BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c25618_g1_i1 len=1182 path=[1692:0-68 16110:69-110 16152:111-129
1796:130-155 13314:156-179 35402:180-192 35416:193-215 13374:216-880
14039:881-907 14066:908-925 1859:926-970 35496:971-988 14960:989-989
1923:990-998 1932:999-1026 35537:1027-1027 35538:1028-1028
16016:1029-1084 18864:1085-1088 16076:1089-1099 1962:1100-1112
1975:1113-1140 14984:1141-1145 14989:1146-1169 35641:1170-1181]

Length=1182
                                                                      Score     E

ref|XP_006361281.1|  PREDICTED: DNA (cytosine-5)-methyltransferas...    450   1e-144   
ref|XP_010324482.1|  PREDICTED: DNA (cytosine-5)-methyltransferas...    448   6e-144   
ref|XP_009625195.1|  PREDICTED: DNA (cytosine-5)-methyltransferas...    430   5e-140   
ref|XP_009785637.1|  PREDICTED: DNA (cytosine-5)-methyltransferas...    428   2e-139   
emb|CDP11756.1|  unnamed protein product                                388   1e-123   
ref|XP_011092593.1|  PREDICTED: DNA (cytosine-5)-methyltransferas...    399   3e-123   
gb|EPS61564.1|  hypothetical protein M569_13232                         364   1e-119   
ref|XP_008238301.1|  PREDICTED: DNA (cytosine-5)-methyltransferas...    368   2e-116   
ref|XP_010665035.1|  PREDICTED: DNA (cytosine-5)-methyltransferas...    380   4e-116   
ref|XP_010665031.1|  PREDICTED: DNA (cytosine-5)-methyltransferas...    380   5e-116   
ref|XP_009373520.1|  PREDICTED: DNA (cytosine-5)-methyltransferas...    369   3e-112   
ref|XP_007210636.1|  hypothetical protein PRUPE_ppa019831mg             358   3e-110   
ref|XP_004301642.1|  PREDICTED: DNA (cytosine-5)-methyltransferas...    357   3e-109   
ref|XP_007040779.1|  DNA-methyltransferase CMT2                         357   9e-108   
gb|KGN55702.1|  hypothetical protein Csa_3G006640                       355   1e-107   
ref|XP_011075808.1|  PREDICTED: DNA (cytosine-5)-methyltransferas...    340   2e-104   
ref|XP_010662142.1|  PREDICTED: DNA (cytosine-5)-methyltransferas...    336   2e-104   
ref|XP_004146191.1|  PREDICTED: DNA (cytosine-5)-methyltransferas...    346   2e-104   
ref|XP_004509555.1|  PREDICTED: DNA (cytosine-5)-methyltransferas...    344   2e-104   
ref|XP_008448611.1|  PREDICTED: DNA (cytosine-5)-methyltransferas...    342   4e-104   
ref|XP_010662140.1|  PREDICTED: DNA (cytosine-5)-methyltransferas...    336   5e-104   
ref|XP_011075807.1|  PREDICTED: DNA (cytosine-5)-methyltransferas...    339   7e-104   
ref|XP_006599217.1|  PREDICTED: DNA (cytosine-5)-methyltransferas...    336   8e-104   
gb|KEH20304.1|  DNA (cytosine-5)-methyltransferase                      339   4e-103   
ref|XP_008448610.1|  PREDICTED: DNA (cytosine-5)-methyltransferas...    342   4e-103   
ref|XP_010662139.1|  PREDICTED: DNA (cytosine-5)-methyltransferas...    336   8e-103   
emb|CBI37413.3|  unnamed protein product                                331   1e-102   
gb|AHB20162.1|  DNA methyltransferase                                   332   2e-102   
ref|XP_007156278.1|  hypothetical protein PHAVU_003G273100g             338   2e-102   
emb|CBI26560.3|  unnamed protein product                                334   2e-102   
ref|XP_011028082.1|  PREDICTED: DNA (cytosine-5)-methyltransferas...    337   3e-102   
gb|KHN10109.1|  DNA (cytosine-5)-methyltransferase CMT2                 337   3e-102   
ref|XP_006599216.1|  PREDICTED: DNA (cytosine-5)-methyltransferas...    337   4e-102   
ref|XP_010243148.1|  PREDICTED: DNA (cytosine-5)-methyltransferas...    338   5e-102   
ref|XP_006599215.1|  PREDICTED: DNA (cytosine-5)-methyltransferas...    337   9e-102   
ref|XP_011028081.1|  PREDICTED: DNA (cytosine-5)-methyltransferas...    337   3e-101   
ref|XP_011028080.1|  PREDICTED: DNA (cytosine-5)-methyltransferas...    337   3e-101   
ref|XP_010110416.1|  DNA (cytosine-5)-methyltransferase CMT2            335   3e-100   
ref|XP_010677407.1|  PREDICTED: DNA (cytosine-5)-methyltransferas...    325   8e-100   
ref|XP_008790945.1|  PREDICTED: DNA (cytosine-5)-methyltransferas...    330   9e-100   
ref|XP_010677408.1|  PREDICTED: DNA (cytosine-5)-methyltransferas...    323   3e-99    
ref|XP_010677406.1|  PREDICTED: DNA (cytosine-5)-methyltransferas...    325   9e-98    
ref|XP_010908353.1|  PREDICTED: DNA (cytosine-5)-methyltransferas...    324   1e-97    
ref|XP_010054090.1|  PREDICTED: DNA (cytosine-5)-methyltransferas...    322   8e-96    
gb|KDO58824.1|  hypothetical protein CISIN_1g046469mg                   306   3e-95    
ref|XP_010671153.1|  PREDICTED: DNA (cytosine-5)-methyltransferas...    311   6e-94    
ref|XP_010665041.1|  PREDICTED: DNA (cytosine-5)-methyltransferas...    314   1e-92    
ref|XP_006414021.1|  hypothetical protein EUTSA_v10024250mg             313   1e-92    
ref|XP_010518849.1|  PREDICTED: DNA (cytosine-5)-methyltransferas...    305   3e-91    
ref|XP_010518848.1|  PREDICTED: DNA (cytosine-5)-methyltransferas...    307   1e-90    
ref|XP_006385690.1|  hypothetical protein POPTR_0003s09920g             304   2e-90    
ref|XP_010518846.1|  PREDICTED: DNA (cytosine-5)-methyltransferas...    307   2e-90    
gb|EYU45367.1|  hypothetical protein MIMGU_mgv1a020188mg                300   1e-89    
gb|AHB20163.1|  DNA methyltransferase                                   295   2e-88    
ref|XP_004960649.1|  PREDICTED: DNA (cytosine-5)-methyltransferas...    301   2e-88    
ref|XP_004960650.1|  PREDICTED: DNA (cytosine-5)-methyltransferas...    301   2e-88    
ref|NP_193637.2|  chromomethylase 2                                     300   5e-88    Arabidopsis thaliana [mouse-ear cress]
ref|XP_006471441.1|  PREDICTED: DNA (cytosine-5)-methyltransferas...    297   7e-88    
ref|XP_002870005.1|  chromomethylase 2                                  299   1e-87    
ref|XP_009392768.1|  PREDICTED: DNA (cytosine-5)-methyltransferas...    298   2e-87    
ref|XP_009392766.1|  PREDICTED: DNA (cytosine-5)-methyltransferas...    298   2e-87    
ref|XP_009132470.1|  PREDICTED: DNA (cytosine-5)-methyltransferas...    298   2e-87    
emb|CDX78915.1|  BnaA01g09820D                                          297   3e-87    
ref|XP_006282433.1|  hypothetical protein CARUB_v10003999mg             298   3e-87    
ref|XP_010449422.1|  PREDICTED: DNA (cytosine-5)-methyltransferas...    298   4e-87    
dbj|BAH37021.1|  chromomethylase OsMET2c                                291   4e-87    Oryza sativa Japonica Group [Japonica rice]
ref|XP_002519960.1|  protein with unknown function                      290   6e-87    Ricinus communis
gb|EMS55851.1|  DNA (cytosine-5)-methyltransferase CMT2                 293   1e-86    
emb|CDX99400.1|  BnaC01g11520D                                          295   1e-86    
gb|EMT28418.1|  DNA (cytosine-5)-methyltransferase 1                    295   4e-86    
ref|XP_006849583.1|  hypothetical protein AMTR_s00024p00193220          291   4e-86    
ref|XP_006655109.1|  PREDICTED: DNA (cytosine-5)-methyltransferas...    294   8e-86    
ref|XP_006854149.1|  hypothetical protein AMTR_s00048p00181490          293   9e-86    
ref|XP_002439474.1|  hypothetical protein SORBIDRAFT_09g007390          284   6e-82    Sorghum bicolor [broomcorn]
ref|XP_010054093.1|  PREDICTED: DNA (cytosine-5)-methyltransferas...    281   2e-81    
ref|XP_006431407.1|  hypothetical protein CICLE_v10000251mg             273   2e-79    
ref|XP_009390334.1|  PREDICTED: DNA (cytosine-5)-methyltransferas...    272   4e-79    
ref|XP_009390335.1|  PREDICTED: DNA (cytosine-5)-methyltransferas...    272   4e-79    
ref|XP_009390332.1|  PREDICTED: DNA (cytosine-5)-methyltransferas...    272   5e-79    
ref|XP_006470820.1|  PREDICTED: DNA (cytosine-5)-methyltransferas...    270   1e-78    
ref|XP_010936992.1|  PREDICTED: DNA (cytosine-5)-methyltransferas...    266   6e-77    
gb|ABW96889.1|  CMT-type DNA-methyltransferase                          266   7e-77    Elaeis guineensis
ref|XP_004512254.1|  PREDICTED: putative DNA (cytosine-5)-methylt...    261   3e-75    
gb|EEE62800.1|  hypothetical protein OsJ_17603                          262   1e-74    Oryza sativa Japonica Group [Japonica rice]
ref|XP_002275932.1|  PREDICTED: putative DNA (cytosine-5)-methylt...    258   2e-74    Vitis vinifera
emb|CBI29991.3|  unnamed protein product                                258   2e-74    
gb|KEH27061.1|  DNA (cytosine-5)-methyltransferase CMT3-like protein    258   4e-74    
gb|EEC78738.1|  hypothetical protein OsI_18945                          261   7e-74    Oryza sativa Indica Group [Indian rice]
gb|AIU80190.1|  chromomethylase                                         257   7e-74    
ref|XP_008797880.1|  PREDICTED: DNA (cytosine-5)-methyltransferas...    257   2e-73    
ref|XP_009132479.1|  PREDICTED: DNA (cytosine-5)-methyltransferas...    256   1e-72    
ref|XP_010091206.1|  DNA (cytosine-5)-methyltransferase 1               254   2e-72    
ref|XP_002530367.1|  protein with unknown function                      251   8e-72    Ricinus communis
gb|EYU23276.1|  hypothetical protein MIMGU_mgv1a002680mg                246   5e-71    
ref|XP_003636958.1|  DNA (cytosine-5)-methyltransferase                 247   3e-70    
ref|XP_003612312.1|  DNA (cytosine-5)-methyltransferase                 247   3e-70    
gb|AIO05713.1|  CMT-type DNA-methyltransferase                          242   5e-70    
gb|KEH27609.1|  DNA (cytosine-5)-methyltransferase CMT3-like protein    246   7e-70    
ref|XP_007041239.1|  Chromomethylase 1, putative                        246   1e-69    
ref|XP_010651344.1|  PREDICTED: DNA (cytosine-5)-methyltransferas...    246   2e-69    
ref|XP_010533849.1|  PREDICTED: putative DNA (cytosine-5)-methylt...    243   5e-69    
ref|XP_010673524.1|  PREDICTED: DNA (cytosine-5)-methyltransferas...    244   6e-69    
ref|XP_010043881.1|  PREDICTED: DNA (cytosine-5)-methyltransferas...    243   2e-68    
gb|KDP34481.1|  hypothetical protein JCGZ_12764                         242   3e-68    
ref|XP_004170052.1|  PREDICTED: DNA (cytosine-5)-methyltransferas...    240   3e-68    
ref|XP_006590741.1|  PREDICTED: putative DNA (cytosine-5)-methylt...    241   3e-68    
ref|XP_004149031.1|  PREDICTED: DNA (cytosine-5)-methyltransferas...    241   5e-68    
gb|KDO42578.1|  hypothetical protein CISIN_1g0039742mg                  231   2e-67    
gb|AEP33250.1|  CMT-type DNA-methyltransferase                          239   2e-67    
ref|XP_008451103.1|  PREDICTED: DNA (cytosine-5)-methyltransferas...    239   3e-67    
gb|EMT30784.1|  DNA (cytosine-5)-methyltransferase 1                    237   5e-67    
ref|XP_007157973.1|  hypothetical protein PHAVU_002G113900g             238   1e-66    
gb|KDO40233.1|  hypothetical protein CISIN_1g013949mg                   229   1e-66    
ref|XP_006573534.1|  PREDICTED: putative DNA (cytosine-5)-methylt...    236   2e-66    
gb|KFK28331.1|  chromomethylase                                         234   8e-66    
ref|XP_007152975.1|  hypothetical protein PHAVU_004G176100g             235   1e-65    
emb|CDP13153.1|  unnamed protein product                                234   3e-65    
pdb|4FT2|A  Chain A, Crystal Structure Of Zea Mays Zmet2 In Compl...    231   9e-65    
ref|XP_002448525.1|  hypothetical protein SORBIDRAFT_06g028430          232   2e-64    Sorghum bicolor [broomcorn]
ref|NP_001104978.1|  DNA (cytosine-5)-methyltransferase 1               232   2e-64    Zea mays [maize]
gb|AFW59438.1|  DNA (cytosine-5)-methyltransferase 1                    232   2e-64    
ref|XP_007014771.1|  Chromomethylase 1, putative isoform 6              230   2e-64    
ref|XP_010230204.1|  PREDICTED: DNA (cytosine-5)-methyltransferas...    231   3e-64    
ref|XP_011089105.1|  PREDICTED: DNA (cytosine-5)-methyltransferas...    231   3e-64    
ref|XP_007014769.1|  Chromomethylase 1, putative isoform 4              230   4e-64    
ref|XP_007014770.1|  Chromomethylase 1, putative isoform 5              229   4e-64    
ref|XP_004987095.1|  PREDICTED: LOW QUALITY PROTEIN: DNA (cytosin...    234   5e-64    
ref|XP_006445885.1|  hypothetical protein CICLE_v10014232mg             230   6e-64    
gb|KDO62937.1|  hypothetical protein CISIN_1g047980mg                   228   8e-64    
gb|KDP44326.1|  hypothetical protein JCGZ_19193                         228   8e-64    
ref|XP_007014768.1|  Chromomethylase 1, putative isoform 3              229   1e-63    
ref|XP_002454088.1|  hypothetical protein SORBIDRAFT_04g024430          228   2e-63    Sorghum bicolor [broomcorn]
ref|NP_001275877.1|  DNA (cytosine-5)-methyltransferase CMT3-like       228   4e-63    
ref|XP_007014766.1|  Chromomethylase 1, putative isoform 1              228   4e-63    
emb|CDX97957.1|  BnaA06g07080D                                          226   8e-63    
ref|XP_009148471.1|  PREDICTED: putative DNA (cytosine-5)-methylt...    226   9e-63    
ref|XP_010236739.1|  PREDICTED: DNA (cytosine-5)-methyltransferas...    226   1e-62    
gb|KEH28933.1|  DNA (cytosine-5)-methyltransferase CMT1                 226   2e-62    
pdb|4FSX|A  Chain A, Crystal Structure Of Se-Substituted Zea Mays...    225   2e-62    
ref|XP_004983483.1|  PREDICTED: DNA (cytosine-5)-methyltransferas...    226   2e-62    
ref|XP_006417360.1|  hypothetical protein EUTSA_v10006850mg             224   3e-62    
emb|CDY19364.1|  BnaC05g08730D                                          224   3e-62    
ref|XP_009781267.1|  PREDICTED: DNA (cytosine-5)-methyltransferas...    225   3e-62    
ref|XP_006662134.1|  PREDICTED: DNA (cytosine-5)-methyltransferas...    224   4e-62    
emb|CAQ18903.1|  chromomethylase                                        223   5e-62    Nicotiana sylvestris
ref|XP_009781264.1|  PREDICTED: DNA (cytosine-5)-methyltransferas...    225   5e-62    
ref|XP_009781265.1|  PREDICTED: DNA (cytosine-5)-methyltransferas...    224   8e-62    
ref|XP_006572936.1|  PREDICTED: DNA (cytosine-5)-methyltransferas...    223   1e-61    
gb|KHN41840.1|  DNA (cytosine-5)-methyltransferase 1                    223   1e-61    
tpg|DAA36033.1|  TPA: hypothetical protein ZEAMMB73_314017              223   2e-61    
ref|XP_009590684.1|  PREDICTED: DNA (cytosine-5)-methyltransferas...    223   2e-61    
sp|Q8LPU5.1|CMT3_MAIZE  RecName: Full=DNA (cytosine-5)-methyltran...    223   2e-61    Zea mays [maize]
dbj|BAC53936.1|  chromomethylase-like protein                           222   2e-61    Nicotiana tabacum [American tobacco]
ref|XP_009625627.1|  PREDICTED: DNA (cytosine-5)-methyltransferas...    223   2e-61    
ref|XP_010666617.1|  PREDICTED: putative DNA (cytosine-5)-methylt...    222   3e-61    
gb|AGH70220.1|  chromomethylase 3                                       222   4e-61    
gb|EEE58631.1|  hypothetical protein OsJ_09996                          223   5e-61    Oryza sativa Japonica Group [Japonica rice]
ref|XP_004252840.1|  PREDICTED: DNA (cytosine-5)-methyltransferas...    221   1e-60    
emb|CDN40869.1|  chromomethylase                                        217   2e-60    
gb|EEC74798.1|  hypothetical protein OsI_10599                          223   2e-60    Oryza sativa Indica Group [Indian rice]
ref|NP_001105167.1|  DNA (cytosine-5)-methyltransferase 3               220   3e-60    Zea mays [maize]
gb|AAN60988.1|  Putative DNA cytosine methyltransferase MET2a           222   6e-60    Oryza sativa Japonica Group [Japonica rice]
gb|EEC70797.1|  hypothetical protein OsI_02246                          218   8e-60    Oryza sativa Indica Group [Indian rice]
gb|AAL75761.1|  Putative DNA cytosine methyltransferase MET2a           216   1e-59    Oryza sativa Japonica Group [Japonica rice]
dbj|BAH37019.1|  chromomethylase OsMET2a                                218   2e-59    Oryza sativa Japonica Group [Japonica rice]
gb|EEE50451.1|  hypothetical protein OsJ_30466                          217   2e-59    Oryza sativa Japonica Group [Japonica rice]
emb|CDN40870.1|  chromomethylase                                        216   4e-59    
ref|XP_010234610.1|  PREDICTED: DNA (cytosine-5)-methyltransferas...    216   6e-59    
ref|XP_010429915.1|  PREDICTED: putative DNA (cytosine-5)-methylt...    215   9e-59    
ref|XP_010429914.1|  PREDICTED: putative DNA (cytosine-5)-methylt...    214   1e-58    
ref|XP_009343271.1|  PREDICTED: DNA (cytosine-5)-methyltransferas...    199   1e-58    
ref|XP_010243382.1|  PREDICTED: DNA (cytosine-5)-methyltransferas...    214   2e-58    
ref|XP_010243384.1|  PREDICTED: DNA (cytosine-5)-methyltransferas...    214   2e-58    
ref|XP_008373679.1|  PREDICTED: DNA (cytosine-5)-methyltransferas...    211   2e-58    
dbj|BAH37020.1|  chromomethylase OsMET2b                                213   2e-58    Oryza sativa Japonica Group [Japonica rice]
ref|XP_006300613.1|  hypothetical protein CARUB_v10019805mg             213   3e-58    
ref|NP_001289523.1|  DNA (cytosine-5)-methyltransferase CMT3-like       213   7e-58    
ref|XP_011037978.1|  PREDICTED: DNA (cytosine-5)-methyltransferas...    211   3e-57    
ref|XP_011037979.1|  PREDICTED: DNA (cytosine-5)-methyltransferas...    211   4e-57    
emb|CAJ01708.1|  chromomethylase 1                                      209   7e-57    Hordeum vulgare [barley]
ref|XP_010541913.1|  PREDICTED: DNA (cytosine-5)-methyltransferas...    207   6e-56    
emb|CAA16759.1|  putative protein                                       209   7e-56    Arabidopsis thaliana [mouse-ear cress]
gb|AAK69757.1|AF383171_1  chromomethylase CMT2                          207   4e-55    Arabidopsis thaliana [mouse-ear cress]
ref|XP_007014767.1|  Chromomethylase 3, putative isoform 2              203   5e-55    
ref|XP_008226363.1|  PREDICTED: DNA (cytosine-5)-methyltransferas...    204   7e-55    
ref|XP_004513047.1|  PREDICTED: DNA (cytosine-5)-methyltransferas...    204   9e-55    
ref|XP_004513046.1|  PREDICTED: DNA (cytosine-5)-methyltransferas...    204   1e-54    
ref|XP_010470978.1|  PREDICTED: DNA (cytosine-5)-methyltransferas...    203   1e-54    
gb|AAC02667.1|  chromomethylase                                         200   1e-54    Arabidopsis thaliana [mouse-ear cress]
gb|AAC02665.1|  chromomethylase                                         200   1e-54    Arabidopsis thaliana [mouse-ear cress]
ref|XP_010470977.1|  PREDICTED: DNA (cytosine-5)-methyltransferas...    203   1e-54    
ref|XP_009781266.1|  PREDICTED: DNA (cytosine-5)-methyltransferas...    201   5e-54    
gb|AAC02670.1|  chromomethylase                                         200   8e-54    Arabidopsis suecica
gb|AAC02662.1|  chromomethylase                                         200   9e-54    Arabidopsis thaliana [mouse-ear cress]
emb|CBI16477.3|  unnamed protein product                                201   1e-53    
gb|AAC02663.1|  chromomethylase                                         200   1e-53    Arabidopsis thaliana [mouse-ear cress]
ref|NP_565245.1|  chromomethylase 1                                     200   1e-53    Arabidopsis thaliana [mouse-ear cress]
ref|XP_009625628.1|  PREDICTED: DNA (cytosine-5)-methyltransferas...    199   2e-53    
gb|AAB95485.1|  chromomethylase                                         199   2e-53    Arabidopsis thaliana [mouse-ear cress]
gb|AAB95486.1|  chromomethylase                                         198   6e-53    Arabidopsis arenosa
ref|XP_002886525.1|  predicted protein                                  196   3e-52    
gb|KEH25929.1|  DNA (cytosine-5)-methyltransferase CMT1                 196   3e-52    
gb|KEH27204.1|  DNA (cytosine-5)-methyltransferase CMT3-like protein    196   9e-52    
ref|XP_006300392.1|  hypothetical protein CARUB_v10019778mg             194   3e-51    
gb|AEC12443.1|  chromomethylase 3                                       193   3e-51    
ref|XP_002888734.1|  chromomethylase CMT3                               193   4e-51    
ref|XP_010415636.1|  PREDICTED: DNA (cytosine-5)-methyltransferas...    193   5e-51    
ref|XP_010415637.1|  PREDICTED: DNA (cytosine-5)-methyltransferas...    192   7e-51    
ref|XP_002990857.1|  hypothetical protein SELMODRAFT_132507             191   4e-50    
ref|XP_006432634.1|  hypothetical protein CICLE_v100004871mg            187   4e-50    
gb|EYU39242.1|  hypothetical protein MIMGU_mgv1a001319mg                189   1e-49    
gb|AFK80345.1|  chromomethylase 3                                       187   4e-49    
ref|XP_006354167.1|  PREDICTED: DNA (cytosine-5)-methyltransferas...    187   7e-49    
ref|XP_002974335.1|  hypothetical protein SELMODRAFT_30570              186   7e-49    
gb|AAK71870.1|  chromomethylase 3                                       186   1e-48    Arabidopsis thaliana [mouse-ear cress]
ref|XP_004293200.1|  PREDICTED: DNA (cytosine-5)-methyltransferas...    185   2e-48    
gb|KHN40382.1|  DNA (cytosine-5)-methyltransferase 1                    184   3e-48    
ref|XP_002299134.2|  hypothetical protein POPTR_0001s04700g             186   5e-48    Populus trichocarpa [western balsam poplar]
ref|XP_010316153.1|  PREDICTED: DNA (cytosine-5)-methyltransferas...    181   7e-47    
ref|XP_004228597.2|  PREDICTED: DNA (cytosine-5)-methyltransferas...    181   8e-47    
ref|XP_001769709.1|  predicted protein                                  179   1e-46    
ref|NP_177135.1|  DNA (cytosine-5)-methyltransferase CMT3               180   1e-46    Arabidopsis thaliana [mouse-ear cress]
dbj|BAF01425.1|  putative chromomethylase                               180   2e-46    Arabidopsis thaliana [mouse-ear cress]
gb|EMS51591.1|  DNA (cytosine-5)-methyltransferase 1                    178   5e-46    
gb|AAK69756.1|AF383170_1  chromomethylase CMT3                          178   6e-46    Arabidopsis thaliana [mouse-ear cress]
ref|XP_006390678.1|  hypothetical protein EUTSA_v10018159mg             177   1e-45    
gb|EMT27177.1|  DNA (cytosine-5)-methyltransferase 1                    170   2e-43    
ref|XP_002889276.1|  hypothetical protein ARALYDRAFT_895912             169   2e-42    
ref|XP_009364100.1|  PREDICTED: DNA (cytosine-5)-methyltransferas...    169   3e-42    
emb|CDY14524.1|  BnaC03g49350D                                          166   1e-41    
ref|XP_009376742.1|  PREDICTED: DNA (cytosine-5)-methyltransferas...    167   2e-41    
ref|XP_007208072.1|  hypothetical protein PRUPE_ppa001672mg             162   4e-40    
ref|XP_004288717.1|  PREDICTED: DNA (cytosine-5)-methyltransferas...    163   4e-40    
ref|XP_008373678.1|  PREDICTED: DNA (cytosine-5)-methyltransferas...    160   5e-40    
gb|EMS48088.1|  DNA (cytosine-5)-methyltransferase 1                    160   6e-40    
emb|CDY08836.1|  BnaA06g23880D                                          161   6e-40    
ref|XP_007152976.1|  hypothetical protein PHAVU_004G176100g             160   7e-40    
ref|XP_002304879.1|  chromomethylase 3 family protein                   155   1e-39    Populus trichocarpa [western balsam poplar]
ref|XP_009150572.1|  PREDICTED: DNA (cytosine-5)-methyltransferas...    160   1e-39    
gb|KCW85898.1|  hypothetical protein EUGRSUZ_B02615                     159   2e-39    
ref|XP_008390169.1|  PREDICTED: DNA (cytosine-5)-methyltransferas...    161   2e-39    
gb|EMT16647.1|  DNA (cytosine-5)-methyltransferase 2                    158   3e-39    
ref|NP_001280801.1|  DNA (cytosine-5)-methyltransferase CMT3            160   6e-39    
dbj|BAF34637.1|  chromomethylase                                        157   2e-38    Brassica rapa
ref|XP_003615342.1|  DNA (cytosine-5)-methyltransferase                 150   3e-36    
gb|EMT24338.1|  DNA (cytosine-5)-methyltransferase 1                    148   2e-35    
gb|KFK30827.1|  hypothetical protein AALP_AA6G031000                    149   2e-35    
gb|ACX83573.1|  DNA chromomethylase                                     140   4e-33    Hieracium piloselloides
ref|XP_011025397.1|  PREDICTED: DNA (cytosine-5)-methyltransferas...    137   3e-32    
gb|EYU22416.1|  hypothetical protein MIMGU_mgv1a001955mg                132   4e-30    
gb|KFK28574.1|  chromomethylase 2                                       132   1e-29    
ref|XP_009364101.1|  PREDICTED: DNA (cytosine-5)-methyltransferas...    127   3e-28    
gb|AAA98912.1|  theoretical protein with similarity to Swiss-Prot...    124   9e-28    Arabidopsis thaliana [mouse-ear cress]
ref|XP_008346523.1|  PREDICTED: DNA (cytosine-5)-methyltransferas...    124   1e-27    
gb|AAC02661.1|  chromomethylase                                         115   5e-26    Arabidopsis thaliana [mouse-ear cress]
gb|AFV99137.1|  CMT-type cytosine DNA-methyltransferase 3c              116   1e-24    
gb|KDP46676.1|  hypothetical protein JCGZ_12200                         113   5e-24    
emb|CAS84142.1|  chromomethylase                                        110   4e-23    Nicotiana tomentosiformis
emb|CAN77849.1|  hypothetical protein VITISV_020833                     109   1e-22    Vitis vinifera
gb|AGT16212.1|  methyltransferase                                       109   2e-22    
gb|AET03084.2|  DNA (cytosine-5)-methyltransferase CMT3               99.4    9e-20    
emb|CAN77234.1|  hypothetical protein VITISV_010061                   95.1    1e-17    Vitis vinifera
ref|XP_003609231.1|  Cytosine-specific methyltransferase              94.4    1e-17    
ref|XP_003628607.1|  Cytosine-specific methyltransferase              86.3    2e-16    
ref|XP_004506519.1|  PREDICTED: DNA (cytosine-5)-methyltransferas...  76.3    1e-12    
gb|EMT31695.1|  DNA (cytosine-5)-methyltransferase 1                  78.6    2e-12    
gb|EPS58007.1|  chromomethylase                                       75.5    2e-11    
ref|NP_001280869.1|  DNA (cytosine-5)-methyltransferase CMT3-like     73.2    7e-11    
ref|XP_008361459.1|  PREDICTED: DNA (cytosine-5)-methyltransferas...  63.9    3e-09    
ref|XP_008361460.1|  PREDICTED: DNA (cytosine-5)-methyltransferas...  63.2    5e-09    
gb|KEH22438.1|  DNA (cytosine-5)-methyltransferase, putative          63.9    9e-09    
ref|XP_009359596.1|  PREDICTED: DNA (cytosine-5)-methyltransferas...  67.0    2e-08    
gb|AAM96952.1|  DNA cytosine-5-methyltransferase                      66.6    2e-08    Prunus persica
gb|AFV99138.1|  MET-type cytosine DNA-methyltransferase 1             66.6    2e-08    
ref|XP_009369802.1|  PREDICTED: DNA (cytosine-5)-methyltransferas...  66.2    3e-08    
ref|XP_008241935.1|  PREDICTED: DNA (cytosine-5)-methyltransferas...  65.9    4e-08    
ref|XP_007203206.1|  hypothetical protein PRUPE_ppa000190mg           65.5    5e-08    
ref|XP_007204772.1|  hypothetical protein PRUPE_ppa015623mg           63.9    1e-07    
ref|XP_008361333.1|  PREDICTED: LOW QUALITY PROTEIN: DNA (cytosin...  62.4    5e-07    
ref|XP_010274981.1|  PREDICTED: DNA (cytosine-5)-methyltransferas...  60.8    1e-06    
ref|XP_010274979.1|  PREDICTED: DNA (cytosine-5)-methyltransferas...  60.8    1e-06    
ref|XP_009364160.1|  PREDICTED: DNA (cytosine-5)-methyltransferas...  56.6    2e-06    
gb|EPS62932.1|  cytosine-specific methyltransferase                   60.1    2e-06    
ref|XP_006470462.1|  PREDICTED: LOW QUALITY PROTEIN: DNA (cytosin...  60.1    2e-06    
emb|CDP11566.1|  unnamed protein product                              60.1    3e-06    
ref|XP_010688470.1|  PREDICTED: DNA (cytosine-5)-methyltransferas...  59.7    3e-06    
ref|XP_006471008.1|  PREDICTED: DNA (cytosine-5)-methyltransferas...  59.3    3e-06    
ref|XP_010688471.1|  PREDICTED: DNA (cytosine-5)-methyltransferas...  59.7    3e-06    
gb|AAC39356.1|  Met2-type cytosine DNA-methyltransferase              59.3    5e-06    
gb|AAC49931.1|  cytosine-5 DNA methyltransferase                      58.9    5e-06    
gb|KCW54105.1|  hypothetical protein EUGRSUZ_I000871                  55.5    5e-06    
ref|XP_009398381.1|  PREDICTED: DNA (cytosine-5)-methyltransferas...  58.9    6e-06    
ref|XP_009398383.1|  PREDICTED: DNA (cytosine-5)-methyltransferas...  58.9    6e-06    
gb|KDP24228.1|  hypothetical protein JCGZ_25885                       58.5    7e-06    
gb|EMT20605.1|  DNA (cytosine-5)-methyltransferase 2                  57.8    7e-06    
gb|KHF99624.1|  DNA (cytosine-5)-methyltransferase 1B                 58.5    8e-06    
ref|XP_011092241.1|  PREDICTED: DNA (cytosine-5)-methyltransferas...  58.5    8e-06    
ref|XP_007152468.1|  hypothetical protein PHAVU_004G133200g           58.5    8e-06    
gb|KGN49566.1|  hypothetical protein Csa_5G002610                     58.5    9e-06    
gb|KCW54050.1|  hypothetical protein EUGRSUZ_I00036                   58.2    1e-05    
ref|XP_010027506.1|  PREDICTED: DNA (cytosine-5)-methyltransferas...  58.2    1e-05    
dbj|BAF36443.1|  DNA methyltransferase type 1                         57.8    1e-05    
dbj|BAA92852.1|  DNA (cytosine-5-)-methyltransferase                  57.8    1e-05    
ref|XP_009627548.1|  PREDICTED: DNA (cytosine-5)-methyltransferas...  57.8    1e-05    
gb|EMS53431.1|  DNA (cytosine-5)-methyltransferase 1                  57.0    2e-05    
gb|KHN30945.1|  DNA (cytosine-5)-methyltransferase 1                  57.4    2e-05    
ref|XP_008464733.1|  PREDICTED: DNA (cytosine-5)-methyltransferas...  57.0    2e-05    
gb|ACI31553.1|  MET1                                                  55.1    2e-05    
ref|XP_007361443.1|  S-adenosyl-L-methionine-dependent methyltran...  57.0    2e-05    
gb|EPS61234.1|  chromomethylase-like protein                          52.8    2e-05    
gb|ACQ91179.1|  Met1-type cytosine DNA-methyltransferase              57.0    2e-05    
gb|ACQ91178.1|  Met1-type cytosine DNA-methyltransferase              57.0    2e-05    
gb|ACX83569.1|  DNA methyltransferase                                 57.0    2e-05    
gb|KHN19261.1|  DNA (cytosine-5)-methyltransferase 1                  57.0    3e-05    
ref|XP_010549723.1|  PREDICTED: DNA (cytosine-5)-methyltransferas...  56.6    3e-05    
emb|CBI27717.3|  unnamed protein product                              56.6    3e-05    
ref|XP_002267284.3|  PREDICTED: DNA (cytosine-5)-methyltransferas...  56.6    3e-05    
ref|XP_003619753.1|  DNA (cytosine-5)-methyltransferase               56.2    4e-05    
emb|CBI27718.3|  unnamed protein product                              56.2    4e-05    
ref|XP_002267200.1|  PREDICTED: DNA (cytosine-5)-methyltransferas...  56.2    4e-05    
gb|AES75971.2|  DNA (cytosine-5)-methyltransferase                    56.2    4e-05    
ref|NP_001289530.1|  DNA (cytosine-5)-methyltransferase 1B-like       56.2    4e-05    
ref|XP_007048602.1|  DNA-methyltransferase family protein             56.2    4e-05    
ref|XP_010030294.1|  PREDICTED: DNA (cytosine-5)-methyltransferas...  55.8    4e-05    
ref|XP_010095630.1|  DNA (cytosine-5)-methyltransferase 1             56.2    4e-05    
ref|XP_008338533.1|  PREDICTED: uncharacterized protein LOC103401597  55.1    6e-05    
ref|XP_002863965.1|  hypothetical protein ARALYDRAFT_331330           55.5    8e-05    
gb|KFK37543.1|  dna methyltransferase 2                               55.1    9e-05    
emb|CDX89531.1|  BnaC04g35500D                                        54.7    1e-04    
emb|CDO97647.1|  unnamed protein product                              54.7    1e-04    
gb|ACX83570.1|  DNA methyltransferase                                 54.7    1e-04    
dbj|BAF34636.1|  DNA methyltransferase 1b                             54.7    1e-04    
emb|CDX85419.1|  BnaC07g27300D                                        54.7    1e-04    
sp|Q7Y1I7.1|DNM1A_ORYSJ  RecName: Full=DNA (cytosine-5)-methyltra...  54.7    1e-04    
ref|XP_009140404.1|  PREDICTED: LOW QUALITY PROTEIN: DNA (cytosin...  54.7    1e-04    
gb|EEC76339.1|  hypothetical protein OsI_13909                        54.7    1e-04    
emb|CDY25647.1|  BnaA04g13390D                                        54.7    1e-04    
ref|XP_004287724.1|  PREDICTED: DNA (cytosine-5)-methyltransferas...  54.7    1e-04    
gb|AAL77415.1|  putative cytosine-5 DNA methyltransferase             54.3    1e-04    
ref|XP_006847211.1|  hypothetical protein AMTR_s00017p00254260        54.3    1e-04    
gb|AAC39355.1|  Met1-type cytosine DNA-methyltransferase              54.3    2e-04    
ref|XP_006395090.1|  hypothetical protein EUTSA_v10003514mg           53.9    2e-04    
ref|XP_002518029.1|  DNA (cytosine-5)-methyltransferase, putative     53.9    2e-04    
gb|AAX22756.1|  DMT1                                                  53.9    2e-04    
gb|KEH33167.1|  cytosine-specific methyltransferase, putative         53.5    2e-04    
ref|XP_004159609.1|  PREDICTED: DNA (cytosine-5)-methyltransferas...  53.5    2e-04    
gb|KFK31662.1|  dna (cytosine-5)-methyltransferase                    53.9    2e-04    
dbj|BAF01962.1|  DNA (cytosine-5)-methyltransferase                   53.5    2e-04    
ref|XP_005832238.1|  hypothetical protein GUITHDRAFT_139172           52.8    3e-04    
ref|NP_001234748.1|  DNA (cytosine-5)-methyltransferase               53.5    3e-04    
ref|XP_002527854.1|  DNA (cytosine-5)-methyltransferase, putative     53.5    3e-04    
ref|NP_199727.1|  DNA (cytosine-5)-methyltransferase 1                53.5    3e-04    
ref|XP_006426373.1|  hypothetical protein CICLE_v10027585mg           53.5    3e-04    
gb|KEH37716.1|  DNA (cytosine-5)-methyltransferase                    53.5    3e-04    
ref|XP_004512642.1|  PREDICTED: DNA (cytosine-5)-methyltransferas...  53.5    3e-04    
gb|EYU33310.1|  hypothetical protein MIMGU_mgv1a0001781mg             53.1    3e-04    
emb|CDX86225.1|  BnaA06g29420D                                        53.1    4e-04    
ref|XP_002870372.1|  hypothetical protein ARALYDRAFT_355455           53.1    4e-04    
ref|XP_001758167.1|  predicted protein                                53.1    4e-04    
ref|NP_001275841.1|  DNA (cytosine-5)-methyltransferase 1-like        53.1    4e-04    
ref|NP_001028141.1|  DNA (cytosine-5)-methyltransferase 1             52.8    4e-04    
ref|XP_008807008.1|  PREDICTED: DNA (cytosine-5)-methyltransferas...  52.8    5e-04    
ref|XP_010450186.1|  PREDICTED: DNA (cytosine-5)-methyltransferas...  52.8    5e-04    
ref|XP_006395050.1|  hypothetical protein EUTSA_v10005683mg           52.8    5e-04    
ref|XP_006339355.1|  PREDICTED: DNA (cytosine-5)-methyltransferas...  52.8    5e-04    
ref|XP_010472459.1|  PREDICTED: DNA (cytosine-5)-methyltransferas...  52.4    6e-04    
ref|XP_008805951.1|  PREDICTED: DNA (cytosine-5)-methyltransferas...  52.4    6e-04    
ref|WP_015176744.1|  DNA-cytosine methyltransferase                   51.6    6e-04    
ref|XP_002459440.1|  hypothetical protein SORBIDRAFT_02g004680        52.4    6e-04    
ref|XP_010435242.1|  PREDICTED: DNA (cytosine-5)-methyltransferas...  52.4    6e-04    
ref|XP_010472460.1|  PREDICTED: DNA (cytosine-5)-methyltransferas...  52.4    7e-04    
ref|XP_004986184.1|  PREDICTED: DNA (cytosine-5)-methyltransferas...  52.4    7e-04    
ref|XP_007488939.1|  PREDICTED: DNA (cytosine-5)-methyltransferas...  52.4    7e-04    
ref|XP_010445976.1|  PREDICTED: DNA (cytosine-5)-methyltransferas...  52.0    7e-04    
ref|XP_010417708.1|  PREDICTED: DNA (cytosine-5)-methyltransferas...  52.4    7e-04    
ref|XP_010440260.1|  PREDICTED: DNA (cytosine-5)-methyltransferas...  52.0    7e-04    
ref|XP_010482195.1|  PREDICTED: DNA (cytosine-5)-methyltransferas...  52.0    8e-04    
ref|XP_010442374.1|  PREDICTED: DNA (cytosine-5)-methyltransferas...  52.0    8e-04    
ref|XP_010910589.1|  PREDICTED: LOW QUALITY PROTEIN: DNA (cytosin...  52.0    8e-04    
ref|XP_010429957.1|  PREDICTED: DNA (cytosine-5)-methyltransferas...  52.0    8e-04    
emb|CDY49442.1|  BnaA09g42250D                                        52.0    9e-04    
gb|EMS57761.1|  DNA (cytosine-5)-methyltransferase 1B                 52.0    9e-04    
ref|XP_009117317.1|  PREDICTED: DNA (cytosine-5)-methyltransferas...  52.0    9e-04    
ref|XP_003599650.1|  Cytosine-specific methyltransferase              48.9    9e-04    
emb|CDX76884.1|  BnaC08g34700D                                        52.0    0.001    
gb|EMT32721.1|  DNA (cytosine-5)-methyltransferase 1A                 52.0    0.001    
gb|EMT23445.1|  DNA (cytosine-5)-methyltransferase 1B                 52.0    0.001    
ref|XP_010228267.1|  PREDICTED: DNA (cytosine-5)-methyltransferas...  52.0    0.001    



>ref|XP_006361281.1| PREDICTED: DNA (cytosine-5)-methyltransferase CMT2-like [Solanum 
tuberosum]
Length=1086

 Score =   450 bits (1157),  Expect = 1e-144, Method: Compositional matrix adjust.
 Identities = 233/331 (70%), Positives = 271/331 (82%), Gaps = 4/331 (1%)
 Frame = -2

Query  1022  EEDEVILNVDCHYAQAKVLSFILNIGDCVYVKGEGEKKHVGRILEFFKTTEGEDYFRVQW  843
             EEDE+ILNV+CHYAQAKV  FI NIGDC +VKGEG+KKH+GRILEFFKTTEGEDYFRVQW
Sbjct  344   EEDEIILNVECHYAQAKVAGFIFNIGDCAFVKGEGKKKHIGRILEFFKTTEGEDYFRVQW  403

Query  842   FFRAEDTVMRDAAALHDKKRLFYSTLMNDNLLDCIISKVNVTEISPGLGLEVNNSPPSGF  663
             FFRAEDTV++ AA+ HD+KR+FYSTL NDNLLDCI+SKVNV E+   L L   + PP+ F
Sbjct  404   FFRAEDTVLQGAASFHDRKRVFYSTLENDNLLDCIVSKVNVVELPTRLDLNKKDVPPAHF  463

Query  662   YYDMEYCVDYSTFRNLPTVQSVNSWDSPSLIDASYKPITAYPVEHFKSCEPSKVELSLLD  483
             YYDMEYCVDYSTFR   T+ +V S  SPSL+DASYKPIT YP+E   SCEP KVELSLLD
Sbjct  464   YYDMEYCVDYSTFR---TLHNVKSSVSPSLVDASYKPITTYPLEVSPSCEPMKVELSLLD  520

Query  482   LYAGCGGMSTGLCLGAKLSGLNLVTKWAVDYQKSACDSLKFNHPETQVRNESVenflkll  303
             LYAGCGGMS GLCLG KLSG+NLVTKWAVD+  +ACDSLK NHP+T VRNE VENFL+LL
Sbjct  521   LYAGCGGMSMGLCLGTKLSGVNLVTKWAVDFNSAACDSLKLNHPQTHVRNEGVENFLELL  580

Query  302   keweklckEYG-SEPNAGSDDVLEGMEEGaddansladsddsdAEYEILRLVDICFGDPN  126
             K WEKL K YG S+    S+  L+  +EG ++ +S + S+ S  EYE+LRLVDIC+GDPN
Sbjct  581   KRWEKLIKSYGCSDIKTSSNGELDDRDEGENNDDSQSGSNASSGEYEVLRLVDICYGDPN  640

Query  125   DTGKPGIHFQVRWKGYGPSEDTWEPIDGLKS  33
             D GK G+HF+VRWKGY PSEDTWEPI  L++
Sbjct  641   DEGKSGLHFKVRWKGYSPSEDTWEPIANLEN  671



>ref|XP_010324482.1| PREDICTED: DNA (cytosine-5)-methyltransferase CMT2 [Solanum lycopersicum]
Length=1075

 Score =   448 bits (1152),  Expect = 6e-144, Method: Compositional matrix adjust.
 Identities = 233/331 (70%), Positives = 270/331 (82%), Gaps = 4/331 (1%)
 Frame = -2

Query  1022  EEDEVILNVDCHYAQAKVLSFILNIGDCVYVKGEGEKKHVGRILEFFKTTEGEDYFRVQW  843
             EEDE+ILNV+CHYAQAKV  FI NIGDC +VKGEG+KKH+GRILEFFKTTEGEDYFRVQW
Sbjct  333   EEDEIILNVECHYAQAKVAGFIFNIGDCAFVKGEGKKKHIGRILEFFKTTEGEDYFRVQW  392

Query  842   FFRAEDTVMRDAAALHDKKRLFYSTLMNDNLLDCIISKVNVTEISPGLGLEVNNSPPSGF  663
             FFRAEDTV++ AA+ HD KR+FYSTL NDNLLDCI+SKVNV E+     L   + PP+ F
Sbjct  393   FFRAEDTVLQGAASFHDPKRVFYSTLENDNLLDCIVSKVNVVELPTRHDLNKKDVPPAHF  452

Query  662   YYDMEYCVDYSTFRNLPTVQSVNSWDSPSLIDASYKPITAYPVEHFKSCEPSKVELSLLD  483
             YYDMEYCVDYSTFR   T+ +V S  SPSL+D SYKPIT YP+E   SCEP KVELSLLD
Sbjct  453   YYDMEYCVDYSTFR---TLHNVKSSVSPSLVDVSYKPITTYPLEVSPSCEPMKVELSLLD  509

Query  482   LYAGCGGMSTGLCLGAKLSGLNLVTKWAVDYQKSACDSLKFNHPETQVRNESVenflkll  303
             LYAGCGGMS GLCLG KLSGLNLVTKWAVD+ K+ACDSLK NHP+T VRNE VENFL+LL
Sbjct  510   LYAGCGGMSMGLCLGTKLSGLNLVTKWAVDFNKAACDSLKLNHPQTHVRNEGVENFLELL  569

Query  302   keweklckEYG-SEPNAGSDDVLEGMEEGaddansladsddsdAEYEILRLVDICFGDPN  126
             K WEKL K YG S+    S+  L+  +EG ++ +S + S+ S  EYE+LR VDIC+GDPN
Sbjct  570   KRWEKLIKSYGCSDIKTSSNIELDDRDEGENNDDSQSGSNASSGEYEVLRFVDICYGDPN  629

Query  125   DTGKPGIHFQVRWKGYGPSEDTWEPIDGLKS  33
             + GK G+HF+VRWKGYGPSEDTWEPI+ LK+
Sbjct  630   NDGKSGLHFKVRWKGYGPSEDTWEPIENLKN  660



>ref|XP_009625195.1| PREDICTED: DNA (cytosine-5)-methyltransferase CMT2, partial [Nicotiana 
tomentosiformis]
Length=773

 Score =   430 bits (1105),  Expect = 5e-140, Method: Compositional matrix adjust.
 Identities = 225/334 (67%), Positives = 260/334 (78%), Gaps = 4/334 (1%)
 Frame = -2

Query  1031  SADEEDEVILNVDCHYAQAKVLSFILNIGDCVYVKGEGEKKHVGRILEFFKTTEGEDYFR  852
             +A EEDE+I NV+CHYAQAKV  F  NIGDC YVKGEG K H+GRILEFFKT EGEDYFR
Sbjct  27    NAGEEDEIIFNVECHYAQAKVAGFTFNIGDCAYVKGEGRKNHIGRILEFFKTAEGEDYFR  86

Query  851   VQWFFRAEDTVMRDAAALHDKKRLFYSTLMNDNLLDCIISKVNVTEISPGLGLEVNNSPP  672
             VQWFFRAEDTV++ AA+ HD KR+FYSTL NDN LDCI+SKVNV E+    GL   + PP
Sbjct  87    VQWFFRAEDTVLKGAASFHDTKRIFYSTLENDNPLDCIVSKVNVVELPASNGLNTKDVPP  146

Query  671   SGFYYDMEYCVDYSTFRNLPTVQSVNSWDSPSLIDASYKPITAYPVEHFKSCEPSKVELS  492
             + FYYDMEYCVDYSTFR   T+ +V S   PSL D SYKPIT YP+E   SCEP   +LS
Sbjct  147   AHFYYDMEYCVDYSTFR---TLDNVKSLVIPSLADTSYKPITTYPLEVLPSCEPMTAKLS  203

Query  491   LLDLYAGCGGMSTGLCLGAKLSGLNLVTKWAVDYQKSACDSLKFNHPETQVRNESVenfl  312
             LLDLYAGCGGMS GLCLG KLSGL LVTKWAVD+ +SACDSLK NHP+T VRNE+VE+FL
Sbjct  204   LLDLYAGCGGMSMGLCLGTKLSGLKLVTKWAVDFNRSACDSLKLNHPQTHVRNEAVEDFL  263

Query  311   kllkeweklckEYG-SEPNAGSDDVLEGMEEGaddansladsddsdAEYEILRLVDICFG  135
             +LLK WEKL   YG S     S+  L+  +EG ++ N  A S  S  EYE+LRLVDIC+G
Sbjct  264   ELLKRWEKLINTYGCSNFKTSSNCELDDADEGENNDNFQAGSKASSGEYEVLRLVDICYG  323

Query  134   DPNDTGKPGIHFQVRWKGYGPSEDTWEPIDGLKS  33
             DPN+ GK G+HF+VRWKGYGPSEDTWEPI+ L++
Sbjct  324   DPNNKGKSGLHFKVRWKGYGPSEDTWEPIENLEN  357



>ref|XP_009785637.1| PREDICTED: DNA (cytosine-5)-methyltransferase CMT2-like, partial 
[Nicotiana sylvestris]
Length=764

 Score =   428 bits (1100),  Expect = 2e-139, Method: Compositional matrix adjust.
 Identities = 225/337 (67%), Positives = 265/337 (79%), Gaps = 4/337 (1%)
 Frame = -2

Query  1031  SADEEDEVILNVDCHYAQAKVLSFILNIGDCVYVKGEGEKKHVGRILEFFKTTEGEDYFR  852
             +A EED +ILNV+CHYAQAKV  F  NIGDC YVKGEG K H+GRILEFFKT+EGEDYFR
Sbjct  18    NAGEEDAIILNVECHYAQAKVAGFTFNIGDCAYVKGEGRKNHIGRILEFFKTSEGEDYFR  77

Query  851   VQWFFRAEDTVMRDAAALHDKKRLFYSTLMNDNLLDCIISKVNVTEISPGLGLEVNNSPP  672
             VQWFFRAEDTV++ AA+ HD KR+FYSTL NDN LDCI+SKVNV E     GL   + PP
Sbjct  78    VQWFFRAEDTVLKGAASFHDTKRIFYSTLENDNPLDCIVSKVNVVERPASNGLNTKDVPP  137

Query  671   SGFYYDMEYCVDYSTFRNLPTVQSVNSWDSPSLIDASYKPITAYPVEHFKSCEPSKVELS  492
             + FYYDMEYCVDYSTFR   T+ +V S   PSL++ASYKPIT YP+E   SCEP   +LS
Sbjct  138   AHFYYDMEYCVDYSTFR---TLDNVKSLVIPSLVEASYKPITTYPLEVLPSCEPMTAKLS  194

Query  491   LLDLYAGCGGMSTGLCLGAKLSGLNLVTKWAVDYQKSACDSLKFNHPETQVRNESVenfl  312
             LLDLYAGCGGMS GLCLGAKLSGL LVTKWAVD+ +SACDSLK NHP+T VRNE+VE+FL
Sbjct  195   LLDLYAGCGGMSMGLCLGAKLSGLKLVTKWAVDFNRSACDSLKLNHPQTHVRNEAVEDFL  254

Query  311   kllkeweklckEYG-SEPNAGSDDVLEGMEEGaddansladsddsdAEYEILRLVDICFG  135
             +LLK WEKL K YG S     S+  L+  +EG ++ N  A S  S  EYE+LRLVD+C+G
Sbjct  255   ELLKRWEKLIKTYGCSNFKTSSNCELDDADEGENNDNFQAGSKASSGEYEVLRLVDVCYG  314

Query  134   DPNDTGKPGIHFQVRWKGYGPSEDTWEPIDGLKSWKN  24
             DPN+ GK G+HF+VRWKGYG SEDTWEPI+ L++ ++
Sbjct  315   DPNNKGKSGLHFKVRWKGYGSSEDTWEPIENLENCQD  351



>emb|CDP11756.1| unnamed protein product [Coffea canephora]
Length=792

 Score =   388 bits (996),  Expect = 1e-123, Method: Compositional matrix adjust.
 Identities = 209/343 (61%), Positives = 260/343 (76%), Gaps = 11/343 (3%)
 Frame = -2

Query  1028  ADEEDEVILNVDCHYAQAKVLSFILNIGDCVYVKGEGEKKHVGRILEFFKTTEGEDYFRV  849
             A EEDE ILNVD HYAQA V   +L+IGDC Y+KGEG KKH+GRILEFF+TT+GEDYFRV
Sbjct  42    AGEEDETILNVDFHYAQANVDGCVLSIGDCAYIKGEGRKKHIGRILEFFRTTQGEDYFRV  101

Query  848   QWFFRAEDTVMRDAAALHDKKRLFYSTLMNDNLLDCIISKVNVTEISPGLGLEVNNSPPS  669
             QW+FR EDTV+++AA  HD+KR+FYST+MNDNLLDCI+SKV+V EI   +GLE +  PP+
Sbjct  102   QWYFRVEDTVIKEAATFHDEKRIFYSTMMNDNLLDCILSKVHVAEIPLAVGLEPDTIPPA  161

Query  668   GFYYDMEYCVDYSTFRNLPTVQSVNSWDSPSL--IDASYKPITAYPVEHFKSCEPSKVEL  495
              FYYDMEY V+YSTF NL T  S    DS SL  ++  + PITA  +E F    P K EL
Sbjct  162   DFYYDMEYSVEYSTFHNLQTDNSYKIDDSHSLQPVEGFHAPITATHLEVFSGSGPLKSEL  221

Query  494   SLLDLYAGCGGMSTGLCLGAKLSGLNLVTKWAVDYQKSACDSLKFNHPETQVRNESVenf  315
             +LLDLY+GCGGMSTGL +GAK+S +++VT+WAVD +KSACDSLK NHPETQVRNES E+F
Sbjct  222   ALLDLYSGCGGMSTGLGIGAKVSSIDVVTRWAVDLEKSACDSLKLNHPETQVRNESAEDF  281

Query  314   lkllkeweklckEY-----GSEPNAGSDDVLEGMEEGaddansladsddsdAEYEILRLV  150
             L+LLK W++LC+ Y      + P  G D+ +    EG  +  S   ++D D EYE+  LV
Sbjct  282   LELLKRWKQLCESYIFNDLKNPPEDGPDNQI----EGESNETSKLANEDPDGEYEVSCLV  337

Query  149   DICFGDPNDTGKPGIHFQVRWKGYGPSEDTWEPIDGLKSWKNR  21
             DIC+GDPN+TGK G+HF+VRWKGYGP EDTWEP +GL + + R
Sbjct  338   DICYGDPNETGKHGLHFKVRWKGYGPDEDTWEPFEGLSNCQER  380



>ref|XP_011092593.1| PREDICTED: DNA (cytosine-5)-methyltransferase CMT2 [Sesamum indicum]
Length=1352

 Score =   399 bits (1024),  Expect = 3e-123, Method: Compositional matrix adjust.
 Identities = 219/340 (64%), Positives = 259/340 (76%), Gaps = 6/340 (2%)
 Frame = -2

Query  1031  SADEEDEVILNVDCHYAQAKVLSFILNIGDCVYVKGEGEKKHVGRILEFFKTTEGEDYFR  852
             +A EEDE+ILNVDCHYAQAKV S +LNIGDCVYVKGEG+KKHVGRILEFFKT EGE+YFR
Sbjct  607   NAGEEDEIILNVDCHYAQAKVGSCVLNIGDCVYVKGEGKKKHVGRILEFFKTMEGEEYFR  666

Query  851   VQWFFRAEDTVMRDAAALHDKKRLFYSTLMNDNLLDCIISKVNVTEISPGLGLEVNNSPP  672
             VQWFFRAEDTV++DAA +HDK+RLFYSTL+NDN LDCIISKVNV ++ P L L+ N    
Sbjct  667   VQWFFRAEDTVLKDAALVHDKRRLFYSTLLNDNPLDCIISKVNVVKVPPALCLKSNPVAS  726

Query  671   SGFYYDMEYCVDYSTFRNLPTVQSVNS---WDSPSLIDASYKPITAYPVEHFKSCEPSKV  501
             + FYYDMEYCV+YSTFR L T  S  S     SP   D   KPIT  P+E   + E  K 
Sbjct  727   AAFYYDMEYCVEYSTFRTLRTEMSTESRSFLSSPKHSDD--KPITLTPLEVLPNDESLKP  784

Query  500   ELSLLDLYAGCGGMSTGLCLGAKLSGLNLVTKWAVDYQKSACDSLKFNHPETQVRNESVe  321
             EL+LLDLY+GCGGMSTGLC+GAKLS +NLVTKWAVDY  SAC+SLK NHPETQVRN S E
Sbjct  785   ELALLDLYSGCGGMSTGLCIGAKLSSVNLVTKWAVDYNSSACESLKLNHPETQVRNSSAE  844

Query  320   nflkllkeweklckEYGSEPNAGSDDVLEGMEEGaddansladsddsdAEYEILRLVDIC  141
             +FL+LL++WEKLCK Y  +        LE   E  +   +  D + S  EYE+  LVDIC
Sbjct  845   DFLELLRQWEKLCKLYVCDLERTLKCELESPSEA-EGYATQLDGEVSSGEYEVSCLVDIC  903

Query  140   FGDPNDTGKPGIHFQVRWKGYGPSEDTWEPIDGLKSWKNR  21
             +GDP+D+GK G+HF+VRWKGYGP +DTWE I+GL + + R
Sbjct  904   YGDPSDSGKCGLHFKVRWKGYGPDDDTWESIEGLSNCQER  943



>gb|EPS61564.1| hypothetical protein M569_13232, partial [Genlisea aurea]
Length=383

 Score =   364 bits (935),  Expect = 1e-119, Method: Compositional matrix adjust.
 Identities = 199/336 (59%), Positives = 249/336 (74%), Gaps = 18/336 (5%)
 Frame = -2

Query  1025  DEEDEVILNVDCHYAQAKVLSFILNIGDCVYVKGEGEKKHVGRILEFFKTTEGEDYFRVQ  846
             DEEDE+ILNVDCHYAQAKV S+ILNIGDCV VKGE  K+H+GRILEFFKT EGEDYFRVQ
Sbjct  48    DEEDEIILNVDCHYAQAKVGSWILNIGDCVCVKGEETKEHIGRILEFFKTMEGEDYFRVQ  107

Query  845   WFFRAEDTVMRDAAALHDKKRLFYSTLMNDNLLDCIISKVNVTEISPGLGLEVNNSPPSG  666
             WFFRAEDTV++DAA+ HD++RLFYSTL NDNLL CIISKV V ++ P L L+     P+ 
Sbjct  108   WFFRAEDTVLKDAASSHDERRLFYSTLTNDNLLGCIISKVEVVKLPPSLQLKPKLVHPAA  167

Query  665   FYYDMEYCVDYSTFRNLPTVQSVNSWDSPSLIDASYKPITAYPVEHFKSCEPSKVELSLL  486
             +YYDMEYCVDYST + L     +N+  S S       P+   P  + +S E SK EL LL
Sbjct  168   YYYDMEYCVDYSTHQLL-----LNAEHSVS------PPLNVLP-RYGESLESSKQELWLL  215

Query  485   DLYAGCGGMSTGLCLGAKLSGLNLVTKWAVDYQKSACDSLKFNHPETQVRNESVenflkl  306
             DLY+GCGGMSTGLC+GAK+SG+NLVTKWAVD   SAC+SL+ NHPETQVRNES E+FL+L
Sbjct  216   DLYSGCGGMSTGLCIGAKVSGINLVTKWAVDQNSSACNSLRMNHPETQVRNESAEDFLEL  275

Query  305   lke-weklckEYGSEPNAGSDDVLEGMEEGaddansladsddsdAEYEILRLVDICFGDP  129
             +K+  +   ++Y ++    S    EG+++  +   + ++ +    EYE+LRLVDIC+GDP
Sbjct  276   IKQWKKLSEQQYITDVENES----EGLQKA-EHHPTKSEPNKPTDEYEVLRLVDICYGDP  330

Query  128   NDTGKPGIHFQVRWKGYGPSEDTWEPIDGLKSWKNR  21
              + G   +HFQVRWKGY PSEDTWEPI  L + + +
Sbjct  331   CNNGSRSLHFQVRWKGYSPSEDTWEPIKNLSNCREK  366



>ref|XP_008238301.1| PREDICTED: DNA (cytosine-5)-methyltransferase CMT2 [Prunus mume]
Length=752

 Score =   368 bits (945),  Expect = 2e-116, Method: Compositional matrix adjust.
 Identities = 196/336 (58%), Positives = 252/336 (75%), Gaps = 7/336 (2%)
 Frame = -2

Query  1034  CSADEEDEVILNVDCHYAQAKVLSFILNIGDCVYVKGEGEKKHVGRILEFFKTTEGEDYF  855
             CS DEEDE+ILNV+CH++QAK+ + I ++GDC Y+KG+G KKHVGRILEFFKTT+GE+YF
Sbjct  4     CSEDEEDEIILNVECHFSQAKIGNCIFSLGDCAYIKGDGGKKHVGRILEFFKTTDGENYF  63

Query  854   RVQWFFRAEDTVMRDAAALHDKKRLFYSTLMNDNLLDCIISKVNVTEISPGLGLEVNNSP  675
             RVQWF++ EDTV++D   +HDK+RLFYST+MNDNL+DCI+SKVNV  +SP +GL+ N+  
Sbjct  64    RVQWFYKVEDTVIKDVGDVHDKRRLFYSTIMNDNLIDCIVSKVNVKHVSPRVGLKGNSIL  123

Query  674   PSGFYYDMEYCVDYSTFRNLPTVQSVNSWDSPSL--IDASYKPITAYPVEHFKSCEPSKV  501
              S FYYDMEYCVDYSTFR+L T  S+ + + P+   I+A     TA  +E+  S E    
Sbjct  124   SSDFYYDMEYCVDYSTFRSLITDNSLKNQNLPAYNSIEAVSILSTANLLENMPSSETYNA  183

Query  500   ELSLLDLYAGCGGMSTGLCLGAKLSGLNLVTKWAVDYQKSACDSLKFNHPETQVRNESVe  321
             EL++LDLY GCGGMSTGLCLGAKLS +NL+T+WA+D  KSAC+SLK NHPETQVRNE+ E
Sbjct  184   ELAVLDLYCGCGGMSTGLCLGAKLSCVNLLTRWALDSDKSACESLKLNHPETQVRNEAAE  243

Query  320   nflkllkeweklckEYGSEPNAGSDDVLEGMEEGaddansladsddsdAEYEILRLVDIC  141
             +FL+LLKEWEKLC+ Y       +  +                ++ +  EYE+ R+VDIC
Sbjct  244   DFLELLKEWEKLCRRYTVNDVERTHPL-----RSKTSKTPKNSNEIATDEYEVSRIVDIC  298

Query  140   FGDPNDTGKPGIHFQVRWKGYGPSEDTWEPIDGLKS  33
             +GDPN TGK G++F+V WKGY  SEDTWEPI GL +
Sbjct  299   YGDPNKTGKHGVNFKVHWKGYSSSEDTWEPIGGLSN  334



>ref|XP_010665035.1| PREDICTED: DNA (cytosine-5)-methyltransferase CMT2-like isoform 
X2 [Vitis vinifera]
Length=1430

 Score =   380 bits (976),  Expect = 4e-116, Method: Compositional matrix adjust.
 Identities = 202/335 (60%), Positives = 252/335 (75%), Gaps = 9/335 (3%)
 Frame = -2

Query  1025  DEEDEVILNVDCHYAQAKVLSFILNIGDCVYVKGEGEKKHVGRILEFFKTTEGEDYFRVQ  846
             D E+E++ NV+CHY QAK+   I N+GDC ++KGEGE+KHVGRILEFFKTTEGEDYFRVQ
Sbjct  691   DNEEEIVTNVECHYTQAKLDGTIFNLGDCAHIKGEGEQKHVGRILEFFKTTEGEDYFRVQ  750

Query  845   WFFRAEDTVMRDAAALHDKKRLFYSTLMNDNLLDCIISKVNVTEISPGLGLEVNNSPPSG  666
             WF+RAEDTVM++ AA HDKKR+F ST+MNDN LDCIISKVNV E++P + L++++ PP  
Sbjct  751   WFYRAEDTVMKEEAASHDKKRIFCSTIMNDNSLDCIISKVNVLELTPRVSLKLDSIPPFD  810

Query  665   FYYDMEYCVDYSTFRNLPTVQSVNSWD--SPSLIDASYKPITAYPVEHFKSCEPSKVELS  492
             +YYDM+Y V+YSTF  L +  SV  +D  SP+ I+           E    C+P K EL+
Sbjct  811   YYYDMKYNVEYSTFHTLLSDNSVKGYDLVSPNCIETPLSVANTTFPEDMDGCKPDKAELA  870

Query  491   LLDLYAGCGGMSTGLCLGAKLSGLNLVTKWAVDYQKSACDSLKFNHPETQVRNESVenfl  312
             LLDLY+GCGGMSTGLCLGAKLS +NLVTKWA+D+ KSAC+SLK NHPETQVRNE+ E+FL
Sbjct  871   LLDLYSGCGGMSTGLCLGAKLSCVNLVTKWALDFDKSACESLKLNHPETQVRNETAEDFL  930

Query  311   kllkeweklckEYG----SEPNAGSDDVLEGMEEGaddansladsddsdAEYEILRLVDI  144
              LLKEWE LC++Y        +    +VL   +      NS  D   +  E EIL+LVDI
Sbjct  931   DLLKEWEMLCEQYALNLVERKSQSRSNVLRTSKSN---INSPHDIKVATDELEILKLVDI  987

Query  143   CFGDPNDTGKPGIHFQVRWKGYGPSEDTWEPIDGL  39
             C+GDP++TGK G+ F+VRWKGYGPSEDTWEPI+GL
Sbjct  988   CYGDPSETGKRGLKFKVRWKGYGPSEDTWEPIEGL  1022



>ref|XP_010665031.1| PREDICTED: DNA (cytosine-5)-methyltransferase CMT2-like isoform 
X1 [Vitis vinifera]
Length=1432

 Score =   380 bits (975),  Expect = 5e-116, Method: Compositional matrix adjust.
 Identities = 202/335 (60%), Positives = 252/335 (75%), Gaps = 9/335 (3%)
 Frame = -2

Query  1025  DEEDEVILNVDCHYAQAKVLSFILNIGDCVYVKGEGEKKHVGRILEFFKTTEGEDYFRVQ  846
             D E+E++ NV+CHY QAK+   I N+GDC ++KGEGE+KHVGRILEFFKTTEGEDYFRVQ
Sbjct  693   DNEEEIVTNVECHYTQAKLDGTIFNLGDCAHIKGEGEQKHVGRILEFFKTTEGEDYFRVQ  752

Query  845   WFFRAEDTVMRDAAALHDKKRLFYSTLMNDNLLDCIISKVNVTEISPGLGLEVNNSPPSG  666
             WF+RAEDTVM++ AA HDKKR+F ST+MNDN LDCIISKVNV E++P + L++++ PP  
Sbjct  753   WFYRAEDTVMKEEAASHDKKRIFCSTIMNDNSLDCIISKVNVLELTPRVSLKLDSIPPFD  812

Query  665   FYYDMEYCVDYSTFRNLPTVQSVNSWD--SPSLIDASYKPITAYPVEHFKSCEPSKVELS  492
             +YYDM+Y V+YSTF  L +  SV  +D  SP+ I+           E    C+P K EL+
Sbjct  813   YYYDMKYNVEYSTFHTLLSDNSVKGYDLVSPNCIETPLSVANTTFPEDMDGCKPDKAELA  872

Query  491   LLDLYAGCGGMSTGLCLGAKLSGLNLVTKWAVDYQKSACDSLKFNHPETQVRNESVenfl  312
             LLDLY+GCGGMSTGLCLGAKLS +NLVTKWA+D+ KSAC+SLK NHPETQVRNE+ E+FL
Sbjct  873   LLDLYSGCGGMSTGLCLGAKLSCVNLVTKWALDFDKSACESLKLNHPETQVRNETAEDFL  932

Query  311   kllkeweklckEYG----SEPNAGSDDVLEGMEEGaddansladsddsdAEYEILRLVDI  144
              LLKEWE LC++Y        +    +VL   +      NS  D   +  E EIL+LVDI
Sbjct  933   DLLKEWEMLCEQYALNLVERKSQSRSNVLRTSKSN---INSPHDIKVATDELEILKLVDI  989

Query  143   CFGDPNDTGKPGIHFQVRWKGYGPSEDTWEPIDGL  39
             C+GDP++TGK G+ F+VRWKGYGPSEDTWEPI+GL
Sbjct  990   CYGDPSETGKRGLKFKVRWKGYGPSEDTWEPIEGL  1024



>ref|XP_009373520.1| PREDICTED: DNA (cytosine-5)-methyltransferase CMT2-like [Pyrus 
x bretschneideri]
Length=1384

 Score =   369 bits (947),  Expect = 3e-112, Method: Compositional matrix adjust.
 Identities = 196/332 (59%), Positives = 250/332 (75%), Gaps = 9/332 (3%)
 Frame = -2

Query  1025  DEEDEVILNVDCHYAQAKVLSFILNIGDCVYVKGEGEKKHVGRILEFFKTTEGEDYFRVQ  846
             DEEDE+IL+V+CH++QAK+   I ++GDC Y++G+  +KHVGRI+EFFKT +GE YFRVQ
Sbjct  582   DEEDEIILDVECHFSQAKIGDCIFDLGDCAYIEGDEGQKHVGRIIEFFKTADGEKYFRVQ  641

Query  845   WFFRAEDTVMRDAAALHDKKRLFYSTLMNDNLLDCIISKVNVTEISPGLGLEVNNSPPSG  666
             WF++ EDTV+++A   HDK+RLFYST+MNDNL+DCIISKVNVT ISP +GL+VN+  PS 
Sbjct  642   WFYKVEDTVIKEAGTSHDKRRLFYSTVMNDNLIDCIISKVNVTHISPKVGLKVNSISPSD  701

Query  665   FYYDMEYCVDYSTFRNLPTVQSVNSWDSPSL--IDASYKPITAYPVEHFKSCEPSKVELS  492
             FYYDMEYCVDYSTFR+  +  SV S + PS   I+A     T+  +E+  S E  K EL+
Sbjct  702   FYYDMEYCVDYSTFRSFISDNSVKSHNMPSCNSIEAVGTLSTSNLLENMPSSETYKAELA  761

Query  491   LLDLYAGCGGMSTGLCLGAKLSGLNLVTKWAVDYQKSACDSLKFNHPETQVRNESVenfl  312
             LLDL+ GCGGMSTGL  GAKLS +NLVTKWA+D  KSAC+SLK NHPETQVRNE+ E+FL
Sbjct  762   LLDLFCGCGGMSTGLSFGAKLSSVNLVTKWALDSDKSACESLKLNHPETQVRNETAEDFL  821

Query  311   kllkeweklckEYGSEPNAGSDDVLEGME-EGaddansladsddsdAEYEILRLVDICFG  135
             +LLKEWEKLC+ +       ++DV           +     ++    EYE+ R+VD+CFG
Sbjct  822   QLLKEWEKLCRRH------KANDVERTHPLRSKTSSVPKNGNEVGTGEYEVSRIVDVCFG  875

Query  134   DPNDTGKPGIHFQVRWKGYGPSEDTWEPIDGL  39
             DPN TGK G++F+V WKGYG SEDTWEPI+GL
Sbjct  876   DPNKTGKHGVNFKVHWKGYGSSEDTWEPIEGL  907



>ref|XP_007210636.1| hypothetical protein PRUPE_ppa019831mg, partial [Prunus persica]
 gb|EMJ11835.1| hypothetical protein PRUPE_ppa019831mg, partial [Prunus persica]
Length=998

 Score =   358 bits (918),  Expect = 3e-110, Method: Compositional matrix adjust.
 Identities = 192/330 (58%), Positives = 243/330 (74%), Gaps = 22/330 (7%)
 Frame = -2

Query  1025  DEEDEVILNVDCHYAQAKVLSFILNIGDCVYVKGEGEKKHVGRILEFFKTTEGEDYFRVQ  846
             DEEDE+ILNV+CH++QAK+ + I ++GDC Y+KG+G KKHVGRILEFFKTT+G++YFRVQ
Sbjct  284   DEEDEIILNVECHFSQAKIGNCIFSLGDCAYIKGDGGKKHVGRILEFFKTTDGKNYFRVQ  343

Query  845   WFFRAEDTVMRDAAALHDKKRLFYSTLMNDNLLDCIISKVNVTEISPGLGLEVNNSPPSG  666
             WF++ EDTV++D   +HDK+RLFYST+MNDNL+DCI+SKVNV  +SP +GL+ N+   S 
Sbjct  344   WFYKVEDTVIKDVGDVHDKRRLFYSTIMNDNLIDCIVSKVNVKHVSPRVGLKGNSILSSD  403

Query  665   FYYDMEYCVDYSTFRNLPTVQSVNSWDSPSLIDASYKPITAYPVEHFKSCEPSKVELSLL  486
             FYYDMEYCVDYSTFR+L TV  ++               T   +E+  S E    EL++L
Sbjct  404   FYYDMEYCVDYSTFRSLITVSILS---------------TVNLLENMPSSETYNAELAVL  448

Query  485   DLYAGCGGMSTGLCLGAKLSGLNLVTKWAVDYQKSACDSLKFNHPETQVRNESVenflkl  306
             DLY GCGGMSTGLCLGAKLS +NLVT+WA+D  KSAC+SLK NHPETQVRNE+ E+FL+L
Sbjct  449   DLYCGCGGMSTGLCLGAKLSCVNLVTRWALDSDKSACESLKLNHPETQVRNEAAEDFLEL  508

Query  305   lkeweklckEYGSEPNAGSDDVLEGME-EGaddansladsddsdAEYEILRLVDICFGDP  129
             LKEWEKLC+ Y        +DV                 ++ +  EYE+ R+VDIC+GDP
Sbjct  509   LKEWEKLCRRY------TVNDVERTYPLRSKTSKIPKNSNEIATDEYEVSRIVDICYGDP  562

Query  128   NDTGKPGIHFQVRWKGYGPSEDTWEPIDGL  39
             N TGK G++F+V WKGY  SEDTWEPI GL
Sbjct  563   NKTGKHGVNFKVHWKGYSSSEDTWEPIGGL  592



>ref|XP_004301642.1| PREDICTED: DNA (cytosine-5)-methyltransferase CMT2-like [Fragaria 
vesca subsp. vesca]
Length=1112

 Score =   357 bits (916),  Expect = 3e-109, Method: Compositional matrix adjust.
 Identities = 191/335 (57%), Positives = 246/335 (73%), Gaps = 10/335 (3%)
 Frame = -2

Query  1025  DEEDEVILNVDCHYAQAKVLSFILNIGDCVYVKGEGEKKHVGRILEFFKTTEGEDYFRVQ  846
             DEEDE++LNV+CH+AQAK+ + I ++GDCVYV+G   KK VGRILEFF+TT+GE+YFRVQ
Sbjct  384   DEEDEIVLNVECHFAQAKIGNCIFSLGDCVYVQGNEGKKDVGRILEFFRTTDGENYFRVQ  443

Query  845   WFFRAEDTVMRDAAALHDKKRLFYSTLMNDNLLDCIISKVNVTEISPGLGLEVNNSPPSG  666
             WF+R EDTV+++  + HDK+RLFYST+MNDNL+DCIISKV+VT+ISP +GL+V +   S 
Sbjct  444   WFYRVEDTVIKEVGSSHDKRRLFYSTIMNDNLIDCIISKVDVTQISPRVGLKVKSILSSD  503

Query  665   FYYDMEYCVDYSTFRNLPTVQSVNSWDSPSLIDASYKPITAYPVEHFKSCEPSKVELSLL  486
             FYYDMEYC+DYSTFR +    ++N    P+L        TA  + +  SC+    E SLL
Sbjct  504   FYYDMEYCIDYSTFRTMVPGNNLNKM-VPTL-------RTAKSLGNSPSCDTCNAEFSLL  555

Query  485   DLYAGCGGMSTGLCLGAKLSGLNLVTKWAVDYQKSACDSLKFNHPETQVRNESVenflkl  306
             DLY+GCGGMSTGLCLG KLS +NL TKWA+D  KSAC+SLK NHPET VRNE+ E+FL+L
Sbjct  556   DLYSGCGGMSTGLCLGTKLSSVNLATKWALDSDKSACESLKLNHPETHVRNEAAEDFLEL  615

Query  305   lkeweklckEYGSEPNAGSDDVLEGMEEGaddansladsddsdAEYEILRLVDICFGDPN  126
             LKEWEKLCK+Y  E +          E          D + +  E+E+ R++DIC+GDPN
Sbjct  616   LKEWEKLCKQY--EVDNAETTTRSRSETPETSRVPKHDDEITTGEFEVSRIIDICYGDPN  673

Query  125   DTGKPGIHFQVRWKGYGPSEDTWEPIDGLKSWKNR  21
              +GK G++F++ WKGYG S+DTWEPI GL   K R
Sbjct  674   KSGKRGVNFKLHWKGYGSSDDTWEPIGGLSKCKER  708



>ref|XP_007040779.1| DNA-methyltransferase CMT2 [Theobroma cacao]
 gb|EOY25280.1| DNA-methyltransferase CMT2 [Theobroma cacao]
Length=1427

 Score =   357 bits (915),  Expect = 9e-108, Method: Compositional matrix adjust.
 Identities = 189/329 (57%), Positives = 242/329 (74%), Gaps = 4/329 (1%)
 Frame = -2

Query  1025  DEEDEVILNVDCHYAQAKVLSFILNIGDCVYVKGEGEKKHVGRILEFFKTTEGEDYFRVQ  846
             D+ED+++ NV+CHYAQA++    +N+GDCVY+KGE  K+H+GRILEFFKTT+GE+YFRVQ
Sbjct  676   DDEDKIVWNVECHYAQAEIDGCAINLGDCVYIKGEEAKEHIGRILEFFKTTDGENYFRVQ  735

Query  845   WFFRAEDTVMRDAAALHDKKRLFYSTLMNDNLLDCIISKVNVTEISPGLGLEVNNSPPSG  666
             WF+RAEDTV++   A HDK+RLFYST+MNDN +DCI+SKV+VT+ SP LGL++N+ P S 
Sbjct  736   WFYRAEDTVLKQETAFHDKRRLFYSTVMNDNPIDCIVSKVSVTQRSPKLGLKLNSIPQSD  795

Query  665   FYYDMEYCVDYSTFRNLPTVQSVNSWDSPSLIDASYKPITAYPVEHFKSCEPSKVELSLL  486
             +Y+DMEYCV+YSTFR LP+  S  S++S +     +         +  SC   K EL+LL
Sbjct  796   YYFDMEYCVEYSTFRTLPSDDSFKSYNSSNCCKGIFPTTPTAFSANIPSCGTHKAELALL  855

Query  485   DLYAGCGGMSTGLCLGAKLSGLNLVTKWAVDYQKSACDSLKFNHPETQVRNESVenflkl  306
             DLY+GCGGMS GLCLGAK S ++LVTKWAVD  KSAC SLK NHPET VRNE+ ++FL+L
Sbjct  856   DLYSGCGGMSMGLCLGAKASCIDLVTKWAVDSDKSACKSLKLNHPETHVRNEAADDFLQL  915

Query  305   lkeweklckEYGSEPNAGSDDVLEGMEEGaddansladsddsdAEYEILRLVDICFGDPN  126
             LKEWEKLCK Y  E NAG              A     +  +D E E+  LVDIC+GDP 
Sbjct  916   LKEWEKLCKRYAVE-NAGRR---YSSRSTTSQAAGNDANSPNDGELEVSSLVDICYGDPC  971

Query  125   DTGKPGIHFQVRWKGYGPSEDTWEPIDGL  39
              TGK  ++F+V+W+GY  SEDTWEPI+GL
Sbjct  972   KTGKHSLYFKVQWRGYSASEDTWEPIEGL  1000



>gb|KGN55702.1| hypothetical protein Csa_3G006640 [Cucumis sativus]
Length=1239

 Score =   355 bits (910),  Expect = 1e-107, Method: Compositional matrix adjust.
 Identities = 184/337 (55%), Positives = 243/337 (72%), Gaps = 9/337 (3%)
 Frame = -2

Query  1031  SADEEDEVILNVDCHYAQAKVLSFILNIGDCVYVKGEGEKKHVGRILEFFKTTEGEDYFR  852
             S D+ED +++NVDCHY QA + + + ++GDCVY+KGEGEK HVG I+EFFKTT+G++YFR
Sbjct  489   SDDDEDMIVVNVDCHYTQANIGNTVFSLGDCVYIKGEGEKNHVGTIIEFFKTTDGDNYFR  548

Query  851   VQWFFRAEDTVMRDAAALHDKKRLFYSTLMNDNLLDCIISKVNVTEISPGLGLEVNNSPP  672
              QWF+R EDTV+++  A HD +RLFYST+MNDN LDCI+SKVN+  + P +G + N++  
Sbjct  549   GQWFYRVEDTVIQEEGAFHDPRRLFYSTVMNDNPLDCIVSKVNIKRVKPRVGQKSNSASS  608

Query  671   SGFYYDMEYCVDYSTFRNLPTVQSVNSWDSPSLIDASYKPITAYPVEHFKSCE------P  510
               FYYDMEYCV+YSTFR L   +S+ + D+PS +D +  P       H  S        P
Sbjct  609   YDFYYDMEYCVEYSTFRTLKNDESLKNVDTPSNLDKA-APTNCIDTPHVTSTSNTFENMP  667

Query  509   SKVELSLLDLYAGCGGMSTGLCLGAKLSGLNLVTKWAVDYQKSACDSLKFNHPETQVRNE  330
              K EL LLDL++GCGGMSTGLCLGAKLS ++L+++WAVD   SAC+SL+ NHPET VRNE
Sbjct  668   KKAELELLDLFSGCGGMSTGLCLGAKLSSIDLISRWAVDSHMSACESLRLNHPETHVRNE  727

Query  329   SVenflkllkeweklckEYGSEPNAGSDDVLEGMEEGaddansladsddsdAEYEILRLV  150
             + E+FL LLKEWEKLC+ Y +  + GS  +     +     +S  + +   +E+E+  LV
Sbjct  728   TAEDFLDLLKEWEKLCRRYKANESEGSHQLRSKAND--YLTSSDDEDEFPTSEFEVSSLV  785

Query  149   DICFGDPNDTGKPGIHFQVRWKGYGPSEDTWEPIDGL  39
             DIC+GDP  TGK G+ F VRWKGYGPSEDTWEPI+GL
Sbjct  786   DICYGDPTRTGKRGLMFLVRWKGYGPSEDTWEPIEGL  822



>ref|XP_011075808.1| PREDICTED: DNA (cytosine-5)-methyltransferase CMT2-like isoform 
X2 [Sesamum indicum]
Length=907

 Score =   340 bits (873),  Expect = 2e-104, Method: Compositional matrix adjust.
 Identities = 182/351 (52%), Positives = 244/351 (70%), Gaps = 16/351 (5%)
 Frame = -2

Query  1025  DEEDEVILNVDCHYAQAKVLSFILNIGDCVYVKG-EGEKKHVGRILEFFKTTEGEDYFRV  849
             D+++E++LN+ CHY+QA++L  + ++GDC YVKG +G   ++G+ILEFF+TT+GE+YFRV
Sbjct  156   DDDEELVLNIKCHYSQAEILKTVFDLGDCAYVKGPKGGSNYIGKILEFFETTDGEEYFRV  215

Query  848   QWFFRAEDTVMRDAAALHDKKRLFYSTLMNDNLLDCIISKVNVTEISPGLGLEVNNSPPS  669
             QWFFRAEDTV++D    HDKKRLFYSTLMNDNLLDCI+SKV V +I+P +  +  + PP 
Sbjct  216   QWFFRAEDTVIKDDGRSHDKKRLFYSTLMNDNLLDCIVSKVKVVQIAPNVNFKEKSIPPC  275

Query  668   GFYYDMEYCVDYSTFRNLPT-VQSVNSWDSPSLIDASYKPI--------TAYPVEHFKSC  516
              FY+DM+Y VDYSTF  + T   S+ S  SP ++ A  K +        TA        C
Sbjct  276   DFYFDMKYSVDYSTFSVIITDDSSLTSLTSPPMMSAKKKDMSCKTGRKCTADGASSNDVC  335

Query  515   EPSKVELSLLDLYAGCGGMSTGLCLGAKLSGLNLVTKWAVDYQKSACDSLKFNHPETQVR  336
             EP   EL+LLD+Y+GCGGMSTGLCLG K  G++LVT+WAVD  K+AC+SLK NHPETQ+R
Sbjct  336   EP---ELALLDMYSGCGGMSTGLCLGTKACGVDLVTRWAVDIDKAACESLKLNHPETQIR  392

Query  335   NESVenflkllkeweklckEYGSEPNAGSDDVLEGMEEGaddansladsddsdAEYEILR  156
             NES E+ L LLKEW+ +CK YGS         + G  +   +         +  EYE+ +
Sbjct  393   NESAEDLLDLLKEWDCMCKRYGSHEGKELRPRIIGETD---EVKRSKMDHKNSDEYEVEK  449

Query  155   LVDICFGDPNDTGKPGIHFQVRWKGYGPSEDTWEPIDGLKSWKNRQGWFTI  3
             LVDIC+GDP + GK G+ F+VRW GYGPS+DTWEPI+ L+  ++R   F +
Sbjct  450   LVDICYGDPTEMGKRGLKFKVRWVGYGPSDDTWEPIESLRKCQDRIRDFIL  500



>ref|XP_010662142.1| PREDICTED: DNA (cytosine-5)-methyltransferase CMT2-like isoform 
X3 [Vitis vinifera]
Length=731

 Score =   336 bits (862),  Expect = 2e-104, Method: Compositional matrix adjust.
 Identities = 185/340 (54%), Positives = 243/340 (71%), Gaps = 20/340 (6%)
 Frame = -2

Query  1025  DEEDEVILNVDCHYAQAKVLSFILNIGDCVYVKGE-GEKKHVGRILEFFKTTEGEDYFRV  849
             DEEDE++L+V CHY+QA++   I N+GDC YVKG+ G + ++GRILEFFKT + EDYFRV
Sbjct  144   DEEDELVLDVKCHYSQAEIEKCIFNLGDCAYVKGKKGGRNYIGRILEFFKTMDDEDYFRV  203

Query  848   QWFFRAEDTVMRDAAALHDKKRLFYSTLMNDNLLDCIISKVNVTEISPGLGLEVNNSPPS  669
             QWFFR EDTVM +  A H+KKRLFYS L+NDNLLDCI+SKVN+ +I+P + L+  +  P 
Sbjct  204   QWFFRPEDTVMEEEGAFHEKKRLFYSNLVNDNLLDCIVSKVNIIQITPSVNLKSKSILPC  263

Query  668   GFYYDMEYCVDYSTFRNLPTVQSVNSWDSPSL-IDASYKPITAYPVE----HFKSCEPSK  504
              FYYDM+Y +DYSTF    T++  NS D  +L   A  K +    ++       S +P K
Sbjct  264   DFYYDMKYLIDYSTF---CTMEVDNSADRTNLSTSACLKTVHMNGIKPEFNRMSSHKPYK  320

Query  503   VELSLLDLYAGCGGMSTGLCLGAKLSGLNLVTKWAVDYQKSACDSLKFNHPETQVRNESV  324
              EL+LLD+Y+GCGGMSTGLCLGAKLSG++LVT+WA+D  KSAC+SLK NHPETQ+RNES 
Sbjct  321   PELALLDIYSGCGGMSTGLCLGAKLSGVDLVTRWALDINKSACESLKLNHPETQIRNESA  380

Query  323   enflkllkeweklckEYGSEPNAGSDDVLEGMEEGaddansladsdds-----dAEYEIL  159
             E+FL LLKEW+KLCK Y  +      DV E ++  +    +   +  +       E+E+ 
Sbjct  381   EDFLDLLKEWDKLCKRYVVK------DVQESLKVNSRVLRAAKVNSKTGNKSPSGEFEVA  434

Query  158   RLVDICFGDPNDTGKPGIHFQVRWKGYGPSEDTWEPIDGL  39
              L+DIC+GDP ++GK G+ FQ RW G+GPSEDTWEPI+GL
Sbjct  435   SLIDICYGDPTNSGKHGLKFQARWAGHGPSEDTWEPIEGL  474



>ref|XP_004146191.1| PREDICTED: DNA (cytosine-5)-methyltransferase CMT2-like [Cucumis 
sativus]
 ref|XP_004164187.1| PREDICTED: DNA (cytosine-5)-methyltransferase CMT2-like [Cucumis 
sativus]
Length=1243

 Score =   346 bits (887),  Expect = 2e-104, Method: Compositional matrix adjust.
 Identities = 182/332 (55%), Positives = 240/332 (72%), Gaps = 13/332 (4%)
 Frame = -2

Query  1031  SADEEDEVILNVDCHYAQAKVLSFILNIGDCVYVKGEGEKKHVGRILEFFKTTEGEDYFR  852
             S D+ED +++NVDCHY QA + + + ++GDCVY+KGEGEK HVG I+EFFKTT+G++YFR
Sbjct  507   SDDDEDMIVVNVDCHYTQANIGNTVFSLGDCVYIKGEGEKNHVGTIIEFFKTTDGDNYFR  566

Query  851   VQWFFRAEDTVMRDAAALHDKKRLFYSTLMNDNLLDCIISKVNVTEISPGLGLEVNNSPP  672
              QWF+R EDTV+++  A HD +RLFYST+MNDN LDCI+SKVN+  + P +G + N++  
Sbjct  567   GQWFYRVEDTVIQEEGAFHDPRRLFYSTVMNDNPLDCIVSKVNIKRVKPRVGQKSNSASS  626

Query  671   SGFYYDMEYCVDYSTFRNLPTVQS-VNSWDSPSLIDASYKPITAYPVEHFKSCEPSKVEL  495
               FYYDMEYCV+YSTFR L   +S  N  D+P +        T+   E+     P K EL
Sbjct  627   YDFYYDMEYCVEYSTFRTLKNGESPTNCIDTPHVTS------TSNTFENM----PKKAEL  676

Query  494   SLLDLYAGCGGMSTGLCLGAKLSGLNLVTKWAVDYQKSACDSLKFNHPETQVRNESVenf  315
              LLDL++GCGGMSTGLCLGAKLS ++L+++WAVD   SAC+SL+ NHPET VRNE+ E+F
Sbjct  677   ELLDLFSGCGGMSTGLCLGAKLSSIDLISRWAVDSHMSACESLRLNHPETHVRNETAEDF  736

Query  314   lkllkeweklckEYGSEPNAGSDDVLEGMEEGaddansladsddsdAEYEILRLVDICFG  135
             L LLKEWEKLC+ Y +  + GS  +     +     +S  + +   +E+E+  LVDIC+G
Sbjct  737   LDLLKEWEKLCRRYKANESEGSHQLRSKAND--YLTSSDDEDEFPTSEFEVSSLVDICYG  794

Query  134   DPNDTGKPGIHFQVRWKGYGPSEDTWEPIDGL  39
             DP  TGK G+ F VRWKGYGPSEDTWEPI+GL
Sbjct  795   DPTRTGKRGLMFLVRWKGYGPSEDTWEPIEGL  826



>ref|XP_004509555.1| PREDICTED: DNA (cytosine-5)-methyltransferase CMT2-like [Cicer 
arietinum]
Length=1093

 Score =   344 bits (882),  Expect = 2e-104, Method: Compositional matrix adjust.
 Identities = 186/344 (54%), Positives = 242/344 (70%), Gaps = 8/344 (2%)
 Frame = -2

Query  1046  HTCFCSADEEDEVILNVDCHYAQAKVLSFILNIGDCVYVKGEGEKKHVGRILEFFKTTEG  867
               C  + DEEDE+I+NV CHYAQA + + I  +GDC ++KGEG +K++G+I+EFF+TT+ 
Sbjct  224   QVCKINEDEEDEIIVNVKCHYAQANIGNCIFTLGDCAFIKGEGAQKYIGKIIEFFQTTDS  283

Query  866   EDYFRVQWFFRAEDTVMRDAAALHDKKRLFYSTLMNDNLLDCIISKVNVTEISPGLGLEV  687
             ++YFRVQWF+R +DTV++D    HDK+RLFYST+MNDNL+D II KVNVT I+P +GL++
Sbjct  284   QNYFRVQWFYRIQDTVVKDEGGFHDKRRLFYSTVMNDNLIDSIIEKVNVTYITPKVGLKL  343

Query  686   NNSPPSGFYYDMEYCVDYSTFRNLPT---VQSVNSWDSPSLIDASYKPITAYPVEHFKSC  516
             N+  PS FYYDMEYCVDYSTFR +PT   V + N    P++ +     + A  +     C
Sbjct  344   NSVLPSDFYYDMEYCVDYSTFRKIPTGNAVDNTNELSQPAVPEN--LSMEASTITKDLPC  401

Query  515   -EPSKVELSLLDLYAGCGGMSTGLCLGAKLSGLNLVTKWAVDYQKSACDSLKFNHPETQV  339
              E  K EL+LLDLY+GCGGMSTGLCLGAK S +NL+T+WAVD  +SA  SLK NHP+T V
Sbjct  402   PESHKTELALLDLYSGCGGMSTGLCLGAKTSPVNLITRWAVDSDRSASKSLKLNHPDTHV  461

Query  338   RNESVenflkllkeweklckEYGSEPNAGSDDVLEGMEEGaddansladsddsdAEYEIL  159
             RNES E+FL+LLKEWEKLCK Y S+        L     G     +    D  D E E+ 
Sbjct  462   RNESAEDFLQLLKEWEKLCKRYSSDTERTIP--LRSKSSGGKKNVNSQAQDIPDDELEVS  519

Query  158   RLVDICFGDPNDTGKPGIHFQVRWKGYGPSEDTWEPIDGLKSWK  27
             RLVDIC+GDP+ TG   ++ +V WKGY  SEDTWEPI+ L++ K
Sbjct  520   RLVDICYGDPSKTGNRSLYLKVHWKGYSESEDTWEPIENLRNCK  563



>ref|XP_008448611.1| PREDICTED: DNA (cytosine-5)-methyltransferase CMT2 isoform X2 
[Cucumis melo]
Length=1022

 Score =   342 bits (876),  Expect = 4e-104, Method: Compositional matrix adjust.
 Identities = 181/344 (53%), Positives = 238/344 (69%), Gaps = 14/344 (4%)
 Frame = -2

Query  1031  SADEEDEVILNVDCHYAQAKVLSFILNIGDCVYVKGEGEKKHVGRILEFFKTTEGEDYFR  852
             S D+ED +++NVDCHY QA + + + ++GDCVY+KGEGEK HVG I+EFFKTT+G++YFR
Sbjct  263   SDDDEDMIVVNVDCHYTQANIGNTVFSLGDCVYIKGEGEKNHVGTIIEFFKTTDGDNYFR  322

Query  851   VQWFFRAEDTVMRDAAALHDKKRLFYSTLMNDNLLDCIISKVNVTEISPGLGLEVNNSPP  672
              QWF+R EDTV++   A HD +RLFYST+MNDN LDCI+SKVN+  + P +G + N++  
Sbjct  323   GQWFYRVEDTVIQKEGAFHDPRRLFYSTVMNDNPLDCIVSKVNIKRVKPRVGQKSNSASS  382

Query  671   SGFYYDMEYCVDYSTFRNLPTVQSVNSWDSPSLIDA-SYKPITAYPVEHFKSCE------  513
               FYYDMEYCV+YSTFR L   +S+ + D+ +  +     P       H  S        
Sbjct  383   YDFYYDMEYCVEYSTFRTLKDDESLKNVDTAASTNLDKAAPTNCIDTPHVTSTSNTLENI  442

Query  512   PSKVELSLLDLYAGCGGMSTGLCLGAKLSGLNLVTKWAVDYQKSACDSLKFNHPETQVRN  333
             P K EL LLDL++GCGGMSTGLCLGAKLS ++L+++WAVD   SAC+SL+ NHPET VRN
Sbjct  443   PKKAELQLLDLFSGCGGMSTGLCLGAKLSSVDLISRWAVDNHMSACESLRLNHPETHVRN  502

Query  332   ESVenflkllkeweklckEYGSEPNAGSDDVLEGMEEGaddansladsdds------dAE  171
             E+ E+FL LLKEWEKLC+ Y +  + GS   L  M +    ++       +       +E
Sbjct  503   ETAEDFLDLLKEWEKLCRRYKANESEGSRQ-LRSMADNYLTSSDDDLMSSNDEDEFPTSE  561

Query  170   YEILRLVDICFGDPNDTGKPGIHFQVRWKGYGPSEDTWEPIDGL  39
             +E+  LVDIC+ DP  TGK G+ F VRWKGYGPSEDTWEPI+GL
Sbjct  562   FEVSSLVDICYSDPTRTGKRGLMFLVRWKGYGPSEDTWEPIEGL  605



>ref|XP_010662140.1| PREDICTED: DNA (cytosine-5)-methyltransferase CMT2-like isoform 
X2 [Vitis vinifera]
 ref|XP_010662141.1| PREDICTED: DNA (cytosine-5)-methyltransferase CMT2-like isoform 
X2 [Vitis vinifera]
Length=763

 Score =   336 bits (861),  Expect = 5e-104, Method: Compositional matrix adjust.
 Identities = 185/340 (54%), Positives = 243/340 (71%), Gaps = 20/340 (6%)
 Frame = -2

Query  1025  DEEDEVILNVDCHYAQAKVLSFILNIGDCVYVKGE-GEKKHVGRILEFFKTTEGEDYFRV  849
             DEEDE++L+V CHY+QA++   I N+GDC YVKG+ G + ++GRILEFFKT + EDYFRV
Sbjct  144   DEEDELVLDVKCHYSQAEIEKCIFNLGDCAYVKGKKGGRNYIGRILEFFKTMDDEDYFRV  203

Query  848   QWFFRAEDTVMRDAAALHDKKRLFYSTLMNDNLLDCIISKVNVTEISPGLGLEVNNSPPS  669
             QWFFR EDTVM +  A H+KKRLFYS L+NDNLLDCI+SKVN+ +I+P + L+  +  P 
Sbjct  204   QWFFRPEDTVMEEEGAFHEKKRLFYSNLVNDNLLDCIVSKVNIIQITPSVNLKSKSILPC  263

Query  668   GFYYDMEYCVDYSTFRNLPTVQSVNSWDSPSL-IDASYKPITAYPVE----HFKSCEPSK  504
              FYYDM+Y +DYSTF    T++  NS D  +L   A  K +    ++       S +P K
Sbjct  264   DFYYDMKYLIDYSTF---CTMEVDNSADRTNLSTSACLKTVHMNGIKPEFNRMSSHKPYK  320

Query  503   VELSLLDLYAGCGGMSTGLCLGAKLSGLNLVTKWAVDYQKSACDSLKFNHPETQVRNESV  324
              EL+LLD+Y+GCGGMSTGLCLGAKLSG++LVT+WA+D  KSAC+SLK NHPETQ+RNES 
Sbjct  321   PELALLDIYSGCGGMSTGLCLGAKLSGVDLVTRWALDINKSACESLKLNHPETQIRNESA  380

Query  323   enflkllkeweklckEYGSEPNAGSDDVLEGMEEGaddansladsdds-----dAEYEIL  159
             E+FL LLKEW+KLCK Y  +      DV E ++  +    +   +  +       E+E+ 
Sbjct  381   EDFLDLLKEWDKLCKRYVVK------DVQESLKVNSRVLRAAKVNSKTGNKSPSGEFEVA  434

Query  158   RLVDICFGDPNDTGKPGIHFQVRWKGYGPSEDTWEPIDGL  39
              L+DIC+GDP ++GK G+ FQ RW G+GPSEDTWEPI+GL
Sbjct  435   SLIDICYGDPTNSGKHGLKFQARWAGHGPSEDTWEPIEGL  474



>ref|XP_011075807.1| PREDICTED: DNA (cytosine-5)-methyltransferase CMT2-like isoform 
X1 [Sesamum indicum]
Length=911

 Score =   339 bits (869),  Expect = 7e-104, Method: Compositional matrix adjust.
 Identities = 182/355 (51%), Positives = 244/355 (69%), Gaps = 20/355 (6%)
 Frame = -2

Query  1025  DEEDEVILNVDCHYAQAKVLSFILNIGDCVYVKG-EGEKKHVGRILEFFKTTEGEDYFRV  849
             D+++E++LN+ CHY+QA++L  + ++GDC YVKG +G   ++G+ILEFF+TT+GE+YFRV
Sbjct  156   DDDEELVLNIKCHYSQAEILKTVFDLGDCAYVKGPKGGSNYIGKILEFFETTDGEEYFRV  215

Query  848   QWFFRAEDTVMRDAAALHDKKRLFYSTLMNDNLLDCIISKVNVTEISPGLGLEVNNSPPS  669
             QWFFRAEDTV++D    HDKKRLFYSTLMNDNLLDCI+SKV V +I+P +  +  + PP 
Sbjct  216   QWFFRAEDTVIKDDGRSHDKKRLFYSTLMNDNLLDCIVSKVKVVQIAPNVNFKEKSIPPC  275

Query  668   GFYYDMEYCVDYSTFRNLPT-----VQSVNSWDSPSLIDASYKPI--------TAYPVEH  528
              FY+DM+Y VDYSTF  + T       S+ S  SP ++ A  K +        TA     
Sbjct  276   DFYFDMKYSVDYSTFSVIITDDNADDSSLTSLTSPPMMSAKKKDMSCKTGRKCTADGASS  335

Query  527   FKSCEPSKVELSLLDLYAGCGGMSTGLCLGAKLSGLNLVTKWAVDYQKSACDSLKFNHPE  348
                CEP   EL+LLD+Y+GCGGMSTGLCLG K  G++LVT+WAVD  K+AC+SLK NHPE
Sbjct  336   NDVCEP---ELALLDMYSGCGGMSTGLCLGTKACGVDLVTRWAVDIDKAACESLKLNHPE  392

Query  347   TQVRNESVenflkllkeweklckEYGSEPNAGSDDVLEGMEEGaddansladsddsdAEY  168
             TQ+RNES E+ L LLKEW+ +CK YGS         + G  +   +         +  EY
Sbjct  393   TQIRNESAEDLLDLLKEWDCMCKRYGSHEGKELRPRIIGETD---EVKRSKMDHKNSDEY  449

Query  167   EILRLVDICFGDPNDTGKPGIHFQVRWKGYGPSEDTWEPIDGLKSWKNRQGWFTI  3
             E+ +LVDIC+GDP + GK G+ F+VRW GYGPS+DTWEPI+ L+  ++R   F +
Sbjct  450   EVEKLVDICYGDPTEMGKRGLKFKVRWVGYGPSDDTWEPIESLRKCQDRIRDFIL  504



>ref|XP_006599217.1| PREDICTED: DNA (cytosine-5)-methyltransferase CMT2-like isoform 
X3 [Glycine max]
Length=777

 Score =   336 bits (861),  Expect = 8e-104, Method: Compositional matrix adjust.
 Identities = 184/335 (55%), Positives = 234/335 (70%), Gaps = 26/335 (8%)
 Frame = -2

Query  1022  EEDEVILNVDCHYAQAKVLSFILNIGDCVYVKGEGEKKHVGRILEFFKTTEGEDYFRVQW  843
             EEDE+I NV CHYAQA++ + I ++GDC +VKGEGE+KHVG+I+EFF+TT+G++YFRVQW
Sbjct  8     EEDEIIANVKCHYAQAEIGNCIFSLGDCAFVKGEGEEKHVGKIIEFFQTTDGQNYFRVQW  67

Query  842   FFRAEDTVMRDAAALHDKKRLFYSTLMNDNLLDCIISKVNVTEISPGLGLEVNNSPPSGF  663
             F+R +DTV++D    HDK+R+FYS +MNDNL+DCI+ K NVT I+P +GL++ +   S F
Sbjct  68    FYRIQDTVVQDEGGFHDKRRVFYSAIMNDNLIDCIMGKANVTHITPRVGLKLASISSSDF  127

Query  662   YYDMEYCVDYSTFRNLPTVQSVNSWDSPSLIDASYKPITAYPVEHFKSCEPSKVELSLLD  483
             YYDMEYCVDYSTFRN+PT  S  +   P                     E +K EL+LLD
Sbjct  128   YYDMEYCVDYSTFRNIPTDASTVTESQP-------------------CSELNKTELALLD  168

Query  482   LYAGCGGMSTGLCLGAKLSGLNLVTKWAVDYQKSACDSLKFNHPETQVRNESVenflkll  303
             LY+GCGGMSTGLCLGAK + +NLVT+WAVD  +SA +SLK NH +T VRNES E+FL+LL
Sbjct  169   LYSGCGGMSTGLCLGAKTASVNLVTRWAVDSDRSAGESLKLNHSDTHVRNESAEDFLELL  228

Query  302   keweklckEYGSEPNAGSDDV---LEGMEEGaddansladsddsdAEYEILRLVDICFGD  132
             K WEKLCK Y    N  S +          GA    +    + SD E E+ +LVDICFGD
Sbjct  229   KAWEKLCKRY----NVSSTERKLPFRSNSSGAKKRGNSEVHEISDGELEVSKLVDICFGD  284

Query  131   PNDTGKPGIHFQVRWKGYGPSEDTWEPIDGLKSWK  27
             PN+TGK G++ +V WKGY  SEDTWEPI  L   K
Sbjct  285   PNETGKRGLYLKVHWKGYSASEDTWEPIKSLSKCK  319



>gb|KEH20304.1| DNA (cytosine-5)-methyltransferase [Medicago truncatula]
Length=1011

 Score =   339 bits (869),  Expect = 4e-103, Method: Compositional matrix adjust.
 Identities = 182/335 (54%), Positives = 244/335 (73%), Gaps = 4/335 (1%)
 Frame = -2

Query  1025  DEEDEVILNVDCHYAQAKVLSFILNIGDCVYVKGEGEKKHVGRILEFFKTTEGEDYFRVQ  846
             DEEDE I+NV CHYAQA + + I  +GDC  +KGEGE+KH+G+I+EFF TT+ + YFRVQ
Sbjct  229   DEEDETIINVKCHYAQAIIGNCIFTVGDCASIKGEGEQKHIGKIVEFFLTTDSKKYFRVQ  288

Query  845   WFFRAEDTVMRDAAALHDKKRLFYSTLMNDNLLDCIISKVNVTEISPGLGLEVNNSPPSG  666
             WF+R +DTV++D    HDK+RLFYS++MNDNL+D II KV+V   +P +GL++ ++ PS 
Sbjct  289   WFYRIQDTVVQDEGDYHDKRRLFYSSIMNDNLIDSIIEKVSVRYRTPKVGLKLASNLPSD  348

Query  665   FYYDMEYCVDYSTFRNLPTVQSV--NSWDSPSLIDASYKPITAYPVEHFKSCEPSKVELS  492
             FYYDMEYCVDYSTFR +PT  +V  N    P++++ S+ P  +   +   + E  + EL+
Sbjct  349   FYYDMEYCVDYSTFRKIPTDDAVKINKLSQPAVLE-SHSPEASTITKSLPNPELHRTELA  407

Query  491   LLDLYAGCGGMSTGLCLGAKLSGLNLVTKWAVDYQKSACDSLKFNHPETQVRNESVenfl  312
             LLDLY+GCGGMSTGLCLGAK+S +NLVT+WAVD  + A  SLK NHPET VRNES E+FL
Sbjct  408   LLDLYSGCGGMSTGLCLGAKISSVNLVTRWAVDSNRYASKSLKLNHPETHVRNESAEDFL  467

Query  311   kllkeweklckEYGSEPNAGSDDVLEGMEEGaddansladsddsdAEYEILRLVDICFGD  132
             +LLKEWEKLCK Y    +  +   L     G     +   +D SD ++E+ R+VDIC+GD
Sbjct  468   QLLKEWEKLCKRYNVG-DTKNKTPLRSRNSGGKKQVNSKAADSSDDDFEVSRIVDICYGD  526

Query  131   PNDTGKPGIHFQVRWKGYGPSEDTWEPIDGLKSWK  27
             P++TGK G++ +V WKGY  SEDTWEPI+ L++ K
Sbjct  527   PSETGKHGLYLKVHWKGYDESEDTWEPIENLRNCK  561



>ref|XP_008448610.1| PREDICTED: DNA (cytosine-5)-methyltransferase CMT2 isoform X1 
[Cucumis melo]
Length=1247

 Score =   342 bits (878),  Expect = 4e-103, Method: Compositional matrix adjust.
 Identities = 181/344 (53%), Positives = 238/344 (69%), Gaps = 14/344 (4%)
 Frame = -2

Query  1031  SADEEDEVILNVDCHYAQAKVLSFILNIGDCVYVKGEGEKKHVGRILEFFKTTEGEDYFR  852
             S D+ED +++NVDCHY QA + + + ++GDCVY+KGEGEK HVG I+EFFKTT+G++YFR
Sbjct  488   SDDDEDMIVVNVDCHYTQANIGNTVFSLGDCVYIKGEGEKNHVGTIIEFFKTTDGDNYFR  547

Query  851   VQWFFRAEDTVMRDAAALHDKKRLFYSTLMNDNLLDCIISKVNVTEISPGLGLEVNNSPP  672
              QWF+R EDTV++   A HD +RLFYST+MNDN LDCI+SKVN+  + P +G + N++  
Sbjct  548   GQWFYRVEDTVIQKEGAFHDPRRLFYSTVMNDNPLDCIVSKVNIKRVKPRVGQKSNSASS  607

Query  671   SGFYYDMEYCVDYSTFRNLPTVQSVNSWDSPSLIDA-SYKPITAYPVEHFKSCE------  513
               FYYDMEYCV+YSTFR L   +S+ + D+ +  +     P       H  S        
Sbjct  608   YDFYYDMEYCVEYSTFRTLKDDESLKNVDTAASTNLDKAAPTNCIDTPHVTSTSNTLENI  667

Query  512   PSKVELSLLDLYAGCGGMSTGLCLGAKLSGLNLVTKWAVDYQKSACDSLKFNHPETQVRN  333
             P K EL LLDL++GCGGMSTGLCLGAKLS ++L+++WAVD   SAC+SL+ NHPET VRN
Sbjct  668   PKKAELQLLDLFSGCGGMSTGLCLGAKLSSVDLISRWAVDNHMSACESLRLNHPETHVRN  727

Query  332   ESVenflkllkeweklckEYGSEPNAGSDDVLEGMEEGaddansladsdds------dAE  171
             E+ E+FL LLKEWEKLC+ Y +  + GS   L  M +    ++       +       +E
Sbjct  728   ETAEDFLDLLKEWEKLCRRYKANESEGSRQ-LRSMADNYLTSSDDDLMSSNDEDEFPTSE  786

Query  170   YEILRLVDICFGDPNDTGKPGIHFQVRWKGYGPSEDTWEPIDGL  39
             +E+  LVDIC+ DP  TGK G+ F VRWKGYGPSEDTWEPI+GL
Sbjct  787   FEVSSLVDICYSDPTRTGKRGLMFLVRWKGYGPSEDTWEPIEGL  830



>ref|XP_010662139.1| PREDICTED: DNA (cytosine-5)-methyltransferase CMT2-like isoform 
X1 [Vitis vinifera]
Length=892

 Score =   336 bits (861),  Expect = 8e-103, Method: Compositional matrix adjust.
 Identities = 185/340 (54%), Positives = 243/340 (71%), Gaps = 20/340 (6%)
 Frame = -2

Query  1025  DEEDEVILNVDCHYAQAKVLSFILNIGDCVYVKGE-GEKKHVGRILEFFKTTEGEDYFRV  849
             DEEDE++L+V CHY+QA++   I N+GDC YVKG+ G + ++GRILEFFKT + EDYFRV
Sbjct  144   DEEDELVLDVKCHYSQAEIEKCIFNLGDCAYVKGKKGGRNYIGRILEFFKTMDDEDYFRV  203

Query  848   QWFFRAEDTVMRDAAALHDKKRLFYSTLMNDNLLDCIISKVNVTEISPGLGLEVNNSPPS  669
             QWFFR EDTVM +  A H+KKRLFYS L+NDNLLDCI+SKVN+ +I+P + L+  +  P 
Sbjct  204   QWFFRPEDTVMEEEGAFHEKKRLFYSNLVNDNLLDCIVSKVNIIQITPSVNLKSKSILPC  263

Query  668   GFYYDMEYCVDYSTFRNLPTVQSVNSWDSPSL-IDASYKPITAYPVE----HFKSCEPSK  504
              FYYDM+Y +DYSTF    T++  NS D  +L   A  K +    ++       S +P K
Sbjct  264   DFYYDMKYLIDYSTF---CTMEVDNSADRTNLSTSACLKTVHMNGIKPEFNRMSSHKPYK  320

Query  503   VELSLLDLYAGCGGMSTGLCLGAKLSGLNLVTKWAVDYQKSACDSLKFNHPETQVRNESV  324
              EL+LLD+Y+GCGGMSTGLCLGAKLSG++LVT+WA+D  KSAC+SLK NHPETQ+RNES 
Sbjct  321   PELALLDIYSGCGGMSTGLCLGAKLSGVDLVTRWALDINKSACESLKLNHPETQIRNESA  380

Query  323   enflkllkeweklckEYGSEPNAGSDDVLEGMEEGaddansladsdds-----dAEYEIL  159
             E+FL LLKEW+KLCK Y  +      DV E ++  +    +   +  +       E+E+ 
Sbjct  381   EDFLDLLKEWDKLCKRYVVK------DVQESLKVNSRVLRAAKVNSKTGNKSPSGEFEVA  434

Query  158   RLVDICFGDPNDTGKPGIHFQVRWKGYGPSEDTWEPIDGL  39
              L+DIC+GDP ++GK G+ FQ RW G+GPSEDTWEPI+GL
Sbjct  435   SLIDICYGDPTNSGKHGLKFQARWAGHGPSEDTWEPIEGL  474



>emb|CBI37413.3| unnamed protein product [Vitis vinifera]
Length=729

 Score =   331 bits (849),  Expect = 1e-102, Method: Compositional matrix adjust.
 Identities = 185/303 (61%), Positives = 228/303 (75%), Gaps = 12/303 (4%)
 Frame = -2

Query  929  KGEGEKKHVGRILEFFKTTEGEDYFRVQWFFRAEDTVMRDAAALHDKKRLFYSTLMNDNL  750
            +GEGE+KHVGRILEFFKTTEGEDYFRVQWF+RAEDTVM++ AA HDKKR+F ST+MNDN 
Sbjct  25   QGEGEQKHVGRILEFFKTTEGEDYFRVQWFYRAEDTVMKEEAASHDKKRIFCSTIMNDNS  84

Query  749  LDCIISKVNVTEISPGLGLEVNNSPPSGFYYDMEYCVDYSTFRNLPTVQSVNSWD--SPS  576
            LDCIISKVNV E++P + L++++ PP  +YYDM+Y V+YSTF    T+ SV  +D  SP+
Sbjct  85   LDCIISKVNVLELTPRVSLKLDSIPPFDYYYDMKYNVEYSTFH---TLLSVKGYDLVSPN  141

Query  575  LIDASYKPITAYPVEHFKSCEPSKVELSLLDLYAGCGGMSTGLCLGAKLSGLNLVTKWAV  396
             I+           E    C+P K EL+LLDLY+GCGGMSTGLCLGAKLS +NLVTKWA+
Sbjct  142  CIETPLSVANTTFPEDMDGCKPDKAELALLDLYSGCGGMSTGLCLGAKLSCVNLVTKWAL  201

Query  395  DYQKSACDSLKFNHPETQVRNESVenflkllkeweklckEYG----SEPNAGSDDVLEGM  228
            D+ KSAC+SLK NHPETQVRNE+ E+FL LLKEWE LC++Y        +    +VL   
Sbjct  202  DFDKSACESLKLNHPETQVRNETAEDFLDLLKEWEMLCEQYALNLVERKSQSRSNVLRTS  261

Query  227  EEGaddansladsddsdAEYEILRLVDICFGDPNDTGKPGIHFQVRWKGYGPSEDTWEPI  48
            +      NS  D   +  E EIL+LVDIC+GDP++TGK G+ F+VRWKGYGPSEDTWEPI
Sbjct  262  KSN---INSPHDIKVATDELEILKLVDICYGDPSETGKRGLKFKVRWKGYGPSEDTWEPI  318

Query  47   DGL  39
            +GL
Sbjct  319  EGL  321



>gb|AHB20162.1| DNA methyltransferase, partial [Populus x canadensis]
Length=755

 Score =   332 bits (850),  Expect = 2e-102, Method: Compositional matrix adjust.
 Identities = 187/335 (56%), Positives = 239/335 (71%), Gaps = 5/335 (1%)
 Frame = -2

Query  1031  SADEEDEVILNVDCHYAQAKVLSFILNIGDCVYVKGEGEKKHVGRILEFFKTTEGEDYFR  852
             S D+ED+V+ NV+CHY QA +   I+N+GDCVYVKGEG K H+G ILEF KTT+ EDYFR
Sbjct  3     SDDDEDKVVWNVECHYTQADIEGRIINLGDCVYVKGEGAKNHIGSILEFSKTTDREDYFR  62

Query  851   VQWFFRAEDTVMRDAAALHDKKRLFYSTLMNDNLLDCIISKVNVTEISPGLGLEVNNSPP  672
             VQWF+RAEDTVM++AA  HD KRLFYST+MNDN +DCIISKV V +ISP + L+ +++P 
Sbjct  63    VQWFYRAEDTVMKEAADFHDNKRLFYSTVMNDNPIDCIISKVTVVQISPRVHLKFHSTPA  122

Query  671   SGFYYDMEYCVDYSTFRNLPTVQSVNSWDSPSL--IDASYKPITAYPVEHFKSCEPSKVE  498
             S FY+DMEYCVDYSTFR L T  S+   +   L   D+     +   +E+  +C   K +
Sbjct  123   SDFYFDMEYCVDYSTFRTLLTDCSLRGHELSILPFCDSRSATPSDISMENISTCGSYKAK  182

Query  497   LSLLDLYAGCGGMSTGLCLGAKLSGLNLVTKWAVDYQKSACDSLKFNHPETQVRNESVen  318
             L+LLDL++GCGGMSTGL LGAK+S ++LVT WA+D  +SAC SLK NHPET VR+E+ E+
Sbjct  183   LTLLDLFSGCGGMSTGLRLGAKVSCVDLVTSWALDSDESACQSLKLNHPETHVRSEAAED  242

Query  317   flkllkeweklckEYGSEPNAGSDDVLEGMEEGaddansladsddsdA--EYEILRLVDI  144
             FL+LLKEW+KLCK Y    + G       M       N  + +DD  A  EYE+ RLVDI
Sbjct  243   FLELLKEWQKLCKRYAVN-DVGRTHKSRSMASSMSKQNKNSSNDDDIAPGEYEVARLVDI  301

Query  143   CFGDPNDTGKPGIHFQVRWKGYGPSEDTWEPIDGL  39
             C+G  +  GK G+ F+V WKGY  SED+WEPI+GL
Sbjct  302   CYGKTDKRGKRGLKFKVHWKGYSTSEDSWEPIEGL  336



>ref|XP_007156278.1| hypothetical protein PHAVU_003G273100g [Phaseolus vulgaris]
 gb|ESW28272.1| hypothetical protein PHAVU_003G273100g [Phaseolus vulgaris]
Length=1047

 Score =   338 bits (866),  Expect = 2e-102, Method: Compositional matrix adjust.
 Identities = 186/331 (56%), Positives = 234/331 (71%), Gaps = 29/331 (9%)
 Frame = -2

Query  1022  EEDEVILNVDCHYAQAKVLSFILNIGDCVYVKGEGEKKHVGRILEFFKTTEGEDYFRVQW  843
             EEDE+I NV CHYAQA+V +   ++GDC ++KGEGE+KHVG+I+EFF+TT+G+ YFRVQW
Sbjct  325   EEDEIIANVKCHYAQAEVGNCTFSLGDCAFIKGEGEEKHVGKIIEFFQTTDGQSYFRVQW  384

Query  842   FFRAEDTVMRDAAALHDKKRLFYSTLMNDNLLDCIISKVNVTEISPGLGLEVNNSPPSGF  663
             F+R +DTV++D    HDK+R+FYS++MNDNL+DCI+ K NVT+I+P +GL++ +  PS  
Sbjct  385   FYRIQDTVVQDEGGFHDKRRVFYSSIMNDNLIDCIVGKANVTQITPRVGLKLASISPSDL  444

Query  662   YYDMEYCVDYSTFRNLPTVQSVNSWDSPSLIDASYKPITAYPVEHFKSCEPSKVELSLLD  483
             YYDMEYCVDYSTFRN+PT             DAS         E   S E  K ELSLLD
Sbjct  445   YYDMEYCVDYSTFRNIPT-------------DASAV------TESLPSTELCKKELSLLD  485

Query  482   LYAGCGGMSTGLCLGAKLSGLNLVTKWAVDYQKSACDSLKFNHPETQVRNESVenflkll  303
             LY+GCGGMSTGLCLGAK + +NLVT+WAVD  +SA +SLK NHPET VRNES E+FL+LL
Sbjct  486   LYSGCGGMSTGLCLGAKTASVNLVTRWAVDSDRSASESLKLNHPETHVRNESAEDFLELL  545

Query  302   keweklckEYGSEPNAGSDDVLEGM---EEGaddansladsddsdAEYEILRLVDICFGD  132
             KEWEKLCK Y +       +V+E           A      D+S  E+EI +LVDICFGD
Sbjct  546   KEWEKLCKRYNT-------NVVERKLPCRSNYSGAKEQEVHDNSATEFEISKLVDICFGD  598

Query  131   PNDTGKPGIHFQVRWKGYGPSEDTWEPIDGL  39
             PN+TG  G++ +V WKG    EDTWEPI  L
Sbjct  599   PNETGNRGLYLKVHWKGCSTREDTWEPIKSL  629



>emb|CBI26560.3| unnamed protein product [Vitis vinifera]
Length=847

 Score =   334 bits (856),  Expect = 2e-102, Method: Compositional matrix adjust.
 Identities = 184/340 (54%), Positives = 242/340 (71%), Gaps = 20/340 (6%)
 Frame = -2

Query  1025  DEEDEVILNVDCHYAQAKVLSFILNIGDCVYVKG-EGEKKHVGRILEFFKTTEGEDYFRV  849
             DEEDE++L+V CHY+QA++   I N+GDC YVK  +G + ++GRILEFFKT + EDYFRV
Sbjct  99    DEEDELVLDVKCHYSQAEIEKCIFNLGDCAYVKASKGGRNYIGRILEFFKTMDDEDYFRV  158

Query  848   QWFFRAEDTVMRDAAALHDKKRLFYSTLMNDNLLDCIISKVNVTEISPGLGLEVNNSPPS  669
             QWFFR EDTVM +  A H+KKRLFYS L+NDNLLDCI+SKVN+ +I+P + L+  +  P 
Sbjct  159   QWFFRPEDTVMEEEGAFHEKKRLFYSNLVNDNLLDCIVSKVNIIQITPSVNLKSKSILPC  218

Query  668   GFYYDMEYCVDYSTFRNLPTVQSVNSWDSPSL-IDASYKPITAYPVE----HFKSCEPSK  504
              FYYDM+Y +DYSTF    T++  NS D  +L   A  K +    ++       S +P K
Sbjct  219   DFYYDMKYLIDYSTF---CTMEVDNSADRTNLSTSACLKTVHMNGIKPEFNRMSSHKPYK  275

Query  503   VELSLLDLYAGCGGMSTGLCLGAKLSGLNLVTKWAVDYQKSACDSLKFNHPETQVRNESV  324
              EL+LLD+Y+GCGGMSTGLCLGAKLSG++LVT+WA+D  KSAC+SLK NHPETQ+RNES 
Sbjct  276   PELALLDIYSGCGGMSTGLCLGAKLSGVDLVTRWALDINKSACESLKLNHPETQIRNESA  335

Query  323   enflkllkeweklckEYGSEPNAGSDDVLEGMEEGaddansladsdds-----dAEYEIL  159
             E+FL LLKEW+KLCK Y  +      DV E ++  +    +   +  +       E+E+ 
Sbjct  336   EDFLDLLKEWDKLCKRYVVK------DVQESLKVNSRVLRAAKVNSKTGNKSPSGEFEVA  389

Query  158   RLVDICFGDPNDTGKPGIHFQVRWKGYGPSEDTWEPIDGL  39
              L+DIC+GDP ++GK G+ FQ RW G+GPSEDTWEPI+GL
Sbjct  390   SLIDICYGDPTNSGKHGLKFQARWAGHGPSEDTWEPIEGL  429



>ref|XP_011028082.1| PREDICTED: DNA (cytosine-5)-methyltransferase CMT2 isoform X3 
[Populus euphratica]
Length=1056

 Score =   337 bits (864),  Expect = 3e-102, Method: Compositional matrix adjust.
 Identities = 190/336 (57%), Positives = 244/336 (73%), Gaps = 11/336 (3%)
 Frame = -2

Query  1025  DEEDEVILNVDCHYAQAKVLSFILNIGDCVYVKGEGEKKHVGRILEFFKTTEGEDYFRVQ  846
             D+ED+V+ NV+CHY QA +   I+N+GDCVYVKGEG K H+G ILEFFKTT+ EDYFRVQ
Sbjct  468   DDEDKVVWNVECHYTQADIEGRIINLGDCVYVKGEGAKNHIGSILEFFKTTDREDYFRVQ  527

Query  845   WFFRAEDTVMRDAAALHDKKRLFYSTLMNDNLLDCIISKVNVTEISPGLGLEVNNSPPSG  666
             WF+RAEDTVM++AA  HD KRLFYST+MNDN +DCIIS V V +ISP + L+ +++  S 
Sbjct  528   WFYRAEDTVMKEAADFHDNKRLFYSTVMNDNPIDCIISTVTVVQISPRVDLKFHSTLASD  587

Query  665   FYYDMEYCVDYSTFRNLPTVQSVNSWD-SP-SLIDASYKPITAYPVEHFKSCEPSKVELS  492
             FY+DMEYCVDYSTFR L T  S+   + SP    D+     +   +E+  +C   K +L+
Sbjct  588   FYFDMEYCVDYSTFRTLLTDCSLKGHELSPLPFCDSRSATPSDISMENMSTCGSYKAKLT  647

Query  491   LLDLYAGCGGMSTGLCLGAKLSGLNLVTKWAVDYQKSACDSLKFNHPETQVRNESVenfl  312
             LLDL++GCGGMSTGLCLGAK+S ++LVT+WA+D  +SAC SLK NHPET VRNE+ E+FL
Sbjct  648   LLDLFSGCGGMSTGLCLGAKVSCVDLVTRWALDSDESACQSLKLNHPETHVRNEAAEDFL  707

Query  311   kllkeweklckEY-----GSEPNAGSDDVLEGMEEGaddansladsddsdAEYEILRLVD  147
             +LLKEW+KLCK Y     G   N+ S  +   M +   + NS  D D +  EYE+ RLVD
Sbjct  708   ELLKEWQKLCKRYVVNDVGRTHNSRS--MASSMSK--QNKNSSNDDDIAPGEYEVARLVD  763

Query  146   ICFGDPNDTGKPGIHFQVRWKGYGPSEDTWEPIDGL  39
             IC+G  +  GK G+ F+V WKGY  SED+WEPI+GL
Sbjct  764   ICYGKTDKRGKRGLKFKVHWKGYSTSEDSWEPIEGL  799



>gb|KHN10109.1| DNA (cytosine-5)-methyltransferase CMT2 [Glycine soja]
Length=1031

 Score =   337 bits (863),  Expect = 3e-102, Method: Compositional matrix adjust.
 Identities = 185/335 (55%), Positives = 234/335 (70%), Gaps = 26/335 (8%)
 Frame = -2

Query  1022  EEDEVILNVDCHYAQAKVLSFILNIGDCVYVKGEGEKKHVGRILEFFKTTEGEDYFRVQW  843
             EEDE+I NV CHYAQA++ + I ++GDC +VKGEGE+KHVG+I+EFF+TT+G++YFRVQW
Sbjct  262   EEDEIIANVKCHYAQAEIGNCIFSLGDCAFVKGEGEEKHVGKIIEFFQTTDGQNYFRVQW  321

Query  842   FFRAEDTVMRDAAALHDKKRLFYSTLMNDNLLDCIISKVNVTEISPGLGLEVNNSPPSGF  663
             F+R +DTV++D    HDK+R+FYS +MNDNL+DCI+ K NVT I+P +GL++ +   S F
Sbjct  322   FYRIQDTVVQDEGGFHDKRRVFYSAIMNDNLIDCIMGKANVTHITPRVGLKLASISSSDF  381

Query  662   YYDMEYCVDYSTFRNLPTVQSVNSWDSPSLIDASYKPITAYPVEHFKSCEPSKVELSLLD  483
             YYDMEYCVDYSTFRN+PT  S  +   P                     E +K EL+LLD
Sbjct  382   YYDMEYCVDYSTFRNIPTDASTVTESQP-------------------CSELNKTELALLD  422

Query  482   LYAGCGGMSTGLCLGAKLSGLNLVTKWAVDYQKSACDSLKFNHPETQVRNESVenflkll  303
             LY+GCGGMSTGLCLGAK + +NLVT+WAVD  +SA +SLK NH +T VRNES E+FL+LL
Sbjct  423   LYSGCGGMSTGLCLGAKTASVNLVTRWAVDSDRSAGESLKLNHSDTHVRNESAEDFLELL  482

Query  302   keweklckEYGSEPNAGSDDV---LEGMEEGaddansladsddsdAEYEILRLVDICFGD  132
             K WEKLCK Y    N  S +          GA    +    D SD E E+ +LVDICFGD
Sbjct  483   KAWEKLCKRY----NVSSTERKLPFRSNSSGAKKRGNSEVHDISDGELEVSKLVDICFGD  538

Query  131   PNDTGKPGIHFQVRWKGYGPSEDTWEPIDGLKSWK  27
             PN+TGK G++ +V WKGY  SEDTWEPI  L   K
Sbjct  539   PNETGKRGLYLKVHWKGYSASEDTWEPIKSLSKCK  573



>ref|XP_006599216.1| PREDICTED: DNA (cytosine-5)-methyltransferase CMT2-like isoform 
X2 [Glycine max]
Length=1042

 Score =   337 bits (863),  Expect = 4e-102, Method: Compositional matrix adjust.
 Identities = 184/335 (55%), Positives = 234/335 (70%), Gaps = 26/335 (8%)
 Frame = -2

Query  1022  EEDEVILNVDCHYAQAKVLSFILNIGDCVYVKGEGEKKHVGRILEFFKTTEGEDYFRVQW  843
             EEDE+I NV CHYAQA++ + I ++GDC +VKGEGE+KHVG+I+EFF+TT+G++YFRVQW
Sbjct  273   EEDEIIANVKCHYAQAEIGNCIFSLGDCAFVKGEGEEKHVGKIIEFFQTTDGQNYFRVQW  332

Query  842   FFRAEDTVMRDAAALHDKKRLFYSTLMNDNLLDCIISKVNVTEISPGLGLEVNNSPPSGF  663
             F+R +DTV++D    HDK+R+FYS +MNDNL+DCI+ K NVT I+P +GL++ +   S F
Sbjct  333   FYRIQDTVVQDEGGFHDKRRVFYSAIMNDNLIDCIMGKANVTHITPRVGLKLASISSSDF  392

Query  662   YYDMEYCVDYSTFRNLPTVQSVNSWDSPSLIDASYKPITAYPVEHFKSCEPSKVELSLLD  483
             YYDMEYCVDYSTFRN+PT  S  +   P                     E +K EL+LLD
Sbjct  393   YYDMEYCVDYSTFRNIPTDASTVTESQP-------------------CSELNKTELALLD  433

Query  482   LYAGCGGMSTGLCLGAKLSGLNLVTKWAVDYQKSACDSLKFNHPETQVRNESVenflkll  303
             LY+GCGGMSTGLCLGAK + +NLVT+WAVD  +SA +SLK NH +T VRNES E+FL+LL
Sbjct  434   LYSGCGGMSTGLCLGAKTASVNLVTRWAVDSDRSAGESLKLNHSDTHVRNESAEDFLELL  493

Query  302   keweklckEYGSEPNAGSDDV---LEGMEEGaddansladsddsdAEYEILRLVDICFGD  132
             K WEKLCK Y    N  S +          GA    +    + SD E E+ +LVDICFGD
Sbjct  494   KAWEKLCKRY----NVSSTERKLPFRSNSSGAKKRGNSEVHEISDGELEVSKLVDICFGD  549

Query  131   PNDTGKPGIHFQVRWKGYGPSEDTWEPIDGLKSWK  27
             PN+TGK G++ +V WKGY  SEDTWEPI  L   K
Sbjct  550   PNETGKRGLYLKVHWKGYSASEDTWEPIKSLSKCK  584



>ref|XP_010243148.1| PREDICTED: DNA (cytosine-5)-methyltransferase 1-like [Nelumbo 
nucifera]
Length=1126

 Score =   338 bits (866),  Expect = 5e-102, Method: Compositional matrix adjust.
 Identities = 196/341 (57%), Positives = 240/341 (70%), Gaps = 11/341 (3%)
 Frame = -2

Query  1025  DEEDEVILNVDCHYAQAKVLSFILNIGDCVYVKG-EGEKKHVGRILEFFKTTEGEDYFRV  849
             DEEDE+ILNV CHY QA++   I N+GDC YVKG EG + +VGRILEFFKT EG DYFRV
Sbjct  411   DEEDEIILNVKCHYTQAEIDKCIFNLGDCAYVKGKEGAQNYVGRILEFFKTMEGGDYFRV  470

Query  848   QWFFRAEDTVMRDAAALHDKKRLFYSTLMNDNLLDCIISKVNVTEISPGLGLEVNNSPPS  669
             QWFFRAEDTVM+D A  HDKKRLFYS LMNDNLLDCI+SKV + +++P + L+    PP 
Sbjct  471   QWFFRAEDTVMKDEATFHDKKRLFYSDLMNDNLLDCIVSKVKIVQMAPSVDLKPRYMPPC  530

Query  668   GFYYDMEYCVDYSTFRN-LPTVQSVNSWDSPSLIDASYKPITAYP-VEHFKSCEPSKVEL  495
               YYDM+Y VDYSTF   L  V + +S  S S     +K     P ++      P   EL
Sbjct  531   DLYYDMKYSVDYSTFTTILDDVSAESSGLSSSGFPKIFKKNDTMPYLDKRLDYGPETSEL  590

Query  494   SLLDLYAGCGGMSTGLCLGAKLSGLNLVTKWAVDYQKSACDSLKFNHPETQVRNESVenf  315
             +LLDLY+GCGGMSTGLCLGAKLSG+NLVT+WAVD+   AC+SL+ NHPETQ+RNE+ E+F
Sbjct  591   ALLDLYSGCGGMSTGLCLGAKLSGVNLVTRWAVDFNVHACESLRLNHPETQIRNETAEDF  650

Query  314   lkllkeweklckEY---GSEPNAGSDDVLEGMEEGaddansladsddsdAEYEILRLVDI  144
             L LLKEWEKLCK Y    +E    S       + G     S  +SD    EYE+L+LVDI
Sbjct  651   LDLLKEWEKLCKRYVVRDTERTRRSCSRASKTKVG-----SQCESDIQPGEYEVLKLVDI  705

Query  143   CFGDPNDTGKPGIHFQVRWKGYGPSEDTWEPIDGLKSWKNR  21
             C+GDP +TG   + F+VRWKGY PS+DTWEPI+ L + ++R
Sbjct  706   CYGDPGETGNRALRFKVRWKGYHPSDDTWEPIEHLGNCQDR  746



>ref|XP_006599215.1| PREDICTED: DNA (cytosine-5)-methyltransferase CMT2-like isoform 
X1 [Glycine max]
Length=1118

 Score =   337 bits (864),  Expect = 9e-102, Method: Compositional matrix adjust.
 Identities = 184/335 (55%), Positives = 234/335 (70%), Gaps = 26/335 (8%)
 Frame = -2

Query  1022  EEDEVILNVDCHYAQAKVLSFILNIGDCVYVKGEGEKKHVGRILEFFKTTEGEDYFRVQW  843
             EEDE+I NV CHYAQA++ + I ++GDC +VKGEGE+KHVG+I+EFF+TT+G++YFRVQW
Sbjct  349   EEDEIIANVKCHYAQAEIGNCIFSLGDCAFVKGEGEEKHVGKIIEFFQTTDGQNYFRVQW  408

Query  842   FFRAEDTVMRDAAALHDKKRLFYSTLMNDNLLDCIISKVNVTEISPGLGLEVNNSPPSGF  663
             F+R +DTV++D    HDK+R+FYS +MNDNL+DCI+ K NVT I+P +GL++ +   S F
Sbjct  409   FYRIQDTVVQDEGGFHDKRRVFYSAIMNDNLIDCIMGKANVTHITPRVGLKLASISSSDF  468

Query  662   YYDMEYCVDYSTFRNLPTVQSVNSWDSPSLIDASYKPITAYPVEHFKSCEPSKVELSLLD  483
             YYDMEYCVDYSTFRN+PT  S  +   P                     E +K EL+LLD
Sbjct  469   YYDMEYCVDYSTFRNIPTDASTVTESQP-------------------CSELNKTELALLD  509

Query  482   LYAGCGGMSTGLCLGAKLSGLNLVTKWAVDYQKSACDSLKFNHPETQVRNESVenflkll  303
             LY+GCGGMSTGLCLGAK + +NLVT+WAVD  +SA +SLK NH +T VRNES E+FL+LL
Sbjct  510   LYSGCGGMSTGLCLGAKTASVNLVTRWAVDSDRSAGESLKLNHSDTHVRNESAEDFLELL  569

Query  302   keweklckEYGSEPNAGSDDV---LEGMEEGaddansladsddsdAEYEILRLVDICFGD  132
             K WEKLCK Y    N  S +          GA    +    + SD E E+ +LVDICFGD
Sbjct  570   KAWEKLCKRY----NVSSTERKLPFRSNSSGAKKRGNSEVHEISDGELEVSKLVDICFGD  625

Query  131   PNDTGKPGIHFQVRWKGYGPSEDTWEPIDGLKSWK  27
             PN+TGK G++ +V WKGY  SEDTWEPI  L   K
Sbjct  626   PNETGKRGLYLKVHWKGYSASEDTWEPIKSLSKCK  660



>ref|XP_011028081.1| PREDICTED: DNA (cytosine-5)-methyltransferase CMT2 isoform X2 
[Populus euphratica]
Length=1167

 Score =   337 bits (863),  Expect = 3e-101, Method: Compositional matrix adjust.
 Identities = 190/336 (57%), Positives = 244/336 (73%), Gaps = 11/336 (3%)
 Frame = -2

Query  1025  DEEDEVILNVDCHYAQAKVLSFILNIGDCVYVKGEGEKKHVGRILEFFKTTEGEDYFRVQ  846
             D+ED+V+ NV+CHY QA +   I+N+GDCVYVKGEG K H+G ILEFFKTT+ EDYFRVQ
Sbjct  468   DDEDKVVWNVECHYTQADIEGRIINLGDCVYVKGEGAKNHIGSILEFFKTTDREDYFRVQ  527

Query  845   WFFRAEDTVMRDAAALHDKKRLFYSTLMNDNLLDCIISKVNVTEISPGLGLEVNNSPPSG  666
             WF+RAEDTVM++AA  HD KRLFYST+MNDN +DCIIS V V +ISP + L+ +++  S 
Sbjct  528   WFYRAEDTVMKEAADFHDNKRLFYSTVMNDNPIDCIISTVTVVQISPRVDLKFHSTLASD  587

Query  665   FYYDMEYCVDYSTFRNLPTVQSVNSWD-SP-SLIDASYKPITAYPVEHFKSCEPSKVELS  492
             FY+DMEYCVDYSTFR L T  S+   + SP    D+     +   +E+  +C   K +L+
Sbjct  588   FYFDMEYCVDYSTFRTLLTDCSLKGHELSPLPFCDSRSATPSDISMENMSTCGSYKAKLT  647

Query  491   LLDLYAGCGGMSTGLCLGAKLSGLNLVTKWAVDYQKSACDSLKFNHPETQVRNESVenfl  312
             LLDL++GCGGMSTGLCLGAK+S ++LVT+WA+D  +SAC SLK NHPET VRNE+ E+FL
Sbjct  648   LLDLFSGCGGMSTGLCLGAKVSCVDLVTRWALDSDESACQSLKLNHPETHVRNEAAEDFL  707

Query  311   kllkeweklckEY-----GSEPNAGSDDVLEGMEEGaddansladsddsdAEYEILRLVD  147
             +LLKEW+KLCK Y     G   N+ S  +   M +   + NS  D D +  EYE+ RLVD
Sbjct  708   ELLKEWQKLCKRYVVNDVGRTHNSRS--MASSMSK--QNKNSSNDDDIAPGEYEVARLVD  763

Query  146   ICFGDPNDTGKPGIHFQVRWKGYGPSEDTWEPIDGL  39
             IC+G  +  GK G+ F+V WKGY  SED+WEPI+GL
Sbjct  764   ICYGKTDKRGKRGLKFKVHWKGYSTSEDSWEPIEGL  799



>ref|XP_011028080.1| PREDICTED: DNA (cytosine-5)-methyltransferase CMT2 isoform X1 
[Populus euphratica]
Length=1218

 Score =   337 bits (863),  Expect = 3e-101, Method: Compositional matrix adjust.
 Identities = 190/336 (57%), Positives = 244/336 (73%), Gaps = 11/336 (3%)
 Frame = -2

Query  1025  DEEDEVILNVDCHYAQAKVLSFILNIGDCVYVKGEGEKKHVGRILEFFKTTEGEDYFRVQ  846
             D+ED+V+ NV+CHY QA +   I+N+GDCVYVKGEG K H+G ILEFFKTT+ EDYFRVQ
Sbjct  468   DDEDKVVWNVECHYTQADIEGRIINLGDCVYVKGEGAKNHIGSILEFFKTTDREDYFRVQ  527

Query  845   WFFRAEDTVMRDAAALHDKKRLFYSTLMNDNLLDCIISKVNVTEISPGLGLEVNNSPPSG  666
             WF+RAEDTVM++AA  HD KRLFYST+MNDN +DCIIS V V +ISP + L+ +++  S 
Sbjct  528   WFYRAEDTVMKEAADFHDNKRLFYSTVMNDNPIDCIISTVTVVQISPRVDLKFHSTLASD  587

Query  665   FYYDMEYCVDYSTFRNLPTVQSVNSWD-SP-SLIDASYKPITAYPVEHFKSCEPSKVELS  492
             FY+DMEYCVDYSTFR L T  S+   + SP    D+     +   +E+  +C   K +L+
Sbjct  588   FYFDMEYCVDYSTFRTLLTDCSLKGHELSPLPFCDSRSATPSDISMENMSTCGSYKAKLT  647

Query  491   LLDLYAGCGGMSTGLCLGAKLSGLNLVTKWAVDYQKSACDSLKFNHPETQVRNESVenfl  312
             LLDL++GCGGMSTGLCLGAK+S ++LVT+WA+D  +SAC SLK NHPET VRNE+ E+FL
Sbjct  648   LLDLFSGCGGMSTGLCLGAKVSCVDLVTRWALDSDESACQSLKLNHPETHVRNEAAEDFL  707

Query  311   kllkeweklckEY-----GSEPNAGSDDVLEGMEEGaddansladsddsdAEYEILRLVD  147
             +LLKEW+KLCK Y     G   N+ S  +   M +   + NS  D D +  EYE+ RLVD
Sbjct  708   ELLKEWQKLCKRYVVNDVGRTHNSRS--MASSMSK--QNKNSSNDDDIAPGEYEVARLVD  763

Query  146   ICFGDPNDTGKPGIHFQVRWKGYGPSEDTWEPIDGL  39
             IC+G  +  GK G+ F+V WKGY  SED+WEPI+GL
Sbjct  764   ICYGKTDKRGKRGLKFKVHWKGYSTSEDSWEPIEGL  799



>ref|XP_010110416.1| DNA (cytosine-5)-methyltransferase CMT2 [Morus notabilis]
 gb|EXC26248.1| DNA (cytosine-5)-methyltransferase CMT2 [Morus notabilis]
Length=1399

 Score =   335 bits (860),  Expect = 3e-100, Method: Compositional matrix adjust.
 Identities = 190/365 (52%), Positives = 250/365 (68%), Gaps = 38/365 (10%)
 Frame = -2

Query  1046  HTCFCSADEEDEVILNVDCHYAQAKVLSFILNIGDCVYVKGEGEKKHVGRILEFFKTTEG  867
              T   + D+ED+V+LNV+CH+AQA+V + I ++GDC +++G+G+KKHVGRI+EFFKTT+G
Sbjct  666   RTSKLNDDDEDKVVLNVECHFAQAQVGNCIFSLGDCAHIQGDGKKKHVGRIVEFFKTTDG  725

Query  866   EDYFRVQWFFRAEDTVMRDAAALHDKKRLFYSTLMNDNLLDCIISKVNVTEISPGLGLEV  687
             E YFRVQWF+  EDTV++D  A HDK+RLFYST+ NDNLLDCIISKV+VT+I+P +GL++
Sbjct  726   EKYFRVQWFYPIEDTVVQDVGAFHDKRRLFYSTIRNDNLLDCIISKVHVTKITPRVGLKI  785

Query  686   NNSPPSGFYYDMEYCVDYSTFRNLPTVQSVNSWDSPSLIDASYKPITAYPVEHFKSCEPS  507
             N+  P  FYYDMEYCVDYSTF      QS+ S +S +      K ++        + E  
Sbjct  786   NSISPCDFYYDMEYCVDYSTF------QSIESDNSTT---CGIKRVSTT------ATETH  830

Query  506   KVELSLLDLYAGCGGMSTGLCLGAKLSGLNLVTKWAVDYQKSACDSLKFNHPETQVRNES  327
               EL+LLDLY+GCGGMSTGLCLGAK+SG+NLVT+WA+D  KSAC+SLK NHP+T VRNE+
Sbjct  831   PAELALLDLYSGCGGMSTGLCLGAKISGVNLVTRWALDSSKSACESLKLNHPDTNVRNEA  890

Query  326   VenflkllkeweklckEYGSEPNAGSDDVLEGMEEGaddansladsddsdAEYEILRLVD  147
              E+F++LLKEWEKLCK Y S       +        A   +   D   SD E+E+ R VD
Sbjct  891   AEDFIELLKEWEKLCKRYRS----TKVERTHPSRSKASRESENDDELPSDDEFEVSRFVD  946

Query  146   ICFGDPNDTGKPGIHFQ-------------------VRWKGYGPSEDTWEPIDGLKSWKN  24
             IC+GDP  TGK G+ F+                   V WKGYG SED+WEP++GL + + 
Sbjct  947   ICYGDPAHTGKRGLKFKDAKMMIFLVVSFKSNNMKVVHWKGYGTSEDSWEPVEGLSNCRE  1006

Query  23    RQGWF  9
             +   F
Sbjct  1007  KIEEF  1011



>ref|XP_010677407.1| PREDICTED: DNA (cytosine-5)-methyltransferase CMT2 isoform X2 
[Beta vulgaris subsp. vulgaris]
Length=774

 Score =   325 bits (833),  Expect = 8e-100, Method: Compositional matrix adjust.
 Identities = 180/349 (52%), Positives = 248/349 (71%), Gaps = 10/349 (3%)
 Frame = -2

Query  1031  SADEEDEVILNVDCHYAQAKVLSFILNIGDCVYVKGEGEKKHVGRILEFFKTTEGEDYFR  852
             SA EE+E  L V CHY QA++   I ++GDC  ++GE +K H+GRI+EFF+T + EDYFR
Sbjct  32    SAREENEPTLEVKCHYTQAEINGCIFHLGDCALIRGENQK-HIGRIIEFFETMDREDYFR  90

Query  851   VQWFFRAEDTVMRDAAALHDKKRLFYSTLMNDNLLDCIISKVNVTEISPGLGLEVNNSPP  672
             VQWF++ EDTVM++ A+ HDKKR+FYS++MNDNLL CIISK+NV ++S  L +  ++  P
Sbjct  91    VQWFYKPEDTVMKEEASFHDKKRIFYSSIMNDNLLACIISKLNVIQVSHQLNMNSSSIEP  150

Query  671   SGFYYDMEYCVDYSTFRNLPTVQSVNSWDSPSL-IDASYKPITAYPVEHFKS-CEPSKVE  498
             S FYYDMEYC++YSTFRNLP   S+     PSL    S  P+T+ PV   ++ C+    E
Sbjct  151   SDFYYDMEYCLEYSTFRNLPRGDSLEGCKLPSLSCPESILPLTSSPVAVNRTICKTYNPE  210

Query  497   LSLLDLYAGCGGMSTGLCLGAKLSGLNLVTKWAVDYQKSACDSLKFNHPETQVRNESVen  318
             L++LD+YAGCGGMSTGLC+GAK SG+NLVT+WA+D   SAC+SL+ NH   ++ NE+ ++
Sbjct  211   LTMLDIYAGCGGMSTGLCMGAKHSGINLVTRWAIDADSSACESLRLNHSNIRIMNETADD  270

Query  317   flkllkeweklckEYGSE----PNAGSDDVLEGMEEGaddansladsddsdAEYEILRLV  150
             FL+LLK WE+LCK+Y  E    P +    V +  E     +++ ++SD    E E+L LV
Sbjct  271   FLELLKHWERLCKKYVIEETHQPFSSPQKVSDLAEAS---SDAQSNSDTEGDELEVLGLV  327

Query  149   DICFGDPNDTGKPGIHFQVRWKGYGPSEDTWEPIDGLKSWKNRQGWFTI  3
             DI +GD + +GK G+ F+VRWKG+GPSEDTWEPIDGL + ++    F I
Sbjct  328   DIRYGDADGSGKEGLQFKVRWKGFGPSEDTWEPIDGLSNCQDLIQEFVI  376



>ref|XP_008790945.1| PREDICTED: DNA (cytosine-5)-methyltransferase CMT2-like [Phoenix 
dactylifera]
Length=994

 Score =   330 bits (845),  Expect = 9e-100, Method: Compositional matrix adjust.
 Identities = 184/344 (53%), Positives = 232/344 (67%), Gaps = 16/344 (5%)
 Frame = -2

Query  1031  SADEEDEVILNVDCHYAQAKVLSFILNIGDCVYVKGE-GEKKHVGRILEFFKTTEGEDYF  855
             ++++EDE+IL+V CHY QA +   IL+IGDC YVKGE G+  +VGRILEFF+T  GE YF
Sbjct  259   NSEDEDEIILDVKCHYLQASICGCILDIGDCTYVKGEKGKPNYVGRILEFFETIRGEYYF  318

Query  854   RVQWFFRAEDTVMRDAAALHDKKRLFYSTLMNDNLLDCIISKVNVTEISPGLGLEVNNSP  675
              VQWFFRAEDT+M+   A HDKKRLFYS L NDN LDCI+SKV V ++ P +  +    P
Sbjct  319   TVQWFFRAEDTIMKVQGASHDKKRLFYSDLKNDNPLDCIVSKVRVAQVPPCVDFQSKPIP  378

Query  674   PSGFYYDMEYCVDYSTFRNLPTVQSVNSWDSPSLIDASYKPITAYPVEHFKSCEPSKVEL  495
                FYYDM+Y VDYSTF    T+++ +S D  S+++  Y            SC   K EL
Sbjct  379   SCYFYYDMKYSVDYSTFY---TMENDDSEDK-SIVNQKY-----------SSCASEKTEL  423

Query  494   SLLDLYAGCGGMSTGLCLGAKLSGLNLVTKWAVDYQKSACDSLKFNHPETQVRNESVenf  315
             +LLDLY+GCGGMSTGLC+GA ++G+NL T+WAVD   ++C+SLK NHPETQVRNE+V +F
Sbjct  424   ALLDLYSGCGGMSTGLCMGAHVAGVNLATRWAVDVSVASCESLKLNHPETQVRNEAVNDF  483

Query  314   lkllkeweklckEYGSEPNAGSDDVLEGMEEGaddansladsddsdAEYEILRLVDICFG  135
               LLKEWEKLCK YG       D              + + S     EYE+LRLVDIC+G
Sbjct  484   FDLLKEWEKLCKRYGVNTGKMKDSTSWKSNVKDSRKEAQSYSAIPAGEYEVLRLVDICYG  543

Query  134   DPNDTGKPGIHFQVRWKGYGPSEDTWEPIDGLKSWKNRQGWFTI  3
             DP + GK G+ F+VRWKGY PS DTWEPI+GL + + R   F I
Sbjct  544   DPTNVGKRGLKFKVRWKGYSPSHDTWEPIEGLSNCEERIRDFVI  587



>ref|XP_010677408.1| PREDICTED: DNA (cytosine-5)-methyltransferase CMT2 isoform X3 
[Beta vulgaris subsp. vulgaris]
Length=773

 Score =   323 bits (829),  Expect = 3e-99, Method: Compositional matrix adjust.
 Identities = 179/349 (51%), Positives = 248/349 (71%), Gaps = 10/349 (3%)
 Frame = -2

Query  1031  SADEEDEVILNVDCHYAQAKVLSFILNIGDCVYVKGEGEKKHVGRILEFFKTTEGEDYFR  852
             +A EE+E  L V CHY QA++   I ++GDC  ++GE +K H+GRI+EFF+T + EDYFR
Sbjct  31    NAREENEPTLEVKCHYTQAEINGCIFHLGDCALIRGENQK-HIGRIIEFFETMDREDYFR  89

Query  851   VQWFFRAEDTVMRDAAALHDKKRLFYSTLMNDNLLDCIISKVNVTEISPGLGLEVNNSPP  672
             VQWF++ EDTVM++ A+ HDKKR+FYS++MNDNLL CIISK+NV ++S  L +  ++  P
Sbjct  90    VQWFYKPEDTVMKEEASFHDKKRIFYSSIMNDNLLACIISKLNVIQVSHQLNMNSSSIEP  149

Query  671   SGFYYDMEYCVDYSTFRNLPTVQSVNSWDSPSL-IDASYKPITAYPVEHFKS-CEPSKVE  498
             S FYYDMEYC++YSTFRNLP   S+     PSL    S  P+T+ PV   ++ C+    E
Sbjct  150   SDFYYDMEYCLEYSTFRNLPRGDSLEGCKLPSLSCPESILPLTSSPVAVNRTICKTYNPE  209

Query  497   LSLLDLYAGCGGMSTGLCLGAKLSGLNLVTKWAVDYQKSACDSLKFNHPETQVRNESVen  318
             L++LD+YAGCGGMSTGLC+GAK SG+NLVT+WA+D   SAC+SL+ NH   ++ NE+ ++
Sbjct  210   LTMLDIYAGCGGMSTGLCMGAKHSGINLVTRWAIDADSSACESLRLNHSNIRIMNETADD  269

Query  317   flkllkeweklckEYGSE----PNAGSDDVLEGMEEGaddansladsddsdAEYEILRLV  150
             FL+LLK WE+LCK+Y  E    P +    V +  E     +++ ++SD    E E+L LV
Sbjct  270   FLELLKHWERLCKKYVIEETHQPFSSPQKVSDLAE---ASSDAQSNSDTEGDELEVLGLV  326

Query  149   DICFGDPNDTGKPGIHFQVRWKGYGPSEDTWEPIDGLKSWKNRQGWFTI  3
             DI +GD + +GK G+ F+VRWKG+GPSEDTWEPIDGL + ++    F I
Sbjct  327   DIRYGDADGSGKEGLQFKVRWKGFGPSEDTWEPIDGLSNCQDLIQEFVI  375



>ref|XP_010677406.1| PREDICTED: DNA (cytosine-5)-methyltransferase CMT2 isoform X1 
[Beta vulgaris subsp. vulgaris]
Length=1060

 Score =   325 bits (834),  Expect = 9e-98, Method: Compositional matrix adjust.
 Identities = 178/349 (51%), Positives = 248/349 (71%), Gaps = 10/349 (3%)
 Frame = -2

Query  1031  SADEEDEVILNVDCHYAQAKVLSFILNIGDCVYVKGEGEKKHVGRILEFFKTTEGEDYFR  852
             +A EE+E  L V CHY QA++   I ++GDC  ++GE +K H+GRI+EFF+T + EDYFR
Sbjct  318   NAREENEPTLEVKCHYTQAEINGCIFHLGDCALIRGENQK-HIGRIIEFFETMDREDYFR  376

Query  851   VQWFFRAEDTVMRDAAALHDKKRLFYSTLMNDNLLDCIISKVNVTEISPGLGLEVNNSPP  672
             VQWF++ EDTVM++ A+ HDKKR+FYS++MNDNLL CIISK+NV ++S  L +  ++  P
Sbjct  377   VQWFYKPEDTVMKEEASFHDKKRIFYSSIMNDNLLACIISKLNVIQVSHQLNMNSSSIEP  436

Query  671   SGFYYDMEYCVDYSTFRNLPTVQSVNSWDSPSL-IDASYKPITAYPVEHFKS-CEPSKVE  498
             S FYYDMEYC++YSTFRNLP   S+     PSL    S  P+T+ PV   ++ C+    E
Sbjct  437   SDFYYDMEYCLEYSTFRNLPRGDSLEGCKLPSLSCPESILPLTSSPVAVNRTICKTYNPE  496

Query  497   LSLLDLYAGCGGMSTGLCLGAKLSGLNLVTKWAVDYQKSACDSLKFNHPETQVRNESVen  318
             L++LD+YAGCGGMSTGLC+GAK SG+NLVT+WA+D   SAC+SL+ NH   ++ NE+ ++
Sbjct  497   LTMLDIYAGCGGMSTGLCMGAKHSGINLVTRWAIDADSSACESLRLNHSNIRIMNETADD  556

Query  317   flkllkeweklckEY----GSEPNAGSDDVLEGMEEGaddansladsddsdAEYEILRLV  150
             FL+LLK WE+LCK+Y      +P +    V +  E     +++ ++SD    E E+L LV
Sbjct  557   FLELLKHWERLCKKYVIEETHQPFSSPQKVSDLAEAS---SDAQSNSDTEGDELEVLGLV  613

Query  149   DICFGDPNDTGKPGIHFQVRWKGYGPSEDTWEPIDGLKSWKNRQGWFTI  3
             DI +GD + +GK G+ F+VRWKG+GPSEDTWEPIDGL + ++    F I
Sbjct  614   DIRYGDADGSGKEGLQFKVRWKGFGPSEDTWEPIDGLSNCQDLIQEFVI  662



>ref|XP_010908353.1| PREDICTED: DNA (cytosine-5)-methyltransferase CMT2-like [Elaeis 
guineensis]
Length=1011

 Score =   324 bits (831),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 183/352 (52%), Positives = 230/352 (65%), Gaps = 12/352 (3%)
 Frame = -2

Query  1031  SADEEDEVILNVDCHYAQAKVLSFILNIGDCVYVKGEGEK-KHVGRILEFFKTTEGEDYF  855
             + ++EDE+IL+V CHY QA +   IL+IGDC YVKGE  K  +VGRILEFF+T  GE YF
Sbjct  253   NTEDEDEIILDVKCHYLQASICGCILDIGDCTYVKGEKRKPNYVGRILEFFETIRGEYYF  312

Query  854   RVQWFFRAEDTVMRDAAALHDKKRLFYSTLMNDNLLDCIISKVNVTEISPGLGLEVNNSP  675
              VQWFFRAEDT+M+   A HDKKRLFYS L NDN LDCI+SKV V+++ P +  +    P
Sbjct  313   TVQWFFRAEDTIMKAQGASHDKKRLFYSDLKNDNPLDCIVSKVGVSQVPPCVDFKSRPIP  372

Query  674   PSGFYYDMEYCVDYSTFRNLPT--------VQSVNSWDSPSLIDASYKPITAYPVEHFKS  519
                FYYDM+Y VDYSTF  +          +   N   +    DA  +PI    +    S
Sbjct  373   SCYFYYDMKYSVDYSTFYTMENDYLGEKSDLSLSNCSRTNHTNDAKTEPIM---MPKNSS  429

Query  518   CEPSKVELSLLDLYAGCGGMSTGLCLGAKLSGLNLVTKWAVDYQKSACDSLKFNHPETQV  339
             C   K EL+LLDLY+GCGGMSTGLC+GA ++G+NLVT+WAVD  +++C+ LK NHPETQV
Sbjct  430   CASEKTELALLDLYSGCGGMSTGLCMGAHVAGVNLVTRWAVDVSEASCEGLKLNHPETQV  489

Query  338   RNESVenflkllkeweklckEYGSEPNAGSDDVLEGMEEGaddansladsddsdAEYEIL  159
             RNE+V +F  LLKEWEKLCK Y        D              +   S    AEYE+L
Sbjct  490   RNETVNDFFDLLKEWEKLCKRYVVNIGKKKDSTSWKSNVKDSRKEAQTYSAIPAAEYEVL  549

Query  158   RLVDICFGDPNDTGKPGIHFQVRWKGYGPSEDTWEPIDGLKSWKNRQGWFTI  3
             R+VDIC+GDP + GK G+ F+VRWKGY PS+DTWEPI+GL + + R   F I
Sbjct  550   RIVDICYGDPTNVGKRGLKFKVRWKGYRPSDDTWEPIEGLSNCEERIQDFVI  601



>ref|XP_010054090.1| PREDICTED: DNA (cytosine-5)-methyltransferase CMT2 isoform X1 
[Eucalyptus grandis]
 ref|XP_010054091.1| PREDICTED: DNA (cytosine-5)-methyltransferase CMT2 isoform X1 
[Eucalyptus grandis]
 gb|KCW78468.1| hypothetical protein EUGRSUZ_D02616 [Eucalyptus grandis]
Length=1233

 Score =   322 bits (825),  Expect = 8e-96, Method: Compositional matrix adjust.
 Identities = 181/339 (53%), Positives = 235/339 (69%), Gaps = 12/339 (4%)
 Frame = -2

Query  1028  ADEEDEVILNVDCHYAQAKVLSFILNIGDCVYVKGEGEKKHVGRILEFFKTTEGEDYFRV  849
             +D+EDE+I NV CHY QA+V   I  IGDC Y++G+  KKHVGRILEFF+TT+ EDY RV
Sbjct  472   SDDEDEIITNVKCHYRQAEVNGCIFEIGDCAYLRGDKGKKHVGRILEFFRTTDEEDYIRV  531

Query  848   QWFFRAEDTVMRDAAALHDKKRLFYSTLMNDNLLDCIISKVNVTEISPGLGLEVNNSPPS  669
             +WF+RAEDTVM++ ++ HDKKRLFYS + NDN +DCI+SKV V  ++P +G++  +   S
Sbjct  532   RWFYRAEDTVMQNQSSFHDKKRLFYSAVENDNPVDCILSKVKVARLNPKVGVKSTHI-RS  590

Query  668   GFYYDMEYCVDYSTFRNLPTVQSVNSWDSPSL--IDASYKPITAYPVEHFKSCEPSKVEL  495
              FYYDMEY ++YSTFR L +    N  DSPS   ++ S         E+       K EL
Sbjct  591   DFYYDMEYSLEYSTFRTLISDGLTNGNDSPSCNSLNGSASSDIGTTSENMLRSGTQKEEL  650

Query  494   SLLDLYAGCGGMSTGLCLGAKLSGLNLVTKWAVDYQKSACDSLKFNHPETQVRNESVenf  315
             +LLDLY+GCGGMSTGL LGAKLS  +LVT+WA+D  KSAC+S K NHPET++RNE  E F
Sbjct  651   TLLDLYSGCGGMSTGLHLGAKLSRTDLVTRWALDCDKSACESFKLNHPETKIRNEGAEEF  710

Query  314   lkllkeweklckEYGSEPNAGSDDVLEGMEEG-----addansladsddsdAEYEILRLV  150
             LKLLKEWEKLCK++  +   G    L G+ +          +    +D    E+E+  LV
Sbjct  711   LKLLKEWEKLCKQFAVKSVEG----LHGLRKNNCRVTRSRGSPADVADTPKDEHEVSSLV  766

Query  149   DICFGDPNDTGKPGIHFQVRWKGYGPSEDTWEPIDGLKS  33
             DIC+GDPN+ GKPG+HF+V WKGY   EDTWEPI+GL++
Sbjct  767   DICYGDPNEIGKPGLHFKVHWKGYSSKEDTWEPIEGLRN  805



>gb|KDO58824.1| hypothetical protein CISIN_1g046469mg, partial [Citrus sinensis]
Length=521

 Score =   306 bits (784),  Expect = 3e-95, Method: Compositional matrix adjust.
 Identities = 145/236 (61%), Positives = 185/236 (78%), Gaps = 1/236 (0%)
 Frame = -2

Query  1031  SADEEDEVILNVDCHYAQAKVLSFILNIGDCVYVKGEGEKKHVGRILEFFKTTEGEDYFR  852
             S D+ED+++ NV+CHYAQA++   I ++GDC Y+KGEG +KH+G+ILEFFKTT+GE+YFR
Sbjct  28    SDDDEDKIVSNVECHYAQARIGECIFDLGDCAYIKGEGTQKHIGKILEFFKTTDGEEYFR  87

Query  851   VQWFFRAEDTVMRDAAALHDKKRLFYSTLMNDNLLDCIISKVNVTEISPGLGLEVNNSPP  672
             VQWF+RAEDTVM++AA  HD+KRLFYST+MNDN +DCIISKV V +I P +GL+ N+ P 
Sbjct  88    VQWFYRAEDTVMKEAADFHDRKRLFYSTVMNDNPVDCIISKVIVAQIPPKIGLKSNSIPS  147

Query  671   SGFYYDMEYCVDYSTFRNLPTVQSVNSWDSPSLIDASYKPITAYPVEHFKSCEPSKVELS  492
             S FY+DMEYCV+YSTFR L T + ++    PS  +      T+   E+  +  P K EL+
Sbjct  148   SDFYFDMEYCVEYSTFRTLLTGK-IHDLSLPSCTETVPTTATSTFFENMPNHGPHKAELA  206

Query  491   LLDLYAGCGGMSTGLCLGAKLSGLNLVTKWAVDYQKSACDSLKFNHPETQVRNESV  324
             LLDLY+GCGGMSTGLCLGAKLS  NLVT+WA+D  KSAC+SLK NHPE QVRNE+ 
Sbjct  207   LLDLYSGCGGMSTGLCLGAKLSCTNLVTRWALDSDKSACESLKLNHPEAQVRNEAA  262


 Score = 78.6 bits (192),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 32/56 (57%), Positives = 44/56 (79%), Gaps = 0/56 (0%)
 Frame = -2

Query  173  EYEILRLVDICFGDPNDTGKPGIHFQVRWKGYGPSEDTWEPIDGLKSWKNRQGWFT  6
            EYE+ R+VDIC+GDPN++GK G++F+V WKGY  SED+WEPI+GL++   R   F 
Sbjct  354  EYEVARIVDICYGDPNESGKRGLNFKVHWKGYSTSEDSWEPIEGLRNCPERIKEFV  409



>ref|XP_010671153.1| PREDICTED: DNA (cytosine-5)-methyltransferase CMT2-like [Beta 
vulgaris subsp. vulgaris]
Length=841

 Score =   311 bits (797),  Expect = 6e-94, Method: Compositional matrix adjust.
 Identities = 173/338 (51%), Positives = 233/338 (69%), Gaps = 12/338 (4%)
 Frame = -2

Query  992  CHYAQAKVLSFILNIGDCVYVKGEGEKKH-VGRILEFFKTTEGEDYFRVQWFFRAEDTVM  816
            CHY+QA+V++ + NIGDC YVKGE  KK+ +GRI+EFFKT + EDYFRVQWFFRAEDTV+
Sbjct  101  CHYSQAEVVNHVFNIGDCAYVKGEKRKKNFIGRIVEFFKTMDDEDYFRVQWFFRAEDTVI  160

Query  815  RDAAALHDKKRLFYSTLMNDNLLDCIISKVNVTEISPGLGLEVNNSPPSGFYYDMEYCVD  636
             D A  HD++RLF S LMNDN LDCI+SKV + ++   + L+  +     FYYDM+Y VD
Sbjct  161  EDEAKCHDERRLFLSDLMNDNPLDCIVSKVKIIQVPASVDLKPKSLSAFDFYYDMKYFVD  220

Query  635  YSTFRNLPTVQ-SVNSWDSPSLIDAS-YKPITAYPVEHFKSCEPSKVELSLLDLYAGCGG  462
            Y+TF  +   +  ++S D+   I AS  KP       +F   +P K +++LLDLY+GCGG
Sbjct  221  YTTFSTVVDDEPGLSSCDNMKKIQASGLKP----NFWNFSGHKPKKSDMALLDLYSGCGG  276

Query  461  MSTGLCLGAKLSGLNLVTKWAVDYQKSACDSLKFNHPETQVRNESVenflkllkeweklc  282
            MSTGLCLGAK +G+NL T+WA+D  KSAC+SL+ NHP+ Q+RNE  E +L LLKEW+KLC
Sbjct  277  MSTGLCLGAKFAGINLKTRWALDINKSACESLRLNHPQVQIRNEPAEEYLGLLKEWDKLC  336

Query  281  kEY----GSEPNAGSDDVLEGMEE-GaddansladsddsdAEYEILRLVDICFGDPNDTG  117
            K Y    G++  +      + + +  +  + + + +     EYE+  LVDIC+GDPN  G
Sbjct  337  KRYVDNTGNKTKSSPRVQKQSLSQLQSQRSMNSSKNKKLSVEYEVASLVDICYGDPNKRG  396

Query  116  KPGIHFQVRWKGYGPSEDTWEPIDGLKSWKNRQGWFTI  3
            K G+HFQVRW GYGPSEDTWEPI+GL + + R   F +
Sbjct  397  KHGLHFQVRWVGYGPSEDTWEPIEGLSNCQERIQEFVL  434



>ref|XP_010665041.1| PREDICTED: DNA (cytosine-5)-methyltransferase CMT2-like isoform 
X3 [Vitis vinifera]
Length=1349

 Score =   314 bits (804),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 148/232 (64%), Positives = 183/232 (79%), Gaps = 2/232 (1%)
 Frame = -2

Query  1025  DEEDEVILNVDCHYAQAKVLSFILNIGDCVYVKGEGEKKHVGRILEFFKTTEGEDYFRVQ  846
             D E+E++ NV+CHY QAK+   I N+GDC ++KGEGE+KHVGRILEFFKTTEGEDYFRVQ
Sbjct  693   DNEEEIVTNVECHYTQAKLDGTIFNLGDCAHIKGEGEQKHVGRILEFFKTTEGEDYFRVQ  752

Query  845   WFFRAEDTVMRDAAALHDKKRLFYSTLMNDNLLDCIISKVNVTEISPGLGLEVNNSPPSG  666
             WF+RAEDTVM++ AA HDKKR+F ST+MNDN LDCIISKVNV E++P + L++++ PP  
Sbjct  753   WFYRAEDTVMKEEAASHDKKRIFCSTIMNDNSLDCIISKVNVLELTPRVSLKLDSIPPFD  812

Query  665   FYYDMEYCVDYSTFRNLPTVQSVNSWD--SPSLIDASYKPITAYPVEHFKSCEPSKVELS  492
             +YYDM+Y V+YSTF  L +  SV  +D  SP+ I+           E    C+P K EL+
Sbjct  813   YYYDMKYNVEYSTFHTLLSDNSVKGYDLVSPNCIETPLSVANTTFPEDMDGCKPDKAELA  872

Query  491   LLDLYAGCGGMSTGLCLGAKLSGLNLVTKWAVDYQKSACDSLKFNHPETQVR  336
             LLDLY+GCGGMSTGLCLGAKLS +NLVTKWA+D+ KSAC+SLK NHPETQVR
Sbjct  873   LLDLYSGCGGMSTGLCLGAKLSCVNLVTKWALDFDKSACESLKLNHPETQVR  924



>ref|XP_006414021.1| hypothetical protein EUTSA_v10024250mg [Eutrema salsugineum]
 gb|ESQ55474.1| hypothetical protein EUTSA_v10024250mg [Eutrema salsugineum]
Length=1192

 Score =   313 bits (802),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 179/344 (52%), Positives = 238/344 (69%), Gaps = 8/344 (2%)
 Frame = -2

Query  1031  SADEEDEVILNVDCHYAQAKVLSFILNIGDCVYVKGEGEKKHVGRILEFFKTTEGEDYFR  852
             S D+ED+++ NV+CHY QAKV +   ++GD  Y+KGE E+KH+G+I+EFFKTT+GE YFR
Sbjct  452   SEDDEDKIVANVECHYLQAKVDNQTFSLGDFTYIKGEEEEKHIGKIVEFFKTTDGECYFR  511

Query  851   VQWFFRAEDTVMRDAAALHDKKRLFYSTLMNDNLLDCIISKVNVTEISPGLGLEVNNSPP  672
             VQWF+RA DTVM+  A  HDK+RLFYST+MNDN +DCIISKV V ++SP  GL+  +S  
Sbjct  512   VQWFYRATDTVMKQQATYHDKRRLFYSTVMNDNPIDCIISKVTVLQVSPRAGLKP-SSIK  570

Query  671   SGFYYDMEYCVDYSTFRNLPTVQSVNSWDSPSLIDASYKP-ITAYPVEHFKSCEPSKVEL  495
             S FY+DMEYCV+YSTF+ L  ++S    +     D    P IT   +E+    +    EL
Sbjct  571   SDFYFDMEYCVEYSTFQTLRNLESTE--NKLEFCDDVVPPEITESLLEN----KLFSKEL  624

Query  494   SLLDLYAGCGGMSTGLCLGAKLSGLNLVTKWAVDYQKSACDSLKFNHPETQVRNESVenf  315
              +LDLY+GCGGMSTGL LGAK+SG+++VTKWAVD   +AC+SLK NHP+TQVRN++  +F
Sbjct  625   PVLDLYSGCGGMSTGLSLGAKISGVDVVTKWAVDQNLAACESLKLNHPQTQVRNDAAGDF  684

Query  314   lkllkeweklckEYGSEPNAGSDDVLEGMEEGaddansladsddsdAEYEILRLVDICFG  135
             L LLKEW+KLCK Y    N  +D +     +      S +  D    EYEI +LVDIC+G
Sbjct  685   LLLLKEWDKLCKRYVFNNNQTTDTLRSINSKRETSERSSSSDDSEPEEYEIEKLVDICYG  744

Query  134   DPNDTGKPGIHFQVRWKGYGPSEDTWEPIDGLKSWKNRQGWFTI  3
             DP++TG  G+ F+V WKGY  +EDTWEP   L + ++    F I
Sbjct  745   DPDNTGASGLKFKVHWKGYNSNEDTWEPAKELSNCQDSMRDFVI  788



>ref|XP_010518849.1| PREDICTED: DNA (cytosine-5)-methyltransferase CMT2 isoform X3 
[Tarenaya hassleriana]
Length=917

 Score =   305 bits (782),  Expect = 3e-91, Method: Compositional matrix adjust.
 Identities = 176/333 (53%), Positives = 236/333 (71%), Gaps = 7/333 (2%)
 Frame = -2

Query  1025  DEEDEVILNVDCHYAQAKVLSFILNIGDCVYVKGEGEKKHVGRILEFFKTTEGEDYFRVQ  846
             D+EDE++ +V+CHY+QA V     ++GD  Y++GE E+KHVG+I+EFFKTT+GE YFRVQ
Sbjct  175   DDEDEIVASVECHYSQANVNGRTFSLGDFAYIRGE-EQKHVGKIIEFFKTTDGEGYFRVQ  233

Query  845   WFFRAEDTVMRDAAALHDKKRLFYSTLMNDNLLDCIISKVNVTEISPGLGLEVNNSPPSG  666
             WF+RAEDTVM+  AA HD++RLFYST+MNDN +DCIIS V+++++SP  G    +S  S 
Sbjct  234   WFYRAEDTVMKQQAAAHDERRLFYSTVMNDNPIDCIISNVSISQVSPRAGRN-PSSIQSD  292

Query  665   FYYDMEYCVDYSTFRNLPTVQSVNSWDSPSLIDASYKPITAYPVEHFKSCEPSKVELSLL  486
             FY+DMEYCV+YSTFR L    S  + +   L      P T+   +     E    EL+LL
Sbjct  293   FYFDMEYCVEYSTFRTLRNNNSSENDNMLLLPHIKAAPKTS--TDGLLVNEHQSRELTLL  350

Query  485   DLYAGCGGMSTGLCLGAKLSGLNLVTKWAVDYQKSACDSLKFNHPETQVRNESVenflkl  306
             DLY+GCGGMSTGLCLGAK+SG+ ++TKWAVD + SAC SLK NHPETQVRN++  +FL+L
Sbjct  351   DLYSGCGGMSTGLCLGAKISGVGVITKWAVDLELSACQSLKLNHPETQVRNDAAGDFLQL  410

Query  305   lkeweklckEYG--SEPNAGSDDVLEGMEEGaddansladsddsdAEYEILRLVDICFGD  132
             LKEW+KLCK Y   +E  A     +   E    +++S +D D    E+E+ +LVDIC+GD
Sbjct  411   LKEWDKLCKLYAFDNEQRAHKSRSMV-SEVETSESSSSSDYDSESDEFEVEKLVDICYGD  469

Query  131   PNDTGKPGIHFQVRWKGYGPSEDTWEPIDGLKS  33
             P  TGK G+ F+V W+GY  SED+WEP + L +
Sbjct  470   PGKTGKAGLKFKVHWRGYSCSEDSWEPAENLST  502



>ref|XP_010518848.1| PREDICTED: DNA (cytosine-5)-methyltransferase CMT2 isoform X2 
[Tarenaya hassleriana]
Length=1227

 Score =   307 bits (787),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 177/339 (52%), Positives = 245/339 (72%), Gaps = 13/339 (4%)
 Frame = -2

Query  1025  DEEDEVILNVDCHYAQAKVLSFILNIGDCVYVKGEGEKKHVGRILEFFKTTEGEDYFRVQ  846
             D+EDE++ +V+CHY+QA V     ++GD  Y++GE E+KHVG+I+EFFKTT+GE YFRVQ
Sbjct  548   DDEDEIVASVECHYSQANVNGRTFSLGDFAYIRGE-EQKHVGKIIEFFKTTDGEGYFRVQ  606

Query  845   WFFRAEDTVMRDAAALHDKKRLFYSTLMNDNLLDCIISKVNVTEISPGLGLEVNNSPPSG  666
             WF+RAEDTVM+  AA HD++RLFYST+MNDN +DCIIS V+++++SP  G    +S  S 
Sbjct  607   WFYRAEDTVMKQQAAAHDERRLFYSTVMNDNPIDCIISNVSISQVSPRAGRNP-SSIQSD  665

Query  665   FYYDMEYCVDYSTFRNLPTVQSVNSWDSPSLIDASYKPITAYP---VEHFKSCEPSKVEL  495
             FY+DMEYCV+YSTFR   T+++ NS ++ +++   +  I A P    +     E    EL
Sbjct  666   FYFDMEYCVEYSTFR---TLRNNNSSENDNMLLLPH--IKAAPKTSTDGLLVNEHQSREL  720

Query  494   SLLDLYAGCGGMSTGLCLGAKLSGLNLVTKWAVDYQKSACDSLKFNHPETQVRNESVenf  315
             +LLDLY+GCGGMSTGLCLGAK+SG+ ++TKWAVD + SAC SLK NHPETQVRN++  +F
Sbjct  721   TLLDLYSGCGGMSTGLCLGAKISGVGVITKWAVDLELSACQSLKLNHPETQVRNDAAGDF  780

Query  314   lkllkeweklckEYG--SEPNAGSDDVLEGMEEGaddansladsddsdAEYEILRLVDIC  141
             L+LLKEW+KLCK Y   +E  A     +   E    +++S +D D    E+E+ +LVDIC
Sbjct  781   LQLLKEWDKLCKLYAFDNEQRAHKSRSMV-SEVETSESSSSSDYDSESDEFEVEKLVDIC  839

Query  140   FGDPNDTGKPGIHFQVRWKGYGPSEDTWEPIDGLKSWKN  24
             +GDP  TGK G+ F+V W+GY  SED+WEP + L + ++
Sbjct  840   YGDPGKTGKAGLKFKVHWRGYSCSEDSWEPAENLSTCQD  878



>ref|XP_006385690.1| hypothetical protein POPTR_0003s09920g, partial [Populus trichocarpa]
 gb|ERP63487.1| hypothetical protein POPTR_0003s09920g, partial [Populus trichocarpa]
Length=972

 Score =   304 bits (779),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 181/362 (50%), Positives = 235/362 (65%), Gaps = 24/362 (7%)
 Frame = -2

Query  1118  WR*QNEVLFFAVFKTSICLHSFIWHTCFCSADEEDEVILNVDCHYAQAKVLSFILNIGDC  939
             W  + E+    VF    CL  F++   F S D+ED+V+ NV+CHY QA +   I+N+GDC
Sbjct  419   WHWRYEMKLLMVF----CLSIFVYARLF-SDDDEDKVVWNVECHYTQANIEGRIINLGDC  473

Query  938   VYVKGEGEKKHVGRILEFFKTTEGEDYFRVQWFFRAEDTVMRDAAALHDKKRLFYSTLMN  759
             VYVKGEG K H+G ILEFFKTT+ EDYFRVQWF+RAEDTVM++AA  HD KRLFYST+MN
Sbjct  474   VYVKGEGAKNHIGSILEFFKTTDREDYFRVQWFYRAEDTVMKEAADFHDNKRLFYSTVMN  533

Query  758   DNLLDCIISKVNVTEISPGLGLEVNNSPPSGFYYDMEYCVDYSTFRNLPTVQSVNSWDSP  579
             DN +DCIISKV V +ISP     V +   +      +  +       LP   S ++  +P
Sbjct  534   DNPIDCIISKVTVVQISP----RVRHDTYTSDVLSPDCSLRGHELSPLPFCDSRSA--TP  587

Query  578   SLIDASYKPITAYPVEHFKSCEPSKVELSLLDLYAGCGGMSTGLCLGAKLSGLNLVTKWA  399
             S I           +E+  +C   K +L+LLDL++GCGGMSTGLCLGAK+S ++LVT+WA
Sbjct  588   SDIS----------MENMSTCGSYKAKLTLLDLFSGCGGMSTGLCLGAKVSCVDLVTRWA  637

Query  398   VDYQKSACDSLKFNHPETQVRNESVenflkllkeweklckEYGSEPNAGSDDVLEGMEEG  219
             +D  +SAC SLK NHPET VRNE+ E+FL+LLKEW+KLCK Y    + G       M   
Sbjct  638   LDSDESACQSLKLNHPETHVRNEAAEDFLELLKEWQKLCKRYAVN-DVGRTHKSRSMASS  696

Query  218   addanslads--ddsdAEYEILRLVDICFGDPNDTGKPGIHFQVRWKGYGPSEDTWEPID  45
                 N  + +  D +  EYE+ RLVDIC+G  +  GK G+ F+V WKGY  SED+WEPI+
Sbjct  697   MSKQNKNSSNDDDIASGEYEVARLVDICYGKTDKRGKRGLKFKVHWKGYSTSEDSWEPIE  756

Query  44    GL  39
             GL
Sbjct  757   GL  758



>ref|XP_010518846.1| PREDICTED: DNA (cytosine-5)-methyltransferase CMT2 isoform X1 
[Tarenaya hassleriana]
Length=1290

 Score =   307 bits (786),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 177/339 (52%), Positives = 245/339 (72%), Gaps = 13/339 (4%)
 Frame = -2

Query  1025  DEEDEVILNVDCHYAQAKVLSFILNIGDCVYVKGEGEKKHVGRILEFFKTTEGEDYFRVQ  846
             D+EDE++ +V+CHY+QA V     ++GD  Y++GE E+KHVG+I+EFFKTT+GE YFRVQ
Sbjct  548   DDEDEIVASVECHYSQANVNGRTFSLGDFAYIRGE-EQKHVGKIIEFFKTTDGEGYFRVQ  606

Query  845   WFFRAEDTVMRDAAALHDKKRLFYSTLMNDNLLDCIISKVNVTEISPGLGLEVNNSPPSG  666
             WF+RAEDTVM+  AA HD++RLFYST+MNDN +DCIIS V+++++SP  G    +S  S 
Sbjct  607   WFYRAEDTVMKQQAAAHDERRLFYSTVMNDNPIDCIISNVSISQVSPRAGRNP-SSIQSD  665

Query  665   FYYDMEYCVDYSTFRNLPTVQSVNSWDSPSLIDASYKPITAYP---VEHFKSCEPSKVEL  495
             FY+DMEYCV+YSTFR   T+++ NS ++ +++   +  I A P    +     E    EL
Sbjct  666   FYFDMEYCVEYSTFR---TLRNNNSSENDNMLLLPH--IKAAPKTSTDGLLVNEHQSREL  720

Query  494   SLLDLYAGCGGMSTGLCLGAKLSGLNLVTKWAVDYQKSACDSLKFNHPETQVRNESVenf  315
             +LLDLY+GCGGMSTGLCLGAK+SG+ ++TKWAVD + SAC SLK NHPETQVRN++  +F
Sbjct  721   TLLDLYSGCGGMSTGLCLGAKISGVGVITKWAVDLELSACQSLKLNHPETQVRNDAAGDF  780

Query  314   lkllkeweklckEYG--SEPNAGSDDVLEGMEEGaddansladsddsdAEYEILRLVDIC  141
             L+LLKEW+KLCK Y   +E  A     +   E    +++S +D D    E+E+ +LVDIC
Sbjct  781   LQLLKEWDKLCKLYAFDNEQRAHKSRSMV-SEVETSESSSSSDYDSESDEFEVEKLVDIC  839

Query  140   FGDPNDTGKPGIHFQVRWKGYGPSEDTWEPIDGLKSWKN  24
             +GDP  TGK G+ F+V W+GY  SED+WEP + L + ++
Sbjct  840   YGDPGKTGKAGLKFKVHWRGYSCSEDSWEPAENLSTCQD  878



>gb|EYU45367.1| hypothetical protein MIMGU_mgv1a020188mg [Erythranthe guttata]
Length=885

 Score =   300 bits (769),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 164/336 (49%), Positives = 229/336 (68%), Gaps = 10/336 (3%)
 Frame = -2

Query  1010  VILNVDCHYAQAKVLSFILNIGDCVYVKG-EGEKKHVGRILEFFKTTEGEDYFRVQWFFR  834
             +++N+ CHY++A++   + ++GDC YVKG EG   +VG+ILEFF+T +GEDYFRVQWFFR
Sbjct  151   IVMNIKCHYSKAEIHKIVFDLGDCAYVKGPEGGPNYVGKILEFFETIDGEDYFRVQWFFR  210

Query  833   AEDTVMRDAAALHDKKRLFYSTLMNDNLLDCIISKVNVTEISPGLGLEVNNSPPSGFYYD  654
             AEDTV++D    HD KRLFYSTLMNDNLLD I+SKV V +I+P + L+  + PP  FY+D
Sbjct  211   AEDTVIKDDGRSHDNKRLFYSTLMNDNLLDSIVSKVQVVQITPDVNLKATSIPPCDFYFD  270

Query  653   MEYCVDYSTFRNLPTVQSVNSWDSPSLID-----ASYKPITAYPVEHFKSCEPSKVELSL  489
             M+Y +DYSTF N  T + ++S   P  +       + K  T +  +   + E  K EL+L
Sbjct  271   MKYSLDYSTF-NAITGKFLSSLPHPPTMSTKNKHGTCKTGTMHTADEMSNKEVCKPELAL  329

Query  488   LDLYAGCGGMSTGLCLGAKLSGLNLVTKWAVDYQKSACDSLKFNHPETQVRNESVenflk  309
             LD+Y+GCGGMSTGLCLG K+  ++LVT+WAVD  ++AC+SLK NHPETQ+R+ S E+FL 
Sbjct  330   LDMYSGCGGMSTGLCLGTKVCDVDLVTRWAVDMDRAACESLKLNHPETQIRHGSAEDFLD  389

Query  308   llkeweklckEYGSEPNAGSDDVLEGMEEGaddansladsddsdAEYEILRLVDICFGDP  129
             LLKEW+ LC++YGS         L G  +   +     +  +   EYE+ +LVDI F   
Sbjct  390   LLKEWDSLCRQYGSHEEKELVTRLTGEAD---EDIQSKEDHEKSCEYEVEKLVDIRFSAI  446

Query  128   NDTGKPGIHFQVRWKGYGPSEDTWEPIDGLKSWKNR  21
               +G  G+ F+VRW GY P++DTWEPI+ L++ + R
Sbjct  447   TKSGNRGLKFKVRWLGYDPTDDTWEPIEALRNCQER  482



>gb|AHB20163.1| DNA methyltransferase, partial [Populus x canadensis]
Length=760

 Score =   295 bits (755),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 179/360 (50%), Positives = 232/360 (64%), Gaps = 49/360 (14%)
 Frame = -2

Query  1031  SADEEDEVILNVDCHYAQAKVLSFILNIGDCVYVKGEGEKKHVGRILEFFKTTEGEDYFR  852
             S D+ED+V+ NV+CHY QA +   I+N+GDCVYVKGEG K H+G ILEFFKTT+ EDYFR
Sbjct  3     SDDDEDKVVWNVECHYTQANIEGRIINLGDCVYVKGEGAKNHIGSILEFFKTTDREDYFR  62

Query  851   VQWFFRAEDTVMRDAAALHDKKRLFYSTLMNDNLLDCIISKVNVTEISPGLGLEVNNSPP  672
             VQWF+RAEDTVM++AA  HD KRLFYST+MNDN +DCIISKV V +ISP + L+ +++P 
Sbjct  63    VQWFYRAEDTVMKEAADFHDNKRLFYSTVMNDNPIDCIISKVTVVQISPRVHLKFHSTPA  122

Query  671   SGFYYDMEYCVDYSTFRNLPTVQSVNSWDSPSLI--------------------------  570
             S FY+DMEY VDYSTFR L T +++N      L+                          
Sbjct  123   SDFYFDMEYSVDYSTFRTLLTRKNLNPTPGTELLFESCCNCMSNGGREGTISSFNGRHEI  182

Query  569   -----DASYK-----PI------TAYP----VEHFKSCEPSKVELSLLDLYAGCGGMSTG  450
                  D S +     P+      +A P    +E+  +C   K +L+LLDL++GCGGMSTG
Sbjct  183   LVRNQDCSLRGRELSPLPFCDSRSATPSDISMENMSTCGSYKAKLTLLDLFSGCGGMSTG  242

Query  449   LCLGAKLSGLNLVTKWAVDYQKSACDSLKFNHPETQVRNESVenflkllkeweklckEYG  270
             LCLGAK+S ++LVT+WA+D  +SAC SLK NHPET VRNE+ E+FL+LLKEW+KLCK Y 
Sbjct  243   LCLGAKVSCVDLVTRWALDSDESACQSLKLNHPETHVRNEAAEDFLELLKEWQKLCKRYA  302

Query  269   SEPNAGSDDVLEGMEEGaddansladsddsdA--EYEILRLVDICFGDPNDTGKPGIHFQ  96
                + G       M       N  + +DD  A  EYE+ RLVDIC+G  +  GK G+ F+
Sbjct  303   VN-DVGRTHKSRSMASSMSKQNKNSSNDDDIAPGEYEVARLVDICYGKTDKRGKRGLKFK  361



>ref|XP_004960649.1| PREDICTED: DNA (cytosine-5)-methyltransferase CMT2-like isoform 
X1 [Setaria italica]
Length=1296

 Score =   301 bits (772),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 173/349 (50%), Positives = 235/349 (67%), Gaps = 27/349 (8%)
 Frame = -2

Query  1013  EVILNVDCHYAQAKVLSFILNIGDCVYVKG-EGEKKHVGRILEFFKTTEGEDYFRVQWFF  837
             + + +V CHY +A V    L IGDC ++KG EG+  ++GR+LEFF+T+ G+ YF VQWFF
Sbjct  553   KAVFDVKCHYLRASVCGSTLCIGDCAFIKGPEGKPHYIGRLLEFFETSAGQYYFSVQWFF  612

Query  836   RAEDTVMRDAAALHDKKRLFYSTLMNDNLLDCIISKVNVTEISPGLGLEVNNSPPSGFYY  657
             RAEDTVM D A  HD +RLFYS L +DNLLDCI+SKV + ++SP +  +  + P   +YY
Sbjct  613   RAEDTVMEDQAQAHDPRRLFYSDLKDDNLLDCIVSKVTIVQVSPSVNEKSQSIPSFHYYY  672

Query  656   DMEYCVDYSTFRNL------PTVQS--VNSWDSPSLIDASYKPITAYPVEHFKSCEPSKV  501
             DM+Y +DYSTF N+       T+QS   +  D+   ID++         E  KS  P   
Sbjct  673   DMKYSLDYSTFSNMEMGDANETLQSHHTSGNDNVKRIDST---------EKQKSPAPEMR  723

Query  500   ELSLLDLYAGCGGMSTGLCLGAKLSGLNLVTKWAVDYQKSACDSLKFNHPETQVRNESVe  321
             ELSLLDLY GCGGMSTGLCLGA+  G+NL+ +WAVD  + AC+S + NHPET+VRNE+ +
Sbjct  724   ELSLLDLYCGCGGMSTGLCLGARGGGVNLIARWAVDGDEVACESFRLNHPETRVRNETTD  783

Query  320   nflkllkeweklckEY---GSEPNAGSDDVLEGMEEGaddansladsddsdAEYEILRLV  150
             +FL+LL+EWEKLCK Y    S+  + S+  ++  +E      +   S     E+E+ +LV
Sbjct  784   DFLELLREWEKLCKTYVKQRSKVKSRSNISVQSSDE------TPDCSTIPPEEFEVWKLV  837

Query  149   DICFGDPNDTGKPGIHFQVRWKGYGPSEDTWEPIDGLKSWKNRQGWFTI  3
             DICFGDPN  GK G++F+VRWKGYGP++DTWEPI+GLK+ K+    F I
Sbjct  838   DICFGDPNGVGKHGLYFKVRWKGYGPNDDTWEPIEGLKNCKDAIRDFVI  886



>ref|XP_004960650.1| PREDICTED: DNA (cytosine-5)-methyltransferase CMT2-like isoform 
X2 [Setaria italica]
Length=1295

 Score =   301 bits (772),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 173/349 (50%), Positives = 235/349 (67%), Gaps = 27/349 (8%)
 Frame = -2

Query  1013  EVILNVDCHYAQAKVLSFILNIGDCVYVKG-EGEKKHVGRILEFFKTTEGEDYFRVQWFF  837
             + + +V CHY +A V    L IGDC ++KG EG+  ++GR+LEFF+T+ G+ YF VQWFF
Sbjct  553   KAVFDVKCHYLRASVCGSTLCIGDCAFIKGPEGKPHYIGRLLEFFETSAGQYYFSVQWFF  612

Query  836   RAEDTVMRDAAALHDKKRLFYSTLMNDNLLDCIISKVNVTEISPGLGLEVNNSPPSGFYY  657
             RAEDTVM D A  HD +RLFYS L +DNLLDCI+SKV + ++SP +  +  + P   +YY
Sbjct  613   RAEDTVMEDQAQAHDPRRLFYSDLKDDNLLDCIVSKVTIVQVSPSVNEKSQSIPSFHYYY  672

Query  656   DMEYCVDYSTFRNL------PTVQS--VNSWDSPSLIDASYKPITAYPVEHFKSCEPSKV  501
             DM+Y +DYSTF N+       T+QS   +  D+   ID++         E  KS  P   
Sbjct  673   DMKYSLDYSTFSNMEMGDANETLQSHHTSGNDNVKRIDST---------EKQKSPAPEMR  723

Query  500   ELSLLDLYAGCGGMSTGLCLGAKLSGLNLVTKWAVDYQKSACDSLKFNHPETQVRNESVe  321
             ELSLLDLY GCGGMSTGLCLGA+  G+NL+ +WAVD  + AC+S + NHPET+VRNE+ +
Sbjct  724   ELSLLDLYCGCGGMSTGLCLGARGGGVNLIARWAVDGDEVACESFRLNHPETRVRNETTD  783

Query  320   nflkllkeweklckEY---GSEPNAGSDDVLEGMEEGaddansladsddsdAEYEILRLV  150
             +FL+LL+EWEKLCK Y    S+  + S+  ++  +E      +   S     E+E+ +LV
Sbjct  784   DFLELLREWEKLCKTYVKQRSKVKSRSNISVQSSDE------TPDCSTIPPEEFEVWKLV  837

Query  149   DICFGDPNDTGKPGIHFQVRWKGYGPSEDTWEPIDGLKSWKNRQGWFTI  3
             DICFGDPN  GK G++F+VRWKGYGP++DTWEPI+GLK+ K+    F I
Sbjct  838   DICFGDPNGVGKHGLYFKVRWKGYGPNDDTWEPIEGLKNCKDAIRDFVI  886



>ref|NP_193637.2| chromomethylase 2 [Arabidopsis thaliana]
 sp|Q94F87.3|CMT2_ARATH RecName: Full=DNA (cytosine-5)-methyltransferase CMT2; AltName: 
Full=Chromomethylase 2; AltName: Full=Protein CHROMOMETHYLASE 
2 [Arabidopsis thaliana]
 gb|AEE84126.1| chromomethylase 2 [Arabidopsis thaliana]
Length=1295

 Score =   300 bits (769),  Expect = 5e-88, Method: Compositional matrix adjust.
 Identities = 170/327 (52%), Positives = 226/327 (69%), Gaps = 7/327 (2%)
 Frame = -2

Query  1031  SADEEDEVILNVDCHYAQAKVLSFILNIGDCVYVKGEGEKKHVGRILEFFKTTEGEDYFR  852
             S D+ED+++ NV+CHY+QAKV     ++GD  Y+KGE E+ HVG+I+EFFKTT+GE YFR
Sbjct  555   SEDDEDKIVANVECHYSQAKVDGHTFSLGDFAYIKGEEEETHVGQIVEFFKTTDGESYFR  614

Query  851   VQWFFRAEDTVMRDAAALHDKKRLFYSTLMNDNLLDCIISKVNVTEISPGLGLEVNNSPP  672
             VQWF+RA DT+M   A  HDK+RLFYST+MNDN +DC+ISKV V ++SP +GL+  NS  
Sbjct  615   VQWFYRATDTIMERQATNHDKRRLFYSTVMNDNPVDCLISKVTVLQVSPRVGLKP-NSIK  673

Query  671   SGFYYDMEYCVDYSTFRNLPTVQSVNSWDSPSLIDASYKPITAYPVEHFKSCEPSKVELS  492
             S +Y+DMEYCV+YSTF+ L      N   S + ++     +     E     +    EL 
Sbjct  674   SDYYFDMEYCVEYSTFQTL-----RNPKTSENKLECCADVVPTESTESILKKKSFSGELP  728

Query  491   LLDLYAGCGGMSTGLCLGAKLSGLNLVTKWAVDYQKSACDSLKFNHPETQVRNESVenfl  312
             +LDLY+GCGGMSTGL LGAK+SG+++VTKWAVD   +AC SLK NHP TQVRN++  +FL
Sbjct  729   VLDLYSGCGGMSTGLSLGAKISGVDVVTKWAVDQNTAACKSLKLNHPNTQVRNDAAGDFL  788

Query  311   kllkeweklckEYGSEPNAGSDDVLE-GMEEGaddansladsddsdAEYEILRLVDICFG  135
             +LLKEW+KLCK Y    +  +D +      +    ++S +D D    EYE+ +LVDICFG
Sbjct  789   QLLKEWDKLCKRYVFNNDQRTDTLRSVNSTKETSGSSSSSDDDSDSEEYEVEKLVDICFG  848

Query  134   DPNDTGKPGIHFQVRWKGYGPSEDTWE  54
             D + TGK G+ F+V WKGY   EDTWE
Sbjct  849   DHDKTGKNGLKFKVHWKGYRSDEDTWE  875



>ref|XP_006471441.1| PREDICTED: DNA (cytosine-5)-methyltransferase CMT2-like [Citrus 
sinensis]
Length=969

 Score =   297 bits (760),  Expect = 7e-88, Method: Compositional matrix adjust.
 Identities = 141/232 (61%), Positives = 179/232 (77%), Gaps = 2/232 (1%)
 Frame = -2

Query  1013  EVILNVDCHYAQAKVLSFILNIGDCVYVKGEGEKKHVGRILEFFKTTEGEDYFRVQWFFR  834
             +++ NV+CHYAQA++   I ++GDC Y+KGEG +KH+G+ILEFFKTT+GE+YFRVQWF+R
Sbjct  185   KIVSNVECHYAQARIGECIFDLGDCAYIKGEGTQKHIGKILEFFKTTDGEEYFRVQWFYR  244

Query  833   AEDTVMRDAAALHDKKRLFYSTLMNDNLLDCIISKVNVTEISPGLGLEVNNSPPSGFYYD  654
             AEDTVM++AA  HD+K LFYST+MNDN +DCIISKV V +I P +GL+ N+ P S FY+D
Sbjct  245   AEDTVMKEAANFHDRKCLFYSTVMNDNPVDCIISKVIVAQIPPKIGLKSNSIPSSDFYFD  304

Query  653   MEYCVDYSTFRNLPTVQS--VNSWDSPSLIDASYKPITAYPVEHFKSCEPSKVELSLLDL  480
             MEYCV+YSTFR L T  S  ++    PS  +      T+   E+  +  P K EL+LLDL
Sbjct  305   MEYCVEYSTFRTLLTDYSSRIHDLSLPSCTETVPTTATSTFFENMPNHGPHKAELALLDL  364

Query  479   YAGCGGMSTGLCLGAKLSGLNLVTKWAVDYQKSACDSLKFNHPETQVRNESV  324
             Y+GCGGMSTGLCLGAKLS  NLVT+WA+D  KSAC+SLK NHPE QVRNE+ 
Sbjct  365   YSGCGGMSTGLCLGAKLSCTNLVTRWALDSDKSACESLKLNHPEAQVRNEAA  416


 Score = 79.0 bits (193),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 32/55 (58%), Positives = 44/55 (80%), Gaps = 0/55 (0%)
 Frame = -2

Query  173  EYEILRLVDICFGDPNDTGKPGIHFQVRWKGYGPSEDTWEPIDGLKSWKNRQGWF  9
            EYE+ R+VDIC+GDPN++GK G++F+V WKGY  SED+WEPI+GL++   R   F
Sbjct  508  EYEVARIVDICYGDPNESGKRGLNFKVHWKGYSTSEDSWEPIEGLRNCPERIKEF  562



>ref|XP_002870005.1| chromomethylase 2 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH46264.1| chromomethylase 2 [Arabidopsis lyrata subsp. lyrata]
Length=1253

 Score =   299 bits (765),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 177/331 (53%), Positives = 229/331 (69%), Gaps = 15/331 (5%)
 Frame = -2

Query  1031  SADEEDEVILNVDCHYAQAKVLSFILNIGDCVYVKGEGEKKHVGRILEFFKTTEGEDYFR  852
             S D+ED+++ NV+CHY QAKV     ++GD   +KGE E+ HVG+ILEFFKTT+ E YFR
Sbjct  513   SEDDEDKIVANVECHYLQAKVDGHTFSLGDFACIKGEEEETHVGKILEFFKTTDEESYFR  572

Query  851   VQWFFRAEDTVMRDAAALHDKKRLFYSTLMNDNLLDCIISKVNVTEISPGLGLEVNNSPP  672
             VQWF+RA DTVM+  A  HDKKRLFYST+MNDN +DC+ISKV V ++SP  GL+  NS  
Sbjct  573   VQWFYRATDTVMKQQATNHDKKRLFYSTVMNDNPVDCLISKVTVLQVSPMAGLKP-NSIK  631

Query  671   SGFYYDMEYCVDYSTFRNLPTVQSVNSWDSPSLIDASYKPITAYPVEHFKSCEPSKV---  501
             S +Y+DMEYCV+YSTF+ L      N   S + ++     +   P E  +S    K+   
Sbjct  632   SDYYFDMEYCVEYSTFQTLK-----NPKSSENKLECCADVV---PTESTESILKKKIFSG  683

Query  500   ELSLLDLYAGCGGMSTGLCLGAKLSGLNLVTKWAVDYQKSACDSLKFNHPETQVRNESVe  321
             EL +LDLY+GCGGMSTGL LGAK+SG+++VTKWAVD   +AC+SLK NHP TQVRN++  
Sbjct  684   ELPVLDLYSGCGGMSTGLSLGAKISGVDVVTKWAVDQNMAACESLKLNHPNTQVRNDAAG  743

Query  320   nflkllkeweklckEYGSEPNAGSDDVLEGME--EGaddansladsddsdAEYEILRLVD  147
             +FL+LLKEW+KLCK Y    N    D L  +   +   +++S  D D    EYE+ +LVD
Sbjct  744   DFLQLLKEWDKLCKRYVFN-NDQRTDTLRSVNSIKETSESSSSRDDDSDSEEYEVEKLVD  802

Query  146   ICFGDPNDTGKPGIHFQVRWKGYGPSEDTWE  54
             ICFGDP+ TGK G+ F+V WKGY   EDTWE
Sbjct  803   ICFGDPDKTGKNGLKFKVHWKGYRSDEDTWE  833



>ref|XP_009392768.1| PREDICTED: DNA (cytosine-5)-methyltransferase 1-like isoform 
X2 [Musa acuminata subsp. malaccensis]
Length=1098

 Score =   298 bits (762),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 170/360 (47%), Positives = 226/360 (63%), Gaps = 32/360 (9%)
 Frame = -2

Query  1061  HSFIWH-------TCFCSADEEDEVILNVDCHYAQAKVLSFILNIGDCVYVKGEGEK-KH  906
             H F W        +   + D+EDE+IL+V CHY +A +   + +IGDC YVKG   K  +
Sbjct  362   HRFGWKDKGGNRKSSTSNIDDEDEIILDVKCHYQKASICGCLFDIGDCAYVKGPKHKPNY  421

Query  905   VGRILEFFKTTEGEDYFRVQWFFRAEDTVMRDAAALHDKKRLFYSTLMNDNLLDCIISKV  726
             +GRILEFF+T +G+ Y RVQWFFRAEDTV+++ AALHD+KRLFYS L NDNLLDC++SKV
Sbjct  422   IGRILEFFETKKGDYYCRVQWFFRAEDTVLKEQAALHDRKRLFYSDLKNDNLLDCLVSKV  481

Query  725   NVTEISPGLGLEVNNSPPSGFYYDMEYCVDYSTFRNLPTVQSVNSWDSPSLIDASYKPIT  546
              + E+     LE  + P   FY DM+Y V+YS+F N+   +          +D + +   
Sbjct  482   RIAEVPASECLESKSIPSCYFYCDMKYSVEYSSFYNMQCRKGN--------VDLALE---  530

Query  545   AYPVEHFKSCEPSKVELSLLDLYAGCGGMSTGLCLGAKLSGLNLVTKWAVDYQKSACDSL  366
                          K EL LLDLY+GCGGMSTGLC GA  +G+ LV++WAVD  ++AC+S 
Sbjct  531   -------------KTELGLLDLYSGCGGMSTGLCFGAHFAGVKLVSRWAVDSDEAACESF  577

Query  365   KFNHPETQVRNESVenflkllkeweklckEYGSEPNAGSDDVLEGMEEGaddansladsd  186
             K NH ETQVRNES ++F  LLKEW KLCK+Y        D   +          + ++  
Sbjct  578   KLNHKETQVRNESADDFFSLLKEWRKLCKKYCVNVGKLGDSCSKNFILKYSKRITDSNFK  637

Query  185   dsdAEYEILRLVDICFGDPNDTGKPGIHFQVRWKGYGPSEDTWEPIDGLKSWKNRQGWFT  6
              SD EYE+L++VDIC+GDP  TGK G+ F+VRWKGYGP EDTWEP++ L + + R   F 
Sbjct  638   ISDGEYEVLKIVDICYGDPTSTGKSGLKFKVRWKGYGPGEDTWEPMESLSNCEGRLREFV  697



>ref|XP_009392766.1| PREDICTED: DNA (cytosine-5)-methyltransferase 1-like isoform 
X1 [Musa acuminata subsp. malaccensis]
Length=1098

 Score =   298 bits (762),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 170/360 (47%), Positives = 226/360 (63%), Gaps = 32/360 (9%)
 Frame = -2

Query  1061  HSFIWH-------TCFCSADEEDEVILNVDCHYAQAKVLSFILNIGDCVYVKGEGEK-KH  906
             H F W        +   + D+EDE+IL+V CHY +A +   + +IGDC YVKG   K  +
Sbjct  362   HRFGWKDKGGNRKSSTSNIDDEDEIILDVKCHYQKASICGCLFDIGDCAYVKGPKHKPNY  421

Query  905   VGRILEFFKTTEGEDYFRVQWFFRAEDTVMRDAAALHDKKRLFYSTLMNDNLLDCIISKV  726
             +GRILEFF+T +G+ Y RVQWFFRAEDTV+++ AALHD+KRLFYS L NDNLLDC++SKV
Sbjct  422   IGRILEFFETKKGDYYCRVQWFFRAEDTVLKEQAALHDRKRLFYSDLKNDNLLDCLVSKV  481

Query  725   NVTEISPGLGLEVNNSPPSGFYYDMEYCVDYSTFRNLPTVQSVNSWDSPSLIDASYKPIT  546
              + E+     LE  + P   FY DM+Y V+YS+F N+   +          +D + +   
Sbjct  482   RIAEVPASECLESKSIPSCYFYCDMKYSVEYSSFYNMQCRKGN--------VDLALE---  530

Query  545   AYPVEHFKSCEPSKVELSLLDLYAGCGGMSTGLCLGAKLSGLNLVTKWAVDYQKSACDSL  366
                          K EL LLDLY+GCGGMSTGLC GA  +G+ LV++WAVD  ++AC+S 
Sbjct  531   -------------KTELGLLDLYSGCGGMSTGLCFGAHFAGVKLVSRWAVDSDEAACESF  577

Query  365   KFNHPETQVRNESVenflkllkeweklckEYGSEPNAGSDDVLEGMEEGaddansladsd  186
             K NH ETQVRNES ++F  LLKEW KLCK+Y        D   +          + ++  
Sbjct  578   KLNHKETQVRNESADDFFSLLKEWRKLCKKYCVNVGKLGDSCSKNFILKYSKRITDSNFK  637

Query  185   dsdAEYEILRLVDICFGDPNDTGKPGIHFQVRWKGYGPSEDTWEPIDGLKSWKNRQGWFT  6
              SD EYE+L++VDIC+GDP  TGK G+ F+VRWKGYGP EDTWEP++ L + + R   F 
Sbjct  638   ISDGEYEVLKIVDICYGDPTSTGKSGLKFKVRWKGYGPGEDTWEPMESLSNCEGRLREFV  697



>ref|XP_009132470.1| PREDICTED: DNA (cytosine-5)-methyltransferase CMT2 isoform X1 
[Brassica rapa]
Length=1141

 Score =   298 bits (762),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 172/341 (50%), Positives = 236/341 (69%), Gaps = 16/341 (5%)
 Frame = -2

Query  1031  SADEEDEVILNVDCHYAQAKVLSFILNIGDCVYVKGEGEKKHVGRILEFFKTTEGEDYFR  852
             + D+ED ++ NV+CHY+QAKV +   ++GD   + G GE+  +G+I+EFFKTT+GE YFR
Sbjct  401   AEDDEDMIVANVECHYSQAKVDNETFSLGDFACLMGNGEEPPIGKIVEFFKTTDGESYFR  460

Query  851   VQWFFRAEDTVMRDAAALHDKKRLFYSTLMNDNLLDCIISKVNVTEISPGLGLEVNNSPP  672
             VQW +RA DTVM+  AA H+++RLFYST+MNDN +DC+ISKV V ++SP  GL   NS  
Sbjct  461   VQWLYRATDTVMQKQAADHERRRLFYSTVMNDNPIDCLISKVTVLQVSPRAGLNP-NSIK  519

Query  671   SGFYYDMEYCVDYSTFRNLPTVQSVNSWDSPSLIDASYKPITAYPVEHFKSCEPSKV---  501
             S FY+DMEYCV++STF+ L T  S N  +  + +          P E  +S    K    
Sbjct  520   SDFYFDMEYCVEFSTFQTLRTQTSENKLECGADV---------TPTESIESILEDKSFSK  570

Query  500   ELSLLDLYAGCGGMSTGLCLGAKLSGLNLVTKWAVDYQKSACDSLKFNHPETQVRNESVe  321
             EL +LDLY+GCGGMSTGL LGAK+SG+++VTKWA+D   +AC+SLK NHP+TQVRN+S  
Sbjct  571   ELLVLDLYSGCGGMSTGLNLGAKISGVDVVTKWAIDQNLAACESLKLNHPQTQVRNDSAG  630

Query  320   nflkllkeweklckEYGSEPNAGSDDVL--EGMEEGaddansladsddsdAEYEILRLVD  147
             +FL+LLKEW KLCK Y    N  + D L  E   + A +++S  + D    EYE+ +LVD
Sbjct  631   DFLQLLKEWGKLCKRYVRN-NGHTTDTLNPENSTKEATESSSSTEDDSEPEEYEVEKLVD  689

Query  146   ICFGDPNDTGKPGIHFQVRWKGYGPSEDTWEPIDGLKSWKN  24
             IC+GDP+ TG+ G+ F+V WKGY  +EDTWEP + L + ++
Sbjct  690   ICYGDPDKTGERGLKFKVHWKGYSSNEDTWEPAEELSNCQD  730



>emb|CDX78915.1| BnaA01g09820D [Brassica napus]
Length=1098

 Score =   297 bits (760),  Expect = 3e-87, Method: Compositional matrix adjust.
 Identities = 169/338 (50%), Positives = 235/338 (70%), Gaps = 10/338 (3%)
 Frame = -2

Query  1031  SADEEDEVILNVDCHYAQAKVLSFILNIGDCVYVKGEGEKKHVGRILEFFKTTEGEDYFR  852
             + D+ED ++ NV+CHY+QAKV +   ++GD   + G GE+  +G+I+EFFKTT+GE YFR
Sbjct  358   AEDDEDMIVANVECHYSQAKVDNETFSLGDFACLMGNGEEPPIGKIVEFFKTTDGESYFR  417

Query  851   VQWFFRAEDTVMRDAAALHDKKRLFYSTLMNDNLLDCIISKVNVTEISPGLGLEVNNSPP  672
             VQW +RA DTVM+  AA H+++RLFYST+MNDN +DC+ISKV V ++SP  GL   NS  
Sbjct  418   VQWLYRATDTVMQKQAADHERRRLFYSTVMNDNPIDCLISKVTVLQVSPRAGLNP-NSIK  476

Query  671   SGFYYDMEYCVDYSTFRNLPTVQSVNSWDSPSLIDASYKPITAYPVEHFKSCEPSKVELS  492
             S FY+DMEYCV++STF+ L T  S N  +  + +  +    +    + F        EL 
Sbjct  477   SDFYFDMEYCVEFSTFQTLRTQTSENKLECGADVTPTESTESILEDKSFSK------ELL  530

Query  491   LLDLYAGCGGMSTGLCLGAKLSGLNLVTKWAVDYQKSACDSLKFNHPETQVRNESVenfl  312
             +LDLY+GCGGMSTGL LGAK+SG+++VTKWA+D   +AC+SLK NHP+TQVRN+S  +FL
Sbjct  531   VLDLYSGCGGMSTGLNLGAKISGVDVVTKWAIDQNLAACESLKLNHPQTQVRNDSAGDFL  590

Query  311   kllkeweklckEYGSEPNAGSDDVL--EGMEEGaddansladsddsdAEYEILRLVDICF  138
             +LLKEW KLCK Y    N  + D L  E   + A +++S  + D    EYE+ +LVDIC+
Sbjct  591   QLLKEWGKLCKRY-VRNNGHTTDTLNPENSTKEATESSSSTEDDSEPEEYEVEKLVDICY  649

Query  137   GDPNDTGKPGIHFQVRWKGYGPSEDTWEPIDGLKSWKN  24
             GDP+ TG+ G+ F+V WKGY  +EDTWEP + L + ++
Sbjct  650   GDPDKTGERGLKFKVHWKGYSSNEDTWEPAEELSNCQD  687



>ref|XP_006282433.1| hypothetical protein CARUB_v10003999mg, partial [Capsella rubella]
 gb|EOA15331.1| hypothetical protein CARUB_v10003999mg, partial [Capsella rubella]
Length=1275

 Score =   298 bits (763),  Expect = 3e-87, Method: Compositional matrix adjust.
 Identities = 174/341 (51%), Positives = 234/341 (69%), Gaps = 14/341 (4%)
 Frame = -2

Query  1031  SADEEDEVILNVDCHYAQAKVLSFILNIGDCVYVKGEGEKKHVGRILEFFKTTEGEDYFR  852
             S D+ED+++ NV+CHY+QAKV     ++GD   +KGE E+ +VG+I+EFFKTT+GE Y R
Sbjct  534   SEDDEDKIVANVECHYSQAKVDGHTFSLGDFACIKGEEEENYVGKIVEFFKTTDGESYLR  593

Query  851   VQWFFRAEDTVMRDAAALHDKKRLFYSTLMNDNLLDCIISKVNVTEISPGLGLEVNNSPP  672
             VQWF+RA DTVM+  A  HDK+RLFYST++NDN +DC+ISKV V ++SP  GL+  NS  
Sbjct  594   VQWFYRATDTVMKQQATNHDKRRLFYSTVVNDNPVDCLISKVTVLQVSPTAGLKP-NSIK  652

Query  671   SGFYYDMEYCVDYSTFRNLPTVQSV-NSWDSPSLI--DASYKPITAYPVEHFKSCEPSKV  501
             S +Y+DMEYCV+YSTF+ L   +S  N  +  + +    S KPI        K C   K 
Sbjct  653   SDYYFDMEYCVEYSTFQTLRNPKSSENKLECCANVVPTESTKPILK------KKCFSGK-  705

Query  500   ELSLLDLYAGCGGMSTGLCLGAKLSGLNLVTKWAVDYQKSACDSLKFNHPETQVRNESVe  321
              L +LDLY+GCGGMSTGL LGA++SG+++VTKWAVD   +AC+SLK NHP TQVRN++  
Sbjct  706   -LPVLDLYSGCGGMSTGLSLGAQISGVDVVTKWAVDQNMAACESLKLNHPNTQVRNDAAG  764

Query  320   nflkllkeweklckEYGSEPNAGSDDVLEGME--EGaddansladsddsdAEYEILRLVD  147
             +FL LLKEW++LCK Y    N    D L  +   +    ++S  D D    EYE+ +LVD
Sbjct  765   DFLLLLKEWDRLCKRYVFNNNNQRTDTLRSVNSTKEKSKSSSSGDDDSDTEEYEVEKLVD  824

Query  146   ICFGDPNDTGKPGIHFQVRWKGYGPSEDTWEPIDGLKSWKN  24
             IC+GDP+ TGK G+ F+V WKGY  +EDTWE  D L + ++
Sbjct  825   ICYGDPDKTGKSGLKFKVHWKGYSSNEDTWELADELSNCQD  865



>ref|XP_010449422.1| PREDICTED: DNA (cytosine-5)-methyltransferase CMT2-like [Camelina 
sativa]
Length=1242

 Score =   298 bits (762),  Expect = 4e-87, Method: Compositional matrix adjust.
 Identities = 167/328 (51%), Positives = 229/328 (70%), Gaps = 8/328 (2%)
 Frame = -2

Query  1031  SADEEDEVILNVDCHYAQAKVLSFILNIGDCVYVKGEGEKKHVGRILEFFKTTEGEDYFR  852
             S ++E++++ NV+CHY+QAKV     ++GD   +KGE E+ H+G+I+EFFKTT+GE YFR
Sbjct  501   SKNDENKIVANVECHYSQAKVDGHTFSLGDFACIKGEEEENHIGKIVEFFKTTDGESYFR  560

Query  851   VQWFFRAEDTVMRDAAALHDKKRLFYSTLMNDNLLDCIISKVNVTEISPGLGLEVNNSPP  672
             VQWF+RA DTVM+  A  HDK+RLFYST+MNDN +DC++S+V V ++SP  GL+  NS  
Sbjct  561   VQWFYRATDTVMKQQATNHDKRRLFYSTVMNDNPVDCLVSRVTVLQVSPRAGLKP-NSIK  619

Query  671   SGFYYDMEYCVDYSTFRNLPTVQSVNSWDSPSLIDASYKPITAYPVEHFKSCEPSKVELS  492
             S +Y+DMEYCV+YSTFR   T+++  S ++     A   P  +   E   +      +L 
Sbjct  620   SDYYFDMEYCVEYSTFR---TLRNPKSSENKHECRADVVPTKS--TESILNKNSFSGKLP  674

Query  491   LLDLYAGCGGMSTGLCLGAKLSGLNLVTKWAVDYQKSACDSLKFNHPETQVRNESVenfl  312
             +LDLY+GCGGMSTGL LGAK+SG+ +VTKWAVD   +AC+SLK NHP T+VRN++  +FL
Sbjct  675   VLDLYSGCGGMSTGLSLGAKISGVGVVTKWAVDQNMAACESLKLNHPNTKVRNDAAGDFL  734

Query  311   kllkeweklckEYGSEPNAGSDDVLEGME--EGaddansladsddsdAEYEILRLVDICF  138
              LLKEW++LCK Y    N    D L  +   +   +++S  D D    EYE+ +LVDIC+
Sbjct  735   LLLKEWDRLCKRYVLNNNDQRTDTLRSVNSTKKTSESSSSTDDDSDSDEYEVEKLVDICY  794

Query  137   GDPNDTGKPGIHFQVRWKGYGPSEDTWE  54
             GDPN TGK G+ F+V WKGY  +EDTWE
Sbjct  795   GDPNKTGKIGLRFKVHWKGYSSNEDTWE  822



>dbj|BAH37021.1| chromomethylase OsMET2c [Oryza sativa Japonica Group]
Length=749

 Score =   291 bits (744),  Expect = 4e-87, Method: Compositional matrix adjust.
 Identities = 170/342 (50%), Positives = 224/342 (65%), Gaps = 13/342 (4%)
 Frame = -2

Query  1013  EVILNVDCHYAQAKVLSFILNIGDCVYVKG-EGEKKHVGRILEFFKTTEGEDYFRVQWFF  837
             + +L+V CHY QAKV  +   IG+C +VKG EG+  ++GR+LEFF+T  GE YFRVQWFF
Sbjct  41    KAVLDVKCHYLQAKVSRYTFCIGECAFVKGPEGKPNYIGRLLEFFETKTGECYFRVQWFF  100

Query  836   RAEDTVMRDAAALHDKKRLFYSTLMNDNLLDCIISKVNVTEISPGLGLEVNNSPPSGFYY  657
              AEDTV+ + A  HD +RLFYS L +DNLLDCI+SKV + ++ P +  +  + P S +YY
Sbjct  101   TAEDTVIGEQAQSHDPRRLFYSDLTDDNLLDCIVSKVTIVQVPPSVDGKSKSVPSSDYYY  160

Query  656   DMEYCVDYSTFRNLPTVQSVNSWDS--PSLIDASYKPITAYPVEHFKSCEPSKVELSLLD  483
             DM+Y +DYSTF  +    + +   S   S I+   K I     +  KS    K+ELSLLD
Sbjct  161   DMKYSIDYSTFSTIEMEDTDDLMQSCYTSRINDKMKKIDVN--KKHKSPVLEKMELSLLD  218

Query  482   LYAGCGGMSTGLCLGAKLSGLNLVTKWAVDYQKSACDSLKFNHPETQVRNESVenflkll  303
             LY GCGGMSTGLCLGA+  G+NL  +WA+D  + AC+S + NHPET+VRNE+ ++FL+LL
Sbjct  219   LYCGCGGMSTGLCLGARGGGVNLSARWAIDDDEIACESFRNNHPETRVRNETTDDFLELL  278

Query  302   keweklckEY--GSEPNAGSDDVLEGMEEGaddansladsddsdAEYEILRLVDICFGDP  129
             KEWEKLCK Y   S   A  D   E   E      +   S     E+E+ +LVDICFGDP
Sbjct  279   KEWEKLCKTYVKHSRTKACVDSTTESNNE------TPDCSTVPPEEFEVWKLVDICFGDP  332

Query  128   NDTGKPGIHFQVRWKGYGPSEDTWEPIDGLKSWKNRQGWFTI  3
             N   K G++F+VRWKGYGP  DTWEP++GL++ K     F I
Sbjct  333   NKVSKHGLYFKVRWKGYGPHHDTWEPVEGLRNCKEAIRDFVI  374



>ref|XP_002519960.1| protein with unknown function [Ricinus communis]
 gb|EEF42564.1| protein with unknown function [Ricinus communis]
Length=734

 Score =   290 bits (743),  Expect = 6e-87, Method: Compositional matrix adjust.
 Identities = 162/311 (52%), Positives = 228/311 (73%), Gaps = 19/311 (6%)
 Frame = -2

Query  932  VKGEGEKKHVGRILEFFKTTEGEDYFRVQWFFRAEDTVMRDAAALHDKKRLFYSTLMNDN  753
            ++GEG +KHVGRI+EFFKTT+GEDYFRVQWF+RAEDTV+++ A  HDKKRLFYST+MNDN
Sbjct  15   LQGEGGQKHVGRIVEFFKTTDGEDYFRVQWFYRAEDTVIKEEAGFHDKKRLFYSTIMNDN  74

Query  752  LLDCIISKVNVTEISPGLGLEVNNSPPSGFYYDMEYCVDYSTFRNLPTVQSV---NSWDS  582
             +DCIISKV + ++   +G + ++   + FY+DMEY VDYS+FR L   +     ++  S
Sbjct  75   PIDCIISKVRIVQLPSMIGSK-SSIRSTDFYFDMEYNVDYSSFRTLLIGKHFCLRDNSSS  133

Query  581  PSLIDASYKPITAYPVEHFKSCEPSKVELSLLDLYAGCGGMSTGLCLGAKLSGLNLVTKW  402
            P++++A         +E+ +S E +K EL+LLDL++GCGGMSTGLCLGAK+S ++LVT+W
Sbjct  134  PNVVEAVSTTGGNTSLENMRSSESNKAELALLDLFSGCGGMSTGLCLGAKVSCVDLVTRW  193

Query  401  AVDYQKSACDSLKFNHPETQVRNESVenflkllkeweklckEYGSEPNAGSDDVLEGMEE  222
            A+D  KSAC+SLK NHPET VRNE+ E+FL+LLK WEKLCK Y  +        ++ M++
Sbjct  194  ALDSNKSACESLKLNHPETNVRNEAAEDFLELLKVWEKLCKRYAVKD-------IKSMQQ  246

Query  221  GaddansladsddsdA--------EYEILRLVDICFGDPNDTGKPGIHFQVRWKGYGPSE  66
                A+ +A+ +D+          EYE+ +LVD+C+GDP++ GK G+ F+V WKGY  SE
Sbjct  247  SRSIASRVAEENDNSLSDNDITPGEYEVSKLVDLCYGDPDNIGKRGLKFKVHWKGYSTSE  306

Query  65   DTWEPIDGLKS  33
            DTWEP++GL++
Sbjct  307  DTWEPVEGLRN  317



>gb|EMS55851.1| DNA (cytosine-5)-methyltransferase CMT2 [Triticum urartu]
Length=897

 Score =   293 bits (749),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 169/327 (52%), Positives = 220/327 (67%), Gaps = 11/327 (3%)
 Frame = -2

Query  1010  VILNVDCHYAQAKVLSFILNIGDCVYVKG-EGEKKHVGRILEFFKTTEGEDYFRVQWFFR  834
              +L+V CHY QA +    L IGDC +VKG EG+  ++G+ILEFF+T  GE Y RVQWFFR
Sbjct  471   AVLDVKCHYLQASISGSTLCIGDCAFVKGPEGKPDYIGKILEFFETVAGEYYCRVQWFFR  530

Query  833   AEDTVMRDAAALHDKKRLFYSTLMNDNLLDCIISKVNVTEISPGLGLEVNNSPPSGFYYD  654
             AEDT+M D A  HD +RLFYS L +DN LDCI+SKV++ ++SP +  +  + P   +YYD
Sbjct  531   AEDTIMEDQAQSHDPRRLFYSDLKDDNALDCIVSKVSIVQVSPCVDNQSKSIPSPQYYYD  590

Query  653   MEYCVDYSTFRNLPTVQSVNSWDSPSLIDASYKPITAYPVEHFKSCEPSKVELSLLDLYA  474
             M+Y  DYSTF  L    +     S  +   S K       +  KS  P+K +LSLLDLY 
Sbjct  591   MKYSQDYSTFSTLEMEDTHARLQSSQVSSISMKKADFNKTQ--KSHVPNKKDLSLLDLYC  648

Query  473   GCGGMSTGLCLGAKLSGLNLVTKWAVDYQKSACDSLKFNHPETQVRNESVenflkllkew  294
             GCGGMSTGLCLGA   G+NLVT+WAVD  + AC+S + NHPET+VRNE+ ++FL+LLKEW
Sbjct  649   GCGGMSTGLCLGAHGGGVNLVTRWAVDDDEVACESFRMNHPETRVRNETTDDFLELLKEW  708

Query  293   eklckEY--GSEPNAGSDDVLEGMEEGaddansladsddsdAEYEILRLVDICFGDPNDT  120
             +KLCK+Y   SE N  +D + E    G        DS     E E+ +LVDICFGDP++ 
Sbjct  709   QKLCKQYVKESEVNDHADAITEFSNGG------PDDSAVPPEELEVWKLVDICFGDPSNV  762

Query  119   GKPGIHFQVRWKGYGPSEDTWEPIDGL  39
              K  ++F+VRWKGYGP++DTWEPI+GL
Sbjct  763   RKRCLYFKVRWKGYGPNDDTWEPIEGL  789



>emb|CDX99400.1| BnaC01g11520D [Brassica napus]
Length=1144

 Score =   295 bits (756),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 172/341 (50%), Positives = 235/341 (69%), Gaps = 16/341 (5%)
 Frame = -2

Query  1031  SADEEDEVILNVDCHYAQAKVLSFILNIGDCVYVKGEGEKKHVGRILEFFKTTEGEDYFR  852
             S D+ED ++ NV+CHY QAKV +   ++GD   + G+GE+  +G+I+E FKTT+GE YFR
Sbjct  430   SEDDEDMIVANVECHYLQAKVDNETFSLGDFACLMGDGEEPPIGKIVELFKTTDGESYFR  489

Query  851   VQWFFRAEDTVMRDAAALHDKKRLFYSTLMNDNLLDCIISKVNVTEISPGLGLEVNNSPP  672
             VQW +RA DTVM+  AA H+++RLFYST+MNDN +DC+ISKV V ++SP  GL+  NS  
Sbjct  490   VQWLYRATDTVMQKQAADHERRRLFYSTVMNDNPIDCLISKVTVLQVSPRAGLKP-NSIK  548

Query  671   SGFYYDMEYCVDYSTFRNLPTVQSVNSWDSPSLIDASYKPITAYPVEHFKSCEPSKV---  501
             S FY+DMEYCV++STF+ L T  S N  +  + +          P E  +S    K    
Sbjct  549   SDFYFDMEYCVEFSTFQTLRTQTSENKLECCADV---------TPTESTESILEDKSFSK  599

Query  500   ELSLLDLYAGCGGMSTGLCLGAKLSGLNLVTKWAVDYQKSACDSLKFNHPETQVRNESVe  321
             EL +LDLY+GCGGMSTGL LGAK+SG+++VTKWA+D   +AC+SLK NHP+TQVRN+S  
Sbjct  600   ELLVLDLYSGCGGMSTGLNLGAKISGVDVVTKWAIDQNLAACESLKLNHPQTQVRNDSAG  659

Query  320   nflkllkeweklckEYGSEPNAGSDDVL--EGMEEGaddansladsddsdAEYEILRLVD  147
             +FL+LLKEW KLCK Y    N  + D L  E   + A +++S  + D    EYE+ +LVD
Sbjct  660   DFLQLLKEWGKLCKRYVRN-NGHTTDTLNPENSTKEATESSSSTEDDSEPEEYEVEKLVD  718

Query  146   ICFGDPNDTGKPGIHFQVRWKGYGPSEDTWEPIDGLKSWKN  24
             IC+GDP+ TG+ G+ F+V WKGY  +EDTWEP   L + ++
Sbjct  719   ICYGDPDKTGERGLKFKVHWKGYSSNEDTWEPAKELSNCQD  759



>gb|EMT28418.1| DNA (cytosine-5)-methyltransferase 1 [Aegilops tauschii]
Length=1236

 Score =   295 bits (755),  Expect = 4e-86, Method: Compositional matrix adjust.
 Identities = 171/330 (52%), Positives = 221/330 (67%), Gaps = 17/330 (5%)
 Frame = -2

Query  1010  VILNVDCHYAQAKVLSFILNIGDCVYVKG-EGEKKHVGRILEFFKTTEGEDYFRVQWFFR  834
              +L+V CHY QA +    L IGDC +VKG EG+  ++G+ILEFF+T  GE Y RVQWFFR
Sbjct  486   AVLDVKCHYLQASISGSTLCIGDCAFVKGPEGKPNYIGKILEFFETVAGEYYCRVQWFFR  545

Query  833   AEDTVMRDAAALHDKKRLFYSTLMNDNLLDCIISKVNVTEISPGLGLEVNNSPPSGFYYD  654
             AEDT+M D A  HD +RLFYS L +DN LDCI+SKV++ ++SP +  +  + P S +YYD
Sbjct  546   AEDTIMEDQAQSHDPRRLFYSDLKDDNALDCIVSKVSIVQVSPCVDNQSKSIPSSQYYYD  605

Query  653   MEYCVDYSTFRNLPTVQSVNSWDSPSLIDASYKPITAYPVEHF----KSCEPSKVELSLL  486
             M+Y  DYSTF  L    +     S  +   S K       E F    KS  P+K ELSLL
Sbjct  606   MKYSQDYSTFSTLEMEDTHAKLQSSQVSSISMK------KEDFNKTQKSHVPNKKELSLL  659

Query  485   DLYAGCGGMSTGLCLGAKLSGLNLVTKWAVDYQKSACDSLKFNHPETQVRNESVenflkl  306
             DLY GCGGMSTGLCLGA+  G+NLVT+WAVD  + AC+S + NHPET+VRNE+ ++FL+L
Sbjct  660   DLYCGCGGMSTGLCLGARGGGVNLVTRWAVDDDEVACESFRMNHPETRVRNETTDDFLEL  719

Query  305   lkeweklckEYGSEPNAGSD-DVLEGMEEGaddansladsddsdAEYEILRLVDICFGDP  129
             LKEW+KLCK+Y  E     + D +     G     +  DS     E E+ +LVDICFGDP
Sbjct  720   LKEWQKLCKQYVKESEVQDNADAITEFGNG-----TPDDSAVPPEELEVWKLVDICFGDP  774

Query  128   NDTGKPGIHFQVRWKGYGPSEDTWEPIDGL  39
             N+  K  ++F+VRWKGYGP++DTWEPI+GL
Sbjct  775   NNVRKRCLYFKVRWKGYGPNDDTWEPIEGL  804



>ref|XP_006849583.1| hypothetical protein AMTR_s00024p00193220 [Amborella trichopoda]
 gb|ERN11164.1| hypothetical protein AMTR_s00024p00193220 [Amborella trichopoda]
Length=884

 Score =   291 bits (745),  Expect = 4e-86, Method: Compositional matrix adjust.
 Identities = 178/349 (51%), Positives = 233/349 (67%), Gaps = 9/349 (3%)
 Frame = -2

Query  1031  SADEEDEVILNVDCHYAQAKVLSFILNIGDCVYVKGE-GEKKHVGRILEFFKTTEGEDYF  855
             + D   E  LNV CHY Q +V   I  + D   VKGE G + ++G+I+E F+TT+G+ YF
Sbjct  127   NGDNGGETALNVKCHYEQCEVDGCIYILNDSAIVKGEEGGEDYIGKIVELFETTDGQRYF  186

Query  854   RVQWFFRAEDTVMRDAAA-LHDKKRLFYSTLMNDNLLDCIISKVNVTEISPGLGL--EVN  684
               QWFF+A+DTV+++ AA  HDKKR+FYS + +DNLLDCIISK+++ +++P + L  +  
Sbjct  187   TAQWFFKAQDTVIKEEAADFHDKKRVFYSDMKDDNLLDCIISKLHIVQVAPNVDLVAKAA  246

Query  683   NSPPSGFYYDMEYCVDYSTFRNLPTVQSVNSWDSPSLIDASYKPITAYPVEHFKSCEPSK  504
             + PP  +YYDM Y + YSTF NL +     + DS S I +      A   +    C    
Sbjct  247   SIPPCDYYYDMSYSIPYSTFSNLKSDNLKFNSDS-STISSEAAVDGAEKSDSDGGCSSES  305

Query  503   VE---LSLLDLYAGCGGMSTGLCLGAKLSGLNLVTKWAVDYQKSACDSLKFNHPETQVRN  333
              E    SLLDLY+GCGGMSTGLC GAKL G+NLVT+WAVD  KSACDSLK NHPET+VRN
Sbjct  306   YEKSGFSLLDLYSGCGGMSTGLCFGAKLCGVNLVTRWAVDMNKSACDSLKLNHPETEVRN  365

Query  332   ESVenflkllkeweklckEYGSEPNAGSDDVLEGMEEGaddansladsddsdAEYEILRL  153
             ES E+FLKLL++WE+LCKEY       S   LE  + G  D  S  D+  S  E+E+ +L
Sbjct  366   ESAEDFLKLLRKWEELCKEYSLIGTEKSRWRLEATDNG-YDEESDDDTKLSPGEFEVGKL  424

Query  152   VDICFGDPNDTGKPGIHFQVRWKGYGPSEDTWEPIDGLKSWKNRQGWFT  6
             V IC+GDP++TGK G+ F+VRWKGYGPS+DTWEP+DGL + K R   F 
Sbjct  425   VGICYGDPSETGKIGLKFKVRWKGYGPSDDTWEPLDGLSNCKERIKEFV  473



>ref|XP_006655109.1| PREDICTED: DNA (cytosine-5)-methyltransferase CMT2-like [Oryza 
brachyantha]
Length=1221

 Score =   294 bits (752),  Expect = 8e-86, Method: Compositional matrix adjust.
 Identities = 164/340 (48%), Positives = 225/340 (66%), Gaps = 10/340 (3%)
 Frame = -2

Query  1013  EVILNVDCHYAQAKVLSFILNIGDCVYVKG-EGEKKHVGRILEFFKTTEGEDYFRVQWFF  837
             + +L+V CHY QAKV +    IGDC ++KG EG+  ++GR+LEFF+T  GE Y RVQWFF
Sbjct  488   KAVLDVKCHYLQAKVSTCTFCIGDCAFIKGPEGKPNYIGRLLEFFETKAGEYYVRVQWFF  547

Query  836   RAEDTVMRDAAALHDKKRLFYSTLMNDNLLDCIISKVNVTEISPGLGLEVNNSPPSGFYY  657
             RAEDTVM++ A  H  +RLFYS L +DNLLDC++SKV + ++ P +  +  + P   +YY
Sbjct  548   RAEDTVMKEQAQSHAPRRLFYSDLTDDNLLDCVVSKVTIVQVPPTINGKSKSVPSFHYYY  607

Query  656   DMEYCVDYSTFRNLPTVQSVNSWDSPSLIDASYKPITAYPVEHFKSCEPSKVELSLLDLY  477
             DM+Y +DYSTF  +  +   N          +   +    ++  K  E  K+ELSLLDLY
Sbjct  608   DMKYSIDYSTFSTI-QMGDTNDVAQSGYTSRTTDKMKIDVIKKHKFPELEKMELSLLDLY  666

Query  476   AGCGGMSTGLCLGAKLSGLNLVTKWAVDYQKSACDSLKFNHPETQVRNESVenflkllke  297
              GCGGMSTGLCLGA+  G+NL  +WA+D  + AC+S + NHPET+VRNE+V++FL+LLKE
Sbjct  667   CGCGGMSTGLCLGARGGGVNLSARWAIDDDEIACESFRHNHPETRVRNETVDDFLELLKE  726

Query  296   weklckEYGSEPNAGS--DDVLEGMEEGaddansladsddsdAEYEILRLVDICFGDPND  123
             WEKLCK Y    NA +  D  +E  +E      +   S     E+E+ ++VDICFGDPN 
Sbjct  727   WEKLCKTYVKHSNAKARVDSTIETNDE------TPDCSTVPPDEFEVWKIVDICFGDPNK  780

Query  122   TGKPGIHFQVRWKGYGPSEDTWEPIDGLKSWKNRQGWFTI  3
               K G++F+VRWKGYGP +DTWEP++GL++ K     F I
Sbjct  781   VRKHGLYFKVRWKGYGPHDDTWEPVEGLRNCKEAIRDFVI  820



>ref|XP_006854149.1| hypothetical protein AMTR_s00048p00181490 [Amborella trichopoda]
 gb|ERN15616.1| hypothetical protein AMTR_s00048p00181490 [Amborella trichopoda]
Length=1183

 Score =   293 bits (751),  Expect = 9e-86, Method: Compositional matrix adjust.
 Identities = 176/348 (51%), Positives = 225/348 (65%), Gaps = 18/348 (5%)
 Frame = -2

Query  1022  EEDEVILNVDCHYAQAKVLSFILNIGDCVYVKGE-GEKKHVGRILEFFKTTEGEDYFRVQ  846
             + DE+IL+V CHY QA +     N+GD  YVKG+ G   ++GRILEFF+T +G  YF  Q
Sbjct  435   DSDELILDVRCHYLQADICGHKFNLGDTAYVKGQKGGPNYIGRILEFFETMDGIQYFNAQ  494

Query  845   WFFRAEDTVMRDAAALHDKKRLFYSTLMNDNLLDCIISKVNVTEISPGLGLEVNNS-PPS  669
             WFFRA DTV++  A+ HDKKR+FYS L NDNLLDCI+SK+ + +++P + L    S PP 
Sbjct  495   WFFRAADTVIQGLASQHDKKRIFYSDLKNDNLLDCIVSKIKIVQVTPNVNLAKRKSIPPC  554

Query  668   GFYYDMEYCVDYSTFRNLPTVQSVNSWDSPSLI--------DASYKPITAYPVEHFKSCE  513
              FYYDM Y + YSTF N+ +  S  + DS S +        D + K  T    +  +S E
Sbjct  555   DFYYDMSYSIPYSTFSNILSETSNGNSDSLSSVCTETGCVSDIASKSSTR---KASRSNE  611

Query  512   PSKVELSLLDLYAGCGGMSTGLCLGAKLSGLNLVTKWAVDYQKSACDSLKFNHPETQVRN  333
             P + EL+LLDL+ GCGGMSTGL LGAKLSG+NLVT+WA+D  +SAC SLK NHPET+VRN
Sbjct  612   PERTELTLLDLFCGCGGMSTGLSLGAKLSGVNLVTRWALDLNESACQSLKLNHPETEVRN  671

Query  332   ESVenflkllkeweklckEYGSEPNAGSDDVLEGMEEGaddansladsddsdAEYEILRL  153
             ES E F +LLK WEKLCK+Y   P+        G++    D N   DS     EYE+   
Sbjct  672   ESAEEFFELLKAWEKLCKQYC--PSGVEKAPSRGLQS---DGNPKEDSKIPSGEYEVSHF  726

Query  152   VDICFGDPNDTGKPGIHFQVRWKGYGPSEDTWEPIDGLKSWKNRQGWF  9
             V I +GD  ++GK G+ F+VRWKGYG SEDTWEPI  L   + R   F
Sbjct  727   VGIRYGDHIESGKRGLMFKVRWKGYGSSEDTWEPIGSLGKCQERTREF  774



>ref|XP_002439474.1| hypothetical protein SORBIDRAFT_09g007390 [Sorghum bicolor]
 gb|EES17904.1| hypothetical protein SORBIDRAFT_09g007390 [Sorghum bicolor]
Length=1441

 Score =   284 bits (727),  Expect = 6e-82, Method: Compositional matrix adjust.
 Identities = 166/338 (49%), Positives = 218/338 (64%), Gaps = 6/338 (2%)
 Frame = -2

Query  1013  EVILNVDCHYAQAKVLSFILNIGDCVYVKG-EGEKKHVGRILEFFKTTEGEDYFRVQWFF  837
             + +L+V CHY +A +    L IGDC ++KG EG+  ++GR+LEFF+TT  E YF VQWFF
Sbjct  685   KAVLDVKCHYLEASICGSTLCIGDCAFIKGLEGKPHYIGRLLEFFETTADEYYFTVQWFF  744

Query  836   RAEDTVMRDAAALHDKKRLFYSTLMNDNLLDCIISKVNVTEISPGLGLEVNNSPPSGFYY  657
             RAEDTVM D A  HD +RLFYS L +DNLLDCI+SKV +  +SP L  +    P   +YY
Sbjct  745   RAEDTVMEDQAQSHDPRRLFYSDLKDDNLLDCIVSKVTIMPVSPSLNEKPRLIPSFHYYY  804

Query  656   DMEYCVDYSTFRNLPTVQSVNSWDSPSLIDASYKPITAYPVEHFKSCEPSKVELSLLDLY  477
             DM+Y +DYSTF  +      ++  S      + K I     E  KS      ELSLLDLY
Sbjct  805   DMKYSLDYSTFSTMEMGDPNDTLHSHYTSSNNVKRIDF--TEKQKSPTSEMRELSLLDLY  862

Query  476   AGCGGMSTGLCLGAKLSGLNLVTKWAVDYQKSACDSLKFNHPETQVRNESVenflkllke  297
              GCGGMSTGLCLGA+  G+NLV +WAVD  + AC++ + NHPET+VRNE+ ++FL+LLKE
Sbjct  863   CGCGGMSTGLCLGARGGGVNLVARWAVDGDEVACETFRLNHPETRVRNETTDDFLELLKE  922

Query  296   weklckEYGSEPNAGSDDVLEGMEEGaddansladsddsdAEYEILRLVDICFGDPNDTG  117
             W+KLCK Y       S    +          +   S  S  E+E+ +LVDICFGDPN   
Sbjct  923   WKKLCKTYV---KPCSKVKSQSNVPTQSSNGTPDCSTFSTEEFEVWKLVDICFGDPNGVR  979

Query  116   KPGIHFQVRWKGYGPSEDTWEPIDGLKSWKNRQGWFTI  3
             K  ++F+VRWKGYGP++DTWEP++GLK+ K+    F I
Sbjct  980   KRALYFKVRWKGYGPNDDTWEPMEGLKNCKDAIRDFVI  1017



>ref|XP_010054093.1| PREDICTED: DNA (cytosine-5)-methyltransferase CMT2 isoform X2 
[Eucalyptus grandis]
Length=1187

 Score =   281 bits (719),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 163/307 (53%), Positives = 212/307 (69%), Gaps = 12/307 (4%)
 Frame = -2

Query  932  VKGEGEKKHVGRILEFFKTTEGEDYFRVQWFFRAEDTVMRDAAALHDKKRLFYSTLMNDN  753
            +KG+  KKHVGRILEFF+TT+ EDY RV+WF+RAEDTVM++ ++ HDKKRLFYS + NDN
Sbjct  458  MKGDKGKKHVGRILEFFRTTDEEDYIRVRWFYRAEDTVMQNQSSFHDKKRLFYSAVENDN  517

Query  752  LLDCIISKVNVTEISPGLGLEVNNSPPSGFYYDMEYCVDYSTFRNLPTVQSVNSWDSPSL  573
             +DCI+SKV V  ++P +G++  +   S FYYDMEY ++YSTFR L +    N  DSPS 
Sbjct  518  PVDCILSKVKVARLNPKVGVKSTHI-RSDFYYDMEYSLEYSTFRTLISDGLTNGNDSPSC  576

Query  572  --IDASYKPITAYPVEHFKSCEPSKVELSLLDLYAGCGGMSTGLCLGAKLSGLNLVTKWA  399
              ++ S         E+       K EL+LLDLY+GCGGMSTGL LGAKLS  +LVT+WA
Sbjct  577  NSLNGSASSDIGTTSENMLRSGTQKEELTLLDLYSGCGGMSTGLHLGAKLSRTDLVTRWA  636

Query  398  VDYQKSACDSLKFNHPETQVRNESVenflkllkeweklckEYGSEPNAGSDDVLEGMEEG  219
            +D  KSAC+S K NHPET++RNE  E FLKLLKEWEKLCK++  +   G    L G+ + 
Sbjct  637  LDCDKSACESFKLNHPETKIRNEGAEEFLKLLKEWEKLCKQFAVKSVEG----LHGLRKN  692

Query  218  -----addansladsddsdAEYEILRLVDICFGDPNDTGKPGIHFQVRWKGYGPSEDTWE  54
                     +    +D    E+E+  LVDIC+GDPN+ GKPG+HF+V WKGY   EDTWE
Sbjct  693  NCRVTRSRGSPADVADTPKDEHEVSSLVDICYGDPNEIGKPGLHFKVHWKGYSSKEDTWE  752

Query  53   PIDGLKS  33
            PI+GL++
Sbjct  753  PIEGLRN  759



>ref|XP_006431407.1| hypothetical protein CICLE_v10000251mg [Citrus clementina]
 gb|ESR44647.1| hypothetical protein CICLE_v10000251mg [Citrus clementina]
Length=859

 Score =   273 bits (697),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 158/353 (45%), Positives = 222/353 (63%), Gaps = 25/353 (7%)
 Frame = -2

Query  1028  ADEEDEVILNVDCHYAQAKVLSFILNIGDCVYVKGE-GEKKHVGRILEFFKTTEGEDYFR  852
             A  E+E +L   CHY QA V   + N+GD  YVK E G   ++ RI+E F++ +GE YF+
Sbjct  111   ALNEEEEVLQARCHYTQASVDGCLYNLGDDAYVKAEEGAVDYIARIVELFESVDGEPYFK  170

Query  851   VQWFFRAEDTVMRDAAALHDKKRLFYSTLMNDNLLDCIISKVNVTEISPGLGLEVN--NS  678
              +WF+RAEDTV++D A L D+KR+F S + +DN L+CI+SK  + E++  + LE    N 
Sbjct  171   ARWFYRAEDTVIKDLACLVDRKRVFLSDVEDDNPLNCIVSKAKIAEVATNMDLEAKQKNI  230

Query  677   PPSGFYYDMEYCVDYSTFRNLPTVQSVNSWDSPSLIDA---SYKPITAYPVEHFKSCEPS  507
             PP   YYDM+Y + + TF N+    +    D+ S I +   S  PI              
Sbjct  231   PPCDLYYDMKYTLPHLTFLNINNESNRRDSDASSTISSETGSNSPI-------------G  277

Query  506   KVELSLLDLYAGCGGMSTGLCLGAKLSGLNLVTKWAVDYQKSACDSLKFNHPETQVRNES  327
             + E+SLLDLY+GCG MSTGLC+GA LSG+ LVT+WA+D    AC SLKFNHPET+VRNE+
Sbjct  278   QPEMSLLDLYSGCGAMSTGLCIGASLSGVKLVTRWAIDINPHACKSLKFNHPETKVRNEA  337

Query  326   VenflkllkeweklckEYG-SEPNAGSDDVLEGMEEGaddanslad-----sddsdAEYE  165
              ++FL LLKEW KLC+ +   + +   +  L  M E  ++     +     ++  + E+E
Sbjct  338   ADDFLSLLKEWAKLCQYFSIYDTDKVPEQSLNFMSEEEEEEEEEEEENDDDANVPNEEFE  397

Query  164   ILRLVDICFGDPNDTGKPGIHFQVRWKGYGPSEDTWEPIDGLKSWKNRQGWFT  6
             + RL+ +C+GDPN T KPG++F+VRWKGYGPSEDTWEPI+GL   K +   F 
Sbjct  398   VERLIAVCYGDPNKTKKPGVYFKVRWKGYGPSEDTWEPIEGLSKCKEKLKEFV  450



>ref|XP_009390334.1| PREDICTED: DNA (cytosine-5)-methyltransferase 1-like isoform 
X2 [Musa acuminata subsp. malaccensis]
Length=875

 Score =   272 bits (695),  Expect = 4e-79, Method: Compositional matrix adjust.
 Identities = 164/342 (48%), Positives = 214/342 (63%), Gaps = 23/342 (7%)
 Frame = -2

Query  1019  EDEVILNVDCHYAQAKVLSFILNIGDCVYVKG-EGEKKHVGRILEFFKTTEGEDYFRVQW  843
             +DE +L   CHY +AKV      + D  YVK  EGE  ++GRI+EFF+TT+GE YF  QW
Sbjct  144   DDEQLLRAKCHYREAKVDGVSYKLDDDAYVKAAEGELDYIGRIVEFFETTDGELYFTAQW  203

Query  842   FFRAEDTVMRD------AAALHDKKRLFYSTLMNDNLLDCIISKVNVTEISPGLGLEVNN  681
             FFRAEDTVM+D      A  +HD +R+F S   NDNLLDC++SK+ +  + P + LEV  
Sbjct  204   FFRAEDTVMKDHACCHGAKVVHDPRRVFLSEEKNDNLLDCMVSKIKIERVDPNINLEVKK  263

Query  680   S--PPSGFYYDMEYCVDYSTFRNLPTVQSVNSWDSPSLIDASYKPITAYPVEHFKSCEPS  507
                P    YYDM Y + YSTF NLP        D  +   +S    +      F+     
Sbjct  264   KGIPSCDLYYDMSYSLAYSTFANLP------ENDRAASGSSSTMSSSDPDSPSFRE----  313

Query  506   KVELSLLDLYAGCGGMSTGLCLGAKLSGLNLVTKWAVDYQKSACDSLKFNHPETQVRNES  327
             K  ++LLDLY+GCG MSTGLCLGA LSG+NL T+WAVD  + AC SLK NHP T+VRNE 
Sbjct  314   KNVVTLLDLYSGCGAMSTGLCLGANLSGINLQTRWAVDLNQYACQSLKLNHPNTEVRNEK  373

Query  326   VenflkllkeweklckEYGSEPNAGSDDVLEGMEEGaddansladsddsdAEYEILRLVD  147
              E+FL LL EWEKLC++Y    +   + V E ++    D   L D    + E+E+ +LV 
Sbjct  374   AEDFLALLIEWEKLCEKY----HVIGNQVKEEIDSNGLDGEELNDPKVPNDEFEVDKLVG  429

Query  146   ICFGDPNDTGKPGIHFQVRWKGYGPSEDTWEPIDGLKSWKNR  21
             IC+GDP+D GK G+ F+VRWKGYGPS+DTWEP++GL   + R
Sbjct  430   ICYGDPSDIGKIGLKFKVRWKGYGPSDDTWEPVEGLSKCEER  471



>ref|XP_009390335.1| PREDICTED: DNA (cytosine-5)-methyltransferase 1-like isoform 
X3 [Musa acuminata subsp. malaccensis]
Length=873

 Score =   272 bits (695),  Expect = 4e-79, Method: Compositional matrix adjust.
 Identities = 164/342 (48%), Positives = 214/342 (63%), Gaps = 23/342 (7%)
 Frame = -2

Query  1019  EDEVILNVDCHYAQAKVLSFILNIGDCVYVKG-EGEKKHVGRILEFFKTTEGEDYFRVQW  843
             +DE +L   CHY +AKV      + D  YVK  EGE  ++GRI+EFF+TT+GE YF  QW
Sbjct  144   DDEQLLRAKCHYREAKVDGVSYKLDDDAYVKAAEGELDYIGRIVEFFETTDGELYFTAQW  203

Query  842   FFRAEDTVMRD------AAALHDKKRLFYSTLMNDNLLDCIISKVNVTEISPGLGLEVNN  681
             FFRAEDTVM+D      A  +HD +R+F S   NDNLLDC++SK+ +  + P + LEV  
Sbjct  204   FFRAEDTVMKDHACCHGAKVVHDPRRVFLSEEKNDNLLDCMVSKIKIERVDPNINLEVKK  263

Query  680   S--PPSGFYYDMEYCVDYSTFRNLPTVQSVNSWDSPSLIDASYKPITAYPVEHFKSCEPS  507
                P    YYDM Y + YSTF NLP        D  +   +S    +      F+     
Sbjct  264   KGIPSCDLYYDMSYSLAYSTFANLP------ENDRAASGSSSTMSSSDPDSPSFRE----  313

Query  506   KVELSLLDLYAGCGGMSTGLCLGAKLSGLNLVTKWAVDYQKSACDSLKFNHPETQVRNES  327
             K  ++LLDLY+GCG MSTGLCLGA LSG+NL T+WAVD  + AC SLK NHP T+VRNE 
Sbjct  314   KNVVTLLDLYSGCGAMSTGLCLGANLSGINLQTRWAVDLNQYACQSLKLNHPNTEVRNEK  373

Query  326   VenflkllkeweklckEYGSEPNAGSDDVLEGMEEGaddansladsddsdAEYEILRLVD  147
              E+FL LL EWEKLC++Y    +   + V E ++    D   L D    + E+E+ +LV 
Sbjct  374   AEDFLALLIEWEKLCEKY----HVIGNQVKEEIDSNGLDGEELNDPKVPNDEFEVDKLVG  429

Query  146   ICFGDPNDTGKPGIHFQVRWKGYGPSEDTWEPIDGLKSWKNR  21
             IC+GDP+D GK G+ F+VRWKGYGPS+DTWEP++GL   + R
Sbjct  430   ICYGDPSDIGKIGLKFKVRWKGYGPSDDTWEPVEGLSKCEER  471



>ref|XP_009390332.1| PREDICTED: DNA (cytosine-5)-methyltransferase 1-like isoform 
X1 [Musa acuminata subsp. malaccensis]
Length=885

 Score =   272 bits (695),  Expect = 5e-79, Method: Compositional matrix adjust.
 Identities = 164/342 (48%), Positives = 214/342 (63%), Gaps = 23/342 (7%)
 Frame = -2

Query  1019  EDEVILNVDCHYAQAKVLSFILNIGDCVYVKG-EGEKKHVGRILEFFKTTEGEDYFRVQW  843
             +DE +L   CHY +AKV      + D  YVK  EGE  ++GRI+EFF+TT+GE YF  QW
Sbjct  144   DDEQLLRAKCHYREAKVDGVSYKLDDDAYVKAAEGELDYIGRIVEFFETTDGELYFTAQW  203

Query  842   FFRAEDTVMRD------AAALHDKKRLFYSTLMNDNLLDCIISKVNVTEISPGLGLEVNN  681
             FFRAEDTVM+D      A  +HD +R+F S   NDNLLDC++SK+ +  + P + LEV  
Sbjct  204   FFRAEDTVMKDHACCHGAKVVHDPRRVFLSEEKNDNLLDCMVSKIKIERVDPNINLEVKK  263

Query  680   S--PPSGFYYDMEYCVDYSTFRNLPTVQSVNSWDSPSLIDASYKPITAYPVEHFKSCEPS  507
                P    YYDM Y + YSTF NLP        D  +   +S    +      F+     
Sbjct  264   KGIPSCDLYYDMSYSLAYSTFANLP------ENDRAASGSSSTMSSSDPDSPSFRE----  313

Query  506   KVELSLLDLYAGCGGMSTGLCLGAKLSGLNLVTKWAVDYQKSACDSLKFNHPETQVRNES  327
             K  ++LLDLY+GCG MSTGLCLGA LSG+NL T+WAVD  + AC SLK NHP T+VRNE 
Sbjct  314   KNVVTLLDLYSGCGAMSTGLCLGANLSGINLQTRWAVDLNQYACQSLKLNHPNTEVRNEK  373

Query  326   VenflkllkeweklckEYGSEPNAGSDDVLEGMEEGaddansladsddsdAEYEILRLVD  147
              E+FL LL EWEKLC++Y    +   + V E ++    D   L D    + E+E+ +LV 
Sbjct  374   AEDFLALLIEWEKLCEKY----HVIGNQVKEEIDSNGLDGEELNDPKVPNDEFEVDKLVG  429

Query  146   ICFGDPNDTGKPGIHFQVRWKGYGPSEDTWEPIDGLKSWKNR  21
             IC+GDP+D GK G+ F+VRWKGYGPS+DTWEP++GL   + R
Sbjct  430   ICYGDPSDIGKIGLKFKVRWKGYGPSDDTWEPVEGLSKCEER  471



>ref|XP_006470820.1| PREDICTED: DNA (cytosine-5)-methyltransferase 1-like [Citrus 
sinensis]
Length=845

 Score =   270 bits (691),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 161/351 (46%), Positives = 221/351 (63%), Gaps = 23/351 (7%)
 Frame = -2

Query  1028  ADEEDEVILNVDCHYAQAKVLSFILNIGDCVYVKGE-GEKKHVGRILEFFKTTEGEDYFR  852
             A  E+E +L   CHY QA V   + N+GD  YVK E G   ++ RI+E F++ +GE YF+
Sbjct  99    ALNEEEEVLQARCHYTQASVDGCLYNLGDDAYVKAEEGAVDYIARIVELFESVDGEPYFK  158

Query  851   VQWFFRAEDTVMRDAAALHDKKRLFYSTLMNDNLLDCIISKVNVTEISPGLGLEVN--NS  678
              +WF+RAEDTV++D A L D+KR+F S + +DN L+CI+SK  + E++  + LE    N 
Sbjct  159   ARWFYRAEDTVIKDLAYLVDRKRVFLSDVEDDNPLNCIVSKAKIAEVAANMDLEAKQKNI  218

Query  677   PPSGFYYDMEYCVDYSTFRNLPTVQSVNSWDSPSLIDA---SYKPITAYPVEHFKSCEPS  507
             PP   YYDM+Y + + TF N+    +    D+ S I +   S  PI           EP 
Sbjct  219   PPCDLYYDMKYTLPHLTFSNINNESNRRDSDASSTISSETGSNSPIG----------EP-  267

Query  506   KVELSLLDLYAGCGGMSTGLCLGAKLSGLNLVTKWAVDYQKSACDSLKFNHPETQVRNES  327
               E+SLLDLY+GCG MSTGLC+GA LSG+ LVT+WA+D    AC SLKFNHPET+VRNE+
Sbjct  268   --EMSLLDLYSGCGAMSTGLCIGASLSGVKLVTRWAIDINPHACKSLKFNHPETKVRNEA  325

Query  326   VenflkllkeweklckEYG----SEPNAGSDDVLEGMEEGaddansladsddsdAEYEIL  159
              ++FL LLKEW KLC+ +      +    S + +   EE  ++  +  DS+  + E+E+ 
Sbjct  326   ADDFLSLLKEWAKLCQYFSIYDTDKVPEQSLNFMSEDEEEEEEEENDDDSNVPNEEFEVE  385

Query  158   RLVDICFGDPNDTGKPGIHFQVRWKGYGPSEDTWEPIDGLKSWKNRQGWFT  6
              L  +C+GDPN T KPG++F+VRWKGYGPSEDTWEPI GL   K +   F 
Sbjct  386   SLTAVCYGDPNKTKKPGVYFKVRWKGYGPSEDTWEPIKGLSKCKEKLKEFV  436



>ref|XP_010936992.1| PREDICTED: DNA (cytosine-5)-methyltransferase 1-like [Elaeis 
guineensis]
Length=925

 Score =   266 bits (681),  Expect = 6e-77, Method: Compositional matrix adjust.
 Identities = 168/359 (47%), Positives = 223/359 (62%), Gaps = 34/359 (9%)
 Frame = -2

Query  1031  SADEEDEVILNVDCHYAQAKVLSFILNIGDCVYVK-GEGEKKHVGRILEFFKTTEGEDYF  855
             S   ++E +L    HY QA V + I N+ D  Y+K G+GE  ++GRI+EFF+TT+G+ YF
Sbjct  163   SKKSDEEEVLKARRHYWQAMVDNVIYNLNDDAYIKAGDGEPDYIGRIVEFFETTDGQLYF  222

Query  854   RVQWFFRAEDTVMRDAA----ALHDKKRLFYSTLMNDNLLDCIISKVNVTEISPGLGLEV  687
               QWFFRAEDTV+++ A     +HD +R+F S   NDN+LDCI+SK+ +  +   + L+ 
Sbjct  223   AAQWFFRAEDTVIKEIAHDPKTVHDPRRVFLSEEKNDNVLDCIVSKIRIVRVESNIDLKA  282

Query  686   --NNSPPSGFYYDMEYCVDYSTFRNLPTVQSVNS----WDSPSLIDASYKPITAYPVEHF  525
               ++ PP   YYDM Y + YSTF NLP  +S+ +      + S  DAS         +  
Sbjct  283   KEDSIPPCDLYYDMSYSLSYSTFGNLPP-ESLRAGSETSSTISSEDASNVCKGKCQSDSE  341

Query  524   KSCEPSKVELSLLDLYAGCGGMSTGLCLGAKLSGLNLVTKWAVDYQKSACDSLKFNHPET  345
              S    K  LSLLDLY+GCG MSTGLCLGA LSGL L T+WAVD    AC+SLK NHP T
Sbjct  342   ASSSGEKRVLSLLDLYSGCGAMSTGLCLGANLSGLKLETRWAVDINPYACESLKLNHPHT  401

Query  344   QVRNESVenflkllkeweklckEY-----------GSEPNAGSDDVLEGMEEGaddansl  198
             +VRNE  E+FL LL+EWEKLC ++           GSE ++GSDD  E            
Sbjct  402   EVRNEKAEDFLALLREWEKLCAKFNLIGMESSFAQGSE-SSGSDDEDESR----------  450

Query  197   adsddsdAEYEILRLVDICFGDPNDTGKPGIHFQVRWKGYGPSEDTWEPIDGLKSWKNR  21
               ++    E+E+ +LV IC+GDP++ GK G+ F+VRWKGYGPSEDTWEPIDGL   + R
Sbjct  451   ISTEVPRGEFEVGKLVGICYGDPSNIGKVGLKFKVRWKGYGPSEDTWEPIDGLSKCQER  509



>gb|ABW96889.1| CMT-type DNA-methyltransferase [Elaeis guineensis]
Length=925

 Score =   266 bits (681),  Expect = 7e-77, Method: Compositional matrix adjust.
 Identities = 168/359 (47%), Positives = 223/359 (62%), Gaps = 34/359 (9%)
 Frame = -2

Query  1031  SADEEDEVILNVDCHYAQAKVLSFILNIGDCVYVK-GEGEKKHVGRILEFFKTTEGEDYF  855
             S   ++E +L    HY QA V + I N+ D  Y+K G+GE  ++GRI+EFF+TT+G+ YF
Sbjct  163   SKKSDEEEVLKARRHYWQAMVDNVIYNLNDDAYIKAGDGEPDYIGRIVEFFETTDGQLYF  222

Query  854   RVQWFFRAEDTVMRDAA----ALHDKKRLFYSTLMNDNLLDCIISKVNVTEISPGLGLEV  687
               QWFFRAEDTV+++ A     +HD +R+F S   NDN+LDCI+SK+ +  +   + L+ 
Sbjct  223   AAQWFFRAEDTVIKEIAHDPKTVHDPRRVFLSEEKNDNVLDCIVSKIRIVRVESNIDLKA  282

Query  686   --NNSPPSGFYYDMEYCVDYSTFRNLPTVQSVNS----WDSPSLIDASYKPITAYPVEHF  525
               ++ PP   YYDM Y + YSTF NLP  +S+ +      + S  DAS         +  
Sbjct  283   KEDSIPPCDLYYDMSYSLSYSTFGNLPP-ESLRAGSETSSTISSEDASNVCKGKCQSDSE  341

Query  524   KSCEPSKVELSLLDLYAGCGGMSTGLCLGAKLSGLNLVTKWAVDYQKSACDSLKFNHPET  345
              S    K  LSLLDLY+GCG MSTGLCLGA LSGL L T+WAVD    AC+SLK NHP T
Sbjct  342   ASSSGEKRVLSLLDLYSGCGAMSTGLCLGANLSGLKLETRWAVDINPYACESLKLNHPHT  401

Query  344   QVRNESVenflkllkeweklckEY-----------GSEPNAGSDDVLEGMEEGaddansl  198
             +VRNE  E+FL LL+EWEKLC ++           GSE ++GSDD  E            
Sbjct  402   EVRNEKAEDFLALLREWEKLCAKFNLIGMESSFAQGSE-SSGSDDEDESR----------  450

Query  197   adsddsdAEYEILRLVDICFGDPNDTGKPGIHFQVRWKGYGPSEDTWEPIDGLKSWKNR  21
               ++    E+E+ +LV IC+GDP++ GK G+ F+VRWKGYGPSEDTWEPIDGL   + R
Sbjct  451   ISTEVPRGEFEVGKLVGICYGDPSNIGKVGLKFKVRWKGYGPSEDTWEPIDGLSKCQER  509



>ref|XP_004512254.1| PREDICTED: putative DNA (cytosine-5)-methyltransferase CMT1-like 
[Cicer arietinum]
Length=882

 Score =   261 bits (668),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 161/337 (48%), Positives = 210/337 (62%), Gaps = 17/337 (5%)
 Frame = -2

Query  1004  LNVDCHYAQAKVLSFILNIGDCVYVKGE-GEKKHVGRILEFFKTTEGEDYFRVQWFFRAE  828
             L   CHY +A V   I  + D  YVK E G+  ++ RI+E F+T + E YF  QWF+RAE
Sbjct  73    LQAKCHYREANVDGVIYKLNDNAYVKAEDGKPDYIARIVEMFETPDKEHYFTAQWFYRAE  132

Query  827   DTVMRDAAALHDKKRLFYSTLMNDNLLDCIISKVNVTEISPGLGLEVNNSPPSGFYYDME  648
             DTV++D   L DKKR+F S + ++N LDCI+SKV + +I+P +G +    P    YYDM+
Sbjct  133   DTVIKDHGNLVDKKRVFISDVKDENPLDCIVSKVKIVQIAPNVGTK-KKIPSCDLYYDMK  191

Query  647   YCVDYSTFRNLPTVQSVNSWDSPSLIDA---SYKPITAYPVEHFKSCE---PSKVELSLL  486
             Y V Y TF N+     VN  DS S I +   S   +    V +   C+     K E +LL
Sbjct  192   YTVPYLTFSNI-----VNESDSTSTISSESGSNGCVADSNVANGGKCQHNSSDKSEWTLL  246

Query  485   DLYAGCGGMSTGLCLGAKLSGLNLVTKWAVDYQKSACDSLKFNHPETQVRNESVenflkl  306
             DLY+GCG MSTGLC GA +SG+ LVT+WAVD    AC+SLK NHPETQVRNE  E+FL L
Sbjct  247   DLYSGCGAMSTGLCFGASISGMKLVTRWAVDINSHACESLKLNHPETQVRNEPAEDFLSL  306

Query  305   lkeweklckEY---GSEPNAGSDDV-LEGMEEGaddansladsddsdAEYEILRLVDICF  138
             LK W KLC+E+   GSE +    DV  E  +E +D  N   D+     E+E+ +L+ +C+
Sbjct  307   LKAWVKLCEEFSLIGSERSDSDLDVDEEADDEASDVKNEATDNPSDSEEFEVEKLLSVCY  366

Query  137   GDPNDTGKPGIHFQVRWKGYGPSEDTWEPIDGLKSWK  27
             GDPN   K G+HF+VRW+GY  SEDTWEPIDGL   K
Sbjct  367   GDPNGVKKSGLHFKVRWRGYDSSEDTWEPIDGLSDCK  403



>gb|EEE62800.1| hypothetical protein OsJ_17603 [Oryza sativa Japonica Group]
Length=1190

 Score =   262 bits (669),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 155/311 (50%), Positives = 203/311 (65%), Gaps = 12/311 (4%)
 Frame = -2

Query  923  EGEKKHVGRILEFFKTTEGEDYFRVQWFFRAEDTVMRDAAALHDKKRLFYSTLMNDNLLD  744
            EG+  ++GR+LEFF+T  GE YFRVQWFF AEDTV+ + A  HD +RLFYS L +DNLLD
Sbjct  429  EGKPNYIGRLLEFFETKTGECYFRVQWFFTAEDTVIGEQAQSHDPRRLFYSDLTDDNLLD  488

Query  743  CIISKVNVTEISPGLGLEVNNSPPSGFYYDMEYCVDYSTFRNLPTVQSVNSWDS--PSLI  570
            CI+SKV + ++ P +  +  + P S +YYDM+Y +DYSTF  +    + +   S   S I
Sbjct  489  CIVSKVTIVQVPPSVDGKSKSVPSSDYYYDMKYSIDYSTFSTIEMEDTDDLMQSCYTSRI  548

Query  569  DASYKPITAYPVEHFKSCEPSKVELSLLDLYAGCGGMSTGLCLGAKLSGLNLVTKWAVDY  390
            +   K I     +  KS    K+ELSLLDLY GCGGMSTGLCLGA+  G+NL  +WA+D 
Sbjct  549  NDKMKKIDVN--KKHKSPVLEKMELSLLDLYCGCGGMSTGLCLGARGGGVNLSARWAIDD  606

Query  389  QKSACDSLKFNHPETQVRNESVenflkllkeweklckEY--GSEPNAGSDDVLEGMEEGa  216
             + AC+S + NHPET+VRNE+ ++FL+LLKEWEKLCK Y   S   A  D   E   E  
Sbjct  607  DEIACESFRNNHPETRVRNETTDDFLELLKEWEKLCKTYVKHSRTKACVDSTTESNNE--  664

Query  215  ddansladsddsdAEYEILRLVDICFGDPNDTGKPGIHFQVRWKGYGPSEDTWEPIDGLK  36
                +   S     E+E+ +LVDICFGDPN   K G++F+VRWKGYGP  DTWEP++GL+
Sbjct  665  ----TPDCSTVPPEEFEVWKLVDICFGDPNKVSKHGLYFKVRWKGYGPHHDTWEPVEGLR  720

Query  35   SWKNRQGWFTI  3
            + K     F I
Sbjct  721  NCKEAIRDFVI  731



>ref|XP_002275932.1| PREDICTED: putative DNA (cytosine-5)-methyltransferase CMT1 [Vitis 
vinifera]
Length=829

 Score =   258 bits (660),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 158/345 (46%), Positives = 210/345 (61%), Gaps = 13/345 (4%)
 Frame = -2

Query  1019  EDEVILNVDCHYAQAKVLSFILNIGDCVYVKGE-GEKKHVGRILEFFKTTEGEDYFRVQW  843
             E E IL    H+ +A V   I  + D  YVK E G+   + +I+E F+T + E YF  QW
Sbjct  71    EAEDILQARRHFTEAVVDGCIYKLYDYAYVKAEDGQPDFIAKIVELFETIDREPYFTAQW  130

Query  842   FFRAEDTVMRDAAALHDKKRLFYSTLMNDNLLDCIISKVNVTEISPGLGLEVNNS--PPS  669
             FFRAEDTV++D A L D+KR+FYS + +DN LDCI+SKV + +++P + L       PP 
Sbjct  131   FFRAEDTVIKDHAHLVDQKRVFYSDMRDDNPLDCIVSKVEIVQVAPNVDLAEKEKTIPPC  190

Query  668   GFYYDMEYCVDYSTFRNLPTVQSVNSWDSPSLIDASYKPITAYPVEHFKSCEPSKVE---  498
               YYDM Y + + TF NL T  S    D  S I +     +     +    E S+V    
Sbjct  191   DLYYDMSYSLKHLTFANLLTENSRTESDESSTISSEIGLNSTTDGINSAIGESSQVHKFQ  250

Query  497   ---LSLLDLYAGCGGMSTGLCLGAKLSGLNLVTKWAVDYQKSACDSLKFNHPETQVRNES  327
                ++LLDLY+GCG MSTGLCLGA LSGL LVT+WAVD    AC+SLK NHPET+VRNE+
Sbjct  251   GSGMTLLDLYSGCGAMSTGLCLGASLSGLKLVTRWAVDINPHACESLKLNHPETEVRNEA  310

Query  326   VenflkllkeweklckEY----GSEPNAGSDDVLEGMEEGaddansladsddsdAEYEIL  159
              E+FL LLKEW  LC+++       P   +        +  +DA+    S     E+E+ 
Sbjct  311   AEDFLSLLKEWATLCEDFSLLGSRRPEVVNPISNRSGSDDEEDADGDDGSPVPRGEFEVK  370

Query  158   RLVDICFGDPNDTGKPGIHFQVRWKGYGPSEDTWEPIDGLKSWKN  24
             +LV IC+GDPN+  KPG++F+VRWKGYGPS+DTWEPI+GL   K 
Sbjct  371   KLVAICYGDPNEINKPGLYFKVRWKGYGPSDDTWEPIEGLSKCKK  415



>emb|CBI29991.3| unnamed protein product [Vitis vinifera]
Length=827

 Score =   258 bits (660),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 158/345 (46%), Positives = 210/345 (61%), Gaps = 13/345 (4%)
 Frame = -2

Query  1019  EDEVILNVDCHYAQAKVLSFILNIGDCVYVKGE-GEKKHVGRILEFFKTTEGEDYFRVQW  843
             E E IL    H+ +A V   I  + D  YVK E G+   + +I+E F+T + E YF  QW
Sbjct  69    EAEDILQARRHFTEAVVDGCIYKLYDYAYVKAEDGQPDFIAKIVELFETIDREPYFTAQW  128

Query  842   FFRAEDTVMRDAAALHDKKRLFYSTLMNDNLLDCIISKVNVTEISPGLGLEVNNS--PPS  669
             FFRAEDTV++D A L D+KR+FYS + +DN LDCI+SKV + +++P + L       PP 
Sbjct  129   FFRAEDTVIKDHAHLVDQKRVFYSDMRDDNPLDCIVSKVEIVQVAPNVDLAEKEKTIPPC  188

Query  668   GFYYDMEYCVDYSTFRNLPTVQSVNSWDSPSLIDASYKPITAYPVEHFKSCEPSKVE---  498
               YYDM Y + + TF NL T  S    D  S I +     +     +    E S+V    
Sbjct  189   DLYYDMSYSLKHLTFANLLTENSRTESDESSTISSEIGLNSTTDGINSAIGESSQVHKFQ  248

Query  497   ---LSLLDLYAGCGGMSTGLCLGAKLSGLNLVTKWAVDYQKSACDSLKFNHPETQVRNES  327
                ++LLDLY+GCG MSTGLCLGA LSGL LVT+WAVD    AC+SLK NHPET+VRNE+
Sbjct  249   GSGMTLLDLYSGCGAMSTGLCLGASLSGLKLVTRWAVDINPHACESLKLNHPETEVRNEA  308

Query  326   VenflkllkeweklckEY----GSEPNAGSDDVLEGMEEGaddansladsddsdAEYEIL  159
              E+FL LLKEW  LC+++       P   +        +  +DA+    S     E+E+ 
Sbjct  309   AEDFLSLLKEWATLCEDFSLLGSRRPEVVNPISNRSGSDDEEDADGDDGSPVPRGEFEVK  368

Query  158   RLVDICFGDPNDTGKPGIHFQVRWKGYGPSEDTWEPIDGLKSWKN  24
             +LV IC+GDPN+  KPG++F+VRWKGYGPS+DTWEPI+GL   K 
Sbjct  369   KLVAICYGDPNEINKPGLYFKVRWKGYGPSDDTWEPIEGLSKCKK  413



>gb|KEH27061.1| DNA (cytosine-5)-methyltransferase CMT3-like protein [Medicago 
truncatula]
Length=835

 Score =   258 bits (658),  Expect = 4e-74, Method: Compositional matrix adjust.
 Identities = 158/359 (44%), Positives = 217/359 (60%), Gaps = 13/359 (4%)
 Frame = -2

Query  1049  WHTCFCSADEE-DEVILNVDCHYAQAKVLSFILNIGDCVYVKGE-GEKKHVGRILEFFKT  876
             W   +   DE  D+       HY +AKV   +  + D  YVKGE G++ ++ RI+E F+T
Sbjct  74    WPHRYTKNDESSDDESFKAKFHYREAKVDGILYKLDDNAYVKGEEGKEDYIARIVELFET  133

Query  875   TEGEDYFRVQWFFRAEDTVMRDAAALHDKKRLFYSTLMNDNLLDCIISKVNVTEISPGLG  696
              + E YF  QWF+RAEDTV++D   L DKKR+F S + ++N LDC++ KVN+ +ISP   
Sbjct  134   PDEEQYFTAQWFYRAEDTVIKDHGNLVDKKRIFKSDVKDENPLDCLVRKVNIVQISPDAA  193

Query  695   LEVNNSPPSGFYYDMEYCVDYSTFRNLPTVQSVNSWDSPSLIDASYKPITAYPVEHFKSC  516
              +    PP  FY+DM+Y V Y TF N+    ++    + +L   S   + A   +  K  
Sbjct  194   -KKKKIPPCDFYFDMKYTVPYLTFCNIDNAPAIIESKTSTLSSESGSNVHATDKKGVKEK  252

Query  515   -----EPSKVELSLLDLYAGCGGMSTGLCLGAKLSGLNLVTKWAVDYQKSACDSLKFNHP  351
                  E ++ E +LLDLY+GCG MSTGLC GA +SG+ LVT+WAVD  K AC+SLK NHP
Sbjct  253   STQIKESNRREWTLLDLYSGCGAMSTGLCFGASISGIKLVTRWAVDINKHACESLKLNHP  312

Query  350   ETQVRNESVenflkllkeweklckEY---GSEPNAGSDDVLEGMEEGaddansladsdds  180
             ET VRNE  E+FL LLKEW KLC E+   G+E  +   D+  G E   +  +   D+   
Sbjct  313   ETHVRNEPTEDFLSLLKEWAKLCDEFVLNGAE--STDSDLNAGKEAEEEADDEAMDNSLD  370

Query  179   dAEYEILRLVDICFGDPNDTGKPGIHFQVRWKGYGPSEDTWEPIDGLKSWKNRQGWFTI  3
                +E+ RL+ IC+GDPN+ GKPG++F+V WKGY  S DTWEPI+GL   K+    F I
Sbjct  371   SEVFEVERLLSICYGDPNEDGKPGLYFKVHWKGYDSSNDTWEPIEGLSECKDAMKDFVI  429



>gb|EEC78738.1| hypothetical protein OsI_18945 [Oryza sativa Indica Group]
Length=1325

 Score =   261 bits (666),  Expect = 7e-74, Method: Compositional matrix adjust.
 Identities = 155/311 (50%), Positives = 203/311 (65%), Gaps = 12/311 (4%)
 Frame = -2

Query  923  EGEKKHVGRILEFFKTTEGEDYFRVQWFFRAEDTVMRDAAALHDKKRLFYSTLMNDNLLD  744
            EG+  ++GR+LEFF+T  GE YFRVQWFF AEDTV+ + A  HD +RLFYS L +DNLLD
Sbjct  606  EGKPNYIGRLLEFFETKTGECYFRVQWFFTAEDTVIGEQAQSHDPRRLFYSDLTDDNLLD  665

Query  743  CIISKVNVTEISPGLGLEVNNSPPSGFYYDMEYCVDYSTFRNLPTVQSVNSWDS--PSLI  570
            CI+SKV + ++ P +  +  + P S +YYDM+Y +DYSTF  +    + +   S   S I
Sbjct  666  CIVSKVTIVQVPPSVDGKSKSVPSSDYYYDMKYSIDYSTFSTIEMEDTDDLMQSCYTSRI  725

Query  569  DASYKPITAYPVEHFKSCEPSKVELSLLDLYAGCGGMSTGLCLGAKLSGLNLVTKWAVDY  390
            +   K I     +  KS    K+ELSLLDLY GCGGMSTGLCLGA+  G+NL  +WA+D 
Sbjct  726  NDKMKKIDVN--KKHKSPVLEKMELSLLDLYCGCGGMSTGLCLGARGGGVNLSARWAIDD  783

Query  389  QKSACDSLKFNHPETQVRNESVenflkllkeweklckEY--GSEPNAGSDDVLEGMEEGa  216
             + AC+S + NHPET+VRNE+ ++FL+LLKEWEKLCK Y   S   A  D   E   E  
Sbjct  784  DEIACESFRNNHPETRVRNETTDDFLELLKEWEKLCKTYVKHSRTKACVDSTTESNNE--  841

Query  215  ddansladsddsdAEYEILRLVDICFGDPNDTGKPGIHFQVRWKGYGPSEDTWEPIDGLK  36
                +   S     E+E+ +LVDICFGDPN   K G++F+VRWKGYGP  DTWEP++GL+
Sbjct  842  ----TPDCSTVPPEEFEVWKLVDICFGDPNKVSKHGLYFKVRWKGYGPHHDTWEPVEGLR  897

Query  35   SWKNRQGWFTI  3
            + K     F I
Sbjct  898  NCKEAIRDFVI  908



>gb|AIU80190.1| chromomethylase [Hevea brasiliensis]
Length=851

 Score =   257 bits (657),  Expect = 7e-74, Method: Compositional matrix adjust.
 Identities = 157/378 (42%), Positives = 217/378 (57%), Gaps = 56/378 (15%)
 Frame = -2

Query  1028  ADEEDEVILNVDCHYAQAKVLSFILNIGDCVYVKGE-GEKKHVGRILEFFKTTEGEDYFR  852
             A  E+E +L   CHY QA V + +  +GD  YVK + G   ++ RI+E F+T EGE YF 
Sbjct  82    ASGEEEDVLQAKCHYTQAMVDNVLYKLGDDAYVKADDGSPDYIARIVELFETIEGEPYFT  141

Query  851   VQWFFRAEDTVMRDAAALHDKKRLFYSTLMNDNLLDCIISKVNVTEISPGLGLEVNNS--  678
              QWF+R EDTV++D A   + +R+F S + +DN L+CI+SK+ +  ++P + L       
Sbjct  142   AQWFYRTEDTVIKDHAQSTESRRVFLSEIKDDNPLNCIVSKIKIALVAPNMDLAAKERKI  201

Query  677   PPSGFYYDMEYCVDYSTFRNLPTVQSV----------------NSWDSPSLIDASYKPIT  546
             PP   YYDM+Y + + TF+ + +  S+                NS D   + DA  KP  
Sbjct  202   PPCDLYYDMKYTLPFLTFQTIKSDNSIRDSGSSSTISSESDSNNSIDD--VNDAIGKPSK  259

Query  545   AYPVEHFKSCEPSKVELSLLDLYAGCGGMSTGLCLGAKLSGLNLVTKWAVDYQKSACDSL  366
             A+       CE  K E+ LLDLY+GCG MSTGLC+GA LS + LVTKWAVD   +AC SL
Sbjct  260   AH------RCE--KSEMHLLDLYSGCGAMSTGLCMGASLSSVKLVTKWAVDINPNACKSL  311

Query  365   KFNHPETQVRNESVenflkllk---eweklckEYGSE--PNAGSDDVLE-----------  234
             K NHPET+VRNE+ E+FL LLK   +  +    + SE  P   S+ V +           
Sbjct  312   KINHPETEVRNEAAEDFLSLLKEWEKLCRNFSLFASERHPEQSSNSVSDNEEDEDEEDQD  371

Query  233   --GMEEGaddansladsddsdAEYEILRLVDICFGDPNDTGKPGIHFQVRWKGYGPSEDT  60
               G +EG         S+    E+E+ +L+ IC+GDPN T   G++F+VRWKGYGPSEDT
Sbjct  372   NYGTDEG---------SEILSEEFEVEKLLAICYGDPNKTKTRGLYFKVRWKGYGPSEDT  422

Query  59    WEPIDGLKSWKNRQGWFT  6
             WEPI+GL   K++   F 
Sbjct  423   WEPIEGLSKCKDKLQEFV  440



>ref|XP_008797880.1| PREDICTED: DNA (cytosine-5)-methyltransferase 1-like [Phoenix 
dactylifera]
Length=928

 Score =   257 bits (657),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 164/359 (46%), Positives = 215/359 (60%), Gaps = 30/359 (8%)
 Frame = -2

Query  1019  EDEVILNVDCHYAQAKVLSFILNIGDCVYVK-GEGEKKHVGRILEFFKTTEGEDYFRVQW  843
             ++E ++    HY QA V + I N+ D  Y+K G+GE  ++GRI+EFF+T + + YF  QW
Sbjct  170   DEEEVVKARRHYWQAMVDNVIYNLNDDAYIKAGDGEPDYIGRIVEFFETIDRQLYFTAQW  229

Query  842   FFRAEDTVMRDAA----ALHDKKRLFYSTLMNDNLLDCIISKVNVTEISPGLGLEV--NN  681
             FFRAEDTV+++ A     +HD +R+F S   NDN+LDCI+SK+ +  + P + L+   ++
Sbjct  230   FFRAEDTVIKELAHGPKTVHDPRRVFLSEEKNDNILDCIVSKIRIVHVEPNIDLKAKEDS  289

Query  680   SPPSGFYYDMEYCVDYSTFRNLPT---VQSVNSWDSPSLIDASYKPITAYPVEHFKSCEP  510
              PP   YYDM Y + YSTF NLP         +  + S  DAS         +   S   
Sbjct  290   IPPCDLYYDMSYSLPYSTFGNLPPENLRAGSETSSTISSEDASNNCKGKCQSDSEASSSG  349

Query  509   SKVELSLLDLYAGCGGMSTGLCLGAKLSGLNLVTKWAVDYQKSACDSLKFNHPETQVRNE  330
              K  LSLLDLY+GCG MSTGLCLG  LSGL L T+WAVD    AC+SLK NHP T+VRNE
Sbjct  350   EKRVLSLLDLYSGCGAMSTGLCLGTNLSGLKLETRWAVDVNPYACESLKLNHPHTEVRNE  409

Query  329   SVenflkllkeweklckEYGSEPNAGSDDVLEGMEE----------Gaddansladsdds  180
               E+FL LL+EWEKLC +Y           L GME             D+  S   S+  
Sbjct  410   KAEDFLALLREWEKLCTQYN----------LVGMENFFAQESESSSSDDEDVSGISSEVP  459

Query  179   dAEYEILRLVDICFGDPNDTGKPGIHFQVRWKGYGPSEDTWEPIDGLKSWKNRQGWFTI  3
               E+E+ +LV IC+GDP++ GK G+ F+VRWKGYGPSEDTWEPIDGL   +     F I
Sbjct  460   KGEFEVGKLVGICYGDPSNIGKVGLKFKVRWKGYGPSEDTWEPIDGLSKCQEHIKVFVI  518



>ref|XP_009132479.1| PREDICTED: DNA (cytosine-5)-methyltransferase CMT2 isoform X2 
[Brassica rapa]
Length=1119

 Score =   256 bits (654),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 158/341 (46%), Positives = 219/341 (64%), Gaps = 38/341 (11%)
 Frame = -2

Query  1031  SADEEDEVILNVDCHYAQAKVLSFILNIGDCVYVKGEGEKKHVGRILEFFKTTEGEDYFR  852
             + D+ED ++ NV+CHY+QAKV +   ++GD   + G GE+  +G+I+EFFKTT+GE YFR
Sbjct  401   AEDDEDMIVANVECHYSQAKVDNETFSLGDFACLMGNGEEPPIGKIVEFFKTTDGESYFR  460

Query  851   VQWFFRAEDTVMRDAAALHDKKRLFYSTLMNDNLLDCIISKVNVTEISPGLGLEVNNSPP  672
             VQW +RA DTVM+  AA H+++RLFYST                  ++P       NS  
Sbjct  461   VQWLYRATDTVMQKQAADHERRRLFYST----------------AGLNP-------NSIK  497

Query  671   SGFYYDMEYCVDYSTFRNLPTVQSVNSWDSPSLIDASYKPITAYPVEHFKSCEPSKV---  501
             S FY+DMEYCV++STF+ L T  S N  +  + +          P E  +S    K    
Sbjct  498   SDFYFDMEYCVEFSTFQTLRTQTSENKLECGADV---------TPTESIESILEDKSFSK  548

Query  500   ELSLLDLYAGCGGMSTGLCLGAKLSGLNLVTKWAVDYQKSACDSLKFNHPETQVRNESVe  321
             EL +LDLY+GCGGMSTGL LGAK+SG+++VTKWA+D   +AC+SLK NHP+TQVRN+S  
Sbjct  549   ELLVLDLYSGCGGMSTGLNLGAKISGVDVVTKWAIDQNLAACESLKLNHPQTQVRNDSAG  608

Query  320   nflkllkeweklckEYGSEPNAGSDDVL--EGMEEGaddansladsddsdAEYEILRLVD  147
             +FL+LLKEW KLCK Y    N  + D L  E   + A +++S  + D    EYE+ +LVD
Sbjct  609   DFLQLLKEWGKLCKRY-VRNNGHTTDTLNPENSTKEATESSSSTEDDSEPEEYEVEKLVD  667

Query  146   ICFGDPNDTGKPGIHFQVRWKGYGPSEDTWEPIDGLKSWKN  24
             IC+GDP+ TG+ G+ F+V WKGY  +EDTWEP + L + ++
Sbjct  668   ICYGDPDKTGERGLKFKVHWKGYSSNEDTWEPAEELSNCQD  708



>ref|XP_010091206.1| DNA (cytosine-5)-methyltransferase 1 [Morus notabilis]
 gb|EXB43461.1| DNA (cytosine-5)-methyltransferase 1 [Morus notabilis]
Length=851

 Score =   254 bits (648),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 150/332 (45%), Positives = 208/332 (63%), Gaps = 21/332 (6%)
 Frame = -2

Query  989  HYAQAKVLSFILNIGDCVYVKGEGEKK-HVGRILEFFKTTEGEDYFRVQWFFRAEDTVMR  813
            HY QA V   + N+ D  YVK E +K  ++ RI+EFF+  +GE YF  QWF+RAEDT ++
Sbjct  118  HYTQAMVEGVVFNLNDDAYVKAEDDKPDYIARIVEFFEGVDGERYFTAQWFYRAEDTPIK  177

Query  812  DAA---ALHDKKRLFYSTLMNDNLLDCIISKVNVTEISPGLGLEVNNS--PPSGFYYDME  648
            D A    + DK+R+F S + N N +DCI+SKV + ++SP L LE      P    YYDM+
Sbjct  178  DLANHAQMFDKRRVFLSEIRNINPIDCIVSKVKIAKVSPNLDLEAKEKTIPECDLYYDMK  237

Query  647  YCVDYSTFRNLPTVQSVNSWDSPSLIDASYKPITAYPVEHFKSCEPSKVELSLLDLYAGC  468
            Y V + TF +L T    N++   S   ++    +    E F +    K E+SLLDLY+GC
Sbjct  238  YLVPHLTFASLET----NTYRQDSEASSTISSESGSSGEVFPNISLRKSEMSLLDLYSGC  293

Query  467  GGMSTGLCLGAKLSGLNLVTKWAVDYQKSACDSLKFNHPETQVRNESVenflkllk---e  297
            G MSTGLC+GAK SG+NLVT+WAVD    AC+SLK NHPET+VRNE+ ++FL LLK   +
Sbjct  294  GAMSTGLCIGAKRSGINLVTRWAVDINSYACESLKLNHPETEVRNEAADDFLHLLKEWDK  353

Query  296  weklckEYGSEPNAGSDDVLEGMEEGaddansladsddsdAEYEILRLVDICFGDPNDTG  117
                 +EY S  + G DD     +E +DD+ + ++       YE+ RL+ +C+GDPN+  
Sbjct  354  LISELQEYDS--SGGVDDASNDKDESSDDSTNPSEV------YEVERLLGVCYGDPNNVK  405

Query  116  KPGIHFQVRWKGYGPSEDTWEPIDGLKSWKNR  21
              G++F+VRWKGY   EDTWEP+DGL   K+R
Sbjct  406  NSGLYFKVRWKGYDSDEDTWEPLDGLSDCKDR  437



>ref|XP_002530367.1| protein with unknown function [Ricinus communis]
 gb|EEF32028.1| protein with unknown function [Ricinus communis]
Length=845

 Score =   251 bits (642),  Expect = 8e-72, Method: Compositional matrix adjust.
 Identities = 155/360 (43%), Positives = 214/360 (59%), Gaps = 23/360 (6%)
 Frame = -2

Query  1019  EDEVILNVDCHYAQAKVLSFILNIGDCVYVKGE-GEKKHVGRILEFFKTTEGEDYFRVQW  843
             +D+ +    CHY QA V   + ++GD  YVK E G+  ++ RI+E F++ +GE  F  QW
Sbjct  88    KDDDVTQAKCHYKQAMVDGILYDLGDDAYVKAEDGKPDYIARIVEMFESIDGEPLFTAQW  147

Query  842   FFRAEDTVMRDAAALHDKKRLFYSTLMNDNLLDCIISKVNVTEISPGLGL--EVNNSPPS  669
             F+RAEDTV++D     + +R+F S + +DN LDCI+SKV +  + P L L  +  N PP 
Sbjct  148   FYRAEDTVIKDYVKTAESRRVFLSEIRDDNPLDCIVSKVKIALVEPNLDLAEKERNLPPC  207

Query  668   GFYYDMEYCVDYSTFRNLPTVQSVNSW----------DSPSLIDASYKPITAYPVEHFKS  519
               YYDM+Y + + T+  + T  S              DS + ID   K  TA P++    
Sbjct  208   DLYYDMKYTLPFLTYETIKTDDSGRDSGSSSTISSENDSNNSID-DVKVTTAKPLKVLSK  266

Query  518   CEPS-KVELSLLDLYAGCGGMSTGLCLGAKLSGLNLVTKWAVDYQKSACDSLKFNHPETQ  342
                S K EL LLDLY+GCG MSTGLC+GA LSG+ LVTKWAVD    AC SLK NHPET+
Sbjct  267   VHSSEKSELYLLDLYSGCGAMSTGLCMGASLSGVKLVTKWAVDINAFACKSLKTNHPETE  326

Query  341   VRNESVenflkllk---eweklckEYGSE--PNAGSDDVLEGMEEGaddansladsddsd  177
             VRNE+ E+FL LLK   +  +    +GSE  P   S+   +  EE  ++       D  D
Sbjct  327   VRNEAAEDFLSLLKEWEKLCRKFSLFGSEKHPEQSSNSASDEEEEDEEEEEEEKGKDKDD  386

Query  176   AE---YEILRLVDICFGDPNDTGKPGIHFQVRWKGYGPSEDTWEPIDGLKSWKNRQGWFT  6
              +   +E+ +L+ +C+GDPN   K G++F+VRWKGYGPSEDTWEPI+GL   K++   F 
Sbjct  387   DDDEIFEVEKLLAVCYGDPNKVNKRGLYFKVRWKGYGPSEDTWEPIEGLSDCKDKLKEFV  446



>gb|EYU23276.1| hypothetical protein MIMGU_mgv1a002680mg [Erythranthe guttata]
Length=647

 Score =   246 bits (627),  Expect = 5e-71, Method: Compositional matrix adjust.
 Identities = 156/284 (55%), Positives = 184/284 (65%), Gaps = 50/284 (18%)
 Frame = -2

Query  872  EGEDYFRVQWFFRAEDTVMRDAAALHDKKRLFYSTLMNDNLLDCIISKVNVTEISPGLGL  693
            EGEDYFRVQWFFRAEDTV++DAA+ HDK+RLFYSTLMNDNLLDCIISKVNV  I P    
Sbjct  2    EGEDYFRVQWFFRAEDTVLKDAASSHDKRRLFYSTLMNDNLLDCIISKVNVVRIPPA---  58

Query  692  EVNNSPPSGFYYDMEYCVDYSTFRNLPTVQSVNSWDSPSLIDASYKPITAYPVEHFKSCE  513
                                                          PIT  P++ F   E
Sbjct  59   ----------------------------------------------PITFSPLDIFPKNE  72

Query  512  PSKVELSLLDLYAGCGGMSTGLCLGAKLSGLNLVTKWAVDYQKSACDSLKFNHPETQVRN  333
              K EL+LLDLYAGCGGMSTGLC GAKLS LNLVTKWAVD   SAC+SLK NHPET+VRN
Sbjct  73   SLKQELTLLDLYAGCGGMSTGLCFGAKLSNLNLVTKWAVDLNSSACESLKLNHPETKVRN  132

Query  332  ESVenflkllkeweklckEYGSEPNAGSD-DVLEGMEEGaddansladsddsdAEYEILR  156
            ES +NFL+LLK+W+KLCK Y  +     D ++ +  E     A S +DS++S  EYE+  
Sbjct  133  ESTDNFLELLKQWKKLCKLYVGDLERALDCELADPHESENCTAQSDSDSEESSEEYEVSF  192

Query  155  LVDICFGDPNDTGKPGIHFQVRWKGYGPSEDTWEPIDGLKSWKN  24
            LVDIC+GDPN  GK G+HF+VRWKGYGP +DTWEPI+ L + K+
Sbjct  193  LVDICYGDPNKNGKCGLHFKVRWKGYGPDDDTWEPIESLSNSKD  236



>ref|XP_003636958.1| DNA (cytosine-5)-methyltransferase [Medicago truncatula]
 gb|KEH21528.1| DNA (cytosine-5)-methyltransferase CMT3-like protein [Medicago 
truncatula]
Length=827

 Score =   247 bits (631),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 159/354 (45%), Positives = 219/354 (62%), Gaps = 8/354 (2%)
 Frame = -2

Query  1049  WHTCFCSADEEDE-VILNVDCHYAQAKVLSFILNIGDCVYVKGE-GEKKHVGRILEFFKT  876
             W   +   DE  E   L    HY +AKV   +  + D  YVKGE G++ ++ RI+E F+T
Sbjct  71    WPHRYTKNDELSEGESLKAKFHYHEAKVDGILYKLEDNAYVKGEEGKEDYIARIVEMFET  130

Query  875   TEGEDYFRVQWFFRAEDTVMRDAAALHDKKRLFYSTLMNDNLLDCIISKVNVTEISPGLG  696
              + E YF  QWF+RAEDTV++D   L DKKR+F S + ++N LDC++ KVN+ +ISP   
Sbjct  131   PDEEQYFTAQWFYRAEDTVIKDHGNLVDKKRIFISDVKDENPLDCLVRKVNIVQISPDAA  190

Query  695   LEVNNSPPSGFYYDMEYCVDYSTFRNLPTVQSVNSWDSPS--LIDASYKPITAYPVEHFK  522
              +    PP  FY+DM+Y V Y TF N+      ++  S S   + A+ K          K
Sbjct  191   -KKKKIPPCEFYFDMKYTVPYLTFSNVGNESETSTLSSESGYNVHAADKNAVKEKSSQIK  249

Query  521   SCEPSKVELSLLDLYAGCGGMSTGLCLGAKLSGLNLVTKWAVDYQKSACDSLKFNHPETQ  342
              C  ++ E +LLDLY+GCG MSTGLC GA +SG+ LVT+WAVD    AC+SLK NHPET 
Sbjct  250   EC--NRPEWTLLDLYSGCGAMSTGLCFGASISGIKLVTRWAVDINDHACESLKLNHPETH  307

Query  341   VRNESVenflkllkeweklckEYGSEPNAGSDDVLEGMEEGaddansladsddsdAE-YE  165
             VRNE  E+FL LLKEW KLC+++       +D  L   EE  ++A+  A ++  D+E +E
Sbjct  308   VRNEPTEDFLSLLKEWAKLCEKFVLNGAESTDSDLNAGEEAGEEADGEATNNSPDSEVFE  367

Query  164   ILRLVDICFGDPNDTGKPGIHFQVRWKGYGPSEDTWEPIDGLKSWKNRQGWFTI  3
             + RL+ IC+GDPN+  KPG++F+V+WKGY  S DTWEPI+GL   K+    F I
Sbjct  368   VERLLSICYGDPNEDEKPGLYFRVQWKGYDSSYDTWEPIEGLSECKDAMKDFVI  421



>ref|XP_003612312.1| DNA (cytosine-5)-methyltransferase [Medicago truncatula]
 gb|AES95270.1| DNA (cytosine-5)-methyltransferase CMT3-like protein [Medicago 
truncatula]
Length=835

 Score =   247 bits (631),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 163/358 (46%), Positives = 219/358 (61%), Gaps = 11/358 (3%)
 Frame = -2

Query  1049  WHTCFCSADE--EDEVILNVDCHYAQAKVLSFILNIGDCVYVKGE-GEKKHVGRILEFFK  879
             W   +   DE  EDE  L    HY +AKV   +  + D  YVKGE G++ ++  I+E F+
Sbjct  75    WPHRYTKNDESSEDES-LKAKFHYREAKVDGILYKLEDNAYVKGEEGKEDYIATIVEMFE  133

Query  878   TTEGEDYFRVQWFFRAEDTVMRDAAALHDKKRLFYSTLMNDNLLDCIISKVNVTEISPGL  699
             T E E YF  QWF+RAEDTV++D   L DKKR+F S + ++N LDC++ K+N+ +ISP  
Sbjct  134   TPEEEQYFTAQWFYRAEDTVIKDHGNLVDKKRIFKSDVKDENPLDCLVRKINIVQISPDA  193

Query  698   GLEVNNSPPSGFYYDMEYCVDYSTFRNLPTVQSVNSWDSPSLIDASYKPITAYPVEHFKS  519
               +    PP  FY+DM+Y V Y TF N+    ++   ++ +L   S   + A   +  K 
Sbjct  194   A-KKKKIPPCDFYFDMKYNVPYLTFSNIDNAHAIIESETSTLSSESGSNVRATDKKGVKE  252

Query  518   C-----EPSKVELSLLDLYAGCGGMSTGLCLGAKLSGLNLVTKWAVDYQKSACDSLKFNH  354
                   E ++ E +LLDLY+GCG MSTGLC GA +SG+ LVTKWAVD  K AC+SLK NH
Sbjct  253   KSTQIKESNRPEWTLLDLYSGCGAMSTGLCFGASISGIKLVTKWAVDINKYACESLKLNH  312

Query  353   PETQVRNESVenflkllkeweklckEYGSEPNAGSDDVLEGMEEGaddansladsddsdA  174
             PET VRNE  E+FL LLKEW KLC E+       +D  L   EE  + A+  A  D  D+
Sbjct  313   PETYVRNEPTEDFLSLLKEWAKLCDEFVLNGAESTDSDLNAAEEAEEKADDEAMDDSPDS  372

Query  173   E-YEILRLVDICFGDPNDTGKPGIHFQVRWKGYGPSEDTWEPIDGLKSWKNRQGWFTI  3
             E +E+ RL+ IC+GDPN+  KPG++F+V WKGY  S DTWEPI+GL   K+    F I
Sbjct  373   EVFEVERLLSICYGDPNEDEKPGLYFKVHWKGYDSSYDTWEPIEGLSECKDAMKDFVI  430



>gb|AIO05713.1| CMT-type DNA-methyltransferase, partial [Cocos nucifera]
Length=579

 Score =   242 bits (617),  Expect = 5e-70, Method: Compositional matrix adjust.
 Identities = 157/347 (45%), Positives = 207/347 (60%), Gaps = 15/347 (4%)
 Frame = -2

Query  1031  SADEEDEVILNVDCHYAQAKVLSFILNIGDCVYVK-GEGEKKHVGRILEFFKTTEGEDYF  855
             S   ++E +L    HY QA V + I N+ D  Y+K G+GE  ++GRI+EFF+TT+ E YF
Sbjct  85    SKKSDEEEVLQARRHYWQAMVDNVIYNLNDDAYIKAGDGEPDYIGRIVEFFETTDRELYF  144

Query  854   RVQWFFRAEDTVMR----DAAALHDKKRLFYSTLMNDNLLDCIISKVNVTEISPGLGLEV  687
               QWFFR EDTV++    D   +HD +R+F S   NDN+LDCIISK+ +  +   + L+ 
Sbjct  145   AAQWFFRVEDTVIKELAHDPKTVHDPRRVFLSEEKNDNVLDCIISKIRIVRVESNIDLKA  204

Query  686   --NNSPPSGFYYDMEYCVDYSTFRNLPTVQ---SVNSWDSPSLIDASYKPITAYPVEHFK  522
               ++ PP   YYDM Y + YSTF NLP         +  + S  DAS         +   
Sbjct  205   KEDSIPPCDLYYDMSYSLSYSTFGNLPPESLWAGSETSSTISSEDASNMCKGKCQSDSEA  264

Query  521   SCEPSKVELSLLDLYAGCGGMSTGLCLGAKLSGLNLVTKWAVDYQKSACDSLKFNHPETQ  342
             S    K  LSLLDLY+GCG MSTGLCLGA LSGL L T+WAVD    AC+SLK NHP T+
Sbjct  265   SSSGEKRVLSLLDLYSGCGAMSTGLCLGANLSGLKLETRWAVDLNPYACESLKLNHPNTE  324

Query  341   VRNESVenflkllkeweklckEYGSEPNAGSDDVLEGMEEGaddansladsddsdAEYEI  162
             VRNE  E+FL LL+EWEKLC ++       S           D+  S   +D    E+E+
Sbjct  325   VRNEKAEDFLALLREWEKLCTKFNLVGMENSFAQESESSSSDDEDESGISTDVPKGEFEV  384

Query  161   LRLVDICFGDPNDTGKPGIHFQVRWKGYGPSEDTWEPIDGLKSWKNR  21
              +LV IC+GDP++TG+ G+ F+VRWKG     DTWEP+DGL   + R
Sbjct  385   GKLVGICYGDPSNTGEVGLKFKVRWKG-----DTWEPMDGLSKCQER  426



>gb|KEH27609.1| DNA (cytosine-5)-methyltransferase CMT3-like protein [Medicago 
truncatula]
Length=830

 Score =   246 bits (628),  Expect = 7e-70, Method: Compositional matrix adjust.
 Identities = 164/355 (46%), Positives = 217/355 (61%), Gaps = 10/355 (3%)
 Frame = -2

Query  1049  WHTCFCSADE--EDEVILNVDCHYAQAKVLSFILNIGDCVYVKGE-GEKKHVGRILEFFK  879
             W   +   DE  EDE  L    HY +AKV   +  + D  YVKGE G++ ++  I+E F+
Sbjct  75    WPHRYTKNDESSEDES-LKAKFHYREAKVDGILYKLEDNAYVKGEEGKEDYIATIVEMFE  133

Query  878   TTEGEDYFRVQWFFRAEDTVMRDAAALHDKKRLFYSTLMNDNLLDCIISKVNVTEISPGL  699
             T E E YF  QWF+RAEDTV++D   L DKKR+F S + ++N LDC++ K+N+ +ISP  
Sbjct  134   TPEEEQYFTAQWFYRAEDTVIKDHGNLVDKKRIFKSDVKDENPLDCLVRKINIVQISPDA  193

Query  698   GLEVNNSPPSGFYYDMEYCVDYSTFRNLPTVQSVNSWDSP--SLIDASYKPITAYPVEHF  525
               +    PP  FY+DM+Y V Y TF N+      ++  S   S + A+ K          
Sbjct  194   A-KKKKIPPCDFYFDMKYNVPYLTFSNIDNESETSTLSSESGSNVRATDKKGVKEKSTQI  252

Query  524   KSCEPSKVELSLLDLYAGCGGMSTGLCLGAKLSGLNLVTKWAVDYQKSACDSLKFNHPET  345
             K  E ++ E +LLDLY+GCG MSTGLC GA +SG+ LVTKWAVD  K AC+SLK NHPET
Sbjct  253   K--ESNRPEWTLLDLYSGCGAMSTGLCFGASISGIKLVTKWAVDINKYACESLKLNHPET  310

Query  344   QVRNESVenflkllkeweklckEYGSEPNAGSDDVLEGMEEGaddansladsddsdAE-Y  168
              VRNE  E+FL LLKEW KLC E+       +D  L   EE  + A+  A  D  D+E +
Sbjct  311   YVRNEPTEDFLSLLKEWAKLCDEFVLNGAESTDSDLNAAEEAEEKADDEAMDDSPDSEVF  370

Query  167   EILRLVDICFGDPNDTGKPGIHFQVRWKGYGPSEDTWEPIDGLKSWKNRQGWFTI  3
             E+ RL+ IC+GDPN+  KPG++F+V WKGY  S DTWEPI+GL   K+    F I
Sbjct  371   EVERLLSICYGDPNEDEKPGLYFKVHWKGYDSSYDTWEPIEGLSECKDAMKDFVI  425



>ref|XP_007041239.1| Chromomethylase 1, putative [Theobroma cacao]
 gb|EOX97070.1| Chromomethylase 1, putative [Theobroma cacao]
Length=844

 Score =   246 bits (627),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 163/350 (47%), Positives = 223/350 (64%), Gaps = 27/350 (8%)
 Frame = -2

Query  1031  SADEEDEVILNVDCHYAQAKVLSFILNIGDCVYVKGE-GEKKHVGRILEFFKTTEGEDYF  855
             S DEED+V L    HY +AKV   +  +GD  YV+ E G   ++ RI+E F+T + + YF
Sbjct  84    SNDEEDDV-LQARNHYDKAKVDGCLYKLGDNAYVQAEDGNLNYIARIVELFETIDKKPYF  142

Query  854   RVQWFFRAEDTVM-RDAAALHDKKRLFYSTLMNDNLLDCIISKVNVTEISPGLGLEVNNS  678
             + QWF+RAEDTV+ +D A L DK+R+F S + +DN L+CI+SKV + +++P + L     
Sbjct  143   KAQWFYRAEDTVINKDNAHLLDKRRVFLSDIHDDNPLNCILSKVEIAQVAPNIDLVAKER  202

Query  677   --PPSGFYYDMEYCVDYSTFRNLPTVQSVNSWDSPSLIDASYKPITAY--PVEHFKSCEP  510
               P S  YYDM+Y + Y TF+N+ T       ++P     +   +++     E   +   
Sbjct  203   TIPQSELYYDMKYSLPYLTFKNIVT-------ETPKRDSDTSSVVSSECGSSECNSNNTT  255

Query  509   SKVELSLLDLYAGCGGMSTGLCLGAKLSGLNLVTKWAVDYQKSACDSLKFNHPETQVRNE  330
             SKVE SLLDLY+GCG MSTGLC+GA LSG+ LVT+WAVD    AC SL++NHPET+VRNE
Sbjct  256   SKVERSLLDLYSGCGAMSTGLCMGASLSGVKLVTRWAVDINSYACKSLQWNHPETKVRNE  315

Query  329   SVenflkllkeweklckEY------------GSEPNAGSDDVLEG-MEEGaddanslads  189
             + E+FL LLKEWEKLC+++             SE +   DD  +G  EE   +     DS
Sbjct  316   TAEDFLCLLKEWEKLCQKFSLLGADKPLENGSSETSDEEDDDGQGCEEEQEKEREDDGDS  375

Query  188   ddsdAEYEILRLVDICFGDPNDTGKPGIHFQVRWKGYGPSEDTWEPIDGL  39
             +DS  E+E+ RL+DICFGDPN   KPG++F+VRWKGY  S DTWEP+ GL
Sbjct  376   EDSSEEFEVERLLDICFGDPNQVNKPGLYFKVRWKGYDASYDTWEPMKGL  425



>ref|XP_010651344.1| PREDICTED: DNA (cytosine-5)-methyltransferase CMT3 [Vitis vinifera]
Length=965

 Score =   246 bits (628),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 146/343 (43%), Positives = 217/343 (63%), Gaps = 18/343 (5%)
 Frame = -2

Query  1013  EVILNVDCHYAQAKV-LSFILNIGDCVYVK-GEGEKKHVGRILEFFKTTEGEDYFRVQWF  840
             E I+   CHY QA++    I+N+ D  +VK G+    ++ +I+E F   +G  YF  QWF
Sbjct  205   EEIVKARCHYRQAEIDGRVIVNLNDDAHVKAGDNADHYICKIVELFVALDGTPYFTAQWF  264

Query  839   FRAEDTVMRDAAALHDKKRLFYSTLMNDNLLDCIISKVNVTEISPGLGLEVNNSPPSG--  666
             +RA DTV++D A L D KR+F+S + +DN LDC++ K+N+  +   L LE      S   
Sbjct  265   YRARDTVIKDHANLIDNKRVFFSEMRDDNPLDCLVQKLNIARVPHNLDLEARKLAISSCD  324

Query  665   FYYDMEYCVDYSTFRNLP------TVQSVNSWDSPSLIDASYKPITAYPVEHFKSCEPSK  504
             +YYDM Y +DYS+F  LP        +++++  S + +D S   + +   E  ++ E S 
Sbjct  325   YYYDMLYLLDYSSFIKLPPENSRVNSEALSTISSEANMDGSTCELKSDSEEVSQARERSL  384

Query  503   VELSLLDLYAGCGGMSTGLCLGAKLSGLNLVTKWAVDYQKSACDSLKFNHPETQVRNESV  324
              E++LLDLY+GCG MS+GLCLGAK+SG+NLVT+WA+D    AC+S++ NHPETQVRNES 
Sbjct  385   SEMTLLDLYSGCGAMSSGLCLGAKMSGVNLVTRWAIDINAYACESVRLNHPETQVRNESA  444

Query  323   enflkllkeweklckEYG----SEPNAGSDDVLEGMEEGaddansladsddsdAE----Y  168
             E+FL LL+EWEKLC  +      +PNA   D ++   +  +D +   + +  D +    +
Sbjct  445   EDFLALLREWEKLCVRFSLIGNKDPNAHDLDPIDAKADEENDDDDNDNDNSEDEDDFEVF  504

Query  167   EILRLVDICFGDPNDTGKPGIHFQVRWKGYGPSEDTWEPIDGL  39
             E+ +++ IC+GDP D G   +HF+VRWKGYGPS D+WEP +GL
Sbjct  505   EVQKIIGICYGDPKDKGDRELHFKVRWKGYGPSADSWEPFEGL  547



>ref|XP_010533849.1| PREDICTED: putative DNA (cytosine-5)-methyltransferase CMT1 [Tarenaya 
hassleriana]
Length=799

 Score =   243 bits (621),  Expect = 5e-69, Method: Compositional matrix adjust.
 Identities = 147/337 (44%), Positives = 210/337 (62%), Gaps = 18/337 (5%)
 Frame = -2

Query  1022  EEDEVILNVDCHYAQAKVLSFILNIGDCVYVKGE-GEKKHVGRILEFFKTTEGEDYFRVQ  846
             E ++ ++    HY QAKV   + N+ D  YV+ E G+  ++ +ILEFF+  +GE YFR Q
Sbjct  57    EGEKDMMQAKHHYLQAKVDGVLFNLDDDAYVQAEDGKPDYIAKILEFFEGLDGEPYFRAQ  116

Query  845   WFFRAEDTVMRDAAALHDKKRLFYSTLMNDNLLDCIISKVNVTEISPGLGLEVNNS-PPS  669
             WF+R EDTV+++ A L  +KR+F S + +DN L+CI+SKV + ++ P L  E  +  PP 
Sbjct  117   WFYRPEDTVIKNHAYLVQEKRVFLSDVKDDNPLNCIVSKVKIVKVPPKLASETESVIPPC  176

Query  668   GFYYDMEYCVDYSTFRNLPTVQSVNSWDSPSLIDASYKPITAYPVEHFKSC--EPSKVEL  495
               YYDM+Y + + TF +     S    D+ S + +          E   +C  +  K   
Sbjct  177   DLYYDMKYHLSHLTFSSADNESSNVESDASSTVSS----------ETGSNCIGDSYKGGK  226

Query  494   SLLDLYAGCGGMSTGLCLGAKLSGLNLVTKWAVDYQKSACDSLKFNHPETQVRNESVenf  315
              LLDLY+GCG MSTGLC+GA LSGLNL+TKWAVD    AC+SLK NHPET+VRNE+ E+F
Sbjct  227   FLLDLYSGCGAMSTGLCMGASLSGLNLITKWAVDINSFACESLKLNHPETEVRNEAAEDF  286

Query  314   lkllkeweklckEY----GSEPNAGSDDVLEGMEEGaddansladsddsdAEYEILRLVD  147
             L LLK+W +LC+++     +EP    +D  +  E+  +       S+    E+E+ +L++
Sbjct  287   LSLLKKWRRLCQKFSLVIANEPIESDNDSEDEEEDEDETEGDDDGSEVPTGEFEVGKLLE  346

Query  146   ICFGDPNDTGKPGIHFQVRWKGYGPSEDTWEPIDGLK  36
             IC GDPN     G++F+VRWKGYGP EDTWEP DGL+
Sbjct  347   ICHGDPNGVNASGLYFKVRWKGYGPEEDTWEPYDGLR  383



>ref|XP_010673524.1| PREDICTED: DNA (cytosine-5)-methyltransferase CMT3 [Beta vulgaris 
subsp. vulgaris]
Length=868

 Score =   244 bits (622),  Expect = 6e-69, Method: Compositional matrix adjust.
 Identities = 147/356 (41%), Positives = 221/356 (62%), Gaps = 15/356 (4%)
 Frame = -2

Query  1031  SADEEDEVILNVDCHYAQAKV-LSFILNIGDCVYVKGE-GEKKHVGRILEFFKTTEGEDY  858
             +AD++DE+I    CHY +A+V  S I  + D  +V+ E G+  ++ +I+EFF+  +G  Y
Sbjct  108   AADDDDEII-QAKCHYLKAEVDGSMIFELNDDAHVQSEDGKPPYICKIVEFFEGVDGLPY  166

Query  857   FRVQWFFRAEDTVMRDAAALHDKKRLFYSTLMNDNLLDCIISKVNVTEISPGLGLEVNNS  678
             FR +W++R+ DTV++D+  L ++KR+F S +M+DN LDC++ K+N+  ++P L L+   S
Sbjct  167   FRAKWYYRSVDTVIKDSITLREEKRIFPSEVMDDNPLDCLLRKLNIVRVNPNLDLDAKLS  226

Query  677   --PPSGFYYDMEYCVDYSTFRNLPTVQSVNSWDSPSLIDASYKPITAYPV------EHFK  522
               P   +YYDM Y + YST+   P   +    +S S I +      A         E  +
Sbjct  227   IIPDCDYYYDMLYLLPYSTYIKPPPETAGPGSESQSTISSDVDGEEAADDTKSDLDEVNQ  286

Query  521   SCEPSKVELSLLDLYAGCGGMSTGLCLGAKLSGLNLVTKWAVDYQKSACDSLKFNHPETQ  342
               EP++ E +LLDLY GCG MSTGLCLGA L G  LVT+WAVD+ K AC+S+  NHPET+
Sbjct  287   GNEPTRSEKTLLDLYCGCGAMSTGLCLGANLQGFKLVTRWAVDFNKFACESVALNHPETK  346

Query  341   VRNESVenflkllkeweklckEYGSEPNAGSDDVLEGMEEGaddansladsddsdAE---  171
             VRNE+V +FL LLKEW KLC  +    +  +   ++ M    DD     +  D D     
Sbjct  347   VRNETVGDFLALLKEWLKLCASFSLIKSENTHKEIDMMGVDDDDNVDDDEGADDDENDDE  406

Query  170   -YEILRLVDICFGDPNDTGKPGIHFQVRWKGYGPSEDTWEPIDGLKSWKNRQGWFT  6
              +E+  ++ IC+GDP ++ KP ++F++RWKGYGPSED+WEP+DGL + + + G F 
Sbjct  407   VFEVEEVIGICYGDPKESKKPRLYFKIRWKGYGPSEDSWEPVDGLGNCREKIGEFV  462



>ref|XP_010043881.1| PREDICTED: DNA (cytosine-5)-methyltransferase CMT3 [Eucalyptus 
grandis]
Length=874

 Score =   243 bits (619),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 146/337 (43%), Positives = 215/337 (64%), Gaps = 12/337 (4%)
 Frame = -2

Query  1013  EVILNVDCHYAQAKVLSFILNIGDCVYVK-GEGEKKHVGRILEFFKTTEGEDYFRVQWFF  837
             E I+   CHY +A V     +IGD  YVK GEGE  ++ +I+E F+  +G  +F  QW++
Sbjct  121   EEIIQAKCHYKKANVDGVFYDIGDDAYVKAGEGEDNYICKIVELFEAVDGSLHFCAQWYY  180

Query  836   RAEDTVMRDAAALHDKKRLFYSTLMNDNLLDCIISKVNVTEISPGLGLEVNNS--PPSGF  663
             RA DTV++  + L D KR+F+S + +DN L+C++ K+N+  +   + L+   +  PP  +
Sbjct  181   RARDTVIKQLSYLIDDKRVFFSEIRDDNPLECLVEKLNIARVPLDVNLDAKRAAIPPCDY  240

Query  662   YYDMEYCVDYSTFRNLPTVQSVNSWDSPSLI---DASYKPITAYPVEHFKSCEPSKVELS  492
             Y D  Y + YSTF++LP  Q V+  ++ S I   D      T+       S + +K E++
Sbjct  241   YCDTLYLLPYSTFKHLPIDQKVDGCETSSTISSDDVDMAGSTSEVNSKEISQKNNKGEVT  300

Query  491   LLDLYAGCGGMSTGLCLGAKLSGLNLVTKWAVDYQKSACDSLKFNHPETQVRNESVenfl  312
             LLD+Y+GCG MSTGLCLGA +SGLNLVT+WAVD  + AC+SLK NHPET+VRNES E+FL
Sbjct  301   LLDMYSGCGAMSTGLCLGANVSGLNLVTRWAVDMNEHACNSLKLNHPETEVRNESAEDFL  360

Query  311   kllkeweklckEYGSEPNAGSD---DVLEGMEEGaddansladsddsdAE---YEILRLV  150
              LLKEW+KLC ++    + G       L  +++G  +    +D DD  ++   +E+ +++
Sbjct  361   MLLKEWQKLCMQFNLIKSDGQQLPYSDLFSVDDGTSNEEGDSDDDDGGSDGEVFEVEKVL  420

Query  149   DICFGDPNDTGKPGIHFQVRWKGYGPSEDTWEPIDGL  39
              IC+GDP + G   ++F+V WKGYGP EDTWEPIDGL
Sbjct  421   AICYGDPKEKGDKALYFKVSWKGYGPDEDTWEPIDGL  457



>gb|KDP34481.1| hypothetical protein JCGZ_12764 [Jatropha curcas]
Length=848

 Score =   242 bits (617),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 149/356 (42%), Positives = 210/356 (59%), Gaps = 17/356 (5%)
 Frame = -2

Query  1022  EEDEVILNVDCHYAQAKVLSFILNIGDCVYVKGE-GEKKHVGRILEFFKTTEGEDYFRVQ  846
              E E +L    HY QA V   + N+G+  YVK + G   ++ RI+E F+   GE YF  Q
Sbjct  83    REAEDLLQAKYHYKQATVDGILYNLGEDAYVKADDGSPNYIARIVELFEAVNGEPYFTAQ  142

Query  845   WFFRAEDTVMRDAAALHDKKRLFYSTLMNDNLLDCIISKVNVTEISPGLGLEVNNS--PP  672
             WF+R EDTV++D     + +R+F S + +DN L+CI+SK+ +  +SP + L       PP
Sbjct  143   WFYRTEDTVIKDHVQPAESRRVFLSEIKDDNPLNCIVSKIKIALVSPNMDLAAKERELPP  202

Query  671   SGFYYDMEYCVDYSTFRNLPT------VQSVNSWDSPSLIDASYKPITAYPVEHFKSCEP  510
                YYDM+Y + + TF+ + T        S ++  S S  + S   + A   +  K    
Sbjct  203   CDLYYDMKYTLPFLTFQTVKTDDARRDSGSSSTISSESDSNNSVNDVNAASEKTSKVHGS  262

Query  509   SKVELSLLDLYAGCGGMSTGLCLGAKLSGLNLVTKWAVDYQKSACDSLKFNHPETQVRNE  330
              K E+ LLDLY+GCG MSTGL +GA LSG+ L+TKWAVD   +AC SLK NHPET+VRNE
Sbjct  263   EKSEMHLLDLYSGCGAMSTGLFMGASLSGVKLMTKWAVDINPNACKSLKMNHPETEVRNE  322

Query  329   SVenflkllk---eweklckEYGSE-PNAGSDDVLEGMEEGaddansladsddsdA----  174
             + E+FL LLK   +  +    +GSE P   S + +   E+  D+ +   D DD       
Sbjct  323   AAEDFLSLLKEWEKLCRKFSSFGSEGPAEQSSNSVSNEEDEEDEEDRDNDGDDDSEVPSG  382

Query  173   EYEILRLVDICFGDPNDTGKPGIHFQVRWKGYGPSEDTWEPIDGLKSWKNRQGWFT  6
             E+E+ +L+ +CFGDPN   K G++F+VRWKGYGPSEDTWEPI+GL   K++   F 
Sbjct  383   EFEVHKLLAVCFGDPNKVRKRGLYFKVRWKGYGPSEDTWEPIEGLSKCKDKLKEFV  438



>ref|XP_004170052.1| PREDICTED: DNA (cytosine-5)-methyltransferase CMT3-like, partial 
[Cucumis sativus]
Length=753

 Score =   240 bits (613),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 149/348 (43%), Positives = 213/348 (61%), Gaps = 20/348 (6%)
 Frame = -2

Query  1025  DEEDEVILNVDCHYAQAKVLSFILNIGDCVYVKGEGEKK-HVGRILEFFKTTEGEDYFRV  849
             D+ +EVI  +  HY+QAKV +   N+ D  +VK EGE+  ++ +I+E F+  +G+ YF  
Sbjct  1     DDSEEVIQALH-HYSQAKVDNITYNLLDDAHVKAEGEEDDYICKIIEMFEAVDGQLYFTA  59

Query  848   QWFFRAEDTVMRDAAALHDKKRLFYSTLMNDNLLDCIISKVNVTEISPGLGLEVNNSPPS  669
             QW++RA+DTV++D A L + KR+F+S + +DN LDC++ K+N+  I   +  + N  P  
Sbjct  60    QWYYRAKDTVVKDHAHLINDKRVFFSEVRDDNPLDCLVKKLNIARIPLTMDEKKNCLPSC  119

Query  668   GFYYDMEYCVDYSTFRNLPTVQSVNSWDSPSLIDASYKPITAYPV--------EHFKSCE  513
              FY DM Y + YS+F  LPT +     ++ S I +      A  V        +  + C+
Sbjct  120   DFYCDMLYLLPYSSFVKLPTSEKKVGSETSSTISSDVDTNEACEVNSQIGDVTQAQQCCK  179

Query  512   PSKVELSLLDLYAGCGGMSTGLCLGAKLSGLNLVTKWAVDYQKSACDSLKFNHPETQVRN  333
             P   +++LLDLY+GCG MSTGLCLG  LSG+NLVTKWAVD  + AC+SL+FNHPETQVRN
Sbjct  180   P---DVALLDLYSGCGAMSTGLCLGGNLSGVNLVTKWAVDLNQYACESLRFNHPETQVRN  236

Query  332   ESVenflkllkewekl----ckEYGSEPNAGSDDVLEGMEEGaddansladsddsdAEYE  165
             E  E+FL L+KEWE L          EP     D+    +E  ++     + ++     +
Sbjct  237   EMAEDFLSLVKEWEVLCKYCSLVKSKEPQQKYIDLFADEDEEENEDEKTEEDEEVFEVEK  296

Query  164   ILRLVDICFGDPNDTGKPGIHFQVRWKGYGPSEDTWEPIDGLKSWKNR  21
             IL    IC+GDPN+T K G+  +VRWKGYG  EDTWEPIDGL + K +
Sbjct  297   ILA---ICYGDPNETKKRGLFLKVRWKGYGSDEDTWEPIDGLSNCKEK  341



>ref|XP_006590741.1| PREDICTED: putative DNA (cytosine-5)-methyltransferase CMT1-like 
[Glycine max]
Length=832

 Score =   241 bits (616),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 150/346 (43%), Positives = 207/346 (60%), Gaps = 14/346 (4%)
 Frame = -2

Query  1028  ADEEDEVILNVDCHYAQAKVLSFILNIGDCVYVKGE-GEKKHVGRILEFFKTTEGEDYFR  852
             A  E+  ++   CHY QAKV   + N+ D  YVK E G+  ++ RI+E F+T + E  F 
Sbjct  72    ATSENSEVMPARCHYRQAKVDGVVYNLYDDAYVKAEDGKPDYIARIVEMFETVDKEQCFT  131

Query  851   VQWFFRAEDTVMRDAAALHDKKRLFYSTLMNDNLLDCIISKVNVTEISPGLGLEVNNS--  678
              QWF+RAEDTV+++   L DKKR+F S + + N LDCI+SKV + + SP + L       
Sbjct  132   AQWFYRAEDTVIKNHGDLVDKKRIFISDVKDVNPLDCIVSKVKIYKKSPSVDLTSKKGKL  191

Query  677   PPSGFYYDMEYCVDYSTFRNLPTVQSVNSWDSPSLIDASYKP---ITAYPVEHFKSCE--  513
             P   +YYDM+Y V Y TF N+         D+ S I +       ++   + + K+ +  
Sbjct  192   PSCDYYYDMKYTVPYLTFSNIVNETVKTESDASSTISSESGSNGCVSNANLANGKTTQNN  251

Query  512   -PSKVELSLLDLYAGCGGMSTGLCLGAKLSGLNLVTKWAVDYQKSACDSLKFNHPETQVR  336
                  E +LLDLY+GCG MSTGLC GA L+G+ LVT+WAVD    AC+SLK NHPETQVR
Sbjct  252   SSGSSEWTLLDLYSGCGAMSTGLCFGASLAGIKLVTRWAVDINAHACESLKLNHPETQVR  311

Query  335   NESVenflkllkeweklckEY---GSEPNAGSDDVLEGMEEGaddansladsddsdAEYE  165
             NE  E+FL L+K W KLC+E+   GSE      D+ E  +E        + +     E+E
Sbjct  312   NEPAEDFLNLIKSWAKLCEEFALLGSERLDSDPDMDE--DENEAVRKEESGNQSDSEEFE  369

Query  164   ILRLVDICFGDPNDTGKPGIHFQVRWKGYGPSEDTWEPIDGLKSWK  27
             + +L+ +C+GDPND  KPG++F+VRW GY  S DTWEPI+GL   K
Sbjct  370   VEKLLAVCYGDPNDVKKPGLYFKVRWLGYASSYDTWEPIEGLSDCK  415



>ref|XP_004149031.1| PREDICTED: DNA (cytosine-5)-methyltransferase CMT3-like [Cucumis 
sativus]
 gb|KGN66422.1| hypothetical protein Csa_1G604080 [Cucumis sativus]
Length=855

 Score =   241 bits (615),  Expect = 5e-68, Method: Compositional matrix adjust.
 Identities = 150/350 (43%), Positives = 214/350 (61%), Gaps = 20/350 (6%)
 Frame = -2

Query  1031  SADEEDEVILNVDCHYAQAKVLSFILNIGDCVYVKGEGEKK-HVGRILEFFKTTEGEDYF  855
             S D+ +EVI  +  HY+QAKV +   N+ D  +VK EGE+  ++ +I+E F+  +G+ YF
Sbjct  101   SRDDSEEVIQALH-HYSQAKVDNITYNLLDDAHVKAEGEEDDYICKIIEMFEAVDGQLYF  159

Query  854   RVQWFFRAEDTVMRDAAALHDKKRLFYSTLMNDNLLDCIISKVNVTEISPGLGLEVNNSP  675
               QW++RA+DTV++D A L + KR+F+S + +DN LDC++ K+N+  I   +  + N  P
Sbjct  160   TAQWYYRAKDTVVKDHAHLINDKRVFFSEVRDDNPLDCLVKKLNIARIPLTMDEKKNCLP  219

Query  674   PSGFYYDMEYCVDYSTFRNLPTVQSVNSWDSPSLIDASYKPITAYPV--------EHFKS  519
                FY DM Y + YS+F  LPT +     ++ S I +      A  V        +  + 
Sbjct  220   SCDFYCDMLYLLPYSSFVKLPTSEKKVGSETSSTISSDVDTNEACEVNSQIGDVTQAQQC  279

Query  518   CEPSKVELSLLDLYAGCGGMSTGLCLGAKLSGLNLVTKWAVDYQKSACDSLKFNHPETQV  339
             C+P   +++LLDLY+GCG MSTGLCLG  LSG+NLVTKWAVD  + AC+SL+FNHPETQV
Sbjct  280   CKP---DVALLDLYSGCGAMSTGLCLGGNLSGVNLVTKWAVDLNQYACESLRFNHPETQV  336

Query  338   RNESVenflkllkewekl----ckEYGSEPNAGSDDVLEGMEEGaddansladsddsdAE  171
             RNE  E+FL L+KEWE L          EP     D+    +E  ++     + ++    
Sbjct  337   RNEMAEDFLSLVKEWEVLCKYCSLVKSKEPQQKYIDLFADEDEEENEDEKTEEDEEVFEV  396

Query  170   YEILRLVDICFGDPNDTGKPGIHFQVRWKGYGPSEDTWEPIDGLKSWKNR  21
              +IL    IC+GDPN+T K G+  +VRWKGYG  EDTWEPIDGL + K +
Sbjct  397   EKILA---ICYGDPNETKKRGLFLKVRWKGYGSDEDTWEPIDGLSNCKEK  443



>gb|KDO42578.1| hypothetical protein CISIN_1g0039742mg, partial [Citrus sinensis]
Length=401

 Score =   231 bits (588),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 137/320 (43%), Positives = 199/320 (62%), Gaps = 25/320 (8%)
 Frame = -2

Query  1019  EDEVILNVDCHYAQAKVLSFILNIGDCVYVKGE-GEKKHVGRILEFFKTTEGEDYFRVQW  843
             E+E +L   CHY QA V   + N+GD  YVK E G   ++ RI+E F++ +GE YF+ +W
Sbjct  95    EEEEVLQARCHYTQASVDGCLYNLGDDAYVKAEEGAVDYIARIVELFESVDGEPYFKARW  154

Query  842   FFRAEDTVMRDAAALHDKKRLFYSTLMNDNLLDCIISKVNVTEISPGLGLEVN--NSPPS  669
             F+RAEDTV++D A L D+KR+F S + +DN L+CI+SK  + E++  + LE    N PP 
Sbjct  155   FYRAEDTVIKDLACLVDRKRVFLSDVEDDNPLNCIVSKAKIAEVATNMDLEAKQKNIPPC  214

Query  668   GFYYDMEYCVDYSTFRNLPTVQSVNSWDSPSLIDA---SYKPITAYPVEHFKSCEPSKVE  498
               YYDM+Y + + TF N+    +    D+ S I +   S  PI              + E
Sbjct  215   DLYYDMKYTLPHLTFLNINNESNRRDSDASSTISSETGSNSPI-------------GQPE  261

Query  497   LSLLDLYAGCGGMSTGLCLGAKLSGLNLVTKWAVDYQKSACDSLKFNHPETQVRNESVen  318
             +SLLDLY+GCG MSTGLC+GA LSG+ LVT+WA+D    AC SLKFNHPET+VRNE+ ++
Sbjct  262   MSLLDLYSGCGAMSTGLCIGASLSGVKLVTRWAIDINPHACKSLKFNHPETKVRNEAADD  321

Query  317   flkllkeweklckEYG-SEPNAGSDDVLEGMEEGaddanslad-----sddsdAEYEILR  156
             FL LLKEW KLC+ +   + +   +  L  M E  ++     +     ++  + E+E+ R
Sbjct  322   FLSLLKEWAKLCQYFSIYDTDKVPEQSLNFMSEEEEEEEEEEEENDDDANVPNEEFEVER  381

Query  155   LVDICFGDPNDTGKPGIHFQ  96
             L+ +C+GDPN T KPG++F+
Sbjct  382   LIAVCYGDPNKTKKPGVYFK  401



>gb|AEP33250.1| CMT-type DNA-methyltransferase [Posidonia oceanica]
Length=802

 Score =   239 bits (610),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 153/334 (46%), Positives = 205/334 (61%), Gaps = 16/334 (5%)
 Frame = -2

Query  1004  LNVDCHYAQAKVLSFILNIGDCVYVKGE-GEKKHVGRILEFFKTTEGEDYFRVQWFFRAE  828
             L   CHY +A+V  F+ N+ D VYVK E G+  ++GRI+EFF+  +GE YF  QWFFR E
Sbjct  59    LLAKCHYERAEVEGFVYNLHDDVYVKAETGKPDYIGRIVEFFEAIDGEYYFTAQWFFRVE  118

Query  827   DTVMRDAAALHDKKRLFYSTLMNDNLLDCIISKVNVTEISPGLGLEVNNSPPSGFYYDME  648
             DT++      HD+ R+F S   NDN+LDCI+SK+ + +  P     +   P    YY+M 
Sbjct  119   DTIIGSVGDFHDRCRVFLSDEKNDNVLDCIVSKIKIVQRDPEQKGPI---PSCDLYYNMS  175

Query  647   YCVDYSTFRNLPTVQSVNSWDSPSLIDASYKPITAYPVEHFKSCEPSKVELSLLDLYAGC  468
             Y V YS+F NL   +S    +  S +  S++       E       S+ + ++LDLY+GC
Sbjct  176   YSVPYSSFTNLSKDKSRAGSEESSTV--SFEDAVDTSNEE----TLSEKKTTVLDLYSGC  229

Query  467   GGMSTGLCLGAKLSGLNLVTKWAVDYQKSACDSLKFNHPETQVRNESVenflkllkewek  288
             G MSTGLC GA L+GLN+ T WAVD  K AC SL+ NH E +VRNE+ E+FL LLKEWEK
Sbjct  230   GAMSTGLCHGAHLAGLNIETMWAVDMNKDACRSLQLNHSEAKVRNENAEHFLALLKEWEK  289

Query  287   lckEYGSEPNAGSDDVLEGMEEGaddansladsddsdAEYEILRLVDICFGDPNDTGKPG  108
             LC++Y    +    D+ E M+E   D +   D  DSD E+ + +L+DIC+GDP   GK G
Sbjct  290   LCEKYSGSKDL---DLEETMQE---DNSEDNDDADSDEEFVVEKLLDICYGDPAKIGKDG  343

Query  107   IHFQVRWKGYGPSEDTWEPIDGLKSWKNRQGWFT  6
             I F+VRWKGYG  EDTWEPI+ L   + R G F 
Sbjct  344   IKFKVRWKGYGSDEDTWEPIENLGKCEERMGNFV  377



>ref|XP_008451103.1| PREDICTED: DNA (cytosine-5)-methyltransferase CMT3 [Cucumis melo]
Length=859

 Score =   239 bits (610),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 156/360 (43%), Positives = 218/360 (61%), Gaps = 26/360 (7%)
 Frame = -2

Query  1031  SADEEDEVILNVDCHYAQAKVLSFILNIGDCVYVKGE-GEKKHVGRILEFFKTTEGEDYF  855
             S D+ +EVI  +  HY+QAKV +   N+ D  +VK E GE  ++ +I+E F+  +GE YF
Sbjct  101   SRDDSEEVIQALH-HYSQAKVDNITYNLFDDAHVKAEDGEDDYICKIIEMFEAVDGELYF  159

Query  854   RVQWFFRAEDTVMRDAAALHDKKRLFYSTLMNDNLLDCIISKVNVTEISPGLGLEVNNSP  675
               QW++RA+DTV++D A L + KR+F+S + +DN LDC++ K+N+  I   +  +    P
Sbjct  160   TAQWYYRAKDTVVKDHAHLINDKRVFFSEVRDDNPLDCLVKKLNIARIPLTMDKKKKRLP  219

Query  674   PSGFYYDMEYCVDYSTFRNLPTVQS------------VNSWDSPSLIDASYKPITAYPVE  531
                FY DM Y + YS+F  LPT +                 D    +++    +T     
Sbjct  220   SCDFYCDMLYLLPYSSFVKLPTSEKKVGSETSSTISSEVDTDGACEVNSEIGDVT-----  274

Query  530   HFKSCEPSKVELSLLDLYAGCGGMSTGLCLGAKLSGLNLVTKWAVDYQKSACDSLKFNHP  351
               + C   K E++LLDLY+GCG MSTGLCLG  LSG+NLVTKWAVD  + AC+SL+FNHP
Sbjct  275   QAQQCR--KPEVTLLDLYSGCGAMSTGLCLGGNLSGVNLVTKWAVDLNQYACESLRFNHP  332

Query  350   ETQVRNESVenflkllkeweklckEY----GSEPNAGSDDVLEGMEEGaddansladsdd  183
             ETQVRNE  E+FL LLKEWE LCK +      EP     D+    +EG D+     +  +
Sbjct  333   ETQVRNEMAEDFLLLLKEWEMLCKYFSLIKSKEPQQKYIDLFANEDEGEDEEEEEDEKTE  392

Query  182   sdAE-YEILRLVDICFGDPNDTGKPGIHFQVRWKGYGPSEDTWEPIDGLKSWKNRQGWFT  6
              D E +E+ +++ IC+GDPN+T K G+  +VRWKGYG  EDTWEPIDGL + K +   F 
Sbjct  393   DDGEVFEVEKILAICYGDPNETKKRGLFLKVRWKGYGSDEDTWEPIDGLSNCKEKLKDFV  452



>gb|EMT30784.1| DNA (cytosine-5)-methyltransferase 1 [Aegilops tauschii]
Length=731

 Score =   237 bits (604),  Expect = 5e-67, Method: Compositional matrix adjust.
 Identities = 160/344 (47%), Positives = 209/344 (61%), Gaps = 25/344 (7%)
 Frame = -2

Query  1031  SADEEDEVILNVDCHYAQAKVLSFILNIGDCVYVK-GEGEKKHVGRILEFFKTTEGEDYF  855
             S D E+E+     CHY  A V   I N+ D VYVK G  E+ ++GRI EFF+ T+   YF
Sbjct  119   SNDPEEEI--GARCHYTSACVDDAIFNLNDDVYVKAGPNEENYIGRITEFFEGTDHVLYF  176

Query  854   RVQWFFRAEDTVMRDAAAL-----HDKKRLFYSTLMNDNLLDCIISKVNVTEISPGLGLE  690
               +WFFRAEDTV+           HD+KR+F S   NDN+++ IISK+N+  + P    +
Sbjct  177   TCRWFFRAEDTVISPNLLEVHDHEHDRKRVFLSEEKNDNMIESIISKLNIIYVDPSKTPQ  236

Query  689   VNNS--PPSGFYYDMEYCVDYSTFRNLPTVQSVNSWDSPSLIDAS---YKPITAYPVEHF  525
               +     S  YYDM Y V YSTF N+P  ++  + DS    D S    KP+ A PV   
Sbjct  237   ERDQLISNSDLYYDMSYSVAYSTFANIP-AENDGATDSEVASDISCEEGKPV-ADPV---  291

Query  524   KSCEPSKVELSLLDLYAGCGGMSTGLCLGAKLSGLNLVTKWAVDYQKSACDSLKFNHPET  345
              S +  +   +LLDLY+GCG MSTGLCLGA LSG+ L TKWAVD  + AC+SLK NHP T
Sbjct  292   GSSDAQRETATLLDLYSGCGAMSTGLCLGAALSGIKLNTKWAVDMNEYACNSLKHNHPGT  351

Query  344   QVRNESVenflkllkeweklckEY--GSEPNAGSDDVLEGMEEGaddansladsddsdAE  171
             QVRNE  E+FL LLK W  LCK+Y   S  ++GSD     + + ++D     +    +  
Sbjct  352   QVRNEKAEDFLALLKHWNALCKKYVVHSSNSSGSD-----LAQMSNDDEDDKNEALPNDL  406

Query  170   YEILRLVDICFGDPNDTGKPGIHFQVRWKGYGPSEDTWEPIDGL  39
             +E+ RL+DIC+GDPN TG  G+ F+VRWK Y PS D+WEPIDGL
Sbjct  407   FEVERLLDICYGDPNKTGNDGLWFKVRWKTYDPSHDSWEPIDGL  450



>ref|XP_007157973.1| hypothetical protein PHAVU_002G113900g [Phaseolus vulgaris]
 gb|ESW29967.1| hypothetical protein PHAVU_002G113900g [Phaseolus vulgaris]
Length=838

 Score =   238 bits (606),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 155/349 (44%), Positives = 215/349 (62%), Gaps = 14/349 (4%)
 Frame = -2

Query  1028  ADEEDEVILNVDCHYAQAKVLSFILNIGDCVYVKGE-GEKKHVGRILEFFKTTEGEDYFR  852
             A  ED  ++   CHY QAK+   + N+ D  YVK E G+  ++ RI+E F T +   YF 
Sbjct  73    ATGEDNEVMLATCHYRQAKIDGVVFNLHDDAYVKAEDGKPDYIARIVELFATVDNGMYFM  132

Query  851   VQWFFRAEDTVMRDAAALHDKKRLFYSTLMNDNLLDCIISKVNVTEISPGLGLEVNNS--  678
              +WF+RAEDTV++    L DKKR+F S + ++N LDCI+SKVN+ +++P +GL       
Sbjct  133   ARWFYRAEDTVIKSHGDLVDKKRVFLSDVKDENPLDCIVSKVNIVKLTPNVGLTTKERKI  192

Query  677   PPSGFYYDMEYCVDYSTFRNL--PTVQS----VNSWDSPSLIDASYKPITAYPVEHFKSC  516
             PP  +YYDM Y + Y TF N+   TV+S     ++  S S     +        +  K  
Sbjct  193   PPCDYYYDMTYTLPYLTFSNVVNDTVKSESDASSTISSESGSSGCFNGANLANGKTIKKN  252

Query  515   EPSKVELSLLDLYAGCGGMSTGLCLGAKLSGLNLVTKWAVDYQKSACDSLKFNHPETQVR  336
               +  E +LLDLY+GCG MSTGLCLGA L+G+ LVT+WAVD    AC SLK NHPETQVR
Sbjct  253   SSNSSEWALLDLYSGCGAMSTGLCLGASLAGVKLVTRWAVDINAHACKSLKQNHPETQVR  312

Query  335   NESVenflkllkeweklckEY---GSEPN-AGSDDVLEGMEEGaddansladsddsdAE-  171
             NE  ENFL L+K W KLC+E+   GSE + +G D   + +++   +  +    D SD+E 
Sbjct  313   NEPAENFLALVKAWAKLCEEFSLLGSERSESGPDMEEDEIDDEDVNVKTEESEDHSDSED  372

Query  170   YEILRLVDICFGDPNDTGKPGIHFQVRWKGYGPSEDTWEPIDGLKSWKN  24
             +E+ +L+ +C GDPN+  K G++F+VRW GY  S DTWEPIDGL   K+
Sbjct  373   FEVEKLLAVCHGDPNNVKKSGLYFKVRWMGYDSSYDTWEPIDGLSDCKD  421



>gb|KDO40233.1| hypothetical protein CISIN_1g013949mg [Citrus sinensis]
Length=433

 Score =   229 bits (584),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 140/318 (44%), Positives = 199/318 (63%), Gaps = 23/318 (7%)
 Frame = -2

Query  1019  EDEVILNVDCHYAQAKVLSFILNIGDCVYVKGE-GEKKHVGRILEFFKTTEGEDYFRVQW  843
             E+E +L   CHY QA V   + N+GD  YVK E G   ++ RI+E F++ +GE YF+ +W
Sbjct  114   EEEEVLQARCHYTQASVDGCLYNLGDDAYVKAEEGAVDYIARIVELFESVDGEPYFKARW  173

Query  842   FFRAEDTVMRDAAALHDKKRLFYSTLMNDNLLDCIISKVNVTEISPGLGLEVN--NSPPS  669
             F+RAEDTV++D A L D+KR+F S + +DN L+CI+SK  + E++  + LE    N PP 
Sbjct  174   FYRAEDTVIKDLAYLVDRKRVFLSDVEDDNPLNCIVSKAKIAEVAANMDLEAKQKNIPPC  233

Query  668   GFYYDMEYCVDYSTFRNLPTVQSVNSWDSPSLIDA---SYKPITAYPVEHFKSCEPSKVE  498
               YYDM+Y + + TF N+    +    D+ S I +   S  PI           EP   E
Sbjct  234   DLYYDMKYTLPHLTFSNINNESNRRDSDASSTISSETGSNSPIG----------EP---E  280

Query  497   LSLLDLYAGCGGMSTGLCLGAKLSGLNLVTKWAVDYQKSACDSLKFNHPETQVRNESVen  318
             +SLLDLY+GCG MSTGLC+GA LSG+ LVT+WA+D    AC SLKFNHPET+VRNE+ ++
Sbjct  281   MSLLDLYSGCGAMSTGLCIGASLSGVKLVTRWAIDINPHACKSLKFNHPETKVRNEAADD  340

Query  317   flkllkeweklckEYG----SEPNAGSDDVLEGMEEGaddansladsddsdAEYEILRLV  150
             FL LLKEW KLC+ +      +    S + +   EE  ++  +  DS+  + E+E+  L 
Sbjct  341   FLSLLKEWAKLCQYFSIYDTDKVPEQSLNFMSEDEEEEEEEENDDDSNVPNEEFEVESLT  400

Query  149   DICFGDPNDTGKPGIHFQ  96
              +C+GDPN T KPG++F+
Sbjct  401   AVCYGDPNKTKKPGVYFK  418



>ref|XP_006573534.1| PREDICTED: putative DNA (cytosine-5)-methyltransferase CMT1-like 
[Glycine max]
 gb|KHN35974.1| DNA (cytosine-5)-methyltransferase 3 [Glycine soja]
Length=833

 Score =   236 bits (603),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 151/344 (44%), Positives = 204/344 (59%), Gaps = 15/344 (4%)
 Frame = -2

Query  1022  EEDEVILNVDCHYAQAKVLSFILNIGDCVYVKGE-GEKKHVGRILEFFKTTEGEDYFRVQ  846
             E  EV+L   CHY QAKV   + N+ D  YVK E G+  ++ RI+E F+T + E  F  Q
Sbjct  77    ENSEVML-ARCHYRQAKVDGVVYNLYDDAYVKAEDGKPDYIARIVEMFETVDKEQCFMAQ  135

Query  845   WFFRAEDTVMRDAAALHDKKRLFYSTLMNDNLLDCIISKVNVTEISPGLGLEVNNS--PP  672
             WF+RAEDTV+++   L DKKR+F S + + N LDCI+SKV + + +P + L    +  P 
Sbjct  136   WFYRAEDTVIKNHGDLVDKKRVFISDVKDVNPLDCIVSKVKIFKKNPSVDLASKKAKLPF  195

Query  671   SGFYYDMEYCVDYSTFRNLPTVQSVNSWDSPSLIDASYKPITAYPVEHFKSCEPSK----  504
               +YYDM+Y V Y TF NL         D+ S I +    I      +    + ++    
Sbjct  196   CDYYYDMKYTVPYLTFSNLVNETVKTESDASSTISSESGSIGCVNNANLAKRKTTQNNSS  255

Query  503   --VELSLLDLYAGCGGMSTGLCLGAKLSGLNLVTKWAVDYQKSACDSLKFNHPETQVRNE  330
                + +LLDLY+GCG MSTGLCLGA L+G+ LVT WAVD    AC SLK NHPET VRNE
Sbjct  256   GSSQWTLLDLYSGCGAMSTGLCLGASLAGIKLVTMWAVDINAHACKSLKLNHPETHVRNE  315

Query  329   SVenflkllkeweklckEY---GSEPNAGSDDVLEGMEEGaddansladsddsdAEYEIL  159
               E+FL L+K W KLC+E+   GSE +    D+ E  +E        + +     E+E+ 
Sbjct  316   PAEDFLNLIKAWAKLCEEFALLGSERSDSDPDMDE--DENEAVQKEESGNQSDLEEFEVE  373

Query  158   RLVDICFGDPNDTGKPGIHFQVRWKGYGPSEDTWEPIDGLKSWK  27
             +L+ +C+GDPN   KPG++F+VRW GY  S DTWEPIDGL   K
Sbjct  374   KLLAVCYGDPNGVKKPGLYFKVRWLGYDSSYDTWEPIDGLSDCK  417



>gb|KFK28331.1| chromomethylase [Arabis alpina]
Length=781

 Score =   234 bits (597),  Expect = 8e-66, Method: Compositional matrix adjust.
 Identities = 151/347 (44%), Positives = 206/347 (59%), Gaps = 33/347 (10%)
 Frame = -2

Query  1025  DEEDEVILNVDCHYAQAKVLSFILNIGDCVYVKGE-GEKKHVGRILEFFKTTEGEDYFRV  849
             DE+D  ++    H+ +AKV     ++GD VYV  E G   H+ +I+EFF+   GE YFR 
Sbjct  55    DEKD--LVEAKHHFLKAKVDDVEFSLGDDVYVTAEPGMPNHLAKIVEFFEAIHGEPYFRA  112

Query  848   QWFFRAEDTVMRDAAALHDKKRLFYSTLMNDNLLDCIISKVNVTEISPGL--GLEVNNSP  675
             +WF+RA DTV++D ++    KR+F S + +DN L CI S V++ +I   +  GLE +  P
Sbjct  113   RWFYRASDTVIKDLSSHVHPKRVFLSNVHDDNPLSCIYSAVHIVKIPLKIVTGLEESMIP  172

Query  674   PSGFYYDMEYCVDYSTFRNLPTVQSVNSWDSPSLIDASYKPITAYPVEHFKSCEPSKVEL  495
                FYYDM+Y +++ TF         +S D     D      ++       +  P K E 
Sbjct  173   ACDFYYDMKYELEHLTF---------SSADD----DCETSSSSSTISNESHTEIPRKNEK  219

Query  494   SLLDLYAGCGGMSTGLCLGAKLSGLNLVTKWAVDYQKSACDSLKFNHPETQVRNESVenf  315
              LLDLY+GCGGMSTGLC GA +SG+ L+TKWAVD   SAC+SLK NHPET+VRNE  + F
Sbjct  220   FLLDLYSGCGGMSTGLCAGALISGVKLITKWAVDINSSACESLKLNHPETEVRNEPTDEF  279

Query  314   lkllkeweklckEY----GSEPNAGSDDVLEGMEEGaddansladsddsdAEYEILRLVD  147
             LKLL EW KLC+ +    G EP  G  D  E  +             D+DAE+E+   ++
Sbjct  280   LKLLIEWRKLCQSFSLIPGGEPIDGDTDSEEDEKND-----------DADAEFEVEEFLE  328

Query  146   ICFGDPNDTGKPGIHFQVRWKGYGPSEDTWEPIDGLKSWKNRQGWFT  6
             IC+GDP +  KPG+H +V WKGYGP EDTWEP +G+K  K+R   F 
Sbjct  329   ICYGDPKEIKKPGLHLKVHWKGYGPEEDTWEPYEGIKGCKDRLKEFV  375



>ref|XP_007152975.1| hypothetical protein PHAVU_004G176100g [Phaseolus vulgaris]
 gb|ESW24969.1| hypothetical protein PHAVU_004G176100g [Phaseolus vulgaris]
Length=877

 Score =   235 bits (599),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 145/353 (41%), Positives = 216/353 (61%), Gaps = 14/353 (4%)
 Frame = -2

Query  1022  EEDEVILNVDCHYAQAKVLS-FILNIGDCVYVKG-EGEKKHVGRILEFFKTTEGEDYFRV  849
             +EDE I     HY +A+V    I  + D  +VK  EGE  ++ +I+E F++ +G  YF  
Sbjct  111   DEDEEIHQARHHYLEAEVDGCTIYKLFDDAHVKADEGEDNYICKIVELFESIDGSLYFTA  170

Query  848   QWFFRAEDTVMRDAAALHDKKRLFYSTLMNDNLLDCIISKVNVTEISPGLGLEVNNS--P  675
             QW++RA+DTV++  A L + KR+F+S + +DN LDC+++K+N+  +   + L V     P
Sbjct  171   QWYYRAKDTVIKKLAYLIEPKRVFFSEVQDDNPLDCLVAKLNIARLPLNMDLNVKKETIP  230

Query  674   PSGFYYDMEYCVDYSTFRNLPTVQSVNSWDSPSLIDASYK-----PITAYPVEHFKSCEP  510
             P  +Y D +Y + YSTF +LP+       ++ S I           + + P + +   E 
Sbjct  231   PCDYYCDTQYLLPYSTFVSLPSENGETGSETCSTISCDTNGVEKCEVDSQPKDAYLPDEN  290

Query  509   SKVELSLLDLYAGCGGMSTGLCLGAKLSGLNLVTKWAVDYQKSACDSLKFNHPETQVRNE  330
               +E++LLDLY GCG MSTGLCLG  LSG+NLVT+WAVD  K AC+ LK NHPET+VRNE
Sbjct  291   KDLEMTLLDLYCGCGAMSTGLCLGGNLSGVNLVTRWAVDLNKHACECLKLNHPETEVRNE  350

Query  329   SVenflkllkeweklckEYGSEPNAGS-----DDVLEGMEEGaddansladsddsdAEYE  165
             S E+FL LLKEW+KLC  +    N  S     D   E  E+ A++       D+ D  +E
Sbjct  351   SAESFLSLLKEWQKLCSYFALVENKVSHEKYVDLFSEVDEDDAEEVKEDGTDDEDDEIFE  410

Query  164   ILRLVDICFGDPNDTGKPGIHFQVRWKGYGPSEDTWEPIDGLKSWKNRQGWFT  6
             + +++ +C+GDPN   + G++F+V+WKGYGP ED+WEPI+GL + K++   F 
Sbjct  411   VSKILAVCYGDPNKKKEQGLYFKVQWKGYGPEEDSWEPIEGLSNCKDKIKEFV  463



>emb|CDP13153.1| unnamed protein product [Coffea canephora]
Length=887

 Score =   234 bits (596),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 141/352 (40%), Positives = 216/352 (61%), Gaps = 11/352 (3%)
 Frame = -2

Query  1028  ADEEDEVILNVDCHYAQAKVLSFILNIGDCVYVKGE-GEKKHVGRILEFFKTTEGEDYFR  852
              +++ E  ++   H+ QA+V   I N+ D  YV+ E G++ ++ +I+E F+ T+G  YF 
Sbjct  133   GEDDSEEFIDAKRHFTQAEVDGQIFNLEDDAYVQAEVGKRNYICKIVEMFEGTDGMPYFT  192

Query  851   VQWFFRAEDTVMRDAAALHDKKRLFYSTLMNDNLLDCIISKVNVTEISPGLGLEVNNSPP  672
              QWF+RAEDT++ +     D+KR+F+S + NDN LDC++ ++ +  + P + LE  ++  
Sbjct  193   AQWFYRAEDTIITECHEFIDEKRVFFSEVKNDNPLDCLVKRLRIARLPPNMDLECKDAAK  252

Query  671   SG--FYYDMEYCVDYSTFRNLPTVQSVNSWDSPSLIDASYKPITAYPVEHFKSCEPSKVE  498
             S   +YYDM +   + TF +LP   +    DS S I +      A       S E + +E
Sbjct  253   SNCDYYYDMMFLEPHCTFISLPPENNGAGSDSGSTISSEADATGAVASGVEVSQEANDLE  312

Query  497   LSLLDLYAGCGGMSTGLCLGAKLSGLNLVTKWAVDYQKSACDSLKFNHPETQVRNESVen  318
             + LLDLY+GCG MSTGLCLGA  +G+ LVTKWAVD  K AC+SLK+NHPET+VRNES EN
Sbjct  313   MRLLDLYSGCGAMSTGLCLGAYSTGVKLVTKWAVDVNKYACESLKWNHPETEVRNESAEN  372

Query  317   flkllkeweklckEYG-SEPN-------AGSDDVLEGMEEGaddansladsddsdAEYEI  162
             FL L+KEWE+LC  Y   E N       + S++ ++ +    +D +      +S   +E+
Sbjct  373   FLLLIKEWERLCVSYALVESNVLPHPYVSSSNEQVDEVGGDDEDDDVDDSDGNSSEVFEV  432

Query  161   LRLVDICFGDPNDTGKPGIHFQVRWKGYGPSEDTWEPIDGLKSWKNRQGWFT  6
               ++ +C+GDP ++G  G++ ++RWKGYGP +DTWEPIDGL   + +   F 
Sbjct  433   KEVLAMCYGDPKESGAVGLYCKIRWKGYGPDDDTWEPIDGLSDCQEKVKEFV  484



>pdb|4FT2|A Chain A, Crystal Structure Of Zea Mays Zmet2 In Complex H3(1-15)k9me2 
Peptide And Sah
 pdb|4FT2|B Chain B, Crystal Structure Of Zea Mays Zmet2 In Complex H3(1-15)k9me2 
Peptide And Sah
 pdb|4FT4|B Chain B, Crystal Structure Of Zea Mays Zmet2 In Complex H3(1-32)k9me2 
Peptide And Sah
 pdb|4FT4|A Chain A, Crystal Structure Of Zea Mays Zmet2 In Complex H3(1-32)k9me2 
Peptide And Sah
Length=784

 Score =   231 bits (590),  Expect = 9e-65, Method: Compositional matrix adjust.
 Identities = 153/353 (43%), Positives = 199/353 (56%), Gaps = 47/353 (13%)
 Frame = -2

Query  1043  TCFCSADEEDEVILNVDCHYAQAKVLSFILNIGDCVYVK-GEGEKKHVGRILEFFKTTEG  867
             T     DEE+E  L   CHY  AKV + +  +GD VYVK GE E  ++GRI EFF+ T+ 
Sbjct  31    TAAKKPDEEEE--LKARCHYRSAKVDNVVYCLGDDVYVKAGENEADYIGRITEFFEGTDQ  88

Query  866   EDYFRVQWFFRAEDTVMRDAAAL------HDKKRLFYSTLMNDNLLDCIISKVNVTEISP  705
               YF  +WFFRAEDTV+    ++      HD +R+F S   NDN+LDCIISKV +  + P
Sbjct  89    CHYFTCRWFFRAEDTVINSLVSISVDGHKHDPRRVFLSEEKNDNVLDCIISKVKIVHVDP  148

Query  704   GLGLEVNNS--PPSGFYYDMEYCVDYSTFRNLPTVQSVNSWDSPSLIDASYKPITAYPVE  531
              +  +           YYDM Y V YSTF N+ +    +  D+ S I +    +      
Sbjct  149   NMDPKAKAQLIESCDLYYDMSYSVAYSTFANISSENGQSGSDTASGISSDDVDLET----  204

Query  530   HFKSCEPSKVELSLLDLYAGCGGMSTGLCLGAKLSGLNLVTKWAVDYQKSACDSLKFNHP  351
                S  P++   +LLDLY+GCGGMSTGLCLGA LSGL L T+WAVD+   AC SLK+NHP
Sbjct  205   --SSSMPTRTA-TLLDLYSGCGGMSTGLCLGAALSGLKLETRWAVDFNSFACQSLKYNHP  261

Query  350   ETQVRNESVenflkllkeweklckEY---------GSEPNAGSDDVLEGMEEGaddansl  198
             +T+VRNE  + FL LLKEW  LCK+Y          SE  A  D  L+            
Sbjct  262   QTEVRNEKADEFLALLKEWAVLCKKYVQDVDSNLASSEDQADEDSPLD------------  309

Query  197   adsddsdAEYEILRLVDICFGDPNDTGKPGIHFQVRWKGYGPSEDTWEPIDGL  39
                     E+ + +LV IC+G  +     GI+F+V+W+GYGP EDTWEPID L
Sbjct  310   ------KDEFVVEKLVGICYGGSDREN--GIYFKVQWEGYGPEEDTWEPIDNL  354



>ref|XP_002448525.1| hypothetical protein SORBIDRAFT_06g028430 [Sorghum bicolor]
 gb|EES12853.1| hypothetical protein SORBIDRAFT_06g028430 [Sorghum bicolor]
Length=913

 Score =   232 bits (591),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 152/337 (45%), Positives = 198/337 (59%), Gaps = 27/337 (8%)
 Frame = -2

Query  1022  EEDEVILNVDCHYAQAKVLSFILNIGDCVYVK-GEGEKKHVGRILEFFKTTEGEDYFRVQ  846
             EEDE  LN  CHY  AKV + +  +GD VYVK GE E  ++GRI EFF+ T+   YF  +
Sbjct  166   EEDEE-LNAKCHYRSAKVDNVVYCLGDDVYVKAGENEADYIGRITEFFEGTDRCHYFTCR  224

Query  845   WFFRAEDTVMRDAAAL------HDKKRLFYSTLMNDNLLDCIISKVNVTEISPGLGLEVN  684
             WFFRAEDTV+    ++      HD +R+F S   NDN+LDCIISKV +  + P +  +  
Sbjct  225   WFFRAEDTVINSLVSINVDGHKHDPRRVFLSEEKNDNVLDCIISKVKIVHVDPNMDPKAK  284

Query  683   NS--PPSGFYYDMEYCVDYSTFRNLPTVQSVNSWDSPSLIDASYKPITAYPVEHFKSCEP  510
                      YYDM Y V YSTF N+ +    +  ++ S I +    + A       S  P
Sbjct  285   AQLIEHCDLYYDMSYSVAYSTFANISSENGQSGSETASGISSDDVDLEA------PSSMP  338

Query  509   SKVELSLLDLYAGCGGMSTGLCLGAKLSGLNLVTKWAVDYQKSACDSLKFNHPETQVRNE  330
              +   +LLDLY+GCGGMSTGLCLGA LSGL L T+WAVD    AC SLK+NHP+T+VRNE
Sbjct  339   ERT-ATLLDLYSGCGGMSTGLCLGAALSGLKLETRWAVDLNSFACQSLKYNHPQTEVRNE  397

Query  329   SVenflkllkeweklckEYGSEPNAGSDDVLEGMEEGaddansladsddsdAEYEILRLV  150
               + FL LLKEW  LC++Y  +     D  L G E+          S     E+ + +L+
Sbjct  398   KADEFLALLKEWAVLCEKYVHQ---DVDSNLAGSED-----QEDEGSPLDKDEFVVEKLI  449

Query  149   DICFGDPNDTGKPGIHFQVRWKGYGPSEDTWEPIDGL  39
              IC+G      K GI+F+V+W+GYGP EDTWEPID L
Sbjct  450   GICYG--GSGRKDGIYFKVQWEGYGPEEDTWEPIDNL  484



>ref|NP_001104978.1| DNA (cytosine-5)-methyltransferase 1 [Zea mays]
 sp|Q9AXT8.1|CMT1_MAIZE RecName: Full=DNA (cytosine-5)-methyltransferase 1; AltName: 
Full=Chromomethylase 1; AltName: Full=DNA cytosine methyltransferase 
MET2a; AltName: Full=Zea methyltransferase2; Short=Zmet2 
[Zea mays]
 gb|AAK11516.1|AF243043_1 DNA cytosine methyltransferase MET2a [Zea mays]
 gb|ACX48824.1| chromomethylase [Zea mays]
Length=912

 Score =   232 bits (591),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 153/353 (43%), Positives = 199/353 (56%), Gaps = 47/353 (13%)
 Frame = -2

Query  1043  TCFCSADEEDEVILNVDCHYAQAKVLSFILNIGDCVYVK-GEGEKKHVGRILEFFKTTEG  867
             T     DEE+E  L   CHY  AKV + +  +GD VYVK GE E  ++GRI EFF+ T+ 
Sbjct  159   TAAKKPDEEEE--LKARCHYRSAKVDNVVYCLGDDVYVKAGENEADYIGRITEFFEGTDQ  216

Query  866   EDYFRVQWFFRAEDTVMRDAAAL------HDKKRLFYSTLMNDNLLDCIISKVNVTEISP  705
               YF  +WFFRAEDTV+    ++      HD +R+F S   NDN+LDCIISKV +  + P
Sbjct  217   CHYFTCRWFFRAEDTVINSLVSISVDGHKHDPRRVFLSEEKNDNVLDCIISKVKIVHVDP  276

Query  704   GLGLEVNNS--PPSGFYYDMEYCVDYSTFRNLPTVQSVNSWDSPSLIDASYKPITAYPVE  531
              +  +           YYDM Y V YSTF N+ +    +  D+ S I +    +      
Sbjct  277   NMDPKAKAQLIESCDLYYDMSYSVAYSTFANISSENGQSGSDTASGISSDDVDLET----  332

Query  530   HFKSCEPSKVELSLLDLYAGCGGMSTGLCLGAKLSGLNLVTKWAVDYQKSACDSLKFNHP  351
                S  P++   +LLDLY+GCGGMSTGLCLGA LSGL L T+WAVD+   AC SLK+NHP
Sbjct  333   --SSSMPTRT-ATLLDLYSGCGGMSTGLCLGAALSGLKLETRWAVDFNSFACQSLKYNHP  389

Query  350   ETQVRNESVenflkllkeweklckEY---------GSEPNAGSDDVLEGMEEGaddansl  198
             +T+VRNE  + FL LLKEW  LCK+Y          SE  A  D  L+            
Sbjct  390   QTEVRNEKADEFLALLKEWAVLCKKYVQDVDSNLASSEDQADEDSPLD------------  437

Query  197   adsddsdAEYEILRLVDICFGDPNDTGKPGIHFQVRWKGYGPSEDTWEPIDGL  39
                     E+ + +LV IC+G  +     GI+F+V+W+GYGP EDTWEPID L
Sbjct  438   ------KDEFVVEKLVGICYGGSDREN--GIYFKVQWEGYGPEEDTWEPIDNL  482



>gb|AFW59438.1| DNA (cytosine-5)-methyltransferase 1 [Zea mays]
Length=915

 Score =   232 bits (591),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 153/353 (43%), Positives = 199/353 (56%), Gaps = 47/353 (13%)
 Frame = -2

Query  1043  TCFCSADEEDEVILNVDCHYAQAKVLSFILNIGDCVYVK-GEGEKKHVGRILEFFKTTEG  867
             T     DEE+E  L   CHY  AKV + +  +GD VYVK GE E  ++GRI EFF+ T+ 
Sbjct  162   TAAKKPDEEEE--LKARCHYRSAKVDNVVYCLGDDVYVKAGENEADYIGRITEFFEGTDQ  219

Query  866   EDYFRVQWFFRAEDTVMRDAAAL------HDKKRLFYSTLMNDNLLDCIISKVNVTEISP  705
               YF  +WFFRAEDTV+    ++      HD +R+F S   NDN+LDCIISKV +  + P
Sbjct  220   CHYFTCRWFFRAEDTVINSLVSISVDGHKHDPRRVFLSEEKNDNVLDCIISKVKIVHVDP  279

Query  704   GLGLEVNNS--PPSGFYYDMEYCVDYSTFRNLPTVQSVNSWDSPSLIDASYKPITAYPVE  531
              +  +           YYDM Y V YSTF N+ +    +  D+ S I +    +      
Sbjct  280   NMDPKAKAQLIESCDLYYDMSYSVAYSTFANISSENGQSDSDTASGISSDDVDLET----  335

Query  530   HFKSCEPSKVELSLLDLYAGCGGMSTGLCLGAKLSGLNLVTKWAVDYQKSACDSLKFNHP  351
                S  P++   +LLDLY+GCGGMSTGLCLGA LSGL L T+WAVD+   AC SLK+NHP
Sbjct  336   --SSSMPTRT-ATLLDLYSGCGGMSTGLCLGAALSGLKLETRWAVDFNSFACQSLKYNHP  392

Query  350   ETQVRNESVenflkllkeweklckEY---------GSEPNAGSDDVLEGMEEGaddansl  198
             +T+VRNE  + FL LLKEW  LCK+Y          SE  A  D  L+            
Sbjct  393   QTEVRNEKADEFLALLKEWAVLCKKYVQDVDSNLASSEDQADEDSPLD------------  440

Query  197   adsddsdAEYEILRLVDICFGDPNDTGKPGIHFQVRWKGYGPSEDTWEPIDGL  39
                     E+ + +LV IC+G  +     GI+F+V+W+GYGP EDTWEPID L
Sbjct  441   ------KDEFVVEKLVGICYGGSDREN--GIYFKVQWEGYGPEEDTWEPIDNL  485



>ref|XP_007014771.1| Chromomethylase 1, putative isoform 6, partial [Theobroma cacao]
 gb|EOY32390.1| Chromomethylase 1, putative isoform 6, partial [Theobroma cacao]
Length=770

 Score =   230 bits (587),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 144/341 (42%), Positives = 203/341 (60%), Gaps = 10/341 (3%)
 Frame = -2

Query  1031  SADEEDEVILNVDCHYAQAKVLSFIL-NIGDCVYVKGE-GEKKHVGRILEFFKTTEGEDY  858
             S DE D  I+    HY QA+V   +L N+ D  +VK E G+  ++ +I+E F+  +G  Y
Sbjct  131   SKDENDSEIIQARRHYTQAEVDGRVLYNLYDDAHVKAEEGQDYYICKIVEMFEAVDGTLY  190

Query  857   FRVQWFFRAEDTVMRDAAALHDKKRLFYSTLMNDNLLDCIISKVNVTEISPGLGLEVNNS  678
             F  QWF+RA DTVM+    L DKKR+F+S + +DN LDC++ K+ + ++S  + LE    
Sbjct  191   FTAQWFYRARDTVMKKLGHLIDKKRVFFSEIRDDNPLDCLVEKLIIAKVSLNVDLEAKKK  250

Query  677   --PPSGFYYDMEYCVDYSTFRNLPTVQSVNSWDSPSLIDA----SYKPITAYPVEHFKSC  516
               P   +Y DM Y + YS+F NLP     N  ++ S I      S     +   E  ++ 
Sbjct  251   MIPCCDYYCDMLYLLPYSSFINLPPEDKTNCSEASSTISTDDVNSVNEEKSQYEEASQAS  310

Query  515   EPSKVELSLLDLYAGCGGMSTGLCLGAKLSGLNLVTKWAVDYQKSACDSLKFNHPETQVR  336
                K +++LLDLY+GCG MSTGLCLGA ++GL L T+WAVD  K  C+SLK+NHPET+VR
Sbjct  311   NNKKSQVTLLDLYSGCGAMSTGLCLGANMAGLKLETRWAVDLNKYGCESLKWNHPETEVR  370

Query  335   NESVenflkllkeweklckEYG--SEPNAGSDDVLEGMEEGaddansladsddsdAEYEI  162
             NES E+FL LLKEWE+LC  +      N           E   D +   + D     +E+
Sbjct  371   NESAEDFLALLKEWERLCVLFSLLKSENLEKQSFNPFRTEDDGDDDDNEEDDTEGDVFEV  430

Query  161   LRLVDICFGDPNDTGKPGIHFQVRWKGYGPSEDTWEPIDGL  39
              +++ IC+GDP   G+ G+HFQVRWK YG  EDTWEP++G+
Sbjct  431   EKILAICYGDPKKKGERGLHFQVRWKNYGLEEDTWEPLEGM  471



>ref|XP_010230204.1| PREDICTED: DNA (cytosine-5)-methyltransferase 1-like [Brachypodium 
distachyon]
Length=956

 Score =   231 bits (590),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 153/345 (44%), Positives = 208/345 (60%), Gaps = 21/345 (6%)
 Frame = -2

Query  1031  SADEEDEVILNVDCHYAQAKVLSFILNIGDCVYVK-GEGEKKHVGRILEFFKTTEGEDYF  855
             SA EED   ++  CHY  A V   I ++ D VYVK G  E+ ++GRI EFF+  +   YF
Sbjct  192   SAGEED---ISARCHYRSACVDDAIFHLDDDVYVKAGPDEENYIGRIAEFFEGIDRGSYF  248

Query  854   RVQWFFRAEDTVMRDAAAL-----HDKKRLFYSTLMNDNLLDCIISKVNVTEISPGLGLE  690
               +WFFR  DTV+     +     HD KR+F S   NDN+++ IISK+N+  + P +  +
Sbjct  249   TCRWFFRTADTVISRKLLMVHDHKHDHKRVFLSEEKNDNMIESIISKINIIYVDPNMTPK  308

Query  689   VNNSPPS--GFYYDMEYCVDYSTFRNLPTVQ-SVNSWDSPSLI----DASYKPITAYPVE  531
                   S   FYYDM Y VDYSTF N+P+     +  ++ S I    D S K     PV 
Sbjct  309   GKAQVISTCDFYYDMSYSVDYSTFANMPSENDGASGSEATSNISCDDDNSSK---ENPVA  365

Query  530   HFKSCEPSKVELS-LLDLYAGCGGMSTGLCLGAKLSGLNLVTKWAVDYQKSACDSLKFNH  354
                +   +++E + LLDLY+GCG MSTGLCLGA LSG+ L T+WAVD    AC+SLK NH
Sbjct  366   DLAAASDAQMETAKLLDLYSGCGAMSTGLCLGAALSGVKLNTRWAVDMNTYACNSLKHNH  425

Query  353   PETQVRNESVenflkllkeweklckEYGSEPNAGSDDVLEGMEEGaddansladsddsdA  174
             P TQVRNE  E+FL LL++WE LC++Y S  +  ++ +   + + + DA         + 
Sbjct  426   PSTQVRNEKAEDFLSLLRQWEALCEKYVSVTHK-NNSLGSALAQTSMDAEDDESEPLPED  484

Query  173   EYEILRLVDICFGDPNDTGKPGIHFQVRWKGYGPSEDTWEPIDGL  39
              YE+ +L+DIC+GDPN TG+ G+ F+VRWK Y  S DTWEPIDGL
Sbjct  485   TYEVEKLLDICYGDPNSTGEIGLCFKVRWKKYDSSHDTWEPIDGL  529



>ref|XP_011089105.1| PREDICTED: DNA (cytosine-5)-methyltransferase CMT3 [Sesamum indicum]
Length=859

 Score =   231 bits (588),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 144/337 (43%), Positives = 203/337 (60%), Gaps = 13/337 (4%)
 Frame = -2

Query  1004  LNVDCHYAQAKVLSFILNIGDCVYVKGE-GEKKHVGRILEFFKTTEGEDYFRVQWFFRAE  828
             +   CH+ QA+V   +  + D  YVK E G++ ++ +I+E F+  +G   F  QW++RA 
Sbjct  117   IQARCHFVQAEVDGQVFFLEDDSYVKAEEGKENYICKIIELFQAVDGSQNFTAQWYYRAS  176

Query  827   DTVMRDAAALHDKKRLFYSTLMNDNLLDCIISKVNVTEISPGLGLEVNNSPPSG--FYYD  654
             DTV+++   L D KR+F+S + +DN LDC++ K+ +  +      +      S   +YYD
Sbjct  177   DTVIKNCGNLIDHKRVFFSEIKDDNPLDCLVKKLKIVPLPLKAESDATEKLRSKCDYYYD  236

Query  653   MEYCVDYSTFRNLPTVQSVNSWDSPSLIDASYKPITAYPVEHFKSCEPSKVELSLLDLYA  474
               Y + YS+F +L    + NS +S S I +    +T      F   E +  E  LLDLY+
Sbjct  237   KMYLLPYSSFVSLQRDSTTNSNESGSTISSDADAVTV----GFSELEEATGERMLLDLYS  292

Query  473   GCGGMSTGLCLGAKLSGLNLVTKWAVDYQKSACDSLKFNHPETQVRNESVenflkllkew  294
             GCG MSTGLCLGA   G+ LVTKWAVD  + AC+SLK NHPETQVRNES ENFL LLKEW
Sbjct  293   GCGAMSTGLCLGANSCGVKLVTKWAVDINQYACESLKLNHPETQVRNESAENFLHLLKEW  352

Query  293   eklckEYGSEPNAGSDDVLEGM-----EEGaddansladsddsdAE-YEILRLVDICFGD  132
             EKLC    S  N GS D    M      EG  + +   D+ + D+E +E+  ++ IC+GD
Sbjct  353   EKLCASLLSSENNGSSDEHGKMNERKDNEGDCNVDDDDDAGEEDSEVFEVEEILAICYGD  412

Query  131   PNDTGKPGIHFQVRWKGYGPSEDTWEPIDGLKSWKNR  21
             PN  G   +HF++RWKGYGP EDTWEP++GL + + +
Sbjct  413   PNKNGNAKLHFKIRWKGYGPEEDTWEPLEGLSTCQEK  449



>ref|XP_007014769.1| Chromomethylase 1, putative isoform 4 [Theobroma cacao]
 gb|EOY32388.1| Chromomethylase 1, putative isoform 4 [Theobroma cacao]
Length=804

 Score =   230 bits (586),  Expect = 4e-64, Method: Compositional matrix adjust.
 Identities = 144/341 (42%), Positives = 203/341 (60%), Gaps = 10/341 (3%)
 Frame = -2

Query  1031  SADEEDEVILNVDCHYAQAKVLSFIL-NIGDCVYVKGE-GEKKHVGRILEFFKTTEGEDY  858
             S DE D  I+    HY QA+V   +L N+ D  +VK E G+  ++ +I+E F+  +G  Y
Sbjct  174   SKDENDSEIIQARRHYTQAEVDGRVLYNLYDDAHVKAEEGQDYYICKIVEMFEAVDGTLY  233

Query  857   FRVQWFFRAEDTVMRDAAALHDKKRLFYSTLMNDNLLDCIISKVNVTEISPGLGLEVNNS  678
             F  QWF+RA DTVM+    L DKKR+F+S + +DN LDC++ K+ + ++S  + LE    
Sbjct  234   FTAQWFYRARDTVMKKLGHLIDKKRVFFSEIRDDNPLDCLVEKLIIAKVSLNVDLEAKKK  293

Query  677   --PPSGFYYDMEYCVDYSTFRNLPTVQSVNSWDSPSLIDA----SYKPITAYPVEHFKSC  516
               P   +Y DM Y + YS+F NLP     N  ++ S I      S     +   E  ++ 
Sbjct  294   MIPCCDYYCDMLYLLPYSSFINLPPEDKTNCSEASSTISTDDVNSVNEEKSQYEEASQAS  353

Query  515   EPSKVELSLLDLYAGCGGMSTGLCLGAKLSGLNLVTKWAVDYQKSACDSLKFNHPETQVR  336
                K +++LLDLY+GCG MSTGLCLGA ++GL L T+WAVD  K  C+SLK+NHPET+VR
Sbjct  354   NNKKSQVTLLDLYSGCGAMSTGLCLGANMAGLKLETRWAVDLNKYGCESLKWNHPETEVR  413

Query  335   NESVenflkllkeweklckEYG--SEPNAGSDDVLEGMEEGaddansladsddsdAEYEI  162
             NES E+FL LLKEWE+LC  +      N           E   D +   + D     +E+
Sbjct  414   NESAEDFLALLKEWERLCVLFSLLKSENLEKQSFNPFRTEDDGDDDDNEEDDTEGDVFEV  473

Query  161   LRLVDICFGDPNDTGKPGIHFQVRWKGYGPSEDTWEPIDGL  39
              +++ IC+GDP   G+ G+HFQVRWK YG  EDTWEP++G+
Sbjct  474   EKILAICYGDPKKKGERGLHFQVRWKNYGLEEDTWEPLEGM  514



>ref|XP_007014770.1| Chromomethylase 1, putative isoform 5, partial [Theobroma cacao]
 gb|EOY32389.1| Chromomethylase 1, putative isoform 5, partial [Theobroma cacao]
Length=774

 Score =   229 bits (585),  Expect = 4e-64, Method: Compositional matrix adjust.
 Identities = 144/341 (42%), Positives = 203/341 (60%), Gaps = 10/341 (3%)
 Frame = -2

Query  1031  SADEEDEVILNVDCHYAQAKVLSFIL-NIGDCVYVKGE-GEKKHVGRILEFFKTTEGEDY  858
             S DE D  I+    HY QA+V   +L N+ D  +VK E G+  ++ +I+E F+  +G  Y
Sbjct  131   SKDENDSEIIQARRHYTQAEVDGRVLYNLYDDAHVKAEEGQDYYICKIVEMFEAVDGTLY  190

Query  857   FRVQWFFRAEDTVMRDAAALHDKKRLFYSTLMNDNLLDCIISKVNVTEISPGLGLEVNNS  678
             F  QWF+RA DTVM+    L DKKR+F+S + +DN LDC++ K+ + ++S  + LE    
Sbjct  191   FTAQWFYRARDTVMKKLGHLIDKKRVFFSEIRDDNPLDCLVEKLIIAKVSLNVDLEAKKK  250

Query  677   --PPSGFYYDMEYCVDYSTFRNLPTVQSVNSWDSPSLIDA----SYKPITAYPVEHFKSC  516
               P   +Y DM Y + YS+F NLP     N  ++ S I      S     +   E  ++ 
Sbjct  251   MIPCCDYYCDMLYLLPYSSFINLPPEDKTNCSEASSTISTDDVNSVNEEKSQYEEASQAS  310

Query  515   EPSKVELSLLDLYAGCGGMSTGLCLGAKLSGLNLVTKWAVDYQKSACDSLKFNHPETQVR  336
                K +++LLDLY+GCG MSTGLCLGA ++GL L T+WAVD  K  C+SLK+NHPET+VR
Sbjct  311   NNKKSQVTLLDLYSGCGAMSTGLCLGANMAGLKLETRWAVDLNKYGCESLKWNHPETEVR  370

Query  335   NESVenflkllkeweklckEYG--SEPNAGSDDVLEGMEEGaddansladsddsdAEYEI  162
             NES E+FL LLKEWE+LC  +      N           E   D +   + D     +E+
Sbjct  371   NESAEDFLALLKEWERLCVLFSLLKSENLEKQSFNPFRTEDDGDDDDNEEDDTEGDVFEV  430

Query  161   LRLVDICFGDPNDTGKPGIHFQVRWKGYGPSEDTWEPIDGL  39
              +++ IC+GDP   G+ G+HFQVRWK YG  EDTWEP++G+
Sbjct  431   EKILAICYGDPKKKGERGLHFQVRWKNYGLEEDTWEPLEGM  471



>ref|XP_004987095.1| PREDICTED: LOW QUALITY PROTEIN: DNA (cytosine-5)-methyltransferase 
1-like [Setaria italica]
Length=1608

 Score =   234 bits (596),  Expect = 5e-64, Method: Compositional matrix adjust.
 Identities = 152/338 (45%), Positives = 201/338 (59%), Gaps = 17/338 (5%)
 Frame = -2

Query  1019  EDEVILNVDCHYAQAKVLSFILNIGDCVYVK-GEGEKKHVGRILEFFKTTEGEDYFRVQW  843
             EDE  L   CHY  A V + I  + D VYVK G  E+ ++GRI EFFK  +   YF  QW
Sbjct  231   EDEE-LKARCHYRSANVDNVIYQLDDDVYVKAGPNEENYIGRITEFFKGLDQGSYFTCQW  289

Query  842   FFRAEDT-----VMRDAAALHDKKRLFYSTLMNDNLLDCIISKVNVTEISPGLG--LEVN  684
             FFR  DT     +++     HD KR+F S   NDN++ CI+SK+ +  + P      +V 
Sbjct  290   FFRTADTAISSKLLKVHDHKHDHKRVFLSEERNDNMIACIVSKIKIIHVDPNTAPQAKVQ  349

Query  683   NSPPSGFYYDMEYCVDYSTFRNLPTVQ-SVNSWDSPSLIDASYKPITAYPVEHFKSCEPS  507
              +    FYYDM Y V YSTF NLP     V+S  + ++ D +        V  F++   +
Sbjct  350   FTKDCDFYYDMSYSVAYSTFANLPADNDGVSSSAASNISDDAVDSSKETLVSCFQASSDA  409

Query  506   KVE-LSLLDLYAGCGGMSTGLCLGAKLSGLNLVTKWAVDYQKSACDSLKFNHPETQVRNE  330
               E +SLLDLY+GCG MSTGLCLGA LS   L T+WAVD    AC+SLK+NHP ++VRNE
Sbjct  410   HAETISLLDLYSGCGAMSTGLCLGAALSNFKLETRWAVDMNAYACESLKYNHPRSKVRNE  469

Query  329   SVenflkllkeweklckEYGSEPNAGSDDVLEGMEEGaddansladsddsdAEYEILRLV  150
                +FL LLKEW+ LCK+Y  +     D  +E   E A       D   S+  +E+ +L+
Sbjct  470   KAGDFLALLKEWDALCKKYIVQ----KDTTIE--SEVAQSLTDDEDEPVSEEIFEVEKLL  523

Query  149   DICFGDPNDTGKPGIHFQVRWKGYGPSEDTWEPIDGLK  36
             DIC+GDPN TG+ G+ F+VRWKGY PS DTWEP+DGL+
Sbjct  524   DICYGDPNSTGQVGLWFKVRWKGYDPSYDTWEPMDGLR  561



>ref|XP_006445885.1| hypothetical protein CICLE_v10014232mg [Citrus clementina]
 gb|ESR59125.1| hypothetical protein CICLE_v10014232mg [Citrus clementina]
Length=869

 Score =   230 bits (586),  Expect = 6e-64, Method: Compositional matrix adjust.
 Identities = 143/343 (42%), Positives = 207/343 (60%), Gaps = 24/343 (7%)
 Frame = -2

Query  1025  DEEDEVILNVDCHYAQAKVLSFIL-NIGDCVYVKGE-GEKKHVGRILEFFKTTEGEDYFR  852
             D+++E I+   CHY +A+V   I  ++ D  +VK E GE+ ++ +I+E F+  +G  YF 
Sbjct  121   DDDEEEIIQAKCHYMRAEVDGHITYDLFDDAHVKAESGEEDYICKIVEMFEAVDGTPYFT  180

Query  851   VQWFFRAEDTVMRDAAALHDKKRLFYSTLMNDNLLDCIISKVNVTEISPGLGLEVNN--S  678
              QW++RA DTV+   A L D++R+F+S + NDN L+C++ K+N+  +   + LE      
Sbjct  181   AQWYYRARDTVIESNAHLIDQRRVFFSEIQNDNPLECLVKKLNIARVPLNIDLEAKKLAI  240

Query  677   PPSGFYYDMEYCVDYSTFRNLP----TVQSVNSWDSPSLIDASYKPITAYPVEHFKSCEP  510
             P   +Y DM Y + YSTF +LP     V S  S    S +DA+            +  EP
Sbjct  241   PHCDYYCDMMYLLPYSTFFSLPPENKRVSSETSSTISSDVDAN----------ECEVGEP  290

Query  509   SKVELSLLDLYAGCGGMSTGLCLGAKLSGLNLVTKWAVDYQKSACDSLKFNHPETQVRNE  330
              K+++ LLDLY+GCG MSTGLCLGA L+GLNLVT+WAVD  + AC SLK NHPET+VRNE
Sbjct  291   QKMDVKLLDLYSGCGAMSTGLCLGANLAGLNLVTRWAVDINEYACQSLKLNHPETEVRNE  350

Query  329   SVenflkllkeweklckEYGSEPNAGSDDVLEGMEEGaddansladsddsdAE------Y  168
             S E+FL LL+EWEKLC  +           L    +  +      + +  D        +
Sbjct  351   SAEDFLTLLREWEKLCISFSLIARKDPQQQLYSFNDDGESEEDDDNGNVEDESEDDSEIF  410

Query  167   EILRLVDICFGDPNDTGKPGIHFQVRWKGYGPSEDTWEPIDGL  39
             E+ +++ IC+GDP +  K G++ +VRW+ YGPSEDTWEPI+GL
Sbjct  411   EVEKILKICYGDPKEIKKRGLYLKVRWRNYGPSEDTWEPIEGL  453



>gb|KDO62937.1| hypothetical protein CISIN_1g047980mg, partial [Citrus sinensis]
Length=718

 Score =   228 bits (581),  Expect = 8e-64, Method: Compositional matrix adjust.
 Identities = 143/343 (42%), Positives = 206/343 (60%), Gaps = 24/343 (7%)
 Frame = -2

Query  1025  DEEDEVILNVDCHYAQAKVLSFIL-NIGDCVYVKGE-GEKKHVGRILEFFKTTEGEDYFR  852
             D+++E I+   CHY  A+V   I  ++ D  +VK E GE+ ++ +I+E F+  +G  YF 
Sbjct  165   DDDEEEIIQAKCHYMWAEVDGHITYDLFDDAHVKAESGEEDYICKIVEMFEAVDGTPYFT  224

Query  851   VQWFFRAEDTVMRDAAALHDKKRLFYSTLMNDNLLDCIISKVNVTEISPGLGLEVNN--S  678
              QW++RA DTV+   A L D++R+F+S + NDN L+C++ K+N+  +   + LE      
Sbjct  225   AQWYYRARDTVIESNAHLIDQRRVFFSEIQNDNPLECLVKKLNIARVPLNIDLEAKKLAI  284

Query  677   PPSGFYYDMEYCVDYSTFRNLP----TVQSVNSWDSPSLIDASYKPITAYPVEHFKSCEP  510
             P   +Y DM Y + YSTF +LP     V S  S    S +DA+            +  EP
Sbjct  285   PHCDYYCDMMYLLPYSTFFSLPPENKRVSSETSSTISSDVDAN----------ECEVGEP  334

Query  509   SKVELSLLDLYAGCGGMSTGLCLGAKLSGLNLVTKWAVDYQKSACDSLKFNHPETQVRNE  330
              K+++ LLDLY+GCG MSTGLCLGA L+GLNLVT+WAVD  + AC SLK NHPET+VRNE
Sbjct  335   QKMDVKLLDLYSGCGAMSTGLCLGANLAGLNLVTRWAVDINEYACQSLKLNHPETEVRNE  394

Query  329   SVenflkllkeweklckEYGSEPNAGSDDVLEGMEEGaddansladsddsdAE------Y  168
             S E+FL LL+EWEKLC  +           L    +  +      + +  D        +
Sbjct  395   SAEDFLTLLREWEKLCISFSLIARKDPQQQLYSFNDDGESEEDDDNGNVEDESEDDSEIF  454

Query  167   EILRLVDICFGDPNDTGKPGIHFQVRWKGYGPSEDTWEPIDGL  39
             E+ +++ IC+GDP +  K G++ +VRW+ YGPSEDTWEPI+GL
Sbjct  455   EVEKILKICYGDPKEIKKRGLYLKVRWRNYGPSEDTWEPIEGL  497



>gb|KDP44326.1| hypothetical protein JCGZ_19193 [Jatropha curcas]
Length=752

 Score =   228 bits (582),  Expect = 8e-64, Method: Compositional matrix adjust.
 Identities = 150/340 (44%), Positives = 217/340 (64%), Gaps = 19/340 (6%)
 Frame = -2

Query  1025  DEEDEVILNVDCHYAQAKVLSF-ILNIGDCVYVKG-EGEKKHVGRILEFFKTTEGEDYFR  852
             D+ D+VIL   CHY QA+V    I N+ D  +VK  +GE  ++ +I+E F+  +G  YF 
Sbjct  4     DDSDDVIL-ARCHYRQAEVDGHNIYNLYDDAHVKAADGEDSYICKIVEMFEAIDGNLYFT  62

Query  851   VQWFFRAEDTVMRDAAALHDKKRLFYSTLMNDNLLDCIISKVNVTEISPGLGLEVNNSPP  672
              QWF+RA DT ++ A  + ++KR+F+S + +DN LDC++ K+N+ ++   + LE   +  
Sbjct  63    AQWFYRARDTAIKHAYQM-EQKRVFFSEIRDDNPLDCLVEKLNIAKLPLNVDLEAKEAAI  121

Query  671   SG--FYYDMEYCVDYSTFRNLPTVQSVNSWDSPSLIDASYKPITAYPVEHFKSCEP--SK  504
                 ++ DM Y + YSTF  LP      S ++ +  ++S    +   +   KS     +K
Sbjct  122   KSCDYFCDMLYLLPYSTFVKLP------SENTTASNESSSTLSSDNEMNELKSANDVYNK  175

Query  503   VELSLLDLYAGCGGMSTGLCLGAKLSGLNLVTKWAVDYQKSACDSLKFNHPETQVRNESV  324
              E++LLDLY+GCG MSTGLCLGAKLSGLNL+TKWAVD  K AC+SLK NHPET+VRNE+ 
Sbjct  176   SEVTLLDLYSGCGAMSTGLCLGAKLSGLNLITKWAVDLNKYACESLKLNHPETEVRNETA  235

Query  323   enflkllkeweklckEY----GSEPNAGSDDVLEGMEEGaddansladsddsdAE-YEIL  159
             E+FL LLKEWEKLC  +     ++P        +  EE +D  ++  D D  D E +E+ 
Sbjct  236   EDFLLLLKEWEKLCIRFSLISSTDPEKQQSYSFDLEEEDSDAQDNDDDDDGDDGEVFEVE  295

Query  158   RLVDICFGDPNDTGKPGIHFQVRWKGYGPSEDTWEPIDGL  39
             +++ IC+GDP + G+ G++F+V WKGYGP  DTWEPIDGL
Sbjct  296   KVLQICYGDPKEKGEHGLYFKVSWKGYGPEYDTWEPIDGL  335



>ref|XP_007014768.1| Chromomethylase 1, putative isoform 3 [Theobroma cacao]
 gb|EOY32387.1| Chromomethylase 1, putative isoform 3 [Theobroma cacao]
Length=931

 Score =   229 bits (585),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 144/341 (42%), Positives = 203/341 (60%), Gaps = 10/341 (3%)
 Frame = -2

Query  1031  SADEEDEVILNVDCHYAQAKVLSFIL-NIGDCVYVKGE-GEKKHVGRILEFFKTTEGEDY  858
             S DE D  I+    HY QA+V   +L N+ D  +VK E G+  ++ +I+E F+  +G  Y
Sbjct  174   SKDENDSEIIQARRHYTQAEVDGRVLYNLYDDAHVKAEEGQDYYICKIVEMFEAVDGTLY  233

Query  857   FRVQWFFRAEDTVMRDAAALHDKKRLFYSTLMNDNLLDCIISKVNVTEISPGLGLEVNNS  678
             F  QWF+RA DTVM+    L DKKR+F+S + +DN LDC++ K+ + ++S  + LE    
Sbjct  234   FTAQWFYRARDTVMKKLGHLIDKKRVFFSEIRDDNPLDCLVEKLIIAKVSLNVDLEAKKK  293

Query  677   --PPSGFYYDMEYCVDYSTFRNLPTVQSVNSWDSPSLIDA----SYKPITAYPVEHFKSC  516
               P   +Y DM Y + YS+F NLP     N  ++ S I      S     +   E  ++ 
Sbjct  294   MIPCCDYYCDMLYLLPYSSFINLPPEDKTNCSEASSTISTDDVNSVNEEKSQYEEASQAS  353

Query  515   EPSKVELSLLDLYAGCGGMSTGLCLGAKLSGLNLVTKWAVDYQKSACDSLKFNHPETQVR  336
                K +++LLDLY+GCG MSTGLCLGA ++GL L T+WAVD  K  C+SLK+NHPET+VR
Sbjct  354   NNKKSQVTLLDLYSGCGAMSTGLCLGANMAGLKLETRWAVDLNKYGCESLKWNHPETEVR  413

Query  335   NESVenflkllkeweklckEYG--SEPNAGSDDVLEGMEEGaddansladsddsdAEYEI  162
             NES E+FL LLKEWE+LC  +      N           E   D +   + D     +E+
Sbjct  414   NESAEDFLALLKEWERLCVLFSLLKSENLEKQSFNPFRTEDDGDDDDNEEDDTEGDVFEV  473

Query  161   LRLVDICFGDPNDTGKPGIHFQVRWKGYGPSEDTWEPIDGL  39
              +++ IC+GDP   G+ G+HFQVRWK YG  EDTWEP++G+
Sbjct  474   EKILAICYGDPKKKGERGLHFQVRWKNYGLEEDTWEPLEGM  514



>ref|XP_002454088.1| hypothetical protein SORBIDRAFT_04g024430 [Sorghum bicolor]
 gb|EES07064.1| hypothetical protein SORBIDRAFT_04g024430 [Sorghum bicolor]
Length=770

 Score =   228 bits (580),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 152/343 (44%), Positives = 200/343 (58%), Gaps = 40/343 (12%)
 Frame = -2

Query  1022  EEDEVILNVDCHYAQAKVLSFILNIGDCVYVK-GEGEKKHVGRILEFFKTTEGEDYFRVQ  846
             EEDE  L   CHY  AKV + +  +GD VYVK GE E  ++GRI EFF+ T+   YF   
Sbjct  172   EEDEE-LKARCHYRSAKVDNVVYCLGDDVYVKAGENEADYIGRITEFFEGTDRCHYFTCH  230

Query  845   WFFRAEDTVMRDAAA------LHDKKRLFYSTLMNDNLLDCIISKVNVTEISPGLGLEVN  684
             WFFRAEDTV+    +      +HD +R+F S   NDN+LDCIISKV +  + P +  +  
Sbjct  231   WFFRAEDTVINSLVSINVDGHMHDPRRVFLSEEKNDNVLDCIISKVKIVRVDPNIDPKAK  290

Query  683   NS--PPSGFYYDMEYCVDYSTFRNLPTVQSVNSWDSPSLI---DASYKPITAYPVEHFKS  519
                      YYDM Y V YSTF N+ +    +  ++ S I   D   +  ++ P      
Sbjct  291   AQLIEHCDLYYDMSYSVAYSTFANISSENGQSGSETASGISDGDVDLETSSSMP------  344

Query  518   CEPSKVELSLLDLYAGCGGMSTGLCLGAKLSGLNLVTKWAVDYQKSACDSLKFNHPETQV  339
                 +   +LLDLY+GCGGMSTGLCLGA LSGL L T+WAVD    AC SLK+NHP+T+V
Sbjct  345   ----ERTATLLDLYSGCGGMSTGLCLGAALSGLKLETRWAVDLNSFACQSLKYNHPQTEV  400

Query  338   RNESVenflkllkeweklckEYGSEPN---AGSDDVLEGMEEGaddansladsddsdAEY  168
             RNE  + FL LLKEW  LC++Y  + +   AGS+D     +EG         S     E+
Sbjct  401   RNEKADEFLALLKEWAVLCEKYVQDIDSNLAGSED---QEDEG---------SPLDKDEF  448

Query  167   EILRLVDICFGDPNDTGKPGIHFQVRWKGYGPSEDTWEPIDGL  39
              + +L+ IC+G      K GI+F+V+W+GYGP EDTWEPID L
Sbjct  449   VVEKLIGICYG--GSGRKNGIYFKVQWEGYGPEEDTWEPIDNL  489



>ref|NP_001275877.1| DNA (cytosine-5)-methyltransferase CMT3-like [Citrus sinensis]
 gb|AGU16982.1| CMT-type DNA-methyltransferase [Citrus sinensis]
Length=869

 Score =   228 bits (580),  Expect = 4e-63, Method: Compositional matrix adjust.
 Identities = 143/343 (42%), Positives = 206/343 (60%), Gaps = 24/343 (7%)
 Frame = -2

Query  1025  DEEDEVILNVDCHYAQAKVLSFIL-NIGDCVYVKGE-GEKKHVGRILEFFKTTEGEDYFR  852
             D+++E I+   CHY  A+V   I  ++ D  +VK E GE+ ++ +I+E F+  +G  YF 
Sbjct  121   DDDEEEIIQAKCHYMWAEVDGHITYDLFDDAHVKAESGEEDYICKIVEMFEAVDGTPYFT  180

Query  851   VQWFFRAEDTVMRDAAALHDKKRLFYSTLMNDNLLDCIISKVNVTEISPGLGLEVNN--S  678
              QW++RA DTV+   A L D++R+F+S + NDN L+C++ K+N+  +   + LE      
Sbjct  181   AQWYYRARDTVIESNAHLIDQRRVFFSEIQNDNPLECLVKKLNIARVPLNIDLEAKKLAI  240

Query  677   PPSGFYYDMEYCVDYSTFRNLP----TVQSVNSWDSPSLIDASYKPITAYPVEHFKSCEP  510
             P   +Y DM Y + YSTF +LP     V S  S    S +DA+            +  EP
Sbjct  241   PHCDYYCDMMYLLPYSTFFSLPPENKRVSSETSSTISSDVDAN----------ECEVGEP  290

Query  509   SKVELSLLDLYAGCGGMSTGLCLGAKLSGLNLVTKWAVDYQKSACDSLKFNHPETQVRNE  330
              K+++ LLDLY+GCG MSTGLCLGA L+GLNLVT+WAVD  + AC SLK NHPET+VRNE
Sbjct  291   QKMDVKLLDLYSGCGAMSTGLCLGANLAGLNLVTRWAVDINEYACQSLKLNHPETEVRNE  350

Query  329   SVenflkllkeweklckEYGSEPNAGSDDVLEGMEEGaddansladsddsdAE------Y  168
             S E+FL LL+EWEKLC  +           L    +  +      + +  D        +
Sbjct  351   SAEDFLTLLREWEKLCISFSLIARKDPQQQLYSFNDDGESEEDDDNGNVEDESEDDSEIF  410

Query  167   EILRLVDICFGDPNDTGKPGIHFQVRWKGYGPSEDTWEPIDGL  39
             E+ +++ IC+GDP +  K G++ +VRW+ YGPSEDTWEPI+GL
Sbjct  411   EVEKILKICYGDPKEIKKRGLYLKVRWRNYGPSEDTWEPIEGL  453



>ref|XP_007014766.1| Chromomethylase 1, putative isoform 1 [Theobroma cacao]
 gb|EOY32385.1| Chromomethylase 1, putative isoform 1 [Theobroma cacao]
Length=930

 Score =   228 bits (581),  Expect = 4e-63, Method: Compositional matrix adjust.
 Identities = 142/340 (42%), Positives = 206/340 (61%), Gaps = 9/340 (3%)
 Frame = -2

Query  1031  SADEEDEVILNVDCHYAQAKVLSFIL-NIGDCVYVKGE-GEKKHVGRILEFFKTTEGEDY  858
             S DE D  I+    HY QA+V   +L N+ D  +VK E G+  ++ +I+E F+  +G  Y
Sbjct  174   SKDENDSEIIQARRHYTQAEVDGRVLYNLYDDAHVKAEEGQDYYICKIVEMFEAVDGTLY  233

Query  857   FRVQWFFRAEDTVMRDAAALHDKKRLFYSTLMNDNLLDCIISKVNVTEISPGLGLEVNNS  678
             F  QWF+RA DTVM+    L DKKR+F+S + +DN LDC++ K+ + ++S  + LE    
Sbjct  234   FTAQWFYRARDTVMKKLGHLIDKKRVFFSEIRDDNPLDCLVEKLIIAKVSLNVDLEAKKK  293

Query  677   --PPSGFYYDMEYCVDYSTFRNLPTVQSVNSWDSPSLIDASYKPITAYPVEHFKSCEPS-  507
               P   +Y DM Y + YS+F NLP  ++  S  S ++       +     ++ ++ + S 
Sbjct  294   MIPCCDYYCDMLYLLPYSSFINLPPDKTNCSEASSTISTDDVNSVNEEKSQYEEASQASN  353

Query  506   --KVELSLLDLYAGCGGMSTGLCLGAKLSGLNLVTKWAVDYQKSACDSLKFNHPETQVRN  333
               K +++LLDLY+GCG MSTGLCLGA ++GL L T+WAVD  K  C+SLK+NHPET+VRN
Sbjct  354   NKKSQVTLLDLYSGCGAMSTGLCLGANMAGLKLETRWAVDLNKYGCESLKWNHPETEVRN  413

Query  332   ESVenflkllkeweklckEYG--SEPNAGSDDVLEGMEEGaddansladsddsdAEYEIL  159
             ES E+FL LLKEWE+LC  +      N           E   D +   + D     +E+ 
Sbjct  414   ESAEDFLALLKEWERLCVLFSLLKSENLEKQSFNPFRTEDDGDDDDNEEDDTEGDVFEVE  473

Query  158   RLVDICFGDPNDTGKPGIHFQVRWKGYGPSEDTWEPIDGL  39
             +++ IC+GDP   G+ G+HFQVRWK YG  EDTWEP++G+
Sbjct  474   KILAICYGDPKKKGERGLHFQVRWKNYGLEEDTWEPLEGM  513



>emb|CDX97957.1| BnaA06g07080D [Brassica napus]
Length=788

 Score =   226 bits (576),  Expect = 8e-63, Method: Compositional matrix adjust.
 Identities = 143/333 (43%), Positives = 205/333 (62%), Gaps = 20/333 (6%)
 Frame = -2

Query  989  HYAQAKVLSFILNIGDCVYVKGE-GEKKHVGRILEFFKTTEGEDYFRVQWFFRAEDTVMR  813
            HY+QA V   + N+GD VYVK E G   ++ +I+EFF+  +GE YFR +WF+R EDTV++
Sbjct  57   HYSQALVDGTLFNLGDDVYVKAEDGNPNYIAKIVEFFEAIDGEPYFRARWFYRPEDTVIK  116

Query  812  DAAALHDKKRLFYSTLMNDNLLDCIISKVNVTEISPGL--GLEVNNSPPSGFYYDMEYCV  639
              A+   +KR+F S + +DN L+CI+S+VN+ ++   +  G E    PP  FYYDM+Y +
Sbjct  117  TLASEVQEKRVFLSNVEDDNPLNCIVSRVNIVKVPAKIVSGAEERVIPPCDFYYDMKYEL  176

Query  638  DYSTFRNLPTVQSVNSWDSPSLIDASYKPITAYPVEHFKSCEPSKVELSLLDLYAGCGGM  459
             + TF       S  + D     DAS    +       +   P + E  LLDLY+GCG M
Sbjct  177  AHLTF-------STAADDG----DASSTISSESDSNCIQI--PQQKEKFLLDLYSGCGAM  223

Query  458  STGLCLGAKLSGLNLVTKWAVDYQKSACDSLKFNHPET-QVRNESVenflkllkeweklc  282
            STGLC+GA LSG+ L+ KWAVD    ACDSL+ NHPET QVRNE+ E+FLKLL EW KLC
Sbjct  224  STGLCMGASLSGVKLIKKWAVDINSFACDSLRLNHPETEQVRNEAAEDFLKLLIEWRKLC  283

Query  281  kEYGSEPNAGSDDVLEGMEEGaddansladsddsdAEYEILRLVDICFGDPND-TGKPGI  105
            +++G    + ++ +    +   ++ +   + D    ++E+ + +DICFG+PN       +
Sbjct  284  QKFGL--ISSTEVIESDGDSEDEEEDGDENDDADGDKFEVDKFLDICFGNPNGLKAASEL  341

Query  104  HFQVRWKGYGPSEDTWEPIDGLKSWKNRQGWFT  6
            H +VRWKGYGP EDTWEP DGL+  K++   F 
Sbjct  342  HLKVRWKGYGPDEDTWEPFDGLRKCKDKLKEFV  374



>ref|XP_009148471.1| PREDICTED: putative DNA (cytosine-5)-methyltransferase CMT1 [Brassica 
rapa]
Length=786

 Score =   226 bits (576),  Expect = 9e-63, Method: Compositional matrix adjust.
 Identities = 148/342 (43%), Positives = 209/342 (61%), Gaps = 30/342 (9%)
 Frame = -2

Query  989  HYAQAKVLSFILNIGDCVYVKGE-GEKKHVGRILEFFKTTEGEDYFRVQWFFRAEDTVMR  813
            HY+QA V   + N+GD VYVK E G   ++ +I+EFF+  +GE YFR +WF+R EDTV++
Sbjct  57   HYSQALVDGTLFNLGDDVYVKAEDGNPNYIAKIVEFFEAIDGEPYFRARWFYRPEDTVIK  116

Query  812  DAAALHDKKRLFYSTLMNDNLLDCIISKVNVTEISPGL--GLEVNNSPPSGFYYDMEYCV  639
              A+   +KR+F S + +DN L+CI+S+VN+ ++   +  G E    PP  FYYDM+Y +
Sbjct  117  TLASEVQEKRVFLSNVEDDNPLNCIVSRVNIVKVPAKIVSGAEERVIPPCDFYYDMKYEL  176

Query  638  DYSTFRNLPTVQSVNSWDSPSLIDASYKPITAYPVEHFKSCEPSKVELSLLDLYAGCGGM  459
             + TF       S  + D     DAS    +       +   P + E  LLDLY+GCG M
Sbjct  177  AHLTF-------STAADDG----DASSTISSESDSNCIQI--PQQKEKFLLDLYSGCGAM  223

Query  458  STGLCLGAKLSGLNLVTKWAVDYQKSACDSLKFNHPETQVRNESVenflkllkeweklck  279
            STGLC+GA LSG+ L+ KWAVD    ACDSL+ NHPET+VRNE+ E+FLKLL EW KLC+
Sbjct  224  STGLCMGASLSGVKLIKKWAVDINSFACDSLRLNHPETEVRNEAAEDFLKLLIEWRKLCQ  283

Query  278  EYGSEPNAGSDDVLEGMEEGaddansladsddsd----------AEYEILRLVDICFGDP  129
            ++G      + +V+E   +  D+     ++DD+D           E+E+ + +DICFG+P
Sbjct  284  KFGL---ISTTEVIESDGDSEDEEEDGDENDDADGDSNGSDIPPEEFEVDKFLDICFGNP  340

Query  128  ND-TGKPGIHFQVRWKGYGPSEDTWEPIDGLKSWKNRQGWFT  6
            N    +   H +VRWKGYGP EDTWEP DGL+  K++   F 
Sbjct  341  NGLKAESAFHLKVRWKGYGPDEDTWEPFDGLRKCKDKLKEFV  382



>ref|XP_010236739.1| PREDICTED: DNA (cytosine-5)-methyltransferase 1-like [Brachypodium 
distachyon]
Length=897

 Score =   226 bits (577),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 156/340 (46%), Positives = 198/340 (58%), Gaps = 39/340 (11%)
 Frame = -2

Query  1025  DEEDEVILNVDCHYAQAKVLSFILNIGDCVYVKG-EGEKKHVGRILEFFKTTEGEDYFRV  849
             DEE E  L   CHY  A V   +  +GD VYVK  E E  ++GRI EFF+ T+   YF  
Sbjct  157   DEEPE--LKARCHYRSANVDGTVYALGDDVYVKAAENEADYIGRITEFFEGTDRHCYFAC  214

Query  848   QWFFRAEDTVMRDAAAL----HDKKRLFYSTLMNDNLLDCIISKVNVTEISPGLGLE---  690
             +WFFR EDTV+  A  +    HD KR+F S   NDN+LDCII KV +  + P +  E   
Sbjct  215   RWFFRPEDTVISTAKFVDDHTHDPKRVFLSEETNDNVLDCIIKKVKIIHVDPNMDPEGKA  274

Query  689   --VNNSPPSGFYYDMEYCVDYSTFRNLPTVQSVNS-WDSPSLIDASYKPITAYPVEHFKS  519
               V +S  +  YYDM Y V YSTF N+P+  + NS   S + ++A   P+          
Sbjct  275   QLVADSE-AELYYDMSYAVAYSTFANIPSDTNENSGISSDADLEAGTPPVRT--------  325

Query  518   CEPSKVELSLLDLYAGCGGMSTGLCLGAKLSGLNLVTKWAVDYQKSACDSLKFNHPETQV  339
                     +LLDLY+GCGGMSTGLCLGA L+GL L T+WAVD    AC SLK+NHP T+V
Sbjct  326   -------AALLDLYSGCGGMSTGLCLGAALAGLKLETRWAVDLNSFACKSLKYNHPGTEV  378

Query  338   RNESVenflkllkeweklckEYGSEPNAGSDDVLEGMEEGaddansladsddsdAEYEIL  159
             RNE  E FL LLKEW  LC  Y    N+ SD  +E  EE         D   +  E+ + 
Sbjct  379   RNEKAEEFLALLKEWAILCDTYVHVNNSESDSPIEDEEE--------DDEPLAKDEFVVE  430

Query  158   RLVDICFGDPNDTGKPGIHFQVRWKGYGPSEDTWEPIDGL  39
             +L++IC+G  +  GK GI+F+V+WKGYGP EDTWEPI  L
Sbjct  431   KLLEICYGG-SGRGK-GIYFKVQWKGYGPEEDTWEPIGNL  468



>gb|KEH28933.1| DNA (cytosine-5)-methyltransferase CMT1 [Medicago truncatula]
Length=843

 Score =   226 bits (575),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 150/358 (42%), Positives = 208/358 (58%), Gaps = 30/358 (8%)
 Frame = -2

Query  1016  DEVILNVDCHYAQAKVLSFILNIGDCVYVKGE-GEKKHVGRILEFFKTTEGEDYFRVQWF  840
             D+  +    HY +  V   I  + D  YVKGE G++ ++  I+E F T E E YF  QWF
Sbjct  88    DDDTVKAKFHYREVNVDGVIYKLNDNAYVKGEEGKENYIAAIVELFVTHENEYYFTAQWF  147

Query  839   FRAEDTVMRDAAALHDKKRLFYSTLMNDNLLDCIISKVNVTEISPGLGLEVNNSPPSGFY  660
             +RAEDTV+++   L D+KR+F S + ++N LDC++ KVN+ +ISP    E  N PP   Y
Sbjct  148   YRAEDTVIKNHGDLIDEKRIFKSDVKDENPLDCLVKKVNIVQISPDDAKE-KNVPPCDLY  206

Query  659   YDMEYCVDYSTFRNLPTVQSVNSWDSPSLIDASYKPITAYPV------------------  534
             YDM+Y + Y TF ++         + PS I++    I +                     
Sbjct  207   YDMKYTLPYLTFSSID--------NEPSKIESETDKIESETSTISSESGSNACATDNNVA  258

Query  533   -EHFKSCEPSKVELSLLDLYAGCGGMSTGLCLGAKLSGLNLVTKWAVDYQKSACDSLKFN  357
              E     + S  E +LLDLY+GCG MSTGLC GA ++ + LVT+WAVD  + AC+SLK N
Sbjct  259   EEGLSKIKESDREWTLLDLYSGCGAMSTGLCFGASIADIKLVTRWAVDTNEYACESLKLN  318

Query  356   HPETQVRNESVenflkllkeweklckEYGSEPNAGSDDVLEGMEEGaddansladsddsd  177
             HPETQVRNE+ E+FL LLKEW KLC+++        D  L   EE  ++A+  A    SD
Sbjct  319   HPETQVRNETTEDFLSLLKEWFKLCEKFVLNGTENIDSELNAGEEAGEEADDEAMDSSSD  378

Query  176   AE-YEILRLVDICFGDPNDTGKPGIHFQVRWKGYGPSEDTWEPIDGLKSWKNRQGWFT  6
             +E +E+ RLV +C+GDPN+  K G++F+V+WKGY  S DTWEPI+GL   K     F 
Sbjct  379   SEVFEVERLVSVCYGDPNEDEKAGLYFKVQWKGYDTSYDTWEPIEGLSDCKEAMKEFV  436



>pdb|4FSX|A Chain A, Crystal Structure Of Se-Substituted Zea Mays Zmet2 In 
Complex With Sah
 pdb|4FSX|B Chain B, Crystal Structure Of Se-Substituted Zea Mays Zmet2 In 
Complex With Sah
Length=784

 Score =   225 bits (573),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 151/353 (43%), Positives = 196/353 (56%), Gaps = 47/353 (13%)
 Frame = -2

Query  1043  TCFCSADEEDEVILNVDCHYAQAKVLSFILNIGDCVYVK-GEGEKKHVGRILEFFKTTEG  867
             T     DEE+E  L   CHY  AKV + +  +GD VYVK GE E  ++GRI EFF+ T+ 
Sbjct  31    TAAKKPDEEEE--LKARCHYRSAKVDNVVYCLGDDVYVKAGENEADYIGRITEFFEGTDQ  88

Query  866   EDYFRVQWFFRAEDTVMRDAAAL------HDKKRLFYSTLMNDNLLDCIISKVNVTEISP  705
               YF  +WFFRAEDTV+    ++      HD +R+F S   NDN+LDCIISKV +  + P
Sbjct  89    CHYFTCRWFFRAEDTVINSLVSISVDGHKHDPRRVFLSEEKNDNVLDCIISKVKIVHVDP  148

Query  704   GLGLEVNNS--PPSGFYYDMEYCVDYSTFRNLPTVQSVNSWDSPSLIDASYKPITAYPVE  531
                 +           YYD  Y V YSTF N+ +    +  D+ S I +    +      
Sbjct  149   NXDPKAKAQLIESCDLYYDXSYSVAYSTFANISSENGQSGSDTASGISSDDVDLET----  204

Query  530   HFKSCEPSKVELSLLDLYAGCGGMSTGLCLGAKLSGLNLVTKWAVDYQKSACDSLKFNHP  351
                S  P++   +LLDLY+GCGG STGLCLGA LSGL L T+WAVD+   AC SLK+NHP
Sbjct  205   --SSSXPTRT-ATLLDLYSGCGGXSTGLCLGAALSGLKLETRWAVDFNSFACQSLKYNHP  261

Query  350   ETQVRNESVenflkllkeweklckEY---------GSEPNAGSDDVLEGMEEGaddansl  198
             +T+VRNE  + FL LLKEW  LCK+Y          SE  A  D  L+            
Sbjct  262   QTEVRNEKADEFLALLKEWAVLCKKYVQDVDSNLASSEDQADEDSPLD------------  309

Query  197   adsddsdAEYEILRLVDICFGDPNDTGKPGIHFQVRWKGYGPSEDTWEPIDGL  39
                     E+ + +LV IC+G  +     GI+F+V+W+GYGP EDTWEPID L
Sbjct  310   ------KDEFVVEKLVGICYGGSDREN--GIYFKVQWEGYGPEEDTWEPIDNL  354



>ref|XP_004983483.1| PREDICTED: DNA (cytosine-5)-methyltransferase 3-like [Setaria 
italica]
Length=915

 Score =   226 bits (575),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 147/340 (43%), Positives = 193/340 (57%), Gaps = 33/340 (10%)
 Frame = -2

Query  1022  EEDEVILNVDCHYAQAKVLSFILNIGDCVYVKGE-GEKKHVGRILEFFKTTEGEDYFRVQ  846
             EEDE +    CHY  AKV + +  +GD VYVK E  E  ++GRI EFF+ T+   YF  +
Sbjct  169   EEDEEV-KARCHYRSAKVDNIVYTLGDDVYVKAEENEADYIGRITEFFEGTDRCQYFTCR  227

Query  845   WFFRAEDTVMRDAAAL------HDKKRLFYSTLMNDNLLDCIISKVNVTEISPGLGLEVN  684
             WFFR EDTV+     +      HD +R+F S   NDN+LDCIISKV +  + P +  +  
Sbjct  228   WFFRPEDTVINSLVCIDVDGKKHDPRRVFLSEEKNDNVLDCIISKVKIVHVDPNMDPKAK  287

Query  683   NS--PPSGFYYDMEYCVDYSTFRNLPTVQSVNSWDSPSLI---DASYKPITAYPVEHFKS  519
                      YYDM Y V YSTF N+P+    +  ++ S I   D   +  +  PV     
Sbjct  288   AQLIEHCDLYYDMSYSVAYSTFANIPSENGASGSETASGISSDDMDLETSSGAPVR----  343

Query  518   CEPSKVELSLLDLYAGCGGMSTGLCLGAKLSGLNLVTKWAVDYQKSACDSLKFNHPETQV  339
                     +LLDLY+GCGGMSTGLCLGA L+GL L T+WAVD    AC SLK+NHP+T+V
Sbjct  344   ------TATLLDLYSGCGGMSTGLCLGAALAGLKLETRWAVDLNSYACQSLKYNHPQTEV  397

Query  338   RNESVenflkllkeweklckEYGSEPNAGSDDVLEGMEEGaddansladsddsdAEYEIL  159
             RNE  + FL LLKEW  LC +Y  + + GSD    G E+          S     E+ + 
Sbjct  398   RNEKADEFLALLKEWAVLCDKYVHK-DVGSDSA--GSED-----QEDDGSPLDKDEFVVE  449

Query  158   RLVDICFGDPNDTGKPGIHFQVRWKGYGPSEDTWEPIDGL  39
             +L+ IC+G        G++F+V+W GYGP EDTWEPID L
Sbjct  450   KLIGICYGGSGREN--GLYFKVQWAGYGPEEDTWEPIDNL  487



>ref|XP_006417360.1| hypothetical protein EUTSA_v10006850mg [Eutrema salsugineum]
 gb|ESQ35713.1| hypothetical protein EUTSA_v10006850mg [Eutrema salsugineum]
Length=784

 Score =   224 bits (572),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 148/337 (44%), Positives = 200/337 (59%), Gaps = 23/337 (7%)
 Frame = -2

Query  989  HYAQAKVLSFILNIGDCVYVKGE-GEKKHVGRILEFFKTTEGEDYFRVQWFFRAEDTVMR  813
            HY +A V   + N+GD VYVK E G+  ++ +ILEFF+T +G+ +FR +WF+R EDTV++
Sbjct  59   HYNRAIVDGNLFNLGDNVYVKAEEGKPNYIAKILEFFETIDGKPFFRARWFYRPEDTVIK  118

Query  812  DAAALHDKKRLFYSTLMNDNLLDCIISKVNVTEISPGL--GLEVNNSPPSGFYYDMEYCV  639
              A     KR+F S + +DN L+CIIS + + +I P +    E    P   FYYDM+Y +
Sbjct  119  AHAHELQDKRVFLSNVEDDNPLNCIISSLKIVQIPPKIVSTTEERIIPECDFYYDMDYDL  178

Query  638  DYSTFRNLPTVQSVNSWDSPSLIDASYKPITAYPVEHFKSCE-PSKVELSLLDLYAGCGG  462
            ++ TF               S  D      T        S E P K E  LLDLY+GCG 
Sbjct  179  EHLTFS--------------SAADDCDGSSTISSESDSNSIEIPHKNEKFLLDLYSGCGA  224

Query  461  MSTGLCLGAKLSGLNLVTKWAVDYQKSACDSLKFNHPETQVRNESVenflkllkeweklc  282
            MSTGL +GA LSG+ L+TKWAVD  + ACDSL+ NHPET+VRNE+ E+FL+LLKEW KLC
Sbjct  225  MSTGLSMGASLSGIKLITKWAVDINEFACDSLRLNHPETEVRNEAAEDFLRLLKEWRKLC  284

Query  281  kEYG----SEPNAGSDDVLEGMEEGaddansladsddsdAEYEILRLVDICFGDPNDTGK  114
             ++     +EP     +  E  +E  D       S+    E+E+   +DICFGDPN + +
Sbjct  285  IKFALISSTEPIESDGEEEEDGDENDDADEDSDGSEIPPEEFEVDEFLDICFGDPNGSKE  344

Query  113  P-GIHFQVRWKGYGPSEDTWEPIDGLKSWKNRQGWFT  6
               +H +VRWKGYGP EDTWEP DGLK  K++   F 
Sbjct  345  ASALHLKVRWKGYGPDEDTWEPYDGLKKCKDKLKEFV  381



>emb|CDY19364.1| BnaC05g08730D [Brassica napus]
Length=796

 Score =   224 bits (572),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 149/360 (41%), Positives = 212/360 (59%), Gaps = 30/360 (8%)
 Frame = -2

Query  1043  TCFCSADEEDEVILNVDCHYAQAKVLSFILNIGDCVYVKGE-GEKKHVGRILEFFKTTEG  867
             T     D+ +E +     HY+QA V   + N+GD VYVK E G   ++ +I+EFF+  +G
Sbjct  40    TVGTPKDDGEENLEQAKRHYSQALVDGTLFNLGDDVYVKAEDGNPNYIAKIVEFFEAIDG  99

Query  866   EDYFRVQWFFRAEDTVMRDAAALHDKKRLFYSTLMNDNLLDCIISKVNVTEISPGL--GL  693
             E YF+ +WF+R EDTV++  A    +KR+F S + +DN L+CI+S+V++ ++   +  G 
Sbjct  100   EPYFKARWFYRPEDTVIKTLANEVQEKRVFLSNVEDDNPLNCIVSRVDIVKVPAKIVSGA  159

Query  692   EVNNSPPSGFYYDMEYCVDYSTFRNLPTVQSVNSWDSPSLIDASYKPITAYPVEHFKSCE  513
             E    PP  FYYDM+Y + + TF       S  + D     DAS    +       +   
Sbjct  160   EERVIPPCDFYYDMKYELAHLTF-------STAADDG----DASSTISSESDSNCIQI--  206

Query  512   PSKVELSLLDLYAGCGGMSTGLCLGAKLSGLNLVTKWAVDYQKSACDSLKFNHPETQVRN  333
             P + +  LLDLY+GCG MSTGLC+GA LSG+ L+ KWAVD    ACDSL+ NHPET+VRN
Sbjct  207   PQQKDKFLLDLYSGCGAMSTGLCMGASLSGIKLIKKWAVDINSFACDSLRLNHPETEVRN  266

Query  332   ESVenflkllkeweklckEYGSEPNAGSDDVL----------EGMEEGaddansladsdd  183
             E+ E+FLKLL EW KLC+++G      S +VL          E  +E  D     + S+ 
Sbjct  267   EAAEDFLKLLIEWRKLCQKFGL---ISSTEVLESDGDSEDEEEDGDENDDADGDSSGSEI  323

Query  182   sdAEYEILRLVDICFGDPND-TGKPGIHFQVRWKGYGPSEDTWEPIDGLKSWKNRQGWFT  6
                E+E+ + +DICFG+PN    +  +H +VRWKGYGP EDTWEP DGL+  K++   F 
Sbjct  324   PPEEFEVDKFLDICFGNPNGLKAESALHLKVRWKGYGPDEDTWEPFDGLRKCKDKLKEFV  383



>ref|XP_009781267.1| PREDICTED: DNA (cytosine-5)-methyltransferase CMT3-like isoform 
X4 [Nicotiana sylvestris]
Length=859

 Score =   225 bits (573),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 136/340 (40%), Positives = 196/340 (58%), Gaps = 16/340 (5%)
 Frame = -2

Query  1025  DEEDEVILNVDCHYAQAKVLSFILNIGDCVYVKGEG-EKKHVGRILEFFKTTEGEDYFRV  849
             D+ D++I    CH+AQA V   I N+GD  YV+    E  ++ +I+EFF+  +G  YF  
Sbjct  173   DDADQLI-QAKCHFAQAVVDGQIYNLGDDAYVQASNDEDDYICKIVEFFQAVDGMQYFTA  231

Query  848   QWFFRAEDTVMRDAAALHDKKRLFYSTLMNDNLLDCIISKVNVTEISPGLGLEVNNS--P  675
             QWF+RA+DTV++      + KR+F+S + +DN L C++ K+ +  I   + L +  S   
Sbjct  232   QWFYRAKDTVIKAHDQFINNKRVFFSEIKDDNPLGCLVKKIKIVPIPSNVRLPLKESLRS  291

Query  674   PSGFYYDMEYCVDYSTFRNLPTVQSVNS-WDSPSLIDASYKPITAYPVEHFKSCEPSKVE  498
              S +YYDM Y + YS+F +LP   ++ +   SP     S     +  V+     +  K+E
Sbjct  292   NSDYYYDMMYLLPYSSFVSLPQGTAIFADVSSPISESDSTISSDSDTVD----VKEQKLE  347

Query  497   LSLLDLYAGCGGMSTGLCLGAKLSGLNLVTKWAVDYQKSACDSLKFNHPETQVRNES---  327
              +LLDLY+GCG MSTGLCLGA + G+ LVTKWAVD  + ACDSLK+NHPET VRNES   
Sbjct  348   KNLLDLYSGCGAMSTGLCLGADIGGVKLVTKWAVDLNQYACDSLKWNHPETAVRNESADD  407

Query  326   -VenflkllkeweklckEYGSEPNAGSDDVLEGMEEGaddansladsddsdAEYEIL---  159
              +    +  +          + P      V +  EE  +D     +    D + EI    
Sbjct  408   FLLLLREWRQLCASCSLLRNNTPTHPFLKVRDEDEEDNNDNGDEDEGSGDDEQGEIFEVE  467

Query  158   RLVDICFGDPNDTGKPGIHFQVRWKGYGPSEDTWEPIDGL  39
              L++IC+GDP +  KPG++F+VRWKGYG  EDTWEPI+GL
Sbjct  468   ELLEICYGDPKEINKPGLYFKVRWKGYGQEEDTWEPIEGL  507



>ref|XP_006662134.1| PREDICTED: DNA (cytosine-5)-methyltransferase 1-like [Oryza brachyantha]
Length=827

 Score =   224 bits (572),  Expect = 4e-62, Method: Compositional matrix adjust.
 Identities = 153/350 (44%), Positives = 198/350 (57%), Gaps = 40/350 (11%)
 Frame = -2

Query  1025  DEEDEVILNVDCHYAQAKVLSFILNIGDCVYVKGEGEKK-HVGRILEFFKTTEGEDYFRV  849
             DEE+E  L   CHY  AKV   +  + D VYVK E +K  ++GRI EFF+ T+   YF  
Sbjct  72    DEEEE--LKARCHYRSAKVDGIVYCLHDDVYVKAEEDKADYIGRITEFFEGTDHCRYFTC  129

Query  848   QWFFRAEDTVMRDAAAL------HDKKRLFYSTLMNDNLLDCIISKVNVTEISPGLGLEV  687
              WFFRAEDTV+            HD KR+F S   NDN+LDCIISKV +  I P +  E 
Sbjct  130   CWFFRAEDTVISSMMMENVHDHNHDLKRVFLSEEKNDNVLDCIISKVKIVHIDPNMDHEA  189

Query  686   NNSPPSG--FYYDMEYCVDYSTFRNLPTVQSVNSWDSPSLIDASYKPITAYPVEHFKSCE  513
              +   +    YYDM Y V YSTF N+P     +  D+ S I +     +   V       
Sbjct  190   KSQRVADCDLYYDMSYTVAYSTFANIPPENGASGSDTASGISSDDMDSSRGKVASDSEAS  249

Query  512   PSKVELSLLDLYAGCGGMSTGLCLGAKLSGLNLVTKWAVDYQKSACDSLKFNHPETQVRN  333
              S  + +LLDLY+GCGGMSTGLCLGA L+GLNL T+WAVD+   AC+SLK+NHP+T+ RN
Sbjct  250   SSMGKATLLDLYSGCGGMSTGLCLGAALAGLNLETRWAVDFNSFACESLKYNHPKTEARN  309

Query  332   ESVenflkllkeweklckEY----------GSEPNAGSDDVLEGMEEGaddansladsdd  183
             E  + FL LLKEW KLC E+          GS  N   DD  E +E+             
Sbjct  310   EKADEFLALLKEWAKLCDEHVKNNICSDPAGSSENEDDDD--EPLEK-------------  354

Query  182   sdAEYEILRLVDICFGDPNDTGKPGIHFQVRWKGYGPSEDTWEPIDGLKS  33
                E+ + +L  IC+G  +   + GI+F+V+WKGYG  EDTWEPI+ L +
Sbjct  355   --DEFVVEKLSGICYGGSDR--EDGIYFKVQWKGYGREEDTWEPIENLSA  400



>emb|CAQ18903.1| chromomethylase [Nicotiana sylvestris]
 emb|CAQ18904.1| chromomethylase [Nicotiana sylvestris]
 emb|CAQ18905.1| chromomethylase [Nicotiana sylvestris]
 emb|CAQ18906.1| chromomethylase [Nicotiana sylvestris]
Length=741

 Score =   223 bits (569),  Expect = 5e-62, Method: Compositional matrix adjust.
 Identities = 138/339 (41%), Positives = 196/339 (58%), Gaps = 20/339 (6%)
 Frame = -2

Query  1025  DEEDEVILNVDCHYAQAKVLSFILNIGDCVYVKGEG-EKKHVGRILEFFKTTEGEDYFRV  849
             D+ D++I    CH+AQA V   I N+GD  YV+    E  ++ +I+EFF+  +G  YF  
Sbjct  7     DDADQLI-QAKCHFAQAVVDGQIYNLGDDAYVQASNDEDDYICKIVEFFQAVDGMQYFTA  65

Query  848   QWFFRAEDTVMRDAAALHDKKRLFYSTLMNDNLLDCIISKVNVTEISPGLGLEVNNS--P  675
             QWF+RA+DTV++      + KR+F+S + +DN L C++ K+ +  I   + L +  S   
Sbjct  66    QWFYRAKDTVIKAHDQFINNKRVFFSEIKDDNPLGCLVKKIKIVPIPSNVRLPLKESLRS  125

Query  674   PSGFYYDMEYCVDYSTFRNLPTVQSVNSWDSPSLIDASYKPITAYPVEHFKSCEPSKVEL  495
              S +YYDM Y + YS+F +LP  Q V+S   P     S     +  V+     +  K+E 
Sbjct  126   NSDYYYDMMYLLPYSSFVSLP--QDVSS---PISESDSTISSDSDTVD----VKEQKLEK  176

Query  494   SLLDLYAGCGGMSTGLCLGAKLSGLNLVTKWAVDYQKSACDSLKFNHPETQVRNES----  327
             +LLDLY+GCG MSTGLCLGA + G+ LVTKWAVD  + ACDSLK+NHPET VRNES    
Sbjct  177   NLLDLYSGCGAMSTGLCLGADIGGVKLVTKWAVDLNQYACDSLKWNHPETAVRNESADDF  236

Query  326   VenflkllkeweklckEYGSEPNAGSDDVLEGMEEGaddansladsddsdAEYEIL---R  156
             +    +  +          + P      V +  EE  +D     +    D + EI     
Sbjct  237   LLLLREWRQLCASCSLLRNNTPTHPFLKVRDEDEEDNNDNGDEDEGSGDDEQGEIFEVEE  296

Query  155   LVDICFGDPNDTGKPGIHFQVRWKGYGPSEDTWEPIDGL  39
             L++IC+GDP +  KPG++F+VRWKGYG  EDTWEPI+GL
Sbjct  297   LLEICYGDPKEINKPGLYFKVRWKGYGQEEDTWEPIEGL  335



>ref|XP_009781264.1| PREDICTED: DNA (cytosine-5)-methyltransferase CMT3-like isoform 
X1 [Nicotiana sylvestris]
Length=913

 Score =   225 bits (573),  Expect = 5e-62, Method: Compositional matrix adjust.
 Identities = 136/340 (40%), Positives = 196/340 (58%), Gaps = 16/340 (5%)
 Frame = -2

Query  1025  DEEDEVILNVDCHYAQAKVLSFILNIGDCVYVKGEG-EKKHVGRILEFFKTTEGEDYFRV  849
             D+ D++I    CH+AQA V   I N+GD  YV+    E  ++ +I+EFF+  +G  YF  
Sbjct  173   DDADQLI-QAKCHFAQAVVDGQIYNLGDDAYVQASNDEDDYICKIVEFFQAVDGMQYFTA  231

Query  848   QWFFRAEDTVMRDAAALHDKKRLFYSTLMNDNLLDCIISKVNVTEISPGLGLEVNNS--P  675
             QWF+RA+DTV++      + KR+F+S + +DN L C++ K+ +  I   + L +  S   
Sbjct  232   QWFYRAKDTVIKAHDQFINNKRVFFSEIKDDNPLGCLVKKIKIVPIPSNVRLPLKESLRS  291

Query  674   PSGFYYDMEYCVDYSTFRNLPTVQSVNS-WDSPSLIDASYKPITAYPVEHFKSCEPSKVE  498
              S +YYDM Y + YS+F +LP   ++ +   SP     S     +  V+     +  K+E
Sbjct  292   NSDYYYDMMYLLPYSSFVSLPQGTAIFADVSSPISESDSTISSDSDTVD----VKEQKLE  347

Query  497   LSLLDLYAGCGGMSTGLCLGAKLSGLNLVTKWAVDYQKSACDSLKFNHPETQVRNES---  327
              +LLDLY+GCG MSTGLCLGA + G+ LVTKWAVD  + ACDSLK+NHPET VRNES   
Sbjct  348   KNLLDLYSGCGAMSTGLCLGADIGGVKLVTKWAVDLNQYACDSLKWNHPETAVRNESADD  407

Query  326   -VenflkllkeweklckEYGSEPNAGSDDVLEGMEEGaddansladsddsdAEYEIL---  159
              +    +  +          + P      V +  EE  +D     +    D + EI    
Sbjct  408   FLLLLREWRQLCASCSLLRNNTPTHPFLKVRDEDEEDNNDNGDEDEGSGDDEQGEIFEVE  467

Query  158   RLVDICFGDPNDTGKPGIHFQVRWKGYGPSEDTWEPIDGL  39
              L++IC+GDP +  KPG++F+VRWKGYG  EDTWEPI+GL
Sbjct  468   ELLEICYGDPKEINKPGLYFKVRWKGYGQEEDTWEPIEGL  507



>ref|XP_009781265.1| PREDICTED: DNA (cytosine-5)-methyltransferase CMT3-like isoform 
X2 [Nicotiana sylvestris]
Length=907

 Score =   224 bits (571),  Expect = 8e-62, Method: Compositional matrix adjust.
 Identities = 138/339 (41%), Positives = 196/339 (58%), Gaps = 20/339 (6%)
 Frame = -2

Query  1025  DEEDEVILNVDCHYAQAKVLSFILNIGDCVYVKGEG-EKKHVGRILEFFKTTEGEDYFRV  849
             D+ D++I    CH+AQA V   I N+GD  YV+    E  ++ +I+EFF+  +G  YF  
Sbjct  173   DDADQLI-QAKCHFAQAVVDGQIYNLGDDAYVQASNDEDDYICKIVEFFQAVDGMQYFTA  231

Query  848   QWFFRAEDTVMRDAAALHDKKRLFYSTLMNDNLLDCIISKVNVTEISPGLGLEVNNS--P  675
             QWF+RA+DTV++      + KR+F+S + +DN L C++ K+ +  I   + L +  S   
Sbjct  232   QWFYRAKDTVIKAHDQFINNKRVFFSEIKDDNPLGCLVKKIKIVPIPSNVRLPLKESLRS  291

Query  674   PSGFYYDMEYCVDYSTFRNLPTVQSVNSWDSPSLIDASYKPITAYPVEHFKSCEPSKVEL  495
              S +YYDM Y + YS+F +LP  Q V+S   P     S     +  V+     +  K+E 
Sbjct  292   NSDYYYDMMYLLPYSSFVSLP--QDVSS---PISESDSTISSDSDTVD----VKEQKLEK  342

Query  494   SLLDLYAGCGGMSTGLCLGAKLSGLNLVTKWAVDYQKSACDSLKFNHPETQVRNES----  327
             +LLDLY+GCG MSTGLCLGA + G+ LVTKWAVD  + ACDSLK+NHPET VRNES    
Sbjct  343   NLLDLYSGCGAMSTGLCLGADIGGVKLVTKWAVDLNQYACDSLKWNHPETAVRNESADDF  402

Query  326   VenflkllkeweklckEYGSEPNAGSDDVLEGMEEGaddansladsddsdAEYEIL---R  156
             +    +  +          + P      V +  EE  +D     +    D + EI     
Sbjct  403   LLLLREWRQLCASCSLLRNNTPTHPFLKVRDEDEEDNNDNGDEDEGSGDDEQGEIFEVEE  462

Query  155   LVDICFGDPNDTGKPGIHFQVRWKGYGPSEDTWEPIDGL  39
             L++IC+GDP +  KPG++F+VRWKGYG  EDTWEPI+GL
Sbjct  463   LLEICYGDPKEINKPGLYFKVRWKGYGQEEDTWEPIEGL  501



>ref|XP_006572936.1| PREDICTED: DNA (cytosine-5)-methyltransferase CMT3-like [Glycine 
max]
Length=875

 Score =   223 bits (569),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 140/358 (39%), Positives = 206/358 (58%), Gaps = 18/358 (5%)
 Frame = -2

Query  1025  DEEDEVILNVDCHYAQAKVLSFIL-NIGDCVYVKGE-GEKKHVGRILEFFKTTEGEDYFR  852
             ++EDE I     HY QA+V   +L  + D  +VK E GE  ++ +I+E F+  +G  YF 
Sbjct  110   NDEDEEIQQARRHYTQAEVDGCMLYKLYDDAHVKAEEGEDNYICKIVEIFEAIDGALYFT  169

Query  851   VQWFFRAEDTVMRDAAALHDKKRLFYSTLMNDNLLDCIISKVNVTEISPGLGLEVNNS--  678
              QW++RA+DTV++  A L + KR+F+S + +DN LDC++ K+N+  I+  + LE      
Sbjct  170   AQWYYRAKDTVIKKLAYLIEPKRVFFSEVQDDNPLDCLVEKLNIARITLNVDLEAKKETI  229

Query  677   PPSGFYYDMEYCVDYSTFRNLPTVQSVNSWDSPSLIDASYKPITAY-----PVEHFKSCE  513
             PP  +Y D +Y + YSTF NLP+    +  ++ S I +    I  Y     P E F   E
Sbjct  230   PPCDYYCDTQYLLPYSTFVNLPSENGESGSETSSTISSETNGIGKYEVNSQPKEAFLPEE  289

Query  512   PSKVELSLLDLYAGCGGMSTGLCLGAKLSGLNLVTKWAVDYQKSACDSLKFNHPETQVRN  333
                 E+ LLDLY GCG MSTGLCLG  LSG+NLVT+WAVD  + AC+ LK NHPET+VRN
Sbjct  290   SKDPEMKLLDLYCGCGAMSTGLCLGGNLSGVNLVTRWAVDLNQHACECLKLNHPETEVRN  349

Query  332   ESVenflkllk---------eweklckEYGSEPNAGSDDVLEGMEEGaddansladsdds  180
             ES ENFL LLK            +    +    N  S+D  +       ++    + ++ 
Sbjct  350   ESAENFLSLLKEWQELCSYFSLVEKKVSHEKYVNLFSEDDDDTSSNEEVNSEDDNELNED  409

Query  179   dAEYEILRLVDICFGDPNDTGKPGIHFQVRWKGYGPSEDTWEPIDGLKSWKNRQGWFT  6
             D  +E+  ++ +C+GDPN   + G++F+V WKGY  + D+WEPI+GL + K +   F 
Sbjct  410   DEIFEVSEILAVCYGDPNKKKEQGLYFKVHWKGYESALDSWEPIEGLSNCKEKIKEFV  467



>gb|KHN41840.1| DNA (cytosine-5)-methyltransferase 1 [Glycine soja]
Length=823

 Score =   223 bits (568),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 146/346 (42%), Positives = 200/346 (58%), Gaps = 23/346 (7%)
 Frame = -2

Query  1028  ADEEDEVILNVDCHYAQAKVLSFILNIGDCVYVKGE-GEKKHVGRILEFFKTTEGEDYFR  852
             A  E+  ++   CHY QAKV   + N+ D  YVK E G+  ++ RI+E F+T + E  F 
Sbjct  72    ATSENSEVMPARCHYRQAKVDGVVYNLYDDAYVKAEDGKPDYIARIVEMFETVDKEQCFT  131

Query  851   VQWFFRAEDTVMRDAAALHDKKRLFYSTLMNDNLLDCIISKVNVTEISPGLGLEVNNS--  678
              QWF+RAEDTV+++   L DKKR+F S + + N LDCI+SKV + + SP + L       
Sbjct  132   AQWFYRAEDTVIKNHGDLVDKKRIFISDVKDVNPLDCIVSKVKIYKKSPSVDLTSKKGKL  191

Query  677   PPSGFYYDMEYCVDYSTFRNLPTVQSVNSWDSPSLIDASYKP---ITAYPVEHFKSCE--  513
             P   +YYDM+Y V Y TF N+         D+ S I +       ++   + + K+ +  
Sbjct  192   PSCDYYYDMKYTVPYLTFSNIVNETVKTESDASSTISSESGSNGCVSNANLANGKTTQNN  251

Query  512   -PSKVELSLLDLYAGCGGMSTGLCLGAKLSGLNLVTKWAVDYQKSACDSLKFNHPETQVR  336
                  E +LLDLY+GCG MSTGLC GA L+G+ LVT+WAVD    AC+SLK NHPETQVR
Sbjct  252   SSGSSEWTLLDLYSGCGAMSTGLCFGASLAGIKLVTRWAVDINAHACESLKLNHPETQVR  311

Query  335   NESVenflkllkeweklckEY---GSEPNAGSDDVLEGMEEGaddansladsddsdAEYE  165
             NE  E+FL L+K W KLC+E+   GSE      D+ E  +E        + +     E+E
Sbjct  312   NEPAEDFLNLIKSWAKLCEEFALLGSERLDSDPDMDE--DENEAVRKEESGNQSDSEEFE  369

Query  164   ILRLVDICFGDPNDTGKPGIHFQVRWKGYGPSEDTWEPIDGLKSWK  27
             + +L+ +C+GDPND         VRW GY  S DTWEPI+GL   K
Sbjct  370   VEKLLAVCYGDPND---------VRWLGYASSYDTWEPIEGLSDCK  406



>tpg|DAA36033.1| TPA: hypothetical protein ZEAMMB73_314017 [Zea mays]
Length=849

 Score =   223 bits (568),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 149/348 (43%), Positives = 199/348 (57%), Gaps = 37/348 (11%)
 Frame = -2

Query  1043  TCFCSADEEDEVILNVDCHYAQAKVLSFILNIGDCVYVK-GEGEKKHVGRILEFFKTTEG  867
             T     +E+DE  L   CHY  AKV + +  +GD VYVK GE E  ++GRI EFF+ T+ 
Sbjct  163   TAANKPEEDDE--LKARCHYRSAKVDNIVYCLGDDVYVKAGENEADYIGRITEFFEGTDR  220

Query  866   EDYFRVQWFFRAEDTVMRDAAAL------HDKKRLFYSTLMNDNLLDCIISKVNVTEISP  705
               YF  +WFFRAEDTV+    ++      HD +R+F S   NDN+LDCIISKV +  + P
Sbjct  221   CHYFTCRWFFRAEDTVINSLVSINVDGHKHDPRRVFLSEEKNDNVLDCIISKVKIVHVDP  280

Query  704   GLGLEVNNS--PPSGFYYDMEYCVDYSTFRNLPTVQSVNSWDSPSLI---DASYKPITAY  540
              +  +           YYDM Y V YSTF N+ +    +  ++ S I   DA  +  +  
Sbjct  281   NMDPKAKAQLIEHCDLYYDMSYSVAYSTFANISSENGQSGSETASGISSDDAGLETSSNM  340

Query  539   PVEHFKSCEPSKVELSLLDLYAGCGGMSTGLCLGAKLSGLNLVTKWAVDYQKSACDSLKF  360
             P          +   +LLDLY+GCGGMSTGLCLGA LSGL L T+WAVD    AC SLK+
Sbjct  341   P----------ERTATLLDLYSGCGGMSTGLCLGAALSGLKLETRWAVDLNSFACQSLKY  390

Query  359   NHPETQVRNESVenflkllkeweklckEYGSEPNAGSDDVLEGMEEGaddansladsdds  180
             NHP+T+VRNE  + FL LLKEW  LC++Y  +     D  L G E+              
Sbjct  391   NHPQTEVRNEKADEFLALLKEWAVLCEKYVHQ---DVDSNLAGSED------QEDADTLD  441

Query  179   dAEYEILRLVDICFGDPNDTG-KPGIHFQVRWKGYGPSEDTWEPIDGL  39
               E+ + +L+ I +   + TG K G++F+V+W+GYGP EDTWEPID L
Sbjct  442   KDEFVVQKLIGIRY---DGTGRKKGVYFKVQWEGYGPEEDTWEPIDNL  486



>ref|XP_009590684.1| PREDICTED: DNA (cytosine-5)-methyltransferase CMT3-like [Nicotiana 
tomentosiformis]
Length=903

 Score =   223 bits (568),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 136/330 (41%), Positives = 189/330 (57%), Gaps = 18/330 (5%)
 Frame = -2

Query  1004  LNVDCHYAQAKVLSFILNIGDCVYVKG-EGEKKHVGRILEFFKTTEGEDYFRVQWFFRAE  828
             L   CH+ QA V   I  + D  +VK  +GE+ ++ +I+EFF+  +G  YF  QWF+RA+
Sbjct  181   LQAKCHFTQASVDGQIYCLEDDAHVKAADGEEDYICKIVEFFEAVDGMQYFTAQWFYRAK  240

Query  827   DTVMRDAAALHDKKRLFYSTLMNDNLLDCIISKVNVTEISPGLGLEVNNSPPSG--FYYD  654
             DTV++      DKKR+F S +M+DN +DC++ K+ +  +     L+   +  S   FYYD
Sbjct  241   DTVIKSHDQFIDKKRVFLSEIMDDNPIDCLVIKLKIVPVPSNATLQFKENAKSNCDFYYD  300

Query  653   MEYCVDYSTFRNLPTVQSVNSWDSPSLIDASYKPITAYPVEHFKSCEPSKVELSLLDLYA  474
             M Y + YS+F    ++   +S    S    S         EH        +E  LLDLY+
Sbjct  301   MMYLLPYSSFL---SLPPDSSSPVSSSSTISSDTDAGEVKEH-------NLEKKLLDLYS  350

Query  473   GCGGMSTGLCLGAKLSGLNLVTKWAVDYQKSACDSLKFNHPETQVRNESVenflkl----  306
             GCG MSTGLCLGA  +G+ LVTKWAVD    ACDSL+ NHPETQVRNE   +FL L    
Sbjct  351   GCGAMSTGLCLGANSNGVKLVTKWAVDLNSFACDSLRLNHPETQVRNEYASDFLSLLKEW  410

Query  305   lkeweklckEYGSEPNAGSDDVLEGMEEGaddansladsddsdAE-YEILRLVDICFGDP  129
             ++          S P      V++ +EE  +   S    DD   E +E+  L+++C+GDP
Sbjct  411   MQLCSSCSLVKSSVPPHPHLKVIDEVEEDENADESEDSGDDKRGENFEVEELLEVCYGDP  470

Query  128   NDTGKPGIHFQVRWKGYGPSEDTWEPIDGL  39
             N   KPG++F+V W+GYGP EDTWEPIDGL
Sbjct  471   NAVKKPGLYFKVHWQGYGPEEDTWEPIDGL  500



>sp|Q8LPU5.1|CMT3_MAIZE RecName: Full=DNA (cytosine-5)-methyltransferase 3; AltName: 
Full=Chromomethylase 3; AltName: Full=DNA methyltransferase 
105 [Zea mays]
 gb|AAM28227.1| DNA methyltransferase 105 [Zea mays]
 tpg|DAA36032.1| TPA: DNA (cytosine-5)-methyltransferase 2 [Zea mays]
Length=915

 Score =   223 bits (568),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 149/348 (43%), Positives = 199/348 (57%), Gaps = 37/348 (11%)
 Frame = -2

Query  1043  TCFCSADEEDEVILNVDCHYAQAKVLSFILNIGDCVYVK-GEGEKKHVGRILEFFKTTEG  867
             T     +E+DE  L   CHY  AKV + +  +GD VYVK GE E  ++GRI EFF+ T+ 
Sbjct  163   TAANKPEEDDE--LKARCHYRSAKVDNIVYCLGDDVYVKAGENEADYIGRITEFFEGTDR  220

Query  866   EDYFRVQWFFRAEDTVMRDAAAL------HDKKRLFYSTLMNDNLLDCIISKVNVTEISP  705
               YF  +WFFRAEDTV+    ++      HD +R+F S   NDN+LDCIISKV +  + P
Sbjct  221   CHYFTCRWFFRAEDTVINSLVSINVDGHKHDPRRVFLSEEKNDNVLDCIISKVKIVHVDP  280

Query  704   GLGLEVNNS--PPSGFYYDMEYCVDYSTFRNLPTVQSVNSWDSPSLI---DASYKPITAY  540
              +  +           YYDM Y V YSTF N+ +    +  ++ S I   DA  +  +  
Sbjct  281   NMDPKAKAQLIEHCDLYYDMSYSVAYSTFANISSENGQSGSETASGISSDDAGLETSSNM  340

Query  539   PVEHFKSCEPSKVELSLLDLYAGCGGMSTGLCLGAKLSGLNLVTKWAVDYQKSACDSLKF  360
             P          +   +LLDLY+GCGGMSTGLCLGA LSGL L T+WAVD    AC SLK+
Sbjct  341   P----------ERTATLLDLYSGCGGMSTGLCLGAALSGLKLETRWAVDLNSFACQSLKY  390

Query  359   NHPETQVRNESVenflkllkeweklckEYGSEPNAGSDDVLEGMEEGaddansladsdds  180
             NHP+T+VRNE  + FL LLKEW  LC++Y  +     D  L G E+              
Sbjct  391   NHPQTEVRNEKADEFLALLKEWAVLCEKYVHQ---DVDSNLAGSED------QEDADTLD  441

Query  179   dAEYEILRLVDICFGDPNDTG-KPGIHFQVRWKGYGPSEDTWEPIDGL  39
               E+ + +L+ I +   + TG K G++F+V+W+GYGP EDTWEPID L
Sbjct  442   KDEFVVQKLIGIRY---DGTGRKKGVYFKVQWEGYGPEEDTWEPIDNL  486



>dbj|BAC53936.1| chromomethylase-like protein [Nicotiana tabacum]
Length=741

 Score =   222 bits (565),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 135/339 (40%), Positives = 195/339 (58%), Gaps = 20/339 (6%)
 Frame = -2

Query  1025  DEEDEVILNVDCHYAQAKVLSFILNIGDCVYVKGEG-EKKHVGRILEFFKTTEGEDYFRV  849
             D+ D++I    CH+ QA V   I N+GD  YV+    E  ++ +I+EFF+  +G  YF  
Sbjct  7     DDGDQLI-QAKCHFTQAVVDGQIYNLGDDAYVQASSDEDDYICKIVEFFQAVDGMQYFTA  65

Query  848   QWFFRAEDTVMRDAAALHDKKRLFYSTLMNDNLLDCIISKVNVTEISPGLGLEVNNS--P  675
             QWF+RA+DTV++      D KR+F+S + +DN L C++ K+ +  I   +   +  S   
Sbjct  66    QWFYRAKDTVIKAHDQFIDNKRVFFSEIKDDNPLGCLVKKIKIVAIPSNVRPPLKESLRS  125

Query  674   PSGFYYDMEYCVDYSTFRNLPTVQSVNSWDSPSLIDASYKPITAYPVEHFKSCEPSKVEL  495
              S +YYDM Y + YS+F +LP  Q V+S   P     S     +  V+     +  K+E 
Sbjct  126   NSDYYYDMMYLLPYSSFVSLP--QDVSS---PISESDSTISSDSDTVD----VKEQKLEK  176

Query  494   SLLDLYAGCGGMSTGLCLGAKLSGLNLVTKWAVDYQKSACDSLKFNHPETQVRNES----  327
             +LLDLY+GCG MSTGLCLGA + G+ LVTKWAVD  + ACDSLK+NHPET VRNES    
Sbjct  177   NLLDLYSGCGAMSTGLCLGADIGGVKLVTKWAVDLNQYACDSLKWNHPETAVRNESADDF  236

Query  326   VenflkllkeweklckEYGSEPNAGSDDVLEGMEEGaddansladsddsdAEYEIL---R  156
             +    +  +          + P      V +  ++  +D     +    D + EI    +
Sbjct  237   LLLLREWRQLCASCSLLRNNTPTHSFLKVRDEDDKDDNDNEDEDEGSGDDEQGEIFEVEQ  296

Query  155   LVDICFGDPNDTGKPGIHFQVRWKGYGPSEDTWEPIDGL  39
             L++IC+GDP +  KPG++F+VRWKGYG  EDTWEPI+GL
Sbjct  297   LLEICYGDPKEKNKPGLYFKVRWKGYGQEEDTWEPIEGL  335



>ref|XP_009625627.1| PREDICTED: DNA (cytosine-5)-methyltransferase CMT3-like isoform 
X1 [Nicotiana tomentosiformis]
Length=856

 Score =   223 bits (567),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 135/339 (40%), Positives = 195/339 (58%), Gaps = 20/339 (6%)
 Frame = -2

Query  1025  DEEDEVILNVDCHYAQAKVLSFILNIGDCVYVKGEG-EKKHVGRILEFFKTTEGEDYFRV  849
             D+ D++I    CH+ QA V   I N+GD  YV+    E  ++ +I+EFF+  +G  YF  
Sbjct  122   DDGDQLI-QAKCHFTQAVVDGQIYNLGDDAYVQASSDEDDYICKIVEFFQAVDGMQYFTA  180

Query  848   QWFFRAEDTVMRDAAALHDKKRLFYSTLMNDNLLDCIISKVNVTEISPGLGLEVNNS--P  675
             QWF+RA+DTV++      D KR+F+S + +DN L C++ K+ +  I   +   +  S   
Sbjct  181   QWFYRAKDTVIKAHDQFIDNKRVFFSEIKDDNPLGCLVKKIKIVAIPSNVRPPLKESLRS  240

Query  674   PSGFYYDMEYCVDYSTFRNLPTVQSVNSWDSPSLIDASYKPITAYPVEHFKSCEPSKVEL  495
              S +YYDM Y + YS+F +LP  Q V+S   P     S     +  V+     +  K+E 
Sbjct  241   NSDYYYDMMYLLPYSSFVSLP--QDVSS---PISESDSTISSDSDTVD----VKEQKLEK  291

Query  494   SLLDLYAGCGGMSTGLCLGAKLSGLNLVTKWAVDYQKSACDSLKFNHPETQVRNES----  327
             +LLDLY+GCG MSTGLCLGA + G+ LVTKWAVD  + ACDSLK+NHPET VRNES    
Sbjct  292   NLLDLYSGCGAMSTGLCLGADIGGVKLVTKWAVDLNQYACDSLKWNHPETAVRNESADDF  351

Query  326   VenflkllkeweklckEYGSEPNAGSDDVLEGMEEGaddansladsddsdAEYEIL---R  156
             +    +  +          + P      V +  ++  +D     +    D + EI    +
Sbjct  352   LLLLREWRQLCASCSLLRNNTPTHSFLKVRDEDDKDDNDNEDEDEGSGDDEQGEIFEVEQ  411

Query  155   LVDICFGDPNDTGKPGIHFQVRWKGYGPSEDTWEPIDGL  39
             L++IC+GDP +  KPG++F+VRWKGYG  EDTWEPI+GL
Sbjct  412   LLEICYGDPKEKNKPGLYFKVRWKGYGQEEDTWEPIEGL  450



>ref|XP_010666617.1| PREDICTED: putative DNA (cytosine-5)-methyltransferase CMT1 [Beta 
vulgaris subsp. vulgaris]
Length=832

 Score =   222 bits (566),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 146/348 (42%), Positives = 204/348 (59%), Gaps = 19/348 (5%)
 Frame = -2

Query  1019  EDEVILNVDCHYAQAKVLSFILNIGDCVYVKGE-GEKKHVGRILEFFKTTEGEDYFRVQW  843
             E + I+    HY +A +    + + D VY++ E G   ++ +I+E F+T + E Y   QW
Sbjct  94    ESDEIMQACRHYNEALIDGVTVRLLDDVYIQAEEGTPDYITKIVELFETVDKEQYITAQW  153

Query  842   FFRAEDTVMRDAAALHDKKRLFYSTLMNDNLLDCIISKVNVTEISPGLGLEVNNSPPSGF  663
             F+RAEDTV++  A L D +R+F+S + NDN L CI+ KVN+      +G++ ++      
Sbjct  154   FYRAEDTVIKVHAELIDNRRVFFSDVKNDNPLGCIVRKVNIAANPSNVGVDKSHE----L  209

Query  662   YYDMEYCVDYSTFRNL-PTVQS--------VNSWDSPSLIDASYKPITAYPVEHFKSCEP  510
             + D+ Y + Y TF NL P  Q+               S  +A+    +    E  +    
Sbjct  210   FCDLSYKLPYLTFANLVPDGQNQGGGSDTSSTISSDHSSDEATADVTSNGVAETMQEVVE  269

Query  509   SKVELSLLDLYAGCGGMSTGLCLGAKLSGLNLVTKWAVDYQKSACDSLKFNHPETQVRNE  330
              K E+ LLDLY+GCG MSTGLCLGA LSG+ LV KWAVD  + AC+SL+ NHPET+VRNE
Sbjct  270   PKNEMRLLDLYSGCGAMSTGLCLGASLSGIKLVNKWAVDMNQDACESLRKNHPETEVRNE  329

Query  329   SVenflkllkeweklckEYGSEPNAGSDDVLEGMEEGaddansladsddsdAEYEILRLV  150
               ++FL LLKEWE+LC +      + S +V    EE     +   DS  S  E+E+  L+
Sbjct  330   KADDFLALLKEWERLCNDLLLSAASPSPEVACSEEE-----DIDDDSPLSPGEFEVETLL  384

Query  149   DICFGDPNDTGKPGIHFQVRWKGYGPSEDTWEPIDGLKSWKNRQGWFT  6
             DICFGDPN   K G++F+VRWKGYGP EDTWEPIDGL   ++R   F 
Sbjct  385   DICFGDPNYVRKRGLYFKVRWKGYGPEEDTWEPIDGLSGSEDRIKEFV  432



>gb|AGH70220.1| chromomethylase 3, partial [Nicotiana benthamiana]
Length=901

 Score =   222 bits (566),  Expect = 4e-61, Method: Compositional matrix adjust.
 Identities = 135/330 (41%), Positives = 190/330 (58%), Gaps = 18/330 (5%)
 Frame = -2

Query  1004  LNVDCHYAQAKVLSFILNIGDCVYVKG-EGEKKHVGRILEFFKTTEGEDYFRVQWFFRAE  828
             L   CH+ QA V   I  + D  +VK  +GE+ ++ +I+EFF+  +G  YF  QWF+RA+
Sbjct  179   LQAKCHFTQASVDGQIYCLEDDAHVKAADGEEDYICKIVEFFEAVDGMQYFTAQWFYRAK  238

Query  827   DTVMRDAAALHDKKRLFYSTLMNDNLLDCIISKVNVTEISPGLGLEVNNSPPSG--FYYD  654
             DTV++      DKKR+F S +M+DN +DC++ K+ +  +     L+   +  S   FYYD
Sbjct  239   DTVIKTHDQFIDKKRVFLSEIMDDNPIDCLVIKLKIVPVPSNATLQFKENAKSNCDFYYD  298

Query  653   MEYCVDYSTFRNLPTVQSVNSWDSPSLIDASYKPITAYPVEHFKSCEPSKVELSLLDLYA  474
             M Y + YS+F +LP   S     S ++   +               +   +E  LLDLY+
Sbjct  299   MMYLLPYSSFLSLPPDSSSPVSSSSTISSEN----------DAGEVKEHNLEKKLLDLYS  348

Query  473   GCGGMSTGLCLGAKLSGLNLVTKWAVDYQKSACDSLKFNHPETQVRNESVenflkl----  306
             GCG MSTGLCLGA  +G+ LVTKWAVD    ACDSL+ NHPETQVRNE   +FL L    
Sbjct  349   GCGAMSTGLCLGANSNGVKLVTKWAVDLNSFACDSLRLNHPETQVRNEYASDFLSLLKEW  408

Query  305   lkeweklckEYGSEPNAGSDDVLEGMEEGaddansladsddsdAE-YEILRLVDICFGDP  129
             ++          S P      V++ +EE  +   S    DD   E +E+  L+++C+GDP
Sbjct  409   MQLCSSCSLVKSSVPPHPHLKVIDEVEEDENADESEDSGDDKRGENFEVEELLEVCYGDP  468

Query  128   NDTGKPGIHFQVRWKGYGPSEDTWEPIDGL  39
             N   KPG++F+V W+GYGP EDTWEPIDGL
Sbjct  469   NAVKKPGLYFKVHWQGYGPEEDTWEPIDGL  498



>gb|EEE58631.1| hypothetical protein OsJ_09996 [Oryza sativa Japonica Group]
Length=1033

 Score =   223 bits (567),  Expect = 5e-61, Method: Compositional matrix adjust.
 Identities = 145/355 (41%), Positives = 200/355 (56%), Gaps = 24/355 (7%)
 Frame = -2

Query  1025  DEEDEVILNVDCHYAQAKVLSFILNIGDCVYVK-GEGEKKHVGRILEFFKTTEGEDYFRV  849
             DE++E  +   CHY  A V   I ++ D VYVK G  E+ ++GRI EFF+  +   YF  
Sbjct  267   DEDEE--MKARCHYLAANVDDEIYHLDDDVYVKAGPDEENYIGRITEFFEGVDRGSYFSC  324

Query  848   QWFFRAEDTVMRDAAA-----LHDKKRLFYSTLMNDNLLDCIISKVNVTEISPGLGLEVN  684
             QWFFR  DTV+           H+ KR+F S   NDNL++CI+SKV +  + P +  +  
Sbjct  325   QWFFRTADTVISSKLLKVHDHRHNHKRVFLSKEKNDNLIECIVSKVKIAHVDPNMTPQAR  384

Query  683   NSPPSG--FYYDMEYCVDYSTFRNLPT-------VQSVNSWDSPSLIDASYKPITAYPVE  531
                 S    YYDM Y V YSTF NLP         ++ ++       ++S   ++A  V 
Sbjct  385   AHAISDCDLYYDMSYSVAYSTFANLPADNDGALGSEATSNISCDDADNSSKGKLSADIVA  444

Query  530   HFKSCEPSKVELSLLDLYAGCGGMSTGLCLGAKLSGLNLVTKWAVDYQKSACDSLKFNHP  351
              +     +    SLLDLY+GCG MSTGLCLG   SG+NL T+WAVD  K AC  LK NHP
Sbjct  445   PYSEQTET---ASLLDLYSGCGAMSTGLCLGFAFSGINLETRWAVDINKYACACLKHNHP  501

Query  350   ETQVRNESVenflkllkeweklckEYGSEPNAGSDDVLEGMEEGaddansladsddsdAE  171
              +QVRNE  E+FL L+++W+ LC++Y    N    D LE   +   +     +    +  
Sbjct  502   YSQVRNEKTEDFLALIQQWDALCRKYVVHKN----DTLEPSIDMPLNDADDVNEPLPEDI  557

Query  170   YEILRLVDICFGDPNDTGKPGIHFQVRWKGYGPSEDTWEPIDGLKSWKNRQGWFT  6
             +++  L++IC+GDP++TGK G+ F+VRWKGY PS DTWEPIDGL     R   F 
Sbjct  558   FDVEELLEICYGDPSNTGKNGLWFKVRWKGYDPSYDTWEPIDGLSDCPERIKEFV  612



>ref|XP_004252840.1| PREDICTED: DNA (cytosine-5)-methyltransferase CMT3 [Solanum lycopersicum]
Length=933

 Score =   221 bits (563),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 139/351 (40%), Positives = 198/351 (56%), Gaps = 22/351 (6%)
 Frame = -2

Query  1025  DEEDEVILNVDCHYAQAKVLSFILNIGDCVYVKG-EGEKKHVGRILEFFKTTEGEDYFRV  849
             D+ D++I    CH+++A V   I  + D  +VK  +GE  ++ +I+EFF+  +G  YF  
Sbjct  202   DDPDQLI-QAKCHFSRADVDGQIYYLEDDAHVKAADGEDDYICKIVEFFEAVDGVQYFTA  260

Query  848   QWFFRAEDTVMRDAAALHDKKRLFYSTLMNDNLLDCIISKVNVTEISPGLGLEVNNSPPS  669
             QWF+RA+DTV++      DKKR+F S + +DN LDC+++K+ +  +      +   +  S
Sbjct  261   QWFYRAKDTVIKSHDQFIDKKRVFLSEIKDDNPLDCLVTKLKIVPVPSNATSQFKENVKS  320

Query  668   G--FYYDMEYCVDYSTFRNLPTVQSVNSWDSPSLIDASYKPITAYPVEHFKSCEPSKVEL  495
                FYYDM+Y + YS+F +LP          P          T          +   +E 
Sbjct  321   NCDFYYDMKYLLPYSSFISLP----------PDTTSPVSSSSTISSDIDAGEVKEHNLEK  370

Query  494   SLLDLYAGCGGMSTGLCLGAKLSGLNLVTKWAVDYQKSACDSLKFNHPETQVRNESVenf  315
              LLDLY+GCG MSTGLCLGA   G+ LVTKWAVD  K ACDSL+ NHPETQVRNE   +F
Sbjct  371   KLLDLYSGCGAMSTGLCLGANSKGVKLVTKWAVDLNKHACDSLRLNHPETQVRNEYASDF  430

Query  314   lkllkewekl----ckEYGSEPNAGSDDVLEGMEEGaddansladsddsdAEYEILRL--  153
             L LLKEW +L        GS P      V +   +  ++ +   +    D E EI  +  
Sbjct  431   LSLLKEWVQLCVSCSLIKGSVPPHPHLKVTD-EVDEDEENDDEGEDSGDDKEGEIFEVEE  489

Query  152   -VDICFGDPNDTGKPGIHFQVRWKGYGPSEDTWEPIDGLKSWKNRQGWFTI  3
              +++C+GDP +  KPG++F+VRW+GYGP EDTWEPIDGL     +   F +
Sbjct  490   LLEVCYGDPKENNKPGLYFKVRWRGYGPEEDTWEPIDGLSDCPKKISEFVV  540



>emb|CDN40869.1| chromomethylase, partial [Nicotiana sylvestris]
Length=597

 Score =   217 bits (552),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 137/330 (42%), Positives = 194/330 (59%), Gaps = 18/330 (5%)
 Frame = -2

Query  1004  LNVDCHYAQAKVLSFILNIGDCVYVKG-EGEKKHVGRILEFFKTTEGEDYFRVQWFFRAE  828
             L   CH+ QA V   I  + D  +VK  +GE+ ++ +I+EFF+  +G  YF  QWF+RA+
Sbjct  179   LQAKCHFTQASVDGQIYYLEDDAHVKAADGEEDYICKIVEFFEAVDGMQYFTAQWFYRAK  238

Query  827   DTVMRDAAALHDKKRLFYSTLMNDNLLDCIISKVNVTEISPGLGLEVNNSPPSG--FYYD  654
             DTV++      DKKR+F S + +DN +DC++ K+ +  +     L+   +  S   FYYD
Sbjct  239   DTVIKSHDQFIDKKRVFLSEIKDDNPIDCLVIKLKIVPVPSNATLQFKENAKSNCDFYYD  298

Query  653   MEYCVDYSTFRNLPTVQSVNSWDSPSLIDASYKPITAYPVEHFKSCEPSKVELSLLDLYA  474
             M Y + YS+F +LP   +     S ++   +         EH        +E  LLDLY+
Sbjct  299   MMYLLPYSSFLSLPPDSTSPVSSSSTISSDTD---AGEVKEH-------NLEKKLLDLYS  348

Query  473   GCGGMSTGLCLGAKLSGLNLVTKWAVDYQKSACDSLKFNHPETQVRNESVenflkllkew  294
             GCG MSTGLCLGA  +G+ LVTKWAVD  + ACDSL+ NHP TQVRNE   +FL LLKEW
Sbjct  349   GCGAMSTGLCLGANSNGVKLVTKWAVDLNRFACDSLRLNHPGTQVRNEYASDFLSLLKEW  408

Query  293   eklckEYG-----SEPNAGSDDVLEGMEEGaddansladsddsdAEYEILRLVDICFGDP  129
              +LC  +        P+       E  E+  DD +  +  D     +E+  ++++C+GDP
Sbjct  409   VQLCSSFSLVKSNVPPHPHLKVTDEVEEDENDDESEDSGDDKKGEIFEVEEILEVCYGDP  468

Query  128   NDTGKPGIHFQVRWKGYGPSEDTWEPIDGL  39
             N   KPG++F+VRW+GYGP EDTWEPIDGL
Sbjct  469   NAVKKPGLYFKVRWQGYGPEEDTWEPIDGL  498



>gb|EEC74798.1| hypothetical protein OsI_10599 [Oryza sativa Indica Group]
Length=1760

 Score =   223 bits (569),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 148/366 (40%), Positives = 201/366 (55%), Gaps = 46/366 (13%)
 Frame = -2

Query  1025  DEEDEVILNVDCHYAQAKVLSFILNIGDCVYVK-GEGEKKHVGRILEFFKTTEGEDYFRV  849
             DE++E  +   CHY  A V   I ++ D VYVK G  E+ ++GRI EFF+  +   YF  
Sbjct  267   DEDEE--MKARCHYLAANVDDEIYHLDDDVYVKAGPDEENYIGRITEFFEGVDRGSYFSC  324

Query  848   QWFFRAEDTVMRDAAA-----LHDKKRLFYSTLMNDNLLDCIISKVNVTEISPGLGLEVN  684
             QWFFR  DTV+           H+ KR+F S   NDNL++CI+SKV +  + P +  +  
Sbjct  325   QWFFRTADTVISSKLLKVHDHRHNHKRVFLSKEKNDNLIECIVSKVKIAHVDPNMTPQAR  384

Query  683   NSPPSG--FYYDMEYCVDYSTFRNLPT-------VQSVNSWDSPSLIDASYKPITAYPVE  531
                 S    YYDM Y V YSTF NLP         ++ ++       ++S   ++A  V 
Sbjct  385   AHAISDCDLYYDMSYSVAYSTFANLPADNDGALGSEATSNISCDDADNSSKGKLSADIVS  444

Query  530   HFKSCEPSKVELSLLDLYAGCGGMSTGLCLGAKLSGLNLVTKWAVDYQKSACDSLKFNHP  351
              +     +    SLLDLY+GCG MSTGLCLG   SG+NL T+WAVD  K AC SLK NHP
Sbjct  445   PYSEQTETA---SLLDLYSGCGAMSTGLCLGFAFSGINLETRWAVDINKYACASLKHNHP  501

Query  350   ETQVRNESVenflkllkeweklckEYGSEPN-----------AGSDDVLEGMEEGaddan  204
              +QVRNE  E+FL L+++W+ LC++Y    N             +DDV E + E      
Sbjct  502   YSQVRNEKTEDFLALIQQWDALCRKYVVHKNNTLEPGIDMPLNDADDVNEPLPEDI----  557

Query  203   sladsddsdAEYEILRLVDICFGDPNDTGKPGIHFQVRWKGYGPSEDTWEPIDGLKSWKN  24
                        +++  L++IC+GDP++TGK G+ F+VRWKGY PS DTWEPIDGL     
Sbjct  558   -----------FDVEELLEICYGDPSNTGKNGLWFKVRWKGYDPSYDTWEPIDGLSDCPE  606

Query  23    RQGWFT  6
             R   F 
Sbjct  607   RIKEFV  612



>ref|NP_001105167.1| DNA (cytosine-5)-methyltransferase 3 [Zea mays]
 sp|Q9ARI6.1|CMT2_MAIZE RecName: Full=DNA (cytosine-5)-methyltransferase 2; AltName: 
Full=Chromomethylase 2; AltName: Full=DNA cytosine methyltransferase 
MET5; AltName: Full=Zea methyltransferase5; Short=Zmet5 
[Zea mays]
 gb|AAK15805.1| chromomethylase [Zea mays]
Length=915

 Score =   220 bits (560),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 148/348 (43%), Positives = 198/348 (57%), Gaps = 37/348 (11%)
 Frame = -2

Query  1043  TCFCSADEEDEVILNVDCHYAQAKVLSFILNIGDCVYVK-GEGEKKHVGRILEFFKTTEG  867
             T     +E+DE  L   CHY  AKV + +  +GD VYVK GE E  ++GRI EFF+ T+ 
Sbjct  163   TAANKPEEDDE--LKARCHYRSAKVDNIVYCLGDDVYVKAGENEADYIGRITEFFEGTDR  220

Query  866   EDYFRVQWFFRAEDTVMRDAAAL------HDKKRLFYSTLMNDNLLDCIISKVNVTEISP  705
               YF  +WFFRAEDTV+    ++      HD +R+F S   NDN+LDCIISKV +  + P
Sbjct  221   CHYFTCRWFFRAEDTVINSLVSINVDGHKHDPRRVFLSEEKNDNVLDCIISKVKIVHVDP  280

Query  704   GLGLEVNNS--PPSGFYYDMEYCVDYSTFRNLPTVQSVNSWDSPSLI---DASYKPITAY  540
              +  +           YYDM Y V YSTF N+ +    +  ++ S I   DA  +  +  
Sbjct  281   NMDPKAKAQLIEHCDLYYDMSYSVAYSTFANISSENGQSGSETASGISSDDAGLETSSNM  340

Query  539   PVEHFKSCEPSKVELSLLDLYAGCGGMSTGLCLGAKLSGLNLVTKWAVDYQKSACDSLKF  360
             P          +   +LLDLY+GCGGMSTGLCLGA LSGL L T+WAVD    AC SLK+
Sbjct  341   P----------ERTATLLDLYSGCGGMSTGLCLGAALSGLKLETRWAVDLNSFACQSLKY  390

Query  359   NHPETQVRNESVenflkllkeweklckEYGSEPNAGSDDVLEGMEEGaddansladsdds  180
             NHP+T+VRNE  + FL LLKEW  LC++Y  +     D  L G E+              
Sbjct  391   NHPQTEVRNEKADEFLALLKEWAVLCEKYVHQ---DVDSNLAGSED------QEDADTLD  441

Query  179   dAEYEILRLVDICFGDPNDTG-KPGIHFQVRWKGYGPSEDTWEPIDGL  39
               E+ + +L+ I +   + TG K G++F+V+W+ YGP EDTWEPID L
Sbjct  442   KDEFVVQKLIGIRY---DGTGRKKGVYFKVQWEEYGPEEDTWEPIDNL  486



>gb|AAN60988.1| Putative DNA cytosine methyltransferase MET2a [Oryza sativa Japonica 
Group]
 gb|ABF94750.1| C-5 cytosine-specific DNA methylase family protein, expressed 
[Oryza sativa Japonica Group]
Length=1761

 Score =   222 bits (565),  Expect = 6e-60, Method: Compositional matrix adjust.
 Identities = 145/355 (41%), Positives = 200/355 (56%), Gaps = 24/355 (7%)
 Frame = -2

Query  1025  DEEDEVILNVDCHYAQAKVLSFILNIGDCVYVK-GEGEKKHVGRILEFFKTTEGEDYFRV  849
             DE++E  +   CHY  A V   I ++ D VYVK G  E+ ++GRI EFF+  +   YF  
Sbjct  267   DEDEE--MKARCHYLAANVDDEIYHLDDDVYVKAGPDEENYIGRITEFFEGVDRGSYFSC  324

Query  848   QWFFRAEDTVMRDAAA-----LHDKKRLFYSTLMNDNLLDCIISKVNVTEISPGLGLEVN  684
             QWFFR  DTV+           H+ KR+F S   NDNL++CI+SKV +  + P +  +  
Sbjct  325   QWFFRTADTVISSKLLKVHDHRHNHKRVFLSKEKNDNLIECIVSKVKIAHVDPNMTPQAR  384

Query  683   NSPPSG--FYYDMEYCVDYSTFRNLPT-------VQSVNSWDSPSLIDASYKPITAYPVE  531
                 S    YYDM Y V YSTF NLP         ++ ++       ++S   ++A  V 
Sbjct  385   AHAISDCDLYYDMSYSVAYSTFANLPADNDGALGSEATSNISCDDADNSSKGKLSADIVA  444

Query  530   HFKSCEPSKVELSLLDLYAGCGGMSTGLCLGAKLSGLNLVTKWAVDYQKSACDSLKFNHP  351
              +     +    SLLDLY+GCG MSTGLCLG   SG+NL T+WAVD  K AC  LK NHP
Sbjct  445   PYSEQTETA---SLLDLYSGCGAMSTGLCLGFAFSGINLETRWAVDINKYACACLKHNHP  501

Query  350   ETQVRNESVenflkllkeweklckEYGSEPNAGSDDVLEGMEEGaddansladsddsdAE  171
              +QVRNE  E+FL L+++W+ LC++Y    N    D LE   +   +     +    +  
Sbjct  502   YSQVRNEKTEDFLALIQQWDALCRKYVVHKN----DTLEPSIDMPLNDADDVNEPLPEDI  557

Query  170   YEILRLVDICFGDPNDTGKPGIHFQVRWKGYGPSEDTWEPIDGLKSWKNRQGWFT  6
             +++  L++IC+GDP++TGK G+ F+VRWKGY PS DTWEPIDGL     R   F 
Sbjct  558   FDVEELLEICYGDPSNTGKNGLWFKVRWKGYDPSYDTWEPIDGLSDCPERIKEFV  612



>gb|EEC70797.1| hypothetical protein OsI_02246 [Oryza sativa Indica Group]
Length=907

 Score =   218 bits (556),  Expect = 8e-60, Method: Compositional matrix adjust.
 Identities = 151/350 (43%), Positives = 198/350 (57%), Gaps = 43/350 (12%)
 Frame = -2

Query  1025  DEEDEVILNVDCHYAQAKVLSFILNIGDCVYVKGEGEKK-HVGRILEFFKTTEGEDYFRV  849
             DEE+++     CHY+ AKV   +  + D VYVK E +K  ++GRI EFF+ T+   YF  
Sbjct  153   DEEEDI--KARCHYSSAKVDGTLYCLHDDVYVKAEEDKADYIGRITEFFEGTDHCRYFTC  210

Query  848   QWFFRAEDTVMRDAAA------LHDKKRLFYSTLMNDNLLDCIISKVNVTEISPGLGLEV  687
             +WFFRAEDTV+            HD KR+F S   NDN+LDCIISKV +  I P +  E 
Sbjct  211   RWFFRAEDTVISSIMMENADDEKHDLKRVFLSEEKNDNVLDCIISKVKIVHIDPNMESEA  270

Query  686   NNSPPSG--FYYDMEYCVDYSTFRNLPTVQSVNSWDSPSLIDASYKPITAYPVEHFKSCE  513
                  +    YYDM Y V YSTF N+P     +  D+ S I +     +   V      E
Sbjct  271   KARRLADCDLYYDMSYTVAYSTFANIPLENGASGSDTASDISSDDVDSSKGKV--VSDSE  328

Query  512   PSKV-ELSLLDLYAGCGGMSTGLCLGAKLSGLNLVTKWAVDYQKSACDSLKFNHPETQVR  336
              S V + +LLDLY+GCGGMSTGLCLGA L+GLNL T+WAVD+   AC+SLK+NHP T+VR
Sbjct  329   ASSVGKATLLDLYSGCGGMSTGLCLGAALAGLNLETRWAVDFNSFACESLKYNHPRTEVR  388

Query  335   NESVenflkllkeweklckEY----------GSEPNAGSDDVLEGMEEGaddansladsd  186
             NE  + FL LLK W  LC EY          G+  N   DD  E +E+            
Sbjct  389   NEKADEFLALLKGWHSLCDEYVKKDIDFSSAGASENEEDDD--EPLEK------------  434

Query  185   dsdAEYEILRLVDICFGDPNDTGKPGIHFQVRWKGYGPSEDTWEPIDGLK  36
                 E+ + +L  IC+G      + G++F+V+WKGYG  EDTWEPI+ L+
Sbjct  435   ---DEFVVEKLAGICYG--GSGREDGLYFKVQWKGYGREEDTWEPIENLR  479



>gb|AAL75761.1| Putative DNA cytosine methyltransferase MET2a [Oryza sativa Japonica 
Group]
Length=719

 Score =   216 bits (551),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 147/349 (42%), Positives = 194/349 (56%), Gaps = 63/349 (18%)
 Frame = -2

Query  1025  DEEDEVILNVDCHYAQAKVLSFILNIGDCVYVKGEGEKK-HVGRILEFFKTTEGEDYFRV  849
             DEE+++     CHY+ AKV   +  + D VYVK E +K  ++GRI EFF+ T+   YF  
Sbjct  153   DEEEDI--KARCHYSSAKVDGTLYCLHDDVYVKAEEDKADYIGRITEFFEGTDHCHYFTC  210

Query  848   QWFFRAEDTVMRDAAA------LHDKKRLFYSTLMNDNLLDCIISKVNVTEISPGLGLEV  687
             +WFFRAEDTV+            HD KR+F S   NDN+LDCIISKV +  I P +  E 
Sbjct  211   RWFFRAEDTVISSIMMENADDEKHDLKRVFLSEEKNDNVLDCIISKVKIVYIDPNMESEA  270

Query  686   NNSPPSG--FYYDMEYCVDYSTFRNLPTVQSVNSWDSPSLIDASYKPITAYPVEHFKSCE  513
                  +    YYDM Y V YSTF N+P  + V+  ++ S+  A+                
Sbjct  271   KARRLADCDLYYDMSYTVAYSTFANIPLGKVVSDSEASSVGKAT----------------  314

Query  512   PSKVELSLLDLYAGCGGMSTGLCLGAKLSGLNLVTKWAVDYQKSACDSLKFNHPETQVRN  333
                    LLDLY+GCGGMSTGLCLGA L+GLNL T+WAVD+   AC+SLK+NHP T+VRN
Sbjct  315   -------LLDLYSGCGGMSTGLCLGAALAGLNLETRWAVDFNSFACESLKYNHPRTEVRN  367

Query  332   ESVenflkllkeweklckEY----------GSEPNAGSDDVLEGMEEGaddansladsdd  183
             E  + FL LLK W  LC EY          G+  N   DD  E +E+             
Sbjct  368   EKADEFLALLKGWHSLCDEYVKKDIDFSSAGASENEEDDD--EPLEK-------------  412

Query  182   sdAEYEILRLVDICFGDPNDTGKPGIHFQVRWKGYGPSEDTWEPIDGLK  36
                E+ + +L  IC+G      + G++F+V+WKGYG  EDTWEPI+ L+
Sbjct  413   --DEFVVEKLAGICYG--GSGREDGLYFKVQWKGYGREEDTWEPIENLR  457



>dbj|BAH37019.1| chromomethylase OsMET2a [Oryza sativa Japonica Group]
Length=907

 Score =   218 bits (554),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 151/350 (43%), Positives = 198/350 (57%), Gaps = 43/350 (12%)
 Frame = -2

Query  1025  DEEDEVILNVDCHYAQAKVLSFILNIGDCVYVKGEGEKK-HVGRILEFFKTTEGEDYFRV  849
             DEE+++     CHY+ AKV   +  + D VYVK E +K  ++GRI EFF+ T+   YF  
Sbjct  153   DEEEDI--KARCHYSSAKVDGTLYCLHDDVYVKAEEDKADYIGRITEFFEGTDHCHYFTC  210

Query  848   QWFFRAEDTVMRDAAA------LHDKKRLFYSTLMNDNLLDCIISKVNVTEISPGLGLEV  687
             +WFFRAEDTV+            HD KR+F S   NDN+LDCIISKV +  I P +  E 
Sbjct  211   RWFFRAEDTVISSIMMENADDEKHDLKRVFLSEEKNDNVLDCIISKVKIVYIDPNMESEA  270

Query  686   NNSPPSG--FYYDMEYCVDYSTFRNLPTVQSVNSWDSPSLIDASYKPITAYPVEHFKSCE  513
                  +    YYDM Y V YSTF N+P     +  D+ S I +     +   V      E
Sbjct  271   KARRLADCDLYYDMSYTVAYSTFANIPLENGASGSDTASDISSDDVDSSKGKV--VSDSE  328

Query  512   PSKV-ELSLLDLYAGCGGMSTGLCLGAKLSGLNLVTKWAVDYQKSACDSLKFNHPETQVR  336
              S V + +LLDLY+GCGGMSTGLCLGA L+GLNL T+WAVD+   AC+SLK+NHP T+VR
Sbjct  329   ASSVGKATLLDLYSGCGGMSTGLCLGAALAGLNLETRWAVDFNSFACESLKYNHPRTEVR  388

Query  335   NESVenflkllkeweklckEY----------GSEPNAGSDDVLEGMEEGaddansladsd  186
             NE  + FL LLK W  LC EY          G+  N   DD  E +E+            
Sbjct  389   NEKADEFLALLKGWHSLCDEYVKKDIDFSSAGASENEEDDD--EPLEK------------  434

Query  185   dsdAEYEILRLVDICFGDPNDTGKPGIHFQVRWKGYGPSEDTWEPIDGLK  36
                 E+ + +L  IC+G      + G++F+V+WKGYG  EDTWEPI+ L+
Sbjct  435   ---DEFVVEKLAGICYG--GSGREDGLYFKVQWKGYGREEDTWEPIENLR  479



>gb|EEE50451.1| hypothetical protein OsJ_30466 [Oryza sativa Japonica Group]
Length=907

 Score =   217 bits (553),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 151/350 (43%), Positives = 198/350 (57%), Gaps = 43/350 (12%)
 Frame = -2

Query  1025  DEEDEVILNVDCHYAQAKVLSFILNIGDCVYVKGEGEKK-HVGRILEFFKTTEGEDYFRV  849
             DEE+++     CHY+ AKV   +  + D VYVK E +K  ++GRI EFF+ T+   YF  
Sbjct  153   DEEEDI--KARCHYSSAKVDGTLYCLHDDVYVKAEEDKADYIGRITEFFEGTDHCHYFTC  210

Query  848   QWFFRAEDTVMRDAAA------LHDKKRLFYSTLMNDNLLDCIISKVNVTEISPGLGLEV  687
             +WFFRAEDTV+            HD KR+F S   NDN+LDCIISKV +  I P +  E 
Sbjct  211   RWFFRAEDTVISSIMMENADDEKHDLKRVFLSEEKNDNVLDCIISKVKIVYIDPNMESEA  270

Query  686   NNSPPSG--FYYDMEYCVDYSTFRNLPTVQSVNSWDSPSLIDASYKPITAYPVEHFKSCE  513
                  +    YYDM Y V YSTF N+P     +  D+ S I +     +   V      E
Sbjct  271   KARRLADCDLYYDMSYTVAYSTFANIPLENGASGSDTASDISSDDVDSSKGKV--VSDSE  328

Query  512   PSKV-ELSLLDLYAGCGGMSTGLCLGAKLSGLNLVTKWAVDYQKSACDSLKFNHPETQVR  336
              S V + +LLDLY+GCGGMSTGLCLGA L+GLNL T+WAVD+   AC+SLK+NHP T+VR
Sbjct  329   ASSVGKATLLDLYSGCGGMSTGLCLGAALAGLNLETRWAVDFNSFACESLKYNHPRTEVR  388

Query  335   NESVenflkllkeweklckEY----------GSEPNAGSDDVLEGMEEGaddansladsd  186
             NE  + FL LLK W  LC EY          G+  N   DD  E +E+            
Sbjct  389   NEKADEFLALLKGWHSLCDEYVKKDIDFSSAGASENEEDDD--EPLEK------------  434

Query  185   dsdAEYEILRLVDICFGDPNDTGKPGIHFQVRWKGYGPSEDTWEPIDGLK  36
                 E+ + +L  IC+G      + G++F+V+WKGYG  EDTWEPI+ L+
Sbjct  435   ---DEFVVEKLAGICYG--GSGREDGLYFKVQWKGYGREEDTWEPIENLR  479



>emb|CDN40870.1| chromomethylase [Nicotiana sylvestris]
Length=901

 Score =   216 bits (551),  Expect = 4e-59, Method: Compositional matrix adjust.
 Identities = 137/330 (42%), Positives = 194/330 (59%), Gaps = 18/330 (5%)
 Frame = -2

Query  1004  LNVDCHYAQAKVLSFILNIGDCVYVKG-EGEKKHVGRILEFFKTTEGEDYFRVQWFFRAE  828
             L   CH+ QA V   I  + D  +VK  +GE+ ++ +I+EFF+  +G  YF  QWF+RA+
Sbjct  179   LQAKCHFTQASVDGQIYYLEDDAHVKAADGEEDYICKIVEFFEAVDGMQYFTAQWFYRAK  238

Query  827   DTVMRDAAALHDKKRLFYSTLMNDNLLDCIISKVNVTEISPGLGLEVNNSPPSG--FYYD  654
             DTV++      DKKR+F S + +DN +DC++ K+ +  +     L+   +  S   FYYD
Sbjct  239   DTVIKSHDQFIDKKRVFLSEIKDDNPIDCLVIKLKIVPVPSNATLQFKENAKSNCDFYYD  298

Query  653   MEYCVDYSTFRNLPTVQSVNSWDSPSLIDASYKPITAYPVEHFKSCEPSKVELSLLDLYA  474
             M Y + YS+F +LP   +     S ++   +         EH        +E  LLDLY+
Sbjct  299   MMYLLPYSSFLSLPPDSTSPVSSSSTISSDTD---AGEVKEH-------NLEKKLLDLYS  348

Query  473   GCGGMSTGLCLGAKLSGLNLVTKWAVDYQKSACDSLKFNHPETQVRNESVenflkllkew  294
             GCG MSTGLCLGA  +G+ LVTKWAVD  + ACDSL+ NHP TQVRNE   +FL LLKEW
Sbjct  349   GCGAMSTGLCLGANSNGVKLVTKWAVDLNRFACDSLRLNHPGTQVRNEYASDFLSLLKEW  408

Query  293   eklckEYG-----SEPNAGSDDVLEGMEEGaddansladsddsdAEYEILRLVDICFGDP  129
              +LC  +        P+       E  E+  DD +  +  D     +E+  ++++C+GDP
Sbjct  409   VQLCSSFSLVKSNVPPHPHLKVTDEVEEDENDDESEDSGDDKKGEIFEVEEILEVCYGDP  468

Query  128   NDTGKPGIHFQVRWKGYGPSEDTWEPIDGL  39
             N   KPG++F+VRW+GYGP EDTWEPIDGL
Sbjct  469   NAVKKPGLYFKVRWQGYGPEEDTWEPIDGL  498



>ref|XP_010234610.1| PREDICTED: DNA (cytosine-5)-methyltransferase 1-like [Brachypodium 
distachyon]
Length=894

 Score =   216 bits (549),  Expect = 6e-59, Method: Compositional matrix adjust.
 Identities = 142/329 (43%), Positives = 184/329 (56%), Gaps = 40/329 (12%)
 Frame = -2

Query  992  CHYAQAKVLSFILNIGDCVYV-KGEGEKKHVGRILEFFKTTEGEDYFRVQWFFRAEDTVM  816
            CHY  AKV   I N+GD VYV  GE E  ++GRI EFF+  + + YF  +WFFR EDTV+
Sbjct  166  CHYRSAKVDEAIYNLGDDVYVMAGENEPHYIGRITEFFEGIDKKCYFTCRWFFRPEDTVI  225

Query  815  RDAAAL----HDKKRLFYSTLMNDNLLDCIISKVNVTEISPGLGLEVNNS--PPSGFYYD  654
              A  +    HD KR+F S   NDN+L+CI+ KVN+  + P +  E        S  YYD
Sbjct  226  STAKFVNDHTHDPKRVFLSEEKNDNVLECIVLKVNIVHVDPNMDSEAKAQLVAESDLYYD  285

Query  653  MEYCVDYSTFRNLPTVQSVNSWDSPSLIDASYKPITAYPVEHFKSCEPSKVELSLLDLYA  474
            M Y V YSTF N+ +  + NS  S  +   +  P+                   LLDLY+
Sbjct  286  MSYSVAYSTFANITSDTNDNSGISSDVDSEAASPVRT---------------AVLLDLYS  330

Query  473  GCGGMSTGLCLGAKLSGLNLVTKWAVDYQKSACDSLKFNHPETQVRNESVenflkllkew  294
            GCGGMSTGLCLG+ L+GL L T+WAVD    AC SLK+NHP T+VRNE  E+FL LLKEW
Sbjct  331  GCGGMSTGLCLGSALAGLKLETRWAVDLNSFACKSLKYNHPGTEVRNEKAEDFLALLKEW  390

Query  293  eklckEY----GSEPNAGSDDVLEGMEEGaddansladsddsdAEYEILRLVDICFGDPN  126
              LC  Y     S+P + S            +     D      E+ + +L++IC+G   
Sbjct  391  AILCDTYVHGNNSDPASPS------------EDEEEDDEPLGKDEFVVEKLLEICYG--G  436

Query  125  DTGKPGIHFQVRWKGYGPSEDTWEPIDGL  39
               +  I+F+V+WKGYGP EDTWEPI  L
Sbjct  437  SGREKAIYFKVQWKGYGPEEDTWEPIGNL  465



>ref|XP_010429915.1| PREDICTED: putative DNA (cytosine-5)-methyltransferase CMT1 isoform 
X2 [Camelina sativa]
Length=795

 Score =   215 bits (547),  Expect = 9e-59, Method: Compositional matrix adjust.
 Identities = 140/347 (40%), Positives = 202/347 (58%), Gaps = 22/347 (6%)
 Frame = -2

Query  1019  EDEVILNVDCHYAQAKVLSFILNIGDCVYVKGE-GEKKHVGRILEFFKTTEGEDYFRVQW  843
             ++E I     HY QA V   ++N+ D VYV  + G+   + +++E F+  +GE YFR +W
Sbjct  59    KEEEIKQAKRHYEQALVDGVLINLNDDVYVTADPGKANFIAKVIELFEAADGEPYFRARW  118

Query  842   FFRAEDTVMRDAAALHDKKRLFYSTLMNDNLLDCIISKVNVTEIS-PGLGLEVNNS--PP  672
             F+R +DTV+     L ++KR+F S + +DN L CI SK+N+ ++  P +    +    PP
Sbjct  119   FYRPDDTVIERFKQLVEEKRVFLSNVEDDNHLSCIHSKINIAKVPLPKIDSRASERIIPP  178

Query  671   SGFYYDMEYCVDYSTFRNLPTVQSVNSWDSPSLIDASYKPITAYPVEHFKSCEPSKVELS  492
               F+YDM+Y + + TF       + +S  S                       P   E  
Sbjct  179   CDFFYDMKYELPHLTFAKADDDSASSSTISSDSDSNCI-------------VNPHSDEKF  225

Query  491   LLDLYAGCGGMSTGLCLGAKLSGLNLVTKWAVDYQKSACDSLKFNHPETQVRNESVenfl  312
             LLDLY+GCG MSTG C+GA +SG+ L TKWAVD  +SACDSL+ NHPET+VRNE+ E+FL
Sbjct  226   LLDLYSGCGAMSTGFCMGASISGVKLTTKWAVDLNRSACDSLRLNHPETEVRNEAAEDFL  285

Query  311   kllkeweklckEY----GSEPNAG-SDDVLEGMEEGaddansladsddsdAEYEILRLVD  147
              LLKEW+KLC+++     +EP    S+   E  +E  D   +  D++ S  E+E+    D
Sbjct  286   VLLKEWKKLCEKFSLISSTEPKESISELEAEEGDEEDDIDETSIDTELSPGEFEVQEFRD  345

Query  146   ICFGDPNDTGKPGIHFQVRWKGYGPSEDTWEPIDGLKSWKNRQGWFT  6
             I FGDPND G+  +H +VRWKGYGP +DTWEP  GL + K++   F 
Sbjct  346   IAFGDPNDKGEKSLHLKVRWKGYGPDDDTWEPYAGLGNCKDKLKEFV  392



>ref|XP_010429914.1| PREDICTED: putative DNA (cytosine-5)-methyltransferase CMT1 isoform 
X1 [Camelina sativa]
Length=796

 Score =   214 bits (546),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 142/347 (41%), Positives = 205/347 (59%), Gaps = 21/347 (6%)
 Frame = -2

Query  1019  EDEVILNVDCHYAQAKVLSFILNIGDCVYVKGE-GEKKHVGRILEFFKTTEGEDYFRVQW  843
             ++E I     HY QA V   ++N+ D VYV  + G+   + +++E F+  +GE YFR +W
Sbjct  59    KEEEIKQAKRHYEQALVDGVLINLNDDVYVTADPGKANFIAKVIELFEAADGEPYFRARW  118

Query  842   FFRAEDTVMRDAAALHDKKRLFYSTLMNDNLLDCIISKVNVTEIS-PGLGLEVNNS--PP  672
             F+R +DTV+     L ++KR+F S + +DN L CI SK+N+ ++  P +    +    PP
Sbjct  119   FYRPDDTVIERFKQLVEEKRVFLSNVEDDNHLSCIHSKINIAKVPLPKIDSRASERIIPP  178

Query  671   SGFYYDMEYCVDYSTFRNLPTVQSVNSWDSPSLIDASYKPITAYPVEHFKSCEPSKVELS  492
               F+YDM+Y + + TF       S +S    S  D++                P   E  
Sbjct  179   CDFFYDMKYELPHLTFAKADDADSASSSTISSDSDSNC------------IVNPHSDEKF  226

Query  491   LLDLYAGCGGMSTGLCLGAKLSGLNLVTKWAVDYQKSACDSLKFNHPETQVRNESVenfl  312
             LLDLY+GCG MSTG C+GA +SG+ L TKWAVD  +SACDSL+ NHPET+VRNE+ E+FL
Sbjct  227   LLDLYSGCGAMSTGFCMGASISGVKLTTKWAVDLNRSACDSLRLNHPETEVRNEAAEDFL  286

Query  311   kllkeweklckEY----GSEPNAG-SDDVLEGMEEGaddansladsddsdAEYEILRLVD  147
              LLKEW+KLC+++     +EP    S+   E  +E  D   +  D++ S  E+E+    D
Sbjct  287   VLLKEWKKLCEKFSLISSTEPKESISELEAEEGDEEDDIDETSIDTELSPGEFEVQEFRD  346

Query  146   ICFGDPNDTGKPGIHFQVRWKGYGPSEDTWEPIDGLKSWKNRQGWFT  6
             I FGDPND G+  +H +VRWKGYGP +DTWEP  GL + K++   F 
Sbjct  347   IAFGDPNDKGEKSLHLKVRWKGYGPDDDTWEPYAGLGNCKDKLKEFV  393



>ref|XP_009343271.1| PREDICTED: DNA (cytosine-5)-methyltransferase CMT2-like [Pyrus 
x bretschneideri]
Length=150

 Score =   199 bits (506),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 89/139 (64%), Positives = 116/139 (83%), Gaps = 0/139 (0%)
 Frame = -2

Query  1025  DEEDEVILNVDCHYAQAKVLSFILNIGDCVYVKGEGEKKHVGRILEFFKTTEGEDYFRVQ  846
             DEEDE+IL+V+  ++QAK+   I ++GDC Y++G+  +KHVGRI+EFFKT +GE YFRVQ
Sbjct  11    DEEDEIILDVEFSFSQAKIGDCIFDLGDCAYIEGDEGQKHVGRIIEFFKTADGEKYFRVQ  70

Query  845   WFFRAEDTVMRDAAALHDKKRLFYSTLMNDNLLDCIISKVNVTEISPGLGLEVNNSPPSG  666
             WF++ EDTV+++A   HDK+RLFYST+MNDNL+DCIISKVNVT ISP +GL+VN+   S 
Sbjct  71    WFYKVEDTVIKEAGTSHDKRRLFYSTVMNDNLIDCIISKVNVTHISPKVGLKVNSISRSD  130

Query  665   FYYDMEYCVDYSTFRNLPT  609
             FYYDMEYCVDYSTFR+  +
Sbjct  131   FYYDMEYCVDYSTFRSFIS  149



>ref|XP_010243382.1| PREDICTED: DNA (cytosine-5)-methyltransferase 1-like isoform 
X1 [Nelumbo nucifera]
Length=839

 Score =   214 bits (545),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 117/250 (47%), Positives = 162/250 (65%), Gaps = 21/250 (8%)
 Frame = -2

Query  1025  DEEDEVILNVDCHYAQAKVLSFILNIGDCVYVKGE-GEKKHVGRILEFFKTTEGEDYFRV  849
             ++ DE +L   CHY QA+V   I N+ D  YVKGE G+  ++GRI+E F+TT+GE YF  
Sbjct  72    EDTDEEVLLARCHYRQAEVDGCIFNLNDDAYVKGEEGKPNYIGRIVELFETTDGEPYFTA  131

Query  848   QWFFRAEDTVM-RDAAALHDKKRLFYSTLMNDNLLDCIISKVNVTEISPGLGLEV-NNSP  675
             QWFF+AEDTV+ +D ++L D +R+F S + +DN LDCI+SK+ + ++SP + L     + 
Sbjct  132   QWFFKAEDTVIGKDHSSLIDSRRVFLSNMRDDNPLDCIVSKIQIAQVSPNMDLVAKQRTI  191

Query  674   PSG--FYYDMEYCVDYSTFRNLPTVQSVNSWDSPSL----------IDASYKPITAYPVE  531
             PS    YYDM Y   YSTF NL +++S  +    S            +   KP++    E
Sbjct  192   PSSCDLYYDMSYSPTYSTFANL-SIESTRAGSETSSTISSEVSFDGAEGECKPVS----E  246

Query  530   HFKSCE-PSKVELSLLDLYAGCGGMSTGLCLGAKLSGLNLVTKWAVDYQKSACDSLKFNH  354
                S   P+K E++LLDLY+GCG MSTGLCLGA +SG+NLVT+WAVD  + AC+SL+ NH
Sbjct  247   KSSSISLPTKPEIALLDLYSGCGAMSTGLCLGAAISGINLVTRWAVDLNQYACESLRLNH  306

Query  353   PETQVRNESV  324
             PET VRNE+ 
Sbjct  307   PETVVRNETA  316


 Score = 72.0 bits (175),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 29/46 (63%), Positives = 37/46 (80%), Gaps = 0/46 (0%)
 Frame = -2

Query  158  RLVDICFGDPNDTGKPGIHFQVRWKGYGPSEDTWEPIDGLKSWKNR  21
            +++ ICFGDPN++ K G++F+VRWKGYGPSEDTWEP  GL   K R
Sbjct  380  KILGICFGDPNESQKKGLYFKVRWKGYGPSEDTWEPFGGLGDCKER  425



>ref|XP_010243384.1| PREDICTED: DNA (cytosine-5)-methyltransferase 1-like isoform 
X2 [Nelumbo nucifera]
Length=838

 Score =   214 bits (545),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 117/250 (47%), Positives = 162/250 (65%), Gaps = 21/250 (8%)
 Frame = -2

Query  1025  DEEDEVILNVDCHYAQAKVLSFILNIGDCVYVKGE-GEKKHVGRILEFFKTTEGEDYFRV  849
             ++ DE +L   CHY QA+V   I N+ D  YVKGE G+  ++GRI+E F+TT+GE YF  
Sbjct  71    EDTDEEVLLARCHYRQAEVDGCIFNLNDDAYVKGEEGKPNYIGRIVELFETTDGEPYFTA  130

Query  848   QWFFRAEDTVM-RDAAALHDKKRLFYSTLMNDNLLDCIISKVNVTEISPGLGLEV-NNSP  675
             QWFF+AEDTV+ +D ++L D +R+F S + +DN LDCI+SK+ + ++SP + L     + 
Sbjct  131   QWFFKAEDTVIGKDHSSLIDSRRVFLSNMRDDNPLDCIVSKIQIAQVSPNMDLVAKQRTI  190

Query  674   PSG--FYYDMEYCVDYSTFRNLPTVQSVNSWDSPSL----------IDASYKPITAYPVE  531
             PS    YYDM Y   YSTF NL +++S  +    S            +   KP++    E
Sbjct  191   PSSCDLYYDMSYSPTYSTFANL-SIESTRAGSETSSTISSEVSFDGAEGECKPVS----E  245

Query  530   HFKSCE-PSKVELSLLDLYAGCGGMSTGLCLGAKLSGLNLVTKWAVDYQKSACDSLKFNH  354
                S   P+K E++LLDLY+GCG MSTGLCLGA +SG+NLVT+WAVD  + AC+SL+ NH
Sbjct  246   KSSSISLPTKPEIALLDLYSGCGAMSTGLCLGAAISGINLVTRWAVDLNQYACESLRLNH  305

Query  353   PETQVRNESV  324
             PET VRNE+ 
Sbjct  306   PETVVRNETA  315


 Score = 72.0 bits (175),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 29/46 (63%), Positives = 37/46 (80%), Gaps = 0/46 (0%)
 Frame = -2

Query  158  RLVDICFGDPNDTGKPGIHFQVRWKGYGPSEDTWEPIDGLKSWKNR  21
            +++ ICFGDPN++ K G++F+VRWKGYGPSEDTWEP  GL   K R
Sbjct  379  KILGICFGDPNESQKKGLYFKVRWKGYGPSEDTWEPFGGLGDCKER  424



>ref|XP_008373679.1| PREDICTED: DNA (cytosine-5)-methyltransferase CMT2-like [Malus 
domestica]
Length=630

 Score =   211 bits (538),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 91/137 (66%), Positives = 117/137 (85%), Gaps = 0/137 (0%)
 Frame = -2

Query  1025  DEEDEVILNVDCHYAQAKVLSFILNIGDCVYVKGEGEKKHVGRILEFFKTTEGEDYFRVQ  846
             DEEDE+IL+V+CH++QAK+   I ++GDC Y++G+  +KHVGRI+EFFKT +GE YFRVQ
Sbjct  427   DEEDEIILDVECHFSQAKIGDCIFDLGDCAYIEGDEGQKHVGRIIEFFKTADGEKYFRVQ  486

Query  845   WFFRAEDTVMRDAAALHDKKRLFYSTLMNDNLLDCIISKVNVTEISPGLGLEVNNSPPSG  666
             WF++ EDTV+++    HDK+RLFYST+MNDNL+DCIISKVNVT ISP +GL+VN+  PS 
Sbjct  487   WFYKVEDTVIKEVGTSHDKRRLFYSTVMNDNLIDCIISKVNVTHISPKVGLKVNSISPSD  546

Query  665   FYYDMEYCVDYSTFRNL  615
             FYYDMEYCVDYSTFR+ 
Sbjct  547   FYYDMEYCVDYSTFRSF  563



>dbj|BAH37020.1| chromomethylase OsMET2b [Oryza sativa Japonica Group]
Length=690

 Score =   213 bits (541),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 137/333 (41%), Positives = 189/333 (57%), Gaps = 22/333 (7%)
 Frame = -2

Query  959  ILNIGDCVYVK-GEGEKKHVGRILEFFKTTEGEDYFRVQWFFRAEDTVMRDAAA-----L  798
            I ++ D VYVK G  E+ ++GRI EFF+  +   YF  QWFFR  DTV+           
Sbjct  5    IYHLDDDVYVKAGPDEENYIGRITEFFEGVDRGSYFSCQWFFRTADTVISSKLLKVHDHR  64

Query  797  HDKKRLFYSTLMNDNLLDCIISKVNVTEISPGLGLEVNNSPPSG--FYYDMEYCVDYSTF  624
            H+ KR+F S   NDNL++CI+SKV +  + P +  +      S    YYDM Y V YSTF
Sbjct  65   HNHKRVFLSKEKNDNLIECIVSKVKIAHVDPNMTPQARAHAISDCDLYYDMSYSVAYSTF  124

Query  623  RNLPT-------VQSVNSWDSPSLIDASYKPITAYPVEHFKSCEPSKVELSLLDLYAGCG  465
             NLP         ++ ++       ++S   ++A  V  +     +    SLLDLY+GCG
Sbjct  125  ANLPADNDGALGSEATSNISCDDADNSSKGKLSADIVAPYSEQTETA---SLLDLYSGCG  181

Query  464  GMSTGLCLGAKLSGLNLVTKWAVDYQKSACDSLKFNHPETQVRNESVenflkllkewekl  285
             MSTGLCLG   SG+NL T+WAVD  K AC  LK NHP +QVRNE  E+FL L+++W+ L
Sbjct  182  AMSTGLCLGFAFSGINLETRWAVDINKYACACLKHNHPYSQVRNEKTEDFLALIQQWDAL  241

Query  284  ckEYGSEPNAGSDDVLEGMEEGaddansladsddsdAEYEILRLVDICFGDPNDTGKPGI  105
            C++Y    N    D LE   +   +     +    +  +++  L++IC+GDP++TGK G+
Sbjct  242  CRKYVVHKN----DTLEPSIDMPLNDADDVNEPLPEDIFDVEELLEICYGDPSNTGKNGL  297

Query  104  HFQVRWKGYGPSEDTWEPIDGLKSWKNRQGWFT  6
             F+VRWKGY PS DTWEPIDGL     R   F 
Sbjct  298  WFKVRWKGYDPSYDTWEPIDGLSDCPERIKEFV  330



>ref|XP_006300613.1| hypothetical protein CARUB_v10019805mg, partial [Capsella rubella]
 gb|EOA33511.1| hypothetical protein CARUB_v10019805mg, partial [Capsella rubella]
Length=824

 Score =   213 bits (543),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 141/337 (42%), Positives = 198/337 (59%), Gaps = 22/337 (7%)
 Frame = -2

Query  989  HYAQAKVLSFILNIGDCVYVKGE-GEKKHVGRILEFFKTTEGEDYFRVQWFFRAEDTVMR  813
            HY QA V   ++N+ D VYV  E G+  ++ ++ E F+  +GE YFR QWF+R EDTV++
Sbjct  99   HYEQALVDGVLINLNDDVYVTAESGKPNYIAKVAELFEADDGEPYFRAQWFYRPEDTVIK  158

Query  812  DAAALHDKKRLFYSTLMNDNLLDCIISKVNVTEIS-PGLGLEVNNS--PPSGFYYDMEYC  642
              + L  +KR+F S + +DN L CI SKVN+ ++  P +     +   PP  FYYDM+Y 
Sbjct  159  RFSELVQEKRVFLSNMEDDNPLTCIYSKVNIAKVPLPKIASRTADRIIPPCDFYYDMKYQ  218

Query  641  VDYSTFRNLPTVQSVNSWDSPSLIDASYKPITAYPVEHFKSCEPSKVELSLLDLYAGCGG  462
            + + TF +     + +S  S                       P K E  LLDLY+GCG 
Sbjct  219  LPHLTFASADDDSASSSTISSDSDSNCI-------------VNPPKDEKFLLDLYSGCGA  265

Query  461  MSTGLCLGAKLSGLNLVTKWAVDYQKSACDSLKFNHPETQVRNESVenflkllkeweklc  282
            MSTG C+GA LSG+ L TKWAVD   SAC SLK NHPET+VRNE+ E+FL LLKEW+KLC
Sbjct  266  MSTGFCMGASLSGIKLTTKWAVDLNTSACASLKHNHPETEVRNEAAEDFLILLKEWKKLC  325

Query  281  kEYG----SEP-NAGSDDVLEGMEEGaddansladsddsdAEYEILRLVDICFGDPNDTG  117
            +++     +EP  + S+   E  +E  D   +   ++ S  E+E+     I +GDPN  G
Sbjct  326  EKFSLISMTEPMESISELEDEEGDEDEDIDETSIGTELSPGEFEVQEFSAIVYGDPNRKG  385

Query  116  KPGIHFQVRWKGYGPSEDTWEPIDGLKSWKNRQGWFT  6
            +  +H +VRWKGYGP +DTWEP  GL++ K++   F 
Sbjct  386  EKSLHLRVRWKGYGPDDDTWEPSAGLENCKDKLKEFV  422



>ref|NP_001289523.1| DNA (cytosine-5)-methyltransferase CMT3-like [Nicotiana sylvestris]
 emb|CDN40871.1| chromomethylase [Nicotiana sylvestris]
Length=901

 Score =   213 bits (542),  Expect = 7e-58, Method: Compositional matrix adjust.
 Identities = 136/330 (41%), Positives = 193/330 (58%), Gaps = 18/330 (5%)
 Frame = -2

Query  1004  LNVDCHYAQAKVLSFILNIGDCVYVKG-EGEKKHVGRILEFFKTTEGEDYFRVQWFFRAE  828
             L   CH+ QA V   I  + D  +VK  +GE+ ++ +I+EFF+  +G  YF  QWF+ A+
Sbjct  179   LQAKCHFTQASVDGQIYYLEDDAHVKAADGEEDYICKIVEFFEAVDGMQYFTAQWFYIAK  238

Query  827   DTVMRDAAALHDKKRLFYSTLMNDNLLDCIISKVNVTEISPGLGLEVNNSPPSG--FYYD  654
             DTV++      DKKR+F S + +DN +DC++ K+ +  +     L+   +  S   FYYD
Sbjct  239   DTVIKSHDQFIDKKRVFLSEIKDDNPIDCLVIKLKIVPVPSNATLQFKENAKSNCDFYYD  298

Query  653   MEYCVDYSTFRNLPTVQSVNSWDSPSLIDASYKPITAYPVEHFKSCEPSKVELSLLDLYA  474
             M Y + YS+F +LP   +     S ++   +         EH        +E  LLDLY+
Sbjct  299   MMYLLPYSSFLSLPPDSTSPVSSSSTISSDTD---AGEVKEH-------NLEKKLLDLYS  348

Query  473   GCGGMSTGLCLGAKLSGLNLVTKWAVDYQKSACDSLKFNHPETQVRNESVenflkllkew  294
             GCG MSTGLCLGA  +G+ LVTKWAVD  + ACDSL+ NHP TQVRNE   +FL LLKEW
Sbjct  349   GCGAMSTGLCLGANSNGVKLVTKWAVDLNRFACDSLRLNHPGTQVRNEYASDFLSLLKEW  408

Query  293   eklckEYG-----SEPNAGSDDVLEGMEEGaddansladsddsdAEYEILRLVDICFGDP  129
              +LC  +        P+       E  E+  DD +  +  D     +E+  ++++C+GDP
Sbjct  409   VQLCSSFSLVKSNVPPHPHLKVTDEVEEDENDDESEDSGDDKKGEIFEVEEILEVCYGDP  468

Query  128   NDTGKPGIHFQVRWKGYGPSEDTWEPIDGL  39
             N   KPG++F+VRW+GYGP EDTWEPIDGL
Sbjct  469   NAVKKPGLYFKVRWQGYGPEEDTWEPIDGL  498



>ref|XP_011037978.1| PREDICTED: DNA (cytosine-5)-methyltransferase CMT3 isoform X1 
[Populus euphratica]
Length=966

 Score =   211 bits (538),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 150/357 (42%), Positives = 213/357 (60%), Gaps = 21/357 (6%)
 Frame = -2

Query  1022  EEDEVILNVDCHYAQAKVLSFILNIGDCVYVKG-EGEKKHVGRILEFFKTTEGEDYFRVQ  846
             ++ E I+   CHY +A+V   I N+ D  +V+  +GE  ++ RI+E F++ +   +F  Q
Sbjct  218   DDSEEIVKARCHYKRAEVDGIIYNLYDDAHVQASDGEADYICRIIEMFESEDRTPHFTAQ  277

Query  845   WFFRAEDTVMRDAAALHDKKRLFYSTLMNDNLLDCIISKVNVTEISPGLGLEVNNSPPSG  666
             W++R+ DT+++D   L D K +F+S + NDN LDC+  K+ +  ++ G+  E   +    
Sbjct  278   WYYRSTDTIIKDKYIL-DPKCVFFSEIRNDNPLDCLTRKLKIVRLALGVDSETRRAKTLN  336

Query  665   --FYYDMEYCVDYSTFRNLPTVQSVNSWDSPSLIDASYKPITAYPV--EHFKSCEPS---  507
               FY DM Y + YSTF  LP   S N+  +P         I A  V  E  + CE S   
Sbjct  337   CDFYCDMLYLLPYSTFVKLP---SENNTTAPESSSTISSDIDAAGVKFECDEVCETSGRR  393

Query  506   KVELSLLDLYAGCGGMSTGLCLGAKLSGLNLVTKWAVDYQKSACDSLKFNHPETQVRNES  327
             K E++LLDLY+GCG MSTGLCLGA LSGLNLVTKWAVD  K AC+SL+ NHPETQVRNE+
Sbjct  394   KSEVALLDLYSGCGAMSTGLCLGANLSGLNLVTKWAVDLNKHACESLRLNHPETQVRNET  453

Query  326   VenflkllkeweklckEYGSEPNAGS--------DDVLEGMEEGaddansladsddsdAE  171
              E+FL LLKEWEKLC  +    N           D   E  +E  DD N ++D+DD    
Sbjct  454   AEDFLMLLKEWEKLCIRFSLVKNDDPEKQQKYSFDMDDEDEDEDDDDNNDVSDNDDDSDV  513

Query  170   YEILRLVDICFGDPNDT-GKPGIHFQVRWKGYGPSEDTWEPIDGLKSWKNRQGWFTI  3
             +E+ +++++C GDP +  G+  ++F+V WK YGP  DTWEPI GL + +     F +
Sbjct  514   FEVEKILEVCHGDPKEIGGQRDLYFKVSWKNYGPDYDTWEPISGLSNCREAIKKFVV  570



>ref|XP_011037979.1| PREDICTED: DNA (cytosine-5)-methyltransferase CMT3 isoform X2 
[Populus euphratica]
Length=951

 Score =   211 bits (537),  Expect = 4e-57, Method: Compositional matrix adjust.
 Identities = 150/357 (42%), Positives = 213/357 (60%), Gaps = 21/357 (6%)
 Frame = -2

Query  1022  EEDEVILNVDCHYAQAKVLSFILNIGDCVYVKG-EGEKKHVGRILEFFKTTEGEDYFRVQ  846
             ++ E I+   CHY +A+V   I N+ D  +V+  +GE  ++ RI+E F++ +   +F  Q
Sbjct  203   DDSEEIVKARCHYKRAEVDGIIYNLYDDAHVQASDGEADYICRIIEMFESEDRTPHFTAQ  262

Query  845   WFFRAEDTVMRDAAALHDKKRLFYSTLMNDNLLDCIISKVNVTEISPGLGLEVNNSPPSG  666
             W++R+ DT+++D   L D K +F+S + NDN LDC+  K+ +  ++ G+  E   +    
Sbjct  263   WYYRSTDTIIKDKYIL-DPKCVFFSEIRNDNPLDCLTRKLKIVRLALGVDSETRRAKTLN  321

Query  665   --FYYDMEYCVDYSTFRNLPTVQSVNSWDSPSLIDASYKPITAYPV--EHFKSCEPS---  507
               FY DM Y + YSTF  LP   S N+  +P         I A  V  E  + CE S   
Sbjct  322   CDFYCDMLYLLPYSTFVKLP---SENNTTAPESSSTISSDIDAAGVKFECDEVCETSGRR  378

Query  506   KVELSLLDLYAGCGGMSTGLCLGAKLSGLNLVTKWAVDYQKSACDSLKFNHPETQVRNES  327
             K E++LLDLY+GCG MSTGLCLGA LSGLNLVTKWAVD  K AC+SL+ NHPETQVRNE+
Sbjct  379   KSEVALLDLYSGCGAMSTGLCLGANLSGLNLVTKWAVDLNKHACESLRLNHPETQVRNET  438

Query  326   VenflkllkeweklckEYGSEPNAGS--------DDVLEGMEEGaddansladsddsdAE  171
              E+FL LLKEWEKLC  +    N           D   E  +E  DD N ++D+DD    
Sbjct  439   AEDFLMLLKEWEKLCIRFSLVKNDDPEKQQKYSFDMDDEDEDEDDDDNNDVSDNDDDSDV  498

Query  170   YEILRLVDICFGDPNDT-GKPGIHFQVRWKGYGPSEDTWEPIDGLKSWKNRQGWFTI  3
             +E+ +++++C GDP +  G+  ++F+V WK YGP  DTWEPI GL + +     F +
Sbjct  499   FEVEKILEVCHGDPKEIGGQRDLYFKVSWKNYGPDYDTWEPISGLSNCREAIKKFVV  555



>emb|CAJ01708.1| chromomethylase 1 [Hordeum vulgare subsp. vulgare]
Length=735

 Score =   209 bits (532),  Expect = 7e-57, Method: Compositional matrix adjust.
 Identities = 143/321 (45%), Positives = 180/321 (56%), Gaps = 33/321 (10%)
 Frame = -2

Query  980  QAKVLSFILNIGDCVYV-KGEGEKKHVGRILEFFKTTEGEDYFRVQWFFRAEDTVMRDAA  804
            +AKV      +GD VYV  GE E  ++GRI EFF+  +  +YF  +WFFR EDTV+  A 
Sbjct  11   EAKVDDVDYTLGDDVYVMAGENEADYIGRITEFFEGVDKTNYFTCRWFFRPEDTVISRAK  70

Query  803  AL----HDKKRLFYSTLMNDNLLDCIISKVNVTEISPGLGLEVNNSPPSG--FYYDMEYC  642
             +    HD KR+F S   NDN LDCIISKV +  + P           +G   YYDM Y 
Sbjct  71   FVNDHTHDPKRVFLSEEKNDNPLDCIISKVKIIHVDPNTDSVTKAKLVAGTDLYYDMSYS  130

Query  641  VDYSTFRNLPTVQSVNSWDSPSLIDASYKPITAYPVEHFKSCEPSKVELSLLDLYAGCGG  462
            V YSTF N+P+  + NS  S      +  P+                  SLLDLY+GCGG
Sbjct  131  VAYSTFANIPSDTTENSGISTDADSENGTPVKT---------------ASLLDLYSGCGG  175

Query  461  MSTGLCLGAKLSGLNLVTKWAVDYQKSACDSLKFNHPETQVRNESVenflkllkeweklc  282
            MSTGLCLG+ L+GL L TKWAVD    AC SLK+NHP+T+VRNE  E+FL LLKEW  LC
Sbjct  176  MSTGLCLGSALAGLKLETKWAVDLNSFACKSLKYNHPKTEVRNEKAEDFLALLKEWVILC  235

Query  281  kEYGSEPNAGSDDVLEGMEEGaddansladsddsdAEYEILRLVDICFGDPNDTGKPGIH  102
             +Y      G+D       E         D      E+ + +L+ IC+G      K GI+
Sbjct  236  DKYVH----GNDSDAAEPVE-----EEEDDEPLGKDEFVVQKLLGICYG--GSGRKNGIY  284

Query  101  FQVRWKGYGPSEDTWEPIDGL  39
            F+V+WKGYGP EDTWEPI+ L
Sbjct  285  FKVQWKGYGPEEDTWEPIENL  305



>ref|XP_010541913.1| PREDICTED: DNA (cytosine-5)-methyltransferase CMT3 [Tarenaya 
hassleriana]
Length=874

 Score =   207 bits (527),  Expect = 6e-56, Method: Compositional matrix adjust.
 Identities = 143/359 (40%), Positives = 212/359 (59%), Gaps = 17/359 (5%)
 Frame = -2

Query  1031  SADEEDEVILNVDCHYAQAKV---LSFILNIGDCVYVKGEGEKKHVGRILEFFKTTEGED  861
             + ++ +E I+    H+ QA V    ++ L + D     GEGE+ ++ +I+E F++ +G  
Sbjct  111   TKEDHNEDIIQAQRHFRQALVDDSETYDLYV-DAHVEAGEGEEPYICKIVEMFESVDGTL  169

Query  860   YFRVQWFFRAEDTVMRDA-AALHDKKRLFYSTLMNDNLLDCIISKVNVTEISPGLGLEVN  684
             YF  QWF+RA DTV+ +    L D KR+F+S + N N L+C++ K+ +  I      E  
Sbjct  170   YFTAQWFYRACDTVIGNQHTCLIDNKRVFFSEIRNTNPLECLLKKLKILMIPLNASKEAV  229

Query  683   NSPPSGF--YYDMEYCVDYSTFRNLPTVQSVNSWDSPSLIDASYK----PITAYPVEHFK  522
              +    F  Y +M Y + YSTF +LP    + + DS ++           + +   E  +
Sbjct  230   MASGETFDYYCNMRYLLPYSTFVSLPPDVKMAASDSSTISSDIDANGATDVKSDQEEVSQ  289

Query  521   SCEPSKVELSLLDLYAGCGGMSTGLCLGAKLSGLNLVTKWAVDYQKSACDSLKFNHPETQ  342
               +P + E++LLDLY+GCG MSTGLC GA+LSGLNLVT+WAVD  + AC SLKFNHPETQ
Sbjct  290   VAQPQRSEVTLLDLYSGCGAMSTGLCFGAQLSGLNLVTRWAVDLNEYACHSLKFNHPETQ  349

Query  341   VRNESVenflkllkeweklckEYGSEP--NAGSDDVLEGMEEGaddansladsddsdAE-  171
             VRNES E FL LLKEWEKLC  +G     +   D  L G+ +   D +   D +  + + 
Sbjct  350   VRNESAEYFLFLLKEWEKLCIYFGLRKCDDPEEDSNLYGLNDCETDEDEDVDDESGNEDG  409

Query  170   ---YEILRLVDICFGDPNDTGKPGIHFQVRWKGYGPSEDTWEPIDGLKSWKNRQGWFTI  3
                +E+ +++DIC+GDP    K G++ +VRWK YGPS D+WEPI+GL + + R   F +
Sbjct  410   GEIFEVEKILDICYGDPKGIKKCGLYLKVRWKKYGPSYDSWEPIEGLSNCRERIKEFVV  468



>emb|CAA16759.1| putative protein [Arabidopsis thaliana]
 emb|CAB78904.1| putative protein [Arabidopsis thaliana]
Length=1171

 Score =   209 bits (532),  Expect = 7e-56, Method: Compositional matrix adjust.
 Identities = 130/274 (47%), Positives = 179/274 (65%), Gaps = 3/274 (1%)
 Frame = -2

Query  854  RVQWFFRAEDTVMRDAAALHDKKRLFYSTLMNDNLLDCIISKVNVTEISPGLGLEVNNSP  675
            R+Q  ++    +M   A  HDK+RLFYST+MNDN +DC+ISKV V ++SP +GL+ N S 
Sbjct  559  RIQCVYKFFSFIMERQATNHDKRRLFYSTVMNDNPVDCLISKVTVLQVSPRVGLKPN-SI  617

Query  674  PSGFYYDMEYCVDYSTFRNLPTVQSVNSWDSPSLIDASYKPITAYPVEHFKSCEPSKVEL  495
             S +Y+DMEYCV+YSTF+ L   +  +S  S + ++     +     E     +    EL
Sbjct  618  KSDYYFDMEYCVEYSTFQTLRN-RKCSSKTSENKLECCADVVPTESTESILKKKSFSGEL  676

Query  494  SLLDLYAGCGGMSTGLCLGAKLSGLNLVTKWAVDYQKSACDSLKFNHPETQVRNESVenf  315
             +LDLY+GCGGMSTGL LGAK+SG+++VTKWAVD   +AC SLK NHP TQVRN++  +F
Sbjct  677  PVLDLYSGCGGMSTGLSLGAKISGVDVVTKWAVDQNTAACKSLKLNHPNTQVRNDAAGDF  736

Query  314  lkllkeweklckEYGSEPNAGSDDVLE-GMEEGaddansladsddsdAEYEILRLVDICF  138
            L+LLKEW+KLCK Y    +  +D +      +    ++S +D D    EYE+ +LVDICF
Sbjct  737  LQLLKEWDKLCKRYVFNNDQRTDTLRSVNSTKETSGSSSSSDDDSDSEEYEVEKLVDICF  796

Query  137  GDPNDTGKPGIHFQVRWKGYGPSEDTWEPIDGLK  36
            GD + TGK G+ F+V WKGY   EDTWE  + L+
Sbjct  797  GDHDKTGKNGLKFKVHWKGYRSDEDTWELAEELR  830



>gb|AAK69757.1|AF383171_1 chromomethylase CMT2 [Arabidopsis thaliana]
Length=1244

 Score =   207 bits (527),  Expect = 4e-55, Method: Compositional matrix adjust.
 Identities = 132/269 (49%), Positives = 176/269 (65%), Gaps = 5/269 (2%)
 Frame = -2

Query  854  RVQWFFRAEDTVMRDAAALHDKKRLFYSTLMNDNLLDCIISKVNVTEISPGLGLEVNNSP  675
            R+Q  ++    +M   A  HDK+RLFYST+MNDN +DC+ISKV V ++SP  GL+ N S 
Sbjct  559  RIQCVYKFFSFIMERQATNHDKRRLFYSTVMNDNPVDCLISKVTVLQVSPRAGLKPN-SI  617

Query  674  PSGFYYDMEYCVDYSTFRNLPTVQSVNSWDSPSLIDASYKPITAYPVEHFKSCEPSKVEL  495
             S +Y+DMEYCV+YSTF+ L   +  +S  S + ++     +     E     +    EL
Sbjct  618  KSDYYFDMEYCVEYSTFQTLRN-RKCSSKTSENKLECWADVVPTESTESILKKKSFSGEL  676

Query  494  SLLDLYAGCGGMSTGLCLGAKLSGLNLVTKWAVDYQKSACDSLKFNHPETQVRNESVenf  315
             +LDLY+GCGGMSTGL LGAK+SG+++VTKWAVD   +AC SLK NHP TQVRN++  +F
Sbjct  677  PVLDLYSGCGGMSTGLSLGAKISGVDVVTKWAVDQNTAACKSLKLNHPNTQVRNDAAGDF  736

Query  314  lkllkeweklckEYGSEPNAGSDDVLEGMEEGadd--ansladsddsdAEYEILRLVDIC  141
            L+LLKEW+KLCK Y    N    D L  +    +   ++S +D D    EYE+ +LVDIC
Sbjct  737  LQLLKEWDKLCKRYVFN-NDQRTDTLRSVNSTKETSESSSSSDDDSDSEEYEVEKLVDIC  795

Query  140  FGDPNDTGKPGIHFQVRWKGYGPSEDTWE  54
            FGDP+ TGK G+ F+V WKGY   EDTWE
Sbjct  796  FGDPDKTGKNGLKFKVHWKGYRSDEDTWE  824



>ref|XP_007014767.1| Chromomethylase 3, putative isoform 2 [Theobroma cacao]
 gb|EOY32386.1| Chromomethylase 3, putative isoform 2 [Theobroma cacao]
Length=708

 Score =   203 bits (517),  Expect = 5e-55, Method: Compositional matrix adjust.
 Identities = 125/291 (43%), Positives = 174/291 (60%), Gaps = 8/291 (3%)
 Frame = -2

Query  887  FFKTTEGEDYFRVQWFFRAEDTVMRDAAALHDKKRLFYSTLMNDNLLDCIISKVNVTEIS  708
             F+  +G  YF  QWF+RA DTVM+    L DKKR+F+S + +DN LDC++ K+ + ++S
Sbjct  1    MFEAVDGTLYFTAQWFYRARDTVMKKLGHLIDKKRVFFSEIRDDNPLDCLVEKLIIAKVS  60

Query  707  PGLGLEVNNS--PPSGFYYDMEYCVDYSTFRNLPTVQSVNSWDSPSLIDA----SYKPIT  546
              + LE      P   +Y DM Y + YS+F NLP     N  ++ S I      S     
Sbjct  61   LNVDLEAKKKMIPCCDYYCDMLYLLPYSSFINLPPEDKTNCSEASSTISTDDVNSVNEEK  120

Query  545  AYPVEHFKSCEPSKVELSLLDLYAGCGGMSTGLCLGAKLSGLNLVTKWAVDYQKSACDSL  366
            +   E  ++    K +++LLDLY+GCG MSTGLCLGA ++GL L T+WAVD  K  C+SL
Sbjct  121  SQYEEASQASNNKKSQVTLLDLYSGCGAMSTGLCLGANMAGLKLETRWAVDLNKYGCESL  180

Query  365  KFNHPETQVRNESVenflkllkeweklckEYG--SEPNAGSDDVLEGMEEGaddanslad  192
            K+NHPET+VRNES E+FL LLKEWE+LC  +      N           E   D +   +
Sbjct  181  KWNHPETEVRNESAEDFLALLKEWERLCVLFSLLKSENLEKQSFNPFRTEDDGDDDDNEE  240

Query  191  sddsdAEYEILRLVDICFGDPNDTGKPGIHFQVRWKGYGPSEDTWEPIDGL  39
             D     +E+ +++ IC+GDP   G+ G+HFQVRWK YG  EDTWEP++G+
Sbjct  241  DDTEGDVFEVEKILAICYGDPKKKGERGLHFQVRWKNYGLEEDTWEPLEGM  291



>ref|XP_008226363.1| PREDICTED: DNA (cytosine-5)-methyltransferase CMT3 [Prunus mume]
Length=869

 Score =   204 bits (519),  Expect = 7e-55, Method: Compositional matrix adjust.
 Identities = 146/370 (39%), Positives = 215/370 (58%), Gaps = 38/370 (10%)
 Frame = -2

Query  1019  EDEVILNVDCHYAQAKVLSF-ILNIGDCVYVK-GEGEKKHVGRILEFFKTTEGEDYFRVQ  846
             +DE  +    HY +A+V    I ++ D  +V+ G+G + +V +I+E F+  +G  YF  Q
Sbjct  101   QDEDAIQARGHYIKAEVDGRNIFDLYDDAHVQAGDGNEPYVCKIVEMFEAIDGTLYFTAQ  160

Query  845   WFFRAEDTVMRDAAALHDKKRLFYSTLMNDNLLDCIISKVNVTEISPGLGLEVNNSPPSG  666
             W++R+ DTV+++ A + D++R+F S + + N LDC++ K+N+  +S    L V+ +  S 
Sbjct  161   WYYRSPDTVIKECATI-DRRRVFLSEIQDVNPLDCLVEKLNIVRLS----LNVDQNEKSK  215

Query  665   ------FYYDMEYCVDYSTFRNLPTVQSVNSWDSPSLIDASYKPITAYPVEHF-----KS  519
                   ++ D  Y + YSTF NLP  +++ +    S I +      A  V        K+
Sbjct  216   LISTCKYFCDTTYLLPYSTFMNLPE-ENIQTGSDDSTISSEADVDRACEVNSEGADVDKA  274

Query  518   C-------------EPSKVELSLLDLYAGCGGMSTGLCLGAKLSGLNLVTKWAVDYQKSA  378
             C             E  K E++LLDLY+GCG MSTGLCLGA+LS +NLVT+WAVD  + A
Sbjct  275   CQVNSKVAQLCPVRECGKPEVTLLDLYSGCGAMSTGLCLGAQLSNVNLVTRWAVDVNEYA  334

Query  377   CDSLKFNHPETQVRNESVenflkllkeweklckEYG------SEPNAGSDDVLEGMEEGa  216
             C SLK NHPET+VRNES E+FL LLKEW KLC  +       SE +       E  EE  
Sbjct  335   CQSLKLNHPETEVRNESAEDFLSLLKEWRKLCFYFNLVETKDSENDQFDFFETEDEEEEE  394

Query  215   ddansladsddsdAEYEILRLVDICFGDPNDTGKPGIHFQVRWKGYGPSEDTWEPIDGLK  36
             D  +   ++D  D E+E+  ++++C+GDPN   K G++F++RWKGYG  EDTWEPIDGL 
Sbjct  395   DGDSGNDENDSDDPEFEVDYVLEVCYGDPNKINKRGLYFKIRWKGYGDDEDTWEPIDGLG  454

Query  35    SWKNRQGWFT  6
               +   G F 
Sbjct  455   HCRKAIGDFV  464



>ref|XP_004513047.1| PREDICTED: DNA (cytosine-5)-methyltransferase CMT3-like isoform 
X2 [Cicer arietinum]
Length=863

 Score =   204 bits (518),  Expect = 9e-55, Method: Compositional matrix adjust.
 Identities = 141/349 (40%), Positives = 205/349 (59%), Gaps = 15/349 (4%)
 Frame = -2

Query  1028  ADEEDEVILNVDCHYAQAKVLS-FILNIGDCVYVKGE-GEKKHVGRILEFFKTTEGEDYF  855
             ++ +DE IL    HY +A++    I  + D  +VKGE G + ++ +I+E F+  +G  YF
Sbjct  106   SNSDDEEILQARHHYTEAEIDGCTIYKLNDDAHVKGEEGGENYICKIVEMFEAVDGGLYF  165

Query  854   RVQWFFRAEDTVMRDAAALHDKKRLFYSTLMNDNLLDCIISKVNVTEISPGLGLEVNNS-  678
               QW++RA+DTV+++   L + KR+F+S + +DN LDC++ K+N+  +   +  +     
Sbjct  166   TAQWYYRAKDTVIQNLGHLIEPKRVFFSEVQDDNPLDCLVEKLNIARLPLNVNFDAKKKV  225

Query  677   -PPSGFYYDMEYCVDYSTFRNLPTVQSVNSWDSPSLIDA-----SYKPITAYPVEHFKSC  516
              PP  +Y D  Y + YSTF  LP+       +S S I +         + +     F S 
Sbjct  226   IPPCDYYCDTLYLLPYSTFVKLPSESKEGGSESSSTISSEIEVNGRSEVNSKIGNTFHSE  285

Query  515   EPSKVELSLLDLYAGCGGMSTGLCLGAKLSGLNLVTKWAVDYQKSACDSLKFNHPETQVR  336
             E  + EL LLDLY+GCG MSTGLC G  LSG N+VT+WAVD  + AC SLK NHPET+VR
Sbjct  286   ESKEPELKLLDLYSGCGAMSTGLCQGGILSGSNIVTRWAVDLNEHACKSLKLNHPETEVR  345

Query  335   NESVenflkllkeweklckEY----GSEPNAGSDDVLEGMEEGaddansladsddsdAEY  168
             NE+ ENFL LLKEWEKLC  +       P+    D+    EE  DD     D++D +  +
Sbjct  346   NETAENFLSLLKEWEKLCSYFSLVQNKVPHKEYVDLFNAEEEEDDDTGGEEDNNDEEV-F  404

Query  167   EILRLVDICFGDPNDTGKPGIHFQVRWKGYGPSEDTWEPIDGLKSWKNR  21
             E+  ++ + +GDP    KPG++ +V WKGYG   D+WEPIDGL + K R
Sbjct  405   EVSEVLAVRYGDPK-KNKPGLYLKVSWKGYGSDADSWEPIDGLSNCKER  452



>ref|XP_004513046.1| PREDICTED: DNA (cytosine-5)-methyltransferase CMT3-like isoform 
X1 [Cicer arietinum]
Length=864

 Score =   204 bits (518),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 142/350 (41%), Positives = 204/350 (58%), Gaps = 15/350 (4%)
 Frame = -2

Query  1031  SADEEDEVILNVDCHYAQAKVLS-FILNIGDCVYVKGE-GEKKHVGRILEFFKTTEGEDY  858
             S   +DE IL    HY +A++    I  + D  +VKGE G + ++ +I+E F+  +G  Y
Sbjct  106   SNSSDDEEILQARHHYTEAEIDGCTIYKLNDDAHVKGEEGGENYICKIVEMFEAVDGGLY  165

Query  857   FRVQWFFRAEDTVMRDAAALHDKKRLFYSTLMNDNLLDCIISKVNVTEISPGLGLEVNNS  678
             F  QW++RA+DTV+++   L + KR+F+S + +DN LDC++ K+N+  +   +  +    
Sbjct  166   FTAQWYYRAKDTVIQNLGHLIEPKRVFFSEVQDDNPLDCLVEKLNIARLPLNVNFDAKKK  225

Query  677   --PPSGFYYDMEYCVDYSTFRNLPTVQSVNSWDSPSLIDA-----SYKPITAYPVEHFKS  519
               PP  +Y D  Y + YSTF  LP+       +S S I +         + +     F S
Sbjct  226   VIPPCDYYCDTLYLLPYSTFVKLPSESKEGGSESSSTISSEIEVNGRSEVNSKIGNTFHS  285

Query  518   CEPSKVELSLLDLYAGCGGMSTGLCLGAKLSGLNLVTKWAVDYQKSACDSLKFNHPETQV  339
              E  + EL LLDLY+GCG MSTGLC G  LSG N+VT+WAVD  + AC SLK NHPET+V
Sbjct  286   EESKEPELKLLDLYSGCGAMSTGLCQGGILSGSNIVTRWAVDLNEHACKSLKLNHPETEV  345

Query  338   RNESVenflkllkeweklckEY----GSEPNAGSDDVLEGMEEGaddansladsddsdAE  171
             RNE+ ENFL LLKEWEKLC  +       P+    D+    EE  DD     D++D +  
Sbjct  346   RNETAENFLSLLKEWEKLCSYFSLVQNKVPHKEYVDLFNAEEEEDDDTGGEEDNNDEEV-  404

Query  170   YEILRLVDICFGDPNDTGKPGIHFQVRWKGYGPSEDTWEPIDGLKSWKNR  21
             +E+  ++ + +GDP    KPG++ +V WKGYG   D+WEPIDGL + K R
Sbjct  405   FEVSEVLAVRYGDPK-KNKPGLYLKVSWKGYGSDADSWEPIDGLSNCKER  453



>ref|XP_010470978.1| PREDICTED: DNA (cytosine-5)-methyltransferase CMT3-like isoform 
X2 [Camelina sativa]
Length=830

 Score =   203 bits (517),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 140/350 (40%), Positives = 206/350 (59%), Gaps = 11/350 (3%)
 Frame = -2

Query  1025  DEEDEVILNVDCHYAQAKV-LSFILNIGDCVYVK-GEGEKKHVGRILEFFKTTEGEDYFR  852
             D++ E I+   CH+ +A V  S    + D  YV+ GEG   ++ +I+E F+   G+ YF 
Sbjct  86    DDDVEEIIRARCHFRRAIVDESITYELNDDAYVQAGEGNAPYICKIVEMFEGANGKLYFA  145

Query  851   VQWFFRAEDTVMRDAAALHDKKRLFYSTLMNDNLLDCIISKVNVTEIS--PGLGLEVNNS  678
              QWF+RA DTV+ +  AL  +KR+F+S + + N L  ++ K+ +  IS        +  +
Sbjct  146   AQWFYRASDTVIGNLNALISEKRVFFSKVRDTNELGTLVKKLEILMISLNENTTETIAAT  205

Query  677   PPSGFYYDMEYCVDYSTFRNLP--TVQSVNSWDSPSLIDASYKPITAYPVEHFKSCEP--  510
                 +Y DM Y + YSTF      T+ +++   + S  D      TA   E  ++ +   
Sbjct  206   KNCDYYCDMNYLLPYSTFEAFQEDTMMAISESSTIS-SDNDVNGGTAVISEDDETSQANG  264

Query  509   SKVELSLLDLYAGCGGMSTGLCLGAKLSGLNLVTKWAVDYQKSACDSLKFNHPETQVRNE  330
             +K E  LLDLY GCG MSTGLC+GAKL+GLNLVTKWAVD    AC SL+ NHPETQVRN 
Sbjct  265   AKREARLLDLYCGCGAMSTGLCMGAKLAGLNLVTKWAVDMNAHACKSLEHNHPETQVRNM  324

Query  329   SVenflkllkeweklckEYGSE--PNAGSDDVLEGMEEGaddansladsddsdAEYEILR  156
             S E+FL LLKEWEKLC  +     PN+   + L GM++  +D +  ++++D    + + +
Sbjct  325   SAEDFLLLLKEWEKLCIHFSLRKCPNSEEYNNLYGMDDEDEDDSKESENEDDGEVFTVAK  384

Query  155   LVDICFGDPNDTGKPGIHFQVRWKGYGPSEDTWEPIDGLKSWKNRQGWFT  6
             ++ I FGDP +  K G++ +VRW GY PS DTWEPI+GL + + +   F 
Sbjct  385   IIGITFGDPKNIKKSGLYLKVRWLGYAPSHDTWEPIEGLSNCREKIKEFV  434



>gb|AAC02667.1| chromomethylase [Arabidopsis thaliana]
Length=560

 Score =   200 bits (509),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 138/349 (40%), Positives = 201/349 (58%), Gaps = 22/349 (6%)
 Frame = -2

Query  1022  EEDEVILNVDCHYAQAKVLSFILNIGDCVYVKG-EGEKKHVGRILEFFKTTEGEDYFRVQ  846
             E++E+I    CH+ +A V   ++N+ D VYV G  G+ K + +++E F+  +G  Y R +
Sbjct  59    EDEEIIKQAKCHFDKALVDGVLINLNDDVYVTGLPGKLKFIAKVIELFEADDGVPYCRFR  118

Query  845   WFFRAEDTVMRDAAALHDKKRLFYSTLMNDNLLDCIISKVNVTEIS-PGLGLEVNNS--P  675
             W++R EDT++   + L   KR+F S   NDN L CI SKVN+ ++  P +   +     P
Sbjct  119   WYYRPEDTLIERFSHLVQPKRVFLSNDENDNPLTCIWSKVNIAKVPLPKITSRIEQRVIP  178

Query  674   PSGFYYDMEYCVDYSTFRNLPTVQSVNSWDSPSLIDASYKPITAYPVEHFKSCEPSKVEL  495
             P  +YYDM+Y V Y  F       S +     S   +S   +  +   H       K E 
Sbjct  179   PCDYYYDMKYEVPYLNF------TSTDDGSDASSSLSSDSALNCFENLH-------KDEK  225

Query  494   SLLDLYAGCGGMSTGLCLGAKLSGLNLVTKWAVDYQKSACDSLKFNHPETQVRNESVenf  315
              LLDLY+GCG MSTG C+GA +SG+ L+TKW+VD  K ACDSLK NHPET+VRNE+ E+F
Sbjct  226   FLLDLYSGCGAMSTGFCMGASISGVKLITKWSVDINKFACDSLKLNHPETEVRNEAAEDF  285

Query  314   lkllkeweklckEY----GSEP-NAGSDDVLEGMEEGaddansladsddsdAEYEILRLV  150
             L LLKEW++LC+++     +EP  + S+   E +EE  D   +   ++    E+E+ + +
Sbjct  286   LALLKEWKRLCEKFSLVSSTEPVESISELEDEEVEENDDIDEASTGAELEPGEFEVEKFL  345

Query  149   DICFGDPNDTGKPGIHFQVRWKGYGPSEDTWEPIDGLKSWKNRQGWFTI  3
              I FGDP  TG+  +   VRWKGY  S DTWEP  GL + K +   + I
Sbjct  346   GIMFGDPQGTGEKTLQLMVRWKGYNSSYDTWEPYSGLGNCKEKLKEYVI  394



>gb|AAC02665.1| chromomethylase [Arabidopsis thaliana]
 gb|AAC02668.1| chromomethylase [Arabidopsis thaliana]
Length=560

 Score =   200 bits (509),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 136/349 (39%), Positives = 200/349 (57%), Gaps = 22/349 (6%)
 Frame = -2

Query  1022  EEDEVILNVDCHYAQAKVLSFILNIGDCVYVKG-EGEKKHVGRILEFFKTTEGEDYFRVQ  846
             E++E+I    CH+ +A V   ++N+ D VYV G  G+ K + +++E F+  +G  Y R +
Sbjct  59    EDEEIIKQAKCHFDKALVDGVLINLNDDVYVTGLPGKLKFIAKVIELFEADDGVPYCRFR  118

Query  845   WFFRAEDTVMRDAAALHDKKRLFYSTLMNDNLLDCIISKVNVTEIS-PGLGLEVNNS--P  675
             W++R EDT++   + L   KR+F S   NDN L CI SKVN+ ++  P +   +     P
Sbjct  119   WYYRPEDTLIERFSHLVQPKRVFLSNDENDNPLTCIWSKVNIAKVPLPKITSRIEQRVIP  178

Query  674   PSGFYYDMEYCVDYSTFRNLPTVQSVNSWDSPSLIDASYKPITAYPVEHFKSCEPSKVEL  495
             P  +YYDM+Y V Y  F +       +S  S       ++ +              K E 
Sbjct  179   PCDYYYDMKYEVPYLNFTSADDGSDASSSLSSDSALNCFENL-------------HKDEK  225

Query  494   SLLDLYAGCGGMSTGLCLGAKLSGLNLVTKWAVDYQKSACDSLKFNHPETQVRNESVenf  315
              LLDLY+GCG MSTG C+GA +SG+ L+TKW+VD  K ACDSLK NHPET+VRNE+ E+F
Sbjct  226   FLLDLYSGCGAMSTGFCMGASISGVKLITKWSVDINKFACDSLKLNHPETEVRNEAAEDF  285

Query  314   lkllkeweklckEY----GSEP-NAGSDDVLEGMEEGaddansladsddsdAEYEILRLV  150
             L LLKEW++LC+++     +EP  + S+   E +EE  D   +   ++    E+E+ + +
Sbjct  286   LALLKEWKRLCEKFSLVSSTEPVESISELEDEEVEENDDIDEASTGAELEPGEFEVEKFL  345

Query  149   DICFGDPNDTGKPGIHFQVRWKGYGPSEDTWEPIDGLKSWKNRQGWFTI  3
              I FGDP  TG+  +   VRWKGY  S DTWEP  GL + K +   + I
Sbjct  346   GIMFGDPQGTGEKTLQLMVRWKGYNSSYDTWEPYSGLGNCKEKLKEYVI  394



>ref|XP_010470977.1| PREDICTED: DNA (cytosine-5)-methyltransferase CMT3-like isoform 
X1 [Camelina sativa]
Length=831

 Score =   203 bits (517),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 140/350 (40%), Positives = 206/350 (59%), Gaps = 11/350 (3%)
 Frame = -2

Query  1025  DEEDEVILNVDCHYAQAKV-LSFILNIGDCVYVK-GEGEKKHVGRILEFFKTTEGEDYFR  852
             D++ E I+   CH+ +A V  S    + D  YV+ GEG   ++ +I+E F+   G+ YF 
Sbjct  86    DDDVEEIIRARCHFRRAIVDESITYELNDDAYVQAGEGNAPYICKIVEMFEGANGKLYFA  145

Query  851   VQWFFRAEDTVMRDAAALHDKKRLFYSTLMNDNLLDCIISKVNVTEIS--PGLGLEVNNS  678
              QWF+RA DTV+ +  AL  +KR+F+S + + N L  ++ K+ +  IS        +  +
Sbjct  146   AQWFYRASDTVIGNLNALISEKRVFFSKVRDTNELGTLVKKLEILMISLNENTTETIAAT  205

Query  677   PPSGFYYDMEYCVDYSTFRNLP--TVQSVNSWDSPSLIDASYKPITAYPVEHFKSCEP--  510
                 +Y DM Y + YSTF      T+ +++   + S  D      TA   E  ++ +   
Sbjct  206   KNCDYYCDMNYLLPYSTFEAFQEDTMMAISESSTIS-SDNDVNGGTAVISEDDETSQANG  264

Query  509   SKVELSLLDLYAGCGGMSTGLCLGAKLSGLNLVTKWAVDYQKSACDSLKFNHPETQVRNE  330
             +K E  LLDLY GCG MSTGLC+GAKL+GLNLVTKWAVD    AC SL+ NHPETQVRN 
Sbjct  265   AKREARLLDLYCGCGAMSTGLCMGAKLAGLNLVTKWAVDMNAHACKSLEHNHPETQVRNM  324

Query  329   SVenflkllkeweklckEYGSE--PNAGSDDVLEGMEEGaddansladsddsdAEYEILR  156
             S E+FL LLKEWEKLC  +     PN+   + L GM++  +D +  ++++D    + + +
Sbjct  325   SAEDFLLLLKEWEKLCIHFSLRKCPNSEEYNNLYGMDDEDEDDSKESENEDDGEVFTVAK  384

Query  155   LVDICFGDPNDTGKPGIHFQVRWKGYGPSEDTWEPIDGLKSWKNRQGWFT  6
             ++ I FGDP +  K G++ +VRW GY PS DTWEPI+GL + + +   F 
Sbjct  385   IIGITFGDPKNIKKSGLYLKVRWLGYAPSHDTWEPIEGLSNCREKIKEFV  434



>ref|XP_009781266.1| PREDICTED: DNA (cytosine-5)-methyltransferase CMT3-like isoform 
X3 [Nicotiana sylvestris]
Length=871

 Score =   201 bits (512),  Expect = 5e-54, Method: Compositional matrix adjust.
 Identities = 125/339 (37%), Positives = 176/339 (52%), Gaps = 56/339 (17%)
 Frame = -2

Query  1025  DEEDEVILNVDCHYAQAKVLSFILNIGDCVYVKGEG-EKKHVGRILEFFKTTEGEDYFRV  849
             D+ D++I    CH+AQA V   I N+GD  YV+    E  ++ +I+EFF+  +G  YF  
Sbjct  173   DDADQLI-QAKCHFAQAVVDGQIYNLGDDAYVQASNDEDDYICKIVEFFQAVDGMQYFTA  231

Query  848   QWFFRAEDTVMRDAAALHDKKRLFYSTLMNDNLLDCIISKVNVTEISPGLGLEVNNS--P  675
             QWF+RA+DTV++      + KR+F+S + +DN L C++ K+ +  I   + L +  S   
Sbjct  232   QWFYRAKDTVIKAHDQFINNKRVFFSEIKDDNPLGCLVKKIKIVPIPSNVRLPLKESLRS  291

Query  674   PSGFYYDMEYCVDYSTFRNLPTVQSVNSWDSPSLIDASYKPITAYPVEHFKSCEPSKVEL  495
              S +YYDM Y + YS+F +LP                                       
Sbjct  292   NSDYYYDMMYLLPYSSFVSLPQ--------------------------------------  313

Query  494   SLLDLYAGCGGMSTGLCLGAKLSGLNLVTKWAVDYQKSACDSLKFNHPETQVRNES----  327
                    GCG MSTGLCLGA + G+ LVTKWAVD  + ACDSLK+NHPET VRNES    
Sbjct  314   -------GCGAMSTGLCLGADIGGVKLVTKWAVDLNQYACDSLKWNHPETAVRNESADDF  366

Query  326   VenflkllkeweklckEYGSEPNAGSDDVLEGMEEGaddansladsddsdAEYEIL---R  156
             +    +  +          + P      V +  EE  +D     +    D + EI     
Sbjct  367   LLLLREWRQLCASCSLLRNNTPTHPFLKVRDEDEEDNNDNGDEDEGSGDDEQGEIFEVEE  426

Query  155   LVDICFGDPNDTGKPGIHFQVRWKGYGPSEDTWEPIDGL  39
             L++IC+GDP +  KPG++F+VRWKGYG  EDTWEPI+GL
Sbjct  427   LLEICYGDPKEINKPGLYFKVRWKGYGQEEDTWEPIEGL  465



>gb|AAC02670.1| chromomethylase [Arabidopsis suecica]
Length=754

 Score =   200 bits (509),  Expect = 8e-54, Method: Compositional matrix adjust.
 Identities = 136/349 (39%), Positives = 200/349 (57%), Gaps = 22/349 (6%)
 Frame = -2

Query  1022  EEDEVILNVDCHYAQAKVLSFILNIGDCVYVKG-EGEKKHVGRILEFFKTTEGEDYFRVQ  846
             E++E+I    CH+ +A V   ++N+ D VYV G  G+ K + +++E F+  +G  Y R +
Sbjct  59    EDEEIIKQAKCHFDKALVDGVLINLNDDVYVTGLPGKLKFIAKVIELFEADDGVPYCRFR  118

Query  845   WFFRAEDTVMRDAAALHDKKRLFYSTLMNDNLLDCIISKVNVTEIS-PGLGLEVNNS--P  675
             W++R EDT++   + L   KR+F S   NDN L CI SKVN+ ++  P +   +     P
Sbjct  119   WYYRPEDTLIERFSHLVQPKRVFLSNDENDNPLTCIWSKVNIAKVPLPKITSRIEQRVIP  178

Query  674   PSGFYYDMEYCVDYSTFRNLPTVQSVNSWDSPSLIDASYKPITAYPVEHFKSCEPSKVEL  495
             P  +YYDM+Y V Y  F +       +S  S       ++ +              K E 
Sbjct  179   PCDYYYDMKYEVPYLNFTSADDGSDASSSLSSDSALNCFENL-------------HKDEK  225

Query  494   SLLDLYAGCGGMSTGLCLGAKLSGLNLVTKWAVDYQKSACDSLKFNHPETQVRNESVenf  315
              LLDLY+GCG MSTG C+GA +SG+ L+TKW+VD  K ACDSLK NHPET+VRNE+ E+F
Sbjct  226   FLLDLYSGCGAMSTGFCMGASISGVKLITKWSVDINKFACDSLKLNHPETEVRNEAAEDF  285

Query  314   lkllkeweklckEY----GSEP-NAGSDDVLEGMEEGaddansladsddsdAEYEILRLV  150
             L LLKEW++LC+++     +EP  + S+   E +EE  D   +   ++    E+E+ + +
Sbjct  286   LALLKEWKRLCEKFSLVSSTEPVESISELEDEEVEENDDIDEASTGAELEPGEFEVEKFL  345

Query  149   DICFGDPNDTGKPGIHFQVRWKGYGPSEDTWEPIDGLKSWKNRQGWFTI  3
              I FGDP  TG+  +   VRWKGY  S DTWEP  GL + K +   + I
Sbjct  346   GIMFGDPQGTGEKTLQLMVRWKGYNSSYDTWEPYSGLGNCKEKLKEYVI  394



>gb|AAC02662.1| chromomethylase [Arabidopsis thaliana]
Length=754

 Score =   200 bits (509),  Expect = 9e-54, Method: Compositional matrix adjust.
 Identities = 136/349 (39%), Positives = 200/349 (57%), Gaps = 22/349 (6%)
 Frame = -2

Query  1022  EEDEVILNVDCHYAQAKVLSFILNIGDCVYVKG-EGEKKHVGRILEFFKTTEGEDYFRVQ  846
             E++E+I    CH+ +A V   ++N+ D VYV G  G+ K + +++E F+  +G  Y R +
Sbjct  59    EDEEIIKQAKCHFDKALVDGVLINLNDDVYVTGLPGKLKFIAKVIELFEADDGVPYCRFR  118

Query  845   WFFRAEDTVMRDAAALHDKKRLFYSTLMNDNLLDCIISKVNVTEIS-PGLGLEVNNS--P  675
             W++R EDT++   + L   KR+F S   NDN L CI SKVN+ ++  P +   +     P
Sbjct  119   WYYRPEDTLIERFSHLVQPKRVFLSNDENDNPLTCIWSKVNIAKVPLPKITSRIEQRVIP  178

Query  674   PSGFYYDMEYCVDYSTFRNLPTVQSVNSWDSPSLIDASYKPITAYPVEHFKSCEPSKVEL  495
             P  +YYDM+Y V Y  F +       +S  S       ++ +              K E 
Sbjct  179   PCDYYYDMKYEVPYLNFTSADDGSDASSSLSSDSALNCFENL-------------HKDEK  225

Query  494   SLLDLYAGCGGMSTGLCLGAKLSGLNLVTKWAVDYQKSACDSLKFNHPETQVRNESVenf  315
              LLDLY+GCG MSTG C+GA +SG+ L+TKW+VD  K ACDSLK NHPET+VRNE+ E+F
Sbjct  226   FLLDLYSGCGAMSTGFCMGASISGVKLITKWSVDINKFACDSLKLNHPETEVRNEAAEDF  285

Query  314   lkllkeweklckEY----GSEP-NAGSDDVLEGMEEGaddansladsddsdAEYEILRLV  150
             L LLKEW++LC+++     +EP  + S+   E +EE  D   +   ++    E+E+ + +
Sbjct  286   LALLKEWKRLCEKFSLVSSTEPVESISELEDEEVEENDDIDEASTGAELEPGEFEVEKFL  345

Query  149   DICFGDPNDTGKPGIHFQVRWKGYGPSEDTWEPIDGLKSWKNRQGWFTI  3
              I FGDP  TG+  +   VRWKGY  S DTWEP  GL + K +   + I
Sbjct  346   GIMFGDPQGTGEKTLQLMVRWKGYNSSYDTWEPYSGLGNCKEKLKEYVI  394



>emb|CBI16477.3| unnamed protein product [Vitis vinifera]
Length=821

 Score =   201 bits (510),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 104/247 (42%), Positives = 149/247 (60%), Gaps = 24/247 (10%)
 Frame = -2

Query  1052  IWHTCFCSADEEDEVILNVDCHYAQAKV-LSFILNIGDCVYVK-GEGEKKHVGRILEFFK  879
             ++   FCS  ++ E I+   CHY QA++    I+N+ D  +VK G+    ++ +I+E F 
Sbjct  35    VYRNWFCSTKDDSEEIVKARCHYRQAEIDGRVIVNLNDDAHVKAGDNADHYICKIVELFV  94

Query  878   TTEGEDYFRVQWFFRAEDTVMRDAAALHDKKRLFYSTLMNDNLLDCIISKVNVTEISPGL  699
               +G  YF  QWF+RA DTV++D A L D KR+F+S + +DN LDC++ K+N+  +   L
Sbjct  95    ALDGTPYFTAQWFYRARDTVIKDHANLIDNKRVFFSEMRDDNPLDCLVQKLNIARVPHNL  154

Query  698   GLEVNNSPPSG--FYYDMEYCVDYSTFRNLPTVQSVNSWDSPSLIDASYKPITAYPVEHF  525
              LE      S   +YYDM Y +DYS+F  LP   +                      E  
Sbjct  155   DLEARKLAISSCDYYYDMLYLLDYSSFIKLPPENNSE--------------------EVS  194

Query  524   KSCEPSKVELSLLDLYAGCGGMSTGLCLGAKLSGLNLVTKWAVDYQKSACDSLKFNHPET  345
             ++ E S  E++LLDLY+GCG MS+GLCLGAK+SG+NLVT+WA+D    AC+S++ NHPET
Sbjct  195   QARERSLSEMTLLDLYSGCGAMSSGLCLGAKMSGVNLVTRWAIDINAYACESVRLNHPET  254

Query  344   QVRNESV  324
             QVRNES 
Sbjct  255   QVRNESA  261



>gb|AAC02663.1| chromomethylase [Arabidopsis thaliana]
Length=791

 Score =   200 bits (508),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 136/349 (39%), Positives = 200/349 (57%), Gaps = 22/349 (6%)
 Frame = -2

Query  1022  EEDEVILNVDCHYAQAKVLSFILNIGDCVYVKG-EGEKKHVGRILEFFKTTEGEDYFRVQ  846
             E++E+I    CH+ +A V   ++N+ D VYV G  G+ K + +++E F+  +G  Y R +
Sbjct  59    EDEEIIKQAKCHFDKALVDGVLINLNDDVYVTGLPGKLKFIAKVIELFEADDGVPYCRFR  118

Query  845   WFFRAEDTVMRDAAALHDKKRLFYSTLMNDNLLDCIISKVNVTEIS-PGLGLEVNNS--P  675
             W++R EDT++   + L   KR+F S   NDN L CI SKVN+ ++  P +   +     P
Sbjct  119   WYYRPEDTLIERFSHLVQPKRVFLSNDENDNPLTCIWSKVNIAKVPLPKITSRIEQRVIP  178

Query  674   PSGFYYDMEYCVDYSTFRNLPTVQSVNSWDSPSLIDASYKPITAYPVEHFKSCEPSKVEL  495
             P  +YYDM+Y V Y  F +       +S  S       ++ +              K E 
Sbjct  179   PCDYYYDMKYEVPYLNFTSADDGSDASSSLSSDSALNCFENL-------------HKDEK  225

Query  494   SLLDLYAGCGGMSTGLCLGAKLSGLNLVTKWAVDYQKSACDSLKFNHPETQVRNESVenf  315
              LLDLY+GCG MSTG C+GA +SG+ L+TKW+VD  K ACDSLK NHPET+VRNE+ E+F
Sbjct  226   FLLDLYSGCGAMSTGFCMGASISGVKLITKWSVDINKFACDSLKLNHPETEVRNEAAEDF  285

Query  314   lkllkeweklckEY----GSEP-NAGSDDVLEGMEEGaddansladsddsdAEYEILRLV  150
             L LLKEW++LC+++     +EP  + S+   E +EE  D   +   ++    E+E+ + +
Sbjct  286   LALLKEWKRLCEKFSLVSSTEPVESISELEDEEVEENDDIDEASTGAELEPGEFEVEKFL  345

Query  149   DICFGDPNDTGKPGIHFQVRWKGYGPSEDTWEPIDGLKSWKNRQGWFTI  3
              I FGDP  TG+  +   VRWKGY  S DTWEP  GL + K +   + I
Sbjct  346   GIMFGDPQGTGEKTLQLMVRWKGYNSSYDTWEPYSGLGNCKEKLKEYVI  394



>ref|NP_565245.1| chromomethylase 1 [Arabidopsis thaliana]
 sp|O49139.2|CMT1_ARATH RecName: Full=Putative DNA (cytosine-5)-methyltransferase CMT1; 
AltName: Full=Chromomethylase 1; AltName: Full=Protein CHROMOMETHYLASE 
1 [Arabidopsis thaliana]
 gb|AAF14662.1|AC011713_10 Identical to gb|AF039367 ecotype Col-0 chromomethylase (CMT1) 
gene from Arabidopsis thaliana [Arabidopsis thaliana]
 gb|AAC02660.1| chromomethylase [Arabidopsis thaliana]
 gb|AEE36442.1| chromomethylase 1 [Arabidopsis thaliana]
Length=791

 Score =   200 bits (508),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 136/349 (39%), Positives = 200/349 (57%), Gaps = 22/349 (6%)
 Frame = -2

Query  1022  EEDEVILNVDCHYAQAKVLSFILNIGDCVYVKG-EGEKKHVGRILEFFKTTEGEDYFRVQ  846
             E++E+I    CH+ +A V   ++N+ D VYV G  G+ K + +++E F+  +G  Y R +
Sbjct  59    EDEEIIKQAKCHFDKALVDGVLINLNDDVYVTGLPGKLKFIAKVIELFEADDGVPYCRFR  118

Query  845   WFFRAEDTVMRDAAALHDKKRLFYSTLMNDNLLDCIISKVNVTEIS-PGLGLEVNNS--P  675
             W++R EDT++   + L   KR+F S   NDN L CI SKVN+ ++  P +   +     P
Sbjct  119   WYYRPEDTLIERFSHLVQPKRVFLSNDENDNPLTCIWSKVNIAKVPLPKITSRIEQRVIP  178

Query  674   PSGFYYDMEYCVDYSTFRNLPTVQSVNSWDSPSLIDASYKPITAYPVEHFKSCEPSKVEL  495
             P  +YYDM+Y V Y  F +       +S  S       ++ +              K E 
Sbjct  179   PCDYYYDMKYEVPYLNFTSADDGSDASSSLSSDSALNCFENL-------------HKDEK  225

Query  494   SLLDLYAGCGGMSTGLCLGAKLSGLNLVTKWAVDYQKSACDSLKFNHPETQVRNESVenf  315
              LLDLY+GCG MSTG C+GA +SG+ L+TKW+VD  K ACDSLK NHPET+VRNE+ E+F
Sbjct  226   FLLDLYSGCGAMSTGFCMGASISGVKLITKWSVDINKFACDSLKLNHPETEVRNEAAEDF  285

Query  314   lkllkeweklckEY----GSEP-NAGSDDVLEGMEEGaddansladsddsdAEYEILRLV  150
             L LLKEW++LC+++     +EP  + S+   E +EE  D   +   ++    E+E+ + +
Sbjct  286   LALLKEWKRLCEKFSLVSSTEPVESISELEDEEVEENDDIDEASTGAELEPGEFEVEKFL  345

Query  149   DICFGDPNDTGKPGIHFQVRWKGYGPSEDTWEPIDGLKSWKNRQGWFTI  3
              I FGDP  TG+  +   VRWKGY  S DTWEP  GL + K +   + I
Sbjct  346   GIMFGDPQGTGEKTLQLMVRWKGYNSSYDTWEPYSGLGNCKEKLKEYVI  394



>ref|XP_009625628.1| PREDICTED: DNA (cytosine-5)-methyltransferase 1-like isoform 
X2 [Nicotiana tomentosiformis]
Length=820

 Score =   199 bits (507),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 122/339 (36%), Positives = 175/339 (52%), Gaps = 56/339 (17%)
 Frame = -2

Query  1025  DEEDEVILNVDCHYAQAKVLSFILNIGDCVYVKGEG-EKKHVGRILEFFKTTEGEDYFRV  849
             D+ D++I    CH+ QA V   I N+GD  YV+    E  ++ +I+EFF+  +G  YF  
Sbjct  122   DDGDQLI-QAKCHFTQAVVDGQIYNLGDDAYVQASSDEDDYICKIVEFFQAVDGMQYFTA  180

Query  848   QWFFRAEDTVMRDAAALHDKKRLFYSTLMNDNLLDCIISKVNVTEISPGLGLEVNNS--P  675
             QWF+RA+DTV++      D KR+F+S + +DN L C++ K+ +  I   +   +  S   
Sbjct  181   QWFYRAKDTVIKAHDQFIDNKRVFFSEIKDDNPLGCLVKKIKIVAIPSNVRPPLKESLRS  240

Query  674   PSGFYYDMEYCVDYSTFRNLPTVQSVNSWDSPSLIDASYKPITAYPVEHFKSCEPSKVEL  495
              S +YYDM Y + YS+F +LP                                       
Sbjct  241   NSDYYYDMMYLLPYSSFVSLPQ--------------------------------------  262

Query  494   SLLDLYAGCGGMSTGLCLGAKLSGLNLVTKWAVDYQKSACDSLKFNHPETQVRNES----  327
                    GCG MSTGLCLGA + G+ LVTKWAVD  + ACDSLK+NHPET VRNES    
Sbjct  263   -------GCGAMSTGLCLGADIGGVKLVTKWAVDLNQYACDSLKWNHPETAVRNESADDF  315

Query  326   VenflkllkeweklckEYGSEPNAGSDDVLEGMEEGaddansladsddsdAEYEIL---R  156
             +    +  +          + P      V +  ++  +D     +    D + EI    +
Sbjct  316   LLLLREWRQLCASCSLLRNNTPTHSFLKVRDEDDKDDNDNEDEDEGSGDDEQGEIFEVEQ  375

Query  155   LVDICFGDPNDTGKPGIHFQVRWKGYGPSEDTWEPIDGL  39
             L++IC+GDP +  KPG++F+VRWKGYG  EDTWEPI+GL
Sbjct  376   LLEICYGDPKEKNKPGLYFKVRWKGYGQEEDTWEPIEGL  414



>gb|AAB95485.1| chromomethylase [Arabidopsis thaliana]
 gb|AAC02659.1| chromomethylase [Arabidopsis thaliana]
Length=791

 Score =   199 bits (507),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 136/349 (39%), Positives = 200/349 (57%), Gaps = 22/349 (6%)
 Frame = -2

Query  1022  EEDEVILNVDCHYAQAKVLSFILNIGDCVYVKG-EGEKKHVGRILEFFKTTEGEDYFRVQ  846
             E++E+I    CH+ +A V   ++N+ D VYV G  G+ K + +++E F+  +G  Y R +
Sbjct  59    EDEEIIKQAKCHFDKALVDGVLINLNDDVYVTGLPGKLKFIAKVIELFEADDGVPYCRFR  118

Query  845   WFFRAEDTVMRDAAALHDKKRLFYSTLMNDNLLDCIISKVNVTEIS-PGLGLEVNNS--P  675
             W++R EDT++   + L   KR+F S   NDN L CI SKVN+ ++  P +   +     P
Sbjct  119   WYYRPEDTLIERFSHLVQPKRVFLSNDENDNPLTCIWSKVNIAKVPLPKITSRIEQRVIP  178

Query  674   PSGFYYDMEYCVDYSTFRNLPTVQSVNSWDSPSLIDASYKPITAYPVEHFKSCEPSKVEL  495
             P  +YYDM+Y V Y  F +       +S  S       ++ +              K E 
Sbjct  179   PCDYYYDMKYEVPYLNFISADDGSDASSSLSSDSALNCFENL-------------HKDEK  225

Query  494   SLLDLYAGCGGMSTGLCLGAKLSGLNLVTKWAVDYQKSACDSLKFNHPETQVRNESVenf  315
              LLDLY+GCG MSTG C+GA +SG+ L+TKW+VD  K ACDSLK NHPET+VRNE+ E+F
Sbjct  226   FLLDLYSGCGAMSTGFCMGASISGVKLITKWSVDINKFACDSLKLNHPETEVRNEAAEDF  285

Query  314   lkllkeweklckEY----GSEP-NAGSDDVLEGMEEGaddansladsddsdAEYEILRLV  150
             L LLKEW++LC+++     +EP  + S+   E +EE  D   +   ++    E+E+ + +
Sbjct  286   LALLKEWKRLCEKFSLVSSTEPVESISELEDEEVEENDDIDEASTGAELEPGEFEVEKFL  345

Query  149   DICFGDPNDTGKPGIHFQVRWKGYGPSEDTWEPIDGLKSWKNRQGWFTI  3
              I FGDP  TG+  +   VRWKGY  S DTWEP  GL + K +   + I
Sbjct  346   GIMFGDPQGTGEKTLQLMVRWKGYNSSYDTWEPYSGLGNCKEKLKEYVI  394



>gb|AAB95486.1| chromomethylase [Arabidopsis arenosa]
 gb|AAC02671.1| chromomethylase [Arabidopsis arenosa]
Length=744

 Score =   198 bits (503),  Expect = 6e-53, Method: Compositional matrix adjust.
 Identities = 132/332 (40%), Positives = 193/332 (58%), Gaps = 22/332 (7%)
 Frame = -2

Query  989  HYAQAKVLSFILNIGDCVYV-KGEGEKKHVGRILEFFKTTEGEDYFRVQWFFRAEDTVMR  813
            HY QA V   ++N+ D VYV    G+   +G+++E F+  +G  Y R++WF+R +DT++ 
Sbjct  54   HYEQALVDGVLINLNDDVYVTHATGKLNFIGKVIEMFEADDGVPYCRIRWFYRPDDTLIE  113

Query  812  DAAALHDKKRLFYSTLMNDNLLDCIISKVNVTEIS-PGLGLEVNNS--PPSGFYYDMEYC  642
              A L  KKR+F S + +DN L CI SKVN+ ++  P +   +     PP  +YYDM+Y 
Sbjct  114  RFAELVQKKRVFLSNVEDDNPLTCIYSKVNIAKVPLPKITSRIEQRVIPPCDYYYDMKYE  173

Query  641  VDYSTFRNLPTVQSVNSWDSPSLIDASYKPITAYPVEHFKSCEPSKVELSLLDLYAGCGG  462
            V Y    +     + +S  S       ++ +              K E  LLDLY+GCG 
Sbjct  174  VPYLNLTSADDDSAASSTLSSDSASNCFETL-------------HKDEKFLLDLYSGCGA  220

Query  461  MSTGLCLGAKLSGLNLVTKWAVDYQKSACDSLKFNHPETQVRNESVenflkllkeweklc  282
            MSTG C+GA ++G+ L+TKW+VD  K ACDS + NHPET+VRNE+ E+FL LLKEW++LC
Sbjct  221  MSTGFCMGASIAGVKLITKWSVDINKFACDSFRHNHPETEVRNEAAEDFLILLKEWKRLC  280

Query  281  kEY----GSEP-NAGSDDVLEGMEEGaddansladsddsdAEYEILRLVDICFGDPNDTG  117
            + +     +EP  + S+   E  +E  D   +  D + S  E+E+ + V I FGDP  TG
Sbjct  281  ERFSLISSTEPMESISELEDEESDENDDIDEASTDMELSAGEFEVEKFVGIVFGDPKGTG  340

Query  116  KPGIHFQVRWKGYGPSEDTWEPIDGLKSWKNR  21
            +  +H +VRWKGY P  DTWEP  GL + K +
Sbjct  341  EKTLHLKVRWKGYSPKYDTWEPYSGLGNCKEK  372



>ref|XP_002886525.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH62784.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
Length=732

 Score =   196 bits (498),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 124/345 (36%), Positives = 182/345 (53%), Gaps = 31/345 (9%)
 Frame = -2

Query  1004  LNVDCHYAQAKVLSFILNIGDCVYVKGEGEKKHVGRILEFFKTTEGEDYFRVQWFFRAED  825
             L    HY +A V   + ++ D +YV+ +GE   + +I+E F+  +GE YFR Q F+RAED
Sbjct  16    LEATSHYDKALVNGVVYSLNDDIYVQAKGEPNRIAKIIELFEGVDGEGYFRAQLFYRAED  75

Query  824   TVMRDAAA--LHDKKRLFYSTLMNDNLLDCIISKVNVTEISPGLGLE--VNNSPPSGFYY  657
             TV++D A   L +K+R+F S +  D  L+ I+SKV++ ++   + LE    + P   F+Y
Sbjct  76    TVIQDLAGEYLQEKRRVFLSNVEADYSLNLIVSKVHIIKLPAKILLENEERDIPACDFFY  135

Query  656   DMEYCVDYSTFRNLPTVQSVNSWDSPSLIDASYKPITAYPVEHFKSCEPSKVELSLLDLY  477
             DM Y +++ TF               S +D     +      +  SC   K    +LDLY
Sbjct  136   DMRYNLEHLTF---------------SSVDNEISNVEGNDSNNVGSCNKEKY---MLDLY  177

Query  476   AGCGGMSTGLCLGAKLSGLNLVTKWAVDYQKSACDSLKFNHPETQVRNESVenflkllke  297
             +GCG MSTGLC+GA LSG+NL+TKWAVD    AC+SLK NHPET+ R    E    + K 
Sbjct  178   SGCGAMSTGLCMGASLSGVNLITKWAVDNNSFACESLKLNHPETKCR-RIFEIAEGMEKA  236

Query  296   weklckEYGSEPNAGSDDVLEGMEEGaddansladsddsdAEYEILRLVDICFGDPNDTG  117
               K+     +EP     D  +  E   +        + S  E+E+  ++ IC+GDP    
Sbjct  237   MPKVFTSPKTEPLELDSDFEDDNESENNVEGESDGYEMSPDEFEVDEVLSICYGDPKKAN  296

Query  116   ------KP-GIHFQVRWKGY-GPSEDTWEPIDGLKSWKNRQGWFT  6
                   KP  ++F+V WKGY    E+TWEP DGL+  K +   F 
Sbjct  297   ASVKKVKPSALYFKVHWKGYDSEEENTWEPYDGLRKCKEKVKEFV  341



>gb|KEH25929.1| DNA (cytosine-5)-methyltransferase CMT1 [Medicago truncatula]
Length=843

 Score =   196 bits (498),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 138/346 (40%), Positives = 194/346 (56%), Gaps = 33/346 (10%)
 Frame = -2

Query  1001  NVDC-----HYAQAKVLSFILNIGDCVYVKGE-GEKKHVGRILEFFKTTEGEDYFRVQWF  840
             N DC     HY +AKV   I  + D  YV+ E G+K  + RILE F + + + +F  QWF
Sbjct  98    NNDCIKAKYHYRKAKVDGVIYELNDNAYVQAEKGKKDSIARILELFVSDDQQQFFTAQWF  157

Query  839   FRAEDTVMRDAAALHDKKRLFYSTLMNDNLLDCIISKVNVTEISPGLGLEVNNSPPSGFY  660
             +RA+DTV++D   L DKKR+F S + ++  L CI+ KV++ E+ P      N  P    Y
Sbjct  158   YRAQDTVLQDHGRLVDKKRVFISDVKDEIPLGCILRKVDIAEVKPDKKKNKNKIPSCELY  217

Query  659   YDMEYCVDYSTFRNLPTVQSVNSWDSPSLIDASYKPITAYPVEHFKSCEPSKVELSLLDL  480
             +DM+Y   Y TF  +          + ++   S   + A            K E SLLDL
Sbjct  218   FDMKYTAPYLTFSKISNEPERIESSTSTISSESGSNVVA----------ADKSEWSLLDL  267

Query  479   YAGCGGMSTGLCLGAKLSGLNLVTKWAVDYQKSACDSLKFNHPETQVRNESVenflkllk  300
             YAGCG MSTGL  GA  SG+ LVT+WA+D  K AC+SLK NHP+T VRNE+ ENFL LLK
Sbjct  268   YAGCGAMSTGLFFGAFKSGIKLVTRWAIDINKHACESLKLNHPQTHVRNETAENFLSLLK  327

Query  299   eweklckEYGSEPNAGSDDVLEGMEEGaddansladsddsdAEYEILRLVDICFGDPN--  126
             EW KLC+E+    +  SD  ++  EE  D+    +   +    +E+ +L+ +C+G+PN  
Sbjct  328   EWAKLCEEFVLNGSESSDSDMDDGEEANDEVVDDSSDSEV---FEVEKLLQVCYGNPNKD  384

Query  125   ------------DTGKPGIHFQVRWKGYGPSEDTWEPIDGLKSWKN  24
                         +  K G++F+V+WKGY  S DTWEPI+GL   K+
Sbjct  385   KKKSKKDKEKASEDEKLGLYFKVQWKGYDSSYDTWEPIEGLSDCKD  430



>gb|KEH27204.1| DNA (cytosine-5)-methyltransferase CMT3-like protein [Medicago 
truncatula]
Length=935

 Score =   196 bits (497),  Expect = 9e-52, Method: Compositional matrix adjust.
 Identities = 136/350 (39%), Positives = 200/350 (57%), Gaps = 16/350 (5%)
 Frame = -2

Query  1031  SADEEDEVILNVDCHYAQAKV-LSFILNIGDCVYVKGEGEKKH-VGRILEFFKTTEGEDY  858
             S  +E+EVIL   CHY +A+V    I  + D  YV+GE +  H + +I+E F+  +G  +
Sbjct  176   SNSDEEEVIL-ARCHYTEAQVDEGVIYKLYDDAYVQGETDDYHFICKIVEMFEAVDGGLF  234

Query  857   FRVQWFFRAEDTVMRDAAALHDKKRLFYSTLMNDNLLDCIISKVNVTEISPGLGLEVNNS  678
             F  QW++RA DTV++    L + KR+F+S + +DN LDC++ K+ +  +      +    
Sbjct  235   FTAQWYYRANDTVIKQLGNLIEPKRVFFSEIQDDNPLDCLVKKLTILRLELKKDFDATKD  294

Query  677   --PPSGFYYDMEYCVDYSTFRNLPTVQSVNSWDSPSLIDASYKPITAYPVEHFKS-----  519
               PP  +Y D  Y + YSTF  LP+  + N  +  S I    +      V+   S     
Sbjct  295   IIPPCDYYCDTLYLLPYSTFLKLPSETTENGSEISSTISNETEGNGKAEVDSKCSNTDIC  354

Query  518   CEPSKVELSLLDLYAGCGGMSTGLCLGAKLSGLNLVTKWAVDYQKSACDSLKFNHPETQV  339
              E  K ++ LLDLY+GCGGMSTGLC G  LSG +++TKWAVD  + AC SLK NHPET+V
Sbjct  355   VEKKKPQMKLLDLYSGCGGMSTGLCQGGILSGSDIITKWAVDLNQDACQSLKLNHPETEV  414

Query  338   RNESVenflkllkeweklckEYG----SEPNAGSDDVLEGMEEGaddansladsddsdAE  171
             RN S E FL LLKEWEKLC  +     S P+    ++    +E  ++ +   + +     
Sbjct  415   RNVSAELFLFLLKEWEKLCSYFSLIENSVPHEEYANLFNKEDEEEEENDGAVEENIDGEI  474

Query  170   YEILRLVDICFGDPNDTGKPGIHFQVRWKGYGPSEDTWEPIDGLKSWKNR  21
             +E+  + D+ + D  +TG PG++F+V WKGY   +DTWEPI GL + K R
Sbjct  475   FEVSEVHDVRYDD-KETG-PGLYFKVSWKGYNSDKDTWEPITGLSNCKER  522



>ref|XP_006300392.1| hypothetical protein CARUB_v10019778mg, partial [Capsella rubella]
 gb|EOA33290.1| hypothetical protein CARUB_v10019778mg, partial [Capsella rubella]
Length=865

 Score =   194 bits (492),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 137/355 (39%), Positives = 202/355 (57%), Gaps = 23/355 (6%)
 Frame = -2

Query  1007  ILNVDCHYAQAKV---LSFILNIGDCVYVK-GEGEKKHVGRILEFFKTTEGEDYFRVQWF  840
             I+   CH+ +A V    ++ LN  D  YV+ GEG+   + +I+E F+  +G+ YF  QWF
Sbjct  115   IIRARCHFRRAIVDECQTYELN--DDAYVEAGEGKAPFICKIVEMFEGADGKLYFTAQWF  172

Query  839   FRAEDTVMRDAAALHDKKRLFYSTLMNDNLLDCIISKVNVTEISPGLGLEVNNSPPSGFY  660
             +RA DTV+   +AL ++KR+F+S   N N L  ++ ++ +  I      E  ++  S  Y
Sbjct  173   YRASDTVIGMHSALINEKRVFFSKDRNTNELGTLLKRLKILMIPLNENTETIDATKSCDY  232

Query  659   Y-DMEYCVDYSTFRNLPTVQSVNSWDSPSL---IDASYKPITAYPVEHFKSCEPSKVELS  492
             + DM Y + YSTF  L     +   +S ++    + + +       E       SK E +
Sbjct  233   FCDMNYLLPYSTFEALQQDNKMAISESSTISSDTEVNERAAVISGDEEASQATGSKREAT  292

Query  491   LLDLYAGCGGMSTGLCLGAKLSGLNLVTKWAVDYQKSACDSLKFNHPETQVRNESVenfl  312
             +LDLY GCG MSTGLC+GA+L+GLNLVTKWAVD    AC SL+ NHPETQVRN S E+FL
Sbjct  293   MLDLYCGCGAMSTGLCMGAQLAGLNLVTKWAVDMNPHACKSLEHNHPETQVRNMSAEDFL  352

Query  311   kllkeweklckEYGSE--PNAGSDDVLEGM-----------EEGaddansladsddsdAE  171
              LLKEW KLC  +     PN+   + L GM           E   +D    +D++D+   
Sbjct  353   LLLKEWLKLCIHFSLRTCPNSEEYNNLYGMSNVEDNEDESKESDNEDEGKESDNEDNGEV  412

Query  170   YEILRLVDICFGDPNDTGKPGIHFQVRWKGYGPSEDTWEPIDGLKSWKNRQGWFT  6
             + + ++V I FGDP    + G++ +VRW+GY PS+DTWEPI+GL + + +   F 
Sbjct  413   FTVEKIVGISFGDPKKIKERGLYLKVRWQGYKPSDDTWEPIEGLSNCREKIKEFV  467



>gb|AEC12443.1| chromomethylase 3 [Gossypium hirsutum]
Length=824

 Score =   193 bits (491),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 106/240 (44%), Positives = 148/240 (62%), Gaps = 14/240 (6%)
 Frame = -2

Query  1031  SADEEDEVILNVDCHYAQAKVLS-FILNIGDCVYVKGE-GEKKHVGRILEFFKTTEGEDY  858
             S++ + E I+    HY QAKV    I N+ D  +VK E GE  ++ +I+E F+  +G+ Y
Sbjct  76    SSNGDSEEIIQARRHYTQAKVDGCMIFNLYDDAHVKAEDGEDCYICKIVEMFEAVDGDLY  135

Query  857   FRVQWFFRAEDTVMRDAAALHDKKRLFYSTLMNDNLLDCIISKVNVTEISPGLGLEVNNS  678
             F  QWF+RA+DTV++    L DKKR+F+S + +DN LDC+++K+N+ ++     LE  N 
Sbjct  136   FTAQWFYRAQDTVLKTLGHLIDKKRVFFSQIQDDNPLDCLVAKLNIAKVD----LEAKNK  191

Query  677   --PPSGFYYDMEYCVDYSTFRNLPTVQSVNSWDSPSLIDASYKPITAYPVEHFKSCEPSK  504
               P   +Y DM Y ++YS+F NLP     N+ +  S   +   P T              
Sbjct  192   EIPSCDYYCDMLYKLEYSSFTNLPPEGKTNASEEASSTISDDSPDTV------NGANSGS  245

Query  503   VELSLLDLYAGCGGMSTGLCLGAKLSGLNLVTKWAVDYQKSACDSLKFNHPETQVRNESV  324
              + SLLDLY+GCG MSTGLCLGA ++GL LVTKWAVD  K AC+SL++NHPET VRNES 
Sbjct  246   EDASLLDLYSGCGAMSTGLCLGANMAGLRLVTKWAVDINKYACESLQWNHPETTVRNESA  305


 Score = 66.6 bits (161),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 24/44 (55%), Positives = 35/44 (80%), Gaps = 0/44 (0%)
 Frame = -2

Query  170  YEILRLVDICFGDPNDTGKPGIHFQVRWKGYGPSEDTWEPIDGL  39
            +E+ + + IC+GDP + G+ G++ +VRWK YGP EDTWEP+DGL
Sbjct  362  FEVEKFLAICYGDPKEKGERGLYLKVRWKNYGPEEDTWEPLDGL  405



>ref|XP_002888734.1| chromomethylase CMT3 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH64993.1| chromomethylase CMT3 [Arabidopsis lyrata subsp. lyrata]
Length=838

 Score =   193 bits (490),  Expect = 4e-51, Method: Compositional matrix adjust.
 Identities = 142/358 (40%), Positives = 201/358 (56%), Gaps = 19/358 (5%)
 Frame = -2

Query  1034  CSADEEDEVILNVDCHYAQAKV-LSFILNIGDCVYVK-GEGEKKHVGRILEFFKTTEGED  861
              + D+E + I+   CHY +A V    I  + D  YV+ GEG +  V +I+E F+   G+ 
Sbjct  83    TTKDDEKDKIIRARCHYRRAIVDERQIYELNDDAYVQAGEGNQPFVCKIVEMFEGANGKL  142

Query  860   YFRVQWFFRAEDTVMRDAAALHDKKRLFYSTLMNDNLLDCIISKVNVTEISPGLGLEVNN  681
             YF  +WF+RA+DTVM+    L D KR+F+S + + N L  +  K+N+  I     L  N 
Sbjct  143   YFTARWFYRADDTVMKQFKILIDDKRVFFSEIRDTNELGLLEKKLNILMIP----LNENA  198

Query  680   SPPSG------FYYDMEYCVDYSTFRNLPTVQSVNSWDSPSLI-DASYKPITAYPVEHFK  522
             + P        +Y DM Y + Y TF  L     +   +S ++  D       A   E+ +
Sbjct  199   AGPIAATKTCDYYCDMNYLLPYDTFEALQQDTKMAISESSTISSDTDVNEGAAAISENQE  258

Query  521   SCEPSKV--ELSLLDLYAGCGGMSTGLCLGAKLSGLNLVTKWAVDYQKSACDSLKFNHPE  348
               + ++V  E +LLDLY+GCG MSTGLC+GA+LSGLNLVTKWAVD    AC SL  NHPE
Sbjct  259   GSQDTRVQRETTLLDLYSGCGAMSTGLCMGAQLSGLNLVTKWAVDMNAHACKSLGHNHPE  318

Query  347   TQVRNESVenflkllkeweklckEYG--SEPNAGSDDVLEGME--EGaddansladsdds  180
             T VRN S E+FL LLKEWEKLC  +   + PN+   + L GM   E  +D +  +D +D 
Sbjct  319   THVRNMSAEDFLFLLKEWEKLCIHFSLRNSPNSEEYENLHGMTNVEDNEDVSEESDDEDD  378

Query  179   dAEYEILRLVDICFGDPNDTGKPGIHFQVRWKGYGPSEDTWEPIDGLKSWKNRQGWFT  6
                + + ++V I FG P    K G++ +VRW  Y  S DTWEPI+GL + + +   F 
Sbjct  379   GEVFTVEKIVGISFGVPKKLQKRGLYLKVRWLNYDDSHDTWEPIEGLSNCREKIKEFV  436



>ref|XP_010415636.1| PREDICTED: DNA (cytosine-5)-methyltransferase CMT3-like isoform 
X1 [Camelina sativa]
Length=835

 Score =   193 bits (490),  Expect = 5e-51, Method: Compositional matrix adjust.
 Identities = 135/347 (39%), Positives = 192/347 (55%), Gaps = 13/347 (4%)
 Frame = -2

Query  1007  ILNVDCHYAQAKV-LSFILNIGDCVYVK-GEGEKKHVGRILEFFKTTEGEDYFRVQWFFR  834
             I+   CH+ +A V  S    + D  YV+ GEG   ++ +I+E F+   G+ YF  QWF+R
Sbjct  92    IIRARCHFRRAIVDESITYELNDDAYVQAGEGNAPYICKIVEMFEGANGKLYFAAQWFYR  151

Query  833   AEDTVMRDAAALHDKKRLFYSTLMNDNLLDCIISKVNVTEIS--PGLGLEVNNSPPSGFY  660
             A DTV+ +  AL   KR+F+S + + N L  ++ K+ +  IS        +  +    +Y
Sbjct  152   ASDTVIGNLNALISDKRVFFSKVRDTNELGTLVKKLEILMISLNENTTETIAATKNCDYY  211

Query  659   YDMEYCVDYSTFRNLPTVQSVNSWDSPSLI---DASYKPITAYPVEHFKSCEPSKVELSL  489
              DM Y + YSTF        +   +S ++    D +         +       +K E +L
Sbjct  212   CDMNYLLPYSTFEAFQEDTKMAISESSTISSDNDVNGGAAVISEDDETSQANGAKREATL  271

Query  488   LDLYAGCGGMSTGLCLGAKLSGLNLVTKWAVDYQKSACDSLKFNHPETQVRNESVenflk  309
             LDLY GCG MSTGLC+GAKL+GLNLVTKWAVD  + AC SL+ NHPETQVRN S ENFL 
Sbjct  272   LDLYCGCGAMSTGLCMGAKLAGLNLVTKWAVDMNEHACKSLEHNHPETQVRNMSAENFLL  331

Query  308   llkeweklckEYG--SEPNAGSDDVLEGMEEGaddansladsddsdAE----YEILRLVD  147
             LLKEWEKLC  +     PN+   + L GM    DD +     +  + +    + + ++V 
Sbjct  332   LLKEWEKLCIHFSLRKSPNSEEYNNLYGMTVVEDDEDEDDSKESDNEDDGEVFTVAKIVG  391

Query  146   ICFGDPNDTGKPGIHFQVRWKGYGPSEDTWEPIDGLKSWKNRQGWFT  6
             I FGD  +  K G++ +VRW GY PS DTWEPI+GL + + +   F 
Sbjct  392   ITFGDLKNIKKSGLYLKVRWLGYAPSHDTWEPIEGLSNCREKIKEFV  438



>ref|XP_010415637.1| PREDICTED: DNA (cytosine-5)-methyltransferase CMT3-like isoform 
X2 [Camelina sativa]
Length=834

 Score =   192 bits (489),  Expect = 7e-51, Method: Compositional matrix adjust.
 Identities = 135/347 (39%), Positives = 192/347 (55%), Gaps = 13/347 (4%)
 Frame = -2

Query  1007  ILNVDCHYAQAKV-LSFILNIGDCVYVK-GEGEKKHVGRILEFFKTTEGEDYFRVQWFFR  834
             I+   CH+ +A V  S    + D  YV+ GEG   ++ +I+E F+   G+ YF  QWF+R
Sbjct  92    IIRARCHFRRAIVDESITYELNDDAYVQAGEGNAPYICKIVEMFEGANGKLYFAAQWFYR  151

Query  833   AEDTVMRDAAALHDKKRLFYSTLMNDNLLDCIISKVNVTEIS--PGLGLEVNNSPPSGFY  660
             A DTV+ +  AL   KR+F+S + + N L  ++ K+ +  IS        +  +    +Y
Sbjct  152   ASDTVIGNLNALISDKRVFFSKVRDTNELGTLVKKLEILMISLNENTTETIAATKNCDYY  211

Query  659   YDMEYCVDYSTFRNLPTVQSVNSWDSPSLI---DASYKPITAYPVEHFKSCEPSKVELSL  489
              DM Y + YSTF        +   +S ++    D +         +       +K E +L
Sbjct  212   CDMNYLLPYSTFEAFQEDTKMAISESSTISSDNDVNGGAAVISEDDETSQANGAKREATL  271

Query  488   LDLYAGCGGMSTGLCLGAKLSGLNLVTKWAVDYQKSACDSLKFNHPETQVRNESVenflk  309
             LDLY GCG MSTGLC+GAKL+GLNLVTKWAVD  + AC SL+ NHPETQVRN S ENFL 
Sbjct  272   LDLYCGCGAMSTGLCMGAKLAGLNLVTKWAVDMNEHACKSLEHNHPETQVRNMSAENFLL  331

Query  308   llkeweklckEYG--SEPNAGSDDVLEGMEEGaddansladsddsdAE----YEILRLVD  147
             LLKEWEKLC  +     PN+   + L GM    DD +     +  + +    + + ++V 
Sbjct  332   LLKEWEKLCIHFSLRKSPNSEEYNNLYGMTVVEDDEDEDDSKESDNEDDGEVFTVAKIVG  391

Query  146   ICFGDPNDTGKPGIHFQVRWKGYGPSEDTWEPIDGLKSWKNRQGWFT  6
             I FGD  +  K G++ +VRW GY PS DTWEPI+GL + + +   F 
Sbjct  392   ITFGDLKNIKKSGLYLKVRWLGYAPSHDTWEPIEGLSNCREKIKEFV  438



>ref|XP_002990857.1| hypothetical protein SELMODRAFT_132507 [Selaginella moellendorffii]
 gb|EFJ08130.1| hypothetical protein SELMODRAFT_132507 [Selaginella moellendorffii]
Length=933

 Score =   191 bits (486),  Expect = 4e-50, Method: Compositional matrix adjust.
 Identities = 144/367 (39%), Positives = 198/367 (54%), Gaps = 55/367 (15%)
 Frame = -2

Query  989  HYAQAKVLSFILNIGDCVYVKGEGE-KKHVGRILEFFKTTEGEDYFRVQWFFRAEDTV--  819
            HY +A V      +GDCV ++ +G+  +++G++LEFFKT   E++FRVQWFFR  DTV  
Sbjct  190  HYEEAVVDGKHYKVGDCVALELQGDDAEYLGKVLEFFKTANQENWFRVQWFFRFSDTVCL  249

Query  818  --------------MRDAAALH-DKKRLFYSTLMNDNLLDCIISKVNVTEISPGLGLEVN  684
                          + D   +H D KR+F S   +DN+++CII KV V+           
Sbjct  250  RLCGYPDCKCSLQAIGDLDDVHLDNKRVFLSDDEDDNMIECIIKKVKVSYAPVMDAFSKK  309

Query  683  NSPPS-GFYYDMEYCVDYSTFRNLPTVQSVNSWDSPSLIDASYKPITAYPVEHFKSCEPS  507
                S  +Y+DM Y  D+STF  +P+  +V  + + +L DAS    +++     +  +  
Sbjct  310  KIKQSCDYYFDMGYTGDFSTFYKVPS-GNVFVFSTDALEDAS----SSFQTAVTRCSDTI  364

Query  506  KVELSLLDLYAGCGGMSTGLCLGAKLSGLNLVTKWAVDYQKSACDSLKFNHPETQVRNES  327
            K EL LLDLY GCG MSTGL +GA L G+NLVTKWAVDY + AC+S+K+NHPET+VRNE 
Sbjct  365  KPELILLDLYCGCGAMSTGLSMGAALGGVNLVTKWAVDYNEHACNSMKYNHPETEVRNED  424

Query  326  VenflkllkeweklckEY-----GSEPNAGSDDV-LEGMEEGaddansladsddsdAEYE  165
             E FL LLKEW+KLC +Y         NA S D    G +E             +  EYE
Sbjct  425  AECFLLLLKEWQKLCTKYEGHVADDNSNASSPDSNTLGADE------------YAADEYE  472

Query  164  ILRLVDICFGDPNDTGKPG-------------IHFQVRWKGYGPSEDTWEPIDGLKSWKN  24
            + ++VDI         KP              + F+VRWKGY    DTWEP+D L S + 
Sbjct  473  VQQVVDIRMAGIQKPKKPDTSSKMPEKPIKRRLEFKVRWKGYTSDHDTWEPVDHLDSCQE  532

Query  23   RQGWFTI  3
            R   F +
Sbjct  533  RIRDFVL  539



>ref|XP_006432634.1| hypothetical protein CICLE_v100004871mg, partial [Citrus clementina]
 gb|ESR45874.1| hypothetical protein CICLE_v100004871mg, partial [Citrus clementina]
Length=496

 Score =   187 bits (474),  Expect = 4e-50, Method: Compositional matrix adjust.
 Identities = 95/165 (58%), Positives = 115/165 (70%), Gaps = 19/165 (12%)
 Frame = -2

Query  818  MRDAAALHDKKRLFYSTLMNDNLLDCIISKVNVTEISPGLGLEVNNSPPSGFYYDMEYCV  639
            M++AA  HD+K LFYST+MNDN +DCIISKV V +I P +GL+ N+ P S FY+DMEYCV
Sbjct  1    MKEAANFHDRKCLFYSTVMNDNPVDCIISKVIVAQIPPKIGLKSNSIPSSDFYFDMEYCV  60

Query  638  DYSTFRNLPTVQSVNSWDSPSLIDASYKPITAYPVEHFKSCEPSKVELSLLDLYAGCGGM  459
            +YSTFR L T                    T+   E+  +  P K EL+LLDLY+GCGGM
Sbjct  61   EYSTFRTLLTA-------------------TSTFFENMPNHGPHKAELALLDLYSGCGGM  101

Query  458  STGLCLGAKLSGLNLVTKWAVDYQKSACDSLKFNHPETQVRNESV  324
            STGLCLGAKLS  NLVT+WA+D  KSAC+SLK NHPE QVRNE+ 
Sbjct  102  STGLCLGAKLSCTNLVTRWALDSDKSACESLKLNHPEAQVRNEAA  146


 Score = 79.0 bits (193),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 32/56 (57%), Positives = 44/56 (79%), Gaps = 0/56 (0%)
 Frame = -2

Query  173  EYEILRLVDICFGDPNDTGKPGIHFQVRWKGYGPSEDTWEPIDGLKSWKNRQGWFT  6
            EYE+ R+VDIC+GDPN++GK G++F+V WKGY  SED+WEPI+GL++   R   F 
Sbjct  238  EYEVARIVDICYGDPNESGKRGLNFKVHWKGYSTSEDSWEPIEGLRNCPERIKEFV  293



>gb|EYU39242.1| hypothetical protein MIMGU_mgv1a001319mg [Erythranthe guttata]
Length=841

 Score =   189 bits (480),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 127/330 (38%), Positives = 193/330 (58%), Gaps = 19/330 (6%)
 Frame = -2

Query  1007  ILNVDCHYAQAKVLSFILNIGDCVYVKGE-GEKKHVGRILEFFKTTEGEDYFRVQWFFRA  831
             ++   CH+ +A+V   I  + D  YV GE G+  ++G+I+E F+  +G   F  QWF+R 
Sbjct  108   VVQARCHFLKAEVDGQIYFLEDDAYVMGEPGKPNYIGKIIEIFEALDGSKNFTAQWFYRG  167

Query  830   EDTVMRDAA---ALHDKKRLFYSTLMNDNLLDCIISKVNVTEISPGLGLEVNNSPPSG--  666
              DTV         + + K +F+S + +DN L C++ K+ +  +     ++V  +  S   
Sbjct  168   GDTVRHSKKMPFKMFNTKCVFFSDIKDDNPLSCLVKKLKIEILPLKADIDVKEALKSTCE  227

Query  665   FYYDMEYCVDYSTFRNLPTVQSVNSWDSPSLIDASYKPITAYPVEHFKSCEPSKVELSLL  486
             +Y D +Y + +S+F +LP+  S +S +S S I +     T   V    +      E +LL
Sbjct  228   YYCDKKYLLPFSSFVSLPSDTSTSSDESGSTISSD----TDGEVPELNN------ERTLL  277

Query  485   DLYAGCGGMSTGLCLGAKLSGLNLVTKWAVDYQKSACDSLKFNHPETQVRNESVenflkl  306
             DLY+GCG MSTGLCLGA   G+ LVTKWAVD  + AC+SL+ NHPETQVRNES ++FL L
Sbjct  278   DLYSGCGAMSTGLCLGANSCGVKLVTKWAVDINEYACESLRLNHPETQVRNESADDFLHL  337

Query  305   lke-weklckEYGSEPNAGSDDVLEGMEEGaddansladsddsdAEYEILRLVDICFGDP  129
             LKE  +   +EYG   +   DD  +  ++  D+ +     D     +E+  ++ +C+GDP
Sbjct  338   LKEWEKLSSREYGVLNDTEDDDDDDDDDDDEDEEDEAGAEDSEV--FEVDEILAVCYGDP  395

Query  128   NDTGKPGIHFQVRWKGYGPSEDTWEPIDGL  39
             N TG P +HF++RW GYGP  DTWEP++GL
Sbjct  396   NKTGNPKLHFKIRWLGYGPDYDTWEPLEGL  425



>gb|AFK80345.1| chromomethylase 3 [Nicotiana benthamiana]
Length=740

 Score =   187 bits (474),  Expect = 4e-49, Method: Compositional matrix adjust.
 Identities = 104/237 (44%), Positives = 145/237 (61%), Gaps = 13/237 (5%)
 Frame = -2

Query  1025  DEEDEVILNVDCHYAQAKVLSFILNIGDCVYVKGEG-EKKHVGRILEFFKTTEGEDYFRV  849
             D+ D +I    CH+ QA V   I N+GD  YV+    E  ++ +I+EFF+  +G  YF  
Sbjct  7     DDADHLI-QAKCHFTQAVVDGQIYNLGDDAYVQASNDEDDYICKIVEFFQAVDGTQYFTA  65

Query  848   QWFFRAEDTVMRDAAALHDKKRLFYSTLMNDNLLDCIISKVNVTEISPGLGLEVNNSPPS  669
             QWF+RA+DTV++      D KR+F+S + +DN L C++ K+ +  I   + L +  S  S
Sbjct  66    QWFYRAKDTVIKAHDQFIDNKRVFFSEIKDDNPLGCLVKKIKIVPIPSNVRLPLKESLKS  125

Query  668   G--FYYDMEYCVDYSTFRNLPTVQSVNSWDSPSLIDASYKPITAYPVEHFKSCEPSKVEL  495
                +YYDM Y + YS+F +LP  Q V+S   P     S     +  V+     +  K+E+
Sbjct  126   NSDYYYDMMYLLPYSSFVSLP--QDVSS---PISESDSTISSDSDTVD----VKEQKLEM  176

Query  494   SLLDLYAGCGGMSTGLCLGAKLSGLNLVTKWAVDYQKSACDSLKFNHPETQVRNESV  324
             +LLDLY+GCG MSTGLCLGA + G+ LVTKWAVD  + ACDSLK+NHPET VRNES 
Sbjct  177   NLLDLYSGCGAMSTGLCLGADIGGVKLVTKWAVDLNQYACDSLKWNHPETAVRNESA  233


 Score = 69.3 bits (168),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 26/44 (59%), Positives = 36/44 (82%), Gaps = 0/44 (0%)
 Frame = -2

Query  170  YEILRLVDICFGDPNDTGKPGIHFQVRWKGYGPSEDTWEPIDGL  39
            +E+  L++IC+GDP +  KPG++F+VRWKGYG  EDTWEPI+G 
Sbjct  291  FEVEELLEICYGDPKEINKPGLYFKVRWKGYGQEEDTWEPIEGF  334



>ref|XP_006354167.1| PREDICTED: DNA (cytosine-5)-methyltransferase 1-like [Solanum 
tuberosum]
Length=854

 Score =   187 bits (474),  Expect = 7e-49, Method: Compositional matrix adjust.
 Identities = 98/229 (43%), Positives = 139/229 (61%), Gaps = 12/229 (5%)
 Frame = -2

Query  1007  ILNVDCHYAQAKVLSFILNIGDCVYVKG-EGEKKHVGRILEFFKTTEGEDYFRVQWFFRA  831
             ++   CH+ QA + + I  +GD  YVK  +GE  ++ +I+EFF+  +   YF  QWF+RA
Sbjct  122   LIQAKCHFVQALIDNAIYKLGDDAYVKAADGEDDYICKIVEFFQGVDDMKYFTAQWFYRA  181

Query  830   EDTVMRDAAALHDKKRLFYSTLMNDNLLDCIISKVNVTEISPGLGLEVNNSPPS--GFYY  657
             +DTV++      D KR+F S + +DN LDC++ K+ +  IS  + L+   S  S   +YY
Sbjct  182   KDTVIKAHDQFIDNKRVFLSDIKDDNPLDCLVKKIKIVPISSNVSLQFKESLRSECDYYY  241

Query  656   DMEYCVDYSTFRNLPTVQSVNSWDSPSLIDASYKPITAYPVEHFKSCEPSKVELSLLDLY  477
             DM+Y V +S+F +LP+  S    +  S I +    +           +  K E  LLDLY
Sbjct  242   DMKYLVPFSSFISLPSDVSSPDSELDSTISSDADVV---------EVDEQKQEKKLLDLY  292

Query  476   AGCGGMSTGLCLGAKLSGLNLVTKWAVDYQKSACDSLKFNHPETQVRNE  330
             +GCGGMSTGLCLGA + G+ LVTKW VD  + ACDSLK NHPET+VRNE
Sbjct  293   SGCGGMSTGLCLGADVCGVKLVTKWTVDLNRYACDSLKVNHPETEVRNE  341


 Score = 71.2 bits (173),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 26/50 (52%), Positives = 40/50 (80%), Gaps = 0/50 (0%)
 Frame = -2

Query  170  YEILRLVDICFGDPNDTGKPGIHFQVRWKGYGPSEDTWEPIDGLKSWKNR  21
            +E+  ++++C+GDP +  KPG++F+V WKGYGP EDTWEPI+GL   +N+
Sbjct  402  FEVEEILEVCYGDPKEIKKPGLYFKVCWKGYGPDEDTWEPIEGLDGCQNK  451



>ref|XP_002974335.1| hypothetical protein SELMODRAFT_30570, partial [Selaginella moellendorffii]
 gb|EFJ24557.1| hypothetical protein SELMODRAFT_30570, partial [Selaginella moellendorffii]
Length=773

 Score =   186 bits (473),  Expect = 7e-49, Method: Compositional matrix adjust.
 Identities = 143/368 (39%), Positives = 197/368 (54%), Gaps = 59/368 (16%)
 Frame = -2

Query  989  HYAQAKVLSFILNIGDCVYVKGEGE-KKHVGRILEFFKTTEGEDYFRVQWFFRAEDTV--  819
            HY +A V      +GDCV ++ +G+  +++G++LEFFKT   E++FRVQWFFR  DTV  
Sbjct  39   HYEEAVVDGKHYKVGDCVALELQGDDTEYLGKVLEFFKTANQENWFRVQWFFRFSDTVCL  98

Query  818  --------------MRDAAALH-DKKRLFYSTLMNDNLLDCIISKVNVTEISPGLGLEVN  684
                          + D   +H D KR+F S   +DN+++CII KV V+  +P +     
Sbjct  99   RLCVYPDCKCSLQAIGDLDDVHLDNKRVFLSDDEDDNMIECIIKKVKVS-YAPVMDAFSK  157

Query  683  NSPPSG--FYYDMEYCVDYSTFRNLPTVQSVNSWDSPSLIDASYKPITAYPVEHFKSCEP  510
                    +Y+DM Y  D+STF  +P   S N +   +L +AS    +++     +  + 
Sbjct  158  KKIKQNCDYYFDMGYTGDFSTFYKVP---SGNVFVFDALEEAS----SSFQTAVTRCSDT  210

Query  509  SKVELSLLDLYAGCGGMSTGLCLGAKLSGLNLVTKWAVDYQKSACDSLKFNHPETQVRNE  330
             K EL LLDLY GCG MSTGL +GA L G+ LVTKWAVDY + AC+S+K+NHPET+VRNE
Sbjct  211  IKPELILLDLYCGCGAMSTGLSMGAALGGVKLVTKWAVDYNEHACNSMKYNHPETEVRNE  270

Query  329  SVenflkllkeweklckEY-----GSEPNAGS-DDVLEGMEEGaddansladsddsdAEY  168
              E FL LLKEW+KLC +Y         NA S D    G +E             +  EY
Sbjct  271  DAECFLLLLKEWQKLCTKYEGHVADDNSNASSPDSTTLGADE------------YAADEY  318

Query  167  EILRLVDICFGDPNDTGKPG-------------IHFQVRWKGYGPSEDTWEPIDGLKSWK  27
            E+ ++VDI         KP              + F+VRWKGY    DTWEP+D L S +
Sbjct  319  EVQQVVDIRMAGIQKPKKPDTSSKMPEKPIKRRLEFKVRWKGYTSDHDTWEPVDHLDSCQ  378

Query  26   NRQGWFTI  3
             R   F +
Sbjct  379  ERIRDFVL  386



>gb|AAK71870.1| chromomethylase 3 [Arabidopsis thaliana]
Length=839

 Score =   186 bits (472),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 134/355 (38%), Positives = 198/355 (56%), Gaps = 15/355 (4%)
 Frame = -2

Query  1031  SADEEDEVILNVDCHYAQAKV-LSFILNIGDCVYVK-GEGEKKHVGRILEFFKTTEGEDY  858
             + D+E   I+   CHY +A V    I  + D  YV+ GEG+   + +I+E F+   G+ Y
Sbjct  84    TKDDEKVEIIRARCHYRRAIVDERQIYELNDDAYVQSGEGKDPFICKIIEMFEGVNGKLY  143

Query  857   FRVQWFFRAEDTVMRDAAALHDKKRLFYSTLMNDNLLDCIISKVNVTEISPGLGLEVNNS  678
             F  +WF+R  DTVM++   L +KKR+F+S + + N L  +  K+N+  I   L      +
Sbjct  144   FTARWFYRPSDTVMKEFEILINKKRVFFSEIQDTNELGLLEKKLNILMIP--LNENTKET  201

Query  677   PPSG----FYYDMEYCVDYSTFRNLPTVQSVNSWDSPSLIDASYKPITAYPVEHFKSCEP  510
              P+     F+ DM Y + Y TF  +     +   +S ++   +     A  +     C  
Sbjct  202   IPATENCDFFCDMNYFLPYDTFEAIQQETMMAISESSTISSDTDIREGAAAISEIGECSQ  261

Query  509   S---KVELSLLDLYAGCGGMSTGLCLGAKLSGLNLVTKWAVDYQKSACDSLKFNHPETQV  339
                 + E +LLDLY+GCG MSTGLC+GA+LSGLNLVTKWAVD    AC SL+ NHPET V
Sbjct  262   ETEGQKEATLLDLYSGCGAMSTGLCMGAQLSGLNLVTKWAVDMNAHACKSLQHNHPETNV  321

Query  338   RNESVenflkllkeweklckEYG--SEPNAGSDDVLEGME--EGaddansladsddsdAE  171
             RN + E+FL LLKEWEKLC  +   + PN+     L G+   E  +D +  ++++D    
Sbjct  322   RNMTAEDFLFLLKEWEKLCIHFSLRNSPNSEEYANLHGLNNVEDNEDVSEESENEDDGEV  381

Query  170   YEILRLVDICFGDPNDTGKPGIHFQVRWKGYGPSEDTWEPIDGLKSWKNRQGWFT  6
             + + ++V I FG P    K G++ +VRW  Y  S DTWEPI+GL + + + G F 
Sbjct  382   FTVDKIVGISFGVPKKLLKRGLYLKVRWLNYDDSHDTWEPIEGLSNCRGKIGEFV  436



>ref|XP_004293200.1| PREDICTED: DNA (cytosine-5)-methyltransferase CMT3-like [Fragaria 
vesca subsp. vesca]
Length=758

 Score =   185 bits (470),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 134/349 (38%), Positives = 188/349 (54%), Gaps = 55/349 (16%)
 Frame = -2

Query  1031  SADEEDEVILNVDCHYAQAKVLSFILNIGDCVYVK-GEGEKKHVGRILEFFKTTEGEDYF  855
             + DE DE  +   CHY +A+V   + N+ D  YVK G+G++ ++ +I+EFFK   G  Y 
Sbjct  69    NKDEIDENSIQAMCHYVKAQVDGIVYNLLDDAYVKAGDGKEPYICKIIEFFKGEGGSMYV  128

Query  854   RVQWFFRAEDTVMRDAAALHDKKRLFYSTLMNDNLLDCIISKVNVTEISPGLGLEVNNSP  675
               QW++RA+DTV                                      G   +    P
Sbjct  129   TSQWYYRAKDTV--------------------------------------GYEGKSKPIP  150

Query  674   PSGFYYDMEYCVDYSTFRNLPTVQSVNSWDSPSLIDASYKPITAYPVEHFKSCEPSKVEL  495
                +Y D +Y + YS+F NLP   + +S  S  L  A          +   S E SK E+
Sbjct  151   KCDYYCDTKYLLPYSSFVNLPAEINTSSTISNDLKSAH--------AQGSSSRESSKPEV  202

Query  494   SLLDLYAGCGGMSTGLCLGAKLSGLNLVTKWAVDYQKSACDSLKFNHPETQVRNESVenf  315
              LLDLY+GCG MSTGLCLGA  +G+NLVTKWAVD  K AC+SLKFNHPET VRNES ++F
Sbjct  203   RLLDLYSGCGAMSTGLCLGACSAGVNLVTKWAVDVNKHACESLKFNHPETMVRNESADDF  262

Query  314   lkllkewekl------ckEYGSEPNAGSDDVLEGMEEGaddansladsddsdAEYEILRL  153
             L L+K+WE L         Y SE + G +   E  + G D+  +   ++D +  YE+ ++
Sbjct  263   LSLIKQWEHLCICFNCFGTYDSEKH-GFNFFFETEDSGDDEEITGTGNEDPEV-YEVGQV  320

Query  152   VDICFGDPNDTGKPGIHFQVRWKGYGPSEDTWEPIDGLKSWKNRQGWFT  6
             +DIC+GDPN   K G++ ++RWKGY  ++DTWEPI+ L   + R   F 
Sbjct  321   LDICYGDPNRIKKRGLYCKIRWKGYDAAQDTWEPIEELSHCRERVQEFV  369



>gb|KHN40382.1| DNA (cytosine-5)-methyltransferase 1 [Glycine soja]
Length=705

 Score =   184 bits (468),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 103/238 (43%), Positives = 145/238 (61%), Gaps = 9/238 (4%)
 Frame = -2

Query  1025  DEEDEVILNVDCHYAQAKVLSFIL-NIGDCVYVKGE-GEKKHVGRILEFFKTTEGEDYFR  852
             ++EDE I     HY QA+V   +L  + D  +VK E GE  ++ +I+E F+  +G  YF 
Sbjct  31    NDEDEEIQQARRHYTQAEVDGCMLYKLYDDAHVKAEEGEDNYICKIVEIFEAIDGALYFT  90

Query  851   VQWFFRAEDTVMRDAAALHDKKRLFYSTLMNDNLLDCIISKVNVTEISPGLGLEVNNS--  678
              QW++RA+DTV++  A L + KR+F+S + +DN LDC++ K+N+  I+  + LE      
Sbjct  91    AQWYYRAKDTVIKKLAYLIEPKRVFFSEVQDDNPLDCLVEKLNIARITLNVDLEAKKETI  150

Query  677   PPSGFYYDMEYCVDYSTFRNLPTVQSVNSWDSPSLIDASYKPITAY-----PVEHFKSCE  513
             PP  +Y D +Y + YSTF NLP+    +  ++ S I +    I  Y     P E F   E
Sbjct  151   PPCDYYCDTQYLLPYSTFVNLPSENGESGSETSSTISSETNGIGKYEVNSQPKEAFLPEE  210

Query  512   PSKVELSLLDLYAGCGGMSTGLCLGAKLSGLNLVTKWAVDYQKSACDSLKFNHPETQV  339
                 E+ LLDLY GCG MSTGLCLG  LSG+NLVT+WAVD  + AC+ LK NHPET+V
Sbjct  211   SKDPEMKLLDLYCGCGAMSTGLCLGGNLSGVNLVTRWAVDLNQHACECLKLNHPETEV  268



>ref|XP_002299134.2| hypothetical protein POPTR_0001s04700g [Populus trichocarpa]
 gb|EEE83939.2| hypothetical protein POPTR_0001s04700g [Populus trichocarpa]
Length=970

 Score =   186 bits (471),  Expect = 5e-48, Method: Compositional matrix adjust.
 Identities = 105/241 (44%), Positives = 148/241 (61%), Gaps = 12/241 (5%)
 Frame = -2

Query  1022  EEDEVILNVDCHYAQAKVLSFILNIGDCVYVKG-EGEKKHVGRILEFFKTTEGEDYFRVQ  846
             ++ E I+   CHY +A+V   I N+ D  +V+  +GE  ++ RI+E F++ +   +F  Q
Sbjct  221   DDSEEIIKARCHYKRAEVDGIIYNLYDDAHVQASDGEADYICRIIEMFESEDRTPHFTAQ  280

Query  845   WFFRAEDTVMRDAAALHDKKRLFYSTLMNDNLLDCIISKVNVTEISPGLGLEVNNSPPSG  666
             W++R+ DT+++D   + D K +F+S + NDN LDC+  K+ +  ++ G+  E   +    
Sbjct  281   WYYRSTDTIIKDKY-ISDPKCVFFSEIRNDNPLDCLTRKLKIVRLALGVDSETRRAKTLN  339

Query  665   --FYYDMEYCVDYSTFRNLPTVQSVNSWDSPSLIDASYKPITAYPV--EHFKSCEPS---  507
               FY DM Y + YSTF  LP   S N+  +P         I A  V  E  + CE S   
Sbjct  340   CDFYCDMLYLLPYSTFVKLP---SENNTTAPESSSTISSDIDAAGVKFECDEVCESSGRR  396

Query  506   KVELSLLDLYAGCGGMSTGLCLGAKLSGLNLVTKWAVDYQKSACDSLKFNHPETQVRNES  327
             K E++LLDLY+GCG MSTGLCLGA LSGLNLVTKWAVD  K AC+SL+ NHPETQVRNE+
Sbjct  397   KSEVALLDLYSGCGAMSTGLCLGANLSGLNLVTKWAVDLNKHACESLRLNHPETQVRNET  456

Query  326   V  324
              
Sbjct  457   A  457


 Score = 54.7 bits (130),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 22/57 (39%), Positives = 37/57 (65%), Gaps = 1/57 (2%)
 Frame = -2

Query  170  YEILRLVDICFGDPNDTG-KPGIHFQVRWKGYGPSEDTWEPIDGLKSWKNRQGWFTI  3
            +E+ +++++C GDP + G +  ++F+V WK YGP  DTWEPI GL + +     F +
Sbjct  521  FEVEKILEVCHGDPKEIGGQRDLYFKVSWKNYGPDYDTWEPISGLSNCREAIKKFVM  577



>ref|XP_010316153.1| PREDICTED: DNA (cytosine-5)-methyltransferase 1 isoform X2 [Solanum 
lycopersicum]
Length=744

 Score =   181 bits (458),  Expect = 7e-47, Method: Compositional matrix adjust.
 Identities = 101/239 (42%), Positives = 141/239 (59%), Gaps = 14/239 (6%)
 Frame = -2

Query  1034  CSADEEDEVILNVDCHYAQAKVLSFILNIGDCVYVKG-EGEKKHVGRILEFFKTTEGEDY  858
             C  D ++  ++   CH+AQA V + I  +GD  YVK  E E  ++ +I+EFF+  +   Y
Sbjct  5     CQHDSDE--LIQAKCHFAQALVDNVIYKLGDDAYVKAAEDEDDYICKIVEFFQGVDDMKY  62

Query  857   FRVQWFFRAEDTVMRDAAALHDKKRLFYSTLMNDNLLDCIISKVNVTEISPGLGLEVNNS  678
             F  QWF+RA+DTV++      DKKR+F S + + N LDC++ K+ +  IS  + L+   S
Sbjct  63    FTAQWFYRAKDTVIKAHDQFIDKKRVFLSDIKDHNPLDCLVKKIKIVPISSNVSLQFKES  122

Query  677   P--PSGFYYDMEYCVDYSTFRNLPTVQSVNSWDSPSLIDASYKPITAYPVEHFKSCEPSK  504
                   +YYDM+Y V +S+F +LP+       +S S I +    +           +  K
Sbjct  123   LRLECDYYYDMKYLVPFSSFISLPSDVLSPDSESNSTISSDGDVV---------EVKEQK  173

Query  503   VELSLLDLYAGCGGMSTGLCLGAKLSGLNLVTKWAVDYQKSACDSLKFNHPETQVRNES  327
              E  LLDLY+GCGGMSTGLCLGA +  + LVTKW VD    ACDSLK NHPET+VRNES
Sbjct  174   QEKKLLDLYSGCGGMSTGLCLGADVCDVKLVTKWTVDLNCYACDSLKANHPETEVRNES  232


 Score = 74.7 bits (182),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 27/50 (54%), Positives = 41/50 (82%), Gaps = 0/50 (0%)
 Frame = -2

Query  170  YEILRLVDICFGDPNDTGKPGIHFQVRWKGYGPSEDTWEPIDGLKSWKNR  21
            +E+  ++++C+GDP +  KPG++F+VRWKGYGP EDTWEPI+GL   +N+
Sbjct  293  FEVEEILEVCYGDPKEIKKPGLYFKVRWKGYGPDEDTWEPIEGLDGCQNK  342



>ref|XP_004228597.2| PREDICTED: DNA (cytosine-5)-methyltransferase 1 isoform X1 [Solanum 
lycopersicum]
Length=855

 Score =   181 bits (459),  Expect = 8e-47, Method: Compositional matrix adjust.
 Identities = 101/239 (42%), Positives = 141/239 (59%), Gaps = 14/239 (6%)
 Frame = -2

Query  1034  CSADEEDEVILNVDCHYAQAKVLSFILNIGDCVYVKG-EGEKKHVGRILEFFKTTEGEDY  858
             C  D ++  ++   CH+AQA V + I  +GD  YVK  E E  ++ +I+EFF+  +   Y
Sbjct  116   CQHDSDE--LIQAKCHFAQALVDNVIYKLGDDAYVKAAEDEDDYICKIVEFFQGVDDMKY  173

Query  857   FRVQWFFRAEDTVMRDAAALHDKKRLFYSTLMNDNLLDCIISKVNVTEISPGLGLEVNNS  678
             F  QWF+RA+DTV++      DKKR+F S + + N LDC++ K+ +  IS  + L+   S
Sbjct  174   FTAQWFYRAKDTVIKAHDQFIDKKRVFLSDIKDHNPLDCLVKKIKIVPISSNVSLQFKES  233

Query  677   P--PSGFYYDMEYCVDYSTFRNLPTVQSVNSWDSPSLIDASYKPITAYPVEHFKSCEPSK  504
                   +YYDM+Y V +S+F +LP+       +S S I +    +           +  K
Sbjct  234   LRLECDYYYDMKYLVPFSSFISLPSDVLSPDSESNSTISSDGDVV---------EVKEQK  284

Query  503   VELSLLDLYAGCGGMSTGLCLGAKLSGLNLVTKWAVDYQKSACDSLKFNHPETQVRNES  327
              E  LLDLY+GCGGMSTGLCLGA +  + LVTKW VD    ACDSLK NHPET+VRNES
Sbjct  285   QEKKLLDLYSGCGGMSTGLCLGADVCDVKLVTKWTVDLNCYACDSLKANHPETEVRNES  343


 Score = 75.1 bits (183),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 27/50 (54%), Positives = 41/50 (82%), Gaps = 0/50 (0%)
 Frame = -2

Query  170  YEILRLVDICFGDPNDTGKPGIHFQVRWKGYGPSEDTWEPIDGLKSWKNR  21
            +E+  ++++C+GDP +  KPG++F+VRWKGYGP EDTWEPI+GL   +N+
Sbjct  404  FEVEEILEVCYGDPKEIKKPGLYFKVRWKGYGPDEDTWEPIEGLDGCQNK  453



>ref|XP_001769709.1| predicted protein [Physcomitrella patens]
 gb|EDQ65510.1| predicted protein [Physcomitrella patens]
Length=700

 Score =   179 bits (455),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 130/333 (39%), Positives = 180/333 (54%), Gaps = 33/333 (10%)
 Frame = -2

Query  989  HYAQAKVLSFILNIGDCVYVKGEGEKKHVGRILEFFKTTEGEDYFRVQWFFRAEDTVMRD  810
            HY QA+V   +  +GDCV+V    E   +GRI EF++  +   +F  QWFFR+ DTV R+
Sbjct  1    HYRQAEVEGKLYKLGDCVHVHSGLEDPFIGRITEFYEKEDKSPWFHAQWFFRSYDTVSRN  60

Query  809  AAALHDKKRLFYSTLMNDNLLDCIISKVNVTEISPGLGLEVN--NSPPSGFYYDMEYCVD  636
                HD K+++YS + ++N L  I+ KV+V  I+     + +   +P   +Y+D  Y   
Sbjct  61   ----HDPKKIYYSEVADENELHVIVGKVSVIRIASKDRSDRSPIKTPACDYYFDKGYMFQ  116

Query  635  YSTFRNLPTVQSVNSWDSPSLIDASYKPITAYPVEHFKSCEPS--KVELSLLDLYAGCGG  462
            Y TF  LP        D P     S         E   SC  S  K +  LLDLY GCG 
Sbjct  117  YGTFYTLPK-------DLPGHGSKS--------TESDNSCSDSNDKKDFYLLDLYCGCGA  161

Query  461  MSTGLCLGAKLSGLNLVTKWAVDYQKSACDSLKFNHPETQVRNESVenflkllkeweklc  282
            MSTG+CLG  L+G+NLVTKWAVD  + AC SLK+NHPET VRNE+ E++L+LLKEW+KLC
Sbjct  162  MSTGICLGMNLAGINLVTKWAVDLNEFACMSLKYNHPETTVRNEAAEDYLQLLKEWKKLC  221

Query  281  kEYGSEPNAGSDDVLEGMEEGaddansladsddsdAEYEILRLVDICFGDPNDTGKPGIH  102
            ++Y           +  + +   + +   D D +  EYE+ RL+ I +          + 
Sbjct  222  EKYP----------VGCVVQEDSEEDEDGDDDPAAGEYEVERLLGIRWVGEVSEKDKEVM  271

Query  101  FQVRWKGYGPSEDTWEPIDGLKSWKNRQGWFTI  3
             QVRWKGY P +DTWEP   L     R   F +
Sbjct  272  EQVRWKGYAPEDDTWEPAASLDHCPERVKEFVL  304



>ref|NP_177135.1| DNA (cytosine-5)-methyltransferase CMT3 [Arabidopsis thaliana]
 sp|Q94F88.2|CMT3_ARATH RecName: Full=DNA (cytosine-5)-methyltransferase CMT3; AltName: 
Full=Chromomethylase 3; AltName: Full=Protein CHROMOMETHYLASE 
3 [Arabidopsis thaliana]
 gb|AAG52543.1|AC013289_10 putative chromomethylase; 17383-22406 [Arabidopsis thaliana]
 gb|AEE34973.1| DNA (cytosine-5)-methyltransferase CMT3 [Arabidopsis thaliana]
Length=839

 Score =   180 bits (457),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 131/350 (37%), Positives = 194/350 (55%), Gaps = 15/350 (4%)
 Frame = -2

Query  1031  SADEEDEVILNVDCHYAQAKV-LSFILNIGDCVYVK-GEGEKKHVGRILEFFKTTEGEDY  858
             + D+E   I+   CHY +A V    I  + D  YV+ GEG+   + +I+E F+   G+ Y
Sbjct  84    TKDDEKVEIIRARCHYRRAIVDERQIYELNDDAYVQSGEGKDPFICKIIEMFEGANGKLY  143

Query  857   FRVQWFFRAEDTVMRDAAALHDKKRLFYSTLMNDNLLDCIISKVNVTEISPGLGLEVNNS  678
             F  +WF+R  DTVM++   L  KKR+F+S + + N L  +  K+N+  I   L      +
Sbjct  144   FTARWFYRPSDTVMKEFEILIKKKRVFFSEIQDTNELGLLEKKLNILMIP--LNENTKET  201

Query  677   PPSG----FYYDMEYCVDYSTFRNLPTVQSVNSWDSPSLIDASYKPITAYPVEHFKSCEP  510
              P+     F+ DM Y + Y TF  +     +   +S ++   +     A  +     C  
Sbjct  202   IPATENCDFFCDMNYFLPYDTFEAIQQETMMAISESSTISSDTDIREGAAAISEIGECSQ  261

Query  509   S---KVELSLLDLYAGCGGMSTGLCLGAKLSGLNLVTKWAVDYQKSACDSLKFNHPETQV  339
                   + +LLDLY+GCG MSTGLC+GA+LSGLNLVTKWAVD    AC SL+ NHPET V
Sbjct  262   ETEGHKKATLLDLYSGCGAMSTGLCMGAQLSGLNLVTKWAVDMNAHACKSLQHNHPETNV  321

Query  338   RNESVenflkllkeweklckEYG--SEPNAGSDDVLEGME--EGaddansladsddsdAE  171
             RN + E+FL LLKEWEKLC  +   + PN+     L G+   E  +D +  ++++D    
Sbjct  322   RNMTAEDFLFLLKEWEKLCIHFSLRNSPNSEEYANLHGLNNVEDNEDVSEESENEDDGEV  381

Query  170   YEILRLVDICFGDPNDTGKPGIHFQVRWKGYGPSEDTWEPIDGLKSWKNR  21
             + + ++V I FG P    K G++ +VRW  Y  S DTWEPI+GL + + +
Sbjct  382   FTVDKIVGISFGVPKKLLKRGLYLKVRWLNYDDSHDTWEPIEGLSNCRGK  431



>dbj|BAF01425.1| putative chromomethylase [Arabidopsis thaliana]
Length=839

 Score =   180 bits (457),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 131/350 (37%), Positives = 194/350 (55%), Gaps = 15/350 (4%)
 Frame = -2

Query  1031  SADEEDEVILNVDCHYAQAKV-LSFILNIGDCVYVK-GEGEKKHVGRILEFFKTTEGEDY  858
             + D+E   I+   CHY +A V    I  + D  YV+ GEG+   + +I+E F+   G+ Y
Sbjct  84    TKDDEKVEIIRARCHYRRAIVGERQIYELNDDAYVQSGEGKDPFICKIIEMFEGANGKLY  143

Query  857   FRVQWFFRAEDTVMRDAAALHDKKRLFYSTLMNDNLLDCIISKVNVTEISPGLGLEVNNS  678
             F  +WF+R  DTVM++   L  KKR+F+S + + N L  +  K+N+  I   L      +
Sbjct  144   FTARWFYRPSDTVMKEFEILIKKKRVFFSEIQDTNELGLLEKKLNILMIP--LNENTKET  201

Query  677   PPSG----FYYDMEYCVDYSTFRNLPTVQSVNSWDSPSLIDASYKPITAYPVEHFKSCEP  510
              P+     F+ DM Y + Y TF  +     +   +S ++   +     A  +     C  
Sbjct  202   IPATENCDFFCDMNYFLPYDTFEAIQQETMMAISESSTISSDTDIREGAAAISEIGECSQ  261

Query  509   S---KVELSLLDLYAGCGGMSTGLCLGAKLSGLNLVTKWAVDYQKSACDSLKFNHPETQV  339
                   + +LLDLY+GCG MSTGLC+GA+LSGLNLVTKWAVD    AC SL+ NHPET V
Sbjct  262   ETEGHKKATLLDLYSGCGAMSTGLCMGAQLSGLNLVTKWAVDMNAHACKSLQHNHPETNV  321

Query  338   RNESVenflkllkeweklckEYG--SEPNAGSDDVLEGME--EGaddansladsddsdAE  171
             RN + E+FL LLKEWEKLC  +   + PN+     L G+   E  +D +  ++++D    
Sbjct  322   RNMTAEDFLFLLKEWEKLCIHFSLRNSPNSEEYANLHGLNNVEDNEDVSEESENEDDGEV  381

Query  170   YEILRLVDICFGDPNDTGKPGIHFQVRWKGYGPSEDTWEPIDGLKSWKNR  21
             + + ++V I FG P    K G++ +VRW  Y  S DTWEPI+GL + + +
Sbjct  382   FTVDKIVGISFGVPKKLLKRGLYLKVRWLNYDDSHDTWEPIEGLSNCRGK  431



>gb|EMS51591.1| DNA (cytosine-5)-methyltransferase 1 [Triticum urartu]
Length=758

 Score =   178 bits (451),  Expect = 5e-46, Method: Compositional matrix adjust.
 Identities = 134/335 (40%), Positives = 176/335 (53%), Gaps = 57/335 (17%)
 Frame = -2

Query  1019  EDEVILNVDCHYAQAKVLSFILNIGDCVYV-KGEGEKKHVGRILEFFKTTEGEDYFRVQW  843
             EDE  +    HY  A V   +  +GD VYV  GE E  ++GRI EFF+  +   YF  +W
Sbjct  20    EDEEDMKARVHYRSAMVDGVVYALGDDVYVMAGENEADYIGRITEFFEGVDKTSYFTCRW  79

Query  842   FFRAEDTVMRDAAAL----HDKKRLFYSTLMNDNLLDCIISKVNVTEISPGL--GLEVNN  681
             +FR EDTV+  A  +    HD KR+F S   NDNLLDCIISKV +  + P +    +   
Sbjct  80    YFRPEDTVISRAKFVNDHTHDPKRVFLSEEKNDNLLDCIISKVKIIHVDPNMDPAAKAKL  139

Query  680   SPPSGFYYDMEYCVDYSTFRNLPTVQSVNSWDSPSLIDASYKPITAYPVEHFKSCEPSKV  501
                +  YYDM Y V YSTF N+P+  + NS  S      +  P+                
Sbjct  140   VARTDLYYDMSYTVAYSTFANIPSDTTENSGISTDADSENGTPVKT--------------  185

Query  500   ELSLLDLYAGCGGMSTGLCLGAKLSGLNLVTKWAVDYQKSACDSLKFNHPETQVRNESVe  321
               SLLDLY+GCGGMSTGLCLG+ L+GL L T                      VRNE  E
Sbjct  186   -ASLLDLYSGCGGMSTGLCLGSALAGLKLET----------------------VRNEKAE  222

Query  320   nflkllkeweklckEYGSEPNAGSDDVLEGMEEGaddansladsddsdAEYEILRLVDIC  141
             +FL LLKEW  LC +Y    ++ + D +E  E+         D      E+ + +L++IC
Sbjct  223   DFLALLKEWAILCDKYVHSNDSDAADPVEEEED---------DEPLGKDEFVVEKLLEIC  273

Query  140   FGDPNDTG-KPGIHFQVRWKGYGPSEDTWEPIDGL  39
             +G    TG K GI+F+V+WKGYGP EDTWEPI+ L
Sbjct  274   YGG---TGRKNGIYFKVQWKGYGPEEDTWEPIENL  305



>gb|AAK69756.1|AF383170_1 chromomethylase CMT3 [Arabidopsis thaliana]
Length=839

 Score =   178 bits (452),  Expect = 6e-46, Method: Compositional matrix adjust.
 Identities = 130/350 (37%), Positives = 194/350 (55%), Gaps = 15/350 (4%)
 Frame = -2

Query  1031  SADEEDEVILNVDCHYAQAKV-LSFILNIGDCVYVK-GEGEKKHVGRILEFFKTTEGEDY  858
             + D+E   I+   CHY +A V    I  + D  YV+ GEG+   + +I+E F+   G+ Y
Sbjct  84    TKDDEKVEIIRARCHYRRAIVDERQIYELNDDAYVQSGEGKDPFICKIIEMFEGANGKLY  143

Query  857   FRVQWFFRAEDTVMRDAAALHDKKRLFYSTLMNDNLLDCIISKVNVTEISPGLGLEVNNS  678
             F  +WF+R  DTVM++   L  +KR+F+S + + N L  +  K+N+  I   L      +
Sbjct  144   FTARWFYRPSDTVMKEFEILIKEKRVFFSEIQDTNELGLLEKKLNILMIP--LNENTKET  201

Query  677   PPSG----FYYDMEYCVDYSTFRNLPTVQSVNSWDSPSLIDASYKPITAYPVEHFKSCEP  510
              P+     F+ DM Y + Y TF  +     +   +S ++   +     A  +     C  
Sbjct  202   IPATENCDFFCDMNYFLPYDTFEAIQQETMMAISESSTISSDTDIREGAAAISEIGECSQ  261

Query  509   S---KVELSLLDLYAGCGGMSTGLCLGAKLSGLNLVTKWAVDYQKSACDSLKFNHPETQV  339
                   + +LLDLY+GCG MSTGLC+GA+LSGLNLVTKWAVD    AC SL+ NHPET V
Sbjct  262   ETEGHKKATLLDLYSGCGAMSTGLCMGAQLSGLNLVTKWAVDMNAHACKSLQHNHPETNV  321

Query  338   RNESVenflkllkeweklckEYG--SEPNAGSDDVLEGME--EGaddansladsddsdAE  171
             RN + E+FL LLKEWEKLC  +   + PN+     L G+   E  +D +  ++++D    
Sbjct  322   RNMTAEDFLFLLKEWEKLCIHFSLRNSPNSEEYANLHGLNNVEDNEDVSEESENEDDGEV  381

Query  170   YEILRLVDICFGDPNDTGKPGIHFQVRWKGYGPSEDTWEPIDGLKSWKNR  21
             + + ++V I FG P    K G++ +VRW  Y  S DTWEPI+GL + + +
Sbjct  382   FTVDKIVGISFGVPKKLLKRGLYLKVRWLNYDDSHDTWEPIEGLSNCRGK  431



>ref|XP_006390678.1| hypothetical protein EUTSA_v10018159mg [Eutrema salsugineum]
 gb|ESQ27964.1| hypothetical protein EUTSA_v10018159mg [Eutrema salsugineum]
Length=774

 Score =   177 bits (449),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 102/242 (42%), Positives = 140/242 (58%), Gaps = 26/242 (11%)
 Frame = -2

Query  1019  EDEVILNVDCHYAQAKVLSFILNIGDCVYVKGEGEK-KHVGRILEFFKTTEGEDYFRVQW  843
             E+E  +    HY +A V    + +GD VYVK E  K  ++ +I+EFF++ + E YFR +W
Sbjct  50    EEEEKMQATHHYRRANVDGIQIALGDDVYVKAEENKPNYIAKIVEFFESIDKEAYFRARW  109

Query  842   FFRAEDTVMRDAAALHDKKRLFYSTLMNDNLLDCIISKVNVTEISPGL---GLEVNNSPP  672
             F+R EDTV++  A    + R+F S + +DN L+CIIS+V + +I P +     E     P
Sbjct  110   FYRPEDTVIKGLAHYVQRNRVFLSNVEDDNPLNCIISRVEILKIPPKVVSRPEERIMPQP  169

Query  671   SGFYYDMEYCVDYSTFRNLPTVQSVNSWDSPSLIDASYKPITAYPVEHFKSCE------P  510
               +YYDM Y +D+ T   +  V  VN+   PS   +S              C+      P
Sbjct  170   CEYYYDMGYDLDHLT---ISCVDDVNTDSVPSSTISS-------------GCDTNCIENP  213

Query  509   SKVELSLLDLYAGCGGMSTGLCLGAKLSGLNLVTKWAVDYQKSACDSLKFNHPETQVRNE  330
              K E  LLDLY+GCG MSTGLC+GA L+G+ L TKWAVD  K AC SLK NHPET+VRNE
Sbjct  214   QKNEKYLLDLYSGCGAMSTGLCMGASLAGIKLTTKWAVDINKFACASLKLNHPETEVRNE  273

Query  329   SV  324
             + 
Sbjct  274   AA  275



>gb|EMT27177.1| DNA (cytosine-5)-methyltransferase 1 [Aegilops tauschii]
Length=616

 Score =   170 bits (431),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 96/207 (46%), Positives = 123/207 (59%), Gaps = 27/207 (13%)
 Frame = -2

Query  923  EGEKKHVGRILEFFKTTEGEDYFRVQWFFRAEDTVMRDAAAL----HDKKRLFYSTLMND  756
            EG+   +GRI E F+ T+   YF  +WFFR+EDTV+  A  +    HD KR+F S   ND
Sbjct  4    EGKPHFIGRITELFEGTDHVKYFNCRWFFRSEDTVISTAKLVDDHSHDPKRVFLSDERND  63

Query  755  NLLDCIISKVNVTEISPGLGLEVNN--SPPSGFYYDMEYCVDYSTFRNLPT-VQSVN--S  591
            N LDCI+SKV + ++ P L LE     +  +  YYDM Y V YSTF N+   +  ++  S
Sbjct  64   NPLDCIVSKVKILQVDPKLDLEAKAQLAADNDLYYDMSYTVPYSTFENITNDINEISGIS  123

Query  590  WDSPSLIDASYKPITAYPVEHFKSCEPSKVELSLLDLYAGCGGMSTGLCLGAKLSGLNLV  411
             D+ S +D S    T                  LLDLY+GCGGMSTGLCLGA L+GL L 
Sbjct  124  SDADSEVDTSVATAT------------------LLDLYSGCGGMSTGLCLGAALAGLKLE  165

Query  410  TKWAVDYQKSACDSLKFNHPETQVRNE  330
            T+WAVD+   AC SLK NHP+T+VRNE
Sbjct  166  TRWAVDFNSHACKSLKSNHPKTEVRNE  192



>ref|XP_002889276.1| hypothetical protein ARALYDRAFT_895912 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH65535.1| hypothetical protein ARALYDRAFT_895912 [Arabidopsis lyrata subsp. 
lyrata]
Length=876

 Score =   169 bits (428),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 120/307 (39%), Positives = 176/307 (57%), Gaps = 22/307 (7%)
 Frame = -2

Query  989  HYAQAKVLSFILNIGDCVYVKG-EGEKKHVGRILEFFKTTEGEDYFRVQWFFRAEDTVMR  813
            HY QA V   ++N+ D VYV G  G+   +G+++E F+  +G  Y R++WF+R  DT++ 
Sbjct  64   HYEQALVDGVLINLNDDVYVTGLPGKLNFIGKVIEMFEADDGVPYSRIRWFYRPNDTLIE  123

Query  812  DAAALHDKKRLFYSTLMNDNLLDCIISKVNVTEIS-PGLGLEVNNS--PPSGFYYDMEYC  642
              A L  KKR+F S + +DN L CI SKVN+ ++  P +   +     PP  +YYDM+Y 
Sbjct  124  RFAELVQKKRVFLSNVEDDNPLTCIYSKVNIAKVPLPKITSRIEQRVIPPCDYYYDMKYE  183

Query  641  VDYSTFRNLPTVQSVNSWDSPSLIDASYKPITAYPVEHFKSCEPSKVELSLLDLYAGCGG  462
            V Y  F       S +   + S   +S      +   H       K E  LLDLY+GCG 
Sbjct  184  VPYLNF------TSADDDTAASSTLSSDSASNCFETLH-------KDEKYLLDLYSGCGA  230

Query  461  MSTGLCLGAKLSGLNLVTKWAVDYQKSACDSLKFNHPETQVRNESVenflkllkeweklc  282
            MSTG C+GA ++G+ L+TKW+VD  K ACDS + NHPET+VRNE+ E+FL LLKEW++LC
Sbjct  231  MSTGFCMGASIAGVKLITKWSVDINKFACDSFRHNHPETEVRNEAAEDFLILLKEWKRLC  290

Query  281  kEY----GSEP-NAGSDDVLEGMEEGaddansladsddsdAEYEILRLVDICFGDPNDTG  117
            + +     +EP  + S+   E  +E  D   +    + S  E+E+ + V I FGDP  TG
Sbjct  291  ERFSLSSSTEPMESISELEDEESDENDDIDEASTGMELSAGEFEVEKFVGIVFGDPKGTG  350

Query  116  KPGIHFQ  96
            +  +H +
Sbjct  351  EKTLHLK  357



>ref|XP_009364100.1| PREDICTED: DNA (cytosine-5)-methyltransferase CMT3-like isoform 
X1 [Pyrus x bretschneideri]
Length=1023

 Score =   169 bits (428),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 96/238 (40%), Positives = 146/238 (61%), Gaps = 10/238 (4%)
 Frame = -2

Query  1019  EDEVILNVDCHYAQAKVLSFILNIGDCVYVKGE-GEKKHVGRILEFFKTTEGEDYFRVQW  843
             +DE I+   CHY +A V     ++ D  +V+GE  E+  + +I+E F+   G  YF  QW
Sbjct  266   DDEDIIQARCHYTKALVDGITYDLYDDAHVQGETKEEPFICKIVEMFEAIGGLLYFTAQW  325

Query  842   FFRAEDTVMRDAAALHDKKRLFYSTLMNDNLLDCIISKVNVTEISPGLGLEVNNS--PPS  669
             ++R+ DTV++  A++    R+F+S + +DN LDC++ K+++  ++  +  +V +   P  
Sbjct  326   YYRSRDTVIKHCASVA-CARVFFSDVRDDNPLDCLVEKLHIVRLTLNVDQDVKSKSIPVC  384

Query  668   GFYYDMEYCVDYSTFRNLPTVQSVNSWDSPSLIDASYKPITAYPVEHFKS---CEPSKVE  498
              +Y D +Y + YSTF NLPT +++ S    S I           V+   S   C  +K E
Sbjct  385   NYYCDTKYLLPYSTFVNLPT-ENMQSGSDDSTISVEDDVCLDSEVDSKLSNGLC--AKSE  441

Query  497   LSLLDLYAGCGGMSTGLCLGAKLSGLNLVTKWAVDYQKSACDSLKFNHPETQVRNESV  324
             + LLDLY+GCG MSTGLCLGA L+ +NLVT+WAVDY + AC SL+ NHPET+VRNE+ 
Sbjct  442   VRLLDLYSGCGAMSTGLCLGAHLANVNLVTRWAVDYNEYACKSLEQNHPETEVRNEAA  499


 Score = 63.5 bits (153),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 27/56 (48%), Positives = 39/56 (70%), Gaps = 1/56 (2%)
 Frame = -2

Query  170  YEILRLVDICFGDPNDTGKPGIHFQVRWKGYGPSEDTWEPIDGLKSWKNR-QGWFT  6
            +E+  +V +CFGDP    K GI+F++ WKGYGP EDTWEP++ L+  K   +G+ T
Sbjct  564  FEVDCVVGVCFGDPKKNEKKGIYFKIHWKGYGPDEDTWEPMNELEHCKKAIKGFIT  619



>emb|CDY14524.1| BnaC03g49350D [Brassica napus]
Length=802

 Score =   166 bits (421),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 125/350 (36%), Positives = 197/350 (56%), Gaps = 48/350 (14%)
 Frame = -2

Query  1022  EEDEVILNVDCHYAQAKV-LSFILNIGDCVYVKG-EGEKKHVGRILEFFKTTEGEDYFRV  849
             EE+E+ L    H+ +A +  S   N+ D  +V+  E EK  + +I+E F+ ++G+ YF  
Sbjct  97    EEEEIFL-ARRHFRRAILDESITYNLFDDAHVQSDEDEKPFICKIVEIFEGSDGKMYFTA  155

Query  848   QWFFRAEDTVMRDAAALHDKKRLFYSTLMNDNLLDCIISKVNVTEISPGLGLEVNNSPPS  669
             QWF+RA DT ++    + D KR+F S + + N +  +++K+ +  I      EV  S   
Sbjct  156   QWFYRACDTAIQKHEEMIDHKRVFISDIKDVNSMGVLLNKLKILMIPLTENYEVTES--C  213

Query  668   GFYYDMEYCVDYSTFRNLPTVQSVNSWDSPSLIDASYKPITAYPVEHFKSCEPSKVELSL  489
              +Y +M+Y + +ST   L + Q +    +P+                       + + ++
Sbjct  214   DYYCNMKYRLPFSTLEALQSSQCI----TPN----------------------QRTDATM  247

Query  488   LDLYAGCGGMSTGLCLGAKLSGLNLVTKWAVDYQKSACDSLKFNHPETQVRNESVenflk  309
             LDLY GCG MSTGLC+GA+LSGLNLVTKWAVD  K A  S+K+NHPET+VRNES E+FL 
Sbjct  248   LDLYCGCGAMSTGLCMGAQLSGLNLVTKWAVDTSKYAVQSIKYNHPETEVRNESAEDFLY  307

Query  308   llkeweklckEYGSEPNAGSD--------DVLEGMEEGaddansladsddsdAEYEILRL  153
             LLK+WEKLC  +    +A S+          +E +E+G+D+++     +     +E+ ++
Sbjct  308   LLKKWEKLCIHFSLIESADSEKYENLYGMSAVEEVEDGSDESDVKDGGEV----FEVEKI  363

Query  152   VDICFGDPNDTGKPGIHFQVRWKGYGPSEDTWEPIDGLKSWKNRQGWFTI  3
             V I      + G  G+H +VRW+ YGPS DTWEPI+ L + + +   F +
Sbjct  364   VGI---KKEEGG--GLHLKVRWENYGPSHDTWEPIENLSNCRKKIKEFVV  408



>ref|XP_009376742.1| PREDICTED: DNA (cytosine-5)-methyltransferase CMT3-like [Pyrus 
x bretschneideri]
Length=989

 Score =   167 bits (422),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 91/235 (39%), Positives = 140/235 (60%), Gaps = 4/235 (2%)
 Frame = -2

Query  1019  EDEVILNVDCHYAQAKVLSFILNIGDCVYV-KGEGEKKHVGRILEFFKTTEGEDYFRVQW  843
             +DE I+   CHY +A V     ++ D  +V  GE E+ ++ +I+E F+   G  YF  QW
Sbjct  227   DDEDIIQAHCHYTKALVDGINYDLYDDAHVFSGEKEEPYICKIVEMFEAIGGLLYFTAQW  286

Query  842   FFRAEDTVMRDAAALHDKKRLFYSTLMNDNLLDCIISKVNVTEISPGLG--LEVNNSPPS  669
             ++R+ DTV++  A +    R+F+S + +DN L+C++ K+++  ++  +   L+  + P  
Sbjct  287   YYRSRDTVIKHCATVA-CGRVFFSDVRDDNPLNCLLEKLHIVRLTLNVDEDLKSKSIPVC  345

Query  668   GFYYDMEYCVDYSTFRNLPTVQSVNSWDSPSLIDASYKPITAYPVEHFKSCEPSKVELSL  489
              +Y D +Y + YSTF NLP        D  ++       + +       + E +K E+ L
Sbjct  346   NYYCDTKYLLPYSTFVNLPAENMQTGSDDSTISVEDDVFLDSEVDSKLPNGERAKSEVRL  405

Query  488   LDLYAGCGGMSTGLCLGAKLSGLNLVTKWAVDYQKSACDSLKFNHPETQVRNESV  324
             LDLY+GCG MSTGLCLGA L+ +NLVT+WAVDY K AC SL  NHPET+VRNE+ 
Sbjct  406   LDLYSGCGAMSTGLCLGAHLANVNLVTRWAVDYNKYACKSLAQNHPETEVRNEAA  460


 Score = 64.7 bits (156),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 26/49 (53%), Positives = 36/49 (73%), Gaps = 0/49 (0%)
 Frame = -2

Query  170  YEILRLVDICFGDPNDTGKPGIHFQVRWKGYGPSEDTWEPIDGLKSWKN  24
            +E+  +V +CFGDP  T K GI+F++ WKGYGP EDTWEP++ L+  K 
Sbjct  530  FEVDCVVGVCFGDPKKTEKKGIYFKIHWKGYGPEEDTWEPMNELEHCKQ  578



>ref|XP_007208072.1| hypothetical protein PRUPE_ppa001672mg [Prunus persica]
 gb|EMJ09271.1| hypothetical protein PRUPE_ppa001672mg [Prunus persica]
Length=782

 Score =   162 bits (409),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 98/252 (39%), Positives = 146/252 (58%), Gaps = 26/252 (10%)
 Frame = -2

Query  1019  EDEVILNVDCHYAQAKVLSF-ILNIGDCVYVK-GEGEKKHVGRILEFFKTTEGEDYFRVQ  846
             +DE  +    HY +A+V    I ++ D  +V+ G+G + +V +I+E F+  +G  YF  Q
Sbjct  12    QDEDAIQARGHYIKAEVDGRNIFDLYDDAHVQAGDGNEPYVCKIVEMFEAIDGTLYFTAQ  71

Query  845   WFFRAEDTVMRDAAALHDKKRLFYSTLMNDNLLDCIISKVNVTEISPGLGLEVNNSPPSG  666
             W++R+ DTV+++ A + DK+R+F S + + N LDC++ K+N+  +S    L         
Sbjct  72    WYYRSPDTVIKECATI-DKRRVFLSEIQDVNPLDCLVEKLNIVRLS----LNSKLISTCK  126

Query  665   FYYDMEYCVDYSTFRNLPTVQSVNSWDSPSLIDASYKPITAYPVEHF-----KSC-----  516
             ++ D  Y + YSTF NLP  +++ +    S I +      A  V        K+C     
Sbjct  127   YFCDTTYLLPYSTFMNLPE-ENIQTGSDDSTISSEADVDRACEVNSEGADVDKACQVNSK  185

Query  515   --------EPSKVELSLLDLYAGCGGMSTGLCLGAKLSGLNLVTKWAVDYQKSACDSLKF  360
                     E  K E++LLDLY+GCG MSTGLCLGA+LS +NLVT+WAVD  + AC SLK 
Sbjct  186   VAQLCPVRECGKPEVTLLDLYSGCGAMSTGLCLGAQLSNVNLVTRWAVDVNEYACQSLKL  245

Query  359   NHPETQVRNESV  324
             NHPET+VRNES 
Sbjct  246   NHPETEVRNESA  257


 Score = 71.6 bits (174),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 29/56 (52%), Positives = 41/56 (73%), Gaps = 0/56 (0%)
 Frame = -2

Query  173  EYEILRLVDICFGDPNDTGKPGIHFQVRWKGYGPSEDTWEPIDGLKSWKNRQGWFT  6
            E+E+  ++++C+GDPN T K G++F++RWKGYG  EDTWEPIDGL   +   G F 
Sbjct  322  EFEVDYVLEVCYGDPNKTNKRGLYFKIRWKGYGDDEDTWEPIDGLGHCRKAIGDFV  377



>ref|XP_004288717.1| PREDICTED: DNA (cytosine-5)-methyltransferase CMT3-like [Fragaria 
vesca subsp. vesca]
Length=965

 Score =   163 bits (412),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 120/344 (35%), Positives = 188/344 (55%), Gaps = 19/344 (6%)
 Frame = -2

Query  1022  EEDEVILNVDCHYAQAKVLSFILNIGDCVYVK-GEGEKKHVGRILEFFKTTEGEDYFRVQ  846
             ++DE  +    H+++A+V   + ++ D  +VK G+ E  ++ +I E F+  +G  YF  Q
Sbjct  209   DDDEEFIEACRHFSKAEVDGCVYDLYDDAHVKAGKNELPYICKITEMFEAVDGLLYFNAQ  268

Query  845   WFFRAEDTVMRDAAALHDKKRLFYSTLMNDNLLDCIISKVNVT----EISPGLGLEVNNS  678
             WF+R++DT + D+  + D KR+FYS + N N L+C++ KVN+     +I P    ++  S
Sbjct  269   WFYRSKDTAIEDSYHI-DSKRVFYSEVTNYNELECLLGKVNIVRCSLDIDPDEKCKLIES  327

Query  677   PPSGFYYDMEYCVDYSTFRNLPTVQSVNSWDSPSLIDASYKPITAYPVEH---FKSCEPS  507
                 +Y D +Y + Y+TF N P   +    D+ S I +     +++ V       S    
Sbjct  328   --CTYYCDTKYLLPYTTFVNFPPENTQAGSDNSSTISSEIDISSSHVVNSELARTSTTNV  385

Query  506   KVELSLLDLYAGCGGMSTGLCLGAKLSGLNLVTKWAVDYQKSACDSLKFNHPETQVRNES  327
             K E ++LDLY+GCGGMSTGLCLGA L+ LNLVT+WAVD  + A  SLK NH ET+VR ES
Sbjct  386   KPEATVLDLYSGCGGMSTGLCLGANLADLNLVTRWAVDLNEHALKSLKINHEETEVRVES  445

Query  326   VenflkllkeweklckEYGSEPNAGSDDVLEGMEEGaddansladsddsdAE--------  171
              + FL LLK+W+ +C  +      GS+                 + D    E        
Sbjct  446   ADEFLSLLKKWKGICVHFKVVEPDGSETPFSAFTSKDAKDEEEEEEDAEAEEEDDADGEV  505

Query  170   YEILRLVDICFGDPNDTGKPGIHFQVRWKGYGPSEDTWEPIDGL  39
             YE+ +++ I +G   +  +  + F+V+WKGY    DTWEP++ L
Sbjct  506   YEVEKIIGIRYGKAKNGEENELLFKVQWKGYEAKYDTWEPLELL  549



>ref|XP_008373678.1| PREDICTED: DNA (cytosine-5)-methyltransferase CMT2-like [Malus 
domestica]
Length=666

 Score =   160 bits (405),  Expect = 5e-40, Method: Compositional matrix adjust.
 Identities = 102/192 (53%), Positives = 129/192 (67%), Gaps = 7/192 (4%)
 Frame = -2

Query  602  SVNSWDSPSL--IDASYKPITAYPVEHFKSCEPSKVELSLLDLYAGCGGMSTGLCLGAKL  429
            SV S + PS   I A     T+  +E+  S E  K EL+LLDL+ GCGGMSTGLC GAKL
Sbjct  61   SVKSHNMPSCNSIQAVGTLSTSNLLENMPSSETYKAELALLDLFCGCGGMSTGLCFGAKL  120

Query  428  SGLNLVTKWAVDYQKSACDSLKFNHPETQVRNESVenflkllkeweklckEYGSEPNAGS  249
            S +NLVTKWA+D  KSAC+SLK NHP TQVRNE+ E+FL+LLKEWEKLC+ + +     +
Sbjct  121  SCVNLVTKWALDSDKSACESLKLNHPXTQVRNETAEDFLQLLKEWEKLCRRHKANDVERT  180

Query  248  DDVLEGMEEGaddansladsddsdAEYEILRLVDICFGDPNDTGKPGIHFQVRWKGYGPS  69
              +          +     ++    EYE+ R+VDICFGDPN TGK G++ +V WKGYG S
Sbjct  181  HPL-----RSKTLSVPKNGNEVGTGEYEVSRIVDICFGDPNKTGKRGVNLKVHWKGYGSS  235

Query  68   EDTWEPIDGLKS  33
            EDTWEPI+GL +
Sbjct  236  EDTWEPIEGLSN  247



>gb|EMS48088.1| DNA (cytosine-5)-methyltransferase 1 [Triticum urartu]
Length=737

 Score =   160 bits (406),  Expect = 6e-40, Method: Compositional matrix adjust.
 Identities = 107/247 (43%), Positives = 131/247 (53%), Gaps = 51/247 (21%)
 Frame = -2

Query  1031  SADEEDEVILNVDCHYAQAKVLSFILNIGDCVYVKG----EGEKKHVGRILEFFKTTEGE  864
             + +EE+EV     CHY  AKV   + N+ D VYV      EG+   +GRI E F   EG 
Sbjct  69    NGEEEEEV--KARCHYRAAKVEGIVYNLRDDVYVVAAMAEEGKPHFIGRITELF---EGT  123

Query  863   DYFRVQWFFRAEDTVMRDAAALHDKKRLFYSTLMNDNLLDCIISKVNVTEISPGLGLEVN  684
             D+                    HD KR+F S   NDN LDCI+SKV + ++ P L LE  
Sbjct  124   DHVN------------------HDPKRVFLSDERNDNPLDCIVSKVKILQVDPKLDLEAK  165

Query  683   N--SPPSGFYYDMEYCVDYSTFRNLPTVQSVNSWDSPSLIDASYKPITAYPVEHFKSCEP  510
                +  S  Y DM Y V YSTF N+  VQ              YK IT    E   S   
Sbjct  166   AQLAADSDLYCDMSYTVPYSTFENITNVQY-------------YKFIT----EGISSDAD  208

Query  509   SKVELS-----LLDLYAGCGGMSTGLCLGAKLSGLNLVTKWAVDYQKSACDSLKFNHPET  345
             S+V+ S     LLDLY+GCGGMSTGLCLGA L+GL L T+WAVD+   AC+SLK NHP+T
Sbjct  209   SEVDTSVATATLLDLYSGCGGMSTGLCLGAALAGLKLETRWAVDFNSYACNSLKSNHPKT  268

Query  344   QVRNESV  324
             +VRNE  
Sbjct  269   EVRNEKA  275



>emb|CDY08836.1| BnaA06g23880D [Brassica napus]
Length=805

 Score =   161 bits (408),  Expect = 6e-40, Method: Compositional matrix adjust.
 Identities = 128/346 (37%), Positives = 194/346 (56%), Gaps = 40/346 (12%)
 Frame = -2

Query  1022  EEDEVILNVDCHYAQAKVL-SFILNIGDCVYVKGE-GEKKHVGRILEFFKTTEGEDYFRV  849
             EE+E+ L    H+ +A +  S   N+ D  +V+ E  EK  + +I E F+  +G+ YF  
Sbjct  97    EEEEIFL-ARRHFRRAILDDSITYNLNDDAHVQSEEDEKPFICKIAEIFEGCDGKMYFTA  155

Query  848   QWFFRAEDTVMRDAAALHDKKRLFYSTLMNDNLLDCIISKVNVTEISPGLGLEVNNSPPS  669
             QWF+RA DTV++    + D KR+F S + + N +  +++K+ +  I      EV  S   
Sbjct  156   QWFYRACDTVIQKHEEMIDDKRVFISDIKDVNSMGVLLNKLKILMIPLTENTEVTES--C  213

Query  668   GFYYDMEYCVDYSTFRNLPTVQSVNSWDSPSLIDASYKPITAYPVEHFKSCEPSKVELSL  489
              +Y +M+Y + +ST   L + Q +    +P+                       + + ++
Sbjct  214   DYYCNMKYHLPFSTLEALQSSQCI----TPN----------------------QRTDATM  247

Query  488   LDLYAGCGGMSTGLCLGAKLSGLNLVTKWAVDYQKSACDSLKFNHPETQVRNESVenflk  309
             LDLY GCG MSTGLC+GA+LSGLNLVTKWAVD  + A  S+K+NHPET+VRNES E+FL 
Sbjct  248   LDLYCGCGAMSTGLCMGAQLSGLNLVTKWAVDTCEYAVQSIKYNHPETEVRNESAEDFLY  307

Query  308   llkeweklckEYGSEPNAGSD--DVLEGME--EGaddansladsddsdAEYEILRLVDIC  141
             LLKEWEKLC  +    +A S+  + L GM   E   D +  +D  D    +E+ ++V I 
Sbjct  308   LLKEWEKLCIHFSLIESADSEKYENLYGMSAAEEVKDGSDESDVKDGGEVFEVEKIVGI-  366

Query  140   FGDPNDTGKPGIHFQVRWKGYGPSEDTWEPIDGLKSWKNRQGWFTI  3
                  + G+  +H +VRW+ YGPS DTWEPI+ L + + +   F +
Sbjct  367   --KKEEGGR--LHLKVRWENYGPSHDTWEPIENLSNCRKKIKEFVV  408



>ref|XP_007152976.1| hypothetical protein PHAVU_004G176100g [Phaseolus vulgaris]
 gb|ESW24970.1| hypothetical protein PHAVU_004G176100g [Phaseolus vulgaris]
Length=658

 Score =   160 bits (404),  Expect = 7e-40, Method: Compositional matrix adjust.
 Identities = 103/242 (43%), Positives = 147/242 (61%), Gaps = 10/242 (4%)
 Frame = -2

Query  701  LGLEVNNSPPSGFYYDMEYCVDYSTFRNLPTVQSVNSWDSPSLIDASYK-----PITAYP  537
            L ++    PP  +Y D +Y + YSTF +LP+       ++ S I           + + P
Sbjct  3    LNVKKETIPPCDYYCDTQYLLPYSTFVSLPSENGETGSETCSTISCDTNGVEKCEVDSQP  62

Query  536  VEHFKSCEPSKVELSLLDLYAGCGGMSTGLCLGAKLSGLNLVTKWAVDYQKSACDSLKFN  357
             + +   E   +E++LLDLY GCG MSTGLCLG  LSG+NLVT+WAVD  K AC+ LK N
Sbjct  63   KDAYLPDENKDLEMTLLDLYCGCGAMSTGLCLGGNLSGVNLVTRWAVDLNKHACECLKLN  122

Query  356  HPETQVRNESVenflkllkeweklckEYGSEPNAGS-----DDVLEGMEEGaddanslad  192
            HPET+VRNES E+FL LLKEW+KLC  +    N  S     D   E  E+ A++      
Sbjct  123  HPETEVRNESAESFLSLLKEWQKLCSYFALVENKVSHEKYVDLFSEVDEDDAEEVKEDGT  182

Query  191  sddsdAEYEILRLVDICFGDPNDTGKPGIHFQVRWKGYGPSEDTWEPIDGLKSWKNRQGW  12
             D+ D  +E+ +++ +C+GDPN   + G++F+V+WKGYGP ED+WEPI+GL + K++   
Sbjct  183  DDEDDEIFEVSKILAVCYGDPNKKKEQGLYFKVQWKGYGPEEDSWEPIEGLSNCKDKIKE  242

Query  11   FT  6
            F 
Sbjct  243  FV  244



>ref|XP_002304879.1| chromomethylase 3 family protein [Populus trichocarpa]
 gb|EEE79858.1| chromomethylase 3 family protein [Populus trichocarpa]
Length=363

 Score =   155 bits (393),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 92/229 (40%), Positives = 138/229 (60%), Gaps = 14/229 (6%)
 Frame = -2

Query  1007  ILNVDCHYAQAKVLSFILNIGDCVYVKG-EGEKKHVGRILEFFKTTEGEDYFRVQWFFRA  831
             I+   CHY +A+V   I ++    +V+  +GE  ++ RI E F++ +   YF  QW++R+
Sbjct  131   IVKARCHYTRAEVDRIIYDLYYDAHVQASDGEPDYICRISEMFESVDRTLYFTTQWYYRS  190

Query  830   EDTVMRDAAALHDKKRLFYSTLMNDNLLDCIISKVNVTEISPGLGLEVNNSPPSG--FYY  657
               T+++D   + D K +F+S + NDN L+C+  K+N+  ++  +  E   +  SG  FY 
Sbjct  191   TVTIIKDKY-ISDPKCVFFSEIRNDNPLECLTWKLNIVRLALNVDPENRRARSSGCDFYC  249

Query  656   DMEYCVDYSTFRNLPTVQSVNSWDSPSL---IDASYKPITAYPVEHFKSCEPSKVELSLL  486
             DM Y + YSTF  LPT  +    +S ++   IDA+   + +   E  ++   SK E++LL
Sbjct  250   DMLYLLPYSTFVRLPTENNTTGPESSTISNDIDAA--GVKSECDEVCETSGSSKSEVALL  307

Query  485   DLYAGCGGMSTGLCLGAKLSGLNLVTKWAVDYQKSACDSLKFNHPETQV  339
             DLY+GCG MSTGLCLG     LNLVTKWAVD   +AC SL+ NHPETQV
Sbjct  308   DLYSGCGAMSTGLCLG-----LNLVTKWAVDLNINACQSLRLNHPETQV  351



>ref|XP_009150572.1| PREDICTED: DNA (cytosine-5)-methyltransferase CMT3 [Brassica 
rapa]
Length=805

 Score =   160 bits (405),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 128/346 (37%), Positives = 194/346 (56%), Gaps = 40/346 (12%)
 Frame = -2

Query  1022  EEDEVILNVDCHYAQAKVL-SFILNIGDCVYVKGE-GEKKHVGRILEFFKTTEGEDYFRV  849
             EE+E+ L    H+ +A +  S   N+ D  +V+ E  EK  + +I E F+  +G+ YF  
Sbjct  97    EEEEIFL-ARRHFRRAILDDSITYNLYDDAHVQSEEDEKPFICKIAEIFEGCDGKMYFTA  155

Query  848   QWFFRAEDTVMRDAAALHDKKRLFYSTLMNDNLLDCIISKVNVTEISPGLGLEVNNSPPS  669
             QWF+RA DTV++    + D KR+F S + + N +  +++K+ +  I      EV  S   
Sbjct  156   QWFYRACDTVIQKHEEMIDDKRVFISDIKDVNSMGVLLNKLKILMIPLTENTEVTES--C  213

Query  668   GFYYDMEYCVDYSTFRNLPTVQSVNSWDSPSLIDASYKPITAYPVEHFKSCEPSKVELSL  489
              +Y +M+Y + +ST   L + Q +    +P+                       + + ++
Sbjct  214   DYYCNMKYHLPFSTLEALQSSQCI----TPN----------------------QRTDATM  247

Query  488   LDLYAGCGGMSTGLCLGAKLSGLNLVTKWAVDYQKSACDSLKFNHPETQVRNESVenflk  309
             LDLY GCG MSTGLC+GA+LSGLNLVTKWAVD  + A  S+K+NHPET+VRNES E+FL 
Sbjct  248   LDLYCGCGAMSTGLCMGAQLSGLNLVTKWAVDTCEYAVQSIKYNHPETEVRNESAEDFLY  307

Query  308   llkeweklckEYGSEPNAGSD--DVLEGME--EGaddansladsddsdAEYEILRLVDIC  141
             LLKEWEKLC  +    +A S+  + L GM   E   D +  +D  D    +E+ ++V I 
Sbjct  308   LLKEWEKLCIHFSLIESADSEKYENLYGMSAVEEVKDGSDESDVKDGGEVFEVEKIVGI-  366

Query  140   FGDPNDTGKPGIHFQVRWKGYGPSEDTWEPIDGLKSWKNRQGWFTI  3
                  + G+  +H +VRW+ YGPS DTWEPI+ L + + +   F +
Sbjct  367   --KKEEGGR--LHLKVRWENYGPSHDTWEPIENLSNCRKKIKEFVV  408



>gb|KCW85898.1| hypothetical protein EUGRSUZ_B02615 [Eucalyptus grandis]
Length=655

 Score =   159 bits (401),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 104/222 (47%), Positives = 145/222 (65%), Gaps = 9/222 (4%)
 Frame = -2

Query  677  PPSGFYYDMEYCVDYSTFRNLPTVQSVNSWDSPSLI---DASYKPITAYPVEHFKSCEPS  507
            PP  +Y D  Y + YSTF++LP  Q V+  ++ S I   D      T+       S + +
Sbjct  17   PPCDYYCDTLYLLPYSTFKHLPIDQKVDGCETSSTISSDDVDMAGSTSEVNSKEISQKNN  76

Query  506  KVELSLLDLYAGCGGMSTGLCLGAKLSGLNLVTKWAVDYQKSACDSLKFNHPETQVRNES  327
            K E++LLD+Y+GCG MSTGLCLGA +SGLNLVT+WAVD  + AC+SLK NHPET+VRNES
Sbjct  77   KGEVTLLDMYSGCGAMSTGLCLGANVSGLNLVTRWAVDMNEHACNSLKLNHPETEVRNES  136

Query  326  VenflkllkeweklckEYGSEPNAGSD---DVLEGMEEGaddansladsddsdAE---YE  165
             E+FL LLKEW+KLC ++    + G       L  +++G  +    +D DD  ++   +E
Sbjct  137  AEDFLMLLKEWQKLCMQFNLIKSDGQQLPYSDLFSVDDGTSNEEGDSDDDDGGSDGEVFE  196

Query  164  ILRLVDICFGDPNDTGKPGIHFQVRWKGYGPSEDTWEPIDGL  39
            + +++ IC+GDP + G   ++F+V WKGYGP EDTWEPIDGL
Sbjct  197  VEKVLAICYGDPKEKGDKALYFKVSWKGYGPDEDTWEPIDGL  238



>ref|XP_008390169.1| PREDICTED: DNA (cytosine-5)-methyltransferase CMT3 [Malus domestica]
Length=1077

 Score =   161 bits (407),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 89/235 (38%), Positives = 138/235 (59%), Gaps = 4/235 (2%)
 Frame = -2

Query  1019  EDEVILNVDCHYAQAKVLSFILNIGDCVYV-KGEGEKKHVGRILEFFKTTEGEDYFRVQW  843
             +DE I+   CHY +A V     ++ D  +V  GE E+ ++ +I+E F+   G  YF  QW
Sbjct  190   DDEDIIQARCHYTKALVDGINYDLYDDAHVFSGEKEEPYICKIVEMFEAIGGLLYFTAQW  249

Query  842   FFRAEDTVMRDAAALHDKKRLFYSTLMNDNLLDCIISKVNVTEISPGLG--LEVNNSPPS  669
             ++R+ DTV++    +    R+F+S + +DN L+C++ K+++  ++  +   L+  + P  
Sbjct  250   YYRSRDTVIKHCTTVA-CGRVFFSDVRDDNPLNCLVEKLHIVRLTLNVDEDLKSKSIPVC  308

Query  668   GFYYDMEYCVDYSTFRNLPTVQSVNSWDSPSLIDASYKPITAYPVEHFKSCEPSKVELSL  489
              +Y D +Y + YSTF NL         D  ++       + +       + E +K E+ L
Sbjct  309   NYYCDTKYLLPYSTFVNLXAENMQTGSDDSTISVEDDVCLDSEVDSKLPNGERAKSEVRL  368

Query  488   LDLYAGCGGMSTGLCLGAKLSGLNLVTKWAVDYQKSACDSLKFNHPETQVRNESV  324
             LDLY+GCG MSTGLCLGA L+ +NLVT+WAVDY K AC SL  NHPET+VRNE+ 
Sbjct  369   LDLYSGCGAMSTGLCLGAHLANVNLVTRWAVDYNKYACKSLAQNHPETEVRNEAA  423


 Score = 64.3 bits (155),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 25/49 (51%), Positives = 36/49 (73%), Gaps = 0/49 (0%)
 Frame = -2

Query  170  YEILRLVDICFGDPNDTGKPGIHFQVRWKGYGPSEDTWEPIDGLKSWKN  24
            +E+  ++ +CFGDP  T K GI+F++ WKGYGP EDTWEP++ L+  K 
Sbjct  488  FEVDCVIGVCFGDPKKTEKKGIYFKIHWKGYGPXEDTWEPMNELEHCKQ  536



>gb|EMT16647.1| DNA (cytosine-5)-methyltransferase 2 [Aegilops tauschii]
Length=660

 Score =   158 bits (400),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 84/207 (41%), Positives = 119/207 (57%), Gaps = 19/207 (9%)
 Frame = -2

Query  926  GEGEKKHVGRILEFFKTTEGEDYFRVQWFFRAEDTVMRDAAAL----HDKKRLFYSTLMN  759
            GE    ++GRI EFF+  +G  YF  +WFFR +DTV+ +        HD KR+F S   N
Sbjct  12   GENLPDYIGRITEFFEGVDGRRYFACRWFFRPQDTVISNTKLFKDHTHDPKRVFLSDERN  71

Query  758  DNLLDCIISKVNVTEISPGLGLEVNN--SPPSGFYYDMEYCVDYSTFRNLPTVQSVNSWD  585
            DN LDCI+SKV + ++ P L  E     +  +  Y+DM Y V YSTF N+          
Sbjct  72   DNDLDCIVSKVKIIQVDPKLDKEAKAQVAADADLYFDMSYTVPYSTFENI----------  121

Query  584  SPSLIDASYKPITAYPVEHFKSCEPSKVELSLLDLYAGCGGMSTGLCLGAKLSGLNLVTK  405
                +D +     ++  E     + +  + ++LDLY+G GGMSTGLCLGA ++GL + T+
Sbjct  122  ---TLDINENSGISFDAEANSESDAAATKATILDLYSGWGGMSTGLCLGAVIAGLQIETR  178

Query  404  WAVDYQKSACDSLKFNHPETQVRNESV  324
            WAVD   +A +S K+NHP T+VRNE V
Sbjct  179  WAVDLNTNAWESFKYNHPITEVRNEKV  205



>ref|NP_001280801.1| DNA (cytosine-5)-methyltransferase CMT3 [Malus domestica]
 gb|AFV99136.1| CMT-type cytosine DNA-methyltransferase 3b [Malus domestica]
Length=1096

 Score =   160 bits (404),  Expect = 6e-39, Method: Compositional matrix adjust.
 Identities = 88/233 (38%), Positives = 137/233 (59%), Gaps = 4/233 (2%)
 Frame = -2

Query  1019  EDEVILNVDCHYAQAKVLSFILNIGDCVYVKGEGEKKHVGRILEFFKTTEGEDYFRVQWF  840
             +DE I+   CHY +A V     ++ D  +  GE E+ ++ +I+E F+   G  YF  QW+
Sbjct  211   DDEDIIQARCHYTKALVDGINYDLYDDAH-SGEKEEPYICKIVEMFEAIGGLLYFTAQWY  269

Query  839   FRAEDTVMRDAAALHDKKRLFYSTLMNDNLLDCIISKVNVTEISPGLG--LEVNNSPPSG  666
             +R+ DTV++    +    R+F+S + +DN L+C++ K+++  ++  +   L+  + P   
Sbjct  270   YRSRDTVIKHCTTVA-CGRVFFSDVRDDNPLNCLVEKLHIVRLTLNVDEDLKSKSIPVCN  328

Query  665   FYYDMEYCVDYSTFRNLPTVQSVNSWDSPSLIDASYKPITAYPVEHFKSCEPSKVELSLL  486
             +Y D +Y + YSTF NL         D  ++       + +       + E +K E+ LL
Sbjct  329   YYCDTKYLLPYSTFVNLXAENMQTGSDDSTISVEDDVCLDSEVDSKLPNGERAKSEVRLL  388

Query  485   DLYAGCGGMSTGLCLGAKLSGLNLVTKWAVDYQKSACDSLKFNHPETQVRNES  327
             DLY+GCG MSTGLCLGA L+ +NLVT+WAVDY K AC SL  NHPET+VRNE+
Sbjct  389   DLYSGCGAMSTGLCLGAHLANVNLVTRWAVDYNKYACKSLAQNHPETEVRNEA  441


 Score = 64.3 bits (155),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 25/49 (51%), Positives = 36/49 (73%), Gaps = 0/49 (0%)
 Frame = -2

Query  170  YEILRLVDICFGDPNDTGKPGIHFQVRWKGYGPSEDTWEPIDGLKSWKN  24
            +E+  ++ +CFGDP  T K GI+F++ WKGYGP EDTWEP++ L+  K 
Sbjct  507  FEVDCVIGVCFGDPKKTEKKGIYFKIHWKGYGPXEDTWEPMNELEHCKQ  555



>dbj|BAF34637.1| chromomethylase [Brassica rapa]
Length=805

 Score =   157 bits (396),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 115/358 (32%), Positives = 182/358 (51%), Gaps = 64/358 (18%)
 Frame = -2

Query  1022  EEDEVILNVDCHYAQAKVL--SFILNIGDCVYVKGE-GEKKHVGRILEFFKTTEGEDYFR  852
             EE+E+ L    H+ +A +L  S   N+ D  +V+ E  EK  + +I E F+  +G+ YF 
Sbjct  97    EEEEIFL-ARRHFRRA-ILDDSITYNLNDDAHVQSEEDEKPFICKIAEIFEGCDGKMYFT  154

Query  851   VQWFFRAEDTVMRDAAALHDKKRLFYSTLMNDNLLDCIISKVNVTEISPGLGLEVNNSPP  672
              QWF+RA DTV++    + D KR+F S + + N +  +++K+ +  I      EV  S  
Sbjct  155   AQWFYRACDTVIQKHEEMIDDKRVFISDIKDVNSMGVLLNKLKILMIPLTENTEVTES--  212

Query  671   SGFYYDMEYCVDYSTFRNLPTVQSVNSWDSPSLIDASYKPITAYPVEHFKSCEPSKVELS  492
               +Y +M+Y + +ST   L + Q +    +P+                       + + +
Sbjct  213   CDYYCNMKYRLPFSTLEALQSSQCI----TPN----------------------QRTDAT  246

Query  491   LLDLYAGCGGMSTGLCLGAKLSGLNLVTKWAVDYQKSACDSLKFNHPETQVRNES-----  327
             +LDLY GCG MSTGLC+GA+LSGL LVTKWAVD  + A  S+K+NHPET VRNES     
Sbjct  247   MLDLYCGCGAMSTGLCMGAQLSGLKLVTKWAVDTCEYAVQSIKYNHPETVVRNESAEDFL  306

Query  326   ----------VenflkllkeweklckEYGSEPNAGSDDVLEGMEEGaddansladsddsd  177
                       +   L   ++ EK    YG    + +++V +G +E               
Sbjct  307   YLLKEWEKLCIHFSLIESEDSEKYENLYGM---SAAEEVKDGSDESDVKDGGEV------  357

Query  176   AEYEILRLVDICFGDPNDTGKPGIHFQVRWKGYGPSEDTWEPIDGLKSWKNRQGWFTI  3
               +E+ ++V I      + G+  +H +VRW+ YGPS DTWEPI+ L + + +   F +
Sbjct  358   --FEVEKIVGI---KKEEGGR--LHLKVRWENYGPSHDTWEPIENLSNCRKKIKEFVV  408



>ref|XP_003615342.1| DNA (cytosine-5)-methyltransferase [Medicago truncatula]
 gb|AES98300.1| DNA (cytosine-5)-methyltransferase CMT3-like protein [Medicago 
truncatula]
Length=800

 Score =   150 bits (380),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 115/344 (33%), Positives = 151/344 (44%), Gaps = 101/344 (29%)
 Frame = -2

Query  1031  SADEEDEVILNVDCHYAQAKVLS-FILNIGDCVYVKGEGEKKH-VGRILEFFKTTEGEDY  858
             S  +EDEV L   CHY +AKV    I  + D  +VKGE +  H + +I+E F+  +GE Y
Sbjct  153   SNSDEDEV-LQARCHYTEAKVDGGVIYKLYDDAHVKGEKDDYHFICKIMEMFEAVDGELY  211

Query  857   FRVQWFFRAEDTVMRDAAALHDKKRLFYSTLMNDNLLDCIISKVNVTEISPGLGLEVNNS  678
             F                      KR+F S + +DN LDC++ K+ +  +      +  N 
Sbjct  212   F--------------------TPKRVFLSEVQDDNPLDCLVEKLTIALLELKKDFDATND  251

Query  677   --PPSGFYYDMEYCVDYS-TFRNLPTVQSVNSWDSPSLI----DASYKPITAYPVEHFKS  519
               PP  +Y D  Y ++ S T  N   V + +  DS S I    D   KP           
Sbjct  252   VIPPCKYYCDTLYLLEISSTISNETEVNAKSEVDSKSAITDINDDKKKP-----------  300

Query  518   CEPSKVELSLLDLYAGCGGMSTGLCLGAKLSGLNLVTKWAVDYQKSACDSLKFNHPETQV  339
                   EL LLDLY+GCGGMSTGLC    LSG ++VTKW VD  K AC SLK NHPET+V
Sbjct  301   ------ELKLLDLYSGCGGMSTGLCQWRILSGSDIVTKWVVDLNKDACQSLKLNHPETEV  354

Query  338   RNESVenflkllkeweklckEYGSEPNAGSDDVLEGMEEGaddansladsddsdAEYEIL  159
             RNE                           DDV                           
Sbjct  355   RNEE-------------------------EDDVH--------------------------  363

Query  158   RLVDICFGDPNDTGKPGIHFQVRWKGYGPSEDTWEPIDGLKSWK  27
                D+ + D N    PG++ +V WKGY   +D WEPI+GL + K
Sbjct  364   ---DVRYDDANKETGPGLYIKVSWKGYNYDKDIWEPINGLSNCK  404



>gb|EMT24338.1| DNA (cytosine-5)-methyltransferase 1 [Aegilops tauschii]
Length=826

 Score =   148 bits (374),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 126/333 (38%), Positives = 162/333 (49%), Gaps = 56/333 (17%)
 Frame = -2

Query  1019  EDEVILNVDCHYAQAKVLSFILNIGDCVYV-KGEGEKKHVGRILEFFKTTEGEDYFRVQW  843
             EDE  +    HY  A V   +  +GD VYV  GE E  ++GRI EFF+  +   YF  +W
Sbjct  143   EDEEDMKARVHYRSAMVDGVVYALGDDVYVMAGENEADYIGRITEFFEGVDKTSYFTCRW  202

Query  842   FFRAEDTVMRDAAAL----HDKKRLFYSTLMNDNLLDCIISKVNVTEISPGLGLEVNNSP  675
             +FR EDTV+  A  +    HD KR+F S   NDN LDCIISKV +  + P +  +     
Sbjct  203   YFRPEDTVISRAKFVNDHTHDPKRVFLSEEKNDNPLDCIISKVKIIHVDPNVA-KAKLVA  261

Query  674   PSGFYYDMEYCVDYSTFRNLPTVQSVNSWDSPSLIDASYKPITAYPVEHFKSCEPSKVEL  495
              +  YYDM Y V YSTF N+P+  + NS  S      +  P+                  
Sbjct  262   RTDLYYDMSYTVAYSTFANIPSDTTENSGISTDADSENGAPVKT---------------A  306

Query  494   SLLDLYAGCGGMSTGLCLGAKLSGLNLVTKWAVDYQKSACDSLKFNHPETQVRNESVenf  315
             SLLDLY+GC         G   +GL L          SA   LK       VRNE  E+F
Sbjct  307   SLLDLYSGC---------GGMSTGLCL---------GSALAGLKLE----TVRNEKAEDF  344

Query  314   lkllkeweklckEYGSEPNAGSDDVLEGMEEGaddansladsddsdAEYEILRLVDICFG  135
             L LLKEW  LC +Y       S+D                D      E+ + +L++IC+G
Sbjct  345   LALLKEWAILCDKY-----VHSNDSDVAEPV----EEEEDDEPLGKDEFVVEKLLEICYG  395

Query  134   DPNDTG-KPGIHFQVRWKGYGPSEDTWEPIDGL  39
                 TG K GIHF+V+WKGYGP EDTWEPI+ L
Sbjct  396   G---TGRKNGIHFKVQWKGYGPEEDTWEPIENL  425



>gb|KFK30827.1| hypothetical protein AALP_AA6G031000 [Arabis alpina]
Length=913

 Score =   149 bits (375),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 90/242 (37%), Positives = 138/242 (57%), Gaps = 9/242 (4%)
 Frame = -2

Query  1025  DEEDEVILNVDCHYAQAKV-LSFILNIGDCVYVK-GEGEKKHVGRILEFFKTTEGEDYFR  852
             D E+E +L    H+ +A V  + I  + D  +V+ G G   ++ +I+E F+  +GE YF 
Sbjct  125   DNEEEFVLGRR-HFRRAIVDETHIFELNDDAHVEAGVGVDPYICKIVEMFEGVDGELYFT  183

Query  851   VQWFFRAEDTVMRDAAALHDKKRLFYSTLMNDNLLDCIISKVNVTEISPGLGLEVNNSPP  672
              QW++RA DTV+     L ++KR+F S + N N L+ ++ K+N++ I      E   +  
Sbjct  184   AQWYYRAVDTVIELHETLINEKRVFISEIRNANPLNTLVKKLNISRIPLMANAEETFAAT  243

Query  671   SG--FYYDMEYCVDYSTFRNL-PTVQSVNSWDSPSLIDASYKPITAYPVEHF---KSCEP  510
                 +Y D +Y + YSTF  L P  +  +S  S    D +     A   +H    +  + 
Sbjct  244   RNCDYYCDTKYHLPYSTFEALLPNAKMSSSESSTISNDIAVNGEAATSSDHAECSRVRDS  303

Query  509   SKVELSLLDLYAGCGGMSTGLCLGAKLSGLNLVTKWAVDYQKSACDSLKFNHPETQVRNE  330
              + + +LLDLY GCG MSTGLC+GA+L+GLNL+TKWAVD    AC +++ NHPET VRNE
Sbjct  304   QRTDATLLDLYCGCGAMSTGLCMGAQLAGLNLITKWAVDLNSHACRTMRHNHPETHVRNE  363

Query  329   SV  324
             + 
Sbjct  364   AT  365



>gb|ACX83573.1| DNA chromomethylase [Hieracium piloselloides]
Length=607

 Score =   140 bits (352),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 84/177 (47%), Positives = 116/177 (66%), Gaps = 0/177 (0%)
 Frame = -2

Query  533  EHFKSCEPSKVELSLLDLYAGCGGMSTGLCLGAKLSGLNLVTKWAVDYQKSACDSLKFNH  354
            E  +S      E+ +LDLY+GCG MSTGLCLGA ++ +NLVT+WAVD  K AC+SLK NH
Sbjct  25   EESQSQNNKSSEMRMLDLYSGCGAMSTGLCLGANMADVNLVTRWAVDLNKYACESLKLNH  84

Query  353  PETQVRNESVenflkllkeweklckEYGSEPNAGSDDVLEGMEEGaddansladsddsdA  174
            PET+ RNES E+FL+LLKEWEKLC+ YG      S    E      D+        D++ 
Sbjct  85   PETEARNESAEDFLQLLKEWEKLCQSYGLVGGGDSQQKEEPATIEEDEEEEDDVEVDNEE  144

Query  173  EYEILRLVDICFGDPNDTGKPGIHFQVRWKGYGPSEDTWEPIDGLKSWKNRQGWFTI  3
             +E+ +++ +C+GDP +  KPG++ ++RWKGYG  EDTWEPI+GL    ++   F +
Sbjct  145  IFEVEQILSVCYGDPKEMKKPGLYLKIRWKGYGSEEDTWEPIEGLSDCHDKIKEFVV  201



>ref|XP_011025397.1| PREDICTED: DNA (cytosine-5)-methyltransferase CMT3-like [Populus 
euphratica]
Length=514

 Score =   137 bits (344),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 83/222 (37%), Positives = 127/222 (57%), Gaps = 8/222 (4%)
 Frame = -2

Query  992  CHYAQAKVLSFILNIGDCVYVKG-EGEKKHVGRILEFFKTTEGEDYFRVQWFFRAEDTVM  816
            CHY +A V   I ++    YV+  +GE  ++ RI E F++ +   YF  QW++R+ DT++
Sbjct  187  CHYTRADVDRIIYDLYYDAYVQASDGEPDYLCRISEMFESVDRTLYFTTQWYYRSPDTII  246

Query  815  RDAAALHDKKRLFYSTLMNDNLLDCIISKVNVTEISPGLGLEVNNSPPSG--FYYDMEYC  642
            ++   + D K +F+S + N N L+C+  K+N+  ++  +  E   +  SG  FY  M Y 
Sbjct  247  KNKY-ISDPKCVFFSEIRNANPLECLTWKLNIVRLALDVDPENKRARSSGCDFYCVMLYF  305

Query  641  VDYSTFRNLPTVQSVNSWDSPSLI-DASYKPITAYPVEHFKSCEPSKVELSLLDLYAGCG  465
            + YSTF  LPT  +    +S ++  D     + +   E   +   SK E++LLDLY+GCG
Sbjct  306  LLYSTFVKLPTENNTTGPESSTISNDIHDAGVKSESDEVCGTSGSSKSEVALLDLYSGCG  365

Query  464  GMSTGLCLGAKLSGLNLVTKWAVDYQKSACDSLKFNHPETQV  339
             MSTGLCLG  L  + +   WAVD   +AC SL+ NHPETQV
Sbjct  366  AMSTGLCLGLTLVTVKI---WAVDLNMNACQSLRLNHPETQV  404



>gb|EYU22416.1| hypothetical protein MIMGU_mgv1a001955mg [Erythranthe guttata]
Length=734

 Score =   132 bits (333),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 88/172 (51%), Positives = 115/172 (67%), Gaps = 14/172 (8%)
 Frame = -2

Query  521  SCEPSKVEL----------SLLDLYAGCGGMSTGLCLGAKLSGLNLVTKWAVDYQKSACD  372
            SC  SKV++          ++LDLY+GCG MS+GL +GA L+G N+VTKWA+DY   AC+
Sbjct  151  SCISSKVKINVLPLDRSKGTMLDLYSGCGAMSSGLSIGASLAGQNIVTKWALDYNSDACE  210

Query  371  SLKFNHPETQVRNESVenflkllkeweklckEYGSEPNAGSDDVLEGMEEGaddanslad  192
            SLKFNHP T+VRNE  E+F  LLKEWEKLCKE+      GS +V    E+   D + + D
Sbjct  211  SLKFNHPNTEVRNEDAEDFFVLLKEWEKLCKEFNL---VGSKEVGSDEEDIDSDGSDIDD  267

Query  191  sdds-dAEYEILRLVDICFGDPNDTGKPGIHFQVRWKGYGPSEDTWEPIDGL  39
            S      E+E+ + V IC+G+PN   K  +HF+VRWKGYG ++DTWEP DGL
Sbjct  268  SAAVPSEEFEVEKFVGICYGNPNKLKKSSLHFKVRWKGYGRADDTWEPADGL  319


 Score = 67.0 bits (162),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 32/92 (35%), Positives = 54/92 (59%), Gaps = 1/92 (1%)
 Frame = -2

Query  989  HYAQAKVLSFILNIGDCVYVKG-EGEKKHVGRILEFFKTTEGEDYFRVQWFFRAEDTVMR  813
            HY  A V     ++ +  Y++  + E  ++ +I+E F+T   E +   QWF+RA +TV++
Sbjct  69   HYTNAVVDGVEYDLLEDAYIEAPDNEPNYIAKIVEMFETVTRESFICTQWFYRANNTVIK  128

Query  812  DAAALHDKKRLFYSTLMNDNLLDCIISKVNVT  717
            +   L D +R+FYS + +DN L CI SKV + 
Sbjct  129  EQYPLIDARRVFYSDIRDDNHLSCISSKVKIN  160



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 2917093240962