVISGLNRDIYSQTGVTISGGIQTDAAINPGNSGGPLLDSKGNLIGINTAIFTQTGTS  852
             TVGVISGLNRDI+SQ GVTI GGIQTDAAINPGNSGGPLLDSKG++IGINTAIFTQTGTS
Sbjct  255   TVGVISGLNRDIFSQAGVTIGGGIQTDAAINPGNSGGPLLDSKGHMIGINTAIFTQTGTS  314

Query  851   AGVGFAIPSSTVLRIVPQLIQSGKVVRAGLNIDIAPDAIANQLNVRNGALVLLVPGNSLA  672
             AGVGFAIPSSTVL+I PQLIQ GKV RAGLN++ APD IA QLNVR G+L+L VPG S A
Sbjct  315   AGVGFAIPSSTVLKIAPQLIQFGKVRRAGLNVEFAPDPIAYQLNVRTGSLILQVPGGSAA  374

Query  671   AKAGILPTTRGFAGNIVLGDIIEAVDNKPVRNKADLYKVLDDYSVGDKVQLKIRRG  504
             AKAG++PT+RGFAGNIVLGD+I AVD KP++ K+DL +VLDDY VGDKV L I+RG
Sbjct  375   AKAGLVPTSRGFAGNIVLGDVIVAVDGKPIKGKSDLSRVLDDYGVGDKVSLTIQRG  430


 Score =   172 bits (436),  Expect = 8e-44, Method: Compositional matrix adjust.
 Identities = 82/111 (74%), Positives = 92/111 (83%), Gaps = 0/111 (0%)
 Frame = -3

Query  1675  LQAYALGDPSVTVEQVTPPTFPSGPLSPSEERIVQLFENNTYSVVNIFDVTLRPRLNVGG  1496
               A ALGDPSV ++ VTP  FPSGPL P+E+RI +LFE NTYSVVNIFD TLRP+LNV G
Sbjct  84    FSALALGDPSVKIDDVTPKIFPSGPLFPTEKRIAELFETNTYSVVNIFDATLRPQLNVTG  143

Query  1495  AVEIPEGNGSGVVWDGEGNIVTNYHVIGNSLSRNPTRGEVVARVNILAPDG  1343
              VEIPEGNGSGVVWD  G+IVTNYHV+GN+LS+ P  GEVVARVNILA DG
Sbjct  144   VVEIPEGNGSGVVWDDSGHIVTNYHVVGNALSKKPKPGEVVARVNILAADG  194



>emb|CBW45783.1| ORW1943Ba0077G13.11 [Oryza rufipogon]
Length=471

 Score =   381 bits (979),  Expect = 1e-122, Method: Compositional matrix adjust.
 Identities = 188/236 (80%), Positives = 212/236 (90%), Gaps = 0/236 (0%)
 Frame = -2

Query  1211  LQKNFEGKLVGADRSKDLAVLKVEASEDLLRPTKIGESSSLRVGQKCLAIGNPFGFDHTL  1032
             +QKNFEGKLVGADRSKDLAVLKV+A  DLL+P  +G+SS+LRVGQ+CLAIGNPFGFDH L
Sbjct  176   IQKNFEGKLVGADRSKDLAVLKVDAPTDLLKPINVGQSSALRVGQQCLAIGNPFGFDHAL  235

Query  1031  TVGVISGLNRDIYSQTGVTISGGIQTDAAINPGNSGGPLLDSKGNLIGINTAIFTQTGTS  852
             TVGVISGLNRDI+SQ GVTI GGIQTDAAINPGNSGGPLLDSKG++IGINTAIFTQTGTS
Sbjct  236   TVGVISGLNRDIFSQAGVTIGGGIQTDAAINPGNSGGPLLDSKGHMIGINTAIFTQTGTS  295

Query  851   AGVGFAIPSSTVLRIVPQLIQSGKVVRAGLNIDIAPDAIANQLNVRNGALVLLVPGNSLA  672
             AGVGFAIPSSTVL+I PQLIQ GKV RAGLN++ APD IA QLNVR G+L+L VPG S A
Sbjct  296   AGVGFAIPSSTVLKIAPQLIQFGKVRRAGLNVEFAPDPIAYQLNVRTGSLILQVPGGSAA  355

Query  671   AKAGILPTTRGFAGNIVLGDIIEAVDNKPVRNKADLYKVLDDYSVGDKVQLKIRRG  504
             AKAG++PT+RGFAGNIVLGD+I AVD KP++ K+DL +VLDDY VGDKV L I+RG
Sbjct  356   AKAGLVPTSRGFAGNIVLGDVIVAVDGKPIKGKSDLSRVLDDYGVGDKVSLTIQRG  411


 Score =   166 bits (420),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 82/117 (70%), Positives = 92/117 (79%), Gaps = 6/117 (5%)
 Frame = -3

Query  1675  LQAYALGDPSVTVEQVTPPTFPSGPLSPSEERIVQLFENNTYSVVNIFDVTLRPRLNVGG  1496
               A ALGDPSV ++ VTP  FPSGPL P+E+RI +LFE NTYSVVNIFD TLRP+LNV G
Sbjct  59    FSALALGDPSVKIDDVTPKIFPSGPLFPTEKRIAELFETNTYSVVNIFDATLRPQLNVTG  118

Query  1495  AVE------IPEGNGSGVVWDGEGNIVTNYHVIGNSLSRNPTRGEVVARVNILAPDG  1343
              VE      IPEGNGSGVVWD  G+IVTNYHV+GN+LS+ P  GEVVARVNILA DG
Sbjct  119   VVEVRVESRIPEGNGSGVVWDDSGHIVTNYHVVGNALSKKPKPGEVVARVNILAADG  175



>ref|XP_006652369.1| PREDICTED: protease Do-like 8, chloroplastic-like [Oryza brachyantha]
Length=397

 Score =   378 bits (971),  Expect = 3e-122, Method: Compositional matrix adjust.
 Identities = 188/236 (80%), Positives = 210/236 (89%), Gaps = 0/236 (0%)
 Frame = -2

Query  1211  LQKNFEGKLVGADRSKDLAVLKVEASEDLLRPTKIGESSSLRVGQKCLAIGNPFGFDHTL  1032
             +QKNFEGKLVGADR+KDLAVLKV+A  DLL+P  +G+SS+LRVGQ+CLAIGNPFGFDHTL
Sbjct  147   IQKNFEGKLVGADRAKDLAVLKVDAPTDLLKPINVGQSSALRVGQQCLAIGNPFGFDHTL  206

Query  1031  TVGVISGLNRDIYSQTGVTISGGIQTDAAINPGNSGGPLLDSKGNLIGINTAIFTQTGTS  852
             TVGVISGLNRDI+SQ GVTI GGIQTDAAINPGNSGGPLLD KG +IGINTAIFTQTGTS
Sbjct  207   TVGVISGLNRDIFSQAGVTIGGGIQTDAAINPGNSGGPLLDLKGRMIGINTAIFTQTGTS  266

Query  851   AGVGFAIPSSTVLRIVPQLIQSGKVVRAGLNIDIAPDAIANQLNVRNGALVLLVPGNSLA  672
             AGVGFAIPSSTVL+I PQLIQ GKV R GLN++ APD IA QLNVRNGAL+L VPG S A
Sbjct  267   AGVGFAIPSSTVLKIAPQLIQFGKVRRPGLNVEFAPDPIAYQLNVRNGALILQVPGGSTA  326

Query  671   AKAGILPTTRGFAGNIVLGDIIEAVDNKPVRNKADLYKVLDDYSVGDKVQLKIRRG  504
             AK G++PT+RGFAGNIVLGDII AVD KP++ K+DL +VLDDY VGDKV L I+RG
Sbjct  327   AKVGLIPTSRGFAGNIVLGDIIVAVDGKPIKGKSDLLRVLDDYGVGDKVSLTIQRG  382


 Score =   166 bits (421),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 79/109 (72%), Positives = 91/109 (83%), Gaps = 0/109 (0%)
 Frame = -3

Query  1669  AYALGDPSVTVEQVTPPTFPSGPLSPSEERIVQLFENNTYSVVNIFDVTLRPRLNVGGAV  1490
             A ALGDP V ++ VTP  FPSGPL P+E+RI +LFE NTYSVVNIFD TLRP+LNV G V
Sbjct  38    ALALGDPPVEIDDVTPKIFPSGPLFPTEKRIAELFETNTYSVVNIFDATLRPQLNVTGVV  97

Query  1489  EIPEGNGSGVVWDGEGNIVTNYHVIGNSLSRNPTRGEVVARVNILAPDG  1343
             EIPEGNGSG+VWD  G+IVTNYHV+GN+LSR P  GE+VARVNILA +G
Sbjct  98    EIPEGNGSGIVWDDSGHIVTNYHVVGNALSRKPKPGEIVARVNILAANG  146



>ref|XP_003579902.2| PREDICTED: protease Do-like 8, chloroplastic [Brachypodium distachyon]
Length=451

 Score =   374 bits (961),  Expect = 4e-120, Method: Compositional matrix adjust.
 Identities = 184/235 (78%), Positives = 211/235 (90%), Gaps = 0/235 (0%)
 Frame = -2

Query  1211  LQKNFEGKLVGADRSKDLAVLKVEASEDLLRPTKIGESSSLRVGQKCLAIGNPFGFDHTL  1032
             +QKNFEGKLVGADRSKDLAVL+V+A  DLL+P  +G+SS+L+VGQ+CLAIGNPFGFDHTL
Sbjct  201   IQKNFEGKLVGADRSKDLAVLQVDAPSDLLKPIIVGQSSALKVGQQCLAIGNPFGFDHTL  260

Query  1031  TVGVISGLNRDIYSQTGVTISGGIQTDAAINPGNSGGPLLDSKGNLIGINTAIFTQTGTS  852
             TVGVISGLNRDI+SQ GVTI GGIQTDAAINPGNSGGPLLDSKG++IGINTAIFTQTGTS
Sbjct  261   TVGVISGLNRDIFSQAGVTIGGGIQTDAAINPGNSGGPLLDSKGHMIGINTAIFTQTGTS  320

Query  851   AGVGFAIPSSTVLRIVPQLIQSGKVVRAGLNIDIAPDAIANQLNVRNGALVLLVPGNSLA  672
             AGVGFAI SST+L+I+PQLIQSGKV RAGLN++ APD IA QLNVR+GALVL VP  S  
Sbjct  321   AGVGFAIQSSTILKIIPQLIQSGKVRRAGLNVEFAPDPIAYQLNVRDGALVLKVPAGSAV  380

Query  671   AKAGILPTTRGFAGNIVLGDIIEAVDNKPVRNKADLYKVLDDYSVGDKVQLKIRR  507
             AKAG++PT+RGFAG IVLGD+I AVD+KP++ K+DL +VLDDY VGD V L IRR
Sbjct  381   AKAGLVPTSRGFAGKIVLGDVIVAVDSKPIKGKSDLLRVLDDYRVGDTVTLTIRR  435


 Score =   174 bits (440),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 83/111 (75%), Positives = 93/111 (84%), Gaps = 0/111 (0%)
 Frame = -3

Query  1675  LQAYALGDPSVTVEQVTPPTFPSGPLSPSEERIVQLFENNTYSVVNIFDVTLRPRLNVGG  1496
               A ALGDPSV +E VTP  FPSGPL P+E+RI +LFE NTYSVVNIFD TLRP+LNV G
Sbjct  90    FSALALGDPSVKIEDVTPKIFPSGPLFPTEKRIAELFETNTYSVVNIFDATLRPQLNVTG  149

Query  1495  AVEIPEGNGSGVVWDGEGNIVTNYHVIGNSLSRNPTRGEVVARVNILAPDG  1343
              VEIPEGNGSGVVWD  G+IVTNYHV+GN+LS+NP  GEVVARVNILA +G
Sbjct  150   VVEIPEGNGSGVVWDESGHIVTNYHVVGNALSKNPNLGEVVARVNILAAEG  200



>gb|EPS68932.1| hypothetical protein M569_05835, partial [Genlisea aurea]
Length=388

 Score =   370 bits (950),  Expect = 2e-119, Method: Compositional matrix adjust.
 Identities = 184/236 (78%), Positives = 213/236 (90%), Gaps = 0/236 (0%)
 Frame = -2

Query  1211  LQKNFEGKLVGADRSKDLAVLKVEASEDLLRPTKIGESSSLRVGQKCLAIGNPFGFDHTL  1032
             +QKNFEGKL+GADR+KDLAVLKV+A +++L+P  +G S++L+VGQ+CLAIGNPFGFDHTL
Sbjct  141   VQKNFEGKLIGADRAKDLAVLKVDAPKEVLKPIVVGSSTALKVGQQCLAIGNPFGFDHTL  200

Query  1031  TVGVISGLNRDIYSQTGVTISGGIQTDAAINPGNSGGPLLDSKGNLIGINTAIFTQTGTS  852
             TVGV+SGLNRDI SQ GVTI GG+QTDAAINPGNSGGPLLDSKGNLIGINTAIFTQTGTS
Sbjct  201   TVGVVSGLNRDINSQAGVTIGGGVQTDAAINPGNSGGPLLDSKGNLIGINTAIFTQTGTS  260

Query  851   AGVGFAIPSSTVLRIVPQLIQSGKVVRAGLNIDIAPDAIANQLNVRNGALVLLVPGNSLA  672
             AGVGFAIPSSTV +IVPQLI+ GKVVRAGL++ IA + IANQLNVRNGALVL VP  S A
Sbjct  261   AGVGFAIPSSTVAKIVPQLIKFGKVVRAGLDVVIASEVIANQLNVRNGALVLQVPQGSSA  320

Query  671   AKAGILPTTRGFAGNIVLGDIIEAVDNKPVRNKADLYKVLDDYSVGDKVQLKIRRG  504
             AKAGI PT+RGFAG I+LGD+I AVD+KPVRN+A+L K LD+YS+GD V LK+RRG
Sbjct  321   AKAGIQPTSRGFAGKIILGDVILAVDDKPVRNRAELLKTLDEYSIGDNVILKLRRG  376


 Score =   184 bits (466),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 91/111 (82%), Positives = 98/111 (88%), Gaps = 0/111 (0%)
 Frame = -3

Query  1675  LQAYALGDPSVTVEQVTPPTFPSGPLSPSEERIVQLFENNTYSVVNIFDVTLRPRLNVGG  1496
             L A ALGD SVTV++VTPP   SGPLSPSEERIV+LFE NTYSVVNIFDVTLRP+LNV G
Sbjct  30    LSAIALGDSSVTVQEVTPPVLSSGPLSPSEERIVKLFEKNTYSVVNIFDVTLRPQLNVTG  89

Query  1495  AVEIPEGNGSGVVWDGEGNIVTNYHVIGNSLSRNPTRGEVVARVNILAPDG  1343
             AVE+PEGNGSGVVWD EG+IVTNYHVIGNSLSRNP  G VVARVNILA +G
Sbjct  90    AVEVPEGNGSGVVWDDEGHIVTNYHVIGNSLSRNPAAGVVVARVNILASEG  140



>ref|XP_006827214.1| hypothetical protein AMTR_s00010p00259680 [Amborella trichopoda]
 gb|ERM94451.1| hypothetical protein AMTR_s00010p00259680 [Amborella trichopoda]
Length=451

 Score =   372 bits (954),  Expect = 5e-119, Method: Compositional matrix adjust.
 Identities = 190/235 (81%), Positives = 218/235 (93%), Gaps = 0/235 (0%)
 Frame = -2

Query  1211  LQKNFEGKLVGADRSKDLAVLKVEASEDLLRPTKIGESSSLRVGQKCLAIGNPFGFDHTL  1032
             LQK++EGKLVGADR+KDLAVLKV+A  DLL+P  +G+SS LRVGQ+CLAIGNPFGFDHTL
Sbjct  201   LQKDYEGKLVGADRAKDLAVLKVDAPTDLLKPINVGKSSGLRVGQQCLAIGNPFGFDHTL  260

Query  1031  TVGVISGLNRDIYSQTGVTISGGIQTDAAINPGNSGGPLLDSKGNLIGINTAIFTQTGTS  852
             TVGVISGLNR+I SQTGVTI GGIQTDAAINPGNSGGPLLDS+GN++GINTAIFTQTGTS
Sbjct  261   TVGVISGLNREILSQTGVTIGGGIQTDAAINPGNSGGPLLDSRGNMVGINTAIFTQTGTS  320

Query  851   AGVGFAIPSSTVLRIVPQLIQSGKVVRAGLNIDIAPDAIANQLNVRNGALVLLVPGNSLA  672
             AGVGFAIPSSTVL+I+PQLIQSGKVVRAG NI+IAPD IANQLNVRNGALVL V  NS+A
Sbjct  321   AGVGFAIPSSTVLKIIPQLIQSGKVVRAGFNIEIAPDPIANQLNVRNGALVLQVLENSVA  380

Query  671   AKAGILPTTRGFAGNIVLGDIIEAVDNKPVRNKADLYKVLDDYSVGDKVQLKIRR  507
             A+AG+LPT RGFAGNI+LGDII ++DN+P+++KA+L KVLDDYSVGD V +KI+R
Sbjct  381   ARAGLLPTKRGFAGNIILGDIIISIDNRPIKSKAELSKVLDDYSVGDTVMVKIKR  435


 Score =   178 bits (452),  Expect = 6e-46, Method: Compositional matrix adjust.
 Identities = 84/109 (77%), Positives = 99/109 (91%), Gaps = 0/109 (0%)
 Frame = -3

Query  1669  AYALGDPSVTVEQVTPPTFPSGPLSPSEERIVQLFENNTYSVVNIFDVTLRPRLNVGGAV  1490
             A+ALGDPSVT+E+VTPP  PSG L PSEERIV++FE NTYSVVNIFDVTLRP+LN+ G V
Sbjct  92    AHALGDPSVTIEEVTPPILPSGKLFPSEERIVKVFEKNTYSVVNIFDVTLRPQLNITGIV  151

Query  1489  EIPEGNGSGVVWDGEGNIVTNYHVIGNSLSRNPTRGEVVARVNILAPDG  1343
             E+PEGNGSGVVWDG+G+IVTNYHV+ N+LSRNP+ G+VVARVNILA +G
Sbjct  152   EVPEGNGSGVVWDGQGHIVTNYHVVSNALSRNPSLGQVVARVNILASEG  200



>dbj|BAJ93901.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=445

 Score =   369 bits (948),  Expect = 3e-118, Method: Compositional matrix adjust.
 Identities = 182/236 (77%), Positives = 210/236 (89%), Gaps = 0/236 (0%)
 Frame = -2

Query  1211  LQKNFEGKLVGADRSKDLAVLKVEASEDLLRPTKIGESSSLRVGQKCLAIGNPFGFDHTL  1032
             +QKNFEG L+GADR+KDLAVLKV+A  D+L+P  +G+SS+L+VGQ+CLAIGNPFGFDHTL
Sbjct  195   IQKNFEGILIGADRAKDLAVLKVDAPSDILKPIIVGQSSALKVGQQCLAIGNPFGFDHTL  254

Query  1031  TVGVISGLNRDIYSQTGVTISGGIQTDAAINPGNSGGPLLDSKGNLIGINTAIFTQTGTS  852
             TVGVISGLNRDI+SQ GVTI GGIQTDAAINPGNSGGPLLDSKG++IGINTAIFTQTGTS
Sbjct  255   TVGVISGLNRDIFSQAGVTIGGGIQTDAAINPGNSGGPLLDSKGHMIGINTAIFTQTGTS  314

Query  851   AGVGFAIPSSTVLRIVPQLIQSGKVVRAGLNIDIAPDAIANQLNVRNGALVLLVPGNSLA  672
             AGVGFAI SST+L+IVPQLIQSGKV RAGLN++ APD IA QLNVR+GAL+L VP  S  
Sbjct  315   AGVGFAIQSSTILKIVPQLIQSGKVRRAGLNVEFAPDPIAYQLNVRDGALILKVPPGSAV  374

Query  671   AKAGILPTTRGFAGNIVLGDIIEAVDNKPVRNKADLYKVLDDYSVGDKVQLKIRRG  504
             AKAG++PT RGFAGNI+LGD+I AVD KP++ K+DL +VLDDY VGD V L IRRG
Sbjct  375   AKAGLVPTGRGFAGNIILGDVIVAVDGKPIKGKSDLLRVLDDYGVGDTVTLTIRRG  430


 Score =   175 bits (444),  Expect = 7e-45, Method: Compositional matrix adjust.
 Identities = 84/111 (76%), Positives = 94/111 (85%), Gaps = 0/111 (0%)
 Frame = -3

Query  1675  LQAYALGDPSVTVEQVTPPTFPSGPLSPSEERIVQLFENNTYSVVNIFDVTLRPRLNVGG  1496
             L A ALGDPSV +E VTP  FPSGPL P+E+RI +LFE NTYSVVNIFD TLRP+LNV G
Sbjct  84    LSALALGDPSVKIEDVTPKIFPSGPLFPTEKRIAELFETNTYSVVNIFDATLRPQLNVTG  143

Query  1495  AVEIPEGNGSGVVWDGEGNIVTNYHVIGNSLSRNPTRGEVVARVNILAPDG  1343
              VEIPEGNGSGVVWD  G+IVTNYHV+GN+LS+NP  GEVVARVNILA +G
Sbjct  144   VVEIPEGNGSGVVWDESGHIVTNYHVVGNALSKNPKLGEVVARVNILAAEG  194



>gb|EMS64886.1| Protease Do-like 8, chloroplastic [Triticum urartu]
Length=440

 Score =   368 bits (944),  Expect = 1e-117, Method: Compositional matrix adjust.
 Identities = 181/236 (77%), Positives = 209/236 (89%), Gaps = 0/236 (0%)
 Frame = -2

Query  1211  LQKNFEGKLVGADRSKDLAVLKVEASEDLLRPTKIGESSSLRVGQKCLAIGNPFGFDHTL  1032
             +QKNFEG L+GADR+KDLAVLKV+A  D+L+P  +G+SS+L+VGQ+CLAIGNPFGFDHTL
Sbjct  190   IQKNFEGILIGADRAKDLAVLKVDAPSDILKPIIVGQSSALKVGQQCLAIGNPFGFDHTL  249

Query  1031  TVGVISGLNRDIYSQTGVTISGGIQTDAAINPGNSGGPLLDSKGNLIGINTAIFTQTGTS  852
             TVGVISGLNRDI+SQ GVTI GGIQTDAAINPGNSGGPLLDSKG++IGINTAIFTQTGTS
Sbjct  250   TVGVISGLNRDIFSQAGVTIGGGIQTDAAINPGNSGGPLLDSKGHMIGINTAIFTQTGTS  309

Query  851   AGVGFAIPSSTVLRIVPQLIQSGKVVRAGLNIDIAPDAIANQLNVRNGALVLLVPGNSLA  672
             AGVGFAI SST+L+IVPQLIQSGKV RAGLN++ APD IA QLNVR+GAL+L VP  S  
Sbjct  310   AGVGFAIQSSTILKIVPQLIQSGKVRRAGLNVEFAPDPIAYQLNVRDGALILKVPPGSAV  369

Query  671   AKAGILPTTRGFAGNIVLGDIIEAVDNKPVRNKADLYKVLDDYSVGDKVQLKIRRG  504
              KAG++PT RGFAGNI+LGD+I AVD KP++ K+DL +VLDDY VGD V L IRRG
Sbjct  370   EKAGLVPTGRGFAGNIILGDVIVAVDGKPIKGKSDLLRVLDDYGVGDTVTLTIRRG  425


 Score =   173 bits (439),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 83/111 (75%), Positives = 94/111 (85%), Gaps = 0/111 (0%)
 Frame = -3

Query  1675  LQAYALGDPSVTVEQVTPPTFPSGPLSPSEERIVQLFENNTYSVVNIFDVTLRPRLNVGG  1496
             L A ALGDP+V +E VTP  FPSGPL P+E+RI +LFE NTYSVVNIFD TLRP+LNV G
Sbjct  79    LSALALGDPTVKIEDVTPKIFPSGPLFPTEKRIAELFETNTYSVVNIFDATLRPQLNVTG  138

Query  1495  AVEIPEGNGSGVVWDGEGNIVTNYHVIGNSLSRNPTRGEVVARVNILAPDG  1343
              VEIPEGNGSGVVWD  G+IVTNYHV+GN+LS+NP  GEVVARVNILA +G
Sbjct  139   VVEIPEGNGSGVVWDESGHIVTNYHVVGNALSKNPKLGEVVARVNILAAEG  189



>ref|XP_004166387.1| PREDICTED: protease Do-like 8, chloroplastic-like [Cucumis sativus]
Length=429

 Score =   366 bits (940),  Expect = 2e-117, Method: Compositional matrix adjust.
 Identities = 181/215 (84%), Positives = 201/215 (93%), Gaps = 0/215 (0%)
 Frame = -2

Query  1211  LQKNFEGKLVGADRSKDLAVLKVEASEDLLRPTKIGESSSLRVGQKCLAIGNPFGFDHTL  1032
             +QKNFEGKL+GADR+KDLAVLKV+AS DLLRP K+G+SSSL+VGQ+CLAIGNPFGFDHTL
Sbjct  212   IQKNFEGKLIGADRTKDLAVLKVDASNDLLRPIKVGQSSSLKVGQQCLAIGNPFGFDHTL  271

Query  1031  TVGVISGLNRDIYSQTGVTISGGIQTDAAINPGNSGGPLLDSKGNLIGINTAIFTQTGTS  852
             TVGVISGLNRDI+SQTGVTI GGIQTDAAINPGNSGGPLLDSKGNLIGINTAIFTQTG S
Sbjct  272   TVGVISGLNRDIFSQTGVTIGGGIQTDAAINPGNSGGPLLDSKGNLIGINTAIFTQTGIS  331

Query  851   AGVGFAIPSSTVLRIVPQLIQSGKVVRAGLNIDIAPDAIANQLNVRNGALVLLVPGNSLA  672
             AGVGFAIPSSTV++IVPQLIQ G+VVRAG+N+D APD I NQLNVR+GAL+L VP NS A
Sbjct  332   AGVGFAIPSSTVVKIVPQLIQFGRVVRAGINVDFAPDLITNQLNVRDGALILQVPANSPA  391

Query  671   AKAGILPTTRGFAGNIVLGDIIEAVDNKPVRNKAD  567
             AKAG+LPTTRGFAGNIVLGDII A+DNKPV+ K +
Sbjct  392   AKAGLLPTTRGFAGNIVLGDIIAAIDNKPVKIKQN  426


 Score =   172 bits (436),  Expect = 6e-44, Method: Compositional matrix adjust.
 Identities = 83/112 (74%), Positives = 97/112 (87%), Gaps = 0/112 (0%)
 Frame = -3

Query  1669  AYALGDPSVTVEQVTPPTFPSGPLSPSEERIVQLFENNTYSVVNIFDVTLRPRLNVGGAV  1490
             A ALGDPSVT+++VTP   PSG L P+EERI QLFE NTYSVVNIFDVTLRP+LNV G V
Sbjct  103   AQALGDPSVTIDEVTPTISPSGSLFPTEERIAQLFEKNTYSVVNIFDVTLRPQLNVTGMV  162

Query  1489  EIPEGNGSGVVWDGEGNIVTNYHVIGNSLSRNPTRGEVVARVNILAPDG*EE  1334
             EIPEGNGSGVVWD +G+IVTNYHVI ++L+RNP+ G+VVARVNILA DG ++
Sbjct  163   EIPEGNGSGVVWDDQGHIVTNYHVIASALARNPSAGQVVARVNILASDGIQK  214



>gb|EMT20257.1| Protease Do-like 8, chloroplastic [Aegilops tauschii]
Length=542

 Score =   370 bits (950),  Expect = 3e-117, Method: Compositional matrix adjust.
 Identities = 182/236 (77%), Positives = 210/236 (89%), Gaps = 0/236 (0%)
 Frame = -2

Query  1211  LQKNFEGKLVGADRSKDLAVLKVEASEDLLRPTKIGESSSLRVGQKCLAIGNPFGFDHTL  1032
             +QKNFEG L+GADR+KDLAVLKV+A  D+L+P  +G+SS+L+VGQ+CLAIGNPFGFDHTL
Sbjct  292   IQKNFEGILIGADRAKDLAVLKVDAPSDILKPIIVGQSSALKVGQQCLAIGNPFGFDHTL  351

Query  1031  TVGVISGLNRDIYSQTGVTISGGIQTDAAINPGNSGGPLLDSKGNLIGINTAIFTQTGTS  852
             TVGVISGLNRDI+SQ GVTI GGIQTDAAINPGNSGGPLLDSKG++IGINTAIFTQTGTS
Sbjct  352   TVGVISGLNRDIFSQAGVTIGGGIQTDAAINPGNSGGPLLDSKGHMIGINTAIFTQTGTS  411

Query  851   AGVGFAIPSSTVLRIVPQLIQSGKVVRAGLNIDIAPDAIANQLNVRNGALVLLVPGNSLA  672
             AGVGFAI SST+L+IVPQLIQSGKV RAGLN++ APD IA QLNVR+GAL+L VP  S  
Sbjct  412   AGVGFAIQSSTILKIVPQLIQSGKVRRAGLNVEFAPDPIAYQLNVRDGALILKVPPGSAV  471

Query  671   AKAGILPTTRGFAGNIVLGDIIEAVDNKPVRNKADLYKVLDDYSVGDKVQLKIRRG  504
             AKAG++PT RGFAGNI+LGD+I AVD KP++ K+DL +VLDDY VGD V L IRRG
Sbjct  472   AKAGLVPTGRGFAGNIILGDVIVAVDGKPIKGKSDLLRVLDDYGVGDTVTLTIRRG  527


 Score =   175 bits (444),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 83/111 (75%), Positives = 94/111 (85%), Gaps = 0/111 (0%)
 Frame = -3

Query  1675  LQAYALGDPSVTVEQVTPPTFPSGPLSPSEERIVQLFENNTYSVVNIFDVTLRPRLNVGG  1496
             L A ALGDP+V +E VTP  FPSGPL P+E+RI +LFE NTYSVVNIFD TLRP+LNV G
Sbjct  181   LSALALGDPTVKIEDVTPKIFPSGPLFPTEKRITELFETNTYSVVNIFDATLRPQLNVTG  240

Query  1495  AVEIPEGNGSGVVWDGEGNIVTNYHVIGNSLSRNPTRGEVVARVNILAPDG  1343
              VEIPEGNGSGVVWD  G+IVTNYHV+GN+LS+NP  GEVVARVNILA +G
Sbjct  241   VVEIPEGNGSGVVWDASGHIVTNYHVVGNALSKNPKLGEVVARVNILAAEG  291



>ref|NP_974863.1| protease DEG 8 [Arabidopsis thaliana]
 gb|AED94481.1| protease DEG 8 [Arabidopsis thaliana]
Length=434

 Score =   365 bits (937),  Expect = 1e-116, Method: Compositional matrix adjust.
 Identities = 184/236 (78%), Positives = 208/236 (88%), Gaps = 14/236 (6%)
 Frame = -2

Query  1211  LQKNFEGKLVGADRSKDLAVLKVEASEDLLRPTKIGESSSLRVGQKCLAIGNPFGFDHTL  1032
             +QKNFEGKLVGADR+KDLAVLKV+A E LL+P K+G+S+SL+VGQ+CLAIGNPFGFDHTL
Sbjct  198   VQKNFEGKLVGADRAKDLAVLKVDAPETLLKPIKVGQSNSLKVGQQCLAIGNPFGFDHTL  257

Query  1031  TVGVISGLNRDIYSQTGVTISGGIQTDAAINPGNSGGPLLDSKGNLIGINTAIFTQTGTS  852
             TVGVISGLNRDI+SQTGVTI GGIQTDAAINPGNSGGPLLDSKGNLIGINTAIFTQ    
Sbjct  258   TVGVISGLNRDIFSQTGVTIGGGIQTDAAINPGNSGGPLLDSKGNLIGINTAIFTQ----  313

Query  851   AGVGFAIPSSTVLRIVPQLIQSGKVVRAGLNIDIAPDAIANQLNVRNGALVLLVPGNSLA  672
                       TVL+IVPQLIQ  KV+RAG+NI++APD +ANQLNVRNGALVL VPG SLA
Sbjct  314   ----------TVLKIVPQLIQFSKVLRAGINIELAPDPVANQLNVRNGALVLQVPGKSLA  363

Query  671   AKAGILPTTRGFAGNIVLGDIIEAVDNKPVRNKADLYKVLDDYSVGDKVQLKIRRG  504
              KAG+ PT+RGFAGNIVLGDII AVD+KPV+NKA+L K+LD+YSVGDKV LKI+RG
Sbjct  364   EKAGLHPTSRGFAGNIVLGDIIVAVDDKPVKNKAELMKILDEYSVGDKVTLKIKRG  419


 Score =   173 bits (439),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 87/112 (78%), Positives = 96/112 (86%), Gaps = 1/112 (1%)
 Frame = -3

Query  1675  LQAYALGDPSV-TVEQVTPPTFPSGPLSPSEERIVQLFENNTYSVVNIFDVTLRPRLNVG  1499
             L A ALGDPSV TVE V+P  FP+GPL P+E RIVQLFE NTYSVVNIFDVTLRP+L + 
Sbjct  86    LSALALGDPSVATVEDVSPTVFPAGPLFPTEGRIVQLFEKNTYSVVNIFDVTLRPQLKMT  145

Query  1498  GAVEIPEGNGSGVVWDGEGNIVTNYHVIGNSLSRNPTRGEVVARVNILAPDG  1343
             G VEIPEGNGSGVVWDG+G IVTNYHVIGN+LSRNP+ G+VV RVNILA DG
Sbjct  146   GVVEIPEGNGSGVVWDGQGYIVTNYHVIGNALSRNPSPGDVVGRVNILASDG  197



>ref|XP_001758182.1| predicted protein [Physcomitrella patens]
 gb|EDQ77004.1| predicted protein [Physcomitrella patens]
Length=389

 Score =   335 bits (859),  Expect = 1e-105, Method: Compositional matrix adjust.
 Identities = 168/234 (72%), Positives = 194/234 (83%), Gaps = 0/234 (0%)
 Frame = -2

Query  1208  QKNFEGKLVGADRSKDLAVLKVEASEDLLRPTKIGESSSLRVGQKCLAIGNPFGFDHTLT  1029
             QKNFE KLVGAD++KDLAVL V+A  +LLRP K+G+SS LRVGQ+CLAIGNPFGFDHTLT
Sbjct  140   QKNFEAKLVGADKTKDLAVLDVDAPVELLRPVKLGQSSKLRVGQRCLAIGNPFGFDHTLT  199

Query  1028  VGVISGLNRDIYSQTGVTISGGIQTDAAINPGNSGGPLLDSKGNLIGINTAIFTQTGTSA  849
             VGV+SGLNRDI+SQTGV I GGIQTDAAINPGNSGG LLDS GNLIGINTAIFT+TGTSA
Sbjct  200   VGVVSGLNRDIFSQTGVVIGGGIQTDAAINPGNSGGVLLDSNGNLIGINTAIFTRTGTSA  259

Query  848   GVGFAIPSSTVLRIVPQLIQSGKVVRAGLNIDIAPDAIANQLNVRNGALVLLVPGNSLAA  669
             GVGFAIP  TV ++VPQLI  GKV+R GLN+  AP+A+A QLNVR+GALVL VP  S AA
Sbjct  260   GVGFAIPIDTVAKLVPQLIAYGKVMRPGLNVQFAPEAVAKQLNVRSGALVLTVPDKSAAA  319

Query  668   KAGILPTTRGFAGNIVLGDIIEAVDNKPVRNKADLYKVLDDYSVGDKVQLKIRR  507
             KAGI+ T RG  GNI+LGD+I  V    V+N  +L K LD Y VGD++ LK++R
Sbjct  320   KAGIIATRRGLTGNILLGDVIVGVGETTVKNPQELTKALDSYQVGDQILLKVQR  373


 Score =   159 bits (401),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 74/109 (68%), Positives = 93/109 (85%), Gaps = 0/109 (0%)
 Frame = -3

Query  1669  AYALGDPSVTVEQVTPPTFPSGPLSPSEERIVQLFENNTYSVVNIFDVTLRPRLNVGGAV  1490
             A ALGDP+VT+++VTP   P+G L P+EER V+LFE NTYSVVNIFDV+LRP++N+ G+V
Sbjct  30    ARALGDPTVTIDEVTPTIAPAGSLPPAEERTVELFERNTYSVVNIFDVSLRPQVNMTGSV  89

Query  1489  EIPEGNGSGVVWDGEGNIVTNYHVIGNSLSRNPTRGEVVARVNILAPDG  1343
             E+PEGNGSG +WD EG+IVTNYHVIG+SL+RNP  G+VVARV +L  DG
Sbjct  90    EVPEGNGSGFIWDEEGHIVTNYHVIGSSLARNPPLGQVVARVTLLGADG  138



>gb|KHN13227.1| Protease Do-like 8, chloroplastic [Glycine soja]
Length=467

 Score =   337 bits (863),  Expect = 3e-105, Method: Compositional matrix adjust.
 Identities = 180/248 (73%), Positives = 203/248 (82%), Gaps = 15/248 (6%)
 Frame = -2

Query  1211  LQKNFEGKLVGADRSKDLAVLKVEASEDLLRPTKIGESSSLRVGQKCLAIGNPFGFDHTL  1032
             LQKNFEG+L+GADR KDLAV   EA +D+LRP K+G+SSSL+VGQ+CLAIGNPFGFDHTL
Sbjct  208   LQKNFEGRLIGADRLKDLAV---EAPKDILRPIKVGQSSSLKVGQQCLAIGNPFGFDHTL  264

Query  1031  TVGVISGLNRDIYSQTGVTISGGIQTDAAINPGNSGGPLLDSKGNLIGINTAIFTQTGTS  852
             TVGVISGLNRDI SQTGVTI GG+QTDAAINPGNSGGPLLDSKG+LIGINTAIFT+TG  
Sbjct  265   TVGVISGLNRDISSQTGVTIGGGVQTDAAINPGNSGGPLLDSKGSLIGINTAIFTRTGKD  324

Query  851   AG-------VGFAIPSSTVLRIVPQLIQSG-----KVVRAGLNIDIAPDAIANQLNVRNG  708
                      +   I + +    + + I S      +VVRAGLN+DIAPD IANQLNVRNG
Sbjct  325   ISWCRICNPIFNCIANCSTADPIRKNIYSNASISYQVVRAGLNVDIAPDLIANQLNVRNG  384

Query  707   ALVLLVPGNSLAAKAGILPTTRGFAGNIVLGDIIEAVDNKPVRNKADLYKVLDDYSVGDK  528
             ALVLLVP NSLAAKAG+ PTTRGFAGNIVLGDII AVDNKPV++KADL K LDDY+VGDK
Sbjct  385   ALVLLVPANSLAAKAGLNPTTRGFAGNIVLGDIIVAVDNKPVKSKADLLKALDDYNVGDK  444

Query  527   VQLKIRRG  504
             V L I+RG
Sbjct  445   VVLMIQRG  452


 Score =   183 bits (464),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 92/118 (78%), Positives = 100/118 (85%), Gaps = 1/118 (1%)
 Frame = -3

Query  1696  LCTQFITLQAYALGDPSVTVEQVTPPTFPSGPLSPSEERIVQLFENNTYSVVNIFDVTLR  1517
             LC+    L A ALGDPSV +E+VTPP F SGPL P E+RIVQLFE NTYSVVNIFDVTLR
Sbjct  91    LCSSRF-LSALALGDPSVKLEEVTPPVFSSGPLFPIEDRIVQLFERNTYSVVNIFDVTLR  149

Query  1516  PRLNVGGAVEIPEGNGSGVVWDGEGNIVTNYHVIGNSLSRNPTRGEVVARVNILAPDG  1343
             P+LNV G VEIPEGNGSGVVWD EG+IVTNYHVIGN+LSRNP  GEVVARVNILA +G
Sbjct  150   PQLNVTGVVEIPEGNGSGVVWDEEGHIVTNYHVIGNALSRNPNSGEVVARVNILASEG  207



>ref|XP_009381431.1| PREDICTED: protease Do-like 8, chloroplastic isoform X2 [Musa 
acuminata subsp. malaccensis]
Length=425

 Score =   327 bits (837),  Expect = 5e-102, Method: Compositional matrix adjust.
 Identities = 169/236 (72%), Positives = 191/236 (81%), Gaps = 29/236 (12%)
 Frame = -2

Query  1211  LQKNFEGKLVGADRSKDLAVLKVEASEDLLRPTKIGESSSLRVGQKCLAIGNPFGFDHTL  1032
             +QK FEG+L+GA+R+KDLAVLKV+AS DLL+P  +G+SS LRVGQ+CLAIGNPFGFDHTL
Sbjct  204   VQKTFEGRLIGANRAKDLAVLKVDASADLLKPINVGQSSVLRVGQQCLAIGNPFGFDHTL  263

Query  1031  TVGVISGLNRDIYSQTGVTISGGIQTDAAINPGNSGGPLLDSKGNLIGINTAIFTQTGTS  852
             TVGVISGLNRDI S+TGVTI GGIQTDAAINPGNSGGPLLDSKGN+IGINTAIFT TG S
Sbjct  264   TVGVISGLNRDIVSKTGVTIGGGIQTDAAINPGNSGGPLLDSKGNMIGINTAIFTNTGAS  323

Query  851   AGVGFAIPSSTVLRIVPQLIQSGKVVRAGLNIDIAPDAIANQLNVRNGALVLLVPGNSLA  672
             AGVGFAIPSSTVLRIVPQLIQ GK                             +P NS+A
Sbjct  324   AGVGFAIPSSTVLRIVPQLIQFGK-----------------------------IPENSVA  354

Query  671   AKAGILPTTRGFAGNIVLGDIIEAVDNKPVRNKADLYKVLDDYSVGDKVQLKIRRG  504
             AKAG+LPTTRG AGNIVLGD+I AVDNKPVR+KADL K+LD+Y+VG+ V LKI+RG
Sbjct  355   AKAGLLPTTRGLAGNIVLGDVIVAVDNKPVRSKADLLKILDEYNVGNTVLLKIQRG  410


 Score =   159 bits (402),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 78/109 (72%), Positives = 89/109 (82%), Gaps = 0/109 (0%)
 Frame = -3

Query  1669  AYALGDPSVTVEQVTPPTFPSGPLSPSEERIVQLFENNTYSVVNIFDVTLRPRLNVGGAV  1490
             A AL +PS+T E VTP  F SGPL PSEER V++FE NTYSVVNIFDVTLRPRLN  G V
Sbjct  95    ALALEEPSITTEDVTPRVFLSGPLFPSEERTVEIFEKNTYSVVNIFDVTLRPRLNATGVV  154

Query  1489  EIPEGNGSGVVWDGEGNIVTNYHVIGNSLSRNPTRGEVVARVNILAPDG  1343
             E+PEGNGSGVVWD  G+IVTNYHV+GN+LS+NP   +VVARVNIL  +G
Sbjct  155   EVPEGNGSGVVWDKFGHIVTNYHVVGNALSKNPNPDQVVARVNILVAEG  203



>ref|XP_002983147.1| hypothetical protein SELMODRAFT_422439 [Selaginella moellendorffii]
 gb|EFJ15956.1| hypothetical protein SELMODRAFT_422439 [Selaginella moellendorffii]
Length=402

 Score =   322 bits (826),  Expect = 1e-100, Method: Compositional matrix adjust.
 Identities = 159/235 (68%), Positives = 195/235 (83%), Gaps = 0/235 (0%)
 Frame = -2

Query  1211  LQKNFEGKLVGADRSKDLAVLKVEASEDLLRPTKIGESSSLRVGQKCLAIGNPFGFDHTL  1032
             +QK F+  LVGAD++KDLAVLK++A E LL P  +G+SS+L+VGQ+CLAIGNPFGFDHTL
Sbjct  152   VQKTFQATLVGADKTKDLAVLKIDAPEALLHPISVGKSSNLKVGQRCLAIGNPFGFDHTL  211

Query  1031  TVGVISGLNRDIYSQTGVTISGGIQTDAAINPGNSGGPLLDSKGNLIGINTAIFTQTGTS  852
             TVGV+SGLNRDI SQTGV I GGIQTDAAINPGNSGGPLL+S G LIGIN AIFT+TGTS
Sbjct  212   TVGVVSGLNRDINSQTGVIIGGGIQTDAAINPGNSGGPLLNSDGKLIGINAAIFTRTGTS  271

Query  851   AGVGFAIPSSTVLRIVPQLIQSGKVVRAGLNIDIAPDAIANQLNVRNGALVLLVPGNSLA  672
             AG+GFAIP   V R+VPQLI+ GK++ AGL I +APD +A QLNV+ G+LVL V  +S A
Sbjct  272   AGIGFAIPVDAVSRVVPQLIKYGKIMHAGLKIQVAPDIVAKQLNVKKGSLVLSVLPSSTA  331

Query  671   AKAGILPTTRGFAGNIVLGDIIEAVDNKPVRNKADLYKVLDDYSVGDKVQLKIRR  507
             AKAG++ T RG AGNI+LGD+I AVDN  ++N A+L K LDD+ +GD+V LK++R
Sbjct  332   AKAGLVATRRGIAGNILLGDVILAVDNLSIKNPAELAKALDDHEIGDQVVLKVQR  386


 Score =   152 bits (385),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 71/112 (63%), Positives = 91/112 (81%), Gaps = 0/112 (0%)
 Frame = -3

Query  1678  TLQAYALGDPSVTVEQVTPPTFPSGPLSPSEERIVQLFENNTYSVVNIFDVTLRPRLNVG  1499
             TL A ALGD +VT+E VTPP  P G L PSEERI +LFENNT+SVVN+FD TL+P LN+ 
Sbjct  40    TLPALALGDSTVTLEDVTPPVAPRGDLPPSEERIAKLFENNTFSVVNVFDTTLKPELNLT  99

Query  1498  GAVEIPEGNGSGVVWDGEGNIVTNYHVIGNSLSRNPTRGEVVARVNILAPDG  1343
             G+VE+PEGNG+G+VWD +G+IVTNYHVIG++LS+   + + VARV++L  DG
Sbjct  100   GSVEVPEGNGTGIVWDKDGHIVTNYHVIGSALSKGLGKKKPVARVSLLVEDG  151



>ref|XP_002965905.1| hypothetical protein SELMODRAFT_407040 [Selaginella moellendorffii]
 gb|EFJ33325.1| hypothetical protein SELMODRAFT_407040 [Selaginella moellendorffii]
Length=372

 Score =   320 bits (821),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 158/235 (67%), Positives = 195/235 (83%), Gaps = 0/235 (0%)
 Frame = -2

Query  1211  LQKNFEGKLVGADRSKDLAVLKVEASEDLLRPTKIGESSSLRVGQKCLAIGNPFGFDHTL  1032
             +QK F+  LVGAD++KDLAVLK++A E LL P  +G+SS+L+VGQ+CLAIGNPFGFDHTL
Sbjct  122   VQKTFQATLVGADKTKDLAVLKIDAPEALLHPISVGKSSNLKVGQRCLAIGNPFGFDHTL  181

Query  1031  TVGVISGLNRDIYSQTGVTISGGIQTDAAINPGNSGGPLLDSKGNLIGINTAIFTQTGTS  852
             TVGV+SGLNRDI SQTGV I GGIQTDAAINPGNSGGPLL+S+G LIGIN AIFT+TGTS
Sbjct  182   TVGVVSGLNRDINSQTGVIIGGGIQTDAAINPGNSGGPLLNSEGKLIGINAAIFTRTGTS  241

Query  851   AGVGFAIPSSTVLRIVPQLIQSGKVVRAGLNIDIAPDAIANQLNVRNGALVLLVPGNSLA  672
             AG+GFAIP   V R+VPQLI+ GK++ AGL I +APD +A QLNV+ G+LVL V  +S A
Sbjct  242   AGIGFAIPVDAVSRVVPQLIKYGKIMHAGLKIQVAPDIVAKQLNVKKGSLVLSVLPSSTA  301

Query  671   AKAGILPTTRGFAGNIVLGDIIEAVDNKPVRNKADLYKVLDDYSVGDKVQLKIRR  507
             AKAG++ T RG AGNI+LGD+I AVDN  ++N  +L K LDD+ +GD+V LK++R
Sbjct  302   AKAGLVATRRGIAGNILLGDVILAVDNLSIKNPPELAKALDDHEIGDRVVLKVQR  356


 Score =   152 bits (383),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 71/112 (63%), Positives = 91/112 (81%), Gaps = 0/112 (0%)
 Frame = -3

Query  1678  TLQAYALGDPSVTVEQVTPPTFPSGPLSPSEERIVQLFENNTYSVVNIFDVTLRPRLNVG  1499
             TL A ALGD +VT+E VTPP  P G L PSEERI +LFENNT+SVVN+FD TL+P LN+ 
Sbjct  10    TLPALALGDSTVTLEDVTPPVAPRGDLPPSEERIAKLFENNTFSVVNVFDTTLKPELNLT  69

Query  1498  GAVEIPEGNGSGVVWDGEGNIVTNYHVIGNSLSRNPTRGEVVARVNILAPDG  1343
             G+VE+PEGNG+G+VWD +G+IVTNYHVIG++LS+   + + VARV++L  DG
Sbjct  70    GSVEVPEGNGTGIVWDKDGHIVTNYHVIGSALSKGLGKKKPVARVSLLVEDG  121



>ref|XP_005645556.1| trypsin-like serine protease [Coccomyxa subellipsoidea C-169]
 gb|EIE21012.1| trypsin-like serine protease [Coccomyxa subellipsoidea C-169]
Length=482

 Score =   282 bits (722),  Expect = 3e-84, Method: Compositional matrix adjust.
 Identities = 146/234 (62%), Positives = 177/234 (76%), Gaps = 1/234 (0%)
 Frame = -2

Query  1205  KNFEGKLVGADRSKDLAVLKVEASEDLLRPTKIGESSSLRVGQKCLAIGNPFGFDHTLTV  1026
             + ++  LVGADR+KDLAVL++ A ++ LRP ++G+S  LRVGQ+ LAIGNPFGFDHTLT 
Sbjct  234   QTYDAVLVGADRAKDLAVLRIAAPKEALRPARLGQSGQLRVGQQVLAIGNPFGFDHTLTT  293

Query  1025  GVISGLNRDIYSQTGVTISGGIQTDAAINPGNSGGPLLDSKGNLIGINTAIFTQTGTSAG  846
             GVISGL R I SQ G +I G IQTDAAINPGNSGGPLLDS G +IG+NTAI+T +GTSAG
Sbjct  294   GVISGLGRQIQSQVGSSIGGAIQTDAAINPGNSGGPLLDSGGRVIGVNTAIYTASGTSAG  353

Query  845   VGFAIPSSTVLRIVPQLIQSGKVVRAGLNIDIAPDAIANQLNVRNGALVLLVPGNSLAAK  666
             VGFAI   TV R+VPQL+Q GKV R  LNI +A +A+A QL V  GA+V  V  NS AAK
Sbjct  354   VGFAIGIDTVRRVVPQLLQFGKVTRPALNIQLASEAVARQLKVTRGAMVQAVAPNSAAAK  413

Query  665   AGILPTTRGFAGNIVLGDIIEAVDNKPVRNKADLYKVLDDYSVGDKVQLKIRRG  504
             AG+LPT R  +G IV GD+I A+D +PV    DL   LDD SVGDK+ L ++RG
Sbjct  414   AGLLPTRRALSG-IVAGDVITALDLRPVTKPGDLALALDDCSVGDKIVLTVQRG  466


 Score = 85.9 bits (211),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 46/110 (42%), Positives = 66/110 (60%), Gaps = 10/110 (9%)
 Frame = -3

Query  1642  TVEQVTPPTFPSGPLSPSEERIVQLFENNTYSVVNIFDVTLRPRLNVGGAVEIPEGNGSG  1463
             T+ +VTP   P+ PLS  E+ ++ +FE +T SVVN+FDVTL+         + PEGNG+G
Sbjct  122   TLAEVTPEVAPAAPLSSREQAVIDVFEQSTRSVVNVFDVTLQGNARPVPQEDQPEGNGTG  181

Query  1462  VVWDGEGNIVTNYHVIGNSL----------SRNPTRGEVVARVNILAPDG  1343
              VWD +GNIVTN+HV+ ++L           R      VVA++ +L  DG
Sbjct  182   FVWDADGNIVTNFHVLASALVAITRRPGGPPREGGPRPVVAKITLLGADG  231



>ref|XP_002955471.1| trypsin family [Volvox carteri f. nagariensis]
 gb|EFJ43542.1| trypsin family [Volvox carteri f. nagariensis]
Length=354

 Score =   265 bits (677),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 139/236 (59%), Positives = 174/236 (74%), Gaps = 2/236 (1%)
 Frame = -2

Query  1211  LQKNFEGKLVGADRSKDLAVLK-VEASEDLLRPTKIGESSSLRVGQKCLAIGNPFGFDHT  1035
             +++ F+  LVGADR++DL VL+ V A   +LRP ++G S SLRVGQ+CLAIGNPFGF HT
Sbjct  101   VEQTFDAVLVGADRTRDLVVLQLVGAPASVLRPVQLGSSGSLRVGQQCLAIGNPFGFGHT  160

Query  1034  LTVGVISGLNRDIYSQTGVTISGGIQTDAAINPGNSGGPLLDSKGNLIGINTAIFTQTGT  855
             LT GVIS LNRDI S  G TI GGIQTDA+INPGNSGGPLLDS G +IG+NTAIFT TG+
Sbjct  161   LTSGVISALNRDIRSPLGTTIPGGIQTDASINPGNSGGPLLDSSGRVIGVNTAIFTPTGS  220

Query  854   SAGVGFAIPSSTVLRIVPQLIQSGKVVRAGLNIDIAPDAIANQLNVRNGALVLLVPGNSL  675
             S+GV FAIP   V R+VPQLIQ+GKVVR  L+  IA D++A +L V  GAL+  V     
Sbjct  221   SSGVAFAIPVDMVKRVVPQLIQNGKVVRPSLDAQIASDSVAQRLKVGRGALIQAVSSGGA  280

Query  674   AAKAGILPTTRGFAGNIVLGDIIEAVDNKPVRNKADLYKVLDDYSVGDKVQLKIRR  507
             A KAG+LPT RG +G I+ GD+I+AV+ +PV +  DL   LD  + GD  ++K+ R
Sbjct  281   ADKAGLLPTRRGLSG-IITGDVIQAVNGRPVNSGGDLLVALDGLAAGDTAKVKVIR  335


 Score = 75.9 bits (185),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 33/67 (49%), Positives = 47/67 (70%), Gaps = 0/67 (0%)
 Frame = -3

Query  1600  LSPSEERIVQLFENNTYSVVNIFDVTLRPRLNVGGAVEIPEGNGSGVVWDGEGNIVTNYH  1421
             +S  E  IV +FE NTYS+ N+ DV L+ R      V++PEGNG+G +WD +G++VTNYH
Sbjct  4     MSQREAAIVSVFERNTYSIANVVDVALQGRAAASPEVDVPEGNGTGFIWDDQGHVVTNYH  63

Query  1420  VIGNSLS  1400
             V+ +SL 
Sbjct  64    VLLSSLK  70



>ref|XP_005845406.1| hypothetical protein CHLNCDRAFT_25936 [Chlorella variabilis]
 gb|EFN53304.1| hypothetical protein CHLNCDRAFT_25936 [Chlorella variabilis]
Length=403

 Score =   262 bits (669),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 141/237 (59%), Positives = 172/237 (73%), Gaps = 3/237 (1%)
 Frame = -2

Query  1208  QKNFEGKLV-GADRSKDLAVLKVEASEDLLRPTKIGESSSLRVGQKCLAIGNPFGFDHTL  1032
             Q+ ++G L  GAD+++DLAVLKV A   LLRP  +G+SSS+RVGQ CLAIGNPFGF+ TL
Sbjct  147   QQAYDGFLAAGADKARDLAVLKVSAPASLLRPLPLGDSSSVRVGQGCLAIGNPFGFERTL  206

Query  1031  TVGVISGL-NRDIYSQTGVTISGGIQTDAAINPGNSGGPLLDSKGNLIGINTAIFTQTGT  855
             T GV+S L    + SQTG TI GGIQTDAA+NPGNSGGPLLD  G +IG+NTAIFT TGT
Sbjct  207   TTGVVSALVACSLLSQTGSTIGGGIQTDAAVNPGNSGGPLLDLSGAVIGVNTAIFTNTGT  266

Query  854   SAGVGFAIPSSTVLRIVPQLIQSGKVVRAGLNIDIAPDAIANQLNVRNGALVLLVPGNSL  675
             SAG+GFAIPS+TV R+VPQLI  G V RA L    APD +A  L V  G ++        
Sbjct  267   SAGLGFAIPSNTVRRVVPQLISLGAVQRASLGFQPAPDPVARALKVSEGVMIQTADPKGA  326

Query  674   AAKAGILPTTRGFAGNIVLGDIIEAVDNKPVRNKADLYKVLDDYSVGDKVQLKIRRG  504
             AA+AG+LPT RG  G IV GD+I AVD +PVRN  DL  +LD+ +VGD V+++  RG
Sbjct  327   AAQAGLLPTRRGL-GGIVAGDVIVAVDGQPVRNLFDLTSLLDERAVGDVVEVRALRG  382


 Score =   101 bits (251),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 56/110 (51%), Positives = 73/110 (66%), Gaps = 6/110 (5%)
 Frame = -3

Query  1648  SVTVEQVTPPTFPSGPLSPSEERIVQLFENNTYSVVNIFDVTLRPRLNVGG--AVEIPEG  1475
             +VT+E VTPP  P+ PLS  E ++  +++     VVN+FDVTLR    VGG  AVE PEG
Sbjct  40    AVTLEDVTPPVAPAQPLSAREAQVADIYDRTAPGVVNVFDVTLR-TTGVGGPQAVEQPEG  98

Query  1474  NGSGVVWDGEGNIVTNYHVIGNSLSRNPTR---GEVVARVNILAPDG*EE  1334
             NG+G VWD EG+IVTNYHV+ + L     +   G  VARV +LAPDG ++
Sbjct  99    NGTGFVWDTEGHIVTNYHVLASVLGGAAGKVLSGAKVARVLLLAPDGTQQ  148



>ref|XP_001689569.1| DegP-type protease [Chlamydomonas reinhardtii]
 gb|EDP09307.1| DegP-type protease [Chlamydomonas reinhardtii]
Length=436

 Score =   263 bits (671),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 139/238 (58%), Positives = 172/238 (72%), Gaps = 2/238 (1%)
 Frame = -2

Query  1217  GRLQKNFEGKLVGADRSKDLAVLK-VEASEDLLRPTKIGESSSLRVGQKCLAIGNPFGFD  1041
             G L++  +  LVG DR++DLAVL+ V      LRP  +G S++LRVGQ+CLAIGNPFGF 
Sbjct  181   GGLEQTLDAVLVGVDRTRDLAVLQLVAPPAGALRPAALGSSATLRVGQQCLAIGNPFGFS  240

Query  1040  HTLTVGVISGLNRDIYSQTGVTISGGIQTDAAINPGNSGGPLLDSKGNLIGINTAIFTQT  861
             HTLT GVIS LNRDI SQ G TI GGIQTDAAINPGNSGGPLLDS G +IGINTAIFT +
Sbjct  241   HTLTTGVISALNRDIKSQLGTTIPGGIQTDAAINPGNSGGPLLDSSGAVIGINTAIFTPS  300

Query  860   GTSAGVGFAIPSSTVLRIVPQLIQSGKVVRAGLNIDIAPDAIANQLNVRNGALVLLVPGN  681
             G+SAGVGFAIP   V  +VPQLI +G+VVR  L+  IA D +A +LNV  GAL+  V   
Sbjct  301   GSSAGVGFAIPVDMVKSVVPQLIANGRVVRPSLDAQIAADTVAARLNVGRGALIQAVTAG  360

Query  680   SLAAKAGILPTTRGFAGNIVLGDIIEAVDNKPVRNKADLYKVLDDYSVGDKVQLKIRR  507
               A KAG+LPT RG +G IV GD+I+A++ + V +  DL   LD  + G++ +L+I R
Sbjct  361   GAAEKAGLLPTRRGLSG-IVAGDVIQAINGRAVNSAGDLLVALDGLAAGERAELRIVR  417


 Score = 91.3 bits (225),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 43/83 (52%), Positives = 57/83 (69%), Gaps = 0/83 (0%)
 Frame = -3

Query  1648  SVTVEQVTPPTFPSGPLSPSEERIVQLFENNTYSVVNIFDVTLRPRLNVGGAVEIPEGNG  1469
             ++T+EQVTP   P+  L P E  IV  FE   YS+VN+ D+ L  R      V+IPEGNG
Sbjct  74    ALTLEQVTPTVVPAPALPPREAAIVSAFERANYSIVNVVDLLLPGRAAANPEVDIPEGNG  133

Query  1468  SGVVWDGEGNIVTNYHVIGNSLS  1400
             +G++WDGEG++VTNYHV+ NSL 
Sbjct  134   TGLIWDGEGHVVTNYHVLLNSLK  156



>gb|EPS73282.1| hypothetical protein M569_01469, partial [Genlisea aurea]
Length=417

 Score =   254 bits (649),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 140/236 (59%), Positives = 169/236 (72%), Gaps = 2/236 (1%)
 Frame = -2

Query  1208  QKNFEGKLVGADRSKDLAVLKVEASEDLLRPTKIGESSSLRVGQKCLAIGNPFGFDHTLT  1029
             Q  ++ K+VG D+ KD+AVL++EAS+D LRP  IG S+ L VGQK  AIGNPFG DHTLT
Sbjct  166   QSTYDAKVVGFDQDKDVAVLRIEASKDKLRPIPIGVSADLLVGQKVYAIGNPFGLDHTLT  225

Query  1028  VGVISGLNRDIYSQ-TGVTISGGIQTDAAINPGNSGGPLLDSKGNLIGINTAIFTQTGTS  852
              GVISGL R+I S  TG  I   IQTDAAINPGNSGGPLLDS GNLIGINTAI++ +G S
Sbjct  226   TGVISGLRREISSAATGRPIQDVIQTDAAINPGNSGGPLLDSSGNLIGINTAIYSPSGAS  285

Query  851   AGVGFAIPSSTVLRIVPQLIQSGKVVRAGLNIDIAPDAIANQLNVRNGALVLLVPGNSLA  672
             +GVGF+IP  TV  IV QL++ GKV R  L I  APD    QL V +G LVL  P N  A
Sbjct  286   SGVGFSIPVDTVSGIVDQLVRFGKVTRPILGIKFAPDQSVEQLGV-SGVLVLDAPSNGPA  344

Query  671   AKAGILPTTRGFAGNIVLGDIIEAVDNKPVRNKADLYKVLDDYSVGDKVQLKIRRG  504
              KAG+LPT R   G +VLGDII +++ K V N +DLY++LD   VGDKV +++ RG
Sbjct  345   GKAGLLPTKRDAYGRLVLGDIITSINGKKVSNGSDLYRILDQCKVGDKVVVEVLRG  400


 Score = 59.7 bits (143),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 36/97 (37%), Positives = 52/97 (54%), Gaps = 7/97 (7%)
 Frame = -3

Query  1699  SLCTQFITLQAYALG--DPSVTVEQVTPPTFPSGPLSPSEERIVQLFENNTYSVVNIFDV  1526
             +LC       +  L   DP++     +P    S  L+      V+LF+ NT SVV I ++
Sbjct  62    ALCASVALSASLVLSPVDPALAFVVTSPRKLQSDELA-----TVRLFQENTPSVVYITNL  116

Query  1525  TLRPRLNVGGAVEIPEGNGSGVVWDGEGNIVTNYHVI  1415
               R        +E+P+G+GSG +WD EG+IVTNYHVI
Sbjct  117   ASRQDAFTLDVLEVPQGSGSGFIWDTEGHIVTNYHVI  153



>ref|XP_011085829.1| PREDICTED: protease Do-like 1, chloroplastic [Sesamum indicum]
 ref|XP_011085830.1| PREDICTED: protease Do-like 1, chloroplastic [Sesamum indicum]
Length=433

 Score =   253 bits (646),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 139/236 (59%), Positives = 168/236 (71%), Gaps = 2/236 (1%)
 Frame = -2

Query  1208  QKNFEGKLVGADRSKDLAVLKVEASEDLLRPTKIGESSSLRVGQKCLAIGNPFGFDHTLT  1029
             Q  ++ K+VG D+ KD+AVL+++A ED LRP  IG S+ L VGQK  AIGNPFG DHTLT
Sbjct  182   QSTYDAKVVGFDQDKDVAVLRIDAPEDKLRPIPIGVSADLLVGQKVYAIGNPFGLDHTLT  241

Query  1028  VGVISGLNRDIYSQ-TGVTISGGIQTDAAINPGNSGGPLLDSKGNLIGINTAIFTQTGTS  852
              GVISGL R+I S  TG  I   IQTDAAINPGNSGGPLLDS GNLIGINTAI++ +G S
Sbjct  242   TGVISGLRREISSAATGRPIQDVIQTDAAINPGNSGGPLLDSSGNLIGINTAIYSPSGAS  301

Query  851   AGVGFAIPSSTVLRIVPQLIQSGKVVRAGLNIDIAPDAIANQLNVRNGALVLLVPGNSLA  672
             +GVGF+IP  TV  IV QL++ GKV R  L I  APD    QL V +G LVL  P N  A
Sbjct  302   SGVGFSIPVDTVSGIVDQLVKFGKVTRPILGIKFAPDQSVEQLGV-SGVLVLDAPANGPA  360

Query  671   AKAGILPTTRGFAGNIVLGDIIEAVDNKPVRNKADLYKVLDDYSVGDKVQLKIRRG  504
              KAG+LPT R   G ++LGDII +V+ K V N +DLY++LD   VGDKV +++ RG
Sbjct  361   GKAGLLPTKRDAYGRLILGDIITSVNGKKVTNGSDLYRILDQCKVGDKVIVEVLRG  416


 Score = 59.7 bits (143),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 30/62 (48%), Positives = 40/62 (65%), Gaps = 0/62 (0%)
 Frame = -3

Query  1600  LSPSEERIVQLFENNTYSVVNIFDVTLRPRLNVGGAVEIPEGNGSGVVWDGEGNIVTNYH  1421
             L   E   V+LF+ NT SVV I ++  R        +E+P+G+GSG VWD +G+IVTNYH
Sbjct  108   LQSDELATVRLFQENTPSVVYITNLAARQDAFTLDVLEVPQGSGSGFVWDTDGHIVTNYH  167

Query  1420  VI  1415
             VI
Sbjct  168   VI  169



>ref|XP_008458762.1| PREDICTED: protease Do-like 1, chloroplastic isoform X2 [Cucumis 
melo]
Length=278

 Score =   248 bits (632),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 137/236 (58%), Positives = 166/236 (70%), Gaps = 2/236 (1%)
 Frame = -2

Query  1208  QKNFEGKLVGADRSKDLAVLKVEASEDLLRPTKIGESSSLRVGQKCLAIGNPFGFDHTLT  1029
             Q  F+ K+VG D+ KD+AVL ++A +D LRP  +G S+ L VGQK  AIGNPFG DHTLT
Sbjct  27    QTTFDAKVVGFDQDKDVAVLSIDAPKDKLRPIPVGISADLLVGQKVFAIGNPFGLDHTLT  86

Query  1028  VGVISGLNRDIYSQ-TGVTISGGIQTDAAINPGNSGGPLLDSKGNLIGINTAIFTQTGTS  852
              GVISGL R+I S  TG  I   IQTDAAINPGNSGGPLLDS GNLIGINTAI++ +G S
Sbjct  87    TGVISGLRREISSAATGRPIQDVIQTDAAINPGNSGGPLLDSSGNLIGINTAIYSPSGAS  146

Query  851   AGVGFAIPSSTVLRIVPQLIQSGKVVRAGLNIDIAPDAIANQLNVRNGALVLLVPGNSLA  672
             +GVGF+IP  TV  IV QL++ GKV R  L I  APD    QL V +G LVL  P N  A
Sbjct  147   SGVGFSIPVDTVSGIVDQLVRFGKVTRPILGIKFAPDQSVEQLGV-SGVLVLDAPANGPA  205

Query  671   AKAGILPTTRGFAGNIVLGDIIEAVDNKPVRNKADLYKVLDDYSVGDKVQLKIRRG  504
              KAG+ PT R   G ++LGDII +V+ K V N +DLY++LD   VGDKV +++ RG
Sbjct  206   GKAGLKPTKRDAYGRLILGDIITSVNGKKVTNGSDLYRILDQCKVGDKVTVEVLRG  261



>ref|XP_002503307.1| predicted protein, partial [Micromonas sp. RCC299]
 gb|ACO64565.1| predicted protein, partial [Micromonas sp. RCC299]
Length=335

 Score =   249 bits (636),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 136/235 (58%), Positives = 161/235 (69%), Gaps = 2/235 (1%)
 Frame = -2

Query  1205  KNFEGKLVGADRSKDLAVLKVEASEDLLRPTKIGESSSLRVGQKCLAIGNPFGFDHTLTV  1026
             K F   LVGA+RSKDLAVLKV A ++ + P   G+S  +RVGQ   AIGNPFGFDHTLT 
Sbjct  102   KTFPATLVGAERSKDLAVLKVNAPKEYITPIARGKSDGVRVGQAVFAIGNPFGFDHTLTT  161

Query  1025  GVISGLNRDIYSQTGVTISGGIQTDAAINPGNSGGPLLDSKGNLIGINTAIFTQTGTSAG  846
             GV+SGL R I SQ G  ISGGIQTDAAINPGNSGGPLLD+ G L+G+NTAIFT TG SAG
Sbjct  162   GVVSGLGRTIQSQAGSLISGGIQTDAAINPGNSGGPLLDASGRLVGVNTAIFTSTGASAG  221

Query  845   VGFAIPSSTVLRIVPQLIQSGKVVRAGLNIDIAPDAIANQLNVRN-GALVLLVPGNSLAA  669
             VGFAIP   V R+VPQLI+ G V    LN+  A   +  QL V++ G LV  VP    AA
Sbjct  222   VGFAIPVDLVQRVVPQLIEFGSVRLPSLNVTAADPNVGKQLGVKSQGVLVQAVPSGGEAA  281

Query  668   KAGILPTTRGFAGNIVLGDIIEAVDNKPVRNKADLYKVLDDYSVGDKVQLKIRRG  504
             KAG+L T RG  G IV GD+I   D + V  + DL   ++ + VG+ V LK+RRG
Sbjct  282   KAGLLATRRGL-GGIVAGDVIVEADGRRVVTEGDLVAAVEAHQVGESVVLKVRRG  335


 Score = 66.6 bits (161),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 50/101 (50%), Positives = 65/101 (64%), Gaps = 6/101 (6%)
 Frame = -3

Query  1633  QVTPPTFPSGPLSPSEERIVQLFENNTYSVVNIFDVT-LRPRLNVGGAVEIPEGNGSGVV  1457
             +VTPP  P+  L+  E   V LFE  T SVVN+ DVT L  +    GAV +PEGNG+G V
Sbjct  1     EVTPPIAPAEALTSLESGTVALFERCTRSVVNVVDVTVLSGKAMTSGAV-VPEGNGTGFV  59

Query  1456  WDGEGNIVTNYHVIGNSLSRNPTR---GEVVARVNILAPDG  1343
             WD +G++VTN+HVIG+ LS+ P     GE VA+V +   DG
Sbjct  60    WDSDGHVVTNWHVIGSILSQVPKGRDPGE-VAKVTLEGADG  99



>ref|XP_001773228.1| predicted protein [Physcomitrella patens]
 gb|EDQ61918.1| predicted protein [Physcomitrella patens]
Length=350

 Score =   249 bits (637),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 137/236 (58%), Positives = 165/236 (70%), Gaps = 2/236 (1%)
 Frame = -2

Query  1208  QKNFEGKLVGADRSKDLAVLKVEASEDLLRPTKIGESSSLRVGQKCLAIGNPFGFDHTLT  1029
             Q  +E  +VG D  KD+AVL ++A ED LRP  +G SS L VGQK  AIGNPFG DHTLT
Sbjct  102   QSVYEADVVGYDEDKDVAVLHIDAPEDKLRPLTVGSSSDLLVGQKVFAIGNPFGLDHTLT  161

Query  1028  VGVISGLNRDIYSQ-TGVTISGGIQTDAAINPGNSGGPLLDSKGNLIGINTAIFTQTGTS  852
              GVISGL R+I S  TG  I   IQTDAAINPGNSGGPLLDS GNLIGINTAI++ +G S
Sbjct  162   TGVISGLRREISSAATGRPIQDVIQTDAAINPGNSGGPLLDSAGNLIGINTAIYSPSGAS  221

Query  851   AGVGFAIPSSTVLRIVPQLIQSGKVVRAGLNIDIAPDAIANQLNVRNGALVLLVPGNSLA  672
             +GVGF+IP  TV  IV Q+++ GKV R  L I  AP+    QL V +G LVL  P N  A
Sbjct  222   SGVGFSIPVDTVSGIVEQIVKFGKVTRPVLGISFAPEQAVEQLGV-SGVLVLDAPPNGPA  280

Query  671   AKAGILPTTRGFAGNIVLGDIIEAVDNKPVRNKADLYKVLDDYSVGDKVQLKIRRG  504
              KAG+ PTTR   G +VLGD+I +V+ K + N +DLYK+LD   VGD V+L++ RG
Sbjct  281   GKAGLRPTTRDSYGRLVLGDVITSVNGKKIANGSDLYKILDRCKVGDMVKLEVLRG  336


 Score = 58.5 bits (140),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 30/74 (41%), Positives = 45/74 (61%), Gaps = 0/74 (0%)
 Frame = -3

Query  1600  LSPSEERIVQLFENNTYSVVNIFDVTLRPRLNVGGAVEIPEGNGSGVVWDGEGNIVTNYH  1421
             L   E   VQLF+ NT SVV I ++ +R  +     + +P+G+GSG +WD +G++VTNYH
Sbjct  28    LQGDELATVQLFQENTPSVVYITNLAVRRDVFTLDVMSVPQGSGSGFIWDKKGHVVTNYH  87

Query  1420  VIGNSLSRNPTRGE  1379
             VI  +     T G+
Sbjct  88    VIRGASDLRVTLGD  101



>ref|XP_008230601.1| PREDICTED: protease Do-like 1, chloroplastic, partial [Prunus 
mume]
Length=436

 Score =   251 bits (642),  Expect = 4e-73, Method: Compositional matrix adjust.
 Identities = 139/236 (59%), Positives = 168/236 (71%), Gaps = 2/236 (1%)
 Frame = -2

Query  1208  QKNFEGKLVGADRSKDLAVLKVEASEDLLRPTKIGESSSLRVGQKCLAIGNPFGFDHTLT  1029
             Q  F+ K+VG D+ KD+AVL+V+A +D LRP  IG S+ L VGQK  AIGNPFG DHTLT
Sbjct  185   QSTFDAKVVGFDQDKDVAVLRVDAPKDKLRPIPIGVSADLLVGQKVFAIGNPFGLDHTLT  244

Query  1028  VGVISGLNRDIYSQ-TGVTISGGIQTDAAINPGNSGGPLLDSKGNLIGINTAIFTQTGTS  852
              GVISGL R+I S  TG  I   IQTDAAINPGNSGGPLLDS G+LIGINTAI++ +G S
Sbjct  245   TGVISGLRREISSAATGRPIQDVIQTDAAINPGNSGGPLLDSTGSLIGINTAIYSPSGAS  304

Query  851   AGVGFAIPSSTVLRIVPQLIQSGKVVRAGLNIDIAPDAIANQLNVRNGALVLLVPGNSLA  672
             +GVGF+IP  TV  IV QL++ GKV R  L I  APD    QL V +G LVL  P N  A
Sbjct  305   SGVGFSIPVDTVNGIVDQLVRFGKVTRPVLGIKFAPDQSVEQLGV-SGVLVLDAPANGPA  363

Query  671   AKAGILPTTRGFAGNIVLGDIIEAVDNKPVRNKADLYKVLDDYSVGDKVQLKIRRG  504
              KAG+LPT R   G ++LGDII +V+ K V N +DLY++LD   VGDKV +++ RG
Sbjct  364   GKAGLLPTKRDAYGRLILGDIITSVNGKKVSNGSDLYRILDQCKVGDKVTVEVLRG  419


 Score = 62.0 bits (149),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 34/72 (47%), Positives = 43/72 (60%), Gaps = 4/72 (6%)
 Frame = -3

Query  1630  VTPPTFPSGPLSPSEERIVQLFENNTYSVVNIFDVTLRPRLNVGGAVEIPEGNGSGVVWD  1451
             VTPP      L   E   VQLF+ NT SVV I ++  R         E+P+G+GSG VWD
Sbjct  105   VTPPR----KLQSDELATVQLFQENTPSVVYITNLAARQDAFTLDVFEVPQGSGSGFVWD  160

Query  1450  GEGNIVTNYHVI  1415
              +G++VTNYHVI
Sbjct  161   KDGHVVTNYHVI  172



>ref|XP_004142804.1| PREDICTED: protease Do-like 1, chloroplastic-like [Cucumis sativus]
 gb|KGN51390.1| hypothetical protein Csa_5G524830 [Cucumis sativus]
Length=439

 Score =   251 bits (642),  Expect = 5e-73, Method: Compositional matrix adjust.
 Identities = 138/236 (58%), Positives = 167/236 (71%), Gaps = 2/236 (1%)
 Frame = -2

Query  1208  QKNFEGKLVGADRSKDLAVLKVEASEDLLRPTKIGESSSLRVGQKCLAIGNPFGFDHTLT  1029
             Q  F+ K+VG D+ KD+AVL ++A +D LRP  +G S+ L VGQK  AIGNPFG DHTLT
Sbjct  188   QTTFDAKVVGFDQDKDVAVLSIDAPKDKLRPIPVGISADLLVGQKVFAIGNPFGLDHTLT  247

Query  1028  VGVISGLNRDIYSQ-TGVTISGGIQTDAAINPGNSGGPLLDSKGNLIGINTAIFTQTGTS  852
              GVISGL R+I S  TG  I   IQTDAAINPGNSGGPLLDS GNLIGINTAI++ +G S
Sbjct  248   TGVISGLRREISSAATGRPIQDVIQTDAAINPGNSGGPLLDSSGNLIGINTAIYSPSGAS  307

Query  851   AGVGFAIPSSTVLRIVPQLIQSGKVVRAGLNIDIAPDAIANQLNVRNGALVLLVPGNSLA  672
             +GVGF+IP  TV  IV QL++ GKV R  L I  APD    QL V +G LVL  P N  A
Sbjct  308   SGVGFSIPVDTVSGIVDQLVRFGKVTRPILGIKFAPDQSVEQLGV-SGVLVLDAPANGPA  366

Query  671   AKAGILPTTRGFAGNIVLGDIIEAVDNKPVRNKADLYKVLDDYSVGDKVQLKIRRG  504
              KAG+LPT R   G ++LGDII +V+ K V N +DLY++LD   VGDKV +++ RG
Sbjct  367   GKAGLLPTKRDAYGRLILGDIITSVNGKKVTNGSDLYRILDQCKVGDKVTVEVLRG  422


 Score = 62.0 bits (149),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 35/80 (44%), Positives = 47/80 (59%), Gaps = 5/80 (6%)
 Frame = -3

Query  1654  DPSVTVEQVTPPTFPSGPLSPSEERIVQLFENNTYSVVNIFDVTLRPRLNVGGAVEIPEG  1475
             DP+V     TP       L   E   V+LF+ NT SVV I ++ +R        +E+P+G
Sbjct  101   DPAVAFVVTTPRK-----LQTDELATVRLFQENTPSVVYITNLAVRQDAFTLDVLEVPQG  155

Query  1474  NGSGVVWDGEGNIVTNYHVI  1415
             +GSG VWD +G+IVTNYHVI
Sbjct  156   SGSGFVWDKDGHIVTNYHVI  175



>ref|XP_004156682.1| PREDICTED: protease Do-like 1, chloroplastic-like [Cucumis sativus]
Length=438

 Score =   251 bits (641),  Expect = 6e-73, Method: Compositional matrix adjust.
 Identities = 138/236 (58%), Positives = 167/236 (71%), Gaps = 2/236 (1%)
 Frame = -2

Query  1208  QKNFEGKLVGADRSKDLAVLKVEASEDLLRPTKIGESSSLRVGQKCLAIGNPFGFDHTLT  1029
             Q  F+ K+VG D+ KD+AVL ++A +D LRP  +G S+ L VGQK  AIGNPFG DHTLT
Sbjct  187   QTTFDAKVVGFDQDKDVAVLSIDAPKDKLRPIPVGISADLLVGQKVFAIGNPFGLDHTLT  246

Query  1028  VGVISGLNRDIYSQ-TGVTISGGIQTDAAINPGNSGGPLLDSKGNLIGINTAIFTQTGTS  852
              GVISGL R+I S  TG  I   IQTDAAINPGNSGGPLLDS GNLIGINTAI++ +G S
Sbjct  247   TGVISGLRREISSAATGRPIQDVIQTDAAINPGNSGGPLLDSSGNLIGINTAIYSPSGAS  306

Query  851   AGVGFAIPSSTVLRIVPQLIQSGKVVRAGLNIDIAPDAIANQLNVRNGALVLLVPGNSLA  672
             +GVGF+IP  TV  IV QL++ GKV R  L I  APD    QL V +G LVL  P N  A
Sbjct  307   SGVGFSIPVDTVSGIVDQLVRFGKVTRPILGIKFAPDQSVEQLGV-SGVLVLDAPANGPA  365

Query  671   AKAGILPTTRGFAGNIVLGDIIEAVDNKPVRNKADLYKVLDDYSVGDKVQLKIRRG  504
              KAG+LPT R   G ++LGDII +V+ K V N +DLY++LD   VGDKV +++ RG
Sbjct  366   GKAGLLPTKRDAYGRLILGDIITSVNGKKVTNGSDLYRILDQCKVGDKVTVEVLRG  421


 Score = 61.6 bits (148),  Expect = 8e-07, Method: Compositional matrix adjust.
 Identities = 35/80 (44%), Positives = 47/80 (59%), Gaps = 5/80 (6%)
 Frame = -3

Query  1654  DPSVTVEQVTPPTFPSGPLSPSEERIVQLFENNTYSVVNIFDVTLRPRLNVGGAVEIPEG  1475
             DP+V     TP       L   E   V+LF+ NT SVV I ++ +R        +E+P+G
Sbjct  100   DPAVAFVVTTPRK-----LQTDELATVRLFQENTPSVVYITNLAVRQDAFTLDVLEVPQG  154

Query  1474  NGSGVVWDGEGNIVTNYHVI  1415
             +GSG VWD +G+IVTNYHVI
Sbjct  155   SGSGFVWDKDGHIVTNYHVI  174



>ref|XP_007215368.1| hypothetical protein PRUPE_ppa005605mg [Prunus persica]
 gb|EMJ16567.1| hypothetical protein PRUPE_ppa005605mg [Prunus persica]
Length=452

 Score =   251 bits (640),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 139/236 (59%), Positives = 167/236 (71%), Gaps = 2/236 (1%)
 Frame = -2

Query  1208  QKNFEGKLVGADRSKDLAVLKVEASEDLLRPTKIGESSSLRVGQKCLAIGNPFGFDHTLT  1029
             Q  F+ K+VG D+ KD+AVL V+A +D LRP  IG S+ L VGQK  AIGNPFG DHTLT
Sbjct  201   QSTFDAKVVGFDQDKDVAVLHVDAPKDKLRPIPIGVSADLLVGQKVFAIGNPFGLDHTLT  260

Query  1028  VGVISGLNRDIYSQ-TGVTISGGIQTDAAINPGNSGGPLLDSKGNLIGINTAIFTQTGTS  852
              GVISGL R+I S  TG  I   IQTDAAINPGNSGGPLLDS G+LIGINTAI++ +G S
Sbjct  261   TGVISGLRREISSAATGRPIQDVIQTDAAINPGNSGGPLLDSTGSLIGINTAIYSPSGAS  320

Query  851   AGVGFAIPSSTVLRIVPQLIQSGKVVRAGLNIDIAPDAIANQLNVRNGALVLLVPGNSLA  672
             +GVGF+IP  TV  IV QL++ GKV R  L I  APD    QL V +G LVL  P N  A
Sbjct  321   SGVGFSIPVDTVNGIVDQLVRFGKVTRPVLGIKFAPDQSVEQLGV-SGVLVLDAPANGPA  379

Query  671   AKAGILPTTRGFAGNIVLGDIIEAVDNKPVRNKADLYKVLDDYSVGDKVQLKIRRG  504
              KAG+LPT R   G ++LGDII +V+ K V N +DLY++LD   VGDKV +++ RG
Sbjct  380   GKAGLLPTKRDAYGRLILGDIITSVNGKKVSNGSDLYRILDQCKVGDKVTVEVLRG  435


 Score = 62.4 bits (150),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 34/72 (47%), Positives = 43/72 (60%), Gaps = 4/72 (6%)
 Frame = -3

Query  1630  VTPPTFPSGPLSPSEERIVQLFENNTYSVVNIFDVTLRPRLNVGGAVEIPEGNGSGVVWD  1451
             VTPP      L   E   VQLF+ NT SVV I ++  R         E+P+G+GSG VWD
Sbjct  121   VTPPR----KLQSDELATVQLFQENTPSVVYITNLAARQDAFTLDVFEVPQGSGSGFVWD  176

Query  1450  GEGNIVTNYHVI  1415
              +G++VTNYHVI
Sbjct  177   KDGHVVTNYHVI  188



>ref|XP_008341723.1| PREDICTED: protease Do-like 1, chloroplastic [Malus domestica]
Length=447

 Score =   250 bits (638),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 137/236 (58%), Positives = 168/236 (71%), Gaps = 2/236 (1%)
 Frame = -2

Query  1208  QKNFEGKLVGADRSKDLAVLKVEASEDLLRPTKIGESSSLRVGQKCLAIGNPFGFDHTLT  1029
             Q  ++ K+VG D+ KD+AVL+V+A ++ LRP  IG+S+ L VGQK  AIGNPFG DHTLT
Sbjct  196   QSTYDAKVVGFDQDKDVAVLRVDAPKEKLRPIPIGQSADLLVGQKVFAIGNPFGLDHTLT  255

Query  1028  VGVISGLNRDIYSQ-TGVTISGGIQTDAAINPGNSGGPLLDSKGNLIGINTAIFTQTGTS  852
              GVISGL R+I S  TG  I   IQTDAAINPGNSGGPLLDS G LIGINTAI++ +G S
Sbjct  256   TGVISGLRREISSAATGRPIQDVIQTDAAINPGNSGGPLLDSTGRLIGINTAIYSPSGAS  315

Query  851   AGVGFAIPSSTVLRIVPQLIQSGKVVRAGLNIDIAPDAIANQLNVRNGALVLLVPGNSLA  672
             +GVGF+IP  TV  IV QL++ GKV R  L I  APD    QL V +G LVL  P N  A
Sbjct  316   SGVGFSIPVDTVSGIVDQLVKFGKVTRPILGIKFAPDQSVEQLGV-SGVLVLDAPANGPA  374

Query  671   AKAGILPTTRGFAGNIVLGDIIEAVDNKPVRNKADLYKVLDDYSVGDKVQLKIRRG  504
              KAG+LPT R   G ++LGDII +V+ K V N +DLY++LD   VGDKV +++ RG
Sbjct  375   GKAGLLPTKRDTYGRLILGDIITSVNGKKVSNGSDLYRILDQCXVGDKVIVEVLRG  430


 Score = 62.8 bits (151),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 35/72 (49%), Positives = 43/72 (60%), Gaps = 4/72 (6%)
 Frame = -3

Query  1630  VTPPTFPSGPLSPSEERIVQLFENNTYSVVNIFDVTLRPRLNVGGAVEIPEGNGSGVVWD  1451
             VTPP      L   E   VQLF+ NT SVV I ++  R         E+P+G+GSG VWD
Sbjct  116   VTPPK----KLQSDELATVQLFQENTPSVVYITNLAARQDAFTLDVFEVPQGSGSGFVWD  171

Query  1450  GEGNIVTNYHVI  1415
              +G+IVTNYHVI
Sbjct  172   TDGHIVTNYHVI  183



>ref|XP_009375106.1| PREDICTED: protease Do-like 1, chloroplastic [Pyrus x bretschneideri]
Length=449

 Score =   249 bits (637),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 136/236 (58%), Positives = 168/236 (71%), Gaps = 2/236 (1%)
 Frame = -2

Query  1208  QKNFEGKLVGADRSKDLAVLKVEASEDLLRPTKIGESSSLRVGQKCLAIGNPFGFDHTLT  1029
             Q  ++ K+VG D+ KD+AVL+V+A ++ LRP  IG+S+ L VGQK  AIGNPFG DHTLT
Sbjct  198   QSTYDAKVVGFDQDKDVAVLRVDAPKEKLRPIPIGQSADLLVGQKVFAIGNPFGLDHTLT  257

Query  1028  VGVISGLNRDIYSQ-TGVTISGGIQTDAAINPGNSGGPLLDSKGNLIGINTAIFTQTGTS  852
              GVISGL R+I S  TG  I   IQTDAAINPGNSGGPLLDS G LIGINTAI++ +G S
Sbjct  258   TGVISGLRREISSAATGRPIQDVIQTDAAINPGNSGGPLLDSTGRLIGINTAIYSPSGAS  317

Query  851   AGVGFAIPSSTVLRIVPQLIQSGKVVRAGLNIDIAPDAIANQLNVRNGALVLLVPGNSLA  672
             +GVGF+IP  TV  IV QL++ GKV R  L I  APD    QL V +G LVL  P N  A
Sbjct  318   SGVGFSIPVDTVSGIVDQLVKFGKVTRPILGIKFAPDQSVEQLGV-SGVLVLDAPANGPA  376

Query  671   AKAGILPTTRGFAGNIVLGDIIEAVDNKPVRNKADLYKVLDDYSVGDKVQLKIRRG  504
              KAG+LPT R   G ++LGDII +V+ K + N +DLY++LD   VGDKV +++ RG
Sbjct  377   GKAGLLPTKRDAYGRLILGDIITSVNGKKISNGSDLYRILDQCKVGDKVIVEVLRG  432


 Score = 62.4 bits (150),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 35/72 (49%), Positives = 43/72 (60%), Gaps = 4/72 (6%)
 Frame = -3

Query  1630  VTPPTFPSGPLSPSEERIVQLFENNTYSVVNIFDVTLRPRLNVGGAVEIPEGNGSGVVWD  1451
             VTPP      L   E   VQLF+ NT SVV I ++  R         E+P+G+GSG VWD
Sbjct  118   VTPPR----KLQSDELATVQLFQENTPSVVYITNLAARQDAFTLDVFEVPQGSGSGFVWD  173

Query  1450  GEGNIVTNYHVI  1415
              +G+IVTNYHVI
Sbjct  174   TDGHIVTNYHVI  185



>emb|CAN72708.1| hypothetical protein VITISV_043787 [Vitis vinifera]
Length=300

 Score =   245 bits (625),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 136/250 (54%), Positives = 171/250 (68%), Gaps = 3/250 (1%)
 Frame = -2

Query  1250  PFLTFIFKFFFGRLQKNFEGKLVGADRSKDLAVLKVEASEDLLRPTKIGESSSLRVGQKC  1071
             P    I++      Q  ++ ++VG D+ KD+AVL+V+A ++ LRP  +G S+ L VGQK 
Sbjct  36    PMPLIIYRVTLAD-QTTYDARVVGFDQDKDVAVLRVDAPKEKLRPIPVGVSADLLVGQKV  94

Query  1070  LAIGNPFGFDHTLTVGVISGLNRDIYSQ-TGVTISGGIQTDAAINPGNSGGPLLDSKGNL  894
              AIGNPFG DHTLT GVISGL R+I S  TG  I   IQTDAAINPGNSGGPLLDS G+L
Sbjct  95    YAIGNPFGLDHTLTTGVISGLRREISSAATGRPIQDVIQTDAAINPGNSGGPLLDSSGSL  154

Query  893   IGINTAIFTQTGTSAGVGFAIPSSTVLRIVPQLIQSGKVVRAGLNIDIAPDAIANQLNVR  714
             IGINTAI++ +G S+GVGF+IP  TV  IV QL++ GKV R  L I  APD    QL V 
Sbjct  155   IGINTAIYSPSGASSGVGFSIPVDTVSGIVDQLVRFGKVTRPILGIKFAPDQSVEQLGV-  213

Query  713   NGALVLLVPGNSLAAKAGILPTTRGFAGNIVLGDIIEAVDNKPVRNKADLYKVLDDYSVG  534
             +G LVL  P N  A KAG+LPT R   G ++LGDII +V+ K V N +DLY++LD   VG
Sbjct  214   SGVLVLDAPANGPAGKAGLLPTKRDAYGRLILGDIITSVNGKKVSNGSDLYRILDQCKVG  273

Query  533   DKVQLKIRRG  504
             D V +++ RG
Sbjct  274   DTVTVEVLRG  283



>ref|XP_004304622.1| PREDICTED: protease Do-like 1, chloroplastic-like [Fragaria vesca 
subsp. vesca]
Length=441

 Score =   249 bits (636),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 138/236 (58%), Positives = 168/236 (71%), Gaps = 2/236 (1%)
 Frame = -2

Query  1208  QKNFEGKLVGADRSKDLAVLKVEASEDLLRPTKIGESSSLRVGQKCLAIGNPFGFDHTLT  1029
             Q  F+ K+VG D+ KD+AVL V+A +D LRP  +G S+ L VGQK  AIGNPFG DHTLT
Sbjct  190   QSTFDAKVVGFDQDKDVAVLHVDAPKDKLRPIPVGVSADLLVGQKVFAIGNPFGLDHTLT  249

Query  1028  VGVISGLNRDIYSQ-TGVTISGGIQTDAAINPGNSGGPLLDSKGNLIGINTAIFTQTGTS  852
              GVISGL R+I S  TG  I   IQTDAAINPGNSGGPLLDS G+LIGINTAI++ +G S
Sbjct  250   TGVISGLRREISSAATGRPIQDVIQTDAAINPGNSGGPLLDSSGSLIGINTAIYSPSGAS  309

Query  851   AGVGFAIPSSTVLRIVPQLIQSGKVVRAGLNIDIAPDAIANQLNVRNGALVLLVPGNSLA  672
             +GVGF+IP  TV  IV QL++ GKV R  L I  APD    QL V +G LVL  P N  A
Sbjct  310   SGVGFSIPVDTVNGIVDQLVKFGKVTRPILGIKFAPDQSVEQLGV-SGVLVLDAPANGPA  368

Query  671   AKAGILPTTRGFAGNIVLGDIIEAVDNKPVRNKADLYKVLDDYSVGDKVQLKIRRG  504
              KAG+LPT R   G ++LGDII +V+ K V N +DLY++LD  +VGDKV +++ RG
Sbjct  369   GKAGLLPTKRDSYGRLILGDIITSVNGKKVTNGSDLYRILDQCNVGDKVIVEVLRG  424


 Score = 61.2 bits (147),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 31/66 (47%), Positives = 40/66 (61%), Gaps = 0/66 (0%)
 Frame = -3

Query  1612  PSGPLSPSEERIVQLFENNTYSVVNIFDVTLRPRLNVGGAVEIPEGNGSGVVWDGEGNIV  1433
             P   L   E   V+LF+ NT SVV I ++  +         E+P+G+GSG VWD +GNIV
Sbjct  112   PQKKLQTDELATVRLFQENTPSVVYITNLAAKQDAFTLDVFEVPQGSGSGFVWDKQGNIV  171

Query  1432  TNYHVI  1415
             TNYHVI
Sbjct  172   TNYHVI  177



>ref|XP_006338559.1| PREDICTED: protease Do-like 1, chloroplastic-like [Solanum tuberosum]
Length=430

 Score =   249 bits (635),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 138/236 (58%), Positives = 165/236 (70%), Gaps = 2/236 (1%)
 Frame = -2

Query  1208  QKNFEGKLVGADRSKDLAVLKVEASEDLLRPTKIGESSSLRVGQKCLAIGNPFGFDHTLT  1029
             Q  ++ K+VG D+ KD+AVL ++A +D LRP  IG S+ L VGQK  AIGNPFG DHTLT
Sbjct  179   QTTYDAKVVGFDQDKDVAVLHIDAPKDKLRPIPIGVSADLLVGQKVFAIGNPFGLDHTLT  238

Query  1028  VGVISGLNRDIYSQ-TGVTISGGIQTDAAINPGNSGGPLLDSKGNLIGINTAIFTQTGTS  852
              GVISGL R+I S  TG  I   IQTDAAINPGNSGGPLLDS GNLIGINTAI++ +G S
Sbjct  239   TGVISGLRREINSAATGRPIQDVIQTDAAINPGNSGGPLLDSSGNLIGINTAIYSPSGAS  298

Query  851   AGVGFAIPSSTVLRIVPQLIQSGKVVRAGLNIDIAPDAIANQLNVRNGALVLLVPGNSLA  672
             +GVGF+IP  TV  IV QL+Q GKV R  L I  APD    QL V  G LVL  P N  A
Sbjct  299   SGVGFSIPVDTVSGIVDQLVQFGKVTRPILGIKFAPDQSVEQLGV-TGVLVLDAPPNGPA  357

Query  671   AKAGILPTTRGFAGNIVLGDIIEAVDNKPVRNKADLYKVLDDYSVGDKVQLKIRRG  504
              KAG+LPT R   G ++LGDII +++ K V N  DLY++LD   VGDKV +++ RG
Sbjct  358   GKAGLLPTKRDSYGRLILGDIITSINGKKVSNGTDLYRILDQCKVGDKVIVEVLRG  413


 Score = 60.5 bits (145),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 31/62 (50%), Positives = 39/62 (63%), Gaps = 0/62 (0%)
 Frame = -3

Query  1600  LSPSEERIVQLFENNTYSVVNIFDVTLRPRLNVGGAVEIPEGNGSGVVWDGEGNIVTNYH  1421
             L   E   V+LF+ NT SVV I ++  R  +      E+P+G+GSG VWD  GNIVTNYH
Sbjct  105   LQTDELATVRLFQENTPSVVYITNLASRQDMFTLDVFEVPQGSGSGFVWDKNGNIVTNYH  164

Query  1420  VI  1415
             VI
Sbjct  165   VI  166



>ref|XP_008458761.1| PREDICTED: protease Do-like 1, chloroplastic isoform X1 [Cucumis 
melo]
Length=439

 Score =   248 bits (634),  Expect = 5e-72, Method: Compositional matrix adjust.
 Identities = 137/236 (58%), Positives = 166/236 (70%), Gaps = 2/236 (1%)
 Frame = -2

Query  1208  QKNFEGKLVGADRSKDLAVLKVEASEDLLRPTKIGESSSLRVGQKCLAIGNPFGFDHTLT  1029
             Q  F+ K+VG D+ KD+AVL ++A +D LRP  +G S+ L VGQK  AIGNPFG DHTLT
Sbjct  188   QTTFDAKVVGFDQDKDVAVLSIDAPKDKLRPIPVGISADLLVGQKVFAIGNPFGLDHTLT  247

Query  1028  VGVISGLNRDIYSQ-TGVTISGGIQTDAAINPGNSGGPLLDSKGNLIGINTAIFTQTGTS  852
              GVISGL R+I S  TG  I   IQTDAAINPGNSGGPLLDS GNLIGINTAI++ +G S
Sbjct  248   TGVISGLRREISSAATGRPIQDVIQTDAAINPGNSGGPLLDSSGNLIGINTAIYSPSGAS  307

Query  851   AGVGFAIPSSTVLRIVPQLIQSGKVVRAGLNIDIAPDAIANQLNVRNGALVLLVPGNSLA  672
             +GVGF+IP  TV  IV QL++ GKV R  L I  APD    QL V +G LVL  P N  A
Sbjct  308   SGVGFSIPVDTVSGIVDQLVRFGKVTRPILGIKFAPDQSVEQLGV-SGVLVLDAPANGPA  366

Query  671   AKAGILPTTRGFAGNIVLGDIIEAVDNKPVRNKADLYKVLDDYSVGDKVQLKIRRG  504
              KAG+ PT R   G ++LGDII +V+ K V N +DLY++LD   VGDKV +++ RG
Sbjct  367   GKAGLKPTKRDAYGRLILGDIITSVNGKKVTNGSDLYRILDQCKVGDKVTVEVLRG  422


 Score = 60.5 bits (145),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 34/80 (43%), Positives = 46/80 (58%), Gaps = 5/80 (6%)
 Frame = -3

Query  1654  DPSVTVEQVTPPTFPSGPLSPSEERIVQLFENNTYSVVNIFDVTLRPRLNVGGAVEIPEG  1475
             DP+V     TP       L   E   V+LF+ NT SVV I ++  R        +E+P+G
Sbjct  101   DPAVAFVVTTPRK-----LQTDELATVRLFQENTPSVVYITNLAARQDAFTLDVLEVPQG  155

Query  1474  NGSGVVWDGEGNIVTNYHVI  1415
             +GSG VWD +G++VTNYHVI
Sbjct  156   SGSGFVWDKDGHVVTNYHVI  175



>gb|KHG20811.1| Protease Do-like 1, chloroplastic [Gossypium arboreum]
Length=435

 Score =   248 bits (634),  Expect = 6e-72, Method: Compositional matrix adjust.
 Identities = 138/236 (58%), Positives = 167/236 (71%), Gaps = 2/236 (1%)
 Frame = -2

Query  1208  QKNFEGKLVGADRSKDLAVLKVEASEDLLRPTKIGESSSLRVGQKCLAIGNPFGFDHTLT  1029
             Q  ++ K+VG D+ KD+AVL+V+A +D LRP  IG S+ L VGQK  AIGNPFG DHTLT
Sbjct  184   QTTYDAKVVGFDQDKDVAVLRVDAPKDKLRPIPIGVSADLLVGQKVYAIGNPFGLDHTLT  243

Query  1028  VGVISGLNRDIYSQ-TGVTISGGIQTDAAINPGNSGGPLLDSKGNLIGINTAIFTQTGTS  852
              GVISGL R+I S  TG  I   IQTDAAINPGNSGGPLLDS GNLIGINTAI++ +G +
Sbjct  244   TGVISGLRREISSAATGRPIQDVIQTDAAINPGNSGGPLLDSSGNLIGINTAIYSPSGAN  303

Query  851   AGVGFAIPSSTVLRIVPQLIQSGKVVRAGLNIDIAPDAIANQLNVRNGALVLLVPGNSLA  672
             +GVGF+IP  TV  IV QL++ GKV R  L I  APD    QL V +G LVL  P N  A
Sbjct  304   SGVGFSIPVDTVSGIVDQLVKFGKVTRPILGIKFAPDQSVEQLGV-SGVLVLDAPANGPA  362

Query  671   AKAGILPTTRGFAGNIVLGDIIEAVDNKPVRNKADLYKVLDDYSVGDKVQLKIRRG  504
              KAG+ PT R   G +VLGDII +V+ K V N +DLY++LD   VGDKV +++ RG
Sbjct  363   GKAGLRPTKRDAYGRLVLGDIITSVNGKKVTNGSDLYRILDQCKVGDKVTVEVLRG  418


 Score = 62.0 bits (149),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 37/95 (39%), Positives = 53/95 (56%), Gaps = 5/95 (5%)
 Frame = -3

Query  1696  LCTQF-ITLQAYALGDPSVTVEQVTPPTFPSGPLSPSEERIVQLFENNTYSVVNIFDVTL  1520
             LCT   ++   +     + +   VTPP      L   E   V+LF+ NT SVV I ++ +
Sbjct  81    LCTSLALSFSLFVTDVGAASAFVVTPPR----KLQSDELATVRLFQENTPSVVYITNLAV  136

Query  1519  RPRLNVGGAVEIPEGNGSGVVWDGEGNIVTNYHVI  1415
             R        +E+P+G+GSG VWD +G+IVTNYHVI
Sbjct  137   RQDAFTLDVLEVPQGSGSGFVWDTDGHIVTNYHVI  171



>ref|XP_009614636.1| PREDICTED: protease Do-like 1, chloroplastic [Nicotiana tomentosiformis]
Length=431

 Score =   248 bits (633),  Expect = 6e-72, Method: Compositional matrix adjust.
 Identities = 137/236 (58%), Positives = 167/236 (71%), Gaps = 2/236 (1%)
 Frame = -2

Query  1208  QKNFEGKLVGADRSKDLAVLKVEASEDLLRPTKIGESSSLRVGQKCLAIGNPFGFDHTLT  1029
             Q  ++ K+VG D+ KD+AVLK++A +D +RP  IG S+ L VGQK  AIGNPFG DHTLT
Sbjct  180   QTTYDAKVVGFDQDKDVAVLKIDAPKDKMRPIPIGVSADLLVGQKVFAIGNPFGLDHTLT  239

Query  1028  VGVISGLNRDIYSQ-TGVTISGGIQTDAAINPGNSGGPLLDSKGNLIGINTAIFTQTGTS  852
              GVISGL R+I S  TG  I   IQTDAAINPGNSGGPLLDS GNLIGINTAI++ +G S
Sbjct  240   TGVISGLRREINSAATGRPIQDVIQTDAAINPGNSGGPLLDSSGNLIGINTAIYSPSGAS  299

Query  851   AGVGFAIPSSTVLRIVPQLIQSGKVVRAGLNIDIAPDAIANQLNVRNGALVLLVPGNSLA  672
             +GVGF+IP  TV  IV QL++ GKV R  L I  APD    QL V +G LVL  P N  A
Sbjct  300   SGVGFSIPVDTVSGIVDQLVKFGKVTRPILGIKFAPDQSVEQLGV-SGVLVLDAPPNGPA  358

Query  671   AKAGILPTTRGFAGNIVLGDIIEAVDNKPVRNKADLYKVLDDYSVGDKVQLKIRRG  504
              KAG+LPT R   G +VLGDII +++ K V N  DLY++LD   VG+KV +++ RG
Sbjct  359   GKAGLLPTKRDAYGRLVLGDIITSINGKKVSNGTDLYRILDQCKVGEKVIVEVLRG  414


 Score = 58.9 bits (141),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 30/62 (48%), Positives = 39/62 (63%), Gaps = 0/62 (0%)
 Frame = -3

Query  1600  LSPSEERIVQLFENNTYSVVNIFDVTLRPRLNVGGAVEIPEGNGSGVVWDGEGNIVTNYH  1421
             L   E   V+LF  NT SVV I ++  R  +      E+P+G+GSG VWD +G+IVTNYH
Sbjct  106   LQTDELATVRLFRENTPSVVYITNLASRQDMFTLDVFEVPQGSGSGFVWDKDGHIVTNYH  165

Query  1420  VI  1415
             VI
Sbjct  166   VI  167



>ref|XP_004232295.1| PREDICTED: protease Do-like 1, chloroplastic [Solanum lycopersicum]
Length=430

 Score =   248 bits (632),  Expect = 8e-72, Method: Compositional matrix adjust.
 Identities = 137/236 (58%), Positives = 165/236 (70%), Gaps = 2/236 (1%)
 Frame = -2

Query  1208  QKNFEGKLVGADRSKDLAVLKVEASEDLLRPTKIGESSSLRVGQKCLAIGNPFGFDHTLT  1029
             Q  ++ K+VG D+ KD+AVL ++A +D LRP  IG S+ L VGQK  AIGNPFG DHTLT
Sbjct  179   QTTYDAKVVGFDQDKDVAVLHIDAPKDKLRPIPIGVSADLLVGQKVFAIGNPFGLDHTLT  238

Query  1028  VGVISGLNRDIYSQ-TGVTISGGIQTDAAINPGNSGGPLLDSKGNLIGINTAIFTQTGTS  852
              GVISGL R+I S  TG  I   IQTDAAINPGNSGGPLLDS GNLIGINTAI++ +G S
Sbjct  239   TGVISGLRREINSAATGRPIQDVIQTDAAINPGNSGGPLLDSSGNLIGINTAIYSPSGAS  298

Query  851   AGVGFAIPSSTVLRIVPQLIQSGKVVRAGLNIDIAPDAIANQLNVRNGALVLLVPGNSLA  672
             +GVGF+IP  TV  IV QL+Q GKV R  L I  APD    QL V  G LVL  P N  A
Sbjct  299   SGVGFSIPVDTVSGIVDQLVQFGKVTRPILGIKFAPDQSVEQLGV-TGVLVLDAPPNGPA  357

Query  671   AKAGILPTTRGFAGNIVLGDIIEAVDNKPVRNKADLYKVLDDYSVGDKVQLKIRRG  504
              KAG+LPT R   G ++LGDII +++ K V N  DLY++LD   VG+KV +++ RG
Sbjct  358   GKAGLLPTKRDSYGRLILGDIITSINGKKVSNGTDLYRILDQCKVGEKVIVEVLRG  413


 Score = 60.5 bits (145),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 31/62 (50%), Positives = 39/62 (63%), Gaps = 0/62 (0%)
 Frame = -3

Query  1600  LSPSEERIVQLFENNTYSVVNIFDVTLRPRLNVGGAVEIPEGNGSGVVWDGEGNIVTNYH  1421
             L   E   V+LF+ NT SVV I ++  R  +      E+P+G+GSG VWD  GNIVTNYH
Sbjct  105   LQTDELATVRLFQENTPSVVYITNLASRQDMFTLDVFEVPQGSGSGFVWDKNGNIVTNYH  164

Query  1420  VI  1415
             VI
Sbjct  165   VI  166



>ref|XP_004489277.1| PREDICTED: protease Do-like 1, chloroplastic-like [Cicer arietinum]
Length=429

 Score =   248 bits (632),  Expect = 8e-72, Method: Compositional matrix adjust.
 Identities = 138/236 (58%), Positives = 168/236 (71%), Gaps = 2/236 (1%)
 Frame = -2

Query  1208  QKNFEGKLVGADRSKDLAVLKVEASEDLLRPTKIGESSSLRVGQKCLAIGNPFGFDHTLT  1029
             Q  F+ K+VG D+ KD+AVL+V+A +D LRP  +G S+ L VGQK  AIGNPFG DHTLT
Sbjct  178   QSTFDAKVVGFDQDKDVAVLRVDAPKDKLRPIPVGVSADLLVGQKVYAIGNPFGLDHTLT  237

Query  1028  VGVISGLNRDIYSQ-TGVTISGGIQTDAAINPGNSGGPLLDSKGNLIGINTAIFTQTGTS  852
              GVISGL R+I S  TG  I   IQTDAAINPGNSGGPLLDS GNLIGINTAI++ +G S
Sbjct  238   TGVISGLRREISSAATGRPIQDVIQTDAAINPGNSGGPLLDSSGNLIGINTAIYSPSGAS  297

Query  851   AGVGFAIPSSTVLRIVPQLIQSGKVVRAGLNIDIAPDAIANQLNVRNGALVLLVPGNSLA  672
             +GVGF+IP  TV  IV QL++ GKV R  L I  APD    QL V +G LVL  P N  A
Sbjct  298   SGVGFSIPVDTVNGIVDQLVKFGKVTRPILGIKFAPDQSVEQLGV-SGVLVLDAPANGPA  356

Query  671   AKAGILPTTRGFAGNIVLGDIIEAVDNKPVRNKADLYKVLDDYSVGDKVQLKIRRG  504
              KAG+L T R   G ++LGDII +V+ K V N +DLY++LD  +VGDKV +++ RG
Sbjct  357   GKAGLLSTKRDSYGRLILGDIITSVNGKKVTNGSDLYRILDQCNVGDKVIVEVLRG  412


 Score = 60.1 bits (144),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 30/62 (48%), Positives = 41/62 (66%), Gaps = 0/62 (0%)
 Frame = -3

Query  1600  LSPSEERIVQLFENNTYSVVNIFDVTLRPRLNVGGAVEIPEGNGSGVVWDGEGNIVTNYH  1421
             L   E   V+LF+ NT SVV I ++ ++        +E+P+G+GSG VWD EG+IVTNYH
Sbjct  104   LQSDELATVRLFQENTPSVVYITNLAVKQDAFTLDVLEVPQGSGSGFVWDREGHIVTNYH  163

Query  1420  VI  1415
             VI
Sbjct  164   VI  165



>ref|XP_009769548.1| PREDICTED: protease Do-like 1, chloroplastic [Nicotiana sylvestris]
Length=431

 Score =   248 bits (632),  Expect = 8e-72, Method: Compositional matrix adjust.
 Identities = 136/236 (58%), Positives = 167/236 (71%), Gaps = 2/236 (1%)
 Frame = -2

Query  1208  QKNFEGKLVGADRSKDLAVLKVEASEDLLRPTKIGESSSLRVGQKCLAIGNPFGFDHTLT  1029
             Q  +E K+VG D+ KD+AVL+++A +D +RP  IG S+ L VGQK  AIGNPFG DHTLT
Sbjct  180   QTTYEAKVVGFDQDKDVAVLQIDAPKDKMRPIPIGVSADLLVGQKVFAIGNPFGLDHTLT  239

Query  1028  VGVISGLNRDIYSQ-TGVTISGGIQTDAAINPGNSGGPLLDSKGNLIGINTAIFTQTGTS  852
              GVISGL R+I S  TG  I   IQTDAAINPGNSGGPLLDS GNLIGINTAI++ +G S
Sbjct  240   TGVISGLRREINSAATGRPIQDVIQTDAAINPGNSGGPLLDSSGNLIGINTAIYSPSGAS  299

Query  851   AGVGFAIPSSTVLRIVPQLIQSGKVVRAGLNIDIAPDAIANQLNVRNGALVLLVPGNSLA  672
             +GVGF+IP  TV  IV QL++ GKV R  L I  APD    QL V +G LVL  P N  A
Sbjct  300   SGVGFSIPVDTVSGIVDQLVRFGKVTRPILGIKFAPDQSVEQLGV-SGVLVLDAPPNGPA  358

Query  671   AKAGILPTTRGFAGNIVLGDIIEAVDNKPVRNKADLYKVLDDYSVGDKVQLKIRRG  504
              KAG+LPT R   G ++LGDII +++ K V N  DLY++LD   VG+KV +++ RG
Sbjct  359   GKAGLLPTKRDAYGRLILGDIITSINGKKVSNGTDLYRILDQCKVGEKVIVEVLRG  414


 Score = 59.7 bits (143),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 30/62 (48%), Positives = 40/62 (65%), Gaps = 0/62 (0%)
 Frame = -3

Query  1600  LSPSEERIVQLFENNTYSVVNIFDVTLRPRLNVGGAVEIPEGNGSGVVWDGEGNIVTNYH  1421
             L   E   V+LF+ NT SVV I ++  R  +      E+P+G+GSG VWD +G+IVTNYH
Sbjct  106   LQTDELATVRLFQENTPSVVYITNLASRQDMFTLDVFEVPQGSGSGFVWDKDGHIVTNYH  165

Query  1420  VI  1415
             VI
Sbjct  166   VI  167



>ref|XP_011098475.1| PREDICTED: protease Do-like 1, chloroplastic [Sesamum indicum]
Length=434

 Score =   247 bits (631),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 133/235 (57%), Positives = 166/235 (71%), Gaps = 1/235 (0%)
 Frame = -2

Query  1208  QKNFEGKLVGADRSKDLAVLKVEASEDLLRPTKIGESSSLRVGQKCLAIGNPFGFDHTLT  1029
             +  ++ K+VG D  KD+AVLK++A +D LRP  IG S+ L VGQK  AIGNPFG DHTLT
Sbjct  184   ESTYDAKVVGFDADKDVAVLKIDAPKDKLRPIPIGVSADLLVGQKVYAIGNPFGLDHTLT  243

Query  1028  VGVISGLNRDIYSQTGVTISGGIQTDAAINPGNSGGPLLDSKGNLIGINTAIFTQTGTSA  849
              GVISGL R+I   TG  I   IQTDAAINPGNSGGPLLDS GNLIGINTAI++ +G S+
Sbjct  244   TGVISGLRREISGTTGRPIQDVIQTDAAINPGNSGGPLLDSSGNLIGINTAIYSPSGASS  303

Query  848   GVGFAIPSSTVLRIVPQLIQSGKVVRAGLNIDIAPDAIANQLNVRNGALVLLVPGNSLAA  669
             GVGF+IP  TV  IV QL++ GKV R  L I  APD +  +L V +G LVL  P N  A 
Sbjct  304   GVGFSIPVDTVSGIVDQLVKFGKVTRPILGIKFAPDQMVEKLGV-SGVLVLDAPPNGPAG  362

Query  668   KAGILPTTRGFAGNIVLGDIIEAVDNKPVRNKADLYKVLDDYSVGDKVQLKIRRG  504
             KAG+ P+ R   G ++LGDII +++ K V N +DLY++LD   VGDKV +++ RG
Sbjct  363   KAGLQPSKRDTFGRLILGDIITSINGKKVSNGSDLYRILDQCKVGDKVIIEVLRG  417


 Score = 61.2 bits (147),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 30/62 (48%), Positives = 41/62 (66%), Gaps = 0/62 (0%)
 Frame = -3

Query  1600  LSPSEERIVQLFENNTYSVVNIFDVTLRPRLNVGGAVEIPEGNGSGVVWDGEGNIVTNYH  1421
             L P E   V+LF+ NT SVV + ++  R        +E+P+G+GSG VWD +G+IVTNYH
Sbjct  110   LQPDELATVRLFQENTPSVVYVTNIASRQDALTLDLLEVPQGSGSGFVWDTQGHIVTNYH  169

Query  1420  VI  1415
             VI
Sbjct  170   VI  171



>ref|XP_010029180.1| PREDICTED: protease Do-like 1, chloroplastic [Eucalyptus grandis]
 gb|KCW56028.1| hypothetical protein EUGRSUZ_I01792 [Eucalyptus grandis]
Length=443

 Score =   246 bits (628),  Expect = 6e-71, Method: Compositional matrix adjust.
 Identities = 136/236 (58%), Positives = 166/236 (70%), Gaps = 2/236 (1%)
 Frame = -2

Query  1208  QKNFEGKLVGADRSKDLAVLKVEASEDLLRPTKIGESSSLRVGQKCLAIGNPFGFDHTLT  1029
             Q  ++ ++VG D+ KD+AVL+V+A  D LRP  IG S+ L VGQK  AIGNPFG DHTLT
Sbjct  192   QSTYDARVVGFDQDKDVAVLRVDAPNDKLRPIPIGISADLLVGQKVYAIGNPFGLDHTLT  251

Query  1028  VGVISGLNRDIYSQ-TGVTISGGIQTDAAINPGNSGGPLLDSKGNLIGINTAIFTQTGTS  852
              GVISGL R+I S  TG  I   IQTDAAINPGNSGGPLLDS G+LIGINTAI++ +G S
Sbjct  252   TGVISGLRREISSAATGRPIQDVIQTDAAINPGNSGGPLLDSSGSLIGINTAIYSPSGAS  311

Query  851   AGVGFAIPSSTVLRIVPQLIQSGKVVRAGLNIDIAPDAIANQLNVRNGALVLLVPGNSLA  672
             +GVGF+IP  TV  IV QL++ GKV R  L I  APD    QL V +G LVL  P N  A
Sbjct  312   SGVGFSIPVDTVSGIVDQLVKFGKVTRPILGIKFAPDQSVEQLGV-SGVLVLDAPANGPA  370

Query  671   AKAGILPTTRGFAGNIVLGDIIEAVDNKPVRNKADLYKVLDDYSVGDKVQLKIRRG  504
              KAG+LPT R   G ++LGDII +V+ K V N +DLY++LD   VGD V +++ RG
Sbjct  371   GKAGLLPTKRDSYGRLILGDIITSVNGKKVVNGSDLYRILDQCKVGDTVTVEVLRG  426


 Score = 60.8 bits (146),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 34/82 (41%), Positives = 48/82 (59%), Gaps = 4/82 (5%)
 Frame = -3

Query  1648  SVTVEQVTPPTF----PSGPLSPSEERIVQLFENNTYSVVNIFDVTLRPRLNVGGAVEIP  1481
             S+ V  V P +     P   L   E   V+LF+ NT SVV I ++ ++        +E+P
Sbjct  98    SLLVADVDPASAFVVTPQRKLQTDELATVRLFQENTPSVVYITNLAVKQDAFTLDVLEVP  157

Query  1480  EGNGSGVVWDGEGNIVTNYHVI  1415
             +G+GSG VWD EG++VTNYHVI
Sbjct  158   QGSGSGFVWDNEGHVVTNYHVI  179



>gb|ACZ74706.1| serine-type peptidase [Phaseolus vulgaris]
Length=424

 Score =   245 bits (625),  Expect = 8e-71, Method: Compositional matrix adjust.
 Identities = 137/236 (58%), Positives = 166/236 (70%), Gaps = 2/236 (1%)
 Frame = -2

Query  1208  QKNFEGKLVGADRSKDLAVLKVEASEDLLRPTKIGESSSLRVGQKCLAIGNPFGFDHTLT  1029
             Q  ++ K+VG D+ KD+AVL VEA +D LRP  IG S+ L VGQK  AIGNPFG DHTLT
Sbjct  173   QSTYDAKVVGFDQDKDVAVLHVEAPKDKLRPIPIGVSADLLVGQKVYAIGNPFGLDHTLT  232

Query  1028  VGVISGLNRDIYSQ-TGVTISGGIQTDAAINPGNSGGPLLDSKGNLIGINTAIFTQTGTS  852
              GVISGL R+I S  TG  I   IQTDAAINPGNSGGPLLDS GNLIGINTAI++ +G S
Sbjct  233   TGVISGLRREISSAATGRPIQDVIQTDAAINPGNSGGPLLDSSGNLIGINTAIYSPSGAS  292

Query  851   AGVGFAIPSSTVLRIVPQLIQSGKVVRAGLNIDIAPDAIANQLNVRNGALVLLVPGNSLA  672
             +GVGF+IP  TV  IV QL++ GKV R  L I  APD    QL V +G LVL  P N  A
Sbjct  293   SGVGFSIPVDTVNGIVDQLVKFGKVTRPILGIKFAPDQSVEQLGV-SGVLVLDAPANGPA  351

Query  671   AKAGILPTTRGFAGNIVLGDIIEAVDNKPVRNKADLYKVLDDYSVGDKVQLKIRRG  504
              KAG+  T R   G ++LGDII +V++K V N +DLY++LD   VG+KV +++ RG
Sbjct  352   GKAGLQSTKRDSYGRLILGDIITSVNDKKVTNGSDLYRILDQCKVGEKVIVEVLRG  407


 Score = 62.0 bits (149),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 31/62 (50%), Positives = 41/62 (66%), Gaps = 0/62 (0%)
 Frame = -3

Query  1600  LSPSEERIVQLFENNTYSVVNIFDVTLRPRLNVGGAVEIPEGNGSGVVWDGEGNIVTNYH  1421
             L   E   V+LF+ NT SVV I ++ ++        +E+P+G+GSG VWD EGNIVTNYH
Sbjct  99    LQSDELATVRLFQENTPSVVYITNLAVKQDAFTLDVLEVPQGSGSGFVWDKEGNIVTNYH  158

Query  1420  VI  1415
             VI
Sbjct  159   VI  160



>ref|XP_010243028.1| PREDICTED: protease Do-like 1, chloroplastic isoform X2 [Nelumbo 
nucifera]
Length=446

 Score =   246 bits (627),  Expect = 8e-71, Method: Compositional matrix adjust.
 Identities = 135/236 (57%), Positives = 166/236 (70%), Gaps = 2/236 (1%)
 Frame = -2

Query  1208  QKNFEGKLVGADRSKDLAVLKVEASEDLLRPTKIGESSSLRVGQKCLAIGNPFGFDHTLT  1029
             Q  +E K+VG D+ KD+AVL+++A E+ LRP  +G S+ L VGQK  AIGNPFG DHTLT
Sbjct  195   QSTYEAKVVGFDQDKDVAVLRIDAPEEKLRPIPVGVSADLLVGQKVYAIGNPFGLDHTLT  254

Query  1028  VGVISGLNRDIYSQ-TGVTISGGIQTDAAINPGNSGGPLLDSKGNLIGINTAIFTQTGTS  852
              GVISGL R+I S  TG  I   IQTDAAINPGNSGGPLLDS G+LIGINTAI++ +G S
Sbjct  255   TGVISGLRREISSAATGRPIQDVIQTDAAINPGNSGGPLLDSSGSLIGINTAIYSPSGAS  314

Query  851   AGVGFAIPSSTVLRIVPQLIQSGKVVRAGLNIDIAPDAIANQLNVRNGALVLLVPGNSLA  672
             +GVGF+IP  TV  IV QL++ GKV R  L I  APD    QL V +G LVL  P N  A
Sbjct  315   SGVGFSIPVDTVSGIVDQLVKYGKVTRPILGIKFAPDQSVEQLGV-SGVLVLDAPPNGPA  373

Query  671   AKAGILPTTRGFAGNIVLGDIIEAVDNKPVRNKADLYKVLDDYSVGDKVQLKIRRG  504
              KAG+ PT R   G ++LGDII +V+ K V N  DLY++LD   VGD+V +++ RG
Sbjct  374   GKAGLQPTKRDTYGRLILGDIITSVNGKKVTNGTDLYRILDQCKVGDQVIVEVLRG  429


 Score = 60.5 bits (145),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 40/105 (38%), Positives = 56/105 (53%), Gaps = 11/105 (10%)
 Frame = -3

Query  1600  LSPSEERIVQLFENNTYSVVNIFDVTLRPRLNVGGAVEIPEGNGSGVVWDGEGNIVTNYH  1421
             L   E   V+LF+ NT SVV I ++  R        +E+P+G+GSG VWD +G+IVTNYH
Sbjct  122   LQTDELATVRLFQENTPSVVYITNLAARQDAFTLDVLEVPQGSGSGFVWDKDGHIVTNYH  181

Query  1420  VIGNS------LSRNPTRGEVV-----ARVNILAPDG*EERLLTI  1319
             VI  +       S++    +VV       V +L  D  EE+L  I
Sbjct  182   VIRGASDLRLVFSQSTYEAKVVGFDQDKDVAVLRIDAPEEKLRPI  226



>ref|XP_010243027.1| PREDICTED: protease Do-like 1, chloroplastic isoform X1 [Nelumbo 
nucifera]
Length=447

 Score =   246 bits (627),  Expect = 9e-71, Method: Compositional matrix adjust.
 Identities = 135/236 (57%), Positives = 166/236 (70%), Gaps = 2/236 (1%)
 Frame = -2

Query  1208  QKNFEGKLVGADRSKDLAVLKVEASEDLLRPTKIGESSSLRVGQKCLAIGNPFGFDHTLT  1029
             Q  +E K+VG D+ KD+AVL+++A E+ LRP  +G S+ L VGQK  AIGNPFG DHTLT
Sbjct  196   QSTYEAKVVGFDQDKDVAVLRIDAPEEKLRPIPVGVSADLLVGQKVYAIGNPFGLDHTLT  255

Query  1028  VGVISGLNRDIYSQ-TGVTISGGIQTDAAINPGNSGGPLLDSKGNLIGINTAIFTQTGTS  852
              GVISGL R+I S  TG  I   IQTDAAINPGNSGGPLLDS G+LIGINTAI++ +G S
Sbjct  256   TGVISGLRREISSAATGRPIQDVIQTDAAINPGNSGGPLLDSSGSLIGINTAIYSPSGAS  315

Query  851   AGVGFAIPSSTVLRIVPQLIQSGKVVRAGLNIDIAPDAIANQLNVRNGALVLLVPGNSLA  672
             +GVGF+IP  TV  IV QL++ GKV R  L I  APD    QL V +G LVL  P N  A
Sbjct  316   SGVGFSIPVDTVSGIVDQLVKYGKVTRPILGIKFAPDQSVEQLGV-SGVLVLDAPPNGPA  374

Query  671   AKAGILPTTRGFAGNIVLGDIIEAVDNKPVRNKADLYKVLDDYSVGDKVQLKIRRG  504
              KAG+ PT R   G ++LGDII +V+ K V N  DLY++LD   VGD+V +++ RG
Sbjct  375   GKAGLQPTKRDTYGRLILGDIITSVNGKKVTNGTDLYRILDQCKVGDQVIVEVLRG  430


 Score = 60.1 bits (144),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 30/62 (48%), Positives = 40/62 (65%), Gaps = 0/62 (0%)
 Frame = -3

Query  1600  LSPSEERIVQLFENNTYSVVNIFDVTLRPRLNVGGAVEIPEGNGSGVVWDGEGNIVTNYH  1421
             L   E   V+LF+ NT SVV I ++  R        +E+P+G+GSG VWD +G+IVTNYH
Sbjct  122   LQTDELATVRLFQENTPSVVYITNLAARQDAFTLDVLEVPQGSGSGFVWDKDGHIVTNYH  181

Query  1420  VI  1415
             VI
Sbjct  182   VI  183



>emb|CBI18180.3| unnamed protein product [Vitis vinifera]
Length=428

 Score =   245 bits (625),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 134/236 (57%), Positives = 167/236 (71%), Gaps = 2/236 (1%)
 Frame = -2

Query  1208  QKNFEGKLVGADRSKDLAVLKVEASEDLLRPTKIGESSSLRVGQKCLAIGNPFGFDHTLT  1029
             Q  ++ ++VG D+ KD+AVL+V+A ++ LRP  +G S+ L VGQK  AIGNPFG DHTLT
Sbjct  177   QTTYDARVVGFDQDKDVAVLRVDAPKEKLRPIPVGVSADLLVGQKVYAIGNPFGLDHTLT  236

Query  1028  VGVISGLNRDIYSQ-TGVTISGGIQTDAAINPGNSGGPLLDSKGNLIGINTAIFTQTGTS  852
              GVISGL R+I S  TG  I   IQTDAAINPGNSGGPLLDS G+LIGINTAI++ +G S
Sbjct  237   TGVISGLRREISSAATGRPIQDVIQTDAAINPGNSGGPLLDSSGSLIGINTAIYSPSGAS  296

Query  851   AGVGFAIPSSTVLRIVPQLIQSGKVVRAGLNIDIAPDAIANQLNVRNGALVLLVPGNSLA  672
             +GVGF+IP  TV  IV QL++ GKV R  L I  APD    QL V +G LVL  P N  A
Sbjct  297   SGVGFSIPVDTVSGIVDQLVRFGKVTRPILGIKFAPDQSVEQLGV-SGVLVLDAPANGPA  355

Query  671   AKAGILPTTRGFAGNIVLGDIIEAVDNKPVRNKADLYKVLDDYSVGDKVQLKIRRG  504
              KAG+LPT R   G ++LGDII +V+ K V N +DLY++LD   VGD V +++ RG
Sbjct  356   GKAGLLPTKRDAYGRLILGDIITSVNGKKVSNGSDLYRILDQCKVGDTVTVEVLRG  411


 Score = 59.3 bits (142),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 37/95 (39%), Positives = 51/95 (54%), Gaps = 5/95 (5%)
 Frame = -3

Query  1696  LCTQF-ITLQAYALGDPSVTVEQVTPPTFPSGPLSPSEERIVQLFENNTYSVVNIFDVTL  1520
             LCT   ++   +     S +   VT P      L   E   V+LF+ NT SVV I ++  
Sbjct  74    LCTSVALSFSLFVADVDSASAFVVTAPR----KLQNDELATVRLFQENTPSVVYITNLAA  129

Query  1519  RPRLNVGGAVEIPEGNGSGVVWDGEGNIVTNYHVI  1415
             R        +E+P+G+GSG VWD +G+IVTNYHVI
Sbjct  130   RQDAFTLDVLEVPQGSGSGFVWDKDGHIVTNYHVI  164



>ref|XP_007151040.1| hypothetical protein PHAVU_004G013600g [Phaseolus vulgaris]
 gb|ESW23034.1| hypothetical protein PHAVU_004G013600g [Phaseolus vulgaris]
Length=424

 Score =   245 bits (625),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 137/236 (58%), Positives = 166/236 (70%), Gaps = 2/236 (1%)
 Frame = -2

Query  1208  QKNFEGKLVGADRSKDLAVLKVEASEDLLRPTKIGESSSLRVGQKCLAIGNPFGFDHTLT  1029
             Q  ++ K+VG D+ KD+AVL VEA +D LRP  IG S+ L VGQK  AIGNPFG DHTLT
Sbjct  173   QSTYDAKVVGFDQDKDVAVLHVEAPKDKLRPIPIGVSADLLVGQKVYAIGNPFGLDHTLT  232

Query  1028  VGVISGLNRDIYSQ-TGVTISGGIQTDAAINPGNSGGPLLDSKGNLIGINTAIFTQTGTS  852
              GVISGL R+I S  TG  I   IQTDAAINPGNSGGPLLDS GNLIGINTAI++ +G S
Sbjct  233   TGVISGLRREISSAATGRPIQDVIQTDAAINPGNSGGPLLDSSGNLIGINTAIYSPSGAS  292

Query  851   AGVGFAIPSSTVLRIVPQLIQSGKVVRAGLNIDIAPDAIANQLNVRNGALVLLVPGNSLA  672
             +GVGF+IP  TV  IV QL++ GKV R  L I  APD    QL V +G LVL  P N  A
Sbjct  293   SGVGFSIPVDTVNGIVDQLVKFGKVTRPILGIKFAPDQSVEQLGV-SGVLVLDAPANGPA  351

Query  671   AKAGILPTTRGFAGNIVLGDIIEAVDNKPVRNKADLYKVLDDYSVGDKVQLKIRRG  504
              KAG+  T R   G ++LGDII +V++K V N +DLY++LD   VG+KV +++ RG
Sbjct  352   GKAGLQSTKRDSYGRLILGDIITSVNDKKVTNGSDLYRILDQCKVGEKVIVEVLRG  407


 Score = 62.0 bits (149),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 31/62 (50%), Positives = 41/62 (66%), Gaps = 0/62 (0%)
 Frame = -3

Query  1600  LSPSEERIVQLFENNTYSVVNIFDVTLRPRLNVGGAVEIPEGNGSGVVWDGEGNIVTNYH  1421
             L   E   V+LF+ NT SVV I ++ ++        +E+P+G+GSG VWD EGNIVTNYH
Sbjct  99    LQSDELATVRLFQENTPSVVYITNLAVKQDAFTLDVLEVPQGSGSGFVWDKEGNIVTNYH  158

Query  1420  VI  1415
             VI
Sbjct  159   VI  160



>ref|XP_002267510.3| PREDICTED: protease Do-like 1, chloroplastic [Vitis vinifera]
Length=452

 Score =   245 bits (626),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 134/236 (57%), Positives = 167/236 (71%), Gaps = 2/236 (1%)
 Frame = -2

Query  1208  QKNFEGKLVGADRSKDLAVLKVEASEDLLRPTKIGESSSLRVGQKCLAIGNPFGFDHTLT  1029
             Q  ++ ++VG D+ KD+AVL+V+A ++ LRP  +G S+ L VGQK  AIGNPFG DHTLT
Sbjct  201   QTTYDARVVGFDQDKDVAVLRVDAPKEKLRPIPVGVSADLLVGQKVYAIGNPFGLDHTLT  260

Query  1028  VGVISGLNRDIYSQ-TGVTISGGIQTDAAINPGNSGGPLLDSKGNLIGINTAIFTQTGTS  852
              GVISGL R+I S  TG  I   IQTDAAINPGNSGGPLLDS G+LIGINTAI++ +G S
Sbjct  261   TGVISGLRREISSAATGRPIQDVIQTDAAINPGNSGGPLLDSSGSLIGINTAIYSPSGAS  320

Query  851   AGVGFAIPSSTVLRIVPQLIQSGKVVRAGLNIDIAPDAIANQLNVRNGALVLLVPGNSLA  672
             +GVGF+IP  TV  IV QL++ GKV R  L I  APD    QL V +G LVL  P N  A
Sbjct  321   SGVGFSIPVDTVSGIVDQLVRFGKVTRPILGIKFAPDQSVEQLGV-SGVLVLDAPANGPA  379

Query  671   AKAGILPTTRGFAGNIVLGDIIEAVDNKPVRNKADLYKVLDDYSVGDKVQLKIRRG  504
              KAG+LPT R   G ++LGDII +V+ K V N +DLY++LD   VGD V +++ RG
Sbjct  380   GKAGLLPTKRDAYGRLILGDIITSVNGKKVSNGSDLYRILDQCKVGDTVTVEVLRG  435


 Score = 59.7 bits (143),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 37/95 (39%), Positives = 51/95 (54%), Gaps = 5/95 (5%)
 Frame = -3

Query  1696  LCTQF-ITLQAYALGDPSVTVEQVTPPTFPSGPLSPSEERIVQLFENNTYSVVNIFDVTL  1520
             LCT   ++   +     S +   VT P      L   E   V+LF+ NT SVV I ++  
Sbjct  98    LCTSVALSFSLFVADVDSASAFVVTAPR----KLQNDELATVRLFQENTPSVVYITNLAA  153

Query  1519  RPRLNVGGAVEIPEGNGSGVVWDGEGNIVTNYHVI  1415
             R        +E+P+G+GSG VWD +G+IVTNYHVI
Sbjct  154   RQDAFTLDVLEVPQGSGSGFVWDKDGHIVTNYHVI  188



>ref|XP_008357876.1| PREDICTED: protease Do-like 1, chloroplastic [Malus domestica]
Length=470

 Score =   246 bits (627),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 136/236 (58%), Positives = 166/236 (70%), Gaps = 2/236 (1%)
 Frame = -2

Query  1208  QKNFEGKLVGADRSKDLAVLKVEASEDLLRPTKIGESSSLRVGQKCLAIGNPFGFDHTLT  1029
             Q  F  K+VG D+ KD+AVL V+A ++ LRP  IG+S+ L VGQK  AIGNPFG DHTLT
Sbjct  219   QSTFNAKVVGFDQDKDVAVLHVDAPKEKLRPIPIGQSADLLVGQKVFAIGNPFGLDHTLT  278

Query  1028  VGVISGLNRDIYSQ-TGVTISGGIQTDAAINPGNSGGPLLDSKGNLIGINTAIFTQTGTS  852
              GVISGL R+I S  TG  I   IQTDAAINPGNSGGPLLDS G+LIGINTAI++  G S
Sbjct  279   TGVISGLRREISSAATGRPIQDVIQTDAAINPGNSGGPLLDSTGSLIGINTAIYSPNGAS  338

Query  851   AGVGFAIPSSTVLRIVPQLIQSGKVVRAGLNIDIAPDAIANQLNVRNGALVLLVPGNSLA  672
             +GVGF+IP  TV  IV QL++ GKV R  L I  APD    QL + +G LVL  P N  A
Sbjct  339   SGVGFSIPVDTVNGIVDQLVKFGKVTRPILGIKFAPDQSVEQLGL-SGVLVLDAPANGPA  397

Query  671   AKAGILPTTRGFAGNIVLGDIIEAVDNKPVRNKADLYKVLDDYSVGDKVQLKIRRG  504
              KAG++PT R   G ++LGDII +V+ K V N +DLY++LD   VGDKV +++ RG
Sbjct  398   GKAGLVPTKRDAYGRLILGDIITSVNGKKVSNGSDLYRILDQCKVGDKVFVEVLRG  453


 Score = 62.4 bits (150),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 37/84 (44%), Positives = 45/84 (54%), Gaps = 4/84 (5%)
 Frame = -3

Query  1630  VTPPTFPSGPLSPSEERIVQLFENNTYSVVNIFDVTLRPRLNVGGAVEIPEGNGSGVVWD  1451
             VTPP      L   E   VQLF  NT SVV I ++  R         E+P+G+GSG VWD
Sbjct  139   VTPPR----KLQSDELATVQLFRENTPSVVYITNLAARQDAFTLDVFEVPQGSGSGFVWD  194

Query  1450  GEGNIVTNYHVIGNSLSRNPTRGE  1379
               GN+VTNYHVI  +     T G+
Sbjct  195   KNGNVVTNYHVIRGASDLRVTLGD  218



>ref|XP_010528252.1| PREDICTED: protease Do-like 1, chloroplastic isoform X1 [Tarenaya 
hassleriana]
Length=485

 Score =   246 bits (628),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 136/236 (58%), Positives = 167/236 (71%), Gaps = 2/236 (1%)
 Frame = -2

Query  1208  QKNFEGKLVGADRSKDLAVLKVEASEDLLRPTKIGESSSLRVGQKCLAIGNPFGFDHTLT  1029
             Q  ++ K+VG D+ KD+AVL+++A +D LRP  +G S+ L VGQK  AIGNPFG DHTLT
Sbjct  234   QSTYDAKVVGFDQDKDVAVLRIDAPKDKLRPIPVGISADLLVGQKVFAIGNPFGLDHTLT  293

Query  1028  VGVISGLNRDIYSQ-TGVTISGGIQTDAAINPGNSGGPLLDSKGNLIGINTAIFTQTGTS  852
              GVISGL R+I S  TG  I   IQTDAAINPGNSGGPLLDS GNLIGINTAI++ +G S
Sbjct  294   TGVISGLRREISSAATGRPIQDVIQTDAAINPGNSGGPLLDSSGNLIGINTAIYSPSGAS  353

Query  851   AGVGFAIPSSTVLRIVPQLIQSGKVVRAGLNIDIAPDAIANQLNVRNGALVLLVPGNSLA  672
             +GVGF+IP  TV  IV QL++ GKV R  L I  APD    QL V +G LVL  P N  A
Sbjct  354   SGVGFSIPVDTVGGIVDQLVKFGKVTRPILGIKFAPDQSVEQLGV-SGVLVLDAPPNGPA  412

Query  671   AKAGILPTTRGFAGNIVLGDIIEAVDNKPVRNKADLYKVLDDYSVGDKVQLKIRRG  504
              KAG+ PT R   G ++LGDII +V+ K V N +DLY++LD   VGDKV +++ RG
Sbjct  413   GKAGLQPTKRDSYGRLILGDIITSVNGKKVSNGSDLYRILDQCQVGDKVIVEVLRG  468


 Score = 63.2 bits (152),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 40/94 (43%), Positives = 51/94 (54%), Gaps = 5/94 (5%)
 Frame = -3

Query  1696  LCTQFITLQAYALGDPSVTVEQVTPPTFPSGPLSPSEERIVQLFENNTYSVVNIFDVTLR  1517
             LCT  + L    L  P      VT P      L   E   V+LF+ NT SVV I ++ +R
Sbjct  133   LCTS-VALSFSLLSAPPADAFVVTTPR----KLQSDELATVRLFQENTPSVVYITNLAVR  187

Query  1516  PRLNVGGAVEIPEGNGSGVVWDGEGNIVTNYHVI  1415
                     +E+P+G+GSG VWD EG+IVTNYHVI
Sbjct  188   QDAFTLDVLEVPQGSGSGFVWDKEGHIVTNYHVI  221



>ref|XP_002300036.2| hypothetical protein POPTR_0001s34960g [Populus trichocarpa]
 gb|ABK96055.1| unknown [Populus trichocarpa]
 gb|EEE84841.2| hypothetical protein POPTR_0001s34960g [Populus trichocarpa]
Length=429

 Score =   244 bits (623),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 134/236 (57%), Positives = 167/236 (71%), Gaps = 2/236 (1%)
 Frame = -2

Query  1208  QKNFEGKLVGADRSKDLAVLKVEASEDLLRPTKIGESSSLRVGQKCLAIGNPFGFDHTLT  1029
             Q  ++ K+VG D+ KD+AVL+V+A +D LRP  +G S+ L VGQK  AIGNPFG DHTLT
Sbjct  178   QSTYDAKVVGFDQDKDVAVLRVDAPKDKLRPIPVGVSADLLVGQKVFAIGNPFGLDHTLT  237

Query  1028  VGVISGLNRDIYSQ-TGVTISGGIQTDAAINPGNSGGPLLDSKGNLIGINTAIFTQTGTS  852
              GVISGL R+I S  TG  I   IQTDAAINPGNSGGPLLDS G+LIGINTAI++ +G S
Sbjct  238   TGVISGLRREISSAATGRPIQDVIQTDAAINPGNSGGPLLDSSGSLIGINTAIYSPSGAS  297

Query  851   AGVGFAIPSSTVLRIVPQLIQSGKVVRAGLNIDIAPDAIANQLNVRNGALVLLVPGNSLA  672
             +GVGF+IP  TV  IV QL++ GKV R  L I  APD    QL V +G LVL  P N  A
Sbjct  298   SGVGFSIPVDTVSGIVDQLVRFGKVTRPILGIKFAPDQSVEQLGV-SGVLVLDAPTNGPA  356

Query  671   AKAGILPTTRGFAGNIVLGDIIEAVDNKPVRNKADLYKVLDDYSVGDKVQLKIRRG  504
              KAG+ PT R   G ++LGDII +V+ K V N +DLY++LD   VG++V +++ RG
Sbjct  357   GKAGLQPTKRDAYGRLILGDIITSVNGKKVTNGSDLYRILDQCKVGEQVTVEVLRG  412


 Score = 60.5 bits (145),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 34/94 (36%), Positives = 50/94 (53%), Gaps = 0/94 (0%)
 Frame = -3

Query  1696  LCTQFITLQAYALGDPSVTVEQVTPPTFPSGPLSPSEERIVQLFENNTYSVVNIFDVTLR  1517
             +CT      +  +GD   +       T     L   E   V+LF+ NT SVV I ++ +R
Sbjct  72    VCTSVALSFSLLIGDVDSSALAFVITTTTPRKLQSDELATVRLFQENTPSVVYITNLAVR  131

Query  1516  PRLNVGGAVEIPEGNGSGVVWDGEGNIVTNYHVI  1415
                     +E+P+G+GSG VWD +G++VTNYHVI
Sbjct  132   QDAFTLDVLEVPQGSGSGFVWDNDGHVVTNYHVI  165



>ref|XP_009402518.1| PREDICTED: protease Do-like 1, chloroplastic [Musa acuminata 
subsp. malaccensis]
Length=445

 Score =   244 bits (624),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 134/236 (57%), Positives = 166/236 (70%), Gaps = 2/236 (1%)
 Frame = -2

Query  1208  QKNFEGKLVGADRSKDLAVLKVEASEDLLRPTKIGESSSLRVGQKCLAIGNPFGFDHTLT  1029
             Q  +E ++VG D+ KD+AVL+++A ++ LRP  +G SS L VGQK  AIGNPFG DHTLT
Sbjct  194   QTTYEARVVGFDQDKDVAVLRIDAPKEKLRPIPVGISSDLLVGQKVYAIGNPFGLDHTLT  253

Query  1028  VGVISGLNRDIYSQ-TGVTISGGIQTDAAINPGNSGGPLLDSKGNLIGINTAIFTQTGTS  852
              GVISGL R+I S  TG  I   IQTDAAINPGNSGGPLLDS GNLIGINTAI++ +G S
Sbjct  254   TGVISGLRREISSAATGRPIQDVIQTDAAINPGNSGGPLLDSSGNLIGINTAIYSPSGAS  313

Query  851   AGVGFAIPSSTVLRIVPQLIQSGKVVRAGLNIDIAPDAIANQLNVRNGALVLLVPGNSLA  672
             +GVGF+IP  TV  IV Q+++ GKV R  L I  APD    QL V +G LVL  P N  A
Sbjct  314   SGVGFSIPVDTVNGIVDQIVKFGKVTRPILGIKFAPDQSVEQLGV-SGVLVLDAPANGPA  372

Query  671   AKAGILPTTRGFAGNIVLGDIIEAVDNKPVRNKADLYKVLDDYSVGDKVQLKIRRG  504
              KAG+ PT R   G ++LGDII +V+ K V N +DLY++LD   VGD V +++ RG
Sbjct  373   GKAGLQPTKRDAYGRLILGDIITSVNGKKVTNGSDLYRILDQCKVGDTVTVEVLRG  428


 Score = 59.7 bits (143),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 30/62 (48%), Positives = 40/62 (65%), Gaps = 0/62 (0%)
 Frame = -3

Query  1600  LSPSEERIVQLFENNTYSVVNIFDVTLRPRLNVGGAVEIPEGNGSGVVWDGEGNIVTNYH  1421
             L   E   V+LF+ NT SVV I ++  R        +E+P+G+GSG VWD +G+IVTNYH
Sbjct  120   LQSDELATVRLFQENTPSVVYITNLAARQDAFTLDVLEVPQGSGSGFVWDKDGHIVTNYH  179

Query  1420  VI  1415
             VI
Sbjct  180   VI  181



>gb|KDP45341.1| hypothetical protein JCGZ_09590 [Jatropha curcas]
Length=448

 Score =   244 bits (624),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 136/236 (58%), Positives = 166/236 (70%), Gaps = 2/236 (1%)
 Frame = -2

Query  1208  QKNFEGKLVGADRSKDLAVLKVEASEDLLRPTKIGESSSLRVGQKCLAIGNPFGFDHTLT  1029
             Q  ++ K+VG D+ KD+AVL+V+A  D LRP  +G S+ L VGQK  AIGNPFG DHTLT
Sbjct  197   QSTYDAKIVGFDQDKDVAVLRVDAPVDKLRPIPVGVSADLLVGQKVYAIGNPFGLDHTLT  256

Query  1028  VGVISGLNRDIYSQ-TGVTISGGIQTDAAINPGNSGGPLLDSKGNLIGINTAIFTQTGTS  852
              GVISGL R+I S  TG  I   IQTDAAINPGNSGGPLLDS G+LIGINTAI++ +G S
Sbjct  257   TGVISGLRREISSAATGRPIQDVIQTDAAINPGNSGGPLLDSSGSLIGINTAIYSPSGAS  316

Query  851   AGVGFAIPSSTVLRIVPQLIQSGKVVRAGLNIDIAPDAIANQLNVRNGALVLLVPGNSLA  672
             +GVGF+IP  TV  IV QL++ GKV R  L I  APD    QL V +G LVL  P N  A
Sbjct  317   SGVGFSIPVDTVSGIVDQLVKYGKVTRPILGIKFAPDQSVEQLGV-SGVLVLDAPANGPA  375

Query  671   AKAGILPTTRGFAGNIVLGDIIEAVDNKPVRNKADLYKVLDDYSVGDKVQLKIRRG  504
              KAG+ PT R   G +VLGDII +V+ K V N +DLY++LD   VG+KV +++ RG
Sbjct  376   GKAGLQPTKRDAYGRLVLGDIITSVNGKKVTNGSDLYRILDQCKVGEKVIVEVLRG  431


 Score = 60.8 bits (146),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 37/96 (39%), Positives = 53/96 (55%), Gaps = 7/96 (7%)
 Frame = -3

Query  1696  LCTQFITLQA--YALGDPSVTVEQVTPPTFPSGPLSPSEERIVQLFENNTYSVVNIFDVT  1523
             LCT      +  +A  DP+      TP    S  L+      V+LF+ NT SVV I ++ 
Sbjct  94    LCTSLALSVSLFFADVDPAAAFVLTTPRKLQSDELA-----TVRLFQENTPSVVYITNLA  148

Query  1522  LRPRLNVGGAVEIPEGNGSGVVWDGEGNIVTNYHVI  1415
             ++        +E+P+G+GSG VWD +G+IVTNYHVI
Sbjct  149   VKQDAFTLDVLEVPQGSGSGFVWDKDGHIVTNYHVI  184



>ref|XP_011047314.1| PREDICTED: protease Do-like 1, chloroplastic [Populus euphratica]
Length=429

 Score =   244 bits (622),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 134/236 (57%), Positives = 166/236 (70%), Gaps = 2/236 (1%)
 Frame = -2

Query  1208  QKNFEGKLVGADRSKDLAVLKVEASEDLLRPTKIGESSSLRVGQKCLAIGNPFGFDHTLT  1029
             Q  ++ K+VG D+ KD+AVL+V+A  D LRP  +G S+ L VGQK  AIGNPFG DHTLT
Sbjct  178   QSTYDAKVVGFDQDKDVAVLRVDAPRDKLRPIPVGVSADLLVGQKVFAIGNPFGLDHTLT  237

Query  1028  VGVISGLNRDIYSQ-TGVTISGGIQTDAAINPGNSGGPLLDSKGNLIGINTAIFTQTGTS  852
              GVISGL R+I S  TG  I   IQTDAAINPGNSGGPLLDS G+LIGINTAI++ +G S
Sbjct  238   TGVISGLRREISSAATGRPIQDVIQTDAAINPGNSGGPLLDSSGSLIGINTAIYSPSGAS  297

Query  851   AGVGFAIPSSTVLRIVPQLIQSGKVVRAGLNIDIAPDAIANQLNVRNGALVLLVPGNSLA  672
             +GVGF+IP  TV  IV QL++ GKV R  L I  APD    QL V +G LVL  P N  A
Sbjct  298   SGVGFSIPVDTVSGIVDQLVRFGKVTRPILGIKFAPDQSVEQLGV-SGVLVLDAPTNGPA  356

Query  671   AKAGILPTTRGFAGNIVLGDIIEAVDNKPVRNKADLYKVLDDYSVGDKVQLKIRRG  504
              KAG+ PT R   G ++LGDII +V+ K V N +DLY++LD   VG++V +++ RG
Sbjct  357   GKAGLQPTKRDAYGRLILGDIITSVNGKKVTNGSDLYRILDQCKVGEQVTVEVLRG  412


 Score = 60.1 bits (144),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 29/62 (47%), Positives = 41/62 (66%), Gaps = 0/62 (0%)
 Frame = -3

Query  1600  LSPSEERIVQLFENNTYSVVNIFDVTLRPRLNVGGAVEIPEGNGSGVVWDGEGNIVTNYH  1421
             L   E   V+LF+ NT SVV I ++ +R        +E+P+G+GSG VWD +G++VTNYH
Sbjct  104   LQSDELATVRLFQENTPSVVYITNLAVRQDAFTLDVLEVPQGSGSGFVWDKDGHVVTNYH  163

Query  1420  VI  1415
             VI
Sbjct  164   VI  165



>ref|XP_007031474.1| DegP protease 1 isoform 2 [Theobroma cacao]
 gb|EOY02400.1| DegP protease 1 isoform 2 [Theobroma cacao]
Length=431

 Score =   244 bits (622),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 135/236 (57%), Positives = 167/236 (71%), Gaps = 2/236 (1%)
 Frame = -2

Query  1208  QKNFEGKLVGADRSKDLAVLKVEASEDLLRPTKIGESSSLRVGQKCLAIGNPFGFDHTLT  1029
             Q  ++ K+VG D+ KD+AVL+V+A +D LRP  IG S+ L VGQK  AIGNPFG DHTLT
Sbjct  180   QSTYDAKVVGFDQDKDVAVLRVDAPKDKLRPIPIGISADLLVGQKVYAIGNPFGLDHTLT  239

Query  1028  VGVISGLNRDIYSQ-TGVTISGGIQTDAAINPGNSGGPLLDSKGNLIGINTAIFTQTGTS  852
              GVISGL R+I S  TG  I   IQTDAAINPGNSGGPLLDS GNLIGINTAI++ +G S
Sbjct  240   TGVISGLRREISSAATGRPIQDVIQTDAAINPGNSGGPLLDSSGNLIGINTAIYSPSGAS  299

Query  851   AGVGFAIPSSTVLRIVPQLIQSGKVVRAGLNIDIAPDAIANQLNVRNGALVLLVPGNSLA  672
             +GVGF+IP  TV  IV QL++ GKV R  L I  APD    QL V +G LVL  P N  A
Sbjct  300   SGVGFSIPVDTVGGIVDQLVKFGKVTRPVLGIKFAPDQSVEQLGV-SGVLVLDAPANGPA  358

Query  671   AKAGILPTTRGFAGNIVLGDIIEAVDNKPVRNKADLYKVLDDYSVGDKVQLKIRRG  504
              KAG+ PT R   G ++LGDII +V+ K V + +DLY++LD   VG++V +++ RG
Sbjct  359   GKAGLQPTKRDSYGRLILGDIITSVNGKKVTSGSDLYRILDQCKVGEQVTVEVLRG  414



>ref|XP_011010443.1| PREDICTED: protease Do-like 1, chloroplastic [Populus euphratica]
Length=430

 Score =   243 bits (621),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 134/236 (57%), Positives = 166/236 (70%), Gaps = 2/236 (1%)
 Frame = -2

Query  1208  QKNFEGKLVGADRSKDLAVLKVEASEDLLRPTKIGESSSLRVGQKCLAIGNPFGFDHTLT  1029
             Q  ++ K+VG D+ KD+AVL+V+A  D LRP  +G S+ L VGQK  AIGNPFG DHTLT
Sbjct  179   QSTYDAKVVGFDQDKDVAVLRVDAPRDKLRPIPVGVSADLLVGQKVFAIGNPFGLDHTLT  238

Query  1028  VGVISGLNRDIYSQ-TGVTISGGIQTDAAINPGNSGGPLLDSKGNLIGINTAIFTQTGTS  852
              GVISGL R+I S  TG  I   IQTDAAINPGNSGGPLLDS G+LIGINTAI++ +G S
Sbjct  239   TGVISGLRREISSAATGRPIQDVIQTDAAINPGNSGGPLLDSSGSLIGINTAIYSPSGAS  298

Query  851   AGVGFAIPSSTVLRIVPQLIQSGKVVRAGLNIDIAPDAIANQLNVRNGALVLLVPGNSLA  672
             +GVGF+IP  TV  IV QL++ GKV R  L I  APD    QL V +G LVL  P N  A
Sbjct  299   SGVGFSIPVDTVSGIVDQLVRFGKVTRPILGIKFAPDQSVEQLGV-SGVLVLDAPTNGPA  357

Query  671   AKAGILPTTRGFAGNIVLGDIIEAVDNKPVRNKADLYKVLDDYSVGDKVQLKIRRG  504
              KAG+ PT R   G ++LGDII +V+ K V N +DLY++LD   VG++V +++ RG
Sbjct  358   GKAGLQPTKRDAYGRLILGDIITSVNGKKVTNGSDLYRILDQCKVGEQVTVEVLRG  413


 Score = 60.1 bits (144),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 29/62 (47%), Positives = 41/62 (66%), Gaps = 0/62 (0%)
 Frame = -3

Query  1600  LSPSEERIVQLFENNTYSVVNIFDVTLRPRLNVGGAVEIPEGNGSGVVWDGEGNIVTNYH  1421
             L   E   V+LF+ NT SVV I ++ +R        +E+P+G+GSG VWD +G++VTNYH
Sbjct  105   LQSDELATVRLFQENTPSVVYITNLAVRQDAFTLDVLEVPQGSGSGFVWDKDGHVVTNYH  164

Query  1420  VI  1415
             VI
Sbjct  165   VI  166



>ref|XP_001417771.1| predicted protein [Ostreococcus lucimarinus CCE9901]
 gb|ABO96064.1| predicted protein [Ostreococcus lucimarinus CCE9901]
Length=368

 Score =   241 bits (615),  Expect = 5e-70, Method: Compositional matrix adjust.
 Identities = 136/236 (58%), Positives = 163/236 (69%), Gaps = 4/236 (2%)
 Frame = -2

Query  1205  KNFEGKLVGADRSKDLAVLKVEASEDLLRPTKIGESSS-LRVGQKCLAIGNPFGFDHTLT  1029
             + F   LVGA + KDL V+KV+A ++LL+P  +  SS  +RVGQ   AIGNPFGFDHTLT
Sbjct  111   RTFAATLVGASKEKDLVVIKVDAPKELLKPAVVSSSSEGVRVGQAVFAIGNPFGFDHTLT  170

Query  1028  VGVISGLNRDIYSQTGVTISGGIQTDAAINPGNSGGPLLDSKGNLIGINTAIFTQTGTSA  849
              GV+SGLNR I SQ G  I+G IQTDAAINPGNSGGPLLDS+G LIGINTAIFT TGTSA
Sbjct  171   TGVVSGLNRSIQSQVGSLITGAIQTDAAINPGNSGGPLLDSRGQLIGINTAIFTPTGTSA  230

Query  848   GVGFAIPSSTVLRIVPQLIQSGKVVRAGLNIDIAPDAIAN--QLNVRNGALVLLVPGNSL  675
             GVGFAIP  TV  +VPQLI +G+VV   LNI  A  ++    Q+ V  GAL+    G+S 
Sbjct  231   GVGFAIPIDTVNAVVPQLIANGEVVFPSLNIKFANASVERDLQVPVGGGALIQSFIGDSA  290

Query  674   AAKAGILPTTRGFAGNIVLGDIIEAVDNKPVRNKADLYKVLDDYSVGDKVQLKIRR  507
             A+KAG L T RG AG I  GD+I AVD  P    AD+ + ++   VGD VQ+   R
Sbjct  291   ASKAGFLATRRGIAG-IAPGDVIIAVDGAPCGVAADVVRAIERKRVGDDVQVTALR  345


 Score = 63.9 bits (154),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 38/101 (38%), Positives = 57/101 (56%), Gaps = 7/101 (7%)
 Frame = -3

Query  1627  TPPTFPSGPLSPSEERIVQLFENNTYSVVNIFDVTLRPRLN----VGGAVEIPEGNGSGV  1460
             TP    SG L   E + + +F     + VN+ D+T+  +        GA+ + EGNG+GV
Sbjct  10    TPAIASSGALGALESQFIDVFGRAERAAVNVVDLTVLNQSGNQSAFAGAI-VAEGNGTGV  68

Query  1459  VWDGEGNIVTNYHVIGNSLSRNPTRGEV--VARVNILAPDG  1343
             VWD EG++VTNYHV+G  L+  P   ++  VA+V I   +G
Sbjct  69    VWDDEGHVVTNYHVLGGVLASAPKGRKLGEVAKVTIQTNEG  109



>ref|XP_007031473.1| DegP protease 1 isoform 1 [Theobroma cacao]
 gb|EOY02399.1| DegP protease 1 isoform 1 [Theobroma cacao]
Length=472

 Score =   244 bits (622),  Expect = 7e-70, Method: Compositional matrix adjust.
 Identities = 135/236 (57%), Positives = 167/236 (71%), Gaps = 2/236 (1%)
 Frame = -2

Query  1208  QKNFEGKLVGADRSKDLAVLKVEASEDLLRPTKIGESSSLRVGQKCLAIGNPFGFDHTLT  1029
             Q  ++ K+VG D+ KD+AVL+V+A +D LRP  IG S+ L VGQK  AIGNPFG DHTLT
Sbjct  221   QSTYDAKVVGFDQDKDVAVLRVDAPKDKLRPIPIGISADLLVGQKVYAIGNPFGLDHTLT  280

Query  1028  VGVISGLNRDIYSQ-TGVTISGGIQTDAAINPGNSGGPLLDSKGNLIGINTAIFTQTGTS  852
              GVISGL R+I S  TG  I   IQTDAAINPGNSGGPLLDS GNLIGINTAI++ +G S
Sbjct  281   TGVISGLRREISSAATGRPIQDVIQTDAAINPGNSGGPLLDSSGNLIGINTAIYSPSGAS  340

Query  851   AGVGFAIPSSTVLRIVPQLIQSGKVVRAGLNIDIAPDAIANQLNVRNGALVLLVPGNSLA  672
             +GVGF+IP  TV  IV QL++ GKV R  L I  APD    QL V +G LVL  P N  A
Sbjct  341   SGVGFSIPVDTVGGIVDQLVKFGKVTRPVLGIKFAPDQSVEQLGV-SGVLVLDAPANGPA  399

Query  671   AKAGILPTTRGFAGNIVLGDIIEAVDNKPVRNKADLYKVLDDYSVGDKVQLKIRRG  504
              KAG+ PT R   G ++LGDII +V+ K V + +DLY++LD   VG++V +++ RG
Sbjct  400   GKAGLQPTKRDSYGRLILGDIITSVNGKKVTSGSDLYRILDQCKVGEQVTVEVLRG  455


 Score = 60.5 bits (145),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 30/62 (48%), Positives = 41/62 (66%), Gaps = 0/62 (0%)
 Frame = -3

Query  1600  LSPSEERIVQLFENNTYSVVNIFDVTLRPRLNVGGAVEIPEGNGSGVVWDGEGNIVTNYH  1421
             L   E   V+LF+ NT SVV I ++ +R        +E+P+G+GSG VWD +G+IVTNYH
Sbjct  147   LQSDELATVRLFQENTPSVVYITNLAVRQDAFTLDVLEVPQGSGSGFVWDKDGHIVTNYH  206

Query  1420  VI  1415
             VI
Sbjct  207   VI  208



>ref|XP_006844985.1| hypothetical protein AMTR_s00058p00188880 [Amborella trichopoda]
 gb|ERN06660.1| hypothetical protein AMTR_s00058p00188880 [Amborella trichopoda]
Length=444

 Score =   243 bits (619),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 134/236 (57%), Positives = 166/236 (70%), Gaps = 2/236 (1%)
 Frame = -2

Query  1208  QKNFEGKLVGADRSKDLAVLKVEASEDLLRPTKIGESSSLRVGQKCLAIGNPFGFDHTLT  1029
             Q  +E ++VG D+ KD+AVL+V+A +D LRP  +G S+ L VGQK  AIGNPFG DHTLT
Sbjct  193   QSTYEARVVGFDQDKDVAVLRVDAPKDKLRPIPVGVSADLLVGQKVYAIGNPFGLDHTLT  252

Query  1028  VGVISGLNRDIYSQ-TGVTISGGIQTDAAINPGNSGGPLLDSKGNLIGINTAIFTQTGTS  852
              GVISGL R+I S  TG  I   IQTDAAINPGNSGGPLLDS G+LIGINTAI++ +G S
Sbjct  253   TGVISGLRREISSAATGRPIQDVIQTDAAINPGNSGGPLLDSSGSLIGINTAIYSPSGAS  312

Query  851   AGVGFAIPSSTVLRIVPQLIQSGKVVRAGLNIDIAPDAIANQLNVRNGALVLLVPGNSLA  672
             +GVGF+IP  TV  IV QL++ GKV R  L I  APD    QL V +G LVL  P N  A
Sbjct  313   SGVGFSIPVDTVSGIVDQLVKFGKVTRPILGIKFAPDQSVEQLGV-SGVLVLDAPANGPA  371

Query  671   AKAGILPTTRGFAGNIVLGDIIEAVDNKPVRNKADLYKVLDDYSVGDKVQLKIRRG  504
              KAG+  T R   G ++LGDII +V+ K V N +DLY++LD   VGD+V +++ RG
Sbjct  372   GKAGLQSTKRDAYGRLILGDIITSVNGKKVTNGSDLYRILDQCKVGDQVTVEVLRG  427


 Score = 62.0 bits (149),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 31/66 (47%), Positives = 43/66 (65%), Gaps = 0/66 (0%)
 Frame = -3

Query  1612  PSGPLSPSEERIVQLFENNTYSVVNIFDVTLRPRLNVGGAVEIPEGNGSGVVWDGEGNIV  1433
             P+  L   E   V+LF+ NT SVV I ++ +R        +E+P+G+GSG VWD +G+IV
Sbjct  115   PARKLQSDELATVRLFQENTPSVVYITNLAVRQDAFTLDVLEVPQGSGSGFVWDKDGHIV  174

Query  1432  TNYHVI  1415
             TNYHVI
Sbjct  175   TNYHVI  180



>ref|XP_006470331.1| PREDICTED: protease Do-like 1, chloroplastic-like [Citrus sinensis]
Length=436

 Score =   242 bits (617),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 135/236 (57%), Positives = 167/236 (71%), Gaps = 2/236 (1%)
 Frame = -2

Query  1208  QKNFEGKLVGADRSKDLAVLKVEASEDLLRPTKIGESSSLRVGQKCLAIGNPFGFDHTLT  1029
             Q  ++ K+VG D+ KD+AVL+++A +D LRP  IG S+ L VGQK  AIGNPFG DHTLT
Sbjct  185   QSTYDAKIVGFDQDKDVAVLRIDAPKDKLRPIPIGVSADLLVGQKVYAIGNPFGLDHTLT  244

Query  1028  VGVISGLNRDIYSQ-TGVTISGGIQTDAAINPGNSGGPLLDSKGNLIGINTAIFTQTGTS  852
              GVISGL R+I S  TG  I   IQTDAAINPGNSGGPLLDS G+LIGINTAI++ +G S
Sbjct  245   TGVISGLRREISSAATGRPIQDVIQTDAAINPGNSGGPLLDSSGSLIGINTAIYSPSGAS  304

Query  851   AGVGFAIPSSTVLRIVPQLIQSGKVVRAGLNIDIAPDAIANQLNVRNGALVLLVPGNSLA  672
             +GVGF+IP  TV  IV QL++ GKV R  L I  APD    QL V +G LVL  P N  A
Sbjct  305   SGVGFSIPVDTVNGIVDQLVKFGKVTRPILGIKFAPDQSVEQLGV-SGVLVLDAPPNGPA  363

Query  671   AKAGILPTTRGFAGNIVLGDIIEAVDNKPVRNKADLYKVLDDYSVGDKVQLKIRRG  504
              KAG+L T R   G ++LGDII +V+ K V N +DLY++LD   VGD+V +++ RG
Sbjct  364   GKAGLLSTKRDAYGRLILGDIIISVNGKKVSNGSDLYRILDQCKVGDEVIVEVLRG  419


 Score = 63.5 bits (153),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 31/66 (47%), Positives = 42/66 (64%), Gaps = 0/66 (0%)
 Frame = -3

Query  1612  PSGPLSPSEERIVQLFENNTYSVVNIFDVTLRPRLNVGGAVEIPEGNGSGVVWDGEGNIV  1433
             P   L   E   V+LF+ NT SVVNI ++  R        +E+P+G+GSG VWD +G++V
Sbjct  107   PQRKLQTDELATVRLFQENTPSVVNITNLAARQDAFTLDVLEVPQGSGSGFVWDSKGHVV  166

Query  1432  TNYHVI  1415
             TNYHVI
Sbjct  167   TNYHVI  172



>ref|XP_010667674.1| PREDICTED: protease Do-like 1, chloroplastic [Beta vulgaris subsp. 
vulgaris]
Length=437

 Score =   242 bits (617),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 134/236 (57%), Positives = 166/236 (70%), Gaps = 2/236 (1%)
 Frame = -2

Query  1208  QKNFEGKLVGADRSKDLAVLKVEASEDLLRPTKIGESSSLRVGQKCLAIGNPFGFDHTLT  1029
             Q  +E K+VG D+ KD+AVL+++   + LRP  IG S+ L VGQK  AIGNPFG DHTLT
Sbjct  186   QTTYEAKVVGYDQDKDVAVLRIDPPNNKLRPIPIGVSADLLVGQKVFAIGNPFGLDHTLT  245

Query  1028  VGVISGLNRDIYSQ-TGVTISGGIQTDAAINPGNSGGPLLDSKGNLIGINTAIFTQTGTS  852
              GVISGL R+I S  TG  I   IQTDAAINPGNSGGPLLDS GNLIGINTAI++ +G S
Sbjct  246   TGVISGLRREISSAATGRPIQDVIQTDAAINPGNSGGPLLDSSGNLIGINTAIYSPSGAS  305

Query  851   AGVGFAIPSSTVLRIVPQLIQSGKVVRAGLNIDIAPDAIANQLNVRNGALVLLVPGNSLA  672
             +GVGF+IP  TV  IV Q+++ GKV R  L I  APD    QL V +G LVL  P +  A
Sbjct  306   SGVGFSIPVDTVAGIVDQIVKFGKVTRPILGIKFAPDQSVEQLGV-SGVLVLDAPPSGPA  364

Query  671   AKAGILPTTRGFAGNIVLGDIIEAVDNKPVRNKADLYKVLDDYSVGDKVQLKIRRG  504
              KAG+L T R   G ++LGDII +V+ K V N +DLY++LD+  VGDKV +++ RG
Sbjct  365   GKAGLLSTKRDAYGRLILGDIITSVNGKKVTNGSDLYRILDNCKVGDKVVVEVLRG  420


 Score = 55.8 bits (133),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 28/62 (45%), Positives = 40/62 (65%), Gaps = 0/62 (0%)
 Frame = -3

Query  1600  LSPSEERIVQLFENNTYSVVNIFDVTLRPRLNVGGAVEIPEGNGSGVVWDGEGNIVTNYH  1421
             L   E   V+LF+ NT SVV I ++  +  +     +E+P+G+GSG +WD  G+IVTNYH
Sbjct  112   LQTDELATVRLFQENTPSVVYITNLATKQDVFTLDVLEVPQGSGSGFIWDNLGHIVTNYH  171

Query  1420  VI  1415
             VI
Sbjct  172   VI  173



>gb|EMS49623.1| Protease Do-like 1, chloroplastic [Triticum urartu]
Length=308

 Score =   237 bits (604),  Expect = 4e-69, Method: Compositional matrix adjust.
 Identities = 133/236 (56%), Positives = 163/236 (69%), Gaps = 2/236 (1%)
 Frame = -2

Query  1208  QKNFEGKLVGADRSKDLAVLKVEASEDLLRPTKIGESSSLRVGQKCLAIGNPFGFDHTLT  1029
             Q  +E ++VG D+ KD+AVL +EA +D LRP  +G S+ L VGQK  AIGNPFG DHTLT
Sbjct  57    QSVYEAQVVGFDQDKDVAVLSIEAPKDKLRPLPVGVSADLLVGQKVYAIGNPFGLDHTLT  116

Query  1028  VGVISGLNRDIYSQ-TGVTISGGIQTDAAINPGNSGGPLLDSKGNLIGINTAIFTQTGTS  852
              GVISGL R+I S  TG  I   IQTDAAINPGNSGGPLLDS GNLIG+NTAI++ +G S
Sbjct  117   TGVISGLRREISSAATGRPIQDVIQTDAAINPGNSGGPLLDSSGNLIGVNTAIYSPSGAS  176

Query  851   AGVGFAIPSSTVLRIVPQLIQSGKVVRAGLNIDIAPDAIANQLNVRNGALVLLVPGNSLA  672
             +GVGF+IP  TV  IV QLIQ GKV R  L I  APD    QL + +G LVL  P N  A
Sbjct  177   SGVGFSIPVDTVGGIVDQLIQFGKVTRPILGIKFAPDQSVEQLGL-SGVLVLDAPPNGPA  235

Query  671   AKAGILPTTRGFAGNIVLGDIIEAVDNKPVRNKADLYKVLDDYSVGDKVQLKIRRG  504
              KAG+  T R   G ++LGDII +V+   V N +DLY++LD   VG+ V +++ RG
Sbjct  236   GKAGLQSTKRDAYGRLILGDIITSVNGTKVANGSDLYRILDQCKVGETVTVEVLRG  291



>ref|XP_010528253.1| PREDICTED: protease Do-like 1, chloroplastic isoform X2 [Tarenaya 
hassleriana]
Length=466

 Score =   242 bits (617),  Expect = 4e-69, Method: Compositional matrix adjust.
 Identities = 134/229 (59%), Positives = 162/229 (71%), Gaps = 2/229 (1%)
 Frame = -2

Query  1208  QKNFEGKLVGADRSKDLAVLKVEASEDLLRPTKIGESSSLRVGQKCLAIGNPFGFDHTLT  1029
             Q  ++ K+VG D+ KD+AVL+++A +D LRP  +G S+ L VGQK  AIGNPFG DHTLT
Sbjct  234   QSTYDAKVVGFDQDKDVAVLRIDAPKDKLRPIPVGISADLLVGQKVFAIGNPFGLDHTLT  293

Query  1028  VGVISGLNRDIYSQ-TGVTISGGIQTDAAINPGNSGGPLLDSKGNLIGINTAIFTQTGTS  852
              GVISGL R+I S  TG  I   IQTDAAINPGNSGGPLLDS GNLIGINTAI++ +G S
Sbjct  294   TGVISGLRREISSAATGRPIQDVIQTDAAINPGNSGGPLLDSSGNLIGINTAIYSPSGAS  353

Query  851   AGVGFAIPSSTVLRIVPQLIQSGKVVRAGLNIDIAPDAIANQLNVRNGALVLLVPGNSLA  672
             +GVGF+IP  TV  IV QL++ GKV R  L I  APD    QL V +G LVL  P N  A
Sbjct  354   SGVGFSIPVDTVGGIVDQLVKFGKVTRPILGIKFAPDQSVEQLGV-SGVLVLDAPPNGPA  412

Query  671   AKAGILPTTRGFAGNIVLGDIIEAVDNKPVRNKADLYKVLDDYSVGDKV  525
              KAG+ PT R   G ++LGDII +V+ K V N +DLY++LD   VGDKV
Sbjct  413   GKAGLQPTKRDSYGRLILGDIITSVNGKKVSNGSDLYRILDQCQVGDKV  461


 Score = 63.5 bits (153),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 40/94 (43%), Positives = 51/94 (54%), Gaps = 5/94 (5%)
 Frame = -3

Query  1696  LCTQFITLQAYALGDPSVTVEQVTPPTFPSGPLSPSEERIVQLFENNTYSVVNIFDVTLR  1517
             LCT  + L    L  P      VT P      L   E   V+LF+ NT SVV I ++ +R
Sbjct  133   LCTS-VALSFSLLSAPPADAFVVTTPR----KLQSDELATVRLFQENTPSVVYITNLAVR  187

Query  1516  PRLNVGGAVEIPEGNGSGVVWDGEGNIVTNYHVI  1415
                     +E+P+G+GSG VWD EG+IVTNYHVI
Sbjct  188   QDAFTLDVLEVPQGSGSGFVWDKEGHIVTNYHVI  221



>ref|NP_001289236.1| protease Do-like 1, chloroplastic [Pyrus x bretschneideri]
 gb|AHM26640.1| protease Do-like 1 protein [Pyrus x bretschneideri]
Length=449

 Score =   241 bits (615),  Expect = 4e-69, Method: Compositional matrix adjust.
 Identities = 133/236 (56%), Positives = 165/236 (70%), Gaps = 2/236 (1%)
 Frame = -2

Query  1208  QKNFEGKLVGADRSKDLAVLKVEASEDLLRPTKIGESSSLRVGQKCLAIGNPFGFDHTLT  1029
             Q  F  K+VG D+ KD+AVL V+A ++ L+P  IG+S+ L VGQK  AIGNPFG DHTLT
Sbjct  198   QSTFNAKVVGFDQDKDVAVLHVDAPKEKLKPIPIGQSADLLVGQKVFAIGNPFGLDHTLT  257

Query  1028  VGVISGLNRDIYSQ-TGVTISGGIQTDAAINPGNSGGPLLDSKGNLIGINTAIFTQTGTS  852
              GVISGL R+I S  TG  I   IQ DAAINPGNSGGPLLDS G+LIGINTAI++  G S
Sbjct  258   TGVISGLRREISSAATGRPIQDVIQIDAAINPGNSGGPLLDSTGSLIGINTAIYSPNGAS  317

Query  851   AGVGFAIPSSTVLRIVPQLIQSGKVVRAGLNIDIAPDAIANQLNVRNGALVLLVPGNSLA  672
             +GVGF+IP  TV  IV QL++ GKV R  L I  APD    QL + +G LVL  P N  A
Sbjct  318   SGVGFSIPVDTVSGIVDQLVKFGKVTRPILGIKFAPDQSVEQLGL-SGVLVLDAPANGPA  376

Query  671   AKAGILPTTRGFAGNIVLGDIIEAVDNKPVRNKADLYKVLDDYSVGDKVQLKIRRG  504
              KAG++PT R   G ++LGDII +V+ K V N +DLY++LD   VGD+V +++ RG
Sbjct  377   GKAGLVPTKRDAYGRLILGDIITSVNAKKVSNGSDLYRILDQCKVGDQVIVEVLRG  432


 Score = 63.2 bits (152),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 37/84 (44%), Positives = 46/84 (55%), Gaps = 4/84 (5%)
 Frame = -3

Query  1630  VTPPTFPSGPLSPSEERIVQLFENNTYSVVNIFDVTLRPRLNVGGAVEIPEGNGSGVVWD  1451
             VTPP      L   E   VQLF+ NT SVV I ++  R         E+P+G+GSG VWD
Sbjct  118   VTPPR----KLQSDELATVQLFQENTPSVVYITNLAARQDAFTLDVFEVPQGSGSGFVWD  173

Query  1450  GEGNIVTNYHVIGNSLSRNPTRGE  1379
               GN+VTNYHVI  +     T G+
Sbjct  174   KNGNVVTNYHVIRGASDLRVTLGD  197



>ref|XP_010925542.1| PREDICTED: protease Do-like 1, chloroplastic, partial [Elaeis 
guineensis]
Length=475

 Score =   242 bits (617),  Expect = 4e-69, Method: Compositional matrix adjust.
 Identities = 133/236 (56%), Positives = 165/236 (70%), Gaps = 2/236 (1%)
 Frame = -2

Query  1208  QKNFEGKLVGADRSKDLAVLKVEASEDLLRPTKIGESSSLRVGQKCLAIGNPFGFDHTLT  1029
             Q   E K+VG DR KD+AVL+++A +D LRP  +G S+ L VGQK  AIGNPFG DHTLT
Sbjct  224   QSVCEAKVVGFDRDKDVAVLRIDAPKDKLRPIPVGISADLLVGQKVYAIGNPFGLDHTLT  283

Query  1028  VGVISGLNRDIYSQ-TGVTISGGIQTDAAINPGNSGGPLLDSKGNLIGINTAIFTQTGTS  852
              GVISGL R+I S  TG  I   IQTDAAINPGNSGGPLLDS G+LIG+NTAI++ +G S
Sbjct  284   TGVISGLRREISSAATGRPIQDVIQTDAAINPGNSGGPLLDSSGSLIGVNTAIYSPSGAS  343

Query  851   AGVGFAIPSSTVLRIVPQLIQSGKVVRAGLNIDIAPDAIANQLNVRNGALVLLVPGNSLA  672
             +GVGF+IP  TV  IV QL++ G+V R  L I  APD    QL + +G LVL  P N  A
Sbjct  344   SGVGFSIPVDTVSGIVEQLVKFGRVTRPILGIKFAPDQSVEQLGL-SGVLVLDAPANGPA  402

Query  671   AKAGILPTTRGFAGNIVLGDIIEAVDNKPVRNKADLYKVLDDYSVGDKVQLKIRRG  504
              KAG+ PT R   G ++LGDII +V+ K V N +DLY++LD   VGD V +++ RG
Sbjct  403   GKAGLQPTKRDAYGRLILGDIITSVNGKKVTNGSDLYRILDQCKVGDTVTVEVLRG  458


 Score = 60.1 bits (144),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 29/62 (47%), Positives = 41/62 (66%), Gaps = 0/62 (0%)
 Frame = -3

Query  1600  LSPSEERIVQLFENNTYSVVNIFDVTLRPRLNVGGAVEIPEGNGSGVVWDGEGNIVTNYH  1421
             L   E   ++LF+ NT SVV I ++ +R        +E+P+G+GSG VWD +G+IVTNYH
Sbjct  150   LQSDELSTIRLFQENTPSVVYITNLAVRQDAFTLDVLEVPQGSGSGFVWDKDGHIVTNYH  209

Query  1420  VI  1415
             VI
Sbjct  210   VI  211



>ref|XP_006395390.1| hypothetical protein EUTSA_v10004246mg [Eutrema salsugineum]
 gb|ESQ32676.1| hypothetical protein EUTSA_v10004246mg [Eutrema salsugineum]
Length=436

 Score =   241 bits (614),  Expect = 5e-69, Method: Compositional matrix adjust.
 Identities = 135/236 (57%), Positives = 165/236 (70%), Gaps = 2/236 (1%)
 Frame = -2

Query  1208  QKNFEGKLVGADRSKDLAVLKVEASEDLLRPTKIGESSSLRVGQKCLAIGNPFGFDHTLT  1029
             Q  F+ K+VG D+ KD+AVL+++A +D LRP  +G S+ L VGQK  AIGNPFG DHTLT
Sbjct  185   QTTFDAKVVGFDQDKDVAVLRIDAPKDKLRPIPVGVSADLLVGQKVFAIGNPFGLDHTLT  244

Query  1028  VGVISGLNRDIYSQ-TGVTISGGIQTDAAINPGNSGGPLLDSKGNLIGINTAIFTQTGTS  852
              GVISGL R+I S  TG  I   IQTDAAINPGNSGGPLLDS GNLIGINTAI++ +G S
Sbjct  245   TGVISGLRREISSAATGRPIQDVIQTDAAINPGNSGGPLLDSSGNLIGINTAIYSPSGAS  304

Query  851   AGVGFAIPSSTVLRIVPQLIQSGKVVRAGLNIDIAPDAIANQLNVRNGALVLLVPGNSLA  672
             +GVGF+IP  TV  IV QL++ GKV R  L I  APD    QL V +G LVL  P +  A
Sbjct  305   SGVGFSIPVDTVGGIVDQLVRFGKVTRPILGIKFAPDQSVEQLGV-SGVLVLDAPPSGPA  363

Query  671   AKAGILPTTRGFAGNIVLGDIIEAVDNKPVRNKADLYKVLDDYSVGDKVQLKIRRG  504
              KAG+  T R   G +VLGDII +V+   V N +DLY++LD   VGDKV +++ RG
Sbjct  364   GKAGLQSTKRDGYGRLVLGDIITSVNGTKVSNGSDLYRILDQCKVGDKVTVEVLRG  419


 Score = 60.5 bits (145),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 30/62 (48%), Positives = 41/62 (66%), Gaps = 0/62 (0%)
 Frame = -3

Query  1600  LSPSEERIVQLFENNTYSVVNIFDVTLRPRLNVGGAVEIPEGNGSGVVWDGEGNIVTNYH  1421
             L   E   V+LF+ NT SVV I ++ +R        +E+P+G+GSG VWD +G+IVTNYH
Sbjct  111   LQTDELATVRLFQENTPSVVYITNLAVRQDAFTLDVLEVPQGSGSGFVWDKQGHIVTNYH  170

Query  1420  VI  1415
             VI
Sbjct  171   VI  172



>ref|XP_003524545.1| PREDICTED: protease Do-like 1, chloroplastic-like [Glycine max]
Length=426

 Score =   240 bits (613),  Expect = 5e-69, Method: Compositional matrix adjust.
 Identities = 135/236 (57%), Positives = 165/236 (70%), Gaps = 2/236 (1%)
 Frame = -2

Query  1208  QKNFEGKLVGADRSKDLAVLKVEASEDLLRPTKIGESSSLRVGQKCLAIGNPFGFDHTLT  1029
             Q   +  +VG D+ KD+AVL+V+A +D LRP  IG S+ L VGQK  AIGNPFG DHTLT
Sbjct  175   QSTLDAIVVGFDQDKDVAVLRVDAPKDKLRPIPIGVSADLLVGQKVYAIGNPFGLDHTLT  234

Query  1028  VGVISGLNRDIYSQ-TGVTISGGIQTDAAINPGNSGGPLLDSKGNLIGINTAIFTQTGTS  852
              GVISGL R+I S  TG  I   IQTDAAINPGNSGGPLLDS GNLIGINTAI++ +G S
Sbjct  235   TGVISGLRREISSAATGRPIQDVIQTDAAINPGNSGGPLLDSSGNLIGINTAIYSPSGAS  294

Query  851   AGVGFAIPSSTVLRIVPQLIQSGKVVRAGLNIDIAPDAIANQLNVRNGALVLLVPGNSLA  672
             +GVGF+IP  TV  IV QL++ GKV R  L I  APD    QL V +G LVL  P N  A
Sbjct  295   SGVGFSIPVDTVSGIVDQLVKFGKVTRPILGIKFAPDQSVEQLGV-SGVLVLDAPANGPA  353

Query  671   AKAGILPTTRGFAGNIVLGDIIEAVDNKPVRNKADLYKVLDDYSVGDKVQLKIRRG  504
              KAG+  T R   G ++LGDII +V++K V N +DLY++LD   VGDK+ +++ RG
Sbjct  354   GKAGLQSTKRDSYGRLILGDIITSVNDKKVTNGSDLYRILDQCKVGDKLIVEVLRG  409


 Score = 60.5 bits (145),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 30/62 (48%), Positives = 41/62 (66%), Gaps = 0/62 (0%)
 Frame = -3

Query  1600  LSPSEERIVQLFENNTYSVVNIFDVTLRPRLNVGGAVEIPEGNGSGVVWDGEGNIVTNYH  1421
             L   E   V+LF+ NT SVV I ++ ++        +E+P+G+GSG VWD EG+IVTNYH
Sbjct  101   LQSDELATVRLFQENTPSVVYITNLAVKQDAFTLDVLEVPQGSGSGFVWDKEGHIVTNYH  160

Query  1420  VI  1415
             VI
Sbjct  161   VI  162



>gb|KHN27431.1| Protease Do-like 1, chloroplastic [Glycine soja]
Length=423

 Score =   240 bits (612),  Expect = 5e-69, Method: Compositional matrix adjust.
 Identities = 135/236 (57%), Positives = 165/236 (70%), Gaps = 2/236 (1%)
 Frame = -2

Query  1208  QKNFEGKLVGADRSKDLAVLKVEASEDLLRPTKIGESSSLRVGQKCLAIGNPFGFDHTLT  1029
             Q   +  +VG D+ KD+AVL+V+A +D LRP  IG S+ L VGQK  AIGNPFG DHTLT
Sbjct  172   QSTLDAIVVGFDQDKDVAVLRVDAPKDKLRPIPIGVSADLLVGQKVYAIGNPFGLDHTLT  231

Query  1028  VGVISGLNRDIYSQ-TGVTISGGIQTDAAINPGNSGGPLLDSKGNLIGINTAIFTQTGTS  852
              GVISGL R+I S  TG  I   IQTDAAINPGNSGGPLLDS GNLIGINTAI++ +G S
Sbjct  232   TGVISGLRREISSAATGRPIQDVIQTDAAINPGNSGGPLLDSSGNLIGINTAIYSPSGAS  291

Query  851   AGVGFAIPSSTVLRIVPQLIQSGKVVRAGLNIDIAPDAIANQLNVRNGALVLLVPGNSLA  672
             +GVGF+IP  TV  IV QL++ GKV R  L I  APD    QL V +G LVL  P N  A
Sbjct  292   SGVGFSIPVDTVSGIVDQLVKFGKVTRPILGIKFAPDQSVEQLGV-SGVLVLDAPANGPA  350

Query  671   AKAGILPTTRGFAGNIVLGDIIEAVDNKPVRNKADLYKVLDDYSVGDKVQLKIRRG  504
              KAG+  T R   G ++LGDII +V++K V N +DLY++LD   VGDK+ +++ RG
Sbjct  351   GKAGLQSTKRDSYGRLILGDIITSVNDKKVTNGSDLYRILDQCKVGDKLIVEVLRG  406


 Score = 60.5 bits (145),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 30/62 (48%), Positives = 41/62 (66%), Gaps = 0/62 (0%)
 Frame = -3

Query  1600  LSPSEERIVQLFENNTYSVVNIFDVTLRPRLNVGGAVEIPEGNGSGVVWDGEGNIVTNYH  1421
             L   E   V+LF+ NT SVV I ++ ++        +E+P+G+GSG VWD EG+IVTNYH
Sbjct  98    LQSDELATVRLFQENTPSVVYITNLAVKQDAFTLDVLEVPQGSGSGFVWDKEGHIVTNYH  157

Query  1420  VI  1415
             VI
Sbjct  158   VI  159



>ref|XP_002524640.1| Protease degQ precursor, putative [Ricinus communis]
 gb|EEF37659.1| Protease degQ precursor, putative [Ricinus communis]
Length=451

 Score =   241 bits (614),  Expect = 6e-69, Method: Compositional matrix adjust.
 Identities = 132/236 (56%), Positives = 166/236 (70%), Gaps = 2/236 (1%)
 Frame = -2

Query  1208  QKNFEGKLVGADRSKDLAVLKVEASEDLLRPTKIGESSSLRVGQKCLAIGNPFGFDHTLT  1029
             Q  ++  +VG D+ KD+AVL+VEA ++ LRP  +G S+ L VGQK  AIGNPFG DHTLT
Sbjct  200   QSTYDATVVGYDQDKDVAVLRVEAPKEKLRPIPVGVSADLLVGQKVYAIGNPFGLDHTLT  259

Query  1028  VGVISGLNRDIYSQ-TGVTISGGIQTDAAINPGNSGGPLLDSKGNLIGINTAIFTQTGTS  852
              GVISGL R+I S  TG  I   IQTDAAINPGNSGGPLLDS G+LIGINTAI++ +G S
Sbjct  260   TGVISGLRREISSAATGRPIQDVIQTDAAINPGNSGGPLLDSSGSLIGINTAIYSPSGAS  319

Query  851   AGVGFAIPSSTVLRIVPQLIQSGKVVRAGLNIDIAPDAIANQLNVRNGALVLLVPGNSLA  672
             +GVGF+IP  TV  IV QL++ GKV R  L I  APD    QL V +G LVL  P +  A
Sbjct  320   SGVGFSIPVDTVSGIVEQLVKFGKVTRPILGIKFAPDQSVEQLGV-SGVLVLDAPASGPA  378

Query  671   AKAGILPTTRGFAGNIVLGDIIEAVDNKPVRNKADLYKVLDDYSVGDKVQLKIRRG  504
              KAG+ PT R   G ++LGDII +V+ K + N +DLY++LD   VGD+V +++ RG
Sbjct  379   GKAGLQPTKRDAYGRLILGDIITSVNGKKITNGSDLYRILDQCKVGDQVIVEVLRG  434


 Score = 58.5 bits (140),  Expect = 9e-06, Method: Compositional matrix adjust.
 Identities = 33/80 (41%), Positives = 46/80 (58%), Gaps = 5/80 (6%)
 Frame = -3

Query  1654  DPSVTVEQVTPPTFPSGPLSPSEERIVQLFENNTYSVVNIFDVTLRPRLNVGGAVEIPEG  1475
             DP+      TP    S  L+      V+LF+ NT SVV I ++  +        +E+P+G
Sbjct  113   DPASAFVVTTPRKLQSDELA-----TVRLFQENTPSVVYITNLAAKQDAFTLDVLEVPQG  167

Query  1474  NGSGVVWDGEGNIVTNYHVI  1415
             +GSG VWD EG+IVTN+HVI
Sbjct  168   SGSGFVWDSEGHIVTNFHVI  187



>gb|AFW81178.1| hypothetical protein ZEAMMB73_402948 [Zea mays]
 gb|AFW81179.1| hypothetical protein ZEAMMB73_402948 [Zea mays]
Length=430

 Score =   240 bits (612),  Expect = 7e-69, Method: Compositional matrix adjust.
 Identities = 132/236 (56%), Positives = 165/236 (70%), Gaps = 2/236 (1%)
 Frame = -2

Query  1208  QKNFEGKLVGADRSKDLAVLKVEASEDLLRPTKIGESSSLRVGQKCLAIGNPFGFDHTLT  1029
             Q  +E ++VG D+ KD+AVL++EA +D LRP  +G S+ L VGQK  AIGNPFG DHTLT
Sbjct  179   QSVYEAQVVGFDQDKDVAVLRIEAPKDKLRPIPVGVSADLLVGQKVYAIGNPFGLDHTLT  238

Query  1028  VGVISGLNRDIYSQ-TGVTISGGIQTDAAINPGNSGGPLLDSKGNLIGINTAIFTQTGTS  852
              GVISGL R+I S  TG  I   IQTDAAINPGNSGGPLLDS GNLIG+NTAI++ +G S
Sbjct  239   TGVISGLRREISSAATGRPIQDVIQTDAAINPGNSGGPLLDSSGNLIGVNTAIYSPSGAS  298

Query  851   AGVGFAIPSSTVLRIVPQLIQSGKVVRAGLNIDIAPDAIANQLNVRNGALVLLVPGNSLA  672
             +GVGF+IP  TV  IV QLI+ GKV R  L +  APD    QL + +G LVL  P N  A
Sbjct  299   SGVGFSIPVDTVGGIVDQLIRFGKVTRPILGVKFAPDQSVEQLGL-SGVLVLDAPPNGPA  357

Query  671   AKAGILPTTRGFAGNIVLGDIIEAVDNKPVRNKADLYKVLDDYSVGDKVQLKIRRG  504
              KAG+ PT R   G ++LGDII +V+   V N +DLY++LD   VG+ V +++ RG
Sbjct  358   GKAGLQPTKRDPYGRLILGDIITSVNGTKVTNGSDLYRILDQCKVGETVTVEVLRG  413


 Score = 58.2 bits (139),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 29/62 (47%), Positives = 40/62 (65%), Gaps = 0/62 (0%)
 Frame = -3

Query  1600  LSPSEERIVQLFENNTYSVVNIFDVTLRPRLNVGGAVEIPEGNGSGVVWDGEGNIVTNYH  1421
             L   E   V+LF+ NT SVV I ++ +R        +E+P+G+GSG VWD  G+IVTN+H
Sbjct  105   LQADELATVRLFQENTPSVVYITNLAVRQDAFTLDVLEVPQGSGSGFVWDKSGHIVTNFH  164

Query  1420  VI  1415
             VI
Sbjct  165   VI  166



>ref|XP_001765751.1| predicted protein [Physcomitrella patens]
 gb|EDQ69342.1| predicted protein [Physcomitrella patens]
Length=292

 Score =   236 bits (601),  Expect = 7e-69, Method: Compositional matrix adjust.
 Identities = 126/232 (54%), Positives = 162/232 (70%), Gaps = 1/232 (0%)
 Frame = -2

Query  1199  FEGKLVGADRSKDLAVLKVEASEDLLRPTKIGESSSLRVGQKCLAIGNPFGFDHTLTVGV  1020
             +EG +VG  ++KDLAVLK+ A    LRP  +G S +L+VGQ  LAIGNPFG D TLT G+
Sbjct  47    WEGTVVGVAKNKDLAVLKIAAPASRLRPIVVGSSQALQVGQHVLAIGNPFGLDRTLTSGI  106

Query  1019  ISGLNRDIYSQTGVTISGGIQTDAAINPGNSGGPLLDSKGNLIGINTAIFTQTGTSAGVG  840
             ISG+ RDI S  G  I G +QTDA+INPGNSGGPLLDS+G LIG+NTAI++ +G SAG+G
Sbjct  107   ISGVGRDIRSIGGAMIRGVVQTDASINPGNSGGPLLDSQGRLIGVNTAIYSPSGASAGIG  166

Query  839   FAIPSSTVLRIVPQLIQSGKVVRAGLNIDIAPDAIANQLNVRNGALVLLVPGNSLAAKAG  660
             FAIP  TV R+V +LI+ GKV R GL I  A D+ A QL V NG LV  +  N  AAKAG
Sbjct  167   FAIPVDTVRRVVNELIRKGKVSRPGLGIMCASDSQAKQLGV-NGVLVFGLSENGAAAKAG  225

Query  659   ILPTTRGFAGNIVLGDIIEAVDNKPVRNKADLYKVLDDYSVGDKVQLKIRRG  504
             +LPT R   G I LGDII A++ + +    DL    D+  +GD++++ ++RG
Sbjct  226   LLPTKRDLFGRIELGDIIVAINGQTLSRVDDLVAACDERQIGDRLRVTVKRG  277



>ref|XP_002992168.1| hypothetical protein SELMODRAFT_134817 [Selaginella moellendorffii]
 gb|EFJ06823.1| hypothetical protein SELMODRAFT_134817 [Selaginella moellendorffii]
Length=413

 Score =   239 bits (611),  Expect = 8e-69, Method: Compositional matrix adjust.
 Identities = 132/236 (56%), Positives = 163/236 (69%), Gaps = 2/236 (1%)
 Frame = -2

Query  1208  QKNFEGKLVGADRSKDLAVLKVEASEDLLRPTKIGESSSLRVGQKCLAIGNPFGFDHTLT  1029
             Q  +E  +VG D  KD+AVL ++A  D L+P  +G SS L VGQK  AIGNPFG DHTLT
Sbjct  165   QSVYEADVVGFDEDKDVAVLHIDAPRDRLKPIPVGTSSDLLVGQKVYAIGNPFGLDHTLT  224

Query  1028  VGVISGLNRDIYSQ-TGVTISGGIQTDAAINPGNSGGPLLDSKGNLIGINTAIFTQTGTS  852
              GVISGL R+I S  TG  I   IQTDAAINPGNSGGPLLDS G+LIGINTAI++ +G S
Sbjct  225   TGVISGLRREISSAATGRPIQDVIQTDAAINPGNSGGPLLDSSGDLIGINTAIYSPSGAS  284

Query  851   AGVGFAIPSSTVLRIVPQLIQSGKVVRAGLNIDIAPDAIANQLNVRNGALVLLVPGNSLA  672
             +GVGF+IP  TV  IV QLI+ G+V R  L I  AP+    QL V +G LVL  P    A
Sbjct  285   SGVGFSIPVDTVSGIVEQLIKYGRVTRPVLGITFAPEQSVEQLGV-SGVLVLDAPPGGPA  343

Query  671   AKAGILPTTRGFAGNIVLGDIIEAVDNKPVRNKADLYKVLDDYSVGDKVQLKIRRG  504
              KAG+ PT R   G +VLGDII +++N+ + N +DLY+VLD   VGDK+ +++ RG
Sbjct  344   GKAGLRPTKRDGYGRLVLGDIITSINNQKISNGSDLYRVLDRCKVGDKITVEVLRG  399


 Score = 61.2 bits (147),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 35/84 (42%), Positives = 47/84 (56%), Gaps = 7/84 (8%)
 Frame = -3

Query  1645  VTVEQVTPP-------TFPSGPLSPSEERIVQLFENNTYSVVNIFDVTLRPRLNVGGAVE  1487
             + +  V PP       T P   L   E   VQLF+ NT SVV I ++  R        +E
Sbjct  69    IALSAVAPPLDAHAFVTAPPRKLQSDELATVQLFKLNTPSVVYITNLAARRDAFTLDVLE  128

Query  1486  IPEGNGSGVVWDGEGNIVTNYHVI  1415
             +P+G+GSG VWD EG++VTN+HVI
Sbjct  129   VPQGSGSGFVWDKEGHVVTNFHVI  152



>ref|XP_002977281.1| hypothetical protein SELMODRAFT_176144 [Selaginella moellendorffii]
 gb|EFJ21890.1| hypothetical protein SELMODRAFT_176144 [Selaginella moellendorffii]
Length=435

 Score =   240 bits (612),  Expect = 9e-69, Method: Compositional matrix adjust.
 Identities = 132/236 (56%), Positives = 163/236 (69%), Gaps = 2/236 (1%)
 Frame = -2

Query  1208  QKNFEGKLVGADRSKDLAVLKVEASEDLLRPTKIGESSSLRVGQKCLAIGNPFGFDHTLT  1029
             Q  +E  +VG D  KD+AVL ++A  D L+P  +G SS L VGQK  AIGNPFG DHTLT
Sbjct  187   QSVYEADVVGFDEDKDVAVLHIDAPRDRLKPIPVGTSSDLLVGQKVYAIGNPFGLDHTLT  246

Query  1028  VGVISGLNRDIYSQ-TGVTISGGIQTDAAINPGNSGGPLLDSKGNLIGINTAIFTQTGTS  852
              GVISGL R+I S  TG  I   IQTDAAINPGNSGGPLLDS G+LIGINTAI++ +G S
Sbjct  247   TGVISGLRREISSAATGRPIQDVIQTDAAINPGNSGGPLLDSSGDLIGINTAIYSPSGAS  306

Query  851   AGVGFAIPSSTVLRIVPQLIQSGKVVRAGLNIDIAPDAIANQLNVRNGALVLLVPGNSLA  672
             +GVGF+IP  TV  IV QLI+ G+V R  L I  AP+    QL V +G LVL  P    A
Sbjct  307   SGVGFSIPVDTVSGIVEQLIKYGRVTRPVLGITFAPEQSVEQLGV-SGVLVLDAPPGGPA  365

Query  671   AKAGILPTTRGFAGNIVLGDIIEAVDNKPVRNKADLYKVLDDYSVGDKVQLKIRRG  504
              KAG+ PT R   G +VLGDII +++N+ + N +DLY+VLD   VGDK+ +++ RG
Sbjct  366   GKAGLRPTKRDGYGRLVLGDIITSINNQKISNGSDLYRVLDRCKVGDKITVEVLRG  421


 Score = 60.8 bits (146),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 35/84 (42%), Positives = 47/84 (56%), Gaps = 7/84 (8%)
 Frame = -3

Query  1645  VTVEQVTPP-------TFPSGPLSPSEERIVQLFENNTYSVVNIFDVTLRPRLNVGGAVE  1487
             + +  V PP       T P   L   E   VQLF+ NT SVV I ++  R        +E
Sbjct  91    IALSAVAPPLDAHAFVTAPPRKLQSDELATVQLFKLNTPSVVYITNLAARRDAFTLDVLE  150

Query  1486  IPEGNGSGVVWDGEGNIVTNYHVI  1415
             +P+G+GSG VWD EG++VTN+HVI
Sbjct  151   VPQGSGSGFVWDKEGHVVTNFHVI  174



>ref|XP_008806894.1| PREDICTED: protease Do-like 1, chloroplastic [Phoenix dactylifera]
Length=495

 Score =   241 bits (615),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 136/236 (58%), Positives = 165/236 (70%), Gaps = 2/236 (1%)
 Frame = -2

Query  1208  QKNFEGKLVGADRSKDLAVLKVEASEDLLRPTKIGESSSLRVGQKCLAIGNPFGFDHTLT  1029
             Q   E K+VG D+ KD+AVL+++A +D LRP  IG S+ L VGQK  AIGNPFG DHTLT
Sbjct  244   QSVCEAKVVGFDQDKDVAVLRIDAPKDKLRPIPIGISADLLVGQKVYAIGNPFGLDHTLT  303

Query  1028  VGVISGLNRDIYSQ-TGVTISGGIQTDAAINPGNSGGPLLDSKGNLIGINTAIFTQTGTS  852
              GVISGL R+I S  TG  I   IQTDAAINPGNSGGPLLDS G+LIGINTAI++ +G S
Sbjct  304   TGVISGLRREISSAATGRPIQDVIQTDAAINPGNSGGPLLDSSGSLIGINTAIYSPSGAS  363

Query  851   AGVGFAIPSSTVLRIVPQLIQSGKVVRAGLNIDIAPDAIANQLNVRNGALVLLVPGNSLA  672
             +GVGF+IP  TV  IV QL++ GKV R  L I  APD    QL V +G LVL  P N  A
Sbjct  364   SGVGFSIPVDTVGGIVDQLVRFGKVTRPILGIKFAPDQSVEQLGV-SGVLVLDAPPNGPA  422

Query  671   AKAGILPTTRGFAGNIVLGDIIEAVDNKPVRNKADLYKVLDDYSVGDKVQLKIRRG  504
              KAG+ PT R   G ++LGDII +V+ K V N +DLY++LD   VGD V +++ RG
Sbjct  423   GKAGLQPTKRDTYGRLILGDIITSVNGKKVTNGSDLYRILDQCKVGDTVTVEVLRG  478


 Score = 60.1 bits (144),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 29/62 (47%), Positives = 41/62 (66%), Gaps = 0/62 (0%)
 Frame = -3

Query  1600  LSPSEERIVQLFENNTYSVVNIFDVTLRPRLNVGGAVEIPEGNGSGVVWDGEGNIVTNYH  1421
             L   E   V+LF+ NT SVV I ++ +R        +E+P+G+GSG VWD +G++VTNYH
Sbjct  170   LQSDELATVRLFQENTPSVVYITNLAVRQDAFTLDVLEVPQGSGSGFVWDKDGHVVTNYH  229

Query  1420  VI  1415
             VI
Sbjct  230   VI  231



>gb|EYU34714.1| hypothetical protein MIMGU_mgv1a006761mg [Erythranthe guttata]
Length=432

 Score =   239 bits (609),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 134/236 (57%), Positives = 163/236 (69%), Gaps = 2/236 (1%)
 Frame = -2

Query  1208  QKNFEGKLVGADRSKDLAVLKVEASEDLLRPTKIGESSSLRVGQKCLAIGNPFGFDHTLT  1029
             Q  ++ K+VG D+ KD+AVL ++A +D LRP  IG S+ L VGQK  AIGNPFG DHTLT
Sbjct  181   QSTYDAKVVGFDQDKDVAVLSIDAPKDKLRPLPIGVSADLLVGQKVFAIGNPFGLDHTLT  240

Query  1028  VGVISGLNRDIYSQ-TGVTISGGIQTDAAINPGNSGGPLLDSKGNLIGINTAIFTQTGTS  852
              GVISGL R+I S  TG  I   IQTDAAINPGNSGGPLLDS G+LIGINTAI++ +G S
Sbjct  241   TGVISGLRREISSAATGRPIQDVIQTDAAINPGNSGGPLLDSSGSLIGINTAIYSPSGAS  300

Query  851   AGVGFAIPSSTVLRIVPQLIQSGKVVRAGLNIDIAPDAIANQLNVRNGALVLLVPGNSLA  672
             +GVGF+IP  TV  IV QL++ GKV R  L I  APD    QL V +G LVL  P N  A
Sbjct  301   SGVGFSIPVDTVSGIVDQLVKFGKVTRPILGIKFAPDQSVEQLGV-SGVLVLDAPANGPA  359

Query  671   AKAGILPTTRGFAGNIVLGDIIEAVDNKPVRNKADLYKVLDDYSVGDKVQLKIRRG  504
              KAG+  T R   G +VLGDII +V+   V N +DLY++LD   VGD V +++ RG
Sbjct  360   GKAGLQSTKRDAYGRLVLGDIITSVNGTKVSNGSDLYRILDQCKVGDNVIVEVLRG  415


 Score = 58.2 bits (139),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 34/92 (37%), Positives = 50/92 (54%), Gaps = 2/92 (2%)
 Frame = -3

Query  1684  FITLQAYALGDPSVTVEQVTPPTFPSGP--LSPSEERIVQLFENNTYSVVNIFDVTLRPR  1511
             F+   + AL       +  +   F + P  L   E   V+LF+ NT SVV I ++  R  
Sbjct  77    FVLCASVALSASLFVADVDSAAAFVASPRKLQSDELATVRLFQENTPSVVYITNLASRQD  136

Query  1510  LNVGGAVEIPEGNGSGVVWDGEGNIVTNYHVI  1415
                   +E+P+G+GSG VWD +G+IVTN+HVI
Sbjct  137   AFTLDVLEVPQGSGSGFVWDTKGHIVTNFHVI  168



>ref|XP_003618288.1| Serine-type peptidase [Medicago truncatula]
 gb|AES74506.1| trypsin-like serine protease [Medicago truncatula]
 gb|AFK43894.1| unknown [Medicago truncatula]
Length=432

 Score =   238 bits (607),  Expect = 4e-68, Method: Compositional matrix adjust.
 Identities = 134/236 (57%), Positives = 164/236 (69%), Gaps = 2/236 (1%)
 Frame = -2

Query  1208  QKNFEGKLVGADRSKDLAVLKVEASEDLLRPTKIGESSSLRVGQKCLAIGNPFGFDHTLT  1029
             Q  ++ K+VG D+ KD+AVL+V+A +D LRP  +G S+ L VGQK  AIGNPFG DHTLT
Sbjct  181   QSTYDAKVVGFDQDKDVAVLRVDAPKDKLRPIPVGVSADLLVGQKVYAIGNPFGLDHTLT  240

Query  1028  VGVISGLNRDIYSQ-TGVTISGGIQTDAAINPGNSGGPLLDSKGNLIGINTAIFTQTGTS  852
              GVISGL R+I S  TG  I   IQTDAAINPGNSGGPLLDS GNLIGINTAI++ +G S
Sbjct  241   TGVISGLRREISSAATGRPIQDVIQTDAAINPGNSGGPLLDSSGNLIGINTAIYSPSGAS  300

Query  851   AGVGFAIPSSTVLRIVPQLIQSGKVVRAGLNIDIAPDAIANQLNVRNGALVLLVPGNSLA  672
             +GVGF+IP  TV  IV QL++ GKV R  L I  APD    QL V +G LVL  P    A
Sbjct  301   SGVGFSIPVDTVNGIVDQLVKFGKVTRPILGIKFAPDQSVEQLGV-SGVLVLDAPVTGPA  359

Query  671   AKAGILPTTRGFAGNIVLGDIIEAVDNKPVRNKADLYKVLDDYSVGDKVQLKIRRG  504
              KAG+  T R   G ++LGDII +V+   V N +DLY++LD   VGDKV +++ RG
Sbjct  360   GKAGLQSTKRDSYGRLILGDIITSVNGNKVANGSDLYRILDQCKVGDKVIVEVLRG  415


 Score = 59.7 bits (143),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 37/95 (39%), Positives = 53/95 (56%), Gaps = 5/95 (5%)
 Frame = -3

Query  1696  LCTQF-ITLQAYALGDPSVTVEQVTPPTFPSGPLSPSEERIVQLFENNTYSVVNIFDVTL  1520
             LCT   ++L  +     S +   VT P      L   E   V+LF+ NT SVV I ++ +
Sbjct  78    LCTSLALSLTLFISNVDSASAFVVTAPR----KLQTDELATVRLFQENTPSVVYITNLAV  133

Query  1519  RPRLNVGGAVEIPEGNGSGVVWDGEGNIVTNYHVI  1415
             +        +E+P+G+GSG VWD +G+IVTNYHVI
Sbjct  134   KQDAFTLDVLEVPQGSGSGFVWDKDGHIVTNYHVI  168



>pdb|3QO6|A Chain A, Crystal Structure Analysis Of The Plant Protease Deg1
 pdb|3QO6|B Chain B, Crystal Structure Analysis Of The Plant Protease Deg1
 pdb|3QO6|C Chain C, Crystal Structure Analysis Of The Plant Protease Deg1
Length=348

 Score =   235 bits (600),  Expect = 5e-68, Method: Compositional matrix adjust.
 Identities = 132/236 (56%), Positives = 164/236 (69%), Gaps = 2/236 (1%)
 Frame = -2

Query  1208  QKNFEGKLVGADRSKDLAVLKVEASEDLLRPTKIGESSSLRVGQKCLAIGNPFGFDHTLT  1029
             Q  F+ K+VG D+ KD+AVL+++A ++ LRP  +G S+ L VGQK  AIGNPFG DHTLT
Sbjct  86    QTTFDAKVVGFDQDKDVAVLRIDAPKNKLRPIPVGVSADLLVGQKVFAIGNPFGLDHTLT  145

Query  1028  VGVISGLNRDIYSQ-TGVTISGGIQTDAAINPGNSGGPLLDSKGNLIGINTAIFTQTGTS  852
              GVISGL R+I S  TG  I   IQTDAAINPGNSGGPLLDS G LIGINTAI++ +G S
Sbjct  146   TGVISGLRREISSAATGRPIQDVIQTDAAINPGNSGGPLLDSSGTLIGINTAIYSPSGAS  205

Query  851   AGVGFAIPSSTVLRIVPQLIQSGKVVRAGLNIDIAPDAIANQLNVRNGALVLLVPGNSLA  672
             +GVGF+IP  TV  IV QL++ GKV R  L I  APD    QL V +G LVL  P +  A
Sbjct  206   SGVGFSIPVDTVGGIVDQLVRFGKVTRPILGIKFAPDQSVEQLGV-SGVLVLDAPPSGPA  264

Query  671   AKAGILPTTRGFAGNIVLGDIIEAVDNKPVRNKADLYKVLDDYSVGDKVQLKIRRG  504
              KAG+  T R   G +VLGDII +V+   V N +DLY++LD   VGD+V +++ RG
Sbjct  265   GKAGLQSTKRDGYGRLVLGDIITSVNGTKVSNGSDLYRILDQCKVGDEVTVEVLRG  320


 Score = 59.7 bits (143),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 30/62 (48%), Positives = 41/62 (66%), Gaps = 0/62 (0%)
 Frame = -3

Query  1600  LSPSEERIVQLFENNTYSVVNIFDVTLRPRLNVGGAVEIPEGNGSGVVWDGEGNIVTNYH  1421
             L   E   V+LF+ NT SVV I ++ +R        +E+P+G+GSG VWD +G+IVTNYH
Sbjct  12    LQTDELATVRLFQENTPSVVYITNLAVRQDAFTLDVLEVPQGSGSGFVWDKQGHIVTNYH  71

Query  1420  VI  1415
             VI
Sbjct  72    VI  73



>ref|XP_001775937.1| predicted protein [Physcomitrella patens]
 gb|EDQ59302.1| predicted protein [Physcomitrella patens]
Length=341

 Score =   235 bits (599),  Expect = 6e-68, Method: Compositional matrix adjust.
 Identities = 131/236 (56%), Positives = 159/236 (67%), Gaps = 2/236 (1%)
 Frame = -2

Query  1208  QKNFEGKLVGADRSKDLAVLKVEASEDLLRPTKIGESSSLRVGQKCLAIGNPFGFDHTLT  1029
             Q  +E  +VG D  KD+AVL ++A E+ LRP  +G S  L VGQK  AIGNPFG DHTLT
Sbjct  93    QTVYEADIVGYDEDKDVAVLHIDAPEEELRPLPVGTSYDLLVGQKVFAIGNPFGLDHTLT  152

Query  1028  VGVISGLNRDIYSQ-TGVTISGGIQTDAAINPGNSGGPLLDSKGNLIGINTAIFTQTGTS  852
              GVISGL R+I S  TG  I   IQTDAAINPGNSGGPLLDS GNLIGINTAI++ +G S
Sbjct  153   TGVISGLRREISSAATGRPIQDVIQTDAAINPGNSGGPLLDSGGNLIGINTAIYSPSGAS  212

Query  851   AGVGFAIPSSTVLRIVPQLIQSGKVVRAGLNIDIAPDAIANQLNVRNGALVLLVPGNSLA  672
             +GVGF+IP  TV  IV Q+++ G V R  L I  APD     L V +G LVL  P N  A
Sbjct  213   SGVGFSIPVDTVSSIVEQIVKYGGVTRPVLGISFAPDQSVEPLGV-SGVLVLDAPPNGPA  271

Query  671   AKAGILPTTRGFAGNIVLGDIIEAVDNKPVRNKADLYKVLDDYSVGDKVQLKIRRG  504
              KAG+  T R   G +VLGD+I +++ K + N +DLYK+LD   VGD V L++ RG
Sbjct  272   GKAGLHSTRRDSYGRLVLGDVITSMNGKKISNGSDLYKILDRCKVGDTVNLEVLRG  327


 Score = 58.5 bits (140),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 34/78 (44%), Positives = 49/78 (63%), Gaps = 7/78 (9%)
 Frame = -3

Query  1600  LSPSEERIVQLFENNTYSVVNIFDVTLRPR----LNVGGAVEIPEGNGSGVVWDGEGNIV  1433
             L   E   V+LF++NT SVV I ++  R R    L+V   +++P+G+GSG VWD +G+IV
Sbjct  18    LQGDELATVELFQDNTPSVVYITNLAFRRRDVFTLDV---MQVPQGSGSGFVWDKKGHIV  74

Query  1432  TNYHVIGNSLSRNPTRGE  1379
             TNYHVI  +     T G+
Sbjct  75    TNYHVIRGASDLRVTMGD  92



>ref|XP_006291165.1| hypothetical protein CARUB_v10017283mg [Capsella rubella]
 gb|EOA24063.1| hypothetical protein CARUB_v10017283mg [Capsella rubella]
Length=435

 Score =   237 bits (605),  Expect = 8e-68, Method: Compositional matrix adjust.
 Identities = 133/236 (56%), Positives = 164/236 (69%), Gaps = 2/236 (1%)
 Frame = -2

Query  1208  QKNFEGKLVGADRSKDLAVLKVEASEDLLRPTKIGESSSLRVGQKCLAIGNPFGFDHTLT  1029
             Q  F+ K+VG D+ KD+AVL+++A +D LRP  +G S+ L VGQK  AIGNPFG DHTLT
Sbjct  184   QSTFDAKVVGFDQDKDVAVLRIDAPKDKLRPIPVGVSADLLVGQKVFAIGNPFGLDHTLT  243

Query  1028  VGVISGLNRDIYSQ-TGVTISGGIQTDAAINPGNSGGPLLDSKGNLIGINTAIFTQTGTS  852
              GVISGL R+I S  TG  I   IQTDAAINPGNSGGPLLDS G LIGINTAI++ +G S
Sbjct  244   TGVISGLRREISSAATGRPIQDVIQTDAAINPGNSGGPLLDSSGTLIGINTAIYSPSGAS  303

Query  851   AGVGFAIPSSTVLRIVPQLIQSGKVVRAGLNIDIAPDAIANQLNVRNGALVLLVPGNSLA  672
             +GVGF+IP  TV  IV QL++ GKV R  L I  APD    QL V +G LVL  P +  A
Sbjct  304   SGVGFSIPVDTVGGIVDQLVKFGKVTRPILGIKFAPDQSVEQLGV-SGVLVLDAPPSGPA  362

Query  671   AKAGILPTTRGFAGNIVLGDIIEAVDNKPVRNKADLYKVLDDYSVGDKVQLKIRRG  504
              KAG+  T R   G +VLGDII +V+   V N +DLY++LD   VGD+V +++ RG
Sbjct  363   GKAGLQSTKRDGYGRLVLGDIITSVNGTKVSNGSDLYRILDQCKVGDEVTVEVLRG  418


 Score = 60.8 bits (146),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 30/62 (48%), Positives = 41/62 (66%), Gaps = 0/62 (0%)
 Frame = -3

Query  1600  LSPSEERIVQLFENNTYSVVNIFDVTLRPRLNVGGAVEIPEGNGSGVVWDGEGNIVTNYH  1421
             L   E   V+LF+ NT SVV I ++ +R        +E+P+G+GSG VWD +G+IVTNYH
Sbjct  110   LQTDELATVRLFQENTPSVVYITNLAVRQDAFTLDVLEVPQGSGSGFVWDKQGHIVTNYH  169

Query  1420  VI  1415
             VI
Sbjct  170   VI  171



>ref|XP_010502800.1| PREDICTED: protease Do-like 1, chloroplastic [Camelina sativa]
Length=444

 Score =   238 bits (606),  Expect = 9e-68, Method: Compositional matrix adjust.
 Identities = 133/236 (56%), Positives = 164/236 (69%), Gaps = 2/236 (1%)
 Frame = -2

Query  1208  QKNFEGKLVGADRSKDLAVLKVEASEDLLRPTKIGESSSLRVGQKCLAIGNPFGFDHTLT  1029
             Q  F+ K+VG D+ KD+AVL+++A +D LRP  +G S+ L VGQK  AIGNPFG DHTLT
Sbjct  193   QSTFDAKVVGFDQDKDVAVLRIDAPKDKLRPIPVGVSADLLVGQKVFAIGNPFGLDHTLT  252

Query  1028  VGVISGLNRDIYSQ-TGVTISGGIQTDAAINPGNSGGPLLDSKGNLIGINTAIFTQTGTS  852
              GVISGL R+I S  TG  I   IQTDAAINPGNSGGPLLDS G LIGINTAI++ +G S
Sbjct  253   TGVISGLRREISSAATGRPIQDVIQTDAAINPGNSGGPLLDSSGTLIGINTAIYSPSGAS  312

Query  851   AGVGFAIPSSTVLRIVPQLIQSGKVVRAGLNIDIAPDAIANQLNVRNGALVLLVPGNSLA  672
             +GVGF+IP  TV  IV QL++ GKV R  L I  APD    QL V +G LVL  P +  A
Sbjct  313   SGVGFSIPVDTVGGIVDQLVRFGKVTRPILGIKFAPDQSVEQLGV-SGVLVLDAPPSGPA  371

Query  671   AKAGILPTTRGFAGNIVLGDIIEAVDNKPVRNKADLYKVLDDYSVGDKVQLKIRRG  504
              KAG+  T R   G +VLGDII +V+   V N +DLY++LD   VGD+V +++ RG
Sbjct  372   GKAGLQSTKRDGYGRLVLGDIITSVNGTKVSNGSDLYRILDQCKVGDEVTVEVLRG  427


 Score = 62.4 bits (150),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 37/94 (39%), Positives = 51/94 (54%), Gaps = 1/94 (1%)
 Frame = -3

Query  1696  LCTQFITLQAYALGDPSVTVEQVTPPTFPSGPLSPSEERIVQLFENNTYSVVNIFDVTLR  1517
             LCT F    +     P+V        + P   L   E   V+LF+ NT SVV I ++ +R
Sbjct  88    LCTSFALSFSLFAASPAVESASAFVVSTPR-KLQTDELATVRLFQENTPSVVYITNLAVR  146

Query  1516  PRLNVGGAVEIPEGNGSGVVWDGEGNIVTNYHVI  1415
                     +E+P+G+GSG VWD +G+IVTNYHVI
Sbjct  147   QDAFTLDVLEVPQGSGSGFVWDKQGHIVTNYHVI  180



>ref|NP_001056360.1| Os05g0568900 [Oryza sativa Japonica Group]
 gb|AAT93929.1| putative DegP protease [Oryza sativa Japonica Group]
 gb|AAU10675.1| putative DegP protease [Oryza sativa Japonica Group]
 dbj|BAF18274.1| Os05g0568900 [Oryza sativa Japonica Group]
 dbj|BAG87935.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAH00098.1| unnamed protein product [Oryza sativa Japonica Group]
Length=437

 Score =   237 bits (605),  Expect = 9e-68, Method: Compositional matrix adjust.
 Identities = 132/236 (56%), Positives = 164/236 (69%), Gaps = 2/236 (1%)
 Frame = -2

Query  1208  QKNFEGKLVGADRSKDLAVLKVEASEDLLRPTKIGESSSLRVGQKCLAIGNPFGFDHTLT  1029
             Q  +E ++VG D+ KD+AVL+++A  D LRP  +G S+ L VGQK  AIGNPFG DHTLT
Sbjct  186   QTVYEAQVVGFDQDKDVAVLRIKAPTDKLRPVPVGVSADLLVGQKVFAIGNPFGLDHTLT  245

Query  1028  VGVISGLNRDIYSQ-TGVTISGGIQTDAAINPGNSGGPLLDSKGNLIGINTAIFTQTGTS  852
              GVISGL R+I S  TG  I   IQTDAAINPGNSGGPLLDS GNLIG+NTAI++ +G S
Sbjct  246   TGVISGLRREISSAATGRPIQDVIQTDAAINPGNSGGPLLDSSGNLIGVNTAIYSPSGAS  305

Query  851   AGVGFAIPSSTVLRIVPQLIQSGKVVRAGLNIDIAPDAIANQLNVRNGALVLLVPGNSLA  672
             +GVGF+IP  TV  IV QLI+ GKV R  L I  APD    QL + +G LVL  P N  A
Sbjct  306   SGVGFSIPVDTVGGIVDQLIKFGKVTRPILGIKFAPDQSVEQLGL-SGVLVLDAPPNGPA  364

Query  671   AKAGILPTTRGFAGNIVLGDIIEAVDNKPVRNKADLYKVLDDYSVGDKVQLKIRRG  504
              KAG+  T R   G ++LGDII +V+   V N +DLY++LD   VG+KV +++ RG
Sbjct  365   GKAGLQSTKRDSYGRLILGDIITSVNGTKVTNGSDLYRILDQCKVGEKVTVEVLRG  420


 Score = 58.2 bits (139),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 29/62 (47%), Positives = 40/62 (65%), Gaps = 0/62 (0%)
 Frame = -3

Query  1600  LSPSEERIVQLFENNTYSVVNIFDVTLRPRLNVGGAVEIPEGNGSGVVWDGEGNIVTNYH  1421
             L   E   V+LF+ NT SVV I ++ +R        +E+P+G+GSG VWD  G+IVTN+H
Sbjct  112   LQADELATVRLFQENTPSVVYITNLAVRQDAFTLDVLEVPQGSGSGFVWDKSGHIVTNFH  171

Query  1420  VI  1415
             VI
Sbjct  172   VI  173



>gb|EEE64736.1| hypothetical protein OsJ_19592 [Oryza sativa Japonica Group]
Length=437

 Score =   237 bits (605),  Expect = 9e-68, Method: Compositional matrix adjust.
 Identities = 132/236 (56%), Positives = 164/236 (69%), Gaps = 2/236 (1%)
 Frame = -2

Query  1208  QKNFEGKLVGADRSKDLAVLKVEASEDLLRPTKIGESSSLRVGQKCLAIGNPFGFDHTLT  1029
             Q  +E ++VG D+ KD+AVL+++A  D LRP  +G S+ L VGQK  AIGNPFG DHTLT
Sbjct  186   QTVYEAQVVGFDQDKDVAVLRIKAPTDKLRPVPVGVSADLLVGQKVFAIGNPFGLDHTLT  245

Query  1028  VGVISGLNRDIYSQ-TGVTISGGIQTDAAINPGNSGGPLLDSKGNLIGINTAIFTQTGTS  852
              GVISGL R+I S  TG  I   IQTDAAINPGNSGGPLLDS GNLIG+NTAI++ +G S
Sbjct  246   TGVISGLRREISSAATGRPIQDVIQTDAAINPGNSGGPLLDSSGNLIGVNTAIYSPSGAS  305

Query  851   AGVGFAIPSSTVLRIVPQLIQSGKVVRAGLNIDIAPDAIANQLNVRNGALVLLVPGNSLA  672
             +GVGF+IP  TV  IV QLI+ GKV R  L I  APD    QL + +G LVL  P N  A
Sbjct  306   SGVGFSIPVDTVGGIVDQLIKFGKVTRPILGIKFAPDQSVEQLGL-SGVLVLDAPPNGPA  364

Query  671   AKAGILPTTRGFAGNIVLGDIIEAVDNKPVRNKADLYKVLDDYSVGDKVQLKIRRG  504
              KAG+  T R   G ++LGDII +V+   V N +DLY++LD   VG+KV +++ RG
Sbjct  365   GKAGLQSTKRDSYGRLILGDIITSVNGTKVTNGSDLYRILDQCKVGEKVTVEVLRG  420


 Score = 56.6 bits (135),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 29/62 (47%), Positives = 39/62 (63%), Gaps = 0/62 (0%)
 Frame = -3

Query  1600  LSPSEERIVQLFENNTYSVVNIFDVTLRPRLNVGGAVEIPEGNGSGVVWDGEGNIVTNYH  1421
             L   E   V LF+ NT SVV I ++ +R        +E+P+G+GSG VWD  G+IVTN+H
Sbjct  112   LQADELATVGLFQGNTPSVVYITNLAVRQDAFTLDVLEVPQGSGSGFVWDKSGHIVTNFH  171

Query  1420  VI  1415
             VI
Sbjct  172   VI  173



>ref|WP_013247542.1| 2-alkenal reductase [Candidatus Nitrospira defluvii]
 ref|YP_003796642.1| peptidase S1C, HtrA family [Candidatus Nitrospira defluvii]
 emb|CBK40716.1| Peptidase S1C, HtrA family [Candidatus Nitrospira defluvii]
Length=372

 Score =   235 bits (600),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 127/235 (54%), Positives = 161/235 (69%), Gaps = 1/235 (0%)
 Frame = -2

Query  1208  QKNFEGKLVGADRSKDLAVLKVEASEDLLRPTKIGESSSLRVGQKCLAIGNPFGFDHTLT  1029
             +  F+ K+VGAD   DLAVL+++ASE  L+P  IG S SLRVGQK LAIGNPFG DHTLT
Sbjct  125   RTEFKAKVVGADPDHDLAVLQIQASEAALQPVIIGNSQSLRVGQKVLAIGNPFGLDHTLT  184

Query  1028  VGVISGLNRDIYSQTGVTISGGIQTDAAINPGNSGGPLLDSKGNLIGINTAIFTQTGTSA  849
              GV+S L R I S +  TI G IQTDAAINPGNSGGPLLDS G LIG+NT I + +G  A
Sbjct  185   TGVVSALGRTIKSMSNRTIEGVIQTDAAINPGNSGGPLLDSGGRLIGVNTQIMSPSGAFA  244

Query  848   GVGFAIPSSTVLRIVPQLIQSGKVVRAGLNIDIAPDAIANQLNVRNGALVLLVPGNSLAA  669
             G+GFA+P  TV RIVP+LI+ GK++R GL I + PDA+A +  V+ G ++  V   S+A 
Sbjct  245   GIGFAVPVDTVNRIVPELIKHGKLIRPGLGISLVPDAMARRWGVK-GVIIGKVGRGSIAE  303

Query  668   KAGILPTTRGFAGNIVLGDIIEAVDNKPVRNKADLYKVLDDYSVGDKVQLKIRRG  504
             + G+        G I LGDII AVD KPV    DL  +++ + VGD+V ++  RG
Sbjct  304   RIGLHGARETGGGRIELGDIIVAVDGKPVDTIDDLMDLMEQHKVGDEVTIEYVRG  358


 Score = 54.7 bits (130),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 32/83 (39%), Positives = 46/83 (55%), Gaps = 4/83 (5%)
 Frame = -3

Query  1663  ALGDPSVTVEQVTPPTFPSGPLSPSEERIVQLFENNTYSVVNIFDVTLRPRLNVGGAVEI  1484
             A G   + + Q   PT     LSP E+  + +FE  T SVV I +  ++         E+
Sbjct  34    AEGTNGLLIAQSAAPT----ELSPEEQATIAVFERATRSVVFIANTAMQRDPWSFNLFEV  89

Query  1483  PEGNGSGVVWDGEGNIVTNYHVI  1415
             P+G+G+G VW  +G+IVTNYHVI
Sbjct  90    PQGSGTGFVWSRQGHIVTNYHVI  112



>ref|XP_010514501.1| PREDICTED: protease Do-like 1, chloroplastic [Camelina sativa]
Length=445

 Score =   237 bits (605),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 133/236 (56%), Positives = 164/236 (69%), Gaps = 2/236 (1%)
 Frame = -2

Query  1208  QKNFEGKLVGADRSKDLAVLKVEASEDLLRPTKIGESSSLRVGQKCLAIGNPFGFDHTLT  1029
             Q  F+ K+VG D+ KD+AVL+++A +D LRP  +G S+ L VGQK  AIGNPFG DHTLT
Sbjct  194   QSTFDAKVVGFDQDKDVAVLRIDAPKDKLRPIPVGVSADLLVGQKVFAIGNPFGLDHTLT  253

Query  1028  VGVISGLNRDIYSQ-TGVTISGGIQTDAAINPGNSGGPLLDSKGNLIGINTAIFTQTGTS  852
              GVISGL R+I S  TG  I   IQTDAAINPGNSGGPLLDS G LIGINTAI++ +G S
Sbjct  254   TGVISGLRREISSAATGRPIQDVIQTDAAINPGNSGGPLLDSSGTLIGINTAIYSPSGAS  313

Query  851   AGVGFAIPSSTVLRIVPQLIQSGKVVRAGLNIDIAPDAIANQLNVRNGALVLLVPGNSLA  672
             +GVGF+IP  TV  IV QL++ GKV R  L I  APD    QL V +G LVL  P +  A
Sbjct  314   SGVGFSIPVDTVGGIVDQLVRFGKVTRPILGIKFAPDQSVEQLGV-SGVLVLDAPPSGPA  372

Query  671   AKAGILPTTRGFAGNIVLGDIIEAVDNKPVRNKADLYKVLDDYSVGDKVQLKIRRG  504
              KAG+  T R   G +VLGDII +V+   V N +DLY++LD   VGD+V +++ RG
Sbjct  373   GKAGLQSTKRDGYGRLVLGDIITSVNGTKVSNGSDLYRILDQCKVGDEVTVEVLRG  428


 Score = 60.5 bits (145),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 30/62 (48%), Positives = 41/62 (66%), Gaps = 0/62 (0%)
 Frame = -3

Query  1600  LSPSEERIVQLFENNTYSVVNIFDVTLRPRLNVGGAVEIPEGNGSGVVWDGEGNIVTNYH  1421
             L   E   V+LF+ NT SVV I ++ +R        +E+P+G+GSG VWD +G+IVTNYH
Sbjct  120   LQTDELATVRLFQENTPSVVYITNLAVRQDAFTLDVLEVPQGSGSGFVWDKQGHIVTNYH  179

Query  1420  VI  1415
             VI
Sbjct  180   VI  181



>ref|XP_010924255.1| PREDICTED: protease Do-like 1, chloroplastic [Elaeis guineensis]
Length=498

 Score =   239 bits (609),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 133/236 (56%), Positives = 165/236 (70%), Gaps = 2/236 (1%)
 Frame = -2

Query  1208  QKNFEGKLVGADRSKDLAVLKVEASEDLLRPTKIGESSSLRVGQKCLAIGNPFGFDHTLT  1029
             Q  +E K+VG D+ KD+AVL+++A +  LRP  +G S+ L VGQK  AIGNPFG DHTLT
Sbjct  247   QSVYEAKVVGFDQDKDVAVLRIDAPKGKLRPIPVGISADLLVGQKVFAIGNPFGLDHTLT  306

Query  1028  VGVISGLNRDIYSQ-TGVTISGGIQTDAAINPGNSGGPLLDSKGNLIGINTAIFTQTGTS  852
              GVISGL R+I S  TG  I   IQTDAAINPGNSGGPLLDS G+LIGINTAI++ +G S
Sbjct  307   TGVISGLRREISSAATGRPIQDVIQTDAAINPGNSGGPLLDSSGSLIGINTAIYSPSGAS  366

Query  851   AGVGFAIPSSTVLRIVPQLIQSGKVVRAGLNIDIAPDAIANQLNVRNGALVLLVPGNSLA  672
             +GVGF+IP  TV  IV QL++ G+V R  L I  APD    QL V +G LVL  P N  A
Sbjct  367   SGVGFSIPVDTVGGIVDQLVKFGRVTRPILGIKFAPDQSVEQLGV-SGVLVLDAPANGPA  425

Query  671   AKAGILPTTRGFAGNIVLGDIIEAVDNKPVRNKADLYKVLDDYSVGDKVQLKIRRG  504
              KAG+ PT R   G ++LGDII +V+ K V N +DLY++LD   VGD V +++ RG
Sbjct  426   GKAGLRPTKRDTYGRLILGDIITSVNGKKVTNGSDLYRILDQCKVGDTVIVEVLRG  481


 Score = 60.8 bits (146),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 30/62 (48%), Positives = 41/62 (66%), Gaps = 0/62 (0%)
 Frame = -3

Query  1600  LSPSEERIVQLFENNTYSVVNIFDVTLRPRLNVGGAVEIPEGNGSGVVWDGEGNIVTNYH  1421
             L   E   V+LF+ NT SVV I ++ +R        +E+P+G+GSG VWD +G+IVTNYH
Sbjct  173   LQSDELATVRLFQENTPSVVYITNLAVRQDAFTLDVLEVPQGSGSGFVWDKDGHIVTNYH  232

Query  1420  VI  1415
             VI
Sbjct  233   VI  234



>emb|CDP02112.1| unnamed protein product [Coffea canephora]
Length=454

 Score =   238 bits (606),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 132/236 (56%), Positives = 164/236 (69%), Gaps = 2/236 (1%)
 Frame = -2

Query  1208  QKNFEGKLVGADRSKDLAVLKVEASEDLLRPTKIGESSSLRVGQKCLAIGNPFGFDHTLT  1029
             Q  ++ K+VG D+ KD+AVL++ A +D LRP  IG S  L VGQK  AIGNPFG DHTLT
Sbjct  202   QSTYDAKIVGYDQDKDVAVLRINAPKDKLRPIPIGVSGDLLVGQKVFAIGNPFGLDHTLT  261

Query  1028  VGVISGLNRDIYSQ-TGVTISGGIQTDAAINPGNSGGPLLDSKGNLIGINTAIFTQTGTS  852
              GVISGL R+I S  +G  I   IQTDAAINPGNSGGPLLDS G+LIGINTAI++ +G S
Sbjct  262   TGVISGLRREINSAASGRPIQDVIQTDAAINPGNSGGPLLDSSGSLIGINTAIYSPSGAS  321

Query  851   AGVGFAIPSSTVLRIVPQLIQSGKVVRAGLNIDIAPDAIANQLNVRNGALVLLVPGNSLA  672
             +GVGF+IP  TV  IV QL++ GKV R  L I  APD    QL V +G LVL  P N  A
Sbjct  322   SGVGFSIPVDTVGGIVDQLVKFGKVTRPILGIKFAPDQSVEQLGV-SGVLVLDAPPNGPA  380

Query  671   AKAGILPTTRGFAGNIVLGDIIEAVDNKPVRNKADLYKVLDDYSVGDKVQLKIRRG  504
              KAG+ PT R   G ++LGDII +V+ K V N +DLY++LD   VG++V +++ R 
Sbjct  381   GKAGLQPTKRDSFGRLILGDIITSVNGKKVSNGSDLYRILDQCKVGEEVIVEVLRA  436


 Score = 57.0 bits (136),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 36/93 (39%), Positives = 51/93 (55%), Gaps = 9/93 (10%)
 Frame = -3

Query  1693  CTQFITLQAYALGDPSVTVEQVTPPTFPSGPLSPSEERIVQLFENNTYSVVNIFDVTLRP  1514
             C+ F++  A A    S  V   TP    S  L+      V+LF+ NT SVV I ++  + 
Sbjct  106   CSLFLSDVAPA----SAFVSTTTPRKLQSDELA-----TVRLFQENTPSVVYITNLAAKQ  156

Query  1513  RLNVGGAVEIPEGNGSGVVWDGEGNIVTNYHVI  1415
                     E+P+G+GSG VWD +G+IVTN+HVI
Sbjct  157   DAFTLDIFEVPQGSGSGFVWDKQGHIVTNFHVI  189



>ref|XP_010425574.1| PREDICTED: protease Do-like 1, chloroplastic [Camelina sativa]
Length=444

 Score =   237 bits (605),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 133/236 (56%), Positives = 164/236 (69%), Gaps = 2/236 (1%)
 Frame = -2

Query  1208  QKNFEGKLVGADRSKDLAVLKVEASEDLLRPTKIGESSSLRVGQKCLAIGNPFGFDHTLT  1029
             Q  F+ K+VG D+ KD+AVL+++A +D LRP  +G S+ L VGQK  AIGNPFG DHTLT
Sbjct  193   QSTFDAKVVGFDQDKDVAVLRIDAPKDKLRPIPVGVSADLLVGQKVFAIGNPFGLDHTLT  252

Query  1028  VGVISGLNRDIYSQ-TGVTISGGIQTDAAINPGNSGGPLLDSKGNLIGINTAIFTQTGTS  852
              GVISGL R+I S  TG  I   IQTDAAINPGNSGGPLLDS G LIGINTAI++ +G S
Sbjct  253   TGVISGLRREISSAATGRPIQDVIQTDAAINPGNSGGPLLDSSGTLIGINTAIYSPSGAS  312

Query  851   AGVGFAIPSSTVLRIVPQLIQSGKVVRAGLNIDIAPDAIANQLNVRNGALVLLVPGNSLA  672
             +GVGF+IP  TV  IV QL++ GKV R  L I  APD    QL V +G LVL  P +  A
Sbjct  313   SGVGFSIPVDTVGGIVDQLVRFGKVTRPILGIKFAPDQSVEQLGV-SGVLVLDAPPSGPA  371

Query  671   AKAGILPTTRGFAGNIVLGDIIEAVDNKPVRNKADLYKVLDDYSVGDKVQLKIRRG  504
              KAG+  T R   G +VLGDII +V+   V N +DLY++LD   VGD+V +++ RG
Sbjct  372   GKAGLQSTKRDGYGRLVLGDIITSVNGTKVSNGSDLYRILDQCKVGDEVTVEVLRG  427


 Score = 58.5 bits (140),  Expect = 9e-06, Method: Compositional matrix adjust.
 Identities = 30/62 (48%), Positives = 40/62 (65%), Gaps = 0/62 (0%)
 Frame = -3

Query  1600  LSPSEERIVQLFENNTYSVVNIFDVTLRPRLNVGGAVEIPEGNGSGVVWDGEGNIVTNYH  1421
             L   E   V+LF+ NT SVV I ++ +R        +E+P+G+GSG VWD  G+IVTNYH
Sbjct  119   LQTDELATVRLFQENTPSVVYITNLAVRQDAFTLDVLEVPQGSGSGFVWDKLGHIVTNYH  178

Query  1420  VI  1415
             VI
Sbjct  179   VI  180



>gb|EEC79717.1| hypothetical protein OsI_21033 [Oryza sativa Indica Group]
Length=437

 Score =   237 bits (604),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 132/236 (56%), Positives = 164/236 (69%), Gaps = 2/236 (1%)
 Frame = -2

Query  1208  QKNFEGKLVGADRSKDLAVLKVEASEDLLRPTKIGESSSLRVGQKCLAIGNPFGFDHTLT  1029
             Q  +E ++VG D+ KD+AVL+++A  D LRP  +G S+ L VGQK  AIGNPFG DHTLT
Sbjct  186   QTVYEAQVVGFDQDKDVAVLRIKAPTDKLRPIPVGVSADLLVGQKVFAIGNPFGLDHTLT  245

Query  1028  VGVISGLNRDIYSQ-TGVTISGGIQTDAAINPGNSGGPLLDSKGNLIGINTAIFTQTGTS  852
              GVISGL R+I S  TG  I   IQTDAAINPGNSGGPLLDS GNLIG+NTAI++ +G S
Sbjct  246   TGVISGLRREISSAATGRPIQDVIQTDAAINPGNSGGPLLDSSGNLIGVNTAIYSPSGAS  305

Query  851   AGVGFAIPSSTVLRIVPQLIQSGKVVRAGLNIDIAPDAIANQLNVRNGALVLLVPGNSLA  672
             +GVGF+IP  TV  IV QLI+ GKV R  L I  APD    QL + +G LVL  P N  A
Sbjct  306   SGVGFSIPVDTVGGIVDQLIKFGKVTRPILGIKFAPDQSVEQLGL-SGVLVLDAPPNGPA  364

Query  671   AKAGILPTTRGFAGNIVLGDIIEAVDNKPVRNKADLYKVLDDYSVGDKVQLKIRRG  504
              KAG+  T R   G ++LGDII +V+   V N +DLY++LD   VG+KV +++ RG
Sbjct  365   GKAGLQSTKRDSYGRLILGDIITSVNGTKVTNGSDLYRILDQCKVGEKVTVEVLRG  420


 Score = 58.2 bits (139),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 29/62 (47%), Positives = 40/62 (65%), Gaps = 0/62 (0%)
 Frame = -3

Query  1600  LSPSEERIVQLFENNTYSVVNIFDVTLRPRLNVGGAVEIPEGNGSGVVWDGEGNIVTNYH  1421
             L   E   V+LF+ NT SVV I ++ +R        +E+P+G+GSG VWD  G+IVTN+H
Sbjct  112   LQADELATVRLFQENTPSVVYITNLAVRQDAFTLDVLEVPQGSGSGFVWDKSGHIVTNFH  171

Query  1420  VI  1415
             VI
Sbjct  172   VI  173



>ref|NP_001242692.1| uncharacterized protein LOC100783304 [Glycine max]
 gb|ACU20930.1| unknown [Glycine max]
Length=431

 Score =   236 bits (602),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 134/236 (57%), Positives = 163/236 (69%), Gaps = 2/236 (1%)
 Frame = -2

Query  1208  QKNFEGKLVGADRSKDLAVLKVEASEDLLRPTKIGESSSLRVGQKCLAIGNPFGFDHTLT  1029
             Q  ++  +VG D+ KD+AVL+V+A +D LRP  IG S+   VGQK  AIGNPFG DHTLT
Sbjct  180   QSTYDANVVGFDQDKDVAVLRVDAPKDKLRPIPIGVSADPLVGQKVYAIGNPFGLDHTLT  239

Query  1028  VGVISGLNRDIYSQ-TGVTISGGIQTDAAINPGNSGGPLLDSKGNLIGINTAIFTQTGTS  852
              GVISGL R+I S  TG  I   IQTDAAINPGNSGGP LDS GNLIGINTAI++ +G S
Sbjct  240   TGVISGLRREISSAATGRPIQDVIQTDAAINPGNSGGPPLDSSGNLIGINTAIYSPSGAS  299

Query  851   AGVGFAIPSSTVLRIVPQLIQSGKVVRAGLNIDIAPDAIANQLNVRNGALVLLVPGNSLA  672
             +GVGF+IP  TV  IV QL++ GKV R  L I  APD    QL V +G LVL  P N  A
Sbjct  300   SGVGFSIPVDTVNGIVDQLVKFGKVTRPILGIKFAPDQSVEQLGV-SGVLVLDAPANGPA  358

Query  671   AKAGILPTTRGFAGNIVLGDIIEAVDNKPVRNKADLYKVLDDYSVGDKVQLKIRRG  504
              KAG+  T R   G  +LGDII +V++K V N +DLY++LD   VGDKV +++ RG
Sbjct  359   GKAGLQSTKRDSYGRPILGDIITSVNDKKVTNGSDLYRILDQCKVGDKVIVEVLRG  414


 Score = 60.1 bits (144),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 30/62 (48%), Positives = 41/62 (66%), Gaps = 0/62 (0%)
 Frame = -3

Query  1600  LSPSEERIVQLFENNTYSVVNIFDVTLRPRLNVGGAVEIPEGNGSGVVWDGEGNIVTNYH  1421
             L   E   V+LF+ NT SVV I ++ ++        +E+P+G+GSG VWD EG+IVTNYH
Sbjct  106   LQSDELATVRLFQENTPSVVYITNLAVKQDAFTLDVLEVPQGSGSGFVWDKEGHIVTNYH  165

Query  1420  VI  1415
             VI
Sbjct  166   VI  167



>ref|XP_004961178.1| PREDICTED: protease Do-like 1, chloroplastic-like [Setaria italica]
Length=444

 Score =   236 bits (602),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 131/236 (56%), Positives = 164/236 (69%), Gaps = 2/236 (1%)
 Frame = -2

Query  1208  QKNFEGKLVGADRSKDLAVLKVEASEDLLRPTKIGESSSLRVGQKCLAIGNPFGFDHTLT  1029
             Q  +E ++VG D+ KD+AVL+++A +D LRP  +G S+ L VGQK  AIGNPFG DHTLT
Sbjct  193   QSVYEAQVVGFDQDKDVAVLRIKAPKDKLRPIPVGVSADLLVGQKVYAIGNPFGLDHTLT  252

Query  1028  VGVISGLNRDIYSQ-TGVTISGGIQTDAAINPGNSGGPLLDSKGNLIGINTAIFTQTGTS  852
              GVISGL R+I S  TG  I   IQTDAAINPGNSGGPLLDS GNLIG+NTAI++ +G S
Sbjct  253   TGVISGLRREISSAATGRPIQDVIQTDAAINPGNSGGPLLDSSGNLIGVNTAIYSPSGAS  312

Query  851   AGVGFAIPSSTVLRIVPQLIQSGKVVRAGLNIDIAPDAIANQLNVRNGALVLLVPGNSLA  672
             +GVGF+IP  TV  IV QLI+ GKV R  L I  APD    QL + +G LVL  P N  A
Sbjct  313   SGVGFSIPVDTVGGIVDQLIKFGKVTRPILGIKFAPDQSVEQLGL-SGVLVLDAPSNGPA  371

Query  671   AKAGILPTTRGFAGNIVLGDIIEAVDNKPVRNKADLYKVLDDYSVGDKVQLKIRRG  504
              KAG+  T R   G ++LGDII +V+   V N +DLY++LD   VG+ V +++ RG
Sbjct  372   GKAGLQSTKRDAYGRLILGDIITSVNGTKVTNGSDLYRILDQCKVGETVTVEVLRG  427


 Score = 58.2 bits (139),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 29/62 (47%), Positives = 40/62 (65%), Gaps = 0/62 (0%)
 Frame = -3

Query  1600  LSPSEERIVQLFENNTYSVVNIFDVTLRPRLNVGGAVEIPEGNGSGVVWDGEGNIVTNYH  1421
             L   E   V+LF+ NT SVV I ++ +R        +E+P+G+GSG VWD  G+IVTN+H
Sbjct  119   LQADELATVRLFQENTPSVVYITNLAVRQDAFTLDVLEVPQGSGSGFVWDKSGHIVTNFH  178

Query  1420  VI  1415
             VI
Sbjct  179   VI  180



>ref|WP_007334055.1| 2-alkenal reductase [Rhodopirellula baltica]
 gb|EKK00206.1| 2-alkenal reductase [Rhodopirellula baltica SH28]
Length=392

 Score =   234 bits (597),  Expect = 4e-67, Method: Compositional matrix adjust.
 Identities = 122/234 (52%), Positives = 158/234 (68%), Gaps = 0/234 (0%)
 Frame = -2

Query  1208  QKNFEGKLVGADRSKDLAVLKVEASEDLLRPTKIGESSSLRVGQKCLAIGNPFGFDHTLT  1029
             Q +F  KLVG    KDLAVL ++A  + LRP   G S+ L VG+  LAIGNPFG D TLT
Sbjct  144   QTSFPAKLVGVAPDKDLAVLLIDAPPERLRPIPRGVSADLEVGRTALAIGNPFGLDQTLT  203

Query  1028  VGVISGLNRDIYSQTGVTISGGIQTDAAINPGNSGGPLLDSKGNLIGINTAIFTQTGTSA  849
              GVIS L R+I S +GV I   IQTDAAINPGNSGGPLLD  G LIG+NTAI++ +G  A
Sbjct  204   TGVISALGREIKSDSGVPIKDVIQTDAAINPGNSGGPLLDRSGQLIGVNTAIYSPSGAYA  263

Query  848   GVGFAIPSSTVLRIVPQLIQSGKVVRAGLNIDIAPDAIANQLNVRNGALVLLVPGNSLAA  669
             G+GFAIP  TV  +VP+LI+ G+++R G+ I +A D+++ +  +  G L+L +P    A 
Sbjct  264   GIGFAIPVDTVRWVVPELIEHGRIIRPGIAITVASDSMSKRFKLPPGVLILDMPERGNAE  323

Query  668   KAGILPTTRGFAGNIVLGDIIEAVDNKPVRNKADLYKVLDDYSVGDKVQLKIRR  507
             +AG+ PT R   G+IVLGDII AVD  PV + ADL  + ++Y  GD V L + R
Sbjct  324   RAGLRPTRRTRFGDIVLGDIIVAVDEMPVASTADLTLIFENYESGDVVDLTVIR  377


 Score = 53.5 bits (127),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 29/68 (43%), Positives = 41/68 (60%), Gaps = 0/68 (0%)
 Frame = -3

Query  1609  SGPLSPSEERIVQLFENNTYSVVNIFDVTLRPRLNVGGAVEIPEGNGSGVVWDGEGNIVT  1430
             +G L+ SE R ++LF   + SVV+I    +          EIP+G+G+G VWD  G+IVT
Sbjct  67    AGNLADSESRTIELFRVTSPSVVHITTSKVARDYFSMNVQEIPQGSGTGFVWDKAGHIVT  126

Query  1429  NYHVIGNS  1406
             N HVI N+
Sbjct  127   NNHVIQNA  134



>dbj|BAJ87184.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=427

 Score =   235 bits (600),  Expect = 4e-67, Method: Compositional matrix adjust.
 Identities = 132/236 (56%), Positives = 163/236 (69%), Gaps = 2/236 (1%)
 Frame = -2

Query  1208  QKNFEGKLVGADRSKDLAVLKVEASEDLLRPTKIGESSSLRVGQKCLAIGNPFGFDHTLT  1029
             Q  +E ++VG D+ KD+AVL +EA +D LRP  +G S+ L VGQK  AIGNPFG DHTLT
Sbjct  176   QSVYEAQVVGFDQDKDVAVLSIEAPKDKLRPLPVGVSADLLVGQKVYAIGNPFGLDHTLT  235

Query  1028  VGVISGLNRDIYSQ-TGVTISGGIQTDAAINPGNSGGPLLDSKGNLIGINTAIFTQTGTS  852
              GVISGL R+I S  TG  I   IQTDAAINPGNSGGPLLDS GNLIG+NTAI++ +G S
Sbjct  236   TGVISGLRREISSAATGRPIQDVIQTDAAINPGNSGGPLLDSSGNLIGVNTAIYSPSGAS  295

Query  851   AGVGFAIPSSTVLRIVPQLIQSGKVVRAGLNIDIAPDAIANQLNVRNGALVLLVPGNSLA  672
             +GVGF+IP  TV  IV QLI+ GKV R  L I  APD    QL + +G LVL  P N  A
Sbjct  296   SGVGFSIPVDTVGGIVDQLIKFGKVTRPILGIKFAPDQSVEQLGL-SGVLVLDAPPNGPA  354

Query  671   AKAGILPTTRGFAGNIVLGDIIEAVDNKPVRNKADLYKVLDDYSVGDKVQLKIRRG  504
              KAG+  T R   G ++LGDII +V+   V N +DLY++LD   VG+ V +++ RG
Sbjct  355   GKAGLQSTKRDAYGRLILGDIITSVNGTKVANGSDLYRILDQCKVGETVTVEVLRG  410


 Score = 57.4 bits (137),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 29/62 (47%), Positives = 41/62 (66%), Gaps = 0/62 (0%)
 Frame = -3

Query  1600  LSPSEERIVQLFENNTYSVVNIFDVTLRPRLNVGGAVEIPEGNGSGVVWDGEGNIVTNYH  1421
             L   E   V+LF++NT SVV I ++ +R        +E+P+G+GSG VWD  G+IVTN+H
Sbjct  102   LQADELATVRLFKDNTPSVVYITNLAVRQDAFTLDVLEVPQGSGSGFVWDKLGHIVTNFH  161

Query  1420  VI  1415
             VI
Sbjct  162   VI  163



>ref|WP_011120947.1| 2-alkenal reductase [Rhodopirellula baltica]
 ref|NP_867289.1| protease Do-like (S2 serine-type protease) [Rhodopirellula baltica 
SH 1]
 emb|CAD74835.1| protease Do-like (S2 serine-type protease) [Rhodopirellula baltica 
SH 1]
Length=399

 Score =   234 bits (598),  Expect = 4e-67, Method: Compositional matrix adjust.
 Identities = 122/234 (52%), Positives = 158/234 (68%), Gaps = 0/234 (0%)
 Frame = -2

Query  1208  QKNFEGKLVGADRSKDLAVLKVEASEDLLRPTKIGESSSLRVGQKCLAIGNPFGFDHTLT  1029
             Q +F  KLVG    KDLAVL ++A  + LRP   G S+ L VG+  LAIGNPFG D TLT
Sbjct  151   QTSFPAKLVGVAPDKDLAVLLIDAPPERLRPIPRGVSADLEVGRTALAIGNPFGLDQTLT  210

Query  1028  VGVISGLNRDIYSQTGVTISGGIQTDAAINPGNSGGPLLDSKGNLIGINTAIFTQTGTSA  849
              GVIS L R+I S +GV I   IQTDAAINPGNSGGPLLD  G LIG+NTAI++ +G  A
Sbjct  211   TGVISALGREIKSDSGVPIKDVIQTDAAINPGNSGGPLLDRSGQLIGVNTAIYSPSGAYA  270

Query  848   GVGFAIPSSTVLRIVPQLIQSGKVVRAGLNIDIAPDAIANQLNVRNGALVLLVPGNSLAA  669
             G+GFAIP  TV  +VP+LI+ G+++R G+ I +A D+++ +  +  G L+L +P    A 
Sbjct  271   GIGFAIPVDTVRWVVPELIEHGRIIRPGIAITVASDSMSKRFKLPPGVLILDMPERGNAE  330

Query  668   KAGILPTTRGFAGNIVLGDIIEAVDNKPVRNKADLYKVLDDYSVGDKVQLKIRR  507
             +AG+ PT R   G+IVLGDII AVD  PV + ADL  + ++Y  GD V L + R
Sbjct  331   RAGLRPTRRTRFGDIVLGDIIVAVDEMPVASTADLTLIFENYESGDVVDLTVIR  384


 Score = 53.5 bits (127),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 29/68 (43%), Positives = 41/68 (60%), Gaps = 0/68 (0%)
 Frame = -3

Query  1609  SGPLSPSEERIVQLFENNTYSVVNIFDVTLRPRLNVGGAVEIPEGNGSGVVWDGEGNIVT  1430
             +G L+ SE R ++LF   + SVV+I    +          EIP+G+G+G VWD  G+IVT
Sbjct  74    AGNLAESESRTIELFRVTSPSVVHITTSKVARDYFSMNVQEIPQGSGTGFVWDKAGHIVT  133

Query  1429  NYHVIGNS  1406
             N HVI N+
Sbjct  134   NNHVIQNA  141



>emb|CDY58511.1| BnaCnng33260D [Brassica napus]
Length=435

 Score =   236 bits (601),  Expect = 4e-67, Method: Compositional matrix adjust.
 Identities = 132/236 (56%), Positives = 163/236 (69%), Gaps = 2/236 (1%)
 Frame = -2

Query  1208  QKNFEGKLVGADRSKDLAVLKVEASEDLLRPTKIGESSSLRVGQKCLAIGNPFGFDHTLT  1029
             Q  ++ K+VG D+ KD+AVL+V+A +D LRP  +G S+ L VGQK  AIGNPFG DHTLT
Sbjct  184   QSTYDAKVVGFDQDKDVAVLRVDAPKDKLRPIPVGISADLLVGQKVFAIGNPFGLDHTLT  243

Query  1028  VGVISGLNRDIYSQ-TGVTISGGIQTDAAINPGNSGGPLLDSKGNLIGINTAIFTQTGTS  852
              GVISGL R+I S  TG  I   IQTDAAINPGNSGGPLLDS G LIGINTAI++ +G S
Sbjct  244   TGVISGLRREISSAATGRPIQDVIQTDAAINPGNSGGPLLDSSGTLIGINTAIYSPSGAS  303

Query  851   AGVGFAIPSSTVLRIVPQLIQSGKVVRAGLNIDIAPDAIANQLNVRNGALVLLVPGNSLA  672
             +GVGF+IP  TV  IV QL++ GKV R  L I  APD    QL V +G LVL  P    A
Sbjct  304   SGVGFSIPVDTVGGIVDQLVRFGKVTRPILGIKFAPDQSVEQLGV-SGVLVLDAPPTGPA  362

Query  671   AKAGILPTTRGFAGNIVLGDIIEAVDNKPVRNKADLYKVLDDYSVGDKVQLKIRRG  504
              KAG+  T R   G ++LGDII +V+   V N +DLY++LD   VGD+V +++ RG
Sbjct  363   GKAGLQSTKRDGYGRLILGDIITSVNGTKVTNGSDLYRILDQCKVGDEVTVEVLRG  418


 Score = 60.5 bits (145),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 30/62 (48%), Positives = 41/62 (66%), Gaps = 0/62 (0%)
 Frame = -3

Query  1600  LSPSEERIVQLFENNTYSVVNIFDVTLRPRLNVGGAVEIPEGNGSGVVWDGEGNIVTNYH  1421
             L   E   V+LF+ NT SVV I ++ +R        +E+P+G+GSG VWD +G+IVTNYH
Sbjct  110   LQTDELATVRLFQENTPSVVYITNLAVRQDAFTLDVLEVPQGSGSGFVWDKKGHIVTNYH  169

Query  1420  VI  1415
             VI
Sbjct  170   VI  171



>ref|WP_007327787.1| 2-alkenal reductase [Rhodopirellula baltica]
 gb|EGF26196.1| HtrA2 peptidase [Rhodopirellula baltica WH47]
Length=392

 Score =   234 bits (597),  Expect = 4e-67, Method: Compositional matrix adjust.
 Identities = 122/234 (52%), Positives = 158/234 (68%), Gaps = 0/234 (0%)
 Frame = -2

Query  1208  QKNFEGKLVGADRSKDLAVLKVEASEDLLRPTKIGESSSLRVGQKCLAIGNPFGFDHTLT  1029
             Q +F  KLVG    KDLAVL ++A  + LRP   G S+ L VG+  LAIGNPFG D TLT
Sbjct  144   QTSFPAKLVGVAPDKDLAVLLIDAPPERLRPIPRGVSADLEVGRTALAIGNPFGLDQTLT  203

Query  1028  VGVISGLNRDIYSQTGVTISGGIQTDAAINPGNSGGPLLDSKGNLIGINTAIFTQTGTSA  849
              GVIS L R+I S +GV I   IQTDAAINPGNSGGPLLD  G LIG+NTAI++ +G  A
Sbjct  204   TGVISALGREIKSDSGVPIKDVIQTDAAINPGNSGGPLLDRSGQLIGVNTAIYSPSGAYA  263

Query  848   GVGFAIPSSTVLRIVPQLIQSGKVVRAGLNIDIAPDAIANQLNVRNGALVLLVPGNSLAA  669
             G+GFAIP  TV  +VP+LI+ G+++R G+ I +A D+++ +  +  G L+L +P    A 
Sbjct  264   GIGFAIPVDTVRWVVPELIEHGRIIRPGIAITVASDSMSKRFKLPPGVLILDMPERGNAE  323

Query  668   KAGILPTTRGFAGNIVLGDIIEAVDNKPVRNKADLYKVLDDYSVGDKVQLKIRR  507
             +AG+ PT R   G+IVLGDII AVD  PV + ADL  + ++Y  GD V L + R
Sbjct  324   RAGLRPTRRTRFGDIVLGDIIVAVDEMPVASTADLTLIFENYESGDVVDLTVIR  377


 Score = 53.5 bits (127),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 29/68 (43%), Positives = 41/68 (60%), Gaps = 0/68 (0%)
 Frame = -3

Query  1609  SGPLSPSEERIVQLFENNTYSVVNIFDVTLRPRLNVGGAVEIPEGNGSGVVWDGEGNIVT  1430
             +G L+ SE R ++LF   + SVV+I    +          EIP+G+G+G VWD  G+IVT
Sbjct  67    AGNLADSESRTIELFRVTSPSVVHITTSKVARDYFSMNVQEIPQGSGTGFVWDKAGHIVT  126

Query  1429  NYHVIGNS  1406
             N HVI N+
Sbjct  127   NNHVIQNA  134



>gb|EMT27614.1| Protease Do-like 1, chloroplastic [Aegilops tauschii]
Length=342

 Score =   233 bits (593),  Expect = 5e-67, Method: Compositional matrix adjust.
 Identities = 131/233 (56%), Positives = 160/233 (69%), Gaps = 2/233 (1%)
 Frame = -2

Query  1208  QKNFEGKLVGADRSKDLAVLKVEASEDLLRPTKIGESSSLRVGQKCLAIGNPFGFDHTLT  1029
             Q  +E ++VG D+ KD+AVL +EA +D LRP  +G S+ L VGQK  AIGNPFG DHTLT
Sbjct  79    QSVYEAQVVGFDQDKDVAVLSIEAPKDKLRPLPVGVSADLLVGQKVYAIGNPFGLDHTLT  138

Query  1028  VGVISGLNRDIYSQ-TGVTISGGIQTDAAINPGNSGGPLLDSKGNLIGINTAIFTQTGTS  852
              GVISGL R+I S  TG  I   IQTDAAINPGNSGGPLLDS GNLIG+NTAI++ +G S
Sbjct  139   TGVISGLRREISSAATGRPIQDVIQTDAAINPGNSGGPLLDSSGNLIGVNTAIYSPSGAS  198

Query  851   AGVGFAIPSSTVLRIVPQLIQSGKVVRAGLNIDIAPDAIANQLNVRNGALVLLVPGNSLA  672
             +GVGF+IP  TV  IV QLIQ GKV R  L I  APD    QL + +G LVL  P N  A
Sbjct  199   SGVGFSIPVDTVGGIVDQLIQFGKVTRPILGIKFAPDQSVEQLGL-SGVLVLDAPPNGPA  257

Query  671   AKAGILPTTRGFAGNIVLGDIIEAVDNKPVRNKADLYKVLDDYSVGDKVQLKI  513
              KAG+  T R   G ++LGDII +V+   V N +DLY++LD   VG+ +  K+
Sbjct  258   GKAGLQSTKRDAYGRLILGDIITSVNGTKVANGSDLYRILDQCKVGETMAAKV  310



>ref|WP_007339036.1| 2-alkenal reductase [Rhodopirellula baltica]
 gb|ELP31761.1| 2-alkenal reductase [Rhodopirellula baltica SWK14]
Length=392

 Score =   234 bits (597),  Expect = 5e-67, Method: Compositional matrix adjust.
 Identities = 122/234 (52%), Positives = 158/234 (68%), Gaps = 0/234 (0%)
 Frame = -2

Query  1208  QKNFEGKLVGADRSKDLAVLKVEASEDLLRPTKIGESSSLRVGQKCLAIGNPFGFDHTLT  1029
             Q +F  KLVG    KDLAVL ++A  + LRP   G S+ L VG+  LAIGNPFG D TLT
Sbjct  144   QTSFPAKLVGVAPDKDLAVLLIDAPPERLRPIPRGVSADLEVGRTALAIGNPFGLDQTLT  203

Query  1028  VGVISGLNRDIYSQTGVTISGGIQTDAAINPGNSGGPLLDSKGNLIGINTAIFTQTGTSA  849
              GVIS L R+I S +GV I   IQTDAAINPGNSGGPLLD  G LIG+NTAI++ +G  A
Sbjct  204   TGVISALGREIKSDSGVPIKDVIQTDAAINPGNSGGPLLDRSGQLIGVNTAIYSPSGAYA  263

Query  848   GVGFAIPSSTVLRIVPQLIQSGKVVRAGLNIDIAPDAIANQLNVRNGALVLLVPGNSLAA  669
             G+GFAIP  TV  +VP+LI+ G+++R G+ I +A D+++ +  +  G L+L +P    A 
Sbjct  264   GIGFAIPVDTVRWVVPELIEYGRIIRPGIAITVASDSMSKRFKLPPGVLILDMPERGNAE  323

Query  668   KAGILPTTRGFAGNIVLGDIIEAVDNKPVRNKADLYKVLDDYSVGDKVQLKIRR  507
             +AG+ PT R   G+IVLGDII AVD  PV + ADL  + ++Y  GD V L + R
Sbjct  324   RAGLRPTRRTRFGDIVLGDIIVAVDEMPVASTADLTLIFENYESGDVVDLTVIR  377


 Score = 52.4 bits (124),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 29/68 (43%), Positives = 41/68 (60%), Gaps = 0/68 (0%)
 Frame = -3

Query  1609  SGPLSPSEERIVQLFENNTYSVVNIFDVTLRPRLNVGGAVEIPEGNGSGVVWDGEGNIVT  1430
             +G L+ SE R ++LF   + SVV+I    +          EIP+G+G+G VWD  G+IVT
Sbjct  67    AGNLADSESRTIELFHVTSPSVVHITTSKVARDYFSMNVQEIPQGSGTGFVWDKVGHIVT  126

Query  1429  NYHVIGNS  1406
             N HVI N+
Sbjct  127   NNHVIQNA  134



>ref|XP_010108775.1| Protease Do-like 1 [Morus notabilis]
 gb|EXC20290.1| Protease Do-like 1 [Morus notabilis]
Length=457

 Score =   236 bits (601),  Expect = 6e-67, Method: Compositional matrix adjust.
 Identities = 130/236 (55%), Positives = 164/236 (69%), Gaps = 2/236 (1%)
 Frame = -2

Query  1208  QKNFEGKLVGADRSKDLAVLKVEASEDLLRPTKIGESSSLRVGQKCLAIGNPFGFDHTLT  1029
             Q  ++  +VG D+ KD+AV++V+A +D LRP  +G S+ L VGQK  AIGNPFG DHTLT
Sbjct  206   QTTYDALVVGFDQDKDVAVIQVDAPKDKLRPIPVGVSADLLVGQKVYAIGNPFGLDHTLT  265

Query  1028  VGVISGLNRDIYSQ-TGVTISGGIQTDAAINPGNSGGPLLDSKGNLIGINTAIFTQTGTS  852
              GVISGL R+I S  TG  I   IQTDAAINPGNSGGPLLDS GNLIGINTAI++ +G S
Sbjct  266   TGVISGLRREISSAATGRPIQDVIQTDAAINPGNSGGPLLDSAGNLIGINTAIYSPSGAS  325

Query  851   AGVGFAIPSSTVLRIVPQLIQSGKVVRAGLNIDIAPDAIANQLNVRNGALVLLVPGNSLA  672
             +GVGF+IP  TV  IV QL++ GKV R  L I  APD    QL + +G LVL  P    A
Sbjct  326   SGVGFSIPVDTVSGIVEQLVKFGKVTRPILGIKFAPDQSVEQLGL-SGVLVLDAPATGPA  384

Query  671   AKAGILPTTRGFAGNIVLGDIIEAVDNKPVRNKADLYKVLDDYSVGDKVQLKIRRG  504
              KAG+ PT R   G ++LGDII +V+   V + +DLY++LD   VG+KV +++ RG
Sbjct  385   GKAGLKPTKRDAYGRLILGDIITSVNGTKVTSGSDLYRILDQCKVGEKVTVEVLRG  440


 Score = 60.5 bits (145),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 38/95 (40%), Positives = 51/95 (54%), Gaps = 5/95 (5%)
 Frame = -3

Query  1696  LCTQF-ITLQAYALGDPSVTVEQVTPPTFPSGPLSPSEERIVQLFENNTYSVVNIFDVTL  1520
             LCT   ++L  +     S     VT P      L   E   V+LF+ NT SVV I ++  
Sbjct  103   LCTSVALSLSLFVADVDSAAAFVVTSPRR----LQSDELATVRLFQENTPSVVYITNLAA  158

Query  1519  RPRLNVGGAVEIPEGNGSGVVWDGEGNIVTNYHVI  1415
             R        +E+P+G+GSG VWD +G+IVTNYHVI
Sbjct  159   RQDAFTLDVLEVPQGSGSGFVWDKQGHIVTNYHVI  193



>ref|NP_189431.2| DegP protease 1 [Arabidopsis thaliana]
 sp|O22609.2|DEGP1_ARATH RecName: Full=Protease Do-like 1, chloroplastic; Flags: Precursor 
[Arabidopsis thaliana]
 dbj|BAB02539.1| DegP protease precursor [Arabidopsis thaliana]
 gb|AAK62640.1| K16N12.18/K16N12.18 [Arabidopsis thaliana]
 gb|AAM47381.1| At3g27925/K16N12.18 [Arabidopsis thaliana]
 gb|AEE77381.1| DegP protease 1 [Arabidopsis thaliana]
Length=439

 Score =   235 bits (600),  Expect = 6e-67, Method: Compositional matrix adjust.
 Identities = 132/236 (56%), Positives = 164/236 (69%), Gaps = 2/236 (1%)
 Frame = -2

Query  1208  QKNFEGKLVGADRSKDLAVLKVEASEDLLRPTKIGESSSLRVGQKCLAIGNPFGFDHTLT  1029
             Q  F+ K+VG D+ KD+AVL+++A ++ LRP  +G S+ L VGQK  AIGNPFG DHTLT
Sbjct  188   QTTFDAKVVGFDQDKDVAVLRIDAPKNKLRPIPVGVSADLLVGQKVFAIGNPFGLDHTLT  247

Query  1028  VGVISGLNRDIYSQ-TGVTISGGIQTDAAINPGNSGGPLLDSKGNLIGINTAIFTQTGTS  852
              GVISGL R+I S  TG  I   IQTDAAINPGNSGGPLLDS G LIGINTAI++ +G S
Sbjct  248   TGVISGLRREISSAATGRPIQDVIQTDAAINPGNSGGPLLDSSGTLIGINTAIYSPSGAS  307

Query  851   AGVGFAIPSSTVLRIVPQLIQSGKVVRAGLNIDIAPDAIANQLNVRNGALVLLVPGNSLA  672
             +GVGF+IP  TV  IV QL++ GKV R  L I  APD    QL V +G LVL  P +  A
Sbjct  308   SGVGFSIPVDTVGGIVDQLVRFGKVTRPILGIKFAPDQSVEQLGV-SGVLVLDAPPSGPA  366

Query  671   AKAGILPTTRGFAGNIVLGDIIEAVDNKPVRNKADLYKVLDDYSVGDKVQLKIRRG  504
              KAG+  T R   G +VLGDII +V+   V N +DLY++LD   VGD+V +++ RG
Sbjct  367   GKAGLQSTKRDGYGRLVLGDIITSVNGTKVSNGSDLYRILDQCKVGDEVTVEVLRG  422


 Score = 60.5 bits (145),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 30/62 (48%), Positives = 41/62 (66%), Gaps = 0/62 (0%)
 Frame = -3

Query  1600  LSPSEERIVQLFENNTYSVVNIFDVTLRPRLNVGGAVEIPEGNGSGVVWDGEGNIVTNYH  1421
             L   E   V+LF+ NT SVV I ++ +R        +E+P+G+GSG VWD +G+IVTNYH
Sbjct  114   LQTDELATVRLFQENTPSVVYITNLAVRQDAFTLDVLEVPQGSGSGFVWDKQGHIVTNYH  173

Query  1420  VI  1415
             VI
Sbjct  174   VI  175



>ref|XP_009151909.1| PREDICTED: protease Do-like 1, chloroplastic [Brassica rapa]
 emb|CDX86460.1| BnaA06g31770D [Brassica napus]
Length=438

 Score =   235 bits (599),  Expect = 6e-67, Method: Compositional matrix adjust.
 Identities = 131/236 (56%), Positives = 163/236 (69%), Gaps = 2/236 (1%)
 Frame = -2

Query  1208  QKNFEGKLVGADRSKDLAVLKVEASEDLLRPTKIGESSSLRVGQKCLAIGNPFGFDHTLT  1029
             Q  ++ K+VG D+ KD+AVL+++A +D LRP  +G S+ L VGQK  AIGNPFG DHTLT
Sbjct  187   QSTYDAKVVGFDQDKDVAVLRIDAPKDKLRPIPVGVSADLLVGQKVFAIGNPFGLDHTLT  246

Query  1028  VGVISGLNRDIYSQ-TGVTISGGIQTDAAINPGNSGGPLLDSKGNLIGINTAIFTQTGTS  852
              GVISGL R+I S  TG  I   IQTDAAINPGNSGGPLLDS G LIGINTAI++ +G S
Sbjct  247   TGVISGLRREISSAATGRPIQDVIQTDAAINPGNSGGPLLDSSGTLIGINTAIYSPSGAS  306

Query  851   AGVGFAIPSSTVLRIVPQLIQSGKVVRAGLNIDIAPDAIANQLNVRNGALVLLVPGNSLA  672
             +GVGF+IP  TV  IV QL++ GKV R  L I  APD    QL V +G LVL  P    A
Sbjct  307   SGVGFSIPVDTVGGIVDQLVRFGKVTRPILGIKFAPDQSVEQLGV-SGVLVLDAPPTGPA  365

Query  671   AKAGILPTTRGFAGNIVLGDIIEAVDNKPVRNKADLYKVLDDYSVGDKVQLKIRRG  504
              KAG+  T R   G ++LGDII +V+   V N +DLY++LD   VGD+V +++ RG
Sbjct  366   GKAGLQSTKRDGYGRLILGDIITSVNGTKVTNGSDLYRILDQCKVGDEVTVEVLRG  421


 Score = 60.5 bits (145),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 37/94 (39%), Positives = 50/94 (53%), Gaps = 1/94 (1%)
 Frame = -3

Query  1696  LCTQFITLQAYALGDPSVTVEQVTPPTFPSGPLSPSEERIVQLFENNTYSVVNIFDVTLR  1517
             LCT      +     P+V        T P   L   E   V+LF+ NT SVV I ++ +R
Sbjct  82    LCTSVALSFSLFAASPAVESAAAFVVTTPR-KLQTDELATVRLFQENTPSVVYITNLAVR  140

Query  1516  PRLNVGGAVEIPEGNGSGVVWDGEGNIVTNYHVI  1415
                     +E+P+G+GSG VWD +G+IVTNYHVI
Sbjct  141   QDAFTLDVLEVPQGSGSGFVWDKQGHIVTNYHVI  174



>ref|XP_002441538.1| hypothetical protein SORBIDRAFT_09g028940 [Sorghum bicolor]
 gb|EES19968.1| hypothetical protein SORBIDRAFT_09g028940 [Sorghum bicolor]
Length=433

 Score =   235 bits (599),  Expect = 7e-67, Method: Compositional matrix adjust.
 Identities = 131/236 (56%), Positives = 164/236 (69%), Gaps = 2/236 (1%)
 Frame = -2

Query  1208  QKNFEGKLVGADRSKDLAVLKVEASEDLLRPTKIGESSSLRVGQKCLAIGNPFGFDHTLT  1029
             Q  +E ++VG D+ KD+AVL+++A +D LRP  +G S+ L VGQK  AIGNPFG DHTLT
Sbjct  182   QSVYEAQVVGFDQDKDVAVLRIKAPKDKLRPIPVGVSADLLVGQKVYAIGNPFGLDHTLT  241

Query  1028  VGVISGLNRDIYSQ-TGVTISGGIQTDAAINPGNSGGPLLDSKGNLIGINTAIFTQTGTS  852
              GVISGL R+I S  TG  I   IQTDAAINPGNSGGPLLDS GNLIG+NTAI++ +G S
Sbjct  242   TGVISGLRREISSAATGRPIQDVIQTDAAINPGNSGGPLLDSSGNLIGVNTAIYSPSGAS  301

Query  851   AGVGFAIPSSTVLRIVPQLIQSGKVVRAGLNIDIAPDAIANQLNVRNGALVLLVPGNSLA  672
             +GVGF+IP  TV  IV QLI+ GKV R  L I  APD    QL + +G LVL  P N  A
Sbjct  302   SGVGFSIPVDTVGGIVDQLIKFGKVTRPILGIKFAPDQSVEQLGL-SGVLVLDAPPNGPA  360

Query  671   AKAGILPTTRGFAGNIVLGDIIEAVDNKPVRNKADLYKVLDDYSVGDKVQLKIRRG  504
              KAG+  T R   G ++LGDII +V+   V N +DLY++LD   VG+ V +++ RG
Sbjct  361   GKAGLQSTKRDPYGRLILGDIITSVNGTKVTNGSDLYRILDQCKVGETVTVEVLRG  416



>ref|XP_002877082.1| hypothetical protein ARALYDRAFT_484581 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH53341.1| hypothetical protein ARALYDRAFT_484581 [Arabidopsis lyrata subsp. 
lyrata]
Length=433

 Score =   234 bits (598),  Expect = 9e-67, Method: Compositional matrix adjust.
 Identities = 132/236 (56%), Positives = 164/236 (69%), Gaps = 2/236 (1%)
 Frame = -2

Query  1208  QKNFEGKLVGADRSKDLAVLKVEASEDLLRPTKIGESSSLRVGQKCLAIGNPFGFDHTLT  1029
             Q  F+ K+VG D+ KD+AVL+++A ++ LRP  IG S+ L VGQK  AIGNPFG DHTLT
Sbjct  182   QTTFDAKVVGFDQDKDVAVLRIDAPKNKLRPIPIGVSADLLVGQKVFAIGNPFGLDHTLT  241

Query  1028  VGVISGLNRDIYSQ-TGVTISGGIQTDAAINPGNSGGPLLDSKGNLIGINTAIFTQTGTS  852
              GVISGL R+I S  TG  I   IQTDAAINPGNSGGPLLDS G LIGINTAI++ +G S
Sbjct  242   TGVISGLRREISSAATGRPIQDVIQTDAAINPGNSGGPLLDSSGTLIGINTAIYSPSGAS  301

Query  851   AGVGFAIPSSTVLRIVPQLIQSGKVVRAGLNIDIAPDAIANQLNVRNGALVLLVPGNSLA  672
             +GVGF+IP  TV  IV QL++ GKV R  L I  APD    QL V +G LVL  P +  A
Sbjct  302   SGVGFSIPVDTVGGIVDQLVRFGKVTRPILGIKFAPDQSVEQLGV-SGVLVLDAPPSGPA  360

Query  671   AKAGILPTTRGFAGNIVLGDIIEAVDNKPVRNKADLYKVLDDYSVGDKVQLKIRRG  504
              KAG+  T R   G ++LGDII +V+   V N +DLY++LD   VGD+V +++ RG
Sbjct  361   GKAGLQSTKRDGYGRLILGDIITSVNGTKVSNGSDLYRILDQCKVGDEVTVEVLRG  416


 Score = 60.1 bits (144),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 37/94 (39%), Positives = 49/94 (52%), Gaps = 5/94 (5%)
 Frame = -3

Query  1696  LCTQFITLQAYALGDPSVTVEQVTPPTFPSGPLSPSEERIVQLFENNTYSVVNIFDVTLR  1517
             LCT      +     PS      TP       L   E   V+LF+ NT SVV I ++ +R
Sbjct  81    LCTSVALSFSLFAASPSSAFVVSTPRK-----LQTDELATVRLFQENTPSVVYITNLAVR  135

Query  1516  PRLNVGGAVEIPEGNGSGVVWDGEGNIVTNYHVI  1415
                     +E+P+G+GSG VWD +G+IVTNYHVI
Sbjct  136   QDAFTLDVLEVPQGSGSGFVWDKQGHIVTNYHVI  169



>ref|XP_010231009.1| PREDICTED: protease Do-like 1, chloroplastic [Brachypodium distachyon]
Length=436

 Score =   234 bits (598),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 131/236 (56%), Positives = 163/236 (69%), Gaps = 2/236 (1%)
 Frame = -2

Query  1208  QKNFEGKLVGADRSKDLAVLKVEASEDLLRPTKIGESSSLRVGQKCLAIGNPFGFDHTLT  1029
             Q  +E ++VG D+ KD+AVL ++A +D LRP  +G S+ L VGQK  AIGNPFG DHTLT
Sbjct  185   QSVYEAQVVGFDQDKDVAVLSIQAPKDKLRPLPVGVSADLLVGQKVYAIGNPFGLDHTLT  244

Query  1028  VGVISGLNRDIYSQ-TGVTISGGIQTDAAINPGNSGGPLLDSKGNLIGINTAIFTQTGTS  852
              GVISGL R+I S  TG  I   IQTDAAINPGNSGGPLLDS GNLIG+NTAI++ +G S
Sbjct  245   TGVISGLRREISSAATGRPIQDVIQTDAAINPGNSGGPLLDSSGNLIGVNTAIYSPSGAS  304

Query  851   AGVGFAIPSSTVLRIVPQLIQSGKVVRAGLNIDIAPDAIANQLNVRNGALVLLVPGNSLA  672
             +GVGF+IP  TV  IV QLI+ GKV R  L I  APD    QL + +G LVL  P N  A
Sbjct  305   SGVGFSIPVDTVGGIVDQLIKFGKVTRPILGIKFAPDQSVEQLGL-SGVLVLDAPPNGPA  363

Query  671   AKAGILPTTRGFAGNIVLGDIIEAVDNKPVRNKADLYKVLDDYSVGDKVQLKIRRG  504
              KAG+  T R   G ++LGDII +V+   V N +DLY++LD   VG+ V +++ RG
Sbjct  364   GKAGLQSTKRDSYGRLILGDIITSVNGTKVANGSDLYRILDQCKVGETVTVEVLRG  419


 Score = 57.8 bits (138),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 28/62 (45%), Positives = 41/62 (66%), Gaps = 0/62 (0%)
 Frame = -3

Query  1600  LSPSEERIVQLFENNTYSVVNIFDVTLRPRLNVGGAVEIPEGNGSGVVWDGEGNIVTNYH  1421
             L   E   V+LF++NT SVV I ++ +R        +E+P+G+GSG VWD  G++VTN+H
Sbjct  111   LQADELATVRLFKDNTPSVVYITNLAVRQDAFTLDVLEVPQGSGSGFVWDKMGHVVTNFH  170

Query  1420  VI  1415
             VI
Sbjct  171   VI  172



>gb|AAC39436.1| DegP protease precursor [Arabidopsis thaliana]
Length=437

 Score =   234 bits (596),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 130/236 (55%), Positives = 164/236 (69%), Gaps = 2/236 (1%)
 Frame = -2

Query  1208  QKNFEGKLVGADRSKDLAVLKVEASEDLLRPTKIGESSSLRVGQKCLAIGNPFGFDHTLT  1029
             Q  F+ K+VG D+ KD+AVL+++A ++ LRP  +G S+ L VGQK  AIGNPFG DHTLT
Sbjct  186   QTTFDAKVVGFDQDKDVAVLRIDAPKNKLRPIPVGVSADLLVGQKVFAIGNPFGLDHTLT  245

Query  1028  VGVISGLNRDIYSQ-TGVTISGGIQTDAAINPGNSGGPLLDSKGNLIGINTAIFTQTGTS  852
              GVISGL R+I S  TG  I   IQTDAAINPGNSGGPLLDS G LIGINTAI++ +G S
Sbjct  246   TGVISGLRREISSAATGRPIQDVIQTDAAINPGNSGGPLLDSSGTLIGINTAIYSPSGAS  305

Query  851   AGVGFAIPSSTVLRIVPQLIQSGKVVRAGLNIDIAPDAIANQLNVRNGALVLLVPGNSLA  672
             +GVGF+IP  TV  IV QL++ GKV R  L I  APD    QL V +G L+L  P +  A
Sbjct  306   SGVGFSIPVDTVGGIVDQLVRFGKVTRPILGIKFAPDQSVEQLGV-SGVLLLDAPPSGPA  364

Query  671   AKAGILPTTRGFAGNIVLGDIIEAVDNKPVRNKADLYKVLDDYSVGDKVQLKIRRG  504
              KAG+  T R   G ++LGDII +V+   V N +DLY++LD   VGD+V +++ RG
Sbjct  365   GKAGLQSTKRDGYGRLILGDIITSVNGTKVSNGSDLYRILDQCKVGDEVTVQVLRG  420


 Score = 60.8 bits (146),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 30/62 (48%), Positives = 41/62 (66%), Gaps = 0/62 (0%)
 Frame = -3

Query  1600  LSPSEERIVQLFENNTYSVVNIFDVTLRPRLNVGGAVEIPEGNGSGVVWDGEGNIVTNYH  1421
             L   E   V+LF+ NT SVV I ++ +R        +E+P+G+GSG VWD +G+IVTNYH
Sbjct  112   LQTDELATVRLFQENTPSVVYITNLAVRQDAFTLDVLEVPQGSGSGFVWDKQGHIVTNYH  171

Query  1420  VI  1415
             VI
Sbjct  172   VI  173



>ref|XP_005712448.1| unnamed protein product [Chondrus crispus]
 emb|CDF32677.1| unnamed protein product [Chondrus crispus]
Length=447

 Score =   233 bits (593),  Expect = 6e-66, Method: Compositional matrix adjust.
 Identities = 121/232 (52%), Positives = 165/232 (71%), Gaps = 0/232 (0%)
 Frame = -2

Query  1208  QKNFEGKLVGADRSKDLAVLKVEASEDLLRPTKIGESSSLRVGQKCLAIGNPFGFDHTLT  1029
             +K ++ +LVG+    D+AVLK++A  D L P  +G+SS+LRVGQ   AIGNPFG DHTLT
Sbjct  197   KKTYDAELVGSSADDDVAVLKIKAPRDELFPIDVGDSSNLRVGQSTYAIGNPFGLDHTLT  256

Query  1028  VGVISGLNRDIYSQTGVTISGGIQTDAAINPGNSGGPLLDSKGNLIGINTAIFTQTGTSA  849
              GV+SGL R++ S TG TIS  IQT+A+INPGNSGGPL+D++G LIG+NTAI++ +G SA
Sbjct  257   TGVLSGLGREMKSPTGRTISNVIQTEASINPGNSGGPLIDARGRLIGMNTAIYSPSGASA  316

Query  848   GVGFAIPSSTVLRIVPQLIQSGKVVRAGLNIDIAPDAIANQLNVRNGALVLLVPGNSLAA  669
             GVGFAIP  T+  I   LI++G++VR  + I     + A  L +  G LVL VP  S A 
Sbjct  317   GVGFAIPVDTLKVIAQGLIENGRIVRPVIGISYLESSQARALGIEKGVLVLDVPEGSAAE  376

Query  668   KAGILPTTRGFAGNIVLGDIIEAVDNKPVRNKADLYKVLDDYSVGDKVQLKI  513
             KAG+  T+R   G+I LGDII  +DN+ V+N+ DL+K LD + VGD V++++
Sbjct  377   KAGLRGTSRMTFGSIELGDIIIGIDNEGVKNEGDLFKALDKHKVGDTVRIRV  428



>gb|KFK33710.1| hypothetical protein AALP_AA5G050200 [Arabis alpina]
Length=419

 Score =   231 bits (590),  Expect = 8e-66, Method: Compositional matrix adjust.
 Identities = 130/236 (55%), Positives = 161/236 (68%), Gaps = 2/236 (1%)
 Frame = -2

Query  1208  QKNFEGKLVGADRSKDLAVLKVEASEDLLRPTKIGESSSLRVGQKCLAIGNPFGFDHTLT  1029
             Q  ++ K+VG D+ KD+AVL ++A    LRP  +G S+ L VGQK  AIGNPFG DHTLT
Sbjct  168   QSTYDAKVVGFDQDKDVAVLHIDAPNKKLRPIPVGVSADLLVGQKVFAIGNPFGLDHTLT  227

Query  1028  VGVISGLNRDIYSQ-TGVTISGGIQTDAAINPGNSGGPLLDSKGNLIGINTAIFTQTGTS  852
              GVISGL R+I S  TG  I   IQTDAAINPGNSGGPLLDS G LIGINTAI++ +G S
Sbjct  228   TGVISGLRREISSAATGRPIQDVIQTDAAINPGNSGGPLLDSSGTLIGINTAIYSPSGAS  287

Query  851   AGVGFAIPSSTVLRIVPQLIQSGKVVRAGLNIDIAPDAIANQLNVRNGALVLLVPGNSLA  672
             +GVGF+IP  TV  IV QL++ GKV R  L I  APD    QL V +G LVL  P +  A
Sbjct  288   SGVGFSIPVDTVGGIVDQLVRFGKVTRPILGIKFAPDQSVEQLGV-SGVLVLDAPPSGPA  346

Query  671   AKAGILPTTRGFAGNIVLGDIIEAVDNKPVRNKADLYKVLDDYSVGDKVQLKIRRG  504
              KAG+  T R   G ++LGDII +V+   V N +DLY++LD   VGD+V +++ RG
Sbjct  347   GKAGLQSTKRDGYGRLILGDIITSVNGTKVSNGSDLYRILDQCKVGDEVSVEVLRG  402


 Score = 60.5 bits (145),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 30/62 (48%), Positives = 41/62 (66%), Gaps = 0/62 (0%)
 Frame = -3

Query  1600  LSPSEERIVQLFENNTYSVVNIFDVTLRPRLNVGGAVEIPEGNGSGVVWDGEGNIVTNYH  1421
             L   E   V+LF+ NT SVV I ++ +R        +E+P+G+GSG VWD +G+IVTNYH
Sbjct  94    LQTDELATVRLFQENTPSVVYITNLAVRQDAFTLDVLEVPQGSGSGFVWDKQGHIVTNYH  153

Query  1420  VI  1415
             VI
Sbjct  154   VI  155



>ref|NP_001130694.1| uncharacterized protein LOC100191797 [Zea mays]
 gb|ACF79012.1| unknown [Zea mays]
Length=430

 Score =   232 bits (591),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 130/236 (55%), Positives = 163/236 (69%), Gaps = 2/236 (1%)
 Frame = -2

Query  1208  QKNFEGKLVGADRSKDLAVLKVEASEDLLRPTKIGESSSLRVGQKCLAIGNPFGFDHTLT  1029
             Q  +E ++VG D+ KD+AVL ++A ++ LRP  +G S+ L VGQK  AIGNPFG DHTLT
Sbjct  179   QSVYEAQVVGFDQDKDVAVLGIKAPKNKLRPIPVGVSADLLVGQKVYAIGNPFGLDHTLT  238

Query  1028  VGVISGLNRDIYSQ-TGVTISGGIQTDAAINPGNSGGPLLDSKGNLIGINTAIFTQTGTS  852
              GVISGL R+I S  TG  I   IQTDAAINPGNSGGPLLDS GNLIG+NTAI++ +G S
Sbjct  239   TGVISGLRREISSAATGRPIQDVIQTDAAINPGNSGGPLLDSSGNLIGVNTAIYSPSGAS  298

Query  851   AGVGFAIPSSTVLRIVPQLIQSGKVVRAGLNIDIAPDAIANQLNVRNGALVLLVPGNSLA  672
             +GVGF+IP  TV  IV QLI+ G+V R  L I  APD    QL + +G LVL  P N  A
Sbjct  299   SGVGFSIPVDTVGGIVDQLIKFGRVTRPILGIKFAPDQSVEQLGL-SGVLVLDAPPNGPA  357

Query  671   AKAGILPTTRGFAGNIVLGDIIEAVDNKPVRNKADLYKVLDDYSVGDKVQLKIRRG  504
              KAG+  T R   G ++LGDII +V+   V N +DLY++LD   VGD V +++ RG
Sbjct  358   GKAGLQATKRDPYGRLILGDIITSVNGTKVTNGSDLYRILDQCKVGDTVTVEVLRG  413


 Score = 55.1 bits (131),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 28/62 (45%), Positives = 39/62 (63%), Gaps = 0/62 (0%)
 Frame = -3

Query  1600  LSPSEERIVQLFENNTYSVVNIFDVTLRPRLNVGGAVEIPEGNGSGVVWDGEGNIVTNYH  1421
             L   E   V+LF+ NT SVV I ++ +R        +E+P+G+GSG VWD  G+IVTN+ 
Sbjct  105   LQADELATVRLFQENTPSVVYITNLAVRQDAFTLDVLEVPQGSGSGFVWDKSGHIVTNFR  164

Query  1420  VI  1415
             VI
Sbjct  165   VI  166



>ref|XP_002973741.1| hypothetical protein SELMODRAFT_149210 [Selaginella moellendorffii]
 ref|XP_002975791.1| hypothetical protein SELMODRAFT_150757 [Selaginella moellendorffii]
 gb|EFJ23420.1| hypothetical protein SELMODRAFT_150757 [Selaginella moellendorffii]
 gb|EFJ25401.1| hypothetical protein SELMODRAFT_149210 [Selaginella moellendorffii]
Length=350

 Score =   228 bits (582),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 131/237 (55%), Positives = 160/237 (68%), Gaps = 3/237 (1%)
 Frame = -2

Query  1208  QKNFEGKLVGADRSKDLAVLKVEASED-LLRPTKIGESSSLRVGQKCLAIGNPFGFDHTL  1032
             Q   E  +VG D+ KD+AVLK++AS +  LRP  +G SS L VGQK  AIGNPFG DHTL
Sbjct  101   QSTHEASIVGYDQDKDVAVLKIDASSNKTLRPLPLGNSSELLVGQKVFAIGNPFGLDHTL  160

Query  1031  TVGVISGLNRDIYSQT-GVTISGGIQTDAAINPGNSGGPLLDSKGNLIGINTAIFTQTGT  855
             T GVISGL R+I S   G  I   IQTDAAINPGNSGGPLLDS GNLIGINTAI++ +G 
Sbjct  161   TTGVISGLRREITSAANGRPIQDVIQTDAAINPGNSGGPLLDSSGNLIGINTAIYSPSGA  220

Query  854   SAGVGFAIPSSTVLRIVPQLIQSGKVVRAGLNIDIAPDAIANQLNVRNGALVLLVPGNSL  675
             S+GVGF+IP  TV  IV Q+I+ GKV R  L I  APD    QL V +G LVL    +  
Sbjct  221   SSGVGFSIPVDTVAGIVDQIIKYGKVTRPVLGISFAPDQSVEQLGV-SGVLVLGASPDGP  279

Query  674   AAKAGILPTTRGFAGNIVLGDIIEAVDNKPVRNKADLYKVLDDYSVGDKVQLKIRRG  504
             A KAG+  TTR   G +V+GDII +++ + +   +DLYK+LD   VG  V L++ RG
Sbjct  280   AGKAGLRSTTRDAYGRLVMGDIIVSMNGQKISKGSDLYKILDACKVGQTVNLEVLRG  336


 Score = 58.9 bits (141),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 29/66 (44%), Positives = 42/66 (64%), Gaps = 0/66 (0%)
 Frame = -3

Query  1576  VQLFENNTYSVVNIFDVTLRPRLNVGGAVEIPEGNGSGVVWDGEGNIVTNYHVIGNSLSR  1397
             + LF N+T SVV I ++ +R        +E+P+G+GSG VWD +G+IVTNYHVI  +   
Sbjct  35    INLFRNSTPSVVYITNLAVRRDAFTSDIMEVPQGSGSGFVWDKDGHIVTNYHVIRGASDL  94

Query  1396  NPTRGE  1379
               T G+
Sbjct  95    KITMGD  100



>ref|WP_027328573.1| 2-alkenal reductase [Marinimicrobium agarilyticum]
Length=338

 Score =   228 bits (581),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 124/233 (53%), Positives = 156/233 (67%), Gaps = 1/233 (0%)
 Frame = -2

Query  1208  QKNFEGKLVGADRSKDLAVLKVEASEDLLRPTKIGESSSLRVGQKCLAIGNPFGFDHTLT  1029
             Q N+  ++VG    KDLAVLKVEA E  L+P + G+S  L VG K LAIGNPFG D TLT
Sbjct  89    QSNWPAEVVGIAPEKDLAVLKVEAPEKHLKPLRRGDSGDLVVGHKVLAIGNPFGLDATLT  148

Query  1028  VGVISGLNRDIYSQTGVTISGGIQTDAAINPGNSGGPLLDSKGNLIGINTAIFTQTGTSA  849
              GV+S L R+I S     I   IQTDAAINPGNSGGPLL+S+G LIG+NT I++ +G SA
Sbjct  149   TGVVSALGREIESPNQRKIRNVIQTDAAINPGNSGGPLLNSQGELIGVNTMIYSPSGASA  208

Query  848   GVGFAIPSSTVLRIVPQLIQSGKVVRAGLNIDIAPDAIANQLNVRNGALVLLVPGNSLAA  669
             G+GFAIP +TV  IVPQLI+ G+++R  + IDIAPD  A Q  VR G  +L V   S A 
Sbjct  209   GIGFAIPVNTVESIVPQLIEHGRIIRPVIGIDIAPDQWARQSGVR-GVAILRVAQGSPAD  267

Query  668   KAGILPTTRGFAGNIVLGDIIEAVDNKPVRNKADLYKVLDDYSVGDKVQLKIR  510
             +AG+    R   G+IVLGDII A+D  P RN  +L   L+ Y  G++V L ++
Sbjct  268   RAGLEGAQRSRWGSIVLGDIITAIDQHPTRNYDELMTALEKYEPGNEVVLSVQ  320



>ref|XP_006655603.1| PREDICTED: protease Do-like 1, chloroplastic-like [Oryza brachyantha]
Length=465

 Score =   232 bits (591),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 129/236 (55%), Positives = 163/236 (69%), Gaps = 2/236 (1%)
 Frame = -2

Query  1208  QKNFEGKLVGADRSKDLAVLKVEASEDLLRPTKIGESSSLRVGQKCLAIGNPFGFDHTLT  1029
             Q  +E ++VG D+ KD+AVL+++A  + LRP  +G S+ L VGQK  AIGNPFG DHTLT
Sbjct  214   QSVYEAQVVGFDQDKDVAVLRIKAPTEKLRPIPVGVSADLLVGQKVFAIGNPFGLDHTLT  273

Query  1028  VGVISGLNRDIYSQ-TGVTISGGIQTDAAINPGNSGGPLLDSKGNLIGINTAIFTQTGTS  852
              GVISGL R+I S  TG  I   IQTDAAINPGNSGGPLLDS GNLIG+NTAI++ +G S
Sbjct  274   TGVISGLRREISSAATGRPIQDVIQTDAAINPGNSGGPLLDSSGNLIGVNTAIYSPSGAS  333

Query  851   AGVGFAIPSSTVLRIVPQLIQSGKVVRAGLNIDIAPDAIANQLNVRNGALVLLVPGNSLA  672
             +GVGF+IP  TV  IV QLI+ GKV R  L I  APD    QL + +G LVL  P +  A
Sbjct  334   SGVGFSIPVDTVGGIVDQLIKFGKVTRPILGIKFAPDQSVEQLGL-SGVLVLDAPPSGPA  392

Query  671   AKAGILPTTRGFAGNIVLGDIIEAVDNKPVRNKADLYKVLDDYSVGDKVQLKIRRG  504
              KAG+  T R   G ++LGDII +V+   V N +DLY++LD   VG+ V +++ RG
Sbjct  393   GKAGLQSTKRDSYGRLILGDIITSVNGTKVTNGSDLYRILDQCKVGETVTVEVLRG  448


 Score = 58.2 bits (139),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 29/62 (47%), Positives = 40/62 (65%), Gaps = 0/62 (0%)
 Frame = -3

Query  1600  LSPSEERIVQLFENNTYSVVNIFDVTLRPRLNVGGAVEIPEGNGSGVVWDGEGNIVTNYH  1421
             L   E   V+LF+ NT SVV I ++ +R        +E+P+G+GSG VWD  G+IVTN+H
Sbjct  140   LQADELATVRLFQENTPSVVYITNLAVRQDAFTLDVLEVPQGSGSGFVWDKSGHIVTNFH  199

Query  1420  VI  1415
             VI
Sbjct  200   VI  201



>ref|WP_008655508.1| 2-alkenal reductase [Rhodopirellula europaea]
 gb|EMB17619.1| 2-alkenal reductase [Rhodopirellula europaea 6C]
Length=394

 Score =   229 bits (585),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 120/234 (51%), Positives = 158/234 (68%), Gaps = 0/234 (0%)
 Frame = -2

Query  1208  QKNFEGKLVGADRSKDLAVLKVEASEDLLRPTKIGESSSLRVGQKCLAIGNPFGFDHTLT  1029
             Q +F  KLVG    KDLAVL ++A  + LRP   G S+ L VG+  LAIGNPFG D TLT
Sbjct  146   QTSFPAKLVGVAPDKDLAVLLIDAPPERLRPIPRGVSADLEVGRTALAIGNPFGLDQTLT  205

Query  1028  VGVISGLNRDIYSQTGVTISGGIQTDAAINPGNSGGPLLDSKGNLIGINTAIFTQTGTSA  849
              GVIS L R+I S +GV I   IQTDAAINPGNSGGPLLD  G LIG+NTAI++ +G  A
Sbjct  206   TGVISALGREIKSDSGVPIKDVIQTDAAINPGNSGGPLLDRSGQLIGVNTAIYSPSGAYA  265

Query  848   GVGFAIPSSTVLRIVPQLIQSGKVVRAGLNIDIAPDAIANQLNVRNGALVLLVPGNSLAA  669
             G+GFAIP  TV  +VP+LI+ G+++R G+ I +A D+++ +  +  G L+L +P    A 
Sbjct  266   GIGFAIPVDTVRWVVPELIEHGRIIRPGIAITVASDSMSKRFKLPPGVLILDMPERGNAE  325

Query  668   KAGILPTTRGFAGNIVLGDIIEAVDNKPVRNKADLYKVLDDYSVGDKVQLKIRR  507
             +AG+ PT R   G+IVLGDII AVD+  V + +DL  + ++Y  GD V L + R
Sbjct  326   RAGLRPTRRTRFGDIVLGDIIVAVDDMAVASTSDLTLIFENYESGDVVDLTVIR  379


 Score = 53.1 bits (126),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 29/68 (43%), Positives = 41/68 (60%), Gaps = 0/68 (0%)
 Frame = -3

Query  1609  SGPLSPSEERIVQLFENNTYSVVNIFDVTLRPRLNVGGAVEIPEGNGSGVVWDGEGNIVT  1430
             +G L+ SE R ++LF   + SVV+I    +          EIP+G+G+G VWD  G+IVT
Sbjct  69    AGNLADSETRTIELFRVTSPSVVHITTSKVARDYFSMNVQEIPQGSGTGFVWDKAGHIVT  128

Query  1429  NYHVIGNS  1406
             N HVI N+
Sbjct  129   NNHVIQNA  136



>ref|WP_008664459.1| 2-alkenal reductase [Rhodopirellula europaea]
 gb|EMI28319.1| 2-alkenal reductase [Rhodopirellula europaea SH398]
Length=394

 Score =   229 bits (584),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 120/234 (51%), Positives = 158/234 (68%), Gaps = 0/234 (0%)
 Frame = -2

Query  1208  QKNFEGKLVGADRSKDLAVLKVEASEDLLRPTKIGESSSLRVGQKCLAIGNPFGFDHTLT  1029
             Q +F  KLVG    KDLAVL ++A  + LRP   G S+ L VG+  LAIGNPFG D TLT
Sbjct  146   QTSFPAKLVGVAPDKDLAVLLIDAPPERLRPIPRGVSADLEVGRTALAIGNPFGLDQTLT  205

Query  1028  VGVISGLNRDIYSQTGVTISGGIQTDAAINPGNSGGPLLDSKGNLIGINTAIFTQTGTSA  849
              GVIS L R+I S +GV I   IQTDAAINPGNSGGPLLD  G LIG+NTAI++ +G  A
Sbjct  206   TGVISALGREIKSDSGVPIKDVIQTDAAINPGNSGGPLLDRSGQLIGVNTAIYSPSGAYA  265

Query  848   GVGFAIPSSTVLRIVPQLIQSGKVVRAGLNIDIAPDAIANQLNVRNGALVLLVPGNSLAA  669
             G+GFAIP  TV  +VP+LI+ G+++R G+ I +A D+++ +  +  G L+L +P    A 
Sbjct  266   GIGFAIPVDTVRWVVPELIEHGRIIRPGIAITVASDSMSKRFKLPPGVLILDLPERGNAE  325

Query  668   KAGILPTTRGFAGNIVLGDIIEAVDNKPVRNKADLYKVLDDYSVGDKVQLKIRR  507
             +AG+ PT R   G+IVLGDII AVD+  V + +DL  + ++Y  GD V L + R
Sbjct  326   RAGLRPTRRTRFGDIVLGDIIVAVDDMAVASTSDLTLIFENYESGDVVDLTVIR  379


 Score = 53.1 bits (126),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 33/77 (43%), Positives = 44/77 (57%), Gaps = 1/77 (1%)
 Frame = -3

Query  1633  QVTPPTFPS-GPLSPSEERIVQLFENNTYSVVNIFDVTLRPRLNVGGAVEIPEGNGSGVV  1457
             Q  P   PS G L+ SE R ++LF   + SVV+I    +          EIP+G+G+G V
Sbjct  60    QDIPVHVPSAGNLADSETRTIELFRVTSPSVVHITTSKVARDYFSMNVQEIPQGSGTGFV  119

Query  1456  WDGEGNIVTNYHVIGNS  1406
             WD  G+IVTN HVI N+
Sbjct  120   WDKAGHIVTNNHVIQNA  136



>gb|EKD89775.1| hypothetical protein ACD_32C00151G0002 [uncultured bacterium]
Length=374

 Score =   228 bits (582),  Expect = 4e-65, Method: Compositional matrix adjust.
 Identities = 125/234 (53%), Positives = 154/234 (66%), Gaps = 1/234 (0%)
 Frame = -2

Query  1208  QKNFEGKLVGADRSKDLAVLKVEASEDLLRPTKIGESSSLRVGQKCLAIGNPFGFDHTLT  1029
             QK+FE KLVG     D+AVLK++   D L    I  S  L+VGQK LA+GNPFG D TLT
Sbjct  128   QKSFEAKLVGTAPDYDIAVLKIDIPSDNLLSIPIAHSKELKVGQKVLALGNPFGLDGTLT  187

Query  1028  VGVISGLNRDIYSQTGVTISGGIQTDAAINPGNSGGPLLDSKGNLIGINTAIFTQTGTSA  849
              G+IS L R I S TG  I+  IQTDAAINPGNSGGPLLDS G LIGINTAIF+  G +A
Sbjct  188   TGIISALGRTINSLTGYKINDVIQTDAAINPGNSGGPLLDSSGRLIGINTAIFSPAGVNA  247

Query  848   GVGFAIPSSTVLRIVPQLIQSGKVVRAGLNIDIAPDAIANQLNVRNGALVLLVPGNSLAA  669
             G+GFAIPS TV RIV ++I SGK+ + GL I + PD I    +++ GA++L V  NS A 
Sbjct  248   GIGFAIPSDTVNRIVSEIISSGKITKVGLGISLVPDNIKVNWSIK-GAIILEVAKNSSAE  306

Query  668   KAGILPTTRGFAGNIVLGDIIEAVDNKPVRNKADLYKVLDDYSVGDKVQLKIRR  507
             KAG+  TT+   G IVLGDII  +D+  + + +DL   LD Y   D V +   R
Sbjct  307   KAGLQGTTKTLFGEIVLGDIITQIDSTKIESNSDLVSTLDKYKKDDSVTVYFMR  360


 Score = 58.9 bits (141),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 35/96 (36%), Positives = 53/96 (55%), Gaps = 3/96 (3%)
 Frame = -3

Query  1702  VSLCTQFITLQAYALGDPSVTVEQVTPPTFPSGPLSPSEERIVQLFENNTYSVVNIFDVT  1523
             +SL   FI+    +   P +  + +TP   PS  L   EE  +++FE  +  VV+I + T
Sbjct  23    LSLGKTFISKINLSQTSPEIIPKAITPR--PS-TLGADEEATIEIFEKMSKGVVSIKNAT  79

Query  1522  LRPRLNVGGAVEIPEGNGSGVVWDGEGNIVTNYHVI  1415
                        E+P+G GSG+VWD +G+IVTN+HVI
Sbjct  80    YHRDFFSLNVYEVPQGVGSGIVWDDKGHIVTNFHVI  115



>ref|XP_002508768.1| predicted protein [Micromonas sp. RCC299]
 gb|ACO70026.1| predicted protein [Micromonas sp. RCC299]
Length=343

 Score =   226 bits (577),  Expect = 8e-65, Method: Compositional matrix adjust.
 Identities = 133/240 (55%), Positives = 164/240 (68%), Gaps = 8/240 (3%)
 Frame = -2

Query  1205  KNFEGKLVGADRSKDLAVLKVEASEDLLRPTKIGESSSLRVGQKCLAIGNPFGFDHTLTV  1026
             K +E KL+G D  KD+AVLKV+  +   RP  +G+SS+L VGQK  AIGNPFG DHTLT 
Sbjct  87    KTYEAKLLGYDEDKDVAVLKVDKPD--TRPIPLGKSSTLLVGQKVFAIGNPFGLDHTLTT  144

Query  1025  GVISGLNRDIYS-QTGVTISGGIQTDAAINPGNSGGPLLDSKGNLIGINTAIFTQTGTSA  849
             G++SGL R++ S  TG  I G IQTDAAINPGNSGGPLLDS+G LIG+NTAI++ +G SA
Sbjct  145   GIVSGLGRELPSGNTGRPILGVIQTDAAINPGNSGGPLLDSRGRLIGVNTAIYSPSGASA  204

Query  848   GVGFAIPSSTVLRIVPQLIQSGKVVRAGLNIDIAPDAIANQL---NVRN-GALVLLVPGN  681
             GVGFA+P   V  IV Q+IQ G+V R  L + +APD    QL   N RN G LVL VP  
Sbjct  205   GVGFALPVDNVKGIVEQIIQFGRVTRPVLGLVLAPDGALQQLIGENGRNAGVLVLGVPEG  264

Query  680   SLAAKAGILPTTRG-FAGNIVLGDIIEAVDNKPVRNKADLYKVLDDYSVGDKVQLKIRRG  504
               AA+AGI+ T R    G+I LGDII   +   V+N +DLY+ LD   VG  V+L +RRG
Sbjct  265   GPAARAGIVGTIRDTLRGDITLGDIIVRFNETEVKNSSDLYRALDMAQVGQDVKLTVRRG  324



>gb|AFW79240.1| hypothetical protein ZEAMMB73_880102 [Zea mays]
Length=620

 Score =   233 bits (593),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 130/236 (55%), Positives = 163/236 (69%), Gaps = 2/236 (1%)
 Frame = -2

Query  1208  QKNFEGKLVGADRSKDLAVLKVEASEDLLRPTKIGESSSLRVGQKCLAIGNPFGFDHTLT  1029
             Q  +E ++VG D+ KD+AVL ++A ++ LRP  +G S+ L VGQK  AIGNPFG DHTLT
Sbjct  369   QSVYEAQVVGFDQDKDVAVLGIKAPKNKLRPIPVGVSADLLVGQKVYAIGNPFGLDHTLT  428

Query  1028  VGVISGLNRDIYSQ-TGVTISGGIQTDAAINPGNSGGPLLDSKGNLIGINTAIFTQTGTS  852
              GVISGL R+I S  TG  I   IQTDAAINPGNSGGPLLDS GNLIG+NTAI++ +G S
Sbjct  429   TGVISGLRREISSAATGRPIQDVIQTDAAINPGNSGGPLLDSSGNLIGVNTAIYSPSGAS  488

Query  851   AGVGFAIPSSTVLRIVPQLIQSGKVVRAGLNIDIAPDAIANQLNVRNGALVLLVPGNSLA  672
             +GVGF+IP  TV  IV QLI+ G+V R  L I  APD    QL + +G LVL  P N  A
Sbjct  489   SGVGFSIPVDTVGGIVDQLIKFGRVTRPILGIKFAPDQSVEQLGL-SGVLVLDAPPNGPA  547

Query  671   AKAGILPTTRGFAGNIVLGDIIEAVDNKPVRNKADLYKVLDDYSVGDKVQLKIRRG  504
              KAG+  T R   G ++LGDII +V+   V N +DLY++LD   VGD V +++ RG
Sbjct  548   GKAGLQATKRDPYGRLILGDIITSVNGTKVTNGSDLYRILDQCKVGDTVTVEVLRG  603


 Score = 58.2 bits (139),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 29/62 (47%), Positives = 40/62 (65%), Gaps = 0/62 (0%)
 Frame = -3

Query  1600  LSPSEERIVQLFENNTYSVVNIFDVTLRPRLNVGGAVEIPEGNGSGVVWDGEGNIVTNYH  1421
             L   E   V+LF+ NT SVV I ++ +R        +E+P+G+GSG VWD  G+IVTN+H
Sbjct  295   LQADELATVRLFQENTPSVVYITNLAVRQDAFTLDVLEVPQGSGSGFVWDKSGHIVTNFH  354

Query  1420  VI  1415
             VI
Sbjct  355   VI  356



>ref|WP_013110274.1| 2-alkenal reductase [Planctomyces limnophilus]
 ref|YP_003630042.1| peptidase S1 and S6 chymotrypsin/Hap [Planctomyces limnophilus 
DSM 3776]
 gb|ADG67843.1| peptidase S1 and S6 chymotrypsin/Hap [Planctomyces limnophilus 
DSM 3776]
Length=383

 Score =   226 bits (577),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 119/233 (51%), Positives = 155/233 (67%), Gaps = 0/233 (0%)
 Frame = -2

Query  1205  KNFEGKLVGADRSKDLAVLKVEASEDLLRPTKIGESSSLRVGQKCLAIGNPFGFDHTLTV  1026
               ++  LVG +  +DLAVL+++A    LRP  +G S  L+VGQK  AIGNPFGFDHTLT 
Sbjct  137   SEWDAALVGYEPDRDLAVLRIKAPASRLRPIPVGTSDDLQVGQKVFAIGNPFGFDHTLTT  196

Query  1025  GVISGLNRDIYSQTGVTISGGIQTDAAINPGNSGGPLLDSKGNLIGINTAIFTQTGTSAG  846
             GVISGL RD+   TG TI G IQTDAAINPGNSGGPLLDS G LIG+NT I + +G SAG
Sbjct  197   GVISGLGRDVPGATGETIRGMIQTDAAINPGNSGGPLLDSAGRLIGVNTTILSNSGGSAG  256

Query  845   VGFAIPSSTVLRIVPQLIQSGKVVRAGLNIDIAPDAIANQLNVRNGALVLLVPGNSLAAK  666
             +GFAIP  TV   VP+LI+ G   R  L I    D  A +L V +GALV  V  NS AA+
Sbjct  257   IGFAIPVDTVNAYVPELIKHGWNERPELGIIFMYDTFARRLGVTSGALVKHVIENSAAAR  316

Query  665   AGILPTTRGFAGNIVLGDIIEAVDNKPVRNKADLYKVLDDYSVGDKVQLKIRR  507
             AGI P      G+++LGDII  +D+ P+  + D+++ ++ + +   +Q+K+ R
Sbjct  317   AGIRPMWSDEDGDLILGDIIVQMDDFPITGEMDVFRTMERFKINQVIQVKVIR  369


 Score = 58.2 bits (139),  Expect = 9e-06, Method: Compositional matrix adjust.
 Identities = 32/80 (40%), Positives = 46/80 (58%), Gaps = 0/80 (0%)
 Frame = -3

Query  1639  VEQVTPPTFPSGPLSPSEERIVQLFENNTYSVVNIFDVTLRPRLNVGGAVEIPEGNGSGV  1460
             V  V+ P  P G LS  E+  +++F  +  SVV I  +T+         V+I  G GSG 
Sbjct  49    VNAVSRPITPRGDLSDDEKTTIEIFRESLPSVVYISSLTVNRAQASPNPVQITRGTGSGF  108

Query  1459  VWDGEGNIVTNYHVIGNSLS  1400
             VWD +G++VTNYH+I N+ S
Sbjct  109   VWDHQGHVVTNYHLIRNAQS  128



>ref|WP_028874564.1| 2-alkenal reductase [Tepidiphilus margaritifer]
Length=347

 Score =   225 bits (573),  Expect = 4e-64, Method: Compositional matrix adjust.
 Identities = 122/235 (52%), Positives = 156/235 (66%), Gaps = 0/235 (0%)
 Frame = -2

Query  1208  QKNFEGKLVGADRSKDLAVLKVEASEDLLRPTKIGESSSLRVGQKCLAIGNPFGFDHTLT  1029
             Q  +  KLVGA   +DLAVL+++A  + L P  IGES  L+VGQK LAIGNPFG D +LT
Sbjct  99    QSTWRAKLVGAYPDRDLAVLRIDAPPERLHPIPIGESKGLKVGQKVLAIGNPFGLDQSLT  158

Query  1028  VGVISGLNRDIYSQTGVTISGGIQTDAAINPGNSGGPLLDSKGNLIGINTAIFTQTGTSA  849
              GV+S LNR+I S TG TI G IQTDAAINPGNSGGPLLDS G LIG+NTAI++ +G SA
Sbjct  159   TGVVSALNREIESVTGRTIRGVIQTDAAINPGNSGGPLLDSAGRLIGVNTAIYSPSGASA  218

Query  848   GVGFAIPSSTVLRIVPQLIQSGKVVRAGLNIDIAPDAIANQLNVRNGALVLLVPGNSLAA  669
             G+GFAIP   V RIVP+LI+ G++ R  L I  A  A    L +  G  +L V  +  AA
Sbjct  219   GIGFAIPVDEVNRIVPRLIREGRIRRPVLGIAAASPAFNKALGLPPGVALLRVDPDGPAA  278

Query  668   KAGILPTTRGFAGNIVLGDIIEAVDNKPVRNKADLYKVLDDYSVGDKVQLKIRRG  504
             +AG+ P      G++++GD+I A+D  P  +   L  VL+ Y  GD V L++ RG
Sbjct  279   RAGLKPFVPVTEGSVIVGDLIVAIDGIPTPDADTLLDVLERYQPGDSVTLEVLRG  333


 Score = 52.8 bits (125),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 31/68 (46%), Positives = 42/68 (62%), Gaps = 4/68 (6%)
 Frame = -3

Query  1612  PSGPLSPSEERIVQLFENNTYSVVNIFDVTLRPRLNVG--GAVEIPEGNGSGVVWDGEGN  1439
             P G L+  E   V++F   + SVV+I   T R  LN+     +EIP+G GSG VWD  G+
Sbjct  21    PRGELTADERNTVEVFALASPSVVHI--TTARQALNLFTLNVLEIPQGTGSGFVWDEAGH  78

Query  1438  IVTNYHVI  1415
             +VTN+HVI
Sbjct  79    VVTNFHVI  86



>ref|XP_005763775.1| hypothetical protein EMIHUDRAFT_67415 [Emiliania huxleyi CCMP1516]
 gb|EOD11346.1| hypothetical protein EMIHUDRAFT_67415 [Emiliania huxleyi CCMP1516]
Length=412

 Score =   226 bits (575),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 127/233 (55%), Positives = 155/233 (67%), Gaps = 8/233 (3%)
 Frame = -2

Query  1205  KNFEGKLVGADRSKDLAVLKVEASEDLLRPTKIGESSSLRVGQKCLAIGNPFGFDHTLTV  1026
             K F   LVG +  KD+AVLK+E S   LRP  IG SS+LRVG   LAIGNPFG DHTLTV
Sbjct  165   KMFGATLVGYNPDKDVAVLKIEPSA-ALRPIDIGSSSALRVGSTTLAIGNPFGLDHTLTV  223

Query  1025  GVISGLNRDIYSQTGVTISGGIQTDAAINPGNSGGPLLDSKGNLIGINTAIFTQTGTSAG  846
             GV++       S +G  IS  IQTDAAINPGNSGG LLDS G LIG+NTAI++ +G SAG
Sbjct  224   GVVT-------SPSGRPISNVIQTDAAINPGNSGGALLDSSGRLIGMNTAIYSPSGASAG  276

Query  845   VGFAIPSSTVLRIVPQLIQSGKVVRAGLNIDIAPDAIANQLNVRNGALVLLVPGNSLAAK  666
             +GFAIP+ T+ + V  +++ GKV+R  + I     A A  L V  G LVL VP NS AAK
Sbjct  277   IGFAIPADTLKQQVATILRYGKVLRPAIGISFLEAAQARALGVARGVLVLGVPDNSAAAK  336

Query  665   AGILPTTRGFAGNIVLGDIIEAVDNKPVRNKADLYKVLDDYSVGDKVQLKIRR  507
             AG+ PT R   G + LGD+I  +D  PVRN+ADL++ LD Y  G KV L + R
Sbjct  337   AGLRPTFRLADGTVSLGDVIVQIDAAPVRNEADLFRALDSYQPGQKVTLTVER  389


 Score = 54.3 bits (129),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 30/66 (45%), Positives = 34/66 (52%), Gaps = 0/66 (0%)
 Frame = -3

Query  1612  PSGPLSPSEERIVQLFENNTYSVVNIFDVTLRPRLNVGGAVEIPEGNGSGVVWDGEGNIV  1433
             P   L   E  +  LF   T SVV I     R       AV++P G GSG VWD  G+IV
Sbjct  82    PISALQQQERTVEDLFTRATESVVYINTFVARTDRLTMNAVDVPAGTGSGFVWDDAGHIV  141

Query  1432  TNYHVI  1415
             TNYHVI
Sbjct  142   TNYHVI  147



>ref|WP_024460910.1| 2-alkenal reductase [Marinimicrobium sp. LS-A18]
Length=348

 Score =   222 bits (566),  Expect = 4e-63, Method: Compositional matrix adjust.
 Identities = 120/234 (51%), Positives = 157/234 (67%), Gaps = 1/234 (0%)
 Frame = -2

Query  1208  QKNFEGKLVGADRSKDLAVLKVEASEDLLRPTKIGESSSLRVGQKCLAIGNPFGFDHTLT  1029
             Q  +  ++VG    KDLAVLK+ A +  L+P + G+SS L VG+K LAIGNPFG D TLT
Sbjct  99    QSIWPAEVVGLAPEKDLAVLKINAPDKKLQPLRRGDSSELMVGRKVLAIGNPFGLDATLT  158

Query  1028  VGVISGLNRDIYSQTGVTISGGIQTDAAINPGNSGGPLLDSKGNLIGINTAIFTQTGTSA  849
              GV+S L R+I +     I   IQTDAAINPGNSGGPLL+S+  LIG+NT I++ +G SA
Sbjct  159   TGVVSALGREIEAPNQRKIRNVIQTDAAINPGNSGGPLLNSQAELIGVNTMIYSPSGASA  218

Query  848   GVGFAIPSSTVLRIVPQLIQSGKVVRAGLNIDIAPDAIANQLNVRNGALVLLVPGNSLAA  669
             G+GFAIP +T+  IVPQLI+ G+VVR  + IDIAPD  A Q  V+  A++ + PG S A 
Sbjct  219   GIGFAIPVNTLKDIVPQLIEHGRVVRPVIGIDIAPDQWARQSGVKGVAVLRVAPG-SPAD  277

Query  668   KAGILPTTRGFAGNIVLGDIIEAVDNKPVRNKADLYKVLDDYSVGDKVQLKIRR  507
             +AG+    R   G I+LGDII A+D  P RN  +L   L+ Y+ GD+V+L   R
Sbjct  278   RAGLRGAQRSRWGTIILGDIITAIDQHPTRNYDELMTALEKYAPGDRVELVFAR  331



>ref|WP_034728571.1| hypothetical protein [Bacteriovorax sp. BSW11_IV]
Length=351

 Score =   222 bits (566),  Expect = 4e-63, Method: Compositional matrix adjust.
 Identities = 115/242 (48%), Positives = 158/242 (65%), Gaps = 0/242 (0%)
 Frame = -2

Query  1232  FKFFFGRLQKNFEGKLVGADRSKDLAVLKVEASEDLLRPTKIGESSSLRVGQKCLAIGNP  1053
             F   F   +K ++ KLVG +  KDLAVLK+E     L P   G S  L +GQK +A+GNP
Sbjct  92    FTVTFHNDKKQYKAKLVGVEPLKDLAVLKLEERPGSLAPIITGNSKDLVIGQKAMALGNP  151

Query  1052  FGFDHTLTVGVISGLNRDIYSQTGVTISGGIQTDAAINPGNSGGPLLDSKGNLIGINTAI  873
             FG DHT+T G+IS   R I    GV+I+  IQTD +INPGNSGGPLLDS G +IG+NT I
Sbjct  152   FGLDHTITAGIISATGRSIKGIGGVSIANMIQTDTSINPGNSGGPLLDSTGRVIGVNTMI  211

Query  872   FTQTGTSAGVGFAIPSSTVLRIVPQLIQSGKVVRAGLNIDIAPDAIANQLNVRNGALVLL  693
             ++Q+G+SAGVGFA+P  TV RIVP+LI+ GK+VR G  I + P+   ++  ++ G ++  
Sbjct  212   YSQSGSSAGVGFAVPIDTVKRIVPELIKHGKIVRPGFRIGVLPEPYRDRFGIKKGIVITY  271

Query  692   VPGNSLAAKAGILPTTRGFAGNIVLGDIIEAVDNKPVRNKADLYKVLDDYSVGDKVQLKI  513
             V  +  A KAG+   TR   G   +GDI+  VD K V N  ++Y VL++Y VGD+V+++ 
Sbjct  272   VDEDGPAGKAGMKGMTRDEYGRPYVGDILVKVDGKEVNNFDEIYNVLENYKVGDEVEIEY  331

Query  512   RR  507
              R
Sbjct  332   IR  333



>gb|EQC48376.1| trypsin [Bacteriovorax sp. BSW11_IV]
Length=359

 Score =   222 bits (566),  Expect = 6e-63, Method: Compositional matrix adjust.
 Identities = 115/242 (48%), Positives = 158/242 (65%), Gaps = 0/242 (0%)
 Frame = -2

Query  1232  FKFFFGRLQKNFEGKLVGADRSKDLAVLKVEASEDLLRPTKIGESSSLRVGQKCLAIGNP  1053
             F   F   +K ++ KLVG +  KDLAVLK+E     L P   G S  L +GQK +A+GNP
Sbjct  100   FTVTFHNDKKQYKAKLVGVEPLKDLAVLKLEERPGSLAPIITGNSKDLVIGQKAMALGNP  159

Query  1052  FGFDHTLTVGVISGLNRDIYSQTGVTISGGIQTDAAINPGNSGGPLLDSKGNLIGINTAI  873
             FG DHT+T G+IS   R I    GV+I+  IQTD +INPGNSGGPLLDS G +IG+NT I
Sbjct  160   FGLDHTITAGIISATGRSIKGIGGVSIANMIQTDTSINPGNSGGPLLDSTGRVIGVNTMI  219

Query  872   FTQTGTSAGVGFAIPSSTVLRIVPQLIQSGKVVRAGLNIDIAPDAIANQLNVRNGALVLL  693
             ++Q+G+SAGVGFA+P  TV RIVP+LI+ GK+VR G  I + P+   ++  ++ G ++  
Sbjct  220   YSQSGSSAGVGFAVPIDTVKRIVPELIKHGKIVRPGFRIGVLPEPYRDRFGIKKGIVITY  279

Query  692   VPGNSLAAKAGILPTTRGFAGNIVLGDIIEAVDNKPVRNKADLYKVLDDYSVGDKVQLKI  513
             V  +  A KAG+   TR   G   +GDI+  VD K V N  ++Y VL++Y VGD+V+++ 
Sbjct  280   VDEDGPAGKAGMKGMTRDEYGRPYVGDILVKVDGKEVNNFDEIYNVLENYKVGDEVEIEY  339

Query  512   RR  507
              R
Sbjct  340   IR  341



>ref|WP_012831703.1| HtrA2 peptidase [Haliangium ochraceum]
 ref|YP_003271004.1| HtrA2 peptidase [Haliangium ochraceum DSM 14365]
 gb|ACY19111.1| HtrA2 peptidase [Haliangium ochraceum DSM 14365]
Length=469

 Score =   224 bits (572),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 124/231 (54%), Positives = 162/231 (70%), Gaps = 1/231 (0%)
 Frame = -2

Query  1199  FEGKLVGADRSKDLAVLKVEASEDLLRPTKIGESSSLRVGQKCLAIGNPFGFDHTLTVGV  1020
             +   +VGA   KD+AVL+VEA  + LRP  +G S+ L+VGQK  AIGNPFGFDHTLT GV
Sbjct  224   WPASVVGAAPDKDMAVLEVEAPREKLRPVSLGISNELQVGQKVFAIGNPFGFDHTLTTGV  283

Query  1019  ISGLNRDIYSQTGVTISGGIQTDAAINPGNSGGPLLDSKGNLIGINTAIFTQTGTSAGVG  840
             ISGLNR+I S T  TI   IQTDAAINPGNSGGPLLDS G LIGINTAI++ +G  AG+G
Sbjct  284   ISGLNREIRSVTERTIYDVIQTDAAINPGNSGGPLLDSAGLLIGINTAIYSPSGAYAGIG  343

Query  839   FAIPSSTVLRIVPQLIQSGKVVRAGLNIDIAPDAIANQLNVRNGALVLLVPGNSLAAKAG  660
             FA+P  TV RIVPQL+ +G+V + GL I     ++A + N++ G ++  V  +S AA+AG
Sbjct  344   FAVPVDTVNRIVPQLVSNGRVFKPGLGIYPLNASLAARNNIQ-GVVIREVAEDSAAARAG  402

Query  659   ILPTTRGFAGNIVLGDIIEAVDNKPVRNKADLYKVLDDYSVGDKVQLKIRR  507
             +       AG  +LGD+I  +D   V N  D+Y+VLD+ +VGD+V+L + R
Sbjct  403   LRGLVHTRAGPSMLGDVIVGIDGALVENIDDIYRVLDERNVGDEVELTVVR  453


 Score = 56.6 bits (135),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 30/66 (45%), Positives = 41/66 (62%), Gaps = 3/66 (5%)
 Frame = -3

Query  1606  GPLSPSEERIVQLFENNTYSVVNI--FDVTLRPRLNVGGAVEIPEGNGSGVVWDGEGNIV  1433
             G L+  EE  ++LF     SVV+I       R RL++  A++IP G GSG +WD  G++V
Sbjct  144   GDLAADEEANIELFRQVAPSVVHIESLKAQRRDRLSLN-ALDIPRGTGSGFIWDDRGHVV  202

Query  1432  TNYHVI  1415
             TNYHVI
Sbjct  203   TNYHVI  208



>emb|CBJ29300.1| Serine type protease, similar to Protease Do-like 1, chloroplast 
precursor [Ectocarpus siliculosus]
Length=397

 Score =   222 bits (565),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 117/234 (50%), Positives = 161/234 (69%), Gaps = 5/234 (2%)
 Frame = -2

Query  1208  QKNFEGKLVGADRSKDLAVLKVEASEDLLRPTKIGESSSLRVGQKCLAIGNPFGFDHTLT  1029
             Q+ F+ ++ G D  KD+AVLK++A  +LLRP  +G S++L+VGQ  LAIGNPFG DHTLT
Sbjct  141   QRTFQAQVKGYDPDKDVAVLKIDAPSELLRPIALGVSNTLKVGQLALAIGNPFGLDHTLT  200

Query  1028  VGVISGLNRDIYSQTGVTISGGIQTDAAINPGNSGGPLLDSKGNLIGINTAIFTQTGTSA  849
             +GV+SGL R++ S +G  IS  IQTDAAINPGNSGGPLLDS G +IG+NTAI++ +G SA
Sbjct  201   MGVVSGLGREVKSPSGRPISNVIQTDAAINPGNSGGPLLDSVGRIIGMNTAIYSPSGGSA  260

Query  848   GVGFAIPSSTVLRIVPQLIQSGKVVRAGLNIDIAPDAIANQLNVRNGALVLLVPGNSLAA  669
             G+GFAIP  T+  +V  +IQ G+V R  + I     A AN + ++ G LVL V   + AA
Sbjct  261   GIGFAIPVDTLKTVVGTIIQKGRVSRPIIGITFLESARANTVGIKKGVLVLDVKEGTSAA  320

Query  668   KAGILPTTRGFAGNIVLGDIIEAVDNKPVRNKADLYKVLDDYSVGDKVQLKIRR  507
              +G+ PTTR       LGDII A+D + +  +ADL+K+L+    GD++ +   R
Sbjct  321   NSGLRPTTR-----TQLGDIIVAIDKQEINTEADLFKILESRKPGDEISITAER  369



>ref|WP_012486196.1| 2-alkenal reductase [Cellvibrio japonicus]
 ref|YP_001981039.1| hypothetical protein CJA_0516 [Cellvibrio japonicus Ueda107]
 gb|ACE84340.1| hypothetical protein CJA_0516 [Cellvibrio japonicus Ueda107]
Length=351

 Score =   220 bits (561),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 116/234 (50%), Positives = 158/234 (68%), Gaps = 1/234 (0%)
 Frame = -2

Query  1208  QKNFEGKLVGADRSKDLAVLKVEASEDLLRPTKIGESSSLRVGQKCLAIGNPFGFDHTLT  1029
             Q N+  ++VG    +D+AVL+++A ED L+P  +G+S++LRVG+K LAIGNPFG D TLT
Sbjct  100   QSNWPAEVVGLAPERDIAVLRIKAPEDRLKPLPLGDSANLRVGRKVLAIGNPFGLDATLT  159

Query  1028  VGVISGLNRDIYSQTGVTISGGIQTDAAINPGNSGGPLLDSKGNLIGINTAIFTQTGTSA  849
              GV+S L R+I S     I+  IQTDAAINPGNSGGPLL+S+G LIG+NT I++ +G SA
Sbjct  160   TGVVSALGREITSPNQRKITNVIQTDAAINPGNSGGPLLNSQGELIGVNTMIYSPSGASA  219

Query  848   GVGFAIPSSTVLRIVPQLIQSGKVVRAGLNIDIAPDAIANQLNVRNGALVLLVPGNSLAA  669
             G+GFAIP +TV  +VP+LI+ G++VR  L I +AP+  A Q+ V  G  +L V  NS AA
Sbjct  220   GIGFAIPVNTVKEVVPELIKHGRLVRPVLGIAVAPEQWARQIGV-EGVPILRVEPNSPAA  278

Query  668   KAGILPTTRGFAGNIVLGDIIEAVDNKPVRNKADLYKVLDDYSVGDKVQLKIRR  507
              AG+    R   G I LGD+I A+ + P  N   L   L+ Y  GD+V + + R
Sbjct  279   AAGLEGAKRNAWGQITLGDVIVAIGDTPTTNDDQLLSALEKYKPGDQVNVSVVR  332



>ref|WP_007294861.1| 2-alkenal reductase [delta proteobacterium MLMS-1]
 gb|EAT02198.1| Peptidase S1 and S6, chymotrypsin/Hap:PDZ/DHR/GLGF [delta proteobacterium 
MLMS-1]
Length=372

 Score =   221 bits (562),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 115/234 (49%), Positives = 160/234 (68%), Gaps = 2/234 (1%)
 Frame = -2

Query  1208  QKNFEGKLVGADRSKDLAVLKVEASEDLLRPTKIGESSSLRVGQKCLAIGNPFGFDHTLT  1029
             Q  + G++VG    +DLAVL++EA  + LRP  +GES +L VGQ+  AIGNPFG D T+T
Sbjct  126   QSTWSGRVVGVAPDQDLAVLRIEAPPEQLRPLPMGESDNLLVGQQVFAIGNPFGLDQTMT  185

Query  1028  VGVISGLNRDIYSQTGVTISGGIQTDAAINPGNSGGPLLDSKGNLIGINTAIFTQTGTSA  849
              G++S L R+I ++TG +I G +QTDAAINPGNSGGPLLDS G +IGINTAI++ T  S 
Sbjct  186   SGIVSALGREIRARTGRSIQGVVQTDAAINPGNSGGPLLDSAGRVIGINTAIYSPTEASV  245

Query  848   GVGFAIPSSTVLRIVPQLIQSGKVVRAGLNIDIAPDAIANQLNVRNGALVLLVPGNSLAA  669
             G+GFA+P + + R+VP++I+ G+V+R GL I +A   +A +L V    +V + PG   A 
Sbjct  246   GIGFAVPVAVIKRVVPEVIEHGRVIRPGLGISVAHANLARRLGVEGVLIVNIRPGGP-AD  304

Query  668   KAGILPTTRGFAGNIVLGDIIEAVDNKPVRNKADLYKVLDDYSVGDKVQLKIRR  507
              AG L  TR  AG ++LGDII  V  +PV    +L   L+++ VGD+V+L I R
Sbjct  305   SAG-LRGTRQLAGELLLGDIITGVGGQPVHGYDELRNALEEFQVGDEVELAILR  357


 Score = 58.2 bits (139),  Expect = 9e-06, Method: Compositional matrix adjust.
 Identities = 28/67 (42%), Positives = 43/67 (64%), Gaps = 0/67 (0%)
 Frame = -3

Query  1606  GPLSPSEERIVQLFENNTYSVVNIFDVTLRPRLNVGGAVEIPEGNGSGVVWDGEGNIVTN  1427
             G L+ +E+  +++FEN + +VV I  + LR  +      E+P G GSG +WD  G+IVTN
Sbjct  50    GDLAAAEKTAIEIFENASPAVVFITTIELRRGIFTLNVYELPRGTGSGFIWDQHGHIVTN  109

Query  1426  YHVIGNS  1406
             YHVI ++
Sbjct  110   YHVIEDA  116



>ref|WP_007292741.1| 2-alkenal reductase [delta proteobacterium MLMS-1]
 gb|EAT04651.1| Peptidase S1 and S6, chymotrypsin/Hap:PDZ/DHR/GLGF [delta proteobacterium 
MLMS-1]
Length=372

 Score =   221 bits (562),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 115/234 (49%), Positives = 160/234 (68%), Gaps = 2/234 (1%)
 Frame = -2

Query  1208  QKNFEGKLVGADRSKDLAVLKVEASEDLLRPTKIGESSSLRVGQKCLAIGNPFGFDHTLT  1029
             Q  + G++VG    +DLAVL++EA  + LRP  +GES +L VGQ+  AIGNPFG D T+T
Sbjct  126   QSTWSGRVVGVAPDQDLAVLRIEAPPEQLRPLPMGESDNLLVGQQVFAIGNPFGLDQTMT  185

Query  1028  VGVISGLNRDIYSQTGVTISGGIQTDAAINPGNSGGPLLDSKGNLIGINTAIFTQTGTSA  849
              G++S L R+I ++TG +I G +QTDAAINPGNSGGPLLDS G +IGINTAI++ T  S 
Sbjct  186   SGIVSALGREIRARTGRSIQGVVQTDAAINPGNSGGPLLDSAGRVIGINTAIYSPTEASV  245

Query  848   GVGFAIPSSTVLRIVPQLIQSGKVVRAGLNIDIAPDAIANQLNVRNGALVLLVPGNSLAA  669
             G+GFA+P + + R+VP++I+ G+V+R GL I +A   +A +L V    +V + PG   A 
Sbjct  246   GIGFAVPVAVIKRVVPEVIEHGRVIRPGLGISVAHANLARRLGVEGVLIVNIRPGGP-AD  304

Query  668   KAGILPTTRGFAGNIVLGDIIEAVDNKPVRNKADLYKVLDDYSVGDKVQLKIRR  507
              AG L  TR  AG ++LGDII  V  +PV    +L   L+++ VGD+V+L I R
Sbjct  305   SAG-LRGTRQLAGELLLGDIITGVGGQPVHGYDELRNALEEFQVGDEVELAILR  357


 Score = 58.2 bits (139),  Expect = 9e-06, Method: Compositional matrix adjust.
 Identities = 28/67 (42%), Positives = 43/67 (64%), Gaps = 0/67 (0%)
 Frame = -3

Query  1606  GPLSPSEERIVQLFENNTYSVVNIFDVTLRPRLNVGGAVEIPEGNGSGVVWDGEGNIVTN  1427
             G L+ +E+  +++FEN + +VV I  + LR  +      E+P G GSG +WD  G+IVTN
Sbjct  50    GDLAAAEKTAIEIFENASPAVVFITTIELRRGIFTLNVYELPRGTGSGFIWDQHGHIVTN  109

Query  1426  YHVIGNS  1406
             YHVI ++
Sbjct  110   YHVIEDA  116



>ref|WP_038206276.1| 2-alkenal reductase [Xenophilus azovorans]
Length=350

 Score =   219 bits (559),  Expect = 4e-62, Method: Compositional matrix adjust.
 Identities = 117/234 (50%), Positives = 151/234 (65%), Gaps = 1/234 (0%)
 Frame = -2

Query  1208  QKNFEGKLVGADRSKDLAVLKVEASEDLLRPTKIGESSSLRVGQKCLAIGNPFGFDHTLT  1029
             Q +   +LVG    +DLAVLK++A    LRP  +G S+ L+VGQ+  AIGNPFG D T+T
Sbjct  102   QSSHRARLVGVFPERDLAVLKIDAPAGTLRPLPLGTSADLQVGQRVFAIGNPFGLDQTMT  161

Query  1028  VGVISGLNRDIYSQTGVTISGGIQTDAAINPGNSGGPLLDSKGNLIGINTAIFTQTGTSA  849
              G++S L+R I S    TI G IQTDAAINPGNSGGPLLDS G LIG+NTAIF+ +G SA
Sbjct  162   TGIVSALDRQIESVNRRTIRGAIQTDAAINPGNSGGPLLDSAGRLIGVNTAIFSPSGASA  221

Query  848   GVGFAIPSSTVLRIVPQLIQSGKVVRAGLNIDIAPDAIANQLNVRNGALVLLVPGNSLAA  669
             G+GF+IP   V RIVP+LI+ G+ VR  +    AP  +   L +  G  V+ V   S A 
Sbjct  222   GIGFSIPVDEVNRIVPRLIRDGRFVRPAMGAAYAPQELNRALELPRGVAVVRVQPGSPAE  281

Query  668   KAGILPTTRGFAGNIVLGDIIEAVDNKPVRNKADLYKVLDDYSVGDKVQLKIRR  507
             +AG+ P  RG  G IV GD+I A+D +PV N  DL+ +L+    GD V L + R
Sbjct  282   RAGLRPFMRGERG-IVAGDVITALDGRPVANTDDLFTLLEQRQPGDTVMLTLWR  334


 Score = 53.9 bits (128),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 27/67 (40%), Positives = 41/67 (61%), Gaps = 0/67 (0%)
 Frame = -3

Query  1606  GPLSPSEERIVQLFENNTYSVVNIFDVTLRPRLNVGGAVEIPEGNGSGVVWDGEGNIVTN  1427
             GPL   E   + +F   + SVV+I  + L+  L      ++P+G GSG VWD +G++VTN
Sbjct  26    GPLGAEELNQIAVFRAASPSVVHITSLGLQRDLFSLDVQQVPQGTGSGFVWDTQGHVVTN  85

Query  1426  YHVIGNS  1406
             +HVI N+
Sbjct  86    FHVIENA  92



>ref|WP_020559912.1| hypothetical protein [Thiothrix flexilis]
Length=372

 Score =   220 bits (560),  Expect = 5e-62, Method: Compositional matrix adjust.
 Identities = 120/237 (51%), Positives = 162/237 (68%), Gaps = 5/237 (2%)
 Frame = -2

Query  1208  QKNFEGKLVGADRSKDLAVLKVEASEDLLRPTKIGESSSLRVGQKCLAIGNPFGFDHTLT  1029
             Q+ ++ KLVGA R  DLAVL++   +DL +P +IG S  L+VGQK +AIGNPFG DHTLT
Sbjct  122   QRLYDAKLVGASREHDLAVLRLTELKDLPKPVQIGTSHDLKVGQKVMAIGNPFGLDHTLT  181

Query  1028  VGVISGLNRDIYSQTGVTISGGIQTDAAINPGNSGGPLLDSKGNLIGINTAIFTQTGTSA  849
              G++S L R I       +   IQTDAAINPGNSGGPLLDS G ++G++ AI++ +G SA
Sbjct  182   SGIVSALGRSIDGDNN-QLDDLIQTDAAINPGNSGGPLLDSAGRVVGVSVAIYSPSGVSA  240

Query  848   GVGFAIPSSTVLRIVPQLIQSGKVVRAGLNIDIAPD---AIANQLNVRNGALVLLVPGNS  678
             G+GFAIP  TV R++PQL++SG+  R  L + I  +   A+  +L V+ G LVL V   S
Sbjct  241   GIGFAIPVDTVNRVIPQLVRSGRYERLVLGVSIKDEVNAAVTRRLGVK-GILVLQVTPRS  299

Query  677   LAAKAGILPTTRGFAGNIVLGDIIEAVDNKPVRNKADLYKVLDDYSVGDKVQLKIRR  507
              AA AGI+ T    AG ++LGDII+A+D KPV   AD+ ++LD Y  GD V++K+ R
Sbjct  300   PAADAGIIGTQLDNAGGLILGDIIQAIDGKPVTKVADISRILDTYKRGDTVKVKLLR  356



>ref|XP_002505610.1| predicted protein [Micromonas sp. RCC299]
 gb|ACO66868.1| predicted protein [Micromonas sp. RCC299]
Length=427

 Score =   221 bits (562),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 127/249 (51%), Positives = 164/249 (66%), Gaps = 16/249 (6%)
 Frame = -2

Query  1205  KNFEGKLVGADRSKDLAVLKV--------------EASEDLLRPTKIGESSSLRVGQKCL  1068
             K ++ KLVG +  KDLAVLK+              EA +  L P  +G + +LRVGQK  
Sbjct  160   KTYDAKLVGYEADKDLAVLKLVNGGDGRADADELSEAWKLSLSPIAVGTTQNLRVGQKVF  219

Query  1067  AIGNPFGFDHTLTVGVISGLNRDIYSQTGVTISGGIQTDAAINPGNSGGPLLDSKGNLIG  888
             AIGNPFG D TLT G++SG+ RDI S TG  I   +QTDAAINPGNSGGPLLDS+G LIG
Sbjct  220   AIGNPFGLDQTLTAGIVSGVGRDIKSITGRRIRDVVQTDAAINPGNSGGPLLDSRGRLIG  279

Query  887   INTAIFTQTGTSAGVGFAIPSSTVLRIVPQLIQSGKVVRAGLNIDIAPDAIANQLNVRNG  708
             +NT I++ +G S+GVGFAIPS TV R+V Q+I+ G+VVRAG+ +  A D IA ++NV +G
Sbjct  280   VNTVIYSPSGASSGVGFAIPSDTVRRVVNQIIRRGRVVRAGVGVHCAADQIARRMNV-DG  338

Query  707   ALVLLVPGNSLAAKAGILPTTRG-FAGNIVLGDIIEAVDNKPVRNKADLYKVLDDYSVGD  531
              +VL VP  S AA AGI   TR    G  VLGD+I AV+   V    DL   ++ + VG+
Sbjct  339   VIVLEVPPGSGAAAAGIKGVTRDPGTGAAVLGDVIVAVEGARVTAVEDLLAKVETHDVGE  398

Query  530   KVQLKIRRG  504
              V++ +RRG
Sbjct  399   VVRITVRRG  407


 Score = 53.1 bits (126),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 29/69 (42%), Positives = 44/69 (64%), Gaps = 7/69 (10%)
 Frame = -3

Query  1600  LSPSEERIVQLFENNTYSVVNIFDVTLRPRLNVGG----AVEIPEGNGSGVVWDGEGNIV  1433
             L   E   V+LFE  + SVV+I   T   ++  GG     ++IP+G+GSG VWD +G++V
Sbjct  84    LMAEERNTVELFERCSRSVVHI---TTTVQVQRGGFSMDILDIPQGSGSGFVWDKQGHLV  140

Query  1432  TNYHVIGNS  1406
             TN+HVI ++
Sbjct  141   TNFHVIKDA  149



>ref|WP_010130959.1| 2-alkenal reductase [Microbulbifer agarilyticus]
Length=356

 Score =   218 bits (555),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 120/234 (51%), Positives = 154/234 (66%), Gaps = 1/234 (0%)
 Frame = -2

Query  1208  QKNFEGKLVGADRSKDLAVLKVEASEDLLRPTKIGESSSLRVGQKCLAIGNPFGFDHTLT  1029
             +  +  +LVG+   KDLAVL++ A  + L+P   GESSSL VG+K LAIGNPFG D TLT
Sbjct  110   RSEWPAQLVGSAPEKDLAVLRINAPAERLKPLIPGESSSLSVGRKVLAIGNPFGLDTTLT  169

Query  1028  VGVISGLNRDIYSQTGVTISGGIQTDAAINPGNSGGPLLDSKGNLIGINTAIFTQTGTSA  849
              GV+S L R+I +    TI   IQTDAAINPGNSGGPLLDS G LIG+NTAI++ +G S 
Sbjct  170   TGVVSALGREIDAAGNRTIRNVIQTDAAINPGNSGGPLLDSSGRLIGVNTAIYSPSGASV  229

Query  848   GVGFAIPSSTVLRIVPQLIQSGKVVRAGLNIDIAPDAIANQLNVRNGALVLLVPGNSLAA  669
             G+GFAIP  TV +IVP+LI  G++VR  L I+ APD  AN+ +    A++   PG   A 
Sbjct  230   GIGFAIPVDTVKKIVPELIAHGRLVRPILGIESAPDQWANRYDFEGVAVLRTAPGLP-AE  288

Query  668   KAGILPTTRGFAGNIVLGDIIEAVDNKPVRNKADLYKVLDDYSVGDKVQLKIRR  507
             KAG+    RG  G   LGD+I  +D +P+ N  DL  VL+D   GD+VQ+   R
Sbjct  289   KAGLRGVYRGSRGGWQLGDVIVGIDGRPISNYDDLMNVLEDRRPGDRVQVDYLR  342



>ref|XP_010105634.1| Protease Do-like 8 [Morus notabilis]
 gb|EXC05422.1| Protease Do-like 8 [Morus notabilis]
Length=286

 Score =   216 bits (549),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 105/118 (89%), Positives = 113/118 (96%), Gaps = 0/118 (0%)
 Frame = -2

Query  1211  LQKNFEGKLVGADRSKDLAVLKVEASEDLLRPTKIGESSSLRVGQKCLAIGNPFGFDHTL  1032
             +QKNFEGKLVGADR+KDLAVLKVEA E+LL+P  +G+S  LRVGQ+CLAIGNPFGFDHTL
Sbjct  114   VQKNFEGKLVGADRAKDLAVLKVEAPEELLKPILVGQSYLLRVGQQCLAIGNPFGFDHTL  173

Query  1031  TVGVISGLNRDIYSQTGVTISGGIQTDAAINPGNSGGPLLDSKGNLIGINTAIFTQTG  858
             TVGVISGLNRDI+SQTGVTISGGIQTDAAINPGNSGGPLLDSKGNLIGINTAIFTQTG
Sbjct  174   TVGVISGLNRDIFSQTGVTISGGIQTDAAINPGNSGGPLLDSKGNLIGINTAIFTQTG  231


 Score =   173 bits (438),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 85/113 (75%), Positives = 97/113 (86%), Gaps = 0/113 (0%)
 Frame = -3

Query  1681  ITLQAYALGDPSVTVEQVTPPTFPSGPLSPSEERIVQLFENNTYSVVNIFDVTLRPRLNV  1502
             +   A ALGDPSVT+E+VTP   PS  L P+E RIVQLFE NTYSV NIFDVTLRP+LNV
Sbjct  1     MDFSAQALGDPSVTIEEVTPTVSPSPALFPTENRIVQLFEKNTYSVANIFDVTLRPQLNV  60

Query  1501  GGAVEIPEGNGSGVVWDGEGNIVTNYHVIGNSLSRNPTRGEVVARVNILAPDG  1343
              GAVE+PEGNGSGVVWDG+G+IVTNYHVIGNSL+RNP+ G+VVARVNILA +G
Sbjct  61    TGAVEVPEGNGSGVVWDGQGHIVTNYHVIGNSLTRNPSPGQVVARVNILASEG  113



>ref|WP_035275807.1| 2-alkenal reductase [Desulfobulbus japonicus]
Length=356

 Score =   218 bits (555),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 121/234 (52%), Positives = 156/234 (67%), Gaps = 2/234 (1%)
 Frame = -2

Query  1208  QKNFEGKLVGADRSKDLAVLKVEASEDLLRPTKIGESSSLRVGQKCLAIGNPFGFDHTLT  1029
                ++  LVG    +DLAVL++ A    L+P  IGESS+L VGQK  AIGNPFG D TLT
Sbjct  110   HSTWKAVLVGMAPDRDLAVLQISAPASKLKPIPIGESSNLLVGQKVFAIGNPFGLDQTLT  169

Query  1028  VGVISGLNRDIYSQTGVTISGGIQTDAAINPGNSGGPLLDSKGNLIGINTAIFTQTGTSA  849
              G++S L R+I S TG TI   IQTDAAINPGNSGGPLLDS G LIG+NTAI++ +G S+
Sbjct  170   TGIVSALGREITSVTGRTIHDVIQTDAAINPGNSGGPLLDSAGRLIGVNTAIYSPSGASS  229

Query  848   GVGFAIPSSTVLRIVPQLIQSGKVVRAGLNIDIAPDAIANQLNVRNGALVLLVPGNSLAA  669
             G+GFA+P   V R+VPQ+I+ GK++R GL I +A   +  +L +  G LVL V   S A 
Sbjct  230   GIGFAVPVGEVNRVVPQIIRHGKIIRPGLGITLANQRLTEELELE-GVLVLKVVTGSTAE  288

Query  668   KAGILPTTRGFAGNIVLGDIIEAVDNKPVRNKADLYKVLDDYSVGDKVQLKIRR  507
             KAG L  TR   G ++LGD+I AV+ + V+N   L   ++ Y VG+KV L I R
Sbjct  289   KAG-LRATRQVPGGLILGDVILAVNGESVKNYDSLRDEVEKYRVGEKVILLISR  341


 Score = 63.5 bits (153),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 34/86 (40%), Positives = 48/86 (56%), Gaps = 4/86 (5%)
 Frame = -3

Query  1663  ALGDPSVTVEQVTPPTFPSGPLSPSEERIVQLFENNTYSVVNIFDVTLRPRLNVGGAVEI  1484
             AL DP    + V+ P    G L+  E+  + +F N+  SVV I  + +R  L      E+
Sbjct  19    ALLDP----KAVSRPVAARGDLAADEQNTIDIFRNSAPSVVYITSIAVRRNLFNLNVYEM  74

Query  1483  PEGNGSGVVWDGEGNIVTNYHVIGNS  1406
             P+G GSG +WD  G IVTNYHVI ++
Sbjct  75    PQGTGSGFIWDSSGRIVTNYHVISDA  100



>ref|WP_019561833.1| hypothetical protein [Caldimonas manganoxidans]
Length=374

 Score =   218 bits (556),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 118/234 (50%), Positives = 157/234 (67%), Gaps = 0/234 (0%)
 Frame = -2

Query  1208  QKNFEGKLVGADRSKDLAVLKVEASEDLLRPTKIGESSSLRVGQKCLAIGNPFGFDHTLT  1029
             Q ++   LVGA   +DLAVL+++A  + L+P  +GES+SL+VGQK  AIGNPFG D TLT
Sbjct  126   QSSYPAALVGAFPDRDLAVLRIDAPREKLKPIALGESASLQVGQKVYAIGNPFGLDQTLT  185

Query  1028  VGVISGLNRDIYSQTGVTISGGIQTDAAINPGNSGGPLLDSKGNLIGINTAIFTQTGTSA  849
              G++S LNR+I S T   I G IQTDAAINPGNSGGPLLDS G LIG+NTAI++ +G SA
Sbjct  186   TGIVSALNREIESVTRRPIRGVIQTDAAINPGNSGGPLLDSAGRLIGVNTAIYSPSGASA  245

Query  848   GVGFAIPSSTVLRIVPQLIQSGKVVRAGLNIDIAPDAIANQLNVRNGALVLLVPGNSLAA  669
             G+GFAIP   V R+VP+LI+ G+ +R  L I  APD     L +  G +V+ V  +S AA
Sbjct  246   GIGFAIPVDEVNRVVPRLIRDGRFIRPSLGISAAPDRFGQALGLPAGVVVVDVAADSPAA  305

Query  668   KAGILPTTRGFAGNIVLGDIIEAVDNKPVRNKADLYKVLDDYSVGDKVQLKIRR  507
             +AG+ P  R   G++V GD+I A+  +       L + L+ + VGD V LK+ R
Sbjct  306   QAGLRPFARASDGSLVAGDVILALGGQATPTLDRLLEALEQHQVGDTVTLKLWR  359



>ref|XP_005539130.1| DegP protease precursor [Cyanidioschyzon merolae strain 10D]
 dbj|BAM83094.1| DegP protease precursor [Cyanidioschyzon merolae strain 10D]
Length=474

 Score =   221 bits (562),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 118/234 (50%), Positives = 158/234 (68%), Gaps = 0/234 (0%)
 Frame = -2

Query  1205  KNFEGKLVGADRSKDLAVLKVEASEDLLRPTKIGESSSLRVGQKCLAIGNPFGFDHTLTV  1026
             K +  +LVG D  KD+AVLK++A  + LRP  +G S+ L VGQ+  AIGNPFG + T+T 
Sbjct  224   KTYPARLVGYDADKDVAVLKIDAPTETLRPVTLGSSAGLHVGQRAYAIGNPFGLNETMTQ  283

Query  1025  GVISGLNRDIYSQTGVTISGGIQTDAAINPGNSGGPLLDSKGNLIGINTAIFTQTGTSAG  846
             G+ISGL R+I S TG  I+  +QTD+AINPGNSGGPLLDS+G +IG+ TAI++ +G SAG
Sbjct  284   GIISGLGREIRSPTGRPITNVLQTDSAINPGNSGGPLLDSQGRVIGMTTAIYSPSGASAG  343

Query  845   VGFAIPSSTVLRIVPQLIQSGKVVRAGLNIDIAPDAIANQLNVRNGALVLLVPGNSLAAK  666
             VGFAIP  T+  +V  LI+ GKV R  + I     + A  L +  G LVL VP  S AAK
Sbjct  344   VGFAIPIDTLKTVVDTLIKYGKVTRPMIGISYLESSQAQILGINEGVLVLDVPQGSEAAK  403

Query  665   AGILPTTRGFAGNIVLGDIIEAVDNKPVRNKADLYKVLDDYSVGDKVQLKIRRG  504
             AG+  T R   G + LGDII  +D + +RN+ADL++VL++   G  V L++ RG
Sbjct  404   AGLQGTRRSTFGQLELGDIIVGLDGERIRNEADLFRVLEEKKPGQVVTLEVIRG  457


 Score = 62.0 bits (149),  Expect = 9e-07, Method: Compositional matrix adjust.
 Identities = 29/68 (43%), Positives = 42/68 (62%), Gaps = 0/68 (0%)
 Frame = -3

Query  1618  TFPSGPLSPSEERIVQLFENNTYSVVNIFDVTLRPRLNVGGAVEIPEGNGSGVVWDGEGN  1439
             T+    LSP E+  V LFE N  SVV +  +  R   +    +E+P GNGSG +WD +G+
Sbjct  143   TYTESDLSPEEKATVALFERNRDSVVLVTTLIERRDFSSLNIMEVPSGNGSGFIWDKDGH  202

Query  1438  IVTNYHVI  1415
             +VTN+HV+
Sbjct  203   VVTNFHVV  210



>ref|XP_005853635.1| hypothetical protein NGA_0428900, partial [Nannochloropsis gaditana 
CCMP526]
 gb|EKU22725.1| hypothetical protein NGA_0428900, partial [Nannochloropsis gaditana 
CCMP526]
Length=447

 Score =   220 bits (560),  Expect = 4e-61, Method: Compositional matrix adjust.
 Identities = 121/226 (54%), Positives = 152/226 (67%), Gaps = 0/226 (0%)
 Frame = -2

Query  1208  QKNFEGKLVGADRSKDLAVLKVEASEDLLRPTKIGESSSLRVGQKCLAIGNPFGFDHTLT  1029
             Q  ++  L G D  KD+AVL+VEA    LRP  +G SS+L+VGQ  LAIGNPFG DHTLT
Sbjct  187   QSTYKALLRGFDPDKDVAVLRVEAPPASLRPIPVGSSSTLKVGQAALAIGNPFGLDHTLT  246

Query  1028  VGVISGLNRDIYSQTGVTISGGIQTDAAINPGNSGGPLLDSKGNLIGINTAIFTQTGTSA  849
              GVISGL R++ S +G  IS  IQTDAAINPGNSGGPLLDS G L+G+NTAI++ +G SA
Sbjct  247   SGVISGLGREVRSPSGRPISNVIQTDAAINPGNSGGPLLDSAGRLVGMNTAIYSPSGASA  306

Query  848   GVGFAIPSSTVLRIVPQLIQSGKVVRAGLNIDIAPDAIANQLNVRNGALVLLVPGNSLAA  669
             G+GFAIP  T+  +V  +I+ GKVVR  + I     + A  L +  G LVL VP  S  A
Sbjct  307   GIGFAIPVDTLKFVVETIIKDGKVVRPLIGITYLESSQAKALGIDKGVLVLDVPRQSPGA  366

Query  668   KAGILPTTRGFAGNIVLGDIIEAVDNKPVRNKADLYKVLDDYSVGD  531
              AG+  T+R   G I LGDII  ++N  + N+ADL+K L+ Y  GD
Sbjct  367   LAGMRGTSRSRLGLIQLGDIIVQINNDDINNEADLFKTLEKYRPGD  412



>ref|XP_003077970.1| DegP protease precursor (ISS), partial [Ostreococcus tauri]
Length=470

 Score =   220 bits (561),  Expect = 5e-61, Method: Compositional matrix adjust.
 Identities = 129/252 (51%), Positives = 165/252 (65%), Gaps = 6/252 (2%)
 Frame = -2

Query  1244  LTFIFKFFFGRLQ--KNFEGKLVGADRSKDLAVLKVEASEDL--LRPTKIGESSSLRVGQ  1077
             ++F+ K    RLQ  K ++  +VG D  KD+AVL+V   E L  ++P  IG S    VGQ
Sbjct  183   VSFLPKKGASRLQGQKVYDAAIVGFDEDKDIAVLQVTDPEALEEMKPLSIGRSGEALVGQ  242

Query  1076  KCLAIGNPFGFDHTLTVGVISGLNRDIYS-QTGVTISGGIQTDAAINPGNSGGPLLDSKG  900
             +  AIGNPFG DHTLT G+ISGL R+I S  TG  I G IQTDAAINPGNSGGPLL+S G
Sbjct  243   RVYAIGNPFGLDHTLTTGIISGLGREIQSGNTGRPIDGIIQTDAAINPGNSGGPLLNSSG  302

Query  899   NLIGINTAIFTQTGTSAGVGFAIPSSTVLRIVPQLIQSGKVVRAGLNIDIAPDAIANQLN  720
              LIGINTAI++ +GTS+GVGFA+PS  V  IV Q+I+ G+V R  L +  APD   +QL 
Sbjct  303   QLIGINTAIYSASGTSSGVGFALPSDMVSGIVDQIIRFGRVTRPILGVSFAPDGALDQLG  362

Query  719   VRNGALVLLVPGNSLAAKAGILPTTRGFAGNIVLGDIIEAVDNKPVRNKADLYKVLDDYS  540
             +  G LVL       A +AG+  TTR   G ++LGDII  +  +P+   +DLY+ LD   
Sbjct  363   L-GGVLVLDARPGGPADRAGVHSTTRDDTGRLILGDIIIELAGEPIEGSSDLYRTLDKLR  421

Query  539   VGDKVQLKIRRG  504
             VGD V+LK+ RG
Sbjct  422   VGDVVELKLLRG  433


 Score = 55.5 bits (132),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 30/62 (48%), Positives = 36/62 (58%), Gaps = 0/62 (0%)
 Frame = -3

Query  1600  LSPSEERIVQLFENNTYSVVNIFDVTLRPRLNVGGAVEIPEGNGSGVVWDGEGNIVTNYH  1421
             L+  E   V LF N   SVV I +V +R         E P+G GSGVVWD  G+IVTN+H
Sbjct  114   LTEDERETVNLFNNAKRSVVYITNVAVRRDAFTLDLTEAPQGAGSGVVWDDAGHIVTNFH  173

Query  1420  VI  1415
             VI
Sbjct  174   VI  175



>gb|ETX09290.1| 2-alkenal reductase [Candidatus Entotheonella sp. TSY2]
Length=370

 Score =   217 bits (553),  Expect = 5e-61, Method: Compositional matrix adjust.
 Identities = 118/234 (50%), Positives = 155/234 (66%), Gaps = 1/234 (0%)
 Frame = -2

Query  1208  QKNFEGKLVGADRSKDLAVLKVEASEDLLRPTKIGESSSLRVGQKCLAIGNPFGFDHTLT  1029
                ++ +LVG    +DLAVL + A    L+P  IG S+ L+VGQ   AIGNPFG D TLT
Sbjct  123   HSTWDARLVGVAPDQDLAVLSINAPRSRLKPLPIGRSAGLQVGQNVFAIGNPFGLDQTLT  182

Query  1028  VGVISGLNRDIYSQTGVTISGGIQTDAAINPGNSGGPLLDSKGNLIGINTAIFTQTGTSA  849
              G+IS L R+I S +G TI   IQTDAAINPGNSGGPLLDS G LIG+NTAI++ +G+SA
Sbjct  183   TGIISALGREINSVSGRTIPDVIQTDAAINPGNSGGPLLDSAGRLIGVNTAIYSPSGSSA  242

Query  848   GVGFAIPSSTVLRIVPQLIQSGKVVRAGLNIDIAPDAIANQLNVRNGALVLLVPGNSLAA  669
             G+GFA+P  TV R+VPQLI+ G+VVR GL    A DA A ++ + NG L + V   S A 
Sbjct  243   GIGFAVPVDTVNRVVPQLIRHGRVVRPGLGGRFANDATAQRMGI-NGVLTVDVTEGSAAQ  301

Query  668   KAGILPTTRGFAGNIVLGDIIEAVDNKPVRNKADLYKVLDDYSVGDKVQLKIRR  507
              AG+    R   G +V GD+I  ++ +PV +  DL ++L  Y+VGD V++ I R
Sbjct  302   AAGLQGMRRNRQGELVFGDVIVGIEQEPVGSLDDLMRLLHRYNVGDTVRVVIVR  355


 Score = 58.5 bits (140),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 39/111 (35%), Positives = 63/111 (57%), Gaps = 9/111 (8%)
 Frame = -3

Query  1666  YALGDPSVTVEQVTPPTFPSGPLSPSEERIVQLFENNTYSVVNIFDVTL-RPRLNVGGAV  1490
             Y L DP  T   +TP     G L+  E+  +++F++ + SVV I  + + R R ++    
Sbjct  31    YVLYDPDATPRAITP----RGDLAGDEKTNIEVFQHASPSVVYITSLAIQRDRFSMN-LH  85

Query  1489  EIPEGNGSGVVWDGEGNIVTNYHVIGNSLSRNPTRGEVV---ARVNILAPD  1346
             EIP+G GSG +W+ +G+I+TN+HVI N+     T  +     AR+  +APD
Sbjct  86    EIPQGTGSGFIWNSQGHIITNFHVIQNASGAKVTLADHSTWDARLVGVAPD  136



>ref|WP_020736955.1| serine protease [Sorangium cellulosum]
 ref|YP_008151433.1| serine protease [Sorangium cellulosum So0157-2]
 gb|AGP37492.1| serine protease [Sorangium cellulosum So0157-2]
Length=390

 Score =   217 bits (553),  Expect = 8e-61, Method: Compositional matrix adjust.
 Identities = 121/240 (50%), Positives = 163/240 (68%), Gaps = 10/240 (4%)
 Frame = -2

Query  1208  QKNFEGKLVGADRSKDLAVLKVEASEDLLRPTKIGE-SSSLRVGQKCLAIGNPFGFDHTL  1032
             +K F  KLVG +  KD+AVLK++A +++L+P ++      L VGQK +AIGNPFG DHTL
Sbjct  142   EKTFPAKLVGVEPRKDIAVLKIDAPKEMLKPIQVAPLREPLEVGQKAIAIGNPFGLDHTL  201

Query  1031  TVGVISGLNRDIYSQTGVTISGGIQTDAAINPGNSGGPLLDSKGNLIGINTAIFTQTGTS  852
             T G+IS L R +    GVTI   IQTDAAINPGNSGGPLLDS G+LIG+NT IF+++GTS
Sbjct  202   TTGIISALGRQVEGAGGVTIRDMIQTDAAINPGNSGGPLLDSSGHLIGMNTMIFSKSGTS  261

Query  851   AGVGFAIPSSTVLRIVPQLIQSGKVVRAGLNIDIAPDAIANQLNVRN---GALVL-LVPG  684
             AG+GFA+PS+T+ R+VPQ+I++GK    GL I + P   A +L  RN   G +V+ +VPG
Sbjct  262   AGIGFAVPSTTIARVVPQIIRTGKAETVGLGIQLDP---ARRLERRNGIRGVIVMGIVPG  318

Query  683   NSLAAKAGILPTTRGFAGNIVLGDIIEAVDNKPVRNKADLYKVLDDYSVGDKVQLKIRRG  504
                A KAG+   + G  G + LGD+I  +D  PV +   LY  LD    G+KV++ + RG
Sbjct  319   GP-AEKAGLRGLSEGDRG-LTLGDVIVGIDGAPVADYDALYNALDGKKPGEKVKVDLLRG  376



>ref|WP_014243018.1| protease [Bacteriovorax marinus]
 ref|YP_005034202.1| protease [Bacteriovorax marinus SJ]
 emb|CBW25229.1| probable protease [Bacteriovorax marinus SJ]
Length=353

 Score =   216 bits (550),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 119/242 (49%), Positives = 157/242 (65%), Gaps = 0/242 (0%)
 Frame = -2

Query  1232  FKFFFGRLQKNFEGKLVGADRSKDLAVLKVEASEDLLRPTKIGESSSLRVGQKCLAIGNP  1053
             F   F   +K ++ KLVG   +KD+AVLK+      L P K+GES  L+VGQK +AIGNP
Sbjct  95    FLITFHGDKKQYKAKLVGKVSNKDVAVLKLVERPKTLYPIKVGESKILKVGQKTMAIGNP  154

Query  1052  FGFDHTLTVGVISGLNRDIYSQTGVTISGGIQTDAAINPGNSGGPLLDSKGNLIGINTAI  873
             FG DHT+T G+IS L+R I     V I G IQTDA+INPGNSGGPLL+S+G LIG+NT I
Sbjct  155   FGLDHTITSGIISALDRKIMGIGNVRIYGMIQTDASINPGNSGGPLLNSRGQLIGMNTVI  214

Query  872   FTQTGTSAGVGFAIPSSTVLRIVPQLIQSGKVVRAGLNIDIAPDAIANQLNVRNGALVLL  693
             ++++G+SAG+GFA+P + + R+VP LI++GKV R G+ I  A +    +L +  G +VL 
Sbjct  215   YSKSGSSAGIGFAVPVAIIKRVVPDLIKNGKVTRPGIGIGPASEYQKARLGIEKGIVVLY  274

Query  692   VPGNSLAAKAGILPTTRGFAGNIVLGDIIEAVDNKPVRNKADLYKVLDDYSVGDKVQLKI  513
             V     A KAG+   TR   G    GDII A+D K V    D+Y VL+ Y VGD V+  I
Sbjct  275   VDPEGGAGKAGLQGFTRDQYGRHYPGDIILAIDKKNVNTIDDIYHVLEAYKVGDIVKADI  334

Query  512   RR  507
              R
Sbjct  335   LR  336



>ref|XP_005847403.1| hypothetical protein CHLNCDRAFT_35559 [Chlorella variabilis]
 gb|EFN55301.1| hypothetical protein CHLNCDRAFT_35559 [Chlorella variabilis]
Length=348

 Score =   216 bits (549),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 124/240 (52%), Positives = 163/240 (68%), Gaps = 7/240 (3%)
 Frame = -2

Query  1208  QKNFEGKLVGADRSKDLAVLKVEASEDLL---RPTKIGESSSLRVGQKCLAIGNPFGFDH  1038
             Q  +  K++G D SKD+AVL+VEA  ++L   +P  +G SS L VGQ+  AIGNPFG DH
Sbjct  89    QSTWPAKIIGGDPSKDVAVLQVEAPPEVLANLKPITLGASSGLLVGQQVFAIGNPFGLDH  148

Query  1037  TLTVGVISGLNRDIYS-QTGVTISGGIQTDAAINPGNSGGPLLDSKGNLIGINTAIFTQT  861
             TLT G+ISGLNR++ +   G ++   IQ DAAINPGNSGGPLLDS+G LIGINTAI   T
Sbjct  149   TLTSGIISGLNRELNTGYGGNSLRNVIQCDAAINPGNSGGPLLDSRGRLIGINTAIADPT  208

Query  860   --GTSAGVGFAIPSSTVLRIVPQLIQSGKVVRAGLNIDIAPDAIANQLNVRNGALVLLVP  687
               G S+G+GFAIP  TV  +V Q+++ G+VVR  L I IAP     Q+ ++ G LVL VP
Sbjct  209   GKGASSGIGFAIPIDTVKGLVEQILKYGRVVRPVLGITIAPPQALRQMGIQ-GVLVLDVP  267

Query  686   GNSLAAKAGILPTTRGFAGNIVLGDIIEAVDNKPVRNKADLYKVLDDYSVGDKVQLKIRR  507
               + AAKAG+   TR   G + +GD+I  ++ KPVR +ADL+ +LD   VGDKV + + R
Sbjct  268   PGTPAAKAGMEGITRDNYGRMTIGDVIVGMNGKPVRTEADLFDILDGCKVGDKVTVDVLR  327



>emb|CEG60598.1| DegP protease (Do-like, S2-serine-like) [Tatlockia micdadei]
Length=356

 Score =   216 bits (549),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 116/234 (50%), Positives = 162/234 (69%), Gaps = 5/234 (2%)
 Frame = -2

Query  1190  KLVGADRSKDLAVLKVEASEDL-----LRPTKIGESSSLRVGQKCLAIGNPFGFDHTLTV  1026
             K++G++  KD+AVLKV++S+ L       P ++  ++ L VGQK +AIGNPFG DH+L+V
Sbjct  107   KVIGSEPRKDIAVLKVKSSKALEMLKSFVPFELARTNELLVGQKTIAIGNPFGLDHSLSV  166

Query  1025  GVISGLNRDIYSQTGVTISGGIQTDAAINPGNSGGPLLDSKGNLIGINTAIFTQTGTSAG  846
             GVIS L R +    GVTI   IQTD +INPGNSGGPLLDSKG LIG+NTAI++ +G SAG
Sbjct  167   GVISALGRQVPGVGGVTIRDMIQTDTSINPGNSGGPLLDSKGRLIGLNTAIYSSSGNSAG  226

Query  845   VGFAIPSSTVLRIVPQLIQSGKVVRAGLNIDIAPDAIANQLNVRNGALVLLVPGNSLAAK  666
             VGFA+P+  + RIVPQ+I++G+VV +G+ I     AI+ +L + +G L+  V  N+ AAK
Sbjct  227   VGFAVPADDIARIVPQIIKNGRVVLSGIGIQWVGPAISKRLGITHGILIADVIPNTPAAK  286

Query  665   AGILPTTRGFAGNIVLGDIIEAVDNKPVRNKADLYKVLDDYSVGDKVQLKIRRG  504
              G+  T R   G I LGDII A++  PV+N   LY +L +  VG+++ L + RG
Sbjct  287   IGLRSTYRDSWGRIHLGDIIVALNGHPVKNYDALYNLLTNIKVGEEITLTVSRG  340



>ref|WP_023405839.1| hypothetical protein [uncultured Desulfofustis sp. PB-SRB1]
 gb|ESQ13039.1| hypothetical protein N839_07365 [uncultured Desulfofustis sp. 
PB-SRB1]
Length=365

 Score =   216 bits (549),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 116/234 (50%), Positives = 156/234 (67%), Gaps = 2/234 (1%)
 Frame = -2

Query  1208  QKNFEGKLVGADRSKDLAVLKVEASEDLLRPTKIGESSSLRVGQKCLAIGNPFGFDHTLT  1029
             Q   +  L+GAD  KD+AVL+V+A   LLRP  IGES  L VGQK  AIGNPFG D T+T
Sbjct  120   QSVHKAVLIGADPDKDIAVLQVDAPAHLLRPIAIGESGPLLVGQKVFAIGNPFGLDQTIT  179

Query  1028  VGVISGLNRDIYSQTGVTISGGIQTDAAINPGNSGGPLLDSKGNLIGINTAIFTQTGTSA  849
              G+IS L R+I + TG TI G IQTDAAINPGNSGGPLLDS G LIG+NTAIF+ +G  A
Sbjct  180   SGIISALEREINAITGHTIRGVIQTDAAINPGNSGGPLLDSAGRLIGMNTAIFSPSGAYA  239

Query  848   GVGFAIPSSTVLRIVPQLIQSGKVVRAGLNIDIAPDAIANQLNVRNGALVLLVPGNSLAA  669
             G+GFA+P + + R+VP+LI  G++++ GL + +  + +A +L +  G ++L +   S A 
Sbjct  240   GIGFAVPVAEINRVVPELIAHGRMIKPGLGVSLVDERVARRLGI-EGVIILDIENGSPAE  298

Query  668   KAGILPTTRGFAGNIVLGDIIEAVDNKPVRNKADLYKVLDDYSVGDKVQLKIRR  507
             + G+ PT +   G I LGDII  +D+  + +  DL   L  Y VGD+V L+  R
Sbjct  299   QVGLRPTVQA-GGEISLGDIIVGLDSYEIGSYDDLRTALQRYQVGDEVALRFIR  351


 Score = 64.7 bits (156),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 33/69 (48%), Positives = 41/69 (59%), Gaps = 0/69 (0%)
 Frame = -3

Query  1612  PSGPLSPSEERIVQLFENNTYSVVNIFDVTLRPRLNVGGAVEIPEGNGSGVVWDGEGNIV  1433
             P G L+  E+  + +F N   SVV I  + LR       AVEIP+G GSG VWD  G +V
Sbjct  42    PRGDLAADEQNTIDIFRNAAPSVVYIDSIALRRGFFSLNAVEIPQGTGSGFVWDTYGRVV  101

Query  1432  TNYHVIGNS  1406
             TNYHVI N+
Sbjct  102   TNYHVISNA  110



>emb|CEF96987.1| Peptidase S1C [Ostreococcus tauri]
Length=518

 Score =   220 bits (560),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 129/252 (51%), Positives = 165/252 (65%), Gaps = 6/252 (2%)
 Frame = -2

Query  1244  LTFIFKFFFGRLQ--KNFEGKLVGADRSKDLAVLKVEASEDL--LRPTKIGESSSLRVGQ  1077
             ++F+ K    RLQ  K ++  +VG D  KD+AVL+V   E L  ++P  IG S    VGQ
Sbjct  231   VSFLPKKGASRLQGQKVYDAAIVGFDEDKDIAVLQVTDPEALEEMKPLSIGRSGEALVGQ  290

Query  1076  KCLAIGNPFGFDHTLTVGVISGLNRDIYS-QTGVTISGGIQTDAAINPGNSGGPLLDSKG  900
             +  AIGNPFG DHTLT G+ISGL R+I S  TG  I G IQTDAAINPGNSGGPLL+S G
Sbjct  291   RVYAIGNPFGLDHTLTTGIISGLGREIQSGNTGRPIDGIIQTDAAINPGNSGGPLLNSSG  350

Query  899   NLIGINTAIFTQTGTSAGVGFAIPSSTVLRIVPQLIQSGKVVRAGLNIDIAPDAIANQLN  720
              LIGINTAI++ +GTS+GVGFA+PS  V  IV Q+I+ G+V R  L +  APD   +QL 
Sbjct  351   QLIGINTAIYSASGTSSGVGFALPSDMVSGIVDQIIRFGRVTRPILGVSFAPDGALDQLG  410

Query  719   VRNGALVLLVPGNSLAAKAGILPTTRGFAGNIVLGDIIEAVDNKPVRNKADLYKVLDDYS  540
             +  G LVL       A +AG+  TTR   G ++LGDII  +  +P+   +DLY+ LD   
Sbjct  411   L-GGVLVLDARPGGPADRAGVHSTTRDDTGRLILGDIIIELAGEPIEGSSDLYRTLDKLR  469

Query  539   VGDKVQLKIRRG  504
             VGD V+LK+ RG
Sbjct  470   VGDVVELKLLRG  481


 Score = 55.5 bits (132),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 30/62 (48%), Positives = 36/62 (58%), Gaps = 0/62 (0%)
 Frame = -3

Query  1600  LSPSEERIVQLFENNTYSVVNIFDVTLRPRLNVGGAVEIPEGNGSGVVWDGEGNIVTNYH  1421
             L+  E   V LF N   SVV I +V +R         E P+G GSGVVWD  G+IVTN+H
Sbjct  162   LTEDERETVNLFNNAKRSVVYITNVAVRRDAFTLDLTEAPQGAGSGVVWDDAGHIVTNFH  221

Query  1420  VI  1415
             VI
Sbjct  222   VI  223



>emb|CEF98004.1| Peptidase S1C [Ostreococcus tauri]
Length=356

 Score =   215 bits (548),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 127/222 (57%), Positives = 149/222 (67%), Gaps = 5/222 (2%)
 Frame = -2

Query  1205  KNFEGKLVGADRSKDLAVLKVEASEDLLRPTKIGESSSLRVGQKCLAIGNPFGFDHTLTV  1026
             + F   LVGA + KDL VLKV+A  DLLRP K   S  +RVG   LAIGNPFGFDHTLT 
Sbjct  100   RTFPAALVGASKEKDLVVLKVDAPRDLLRPVKRA-SEEVRVGSAVLAIGNPFGFDHTLTT  158

Query  1025  GVISGLNRDIYSQTGVTISGGIQTDAAINPGNSGGPLLDSKGNLIGINTAIFTQTGTSAG  846
             GV+SGLNR I SQ G  I+G IQTDAAINPGNSGGPLL+S G LIGINTAIFT  G+SAG
Sbjct  159   GVVSGLNRTIQSQVGSLITGAIQTDAAINPGNSGGPLLNSSGQLIGINTAIFTPNGSSAG  218

Query  845   VGFAIPSSTVLRIVPQLIQSGKVVRAGLNIDIAPDAIAN--QLNVRNGALVL-LVPGNSL  675
             VGFAIP   V  +VPQLI++G+ V   L I     ++    QL V +GALV      +S 
Sbjct  219   VGFAIPIDIVNNVVPQLIKNGEAVFPSLEIKFGDISMLRDLQLPVGSGALVQGFTNNDSP  278

Query  674   AAKAGILPTTRGFAGNIVLGDIIEAVDNKPVRNKADLYKVLD  549
             AAKAGIL T R  AG +V GD I  VD +P    AD+ + ++
Sbjct  279   AAKAGILATRRALAG-LVPGDCIIEVDGQPCAVAADVIRAVE  319


 Score = 68.6 bits (166),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 41/94 (44%), Positives = 55/94 (59%), Gaps = 11/94 (12%)
 Frame = -3

Query  1600  LSPSEERIVQLFENNTYSVVNIFDVTLRPRLNVGGAVE------IPEGNGSGVVWDGEGN  1439
             LS  EER V +F   + S VN+ D+T+   LN  G         + EGNG+GVVWD EG+
Sbjct  7     LSALEERFVDVFREASASAVNVVDLTI---LNASGTQSAFAGSIVAEGNGTGVVWDDEGH  63

Query  1438  IVTNYHVIGNSLSRNPT--RGEVVARVNILAPDG  1343
             +V+NYHVI + L+  P   +   VA+V I A DG
Sbjct  64    VVSNYHVISSVLATIPKGRKTSSVAQVTIQAKDG  97



>ref|XP_009034040.1| hypothetical protein AURANDRAFT_20884 [Aureococcus anophagefferens]
 gb|EGB11697.1| hypothetical protein AURANDRAFT_20884 [Aureococcus anophagefferens]
Length=308

 Score =   214 bits (544),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 113/236 (48%), Positives = 155/236 (66%), Gaps = 6/236 (3%)
 Frame = -2

Query  1199  FEGKLVGADRSKDLAVLKVEASEDLLRPTKIGESSSLRVGQKCLAIGNPFGFDHTLTVGV  1020
             ++  LVGA+  KD+AVLKV A   +L P ++G SS L VGQ  LAIGNPFG DHTLT G+
Sbjct  51    YDATLVGAEPEKDIAVLKVRAPASVLEPIEVGSSSELLVGQSVLAIGNPFGLDHTLTKGI  110

Query  1019  ISGLNRDIYSQTGVTISGGIQTDAAINPGNSGGPLLDSKGNLIGINTAIFTQTGTSAGVG  840
             +S + R++    G  I G +QTDAAINPGNSGGPLLD+KG LIG+NTAI++ +G SAG+G
Sbjct  111   VSAVGREVQGVAGRPIKGCVQTDAAINPGNSGGPLLDAKGRLIGVNTAIYSPSGASAGIG  170

Query  839   FAIPSSTVLRIVPQLIQSGKVVRAGLNIDIAPDAIANQLNVR-----NGALVLLVPGNSL  675
             FAIP  +V RIV QLI+ G+++R  + I +A D +   L +R     +G LV+  P NS 
Sbjct  171   FAIPVDSVRRIVNQLIRYGRMLRPSMGISVADDQMTRGLAMRLGAPLDGVLVMEAPPNSP  230

Query  674   AAKAGILPTTRGFAGNIVLGDIIEAVDNKPVRNKADLYKVLDDYSVGDKVQLKIRR  507
              A AG++   R   G + LGD+I  V+  PV+   DL  ++++  +G  V L + R
Sbjct  231   GADAGLVGCMR-KNGQLYLGDLITRVNGTPVKTVEDLLTLVEETEIGSSVVLTVHR  285



>ref|WP_026154707.1| 2-alkenal reductase [Thiothrix disciformis]
Length=366

 Score =   215 bits (548),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 118/237 (50%), Positives = 156/237 (66%), Gaps = 4/237 (2%)
 Frame = -2

Query  1208  QKNFEGKLVGADRSKDLAVLKVEASEDLLRPTKIGESSSLRVGQKCLAIGNPFGFDHTLT  1029
             Q+ F   +VG     DLAVLK+   +D+  P +IG S  L+VGQ  LAIGNPFG DHTLT
Sbjct  116   QRIFTADVVGVSAQHDLAVLKIRERKDIPPPVQIGSSRELKVGQTVLAIGNPFGLDHTLT  175

Query  1028  VGVISGLNRDIYSQTGVTISGGIQTDAAINPGNSGGPLLDSKGNLIGINTAIFTQTGTSA  849
              G++S L R I ++   +++  IQTDA+INPGNSGGPLLDS G +IG+N AI++ +G SA
Sbjct  176   TGILSALGRSIEAEGSSSMADLIQTDASINPGNSGGPLLDSSGRVIGVNAAIYSPSGASA  235

Query  848   GVGFAIPSSTVLRIVPQLIQSGKVVRAGLNIDIAPDA---IANQLNVRNGALVLLVPGNS  678
             G+GFAIP  TV R+VPQLIQ+G  VR  L I +  D    ++ +L V+ G LVL V  NS
Sbjct  236   GIGFAIPIDTVNRVVPQLIQNGHYVRPILGITMNDDVSTRVSERLGVK-GVLVLDVAPNS  294

Query  677   LAAKAGILPTTRGFAGNIVLGDIIEAVDNKPVRNKADLYKVLDDYSVGDKVQLKIRR  507
              AAKAG+  T       +VLGD I+A+D KP+   +DL  +LD Y + D V+L + R
Sbjct  295   PAAKAGLRGTALTQNEELVLGDFIQAIDGKPITKSSDLITILDGYQLNDTVKLSLLR  351



>ref|WP_020412424.1| 2-alkenal reductase [Microbulbifer variabilis]
Length=351

 Score =   215 bits (547),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 117/234 (50%), Positives = 156/234 (67%), Gaps = 1/234 (0%)
 Frame = -2

Query  1208  QKNFEGKLVGADRSKDLAVLKVEASEDLLRPTKIGESSSLRVGQKCLAIGNPFGFDHTLT  1029
             +  +  +LVG+   KDLAVLK+EA ++ L+P   G SS+L VG+K LAIGNPFG D TLT
Sbjct  104   RSEWPAQLVGSAPEKDLAVLKIEAPKERLKPLVAGTSSNLSVGRKVLAIGNPFGLDTTLT  163

Query  1028  VGVISGLNRDIYSQTGVTISGGIQTDAAINPGNSGGPLLDSKGNLIGINTAIFTQTGTSA  849
              GV+S L R+I +    TI   IQTDAAINPGNSGGPLLDS G LIG+NTAI++ +GTS 
Sbjct  164   TGVVSALGREIEAANNRTIRNVIQTDAAINPGNSGGPLLDSLGRLIGVNTAIYSPSGTSV  223

Query  848   GVGFAIPSSTVLRIVPQLIQSGKVVRAGLNIDIAPDAIANQLNVRNGALVLLVPGNSLAA  669
             G+GFAIP  TV +IVP+LI  G++VR  L I+ APD  +++      A++ + PG   A 
Sbjct  224   GIGFAIPVDTVKKIVPELIAHGRLVRPILGIESAPDQWSSRYGFEGVAVLRIAPGLP-AE  282

Query  668   KAGILPTTRGFAGNIVLGDIIEAVDNKPVRNKADLYKVLDDYSVGDKVQLKIRR  507
             KAG+    R   G   LGD+I  V+ +P+R+  DL   L+ + VGD++ L I R
Sbjct  283   KAGLQGIYRTRQGGWQLGDVIVEVEQQPIRSYDDLLNALEKHQVGDEITLGIMR  336



>ref|WP_002709789.1| 2-alkenal reductase [Thiothrix nivea]
 gb|EIJ35895.1| DegP2 peptidase [Thiothrix nivea DSM 5205]
Length=373

 Score =   216 bits (549),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 118/238 (50%), Positives = 160/238 (67%), Gaps = 5/238 (2%)
 Frame = -2

Query  1208  QKNFEGKLVGADRSKDLAVLKVEASEDLLRPTKIGESSSLRVGQKCLAIGNPFGFDHTLT  1029
             Q+ F+  +VGA    DLAVL+++ + D   P ++G SS LRVGQK LAIGNPFG DHTLT
Sbjct  123   QRLFDASVVGASPEHDLAVLQLQETADTPPPVQVGSSSDLRVGQKVLAIGNPFGLDHTLT  182

Query  1028  VGVISGLNRDIYSQTGVTISGGIQTDAAINPGNSGGPLLDSKGNLIGINTAIFTQTGTSA  849
              GVIS L R I S  G ++ G IQTDAAINPGNSGGPLLDS G LIG+N AI++ +G SA
Sbjct  183   TGVISALRRSIDSDDG-SMDGLIQTDAAINPGNSGGPLLDSAGRLIGVNVAIYSPSGASA  241

Query  848   GVGFAIPSSTVLRIVPQLIQSGKVVRAGLNIDIAPDAIANQLNVR---NGALVLLVPGNS  678
             G+GFAIP   V R++P+L++ G+  R  L + +  D+I+  +N +    G LVL V   S
Sbjct  242   GIGFAIPVDVVNRVIPRLVKDGRYTRPILGVSVD-DSISETINEKLGTQGVLVLQVQPGS  300

Query  677   LAAKAGILPTTRGFAGNIVLGDIIEAVDNKPVRNKADLYKVLDDYSVGDKVQLKIRRG  504
              AA AGI PT      +++LGDII+A+D +P+ +  +L  VLD+Y    +V +++ RG
Sbjct  301   PAASAGIRPTGLTRNDDLLLGDIIQAIDGQPITSVNELNSVLDNYPRNSRVNVRLLRG  358


 Score = 52.8 bits (125),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 30/69 (43%), Positives = 38/69 (55%), Gaps = 0/69 (0%)
 Frame = -3

Query  1621  PTFPSGPLSPSEERIVQLFENNTYSVVNIFDVTLRPRLNVGGAVEIPEGNGSGVVWDGEG  1442
             P    G L+  E+  + +FE N+ SVV I  V     L      EIP G G+G VWD  G
Sbjct  42    PVQVRGDLAADEQATISIFEQNSPSVVYITTVERVVSLWSRNVQEIPSGTGTGFVWDKFG  101

Query  1441  NIVTNYHVI  1415
             +IVTNYHV+
Sbjct  102   HIVTNYHVV  110



>ref|WP_028374385.1| peptidase [Legionella lansingensis]
Length=355

 Score =   214 bits (546),  Expect = 4e-60, Method: Compositional matrix adjust.
 Identities = 117/233 (50%), Positives = 160/233 (69%), Gaps = 5/233 (2%)
 Frame = -2

Query  1190  KLVGADRSKDLAVLKVEASE--DLLR---PTKIGESSSLRVGQKCLAIGNPFGFDHTLTV  1026
             K+VGA+  KD+AVL + A +  +LL+   P ++  ++ L VGQK +AIGNPFG DH+LTV
Sbjct  106   KVVGAEPRKDIAVLAITAPKALELLKSYTPFELAHTNELLVGQKTIAIGNPFGLDHSLTV  165

Query  1025  GVISGLNRDIYSQTGVTISGGIQTDAAINPGNSGGPLLDSKGNLIGINTAIFTQTGTSAG  846
             GVIS L R +    GVTI   IQTD +INPGNSGGPLLDSKG LIG+NTAI++ +G+SAG
Sbjct  166   GVISALGRQVPGAGGVTIRDMIQTDTSINPGNSGGPLLDSKGRLIGLNTAIYSNSGSSAG  225

Query  845   VGFAIPSSTVLRIVPQLIQSGKVVRAGLNIDIAPDAIANQLNVRNGALVLLVPGNSLAAK  666
             VGFA+P+  + RIVPQLI++G+VV +G+ I +    IA +L V  G LV  V  ++ AA+
Sbjct  226   VGFAVPADDIARIVPQLIKNGRVVLSGIGIQVVEPHIAKRLGVTKGLLVADVLPHTPAAQ  285

Query  665   AGILPTTRGFAGNIVLGDIIEAVDNKPVRNKADLYKVLDDYSVGDKVQLKIRR  507
               +  TTR   G+I LGD+I A++  PV+N    Y +L D  VG+ + L + R
Sbjct  286   VKLRGTTRDSWGHIHLGDVIVAINGHPVKNYDAFYNILVDIKVGETINLAVLR  338



>ref|XP_009042752.1| hypothetical protein AURANDRAFT_35147 [Aureococcus anophagefferens]
 gb|EGB02549.1| hypothetical protein AURANDRAFT_35147 [Aureococcus anophagefferens]
Length=345

 Score =   214 bits (544),  Expect = 5e-60, Method: Compositional matrix adjust.
 Identities = 113/236 (48%), Positives = 155/236 (66%), Gaps = 6/236 (3%)
 Frame = -2

Query  1199  FEGKLVGADRSKDLAVLKVEASEDLLRPTKIGESSSLRVGQKCLAIGNPFGFDHTLTVGV  1020
             ++  LVGA+  KD+AVLKV A   +L P ++G SS L VGQ  LAIGNPFG DHTLT G+
Sbjct  88    YDATLVGAEPEKDIAVLKVRAPASVLEPIEVGSSSELLVGQSVLAIGNPFGLDHTLTKGI  147

Query  1019  ISGLNRDIYSQTGVTISGGIQTDAAINPGNSGGPLLDSKGNLIGINTAIFTQTGTSAGVG  840
             +S + R++    G  I G +QTDAAINPGNSGGPLLD+KG LIG+NTAI++ +G SAG+G
Sbjct  148   VSAVGREVQGVAGRPIKGCVQTDAAINPGNSGGPLLDAKGRLIGVNTAIYSPSGASAGIG  207

Query  839   FAIPSSTVLRIVPQLIQSGKVVRAGLNIDIAPDAIANQLNVR-----NGALVLLVPGNSL  675
             FAIP  +V RIV QLI+ G+++R  + I +A D +   L +R     +G LV+  P NS 
Sbjct  208   FAIPVDSVRRIVNQLIRYGRMLRPSMGISVADDQMTRGLAMRLGAPLDGVLVMEAPPNSP  267

Query  674   AAKAGILPTTRGFAGNIVLGDIIEAVDNKPVRNKADLYKVLDDYSVGDKVQLKIRR  507
              A AG++   R   G + LGD+I  V+  PV+   DL  ++++  +G  V L + R
Sbjct  268   GADAGLVGCMRK-NGQLYLGDLITRVNGTPVKTVEDLLTLVEETEIGSSVVLTVHR  322



>ref|WP_015405342.1| DegP2 peptidase [Desulfocapsa sulfexigens]
 ref|YP_007469311.1| DegP2 peptidase [Desulfocapsa sulfexigens DSM 10523]
 gb|AGF79658.1| DegP2 peptidase [Desulfocapsa sulfexigens DSM 10523]
Length=370

 Score =   214 bits (546),  Expect = 5e-60, Method: Compositional matrix adjust.
 Identities = 117/234 (50%), Positives = 158/234 (68%), Gaps = 2/234 (1%)
 Frame = -2

Query  1208  QKNFEGKLVGADRSKDLAVLKVEASEDLLRPTKIGESSSLRVGQKCLAIGNPFGFDHTLT  1029
                ++  L+GA   KDLAVL+++A   LLRP  +GES+ L+VGQK  A+GNPFG D T+T
Sbjct  123   HSTWKAVLIGAAPDKDLAVLQIDAPAHLLRPIPVGESTDLQVGQKVFAVGNPFGLDQTIT  182

Query  1028  VGVISGLNRDIYSQTGVTISGGIQTDAAINPGNSGGPLLDSKGNLIGINTAIFTQTGTSA  849
              G+IS L R+I + TG TI   IQTDAAINPGNSGGPLLDS G LIG+NTAIF+ +G  A
Sbjct  183   SGIISALGREIKAITGRTIRDMIQTDAAINPGNSGGPLLDSAGRLIGVNTAIFSPSGAYA  242

Query  848   GVGFAIPSSTVLRIVPQLIQSGKVVRAGLNIDIAPDAIANQLNVRNGALVLLVPGNSLAA  669
             G+GFA+P S V R+VPQLI  G++VR G+   +A   +  +L + +G LVL V     A 
Sbjct  243   GIGFAVPVSEVNRVVPQLISKGRLVRPGIGASLADARLVKRLGI-DGVLVLGVEQGGPAH  301

Query  668   KAGILPTTRGFAGNIVLGDIIEAVDNKPVRNKADLYKVLDDYSVGDKVQLKIRR  507
             +AGI PT + +   +VLGDII  +  K V++  D+   L+ ++VGD+V + I R
Sbjct  302   QAGIRPTKQ-YGNEVVLGDIITDIGGKKVQSYDDIRTELERHAVGDEVVVTILR  354


 Score = 65.5 bits (158),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 31/67 (46%), Positives = 45/67 (67%), Gaps = 0/67 (0%)
 Frame = -3

Query  1606  GPLSPSEERIVQLFENNTYSVVNIFDVTLRPRLNVGGAVEIPEGNGSGVVWDGEGNIVTN  1427
             G L+  E+  ++LF+N + SVV I  + +R  +    AVEIP+G GSG +WDG G +VTN
Sbjct  47    GDLAEDEKNTIELFKNISPSVVYITTIAVRRNMFSLNAVEIPQGTGSGFIWDGSGRVVTN  106

Query  1426  YHVIGNS  1406
             YHVI ++
Sbjct  107   YHVISDA  113



>ref|WP_019014410.1| 2-alkenal reductase [Elioraea tepidiphila]
Length=375

 Score =   214 bits (544),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 119/236 (50%), Positives = 150/236 (64%), Gaps = 4/236 (2%)
 Frame = -2

Query  1205  KNFEGKLVGADRSKDLAVLKVEASEDLLRPTKIGESSSLRVGQKCLAIGNPFGFDHTLTV  1026
             + F   LVG+  + DLAVL++    D   P  +G S  LRVGQK  AIGNPFG D TLT 
Sbjct  126   RAFAATLVGSSPAHDLAVLRIGLGADRPAPLPVGTSHDLRVGQKVFAIGNPFGLDWTLTT  185

Query  1025  GVISGLNRDIYSQTGVTISGGIQTDAAINPGNSGGPLLDSKGNLIGINTAIFTQTGTSAG  846
             G++S LNR++ + TG  I G IQTDAAINPGNSGGPLLDS G LIG+NTAIF+ +G SAG
Sbjct  186   GIVSALNRELPTDTGGAIEGLIQTDAAINPGNSGGPLLDSAGRLIGVNTAIFSPSGASAG  245

Query  845   VGFAIPSSTVLRIVPQLIQSGKVVRAGLNIDIAPD---AIANQLNVRNGALVLLVPGNSL  675
             +GFA+P  TV R+VPQLI +G+ VR  L I +      A+A +  +  G  VL V   S 
Sbjct  246   IGFAVPVDTVNRVVPQLIATGRYVRPALGIRVEHQLNAALARRYGI-EGVFVLEVERGSP  304

Query  674   AAKAGILPTTRGFAGNIVLGDIIEAVDNKPVRNKADLYKVLDDYSVGDKVQLKIRR  507
             AA+AG+ P   G  G    GD+I AVD +PV   ADL   LD +S G +V + + R
Sbjct  305   AARAGLRPARLGGDGAFEPGDVIVAVDGRPVARVADLLNALDRFSPGAEVTVTLMR  360



>ref|XP_003079375.1| Serine protease (ISS) [Ostreococcus tauri]
Length=441

 Score =   216 bits (549),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 127/222 (57%), Positives = 149/222 (67%), Gaps = 5/222 (2%)
 Frame = -2

Query  1205  KNFEGKLVGADRSKDLAVLKVEASEDLLRPTKIGESSSLRVGQKCLAIGNPFGFDHTLTV  1026
             + F   LVGA + KDL VLKV+A  DLLRP K   S  +RVG   LAIGNPFGFDHTLT 
Sbjct  185   RTFPAALVGASKEKDLVVLKVDAPRDLLRPVKRA-SEEVRVGSAVLAIGNPFGFDHTLTT  243

Query  1025  GVISGLNRDIYSQTGVTISGGIQTDAAINPGNSGGPLLDSKGNLIGINTAIFTQTGTSAG  846
             GV+SGLNR I SQ G  I+G IQTDAAINPGNSGGPLL+S G LIGINTAIFT  G+SAG
Sbjct  244   GVVSGLNRTIQSQVGSLITGAIQTDAAINPGNSGGPLLNSSGQLIGINTAIFTPNGSSAG  303

Query  845   VGFAIPSSTVLRIVPQLIQSGKVVRAGLNIDIAPDAIAN--QLNVRNGALVL-LVPGNSL  675
             VGFAIP   V  +VPQLI++G+ V   L I     ++    QL V +GALV      +S 
Sbjct  304   VGFAIPIDIVNNVVPQLIKNGEAVFPSLEIKFGDISMLRDLQLPVGSGALVQGFTNNDSP  363

Query  674   AAKAGILPTTRGFAGNIVLGDIIEAVDNKPVRNKADLYKVLD  549
             AAKAGIL T R  AG +V GD I  VD +P    AD+ + ++
Sbjct  364   AAKAGILATRRALAG-LVPGDCIIEVDGQPCAVAADVIRAVE  404


 Score = 68.9 bits (167),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 41/94 (44%), Positives = 55/94 (59%), Gaps = 11/94 (12%)
 Frame = -3

Query  1600  LSPSEERIVQLFENNTYSVVNIFDVTLRPRLNVGGAVE------IPEGNGSGVVWDGEGN  1439
             LS  EER V +F   + S VN+ D+T+   LN  G         + EGNG+GVVWD EG+
Sbjct  92    LSALEERFVDVFREASASAVNVVDLTI---LNASGTQSAFAGSIVAEGNGTGVVWDDEGH  148

Query  1438  IVTNYHVIGNSLSRNPT--RGEVVARVNILAPDG  1343
             +V+NYHVI + L+  P   +   VA+V I A DG
Sbjct  149   VVSNYHVISSVLATIPKGRKTSSVAQVTIQAKDG  182



>emb|CAJ71979.1| strongly similar to serine protease [Candidatus Kuenenia stuttgartiensis]
Length=373

 Score =   213 bits (543),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 120/231 (52%), Positives = 152/231 (66%), Gaps = 1/231 (0%)
 Frame = -2

Query  1199  FEGKLVGADRSKDLAVLKVEASEDLLRPTKIGESSSLRVGQKCLAIGNPFGFDHTLTVGV  1020
             ++ +LVG D   D+AVL++ A +  L P  IG SS L+VGQK LA+GNPFG D TLT G+
Sbjct  127   WDARLVGVDPDHDIAVLRINAPKTKLIPVLIGTSSDLQVGQKVLALGNPFGLDLTLTTGI  186

Query  1019  ISGLNRDIYSQTGVTISGGIQTDAAINPGNSGGPLLDSKGNLIGINTAIFTQTGTSAGVG  840
             IS L R I + TG TI   IQTDAAINPGNSGGPLLDS G +IG+NT+I + +G S G+G
Sbjct  187   ISALGRTIEAMTGRTIFDVIQTDAAINPGNSGGPLLDSFGRVIGMNTSIMSPSGASTGIG  246

Query  839   FAIPSSTVLRIVPQLIQSGKVVRAGLNIDIAPDAIANQLNVRNGALVLLVPGNSLAAKAG  660
             FA+P  T+ R V QLI  GKV R GL I + P+ I  QL ++ GA +L V  N  A KAG
Sbjct  247   FAVPIDTINRNVSQLIARGKVERPGLGITLVPNNITKQLEIQ-GACILEVIPNGAADKAG  305

Query  659   ILPTTRGFAGNIVLGDIIEAVDNKPVRNKADLYKVLDDYSVGDKVQLKIRR  507
             +  T R   G++++GD+I  V+   V N  DL K L  Y VGD V LK+ R
Sbjct  306   LQGTKRNRTGSLLMGDVIIEVEGNKVNNSEDLIKELSRYKVGDSVTLKVLR  356


 Score = 54.3 bits (129),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 30/76 (39%), Positives = 44/76 (58%), Gaps = 1/76 (1%)
 Frame = -3

Query  1630  VTPPTFPS-GPLSPSEERIVQLFENNTYSVVNIFDVTLRPRLNVGGAVEIPEGNGSGVVW  1454
             V  P  PS G  S  E+  + +F+  + SV+ I +  +R  L      +IP+G GSG +W
Sbjct  39    VFRPVTPSPGEFSSEEQATIDIFKMTSSSVIYITNKQVRRDLFSLDVFKIPQGAGSGFIW  98

Query  1453  DGEGNIVTNYHVIGNS  1406
             D  G+IVTN+HVI N+
Sbjct  99    DENGHIVTNFHVIYNA  114



>gb|EKD38540.1| hypothetical protein ACD_75C00700G0003 [uncultured bacterium]
Length=363

 Score =   213 bits (542),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 118/232 (51%), Positives = 157/232 (68%), Gaps = 2/232 (1%)
 Frame = -2

Query  1202  NFEGKLVGADRSKDLAVLKVEASEDLLRPTKIGESSSLRVGQKCLAIGNPFGFDHTLTVG  1023
              ++  LVGA   KD+AVL+++A  D L+P  IG S+ LRVGQK  AIGNPFG D T+T G
Sbjct  119   TWKAVLVGAAPDKDIAVLQIDAPGDRLQPITIGLSNDLRVGQKVFAIGNPFGLDQTITSG  178

Query  1022  VISGLNRDIYSQTGVTISGGIQTDAAINPGNSGGPLLDSKGNLIGINTAIFTQTGTSAGV  843
             +IS L R+I S TG  I G IQTDAAINPGNSGGPLLDS G LIG+NTAIF+ +G  AG+
Sbjct  179   IISALGREIKSVTGRMIRGVIQTDAAINPGNSGGPLLDSAGRLIGVNTAIFSPSGAYAGI  238

Query  842   GFAIPSSTVLRIVPQLIQSGKVVRAGLNIDIAPDAIANQLNVRNGALVLLVPGNSLAAKA  663
             GFA+    V  IVPQLI++G++VR G+ + +  + +A ++ + +GAL+L V     A  A
Sbjct  239   GFAVAVDIVNEIVPQLIKNGRIVRPGIGVSLVDERVAREIGI-DGALILGVESGGPAEAA  297

Query  662   GILPTTRGFAGNIVLGDIIEAVDNKPVRNKADLYKVLDDYSVGDKVQLKIRR  507
             G+ PTT+ + G +VLGDII AV    V    DL   ++ + VG++V L I R
Sbjct  298   GLRPTTQ-YRGEVVLGDIIVAVAGVKVHTYDDLRSEIEKFKVGEEVTLTIIR  348


 Score = 66.2 bits (160),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 32/67 (48%), Positives = 44/67 (66%), Gaps = 0/67 (0%)
 Frame = -3

Query  1606  GPLSPSEERIVQLFENNTYSVVNIFDVTLRPRLNVGGAVEIPEGNGSGVVWDGEGNIVTN  1427
             G L+  E+  + +F+ N+ SVV +  + LR  L    AVEIP+G GSG VWD +G IVTN
Sbjct  41    GDLATDEQNTIDIFQRNSPSVVYVTSIALRRGLFSLNAVEIPQGTGSGFVWDKQGRIVTN  100

Query  1426  YHVIGNS  1406
             YHVI ++
Sbjct  101   YHVISDA  107



>gb|EYF01971.1| DegP protease [Chondromyces apiculatus DSM 436]
Length=405

 Score =   214 bits (544),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 115/238 (48%), Positives = 155/238 (65%), Gaps = 8/238 (3%)
 Frame = -2

Query  1205  KNFEGKLVGADRSKDLAVLKVEASEDLLRPTKIGESSS-LRVGQKCLAIGNPFGFDHTLT  1029
             K F  ++VG +  KD+AVLK+EA+ + L+P ++  S   L VGQK +AIGNPFG DHTLT
Sbjct  155   KAFPARVVGVEPRKDIAVLKIEAAREELKPIRVAPSREPLEVGQKTIAIGNPFGLDHTLT  214

Query  1028  VGVISGLNRDIYSQTGVTISGGIQTDAAINPGNSGGPLLDSKGNLIGINTAIFTQTGTSA  849
              GV+S + R +    GVTI   IQTDAAINPGNSGGPLLDS G LIG+NT I+++TG+SA
Sbjct  215   TGVVSAIGRQVDGIGGVTIRDMIQTDAAINPGNSGGPLLDSSGQLIGMNTMIYSKTGSSA  274

Query  848   GVGFAIPSSTVLRIVPQLIQSGKVVRAGLNIDIAPDAIANQLNVRNGALVLLVPGNSLAA  669
             G+GFA+P++T+ RIVPQL+++G+V + GL I + P     +     G +V  V     A 
Sbjct  275   GIGFAVPAATIARIVPQLVKTGRVEQVGLGIHLDPSQRLERRLRLRGVIVTAVMPGGAAE  334

Query  668   KA---GILPTTRGFAGNIVLGDIIEAVDNKPVRNKADLYKVLDDYSVGDKVQLKIRRG  504
             KA   G+  T RG A    LGD+I  +D  P+ +   LY  LD   VGDK ++ + RG
Sbjct  335   KAGLQGLTETDRGLA----LGDVIVGIDGAPIEDYDGLYNALDGKKVGDKAKVDVVRG  388



>gb|KFM26732.1| Protease Do-like 1, chloroplastic [Auxenochlorella protothecoides]
Length=399

 Score =   213 bits (543),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 119/236 (50%), Positives = 160/236 (68%), Gaps = 3/236 (1%)
 Frame = -2

Query  1205  KNFEGKLVGADRSKDLAVLKVEA--SEDLLRPTKIGESSSLRVGQKCLAIGNPFGFDHTL  1032
             +++   +VG D+ +D+AVL+++   +E  + P KIG S++L+VGQ+  AIGNPFG DHTL
Sbjct  150   EDYPATVVGVDQDRDVAVLQLQGLPAEKSVTPLKIGSSANLKVGQRVFAIGNPFGLDHTL  209

Query  1031  TVGVISGLNRDIYSQTGVTISGGIQTDAAINPGNSGGPLLDSKGNLIGINTAIFTQTGTS  852
             T GVISG  R+I   TG  I   IQTDAAINPGNSGGPLLDS G LIG+NTAI++ +G +
Sbjct  210   TTGVISGTGREIPGATGRPIQDVIQTDAAINPGNSGGPLLDSGGELIGVNTAIYSPSGAN  269

Query  851   AGVGFAIPSSTVLRIVPQLIQSGKVVRAGLNIDIAPDAIANQLNVRNGALVLLVPGNSLA  672
             +GVGFAIP   V   V Q+++ G+V R  L I  AP+  A QL VR G LVL     S A
Sbjct  270   SGVGFAIPVDIVRSSVDQIVRFGRVTRPMLGIAFAPEQSAEQLGVR-GVLVLDARKGSPA  328

Query  671   AKAGILPTTRGFAGNIVLGDIIEAVDNKPVRNKADLYKVLDDYSVGDKVQLKIRRG  504
              +AGI  T+R   G +VLGDII ++D   V+  +DL++ LD  SVGD + +++ RG
Sbjct  329   DEAGIKGTSRDEYGRLVLGDIIISIDGARVKTGSDLFRALDKRSVGDALDVEVLRG  384



>ref|WP_009151581.1| 2-alkenal reductase [Thiorhodovibrio sp. 970]
 gb|EIC19352.1| trypsin-like serine protease with C-terminal PDZ domain [Thiorhodovibrio 
sp. 970]
Length=375

 Score =   213 bits (541),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 116/238 (49%), Positives = 157/238 (66%), Gaps = 4/238 (2%)
 Frame = -2

Query  1208  QKNFEGKLVGADRSKDLAVLKVEASEDLLRPTKIGESSSLRVGQKCLAIGNPFGFDHTLT  1029
             Q+ +   L+GA +  DLAVL++        P  IG S  LRVGQK  AIGNPFG D++LT
Sbjct  121   QRTYAANLIGASQEHDLAVLRIAVPMAGPSPVMIGTSEDLRVGQKVFAIGNPFGLDYSLT  180

Query  1028  VGVISGLNRDIYSQTGVTISGGIQTDAAINPGNSGGPLLDSKGNLIGINTAIFTQTGTSA  849
              GV+S L+R I S+ G  I   IQTDAAINPGNSGGPL+DS G LIG+NTAIF+ TG  +
Sbjct  181   TGVVSALDRTIVSEDGTEIRRLIQTDAAINPGNSGGPLIDSAGRLIGVNTAIFSPTGGFS  240

Query  848   GVGFAIPSSTVLRIVPQLIQSGKVVRAGLNI---DIAPDAIANQLNVRNGALVLLVPGNS  678
             G+GF++P +TV R+VPQLI  G+ +R  L I   D A  A+  +L + +G LVL V   S
Sbjct  241   GIGFSVPVNTVNRVVPQLIAYGRYIRPRLGIFADDDASRAVLKELGL-SGVLVLRVESGS  299

Query  677   LAAKAGILPTTRGFAGNIVLGDIIEAVDNKPVRNKADLYKVLDDYSVGDKVQLKIRRG  504
              A +AG+  T     G +V GDII++V+ + + N ADL ++L+D+ +GD+V L + RG
Sbjct  300   PADRAGLRATRLTAGGGVVPGDIIQSVNGRKLANMADLIEILEDFQIGDQVSLGLWRG  357



>emb|CEE12129.1| Putative serine protease HtrA [Legionella massiliensis]
 emb|CDZ76391.1| Putative serine protease HtrA [Legionella massiliensis]
Length=357

 Score =   212 bits (539),  Expect = 4e-59, Method: Compositional matrix adjust.
 Identities = 120/235 (51%), Positives = 157/235 (67%), Gaps = 5/235 (2%)
 Frame = -2

Query  1193  GKLVGADRSKDLAVLKVEASEDL-----LRPTKIGESSSLRVGQKCLAIGNPFGFDHTLT  1029
              K+VG +  KD+AVLK+EA E L       P +I   + L VGQK +AIGNP+G DH+L+
Sbjct  107   AKVVGVEPRKDIAVLKIEALEALSLLKQFTPFRIVHLNDLIVGQKAIAIGNPYGLDHSLS  166

Query  1028  VGVISGLNRDIYSQTGVTISGGIQTDAAINPGNSGGPLLDSKGNLIGINTAIFTQTGTSA  849
              GVIS LNR +    GVTI   IQTD  INPGNSGGPLL+S G LIG+NT I++ +G+SA
Sbjct  167   KGVISALNRKVPGIGGVTIRNMIQTDTPINPGNSGGPLLNSAGQLIGMNTMIYSPSGSSA  226

Query  848   GVGFAIPSSTVLRIVPQLIQSGKVVRAGLNIDIAPDAIANQLNVRNGALVLLVPGNSLAA  669
             GVGFA+P+  + RIV Q+I++G+VV +G+ I   P AIA QL +  G L+  V  N+ AA
Sbjct  227   GVGFAVPADDIERIVTQIIENGRVVLSGIGIRRIPSAIARQLGIHKGILIADVLPNTPAA  286

Query  668   KAGILPTTRGFAGNIVLGDIIEAVDNKPVRNKADLYKVLDDYSVGDKVQLKIRRG  504
             +A +  T R   G IVLGDII A++   VRN   LY +L + SVGD+V + I RG
Sbjct  287   QAHLRGTHRDAWGRIVLGDIIVALNGHAVRNYDVLYNMLTEISVGDQVTVTIVRG  341



>ref|WP_012236787.1| serine protease [Sorangium cellulosum]
 ref|YP_001614797.1| serine protease [Sorangium cellulosum So ce56]
 emb|CAN94317.1| Probable serine protease [Sorangium cellulosum So ce56]
Length=388

 Score =   213 bits (541),  Expect = 4e-59, Method: Compositional matrix adjust.
 Identities = 120/241 (50%), Positives = 162/241 (67%), Gaps = 6/241 (2%)
 Frame = -2

Query  1214  RLQ--KNFEGKLVGADRSKDLAVLKVEASEDLLRPTKIGE-SSSLRVGQKCLAIGNPFGF  1044
             RLQ  K F  KLVG +  KD+AV+K++A +D+L+P ++      L VGQK +AIGNPFG 
Sbjct  134   RLQGEKTFPAKLVGVEPRKDIAVIKIDAPKDMLKPIQVAPLREPLEVGQKAIAIGNPFGL  193

Query  1043  DHTLTVGVISGLNRDIYSQTGVTISGGIQTDAAINPGNSGGPLLDSKGNLIGINTAIFTQ  864
             DHTLT G+IS L R +     VTI   IQTDAAINPGNSGGPLLDS G+LIG+NT IF++
Sbjct  194   DHTLTTGIISALGRQVQGVGEVTIRDMIQTDAAINPGNSGGPLLDSSGHLIGMNTMIFSK  253

Query  863   TGTSAGVGFAIPSSTVLRIVPQLIQSGKVVRAGLNIDIAPDAIANQLNVRNGALVL-LVP  687
             +G+SAG+GFA+PS+T+ RIVPQ+I++GK    GL I +       + N   G +V+ +VP
Sbjct  254   SGSSAGIGFAVPSTTIARIVPQIIKTGKAETVGLGIQLDQSRRLERRNGIRGVIVMAIVP  313

Query  686   GNSLAAKAGILPTTRGFAGNIVLGDIIEAVDNKPVRNKADLYKVLDDYSVGDKVQLKIRR  507
             G   A KAG+   + G  G +VLGD+I  +D  PV++   LY  LD    G+KV++ + R
Sbjct  314   GGP-ADKAGLRGLSEGDRG-LVLGDVIVGIDGSPVQDYDGLYNALDGKKPGEKVKVDVLR  371

Query  506   G  504
             G
Sbjct  372   G  372


 Score = 57.0 bits (136),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 34/84 (40%), Positives = 46/84 (55%), Gaps = 1/84 (1%)
 Frame = -3

Query  1648  SVTVEQVTPPTFPS-GPLSPSEERIVQLFENNTYSVVNIFDVTLRPRLNVGGAVEIPEGN  1472
             S T++   PP  PS G L   E   + +F +   S V +    L      G AVE+P G+
Sbjct  47    SATIDTTPPPVPPSKGALIEDERNSIAVFRDVAPSTVFVTQQRLVVDRFWGTAVEVPAGS  106

Query  1471  GSGVVWDGEGNIVTNYHVIGNSLS  1400
             GSG VWD +G+IVTNYHV+  + S
Sbjct  107   GSGFVWDADGHIVTNYHVVAGAQS  130



>ref|WP_012827283.1| peptidase S1 and S6 chymotrypsin/Hap [Haliangium ochraceum]
 ref|YP_003266568.1| peptidase S1 and S6 chymotrypsin/Hap [Haliangium ochraceum DSM 
14365]
 gb|ACY14675.1| peptidase S1 and S6 chymotrypsin/Hap [Haliangium ochraceum DSM 
14365]
Length=368

 Score =   212 bits (539),  Expect = 5e-59, Method: Compositional matrix adjust.
 Identities = 114/234 (49%), Positives = 154/234 (66%), Gaps = 2/234 (1%)
 Frame = -2

Query  1205  KNFEGKLVGADRSKDLAVLKVE-ASEDLLRPTKIGESSSLRVGQKCLAIGNPFGFDHTLT  1029
             + +  +++GA+  +D+AVL ++ A++  L P ++G    LRVGQ  +AIG+PFG D TLT
Sbjct  122   EEYPARVLGAEPKRDIAVLALDGAAKRALTPVRLGHDERLRVGQHVIAIGSPFGLDRTLT  181

Query  1028  VGVISGLNRDIYSQTGVTISGGIQTDAAINPGNSGGPLLDSKGNLIGINTAIFTQTGTSA  849
              GVIS L RDI    GVTI   IQTDA+INPGNSGGPLLDS G LIG+NT I++++G+SA
Sbjct  182   TGVISALGRDIVGIGGVTIPDMIQTDASINPGNSGGPLLDSAGRLIGMNTMIYSKSGSSA  241

Query  848   GVGFAIPSSTVLRIVPQLIQSGKVVRAGLNIDIAPDAIANQLNVRNGALVLLVPGNSLAA  669
             G+GFA+P   + R+VPQ+I++G  +   L      D +A +L V  G ++  VP  S AA
Sbjct  242   GIGFAVPVRFLRRLVPQIIRTGHAITPDLGARYFDDDVARRLRV-EGVIIRAVPRGSSAA  300

Query  668   KAGILPTTRGFAGNIVLGDIIEAVDNKPVRNKADLYKVLDDYSVGDKVQLKIRR  507
             +AG   T R   GNI LGDII  VD+  VRN  DLY   D+Y  GD+V + I R
Sbjct  301   RAGFRGTARTRRGNIRLGDIIVGVDSHRVRNYDDLYNTFDNYKPGDRVVIHIVR  354


 Score = 52.0 bits (123),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 40/110 (36%), Positives = 51/110 (46%), Gaps = 11/110 (10%)
 Frame = -3

Query  1600  LSPSEERIVQLFENNTYSVVNIFDVTLRPRLNVGGAVEIPEGNGSGVVWDGEGNIVTNYH  1421
             L P E   V+LFE    SVV + +  ++  L      E   G GSG VWD  G+IVTNYH
Sbjct  48    LLPEERNTVRLFERTAPSVVFVINRGVQRDLFSRHTGEYQRGTGSGFVWDKSGHIVTNYH  107

Query  1420  VIGNSLS--------RNPTR---GEVVARVNILAPDG*EERLLTIALLAY  1304
             VI  + S          P R    E    + +LA DG  +R LT   L +
Sbjct  108   VIQGASSVAVVIDNEEYPARVLGAEPKRDIAVLALDGAAKRALTPVRLGH  157



>ref|WP_010960979.1| 2-alkenal reductase [Methylococcus capsulatus]
 ref|YP_114164.1| serine protease [Methylococcus capsulatus str. Bath]
 gb|AAU92007.1| putative serine protease [Methylococcus capsulatus str. Bath]
Length=374

 Score =   212 bits (540),  Expect = 5e-59, Method: Compositional matrix adjust.
 Identities = 117/238 (49%), Positives = 156/238 (66%), Gaps = 6/238 (3%)
 Frame = -2

Query  1205  KNFEGKLVGADRSKDLAVLKVEASEDLLRPTKIGESSSLRVGQKCLAIGNPFGFDHTLTV  1026
             +++   LVG  ++ DLAVL+++  + +  P  IG S  L+VGQK  AIGNPFG D +LT 
Sbjct  125   RDYRAALVGVSKAHDLAVLRIDVGQGIPSPLPIGVSHDLKVGQKVFAIGNPFGLDWSLTT  184

Query  1025  GVISGLNRDIYSQTGVTISGGIQTDAAINPGNSGGPLLDSKGNLIGINTAIFTQTGTSAG  846
             G++S L+R +  +TGVTI   IQTDAAINPGNSGGPLLDS G L+GINTAI++ +G  +G
Sbjct  185   GIVSALDRSLTEETGVTIEHLIQTDAAINPGNSGGPLLDSAGRLVGINTAIYSPSGAFSG  244

Query  845   VGFAIPSSTVLRIVPQLIQSGKVVRAGLNIDIAPDAIANQLNVR----NGALVLLVPGNS  678
             VGFA+P  TV R+VPQLI  G+ +R  L I +  D   NQ  V+     G LVL V   S
Sbjct  245   VGFAVPVDTVNRVVPQLIGRGQYIRPALGIAV--DEGLNQRAVQRLGVTGVLVLKVNPGS  302

Query  677   LAAKAGILPTTRGFAGNIVLGDIIEAVDNKPVRNKADLYKVLDDYSVGDKVQLKIRRG  504
              A  AG+   T    G ++ GDII AV+ +PV + + L  +LDDY +G KV+L +RRG
Sbjct  303   AAEAAGLKGATLLPDGRLIPGDIIVAVEGRPVDSVSKLSALLDDYQIGQKVRLSVRRG  360


 Score = 54.3 bits (129),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 35/96 (36%), Positives = 49/96 (51%), Gaps = 5/96 (5%)
 Frame = -3

Query  1693  CTQFITLQAYALGDPSVTVEQVTP-PTFPSGPLSPSEERIVQLFENNTYSVVNIFDVTLR  1517
              T  +     A G  + +   V P P  P G L+  E   V+LFE +  SVV I   TL+
Sbjct  18    ATLLLGFGMVAGGFQAASARDVAPRPISPRGELALEERATVELFEKSKNSVVYIS--TLQ  75

Query  1516  PRLN--VGGAVEIPEGNGSGVVWDGEGNIVTNYHVI  1415
               ++      + IP G GSG +WD  G++VTNYHV+
Sbjct  76    QVMDPWTRNVLSIPRGTGSGFIWDEAGHVVTNYHVV  111



>ref|WP_027443639.1| 2-alkenal reductase, partial [Porphyrobacter cryptus]
Length=343

 Score =   211 bits (537),  Expect = 5e-59, Method: Compositional matrix adjust.
 Identities = 122/237 (51%), Positives = 157/237 (66%), Gaps = 4/237 (2%)
 Frame = -2

Query  1205  KNFEGKLVGADRSKDLAVLKVEASEDLLRPTKIGESSSLRVGQKCLAIGNPFGFDHTLTV  1026
             ++++  LVGA  + D+AVLK+        P  IG S+ LR+GQK  AIGNPFG D TLT 
Sbjct  94    RDYKAALVGASPAHDIAVLKIGIDFRRPPPVPIGTSADLRIGQKVFAIGNPFGLDWTLTT  153

Query  1025  GVISGLNRDIYSQTGVT-ISGGIQTDAAINPGNSGGPLLDSKGNLIGINTAIFTQTGTSA  849
             G++S L+R + S+ G + I   IQTDAAINPGNSGGPLLDS G LIGINTAIF+ +G SA
Sbjct  154   GIVSALDRSLPSEDGRSRIDHLIQTDAAINPGNSGGPLLDSAGRLIGINTAIFSPSGASA  213

Query  848   GVGFAIPSSTVLRIVPQLIQSGKVVRAGLNI--DIAPDAIANQLNVRNGALVLLVPGNSL  675
             G+GFA+P  TV R+VPQLI+ G+ +R  L I  D A +A+  Q +   G  V  +   S 
Sbjct  214   GIGFAVPVDTVNRVVPQLIRQGRYIRPSLGILGDEAANALLQQRSGIAGVFVFGIEPGSP  273

Query  674   AAKAGILPTTRGFAGNIVLGDIIEAVDNKPVRNKADLYKVLDDYSVGDKVQLKIRRG  504
             AAKAGI+P  R     IV GDII A+D KPV   A+L   LDD +VG+ V+L ++RG
Sbjct  274   AAKAGIVPARRE-GEAIVPGDIITALDGKPVAGLAELAARLDDRAVGETVELTLQRG  329


 Score = 54.7 bits (130),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 31/71 (44%), Positives = 39/71 (55%), Gaps = 1/71 (1%)
 Frame = -3

Query  1606  GPLSPSEERIVQLFENNTYSVVNIFDVTLRPRLNVGGAVEIPEGNGSGVVWDGEGNIVTN  1427
             G L+  E+  + LFE    SVV I    L   L      E+P G GSG +WD  G++VTN
Sbjct  17    GDLAEDEKATIALFEKARDSVVFISTAELVADLWTRNVFEVPRGTGSGFIWDDAGHVVTN  76

Query  1426  YHVI-GNSLSR  1397
             YHVI G S +R
Sbjct  77    YHVIAGASQAR  87



>ref|WP_007639839.1| 2-alkenal reductase [Cellvibrio sp. BR]
 gb|EIK46898.1| hypothetical protein O59_000919 [Cellvibrio sp. BR]
Length=347

 Score =   211 bits (537),  Expect = 7e-59, Method: Compositional matrix adjust.
 Identities = 116/234 (50%), Positives = 158/234 (68%), Gaps = 1/234 (0%)
 Frame = -2

Query  1208  QKNFEGKLVGADRSKDLAVLKVEASEDLLRPTKIGESSSLRVGQKCLAIGNPFGFDHTLT  1029
             Q N+  ++VG    +DLAVL+++A  D L    +G+S+ LRVG+K LAIGNPFG D TLT
Sbjct  100   QSNWPAEVVGLAPERDLAVLRIKAPADQLTALPLGDSADLRVGRKVLAIGNPFGLDATLT  159

Query  1028  VGVISGLNRDIYSQTGVTISGGIQTDAAINPGNSGGPLLDSKGNLIGINTAIFTQTGTSA  849
              GV+S L R+I S     I+  IQTDAAINPGNSGGPLL+S+G LIG+NT I++ +G SA
Sbjct  160   TGVVSALGREIESPNQRKITNVIQTDAAINPGNSGGPLLNSEGKLIGVNTMIYSPSGASA  219

Query  848   GVGFAIPSSTVLRIVPQLIQSGKVVRAGLNIDIAPDAIANQLNVRNGALVLLVPGNSLAA  669
             G+GFAIP +TV  +VP+LI+ G++VR  L + +APD  A Q+ ++ G  +L V  NS AA
Sbjct  220   GIGFAIPVNTVKEVVPELIKHGRIVRPVLGVAVAPDHWAQQIGIQ-GVPILRVEPNSAAA  278

Query  668   KAGILPTTRGFAGNIVLGDIIEAVDNKPVRNKADLYKVLDDYSVGDKVQLKIRR  507
             +AG+    R   G I LGD+I A+++ PV N   L   L+ Y  GDKV + + R
Sbjct  279   QAGLQGAKRNSWGQISLGDVIVAIEDYPVTNDDQLLSALEHYKPGDKVNVSVVR  332



>ref|WP_028382216.1| peptidase [Legionella cherrii]
Length=358

 Score =   211 bits (536),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 115/235 (49%), Positives = 158/235 (67%), Gaps = 5/235 (2%)
 Frame = -2

Query  1193  GKLVGADRSKDLAVLKVEASEDL-----LRPTKIGESSSLRVGQKCLAIGNPFGFDHTLT  1029
              K+VG++  KD+AVLK+E+ + L      +P ++   + L VGQK +AIGNPFG DH+L+
Sbjct  108   AKVVGSEPRKDIAVLKIESPQALALLKEFKPFEVVRLNDLMVGQKAIAIGNPFGLDHSLS  167

Query  1028  VGVISGLNRDIYSQTGVTISGGIQTDAAINPGNSGGPLLDSKGNLIGINTAIFTQTGTSA  849
              GVIS L R +    GVTI   IQTD  INPGNSGGPLL+S G LIG+NT IF+ +GTSA
Sbjct  168   KGVISALGRKVPGIGGVTIRNMIQTDTPINPGNSGGPLLNSAGQLIGMNTMIFSHSGTSA  227

Query  848   GVGFAIPSSTVLRIVPQLIQSGKVVRAGLNIDIAPDAIANQLNVRNGALVLLVPGNSLAA  669
             G+GFA+P+  + RIV Q+I++G+VV +G+ I   P +IA QL +R G L+  +  N+ AA
Sbjct  228   GIGFAVPAEDIDRIVTQIIKNGRVVLSGIGIQSVPPSIARQLGIRKGILIADIIPNTPAA  287

Query  668   KAGILPTTRGFAGNIVLGDIIEAVDNKPVRNKADLYKVLDDYSVGDKVQLKIRRG  504
             KA +  T R   G IVLGDII A++   V N   LY +L +  VG++V + I+RG
Sbjct  288   KAHLRATHRDAWGRIVLGDIIVALNGHAVPNYDVLYNMLTEIKVGEQVTVTIQRG  342


 Score = 52.0 bits (123),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 41/134 (31%), Positives = 62/134 (46%), Gaps = 9/134 (7%)
 Frame = -3

Query  1600  LSPSEERIVQLFENNTYSVVNIFDVTLRPRLNVGGAVEIPEGNGSGVVWDGEGNIVTNYH  1421
             L P E+  V++F   +  VV +  +           +E+P+G GSG+VW+  G IVTNYH
Sbjct  30    LLPDEQNTVKVFHEASPKVVYVHRLATVTNRAAARKMEVPDGAGSGIVWNNNGYIVTNYH  89

Query  1420  VIGNSLSRNPTRGEVVARVNILAPDG*EERLLTIALLAY*SGSSLPCESDDIAHFFTPF*  1241
             VI  +     + G++     ++   G E R   IA+L   S  +L    +     F PF 
Sbjct  90    VIKGADKLAISLGKLTVPAKVV---GSEPR-KDIAVLKIESPQALALLKE-----FKPFE  140

Query  1240  PSSLNSSLEGCKRI  1199
                LN  + G K I
Sbjct  141   VVRLNDLMVGQKAI  154



>ref|WP_023409640.1| hypothetical protein, partial [uncultured Thiohalocapsa sp. PB-PSB1]
 gb|ESQ17183.1| hypothetical protein N838_24065, partial [uncultured Thiohalocapsa 
sp. PB-PSB1]
Length=368

 Score =   211 bits (536),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 118/238 (50%), Positives = 159/238 (67%), Gaps = 6/238 (3%)
 Frame = -2

Query  1205  KNFEGKLVGADRSKDLAVLKVEASEDLLRPTKIGESSSLRVGQKCLAIGNPFGFDHTLTV  1026
             + +  + VGA    DLAVL++  S   + P  IG S+ LRVGQK  AIGNPFGFD++LT 
Sbjct  115   RTYNAEFVGASVEHDLAVLRIGVSLARIAPLAIGSSADLRVGQKVFAIGNPFGFDYSLTT  174

Query  1025  GVISGLNRDIYSQTGVTISGGIQTDAAINPGNSGGPLLDSKGNLIGINTAIFTQTGTSAG  846
             GV+S L+R I S+    I   IQTDAAINPGNSGGPLLDS G LIG+NTAIF+ +G+ +G
Sbjct  175   GVVSALDRTIVSERHGEIRRLIQTDAAINPGNSGGPLLDSAGRLIGVNTAIFSPSGSYSG  234

Query  845   VGFAIPSSTVLRIVPQLIQSGKVVRAGLNI----DIAPDAIANQLNVRNGALVLLVPGNS  678
             +GFA+P  TV R+VPQLI +G+ VR  + I    DI+   +A +L +  G LVL V  +S
Sbjct  235   IGFAVPVDTVNRVVPQLIANGRYVRPRIGIYGDDDISRPILA-ELGL-EGVLVLRVEPDS  292

Query  677   LAAKAGILPTTRGFAGNIVLGDIIEAVDNKPVRNKADLYKVLDDYSVGDKVQLKIRRG  504
              A +AG++ T    +G IV GDII+ +D +PV   +DL + L+ Y  GD+V L++ RG
Sbjct  293   PADRAGLIGTRIASSGEIVPGDIIQTIDGEPVMRMSDLIEKLEHYRTGDQVTLELNRG  350



>ref|XP_005703573.1| serine-type peptidase (DEGP1) [Galdieria sulphuraria]
 gb|EME27053.1| serine-type peptidase (DEGP1) [Galdieria sulphuraria]
Length=465

 Score =   213 bits (543),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 121/231 (52%), Positives = 156/231 (68%), Gaps = 1/231 (0%)
 Frame = -2

Query  1199  FEGKLVGADRSKDLAVLKVEASEDLLRPTKIGESSSLRVGQKCLAIGNPFGFDHTLTVGV  1020
             ++ KLVG D  KD+AVLK++A ++ LRP  +G SS L VGQ   AIGNPFG DHTLT GV
Sbjct  221   YDAKLVGVDPDKDVAVLKIDAPKNELRPIPLGHSSDLIVGQSAYAIGNPFGLDHTLTTGV  280

Query  1019  ISGLNRDIYSQTGVTISGGIQTDAAINPGNSGGPLLDSKGNLIGINTAIFTQTGTSAGVG  840
             +SGL R + S TG  IS  IQTDAAINPGNSGG LLDS G LIG+NT+I++ +G SAGVG
Sbjct  281   VSGLGRTMRSPTGKPISNVIQTDAAINPGNSGGTLLDSSGRLIGMNTSIYSPSGASAGVG  340

Query  839   FAIPSSTVLRIVPQLIQSGKVVRAGLNIDIAPDAIANQLNVRNGALVLLVPGNSLAAKAG  660
             FAIP  T+  IV  LI+ GKV+R  + I       ++ L +  G LVL V   S A KAG
Sbjct  341   FAIPVDTLKPIVSSLIKYGKVIRPVIGISYLDGTQSSALGIDRGVLVLDVQRGSPAEKAG  400

Query  659   ILPTTRGFAGNIVLGDIIEAVDNKPVRNKADLYKVLDDYSVGDKVQLKIRR  507
             +  T+R   G I LGDII A+D K + N+ DL+++L++   G  ++LK+ R
Sbjct  401   LRGTSRSPLG-IELGDIIIAIDGKSIGNEGDLFQILEEKKPGQTIRLKVDR  450


 Score = 59.3 bits (142),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 37/98 (38%), Positives = 55/98 (56%), Gaps = 10/98 (10%)
 Frame = -3

Query  1675  LQAYALGDPSVTVEQVTPPTFPSGPLSPSEERIVQLFENNTYSVVNIFDVTLRPRLNVGG  1496
             L+A+A  + S+  E        S  L   E+ +++LF+N T SVV  F  T   RL+   
Sbjct  125   LEAFAFENKSLIRENA------SSTLKQQEKDVIELFQNATPSVV--FATTFVERLDFLS  176

Query  1495  --AVEIPEGNGSGVVWDGEGNIVTNYHVIGNSLSRNPT  1388
                +E+P G GSG +WD +G+IVTN+HVI ++ S   T
Sbjct  177   PNIMELPAGQGSGFIWDTDGHIVTNFHVIRSATSAKIT  214



>ref|WP_009549554.1| 2-alkenal reductase [Burkholderiales bacterium JOSHI_001]
 gb|EHR70409.1| trypsin-like serine protease with PDZ domain [Burkholderiales 
bacterium JOSHI_001]
Length=371

 Score =   211 bits (536),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 116/234 (50%), Positives = 157/234 (67%), Gaps = 0/234 (0%)
 Frame = -2

Query  1208  QKNFEGKLVGADRSKDLAVLKVEASEDLLRPTKIGESSSLRVGQKCLAIGNPFGFDHTLT  1029
             Q +++ +LVGA   +D+AVL+++A +D L P  +G S  L+VGQK  AIGNPFG D TLT
Sbjct  123   QSSWQAELVGAYPDRDIAVLRIKAPKDKLPPIAVGSSRDLQVGQKVFAIGNPFGLDQTLT  182

Query  1028  VGVISGLNRDIYSQTGVTISGGIQTDAAINPGNSGGPLLDSKGNLIGINTAIFTQTGTSA  849
             VG++S LNR+I S T  TI G IQTDAAINPGNSGGPLLD  G LIG+NTAI++ +G SA
Sbjct  183   VGIVSALNREIDSVTRRTIRGVIQTDAAINPGNSGGPLLDGAGRLIGVNTAIYSPSGASA  242

Query  848   GVGFAIPSSTVLRIVPQLIQSGKVVRAGLNIDIAPDAIANQLNVRNGALVLLVPGNSLAA  669
             G+GFAIP   V RIVP+LI+ G+VVR  L +   P++ A  L +  G  ++ V   S AA
Sbjct  243   GIGFAIPVDEVNRIVPRLIRDGRVVRPALGVTSGPESFAKALGLPGGVPLVGVAPGSPAA  302

Query  668   KAGILPTTRGFAGNIVLGDIIEAVDNKPVRNKADLYKVLDDYSVGDKVQLKIRR  507
             + G+ P  RG  G ++ GD++ AV++  V +  DL   L+ +  GD V L + R
Sbjct  303   RGGLQPFRRGANGALLAGDVVTAVNDDAVADLDDLLTQLERHKPGDSVTLSLWR  356



>ref|WP_034934742.1| 2-alkenal reductase [Candidatus Accumulibacter sp. SK-12]
Length=355

 Score =   210 bits (534),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 125/238 (53%), Positives = 155/238 (65%), Gaps = 8/238 (3%)
 Frame = -2

Query  1205  KNFEGKLVGADRSKDLAVLKVEASEDLLRPTKIGESSSLRVGQKCLAIGNPFGFDHTLTV  1026
             +++   LVGA  + D+AVL++        P  +G S  LRVGQK  AIGNPFG D TLT 
Sbjct  106   RSYRAVLVGASPAHDIAVLRIGVGFRRPPPVPLGTSGDLRVGQKVFAIGNPFGLDWTLTS  165

Query  1025  GVISGLNRDIYSQTGVTISGGIQTDAAINPGNSGGPLLDSKGNLIGINTAIFTQTGTSAG  846
             G++S L+R + S  GV+I   IQTDAAINPGNSGGPLLDS G LIGINTAI++ +GTSAG
Sbjct  166   GIVSALDRSLSSDKGVSIEHLIQTDAAINPGNSGGPLLDSAGRLIGINTAIYSPSGTSAG  225

Query  845   VGFAIPSSTVLRIVPQLIQSGKVVRAGLNIDIAPDAIANQ-----LNVRNGALVLLVPGN  681
             +GFA+P  TV R+VPQLI +G+ VR  L I+I  D   NQ     L VR G ++L V   
Sbjct  226   IGFAVPVDTVNRVVPQLISAGRYVRPALGIEI--DESLNQRLQRVLGVR-GVVILRVAPG  282

Query  680   SLAAKAGILPTTRGFAGNIVLGDIIEAVDNKPVRNKADLYKVLDDYSVGDKVQLKIRR  507
             S AA AG+   TR   G+IV GDI+ AVD KPV     L   LDD+ VG+ V+L I R
Sbjct  283   SAAAAAGLRGVTRAADGSIVAGDIVTAVDGKPVETVGRLLARLDDHRVGETVRLGILR  340


 Score = 53.1 bits (126),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 29/75 (39%), Positives = 40/75 (53%), Gaps = 1/75 (1%)
 Frame = -3

Query  1636  EQVTPPTFPS-GPLSPSEERIVQLFENNTYSVVNIFDVTLRPRLNVGGAVEIPEGNGSGV  1460
             +Q  P T  + G L+  E  I++LFEN   SVV I        L       +P G GSG 
Sbjct  18    KQAAPRTVSARGDLAADERSIIELFENARDSVVFITTSRQVRDLWTRNVFTVPRGTGSGF  77

Query  1459  VWDGEGNIVTNYHVI  1415
             +WD  G+++TN+HVI
Sbjct  78    IWDDAGHVITNFHVI  92



>ref|WP_025385943.1| peptidase [Legionella oakridgensis]
 gb|AHE67428.1| trypsin-like serine protease, typically periplasmic, containing 
C-terminal PDZ domain [Legionella oakridgensis ATCC 33761 
= DSM 21215]
 gb|ETO92960.1| DegP2 peptidase [Legionella oakridgensis RV-2-2007]
Length=356

 Score =   210 bits (534),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 115/239 (48%), Positives = 163/239 (68%), Gaps = 5/239 (2%)
 Frame = -2

Query  1208  QKNFEGKLVGADRSKDLAVLKVEA--SEDLLR---PTKIGESSSLRVGQKCLAIGNPFGF  1044
             +  F  K++GA+  KD+AVL + +  + +LL+   P +I  +  L VGQK +AIGNPFG 
Sbjct  101   KYTFPAKVIGAEPRKDIAVLALTSPKARELLQSFTPFEIAHTDELLVGQKAIAIGNPFGL  160

Query  1043  DHTLTVGVISGLNRDIYSQTGVTISGGIQTDAAINPGNSGGPLLDSKGNLIGINTAIFTQ  864
             DH+LT+GVIS L R +    GVTI   IQTDA+INPGNSGGPLLDS G LIG+NTAI++Q
Sbjct  161   DHSLTMGVISALGRQMPGIGGVTIRDMIQTDASINPGNSGGPLLDSSGRLIGMNTAIYSQ  220

Query  863   TGTSAGVGFAIPSSTVLRIVPQLIQSGKVVRAGLNIDIAPDAIANQLNVRNGALVLLVPG  684
             +G+SAGVGFA+P+  ++RIV Q+I++G+VV AG+ +     ++A +L V+ G L+  V  
Sbjct  221   SGSSAGVGFAVPADEIVRIVSQIIKNGRVVLAGIGVQRVDPSVALRLGVKKGILISEVLP  280

Query  683   NSLAAKAGILPTTRGFAGNIVLGDIIEAVDNKPVRNKADLYKVLDDYSVGDKVQLKIRR  507
             NS AA+AG+  T R   G I LGD+I A+D +PV N   LY +    ++G ++ L + R
Sbjct  281   NSPAAQAGLRGTYRDHWGRIHLGDVIVALDGQPVGNYDTLYNLQTKLNIGQEITLTVLR  339



>ref|WP_002809304.1| 2-alkenal reductase [Nitrosococcus oceani]
 ref|YP_343419.1| peptidase S1 and S6, chymotrypsin/Hap [Nitrosococcus oceani ATCC 
19707]
 gb|ABA57889.1| DegP2 peptidase, Serine peptidase, MEROPS family S01B [Nitrosococcus 
oceani ATCC 19707]
 gb|EDZ67307.1| Trypsin domain protein [Nitrosococcus oceani AFC27]
 gb|KFI19616.1| 2-alkenal reductase [Nitrosococcus oceani C-27]
Length=372

 Score =   210 bits (535),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 112/234 (48%), Positives = 151/234 (65%), Gaps = 1/234 (0%)
 Frame = -2

Query  1208  QKNFEGKLVGADRSKDLAVLKVEASEDLLRPTKIGESSSLRVGQKCLAIGNPFGFDHTLT  1029
                ++ KL+GA   KDLAVL+++A  + L P  IG S  L+VGQK  AIGNPFG D TLT
Sbjct  125   HSTWDAKLIGAAPEKDLAVLRIKAPRNKLMPIAIGSSGDLQVGQKAFAIGNPFGLDQTLT  184

Query  1028  VGVISGLNRDIYSQTGVTISGGIQTDAAINPGNSGGPLLDSKGNLIGINTAIFTQTGTSA  849
              GVIS L R++ S   + I   IQTDAAINPGNSGGPLLDS G L+G+NTAI++ +GT A
Sbjct  185   TGVISALGREMESAARIPIRNVIQTDAAINPGNSGGPLLDSAGRLMGVNTAIYSPSGTYA  244

Query  848   GVGFAIPSSTVLRIVPQLIQSGKVVRAGLNIDIAPDAIANQLNVRNGALVLLVPGNSLAA  669
             G+GFAIP  TV  +VP+LI  G+V R  L I++ P      + V    ++ ++PG+  A 
Sbjct  245   GIGFAIPVDTVNWVVPELIAKGRVERPTLGIELLPARAMANMRVEGAVILRVIPGSG-AE  303

Query  668   KAGILPTTRGFAGNIVLGDIIEAVDNKPVRNKADLYKVLDDYSVGDKVQLKIRR  507
             +AG+    R   G I LGDII AV+ +PV +  DL   L+    G+K+Q+++ R
Sbjct  304   QAGLRGVQRDSLGRIYLGDIIVAVEGQPVLDADDLVLALERRQAGEKIQVQVIR  357



>ref|WP_009575009.1| 2-alkenal reductase [gamma proteobacterium IMCC3088]
 gb|EGG30380.1| hypothetical protein IMCC3088_626 [gamma proteobacterium IMCC3088]
Length=368

 Score =   210 bits (535),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 110/228 (48%), Positives = 154/228 (68%), Gaps = 1/228 (0%)
 Frame = -2

Query  1208  QKNFEGKLVGADRSKDLAVLKVEASEDLLRPTKIGESSSLRVGQKCLAIGNPFGFDHTLT  1029
             +  ++ +++G    KDLAVL++E + D L+   +G+SS L+VG+K LAIGNPFG D TLT
Sbjct  121   RSEYDAEVIGVAPEKDLAVLRIEGAPDDLQTLPLGDSSELQVGRKVLAIGNPFGLDTTLT  180

Query  1028  VGVISGLNRDIYSQTGVTISGGIQTDAAINPGNSGGPLLDSKGNLIGINTAIFTQTGTSA  849
              G++S L R+I + +  TI G IQTDAAINPGNSGGPLL+S G LIG+NTAI++ +G SA
Sbjct  181   TGIVSALGREIKAPSNRTIRGVIQTDAAINPGNSGGPLLNSMGQLIGVNTAIYSPSGASA  240

Query  848   GVGFAIPSSTVLRIVPQLIQSGKVVRAGLNIDIAPDAIANQLNVRNGALVLLVPGNSLAA  669
             G+GFAIP +TV  +VPQLI  G+V+R  L +++A D    + N+    +V L PG   A 
Sbjct  241   GIGFAIPVNTVAEVVPQLISYGRVLRPVLGVELASDNWIRRYNIPGVPIVRLFPGLP-AD  299

Query  668   KAGILPTTRGFAGNIVLGDIIEAVDNKPVRNKADLYKVLDDYSVGDKV  525
             +AG+    R + G+I LGDII  ++ + VRN  + Y  L+ Y  GD V
Sbjct  300   QAGMRGAYRNYRGDIALGDIITHINGERVRNNDEYYTQLERYQAGDTV  347



>gb|EXI68651.1| Periplasmic serine endoprotease DegP precursor [Candidatus Accumulibacter 
sp. SK-12]
Length=375

 Score =   210 bits (535),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 125/238 (53%), Positives = 155/238 (65%), Gaps = 8/238 (3%)
 Frame = -2

Query  1205  KNFEGKLVGADRSKDLAVLKVEASEDLLRPTKIGESSSLRVGQKCLAIGNPFGFDHTLTV  1026
             +++   LVGA  + D+AVL++        P  +G S  LRVGQK  AIGNPFG D TLT 
Sbjct  126   RSYRAVLVGASPAHDIAVLRIGVGFRRPPPVPLGTSGDLRVGQKVFAIGNPFGLDWTLTS  185

Query  1025  GVISGLNRDIYSQTGVTISGGIQTDAAINPGNSGGPLLDSKGNLIGINTAIFTQTGTSAG  846
             G++S L+R + S  GV+I   IQTDAAINPGNSGGPLLDS G LIGINTAI++ +GTSAG
Sbjct  186   GIVSALDRSLSSDKGVSIEHLIQTDAAINPGNSGGPLLDSAGRLIGINTAIYSPSGTSAG  245

Query  845   VGFAIPSSTVLRIVPQLIQSGKVVRAGLNIDIAPDAIANQ-----LNVRNGALVLLVPGN  681
             +GFA+P  TV R+VPQLI +G+ VR  L I+I  D   NQ     L VR G ++L V   
Sbjct  246   IGFAVPVDTVNRVVPQLISAGRYVRPALGIEI--DESLNQRLQRVLGVR-GVVILRVAPG  302

Query  680   SLAAKAGILPTTRGFAGNIVLGDIIEAVDNKPVRNKADLYKVLDDYSVGDKVQLKIRR  507
             S AA AG+   TR   G+IV GDI+ AVD KPV     L   LDD+ VG+ V+L I R
Sbjct  303   SAAAAAGLRGVTRAADGSIVAGDIVTAVDGKPVETVGRLLARLDDHRVGETVRLGILR  360


 Score = 53.1 bits (126),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 29/75 (39%), Positives = 40/75 (53%), Gaps = 1/75 (1%)
 Frame = -3

Query  1636  EQVTPPTFPS-GPLSPSEERIVQLFENNTYSVVNIFDVTLRPRLNVGGAVEIPEGNGSGV  1460
             +Q  P T  + G L+  E  I++LFEN   SVV I        L       +P G GSG 
Sbjct  38    KQAAPRTVSARGDLAADERSIIELFENARDSVVFITTSRQVRDLWTRNVFTVPRGTGSGF  97

Query  1459  VWDGEGNIVTNYHVI  1415
             +WD  G+++TN+HVI
Sbjct  98    IWDDAGHVITNFHVI  112



>ref|WP_026609053.1| 2-alkenal reductase [Methylocaldum szegediense]
Length=376

 Score =   210 bits (535),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 120/238 (50%), Positives = 149/238 (63%), Gaps = 6/238 (3%)
 Frame = -2

Query  1205  KNFEGKLVGADRSKDLAVLKVEASEDLLRPTKIGESSSLRVGQKCLAIGNPFGFDHTLTV  1026
             + +   LVG  ++ DLAVLK+    D   P  +G +  LRVGQK  AIGNPFG D TLT 
Sbjct  127   REYSAALVGTSKAHDLAVLKIPTGTDAPAPLPVGTNHDLRVGQKVFAIGNPFGLDWTLTT  186

Query  1025  GVISGLNRDIYSQTGVTISGGIQTDAAINPGNSGGPLLDSKGNLIGINTAIFTQTGTSAG  846
             G++S L+R +  ++GVTI   IQTDAAINPGNSGGPLLDS G LIGINTAI++ +G  +G
Sbjct  187   GIVSALDRSLSGESGVTIEHLIQTDAAINPGNSGGPLLDSAGRLIGINTAIYSPSGAFSG  246

Query  845   VGFAIPSSTVLRIVPQLIQSGKVVRAGLNIDIAPDAIANQLNVR----NGALVLLVPGNS  678
             VGFA+P  TV R+VPQLI SG   R  L   IA D   NQ+  R     G  VL V   S
Sbjct  247   VGFAVPVDTVNRVVPQLITSGHYTRPVLG--IAVDESLNQMASRRLGIKGVFVLKVNPGS  304

Query  677   LAAKAGILPTTRGFAGNIVLGDIIEAVDNKPVRNKADLYKVLDDYSVGDKVQLKIRRG  504
              A  AG+   T    G ++ GDII AV+ KPV +   L  +LDDY +G  V+L +RRG
Sbjct  305   AAQAAGLKGATILPDGRMIPGDIITAVEGKPVDSVGRLSALLDDYRIGQTVRLSVRRG  362


 Score = 53.9 bits (128),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 30/75 (40%), Positives = 38/75 (51%), Gaps = 12/75 (16%)
 Frame = -3

Query  1621  PTFPSGPLSPSEERIVQLFENNTYSVV------NIFDVTLRPRLNVGGAVEIPEGNGSGV  1460
             P  P GPLS  E+  + LFE    SVV       + D   R   N      IP G GSG 
Sbjct  45    PVTPRGPLSLDEQATIDLFERTKNSVVYISTQQRVMDPWTRNVFN------IPRGTGSGF  98

Query  1459  VWDGEGNIVTNYHVI  1415
             +WD  G++VTN+HV+
Sbjct  99    IWDHRGHVVTNFHVV  113



>ref|WP_035216646.1| 2-alkenal reductase [Desulfobulbus elongatus]
Length=361

 Score =   210 bits (534),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 116/234 (50%), Positives = 154/234 (66%), Gaps = 2/234 (1%)
 Frame = -2

Query  1208  QKNFEGKLVGADRSKDLAVLKVEASEDLLRPTKIGESSSLRVGQKCLAIGNPFGFDHTLT  1029
                ++  LVG+   +DLAV+++ A  D LRP  +GES  L VGQK  AIGNPFG D TLT
Sbjct  115   HSTWKAALVGSAPDRDLAVVQISAPADKLRPITLGESKDLLVGQKVFAIGNPFGLDQTLT  174

Query  1028  VGVISGLNRDIYSQTGVTISGGIQTDAAINPGNSGGPLLDSKGNLIGINTAIFTQTGTSA  849
              G++S L R+I + TG TI   IQTDAAINPGNSGGPLLDS G LIG+NTAI++ +G S+
Sbjct  175   TGIVSALGREITAVTGRTIHDVIQTDAAINPGNSGGPLLDSAGRLIGVNTAIYSPSGASS  234

Query  848   GVGFAIPSSTVLRIVPQLIQSGKVVRAGLNIDIAPDAIANQLNVRNGALVLLVPGNSLAA  669
             G+GFA+P   V R+VPQ+I  GK++R GL I +A   +  +L +  G ++L V   S A 
Sbjct  235   GIGFAVPVGEVNRVVPQIIAKGKLIRPGLGIALANRRLTEELGL-EGVMILKVLPGSTAE  293

Query  668   KAGILPTTRGFAGNIVLGDIIEAVDNKPVRNKADLYKVLDDYSVGDKVQLKIRR  507
             KAG+  T +   G +VLGDII AV+ +PV++   L   L+ Y VG  V L + R
Sbjct  294   KAGLRGTAQVRDG-LVLGDIILAVNGRPVKDYDTLRDELERYEVGQSVTLTLMR  346


 Score = 64.7 bits (156),  Expect = 9e-08, Method: Compositional matrix adjust.
 Identities = 32/82 (39%), Positives = 46/82 (56%), Gaps = 0/82 (0%)
 Frame = -3

Query  1651  PSVTVEQVTPPTFPSGPLSPSEERIVQLFENNTYSVVNIFDVTLRPRLNVGGAVEIPEGN  1472
             P +  + V+ P    G L+  E+  + +F N   SVV I  + +R  L      EIP+G 
Sbjct  24    PLLDPKAVSRPVAARGDLAADEQNTIDIFRNAAPSVVYITSIAVRRNLFSLNVYEIPQGT  83

Query  1471  GSGVVWDGEGNIVTNYHVIGNS  1406
             GSG +WD +G IVTNYHVI ++
Sbjct  84    GSGFIWDKQGRIVTNYHVISDA  105



>ref|XP_002952663.1| trypsin family [Volvox carteri f. nagariensis]
 gb|EFJ46216.1| trypsin family [Volvox carteri f. nagariensis]
Length=345

 Score =   209 bits (532),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 119/237 (50%), Positives = 152/237 (64%), Gaps = 4/237 (2%)
 Frame = -2

Query  1205  KNFEGKLVGADRSKDLAVLKV----EASEDLLRPTKIGESSSLRVGQKCLAIGNPFGFDH  1038
             + F  ++VG D+ KD+AVL++     A  ++      G S+ + VGQK  AIGNPFG DH
Sbjct  77    EEFSARVVGVDQDKDIAVLQIGPMGAAEREVQAAATGGPSADIVVGQKVFAIGNPFGLDH  136

Query  1037  TLTVGVISGLNRDIYSQTGVTISGGIQTDAAINPGNSGGPLLDSKGNLIGINTAIFTQTG  858
             TLTVGV+SG  R+I S +G  I   IQTDAAINPGNSGGPLLDS G LIGINTAI++ TG
Sbjct  137   TLTVGVVSGTGREIQSISGRPIQDVIQTDAAINPGNSGGPLLDSGGCLIGINTAIYSPTG  196

Query  857   TSAGVGFAIPSSTVLRIVPQLIQSGKVVRAGLNIDIAPDAIANQLNVRNGALVLLVPGNS  678
              + GVGFAIP   V   V Q+IQ GKV R  L I  APD  +  L ++ G LVL      
Sbjct  197   ANNGVGFAIPVDIVKSSVGQIIQYGKVTRPMLGISFAPDVSSEALGIKAGILVLSTREGG  256

Query  677   LAAKAGILPTTRGFAGNIVLGDIIEAVDNKPVRNKADLYKVLDDYSVGDKVQLKIRR  507
              A KAG+  +TR   G +VLGDII AV+   +++ +DLY+VLD   VGD + + + R
Sbjct  257   PAWKAGLKGSTRDEYGRLVLGDIITAVNGIKIKSSSDLYRVLDKCQVGDTLHITVLR  313


 Score = 60.1 bits (144),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 25/65 (38%), Positives = 45/65 (69%), Gaps = 0/65 (0%)
 Frame = -3

Query  1600  LSPSEERIVQLFENNTYSVVNIFDVTLRPRLNVGGAVEIPEGNGSGVVWDGEGNIVTNYH  1421
             L+P E+  +++F+ +T SVVN+ ++ ++        +E+P+G GSG +WD  G++VTNYH
Sbjct  2     LTPEEQLTIEIFKRSTPSVVNVTNLAVKRDAFTMNMLEMPQGQGSGFIWDSAGHVVTNYH  61

Query  1420  VIGNS  1406
             VI ++
Sbjct  62    VIQDA  66



>ref|XP_001416558.1| predicted protein, partial [Ostreococcus lucimarinus CCE9901]
 gb|ABO94851.1| predicted protein, partial [Ostreococcus lucimarinus CCE9901]
Length=329

 Score =   208 bits (530),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 123/238 (52%), Positives = 160/238 (67%), Gaps = 4/238 (2%)
 Frame = -2

Query  1208  QKNFEGKLVGADRSKDLAVLKVEASEDL--LRPTKIGESSSLRVGQKCLAIGNPFGFDHT  1035
             QK ++  +VG D  KD+AVL+V   E L  ++P  IG S    VGQ+  AIGNPFG DHT
Sbjct  78    QKTYDAAIVGFDDDKDIAVLQVNDPEALREMKPLVIGTSGDSMVGQRVFAIGNPFGLDHT  137

Query  1034  LTVGVISGLNRDIYS-QTGVTISGGIQTDAAINPGNSGGPLLDSKGNLIGINTAIFTQTG  858
             LT G+ISGL R+I S  TG  I G IQTDAAINPGNSGGPLL+S G LIGINTAI++ +G
Sbjct  138   LTTGIISGLGREIQSGNTGRPIDGIIQTDAAINPGNSGGPLLNSSGQLIGINTAIYSASG  197

Query  857   TSAGVGFAIPSSTVLRIVPQLIQSGKVVRAGLNIDIAPDAIANQLNVRNGALVLLVPGNS  678
             TS+GVGFA+PS  V  IV Q+I+ G+V R  L +  APD   +QL +  G LVL      
Sbjct  198   TSSGVGFALPSDMVSGIVDQIIRYGRVTRPILGVSFAPDGALDQLGL-GGVLVLDARAGG  256

Query  677   LAAKAGILPTTRGFAGNIVLGDIIEAVDNKPVRNKADLYKVLDDYSVGDKVQLKIRRG  504
              AA+AG+  TTR  +G ++LGDII  +  + +++ +DLY+ LD  SVG+ V + + RG
Sbjct  257   PAARAGVRSTTRDESGRLILGDIIIELAGEQIQDSSDLYRTLDKLSVGETVDVTLLRG  314


 Score = 55.5 bits (132),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 29/58 (50%), Positives = 36/58 (62%), Gaps = 0/58 (0%)
 Frame = -3

Query  1588  EERIVQLFENNTYSVVNIFDVTLRPRLNVGGAVEIPEGNGSGVVWDGEGNIVTNYHVI  1415
             E   V+LF N   SVV I +V +R         E P+G GSG+VWD +G+IVTNYHVI
Sbjct  1     ERETVRLFNNAKASVVYITNVAVRRDAFTLNLTEQPQGAGSGIVWDDKGHIVTNYHVI  58



>ref|WP_006973648.1| hypothetical protein [Plesiocystis pacifica]
 gb|EDM77208.1| hypothetical protein PPSIR1_26703 [Plesiocystis pacifica SIR-1]
Length=389

 Score =   210 bits (534),  Expect = 4e-58, Method: Compositional matrix adjust.
 Identities = 117/237 (49%), Positives = 157/237 (66%), Gaps = 6/237 (3%)
 Frame = -2

Query  1205  KNFEGKLVGADRSKDLAVLKVE---ASEDLLRPTKIG-ESSSLRVGQKCLAIGNPFGFDH  1038
             +    +LVG DR +D+AVL ++   A   +L P  +  E   L VGQK LAIGNPFG DH
Sbjct  140   RTVPARLVGGDRKRDIAVLALKLDPAEAGMLIPVNLPPEDEPLVVGQKALAIGNPFGLDH  199

Query  1037  TLTVGVISGLNRDIYSQTGVTISGGIQTDAAINPGNSGGPLLDSKGNLIGINTAIFTQTG  858
             TLTVGVIS L R++    GVTI   IQTDA+INPGNSGGPLLDS G LIG+NT IF+++G
Sbjct  200   TLTVGVISALEREVPGYGGVTIRDMIQTDASINPGNSGGPLLDSSGRLIGMNTIIFSKSG  259

Query  857   TSAGVGFAIPSSTVLRIVPQLIQSGKVVRAGLNIDIAPDAIANQLNVRNGALVLLVPGNS  678
             +SAG+GFA+P +TV R+VPQLI+ G   RAGL +++  D +A +  +    +   +PG  
Sbjct  260   SSAGIGFAVPVATVRRLVPQLIEYGHARRAGLGVEVVDDRLAKRNRIEGVIIEAALPGGP  319

Query  677   LAAKAGILPTTRGFAGNIVLGDIIEAVDNKPVRNKADLYKVLDDYSVGDKVQLKIRR  507
              AA AG L   R     ++LGD+I  +D+  V N  +L+  L+DY  GD+VQ+K+RR
Sbjct  320   -AASAG-LRGLRRKGREVLLGDVIVGIDDHAVGNYDELFNALEDYEPGDEVQVKVRR  374



>ref|XP_002185764.1| predicted protein [Phaeodactylum tricornutum CCAP 1055/1]
 gb|ACI65234.1| predicted protein [Phaeodactylum tricornutum CCAP 1055/1]
Length=466

 Score =   212 bits (540),  Expect = 4e-58, Method: Compositional matrix adjust.
 Identities = 115/243 (47%), Positives = 158/243 (65%), Gaps = 5/243 (2%)
 Frame = -2

Query  1220  FGRLQKN-----FEGKLVGADRSKDLAVLKVEASEDLLRPTKIGESSSLRVGQKCLAIGN  1056
             FG +  N     ++ ++VG D  KD+A+L+V+A +++L P  +G S  L+VGQ  +AIGN
Sbjct  179   FGSMSANVKRSVYKARVVGVDPGKDIAILRVDAPKEILAPMALGTSKGLKVGQYSMAIGN  238

Query  1055  PFGFDHTLTVGVISGLNRDIYSQTGVTISGGIQTDAAINPGNSGGPLLDSKGNLIGINTA  876
             PFG DHTLT G+ISG+ R++ S  G  I+  IQTDAAINPGNSGGPLLDS G  IG+NTA
Sbjct  239   PFGLDHTLTAGIISGIGREVKSPIGRPITNVIQTDAAINPGNSGGPLLDSSGKCIGMNTA  298

Query  875   IFTQTGTSAGVGFAIPSSTVLRIVPQLIQSGKVVRAGLNIDIAPDAIANQLNVRNGALVL  696
             I++ +G SAG+GFAIP  TV  IV  LI+ G+VVR  L I       A  L + +G LVL
Sbjct  299   IYSPSGASAGIGFAIPIDTVKFIVETLIRDGRVVRPVLGISYLEYKQARALGINSGVLVL  358

Query  695   LVPGNSLAAKAGILPTTRGFAGNIVLGDIIEAVDNKPVRNKADLYKVLDDYSVGDKVQLK  516
               P  S  A AG+  T R  +G + +GDII  V +K +  ++DL++ L++Y  GD V + 
Sbjct  359   EAPAGSPPALAGLKGTRRTESGLVEIGDIITKVGDKVITVESDLFQALEEYKPGDVVDVT  418

Query  515   IRR  507
             + R
Sbjct  419   VNR  421


 Score = 58.2 bits (139),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 31/71 (44%), Positives = 43/71 (61%), Gaps = 0/71 (0%)
 Frame = -3

Query  1612  PSGPLSPSEERIVQLFENNTYSVVNIFDVTLRPRLNVGGAVEIPEGNGSGVVWDGEGNIV  1433
             P+  L  SE + + +FE    SVV I   T R  +     +E+P G+GSG VWD EG+IV
Sbjct  75    PAWALDDSENKRITVFEKTAPSVVFIDTFTERRDVFSTNVMEVPLGSGSGFVWDTEGHIV  134

Query  1432  TNYHVIGNSLS  1400
             TN+HV+ N+ S
Sbjct  135   TNFHVVRNAQS  145



>ref|WP_036500556.1| 2-alkenal reductase [Nitrosococcus oceani]
 gb|KFI22882.1| 2-alkenal reductase [Nitrosococcus oceani]
Length=372

 Score =   209 bits (533),  Expect = 5e-58, Method: Compositional matrix adjust.
 Identities = 112/234 (48%), Positives = 151/234 (65%), Gaps = 1/234 (0%)
 Frame = -2

Query  1208  QKNFEGKLVGADRSKDLAVLKVEASEDLLRPTKIGESSSLRVGQKCLAIGNPFGFDHTLT  1029
                ++ KL+GA   KDLAVL+++A  + L P  IG S  L+VGQK  AIGNPFG D TLT
Sbjct  125   HSTWDAKLIGAAPEKDLAVLRIKAPRNKLMPIAIGSSGDLQVGQKAFAIGNPFGLDQTLT  184

Query  1028  VGVISGLNRDIYSQTGVTISGGIQTDAAINPGNSGGPLLDSKGNLIGINTAIFTQTGTSA  849
              GVIS L R++ S   + I   IQTDAAINPGNSGGPLLDS G L+G+NTAI++ +GT A
Sbjct  185   TGVISALGREMESAARIPIRNVIQTDAAINPGNSGGPLLDSAGRLMGVNTAIYSPSGTYA  244

Query  848   GVGFAIPSSTVLRIVPQLIQSGKVVRAGLNIDIAPDAIANQLNVRNGALVLLVPGNSLAA  669
             G+GFAIP  TV  +VP+LI  G+V R  L I++ P      + V    ++ ++PG+  A 
Sbjct  245   GIGFAIPVDTVNWVVPELIAKGRVERPTLGIELLPARAMANMRVEGAVILRVIPGSG-AE  303

Query  668   KAGILPTTRGFAGNIVLGDIIEAVDNKPVRNKADLYKVLDDYSVGDKVQLKIRR  507
             +AG+    R   G I LGDII AV+ +PV +  DL   L+    G+K+Q+++ R
Sbjct  304   QAGLRGVQRDSLGRIHLGDIIVAVEGQPVLDADDLVLALERRQAGEKIQVQVIR  357



>ref|WP_011712250.1| 2-alkenal reductase [Magnetococcus marinus]
 ref|YP_864489.1| DegP2 peptidase [Magnetococcus marinus MC-1]
 gb|ABK43083.1| DegP2 peptidase, Serine peptidase, MEROPS family S01B [Magnetococcus 
marinus MC-1]
Length=368

 Score =   209 bits (532),  Expect = 5e-58, Method: Compositional matrix adjust.
 Identities = 121/237 (51%), Positives = 150/237 (63%), Gaps = 5/237 (2%)
 Frame = -2

Query  1208  QKNFEGKLVGADRSKDLAVLKVEASEDLLRPTKIGESSSLRVGQKCLAIGNPFGFDHTLT  1029
             Q ++   LVGA    DLAVL+++ S   ++P  IGES +L+VGQK  AIGNPFG DHTLT
Sbjct  123   QTSYNAVLVGASPEHDLAVLRIKTSASHVQPLPIGESHNLQVGQKVYAIGNPFGLDHTLT  182

Query  1028  VGVISGLNRDIYSQTGVTISGGIQTDAAINPGNSGGPLLDSKGNLIGINTAIFTQTGTSA  849
              GVIS L R I S+ G  +   IQTDAAINPGNSGGPLLDS G LIGINTAI++ +G  A
Sbjct  183   TGVISALERSIDSEAGAVMEDLIQTDAAINPGNSGGPLLDSAGRLIGINTAIYSPSGAYA  242

Query  848   GVGFAIPSSTVLRIVPQLIQSGKVVRAGLNIDIAPDAIANQLNVR---NGALVLLVPGNS  678
             G+GFA+P   V R+VPQLI  G+  R  L I  A D  + Q+  R    G LVL V   S
Sbjct  243   GIGFAVPVDEVNRVVPQLIAQGRYQRPSLGIQ-ASDRSSAQILSRFEITGVLVLGVASGS  301

Query  677   LAAKAGILPTTRGFAGNIVLGDIIEAVDNKPVRNKADLYKVLDDYSVGDKVQLKIRR  507
              A +AGI   +R     IVLGD+I A+ ++P  N   L K L  Y VGD V++ + R
Sbjct  302   AAQRAGI-QASRLDERGIVLGDVIVAIADQPTENIDQLQKALAKYRVGDTVKITLWR  357



>ref|WP_013220653.1| 2-alkenal reductase [Nitrosococcus watsonii]
 ref|YP_003760882.1| HtrA2 peptidase [Nitrosococcus watsonii C-113]
 gb|ADJ28561.1| HtrA2 peptidase [Nitrosococcus watsonii C-113]
Length=372

 Score =   209 bits (532),  Expect = 6e-58, Method: Compositional matrix adjust.
 Identities = 112/234 (48%), Positives = 151/234 (65%), Gaps = 1/234 (0%)
 Frame = -2

Query  1208  QKNFEGKLVGADRSKDLAVLKVEASEDLLRPTKIGESSSLRVGQKCLAIGNPFGFDHTLT  1029
                ++ KL+GA   KDLAVL+++A  + L+P  IG S  L+VGQK  AIGNPFG D TLT
Sbjct  125   HSTWDAKLIGAAPEKDLAVLRIKAPGNKLQPIAIGSSGDLQVGQKAFAIGNPFGLDQTLT  184

Query  1028  VGVISGLNRDIYSQTGVTISGGIQTDAAINPGNSGGPLLDSKGNLIGINTAIFTQTGTSA  849
              GVIS L R++ S   + I   IQTDAAINPGNSGGPLLDS G L+G+NTAI++ +GT A
Sbjct  185   TGVISALGREMESAARIPIRNVIQTDAAINPGNSGGPLLDSAGRLMGVNTAIYSPSGTYA  244

Query  848   GVGFAIPSSTVLRIVPQLIQSGKVVRAGLNIDIAPDAIANQLNVRNGALVLLVPGNSLAA  669
             G+GFAIP  TV  +VP+LI  G+V R  L I++ P      + V    ++ ++PG   A 
Sbjct  245   GIGFAIPVDTVNWVVPELIAKGRVERPTLGIELLPARAMANMRVEGAVILRVIPGGG-AE  303

Query  668   KAGILPTTRGFAGNIVLGDIIEAVDNKPVRNKADLYKVLDDYSVGDKVQLKIRR  507
             +AG+    R   G I LGDII AV+ +PV +  DL   L+    G+K+Q+++ R
Sbjct  304   QAGLRGVQRDSLGRIHLGDIIVAVEGQPVLDADDLVLALEQRQAGEKIQVQVIR  357



>ref|WP_014429493.1| 2-alkenal reductase [Rubrivivax gelatinosus]
 ref|YP_005438131.1| putative DegP protease [Rubrivivax gelatinosus IL144]
 dbj|BAL96632.1| putative DegP protease [Rubrivivax gelatinosus IL144]
Length=358

 Score =   209 bits (531),  Expect = 6e-58, Method: Compositional matrix adjust.
 Identities = 113/234 (48%), Positives = 149/234 (64%), Gaps = 0/234 (0%)
 Frame = -2

Query  1208  QKNFEGKLVGADRSKDLAVLKVEASEDLLRPTKIGESSSLRVGQKCLAIGNPFGFDHTLT  1029
             Q ++E +LVGA   +DLAVL+++A  + L P  IG S  LRVGQ+  AIGNPFG D TLT
Sbjct  110   QTSYEAELVGAFPDRDLAVLRIKAPREKLPPIAIGASRELRVGQRVYAIGNPFGLDQTLT  169

Query  1028  VGVISGLNRDIYSQTGVTISGGIQTDAAINPGNSGGPLLDSKGNLIGINTAIFTQTGTSA  849
              G++S L R+I S    TI G IQTDAAINPGNSGGPLLDS G LIG+NT I + +G SA
Sbjct  170   TGIVSALGREIESFNNRTIRGVIQTDAAINPGNSGGPLLDSAGRLIGVNTQIASPSGASA  229

Query  848   GVGFAIPSSTVLRIVPQLIQSGKVVRAGLNIDIAPDAIANQLNVRNGALVLLVPGNSLAA  669
             G+GFAIP   V RIVP+LI+ G+ +R  + +   P+ +   L +  G  ++ V     AA
Sbjct  230   GIGFAIPVDEVNRIVPRLIRDGRFLRPAIGVTAGPENLTRALGLPRGVPLVQVQPGGPAA  289

Query  668   KAGILPTTRGFAGNIVLGDIIEAVDNKPVRNKADLYKVLDDYSVGDKVQLKIRR  507
             KAG+ P  RG    IV GD+I AV  + V +  D+  +L+    GD+V L + R
Sbjct  290   KAGLKPFQRGRGSQIVAGDVITAVAGEAVDSLDDILSLLETRQPGDRVNLTVWR  343


 Score = 53.5 bits (127),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 28/69 (41%), Positives = 38/69 (55%), Gaps = 0/69 (0%)
 Frame = -3

Query  1621  PTFPSGPLSPSEERIVQLFENNTYSVVNIFDVTLRPRLNVGGAVEIPEGNGSGVVWDGEG  1442
             P  P G LS  E   ++LF   + SVV+I  +  R         ++P G G+G VWD  G
Sbjct  29    PITPRGALSAEETANIELFRKASPSVVHITTLAARRDFFSLNVQQVPAGTGTGFVWDEAG  88

Query  1441  NIVTNYHVI  1415
             +IVTN+HVI
Sbjct  89    HIVTNFHVI  97



>ref|WP_013763684.1| 2-alkenal reductase [Haliscomenobacter hydrossis]
 ref|YP_004446002.1| peptidase S1 and S6 chymotrypsin/Hap [Haliscomenobacter hydrossis 
DSM 1100]
 gb|AEE49129.1| peptidase S1 and S6 chymotrypsin/Hap [Haliscomenobacter hydrossis 
DSM 1100]
Length=375

 Score =   209 bits (531),  Expect = 8e-58, Method: Compositional matrix adjust.
 Identities = 112/236 (47%), Positives = 154/236 (65%), Gaps = 5/236 (2%)
 Frame = -2

Query  1208  QKNFEGKLVGADRSKDLAVLKVEASEDLLRPTKIGESSSLRVGQKCLAIGNPFGFDHTLT  1029
             +  ++ +LVG+   KDLAVLK++A  + + P  +G S  LRVGQ   AIGNPFG D TLT
Sbjct  128   RSTWDAELVGSAPEKDLAVLKIKAPTNKMIPIPVGTSEDLRVGQAVYAIGNPFGLDQTLT  187

Query  1028  VGVISGLNRDIYSQTGVTISGGIQTDAAINPGNSGGPLLDSKGNLIGINTAIFTQTGTSA  849
              G++S L R+I +++G  +   IQTDAAINPGNSGGPLLDS G LIG+NTAI++ +G SA
Sbjct  188   TGIVSALGREIQTESGFPVRDAIQTDAAINPGNSGGPLLDSSGRLIGVNTAIYSPSGASA  247

Query  848   GVGFAIPSSTVLRIVPQLIQSGKVVRAGLNIDI--APDAIANQLNVRNGALVLLVPGNSL  675
             G+GF+IP + V   VP+LI+ GK+ R  L +++    D   N+L    G LV+ V     
Sbjct  248   GIGFSIPVAVVRWAVPELIKYGKIKRPSLGVELLETSDVKRNEL---EGPLVMDVTRGGP  304

Query  674   AAKAGILPTTRGFAGNIVLGDIIEAVDNKPVRNKADLYKVLDDYSVGDKVQLKIRR  507
             AA AG+  T R   G I+LGDII A++NK +  K +L   L++Y  GD+V L + R
Sbjct  305   AASAGLRATRRDEYGRIILGDIIVAMNNKRINTKEELILELENYQAGDEVTLTLLR  360


 Score = 56.6 bits (135),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 28/61 (46%), Positives = 36/61 (59%), Gaps = 0/61 (0%)
 Frame = -3

Query  1597  SPSEERIVQLFENNTYSVVNIFDVTLRPRLNVGGAVEIPEGNGSGVVWDGEGNIVTNYHV  1418
             +P EE  + LFE    SV  I    +R        +EIP+G+GSG VWD  G+I+TNYHV
Sbjct  55    TPEEEHTIALFERAAPSVCYITTSVVRRDFWSRNVMEIPQGSGSGFVWDRSGHIITNYHV  114

Query  1417  I  1415
             I
Sbjct  115   I  115



>ref|WP_009023167.1| 2-alkenal reductase [gamma proteobacterium NOR5-3]
 gb|EED33794.1| peptidase S1 and S6, chymotrypsin/Hap [gamma proteobacterium 
NOR5-3]
Length=360

 Score =   208 bits (530),  Expect = 9e-58, Method: Compositional matrix adjust.
 Identities = 110/234 (47%), Positives = 162/234 (69%), Gaps = 3/234 (1%)
 Frame = -2

Query  1202  NFEGKLVGADRSKDLAVLKV-EASEDLLRPTKIGESSSLRVGQKCLAIGNPFGFDHTLTV  1026
             +++ +L+G+   KDLAVL++ E  EDL+    +G+S+ L VG+K LAIGNPFG D TLT 
Sbjct  115   SYQAELIGSAPEKDLAVLRLLEPPEDLVT-LPLGDSTELSVGRKVLAIGNPFGLDTTLTT  173

Query  1025  GVISGLNRDIYSQTGVTISGGIQTDAAINPGNSGGPLLDSKGNLIGINTAIFTQTGTSAG  846
             GV+S L R+I + +G  I G +QTDAAINPGNSGGPLL+S G LIG+NTAI++ +G SAG
Sbjct  174   GVVSALGREIRAPSGRQIRGVVQTDAAINPGNSGGPLLNSLGQLIGVNTAIYSPSGASAG  233

Query  845   VGFAIPSSTVLRIVPQLIQSGKVVRAGLNIDIAPDAIANQLNVRNGALVLLVPGNSLAAK  666
             +GFAIP +TV  +VPQLI  G+++R  + +++A D    +  +    +V + PG   AA+
Sbjct  234   IGFAIPVNTVKEVVPQLISYGRILRPIMGVELASDRWRRRYGIEGLPVVRVFPGLP-AAE  292

Query  665   AGILPTTRGFAGNIVLGDIIEAVDNKPVRNKADLYKVLDDYSVGDKVQLKIRRG  504
             AG+   +R   G++ LGDII A+DN+PV +  D   +++ +  GD+V ++ RRG
Sbjct  293   AGLRGISRSSRGDLRLGDIIIAIDNQPVNDHDDYLTIMERHKAGDRVSVRARRG  346



>ref|WP_027474142.1| 2-alkenal reductase [Curvibacter gracilis]
Length=348

 Score =   207 bits (528),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 115/234 (49%), Positives = 149/234 (64%), Gaps = 1/234 (0%)
 Frame = -2

Query  1208  QKNFEGKLVGADRSKDLAVLKVEASEDLLRPTKIGESSSLRVGQKCLAIGNPFGFDHTLT  1029
             Q ++  +LVGA   +DLAVL++ A    LRP  +G S  L+VGQ+  AIGNPFG D TLT
Sbjct  100   QSSYRAELVGAFADRDLAVLRINAPASKLRPLPLGSSRELQVGQQVYAIGNPFGLDQTLT  159

Query  1028  VGVISGLNRDIYSQTGVTISGGIQTDAAINPGNSGGPLLDSKGNLIGINTAIFTQTGTSA  849
             +G++S LNR+I S T  TI G IQTDAAINPGNSGGPLLDS G LIG+NT+I++ +G SA
Sbjct  160   LGIVSALNREIESVTRRTIKGAIQTDAAINPGNSGGPLLDSAGRLIGVNTSIYSPSGASA  219

Query  848   GVGFAIPSSTVLRIVPQLIQSGKVVRAGLNIDIAPDAIANQLNVRNGALVLLVPGNSLAA  669
             G+GFAIP   V RIVP LI+ G++VR  L +  A   +   L +  G  ++ +  N  AA
Sbjct  220   GIGFAIPVDEVNRIVPSLIRDGRLVRPALGLSGAGPDLNRALGLPKGVAIVRLQRNGPAA  279

Query  668   KAGILPTTRGFAGNIVLGDIIEAVDNKPVRNKADLYKVLDDYSVGDKVQLKIRR  507
             KAG+   TR   G IV GD+I AV+ +PV    DL   L+    G    L + R
Sbjct  280   KAGLRAFTRSENG-IVAGDVITAVEGEPVETMDDLLTALERLQPGQTCTLTLWR  332


 Score = 55.5 bits (132),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 31/85 (36%), Positives = 47/85 (55%), Gaps = 9/85 (11%)
 Frame = -3

Query  1612  PSGPLSPSEERIVQLFENNTYSVVNIFDVTLRPRLNVGGAVEIPEGNGSGVVWDGEGNIV  1433
             P GPL   E   + +F+ ++ SVVNI  + L   +      ++P+G G+G VWD +G+IV
Sbjct  22    PRGPLGAEELNHINVFKTSSPSVVNITALGLERDVFSLNVQQVPQGTGTGFVWDTQGHIV  81

Query  1432  TNYHVIGNSLSRNPTRGEVVARVNI  1358
             TN+HVI         +G   ARV +
Sbjct  82    TNFHVI---------QGAAAARVTL  97



>ref|WP_015724997.1| 2-alkenal reductase [Desulfobulbus propionicus]
 ref|YP_004195750.1| DegP2 peptidase [Desulfobulbus propionicus DSM 2032]
 gb|ADW18459.1| DegP2 peptidase [Desulfobulbus propionicus DSM 2032]
Length=361

 Score =   208 bits (529),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 117/234 (50%), Positives = 157/234 (67%), Gaps = 2/234 (1%)
 Frame = -2

Query  1208  QKNFEGKLVGADRSKDLAVLKVEASEDLLRPTKIGESSSLRVGQKCLAIGNPFGFDHTLT  1029
                ++  LVGA   +DLAVL++ A  + L+P  IGES +L VGQK  AIGNPFG D TLT
Sbjct  115   HTTWKAVLVGAAPDRDLAVLQISAPANKLQPLAIGESKNLLVGQKVFAIGNPFGLDQTLT  174

Query  1028  VGVISGLNRDIYSQTGVTISGGIQTDAAINPGNSGGPLLDSKGNLIGINTAIFTQTGTSA  849
              GV+S L R+I + TG TI   IQTDAAINPGNSGGPLLDS G LIG+NTAI++ +G S+
Sbjct  175   TGVVSALGREITAVTGRTIHDVIQTDAAINPGNSGGPLLDSAGRLIGVNTAIYSPSGASS  234

Query  848   GVGFAIPSSTVLRIVPQLIQSGKVVRAGLNIDIAPDAIANQLNVRNGALVLLVPGNSLAA  669
             G+GFA+P   V R+VPQ+I  GK++R GL I +A   +  +L +  G +VL V   S A 
Sbjct  235   GIGFAVPVGEVNRVVPQIISKGKLIRPGLGIALANPRLMEELGL-EGVMVLKVQPGSSAE  293

Query  668   KAGILPTTRGFAGNIVLGDIIEAVDNKPVRNKADLYKVLDDYSVGDKVQLKIRR  507
             KAG+  TT+   G +VLGDII AV+ K +++  +L   L+ + VG+ + L + R
Sbjct  294   KAGLRGTTQVREG-LVLGDIIVAVNGKKIKDYDNLRDELERHEVGESIALTLLR  346


 Score = 57.4 bits (137),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 28/67 (42%), Positives = 39/67 (58%), Gaps = 0/67 (0%)
 Frame = -3

Query  1606  GPLSPSEERIVQLFENNTYSVVNIFDVTLRPRLNVGGAVEIPEGNGSGVVWDGEGNIVTN  1427
             G L+  E   + +F N   SVV I  + +R  L      EIP+G GSG +WD +G IVTN
Sbjct  39    GDLASDERTTIDIFRNAAPSVVYITSIAVRRNLFNLNVYEIPQGTGSGFIWDKQGRIVTN  98

Query  1426  YHVIGNS  1406
             +HVI ++
Sbjct  99    FHVISDA  105



>ref|WP_022951449.1| 2-alkenal reductase [Leucothrix mucor]
Length=371

 Score =   208 bits (529),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 121/238 (51%), Positives = 160/238 (67%), Gaps = 5/238 (2%)
 Frame = -2

Query  1208  QKNFEGKLVGADRSKDLAVLKVEASEDLLRPTKIGESSSLRVGQKCLAIGNPFGFDHTLT  1029
             Q+ ++  LVGA    DLAVLK+        P  +G SS L+VGQK  AIGNPFG DHTLT
Sbjct  119   QRTYDAILVGASPRHDLAVLKINVPIGQPTPVPVGRSSDLQVGQKVYAIGNPFGLDHTLT  178

Query  1028  VGVISGLNRDIYSQTGVTISGGIQTDAAINPGNSGGPLLDSKGNLIGINTAIFTQTGTSA  849
              G+IS   R I S+ G  I   IQTDAAINPGNSGGPL+DS G LIGINTAI++ +G SA
Sbjct  179   SGIISATGRSIDSEAGGQIEDLIQTDAAINPGNSGGPLIDSAGRLIGINTAIYSPSGYSA  238

Query  848   GVGFAIPSSTVLRIVPQLIQSGKVVRA--GLNIDIAPDA-IANQLNVRNGALVLLVPGNS  678
             G+GFAIP  +V RIVPQLI  G+ VR   G+ +D   +A I+ Q NV+ G +VL V   S
Sbjct  239   GIGFAIPVDSVNRIVPQLISQGRYVRPVLGIEMDDRYNAMISRQYNVQ-GVVVLAVTPGS  297

Query  677   LAAKAGILPTTRGFAGNIVLGDIIEAVDNKPVRNKADLYKVLDDYSVGDKVQLKIRRG  504
              AA+AG+   ++  A +I+LGD+I+ ++ + V++  DL  +LD+  VGD+V+L + RG
Sbjct  298   GAARAGLTGISQQ-ANSIILGDVIQKINGRDVQSVDDLADILDESEVGDQVELTVYRG  354



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 4862288125142