BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c25615_g1_i2 len=1502 path=[3312:0-160 597:161-174 781:175-198
3509:199-208 815:209-236 980:237-288 5861:289-293 4924:294-335
3628:336-398 3690:399-400 5914:401-489 3777:490-491 3779:492-529
3816:530-559 6009:560-627 6052:628-637 6062:638-666 6091:667-675
3961:676-707 3993:708-780 1553:781-787 1560:788-820 4103:821-868
4151:869-927 4209:928-934 1280:935-1011 141:1012-1094 224:1095-1141
4419:1142-1234 1098:1235-1501]

Length=1502
                                                                      Score     E

gb|AAB02620.1|  chalcone synthase A                                     793   0.0     Ipomoea purpurea
gb|AAB62589.1|  chalcone synthase-A                                     791   0.0     Ipomoea purpurea
gb|AAB62588.1|  chalcone synthase-A                                     790   0.0     Ipomoea purpurea
gb|AAB62590.1|  chalcone synthase-A                                     788   0.0     Ipomoea purpurea
sp|P48397.2|CHSA_IPOPU  RecName: Full=Chalcone synthase A; AltNam...    785   0.0     Ipomoea purpurea
gb|AAB62583.1|  chalcone synthase-A                                     782   0.0     Ipomoea purpurea
gb|AAB62587.1|  chalcone synthase-A                                     779   0.0     Ipomoea purpurea
sp|P48398.1|CHSB_IPOPU  RecName: Full=Chalcone synthase B; AltNam...    743   0.0     Ipomoea purpurea
sp|P48400.1|CHSA_IPOPL  RecName: Full=Chalcone synthase A; AltNam...    694   0.0     Ipomoea platensis
sp|P48394.1|CHSB_IPOCO  RecName: Full=Chalcone synthase B; AltNam...    691   0.0     Ipomoea cordatotriloba
sp|P48402.1|CHSB_IPOTF  RecName: Full=Chalcone synthase B; AltNam...    691   0.0     Ipomoea trifida
sp|P48399.1|CHSC_IPOPU  RecName: Full=Chalcone synthase C; AltNam...    669   0.0     Ipomoea purpurea
sp|P48396.1|CHSB_IPONI  RecName: Full=Chalcone synthase B; AltNam...    669   0.0     Ipomoea nil [qian niu]
sp|P48404.1|CHSB_IPOTR  RecName: Full=Chalcone synthase B; AltNam...    660   0.0     Ipomoea triloba
sp|P48401.1|CHSA_IPOTF  RecName: Full=Chalcone synthase A; AltNam...    657   0.0     Ipomoea trifida
sp|P48403.1|CHSA_IPOTR  RecName: Full=Chalcone synthase A; AltNam...    649   0.0     Ipomoea triloba
sp|P48395.1|CHSA_IPONI  RecName: Full=Chalcone synthase A; AltNam...    648   0.0     Ipomoea nil [qian niu]
sp|P48393.1|CHSA_IPOCO  RecName: Full=Chalcone synthase A; AltNam...    643   0.0     Ipomoea cordatotriloba
sp|P22924.1|CHSB_PETHY  RecName: Full=Chalcone synthase B; AltNam...    580   0.0     Petunia x hybrida [garden petunia]
ref|XP_006355706.1|  PREDICTED: chalcone synthase B-like                576   0.0     
ref|XP_004239898.1|  PREDICTED: chalcone synthase B                     567   0.0     
gb|AIV99854.1|  chalcone synthase                                       563   0.0     
gb|AGW24283.1|  chalcone synthase                                       563   0.0     
gb|KDP20327.1|  hypothetical protein JCGZ_06413                         562   0.0     
sp|P22928.2|CHSJ_PETHY  RecName: Full=Chalcone synthase J; AltNam...    562   0.0     Petunia x hybrida [garden petunia]
gb|AIY22757.1|  chalcone synthase                                       561   0.0     
gb|AIY22756.1|  chalcone synthase                                       561   0.0     
emb|CAA64452.1|  naringenin-chalcone synthase                           560   0.0     Juglans nigra x Juglans regia
ref|XP_009774927.1|  PREDICTED: chalcone synthase 2                     559   0.0     
ref|XP_002264019.1|  PREDICTED: chalcone synthase 2                     558   0.0     Vitis vinifera
gb|ADD74168.1|  chalcone synthase                                       558   0.0     
ref|XP_009616637.1|  PREDICTED: chalcone synthase 2                     558   0.0     
gb|AHK22740.1|  chalcone synthase                                       558   0.0     
ref|XP_006489796.1|  PREDICTED: chalcone synthase 1-like                558   0.0     
ref|XP_011091402.1|  PREDICTED: chalcone synthase                       557   0.0     
gb|ABS52573.1|  chalcone synthase                                       557   0.0     Gossypium hirsutum [American cotton]
gb|AEK80412.1|  type III polyketide synthase                            557   0.0     
emb|CAC88858.1|  chalcone synthase                                      557   0.0     Rhododendron simsii
sp|Q9FUB7.1|CHSY_HYPAN  RecName: Full=Chalcone synthase; AltName:...    557   0.0     Hypericum androsaemum
gb|AEO96989.1|  chalcone synthase                                       556   0.0     
emb|CAA64366.1|  naringenin-chalcone synthase                           556   0.0     Juglans nigra x Juglans regia
sp|P06515.1|CHSY_ANTMA  RecName: Full=Chalcone synthase; AltName:...    556   0.0     Antirrhinum majus [garden snapdragon]
gb|ACH56521.1|  chalcone synthase                                       556   0.0     Gossypium hirsutum [American cotton]
ref|XP_006420608.1|  hypothetical protein CICLE_v10005133mg             556   0.0     
gb|AFU52909.1|  chalcone synthase                                       555   0.0     
gb|AIC75908.1|  chalcone synthase                                       555   0.0     
gb|AFM74036.1|  chalcone synthase                                       555   0.0     
gb|KHG25969.1|  Chalcone synthase 1                                     555   0.0     
sp|O82144.1|CHSY_HYDMC  RecName: Full=Chalcone synthase; AltName:...    555   0.0     Hydrangea macrophylla
gb|ACV72638.1|  chalcone synthase 1                                     555   0.0     Gossypium hirsutum [American cotton]
ref|XP_007034442.1|  Chalcone and stilbene synthase family protein      555   0.0     
gb|ABM63466.1|  aromatic polyketide synthase                            555   0.0     Hypericum hookerianum
gb|AGW22222.1|  chalcone synthase                                       555   0.0     
ref|XP_010264056.1|  PREDICTED: chalcone synthase 1                     555   0.0     
sp|Q9ZRR8.1|CHS1_CASGL  RecName: Full=Chalcone synthase; AltName:...    554   0.0     Casuarina glauca
gb|AGH13332.1|  chalcone synthase                                       554   0.0     
gb|AIA22214.1|  chalcone synthase                                       554   0.0     
gb|ACE60221.1|  chalcone synthase                                       554   0.0     Abelmoschus manihot [aibika]
gb|AAM00232.1|AF358432_1  root-specific chalcone synthase               554   0.0     Senna alata [bajagua]
ref|XP_011020681.1|  PREDICTED: chalcone synthase 1                     554   0.0     
dbj|BAO58434.1|  chalcone synthase                                      553   0.0     
ref|XP_010023738.1|  PREDICTED: chalcone synthase 1                     553   0.0     
ref|XP_003553986.1|  PREDICTED: chalcone synthase-like                  553   0.0     
gb|AAM00230.1|AF358430_1  root-specific chalcone synthase               553   0.0     Senna alata [bajagua]
dbj|BAB92996.1|  chalcone synthase                                      553   0.0     Malus domestica [apple tree]
gb|ADW11243.1|  chalcone synthase 2                                     553   0.0     
gb|AFC37242.1|  chalcone synthase 1                                     553   0.0     
gb|AEO96985.1|  chalcone synthase                                       553   0.0     
gb|AGV53049.1|  chalcone synthase                                       553   0.0     
dbj|BAI66465.1|  chalcone synthase                                      553   0.0     Camellia japonica [common camellia]
sp|P48386.1|CHS1_CAMSI  RecName: Full=Chalcone synthase 1; AltNam...    553   0.0     Camellia sinensis [black tea]
gb|AAL67805.1|AF461105_1  chalcone synthase                             553   0.0     Hypericum perforatum
sp|P48387.1|CHS2_CAMSI  RecName: Full=Chalcone synthase 2; AltNam...    553   0.0     Camellia sinensis [black tea]
sp|Q9FSB8.1|CHS2_RUTGR  RecName: Full=Chalcone synthase 2; AltNam...    553   0.0     Ruta graveolens
gb|AEJ88217.1|  chalcone synthase                                       552   0.0     
ref|XP_008380609.1|  PREDICTED: polyketide synthase 5                   552   0.0     
gb|ADD74167.1|  chalcone synthase                                       552   0.0     
sp|O04111.1|CHSY_PERFR  RecName: Full=Chalcone synthase; AltName:...    552   0.0     Perilla frutescens [beefsteak-mint]
ref|XP_008380608.1|  PREDICTED: polyketide synthase 5-like              552   0.0     
gb|AGE84303.1|  chalcone synthase                                       552   0.0     
gb|AFH68066.1|  chalcone synthase                                       552   0.0     
ref|XP_007032052.1|  Chalcone and stilbene synthase family protein      552   0.0     
ref|XP_011034457.1|  PREDICTED: chalcone synthase 1-like                551   0.0     
gb|AFE56210.1|  chalcone synthase                                       551   0.0     
gb|AFQ92052.1|  chalcone synthase                                       551   0.0     
gb|EPS72180.1|  chalcone synthase                                       551   0.0     
emb|CAH61575.1|  chalcone synthase                                      551   0.0     Dictamnus albus
ref|NP_001234036.1|  chalcone synthase 2                                551   0.0     
dbj|BAC10998.1|  chalcone synthase                                      551   0.0     Nierembergia sp. NB17
gb|AEP17003.1|  chalcone synthase                                       551   0.0     
emb|CAJ44127.1|  chalcone synthase                                      551   0.0     Misopates orontium
emb|CAC19808.1|  chalcone synthase                                      551   0.0     Humulus lupulus [common hop]
ref|XP_002299281.2|  naregenin-chalcone synthase family protein         551   0.0     Populus trichocarpa [western balsam poplar]
gb|AAX16494.1|  chalcone synthase                                       551   0.0     Pyrus communis
ref|XP_007223025.1|  hypothetical protein PRUPE_ppa006888mg             551   0.0     
sp|O22046.1|CHSE_IPONI  RecName: Full=Chalcone synthase E; AltNam...    551   0.0     Ipomoea nil [qian niu]
gb|AGI02994.1|  chalcone synthase                                       551   0.0     
ref|NP_001275296.1|  chalcone synthase 2                                551   0.0     
ref|XP_002299282.1|  naregenin-chalcone synthase family protein         551   0.0     Populus trichocarpa [western balsam poplar]
gb|ABI79305.1|  chalcone synthase                                       551   0.0     Pyrus communis
ref|XP_011034455.1|  PREDICTED: chalcone synthase 1-like                551   0.0     
ref|XP_007223028.1|  hypothetical protein PRUPE_ppa006899mg             551   0.0     
ref|XP_009376347.1|  PREDICTED: polyketide synthase 5                   551   0.0     
sp|P48388.1|CHS3_CAMSI  RecName: Full=Chalcone synthase 3; AltNam...    550   0.0     Camellia sinensis [black tea]
gb|AGM46641.1|  chalcone synthase protein                               550   0.0     
sp|Q9AU11.1|PKS1_RUBID  RecName: Full=Polyketide synthase 1; Shor...    550   0.0     Rubus idaeus [European raspberry]
ref|XP_007161599.1|  hypothetical protein PHAVU_001G083000g             550   0.0     
gb|AGI02993.1|  chalcone synthase                                       550   0.0     
ref|XP_008224580.1|  PREDICTED: polyketide synthase 5-like              550   0.0     
gb|AFK33946.1|  unknown                                                 550   0.0     
gb|ADV29810.1|  chalcone synthase                                       550   0.0     
gb|AFX71920.1|  CHS2 chalcone synthase                                  550   0.0     
ref|XP_004504355.1|  PREDICTED: chalcone synthase 1-like                550   0.0     
gb|AEO36981.1|  chalcone synthase                                       550   0.0     
gb|AIB06736.1|  chalcone synthases-1                                    550   0.0     
ref|XP_002303821.2|  naregenin-chalcone synthase family protein         550   0.0     Populus trichocarpa [western balsam poplar]
sp|Q43163.1|CHSB_SOLTU  RecName: Full=Chalcone synthase 1B; AltNa...    549   0.0     Solanum tuberosum [potatoes]
ref|XP_002518132.1|  Chalcone synthase, putative                        549   0.0     Ricinus communis
gb|AAO13091.1|  chalcone synthase                                       549   0.0     Camellia sinensis [black tea]
sp|Q9XJ58.1|CHS1_CITSI  RecName: Full=Chalcone synthase 1; AltNam...    549   0.0     Citrus sinensis [apfelsine]
sp|Q9MB37.1|CHS7_IPOBA  RecName: Full=Chalcone synthase DIII; Alt...    549   0.0     Ipomoea batatas [batate]
gb|ABB89213.1|  chalcone synthase                                       549   0.0     Sorbus aucuparia [European mountain ash]
ref|XP_006468926.1|  PREDICTED: chalcone synthase 2-like                549   0.0     
gb|AAM90652.1|AF400567_1  chalcone synthase 6                           549   0.0     Rubus idaeus [European raspberry]
ref|XP_008358057.1|  PREDICTED: polyketide synthase 5                   549   0.0     
gb|AHK07000.1|  chalcone synthase                                       549   0.0     
gb|ABY68457.1|  chalcone synthase                                       549   0.0     Ipomoea batatas [batate]
ref|XP_009764938.1|  PREDICTED: chalcone synthase A                     549   0.0     
gb|AHA61354.1|  chalcone synthase                                       549   0.0     
sp|O22047.1|CHSE_IPOPU  RecName: Full=Chalcone synthase E; AltNam...    549   0.0     Ipomoea purpurea
ref|XP_009353802.1|  PREDICTED: chalcone synthase-like                  549   0.0     
gb|ACN30003.1|  chalcone synthase                                       549   0.0     Vitis rotundifolia [fox grape]
gb|AEN83501.1|  chalcone synthase                                       549   0.0     
ref|XP_009370115.1|  PREDICTED: chalcone synthase-like                  549   0.0     
gb|AHZ97870.1|  chalcone synthase                                       549   0.0     
gb|ACS12837.1|  chalcone synthase                                       548   0.0     Nicotiana alata [flowering tobacco]
gb|AEC13058.1|  chalcone synthase protein                               548   0.0     
sp|Q9MB41.1|CHS2_IPOBA  RecName: Full=Chalcone synthase LF2; AltN...    548   0.0     Ipomoea batatas [batate]
gb|AFC37244.1|  chalcone synthase 3                                     548   0.0     
gb|AGZ15299.1|  chalcone synthase                                       548   0.0     
ref|XP_002303820.1|  naregenin-chalcone synthase family protein         548   0.0     Populus trichocarpa [western balsam poplar]
ref|XP_010929491.1|  PREDICTED: chalcone synthase 2                     548   0.0     
ref|XP_009353801.1|  PREDICTED: chalcone synthase                       548   0.0     
gb|AEU17693.1|  chalcone synthase-like protein                          548   0.0     
gb|ACT31917.1|  chalcone synthase                                       548   0.0     
gb|ACQ41890.1|  chalcone synthase                                       548   0.0     Citrus unshiu [satsuma mandarin]
gb|AGL50915.1|  chalcone synthase                                       548   0.0     
gb|KDO45963.1|  hypothetical protein CISIN_1g016330mg                   548   0.0     
sp|Q9ZRS4.1|CHSY_CATRO  RecName: Full=Chalcone synthase; AltName:...    548   0.0     Catharanthus roseus [chatas]
dbj|BAE17124.1|  chalcone synthase                                      548   0.0     Fragaria x ananassa
gb|AEF14414.1|  chalcone synthase                                       548   0.0     
ref|XP_007157043.1|  hypothetical protein PHAVU_002G038700g             548   0.0     
gb|AGI02996.1|  chalcone synthase                                       548   0.0     
gb|AAX63402.1|  chalcone synthase                                       548   0.0     Solanum pinnatisectum
ref|XP_008224578.1|  PREDICTED: polyketide synthase 5                   548   0.0     
dbj|BAM17288.1|  chalcone synthase                                      548   0.0     
ref|XP_009376346.1|  PREDICTED: chalcone synthase-like                  548   0.0     
gb|AFJ44312.1|  chalcone synthase                                       548   0.0     
gb|AGU70032.1|  chalcone synthase                                       548   0.0     
gb|AAT75302.1|  chalcone synthase                                       548   0.0     Camellia sinensis [black tea]
sp|B0LDU6.1|PKS5_RUBID  RecName: Full=Polyketide synthase 5; Shor...    548   0.0     Rubus idaeus [European raspberry]
dbj|BAC87863.1|  chalcone synthase                                      548   0.0     Torenia hybrid cultivar
gb|ADZ54780.1|  naringenin-chalcone synthase                            548   0.0     
dbj|BAM17286.1|  chalcone synthase                                      547   0.0     
emb|CAK19318.1|  naringenin-chalcone synthase                           547   0.0     Humulus lupulus [common hop]
ref|XP_006446902.1|  hypothetical protein CICLE_v10015535mg             547   0.0     
gb|ACX37403.1|  chalcone synthase                                       547   0.0     Citrus maxima [buntan]
ref|XP_007157050.1|  hypothetical protein PHAVU_002G039100g             547   0.0     
sp|Q9FSB9.1|CHS1_RUTGR  RecName: Full=Chalcone synthase 1; AltNam...    547   0.0     Ruta graveolens
gb|ACJ54531.1|  chalcone synthase                                       546   0.0     Malus domestica [apple tree]
gb|AAN76184.1|  chalcone synthase                                       546   0.0     Hydrangea macrophylla
gb|ABP57071.1|  chalcone synthase                                       546   0.0     Solenostemon scutellarioides
emb|CAK19319.1|  naringenin-chalcone synthase                           546   0.0     Humulus lupulus [common hop]
dbj|BAA31259.1|  chalcone synthase                                      546   0.0     Vitis vinifera
ref|XP_004306542.1|  PREDICTED: chalcone synthase 2-like                546   0.0     
gb|ABN80439.1|  chalcone synthase                                       546   0.0     Nicotiana benthamiana
gb|AHL83549.1|  chalcone synthase                                       546   0.0     
gb|AAK39111.1|AF358655_1  chalcone synthase                             546   0.0     Ipomoea purpurea
ref|XP_010249317.1|  PREDICTED: chalcone synthase                       546   0.0     
dbj|BAO58433.1|  chalcone synthase                                      546   0.0     
gb|ADZ45300.1|  chalcone synthase 1                                     546   0.0     
gb|ABM66532.1|  chalcone synthase                                       546   0.0     Glycyrrhiza uralensis [Chinese licorice]
dbj|BAM17287.1|  chalcone synthase                                      546   0.0     
sp|O22045.1|CHSD_IPONI  RecName: Full=Chalcone synthase D; AltNam...    546   0.0     Ipomoea nil [qian niu]
ref|NP_001275352.1|  chalcone synthase 1A                               546   0.0     
dbj|BAC66467.1|  chalcone synthase                                      546   0.0     Rosa hybrid cultivar
gb|AAM00231.1|AF358431_1  root-specific chalcone synthase               546   0.0     Senna alata [bajagua]
ref|XP_008797107.1|  PREDICTED: chalcone synthase 1                     546   0.0     
sp|Q9MB40.1|CHS3_IPOBA  RecName: Full=Chalcone synthase LF3; AltN...    546   0.0     Ipomoea batatas [batate]
sp|P08894.1|CHSA_PETHY  RecName: Full=Chalcone synthase A; AltNam...    546   0.0     Petunia x hybrida [garden petunia]
ref|XP_011020677.1|  PREDICTED: chalcone synthase 1-like isoform X1     546   0.0     
sp|Q9AU09.1|PKS3_RUBID  RecName: Full=Polyketide synthase 3; Shor...    546   0.0     Rubus idaeus [European raspberry]
gb|AAX99413.1|  chalcone synthase                                       545   0.0     Fragaria x ananassa
dbj|BAB84112.1|  chalcone synthase                                      545   0.0     Vitis vinifera
emb|CAK19317.1|  naringenin-chalcone synthase                           545   0.0     Humulus lupulus [common hop]
gb|AAN05791.1|  chalcone synthase                                       545   0.0     Mazus pumilus [tokiwahaze]
ref|XP_010099135.1|  Chalcone synthase                                  545   0.0     
gb|AAM90651.1|AF400566_1  chalcone synthase 11                          545   0.0     Rubus idaeus [European raspberry]
sp|Q9MB39.1|CHS4_IPOBA  RecName: Full=Chalcone synthase LF4; AltN...    545   0.0     Ipomoea batatas [batate]
dbj|BAB20074.1|  chalcone synthase                                      545   0.0     Torenia hybrid cultivar
gb|AAK49457.1|  chalcone synthase                                       545   0.0     Nicotiana tabacum [American tobacco]
ref|XP_011020680.1|  PREDICTED: chalcone synthase 1-like isoform X2     545   0.0     
sp|P49440.1|CHSY_PHAVU  RecName: Full=Chalcone synthase 17; AltNa...    545   0.0     Phaseolus vulgaris [French bean]
gb|ACS36661.1|  CHS4                                                    545   0.0     Vitis labrusca x Vitis vinifera [Labruscan grape]
sp|Q8RVK9.1|CHS_CANSA  RecName: Full=Naringenin-chalcone synthase       545   0.0     Cannabis sativa [marijuana]
ref|XP_008224579.1|  PREDICTED: polyketide synthase 5-like              545   0.0     
gb|AAM90650.1|AF400565_1  chalcone synthase 5                           545   0.0     Rubus idaeus [European raspberry]
ref|NP_001267879.1|  chalcone synthase                                  545   0.0     
ref|XP_004306543.1|  PREDICTED: chalcone synthase 2-like                545   0.0     
gb|AHZ30595.1|  chalcone synthase                                       544   0.0     
sp|Q9MB36.1|CHS8_IPOBA  RecName: Full=Chalcone synthase DIV; AltN...    545   0.0     Ipomoea batatas [batate]
ref|XP_007157042.1|  hypothetical protein PHAVU_002G038600g             545   0.0     
ref|XP_007157053.1|  hypothetical protein PHAVU_002G039300g             545   0.0     
ref|XP_009619773.1|  PREDICTED: chalcone synthase 1B                    545   0.0     
sp|P23569.1|CHSY_PUEML  RecName: Full=Chalcone synthase; AltName:...    545   0.0     Pueraria montana var. lobata [kudzu]
ref|XP_007158815.1|  hypothetical protein PHAVU_002G184300g             545   0.0     
sp|P51090.1|CHSY_VITVI  RecName: Full=Chalcone synthase; AltName:...    545   0.0     Vitis vinifera
sp|P13417.1|CHS3_SINAL  RecName: Full=Chalcone synthase 3; AltNam...    545   0.0     Sinapis alba [bai jie]
gb|ADF43042.1|  chalcone synthase 1 protein                             545   0.0     
gb|AAO32821.1|  chalcone synthase                                       544   0.0     Arachis hypogaea [goober]
gb|EYU43821.1|  hypothetical protein MIMGU_mgv1a007904mg                544   0.0     
gb|ABC86919.1|  chalcone synthase                                       544   0.0     Populus alba [abele]
emb|CAA05512.1|  chalcone synthase                                      544   0.0     Digitalis lanata [Grecian foxglove]
emb|CDX78547.1|  BnaA03g04590D                                          544   0.0     
gb|AFL72079.1|  chalcone synthase                                       544   0.0     
gb|ABD24222.1|  chalcone synthase                                       544   0.0     Populus alba [abele]
gb|ACB78187.1|  chalcone synthase                                       544   0.0     Senna tora
prf||1609233A  chalcone synthase 3                                      544   0.0  
gb|ABW69675.1|  chalcone synthase D                                     544   0.0     Ipomoea purpurea
sp|Q9MB38.1|CHS6_IPOBA  RecName: Full=Chalcone synthase DII; AltN...    544   0.0     Ipomoea batatas [batate]
emb|CAA32731.1|  chalcone synthase                                      544   0.0     Petunia x hybrida [garden petunia]
gb|AAK39110.1|AF358654_1  chalcone synthase                             543   0.0     Ipomoea purpurea
gb|ACT32034.1|  chalcone synthase                                       543   0.0     Glycine soja [wild soybean]
gb|AHY35308.1|  chalcone synthase 1                                     543   0.0     
sp|Q9MB33.1|CHS1_IPOBA  RecName: Full=Chalcone synthase LF1; AltN...    543   0.0     Ipomoea batatas [batate]
dbj|BAE17122.1|  chalcone synthase                                      543   0.0     Fragaria x ananassa
dbj|BAD34456.1|  chalcone synthase                                      543   0.0     Eustoma exaltatum subsp. russellianum [bluebells]
gb|ACM17224.1|  naringenin-chalcone synthase                            543   0.0     Humulus lupulus [common hop]
dbj|BAE17123.1|  chalcone synthase                                      543   0.0     Fragaria x ananassa
gb|ADZ45299.1|  chalcone synthase 1                                     543   0.0     
gb|AAF60297.1|AF233638_1  chalcone synthase                             543   0.0     Petunia x hybrida [garden petunia]
ref|XP_003537853.1|  PREDICTED: chalcone synthase                       543   0.0     
gb|AAU43217.1|  chalcone synthase                                       543   0.0     Arachis hypogaea [goober]
gb|KDP41871.1|  hypothetical protein JCGZ_26889                         543   0.0     
gb|AAB36038.1|  chalcone synthase                                       543   0.0     Petunia x hybrida [garden petunia]
gb|AHB50476.1|  putative stilbene synthase                              543   0.0     
dbj|BAK08888.1|  chalcone synthase 2                                    543   0.0     
gb|AID69535.1|  chalcone synthase                                       543   0.0     
ref|XP_009111334.1|  PREDICTED: chalcone synthase 3-like                543   0.0     
dbj|BAE45039.1|  chalcone synthase                                      543   0.0     Gentiana triflora
ref|XP_004502226.1|  PREDICTED: chalcone synthase 1B-like               543   0.0     
gb|AFW98276.1|  chalone synthase                                        543   0.0     
gb|ADZ45298.1|  chalcone synthase 1                                     543   0.0     
gb|ADZ45296.1|  chalcone synthase 2                                     543   0.0     
gb|ACM62742.1|  chalcone synthase                                       543   0.0     Garcinia mangostana [mangosteen]
sp|P30074.1|CHS2_MEDSA  RecName: Full=Chalcone synthase 2; AltNam...    542   0.0     Medicago sativa [alfalfa]
sp|P48390.1|CHS1_GERHY  RecName: Full=Chalcone synthase 1; AltNam...    543   0.0     Gerbera hybrid cultivar
gb|AAG43356.1|AF144538_1  chalcone synthase                             543   0.0     Cardamine penzesii
sp|P30075.2|CHS4_MEDSA  RecName: Full=Chalcone synthase 4; AltNam...    542   0.0     Medicago sativa [alfalfa]
ref|XP_003601648.1|  Chalcone synthase                                  542   0.0     
gb|AID51449.1|  chalcone synthase 2                                     542   0.0     
dbj|BAA75310.1|  Chalcone synthase                                      542   0.0     Ipomoea batatas [batate]
ref|XP_003621538.1|  Chalcone synthase                                  542   0.0     
ref|XP_010099134.1|  Chalcone synthase                                  542   0.0     
ref|NP_001234033.1|  chalcone synthase 1                                542   0.0     
ref|XP_003601647.1|  Chalcone synthase                                  542   0.0     
gb|ADZ45294.1|  chalcone synthase 3                                     542   0.0     
ref|XP_009421018.1|  PREDICTED: chalcone synthase 2-like                542   0.0     
sp|Q9SEP2.1|CHSY_CARAN  RecName: Full=Chalcone synthase; AltName:...    542   0.0     Cardamine amara
gb|AHB18370.1|  chalcone synthase 1                                     542   0.0     
emb|CAA10131.1|  chalcone synthase                                      542   0.0     Cicer arietinum [garbanzo]
gb|ADE59487.1|  type III polyketide synthase 3                          542   0.0     
gb|AAQ62588.1|  chalcone synthase CHS4                                  541   0.0     Glycine max [soybeans]
gb|ACH67480.1|  chalcone synthase                                       541   0.0     Glycyrrhiza inflata
gb|KEH27375.1|  chalcone and stilbene synthase family protein           541   0.0     
gb|KHN12336.1|  Chalcone synthase 1                                     541   0.0     
gb|ADY02639.1|  chalcone synthase                                       541   0.0     
gb|AHJ80976.1|  chalcone synthase                                       541   0.0     
ref|XP_002321081.1|  chalcone synthase family protein                   542   0.0     Populus trichocarpa [western balsam poplar]
pdb|1I89|A  Chain A, Chalcone Synthase (G256l)                          541   0.0     
dbj|BAJ14519.1|  chalcone synthase 2                                    541   0.0     
ref|XP_003524935.1|  PREDICTED: chalcone synthase                       541   0.0     
ref|XP_003531219.1|  PREDICTED: chalcone synthase 5-like                541   0.0     
dbj|BAJ21532.1|  chalcone synthase type 2                               541   0.0     
sp|Q9AU10.1|PKS2_RUBID  RecName: Full=Inactive polyketide synthas...    541   0.0     
gb|AEW12813.1|  chalcone synthase                                       541   0.0     
gb|AHL69646.1|  chalcone synthase 1                                     541   0.0     
ref|XP_003531225.1|  PREDICTED: chalcone synthase 1 isoform X1          541   0.0     
ref|XP_003621530.1|  Chalcone synthase                                  541   0.0     
gb|ABB30178.1|  chalcone synthase 1                                     541   0.0     
gb|AFU90825.1|  chalcone synthase                                       541   0.0     
gb|ADZ45295.1|  chalcone synthase 3                                     541   0.0     
gb|AAK39114.1|AF358658_1  chalcone synthase                             541   0.0     
emb|CAP20328.1|  chalcone synthase                                      540   0.0     
pdb|1I88|A  Chain A, Chalcone Synthase (G256v)                          540   0.0     
ref|WP_039310897.1|  hypothetical protein                               540   0.0     
ref|XP_003592044.1|  Chalcone synthase                                  540   0.0     
ref|NP_001276296.1|  chalcone synthase                                  540   0.0     
ref|XP_003533807.1|  PREDICTED: chalcone synthase 6                     540   0.0     
ref|XP_009404732.1|  PREDICTED: chalcone synthase 2                     540   0.0     
pdb|1I8B|A  Chain A, Chalcone Synthase (g256f)                          540   0.0     
ref|XP_009131369.1|  PREDICTED: chalcone synthase 3-like                540   0.0     
ref|XP_003517529.1|  PREDICTED: chalcone synthase 7                     540   0.0     
ref|XP_003610852.1|  Chalcone synthase                                  540   0.0     
gb|AAO67373.1|  chalcone synthase                                       540   0.0     
gb|AIM58717.1|  chalcone synthase                                       540   0.0     
sp|O23882.1|CHS4_PEA  RecName: Full=Chalcone synthase 4; AltName:...    540   0.0     
sp|P51082.1|CHSB_PEA  RecName: Full=Chalcone synthase 1B; AltName...    540   0.0     
sp|P51075.2|CHSY_BETPN  RecName: Full=Chalcone synthase; AltName:...    540   0.0     
gb|AHY35309.1|  chalcone synthase 2                                     540   0.0     
sp|Q01288.1|CHS6_PEA  RecName: Full=Chalcone synthase 6; AltName:...    540   0.0     
gb|ABE01413.1|  chalcone synthase                                       540   0.0     
pdb|1I86|A  Chain A, Chalcone Synthase, G256a Mutant                    540   0.0     
ref|XP_006585154.1|  PREDICTED: chalcone synthase 3-like isoform X2     540   0.0     
gb|AFK48401.1|  unknown                                                 540   0.0     
ref|XP_008808192.1|  PREDICTED: chalcone synthase C2                    540   0.0     
sp|P17818.1|CHSY_MATIN  RecName: Full=Chalcone synthase; AltName:...    540   0.0     
gb|ACU21426.1|  unknown                                                 540   0.0     
dbj|BAO58435.1|  chalcone synthase                                      540   0.0     
sp|O23883.1|CHS3_PEA  RecName: Full=Chalcone synthase 3; AltName:...    540   0.0     
pdb|4WUM|A  Chain A, X-ray Crystal Structure Of Chalcone Synthase...    540   0.0     
gb|ADZ45297.1|  chalcone synthase 2                                     540   0.0     
gb|KEH27376.1|  chalcone and stilbene synthase family protein           540   0.0     
sp|O23884.1|CHS5_PEA  RecName: Full=Chalcone synthase 5; AltName:...    540   0.0     
ref|XP_011006130.1|  PREDICTED: chalcone synthase                       540   0.0     
gb|AEN84253.1|  chalcone synthase                                       540   0.0     
pdb|1CML|A  Chain A, Chalcone Synthase From Alfalfa Complexed Wit...    539   0.0     
gb|ADY02641.1|  chalcone synthase                                       540   0.0     
sp|P51088.1|CHS6_TRISU  RecName: Full=Chalcone synthase 6; AltNam...    539   0.0     
gb|ABM73434.1|  chalcone synthase                                       540   0.0     
ref|XP_009376348.1|  PREDICTED: polyketide synthase 5-like              539   0.0     
dbj|BAD34457.1|  chalcone synthase                                      539   0.0     
pdb|1CHW|A  Chain A, Chalcone Synthase From Alfalfa Complexed Wit...    539   0.0     
ref|XP_010908134.1|  PREDICTED: chalcone synthase 3-like                539   0.0     
sp|A2ZEX7.1|CHS1_ORYSI  RecName: Full=Chalcone synthase 1; Short=...    539   0.0     
ref|XP_003621536.1|  Chalcone synthase                                  539   0.0     
gb|ADB28916.1|  chalcone synthase                                       539   0.0     
gb|KHN25612.1|  Chalcone synthase 7                                     539   0.0     
gb|AAG43348.1|AF144530_1  chalcone synthase                             539   0.0     
gb|ABQ95964.1|  chalcone synthase                                       539   0.0     
sp|P51084.1|CHS2_TRISU  RecName: Full=Chalcone synthase 2; AltNam...    539   0.0     
emb|CDX69618.1|  BnaA10g19670D                                          539   0.0     
sp|P30077.1|CHS9_MEDSA  RecName: Full=Chalcone synthase 9; AltNam...    539   0.0     
ref|NP_001068009.1|  Os11g0530600                                       539   0.0     
pdb|1BI5|A  Chain A, Chalcone Synthase From Alfalfa                     538   0.0     
sp|P51087.1|CHS5_TRISU  RecName: Full=Chalcone synthase 5; AltNam...    538   0.0     
ref|XP_002303819.2|  naregenin-chalcone synthase family protein         539   0.0     
sp|P51085.1|CHS3_TRISU  RecName: Full=Chalcone synthase 3; AltNam...    538   0.0     
gb|EYU43822.1|  hypothetical protein MIMGU_mgv1a007937mg                539   0.0     
gb|AAK39113.1|AF358657_1  chalcone synthase                             538   0.0     
sp|P51081.1|CHSA_PEA  RecName: Full=Chalcone synthase 1A; AltName...    538   0.0     
pdb|1BQ6|A  Chain A, Chalcone Synthase From Alfalfa With Coenzyme A     538   0.0     
sp|Q9SML4.1|CHS1_CICAR  RecName: Full=Chalcone synthase 1; AltNam...    538   0.0     
gb|AGU91424.1|  chalcone synthase                                       539   0.0     
gb|AIJ27448.1|  chalcone synthase                                       539   0.0     
dbj|BAF49290.1|  chalcone synthase                                      538   0.0     
gb|AAG43359.1|AF144541_1  chalcone synthase                             539   0.0     
ref|XP_003621532.1|  Chalcone synthase                                  538   0.0     
gb|AAC31912.1|  chalcone synthase A2                                    538   0.0     
ref|XP_003531223.1|  PREDICTED: chalcone synthase 1                     538   0.0     
gb|AEB96143.1|  chalcone synthase                                       538   0.0     
emb|CDY09836.1|  BnaC09g43250D                                          538   0.0     
gb|ABO21005.1|  chalcone synthase                                       538   0.0     
gb|AAP20864.1|  putative chalcone synthase                              538   0.0     
sp|Q01286.1|CHS1_PEA  RecName: Full=Chalcone synthase 1; AltName:...    538   0.0     
sp|P17957.1|CHS2_SOYBN  RecName: Full=Chalcone synthase 2; AltNam...    538   0.0     
gb|ABR16308.1|  unknown                                                 538   0.0     
sp|O22652.1|CHSY_RAPSA  RecName: Full=Chalcone synthase; AltName:...    538   0.0     
emb|CDX91090.1|  BnaC02g05070D                                          538   0.0     
gb|ABD24236.1|  chalcone synthase                                       538   0.0     
sp|P51083.1|CHS1_TRISU  RecName: Full=Chalcone synthase 1; AltNam...    538   0.0     
gb|KEH43642.1|  chalcone and stilbene synthase family protein           538   0.0     
ref|XP_010909688.1|  PREDICTED: chalcone synthase 3-like                538   0.0     
ref|XP_010028921.1|  PREDICTED: chalcone synthase 3                     538   0.0     
gb|AAG43350.1|AF144532_1  chalcone synthase                             538   0.0     
gb|ABR16506.1|  unknown                                                 538   0.0     
dbj|BAA19548.1|  chalcone synthase                                      537   0.0     
gb|ABQ95960.1|  chalcone synthase                                       538   0.0     
sp|P48392.1|CHS3_GERHY  RecName: Full=Chalcone synthase 3; AltNam...    538   0.0     
gb|AEN84248.1|  chalcone synthase                                       538   0.0     
emb|CAD20740.1|  chalcone synthase                                      538   0.0     
gb|ABD24230.1|  chalcone synthase                                       538   0.0     
ref|XP_003621534.1|  Chalcone synthase                                  537   0.0     
ref|XP_003516867.1|  PREDICTED: chalcone synthase 6-like                537   0.0     
gb|AAG43360.1|AF144542_1  chalcone synthase                             538   0.0     
sp|P19168.1|CHS3_SOYBN  RecName: Full=Chalcone synthase 3; AltNam...    537   0.0     
ref|XP_009404102.1|  PREDICTED: chalcone synthase 2-like                537   0.0     
gb|AGJ50587.1|  CHS1                                                    537   0.0     
gb|ADB44077.1|  chalcone synthase                                       537   0.0     
ref|XP_010908135.1|  PREDICTED: chalcone synthase 3-like                537   0.0     
gb|ABK21072.1|  unknown                                                 537   0.0     
gb|AAG43353.1|AF144535_1  chalcone synthase                             537   0.0     
gb|ABF69124.1|  chalcone synthase                                       537   0.0     
gb|AEN84264.1|  chalcone synthase                                       537   0.0     
ref|XP_002450870.1|  hypothetical protein SORBIDRAFT_05g020160          537   0.0     
ref|XP_003624524.1|  Chalcone synthase                                  537   0.0     
gb|ABG76200.1|  chalcone synthase                                       537   0.0     
ref|NP_001268064.1|  chalcone synthase                                  539   0.0     
ref|XP_003592022.1|  Chalcone synthase                                  537   0.0     
gb|ADR63288.1|  chalcone synthase                                       537   0.0     
gb|ABE03669.1|  chalcone synthase                                       537   0.0     
gb|AFM29141.1|  chalcone synthase                                       536   0.0     
gb|AFD36435.1|  chalcone synthase 1                                     536   0.0     
sp|P13416.1|CHS1_SINAL  RecName: Full=Chalcone synthase 1; AltNam...    537   0.0     
dbj|BAH16615.1|  chalcone synthase                                      537   0.0     
gb|KFK25629.1|  hypothetical protein AALP_AA8G139500                    537   0.0     
sp|Q01287.1|CHS2_PEA  RecName: Full=Chalcone synthase 2; AltName:...    536   0.0     
dbj|BAM28981.1|  chalcone synthase C                                    536   0.0     
gb|ABD24228.1|  chalcone synthase                                       537   0.0     
sp|Q9SEP4.1|CHSY_ARAAL  RecName: Full=Chalcone synthase; AltName:...    536   0.0     
ref|XP_006399896.1|  hypothetical protein EUTSA_v10013745mg             536   0.0     
gb|AIZ50175.1|  chalcone synthase                                       536   0.0     
gb|AGC72963.1|  chalcone synthase                                       536   0.0     
gb|AFU90824.1|  chalcone synthase                                       536   0.0     
gb|ABK23777.1|  unknown                                                 536   0.0     
ref|XP_008808809.1|  PREDICTED: chalcone synthase 3                     536   0.0     
gb|AIM48929.1|  chalcone synthase                                       536   0.0     
gb|ABK25340.1|  unknown                                                 536   0.0     
gb|AEN84263.1|  chalcone synthase                                       536   0.0     
gb|ABQ28695.1|  chalcone synthase                                       536   0.0     
gb|AHC07953.1|  chalcone synthase                                       536   0.0     
gb|AGE10597.1|  chalcone synthase                                       536   0.0     
gb|AEN84265.1|  chalcone synthase                                       536   0.0     
gb|AAF23571.1|AF112096_1  chalcone synthase                             536   0.0     
gb|ACJ85339.1|  unknown                                                 536   0.0     
ref|XP_010907554.1|  PREDICTED: chalcone synthase 3-like                536   0.0     
gb|AIB06737.1|  chalcone synthases-1                                    536   0.0     
gb|AFM36767.1|  chalcone synthase                                       536   0.0     
gb|ABE03650.1|  chalcone synthase                                       536   0.0     
gb|AAC31914.1|  chalcone synthase B2                                    536   0.0     
gb|AIM54369.1|  chalcone synthase                                       536   0.0     
gb|ABE03651.1|  chalcone synthase                                       536   0.0     
gb|ACU20027.1|  unknown                                                 536   0.0     
gb|AGC72966.1|  chalcone synthase                                       536   0.0     
pdb|1D6I|A  Chain A, Chalcone Synthase (H303q Mutant)                   536   0.0     
gb|AFA55180.1|  chalcone synthase                                       536   0.0     
gb|AGC72947.1|  chalcone synthase                                       536   0.0     
gb|ABE03648.1|  chalcone synthase                                       536   0.0     
gb|AEK70334.1|  chalcone synthase                                       536   0.0     
ref|XP_003577513.1|  PREDICTED: chalcone synthase 2                     536   0.0     
gb|ABD24251.1|  chalcone synthase                                       536   0.0     
gb|AAF23566.1|AF112091_1  chalcone synthase                             536   0.0     
gb|ABQ95961.1|  chalcone synthase                                       536   0.0     
ref|XP_003610855.1|  Chalcone synthase                                  535   0.0     
gb|AAF23583.1|AF112108_1  chalcone synthase                             536   0.0     
emb|CAC20725.1|  putative chalcone synthase                             535   0.0     
pdb|1D6H|A  Chain A, Chalone Synthase (N336a Mutant Complexed Wit...    535   0.0     
pdb|1JWX|A  Chain A, Chalcone Synthase--F215s Mutant                    535   0.0     
gb|ABD38598.1|  chalcone synthase                                       536   0.0     
gb|ABE77392.2|  chalcone synthase                                       535   0.0     
gb|ABE03647.1|  chalcone synthase                                       535   0.0     
gb|ADD91690.1|  chalcone synthase                                       535   0.0     
sp|Q9M5M0.1|CHS7_PICMA  RecName: Full=Chalcone synthase 7; AltNam...    535   0.0     
gb|ABQ95962.1|  chalcone synthase                                       535   0.0     
gb|ABD38604.1|  chalcone synthase                                       535   0.0     
gb|AGY80771.1|  chalcone synthase                                       535   0.0     
gb|AGU43679.1|  pinocembrin chalcone synthase                           535   0.0     
gb|AGC72954.1|  chalcone synthase                                       535   0.0     
gb|ABK25177.1|  unknown                                                 535   0.0     
gb|AFK65634.1|  chalcone synthase 2                                     536   0.0     
gb|ABF59865.1|  chalcone synthase                                       535   0.0     
sp|O23729.1|CHS3_BROFI  RecName: Full=Chalcone synthase 3; AltNam...    535   0.0     
sp|P51077.1|CHS3_MEDSA  RecName: Full=Chalcone synthase 4-1; AltN...    535   0.0     
gb|ABK25266.1|  unknown                                                 535   0.0     
gb|ABD38596.1|  chalcone synthase                                       535   0.0     
gb|AAO73441.1|  chalcone synthase                                       535   0.0     
gb|AIU98510.1|  chalcone synthase                                       535   0.0     
sp|P48385.2|CHSY_CALCH  RecName: Full=Chalcone synthase; AltName:...    535   0.0     
ref|XP_002449616.1|  hypothetical protein SORBIDRAFT_05g020150          535   0.0     
gb|ACX31605.1|  chalcone synthase                                       535   0.0     
ref|XP_009121714.1|  PREDICTED: chalcone synthase 1                     535   0.0     
gb|ABF68864.1|  chalcone synthase                                       535   0.0     
gb|AAC31913.1|  chalcone synthase B1                                    535   0.0     
sp|P30076.1|CHS8_MEDSA  RecName: Full=Chalcone synthase 8; AltNam...    534   0.0     
gb|AAP85249.1|  chalcone synthase                                       535   0.0     
gb|AAN87170.1|  chalcone synthase                                       535   0.0     
gb|AAM65314.1|  chalcone synthase (naringenin-chalcone synthase) ...    535   0.0     
sp|Q9SBL4.1|CHS5_SORBI  RecName: Full=Chalcone synthase 5; AltNam...    535   0.0     
ref|NP_196897.1|  chalcone synthase                                     535   0.0     
sp|O23731.1|CHS8_BROFI  RecName: Full=Chalcone synthase 8; AltNam...    535   0.0     
gb|AHJ60259.1|  chalcone synthase                                       535   0.0     
gb|ABK24876.1|  unknown                                                 535   0.0     
gb|ABD24253.1|  chalcone synthase                                       535   0.0     
sp|Q9SBL7.1|CHS2_SORBI  RecName: Full=Chalcone synthase 2; AltNam...    535   0.0     
gb|AEN84239.1|  chalcone synthase                                       535   0.0     
ref|XP_008778753.1|  PREDICTED: chalcone synthase 3-like                534   0.0     
gb|AAZ23746.1|  chalcone synthase family protein                        534   0.0     
sp|O23730.1|CHS4_BROFI  RecName: Full=Chalcone synthase 4; AltNam...    534   0.0     
ref|XP_006662967.1|  PREDICTED: chalcone synthase 1-like                535   0.0     
dbj|BAM28982.1|  chalcone synthase C                                    534   0.0     
gb|ABF68860.1|  chalcone synthase                                       534   0.0     
gb|AEN84262.1|  chalcone synthase                                       534   0.0     
gb|AAF23562.1|AF112087_1  chalcone synthase                             534   0.0     
gb|AFL47798.1|  chalcone synthase                                       534   0.0     
gb|AAY83389.1|  chalcone synthase                                       534   0.0     
gb|AAZ23741.1|  chalcone synthase family protein                        534   0.0     
gb|AAG43406.1|  chalcone synthase                                       534   0.0     
gb|ABD24233.1|  chalcone synthase                                       534   0.0     
sp|P30079.1|CHSY_PINSY  RecName: Full=Chalcone synthase; AltName:...    534   0.0     
gb|AAF23570.1|AF112095_1  chalcone synthase                             534   0.0     



>gb|AAB02620.1| chalcone synthase A [Ipomoea purpurea]
 gb|AAB62591.1| chalcone synthase-A [Ipomoea purpurea]
Length=396

 Score =   793 bits (2048),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 380/390 (97%), Positives = 388/390 (99%), Gaps = 0/390 (0%)
 Frame = +3

Query  99    VLTDTWSHRAKRLEGDAKILAIGTATPANWVDQTTYPDFYFRITNSQHLLEHKEKFRRIC  278
             VLTDTWSHRAKRLEGDAKILAIGTATPANWVDQTTYPDFYFRITNS+HLLEHKEKFRRIC
Sbjct  7     VLTDTWSHRAKRLEGDAKILAIGTATPANWVDQTTYPDFYFRITNSEHLLEHKEKFRRIC  66

Query  279   NKSKIMKRHLVLTEELLKKHPNLCTYNEASLNTRQDILVSGVPKLGKEAAMKAIKEWGRP  458
             NKSKIMKRHLV+TEELLKK+PNLCTYNEASLNTRQDILVS VPKLGKEAAMKAIKEWGRP
Sbjct  67    NKSKIMKRHLVITEELLKKNPNLCTYNEASLNTRQDILVSEVPKLGKEAAMKAIKEWGRP  126

Query  459   ISEITHLVFCTTSGVDMPGADFQLTKLLGLNSSVKRLMMYQQGCNAGAAMLRLAKDLAEN  638
             ISEITHLVFCTTSGVDMPGADFQLTKLLGLNSSVKRLMMYQQGCNAGAAMLRLAKDLAEN
Sbjct  127   ISEITHLVFCTTSGVDMPGADFQLTKLLGLNSSVKRLMMYQQGCNAGAAMLRLAKDLAEN  186

Query  639   NKGARVLVVCSEVMLSVFRGPSLQQEDNLLAQCLFGDGSAAVIVGTEPRPGLETPLFELV  818
             NKGARVLVVCSEVMLSVFRGPSLQQEDNLLAQCLFGDGSAAVIVGTEPRPGLETPLFELV
Sbjct  187   NKGARVLVVCSEVMLSVFRGPSLQQEDNLLAQCLFGDGSAAVIVGTEPRPGLETPLFELV  246

Query  819   SSAQTIIPDTDSHLKLQLREMGLTFHCSKAVPSLITQNVEDCLVKAFEPFGISDWNSIFW  998
             S+AQT IPDTDS+LKLQLREMGLTFHCSKAVPSLITQN+EDCLVKAFEPFGISDWNSIFW
Sbjct  247   SAAQTTIPDTDSYLKLQLREMGLTFHCSKAVPSLITQNIEDCLVKAFEPFGISDWNSIFW  306

Query  999   ILHPGGNAILDGVEEKLGLDPEKLRASRDVLSQYGNLTSACVLFILDEVRKKSKKQQQMT  1178
             ILHPGGNAILDGVEEKLGL+PEKLRASRDVLSQYGNLTSACVLFILDEVRKKSKKQQQMT
Sbjct  307   ILHPGGNAILDGVEEKLGLEPEKLRASRDVLSQYGNLTSACVLFILDEVRKKSKKQQQMT  366

Query  1179  TGEGLEWGVLFGFGPGLTIDTVVIRSVPIN  1268
             TGEGLEWGV+FGFGPGLTIDTVVIRSVPIN
Sbjct  367   TGEGLEWGVVFGFGPGLTIDTVVIRSVPIN  396



>gb|AAB62589.1| chalcone synthase-A [Ipomoea purpurea]
Length=396

 Score =   791 bits (2042),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 379/390 (97%), Positives = 387/390 (99%), Gaps = 0/390 (0%)
 Frame = +3

Query  99    VLTDTWSHRAKRLEGDAKILAIGTATPANWVDQTTYPDFYFRITNSQHLLEHKEKFRRIC  278
             VLTDTWSHRAKRLEGDAKILAIGTATPANWVDQTTYPDFYFRITNS+HLLEHKEKFRRIC
Sbjct  7     VLTDTWSHRAKRLEGDAKILAIGTATPANWVDQTTYPDFYFRITNSEHLLEHKEKFRRIC  66

Query  279   NKSKIMKRHLVLTEELLKKHPNLCTYNEASLNTRQDILVSGVPKLGKEAAMKAIKEWGRP  458
             NKSKIMKRHLV+TEELLKK+PNLCTYNEASLNTRQDILVS VPKLGKEAAMKAIKEWGRP
Sbjct  67    NKSKIMKRHLVITEELLKKNPNLCTYNEASLNTRQDILVSEVPKLGKEAAMKAIKEWGRP  126

Query  459   ISEITHLVFCTTSGVDMPGADFQLTKLLGLNSSVKRLMMYQQGCNAGAAMLRLAKDLAEN  638
             ISEITHLVFCTTSGVDMPGADFQLTKLLGLNSSVKRLMMYQQGCNAGAAMLRLAKDLAEN
Sbjct  127   ISEITHLVFCTTSGVDMPGADFQLTKLLGLNSSVKRLMMYQQGCNAGAAMLRLAKDLAEN  186

Query  639   NKGARVLVVCSEVMLSVFRGPSLQQEDNLLAQCLFGDGSAAVIVGTEPRPGLETPLFELV  818
             NKG+RVLVVCSEVMLSVFRGPSLQQEDNLLAQCLFGDGSAAVIVGTEPRPGLETPLFELV
Sbjct  187   NKGSRVLVVCSEVMLSVFRGPSLQQEDNLLAQCLFGDGSAAVIVGTEPRPGLETPLFELV  246

Query  819   SSAQTIIPDTDSHLKLQLREMGLTFHCSKAVPSLITQNVEDCLVKAFEPFGISDWNSIFW  998
             S+AQT IPDTDSHLKL LREMGLTFHCSKAVPSLITQN+EDCLVKAFEPFGISDWNSIFW
Sbjct  247   SAAQTTIPDTDSHLKLHLREMGLTFHCSKAVPSLITQNIEDCLVKAFEPFGISDWNSIFW  306

Query  999   ILHPGGNAILDGVEEKLGLDPEKLRASRDVLSQYGNLTSACVLFILDEVRKKSKKQQQMT  1178
             ILHPGGNAILDGVEEKLGL+PEKLRASRDVLSQYGNLTSACVLFILDEVRKKSKKQQQMT
Sbjct  307   ILHPGGNAILDGVEEKLGLEPEKLRASRDVLSQYGNLTSACVLFILDEVRKKSKKQQQMT  366

Query  1179  TGEGLEWGVLFGFGPGLTIDTVVIRSVPIN  1268
             TGEGLEWGV+FGFGPGLTIDTVVIRSVPIN
Sbjct  367   TGEGLEWGVVFGFGPGLTIDTVVIRSVPIN  396



>gb|AAB62588.1| chalcone synthase-A [Ipomoea purpurea]
Length=396

 Score =   790 bits (2040),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 378/390 (97%), Positives = 388/390 (99%), Gaps = 0/390 (0%)
 Frame = +3

Query  99    VLTDTWSHRAKRLEGDAKILAIGTATPANWVDQTTYPDFYFRITNSQHLLEHKEKFRRIC  278
             VLTDTWSHRAKRLEGDAKILAIGTATPANWVDQTTYPDFYFRITNSQHLLEHKEKF+RIC
Sbjct  7     VLTDTWSHRAKRLEGDAKILAIGTATPANWVDQTTYPDFYFRITNSQHLLEHKEKFKRIC  66

Query  279   NKSKIMKRHLVLTEELLKKHPNLCTYNEASLNTRQDILVSGVPKLGKEAAMKAIKEWGRP  458
             NKSKIMKRHL++TEELLKK+PNLCTYNEASLNTRQDILVS VPKLGK+AAMKAIKEWGRP
Sbjct  67    NKSKIMKRHLLITEELLKKNPNLCTYNEASLNTRQDILVSEVPKLGKDAAMKAIKEWGRP  126

Query  459   ISEITHLVFCTTSGVDMPGADFQLTKLLGLNSSVKRLMMYQQGCNAGAAMLRLAKDLAEN  638
             ISEITHLVFCTTSGVDMPGADFQLTKLLGLNSSVKRLMMYQQGCNAGAAMLRLAKDLAEN
Sbjct  127   ISEITHLVFCTTSGVDMPGADFQLTKLLGLNSSVKRLMMYQQGCNAGAAMLRLAKDLAEN  186

Query  639   NKGARVLVVCSEVMLSVFRGPSLQQEDNLLAQCLFGDGSAAVIVGTEPRPGLETPLFELV  818
             NKGARVLVVCSEVMLSVFRGPSLQQEDNLLAQCLFGDGSAAVIVGTEPRPGLETPLFELV
Sbjct  187   NKGARVLVVCSEVMLSVFRGPSLQQEDNLLAQCLFGDGSAAVIVGTEPRPGLETPLFELV  246

Query  819   SSAQTIIPDTDSHLKLQLREMGLTFHCSKAVPSLITQNVEDCLVKAFEPFGISDWNSIFW  998
             S+AQT IPDTDS+LKLQLREMGLTFHCSKAVPSLITQN+EDCLVKAFEPFGISDWNSIFW
Sbjct  247   SAAQTTIPDTDSYLKLQLREMGLTFHCSKAVPSLITQNIEDCLVKAFEPFGISDWNSIFW  306

Query  999   ILHPGGNAILDGVEEKLGLDPEKLRASRDVLSQYGNLTSACVLFILDEVRKKSKKQQQMT  1178
             ILHPGGNAILDGVEEKLGL+PEKLRASRDVLSQYGNLTSACVLFILDEVRKKSKKQQQMT
Sbjct  307   ILHPGGNAILDGVEEKLGLEPEKLRASRDVLSQYGNLTSACVLFILDEVRKKSKKQQQMT  366

Query  1179  TGEGLEWGVLFGFGPGLTIDTVVIRSVPIN  1268
             TGEGLEWGV+FGFGPGLTIDTVVIRSVPIN
Sbjct  367   TGEGLEWGVVFGFGPGLTIDTVVIRSVPIN  396



>gb|AAB62590.1| chalcone synthase-A [Ipomoea purpurea]
Length=396

 Score =   788 bits (2036),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 378/390 (97%), Positives = 386/390 (99%), Gaps = 0/390 (0%)
 Frame = +3

Query  99    VLTDTWSHRAKRLEGDAKILAIGTATPANWVDQTTYPDFYFRITNSQHLLEHKEKFRRIC  278
             VLTDTWSHRAKRLEGDAKILAIGTATPANWVDQTTYPDFYFRITNS+HLLEHKEKF+RIC
Sbjct  7     VLTDTWSHRAKRLEGDAKILAIGTATPANWVDQTTYPDFYFRITNSEHLLEHKEKFKRIC  66

Query  279   NKSKIMKRHLVLTEELLKKHPNLCTYNEASLNTRQDILVSGVPKLGKEAAMKAIKEWGRP  458
             NKSKIMKRHLV+TEELLKK+PNLCTYNEASLNTRQDILVS VPKLGKEAAMKAIKEWGRP
Sbjct  67    NKSKIMKRHLVITEELLKKNPNLCTYNEASLNTRQDILVSEVPKLGKEAAMKAIKEWGRP  126

Query  459   ISEITHLVFCTTSGVDMPGADFQLTKLLGLNSSVKRLMMYQQGCNAGAAMLRLAKDLAEN  638
             ISEITHLVFCTTSGVDMPGADFQLTKLLGLNSSVKRLMMYQQGCNAGAAMLRLAKDLAEN
Sbjct  127   ISEITHLVFCTTSGVDMPGADFQLTKLLGLNSSVKRLMMYQQGCNAGAAMLRLAKDLAEN  186

Query  639   NKGARVLVVCSEVMLSVFRGPSLQQEDNLLAQCLFGDGSAAVIVGTEPRPGLETPLFELV  818
             NKGARVLVVCSEVMLSVFRGPSLQQEDNLLAQCLFGDGSAAVIVGTEPRPGLETPLFELV
Sbjct  187   NKGARVLVVCSEVMLSVFRGPSLQQEDNLLAQCLFGDGSAAVIVGTEPRPGLETPLFELV  246

Query  819   SSAQTIIPDTDSHLKLQLREMGLTFHCSKAVPSLITQNVEDCLVKAFEPFGISDWNSIFW  998
             S+AQT IPDTD HLKL LREMGLTFHCSKAVPSLITQNVEDCLVKAFEPFGISDWNSIFW
Sbjct  247   SAAQTTIPDTDFHLKLHLREMGLTFHCSKAVPSLITQNVEDCLVKAFEPFGISDWNSIFW  306

Query  999   ILHPGGNAILDGVEEKLGLDPEKLRASRDVLSQYGNLTSACVLFILDEVRKKSKKQQQMT  1178
             ILHPGGNAILDGVEEKLGL+PEKLRASRDVLSQYGNLTSACVLFILDEVRKKSKKQQQMT
Sbjct  307   ILHPGGNAILDGVEEKLGLEPEKLRASRDVLSQYGNLTSACVLFILDEVRKKSKKQQQMT  366

Query  1179  TGEGLEWGVLFGFGPGLTIDTVVIRSVPIN  1268
             TGEGLEWGV+FGFGPGLTIDT+VIRSVPIN
Sbjct  367   TGEGLEWGVVFGFGPGLTIDTIVIRSVPIN  396



>sp|P48397.2|CHSA_IPOPU RecName: Full=Chalcone synthase A; AltName: Full=Naringenin-chalcone 
synthase A; Short=CHS-A [Ipomoea purpurea]
 gb|AAB62582.1| chalcone synthase-A [Ipomoea purpurea]
 gb|AAB62584.1| chalcone synthase-A [Ipomoea purpurea]
 gb|AAB62585.1| chalcone synthase-A [Ipomoea purpurea]
 gb|AAB62586.1| chalcone synthase-A [Ipomoea purpurea]
Length=396

 Score =   785 bits (2027),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 376/390 (96%), Positives = 386/390 (99%), Gaps = 0/390 (0%)
 Frame = +3

Query  99    VLTDTWSHRAKRLEGDAKILAIGTATPANWVDQTTYPDFYFRITNSQHLLEHKEKFRRIC  278
             VLTDTWSHRAKRLEGDAKILAIGTATPANWVDQTTYPDFYFRITNS+HLLEHKEKFRRIC
Sbjct  7     VLTDTWSHRAKRLEGDAKILAIGTATPANWVDQTTYPDFYFRITNSEHLLEHKEKFRRIC  66

Query  279   NKSKIMKRHLVLTEELLKKHPNLCTYNEASLNTRQDILVSGVPKLGKEAAMKAIKEWGRP  458
             NKSKIMKRHLV+TEELLKK+PNLCTYNEASLNTRQDILVS VPKLGK+AAMKAIKEWGRP
Sbjct  67    NKSKIMKRHLVITEELLKKNPNLCTYNEASLNTRQDILVSEVPKLGKDAAMKAIKEWGRP  126

Query  459   ISEITHLVFCTTSGVDMPGADFQLTKLLGLNSSVKRLMMYQQGCNAGAAMLRLAKDLAEN  638
             ISEITHLVFCTTSGVDMPGADFQLTKLLGLNSSVKRLMMYQQGCNAGAAMLRLAKDLAEN
Sbjct  127   ISEITHLVFCTTSGVDMPGADFQLTKLLGLNSSVKRLMMYQQGCNAGAAMLRLAKDLAEN  186

Query  639   NKGARVLVVCSEVMLSVFRGPSLQQEDNLLAQCLFGDGSAAVIVGTEPRPGLETPLFELV  818
             NKG RVLVVCSEVMLSVFRGPSLQQEDNLLAQCLFGDG+AAVIVGTEPRPGLETPLFELV
Sbjct  187   NKGGRVLVVCSEVMLSVFRGPSLQQEDNLLAQCLFGDGAAAVIVGTEPRPGLETPLFELV  246

Query  819   SSAQTIIPDTDSHLKLQLREMGLTFHCSKAVPSLITQNVEDCLVKAFEPFGISDWNSIFW  998
             S+AQT IPDTDS+LKLQLREMGLTFHCSKAVPSLITQNVEDCLVKAFEPFGISDWNSIFW
Sbjct  247   SAAQTTIPDTDSYLKLQLREMGLTFHCSKAVPSLITQNVEDCLVKAFEPFGISDWNSIFW  306

Query  999   ILHPGGNAILDGVEEKLGLDPEKLRASRDVLSQYGNLTSACVLFILDEVRKKSKKQQQMT  1178
             ILHPGGNAILDGVEEKLGL+PEKLRASRDVLSQYGNLTSACVLFILDEVRKKSKK +QMT
Sbjct  307   ILHPGGNAILDGVEEKLGLEPEKLRASRDVLSQYGNLTSACVLFILDEVRKKSKKDEQMT  366

Query  1179  TGEGLEWGVLFGFGPGLTIDTVVIRSVPIN  1268
             TGEGLEWGV+FGFGPGLTIDTVVIRSVPIN
Sbjct  367   TGEGLEWGVVFGFGPGLTIDTVVIRSVPIN  396



>gb|AAB62583.1| chalcone synthase-A [Ipomoea purpurea]
Length=396

 Score =   782 bits (2020),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 375/390 (96%), Positives = 385/390 (99%), Gaps = 0/390 (0%)
 Frame = +3

Query  99    VLTDTWSHRAKRLEGDAKILAIGTATPANWVDQTTYPDFYFRITNSQHLLEHKEKFRRIC  278
             VLTDTWSHRAKRLEGDAKILAIGTATPANWVDQTTYPDFYFRITNS+HLLEHKEKFRRIC
Sbjct  7     VLTDTWSHRAKRLEGDAKILAIGTATPANWVDQTTYPDFYFRITNSEHLLEHKEKFRRIC  66

Query  279   NKSKIMKRHLVLTEELLKKHPNLCTYNEASLNTRQDILVSGVPKLGKEAAMKAIKEWGRP  458
             NKSKIMKRHLV+TEELLKK+PNLCTYNEASLNTRQDILVS VPKLGK+AAMKAIKEWGRP
Sbjct  67    NKSKIMKRHLVITEELLKKNPNLCTYNEASLNTRQDILVSEVPKLGKDAAMKAIKEWGRP  126

Query  459   ISEITHLVFCTTSGVDMPGADFQLTKLLGLNSSVKRLMMYQQGCNAGAAMLRLAKDLAEN  638
             ISEITHLVFCTTSGVDMPGADFQLTKLLGLNSSVKRLMMYQQGCNAGAAMLRLAKDLAEN
Sbjct  127   ISEITHLVFCTTSGVDMPGADFQLTKLLGLNSSVKRLMMYQQGCNAGAAMLRLAKDLAEN  186

Query  639   NKGARVLVVCSEVMLSVFRGPSLQQEDNLLAQCLFGDGSAAVIVGTEPRPGLETPLFELV  818
             NKG RVLVVCSEVMLSVFRGPSLQQEDNLLAQCLFGDG+ AVIVGTEPRPGLETPLFELV
Sbjct  187   NKGGRVLVVCSEVMLSVFRGPSLQQEDNLLAQCLFGDGAGAVIVGTEPRPGLETPLFELV  246

Query  819   SSAQTIIPDTDSHLKLQLREMGLTFHCSKAVPSLITQNVEDCLVKAFEPFGISDWNSIFW  998
             S+AQT IPDTDS+LKLQLREMGLTFHCSKAVPSLITQNVEDCLVKAFEPFGISDWNSIFW
Sbjct  247   SAAQTTIPDTDSYLKLQLREMGLTFHCSKAVPSLITQNVEDCLVKAFEPFGISDWNSIFW  306

Query  999   ILHPGGNAILDGVEEKLGLDPEKLRASRDVLSQYGNLTSACVLFILDEVRKKSKKQQQMT  1178
             ILHPGGNAILDGVEEKLGL+PEKLRASRDVLSQYGNLTSACVLFILDEVRKKSKK +QMT
Sbjct  307   ILHPGGNAILDGVEEKLGLEPEKLRASRDVLSQYGNLTSACVLFILDEVRKKSKKDEQMT  366

Query  1179  TGEGLEWGVLFGFGPGLTIDTVVIRSVPIN  1268
             TGEGLEWGV+FGFGPGLTIDTVVIRSVPIN
Sbjct  367   TGEGLEWGVVFGFGPGLTIDTVVIRSVPIN  396



>gb|AAB62587.1| chalcone synthase-A [Ipomoea purpurea]
Length=396

 Score =   779 bits (2012),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 374/390 (96%), Positives = 384/390 (98%), Gaps = 0/390 (0%)
 Frame = +3

Query  99    VLTDTWSHRAKRLEGDAKILAIGTATPANWVDQTTYPDFYFRITNSQHLLEHKEKFRRIC  278
             VLTDTWSHRAKRLEGDAKILAIGTATPANWVDQTTYPDFYFRITNS+HL EHKEKF+RIC
Sbjct  7     VLTDTWSHRAKRLEGDAKILAIGTATPANWVDQTTYPDFYFRITNSEHLHEHKEKFKRIC  66

Query  279   NKSKIMKRHLVLTEELLKKHPNLCTYNEASLNTRQDILVSGVPKLGKEAAMKAIKEWGRP  458
             NKSKIMKRHLV+TEELLKK+PNLCTYNEASLNTRQDILVS VPKLGKEAAMKAIKEWGRP
Sbjct  67    NKSKIMKRHLVITEELLKKNPNLCTYNEASLNTRQDILVSEVPKLGKEAAMKAIKEWGRP  126

Query  459   ISEITHLVFCTTSGVDMPGADFQLTKLLGLNSSVKRLMMYQQGCNAGAAMLRLAKDLAEN  638
             ISEITHLVFCTTSGVDMPGADFQLTKLLGLNSSVKRLMMYQQGCNAGAAMLRLAKDLAEN
Sbjct  127   ISEITHLVFCTTSGVDMPGADFQLTKLLGLNSSVKRLMMYQQGCNAGAAMLRLAKDLAEN  186

Query  639   NKGARVLVVCSEVMLSVFRGPSLQQEDNLLAQCLFGDGSAAVIVGTEPRPGLETPLFELV  818
             NKG RVLVVCSEVMLSVFRGPSLQQEDNLLAQCLFGDGSAAVIVGTEPRPGLETPLFELV
Sbjct  187   NKGGRVLVVCSEVMLSVFRGPSLQQEDNLLAQCLFGDGSAAVIVGTEPRPGLETPLFELV  246

Query  819   SSAQTIIPDTDSHLKLQLREMGLTFHCSKAVPSLITQNVEDCLVKAFEPFGISDWNSIFW  998
             S+AQT IPDTDS+LKLQLREMGLTFHCSKAVPSLITQNVEDCLVKAFEPFGISDWNSIFW
Sbjct  247   SAAQTTIPDTDSYLKLQLREMGLTFHCSKAVPSLITQNVEDCLVKAFEPFGISDWNSIFW  306

Query  999   ILHPGGNAILDGVEEKLGLDPEKLRASRDVLSQYGNLTSACVLFILDEVRKKSKKQQQMT  1178
             ILHPGGNAILDGVEEKLGL+ EKLRASRDVLSQYGNLTSACVLFILDE+RKKSKK +QMT
Sbjct  307   ILHPGGNAILDGVEEKLGLEAEKLRASRDVLSQYGNLTSACVLFILDEMRKKSKKDEQMT  366

Query  1179  TGEGLEWGVLFGFGPGLTIDTVVIRSVPIN  1268
             TGEGLEWGV+FGFGPGLTIDTVVIRSVPIN
Sbjct  367   TGEGLEWGVVFGFGPGLTIDTVVIRSVPIN  396



>sp|P48398.1|CHSB_IPOPU RecName: Full=Chalcone synthase B; AltName: Full=Naringenin-chalcone 
synthase B; Short=CHS-B [Ipomoea purpurea]
 gb|AAC49030.1| chalcone synthase [Ipomoea purpurea]
Length=396

 Score =   743 bits (1917),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 348/390 (89%), Positives = 376/390 (96%), Gaps = 0/390 (0%)
 Frame = +3

Query  99    VLTDTWSHRAKRLEGDAKILAIGTATPANWVDQTTYPDFYFRITNSQHLLEHKEKFRRIC  278
             VLTDTWS RAKRLEGDAKILAIGTATPA+WVDQTTYPDFYFRITNSQHLLEHKEKFRRIC
Sbjct  7     VLTDTWSRRAKRLEGDAKILAIGTATPASWVDQTTYPDFYFRITNSQHLLEHKEKFRRIC  66

Query  279   NKSKIMKRHLVLTEELLKKHPNLCTYNEASLNTRQDILVSGVPKLGKEAAMKAIKEWGRP  458
             NKSKI KRHLVLTEELLKK+PNLCTYNE SLNTRQDILVS VPKLGKEAAMKAIKEWGRP
Sbjct  67    NKSKIRKRHLVLTEELLKKNPNLCTYNETSLNTRQDILVSEVPKLGKEAAMKAIKEWGRP  126

Query  459   ISEITHLVFCTTSGVDMPGADFQLTKLLGLNSSVKRLMMYQQGCNAGAAMLRLAKDLAEN  638
             ISEITHLVFCTTSGVDMPGADFQLTKLLGLNSSVKRLMMYQQGCNAGAAMLRLAKDLAE+
Sbjct  127   ISEITHLVFCTTSGVDMPGADFQLTKLLGLNSSVKRLMMYQQGCNAGAAMLRLAKDLAES  186

Query  639   NKGARVLVVCSEVMLSVFRGPSLQQEDNLLAQCLFGDGSAAVIVGTEPRPGLETPLFELV  818
             NKG RVLVVC+E+ +++FRGPSL+Q+DNLLAQCLFGDG+AA+IV  +PRPGLETPLFELV
Sbjct  187   NKGGRVLVVCAEITINIFRGPSLEQDDNLLAQCLFGDGAAAMIVAADPRPGLETPLFELV  246

Query  819   SSAQTIIPDTDSHLKLQLREMGLTFHCSKAVPSLITQNVEDCLVKAFEPFGISDWNSIFW  998
             SSAQTI+P+TDSHLKL LREMGLTFHCSKAVPS++ +NVEDCLVKAFEP+GISDWNSIFW
Sbjct  247   SSAQTIVPNTDSHLKLHLREMGLTFHCSKAVPSVLAENVEDCLVKAFEPYGISDWNSIFW  306

Query  999   ILHPGGNAILDGVEEKLGLDPEKLRASRDVLSQYGNLTSACVLFILDEVRKKSKKQQQMT  1178
             + HPGGNAI+D VEE+LGL PEKLRASRDVLS+YGNLTSACVLFILDE+RKKSKK +QMT
Sbjct  307   VFHPGGNAIVDRVEERLGLGPEKLRASRDVLSEYGNLTSACVLFILDEMRKKSKKDEQMT  366

Query  1179  TGEGLEWGVLFGFGPGLTIDTVVIRSVPIN  1268
             TGEGLEWGV+FGFGPGLTIDT++IRSVPIN
Sbjct  367   TGEGLEWGVVFGFGPGLTIDTIIIRSVPIN  396



>sp|P48400.1|CHSA_IPOPL RecName: Full=Chalcone synthase A; AltName: Full=Naringenin-chalcone 
synthase A; Short=CHS-A, partial [Ipomoea platensis]
 gb|AAA62497.1| chalcone synthase, partial [Ipomoea platensis]
Length=362

 Score =   694 bits (1792),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 336/358 (94%), Positives = 343/358 (96%), Gaps = 0/358 (0%)
 Frame = +3

Query  99    VLTDTWSHRAKRLEGDAKILAIGTATPANWVDQTTYPDFYFRITNSQHLLEHKEKFRRIC  278
             VL DTWS RAKR EG AKILA+GTATPANWVDQTTYPDFYFRITNS+HLLEHKEKFRRIC
Sbjct  5     VLPDTWSRRAKRFEGHAKILAVGTATPANWVDQTTYPDFYFRITNSEHLLEHKEKFRRIC  64

Query  279   NKSKIMKRHLVLTEELLKKHPNLCTYNEASLNTRQDILVSGVPKLGKEAAMKAIKEWGRP  458
             NKSKI KRHLVLTEELLKK+PNLCTYNE SLNTRQD LVS VPKLGKEAAMKAIKEWGRP
Sbjct  65    NKSKIRKRHLVLTEELLKKNPNLCTYNETSLNTRQDTLVSEVPKLGKEAAMKAIKEWGRP  124

Query  459   ISEITHLVFCTTSGVDMPGADFQLTKLLGLNSSVKRLMMYQQGCNAGAAMLRLAKDLAEN  638
             ISEITHLVFCTTSGVDMPGADFQLTKLLGLN SVKRLMMYQQGCNAGAAMLRLAKDLAEN
Sbjct  125   ISEITHLVFCTTSGVDMPGADFQLTKLLGLNISVKRLMMYQQGCNAGAAMLRLAKDLAEN  184

Query  639   NKGARVLVVCSEVMLSVFRGPSLQQEDNLLAQCLFGDGSAAVIVGTEPRPGLETPLFELV  818
             NKGARVLVVCSEV LSVFRGPSLQQEDNLLAQCLFGDGSAAVIVGT+PRPGLETPLFELV
Sbjct  185   NKGARVLVVCSEVTLSVFRGPSLQQEDNLLAQCLFGDGSAAVIVGTDPRPGLETPLFELV  244

Query  819   SSAQTIIPDTDSHLKLQLREMGLTFHCSKAVPSLITQNVEDCLVKAFEPFGISDWNSIFW  998
             SSAQTIIPDTDSHLKL L EMGLTFHCSKAVPSLITQNVEDCLVKAFEPFGISDWNSIFW
Sbjct  245   SSAQTIIPDTDSHLKLHLLEMGLTFHCSKAVPSLITQNVEDCLVKAFEPFGISDWNSIFW  304

Query  999   ILHPGGNAILDGVEEKLGLDPEKLRASRDVLSQYGNLTSACVLFILDEVRKKSKKQQQ  1172
             ILHPGGNAILD VEE+LGL PEKLRASRDVLS+YGNLTSACVLFILD VR+KSKKQQQ
Sbjct  305   ILHPGGNAILDRVEERLGLGPEKLRASRDVLSEYGNLTSACVLFILDLVRRKSKKQQQ  362



>sp|P48394.1|CHSB_IPOCO RecName: Full=Chalcone synthase B; AltName: Full=Naringenin-chalcone 
synthase B; Short=CHS-B, partial [Ipomoea cordatotriloba]
 gb|AAC49027.1| chalcone synthase, partial [Ipomoea cordatotriloba]
Length=363

 Score =   691 bits (1783),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 328/357 (92%), Positives = 345/357 (97%), Gaps = 0/357 (0%)
 Frame = +3

Query  99    VLTDTWSHRAKRLEGDAKILAIGTATPANWVDQTTYPDFYFRITNSQHLLEHKEKFRRIC  278
             VLTDTWS R KR EG AKILAIGTATPANWVDQTTYPDFYFRITNSQHLL+HKEKFRRIC
Sbjct  7     VLTDTWSRREKRFEGHAKILAIGTATPANWVDQTTYPDFYFRITNSQHLLDHKEKFRRIC  66

Query  279   NKSKIMKRHLVLTEELLKKHPNLCTYNEASLNTRQDILVSGVPKLGKEAAMKAIKEWGRP  458
             NKSKI KRH++LTEELLKK+PNLCTYN+ASLNTRQDILVS VPKLGKEAAMKAIKEWGRP
Sbjct  67    NKSKIRKRHMILTEELLKKNPNLCTYNDASLNTRQDILVSEVPKLGKEAAMKAIKEWGRP  126

Query  459   ISEITHLVFCTTSGVDMPGADFQLTKLLGLNSSVKRLMMYQQGCNAGAAMLRLAKDLAEN  638
             ISEITHLVFCTTSGVDMPGADFQLTKLLGLNSSVKRLMMYQQGCNAGAAMLRLAKD+AEN
Sbjct  127   ISEITHLVFCTTSGVDMPGADFQLTKLLGLNSSVKRLMMYQQGCNAGAAMLRLAKDVAEN  186

Query  639   NKGARVLVVCSEVMLSVFRGPSLQQEDNLLAQCLFGDGSAAVIVGTEPRPGLETPLFELV  818
             NKGARVLVVCSEVMLSVFRGPSLQQEDNLLAQCLFGDGSAA+IVGT+PRPGLETPLFEL+
Sbjct  187   NKGARVLVVCSEVMLSVFRGPSLQQEDNLLAQCLFGDGSAALIVGTDPRPGLETPLFELI  246

Query  819   SSAQTIIPDTDSHLKLQLREMGLTFHCSKAVPSLITQNVEDCLVKAFEPFGISDWNSIFW  998
             S+AQTIIP+TDSHLKL +REMGLTFHCSKAVP+ ITQNVEDCLVKAFEP+GISDWNSIFW
Sbjct  247   SAAQTIIPNTDSHLKLHVREMGLTFHCSKAVPTFITQNVEDCLVKAFEPYGISDWNSIFW  306

Query  999   ILHPGGNAILDGVEEKLGLDPEKLRASRDVLSQYGNLTSACVLFILDEVRKKSKKQQ  1169
             +LHPGGNAI+DGVEE LGL PEKLRASRDVLS YGNLTSACVLFILDEVRKKSKK +
Sbjct  307   VLHPGGNAIVDGVEETLGLAPEKLRASRDVLSGYGNLTSACVLFILDEVRKKSKKDE  363



>sp|P48402.1|CHSB_IPOTF RecName: Full=Chalcone synthase B; AltName: Full=Naringenin-chalcone 
synthase B; Short=CHS-B, partial [Ipomoea trifida]
 gb|AAC49033.1| chalcone synthase, partial [Ipomoea trifida]
Length=366

 Score =   691 bits (1783),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 329/360 (91%), Positives = 347/360 (96%), Gaps = 2/360 (1%)
 Frame = +3

Query  99    VLTDTWSHRAKR--LEGDAKILAIGTATPANWVDQTTYPDFYFRITNSQHLLEHKEKFRR  272
             +LTDTWS RAKR  +EG AKILAIGTATPANWVDQTTYPDFYFRITNSQHLLEHKEKFRR
Sbjct  7     MLTDTWSRRAKRFEIEGYAKILAIGTATPANWVDQTTYPDFYFRITNSQHLLEHKEKFRR  66

Query  273   ICNKSKIMKRHLVLTEELLKKHPNLCTYNEASLNTRQDILVSGVPKLGKEAAMKAIKEWG  452
             ICNKS I KRH+VLTEELLKK+PNLCTYN+ASLNTRQDILVS VPKLGKEAAMKAIK WG
Sbjct  67    ICNKSNIRKRHMVLTEELLKKNPNLCTYNDASLNTRQDILVSEVPKLGKEAAMKAIKVWG  126

Query  453   RPISEITHLVFCTTSGVDMPGADFQLTKLLGLNSSVKRLMMYQQGCNAGAAMLRLAKDLA  632
             RPISEITHLVFCTTSGVDMPGADFQLTKLLGLNSSVKRLMMYQQGCNAGAAMLRLAKDLA
Sbjct  127   RPISEITHLVFCTTSGVDMPGADFQLTKLLGLNSSVKRLMMYQQGCNAGAAMLRLAKDLA  186

Query  633   ENNKGARVLVVCSEVMLSVFRGPSLQQEDNLLAQCLFGDGSAAVIVGTEPRPGLETPLFE  812
             ENNKGARVLVVCSEVMLSVFRGPSLQQEDNLLAQCLFGDGSAA+I+GT+PRPGLETPLFE
Sbjct  187   ENNKGARVLVVCSEVMLSVFRGPSLQQEDNLLAQCLFGDGSAAIIIGTDPRPGLETPLFE  246

Query  813   LVSSAQTIIPDTDSHLKLQLREMGLTFHCSKAVPSLITQNVEDCLVKAFEPFGISDWNSI  992
             L+S+AQTIIPDTDSHLKL +REMGLTFHCSKAVP+ ITQNVEDCLVKAFEP+GISDWNSI
Sbjct  247   LISAAQTIIPDTDSHLKLHVREMGLTFHCSKAVPTFITQNVEDCLVKAFEPYGISDWNSI  306

Query  993   FWILHPGGNAILDGVEEKLGLDPEKLRASRDVLSQYGNLTSACVLFILDEVRKKSKKQQQ  1172
             FW+LHPGGNAI++GVEE LGL PEKLRASRDVLS+YGNLTSACVLFILDEVRKKSKK +Q
Sbjct  307   FWVLHPGGNAIVEGVEETLGLAPEKLRASRDVLSEYGNLTSACVLFILDEVRKKSKKDEQ  366



>sp|P48399.1|CHSC_IPOPU RecName: Full=Chalcone synthase C; AltName: Full=Naringenin-chalcone 
synthase C; Short=CHS-C, partial [Ipomoea purpurea]
 gb|AAC49031.1| chalcone synthase, partial [Ipomoea purpurea]
Length=352

 Score =   669 bits (1727),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 318/344 (92%), Positives = 332/344 (97%), Gaps = 0/344 (0%)
 Frame = +3

Query  99    VLTDTWSHRAKRLEGDAKILAIGTATPANWVDQTTYPDFYFRITNSQHLLEHKEKFRRIC  278
             +LTDTW+ R KR +G AKILAIGTA PANWVDQTTYPDFYFRITNS+HLLE+KEKFRRIC
Sbjct  7     ILTDTWTRREKRFDGHAKILAIGTAIPANWVDQTTYPDFYFRITNSEHLLEYKEKFRRIC  66

Query  279   NKSKIMKRHLVLTEELLKKHPNLCTYNEASLNTRQDILVSGVPKLGKEAAMKAIKEWGRP  458
             NKSKI KRHLV+TEELLKK+PNLCTYN+ASLNTRQDILVS VPKLGKEAAMKAIKEWGRP
Sbjct  67    NKSKIRKRHLVITEELLKKNPNLCTYNDASLNTRQDILVSEVPKLGKEAAMKAIKEWGRP  126

Query  459   ISEITHLVFCTTSGVDMPGADFQLTKLLGLNSSVKRLMMYQQGCNAGAAMLRLAKDLAEN  638
             ISEITHLVFCT+SGVDMPGADFQL KLLGL+SSV RLMMYQQGCNAGA MLRLAKDLAEN
Sbjct  127   ISEITHLVFCTSSGVDMPGADFQLAKLLGLSSSVNRLMMYQQGCNAGAVMLRLAKDLAEN  186

Query  639   NKGARVLVVCSEVMLSVFRGPSLQQEDNLLAQCLFGDGSAAVIVGTEPRPGLETPLFELV  818
             NKG RVLVVCSEVMLSVFRGPSLQQEDNLLAQCLFGDGSAAVIVGTEPRPGLETPLFELV
Sbjct  187   NKGGRVLVVCSEVMLSVFRGPSLQQEDNLLAQCLFGDGSAAVIVGTEPRPGLETPLFELV  246

Query  819   SSAQTIIPDTDSHLKLQLREMGLTFHCSKAVPSLITQNVEDCLVKAFEPFGISDWNSIFW  998
             S+AQT IPDTDS+LKLQLREMGLTFHCSKAVPSLITQN+EDCLVKAFEPFGISDWNSIFW
Sbjct  247   SAAQTTIPDTDSYLKLQLREMGLTFHCSKAVPSLITQNIEDCLVKAFEPFGISDWNSIFW  306

Query  999   ILHPGGNAILDGVEEKLGLDPEKLRASRDVLSQYGNLTSACVLF  1130
             ILHPGGNAILDGVEEKLGL+PEKLRASRDVLSQYGNLTSACVLF
Sbjct  307   ILHPGGNAILDGVEEKLGLEPEKLRASRDVLSQYGNLTSACVLF  350



>sp|P48396.1|CHSB_IPONI RecName: Full=Chalcone synthase B; AltName: Full=Naringenin-chalcone 
synthase B; Short=CHS-B, partial [Ipomoea nil]
 gb|AAC49029.1| chalcone synthase, partial [Ipomoea nil]
Length=363

 Score =   669 bits (1727),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 314/357 (88%), Positives = 340/357 (95%), Gaps = 0/357 (0%)
 Frame = +3

Query  99    VLTDTWSHRAKRLEGDAKILAIGTATPANWVDQTTYPDFYFRITNSQHLLEHKEKFRRIC  278
             VLTDTWS RAK+LEGDAKI AIGTATPANWVDQTTYPDFYFRITNSQHLLEHKEKFRRIC
Sbjct  7     VLTDTWSPRAKKLEGDAKIWAIGTATPANWVDQTTYPDFYFRITNSQHLLEHKEKFRRIC  66

Query  279   NKSKIMKRHLVLTEELLKKHPNLCTYNEASLNTRQDILVSGVPKLGKEAAMKAIKEWGRP  458
             NKSKI KRHLVLTEELLKK+PNLCTYNE SLNTRQDILV+ VPKLGKEAAMKAIKEWGRP
Sbjct  67    NKSKIRKRHLVLTEELLKKNPNLCTYNETSLNTRQDILVAEVPKLGKEAAMKAIKEWGRP  126

Query  459   ISEITHLVFCTTSGVDMPGADFQLTKLLGLNSSVKRLMMYQQGCNAGAAMLRLAKDLAEN  638
             ISEITHLVFCTTSGVDMPGADFQLTKLLGLNSSVKRLMMYQQGCNAGAAMLRLAKDLAE+
Sbjct  127   ISEITHLVFCTTSGVDMPGADFQLTKLLGLNSSVKRLMMYQQGCNAGAAMLRLAKDLAES  186

Query  639   NKGARVLVVCSEVMLSVFRGPSLQQEDNLLAQCLFGDGSAAVIVGTEPRPGLETPLFELV  818
             NKG RVLVVC+E+ +++FRGPSL+Q+DNLLAQCLFGDG+AA+IV  +PRPGLETPLFELV
Sbjct  187   NKGGRVLVVCAEITINIFRGPSLEQDDNLLAQCLFGDGAAAMIVAADPRPGLETPLFELV  246

Query  819   SSAQTIIPDTDSHLKLQLREMGLTFHCSKAVPSLITQNVEDCLVKAFEPFGISDWNSIFW  998
             SSAQTI+P+TDSHLKL LREMGLTFHCSKAVPS++ +NVEDCLVKAFEP+GISDWNSIFW
Sbjct  247   SSAQTIVPNTDSHLKLHLREMGLTFHCSKAVPSVLAENVEDCLVKAFEPYGISDWNSIFW  306

Query  999   ILHPGGNAILDGVEEKLGLDPEKLRASRDVLSQYGNLTSACVLFILDEVRKKSKKQQ  1169
             + HPGGNAI+D VEE+LGL PEK RASRDVLS+YGNLTSACVLF LDE+RKKSKK +
Sbjct  307   VFHPGGNAIVDRVEERLGLGPEKFRASRDVLSEYGNLTSACVLFTLDEMRKKSKKDE  363



>sp|P48404.1|CHSB_IPOTR RecName: Full=Chalcone synthase B; AltName: Full=Naringenin-chalcone 
synthase B; Short=CHS-B, partial [Ipomoea triloba]
 gb|AAC49035.1| chalcone synthase, partial [Ipomoea triloba]
Length=366

 Score =   660 bits (1704),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 311/360 (86%), Positives = 340/360 (94%), Gaps = 2/360 (1%)
 Frame = +3

Query  99    VLTDTWSHRAKR--LEGDAKILAIGTATPANWVDQTTYPDFYFRITNSQHLLEHKEKFRR  272
             VLTDTW  RAKR  +EG AKILAIGTATPANWVDQTTYPDFYFRITNSQHLLEHKEKFRR
Sbjct  7     VLTDTWGRRAKRFEIEGYAKILAIGTATPANWVDQTTYPDFYFRITNSQHLLEHKEKFRR  66

Query  273   ICNKSKIMKRHLVLTEELLKKHPNLCTYNEASLNTRQDILVSGVPKLGKEAAMKAIKEWG  452
             ICNKSKI KRHLVLTEELL+K+P+LCTYNE SLNTRQDILVS VPKLGKEAAMKAIKEWG
Sbjct  67    ICNKSKIRKRHLVLTEELLQKNPSLCTYNETSLNTRQDILVSEVPKLGKEAAMKAIKEWG  126

Query  453   RPISEITHLVFCTTSGVDMPGADFQLTKLLGLNSSVKRLMMYQQGCNAGAAMLRLAKDLA  632
             RPISEITHLVFCTTSGVDMPGADF+LTKLLGLNSSVKRLMMYQQGCNAGAAMLRLAKDLA
Sbjct  127   RPISEITHLVFCTTSGVDMPGADFRLTKLLGLNSSVKRLMMYQQGCNAGAAMLRLAKDLA  186

Query  633   ENNKGARVLVVCSEVMLSVFRGPSLQQEDNLLAQCLFGDGSAAVIVGTEPRPGLETPLFE  812
             E+NKG R+LVVCSE+ +++FRGPSL+Q+DNLLAQCLFGDGSAA+IVGT+PRP LETPLFE
Sbjct  187   ESNKGGRILVVCSEITINIFRGPSLEQDDNLLAQCLFGDGSAAMIVGTDPRPDLETPLFE  246

Query  813   LVSSAQTIIPDTDSHLKLQLREMGLTFHCSKAVPSLITQNVEDCLVKAFEPFGISDWNSI  992
             LVSSAQTI+P+TDSHLKL LREMGLTFHCS+AVPS++ +NVEDCLVKAFEP+GISDWNSI
Sbjct  247   LVSSAQTIVPNTDSHLKLTLREMGLTFHCSRAVPSVLAENVEDCLVKAFEPYGISDWNSI  306

Query  993   FWILHPGGNAILDGVEEKLGLDPEKLRASRDVLSQYGNLTSACVLFILDEVRKKSKKQQQ  1172
             FW+ HPGGNAI+D VEE+LGL  ++ RASRDVLS+YGNLTSACVLFILDEVR KSKK +Q
Sbjct  307   FWVFHPGGNAIVDRVEERLGLGAQRFRASRDVLSEYGNLTSACVLFILDEVRNKSKKNEQ  366



>sp|P48401.1|CHSA_IPOTF RecName: Full=Chalcone synthase A; AltName: Full=Naringenin-chalcone 
synthase A; Short=CHS-A, partial [Ipomoea trifida]
 gb|AAC49032.1| chalcone synthase, partial [Ipomoea trifida]
Length=362

 Score =   657 bits (1695),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 307/349 (88%), Positives = 334/349 (96%), Gaps = 0/349 (0%)
 Frame = +3

Query  126   AKRLEGDAKILAIGTATPANWVDQTTYPDFYFRITNSQHLLEHKEKFRRICNKSKIMKRH  305
             AKR EG AK+LAIGTATP NWVDQ TYPDFYFRITNS+HLLEHKEKFRRICNKSKI KRH
Sbjct  14    AKRFEGHAKLLAIGTATPTNWVDQATYPDFYFRITNSEHLLEHKEKFRRICNKSKIRKRH  73

Query  306   LVLTEELLKKHPNLCTYNEASLNTRQDILVSGVPKLGKEAAMKAIKEWGRPISEITHLVF  485
             LVLT+ELLKK+PNLCTYN+ASLNTRQDILVS VPKLGKEAAMKAIKEWGRPISEITHLVF
Sbjct  74    LVLTKELLKKNPNLCTYNDASLNTRQDILVSEVPKLGKEAAMKAIKEWGRPISEITHLVF  133

Query  486   CTTSGVDMPGADFQLTKLLGLNSSVKRLMMYQQGCNAGAAMLRLAKDLAENNKGARVLVV  665
             CTTSGVDMPGADFQLTKLLGLNSSVKRLMMYQQGCNAGAAMLRL KDLAENNKGARVLVV
Sbjct  134   CTTSGVDMPGADFQLTKLLGLNSSVKRLMMYQQGCNAGAAMLRLVKDLAENNKGARVLVV  193

Query  666   CSEVMLSVFRGPSLQQEDNLLAQCLFGDGSAAVIVGTEPRPGLETPLFELVSSAQTIIPD  845
             CSE+ +++FRGPSL+Q+DNLLAQCLFGDGSAA+IVG +PRPGLETPLFELVSSAQTI+P+
Sbjct  194   CSEITINIFRGPSLEQDDNLLAQCLFGDGSAAMIVGKDPRPGLETPLFELVSSAQTIVPN  253

Query  846   TDSHLKLQLREMGLTFHCSKAVPSLITQNVEDCLVKAFEPFGISDWNSIFWILHPGGNAI  1025
             TDSHLKL LREMGLTFHCS+AVPS++ +NVEDCLVKAFEP+GISDWNSIFW+ HPGGNAI
Sbjct  254   TDSHLKLHLREMGLTFHCSRAVPSVLAENVEDCLVKAFEPYGISDWNSIFWVFHPGGNAI  313

Query  1026  LDGVEEKLGLDPEKLRASRDVLSQYGNLTSACVLFILDEVRKKSKKQQQ  1172
             +D VEE+LGL PE+LRASRDVLS+YGNLTSACVLFILDE+RKKSKK +Q
Sbjct  314   VDRVEERLGLGPERLRASRDVLSEYGNLTSACVLFILDEMRKKSKKDEQ  362



>sp|P48403.1|CHSA_IPOTR RecName: Full=Chalcone synthase A; AltName: Full=Naringenin-chalcone 
synthase A; Short=CHS-A, partial [Ipomoea triloba]
 gb|AAC49034.1| chalcone synthase, partial [Ipomoea triloba]
Length=362

 Score =   649 bits (1675),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 305/349 (87%), Positives = 330/349 (95%), Gaps = 0/349 (0%)
 Frame = +3

Query  126   AKRLEGDAKILAIGTATPANWVDQTTYPDFYFRITNSQHLLEHKEKFRRICNKSKIMKRH  305
             AKR EG AK+LAIGTATP NWVDQ TYPDFYFRITNS+ LLEHKEKFRRICNKSKI  RH
Sbjct  14    AKRFEGHAKLLAIGTATPTNWVDQATYPDFYFRITNSERLLEHKEKFRRICNKSKIRFRH  73

Query  306   LVLTEELLKKHPNLCTYNEASLNTRQDILVSGVPKLGKEAAMKAIKEWGRPISEITHLVF  485
             LVLTEELLKK PNLCTYN+ASLNTRQDILVS VPKLGKEAAMKAIKEWGRPISEITHLVF
Sbjct  74    LVLTEELLKKSPNLCTYNDASLNTRQDILVSEVPKLGKEAAMKAIKEWGRPISEITHLVF  133

Query  486   CTTSGVDMPGADFQLTKLLGLNSSVKRLMMYQQGCNAGAAMLRLAKDLAENNKGARVLVV  665
             CTTSGVDMPGADFQLTKLLGLNSSVKRLMMYQQGCNAGAAMLRL KDLAENNKGARVLVV
Sbjct  134   CTTSGVDMPGADFQLTKLLGLNSSVKRLMMYQQGCNAGAAMLRLVKDLAENNKGARVLVV  193

Query  666   CSEVMLSVFRGPSLQQEDNLLAQCLFGDGSAAVIVGTEPRPGLETPLFELVSSAQTIIPD  845
             CSE+ +++FRGPSL+Q+DNLLAQCLFGDGSAA+IVG +PRPGLETPLFELVSSAQTI+P+
Sbjct  194   CSEITINIFRGPSLEQDDNLLAQCLFGDGSAAMIVGKDPRPGLETPLFELVSSAQTIVPN  253

Query  846   TDSHLKLQLREMGLTFHCSKAVPSLITQNVEDCLVKAFEPFGISDWNSIFWILHPGGNAI  1025
             TDSHLKL LREMGLTFHCS+AVPS++ +NVEDCLVKAFEP+GISDWNSIFW+ HPGG AI
Sbjct  254   TDSHLKLTLREMGLTFHCSRAVPSVLAENVEDCLVKAFEPYGISDWNSIFWVFHPGGYAI  313

Query  1026  LDGVEEKLGLDPEKLRASRDVLSQYGNLTSACVLFILDEVRKKSKKQQQ  1172
             +D VEE+LGL PE+LRASRDVLS+YGNLTSACVLFILDE+RKKSKK +Q
Sbjct  314   VDRVEERLGLGPERLRASRDVLSEYGNLTSACVLFILDEMRKKSKKDEQ  362



>sp|P48395.1|CHSA_IPONI RecName: Full=Chalcone synthase A; AltName: Full=Naringenin-chalcone 
synthase A; Short=CHS-A, partial [Ipomoea nil]
 gb|AAC49028.1| chalcone synthase, partial [Ipomoea nil]
Length=344

 Score =   648 bits (1672),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 311/341 (91%), Positives = 325/341 (95%), Gaps = 0/341 (0%)
 Frame = +3

Query  99    VLTDTWSHRAKRLEGDAKILAIGTATPANWVDQTTYPDFYFRITNSQHLLEHKEKFRRIC  278
             +LT+TW+ R KR+EG AKILAIGTA PANWVDQTTYPDFYFRITNS+HLLEHKEKFRRIC
Sbjct  4     ILTNTWTRREKRIEGHAKILAIGTAIPANWVDQTTYPDFYFRITNSEHLLEHKEKFRRIC  63

Query  279   NKSKIMKRHLVLTEELLKKHPNLCTYNEASLNTRQDILVSGVPKLGKEAAMKAIKEWGRP  458
             NKSKI KRHLV+TEELLKK+PNLCTYNEASLNTRQDILVS VPKLGKEAAMKAIKEWGRP
Sbjct  64    NKSKIRKRHLVITEELLKKNPNLCTYNEASLNTRQDILVSEVPKLGKEAAMKAIKEWGRP  123

Query  459   ISEITHLVFCTTSGVDMPGADFQLTKLLGLNSSVKRLMMYQQGCNAGAAMLRLAKDLAEN  638
             ISEITHLVFCT+SGVDMPGADFQL KLLGL+SSV RLMMYQQGCNAGAAMLRLAKDLAEN
Sbjct  124   ISEITHLVFCTSSGVDMPGADFQLAKLLGLSSSVNRLMMYQQGCNAGAAMLRLAKDLAEN  183

Query  639   NKGARVLVVCSEVMLSVFRGPSLQQEDNLLAQCLFGDGSAAVIVGTEPRPGLETPLFELV  818
             NKG RVLVVCSEVML+VFRGPSL+QED LLAQCLFGDGSAAVIVGTEPRPGLETPLFELV
Sbjct  184   NKGGRVLVVCSEVMLNVFRGPSLEQEDYLLAQCLFGDGSAAVIVGTEPRPGLETPLFELV  243

Query  819   SSAQTIIPDTDSHLKLQLREMGLTFHCSKAVPSLITQNVEDCLVKAFEPFGISDWNSIFW  998
             S+AQT IPDTDSHLKL LREMGLTFHCSKAVPSLITQNVED LVKAFEPFGISDWNSIFW
Sbjct  244   SAAQTTIPDTDSHLKLHLREMGLTFHCSKAVPSLITQNVEDYLVKAFEPFGISDWNSIFW  303

Query  999   ILHPGGNAILDGVEEKLGLDPEKLRASRDVLSQYGNLTSAC  1121
             ILHPGG AILD VEEKLGL+PEKLRASRDVLS+ GNLTSAC
Sbjct  304   ILHPGGIAILDRVEEKLGLEPEKLRASRDVLSESGNLTSAC  344



>sp|P48393.1|CHSA_IPOCO RecName: Full=Chalcone synthase A; AltName: Full=Naringenin-chalcone 
synthase A; Short=CHS-A, partial [Ipomoea cordatotriloba]
 gb|AAC49026.1| chalcone synthase, partial [Ipomoea cordatotriloba]
Length=361

 Score =   643 bits (1659),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 302/348 (87%), Positives = 329/348 (95%), Gaps = 0/348 (0%)
 Frame = +3

Query  126   AKRLEGDAKILAIGTATPANWVDQTTYPDFYFRITNSQHLLEHKEKFRRICNKSKIMKRH  305
             AKR EG AK+LAIGTATP NWVDQ TYPDFYFRITNS+HLLEHKEKFRRICNKSKI KRH
Sbjct  14    AKRFEGHAKLLAIGTATPTNWVDQATYPDFYFRITNSEHLLEHKEKFRRICNKSKIRKRH  73

Query  306   LVLTEELLKKHPNLCTYNEASLNTRQDILVSGVPKLGKEAAMKAIKEWGRPISEITHLVF  485
             LVLTEELLK++PNLCTYN+ASLNTRQDILVS VPKLGKEAAMKAIKEWGRPISEITHLVF
Sbjct  74    LVLTEELLKENPNLCTYNDASLNTRQDILVSEVPKLGKEAAMKAIKEWGRPISEITHLVF  133

Query  486   CTTSGVDMPGADFQLTKLLGLNSSVKRLMMYQQGCNAGAAMLRLAKDLAENNKGARVLVV  665
             CTTSGVDMPGADFQLTKLLGLNSSVKRLMMYQQGCNAGAAMLRL K LAENNKGARVLVV
Sbjct  134   CTTSGVDMPGADFQLTKLLGLNSSVKRLMMYQQGCNAGAAMLRLVKGLAENNKGARVLVV  193

Query  666   CSEVMLSVFRGPSLQQEDNLLAQCLFGDGSAAVIVGTEPRPGLETPLFELVSSAQTIIPD  845
             CS + +++FRGPSL+Q+DNLLAQCLFGDGSAA+I G +PRPGLETPLFELVSSAQTI+P+
Sbjct  194   CSGITINIFRGPSLEQDDNLLAQCLFGDGSAAMIDGKDPRPGLETPLFELVSSAQTIVPN  253

Query  846   TDSHLKLQLREMGLTFHCSKAVPSLITQNVEDCLVKAFEPFGISDWNSIFWILHPGGNAI  1025
             TDSHLKL LREMGLTFHCS+AVPS++ +NVEDCLVKAFEP+GISDWNSIFW+ HPGGNAI
Sbjct  254   TDSHLKLHLREMGLTFHCSRAVPSVLAENVEDCLVKAFEPYGISDWNSIFWVFHPGGNAI  313

Query  1026  LDGVEEKLGLDPEKLRASRDVLSQYGNLTSACVLFILDEVRKKSKKQQ  1169
             +D VEE+ GL PE+LRASRDVLS+YGNLTSACVLFILDE+RKKSKK +
Sbjct  314   VDRVEERSGLGPERLRASRDVLSEYGNLTSACVLFILDEMRKKSKKDE  361



>sp|P22924.1|CHSB_PETHY RecName: Full=Chalcone synthase B; AltName: Full=Naringenin-chalcone 
synthase B [Petunia x hybrida]
 emb|CAA32732.1| chalcone synthase [Petunia x hybrida]
Length=392

 Score =   580 bits (1494),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 272/380 (72%), Positives = 323/380 (85%), Gaps = 0/380 (0%)
 Frame = +3

Query  126   AKRLEGDAKILAIGTATPANWVDQTTYPDFYFRITNSQHLLEHKEKFRRICNKSKIMKRH  305
             A+R EG AKILAIGTATP +WVDQ +YPD+YFR+TNSQHL++ KEKFRRIC+K+ I KRH
Sbjct  13    AQRAEGPAKILAIGTATPFHWVDQNSYPDYYFRVTNSQHLVDLKEKFRRICSKTMIKKRH  72

Query  306   LVLTEELLKKHPNLCTYNEASLNTRQDILVSGVPKLGKEAAMKAIKEWGRPISEITHLVF  485
             + LTEELL+K+P LC++NE SL+ RQDILVS +PKLGKEAA+KAI EWG+P S ITHLVF
Sbjct  73    MFLTEELLRKNPTLCSHNEPSLDIRQDILVSEIPKLGKEAALKAIGEWGQPKSTITHLVF  132

Query  486   CTTSGVDMPGADFQLTKLLGLNSSVKRLMMYQQGCNAGAAMLRLAKDLAENNKGARVLVV  665
             CT SGVDMPGAD QL KLLGL+ SV+RLMMYQQGC AG  MLRLAKDLAENNKGARVLVV
Sbjct  133   CTRSGVDMPGADCQLVKLLGLSPSVQRLMMYQQGCFAGGTMLRLAKDLAENNKGARVLVV  192

Query  666   CSEVMLSVFRGPSLQQEDNLLAQCLFGDGSAAVIVGTEPRPGLETPLFELVSSAQTIIPD  845
             C+E     FRGPS    DNL+AQ LFGDG+AA+I+G++P+PGLE P+FE+ S+AQT +P+
Sbjct  193   CAESSAIGFRGPSEANVDNLIAQALFGDGAAALIIGSDPKPGLERPVFEIFSAAQTFVPN  252

Query  846   TDSHLKLQLREMGLTFHCSKAVPSLITQNVEDCLVKAFEPFGISDWNSIFWILHPGGNAI  1025
              D HL L LREMGLTFHC+K VP  I +NVE CL+KAFEP GISDWNS+FWILHPGGNAI
Sbjct  253   GDCHLALHLREMGLTFHCTKDVPPTIAKNVESCLIKAFEPLGISDWNSLFWILHPGGNAI  312

Query  1026  LDGVEEKLGLDPEKLRASRDVLSQYGNLTSACVLFILDEVRKKSKKQQQMTTGEGLEWGV  1205
             +D VE  LGL PEKLRA+R++LS+YGNL+SAC LFILDE+RKKS ++   T+G+GL+ GV
Sbjct  313   VDQVESTLGLGPEKLRATRNILSEYGNLSSACCLFILDEIRKKSAREGMRTSGDGLDLGV  372

Query  1206  LFGFGPGLTIDTVVIRSVPI  1265
             L  FGPGLTI+TVV+RSVPI
Sbjct  373   LLSFGPGLTIETVVLRSVPI  392



>ref|XP_006355706.1| PREDICTED: chalcone synthase B-like [Solanum tuberosum]
Length=392

 Score =   576 bits (1485),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 267/379 (70%), Positives = 323/379 (85%), Gaps = 0/379 (0%)
 Frame = +3

Query  129   KRLEGDAKILAIGTATPANWVDQTTYPDFYFRITNSQHLLEHKEKFRRICNKSKIMKRHL  308
             +R EG AKILAIGTATP +WVDQT+YPD+YF++TNS+HL++ KEKFRRIC+++ I KRH+
Sbjct  14    ERAEGPAKILAIGTATPFHWVDQTSYPDYYFKVTNSEHLVDLKEKFRRICSRTMIRKRHM  73

Query  309   VLTEELLKKHPNLCTYNEASLNTRQDILVSGVPKLGKEAAMKAIKEWGRPISEITHLVFC  488
             +LTEE+LKK+PNLC+YN  SL+ RQDILVS +PKLGKEAA+ AI EW +P S+ITHLVFC
Sbjct  74    LLTEEILKKNPNLCSYNGPSLDIRQDILVSEIPKLGKEAALMAIDEWAQPKSKITHLVFC  133

Query  489   TTSGVDMPGADFQLTKLLGLNSSVKRLMMYQQGCNAGAAMLRLAKDLAENNKGARVLVVC  668
             T SGVDMPGAD+QL KLLGL+ SV+RLMMYQQGC AG  MLRLAKDLAENNKGARVLVVC
Sbjct  134   TRSGVDMPGADYQLIKLLGLSPSVQRLMMYQQGCFAGGTMLRLAKDLAENNKGARVLVVC  193

Query  669   SEVMLSVFRGPSLQQEDNLLAQCLFGDGSAAVIVGTEPRPGLETPLFELVSSAQTIIPDT  848
             +E     FRGPS    DNL+AQ LFGDG+ AVI+G++P+ GLE P+FE+VS+AQT +P+ 
Sbjct  194   AESSAIGFRGPSEAHPDNLIAQALFGDGAVAVIIGSDPKMGLERPIFEIVSAAQTFVPNG  253

Query  849   DSHLKLQLREMGLTFHCSKAVPSLITQNVEDCLVKAFEPFGISDWNSIFWILHPGGNAIL  1028
             D HL L LREMGLTFHC++ VP  I +NVE CL+KAFEP GISDWNS+FWILHPGGNAI+
Sbjct  254   DCHLALHLREMGLTFHCTRDVPPTIAKNVESCLIKAFEPLGISDWNSVFWILHPGGNAIV  313

Query  1029  DGVEEKLGLDPEKLRASRDVLSQYGNLTSACVLFILDEVRKKSKKQQQMTTGEGLEWGVL  1208
             D VE  LGL+P+KLRA+R++L +YGNL+SACVLFILDE+RKKS +    TTG+GL+ GVL
Sbjct  314   DQVESTLGLEPDKLRATRNILREYGNLSSACVLFILDEIRKKSARYGLKTTGDGLDLGVL  373

Query  1209  FGFGPGLTIDTVVIRSVPI  1265
               FGPGLTI+TVV+RSVPI
Sbjct  374   LSFGPGLTIETVVLRSVPI  392



>ref|XP_004239898.1| PREDICTED: chalcone synthase B [Solanum lycopersicum]
Length=392

 Score =   567 bits (1462),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 261/379 (69%), Positives = 320/379 (84%), Gaps = 0/379 (0%)
 Frame = +3

Query  129   KRLEGDAKILAIGTATPANWVDQTTYPDFYFRITNSQHLLEHKEKFRRICNKSKIMKRHL  308
             +R EG AKILAIGTATP +WVDQT+YPD+YF++TN++HL++ KEKFRRIC+++ I KRH+
Sbjct  14    ERAEGPAKILAIGTATPFHWVDQTSYPDYYFKVTNNEHLVDLKEKFRRICSRTMIRKRHM  73

Query  309   VLTEELLKKHPNLCTYNEASLNTRQDILVSGVPKLGKEAAMKAIKEWGRPISEITHLVFC  488
             +LTEE+LKK+PNLC+YN  SL+ RQDILVS +PKLGKEAA++AI EW +P S ITHLVFC
Sbjct  74    LLTEEILKKNPNLCSYNGPSLDIRQDILVSEIPKLGKEAALRAIDEWAQPKSNITHLVFC  133

Query  489   TTSGVDMPGADFQLTKLLGLNSSVKRLMMYQQGCNAGAAMLRLAKDLAENNKGARVLVVC  668
             T SGVDMPGAD+QL  LLGL+ SV+R MMYQQGC AG  MLRLAKDLAENNKGARVLVVC
Sbjct  134   TRSGVDMPGADYQLINLLGLSPSVQRFMMYQQGCFAGGTMLRLAKDLAENNKGARVLVVC  193

Query  669   SEVMLSVFRGPSLQQEDNLLAQCLFGDGSAAVIVGTEPRPGLETPLFELVSSAQTIIPDT  848
             +E     FRGPS    DNL+AQ LFGDG+ AVI+G++P+ GLE P+FE+VS+ QT +P+ 
Sbjct  194   AESSAIGFRGPSEAYPDNLIAQALFGDGAVAVIIGSDPKMGLERPVFEIVSAGQTFVPNG  253

Query  849   DSHLKLQLREMGLTFHCSKAVPSLITQNVEDCLVKAFEPFGISDWNSIFWILHPGGNAIL  1028
             D HL L LREMGLTFHC++ VP  I +NVE CL+KAFEP GISDWNS+FWILHPGGNAI+
Sbjct  254   DCHLALHLREMGLTFHCTRDVPPAIAKNVESCLIKAFEPLGISDWNSVFWILHPGGNAIV  313

Query  1029  DGVEEKLGLDPEKLRASRDVLSQYGNLTSACVLFILDEVRKKSKKQQQMTTGEGLEWGVL  1208
             D VE  LGL+P++LRA+R++L +YGNL+SACVLFILDE+RKKS +    TTG+GL+ GVL
Sbjct  314   DQVENILGLEPDRLRATRNILREYGNLSSACVLFILDEIRKKSARDGLKTTGDGLDLGVL  373

Query  1209  FGFGPGLTIDTVVIRSVPI  1265
               FGPGLTI+TVV+RS+PI
Sbjct  374   LSFGPGLTIETVVLRSMPI  392



>gb|AIV99854.1| chalcone synthase [Iochroma calycinum]
 gb|AIY22758.1| chalcone synthase [Iochroma calycinum]
Length=389

 Score =   563 bits (1451),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 263/380 (69%), Positives = 319/380 (84%), Gaps = 0/380 (0%)
 Frame = +3

Query  120   HRAKRLEGDAKILAIGTATPANWVDQTTYPDFYFRITNSQHLLEHKEKFRRICNKSKIMK  299
              RA+R +G A I+AIGTATP+N VDQ+TYPD+YFRITNS+H+ E KEKF+R+C+KS I K
Sbjct  8     RRAQRAKGPATIMAIGTATPSNCVDQSTYPDYYFRITNSEHMTELKEKFKRMCDKSMIKK  67

Query  300   RHLVLTEELLKKHPNLCTYNEASLNTRQDILVSGVPKLGKEAAMKAIKEWGRPISEITHL  479
             R++ LTEE+LK++PN+C Y   SL+ RQDI+V  VPKLGKEAA KAIKEWG+P S+ITHL
Sbjct  68    RYMHLTEEILKENPNICEYMAPSLDARQDIVVVEVPKLGKEAAQKAIKEWGQPKSKITHL  127

Query  480   VFCTTSGVDMPGADFQLTKLLGLNSSVKRLMMYQQGCNAGAAMLRLAKDLAENNKGARVL  659
             VFCTTSGVDMPGAD+QLTKLLGL  SVKRLMMYQQGC AG  ++RLAKDLAENNKGARVL
Sbjct  128   VFCTTSGVDMPGADYQLTKLLGLRPSVKRLMMYQQGCFAGGTVIRLAKDLAENNKGARVL  187

Query  660   VVCSEVMLSVFRGPSLQQEDNLLAQCLFGDGSAAVIVGTEPRPGLETPLFELVSSAQTII  839
             VVCSE+    FRGPS    D+++ Q LFGDG+AA+I+G++P PG+E PLFELVS+AQT++
Sbjct  188   VVCSEITAVTFRGPSDTHLDSMVGQALFGDGAAAIIIGSDPLPGVERPLFELVSAAQTLL  247

Query  840   PDTDSHLKLQLREMGLTFHCSKAVPSLITQNVEDCLVKAFEPFGISDWNSIFWILHPGGN  1019
             PD++  +   LRE+GLTFH  K VP LI+QN+E  L++AF+P GISDWNS+FWI HPGG 
Sbjct  248   PDSEGAIDGHLREVGLTFHLLKDVPGLISQNIEKSLIEAFQPLGISDWNSVFWIAHPGGP  307

Query  1020  AILDGVEEKLGLDPEKLRASRDVLSQYGNLTSACVLFILDEVRKKSKKQQQMTTGEGLEW  1199
             AILD VE KLGL PEKLRA+R VLS YGN++SACVLFILDE+RK S K+   TTGEGL+W
Sbjct  308   AILDQVELKLGLKPEKLRATRQVLSDYGNMSSACVLFILDEIRKASAKEGLSTTGEGLDW  367

Query  1200  GVLFGFGPGLTIDTVVIRSV  1259
             GVLFGFGPGLT++TVV+ SV
Sbjct  368   GVLFGFGPGLTVETVVLHSV  387



>gb|AGW24283.1| chalcone synthase [Melastoma malabathricum]
Length=391

 Score =   563 bits (1451),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 264/380 (69%), Positives = 317/380 (83%), Gaps = 0/380 (0%)
 Frame = +3

Query  120   HRAKRLEGDAKILAIGTATPANWVDQTTYPDFYFRITNSQHLLEHKEKFRRICNKSKIMK  299
              R++R EG A ILAIGTATP N VDQ+TYPD+YFRITNS+H  E KEKF+R+C+KS I K
Sbjct  8     RRSQRAEGPATILAIGTATPPNCVDQSTYPDYYFRITNSEHKAELKEKFQRMCDKSMIKK  67

Query  300   RHLVLTEELLKKHPNLCTYNEASLNTRQDILVSGVPKLGKEAAMKAIKEWGRPISEITHL  479
             R++ LTEE+LK++P++C Y   SL+ RQD++V  VPKLGKEAA KAIKEWG+P S+ITHL
Sbjct  68    RYMYLTEEILKENPSVCAYEAPSLDARQDMVVVEVPKLGKEAAAKAIKEWGQPKSKITHL  127

Query  480   VFCTTSGVDMPGADFQLTKLLGLNSSVKRLMMYQQGCNAGAAMLRLAKDLAENNKGARVL  659
             VFCTTSGVDMPGAD+QLTKLLGL  SVKRLMMYQQGC AG  +LRLAKDLAENNKGARVL
Sbjct  128   VFCTTSGVDMPGADYQLTKLLGLRPSVKRLMMYQQGCFAGGTVLRLAKDLAENNKGARVL  187

Query  660   VVCSEVMLSVFRGPSLQQEDNLLAQCLFGDGSAAVIVGTEPRPGLETPLFELVSSAQTII  839
             VVCSE+    FRGPS    D+L+ Q LFGDG+ A+I+G++P PG+E P+FELVS+AQTI+
Sbjct  188   VVCSEITAVTFRGPSESHLDSLVGQALFGDGAGAIIIGSDPIPGVEKPMFELVSAAQTIL  247

Query  840   PDTDSHLKLQLREMGLTFHCSKAVPSLITQNVEDCLVKAFEPFGISDWNSIFWILHPGGN  1019
             PD+D  +   LRE+GLTFH  K VP LI++NVE  LV+AF+P GISDWNS+FWI HPGG 
Sbjct  248   PDSDGAIDGHLREVGLTFHLLKDVPGLISKNVEKSLVEAFQPLGISDWNSLFWIAHPGGP  307

Query  1020  AILDGVEEKLGLDPEKLRASRDVLSQYGNLTSACVLFILDEVRKKSKKQQQMTTGEGLEW  1199
             AILD VEEKLGL PEK+RA+R VLS YGN++SACVLFILDE+R+ SK+    TTGEGLEW
Sbjct  308   AILDQVEEKLGLKPEKMRATRQVLSDYGNMSSACVLFILDEMRRSSKQNGFKTTGEGLEW  367

Query  1200  GVLFGFGPGLTIDTVVIRSV  1259
             GVLFGFGPGLT++TVV+ S+
Sbjct  368   GVLFGFGPGLTVETVVLHSI  387



>gb|KDP20327.1| hypothetical protein JCGZ_06413 [Jatropha curcas]
 gb|AIC83903.1| chalcone synthase [Jatropha curcas]
Length=389

 Score =   562 bits (1449),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 266/379 (70%), Positives = 320/379 (84%), Gaps = 0/379 (0%)
 Frame = +3

Query  123   RAKRLEGDAKILAIGTATPANWVDQTTYPDFYFRITNSQHLLEHKEKFRRICNKSKIMKR  302
             +A+R +G A +LAIGTATP+N VDQ+TYPD+YFRITNS+H +E KEKF+R+C+KS I KR
Sbjct  9     KAQRAQGPATVLAIGTATPSNCVDQSTYPDYYFRITNSEHKVELKEKFKRMCDKSMIKKR  68

Query  303   HLVLTEELLKKHPNLCTYNEASLNTRQDILVSGVPKLGKEAAMKAIKEWGRPISEITHLV  482
             ++ LTE++LK++PN+C Y   SL+ RQDI+V  +PKLGKEAA+KAIKEWG+P S+ITHLV
Sbjct  69    YMHLTEDILKENPNICEYMAPSLDARQDIVVVEIPKLGKEAAVKAIKEWGQPKSKITHLV  128

Query  483   FCTTSGVDMPGADFQLTKLLGLNSSVKRLMMYQQGCNAGAAMLRLAKDLAENNKGARVLV  662
             FCTTSGVDMPGAD+QLTKLLGL  SVKRLMMYQQGC AG  +LRLAKDLAENNKGARVLV
Sbjct  129   FCTTSGVDMPGADYQLTKLLGLRPSVKRLMMYQQGCFAGGTVLRLAKDLAENNKGARVLV  188

Query  663   VCSEVMLSVFRGPSLQQEDNLLAQCLFGDGSAAVIVGTEPRPGLETPLFELVSSAQTIIP  842
             VCSE+    FRGPS    D+L+ Q LFGDG+AAVIVG++P P LE PLFELVS+AQTI+P
Sbjct  189   VCSEITAVTFRGPSDTHLDSLVGQALFGDGAAAVIVGSDPVPELEKPLFELVSAAQTILP  248

Query  843   DTDSHLKLQLREMGLTFHCSKAVPSLITQNVEDCLVKAFEPFGISDWNSIFWILHPGGNA  1022
             D+D  +   LRE+GLTFH  K VP LI++N+E  LV+AF+P GISDWNS+FWI HPGG A
Sbjct  249   DSDGAIDGHLREVGLTFHLLKDVPGLISKNIEKSLVEAFKPLGISDWNSLFWIAHPGGPA  308

Query  1023  ILDGVEEKLGLDPEKLRASRDVLSQYGNLTSACVLFILDEVRKKSKKQQQMTTGEGLEWG  1202
             ILD VE KLGL PEKL ++R +LS+YGN++SACVLFILDEVRKKS K+   TTGEGLEWG
Sbjct  309   ILDQVEAKLGLKPEKLASTRHILSEYGNMSSACVLFILDEVRKKSAKEGLKTTGEGLEWG  368

Query  1203  VLFGFGPGLTIDTVVIRSV  1259
             VLFGFGPGLT++TVV+ SV
Sbjct  369   VLFGFGPGLTVETVVLHSV  387



>sp|P22928.2|CHSJ_PETHY RecName: Full=Chalcone synthase J; AltName: Full=Naringenin-chalcone 
synthase J [Petunia x hybrida]
 emb|CAA32737.1| chalcone synthase [Petunia x hybrida]
Length=389

 Score =   562 bits (1448),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 266/379 (70%), Positives = 320/379 (84%), Gaps = 0/379 (0%)
 Frame = +3

Query  123   RAKRLEGDAKILAIGTATPANWVDQTTYPDFYFRITNSQHLLEHKEKFRRICNKSKIMKR  302
             RA+R EG A I+AIGTATP+N VDQ+TYPD+YFRITNS+H  E KEKF+R+C+KS I KR
Sbjct  9     RAQRAEGPATIMAIGTATPSNCVDQSTYPDYYFRITNSEHKTELKEKFQRMCDKSMIKKR  68

Query  303   HLVLTEELLKKHPNLCTYNEASLNTRQDILVSGVPKLGKEAAMKAIKEWGRPISEITHLV  482
             ++ LTEE+LK++PN+C Y   SL+ RQDI+V  VPKLGKEAA KAIKEWG+P S+ITHLV
Sbjct  69    YMHLTEEILKENPNICEYMAPSLDARQDIVVVEVPKLGKEAAQKAIKEWGQPKSKITHLV  128

Query  483   FCTTSGVDMPGADFQLTKLLGLNSSVKRLMMYQQGCNAGAAMLRLAKDLAENNKGARVLV  662
             FCTTSGVDMPGAD+QLTKLLGL SSVKRLMMYQQGC AG  +LRLAKDLAENNKGARVLV
Sbjct  129   FCTTSGVDMPGADYQLTKLLGLRSSVKRLMMYQQGCFAGGTVLRLAKDLAENNKGARVLV  188

Query  663   VCSEVMLSVFRGPSLQQEDNLLAQCLFGDGSAAVIVGTEPRPGLETPLFELVSSAQTIIP  842
             VCSE+    FRGP+    D+L+ Q LFGDG+AA+I+G++P PG+E PLFELVS++QT++P
Sbjct  189   VCSEITAVTFRGPNDTHLDSLVGQALFGDGAAAIIIGSDPLPGVERPLFELVSASQTLLP  248

Query  843   DTDSHLKLQLREMGLTFHCSKAVPSLITQNVEDCLVKAFEPFGISDWNSIFWILHPGGNA  1022
             D++  +   LRE+GLTFH  K VP LI++N++  LV+AF+P GISDWNSIFWI HPGG A
Sbjct  249   DSEGAIDGHLREVGLTFHLLKDVPGLISKNIQKSLVEAFQPLGISDWNSIFWIAHPGGPA  308

Query  1023  ILDGVEEKLGLDPEKLRASRDVLSQYGNLTSACVLFILDEVRKKSKKQQQMTTGEGLEWG  1202
             ILD VE KLGL PEKLRA+R VLS+YGN++SACVLFILDE+RK S K+   TTGEGLEWG
Sbjct  309   ILDQVELKLGLKPEKLRATRHVLSEYGNMSSACVLFILDEMRKASSKEGLGTTGEGLEWG  368

Query  1203  VLFGFGPGLTIDTVVIRSV  1259
             VLFGFGPGLT++TVV+ SV
Sbjct  369   VLFGFGPGLTVETVVLHSV  387



>gb|AIY22757.1| chalcone synthase [Iochroma cyaneum]
Length=389

 Score =   561 bits (1445),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 262/380 (69%), Positives = 319/380 (84%), Gaps = 0/380 (0%)
 Frame = +3

Query  120   HRAKRLEGDAKILAIGTATPANWVDQTTYPDFYFRITNSQHLLEHKEKFRRICNKSKIMK  299
              RA+R +G A I+AIGTATP+N VDQ+TYPD+YFRITNS+H+ E KEKF+R+C+KS I K
Sbjct  8     RRAQRAKGPATIMAIGTATPSNCVDQSTYPDYYFRITNSEHMTELKEKFKRMCDKSMIKK  67

Query  300   RHLVLTEELLKKHPNLCTYNEASLNTRQDILVSGVPKLGKEAAMKAIKEWGRPISEITHL  479
             R++ LTEE+LK++PN+C Y   SL+ RQDI+V  VPKLGKEAA KAIKEWG+P S+ITHL
Sbjct  68    RYMHLTEEILKENPNICEYMAPSLDARQDIVVVEVPKLGKEAAQKAIKEWGQPKSKITHL  127

Query  480   VFCTTSGVDMPGADFQLTKLLGLNSSVKRLMMYQQGCNAGAAMLRLAKDLAENNKGARVL  659
             VFCTTSGVDMPGAD+QLTKLLGL  SVKRLMMYQQGC AG  ++RLAKDLAENNKGARVL
Sbjct  128   VFCTTSGVDMPGADYQLTKLLGLRPSVKRLMMYQQGCFAGGTVIRLAKDLAENNKGARVL  187

Query  660   VVCSEVMLSVFRGPSLQQEDNLLAQCLFGDGSAAVIVGTEPRPGLETPLFELVSSAQTII  839
             VVCSE+    FRGPS    D+++ Q LFGDG+AA+I+G++P PG+E PLFELVS+AQT++
Sbjct  188   VVCSEITAVTFRGPSDTHLDSMVGQALFGDGAAAIIIGSDPLPGVERPLFELVSTAQTLL  247

Query  840   PDTDSHLKLQLREMGLTFHCSKAVPSLITQNVEDCLVKAFEPFGISDWNSIFWILHPGGN  1019
             PD++  +   LRE+GLTFH  K VP LI++N+E  L++AF+P GISDWNS+FWI HPGG 
Sbjct  248   PDSEGAIDGHLREVGLTFHLLKDVPGLISKNIEKSLIEAFQPLGISDWNSVFWIAHPGGP  307

Query  1020  AILDGVEEKLGLDPEKLRASRDVLSQYGNLTSACVLFILDEVRKKSKKQQQMTTGEGLEW  1199
             AILD VE KLGL PEKLRA+R VLS YGN++SACVLFILDE+RK S K+   TTGEGL+W
Sbjct  308   AILDQVELKLGLKPEKLRATRQVLSDYGNMSSACVLFILDEMRKASAKEGLSTTGEGLDW  367

Query  1200  GVLFGFGPGLTIDTVVIRSV  1259
             GVLFGFGPGLT++TVV+ SV
Sbjct  368   GVLFGFGPGLTVETVVLHSV  387



>gb|AIY22756.1| chalcone synthase [Iochroma cyaneum]
Length=389

 Score =   561 bits (1445),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 262/380 (69%), Positives = 319/380 (84%), Gaps = 0/380 (0%)
 Frame = +3

Query  120   HRAKRLEGDAKILAIGTATPANWVDQTTYPDFYFRITNSQHLLEHKEKFRRICNKSKIMK  299
              RA+R +G A I+AIGTATP+N VDQ+TYPD+YFRITNS+H+ E KEKF+R+C+KS I K
Sbjct  8     RRAQRAKGPATIMAIGTATPSNCVDQSTYPDYYFRITNSEHMTELKEKFKRMCDKSMIKK  67

Query  300   RHLVLTEELLKKHPNLCTYNEASLNTRQDILVSGVPKLGKEAAMKAIKEWGRPISEITHL  479
             R++ LTEE+LK++PN+C Y   SL+ RQDI+V  VPKLGKEAA KAIKEWG+P S+ITHL
Sbjct  68    RYMHLTEEILKENPNICEYMAPSLDARQDIVVVEVPKLGKEAAQKAIKEWGQPKSKITHL  127

Query  480   VFCTTSGVDMPGADFQLTKLLGLNSSVKRLMMYQQGCNAGAAMLRLAKDLAENNKGARVL  659
             VFCTTSGVDMPGAD+QLTKLLGL  SVKRLMMYQQGC AG  ++RLAKDLAENNKGARVL
Sbjct  128   VFCTTSGVDMPGADYQLTKLLGLRPSVKRLMMYQQGCFAGGTVIRLAKDLAENNKGARVL  187

Query  660   VVCSEVMLSVFRGPSLQQEDNLLAQCLFGDGSAAVIVGTEPRPGLETPLFELVSSAQTII  839
             VVCSE+    FRGPS    D+++ Q LFGDG+AA+I+G++P PG+E PLFELVS+AQT++
Sbjct  188   VVCSEITAVTFRGPSDTHLDSMVGQALFGDGAAAIIIGSDPLPGVERPLFELVSAAQTLL  247

Query  840   PDTDSHLKLQLREMGLTFHCSKAVPSLITQNVEDCLVKAFEPFGISDWNSIFWILHPGGN  1019
             PD++  +   LRE+GLTFH  K VP LI++N+E  L++AF+P GISDWNS+FWI HPGG 
Sbjct  248   PDSEGAIDGHLREVGLTFHLLKDVPGLISKNIEKSLIEAFQPLGISDWNSVFWIAHPGGP  307

Query  1020  AILDGVEEKLGLDPEKLRASRDVLSQYGNLTSACVLFILDEVRKKSKKQQQMTTGEGLEW  1199
             AILD VE KLGL PEKLRA+R VLS YGN++SACVLFILDE+RK S K+   TTGEGL+W
Sbjct  308   AILDQVELKLGLKPEKLRATRQVLSDYGNMSSACVLFILDEMRKASAKEGLSTTGEGLDW  367

Query  1200  GVLFGFGPGLTIDTVVIRSV  1259
             GVLFGFGPGLT++TVV+ SV
Sbjct  368   GVLFGFGPGLTVETVVLHSV  387



>emb|CAA64452.1| naringenin-chalcone synthase [Juglans nigra x Juglans regia]
Length=389

 Score =   560 bits (1443),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 265/380 (70%), Positives = 316/380 (83%), Gaps = 0/380 (0%)
 Frame = +3

Query  120   HRAKRLEGDAKILAIGTATPANWVDQTTYPDFYFRITNSQHLLEHKEKFRRICNKSKIMK  299
              RA+R EG A ++AIGTATP N VDQ+ YPD+YFRITNS+H  E KEKF+R+C KS I K
Sbjct  8     RRAQRAEGPATVMAIGTATPPNCVDQSAYPDYYFRITNSEHKTELKEKFKRMCEKSMIKK  67

Query  300   RHLVLTEELLKKHPNLCTYNEASLNTRQDILVSGVPKLGKEAAMKAIKEWGRPISEITHL  479
             R++ LTEE+LK++PN+C Y  +SL+ RQD++V  VPKLGKEAA KAIKEWG+P S+ITHL
Sbjct  68    RYMHLTEEILKENPNVCAYMASSLDARQDMVVVEVPKLGKEAATKAIKEWGQPKSKITHL  127

Query  480   VFCTTSGVDMPGADFQLTKLLGLNSSVKRLMMYQQGCNAGAAMLRLAKDLAENNKGARVL  659
             VFCTTSGVDMPGAD+QLTKLLGL  SVKRLMMYQQGC AG  +LRLAKDLAENNKGARVL
Sbjct  128   VFCTTSGVDMPGADYQLTKLLGLRPSVKRLMMYQQGCFAGGTVLRLAKDLAENNKGARVL  187

Query  660   VVCSEVMLSVFRGPSLQQEDNLLAQCLFGDGSAAVIVGTEPRPGLETPLFELVSSAQTII  839
             VVCSE+    FRGPS    D+L+ Q LFGDG+AA+IVG +P PG+E PLFELVS+AQTI+
Sbjct  188   VVCSEITAVTFRGPSDTHLDSLVGQALFGDGAAALIVGADPVPGVEKPLFELVSAAQTIL  247

Query  840   PDTDSHLKLQLREMGLTFHCSKAVPSLITQNVEDCLVKAFEPFGISDWNSIFWILHPGGN  1019
             PD+D  +   LRE+GLTFH  K VP LI++N+E  LV+AF+P GI+DWNS+FWI HPGG 
Sbjct  248   PDSDGAIDGHLREVGLTFHLLKDVPGLISKNIEKSLVEAFQPLGITDWNSLFWIAHPGGP  307

Query  1020  AILDGVEEKLGLDPEKLRASRDVLSQYGNLTSACVLFILDEVRKKSKKQQQMTTGEGLEW  1199
             AILD VE KL L PEKLRA+R VLS+YGN++SACVLFILDE+RKKS + +  TTGEGLEW
Sbjct  308   AILDQVESKLELKPEKLRATRHVLSEYGNMSSACVLFILDEMRKKSAEDRLKTTGEGLEW  367

Query  1200  GVLFGFGPGLTIDTVVIRSV  1259
             GVLFGFGPGLT++TVV+ SV
Sbjct  368   GVLFGFGPGLTVETVVLHSV  387



>ref|XP_009774927.1| PREDICTED: chalcone synthase 2 [Nicotiana sylvestris]
Length=389

 Score =   559 bits (1440),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 262/380 (69%), Positives = 319/380 (84%), Gaps = 0/380 (0%)
 Frame = +3

Query  120   HRAKRLEGDAKILAIGTATPANWVDQTTYPDFYFRITNSQHLLEHKEKFRRICNKSKIMK  299
              RA+R +G A I+AIGTATP+N VDQ+TYPD+YFR+TNS+H++E KEKF+R+C+KS I K
Sbjct  8     RRAQRAKGPATIMAIGTATPSNCVDQSTYPDYYFRVTNSEHMIELKEKFKRMCDKSMIKK  67

Query  300   RHLVLTEELLKKHPNLCTYNEASLNTRQDILVSGVPKLGKEAAMKAIKEWGRPISEITHL  479
             R++ LTEE+LK++PN+C Y   SL+ RQDI+V  +PKLGKEAA KAIKEWG+P S+ITHL
Sbjct  68    RYMHLTEEILKENPNICEYMAPSLDARQDIVVVEIPKLGKEAAQKAIKEWGQPKSKITHL  127

Query  480   VFCTTSGVDMPGADFQLTKLLGLNSSVKRLMMYQQGCNAGAAMLRLAKDLAENNKGARVL  659
             VFCTTSGVDMPGAD+QLTKLLGL  SVKRLMMYQQGC AG  +LRLAKDLAENNKGARVL
Sbjct  128   VFCTTSGVDMPGADYQLTKLLGLRPSVKRLMMYQQGCFAGGTVLRLAKDLAENNKGARVL  187

Query  660   VVCSEVMLSVFRGPSLQQEDNLLAQCLFGDGSAAVIVGTEPRPGLETPLFELVSSAQTII  839
             VVCSE+    FRGPS    D+++ Q LFGDG+AA+I+G++  PG+E PLFELVSSAQT++
Sbjct  188   VVCSEITAVTFRGPSDTHVDSMVGQALFGDGAAAIIIGSDLVPGVERPLFELVSSAQTLL  247

Query  840   PDTDSHLKLQLREMGLTFHCSKAVPSLITQNVEDCLVKAFEPFGISDWNSIFWILHPGGN  1019
             PD+D  +   LRE+GLTFH  K VP LI++N+E  L++AF+P G+SDWNSIFWI HPGG 
Sbjct  248   PDSDGAIDGHLREVGLTFHLLKDVPGLISKNIEKSLMEAFQPLGLSDWNSIFWIAHPGGP  307

Query  1020  AILDGVEEKLGLDPEKLRASRDVLSQYGNLTSACVLFILDEVRKKSKKQQQMTTGEGLEW  1199
             AILD VE KLGL PEKLRA+R VLS YGN++SACVLFILDE+RK S K+   TTGEGL+W
Sbjct  308   AILDQVELKLGLKPEKLRATRQVLSDYGNMSSACVLFILDEMRKASAKEGLGTTGEGLDW  367

Query  1200  GVLFGFGPGLTIDTVVIRSV  1259
             GVLFGFGPGLT++TVV+ SV
Sbjct  368   GVLFGFGPGLTVETVVLHSV  387



>ref|XP_002264019.1| PREDICTED: chalcone synthase 2 [Vitis vinifera]
 dbj|BAB84111.1| chalcone synthase [Vitis vinifera]
 emb|CAN75038.1| hypothetical protein VITISV_030544 [Vitis vinifera]
Length=389

 Score =   558 bits (1439),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 264/378 (70%), Positives = 316/378 (84%), Gaps = 0/378 (0%)
 Frame = +3

Query  126   AKRLEGDAKILAIGTATPANWVDQTTYPDFYFRITNSQHLLEHKEKFRRICNKSKIMKRH  305
             A+R EG A ++AIGTATP N VDQ+TYPD+YFRITNS+H  E KEKF+R+C+KS I KR+
Sbjct  10    AQRAEGPATVMAIGTATPPNCVDQSTYPDYYFRITNSEHKTELKEKFKRMCDKSMIKKRY  69

Query  306   LVLTEELLKKHPNLCTYNEASLNTRQDILVSGVPKLGKEAAMKAIKEWGRPISEITHLVF  485
             + LTEE+LK++PN+C Y  ASL+ RQD++V  VPKLGKEAA KAIKEWG+P S+ITHLVF
Sbjct  70    MHLTEEILKENPNVCEYMAASLDARQDMVVVEVPKLGKEAAAKAIKEWGQPKSKITHLVF  129

Query  486   CTTSGVDMPGADFQLTKLLGLNSSVKRLMMYQQGCNAGAAMLRLAKDLAENNKGARVLVV  665
             CTTSGVDMPGAD+QLTKLLGL  SVKR MMYQQGC AG  +LRLAKDLAENNKGARVLVV
Sbjct  130   CTTSGVDMPGADYQLTKLLGLRPSVKRFMMYQQGCFAGGTVLRLAKDLAENNKGARVLVV  189

Query  666   CSEVMLSVFRGPSLQQEDNLLAQCLFGDGSAAVIVGTEPRPGLETPLFELVSSAQTIIPD  845
             CSE+    FRGPS    D+L+ Q LFGDG+AAVIVG++P PG+E P+FELVS+AQTI+PD
Sbjct  190   CSEITAVTFRGPSDTHLDSLVGQALFGDGAAAVIVGSDPIPGVEKPMFELVSAAQTILPD  249

Query  846   TDSHLKLQLREMGLTFHCSKAVPSLITQNVEDCLVKAFEPFGISDWNSIFWILHPGGNAI  1025
             +D  +   LRE+GLTFH  K VP LI++N+E  L +AF+P GI DWNSIFWI HPGG AI
Sbjct  250   SDGAIDGHLREVGLTFHLLKDVPGLISKNIEKSLNEAFQPLGIKDWNSIFWIAHPGGPAI  309

Query  1026  LDGVEEKLGLDPEKLRASRDVLSQYGNLTSACVLFILDEVRKKSKKQQQMTTGEGLEWGV  1205
             LD VEEKL L PEKLR++R VLS+YGN++SACVLFILDE+R+KS ++   TTGEGLEWGV
Sbjct  310   LDQVEEKLALKPEKLRSTRHVLSEYGNMSSACVLFILDEMRRKSAEEGLKTTGEGLEWGV  369

Query  1206  LFGFGPGLTIDTVVIRSV  1259
             LFGFGPGLT++TVV+ SV
Sbjct  370   LFGFGPGLTVETVVLHSV  387



>gb|ADD74168.1| chalcone synthase [Nelumbo nucifera]
Length=389

 Score =   558 bits (1438),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 265/379 (70%), Positives = 315/379 (83%), Gaps = 0/379 (0%)
 Frame = +3

Query  123   RAKRLEGDAKILAIGTATPANWVDQTTYPDFYFRITNSQHLLEHKEKFRRICNKSKIMKR  302
             +A+R EG A ++AIGTATP N VDQ+TYPD+YFRITNS+H  E KEKF+R+C KS I KR
Sbjct  9     KAQRAEGPATVMAIGTATPPNCVDQSTYPDYYFRITNSEHKTELKEKFKRMCEKSMIKKR  68

Query  303   HLVLTEELLKKHPNLCTYNEASLNTRQDILVSGVPKLGKEAAMKAIKEWGRPISEITHLV  482
             ++ LTEE+LK++PN+C Y   SL+ RQD++V  VPKLGKEAA KAIKEWG+P S+ITHLV
Sbjct  69    YMHLTEEILKENPNVCAYMAPSLDARQDMVVVEVPKLGKEAATKAIKEWGQPKSKITHLV  128

Query  483   FCTTSGVDMPGADFQLTKLLGLNSSVKRLMMYQQGCNAGAAMLRLAKDLAENNKGARVLV  662
             FCTTSGVDMPGAD+QLTKLLGL  SVKRLMMYQQGC AG  +LRLAKDLAENN+GARVLV
Sbjct  129   FCTTSGVDMPGADYQLTKLLGLRPSVKRLMMYQQGCFAGGTVLRLAKDLAENNRGARVLV  188

Query  663   VCSEVMLSVFRGPSLQQEDNLLAQCLFGDGSAAVIVGTEPRPGLETPLFELVSSAQTIIP  842
             VCSE+    FRGPS    D+L+ Q LFGDG+AAVIVG +P PG+E PLFELVS+AQTI+P
Sbjct  189   VCSELTAVTFRGPSDTHLDSLVGQALFGDGAAAVIVGADPVPGVEKPLFELVSAAQTILP  248

Query  843   DTDSHLKLQLREMGLTFHCSKAVPSLITQNVEDCLVKAFEPFGISDWNSIFWILHPGGNA  1022
             D+   +   LRE+GLTFH  K VP LI++N+E  LV+AF+P GISDWNSIFWI HPGG A
Sbjct  249   DSHGAIDGHLREVGLTFHLLKDVPGLISKNIEKSLVEAFQPLGISDWNSIFWIAHPGGPA  308

Query  1023  ILDGVEEKLGLDPEKLRASRDVLSQYGNLTSACVLFILDEVRKKSKKQQQMTTGEGLEWG  1202
             ILD VEEKL L PEKLRA+R +LS+YGN++SACVLFILDE+RKKS +    TTGEGLEWG
Sbjct  309   ILDQVEEKLALKPEKLRATRHILSEYGNMSSACVLFILDEMRKKSIEDGLKTTGEGLEWG  368

Query  1203  VLFGFGPGLTIDTVVIRSV  1259
             VLFGFGPGLT++TVV+ S+
Sbjct  369   VLFGFGPGLTVETVVLHSI  387



>ref|XP_009616637.1| PREDICTED: chalcone synthase 2 [Nicotiana tomentosiformis]
Length=389

 Score =   558 bits (1438),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 261/380 (69%), Positives = 318/380 (84%), Gaps = 0/380 (0%)
 Frame = +3

Query  120   HRAKRLEGDAKILAIGTATPANWVDQTTYPDFYFRITNSQHLLEHKEKFRRICNKSKIMK  299
              RA+R +G A I+AIGTATP+N VDQ+TYPD+YFR+TNS+H+ E KEKF+R+C+KS I K
Sbjct  8     RRAQRAKGPATIMAIGTATPSNCVDQSTYPDYYFRVTNSEHMTELKEKFKRMCDKSMIKK  67

Query  300   RHLVLTEELLKKHPNLCTYNEASLNTRQDILVSGVPKLGKEAAMKAIKEWGRPISEITHL  479
             R++ LTEE+LK++PN+C Y   SL+ RQDI+V  +PKLGKEAA KAIKEWG+P S+ITHL
Sbjct  68    RYMHLTEEILKENPNICEYMAPSLDARQDIVVVEIPKLGKEAAQKAIKEWGQPKSKITHL  127

Query  480   VFCTTSGVDMPGADFQLTKLLGLNSSVKRLMMYQQGCNAGAAMLRLAKDLAENNKGARVL  659
             VFCTTSGVDMPGAD+QLTKLLGL  SVKRLMMYQQGC AG  +LRLAKDLAENNKGARVL
Sbjct  128   VFCTTSGVDMPGADYQLTKLLGLRPSVKRLMMYQQGCFAGGTVLRLAKDLAENNKGARVL  187

Query  660   VVCSEVMLSVFRGPSLQQEDNLLAQCLFGDGSAAVIVGTEPRPGLETPLFELVSSAQTII  839
             VVCSE+    FRGPS    D+++ Q LFGDG+AA+I+G++P PG+E PLFELVS+AQT++
Sbjct  188   VVCSEITAVTFRGPSDTHLDSMVGQALFGDGAAAIIIGSDPVPGVERPLFELVSAAQTLL  247

Query  840   PDTDSHLKLQLREMGLTFHCSKAVPSLITQNVEDCLVKAFEPFGISDWNSIFWILHPGGN  1019
             PD+D  +   LRE+GLTFH  K VP LI++N+E  L++AF+P G+SDWNSIFWI HPGG 
Sbjct  248   PDSDGAIDGHLREVGLTFHLLKDVPGLISKNIEKSLMEAFQPLGLSDWNSIFWIAHPGGP  307

Query  1020  AILDGVEEKLGLDPEKLRASRDVLSQYGNLTSACVLFILDEVRKKSKKQQQMTTGEGLEW  1199
             AILD VE  LGL PEKLRA+R VLS YGN++SACVLFILDE+RK S K+   TTGEGL+W
Sbjct  308   AILDQVELTLGLKPEKLRATRQVLSDYGNMSSACVLFILDEMRKTSAKEGFGTTGEGLDW  367

Query  1200  GVLFGFGPGLTIDTVVIRSV  1259
             GVLFGFGPGLT++TVV+ SV
Sbjct  368   GVLFGFGPGLTVETVVLHSV  387



>gb|AHK22740.1| chalcone synthase [Nicotiana tabacum]
Length=389

 Score =   558 bits (1438),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 262/380 (69%), Positives = 318/380 (84%), Gaps = 0/380 (0%)
 Frame = +3

Query  120   HRAKRLEGDAKILAIGTATPANWVDQTTYPDFYFRITNSQHLLEHKEKFRRICNKSKIMK  299
              RA+R +G A I+AIGTATP+N VDQ+TYPD+YFR+TNS+H+ E KEKF+R+C+KS I K
Sbjct  8     RRAQRAKGPATIMAIGTATPSNCVDQSTYPDYYFRVTNSEHMTELKEKFKRMCDKSMIKK  67

Query  300   RHLVLTEELLKKHPNLCTYNEASLNTRQDILVSGVPKLGKEAAMKAIKEWGRPISEITHL  479
             R++ LTEE+LK++PN+C Y   SL+ RQDI+V  +PKLGKEAA KAIKEWG+P S+ITHL
Sbjct  68    RYMHLTEEILKENPNICEYMAPSLDARQDIVVVEIPKLGKEAAQKAIKEWGQPKSKITHL  127

Query  480   VFCTTSGVDMPGADFQLTKLLGLNSSVKRLMMYQQGCNAGAAMLRLAKDLAENNKGARVL  659
             VFCTTSGVDMPGAD+QLTKLLGL  SVKRLMMYQQGC AG  +LRLAKDLAENNKGARVL
Sbjct  128   VFCTTSGVDMPGADYQLTKLLGLRPSVKRLMMYQQGCFAGGTVLRLAKDLAENNKGARVL  187

Query  660   VVCSEVMLSVFRGPSLQQEDNLLAQCLFGDGSAAVIVGTEPRPGLETPLFELVSSAQTII  839
             VVCSE+    FRGPS    D+++ Q LFGDG+AA+I+G++  PG+E PLFELVSSAQT++
Sbjct  188   VVCSEITAVTFRGPSDTHVDSMVGQALFGDGAAAIIIGSDLVPGVERPLFELVSSAQTLL  247

Query  840   PDTDSHLKLQLREMGLTFHCSKAVPSLITQNVEDCLVKAFEPFGISDWNSIFWILHPGGN  1019
             PD+D  +   LRE+GLTFH  K VP LI++N+E  L++AF+P G+SDWNSIFWI HPGG 
Sbjct  248   PDSDGAIDGHLREVGLTFHLLKDVPGLISKNIEKSLMEAFQPLGLSDWNSIFWIAHPGGP  307

Query  1020  AILDGVEEKLGLDPEKLRASRDVLSQYGNLTSACVLFILDEVRKKSKKQQQMTTGEGLEW  1199
             AILD VE KLGL PEKLRA+R VLS YGN++SACVLFILDE+RK S K+   TTGEGL+W
Sbjct  308   AILDQVELKLGLKPEKLRATRQVLSDYGNMSSACVLFILDEMRKASAKEGLGTTGEGLDW  367

Query  1200  GVLFGFGPGLTIDTVVIRSV  1259
             GVLFGFGPGLT++TVV+ SV
Sbjct  368   GVLFGFGPGLTVETVVLHSV  387



>ref|XP_006489796.1| PREDICTED: chalcone synthase 1-like [Citrus sinensis]
Length=390

 Score =   558 bits (1437),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 263/387 (68%), Positives = 319/387 (82%), Gaps = 0/387 (0%)
 Frame = +3

Query  99    VLTDTWSHRAKRLEGDAKILAIGTATPANWVDQTTYPDFYFRITNSQHLLEHKEKFRRIC  278
             +LT     +A+R EG A I+AIGTATP N VDQ+TYPD+YFRITNS+H+ + KEKF+R+C
Sbjct  1     MLTVDEVRKAQRAEGPATIMAIGTATPPNCVDQSTYPDYYFRITNSEHMTDLKEKFKRMC  60

Query  279   NKSKIMKRHLVLTEELLKKHPNLCTYNEASLNTRQDILVSGVPKLGKEAAMKAIKEWGRP  458
             +KS I KR++ LTEE+LK++PN+C Y   SL+TRQD++V  VP+LGKEAA KAIKEWG+P
Sbjct  61    DKSMIKKRYMYLTEEILKENPNVCAYMAPSLDTRQDMVVVEVPRLGKEAATKAIKEWGQP  120

Query  459   ISEITHLVFCTTSGVDMPGADFQLTKLLGLNSSVKRLMMYQQGCNAGAAMLRLAKDLAEN  638
              S+ITHLVFCTTSGVDMPGAD++LTKLLGL  SVKRLMMYQQGC AG  +LRLAKDLAEN
Sbjct  121   KSKITHLVFCTTSGVDMPGADYRLTKLLGLRPSVKRLMMYQQGCFAGGTVLRLAKDLAEN  180

Query  639   NKGARVLVVCSEVMLSVFRGPSLQQEDNLLAQCLFGDGSAAVIVGTEPRPGLETPLFELV  818
             NKGARVLVVCSE+    FRGPS    D+L+ Q LFGDG+AA+I+G +P P +E P+FELV
Sbjct  181   NKGARVLVVCSEITAVTFRGPSDTHLDSLVGQALFGDGAAAIIIGADPIPEIEKPMFELV  240

Query  819   SSAQTIIPDTDSHLKLQLREMGLTFHCSKAVPSLITQNVEDCLVKAFEPFGISDWNSIFW  998
             S+AQTI+PD+D  +   LRE+GLTFH  K VP LI++N++  L +AF+P GISDWNSIFW
Sbjct  241   STAQTILPDSDGSIDGHLREVGLTFHLLKDVPGLISKNIQKSLTEAFKPLGISDWNSIFW  300

Query  999   ILHPGGNAILDGVEEKLGLDPEKLRASRDVLSQYGNLTSACVLFILDEVRKKSKKQQQMT  1178
             I HPGG  ILD VEEKLGL PEKLRA+R VLS+YGN++SACVLFILDE+RKKS +    T
Sbjct  301   IAHPGGPTILDQVEEKLGLKPEKLRATRHVLSEYGNMSSACVLFILDEMRKKSAEDGLET  360

Query  1179  TGEGLEWGVLFGFGPGLTIDTVVIRSV  1259
              GEGLEWGVLFGFGPGLT++TVV+ SV
Sbjct  361   AGEGLEWGVLFGFGPGLTVETVVLHSV  387



>ref|XP_011091402.1| PREDICTED: chalcone synthase [Sesamum indicum]
Length=390

 Score =   557 bits (1436),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 263/382 (69%), Positives = 315/382 (82%), Gaps = 0/382 (0%)
 Frame = +3

Query  123   RAKRLEGDAKILAIGTATPANWVDQTTYPDFYFRITNSQHLLEHKEKFRRICNKSKIMKR  302
             RA+R EG A +LAIGTATP N VDQ+TYPD+YFRIT+S+H  E KEKF+R+C KS I KR
Sbjct  9     RAQRAEGPATVLAIGTATPTNCVDQSTYPDYYFRITDSEHKTELKEKFKRMCEKSMIKKR  68

Query  303   HLVLTEELLKKHPNLCTYNEASLNTRQDILVSGVPKLGKEAAMKAIKEWGRPISEITHLV  482
             ++ LTEE+LK++PN+C Y   SL+ RQDI+V  VPKLGKEAA KAIKEWG+P S+ITHLV
Sbjct  69    YMYLTEEILKENPNICAYMAPSLDARQDIVVVEVPKLGKEAAQKAIKEWGQPKSKITHLV  128

Query  483   FCTTSGVDMPGADFQLTKLLGLNSSVKRLMMYQQGCNAGAAMLRLAKDLAENNKGARVLV  662
             FCTTSGVDMPGAD+QLTKLLGL  SVKR MMYQQGC AG  +LR+AKDLAENN GARVLV
Sbjct  129   FCTTSGVDMPGADYQLTKLLGLRPSVKRFMMYQQGCFAGGTVLRMAKDLAENNAGARVLV  188

Query  663   VCSEVMLSVFRGPSLQQEDNLLAQCLFGDGSAAVIVGTEPRPGLETPLFELVSSAQTIIP  842
             VCSE+    FRGPS    D+L+ Q LFGDG+AAVIVG++P  G+E PLF++VS+AQT++P
Sbjct  189   VCSEITAVTFRGPSDSHLDSLVGQALFGDGAAAVIVGSDPVVGVERPLFQIVSAAQTLLP  248

Query  843   DTDSHLKLQLREMGLTFHCSKAVPSLITQNVEDCLVKAFEPFGISDWNSIFWILHPGGNA  1022
             D+   +   LRE+GLTFH  K VP LI++N+E  L +AFEP GISDWNSIFWI HPGG A
Sbjct  249   DSHGAIDGHLREVGLTFHLLKDVPGLISKNIEKSLKEAFEPLGISDWNSIFWIAHPGGPA  308

Query  1023  ILDGVEEKLGLDPEKLRASRDVLSQYGNLTSACVLFILDEVRKKSKKQQQMTTGEGLEWG  1202
             ILD VEEKL L PEKLR++R VLS+YGN++SACVLFILDE+RK S K+   +TGEGL+WG
Sbjct  309   ILDQVEEKLALKPEKLRSTRHVLSEYGNMSSACVLFILDEMRKSSAKEGMNSTGEGLDWG  368

Query  1203  VLFGFGPGLTIDTVVIRSVPIN  1268
             VLFGFGPGLT++TVV+ SVPIN
Sbjct  369   VLFGFGPGLTVETVVLHSVPIN  390



>gb|ABS52573.1| chalcone synthase [Gossypium hirsutum]
 gb|AEO96990.1| chalcone synthase [Gossypium hirsutum]
 gb|KHF97262.1| Chalcone synthase 1 [Gossypium arboreum]
 gb|KHG14487.1| Chalcone synthase 1 [Gossypium arboreum]
 gb|KHG14899.1| Chalcone synthase 1 [Gossypium arboreum]
Length=389

 Score =   557 bits (1436),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 262/380 (69%), Positives = 315/380 (83%), Gaps = 0/380 (0%)
 Frame = +3

Query  120   HRAKRLEGDAKILAIGTATPANWVDQTTYPDFYFRITNSQHLLEHKEKFRRICNKSKIMK  299
              +A+R +G A +LAIGT+TP N VDQ+TYPD+YFRITNS+H  E KEKF+R+C KS I K
Sbjct  8     RKAQRAQGPATVLAIGTSTPPNCVDQSTYPDYYFRITNSEHKTELKEKFKRMCEKSMIKK  67

Query  300   RHLVLTEELLKKHPNLCTYNEASLNTRQDILVSGVPKLGKEAAMKAIKEWGRPISEITHL  479
             R++ LTEE+LK++PN+C Y   SL+ RQD++V  VPKLGKEAA KAIKEWG+P S+ITHL
Sbjct  68    RYMYLTEEILKENPNVCEYMAPSLDARQDMVVVEVPKLGKEAATKAIKEWGQPKSKITHL  127

Query  480   VFCTTSGVDMPGADFQLTKLLGLNSSVKRLMMYQQGCNAGAAMLRLAKDLAENNKGARVL  659
             VFCTTSGVDMPGAD+QLTKLLGL  SVKRLMMYQQGC AG  +LR+AKDLAENNKGARVL
Sbjct  128   VFCTTSGVDMPGADYQLTKLLGLRPSVKRLMMYQQGCFAGGTVLRVAKDLAENNKGARVL  187

Query  660   VVCSEVMLSVFRGPSLQQEDNLLAQCLFGDGSAAVIVGTEPRPGLETPLFELVSSAQTII  839
             VVCSE+    FRGPS    D+L+ Q LFGDG+AAVI+G +P P +E P+FELVS+AQTI+
Sbjct  188   VVCSEITAVTFRGPSDTHLDSLVGQALFGDGAAAVIIGADPVPEIEKPMFELVSAAQTIL  247

Query  840   PDTDSHLKLQLREMGLTFHCSKAVPSLITQNVEDCLVKAFEPFGISDWNSIFWILHPGGN  1019
             PD+D  +   LRE+GLTFH  K VP LI++N+E  LV+AF+P GISDWNS+FWI HPGG 
Sbjct  248   PDSDGAIDGHLREVGLTFHLLKDVPGLISKNIEKSLVEAFQPLGISDWNSLFWIAHPGGP  307

Query  1020  AILDGVEEKLGLDPEKLRASRDVLSQYGNLTSACVLFILDEVRKKSKKQQQMTTGEGLEW  1199
             AILD VE KL L PEKLRA+R VLS+YGN++SACVLFILDE+RKKS++    TTGEGLEW
Sbjct  308   AILDQVEAKLALKPEKLRATRHVLSEYGNMSSACVLFILDEMRKKSREDGLQTTGEGLEW  367

Query  1200  GVLFGFGPGLTIDTVVIRSV  1259
             GVLFGFGPGLT++TVV+ SV
Sbjct  368   GVLFGFGPGLTVETVVLHSV  387



>gb|AEK80412.1| type III polyketide synthase [Acer maximowiczianum]
Length=390

 Score =   557 bits (1436),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 261/380 (69%), Positives = 316/380 (83%), Gaps = 0/380 (0%)
 Frame = +3

Query  120   HRAKRLEGDAKILAIGTATPANWVDQTTYPDFYFRITNSQHLLEHKEKFRRICNKSKIMK  299
              +A+R +G A ILAIGTATP N VDQ+ YPD+YFRITNS+H  E KEKF+R+C+KS I K
Sbjct  8     RKAQRAQGPATILAIGTATPPNCVDQSEYPDYYFRITNSEHKTELKEKFKRMCDKSMIKK  67

Query  300   RHLVLTEELLKKHPNLCTYNEASLNTRQDILVSGVPKLGKEAAMKAIKEWGRPISEITHL  479
             R++ LTEE+LK++PN+C Y   SL+ RQD++V  +PKLGKEAA KAIKEWG+P S+ITHL
Sbjct  68    RYMYLTEEILKENPNVCAYEAPSLDARQDMVVVEIPKLGKEAATKAIKEWGQPKSKITHL  127

Query  480   VFCTTSGVDMPGADFQLTKLLGLNSSVKRLMMYQQGCNAGAAMLRLAKDLAENNKGARVL  659
             VFCTTSGVDMPGAD+QLTKLLGL  SVKRLMMYQQGC AG  +LRLAKDLAENN GARVL
Sbjct  128   VFCTTSGVDMPGADYQLTKLLGLRPSVKRLMMYQQGCFAGGTVLRLAKDLAENNIGARVL  187

Query  660   VVCSEVMLSVFRGPSLQQEDNLLAQCLFGDGSAAVIVGTEPRPGLETPLFELVSSAQTII  839
             VVCSE+    FRGPS    D+L+ Q LFGDG+AA+I+G++P PG+E P++ELVS+AQTI+
Sbjct  188   VVCSEITAVTFRGPSDTHLDSLVGQALFGDGAAAIIIGSDPLPGIEKPMYELVSAAQTIL  247

Query  840   PDTDSHLKLQLREMGLTFHCSKAVPSLITQNVEDCLVKAFEPFGISDWNSIFWILHPGGN  1019
             PD+D  +   LRE+GLTFH  K VP LI++N+E  LV+AF+P GISDWNSIFWI HPGG 
Sbjct  248   PDSDGAIDGHLREVGLTFHLLKDVPGLISKNIEKSLVEAFKPLGISDWNSIFWIAHPGGP  307

Query  1020  AILDGVEEKLGLDPEKLRASRDVLSQYGNLTSACVLFILDEVRKKSKKQQQMTTGEGLEW  1199
             AILD VE KLGL PEK+RA+R VLS++GN++SACVLFILDE+RKKS +    TTGEGLEW
Sbjct  308   AILDQVEAKLGLKPEKMRATRHVLSEFGNMSSACVLFILDEMRKKSAEDGLKTTGEGLEW  367

Query  1200  GVLFGFGPGLTIDTVVIRSV  1259
             GVLFGFGPGLT++TVV+ SV
Sbjct  368   GVLFGFGPGLTVETVVLHSV  387



>emb|CAC88858.1| chalcone synthase [Rhododendron simsii]
Length=389

 Score =   557 bits (1435),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 264/380 (69%), Positives = 316/380 (83%), Gaps = 0/380 (0%)
 Frame = +3

Query  120   HRAKRLEGDAKILAIGTATPANWVDQTTYPDFYFRITNSQHLLEHKEKFRRICNKSKIMK  299
              RA+R EG A ++AIGTATP+N VDQ+TYPDFYFRITNS+H  E KEKF+R+C+KS I K
Sbjct  8     RRAQRAEGPATVMAIGTATPSNCVDQSTYPDFYFRITNSEHKAELKEKFQRMCDKSMIKK  67

Query  300   RHLVLTEELLKKHPNLCTYNEASLNTRQDILVSGVPKLGKEAAMKAIKEWGRPISEITHL  479
             R++ LTEE+LK++P++C Y   SL+ RQD++V  VPKLGKEAA KAIKEWG+P S+ITHL
Sbjct  68    RYMYLTEEILKENPSVCEYMAPSLDARQDMVVVEVPKLGKEAATKAIKEWGQPKSKITHL  127

Query  480   VFCTTSGVDMPGADFQLTKLLGLNSSVKRLMMYQQGCNAGAAMLRLAKDLAENNKGARVL  659
             VFCTTSGVDMPGAD+QLTKLLGL  SVKRLMMYQQGC AG  +LRLAKDLAENNKGARVL
Sbjct  128   VFCTTSGVDMPGADYQLTKLLGLRPSVKRLMMYQQGCFAGGTVLRLAKDLAENNKGARVL  187

Query  660   VVCSEVMLSVFRGPSLQQEDNLLAQCLFGDGSAAVIVGTEPRPGLETPLFELVSSAQTII  839
             VVCSE+    FRGPS    D+L+ Q LFGDG+AA+IVG +P P +E PLFELVS+AQTI+
Sbjct  188   VVCSEITAVTFRGPSDTHLDSLVGQALFGDGAAAIIVGADPVPEVEKPLFELVSAAQTIL  247

Query  840   PDTDSHLKLQLREMGLTFHCSKAVPSLITQNVEDCLVKAFEPFGISDWNSIFWILHPGGN  1019
             PD+D  +   LRE+GLTFH  K VP LI++N+E  L +AF+P GISDWNSIFWI HPGG 
Sbjct  248   PDSDGAIDGHLREVGLTFHLLKDVPGLISKNIEKALTEAFQPLGISDWNSIFWIAHPGGP  307

Query  1020  AILDGVEEKLGLDPEKLRASRDVLSQYGNLTSACVLFILDEVRKKSKKQQQMTTGEGLEW  1199
             AILD VE KL L PEKLRA+R VLS+YGN++SACVLFILDE+R+KS ++   TTGEGLEW
Sbjct  308   AILDQVELKLSLKPEKLRATRHVLSEYGNMSSACVLFILDEMRRKSAEEGLKTTGEGLEW  367

Query  1200  GVLFGFGPGLTIDTVVIRSV  1259
             GVLFGFGPGLT++TVV+ S+
Sbjct  368   GVLFGFGPGLTVETVVLHSL  387



>sp|Q9FUB7.1|CHSY_HYPAN RecName: Full=Chalcone synthase; AltName: Full=Naringenin-chalcone 
synthase [Hypericum androsaemum]
 gb|AAG30295.1|AF315345_1 chalcone synthase [Hypericum androsaemum]
Length=390

 Score =   557 bits (1435),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 262/383 (68%), Positives = 317/383 (83%), Gaps = 0/383 (0%)
 Frame = +3

Query  120   HRAKRLEGDAKILAIGTATPANWVDQTTYPDFYFRITNSQHLLEHKEKFRRICNKSKIMK  299
              +A+R EG A ++AIGTA P N VDQ TYPD+YFRITNS+H  E KEKF+R+C+KS+I K
Sbjct  8     RKAQRAEGPATVMAIGTAVPPNCVDQATYPDYYFRITNSEHKAELKEKFQRMCDKSQIKK  67

Query  300   RHLVLTEELLKKHPNLCTYNEASLNTRQDILVSGVPKLGKEAAMKAIKEWGRPISEITHL  479
             R++ L EE+LK++PN+C Y   SL+ RQDI+V  VPKLGKEAA+KAIKEWG+P S+ITHL
Sbjct  68    RYMYLNEEVLKENPNMCAYMAPSLDARQDIVVVEVPKLGKEAAVKAIKEWGQPKSKITHL  127

Query  480   VFCTTSGVDMPGADFQLTKLLGLNSSVKRLMMYQQGCNAGAAMLRLAKDLAENNKGARVL  659
             VFCTTSGVDMPGAD+QLTKLLGL  SVKRLMMYQQGC AG  +LRLAKDLAENNKGARVL
Sbjct  128   VFCTTSGVDMPGADYQLTKLLGLRPSVKRLMMYQQGCFAGGTVLRLAKDLAENNKGARVL  187

Query  660   VVCSEVMLSVFRGPSLQQEDNLLAQCLFGDGSAAVIVGTEPRPGLETPLFELVSSAQTII  839
             VVCSE+    FRGP+    D+L+ Q LFGDG+AA+I+G++P P +E PLFELVS+AQTI+
Sbjct  188   VVCSEITAVTFRGPTDTHLDSLVGQALFGDGAAAIIIGSDPIPEVEKPLFELVSAAQTIL  247

Query  840   PDTDSHLKLQLREMGLTFHCSKAVPSLITQNVEDCLVKAFEPFGISDWNSIFWILHPGGN  1019
             PD++  +   LRE+GLTFH  K VP LI++NVE  L +AF+P GISDWNS+FWI HPGG 
Sbjct  248   PDSEGAIDGHLREVGLTFHLLKDVPGLISKNVEKSLTEAFKPLGISDWNSLFWIAHPGGP  307

Query  1020  AILDGVEEKLGLDPEKLRASRDVLSQYGNLTSACVLFILDEVRKKSKKQQQMTTGEGLEW  1199
             AILD VE KL L PEKLRA+R VLS+YGN++SACVLFILDE+R+KSK+    TTGEG+EW
Sbjct  308   AILDQVEAKLSLKPEKLRATRHVLSEYGNMSSACVLFILDEMRRKSKEDGLKTTGEGIEW  367

Query  1200  GVLFGFGPGLTIDTVVIRSVPIN  1268
             GVLFGFGPGLT++TVV+ SV IN
Sbjct  368   GVLFGFGPGLTVETVVLHSVAIN  390



>gb|AEO96989.1| chalcone synthase [Gossypium hirsutum]
Length=389

 Score =   556 bits (1434),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 260/381 (68%), Positives = 317/381 (83%), Gaps = 0/381 (0%)
 Frame = +3

Query  120   HRAKRLEGDAKILAIGTATPANWVDQTTYPDFYFRITNSQHLLEHKEKFRRICNKSKIMK  299
              +A+R +G A +LAIGT+TP N VDQ+TYPD+YFRITNS+H  E KEKF+R+C KS I K
Sbjct  8     RKAQRAQGPATVLAIGTSTPPNCVDQSTYPDYYFRITNSEHKTELKEKFKRMCEKSMIKK  67

Query  300   RHLVLTEELLKKHPNLCTYNEASLNTRQDILVSGVPKLGKEAAMKAIKEWGRPISEITHL  479
             R++ LTEE+LK++PN+C Y E SL+ RQD++V  VPKLGKEAA +AIKEWG+P S+ITHL
Sbjct  68    RYMFLTEEILKENPNVCAYMEPSLDARQDMVVVEVPKLGKEAAARAIKEWGQPKSKITHL  127

Query  480   VFCTTSGVDMPGADFQLTKLLGLNSSVKRLMMYQQGCNAGAAMLRLAKDLAENNKGARVL  659
             VFCTTSGVDMPGAD+QLTKLLGL  SVKRLMMYQQGC AG  +LR+AKDLAENN+GARVL
Sbjct  128   VFCTTSGVDMPGADYQLTKLLGLRPSVKRLMMYQQGCFAGGTVLRVAKDLAENNEGARVL  187

Query  660   VVCSEVMLSVFRGPSLQQEDNLLAQCLFGDGSAAVIVGTEPRPGLETPLFELVSSAQTII  839
             VVCSE+    FRGPS    D+L+ Q LFGDG+AAVI+G++P P +E PLFELVS+AQTI+
Sbjct  188   VVCSEITAVTFRGPSDTHLDSLVGQALFGDGAAAVIIGSDPIPEIEKPLFELVSAAQTIL  247

Query  840   PDTDSHLKLQLREMGLTFHCSKAVPSLITQNVEDCLVKAFEPFGISDWNSIFWILHPGGN  1019
             PD+D  +   LRE+GLTFH  K VP LI++N+E  LV+AF+P GI+DWNS+FWI HPGG 
Sbjct  248   PDSDGAIDGHLREVGLTFHLLKDVPGLISKNIEKSLVEAFQPLGITDWNSLFWIAHPGGP  307

Query  1020  AILDGVEEKLGLDPEKLRASRDVLSQYGNLTSACVLFILDEVRKKSKKQQQMTTGEGLEW  1199
             AILD VE KL L PEKLRA+R VLS+YGN++SACVLFILDE+R KS++    TTGEGLEW
Sbjct  308   AILDQVEAKLALKPEKLRATRHVLSEYGNMSSACVLFILDEMRNKSREDGVQTTGEGLEW  367

Query  1200  GVLFGFGPGLTIDTVVIRSVP  1262
             GVLFGFGPGLT++TVV+ S+P
Sbjct  368   GVLFGFGPGLTVETVVLHSIP  388



>emb|CAA64366.1| naringenin-chalcone synthase [Juglans nigra x Juglans regia]
Length=389

 Score =   556 bits (1434),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 264/380 (69%), Positives = 315/380 (83%), Gaps = 0/380 (0%)
 Frame = +3

Query  120   HRAKRLEGDAKILAIGTATPANWVDQTTYPDFYFRITNSQHLLEHKEKFRRICNKSKIMK  299
              RA+R EG A ++AIGTATP N VDQ+ YPD+YFRITNS+H  E KEKF+R+C KS I K
Sbjct  8     RRAQRAEGPATVMAIGTATPPNCVDQSAYPDYYFRITNSEHKTELKEKFKRMCGKSMIKK  67

Query  300   RHLVLTEELLKKHPNLCTYNEASLNTRQDILVSGVPKLGKEAAMKAIKEWGRPISEITHL  479
             R++ LTEE+LK++PN+C Y  +SL+ RQD++V  VPKLGKEAA KAIKEWG+P S+ITHL
Sbjct  68    RYMHLTEEILKENPNVCAYMASSLDARQDMVVVEVPKLGKEAATKAIKEWGQPKSKITHL  127

Query  480   VFCTTSGVDMPGADFQLTKLLGLNSSVKRLMMYQQGCNAGAAMLRLAKDLAENNKGARVL  659
             VFCTTSGVDMPGAD+QLTKLLGL  SVKRLMMYQQGC AG  +LRLAKDLAENNKGARVL
Sbjct  128   VFCTTSGVDMPGADYQLTKLLGLRPSVKRLMMYQQGCFAGGTVLRLAKDLAENNKGARVL  187

Query  660   VVCSEVMLSVFRGPSLQQEDNLLAQCLFGDGSAAVIVGTEPRPGLETPLFELVSSAQTII  839
             VVCSE+    FRGPS    D+L+ Q LFGDG+AA+IVG +P PG+E PLFELVS+AQTI+
Sbjct  188   VVCSEITAVTFRGPSDTHLDSLVGQALFGDGAAALIVGADPVPGVEKPLFELVSAAQTIL  247

Query  840   PDTDSHLKLQLREMGLTFHCSKAVPSLITQNVEDCLVKAFEPFGISDWNSIFWILHPGGN  1019
             PD+D  +   LRE+GLTFH  K VP LI++N+E  LV+AF+P GI+DWNS+FWI HPGG 
Sbjct  248   PDSDGAIDGHLREVGLTFHLLKDVPGLISKNIEKSLVEAFQPLGITDWNSLFWIAHPGGP  307

Query  1020  AILDGVEEKLGLDPEKLRASRDVLSQYGNLTSACVLFILDEVRKKSKKQQQMTTGEGLEW  1199
             AILD VE KL L PEKLRA+R VLS+YGN++SACVLFILDE+RKKS + +  TTGEGLEW
Sbjct  308   AILDQVESKLELKPEKLRATRHVLSEYGNMSSACVLFILDEMRKKSAEDRLKTTGEGLEW  367

Query  1200  GVLFGFGPGLTIDTVVIRSV  1259
             GVLFGFG GLT++TVV+ SV
Sbjct  368   GVLFGFGSGLTVETVVLHSV  387



>sp|P06515.1|CHSY_ANTMA RecName: Full=Chalcone synthase; AltName: Full=Naringenin-chalcone 
synthase [Antirrhinum majus]
 emb|CAA27338.1| chalcone synthase [Antirrhinum majus]
 dbj|BAM29290.1| chalcone synthase [Antirrhinum majus]
 dbj|BAM29291.1| chalcone synthase [Antirrhinum majus]
 dbj|BAM29292.1| chalcone synthase [Antirrhinum majus]
Length=390

 Score =   556 bits (1433),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 259/383 (68%), Positives = 318/383 (83%), Gaps = 0/383 (0%)
 Frame = +3

Query  120   HRAKRLEGDAKILAIGTATPANWVDQTTYPDFYFRITNSQHLLEHKEKFRRICNKSKIMK  299
              RA+R EG A +LAIGTATPAN VDQ+TYPD+YFRITNS+H+ E KEKF+R+C+KS I +
Sbjct  8     RRAQRAEGPATVLAIGTATPANCVDQSTYPDYYFRITNSEHMTELKEKFKRMCDKSNIKR  67

Query  300   RHLVLTEELLKKHPNLCTYNEASLNTRQDILVSGVPKLGKEAAMKAIKEWGRPISEITHL  479
             R++ LTEE+LK++P +C Y   SL+ RQDI+V  VP+LGKEAA KAIKEWG+P S+ITHL
Sbjct  68    RYMHLTEEILKENPAMCEYMAPSLDARQDIVVVEVPRLGKEAAQKAIKEWGQPKSKITHL  127

Query  480   VFCTTSGVDMPGADFQLTKLLGLNSSVKRLMMYQQGCNAGAAMLRLAKDLAENNKGARVL  659
             VFCTTSGVDMPGAD+QLTKLLGL  SVKR MMYQQGC AG  +LR+AKDLAENN GARVL
Sbjct  128   VFCTTSGVDMPGADYQLTKLLGLRPSVKRFMMYQQGCFAGGTVLRMAKDLAENNAGARVL  187

Query  660   VVCSEVMLSVFRGPSLQQEDNLLAQCLFGDGSAAVIVGTEPRPGLETPLFELVSSAQTII  839
             VVCSE+    FRGP+    D+L+ Q LFGDG+AAVIVG++P  G+E PLF++V++AQT++
Sbjct  188   VVCSEITAVTFRGPADTHLDSLVGQALFGDGAAAVIVGSDPVVGVERPLFQIVTAAQTLL  247

Query  840   PDTDSHLKLQLREMGLTFHCSKAVPSLITQNVEDCLVKAFEPFGISDWNSIFWILHPGGN  1019
             PD+   +   LRE+GLTFH  K VP LI++N+E  L +AF+P GISDWNS+FWI HPGG 
Sbjct  248   PDSHGAIDGHLREVGLTFHLLKDVPGLISKNIEKSLKEAFDPLGISDWNSVFWIAHPGGP  307

Query  1020  AILDGVEEKLGLDPEKLRASRDVLSQYGNLTSACVLFILDEVRKKSKKQQQMTTGEGLEW  1199
             AILD VEEKLGL PEKLR++R VLS+YGN++SACVLFILDE+RK S K+   TTGEGL+W
Sbjct  308   AILDQVEEKLGLKPEKLRSTRQVLSEYGNMSSACVLFILDEMRKSSAKEGMSTTGEGLDW  367

Query  1200  GVLFGFGPGLTIDTVVIRSVPIN  1268
             GVLFGFGPGLT++TVV+ SVP+N
Sbjct  368   GVLFGFGPGLTVETVVLHSVPLN  390



>gb|ACH56521.1| chalcone synthase [Gossypium hirsutum]
 gb|AEO96988.1| chalcone synthase [Gossypium hirsutum]
Length=389

 Score =   556 bits (1432),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 261/380 (69%), Positives = 314/380 (83%), Gaps = 0/380 (0%)
 Frame = +3

Query  120   HRAKRLEGDAKILAIGTATPANWVDQTTYPDFYFRITNSQHLLEHKEKFRRICNKSKIMK  299
              +A+R +G A +LAIGT+TP N VDQ+TYPD+YFRITNS+H  E KEKF+R+C KS I K
Sbjct  8     RKAQRAQGPATVLAIGTSTPPNCVDQSTYPDYYFRITNSEHKTELKEKFKRMCEKSMIKK  67

Query  300   RHLVLTEELLKKHPNLCTYNEASLNTRQDILVSGVPKLGKEAAMKAIKEWGRPISEITHL  479
             R++ LTEE+LK++PN+C Y   SL+ RQD++V  VPKLGKEAA KAIKEWG+P S+ITHL
Sbjct  68    RYMYLTEEILKENPNVCEYMAPSLDARQDMVVVEVPKLGKEAATKAIKEWGQPKSKITHL  127

Query  480   VFCTTSGVDMPGADFQLTKLLGLNSSVKRLMMYQQGCNAGAAMLRLAKDLAENNKGARVL  659
             VFCTTSGVDMPGAD+QLTKLLGL  SVKRLMMYQQGC AG  +LR+AKDLAENNKGARVL
Sbjct  128   VFCTTSGVDMPGADYQLTKLLGLRPSVKRLMMYQQGCFAGGTVLRVAKDLAENNKGARVL  187

Query  660   VVCSEVMLSVFRGPSLQQEDNLLAQCLFGDGSAAVIVGTEPRPGLETPLFELVSSAQTII  839
             VVCSE+    FRGPS    D+L+ Q LFGDG+AAVI+G +P P +E P+FE+VS AQTI+
Sbjct  188   VVCSEITAVTFRGPSDTHLDSLVGQALFGDGAAAVIIGADPMPEIEKPMFEIVSVAQTIL  247

Query  840   PDTDSHLKLQLREMGLTFHCSKAVPSLITQNVEDCLVKAFEPFGISDWNSIFWILHPGGN  1019
             PD+D  +   LRE+GLTFH  K VP LI++N+E  LV+AF+P GISDWNS+FWI HPGG 
Sbjct  248   PDSDGAIDGHLREVGLTFHLLKDVPGLISKNIEKSLVEAFQPLGISDWNSLFWIAHPGGP  307

Query  1020  AILDGVEEKLGLDPEKLRASRDVLSQYGNLTSACVLFILDEVRKKSKKQQQMTTGEGLEW  1199
             AILD VE KL L PEKLRA+R VLS+YGN++SACVLFILDE+RKKS++    TTGEGLEW
Sbjct  308   AILDQVEAKLALKPEKLRATRHVLSEYGNMSSACVLFILDEMRKKSREDGLQTTGEGLEW  367

Query  1200  GVLFGFGPGLTIDTVVIRSV  1259
             GVLFGFGPGLT++TVV+ SV
Sbjct  368   GVLFGFGPGLTVETVVLHSV  387



>ref|XP_006420608.1| hypothetical protein CICLE_v10005133mg [Citrus clementina]
 gb|ESR33848.1| hypothetical protein CICLE_v10005133mg [Citrus clementina]
Length=390

 Score =   556 bits (1432),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 260/380 (68%), Positives = 316/380 (83%), Gaps = 0/380 (0%)
 Frame = +3

Query  120   HRAKRLEGDAKILAIGTATPANWVDQTTYPDFYFRITNSQHLLEHKEKFRRICNKSKIMK  299
              +A+R +G A I+AIGTATP N VDQ+TYPD+YFRITNS+H+ + KEKF+R+C+KS I K
Sbjct  8     RKAQRAQGPATIMAIGTATPPNCVDQSTYPDYYFRITNSEHMTDLKEKFKRMCDKSMIKK  67

Query  300   RHLVLTEELLKKHPNLCTYNEASLNTRQDILVSGVPKLGKEAAMKAIKEWGRPISEITHL  479
             R++ LTEE+LK++PN+C Y   SL+TRQD++V  VP+LGKEAA +AIKEWG+P S+ITHL
Sbjct  68    RYMYLTEEILKENPNVCAYMAPSLDTRQDMVVVEVPRLGKEAATEAIKEWGQPKSKITHL  127

Query  480   VFCTTSGVDMPGADFQLTKLLGLNSSVKRLMMYQQGCNAGAAMLRLAKDLAENNKGARVL  659
             VFCTTSGVDMPGAD++LTKLLGL  SVKRLMMYQQGC AG  +LRLAKDLAENNKGARVL
Sbjct  128   VFCTTSGVDMPGADYRLTKLLGLRPSVKRLMMYQQGCFAGGTVLRLAKDLAENNKGARVL  187

Query  660   VVCSEVMLSVFRGPSLQQEDNLLAQCLFGDGSAAVIVGTEPRPGLETPLFELVSSAQTII  839
             VVCSE+    FRGPS    D+L+ Q LFGDG+AA+I+G +P P +E P+FELVS+AQTI+
Sbjct  188   VVCSEITAVTFRGPSDTHLDSLVGQALFGDGAAAIIIGADPIPEIEKPMFELVSTAQTIL  247

Query  840   PDTDSHLKLQLREMGLTFHCSKAVPSLITQNVEDCLVKAFEPFGISDWNSIFWILHPGGN  1019
             PD+D  +   LRE GLTFH  K VP LI++N++  L +AF+P GISDWNSIFWI HPGG 
Sbjct  248   PDSDGSIDGHLREAGLTFHLLKDVPGLISKNIQKSLTEAFKPLGISDWNSIFWIAHPGGP  307

Query  1020  AILDGVEEKLGLDPEKLRASRDVLSQYGNLTSACVLFILDEVRKKSKKQQQMTTGEGLEW  1199
             AILD VEEKLGL PEKLRA+R VLS+YGN++SACVLFILDE+RKKS +    T GEGLEW
Sbjct  308   AILDQVEEKLGLKPEKLRATRHVLSEYGNMSSACVLFILDEMRKKSAEDGLETAGEGLEW  367

Query  1200  GVLFGFGPGLTIDTVVIRSV  1259
             GVLFGFGPGLT++TVV+ SV
Sbjct  368   GVLFGFGPGLTVETVVLHSV  387



>gb|AFU52909.1| chalcone synthase [Hypericum sampsonii]
Length=390

 Score =   555 bits (1431),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 261/383 (68%), Positives = 317/383 (83%), Gaps = 0/383 (0%)
 Frame = +3

Query  120   HRAKRLEGDAKILAIGTATPANWVDQTTYPDFYFRITNSQHLLEHKEKFRRICNKSKIMK  299
              +A+R EG A ++AIGTA P N VDQ TYPD+YFRITNS+H  E KEKF+R+C+KS+I K
Sbjct  8     RKAQRAEGPATVMAIGTAVPPNCVDQATYPDYYFRITNSEHKAELKEKFQRMCDKSQIKK  67

Query  300   RHLVLTEELLKKHPNLCTYNEASLNTRQDILVSGVPKLGKEAAMKAIKEWGRPISEITHL  479
             R++ L EE+LK++PN+C Y   SL+ RQDI+V  VPKLGKEAA+KAIKEWG+P S+ITHL
Sbjct  68    RYMYLNEEVLKENPNMCAYMAPSLDARQDIVVVEVPKLGKEAAVKAIKEWGQPKSKITHL  127

Query  480   VFCTTSGVDMPGADFQLTKLLGLNSSVKRLMMYQQGCNAGAAMLRLAKDLAENNKGARVL  659
             VFCTTSGVDMPGAD+QLTKLLGL  SVKRLMMYQQGC AG  +LRLAKDLAENNKGARVL
Sbjct  128   VFCTTSGVDMPGADYQLTKLLGLRPSVKRLMMYQQGCFAGGTVLRLAKDLAENNKGARVL  187

Query  660   VVCSEVMLSVFRGPSLQQEDNLLAQCLFGDGSAAVIVGTEPRPGLETPLFELVSSAQTII  839
             VVCSE+    FRGP+    D+L+ Q LFGDG+AA+I+G++P P +E PLFELVS+AQTI+
Sbjct  188   VVCSEITAVTFRGPTDTHLDSLVGQALFGDGAAAIIIGSDPIPEVEKPLFELVSAAQTIL  247

Query  840   PDTDSHLKLQLREMGLTFHCSKAVPSLITQNVEDCLVKAFEPFGISDWNSIFWILHPGGN  1019
             PD++  +   LRE+GLTFH  K VP LI++NVE  L +AF+P GISDWNS+FWI HPGG 
Sbjct  248   PDSEGAIDGHLREVGLTFHLLKDVPGLISKNVEKSLTEAFKPLGISDWNSLFWIAHPGGP  307

Query  1020  AILDGVEEKLGLDPEKLRASRDVLSQYGNLTSACVLFILDEVRKKSKKQQQMTTGEGLEW  1199
             AILD VE KL L PEKLRA+R VLS+YGN++SACVLFILDE+R+KSK+    TTGEG+EW
Sbjct  308   AILDQVEAKLSLKPEKLRATRHVLSEYGNMSSACVLFILDEMRRKSKEDGLKTTGEGIEW  367

Query  1200  GVLFGFGPGLTIDTVVIRSVPIN  1268
             GVLFGFGPGLT++TVV+ S+ IN
Sbjct  368   GVLFGFGPGLTVETVVLHSLAIN  390



>gb|AIC75908.1| chalcone synthase [Hibiscus cannabinus]
Length=389

 Score =   555 bits (1430),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 260/381 (68%), Positives = 315/381 (83%), Gaps = 0/381 (0%)
 Frame = +3

Query  120   HRAKRLEGDAKILAIGTATPANWVDQTTYPDFYFRITNSQHLLEHKEKFRRICNKSKIMK  299
              +A+R EG A +LAIGT+TP N VDQ+TYPDFYFR+T S+H  E KEKF+R+C KS I K
Sbjct  8     RKAQRAEGPATVLAIGTSTPPNCVDQSTYPDFYFRVTKSEHKAELKEKFKRMCEKSMIKK  67

Query  300   RHLVLTEELLKKHPNLCTYNEASLNTRQDILVSGVPKLGKEAAMKAIKEWGRPISEITHL  479
             R++ LTE++LK++PN+C Y   SL+ RQD++V  VPK GKEAA +AIKEWG+P S+ITHL
Sbjct  68    RYMYLTEDILKENPNVCEYMAPSLDARQDMVVVEVPKFGKEAATRAIKEWGQPKSKITHL  127

Query  480   VFCTTSGVDMPGADFQLTKLLGLNSSVKRLMMYQQGCNAGAAMLRLAKDLAENNKGARVL  659
             VFCTTSGVDMPGAD+QLTKLLGL  SVKRLMMYQQGC AG  +LR+AKDLAENNKGARVL
Sbjct  128   VFCTTSGVDMPGADYQLTKLLGLRPSVKRLMMYQQGCFAGGTVLRVAKDLAENNKGARVL  187

Query  660   VVCSEVMLSVFRGPSLQQEDNLLAQCLFGDGSAAVIVGTEPRPGLETPLFELVSSAQTII  839
             VVCSE+    FRGPS    D+L+ Q LFGDG+AAVI+G++P  G+E PLFELVS+AQTI+
Sbjct  188   VVCSEITAVTFRGPSDTHLDSLVGQALFGDGAAAVIIGSDPVDGIEKPLFELVSAAQTIL  247

Query  840   PDTDSHLKLQLREMGLTFHCSKAVPSLITQNVEDCLVKAFEPFGISDWNSIFWILHPGGN  1019
             PD+D  +   LRE+GLTFH  K VP LI++N+E  LV+AF+P GI+DWNS+FWI HPGG 
Sbjct  248   PDSDGAIDGHLREVGLTFHLLKDVPGLISKNIEKSLVEAFQPLGITDWNSLFWIAHPGGP  307

Query  1020  AILDGVEEKLGLDPEKLRASRDVLSQYGNLTSACVLFILDEVRKKSKKQQQMTTGEGLEW  1199
             AILD VE KL L PEKLRA+R VLS+YGN++SACVLFILDE+RKKSK+    TTGEGLEW
Sbjct  308   AILDQVEAKLALKPEKLRATRHVLSEYGNMSSACVLFILDEMRKKSKEDGVQTTGEGLEW  367

Query  1200  GVLFGFGPGLTIDTVVIRSVP  1262
             GVLFGFGPGLT++TVV+ S+P
Sbjct  368   GVLFGFGPGLTVETVVLHSIP  388



>gb|AFM74036.1| chalcone synthase [Acer palmatum]
Length=390

 Score =   555 bits (1430),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 258/380 (68%), Positives = 316/380 (83%), Gaps = 0/380 (0%)
 Frame = +3

Query  120   HRAKRLEGDAKILAIGTATPANWVDQTTYPDFYFRITNSQHLLEHKEKFRRICNKSKIMK  299
              +A+R +G A ILAIGTATP N VDQ+ YPD+YFRITNS+H  E KEKF+R+C KS I K
Sbjct  8     RKAQRAQGPATILAIGTATPPNCVDQSEYPDYYFRITNSEHKTELKEKFKRMCEKSMIKK  67

Query  300   RHLVLTEELLKKHPNLCTYNEASLNTRQDILVSGVPKLGKEAAMKAIKEWGRPISEITHL  479
             R++ LTEE+LK++PN+C Y   SL+ RQD++V  +PKLGKEAA KAIKEWG+P S+ITHL
Sbjct  68    RYMYLTEEILKENPNVCAYEAPSLDARQDMVVVEIPKLGKEAATKAIKEWGQPKSKITHL  127

Query  480   VFCTTSGVDMPGADFQLTKLLGLNSSVKRLMMYQQGCNAGAAMLRLAKDLAENNKGARVL  659
             VFC+TSGVDMPGAD+QLTKLLGL  SVKRLMMYQQGC AG  +LRLAKDLAENN GARVL
Sbjct  128   VFCSTSGVDMPGADYQLTKLLGLRPSVKRLMMYQQGCFAGGTVLRLAKDLAENNTGARVL  187

Query  660   VVCSEVMLSVFRGPSLQQEDNLLAQCLFGDGSAAVIVGTEPRPGLETPLFELVSSAQTII  839
             VVCSE+    FRGPS    D+L+ Q LFGDG+AA+I+G++P+PG+E P++ELVS+AQTI+
Sbjct  188   VVCSEITAVTFRGPSDTHLDSLVGQALFGDGAAAIIIGSDPQPGIEKPMYELVSAAQTIL  247

Query  840   PDTDSHLKLQLREMGLTFHCSKAVPSLITQNVEDCLVKAFEPFGISDWNSIFWILHPGGN  1019
             PD+D  +   LRE+GLTFH  K VP LI++N+E  LV+AF+P GISDWNSIFWI +PGG 
Sbjct  248   PDSDGAIDGHLREVGLTFHLLKDVPGLISKNIEKSLVEAFKPLGISDWNSIFWIAYPGGP  307

Query  1020  AILDGVEEKLGLDPEKLRASRDVLSQYGNLTSACVLFILDEVRKKSKKQQQMTTGEGLEW  1199
             AILD VE KLGL PEK+RA+R VLS++GN++SACVLFILDE+RKKS +    TTGEGLEW
Sbjct  308   AILDQVEAKLGLKPEKMRATRHVLSEFGNMSSACVLFILDEMRKKSAEDGLRTTGEGLEW  367

Query  1200  GVLFGFGPGLTIDTVVIRSV  1259
             GVLFGFGPGLT++TV++ SV
Sbjct  368   GVLFGFGPGLTVETVILHSV  387



>gb|KHG25969.1| Chalcone synthase 1 [Gossypium arboreum]
Length=389

 Score =   555 bits (1430),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 262/380 (69%), Positives = 314/380 (83%), Gaps = 0/380 (0%)
 Frame = +3

Query  120   HRAKRLEGDAKILAIGTATPANWVDQTTYPDFYFRITNSQHLLEHKEKFRRICNKSKIMK  299
              +A+R EG A +LAIGT+TP N VDQ+TYPD+YFRITNS+H  E KEKF+R+C KS I K
Sbjct  8     RKAQRAEGPATVLAIGTSTPPNCVDQSTYPDYYFRITNSEHKTELKEKFKRMCEKSMIKK  67

Query  300   RHLVLTEELLKKHPNLCTYNEASLNTRQDILVSGVPKLGKEAAMKAIKEWGRPISEITHL  479
             R++ LTEE+LK++PN+C Y   SL+ RQD++V  VPKLGKEAA KAIKEWG+P S+ITHL
Sbjct  68    RYMYLTEEILKENPNVCEYMAPSLDARQDMVVVEVPKLGKEAATKAIKEWGQPKSKITHL  127

Query  480   VFCTTSGVDMPGADFQLTKLLGLNSSVKRLMMYQQGCNAGAAMLRLAKDLAENNKGARVL  659
             VFCTTSGVDMPGAD+QLTKLLGL  SVKRLMMYQQGC AG  +LR+AKDLAENNKGARVL
Sbjct  128   VFCTTSGVDMPGADYQLTKLLGLRPSVKRLMMYQQGCFAGGTVLRVAKDLAENNKGARVL  187

Query  660   VVCSEVMLSVFRGPSLQQEDNLLAQCLFGDGSAAVIVGTEPRPGLETPLFELVSSAQTII  839
             VVCSE+    FRGP+    D+L+ Q LFGDG+AAVIVG +P P +E P+FELVS+AQTI+
Sbjct  188   VVCSEITAVTFRGPNDTHLDSLVGQALFGDGAAAVIVGADPLPEIEKPMFELVSAAQTIL  247

Query  840   PDTDSHLKLQLREMGLTFHCSKAVPSLITQNVEDCLVKAFEPFGISDWNSIFWILHPGGN  1019
             PD+D  +   LRE+GLTFH  K VP LI++N+E  L +AF+P GISDWNS+FWI HPGG 
Sbjct  248   PDSDGAIDGHLREVGLTFHLLKDVPGLISKNIEKSLAEAFQPLGISDWNSLFWIAHPGGP  307

Query  1020  AILDGVEEKLGLDPEKLRASRDVLSQYGNLTSACVLFILDEVRKKSKKQQQMTTGEGLEW  1199
             AILD VE KL L PEKLRA+R VLS+YGN++SACVLFILDE+RKKSK+    TTGEGLEW
Sbjct  308   AILDQVEAKLALKPEKLRATRHVLSEYGNMSSACVLFILDEMRKKSKEDGLGTTGEGLEW  367

Query  1200  GVLFGFGPGLTIDTVVIRSV  1259
             GVLFGFGPGLT++TVV+ S+
Sbjct  368   GVLFGFGPGLTVETVVLHSI  387



>sp|O82144.1|CHSY_HYDMC RecName: Full=Chalcone synthase; AltName: Full=Naringenin-chalcone 
synthase [Hydrangea macrophylla]
 dbj|BAA32732.1| chalcone synthase [Hydrangea macrophylla]
Length=389

 Score =   555 bits (1430),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 260/380 (68%), Positives = 315/380 (83%), Gaps = 0/380 (0%)
 Frame = +3

Query  120   HRAKRLEGDAKILAIGTATPANWVDQTTYPDFYFRITNSQHLLEHKEKFRRICNKSKIMK  299
              +A+R EG A ILAIGTATP N+VDQ+TYPDFYFR+TNS+H  E K KF+R+C+ S+I K
Sbjct  8     RKAQRAEGPATILAIGTATPPNYVDQSTYPDFYFRVTNSEHKKELKAKFQRMCDNSQIKK  67

Query  300   RHLVLTEELLKKHPNLCTYNEASLNTRQDILVSGVPKLGKEAAMKAIKEWGRPISEITHL  479
             R++ LTEE+LK++PN+C Y   SL+ RQD++V  +PKLGKEAA +AIKEWG+P S+ITHL
Sbjct  68    RYMHLTEEILKENPNICAYMAPSLDARQDMVVVEIPKLGKEAATRAIKEWGQPKSKITHL  127

Query  480   VFCTTSGVDMPGADFQLTKLLGLNSSVKRLMMYQQGCNAGAAMLRLAKDLAENNKGARVL  659
             VFCTTSGVDMPGAD+QLTKLLGL  SVKRLMMYQQGC AG  +LRLAKDLAENNKGARVL
Sbjct  128   VFCTTSGVDMPGADYQLTKLLGLRPSVKRLMMYQQGCFAGGTVLRLAKDLAENNKGARVL  187

Query  660   VVCSEVMLSVFRGPSLQQEDNLLAQCLFGDGSAAVIVGTEPRPGLETPLFELVSSAQTII  839
             VVCSE+    FRGPS    D+L+ Q LFGDG+AAVI+G++P P +E PLFE+VS+AQTI+
Sbjct  188   VVCSEITAVTFRGPSDTHLDSLVGQALFGDGAAAVIIGSDPMPEVEKPLFEIVSAAQTIL  247

Query  840   PDTDSHLKLQLREMGLTFHCSKAVPSLITQNVEDCLVKAFEPFGISDWNSIFWILHPGGN  1019
             PD+D  +   LRE+GLTFH  K VP LI++N+E  LV+AF P  ISDWNSIFWI HPGG 
Sbjct  248   PDSDGAIDGHLREVGLTFHLLKDVPGLISKNIEKSLVEAFRPLDISDWNSIFWIAHPGGP  307

Query  1020  AILDGVEEKLGLDPEKLRASRDVLSQYGNLTSACVLFILDEVRKKSKKQQQMTTGEGLEW  1199
             AILD VE+KL L PEKLRA+R+VLS YGN++SACVLFI+DE+RK S ++  MTTGEGLEW
Sbjct  308   AILDQVEKKLALKPEKLRATRNVLSDYGNMSSACVLFIMDEMRKNSAEEGLMTTGEGLEW  367

Query  1200  GVLFGFGPGLTIDTVVIRSV  1259
             GVLFGFGPGLT++TVV+  V
Sbjct  368   GVLFGFGPGLTVETVVLHGV  387



>gb|ACV72638.1| chalcone synthase 1 [Gossypium hirsutum]
Length=389

 Score =   555 bits (1430),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 261/379 (69%), Positives = 314/379 (83%), Gaps = 0/379 (0%)
 Frame = +3

Query  123   RAKRLEGDAKILAIGTATPANWVDQTTYPDFYFRITNSQHLLEHKEKFRRICNKSKIMKR  302
             +A+R +G A +LAIGT+TP N VDQ+TYPD+YF ITNS+H  E KEKF+R+C KS I KR
Sbjct  9     KAQRAQGPATVLAIGTSTPPNCVDQSTYPDYYFHITNSEHKTELKEKFKRMCEKSMIKKR  68

Query  303   HLVLTEELLKKHPNLCTYNEASLNTRQDILVSGVPKLGKEAAMKAIKEWGRPISEITHLV  482
             ++ LTEE+LK++PN+C Y   SL+ RQD++V  VPKLGKEAA KAIKEWG+P S+ITHLV
Sbjct  69    YMYLTEEILKENPNVCEYMAPSLDARQDMVVVEVPKLGKEAATKAIKEWGQPKSKITHLV  128

Query  483   FCTTSGVDMPGADFQLTKLLGLNSSVKRLMMYQQGCNAGAAMLRLAKDLAENNKGARVLV  662
             FCTTSGVDMPGAD+QLTKLLGL  SVKRLMMYQQGC AG  +LR+AKDLAENNKGARVLV
Sbjct  129   FCTTSGVDMPGADYQLTKLLGLRPSVKRLMMYQQGCFAGGTVLRVAKDLAENNKGARVLV  188

Query  663   VCSEVMLSVFRGPSLQQEDNLLAQCLFGDGSAAVIVGTEPRPGLETPLFELVSSAQTIIP  842
             VCSE+    FRGPS    D+L+ Q LFGDG+AAVI+G +P P +E P+FELVS+AQTI+P
Sbjct  189   VCSEITAVTFRGPSDTHLDSLVGQALFGDGAAAVIIGADPMPEIEKPMFELVSAAQTILP  248

Query  843   DTDSHLKLQLREMGLTFHCSKAVPSLITQNVEDCLVKAFEPFGISDWNSIFWILHPGGNA  1022
             D+D  +   LRE+GLTFH  K VP LI++N+E  LV+AF+P GISDWNS+FWI HPGG A
Sbjct  249   DSDGAIDGHLREVGLTFHLLKDVPGLISKNIEKSLVEAFQPLGISDWNSLFWIAHPGGPA  308

Query  1023  ILDGVEEKLGLDPEKLRASRDVLSQYGNLTSACVLFILDEVRKKSKKQQQMTTGEGLEWG  1202
             ILD VE KL L PEKLRA+R VLS+YGN++SACVLFILDE+RKKS++    TTGEGLEWG
Sbjct  309   ILDQVEAKLALKPEKLRATRHVLSEYGNMSSACVLFILDEMRKKSREDGLQTTGEGLEWG  368

Query  1203  VLFGFGPGLTIDTVVIRSV  1259
             VLFGFGPGLT++TVV+ SV
Sbjct  369   VLFGFGPGLTVETVVLHSV  387



>ref|XP_007034442.1| Chalcone and stilbene synthase family protein [Theobroma cacao]
 gb|EOY05368.1| Chalcone and stilbene synthase family protein [Theobroma cacao]
Length=389

 Score =   555 bits (1429),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 259/380 (68%), Positives = 314/380 (83%), Gaps = 0/380 (0%)
 Frame = +3

Query  120   HRAKRLEGDAKILAIGTATPANWVDQTTYPDFYFRITNSQHLLEHKEKFRRICNKSKIMK  299
              +A+R EG A +LAIGT+TP N VDQ+TYPD+YFRITNS+H  E KEKF+R+C KS I +
Sbjct  8     RKAQRAEGPATVLAIGTSTPPNCVDQSTYPDYYFRITNSEHKTELKEKFKRMCEKSMIKR  67

Query  300   RHLVLTEELLKKHPNLCTYNEASLNTRQDILVSGVPKLGKEAAMKAIKEWGRPISEITHL  479
             R++ LTEE+LK++PN+C Y   SL+ RQD++V  VPKLGKEAA +AIKEWG+P S+ITHL
Sbjct  68    RYMYLTEEILKENPNICAYMATSLDARQDMVVVEVPKLGKEAATRAIKEWGQPKSKITHL  127

Query  480   VFCTTSGVDMPGADFQLTKLLGLNSSVKRLMMYQQGCNAGAAMLRLAKDLAENNKGARVL  659
             VFCTTSGVDMPGAD+QLTKLLGL  SVKRLMMYQQGC AG  +LR+AKDLAENNKGARVL
Sbjct  128   VFCTTSGVDMPGADYQLTKLLGLRPSVKRLMMYQQGCFAGGTVLRVAKDLAENNKGARVL  187

Query  660   VVCSEVMLSVFRGPSLQQEDNLLAQCLFGDGSAAVIVGTEPRPGLETPLFELVSSAQTII  839
             VVCSE+    FRGPS    D+L+ Q LFGDG+AAVI+G +P P +E P+FELVS+AQTI+
Sbjct  188   VVCSEITAVTFRGPSDTHLDSLVGQALFGDGAAAVIIGADPVPEIEKPMFELVSAAQTIL  247

Query  840   PDTDSHLKLQLREMGLTFHCSKAVPSLITQNVEDCLVKAFEPFGISDWNSIFWILHPGGN  1019
             PD+D  +   LRE+GLTFH  K VP LI++N+E  L +AF+P GISDWNS+FWI HPGG 
Sbjct  248   PDSDGAIDGHLREVGLTFHLLKDVPGLISKNIEKSLAEAFQPLGISDWNSLFWIAHPGGP  307

Query  1020  AILDGVEEKLGLDPEKLRASRDVLSQYGNLTSACVLFILDEVRKKSKKQQQMTTGEGLEW  1199
             AILD VE KL L PEKLRA+R VLS+YGN++SACVLFILDE+RKKS++    TTGEGLEW
Sbjct  308   AILDQVEAKLALKPEKLRATRHVLSEYGNMSSACVLFILDEMRKKSREDGLKTTGEGLEW  367

Query  1200  GVLFGFGPGLTIDTVVIRSV  1259
             GVLFGFGPGLT++TVV+ S+
Sbjct  368   GVLFGFGPGLTVETVVLHSI  387



>gb|ABM63466.1| aromatic polyketide synthase [Hypericum hookerianum]
Length=390

 Score =   555 bits (1429),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 261/383 (68%), Positives = 316/383 (83%), Gaps = 0/383 (0%)
 Frame = +3

Query  120   HRAKRLEGDAKILAIGTATPANWVDQTTYPDFYFRITNSQHLLEHKEKFRRICNKSKIMK  299
              +A+R EG A ++AIGTA P N VDQ TYPD+YFRITNS+H  E KEKF+R+C+KS+I K
Sbjct  8     RKAQRAEGPATVMAIGTAVPPNCVDQATYPDYYFRITNSEHKAELKEKFQRMCDKSQIKK  67

Query  300   RHLVLTEELLKKHPNLCTYNEASLNTRQDILVSGVPKLGKEAAMKAIKEWGRPISEITHL  479
             R++ L EE+LK++PN+C Y   SL+ RQDI+V  VPKLGKEAA+KAIKEWG+P S+ITHL
Sbjct  68    RYMYLNEEVLKENPNMCAYMAPSLDARQDIVVVEVPKLGKEAAVKAIKEWGQPKSKITHL  127

Query  480   VFCTTSGVDMPGADFQLTKLLGLNSSVKRLMMYQQGCNAGAAMLRLAKDLAENNKGARVL  659
             VFCTTSGVDMPGAD+QLTKLLGL  SVKRLMMYQQGC AG  +LRLAKDLAENNKGARVL
Sbjct  128   VFCTTSGVDMPGADYQLTKLLGLRPSVKRLMMYQQGCFAGGTVLRLAKDLAENNKGARVL  187

Query  660   VVCSEVMLSVFRGPSLQQEDNLLAQCLFGDGSAAVIVGTEPRPGLETPLFELVSSAQTII  839
             VVCSE+    FRGP+    D+L+ Q LFGDG+AA+I+G++P P +E PLFELVS+AQTI+
Sbjct  188   VVCSEITAVTFRGPTDTHLDSLVGQALFGDGAAAIIIGSDPIPEVEKPLFELVSAAQTIL  247

Query  840   PDTDSHLKLQLREMGLTFHCSKAVPSLITQNVEDCLVKAFEPFGISDWNSIFWILHPGGN  1019
             PD++  +   LRE+GLTFH  K VP LI++NVE  L +AF+P GISDWNS+FWI HPGG 
Sbjct  248   PDSEGAIDGHLREVGLTFHLLKDVPGLISKNVEKSLTEAFKPLGISDWNSLFWIAHPGGP  307

Query  1020  AILDGVEEKLGLDPEKLRASRDVLSQYGNLTSACVLFILDEVRKKSKKQQQMTTGEGLEW  1199
             AILD VE KL L PEKLRA+R VLS+YGN++SACVLFILDE+R+KSK+    TTGEG+EW
Sbjct  308   AILDQVEAKLSLKPEKLRATRHVLSEYGNMSSACVLFILDEMRRKSKQDGLKTTGEGIEW  367

Query  1200  GVLFGFGPGLTIDTVVIRSVPIN  1268
             GVLFGFGPGLT++TVV+ SV  N
Sbjct  368   GVLFGFGPGLTVETVVLHSVATN  390



>gb|AGW22222.1| chalcone synthase [Abelmoschus esculentus]
Length=389

 Score =   555 bits (1429),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 262/380 (69%), Positives = 314/380 (83%), Gaps = 0/380 (0%)
 Frame = +3

Query  120   HRAKRLEGDAKILAIGTATPANWVDQTTYPDFYFRITNSQHLLEHKEKFRRICNKSKIMK  299
              +A+R EG A +LAIGT+TP N VDQ+TYPD+YFRIT+S+H  E KEKF+R+C KS I K
Sbjct  8     RKAQRAEGPATVLAIGTSTPPNCVDQSTYPDYYFRITSSEHKTELKEKFKRMCEKSMIKK  67

Query  300   RHLVLTEELLKKHPNLCTYNEASLNTRQDILVSGVPKLGKEAAMKAIKEWGRPISEITHL  479
             R++ LTEE+LK++PN+C Y   SL+ RQD++V  VPKLGKEAA KAIKEWG+P S+ITHL
Sbjct  68    RYMYLTEEILKENPNVCEYMAPSLDARQDMVVVEVPKLGKEAATKAIKEWGQPKSKITHL  127

Query  480   VFCTTSGVDMPGADFQLTKLLGLNSSVKRLMMYQQGCNAGAAMLRLAKDLAENNKGARVL  659
             VFCTTSGVDMPGAD+QLTKLLGL  SVKRLMMYQQGC AG  +LR+AKDLAENNKGARVL
Sbjct  128   VFCTTSGVDMPGADYQLTKLLGLRPSVKRLMMYQQGCFAGGTVLRVAKDLAENNKGARVL  187

Query  660   VVCSEVMLSVFRGPSLQQEDNLLAQCLFGDGSAAVIVGTEPRPGLETPLFELVSSAQTII  839
             VVCSE+    FRGPS    D+L+ Q LFGDG+AAVI+G +P P +E P+FELVS+AQTI+
Sbjct  188   VVCSEITAVTFRGPSDTHLDSLVGQALFGDGAAAVIIGADPIPEIEKPMFELVSAAQTIL  247

Query  840   PDTDSHLKLQLREMGLTFHCSKAVPSLITQNVEDCLVKAFEPFGISDWNSIFWILHPGGN  1019
             PD+D  +   LRE+GLTFH  K VP LI++N+E  LV+AF+P GISDWNS+FWI HPGG 
Sbjct  248   PDSDGAIDGHLREVGLTFHLLKDVPGLISKNIEKSLVEAFQPLGISDWNSLFWIAHPGGP  307

Query  1020  AILDGVEEKLGLDPEKLRASRDVLSQYGNLTSACVLFILDEVRKKSKKQQQMTTGEGLEW  1199
             AILD VE KL L PEKLRA+R VLS+YGN++SACVLFILDE+RK SK+    TTGEGLEW
Sbjct  308   AILDQVEAKLALKPEKLRATRHVLSEYGNMSSACVLFILDEMRKSSKENGLGTTGEGLEW  367

Query  1200  GVLFGFGPGLTIDTVVIRSV  1259
             GVLFGFGPGLT++TVV+ SV
Sbjct  368   GVLFGFGPGLTVETVVLHSV  387



>ref|XP_010264056.1| PREDICTED: chalcone synthase 1 [Nelumbo nucifera]
 gb|ADD74169.1| chalcone synthase [Nelumbo nucifera]
 gb|ADD74170.1| chalcone synthase [Nelumbo nucifera]
 gb|ADD74171.1| chalcone synthase [Nelumbo nucifera]
 gb|ADD74172.1| chalcone synthase [Nelumbo nucifera]
Length=389

 Score =   555 bits (1429),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 263/379 (69%), Positives = 314/379 (83%), Gaps = 0/379 (0%)
 Frame = +3

Query  123   RAKRLEGDAKILAIGTATPANWVDQTTYPDFYFRITNSQHLLEHKEKFRRICNKSKIMKR  302
             +A+R EG A ++AIGTA P N VDQ+TYPD+YFRITNS+H  E KEKF+R+C KS I KR
Sbjct  9     KAQRAEGPATVMAIGTANPPNCVDQSTYPDYYFRITNSEHKTELKEKFKRMCEKSMIKKR  68

Query  303   HLVLTEELLKKHPNLCTYNEASLNTRQDILVSGVPKLGKEAAMKAIKEWGRPISEITHLV  482
             ++ LTEE+LK++PN+C Y  +SL+ RQD++V  VPKLGKEAA KAIKEWG+P S+ITHLV
Sbjct  69    YMHLTEEILKENPNICEYMASSLDARQDMVVVEVPKLGKEAATKAIKEWGQPKSKITHLV  128

Query  483   FCTTSGVDMPGADFQLTKLLGLNSSVKRLMMYQQGCNAGAAMLRLAKDLAENNKGARVLV  662
             FCTTSGVDMPGAD+QLTKLLGL  SVKRLMMYQQGC AG  +LRLAKDLAENN+GARVLV
Sbjct  129   FCTTSGVDMPGADYQLTKLLGLRPSVKRLMMYQQGCFAGGTVLRLAKDLAENNRGARVLV  188

Query  663   VCSEVMLSVFRGPSLQQEDNLLAQCLFGDGSAAVIVGTEPRPGLETPLFELVSSAQTIIP  842
             VCSE+    FRGPS    D+L+ Q LFGDG+AAVIVG +P PG+E PLFELVS+AQTI+P
Sbjct  189   VCSELTAVTFRGPSDTHLDSLVGQALFGDGAAAVIVGADPVPGVEKPLFELVSAAQTILP  248

Query  843   DTDSHLKLQLREMGLTFHCSKAVPSLITQNVEDCLVKAFEPFGISDWNSIFWILHPGGNA  1022
             D+   +   LRE+GLTFH  K VP LI++N+E  LV+AF+P GISDWNSIFWI HPGG A
Sbjct  249   DSHGAIDGHLREVGLTFHLLKDVPGLISKNIEKSLVEAFQPLGISDWNSIFWIAHPGGPA  308

Query  1023  ILDGVEEKLGLDPEKLRASRDVLSQYGNLTSACVLFILDEVRKKSKKQQQMTTGEGLEWG  1202
             ILD VEEKL L PEKL A+R +LS+YGN++SACVLFILDE+RKKS +    TTGEGLEWG
Sbjct  309   ILDQVEEKLALKPEKLSATRHILSEYGNMSSACVLFILDEMRKKSIEDGLKTTGEGLEWG  368

Query  1203  VLFGFGPGLTIDTVVIRSV  1259
             VLFGFGPGLT++TVV+ S+
Sbjct  369   VLFGFGPGLTVETVVLHSI  387



>sp|Q9ZRR8.1|CHS1_CASGL RecName: Full=Chalcone synthase; AltName: Full=Naringenin-chalcone 
synthase [Casuarina glauca]
 emb|CAA10641.1| chalcone synthase [Casuarina glauca]
Length=389

 Score =   554 bits (1428),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 259/379 (68%), Positives = 317/379 (84%), Gaps = 0/379 (0%)
 Frame = +3

Query  123   RAKRLEGDAKILAIGTATPANWVDQTTYPDFYFRITNSQHLLEHKEKFRRICNKSKIMKR  302
             +A+R EG A +LAIGTATP N +DQ+TYPD+YFRITNS+H  E KEKF+R+C+KS I KR
Sbjct  9     KAQRAEGPATVLAIGTATPPNCLDQSTYPDYYFRITNSEHKTELKEKFQRMCDKSMIKKR  68

Query  303   HLVLTEELLKKHPNLCTYNEASLNTRQDILVSGVPKLGKEAAMKAIKEWGRPISEITHLV  482
             ++ LTEE+LK+HPN+C Y   SL+ RQD++V  +PKLGKEAA+KAIKEWG+P S+ITHLV
Sbjct  69    YMYLTEEILKEHPNMCAYMAPSLDARQDMVVVEIPKLGKEAAVKAIKEWGQPKSKITHLV  128

Query  483   FCTTSGVDMPGADFQLTKLLGLNSSVKRLMMYQQGCNAGAAMLRLAKDLAENNKGARVLV  662
             FCTTSGVDMPGAD+QLTKLLGL  SVKRLMMYQQGC AG  +LRLAKDLAENN+GARVLV
Sbjct  129   FCTTSGVDMPGADYQLTKLLGLRPSVKRLMMYQQGCFAGGTVLRLAKDLAENNRGARVLV  188

Query  663   VCSEVMLSVFRGPSLQQEDNLLAQCLFGDGSAAVIVGTEPRPGLETPLFELVSSAQTIIP  842
             VCSE+    FRGPS    D+L+ Q LFGDG+AA+IVG +P P +E PLFE+VS+AQTI+P
Sbjct  189   VCSEITAVTFRGPSDTHLDSLVGQALFGDGAAAIIVGADPLPEVEKPLFEVVSTAQTILP  248

Query  843   DTDSHLKLQLREMGLTFHCSKAVPSLITQNVEDCLVKAFEPFGISDWNSIFWILHPGGNA  1022
             D+D  +   LRE+G+TFH  K VP LI++N+E  LV+AF+P GISDWNS+FWI HPGG A
Sbjct  249   DSDGAIDGHLREVGVTFHLLKDVPGLISKNIEKSLVEAFQPLGISDWNSLFWIAHPGGPA  308

Query  1023  ILDGVEEKLGLDPEKLRASRDVLSQYGNLTSACVLFILDEVRKKSKKQQQMTTGEGLEWG  1202
             ILD VEEKL L PEKL A+R VLS+YGN++SACVLFILDE+R+KS ++   TTGEGL+WG
Sbjct  309   ILDQVEEKLALKPEKLGATRHVLSEYGNMSSACVLFILDEMRRKSAEKGLKTTGEGLDWG  368

Query  1203  VLFGFGPGLTIDTVVIRSV  1259
             VLFGFGPGLT++TVV+ S+
Sbjct  369   VLFGFGPGLTVETVVLHSL  387



>gb|AGH13332.1| chalcone synthase [Rhus chinensis]
Length=390

 Score =   554 bits (1428),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 262/380 (69%), Positives = 314/380 (83%), Gaps = 0/380 (0%)
 Frame = +3

Query  120   HRAKRLEGDAKILAIGTATPANWVDQTTYPDFYFRITNSQHLLEHKEKFRRICNKSKIMK  299
              +A+R EG A ++AIGTATP N VDQ+TYPD+YFRITNS+H  E KEKF+R+C KS I K
Sbjct  8     RKAQRAEGPATVMAIGTATPPNCVDQSTYPDYYFRITNSEHKTELKEKFKRMCEKSMIKK  67

Query  300   RHLVLTEELLKKHPNLCTYNEASLNTRQDILVSGVPKLGKEAAMKAIKEWGRPISEITHL  479
             R++ LTEE+LK++P +C Y   SL+ RQD++V  VPKLGKEAA KAIKEWG+P S+ITHL
Sbjct  68    RYMYLTEEILKENPAVCEYMAPSLDARQDMVVVEVPKLGKEAATKAIKEWGQPKSKITHL  127

Query  480   VFCTTSGVDMPGADFQLTKLLGLNSSVKRLMMYQQGCNAGAAMLRLAKDLAENNKGARVL  659
             VFCTTSGVDMPGAD+QLTKLLGL  SVKR MMYQQGC AG  +LRLAKDLAENNKGARVL
Sbjct  128   VFCTTSGVDMPGADYQLTKLLGLRPSVKRYMMYQQGCFAGGTVLRLAKDLAENNKGARVL  187

Query  660   VVCSEVMLSVFRGPSLQQEDNLLAQCLFGDGSAAVIVGTEPRPGLETPLFELVSSAQTII  839
             VVCSE+    FRGP+    D+L+ Q LFGDG+AAVIVG++P PG+E P+FELVS+AQTI+
Sbjct  188   VVCSEITAVTFRGPTDTHLDSLVGQALFGDGAAAVIVGSDPVPGVEKPMFELVSTAQTIL  247

Query  840   PDTDSHLKLQLREMGLTFHCSKAVPSLITQNVEDCLVKAFEPFGISDWNSIFWILHPGGN  1019
             PD+D  +   LRE+GLTFH  K VP LI++N+E  LV+AF+P GISDWNS+FWI HPGG 
Sbjct  248   PDSDGAIDGHLREVGLTFHLLKDVPGLISKNIEKSLVEAFQPLGISDWNSLFWIAHPGGP  307

Query  1020  AILDGVEEKLGLDPEKLRASRDVLSQYGNLTSACVLFILDEVRKKSKKQQQMTTGEGLEW  1199
             AILD VE KLGL  EKLRA+R VLS+YGN++SACVLFILDE+RKKS +    TTGEGLEW
Sbjct  308   AILDQVEIKLGLKEEKLRATRHVLSEYGNMSSACVLFILDEMRKKSTENGLKTTGEGLEW  367

Query  1200  GVLFGFGPGLTIDTVVIRSV  1259
             GVLFGFGPGLT++TVV+ S+
Sbjct  368   GVLFGFGPGLTVETVVLHSI  387



>gb|AIA22214.1| chalcone synthase [Hibiscus cannabinus]
Length=389

 Score =   554 bits (1428),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 260/381 (68%), Positives = 315/381 (83%), Gaps = 0/381 (0%)
 Frame = +3

Query  120   HRAKRLEGDAKILAIGTATPANWVDQTTYPDFYFRITNSQHLLEHKEKFRRICNKSKIMK  299
              +A+R EG A +LAIGT+TP N VDQ+TYPDFYFR+T S+H  E KEKF+R+C KS I K
Sbjct  8     RKAQRAEGPATVLAIGTSTPPNCVDQSTYPDFYFRVTKSEHKAELKEKFKRMCEKSMIKK  67

Query  300   RHLVLTEELLKKHPNLCTYNEASLNTRQDILVSGVPKLGKEAAMKAIKEWGRPISEITHL  479
             R++ LTE++LK++PN+C Y   SL+ RQD++V  VPKLGKEAA +AIKEWG+P S+ITHL
Sbjct  68    RYMYLTEDILKENPNVCEYKAPSLDARQDMVVVEVPKLGKEAATRAIKEWGQPKSKITHL  127

Query  480   VFCTTSGVDMPGADFQLTKLLGLNSSVKRLMMYQQGCNAGAAMLRLAKDLAENNKGARVL  659
             VFCTTSGVDMPGAD+QLTKLLGL  SVKRLMMYQQGC AG  +LR+AKDLAENNKGARVL
Sbjct  128   VFCTTSGVDMPGADYQLTKLLGLRPSVKRLMMYQQGCFAGGTVLRVAKDLAENNKGARVL  187

Query  660   VVCSEVMLSVFRGPSLQQEDNLLAQCLFGDGSAAVIVGTEPRPGLETPLFELVSSAQTII  839
             VVCSE+    FRGPS    D+L+ Q LFGDG+AAVI+G++P  G+E PLFELVS+AQTI+
Sbjct  188   VVCSEITAVTFRGPSDTHLDSLVGQALFGDGAAAVIIGSDPVDGIEKPLFELVSAAQTIL  247

Query  840   PDTDSHLKLQLREMGLTFHCSKAVPSLITQNVEDCLVKAFEPFGISDWNSIFWILHPGGN  1019
             PD+D  +   LRE+GLTF   K VP LI++N+E  LV+AF+P GI+DWNS+FWI HPGG 
Sbjct  248   PDSDGAIDGHLREVGLTFRLLKDVPGLISKNIEKSLVEAFQPLGITDWNSLFWIAHPGGP  307

Query  1020  AILDGVEEKLGLDPEKLRASRDVLSQYGNLTSACVLFILDEVRKKSKKQQQMTTGEGLEW  1199
             AILD VE KL L PEKLRA+R VLS+YGN++SACVLFILDE+RKKSK+    TTGEGLEW
Sbjct  308   AILDQVEAKLALKPEKLRATRHVLSEYGNMSSACVLFILDEMRKKSKEDGVQTTGEGLEW  367

Query  1200  GVLFGFGPGLTIDTVVIRSVP  1262
             GVLFGFGPGLT++TVV+ S+P
Sbjct  368   GVLFGFGPGLTVETVVLHSIP  388



>gb|ACE60221.1| chalcone synthase [Abelmoschus manihot]
Length=389

 Score =   554 bits (1428),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 262/380 (69%), Positives = 313/380 (82%), Gaps = 0/380 (0%)
 Frame = +3

Query  120   HRAKRLEGDAKILAIGTATPANWVDQTTYPDFYFRITNSQHLLEHKEKFRRICNKSKIMK  299
              +A+R EG A +LAIGT+TP N VDQ+TYPD+YFRIT S+H  E KEKF+R+C KS I K
Sbjct  8     RKAQRAEGPATVLAIGTSTPPNCVDQSTYPDYYFRITKSEHKTELKEKFKRMCEKSMIKK  67

Query  300   RHLVLTEELLKKHPNLCTYNEASLNTRQDILVSGVPKLGKEAAMKAIKEWGRPISEITHL  479
             R++ LTEE+LK++PN+C Y   SL+ RQD++V  VPKLGKEAA KAIKEWG+P S+ITHL
Sbjct  68    RYMYLTEEILKENPNVCEYMAPSLDARQDMVVVEVPKLGKEAATKAIKEWGQPKSKITHL  127

Query  480   VFCTTSGVDMPGADFQLTKLLGLNSSVKRLMMYQQGCNAGAAMLRLAKDLAENNKGARVL  659
             VFCTTSGVDMPGAD+QLTKLLGL  SVKRLMMYQQGC AG  +LR+AKDLAENNKGARVL
Sbjct  128   VFCTTSGVDMPGADYQLTKLLGLRPSVKRLMMYQQGCFAGGTVLRVAKDLAENNKGARVL  187

Query  660   VVCSEVMLSVFRGPSLQQEDNLLAQCLFGDGSAAVIVGTEPRPGLETPLFELVSSAQTII  839
             VVCSE+    FRGPS    D+L+ Q LFGDG+AAVI+G +P P +E P+FELVS+AQTI+
Sbjct  188   VVCSEITAVTFRGPSDTHLDSLVGQALFGDGAAAVIIGADPIPEIEKPMFELVSAAQTIL  247

Query  840   PDTDSHLKLQLREMGLTFHCSKAVPSLITQNVEDCLVKAFEPFGISDWNSIFWILHPGGN  1019
             PD+D  +   LRE+GLTFH  K VP LI++N+E  LV+AF+P GISDWNS+FWI HPGG 
Sbjct  248   PDSDGAIDGHLREVGLTFHLLKDVPGLISKNIEKSLVEAFQPLGISDWNSLFWIAHPGGP  307

Query  1020  AILDGVEEKLGLDPEKLRASRDVLSQYGNLTSACVLFILDEVRKKSKKQQQMTTGEGLEW  1199
             AILD VE KL L PEKLRA+R VLS+YGN++SACVLFILDE+RK SK+    TTGEGLEW
Sbjct  308   AILDQVEAKLALKPEKLRATRHVLSEYGNMSSACVLFILDEMRKSSKENGLGTTGEGLEW  367

Query  1200  GVLFGFGPGLTIDTVVIRSV  1259
             GVLFGFGPGLT++TVV+ SV
Sbjct  368   GVLFGFGPGLTVETVVLHSV  387



>gb|AAM00232.1|AF358432_1 root-specific chalcone synthase [Senna alata]
Length=389

 Score =   554 bits (1427),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 261/381 (69%), Positives = 318/381 (83%), Gaps = 0/381 (0%)
 Frame = +3

Query  123   RAKRLEGDAKILAIGTATPANWVDQTTYPDFYFRITNSQHLLEHKEKFRRICNKSKIMKR  302
             +A+R EG A ++AIGTATPAN VDQ+TYPD+YFRITNS+H+ E KEKF+R+C+KS I KR
Sbjct  9     KAQRAEGAATVMAIGTATPANCVDQSTYPDYYFRITNSEHMTELKEKFQRMCDKSMIKKR  68

Query  303   HLVLTEELLKKHPNLCTYNEASLNTRQDILVSGVPKLGKEAAMKAIKEWGRPISEITHLV  482
             ++ LTEE+LK++PN+C Y   S++ RQDI+V  VPKLGKEAA KAIKEWG+P S+ITHL+
Sbjct  69    YMHLTEEILKENPNMCAYMAPSIDARQDIVVLEVPKLGKEAATKAIKEWGQPKSKITHLI  128

Query  483   FCTTSGVDMPGADFQLTKLLGLNSSVKRLMMYQQGCNAGAAMLRLAKDLAENNKGARVLV  662
             FCTTSGVDMPGAD+QLTKLLGL  SVKR MMYQQGC AG  +LRLAKDLAENNKGARVLV
Sbjct  129   FCTTSGVDMPGADYQLTKLLGLRPSVKRYMMYQQGCFAGGTVLRLAKDLAENNKGARVLV  188

Query  663   VCSEVMLSVFRGPSLQQEDNLLAQCLFGDGSAAVIVGTEPRPGLETPLFELVSSAQTIIP  842
             VCSE+    FRGPS    D+L+ Q LFGDG+AAVIVG++P P +E PLFELV +AQTI+P
Sbjct  189   VCSEITAVTFRGPSDTHLDSLVGQALFGDGAAAVIVGSDPIPEVEKPLFELVWTAQTILP  248

Query  843   DTDSHLKLQLREMGLTFHCSKAVPSLITQNVEDCLVKAFEPFGISDWNSIFWILHPGGNA  1022
             D++  +   LRE+GLTFH  K VP LI++N+E  LV+AF+P GISD+NSIFWI HPGG A
Sbjct  249   DSEGAIDGHLREVGLTFHLLKDVPGLISKNIEKALVEAFKPLGISDYNSIFWIAHPGGPA  308

Query  1023  ILDGVEEKLGLDPEKLRASRDVLSQYGNLTSACVLFILDEVRKKSKKQQQMTTGEGLEWG  1202
             ILD VE KLGL PEK++A+R VLS+YGN++SACVLFI+DE+R+KS K    TTGEGLEWG
Sbjct  309   ILDQVEAKLGLKPEKMQATRHVLSEYGNMSSACVLFIMDEMRRKSTKDGLGTTGEGLEWG  368

Query  1203  VLFGFGPGLTIDTVVIRSVPI  1265
             VLFGFGPGLT++TVV+ SV +
Sbjct  369   VLFGFGPGLTVETVVLHSVAV  389



>ref|XP_011020681.1| PREDICTED: chalcone synthase 1 [Populus euphratica]
Length=391

 Score =   554 bits (1427),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 262/380 (69%), Positives = 315/380 (83%), Gaps = 0/380 (0%)
 Frame = +3

Query  120   HRAKRLEGDAKILAIGTATPANWVDQTTYPDFYFRITNSQHLLEHKEKFRRICNKSKIMK  299
              +++R EG A I+AIGT+TP N VDQ+TYPD+YFRITNS+H  E KEKF+R+C KS I K
Sbjct  8     RKSQRAEGPATIMAIGTSTPPNCVDQSTYPDYYFRITNSEHKAELKEKFKRMCEKSMIKK  67

Query  300   RHLVLTEELLKKHPNLCTYNEASLNTRQDILVSGVPKLGKEAAMKAIKEWGRPISEITHL  479
             R++ LTEE+LK++P++C Y   SL+ RQD++V  VPKLGKEAA KAIKEWG+P S+ITHL
Sbjct  68    RYMYLTEEILKENPSVCAYMAPSLDARQDMVVVEVPKLGKEAATKAIKEWGQPKSKITHL  127

Query  480   VFCTTSGVDMPGADFQLTKLLGLNSSVKRLMMYQQGCNAGAAMLRLAKDLAENNKGARVL  659
             VFCTTSGVDMPGAD+QLTKLLGL SSVKR MMYQQGC AG  +LRLAKDLAENNKGARVL
Sbjct  128   VFCTTSGVDMPGADYQLTKLLGLRSSVKRFMMYQQGCFAGGTVLRLAKDLAENNKGARVL  187

Query  660   VVCSEVMLSVFRGPSLQQEDNLLAQCLFGDGSAAVIVGTEPRPGLETPLFELVSSAQTII  839
             VVCSE+    FRGPS    D+L+ Q LFGDG+AA+I+G++P  G+E PLFELVS+AQTI+
Sbjct  188   VVCSEITAVTFRGPSDTHLDSLVGQALFGDGAAALIIGSDPVVGVEKPLFELVSAAQTIL  247

Query  840   PDTDSHLKLQLREMGLTFHCSKAVPSLITQNVEDCLVKAFEPFGISDWNSIFWILHPGGN  1019
             PD+D  +   LRE+GLTFH  K VP LI++NVE  L +AF+P GISDWNS+FWI HPGG 
Sbjct  248   PDSDGAIDGHLREVGLTFHLLKDVPGLISKNVEKSLTEAFKPLGISDWNSLFWIAHPGGP  307

Query  1020  AILDGVEEKLGLDPEKLRASRDVLSQYGNLTSACVLFILDEVRKKSKKQQQMTTGEGLEW  1199
             AILD VE KLGL PEKLRA+R VLS+YGN++SACVLFILDE+RKKS +    +TGEGLEW
Sbjct  308   AILDQVEAKLGLKPEKLRATRHVLSEYGNMSSACVLFILDEMRKKSAEDGLQSTGEGLEW  367

Query  1200  GVLFGFGPGLTIDTVVIRSV  1259
             GVLFGFGPGLT++TVV+ SV
Sbjct  368   GVLFGFGPGLTVETVVLHSV  387



>dbj|BAO58434.1| chalcone synthase [Vaccinium ashei]
Length=389

 Score =   553 bits (1426),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 260/379 (69%), Positives = 317/379 (84%), Gaps = 0/379 (0%)
 Frame = +3

Query  123   RAKRLEGDAKILAIGTATPANWVDQTTYPDFYFRITNSQHLLEHKEKFRRICNKSKIMKR  302
             +A R EG A +LAIGTATPA+ V+Q TYPD+YFR+TNS+H  E KEKF+R+C+KS+I KR
Sbjct  9     KAMRAEGPATVLAIGTATPAHCVEQATYPDYYFRVTNSEHKAELKEKFQRMCDKSQIKKR  68

Query  303   HLVLTEELLKKHPNLCTYNEASLNTRQDILVSGVPKLGKEAAMKAIKEWGRPISEITHLV  482
             ++ LTEE+LK++PN+C Y   SL+ RQD++V  +PKLGKEAA+KAIKEWG+P S+ITHLV
Sbjct  69    YMYLTEEILKENPNVCAYMAPSLDARQDMVVVEIPKLGKEAAVKAIKEWGQPKSKITHLV  128

Query  483   FCTTSGVDMPGADFQLTKLLGLNSSVKRLMMYQQGCNAGAAMLRLAKDLAENNKGARVLV  662
             FCTTSGVDMPGAD+QLTKLLGL  SVKRLMMYQQGC AG  +LRLAKDLAENNKGARVLV
Sbjct  129   FCTTSGVDMPGADYQLTKLLGLRPSVKRLMMYQQGCFAGGTVLRLAKDLAENNKGARVLV  188

Query  663   VCSEVMLSVFRGPSLQQEDNLLAQCLFGDGSAAVIVGTEPRPGLETPLFELVSSAQTIIP  842
             VCSE+    FRGPS    D+L+ Q LFGDG+AA+IVG +P P +E PLFE+VS+AQTI+P
Sbjct  189   VCSEITAVTFRGPSDSHLDSLVGQALFGDGAAAIIVGADPIPEVEKPLFEVVSAAQTILP  248

Query  843   DTDSHLKLQLREMGLTFHCSKAVPSLITQNVEDCLVKAFEPFGISDWNSIFWILHPGGNA  1022
             D+D  +   LRE+GLTFH  K VP LI++N+E  LV+AF+P GISDWNSIFWI HPGG A
Sbjct  249   DSDGAIDGHLREVGLTFHLLKDVPGLISKNIEKSLVEAFQPLGISDWNSIFWIAHPGGPA  308

Query  1023  ILDGVEEKLGLDPEKLRASRDVLSQYGNLTSACVLFILDEVRKKSKKQQQMTTGEGLEWG  1202
             ILD VE+KL L PEKLRA+R VLS+YGN++SACVLFI+DE+RKKS +    TTGEGL+WG
Sbjct  309   ILDQVEQKLALKPEKLRATRHVLSEYGNMSSACVLFIMDEMRKKSAEDGFKTTGEGLDWG  368

Query  1203  VLFGFGPGLTIDTVVIRSV  1259
             VLFGFGPGLT++TVV+ S+
Sbjct  369   VLFGFGPGLTVETVVLHSL  387



>ref|XP_010023738.1| PREDICTED: chalcone synthase 1 [Eucalyptus grandis]
 gb|KCW60095.1| hypothetical protein EUGRSUZ_H02828 [Eucalyptus grandis]
Length=391

 Score =   553 bits (1426),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 261/379 (69%), Positives = 314/379 (83%), Gaps = 0/379 (0%)
 Frame = +3

Query  123   RAKRLEGDAKILAIGTATPANWVDQTTYPDFYFRITNSQHLLEHKEKFRRICNKSKIMKR  302
             RA+R EG A I+AIGTATP N VDQ+ YPD+YFRITNS+H  E KEKF+R+C KS I KR
Sbjct  9     RAQRAEGPATIMAIGTATPPNCVDQSAYPDYYFRITNSEHKTELKEKFKRMCEKSMIKKR  68

Query  303   HLVLTEELLKKHPNLCTYNEASLNTRQDILVSGVPKLGKEAAMKAIKEWGRPISEITHLV  482
             ++ LTE++LK++PN+C Y   SL+ RQD++V  VPKLGKEAA+KAIKEWG+P S++THL+
Sbjct  69    YMHLTEDILKENPNICAYMAPSLDARQDMVVVEVPKLGKEAAVKAIKEWGQPKSKVTHLI  128

Query  483   FCTTSGVDMPGADFQLTKLLGLNSSVKRLMMYQQGCNAGAAMLRLAKDLAENNKGARVLV  662
             FCTTSGVDMPGAD+QLTKLLGL  SVKR MMYQQGC AG  +LRLAKDLAENNKGARVLV
Sbjct  129   FCTTSGVDMPGADYQLTKLLGLRPSVKRYMMYQQGCFAGGTVLRLAKDLAENNKGARVLV  188

Query  663   VCSEVMLSVFRGPSLQQEDNLLAQCLFGDGSAAVIVGTEPRPGLETPLFELVSSAQTIIP  842
             VCSE+    FRGP+    D+L+ Q LFGDG+AAVIVG +P PG+E P+FELVS+AQTI+P
Sbjct  189   VCSEITAVTFRGPTDTHLDSLVGQALFGDGAAAVIVGADPVPGVEKPMFELVSTAQTILP  248

Query  843   DTDSHLKLQLREMGLTFHCSKAVPSLITQNVEDCLVKAFEPFGISDWNSIFWILHPGGNA  1022
             D+D  +   LRE+GLTFH  K VP LI++N+E  LV+AF+P GISDWNS+FWI HPGG A
Sbjct  249   DSDGAIDGHLREVGLTFHLLKDVPGLISKNIEKSLVEAFQPLGISDWNSLFWIAHPGGPA  308

Query  1023  ILDGVEEKLGLDPEKLRASRDVLSQYGNLTSACVLFILDEVRKKSKKQQQMTTGEGLEWG  1202
             ILD VEEKL L  EKLRA+R VLS+YGN++SACVLFILDE+RKKS +    TTGEGLEWG
Sbjct  309   ILDQVEEKLKLKAEKLRATRHVLSEYGNMSSACVLFILDEMRKKSTEDGLKTTGEGLEWG  368

Query  1203  VLFGFGPGLTIDTVVIRSV  1259
             VLFGFGPGLT++TVV+ S+
Sbjct  369   VLFGFGPGLTVETVVLHSL  387



>ref|XP_003553986.1| PREDICTED: chalcone synthase-like [Glycine max]
Length=391

 Score =   553 bits (1426),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 259/380 (68%), Positives = 316/380 (83%), Gaps = 0/380 (0%)
 Frame = +3

Query  126   AKRLEGDAKILAIGTATPANWVDQTTYPDFYFRITNSQHLLEHKEKFRRICNKSKIMKRH  305
             A+R  G A ILA GTATP+N V Q  YPD+YFRITNS+H+ + KEKF+R+C KS I KR+
Sbjct  10    AQRSHGPATILAFGTATPSNCVSQADYPDYYFRITNSEHMTDLKEKFKRMCEKSMIKKRY  69

Query  306   LVLTEELLKKHPNLCTYNEASLNTRQDILVSGVPKLGKEAAMKAIKEWGRPISEITHLVF  485
             + LTEE LK++PN+C Y   SL+ RQD++V  VPKLGK+AA KAIKEWG+P S+ITHLVF
Sbjct  70    MHLTEEFLKENPNMCEYMAPSLDVRQDVVVMEVPKLGKQAATKAIKEWGQPKSKITHLVF  129

Query  486   CTTSGVDMPGADFQLTKLLGLNSSVKRLMMYQQGCNAGAAMLRLAKDLAENNKGARVLVV  665
             CTTSGVDMPGAD+QLTKLLGL  SVKRLMMYQQGC AG  +LRLAKDLAENNKGARVLVV
Sbjct  130   CTTSGVDMPGADYQLTKLLGLRPSVKRLMMYQQGCFAGGTVLRLAKDLAENNKGARVLVV  189

Query  666   CSEVMLSVFRGPSLQQEDNLLAQCLFGDGSAAVIVGTEPRPGLETPLFELVSSAQTIIPD  845
             CSE+    FRGPS    D+L+ Q LFGDG+AA+I+G++P P +E P+FE++S+AQTI+PD
Sbjct  190   CSEITAVTFRGPSDTHLDSLVGQALFGDGAAALIIGSDPDPAVERPIFEMISAAQTILPD  249

Query  846   TDSHLKLQLREMGLTFHCSKAVPSLITQNVEDCLVKAFEPFGISDWNSIFWILHPGGNAI  1025
             +D  +   LRE+GLTFH  K VP +I++N+E  LV+AFEP GISDWNSIFWI HPGG AI
Sbjct  250   SDGAIDGHLREVGLTFHLLKDVPGIISKNIEKSLVEAFEPIGISDWNSIFWIAHPGGPAI  309

Query  1026  LDGVEEKLGLDPEKLRASRDVLSQYGNLTSACVLFILDEVRKKSKKQQQMTTGEGLEWGV  1205
             LD VEEKL L PEKL+++R VLS+YGN++SACVLFILDE+RKKSK++ + TTGEGLEWGV
Sbjct  310   LDQVEEKLRLKPEKLQSTRHVLSEYGNMSSACVLFILDEMRKKSKEEGKSTTGEGLEWGV  369

Query  1206  LFGFGPGLTIDTVVIRSVPI  1265
             LFGFGPGLT++TVV+ SVP+
Sbjct  370   LFGFGPGLTVETVVLHSVPL  389



>gb|AAM00230.1|AF358430_1 root-specific chalcone synthase [Senna alata]
Length=389

 Score =   553 bits (1426),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 260/381 (68%), Positives = 318/381 (83%), Gaps = 0/381 (0%)
 Frame = +3

Query  123   RAKRLEGDAKILAIGTATPANWVDQTTYPDFYFRITNSQHLLEHKEKFRRICNKSKIMKR  302
             +A+R EG A ++AIGTATPAN V+Q+TYPD+YFR+TNS+H+ E KEKF+R+C+KS I KR
Sbjct  9     KAQRAEGAATVMAIGTATPANCVEQSTYPDYYFRVTNSEHMTELKEKFQRMCDKSMIKKR  68

Query  303   HLVLTEELLKKHPNLCTYNEASLNTRQDILVSGVPKLGKEAAMKAIKEWGRPISEITHLV  482
             ++ LTEE+LK++PN+C Y   S++ RQDI+V  VPKLGKEAA KAIKEWG+P S+ITHL+
Sbjct  69    YMHLTEEILKENPNMCAYMAPSIDARQDIVVLEVPKLGKEAATKAIKEWGQPKSKITHLI  128

Query  483   FCTTSGVDMPGADFQLTKLLGLNSSVKRLMMYQQGCNAGAAMLRLAKDLAENNKGARVLV  662
             FCTTSGVDMPGAD+QLTKLLGL  SVKR MMYQQGC AG  +LRLAKDLAENNKGARVLV
Sbjct  129   FCTTSGVDMPGADYQLTKLLGLRPSVKRYMMYQQGCFAGGTVLRLAKDLAENNKGARVLV  188

Query  663   VCSEVMLSVFRGPSLQQEDNLLAQCLFGDGSAAVIVGTEPRPGLETPLFELVSSAQTIIP  842
             VCSE+    FRGPS    D+L+ Q LFGDG+AAVIVG++P P +ETPLFELV +AQTI+P
Sbjct  189   VCSEITAVTFRGPSDTHLDSLVGQALFGDGAAAVIVGSDPIPQVETPLFELVWTAQTILP  248

Query  843   DTDSHLKLQLREMGLTFHCSKAVPSLITQNVEDCLVKAFEPFGISDWNSIFWILHPGGNA  1022
             D++  +   LRE+GLTFH  K VP LI++N+E  LV+AF P GISD+NSIFWI HPGG A
Sbjct  249   DSEGAIDGHLREVGLTFHLLKDVPGLISKNIEKALVEAFNPLGISDYNSIFWIAHPGGPA  308

Query  1023  ILDGVEEKLGLDPEKLRASRDVLSQYGNLTSACVLFILDEVRKKSKKQQQMTTGEGLEWG  1202
             ILD VE KLGL PEK++A+R VLS+YGN++SACVLFI+DE+R+KS K    TTGEGLEWG
Sbjct  309   ILDQVEAKLGLKPEKMQATRHVLSEYGNMSSACVLFIMDEMRRKSTKDGLGTTGEGLEWG  368

Query  1203  VLFGFGPGLTIDTVVIRSVPI  1265
             VLFGFGPGLT++TVV+ S+ I
Sbjct  369   VLFGFGPGLTVETVVLHSIAI  389



>dbj|BAB92996.1| chalcone synthase [Malus domestica]
 gb|ACJ54532.1| chalcone synthase [Malus domestica]
Length=391

 Score =   553 bits (1426),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 261/380 (69%), Positives = 315/380 (83%), Gaps = 0/380 (0%)
 Frame = +3

Query  120   HRAKRLEGDAKILAIGTATPANWVDQTTYPDFYFRITNSQHLLEHKEKFRRICNKSKIMK  299
              +A+R EG A ++AIGTATP+N VDQ TYPD+YFRITNS+H +E KEKF+R+C+KS I K
Sbjct  8     RKAQRAEGPATVMAIGTATPSNCVDQATYPDYYFRITNSEHKVELKEKFQRMCDKSMIKK  67

Query  300   RHLVLTEELLKKHPNLCTYNEASLNTRQDILVSGVPKLGKEAAMKAIKEWGRPISEITHL  479
             R++ LTEE+LK++P++C Y   S++ RQD++V  VPKLGKEAA+KAIKEWG+P S+ITHL
Sbjct  68    RYMYLTEEILKENPSVCEYMAPSIDARQDMVVVEVPKLGKEAAIKAIKEWGQPKSKITHL  127

Query  480   VFCTTSGVDMPGADFQLTKLLGLNSSVKRLMMYQQGCNAGAAMLRLAKDLAENNKGARVL  659
             VFCTTSGVDMPGAD+QLTKLLGL  SVKRLMMYQQGC AG  +LRLAKDLAENNKGARVL
Sbjct  128   VFCTTSGVDMPGADYQLTKLLGLRPSVKRLMMYQQGCFAGGTVLRLAKDLAENNKGARVL  187

Query  660   VVCSEVMLSVFRGPSLQQEDNLLAQCLFGDGSAAVIVGTEPRPGLETPLFELVSSAQTII  839
             VVCSE+    FRGPS    D+L+ Q LFGDG+AAVI+G +P P +E PLFELVS+AQTI+
Sbjct  188   VVCSEITAVTFRGPSDTHLDSLVGQALFGDGAAAVIIGADPVPEVEKPLFELVSAAQTIL  247

Query  840   PDTDSHLKLQLREMGLTFHCSKAVPSLITQNVEDCLVKAFEPFGISDWNSIFWILHPGGN  1019
             PD+D  +   LRE+GLTFH  K VP LI++N+E  L +AF+P GISDWNS+FWI HPGG 
Sbjct  248   PDSDGAIDGHLREVGLTFHLLKDVPGLISKNIEKSLNEAFKPIGISDWNSLFWIAHPGGP  307

Query  1020  AILDGVEEKLGLDPEKLRASRDVLSQYGNLTSACVLFILDEVRKKSKKQQQMTTGEGLEW  1199
             AILD VE KL L PEKL A+R VLS YGN++SACVLFILDEVR+KS ++   TTGEGLEW
Sbjct  308   AILDQVEAKLALKPEKLEATRQVLSDYGNMSSACVLFILDEVRRKSAEKGLKTTGEGLEW  367

Query  1200  GVLFGFGPGLTIDTVVIRSV  1259
             GVLFGFGPGLT++TVV+ SV
Sbjct  368   GVLFGFGPGLTVETVVLHSV  387



>gb|ADW11243.1| chalcone synthase 2 [Camellia chekiangoleosa]
 gb|AFC37243.1| chalcone synthase 2 [Camellia chekiangoleosa]
Length=389

 Score =   553 bits (1426),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 263/380 (69%), Positives = 314/380 (83%), Gaps = 0/380 (0%)
 Frame = +3

Query  120   HRAKRLEGDAKILAIGTATPANWVDQTTYPDFYFRITNSQHLLEHKEKFRRICNKSKIMK  299
              RA+R EG A ++AIGTATP N VDQ+TYPD+YFRITNS+H  E KEKF+R+C+KS I K
Sbjct  8     RRAQRAEGPATVMAIGTATPPNCVDQSTYPDYYFRITNSEHKTELKEKFQRMCDKSMIKK  67

Query  300   RHLVLTEELLKKHPNLCTYNEASLNTRQDILVSGVPKLGKEAAMKAIKEWGRPISEITHL  479
             R++ LTEE+LK++PN+C Y   SL+ RQD++V  VPKLGKEAA KAIKEWG+P S+ITHL
Sbjct  68    RYMYLTEEILKENPNVCAYMAPSLDARQDMVVVEVPKLGKEAATKAIKEWGQPKSKITHL  127

Query  480   VFCTTSGVDMPGADFQLTKLLGLNSSVKRLMMYQQGCNAGAAMLRLAKDLAENNKGARVL  659
             VFCTTSGVDMPGAD+QLTKLLGL  SVKRLMMYQQGC AG  +LRLAKDLAENNKGARVL
Sbjct  128   VFCTTSGVDMPGADYQLTKLLGLRPSVKRLMMYQQGCFAGGTVLRLAKDLAENNKGARVL  187

Query  660   VVCSEVMLSVFRGPSLQQEDNLLAQCLFGDGSAAVIVGTEPRPGLETPLFELVSSAQTII  839
             VVCSE+    FRGPS    D+L+ Q LFGDG+AA+IVG++P P +E PLFELVS+AQTI+
Sbjct  188   VVCSEITAVTFRGPSDAHLDSLVGQALFGDGAAAIIVGSDPIPEVEKPLFELVSAAQTIL  247

Query  840   PDTDSHLKLQLREMGLTFHCSKAVPSLITQNVEDCLVKAFEPFGISDWNSIFWILHPGGN  1019
             PD+D  +   LRE+GLTFH  K VP LI++NVE  L +AF+P  I+DWNS+FWI HPGG 
Sbjct  248   PDSDGAIDGHLREVGLTFHLLKDVPGLISKNVEKSLNEAFQPLNITDWNSLFWIAHPGGP  307

Query  1020  AILDGVEEKLGLDPEKLRASRDVLSQYGNLTSACVLFILDEVRKKSKKQQQMTTGEGLEW  1199
             AILD VE KL L PEKLRA+R VLS+YGN++SACVLFILDE+RK S K+   TTGEGLEW
Sbjct  308   AILDQVELKLALKPEKLRATRHVLSEYGNMSSACVLFILDEMRKSSAKEGLKTTGEGLEW  367

Query  1200  GVLFGFGPGLTIDTVVIRSV  1259
             GVLFGFGPGLT++TVV+ S+
Sbjct  368   GVLFGFGPGLTVETVVLHSL  387



>gb|AFC37242.1| chalcone synthase 1 [Camellia chekiangoleosa]
Length=389

 Score =   553 bits (1425),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 263/380 (69%), Positives = 313/380 (82%), Gaps = 0/380 (0%)
 Frame = +3

Query  120   HRAKRLEGDAKILAIGTATPANWVDQTTYPDFYFRITNSQHLLEHKEKFRRICNKSKIMK  299
              RA+R EG A ++AIGTATP N VDQ+TYPD+YFRITNS+H  E KEKF+R+C+KS I K
Sbjct  8     RRAQRAEGPATVMAIGTATPPNCVDQSTYPDYYFRITNSEHKAELKEKFKRMCDKSMIKK  67

Query  300   RHLVLTEELLKKHPNLCTYNEASLNTRQDILVSGVPKLGKEAAMKAIKEWGRPISEITHL  479
             R++ LTEE+LK++P +C Y   SL+ RQD++V  VPKLGKEAA KAIKEWG+P S+ITHL
Sbjct  68    RYMYLTEEILKENPQVCEYMAPSLDARQDMVVVEVPKLGKEAATKAIKEWGQPKSKITHL  127

Query  480   VFCTTSGVDMPGADFQLTKLLGLNSSVKRLMMYQQGCNAGAAMLRLAKDLAENNKGARVL  659
             VFCTTSGVDMPGAD+QLTKLLGL  SVKRLMMYQQGC AG  +LRLAKDLAENNKGARVL
Sbjct  128   VFCTTSGVDMPGADYQLTKLLGLRPSVKRLMMYQQGCFAGGTVLRLAKDLAENNKGARVL  187

Query  660   VVCSEVMLSVFRGPSLQQEDNLLAQCLFGDGSAAVIVGTEPRPGLETPLFELVSSAQTII  839
             VVCSE+    FRGPS    D+L+ Q LFGDG+AA+IVG++P P +E PLFELVS+AQTI+
Sbjct  188   VVCSEITAVTFRGPSDTHLDSLVGQALFGDGAAAIIVGSDPIPEIEKPLFELVSAAQTIL  247

Query  840   PDTDSHLKLQLREMGLTFHCSKAVPSLITQNVEDCLVKAFEPFGISDWNSIFWILHPGGN  1019
             PD+D  +   LRE+GLTFH  K VP LI++N+E  L +AF+P GISDWNS+FWI HPGG 
Sbjct  248   PDSDGAIDGHLREVGLTFHLLKDVPGLISKNIEKSLAEAFQPLGISDWNSLFWIAHPGGP  307

Query  1020  AILDGVEEKLGLDPEKLRASRDVLSQYGNLTSACVLFILDEVRKKSKKQQQMTTGEGLEW  1199
             AILD VE KLGL  EKLRA+R VLS+YGN++SACVLFILDE+RKKS      TTGEGLEW
Sbjct  308   AILDQVELKLGLKEEKLRATRHVLSEYGNMSSACVLFILDEMRKKSAADGLKTTGEGLEW  367

Query  1200  GVLFGFGPGLTIDTVVIRSV  1259
             GVLFGFGPGLT++TVV+ S+
Sbjct  368   GVLFGFGPGLTVETVVLHSL  387



>gb|AEO96985.1| chalcone synthase [Gossypium hirsutum]
Length=389

 Score =   553 bits (1424),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 261/380 (69%), Positives = 313/380 (82%), Gaps = 0/380 (0%)
 Frame = +3

Query  120   HRAKRLEGDAKILAIGTATPANWVDQTTYPDFYFRITNSQHLLEHKEKFRRICNKSKIMK  299
              +A+R EG A +LAIGT+TP N VDQ+TYPD+YFRITNS+H  E KEKF+R+C KS I K
Sbjct  8     RKAQRAEGPATVLAIGTSTPPNCVDQSTYPDYYFRITNSEHKTELKEKFKRMCEKSMIKK  67

Query  300   RHLVLTEELLKKHPNLCTYNEASLNTRQDILVSGVPKLGKEAAMKAIKEWGRPISEITHL  479
             R++ LTEE+LK++PN+C Y   SL+ RQD++V  VP+LGKEAA KAIKEWG+P S+ITHL
Sbjct  68    RYMYLTEEILKENPNVCEYMAPSLDARQDMVVVEVPRLGKEAATKAIKEWGQPKSKITHL  127

Query  480   VFCTTSGVDMPGADFQLTKLLGLNSSVKRLMMYQQGCNAGAAMLRLAKDLAENNKGARVL  659
             VFCTTSGVDMPGAD+QLTKLLGL  SVKRLMMYQQGC AG  +LR+AKDLAENNKGARVL
Sbjct  128   VFCTTSGVDMPGADYQLTKLLGLRPSVKRLMMYQQGCFAGGTVLRVAKDLAENNKGARVL  187

Query  660   VVCSEVMLSVFRGPSLQQEDNLLAQCLFGDGSAAVIVGTEPRPGLETPLFELVSSAQTII  839
             VVCSE+    FRGPS    D+L+ Q LFGDG+AAVIVG +P   +E P+FELVS+AQTI+
Sbjct  188   VVCSEITAVTFRGPSDTHLDSLVGQALFGDGAAAVIVGADPLSEIEKPMFELVSAAQTIL  247

Query  840   PDTDSHLKLQLREMGLTFHCSKAVPSLITQNVEDCLVKAFEPFGISDWNSIFWILHPGGN  1019
             PD+D  +   LRE+GLTFH  K VP LI++N+E  L +AF+P GISDWNS+FWI HPGG 
Sbjct  248   PDSDGAIDGHLREVGLTFHLLKDVPGLISKNIEKSLAEAFQPLGISDWNSLFWIAHPGGP  307

Query  1020  AILDGVEEKLGLDPEKLRASRDVLSQYGNLTSACVLFILDEVRKKSKKQQQMTTGEGLEW  1199
             AILD VE KL L PEKLRA+R VLS+YGN++SACVLFILDE+RKKSK+    TTGEGLEW
Sbjct  308   AILDQVEAKLALKPEKLRATRHVLSEYGNMSSACVLFILDEMRKKSKEDGLGTTGEGLEW  367

Query  1200  GVLFGFGPGLTIDTVVIRSV  1259
             GVLFGFGPGLT++TVV+ S+
Sbjct  368   GVLFGFGPGLTVETVVLHSI  387



>gb|AGV53049.1| chalcone synthase [Actinidia chinensis]
Length=389

 Score =   553 bits (1424),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 262/380 (69%), Positives = 313/380 (82%), Gaps = 0/380 (0%)
 Frame = +3

Query  120   HRAKRLEGDAKILAIGTATPANWVDQTTYPDFYFRITNSQHLLEHKEKFRRICNKSKIMK  299
              RA+R EG A I+AIGT+TP N VDQ+ YPD+YFRITNS+H  E KEKFRR+C KS I  
Sbjct  8     RRAQRAEGLATIMAIGTSTPPNCVDQSEYPDYYFRITNSEHKTELKEKFRRMCEKSMIKM  67

Query  300   RHLVLTEELLKKHPNLCTYNEASLNTRQDILVSGVPKLGKEAAMKAIKEWGRPISEITHL  479
             R++ LTEE+LK++PN+C Y   SL+ RQD++V  +PKLGKEAA+KAIKEWG+P S+ITHL
Sbjct  68    RYMYLTEEILKENPNVCAYMAPSLDARQDMVVVEIPKLGKEAAVKAIKEWGQPKSKITHL  127

Query  480   VFCTTSGVDMPGADFQLTKLLGLNSSVKRLMMYQQGCNAGAAMLRLAKDLAENNKGARVL  659
             VFCTTSGVDMPGAD+QLTKLLGL  SVKRLMMYQQGC AG  +LRLAKDLAENNKGARVL
Sbjct  128   VFCTTSGVDMPGADYQLTKLLGLRPSVKRLMMYQQGCFAGGTVLRLAKDLAENNKGARVL  187

Query  660   VVCSEVMLSVFRGPSLQQEDNLLAQCLFGDGSAAVIVGTEPRPGLETPLFELVSSAQTII  839
             VVCSE+    FRGPS    D+L+ Q LFGDG+AAVIVG +P P +E P+FELVS+AQTI+
Sbjct  188   VVCSEITAVTFRGPSDTHLDSLVGQALFGDGAAAVIVGADPIPEVEKPMFELVSAAQTIL  247

Query  840   PDTDSHLKLQLREMGLTFHCSKAVPSLITQNVEDCLVKAFEPFGISDWNSIFWILHPGGN  1019
             PD+D  +   LRE+GLTFH  K VP LI++N+E  L +AF+P GISDWNS+FWI HPGG 
Sbjct  248   PDSDGAIDGHLREVGLTFHLLKDVPGLISKNIEKSLAEAFKPLGISDWNSLFWIAHPGGP  307

Query  1020  AILDGVEEKLGLDPEKLRASRDVLSQYGNLTSACVLFILDEVRKKSKKQQQMTTGEGLEW  1199
             AILD VE+KL L PEKLRA+R VLS+YGN++SACVLFILDE+RKKS +    TTGEGLEW
Sbjct  308   AILDQVEQKLALKPEKLRATRHVLSEYGNMSSACVLFILDEMRKKSAEDGLKTTGEGLEW  367

Query  1200  GVLFGFGPGLTIDTVVIRSV  1259
             GVLFGFGPGLT++TVV+ S+
Sbjct  368   GVLFGFGPGLTVETVVLHSL  387



>dbj|BAI66465.1| chalcone synthase [Camellia japonica]
 gb|ADZ28512.1| chalcone synthase [Camellia nitidissima]
Length=389

 Score =   553 bits (1424),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 263/380 (69%), Positives = 313/380 (82%), Gaps = 0/380 (0%)
 Frame = +3

Query  120   HRAKRLEGDAKILAIGTATPANWVDQTTYPDFYFRITNSQHLLEHKEKFRRICNKSKIMK  299
              RA+R EG A ++AIGTATP N VDQ+TYPD+YFRITNS+H  E KEKF+R+C+KS I K
Sbjct  8     RRAQRAEGPATVMAIGTATPPNCVDQSTYPDYYFRITNSEHKAELKEKFKRMCDKSMIKK  67

Query  300   RHLVLTEELLKKHPNLCTYNEASLNTRQDILVSGVPKLGKEAAMKAIKEWGRPISEITHL  479
             R++ LTEE+LK++P +C Y   SL+ RQD++V  VPKLGKEAA KAIKEWG+P S+ITHL
Sbjct  68    RYMYLTEEILKENPQVCEYMAPSLDARQDMVVVEVPKLGKEAATKAIKEWGQPKSKITHL  127

Query  480   VFCTTSGVDMPGADFQLTKLLGLNSSVKRLMMYQQGCNAGAAMLRLAKDLAENNKGARVL  659
             VFCTTSGVDMPGAD+QLTKLLGL  SVKRLMMYQQGC AG  +LRLAKDLAENNKGARVL
Sbjct  128   VFCTTSGVDMPGADYQLTKLLGLRPSVKRLMMYQQGCFAGGTVLRLAKDLAENNKGARVL  187

Query  660   VVCSEVMLSVFRGPSLQQEDNLLAQCLFGDGSAAVIVGTEPRPGLETPLFELVSSAQTII  839
             VVCSE+    FRGPS    D+L+ Q LFGDG+AA+IVG++P P +E PLFELVS+AQTI+
Sbjct  188   VVCSEITAVTFRGPSDTHLDSLVGQALFGDGAAAIIVGSDPIPEVEKPLFELVSAAQTIL  247

Query  840   PDTDSHLKLQLREMGLTFHCSKAVPSLITQNVEDCLVKAFEPFGISDWNSIFWILHPGGN  1019
             PD+D  +   LRE+GLTFH  K VP LI++N+E  L +AF+P GISDWNS+FWI HPGG 
Sbjct  248   PDSDGAIDGHLREVGLTFHLLKDVPGLISKNIEKSLAEAFQPLGISDWNSLFWIAHPGGP  307

Query  1020  AILDGVEEKLGLDPEKLRASRDVLSQYGNLTSACVLFILDEVRKKSKKQQQMTTGEGLEW  1199
             AILD VE KLGL  EKLRA+R VLS+YGN++SACVLFILDE+RKKS      TTGEGLEW
Sbjct  308   AILDQVELKLGLKEEKLRATRHVLSEYGNMSSACVLFILDEMRKKSAADGLKTTGEGLEW  367

Query  1200  GVLFGFGPGLTIDTVVIRSV  1259
             GVLFGFGPGLT++TVV+ S+
Sbjct  368   GVLFGFGPGLTVETVVLHSL  387



>sp|P48386.1|CHS1_CAMSI RecName: Full=Chalcone synthase 1; AltName: Full=Naringenin-chalcone 
synthase 1 [Camellia sinensis]
 dbj|BAA05640.1| chalcone synthase [Camellia sinensis]
 gb|AGI02992.1| chalcone synthase [Camellia sinensis]
Length=389

 Score =   553 bits (1424),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 263/380 (69%), Positives = 313/380 (82%), Gaps = 0/380 (0%)
 Frame = +3

Query  120   HRAKRLEGDAKILAIGTATPANWVDQTTYPDFYFRITNSQHLLEHKEKFRRICNKSKIMK  299
              RA+R EG A ++AIGTATP N VDQ+TYPD+YFRITNS+H  E KEKF+R+C+KS I K
Sbjct  8     RRAQRAEGPATVMAIGTATPPNCVDQSTYPDYYFRITNSEHKAELKEKFKRMCDKSMIKK  67

Query  300   RHLVLTEELLKKHPNLCTYNEASLNTRQDILVSGVPKLGKEAAMKAIKEWGRPISEITHL  479
             R++ LTEE+LK++P +C Y   SL+ RQD++V  VPKLGKEAA KAIKEWG+P S+ITHL
Sbjct  68    RYMYLTEEILKENPQVCEYMAPSLDARQDMVVVEVPKLGKEAATKAIKEWGQPKSKITHL  127

Query  480   VFCTTSGVDMPGADFQLTKLLGLNSSVKRLMMYQQGCNAGAAMLRLAKDLAENNKGARVL  659
             VFCTTSGVDMPGAD+QLTKLLGL  SVKRLMMYQQGC AG  +LRLAKDLAENNKGARVL
Sbjct  128   VFCTTSGVDMPGADYQLTKLLGLRPSVKRLMMYQQGCFAGGTVLRLAKDLAENNKGARVL  187

Query  660   VVCSEVMLSVFRGPSLQQEDNLLAQCLFGDGSAAVIVGTEPRPGLETPLFELVSSAQTII  839
             VVCSE+    FRGPS    D+L+ Q LFGDG+AA+IVG++P P +E PLFELVS+AQTI+
Sbjct  188   VVCSEITAVTFRGPSDTHLDSLVGQALFGDGAAAIIVGSDPIPEVEKPLFELVSAAQTIL  247

Query  840   PDTDSHLKLQLREMGLTFHCSKAVPSLITQNVEDCLVKAFEPFGISDWNSIFWILHPGGN  1019
             PD+D  +   LRE+GLTFH  K VP LI++N+E  L +AF+P GISDWNS+FWI HPGG 
Sbjct  248   PDSDGAIDGHLREVGLTFHLLKDVPGLISKNIEKSLAEAFQPLGISDWNSLFWIAHPGGP  307

Query  1020  AILDGVEEKLGLDPEKLRASRDVLSQYGNLTSACVLFILDEVRKKSKKQQQMTTGEGLEW  1199
             AILD VE KLGL  EKLRA+R VLS+YGN++SACVLFILDE+RKKS      TTGEGLEW
Sbjct  308   AILDQVELKLGLKEEKLRATRHVLSEYGNMSSACVLFILDEMRKKSAADGLKTTGEGLEW  367

Query  1200  GVLFGFGPGLTIDTVVIRSV  1259
             GVLFGFGPGLT++TVV+ S+
Sbjct  368   GVLFGFGPGLTVETVVLHSL  387



>gb|AAL67805.1|AF461105_1 chalcone synthase [Hypericum perforatum]
Length=389

 Score =   553 bits (1424),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 258/380 (68%), Positives = 316/380 (83%), Gaps = 0/380 (0%)
 Frame = +3

Query  120   HRAKRLEGDAKILAIGTATPANWVDQTTYPDFYFRITNSQHLLEHKEKFRRICNKSKIMK  299
              +A+R EG A ++AIGTA P N VDQ TYPD+YFRITNS+H  E KEKF+R+C+KS+I K
Sbjct  8     RKAQRAEGPATVMAIGTAVPPNCVDQATYPDYYFRITNSEHKAELKEKFQRMCDKSQIKK  67

Query  300   RHLVLTEELLKKHPNLCTYNEASLNTRQDILVSGVPKLGKEAAMKAIKEWGRPISEITHL  479
             R++ L EE+LK++PN+C Y   SL+ RQDI+V  VPKLGKEAA+KAIKEWG+P S+ITHL
Sbjct  68    RYMYLNEEILKENPNMCAYMAPSLDARQDIVVVEVPKLGKEAAVKAIKEWGQPKSKITHL  127

Query  480   VFCTTSGVDMPGADFQLTKLLGLNSSVKRLMMYQQGCNAGAAMLRLAKDLAENNKGARVL  659
             VFCTTSGVDMPGAD+QLTKLLGL  SVKRLMMYQQGC AG  +LRLAKDLAENNKGARVL
Sbjct  128   VFCTTSGVDMPGADYQLTKLLGLRPSVKRLMMYQQGCFAGGTVLRLAKDLAENNKGARVL  187

Query  660   VVCSEVMLSVFRGPSLQQEDNLLAQCLFGDGSAAVIVGTEPRPGLETPLFELVSSAQTII  839
             VVCSE+    FRGP+    D+L+ Q LFGDG+A++I+G++P P +E PLFELVS++QTI+
Sbjct  188   VVCSEITAVTFRGPTDTHLDSLVGQALFGDGAASIIIGSDPIPEVEKPLFELVSASQTIL  247

Query  840   PDTDSHLKLQLREMGLTFHCSKAVPSLITQNVEDCLVKAFEPFGISDWNSIFWILHPGGN  1019
             PD++  +   +RE+GLTFH  K VP LI++NVE  L +AF+P GISDWNS+FWI HPGG 
Sbjct  248   PDSEGAIDGHIREVGLTFHLLKDVPGLISKNVEKSLTEAFKPLGISDWNSLFWIAHPGGP  307

Query  1020  AILDGVEEKLGLDPEKLRASRDVLSQYGNLTSACVLFILDEVRKKSKKQQQMTTGEGLEW  1199
             AILD VEEKL L PEKLRA+R VLS+YGN++SACVLFILDE+R+KSK+    TTGEG+EW
Sbjct  308   AILDQVEEKLSLKPEKLRATRHVLSEYGNMSSACVLFILDEMRRKSKEDGLKTTGEGIEW  367

Query  1200  GVLFGFGPGLTIDTVVIRSV  1259
             GVLFGFGPGLT++TVV+ SV
Sbjct  368   GVLFGFGPGLTVETVVLHSV  387



>sp|P48387.1|CHS2_CAMSI RecName: Full=Chalcone synthase 2; AltName: Full=Naringenin-chalcone 
synthase 2 [Camellia sinensis]
 dbj|BAA05641.1| chalcone synthase [Camellia sinensis]
 gb|AGI02995.1| chalcone synthase [Camellia sinensis]
Length=389

 Score =   553 bits (1424),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 262/380 (69%), Positives = 314/380 (83%), Gaps = 0/380 (0%)
 Frame = +3

Query  120   HRAKRLEGDAKILAIGTATPANWVDQTTYPDFYFRITNSQHLLEHKEKFRRICNKSKIMK  299
              RA+R EG A ++AIGTATP N VDQ+TYPD+YFRITNS+H  E KEKF+R+C+KS I K
Sbjct  8     RRAQRAEGPATVMAIGTATPPNCVDQSTYPDYYFRITNSEHKTELKEKFQRMCDKSMIKK  67

Query  300   RHLVLTEELLKKHPNLCTYNEASLNTRQDILVSGVPKLGKEAAMKAIKEWGRPISEITHL  479
             R++ LTEE+LK++PN+C Y   SL+ RQD++V  VPKLGKEAA KAIKEWG+P S+ITHL
Sbjct  68    RYMYLTEEILKENPNVCAYMAPSLDARQDMVVVEVPKLGKEAATKAIKEWGQPKSKITHL  127

Query  480   VFCTTSGVDMPGADFQLTKLLGLNSSVKRLMMYQQGCNAGAAMLRLAKDLAENNKGARVL  659
             VFCTTSGVDMPGAD+QLTKLLGL  SVKRLMMYQQGC AG  +LRLAKDLAENNKGARVL
Sbjct  128   VFCTTSGVDMPGADYQLTKLLGLRPSVKRLMMYQQGCFAGGTVLRLAKDLAENNKGARVL  187

Query  660   VVCSEVMLSVFRGPSLQQEDNLLAQCLFGDGSAAVIVGTEPRPGLETPLFELVSSAQTII  839
             VVCSE+    FRGPS    D+L+ Q LFGDG+AA+IVG++P P +E PLFELVS+AQTI+
Sbjct  188   VVCSEITAVTFRGPSDAHLDSLVGQALFGDGAAAIIVGSDPIPEVEKPLFELVSAAQTIL  247

Query  840   PDTDSHLKLQLREMGLTFHCSKAVPSLITQNVEDCLVKAFEPFGISDWNSIFWILHPGGN  1019
             PD+D  +   LRE+GLTFH  K VP LI++N+E  L +AF+P  I+DWNS+FWI HPGG 
Sbjct  248   PDSDGAIDGHLREVGLTFHLLKDVPGLISKNIEKSLNEAFQPLNITDWNSLFWIAHPGGP  307

Query  1020  AILDGVEEKLGLDPEKLRASRDVLSQYGNLTSACVLFILDEVRKKSKKQQQMTTGEGLEW  1199
             AILD VE KL L PEKLRA+R VLS+YGN++SACVLFILDE+RK S K+   TTGEGL+W
Sbjct  308   AILDQVELKLALKPEKLRATRHVLSEYGNMSSACVLFILDEMRKSSAKKGLKTTGEGLDW  367

Query  1200  GVLFGFGPGLTIDTVVIRSV  1259
             GVLFGFGPGLT++TVV+ SV
Sbjct  368   GVLFGFGPGLTVETVVLHSV  387



>sp|Q9FSB8.1|CHS2_RUTGR RecName: Full=Chalcone synthase 2; AltName: Full=Naringenin-chalcone 
synthase 2 [Ruta graveolens]
 emb|CAC14060.1| putative chalcone synthase [Ruta graveolens]
Length=393

 Score =   553 bits (1424),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 258/383 (67%), Positives = 315/383 (82%), Gaps = 0/383 (0%)
 Frame = +3

Query  120   HRAKRLEGDAKILAIGTATPANWVDQTTYPDFYFRITNSQHLLEHKEKFRRICNKSKIMK  299
              +A+R +G A +LAIGTATPAN+V Q  YPD+YFRIT S+H+ E KEKF+R+C+KS I K
Sbjct  10    RKAQRADGPAAVLAIGTATPANYVTQADYPDYYFRITKSEHMTELKEKFKRMCDKSMIRK  69

Query  300   RHLVLTEELLKKHPNLCTYNEASLNTRQDILVSGVPKLGKEAAMKAIKEWGRPISEITHL  479
             R++ LTE++LK++PN+C Y   SL+ RQDI+V  VPKLGKEAA+KAIKEWG+P S+ITHL
Sbjct  70    RYMYLTEDILKENPNMCAYMAPSLDARQDIVVVEVPKLGKEAAVKAIKEWGQPKSKITHL  129

Query  480   VFCTTSGVDMPGADFQLTKLLGLNSSVKRLMMYQQGCNAGAAMLRLAKDLAENNKGARVL  659
             +FCTTSGVDMPG D+QLTKLLGL  SVKR MMYQQGC AG  +LRLAKDLAENN+GARVL
Sbjct  130   IFCTTSGVDMPGCDYQLTKLLGLRPSVKRFMMYQQGCFAGGTVLRLAKDLAENNRGARVL  189

Query  660   VVCSEVMLSVFRGPSLQQEDNLLAQCLFGDGSAAVIVGTEPRPGLETPLFELVSSAQTII  839
             VVCSE+    FRGP+    D+L+ Q LFGDG+AAVIVG +P   +E PL++LVS+AQTI+
Sbjct  190   VVCSEITAVTFRGPADTHLDSLVGQALFGDGAAAVIVGADPNESIERPLYQLVSAAQTIL  249

Query  840   PDTDSHLKLQLREMGLTFHCSKAVPSLITQNVEDCLVKAFEPFGISDWNSIFWILHPGGN  1019
             PD+D  +   LRE+GLTFH  K VP LI++N+E  L +AF P GISDWNSIFWI HPGG 
Sbjct  250   PDSDGAIDGHLREVGLTFHLLKDVPGLISKNIEKSLKEAFGPIGISDWNSIFWIAHPGGP  309

Query  1020  AILDGVEEKLGLDPEKLRASRDVLSQYGNLTSACVLFILDEVRKKSKKQQQMTTGEGLEW  1199
             AILD VE KLGL  EKLRA+R VLS+YGN++SACVLFILDE+RKK  ++ + TTGEGL+W
Sbjct  310   AILDQVEAKLGLKEEKLRATRQVLSEYGNMSSACVLFILDEMRKKCAEEGRATTGEGLDW  369

Query  1200  GVLFGFGPGLTIDTVVIRSVPIN  1268
             GVLFGFGPGLT++TVV+RSVPIN
Sbjct  370   GVLFGFGPGLTVETVVLRSVPIN  392



>gb|AEJ88217.1| chalcone synthase [Prunus persica]
Length=391

 Score =   552 bits (1423),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 259/383 (68%), Positives = 317/383 (83%), Gaps = 0/383 (0%)
 Frame = +3

Query  120   HRAKRLEGDAKILAIGTATPANWVDQTTYPDFYFRITNSQHLLEHKEKFRRICNKSKIMK  299
              +A+R EG A +LAIGTATP N VDQ TYPD+YFRITNS+H  E KEKF+R+C+KS I K
Sbjct  8     RKAQRAEGPATVLAIGTATPPNCVDQATYPDYYFRITNSEHKTELKEKFQRMCDKSMIKK  67

Query  300   RHLVLTEELLKKHPNLCTYNEASLNTRQDILVSGVPKLGKEAAMKAIKEWGRPISEITHL  479
             R++ LTEE+LK++P++C Y   SL+ RQD++V  +PKLGKEAA KAIKEWG+P S+ITHL
Sbjct  68    RYMYLTEEILKENPSMCEYMAPSLDARQDMVVVEIPKLGKEAATKAIKEWGQPKSKITHL  127

Query  480   VFCTTSGVDMPGADFQLTKLLGLNSSVKRLMMYQQGCNAGAAMLRLAKDLAENNKGARVL  659
             VFCTTSGVDMPGAD+QLTKLLGL SSVKRLMMYQQGC AG  +LRLAKDLAENN+GARVL
Sbjct  128   VFCTTSGVDMPGADYQLTKLLGLRSSVKRLMMYQQGCFAGGTVLRLAKDLAENNRGARVL  187

Query  660   VVCSEVMLSVFRGPSLQQEDNLLAQCLFGDGSAAVIVGTEPRPGLETPLFELVSSAQTII  839
             VVCSE+    FRGPS    D+L+ Q LFGDG+AA+IVG++P P +E PLFE+VS+AQTI+
Sbjct  188   VVCSEITAVTFRGPSDTHLDSLVGQALFGDGAAAIIVGSDPIPEIEKPLFEVVSAAQTIL  247

Query  840   PDTDSHLKLQLREMGLTFHCSKAVPSLITQNVEDCLVKAFEPFGISDWNSIFWILHPGGN  1019
             PD+D  +   LRE+GLTFH  K VP LI++N+E  L +AF+P GISDWNS+FWI HPGG 
Sbjct  248   PDSDGAIDGHLREVGLTFHLLKDVPGLISKNIEKSLNEAFQPLGISDWNSLFWIAHPGGP  307

Query  1020  AILDGVEEKLGLDPEKLRASRDVLSQYGNLTSACVLFILDEVRKKSKKQQQMTTGEGLEW  1199
             AILD VE KL L PEKL A+R +LS+YGN++SACVLFILDEVRK++ K+   TTG+GL+W
Sbjct  308   AILDQVESKLALKPEKLEATRHILSEYGNMSSACVLFILDEVRKRATKKGLKTTGDGLDW  367

Query  1200  GVLFGFGPGLTIDTVVIRSVPIN  1268
             GVLFGFGPGLT++TVV+ SV +N
Sbjct  368   GVLFGFGPGLTVETVVLHSVGLN  390



>ref|XP_008380609.1| PREDICTED: polyketide synthase 5 [Malus domestica]
 gb|AAX16492.1| chalcone synthase [Malus domestica]
 gb|ACJ54530.1| chalcone synthase [Malus domestica]
Length=391

 Score =   552 bits (1423),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 261/380 (69%), Positives = 314/380 (83%), Gaps = 0/380 (0%)
 Frame = +3

Query  120   HRAKRLEGDAKILAIGTATPANWVDQTTYPDFYFRITNSQHLLEHKEKFRRICNKSKIMK  299
              +A+R EG A ++AIGTATP+N VDQ TYPD+YFRITNS+H +E KEKF+R+C+KS I K
Sbjct  8     RKAQRAEGPATVMAIGTATPSNCVDQATYPDYYFRITNSEHKVELKEKFQRMCDKSMIKK  67

Query  300   RHLVLTEELLKKHPNLCTYNEASLNTRQDILVSGVPKLGKEAAMKAIKEWGRPISEITHL  479
             R++ LTEE+LK++P++C Y   S++ RQD++V  VPKLGKEAA KAIKEWG+P S+ITHL
Sbjct  68    RYMYLTEEILKENPSVCEYMAPSIDARQDMVVVEVPKLGKEAATKAIKEWGQPKSKITHL  127

Query  480   VFCTTSGVDMPGADFQLTKLLGLNSSVKRLMMYQQGCNAGAAMLRLAKDLAENNKGARVL  659
             VFCTTSGVDMPGAD+QLTKLLGL  SVKRLMMYQQGC AG  +LRLAKDLAENNKGARVL
Sbjct  128   VFCTTSGVDMPGADYQLTKLLGLRPSVKRLMMYQQGCFAGGTVLRLAKDLAENNKGARVL  187

Query  660   VVCSEVMLSVFRGPSLQQEDNLLAQCLFGDGSAAVIVGTEPRPGLETPLFELVSSAQTII  839
             VVCSE+    FRGPS    D+L+ Q LFGDG+AAVI+G +P P +E PLFELVS+AQTI+
Sbjct  188   VVCSEITAVTFRGPSDTHLDSLVGQALFGDGAAAVIIGADPVPEVEKPLFELVSAAQTIL  247

Query  840   PDTDSHLKLQLREMGLTFHCSKAVPSLITQNVEDCLVKAFEPFGISDWNSIFWILHPGGN  1019
             PD+D  +   LRE+GLTFH  K VP LI++N+E  L +AF+P GISDWNS+FWI HPGG 
Sbjct  248   PDSDGAIDGHLREVGLTFHLLKDVPGLISKNIEKSLNEAFKPIGISDWNSLFWIAHPGGP  307

Query  1020  AILDGVEEKLGLDPEKLRASRDVLSQYGNLTSACVLFILDEVRKKSKKQQQMTTGEGLEW  1199
             AILD VE KL L PEKL A+R VLS YGN++SACVLFILDEVR+KS ++   TTGEGLEW
Sbjct  308   AILDQVEAKLALKPEKLEATRQVLSDYGNMSSACVLFILDEVRRKSAEKGLKTTGEGLEW  367

Query  1200  GVLFGFGPGLTIDTVVIRSV  1259
             GVLFGFGPGLT++TVV+ SV
Sbjct  368   GVLFGFGPGLTVETVVLHSV  387



>gb|ADD74167.1| chalcone synthase [Nelumbo nucifera]
Length=389

 Score =   552 bits (1423),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 262/379 (69%), Positives = 313/379 (83%), Gaps = 0/379 (0%)
 Frame = +3

Query  123   RAKRLEGDAKILAIGTATPANWVDQTTYPDFYFRITNSQHLLEHKEKFRRICNKSKIMKR  302
             +A+R EG A ++AIGTA P N VDQ+TYPD+YFRITNS+H  E KEKF+R+C KS I KR
Sbjct  9     KAQRAEGPATVMAIGTANPPNCVDQSTYPDYYFRITNSEHKTELKEKFKRMCEKSMIKKR  68

Query  303   HLVLTEELLKKHPNLCTYNEASLNTRQDILVSGVPKLGKEAAMKAIKEWGRPISEITHLV  482
             ++ LTEE+LK++PN+C Y  +SL+ RQD++V  VPKLGKEAA KAIKEWG+P S+ITHLV
Sbjct  69    YMHLTEEILKENPNICEYMASSLDARQDMVVVEVPKLGKEAATKAIKEWGQPKSKITHLV  128

Query  483   FCTTSGVDMPGADFQLTKLLGLNSSVKRLMMYQQGCNAGAAMLRLAKDLAENNKGARVLV  662
             FCTTSGVDMPGAD+QLTKLLGL  SVKRLMMYQQGC AG  +LRLAKDLAENN+GARVLV
Sbjct  129   FCTTSGVDMPGADYQLTKLLGLRPSVKRLMMYQQGCFAGGTVLRLAKDLAENNRGARVLV  188

Query  663   VCSEVMLSVFRGPSLQQEDNLLAQCLFGDGSAAVIVGTEPRPGLETPLFELVSSAQTIIP  842
             VCSE+    FRGPS    D+L+ Q LFGDG+AAVIVG +P PG+E PLFELVS+AQTI+P
Sbjct  189   VCSELTAVTFRGPSDTHLDSLVGQALFGDGAAAVIVGADPVPGVEKPLFELVSAAQTILP  248

Query  843   DTDSHLKLQLREMGLTFHCSKAVPSLITQNVEDCLVKAFEPFGISDWNSIFWILHPGGNA  1022
             D+   +   LRE+GLTFH  K VP LI++N+E  LV+AF+P GISDWNSIFWI HPGG A
Sbjct  249   DSHGAIDGHLREVGLTFHLLKDVPGLISKNIEKSLVEAFQPLGISDWNSIFWIAHPGGPA  308

Query  1023  ILDGVEEKLGLDPEKLRASRDVLSQYGNLTSACVLFILDEVRKKSKKQQQMTTGEGLEWG  1202
             ILD VEEKL L PEKL  +R +LS+YGN++SACVLFILDE+RKKS +    TTGEGLEWG
Sbjct  309   ILDQVEEKLALKPEKLSPTRHILSEYGNMSSACVLFILDEMRKKSIEDGLKTTGEGLEWG  368

Query  1203  VLFGFGPGLTIDTVVIRSV  1259
             VLFGFGPGLT++TVV+ S+
Sbjct  369   VLFGFGPGLTVETVVLHSI  387



>sp|O04111.1|CHSY_PERFR RecName: Full=Chalcone synthase; AltName: Full=Naringenin-chalcone 
synthase [Perilla frutescens]
 dbj|BAA19656.1| chalcone synthase [Perilla frutescens]
Length=391

 Score =   552 bits (1423),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 261/383 (68%), Positives = 312/383 (81%), Gaps = 0/383 (0%)
 Frame = +3

Query  120   HRAKRLEGDAKILAIGTATPANWVDQTTYPDFYFRITNSQHLLEHKEKFRRICNKSKIMK  299
              RA+R EG A ++AIGTATP N VDQ+TYPD+YFRITNS+H  + KEKF+R+C KS I K
Sbjct  8     RRAQRAEGPATVMAIGTATPENCVDQSTYPDYYFRITNSEHRTDLKEKFKRMCEKSMIRK  67

Query  300   RHLVLTEELLKKHPNLCTYNEASLNTRQDILVSGVPKLGKEAAMKAIKEWGRPISEITHL  479
             R++ LTEE LK++PN+  Y   SL+ RQDI+V  VPKLGKEAA KAIKEWG+P S+ITHL
Sbjct  68    RYMHLTEEFLKENPNMTAYMAPSLDARQDIVVVEVPKLGKEAAQKAIKEWGQPKSKITHL  127

Query  480   VFCTTSGVDMPGADFQLTKLLGLNSSVKRLMMYQQGCNAGAAMLRLAKDLAENNKGARVL  659
             VFCTTSGVDMPGAD+QLTKLLGL  SVKR MMYQQGC AG  +LR+AKDLAENN GARVL
Sbjct  128   VFCTTSGVDMPGADYQLTKLLGLRPSVKRFMMYQQGCFAGGTVLRMAKDLAENNAGARVL  187

Query  660   VVCSEVMLSVFRGPSLQQEDNLLAQCLFGDGSAAVIVGTEPRPGLETPLFELVSSAQTII  839
             VVCSE+    FRGPS    D+L+ Q LFGDG+AAVIVG++P  G+E PLF+LVS+AQTI+
Sbjct  188   VVCSEITAVTFRGPSESHLDSLVGQALFGDGAAAVIVGSDPVVGVERPLFQLVSAAQTIL  247

Query  840   PDTDSHLKLQLREMGLTFHCSKAVPSLITQNVEDCLVKAFEPFGISDWNSIFWILHPGGN  1019
             PD+D  +   LRE+GLTFH  K VP LI++N+E  L +AF P GISDWNS+FWI HPGG 
Sbjct  248   PDSDGAIDGHLREVGLTFHLLKDVPGLISKNIEKSLKEAFGPLGISDWNSVFWIAHPGGP  307

Query  1020  AILDGVEEKLGLDPEKLRASRDVLSQYGNLTSACVLFILDEVRKKSKKQQQMTTGEGLEW  1199
             AILD VE KLGL PEKLR++R VL +YGN++SACVLFILDE+RK S K+   +TGEGL+W
Sbjct  308   AILDQVEAKLGLKPEKLRSTRHVLGEYGNMSSACVLFILDEMRKSSAKEGMSSTGEGLDW  367

Query  1200  GVLFGFGPGLTIDTVVIRSVPIN  1268
             GVLFGFGPGLT++TVV+ SVPIN
Sbjct  368   GVLFGFGPGLTVETVVLHSVPIN  390



>ref|XP_008380608.1| PREDICTED: polyketide synthase 5-like [Malus domestica]
Length=389

 Score =   552 bits (1422),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 262/380 (69%), Positives = 312/380 (82%), Gaps = 0/380 (0%)
 Frame = +3

Query  120   HRAKRLEGDAKILAIGTATPANWVDQTTYPDFYFRITNSQHLLEHKEKFRRICNKSKIMK  299
              +A+R EG A +LAIGTATP+N VDQ TYPD+YFRITNS+H  E KEKF+R+C+KS I K
Sbjct  8     RKAQRAEGPATVLAIGTATPSNCVDQATYPDYYFRITNSEHKTELKEKFQRMCDKSMIKK  67

Query  300   RHLVLTEELLKKHPNLCTYNEASLNTRQDILVSGVPKLGKEAAMKAIKEWGRPISEITHL  479
             R++ LTEE+LK++P +C Y   SL+ RQD++V  VP+LGKEAA KAIKEWG+P S+ITHL
Sbjct  68    RYMYLTEEILKENPTVCEYMAPSLDARQDMVVVEVPRLGKEAATKAIKEWGQPKSKITHL  127

Query  480   VFCTTSGVDMPGADFQLTKLLGLNSSVKRLMMYQQGCNAGAAMLRLAKDLAENNKGARVL  659
             VFCTTSGVDMPGAD+QLTKLLGL  SVKRLMMYQQGC AG  +LRLAKDLAENNKGARVL
Sbjct  128   VFCTTSGVDMPGADYQLTKLLGLRPSVKRLMMYQQGCFAGGTVLRLAKDLAENNKGARVL  187

Query  660   VVCSEVMLSVFRGPSLQQEDNLLAQCLFGDGSAAVIVGTEPRPGLETPLFELVSSAQTII  839
             VVCSE+    FRGPS    D+L+ Q LFGDG+AAVI+G +P P +E PLFELVS+AQTI+
Sbjct  188   VVCSEITAVTFRGPSDTHLDSLVGQALFGDGAAAVIIGADPLPEVEKPLFELVSAAQTIL  247

Query  840   PDTDSHLKLQLREMGLTFHCSKAVPSLITQNVEDCLVKAFEPFGISDWNSIFWILHPGGN  1019
             PD+D  +   LRE+GLTFH  K VP LI++N+E  L +AF+P GISDWNS+FWI HPGG 
Sbjct  248   PDSDGAIDGHLREVGLTFHLLKDVPGLISKNIEKSLNEAFKPIGISDWNSLFWIAHPGGP  307

Query  1020  AILDGVEEKLGLDPEKLRASRDVLSQYGNLTSACVLFILDEVRKKSKKQQQMTTGEGLEW  1199
             AILD VE KL L PEKL A+R VLS YGN++SACVLFILDEVR+KS ++   TTGEGLEW
Sbjct  308   AILDQVESKLALKPEKLEATRQVLSNYGNMSSACVLFILDEVRRKSAEKGLKTTGEGLEW  367

Query  1200  GVLFGFGPGLTIDTVVIRSV  1259
             GVLFGFGPGLT++TVV+ SV
Sbjct  368   GVLFGFGPGLTVETVVLHSV  387



>gb|AGE84303.1| chalcone synthase [Malus domestica]
Length=389

 Score =   552 bits (1422),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 262/380 (69%), Positives = 312/380 (82%), Gaps = 0/380 (0%)
 Frame = +3

Query  120   HRAKRLEGDAKILAIGTATPANWVDQTTYPDFYFRITNSQHLLEHKEKFRRICNKSKIMK  299
              +A+R EG A +LAIGTATP+N VDQ TYPD+YFRITNS+H  E KEKF+R+C+KS I K
Sbjct  8     RKAQRAEGPATVLAIGTATPSNCVDQATYPDYYFRITNSEHKTELKEKFQRMCDKSMIKK  67

Query  300   RHLVLTEELLKKHPNLCTYNEASLNTRQDILVSGVPKLGKEAAMKAIKEWGRPISEITHL  479
             R++ LTEE+LK++P +C Y   SL+ RQD++V  VP+LGKEAA KAIKEWG+P S+ITHL
Sbjct  68    RYMYLTEEILKENPTVCEYMAPSLDARQDMVVVEVPRLGKEAATKAIKEWGQPKSKITHL  127

Query  480   VFCTTSGVDMPGADFQLTKLLGLNSSVKRLMMYQQGCNAGAAMLRLAKDLAENNKGARVL  659
             VFCTTSGVDMPGAD+QLTKLLGL  SVKRLMMYQQGC AG  +LRLAKDLAENNKGARVL
Sbjct  128   VFCTTSGVDMPGADYQLTKLLGLRPSVKRLMMYQQGCFAGGTVLRLAKDLAENNKGARVL  187

Query  660   VVCSEVMLSVFRGPSLQQEDNLLAQCLFGDGSAAVIVGTEPRPGLETPLFELVSSAQTII  839
             VVCSE+    FRGPS    D+L+ Q LFGDG+AAVI+G +P P +E PLFELVS+AQTI+
Sbjct  188   VVCSEITAVTFRGPSDTHLDSLVGQALFGDGAAAVIIGADPLPEVEKPLFELVSAAQTIL  247

Query  840   PDTDSHLKLQLREMGLTFHCSKAVPSLITQNVEDCLVKAFEPFGISDWNSIFWILHPGGN  1019
             PD+D  +   LRE+GLTFH  K VP LI++N+E  L +AF+P GISDWNS+FWI HPGG 
Sbjct  248   PDSDGAIDGHLREVGLTFHLLKDVPGLISKNIEKSLNEAFKPIGISDWNSLFWIAHPGGP  307

Query  1020  AILDGVEEKLGLDPEKLRASRDVLSQYGNLTSACVLFILDEVRKKSKKQQQMTTGEGLEW  1199
             AILD VE KL L PEKL A+R VLS YGN++SACVLFILDEVR+KS ++   TTGEGLEW
Sbjct  308   AILDQVESKLALKPEKLEATRQVLSNYGNMSSACVLFILDEVRRKSTEKGLRTTGEGLEW  367

Query  1200  GVLFGFGPGLTIDTVVIRSV  1259
             GVLFGFGPGLT++TVV+ SV
Sbjct  368   GVLFGFGPGLTVETVVLHSV  387



>gb|AFH68066.1| chalcone synthase [Pyrus pyrifolia]
Length=389

 Score =   552 bits (1422),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 260/380 (68%), Positives = 314/380 (83%), Gaps = 0/380 (0%)
 Frame = +3

Query  120   HRAKRLEGDAKILAIGTATPANWVDQTTYPDFYFRITNSQHLLEHKEKFRRICNKSKIMK  299
              +A+R EG A ++AIGT+TP+N VDQ TYPD+YFRITNS+H +E KEKF+R+C+KS I K
Sbjct  8     RKAQRAEGPATVMAIGTSTPSNCVDQATYPDYYFRITNSEHKVELKEKFQRMCDKSMIKK  67

Query  300   RHLVLTEELLKKHPNLCTYNEASLNTRQDILVSGVPKLGKEAAMKAIKEWGRPISEITHL  479
             R++ LTEE+LK++P++C Y   S++ RQD++V  VPKLGKEAA KAIKEWG+P S+ITHL
Sbjct  68    RYMYLTEEILKENPSVCEYMAPSIDARQDMVVVKVPKLGKEAATKAIKEWGQPKSKITHL  127

Query  480   VFCTTSGVDMPGADFQLTKLLGLNSSVKRLMMYQQGCNAGAAMLRLAKDLAENNKGARVL  659
             VFCTTSGVDMPGAD+QLTKLLGL  SVKRLMMYQQGC AG  +LRLAKDLAENNKGARVL
Sbjct  128   VFCTTSGVDMPGADYQLTKLLGLRPSVKRLMMYQQGCFAGGTVLRLAKDLAENNKGARVL  187

Query  660   VVCSEVMLSVFRGPSLQQEDNLLAQCLFGDGSAAVIVGTEPRPGLETPLFELVSSAQTII  839
             VVCSE+    FRGPS    D+L+ Q LFGDG+AAVI+G +P P +E PLFELVS+AQTI+
Sbjct  188   VVCSEITAVTFRGPSDTHLDSLVGQALFGDGAAAVIIGADPVPEVEKPLFELVSAAQTIL  247

Query  840   PDTDSHLKLQLREMGLTFHCSKAVPSLITQNVEDCLVKAFEPFGISDWNSIFWILHPGGN  1019
             PD+D  +   LRE+GLTFH  K VP LI++N+E  L +AF+P GISDWNS+FWI HPGG 
Sbjct  248   PDSDGAIDGHLREVGLTFHLLKDVPGLISKNIEKSLNEAFKPIGISDWNSLFWIAHPGGP  307

Query  1020  AILDGVEEKLGLDPEKLRASRDVLSQYGNLTSACVLFILDEVRKKSKKQQQMTTGEGLEW  1199
             AILD VE KL L PEKL A+R VLS YGN++SACVLFILDEVR+KS ++   TTGEGLEW
Sbjct  308   AILDQVEAKLALKPEKLEATRQVLSDYGNMSSACVLFILDEVRRKSAEKGLKTTGEGLEW  367

Query  1200  GVLFGFGPGLTIDTVVIRSV  1259
             GVLFGFGPGLT++TVV+ SV
Sbjct  368   GVLFGFGPGLTVETVVLHSV  387



>ref|XP_007032052.1| Chalcone and stilbene synthase family protein [Theobroma cacao]
 gb|EOY02978.1| Chalcone and stilbene synthase family protein [Theobroma cacao]
Length=395

 Score =   552 bits (1422),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 261/380 (69%), Positives = 315/380 (83%), Gaps = 0/380 (0%)
 Frame = +3

Query  123   RAKRLEGDAKILAIGTATPANWVDQTTYPDFYFRITNSQHLLEHKEKFRRICNKSKIMKR  302
             +A+R +G A +LAIGTATP N V Q  YPD+YFRITNS+HL E KEKF+R+C+KS I KR
Sbjct  11    KAQRAQGPATVLAIGTATPPNCVSQADYPDYYFRITNSEHLTELKEKFKRMCDKSMIKKR  70

Query  303   HLVLTEELLKKHPNLCTYNEASLNTRQDILVSGVPKLGKEAAMKAIKEWGRPISEITHLV  482
             ++ LTEE+LK++PN+C Y  +SL+ RQD++V  VPKLGKEAA KAIKEWG+P S+ITHLV
Sbjct  71    YMYLTEEILKENPNMCAYMASSLDARQDMVVVEVPKLGKEAATKAIKEWGQPKSKITHLV  130

Query  483   FCTTSGVDMPGADFQLTKLLGLNSSVKRLMMYQQGCNAGAAMLRLAKDLAENNKGARVLV  662
             FCTTSGVDMPGAD+QLTKLLGL  SVKRLMMYQQGC AG  +LR+AKDLAENNKGARVLV
Sbjct  131   FCTTSGVDMPGADYQLTKLLGLRPSVKRLMMYQQGCFAGGTVLRVAKDLAENNKGARVLV  190

Query  663   VCSEVMLSVFRGPSLQQEDNLLAQCLFGDGSAAVIVGTEPRPGLETPLFELVSSAQTIIP  842
             VCSE+    FRGPS    D+L+ Q LFGDG+AA+IVG +P   +E PLFELVS+AQTI+P
Sbjct  191   VCSEITAVTFRGPSDTHLDSLVGQALFGDGAAAIIVGADPDTKIERPLFELVSAAQTILP  250

Query  843   DTDSHLKLQLREMGLTFHCSKAVPSLITQNVEDCLVKAFEPFGISDWNSIFWILHPGGNA  1022
             D+D  +   LRE+GLTFH  K VP LI++NVE  LV+AF P GI+DWNSIFWI HPGG A
Sbjct  251   DSDGAIDGHLREVGLTFHLLKDVPGLISKNVEKSLVEAFSPIGINDWNSIFWIAHPGGPA  310

Query  1023  ILDGVEEKLGLDPEKLRASRDVLSQYGNLTSACVLFILDEVRKKSKKQQQMTTGEGLEWG  1202
             ILD VE KLGL  EKL+A+R VLS++GN++SACVLFILDE+RK+S +Q + TTGEGLEWG
Sbjct  311   ILDQVEAKLGLKEEKLKATRHVLSEFGNMSSACVLFILDEMRKQSLEQGKPTTGEGLEWG  370

Query  1203  VLFGFGPGLTIDTVVIRSVP  1262
             VLFGFGPGLT++TVV+ S+P
Sbjct  371   VLFGFGPGLTVETVVLHSIP  390



>ref|XP_011034457.1| PREDICTED: chalcone synthase 1-like [Populus euphratica]
Length=390

 Score =   551 bits (1421),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 261/380 (69%), Positives = 312/380 (82%), Gaps = 0/380 (0%)
 Frame = +3

Query  120   HRAKRLEGDAKILAIGTATPANWVDQTTYPDFYFRITNSQHLLEHKEKFRRICNKSKIMK  299
              +A+R EG A ILAIGT+TP N VDQ+TYPD+YFRITNS+H +E KEKF+R+C KS I K
Sbjct  8     RKAQRAEGPAAILAIGTSTPPNCVDQSTYPDYYFRITNSEHKVELKEKFKRMCEKSMIKK  67

Query  300   RHLVLTEELLKKHPNLCTYNEASLNTRQDILVSGVPKLGKEAAMKAIKEWGRPISEITHL  479
             R++ LTEE+LK++P++C Y   SL+ RQD++V  VPKLGKEAA KAIKEWG+P S+ITHL
Sbjct  68    RYMHLTEEILKENPSICEYRAPSLDARQDMVVVEVPKLGKEAAAKAIKEWGQPKSKITHL  127

Query  480   VFCTTSGVDMPGADFQLTKLLGLNSSVKRLMMYQQGCNAGAAMLRLAKDLAENNKGARVL  659
             VFCTTSGVDMPGAD+QLTKLLGL  SVKR MMYQQGC AG  +LRLAKDLAENNKGARVL
Sbjct  128   VFCTTSGVDMPGADYQLTKLLGLRPSVKRFMMYQQGCFAGGTVLRLAKDLAENNKGARVL  187

Query  660   VVCSEVMLSVFRGPSLQQEDNLLAQCLFGDGSAAVIVGTEPRPGLETPLFELVSSAQTII  839
             VVCSE+    FRGPS    D+L+ Q LFGDG+AA+I+G +P P +E PLFELVS+AQTI+
Sbjct  188   VVCSEITAVTFRGPSDTHLDSLVGQALFGDGAAAIIIGADPVPAIEKPLFELVSAAQTIL  247

Query  840   PDTDSHLKLQLREMGLTFHCSKAVPSLITQNVEDCLVKAFEPFGISDWNSIFWILHPGGN  1019
             PD+D  +   LRE+GLTFH  K VP LI++NVE  L +AF+P GISDWNS+FWI HPGG 
Sbjct  248   PDSDGAIDGHLREVGLTFHLLKDVPGLISKNVEKSLTEAFKPLGISDWNSLFWIAHPGGP  307

Query  1020  AILDGVEEKLGLDPEKLRASRDVLSQYGNLTSACVLFILDEVRKKSKKQQQMTTGEGLEW  1199
             AILD VE KL L PEKLRA+R VL+ YGN++SACVLFILDE+RKKS +    +TGEGLEW
Sbjct  308   AILDQVEAKLELKPEKLRATRQVLADYGNMSSACVLFILDEMRKKSAEDGLKSTGEGLEW  367

Query  1200  GVLFGFGPGLTIDTVVIRSV  1259
             GVLFGFGPGLT++TVV+ SV
Sbjct  368   GVLFGFGPGLTVETVVLHSV  387



>gb|AFE56210.1| chalcone synthase [Camellia sinensis]
Length=389

 Score =   551 bits (1421),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 262/380 (69%), Positives = 313/380 (82%), Gaps = 0/380 (0%)
 Frame = +3

Query  120   HRAKRLEGDAKILAIGTATPANWVDQTTYPDFYFRITNSQHLLEHKEKFRRICNKSKIMK  299
              RA+R EG A ++AIGTATP N VDQ+TYPD+YFRITNS+H  E KEKF+R+C+KS I K
Sbjct  8     RRAQRAEGPATVMAIGTATPPNCVDQSTYPDYYFRITNSEHKAELKEKFKRMCDKSMIKK  67

Query  300   RHLVLTEELLKKHPNLCTYNEASLNTRQDILVSGVPKLGKEAAMKAIKEWGRPISEITHL  479
             R++ LTEE+LK++P +C Y   SL+ RQD++V  VPKLGKEAA KAIKEWG+P S+ITHL
Sbjct  68    RYMYLTEEILKENPQVCEYMAPSLDARQDMVVVEVPKLGKEAATKAIKEWGQPKSKITHL  127

Query  480   VFCTTSGVDMPGADFQLTKLLGLNSSVKRLMMYQQGCNAGAAMLRLAKDLAENNKGARVL  659
             VFCTTSGVDMPGAD+QLTKLLGL  SVKRLMMYQQGC AG  +LRLAKDLAENNKGARVL
Sbjct  128   VFCTTSGVDMPGADYQLTKLLGLRPSVKRLMMYQQGCFAGGTVLRLAKDLAENNKGARVL  187

Query  660   VVCSEVMLSVFRGPSLQQEDNLLAQCLFGDGSAAVIVGTEPRPGLETPLFELVSSAQTII  839
             VVCSE+    FRGPS    D+L+ Q LFGDG+AA+IVG++P P +E PLFELVS+AQTI+
Sbjct  188   VVCSEITAVTFRGPSDTHLDSLVGQALFGDGAAAIIVGSDPIPEVEKPLFELVSAAQTIL  247

Query  840   PDTDSHLKLQLREMGLTFHCSKAVPSLITQNVEDCLVKAFEPFGISDWNSIFWILHPGGN  1019
             PD+D  +   LRE+GLTFH  K VP LI++N+E  L +AF+P GISDWNS+FWI HPGG 
Sbjct  248   PDSDGAIDGHLREVGLTFHLLKDVPGLISKNIEKSLAEAFQPLGISDWNSLFWIAHPGGP  307

Query  1020  AILDGVEEKLGLDPEKLRASRDVLSQYGNLTSACVLFILDEVRKKSKKQQQMTTGEGLEW  1199
             AILD VE KLGL  EKLRA+R VLS+YGN++SACVLFILDE+RK+S      TTGEGLEW
Sbjct  308   AILDQVELKLGLKEEKLRATRHVLSEYGNMSSACVLFILDEMRKRSAADGLKTTGEGLEW  367

Query  1200  GVLFGFGPGLTIDTVVIRSV  1259
             GVLFGFGPGLT++TVV+ S+
Sbjct  368   GVLFGFGPGLTVETVVLHSL  387



>gb|AFQ92052.1| chalcone synthase [Pyrus pyrifolia]
 gb|AGL81345.1| chalcone synthase [Pyrus communis]
Length=391

 Score =   551 bits (1421),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 260/380 (68%), Positives = 314/380 (83%), Gaps = 0/380 (0%)
 Frame = +3

Query  120   HRAKRLEGDAKILAIGTATPANWVDQTTYPDFYFRITNSQHLLEHKEKFRRICNKSKIMK  299
              +A+R EG A ++AIGT+TP+N VDQ TYPD+YFRITNS+H +E KEKF+R+C+KS I K
Sbjct  8     RKAQRAEGPATVMAIGTSTPSNCVDQATYPDYYFRITNSEHKVELKEKFQRMCDKSMIKK  67

Query  300   RHLVLTEELLKKHPNLCTYNEASLNTRQDILVSGVPKLGKEAAMKAIKEWGRPISEITHL  479
             R++ LTEE+LK++P++C Y   S++ RQD++V  VPKLGKEAA KAIKEWG+P S+ITHL
Sbjct  68    RYMYLTEEILKENPSVCEYMAPSIDARQDMVVVEVPKLGKEAATKAIKEWGQPKSKITHL  127

Query  480   VFCTTSGVDMPGADFQLTKLLGLNSSVKRLMMYQQGCNAGAAMLRLAKDLAENNKGARVL  659
             VFCTTSGVDMPGAD+QLTKLLGL  SVKRLMMYQQGC AG  +LRLAKDLAENNKGARVL
Sbjct  128   VFCTTSGVDMPGADYQLTKLLGLRPSVKRLMMYQQGCFAGGTVLRLAKDLAENNKGARVL  187

Query  660   VVCSEVMLSVFRGPSLQQEDNLLAQCLFGDGSAAVIVGTEPRPGLETPLFELVSSAQTII  839
             VVCSE+    FRGPS    D+L+ Q LFGDG+AAVI+G +P P +E PLFELVS+AQTI+
Sbjct  188   VVCSEITAVTFRGPSDTHLDSLVGQALFGDGAAAVIIGADPVPEVEKPLFELVSAAQTIL  247

Query  840   PDTDSHLKLQLREMGLTFHCSKAVPSLITQNVEDCLVKAFEPFGISDWNSIFWILHPGGN  1019
             PD+D  +   LRE+GLTFH  K VP LI++N+E  L +AF+P GISDWNS+FWI HPGG 
Sbjct  248   PDSDGAIDGHLREVGLTFHLLKDVPGLISKNIEKSLNEAFKPIGISDWNSLFWIAHPGGP  307

Query  1020  AILDGVEEKLGLDPEKLRASRDVLSQYGNLTSACVLFILDEVRKKSKKQQQMTTGEGLEW  1199
             AILD VE KL L PEKL A+R VLS YGN++SACVLFILDEVR+KS ++   TTGEGLEW
Sbjct  308   AILDQVEAKLALKPEKLEATRQVLSDYGNMSSACVLFILDEVRRKSAEKGLKTTGEGLEW  367

Query  1200  GVLFGFGPGLTIDTVVIRSV  1259
             GVLFGFGPGLT++TVV+ SV
Sbjct  368   GVLFGFGPGLTVETVVLHSV  387



>gb|EPS72180.1| chalcone synthase [Genlisea aurea]
Length=390

 Score =   551 bits (1421),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 254/383 (66%), Positives = 316/383 (83%), Gaps = 0/383 (0%)
 Frame = +3

Query  120   HRAKRLEGDAKILAIGTATPANWVDQTTYPDFYFRITNSQHLLEHKEKFRRICNKSKIMK  299
              RA+R EG A +LAIGTATPAN V+Q TYPD+YFRITNS+H+ E K+KF+R+C+KS I +
Sbjct  8     RRAQRAEGPAAVLAIGTATPANCVEQATYPDYYFRITNSEHMTELKDKFKRMCDKSMIKR  67

Query  300   RHLVLTEELLKKHPNLCTYNEASLNTRQDILVSGVPKLGKEAAMKAIKEWGRPISEITHL  479
             R++ LTEE+LK++P++C Y   SL+ RQDI+V  VP+LGKEAA KAIKEWG+P S+ITH+
Sbjct  68    RYMYLTEEILKENPDMCAYMSPSLDARQDIVVVEVPRLGKEAAQKAIKEWGQPKSKITHV  127

Query  480   VFCTTSGVDMPGADFQLTKLLGLNSSVKRLMMYQQGCNAGAAMLRLAKDLAENNKGARVL  659
             +FCTTSGVDMPGAD+QL KLLGL  SV+R M+YQQGC AG  +LR+AKDLAENN+GARVL
Sbjct  128   IFCTTSGVDMPGADYQLVKLLGLRPSVRRTMLYQQGCFAGGTVLRVAKDLAENNRGARVL  187

Query  660   VVCSEVMLSVFRGPSLQQEDNLLAQCLFGDGSAAVIVGTEPRPGLETPLFELVSSAQTII  839
             VVCSE+    FRGPS    D+L+ Q LFGDG+AAVIVG++P  G+E PLF++VS+AQTI+
Sbjct  188   VVCSEITAVTFRGPSESSLDSLVGQALFGDGAAAVIVGSDPIVGVERPLFQMVSAAQTIL  247

Query  840   PDTDSHLKLQLREMGLTFHCSKAVPSLITQNVEDCLVKAFEPFGISDWNSIFWILHPGGN  1019
             PD+D  +   LRE+GLTFH  K VP +I++N+E  L +AFEP GISDWNS+FWI HPGG 
Sbjct  248   PDSDGAIDGHLREVGLTFHLLKDVPGIISKNIEKSLKEAFEPLGISDWNSLFWIAHPGGP  307

Query  1020  AILDGVEEKLGLDPEKLRASRDVLSQYGNLTSACVLFILDEVRKKSKKQQQMTTGEGLEW  1199
             AILD VE KL L PEK+RA+R VL++YGN++SACVLFILDE+RK S K    TTGEGLEW
Sbjct  308   AILDQVEAKLALKPEKMRATRRVLAEYGNMSSACVLFILDEMRKSSAKDGANTTGEGLEW  367

Query  1200  GVLFGFGPGLTIDTVVIRSVPIN  1268
             GVLFGFGPGLT++TVV+ SVP+N
Sbjct  368   GVLFGFGPGLTVETVVLHSVPVN  390



>emb|CAH61575.1| chalcone synthase [Dictamnus albus]
Length=391

 Score =   551 bits (1421),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 261/382 (68%), Positives = 316/382 (83%), Gaps = 0/382 (0%)
 Frame = +3

Query  123   RAKRLEGDAKILAIGTATPANWVDQTTYPDFYFRITNSQHLLEHKEKFRRICNKSKIMKR  302
             +AKR EG A ILAIGTATPAN V+Q  YPD+YFRIT S+H+ E KEKF+R+C+KS I KR
Sbjct  9     KAKRAEGPATILAIGTATPANSVNQADYPDYYFRITKSEHMTELKEKFKRMCDKSMIKKR  68

Query  303   HLVLTEELLKKHPNLCTYNEASLNTRQDILVSGVPKLGKEAAMKAIKEWGRPISEITHLV  482
             ++ LTE++LK++PN+C Y   SL+ RQD++V  VPKLGKEAA KAIKEWG+P S+ITHLV
Sbjct  69    YMHLTEDILKENPNMCAYMAPSLDARQDVVVVEVPKLGKEAATKAIKEWGQPKSKITHLV  128

Query  483   FCTTSGVDMPGADFQLTKLLGLNSSVKRLMMYQQGCNAGAAMLRLAKDLAENNKGARVLV  662
             FCTTSGVDMPGAD+QLTKLLGL  SVKRLMMYQQGC AG  +LRLAKDLAENNKGARVLV
Sbjct  129   FCTTSGVDMPGADYQLTKLLGLRPSVKRLMMYQQGCFAGGTVLRLAKDLAENNKGARVLV  188

Query  663   VCSEVMLSVFRGPSLQQEDNLLAQCLFGDGSAAVIVGTEPRPGLETPLFELVSSAQTIIP  842
             VCSE+    FRGP+    D+L+ Q LFGDG+AA+IVG +P   +E PL++LVS++QTI+P
Sbjct  189   VCSEITAVTFRGPADTHLDSLVGQALFGDGAAALIVGADPDTTVERPLYQLVSASQTILP  248

Query  843   DTDSHLKLQLREMGLTFHCSKAVPSLITQNVEDCLVKAFEPFGISDWNSIFWILHPGGNA  1022
             D+D  +   LRE+GLTFH  K VP LI++N+E  LV+AF P GI+DWNSIFWI HPGG A
Sbjct  249   DSDGAIDGHLREVGLTFHLLKDVPGLISKNIEKSLVEAFSPIGINDWNSIFWIAHPGGPA  308

Query  1023  ILDGVEEKLGLDPEKLRASRDVLSQYGNLTSACVLFILDEVRKKSKKQQQMTTGEGLEWG  1202
             ILD VEEKLGL  EKLRA+R VLS+YGN++SACVLFILDE+RKK  ++ + TTGEGL+WG
Sbjct  309   ILDQVEEKLGLKEEKLRATRHVLSEYGNMSSACVLFILDEMRKKCVEEGKATTGEGLDWG  368

Query  1203  VLFGFGPGLTIDTVVIRSVPIN  1268
             VLFGFGPGLT++TVV+ SVPI 
Sbjct  369   VLFGFGPGLTVETVVLHSVPIK  390



>ref|NP_001234036.1| chalcone synthase 2 [Solanum lycopersicum]
 sp|P23419.2|CHS2_SOLLC RecName: Full=Chalcone synthase 2; AltName: Full=Naringenin-chalcone 
synthase 2 [Solanum lycopersicum]
 emb|CAA38981.1| chalcone synthase [Solanum lycopersicum]
 gb|AEK99072.1| chalcone synthase [Solanum lycopersicum]
Length=389

 Score =   551 bits (1420),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 259/380 (68%), Positives = 316/380 (83%), Gaps = 0/380 (0%)
 Frame = +3

Query  120   HRAKRLEGDAKILAIGTATPANWVDQTTYPDFYFRITNSQHLLEHKEKFRRICNKSKIMK  299
              RA+R +G A I+AIGTATP+N VDQ+TYPD+YFRITNS+H+ E KEKF+R+C+KS I K
Sbjct  8     RRAQRAKGPATIMAIGTATPSNCVDQSTYPDYYFRITNSEHMTELKEKFKRMCDKSMINK  67

Query  300   RHLVLTEELLKKHPNLCTYNEASLNTRQDILVSGVPKLGKEAAMKAIKEWGRPISEITHL  479
             R++ LTEE+LK++PN+C Y   SL+ RQDI+V  VPKLGKEAA KAIKEWG+P S+ITH+
Sbjct  68    RYMHLTEEILKENPNICEYMAPSLDARQDIVVVEVPKLGKEAAQKAIKEWGQPKSKITHV  127

Query  480   VFCTTSGVDMPGADFQLTKLLGLNSSVKRLMMYQQGCNAGAAMLRLAKDLAENNKGARVL  659
             VFCTTSGVDMPGAD+QLTKLLGL  SVKRLMMYQQGC AG  ++RLAKDLAENNKGARVL
Sbjct  128   VFCTTSGVDMPGADYQLTKLLGLRPSVKRLMMYQQGCFAGGTVIRLAKDLAENNKGARVL  187

Query  660   VVCSEVMLSVFRGPSLQQEDNLLAQCLFGDGSAAVIVGTEPRPGLETPLFELVSSAQTII  839
             VVCSE+    FRGPS    D+++ Q LFGD +AA+I+G++P P +E PLFELVS+AQT++
Sbjct  188   VVCSEITAVTFRGPSDTHLDSMVGQALFGDRAAAMIIGSDPLPEVERPLFELVSAAQTLL  247

Query  840   PDTDSHLKLQLREMGLTFHCSKAVPSLITQNVEDCLVKAFEPFGISDWNSIFWILHPGGN  1019
             PD++  +   LRE+GLTFH  K VP LI++N+E  L++AF+P GISDWNSIFWI HPGG 
Sbjct  248   PDSEGAIDGHLREVGLTFHLLKDVPGLISKNIEKSLIEAFQPLGISDWNSIFWIAHPGGP  307

Query  1020  AILDGVEEKLGLDPEKLRASRDVLSQYGNLTSACVLFILDEVRKKSKKQQQMTTGEGLEW  1199
             AILD VE KL L PEKLRA+R VLS YGN++SACVLFILDE+RK S K+   TTGEGL+W
Sbjct  308   AILDQVELKLSLKPEKLRATRQVLSDYGNMSSACVLFILDEMRKASSKEGLSTTGEGLDW  367

Query  1200  GVLFGFGPGLTIDTVVIRSV  1259
             GVLFGFGPGLT++TVV+ SV
Sbjct  368   GVLFGFGPGLTVETVVLHSV  387



>dbj|BAC10998.1| chalcone synthase [Nierembergia sp. NB17]
Length=389

 Score =   551 bits (1420),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 262/380 (69%), Positives = 314/380 (83%), Gaps = 0/380 (0%)
 Frame = +3

Query  120   HRAKRLEGDAKILAIGTATPANWVDQTTYPDFYFRITNSQHLLEHKEKFRRICNKSKIMK  299
              R++R  G A I+AIGTATP+N VDQTTYPDFYFRITNS+H  E KEKF+R+C+KS I K
Sbjct  8     RRSQRAIGPATIMAIGTATPSNCVDQTTYPDFYFRITNSEHKTELKEKFQRMCDKSMIKK  67

Query  300   RHLVLTEELLKKHPNLCTYNEASLNTRQDILVSGVPKLGKEAAMKAIKEWGRPISEITHL  479
             R++ LTEE+LK++P++C Y   SL+ RQDI+V  VPKLGKEAA KAIKEWG+P S+ITHL
Sbjct  68    RYMYLTEEILKENPSMCEYMAPSLDARQDIVVVEVPKLGKEAAQKAIKEWGQPKSKITHL  127

Query  480   VFCTTSGVDMPGADFQLTKLLGLNSSVKRLMMYQQGCNAGAAMLRLAKDLAENNKGARVL  659
             VFCTTSGVDMPG D+QLTKLLGL SSVKR MMYQQGC AG  +LRLAKDLAENNKGARVL
Sbjct  128   VFCTTSGVDMPGCDYQLTKLLGLKSSVKRFMMYQQGCFAGGTVLRLAKDLAENNKGARVL  187

Query  660   VVCSEVMLSVFRGPSLQQEDNLLAQCLFGDGSAAVIVGTEPRPGLETPLFELVSSAQTII  839
             VVCSE+    FRGPS    D+L+ Q LFGDG+AA+I+G++P P +E PLFELVS++QT++
Sbjct  188   VVCSEITAVTFRGPSDAHLDSLVGQALFGDGAAAIIIGSDPLPEVERPLFELVSASQTLL  247

Query  840   PDTDSHLKLQLREMGLTFHCSKAVPSLITQNVEDCLVKAFEPFGISDWNSIFWILHPGGN  1019
             PD+   +   LRE+GLTFH  K VP LI++N+E  LV+AF+P GISDWNSIFWI HPGG 
Sbjct  248   PDSHGAIDGHLREVGLTFHLLKDVPGLISKNIEKSLVEAFQPLGISDWNSIFWIAHPGGP  307

Query  1020  AILDGVEEKLGLDPEKLRASRDVLSQYGNLTSACVLFILDEVRKKSKKQQQMTTGEGLEW  1199
             AILD VE KLGL PEKLRA+R VLS+YGN++SACVLFILDE+RK S K    +TGEGL+W
Sbjct  308   AILDQVELKLGLKPEKLRATRQVLSEYGNMSSACVLFILDEMRKTSSKMGLGSTGEGLDW  367

Query  1200  GVLFGFGPGLTIDTVVIRSV  1259
             GVLFGFGPGLT++TVV+ SV
Sbjct  368   GVLFGFGPGLTVETVVLHSV  387



>gb|AEP17003.1| chalcone synthase [Vitis vinifera]
Length=389

 Score =   551 bits (1420),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 262/378 (69%), Positives = 314/378 (83%), Gaps = 0/378 (0%)
 Frame = +3

Query  126   AKRLEGDAKILAIGTATPANWVDQTTYPDFYFRITNSQHLLEHKEKFRRICNKSKIMKRH  305
             A+R EG A ++AIGTATP N VDQ+TYPD+YFRITNS+H  E KEKF+R+C+KS I KR+
Sbjct  10    AQRAEGPATVMAIGTATPPNCVDQSTYPDYYFRITNSEHKTELKEKFKRMCDKSMIKKRY  69

Query  306   LVLTEELLKKHPNLCTYNEASLNTRQDILVSGVPKLGKEAAMKAIKEWGRPISEITHLVF  485
             + LTEE+LK++PN+C Y  ASL+ RQD++V  VPKLGKEAA KAIKEWG+P S+ITHLVF
Sbjct  70    MHLTEEILKENPNVCEYMAASLDARQDMVVVEVPKLGKEAAAKAIKEWGQPKSKITHLVF  129

Query  486   CTTSGVDMPGADFQLTKLLGLNSSVKRLMMYQQGCNAGAAMLRLAKDLAENNKGARVLVV  665
             CTTSGVDMPGAD+QLTKLLGL  SVKR MMYQQGC AG  +LRLAKDLAENNKGARVLVV
Sbjct  130   CTTSGVDMPGADYQLTKLLGLRPSVKRFMMYQQGCFAGGTVLRLAKDLAENNKGARVLVV  189

Query  666   CSEVMLSVFRGPSLQQEDNLLAQCLFGDGSAAVIVGTEPRPGLETPLFELVSSAQTIIPD  845
             CSE+    FRGPS    D+L+ Q LFGDG+AAVIVG++P PG+E P+FELVS+AQTI+PD
Sbjct  190   CSEITAVTFRGPSDTHLDSLVGQALFGDGAAAVIVGSDPIPGVEKPMFELVSAAQTILPD  249

Query  846   TDSHLKLQLREMGLTFHCSKAVPSLITQNVEDCLVKAFEPFGISDWNSIFWILHPGGNAI  1025
             +D  +   LRE+GLTFH  K VP LI++N+E  L +AF+P GI DWNSIFWI HPGG AI
Sbjct  250   SDGAIDGHLREVGLTFHLLKDVPGLISKNIEKSLNEAFQPLGIKDWNSIFWIAHPGGPAI  309

Query  1026  LDGVEEKLGLDPEKLRASRDVLSQYGNLTSACVLFILDEVRKKSKKQQQMTTGEGLEWGV  1205
             LD VEEKL L PEKLR++R VLS+ GN++SACVLFILDE+R+KS ++   TTGEG EWGV
Sbjct  310   LDQVEEKLALKPEKLRSTRHVLSECGNMSSACVLFILDEMRRKSAEEGLKTTGEGPEWGV  369

Query  1206  LFGFGPGLTIDTVVIRSV  1259
             LFGFGPGLT++TVV+ SV
Sbjct  370   LFGFGPGLTVETVVLHSV  387



>emb|CAJ44127.1| chalcone synthase [Misopates orontium]
Length=390

 Score =   551 bits (1420),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 258/382 (68%), Positives = 316/382 (83%), Gaps = 0/382 (0%)
 Frame = +3

Query  123   RAKRLEGDAKILAIGTATPANWVDQTTYPDFYFRITNSQHLLEHKEKFRRICNKSKIMKR  302
             RA+R EG A +LAIGTATPAN VDQ+TYPD+YFRITNS+H+ + KEKF+R+C KS I KR
Sbjct  9     RAQRAEGPATVLAIGTATPANCVDQSTYPDYYFRITNSEHMTDLKEKFKRMCEKSMIKKR  68

Query  303   HLVLTEELLKKHPNLCTYNEASLNTRQDILVSGVPKLGKEAAMKAIKEWGRPISEITHLV  482
             ++ LTEE+LK++P +C Y   SL+ RQDI+V  VP+LGKEAA KAIKEWG+P S+ITHLV
Sbjct  69    YMHLTEEILKENPAMCEYMAPSLDARQDIVVVEVPRLGKEAAQKAIKEWGQPKSKITHLV  128

Query  483   FCTTSGVDMPGADFQLTKLLGLNSSVKRLMMYQQGCNAGAAMLRLAKDLAENNKGARVLV  662
             FCTTSGVDMPGAD+QLTKLLGL  SVKR MMYQQGC AG  +LR+AKDLAENN GARVLV
Sbjct  129   FCTTSGVDMPGADYQLTKLLGLRPSVKRFMMYQQGCFAGGTVLRMAKDLAENNAGARVLV  188

Query  663   VCSEVMLSVFRGPSLQQEDNLLAQCLFGDGSAAVIVGTEPRPGLETPLFELVSSAQTIIP  842
             VCSE+    FRGP+    D+L+ Q LFGDG+AAVIVG++P  G+E PLF+LV++AQT++P
Sbjct  189   VCSEITAVTFRGPADTHLDSLVGQALFGDGAAAVIVGSDPVVGVERPLFQLVTAAQTLLP  248

Query  843   DTDSHLKLQLREMGLTFHCSKAVPSLITQNVEDCLVKAFEPFGISDWNSIFWILHPGGNA  1022
             D+   +   LRE+GLTFH  K VP LI++++E  L +AF+P GISDWNS+FWI HPGG A
Sbjct  249   DSHGAIDGHLREVGLTFHLLKDVPGLISKHIEKSLKEAFDPLGISDWNSVFWIAHPGGPA  308

Query  1023  ILDGVEEKLGLDPEKLRASRDVLSQYGNLTSACVLFILDEVRKKSKKQQQMTTGEGLEWG  1202
             ILD VEEKLGL PEKLR++R VLS+YGN++SACVLFILDE+RK S K+   TTGEG +WG
Sbjct  309   ILDQVEEKLGLKPEKLRSTRHVLSEYGNMSSACVLFILDEMRKSSTKEGMSTTGEGFDWG  368

Query  1203  VLFGFGPGLTIDTVVIRSVPIN  1268
             VLFGFGPGLT++TVV+ SVP+N
Sbjct  369   VLFGFGPGLTVETVVLHSVPLN  390



>emb|CAC19808.1| chalcone synthase [Humulus lupulus]
Length=389

 Score =   551 bits (1420),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 263/382 (69%), Positives = 314/382 (82%), Gaps = 0/382 (0%)
 Frame = +3

Query  120   HRAKRLEGDAKILAIGTATPANWVDQTTYPDFYFRITNSQHLLEHKEKFRRICNKSKIMK  299
              +A+R EG A ILAIGTATPAN + Q+ YPD+YFRITNS+H  E KEKF+R+C KS I K
Sbjct  8     RKAQRAEGPATILAIGTATPANCILQSEYPDYYFRITNSEHKTELKEKFKRMCGKSMIRK  67

Query  300   RHLVLTEELLKKHPNLCTYNEASLNTRQDILVSGVPKLGKEAAMKAIKEWGRPISEITHL  479
             R++ LTEE+LK++PNLC Y   SL+ RQD++V  VPKLGKEAA KAIKEWG+P SEITH+
Sbjct  68    RYMHLTEEILKENPNLCAYEAPSLDARQDMVVVEVPKLGKEAATKAIKEWGQPKSEITHV  127

Query  480   VFCTTSGVDMPGADFQLTKLLGLNSSVKRLMMYQQGCNAGAAMLRLAKDLAENNKGARVL  659
             VFCTTSGVDMPGAD+QLTKLLGL  SVKRLMMYQQGC AG  +LR+AKDLAENNKGARVL
Sbjct  128   VFCTTSGVDMPGADYQLTKLLGLRPSVKRLMMYQQGCFAGGTVLRVAKDLAENNKGARVL  187

Query  660   VVCSEVMLSVFRGPSLQQEDNLLAQCLFGDGSAAVIVGTEPRPGLETPLFELVSSAQTII  839
             VVCSE+    FRGP+    D+L+AQ LFGDGSAA+I+G +P P +E P+FELVS+AQTI+
Sbjct  188   VVCSEITAVTFRGPNDTHLDSLVAQALFGDGSAALIIGADPIPEIEKPIFELVSAAQTIL  247

Query  840   PDTDSHLKLQLREMGLTFHCSKAVPSLITQNVEDCLVKAFEPFGISDWNSIFWILHPGGN  1019
             PD+D  +   LRE+GLTFH  K VP LI++N+E  LV+AF+P GISDWNS+FWI HPGG 
Sbjct  248   PDSDGAIDGHLREVGLTFHLLKDVPGLISKNIEKSLVEAFKPLGISDWNSLFWITHPGGP  307

Query  1020  AILDGVEEKLGLDPEKLRASRDVLSQYGNLTSACVLFILDEVRKKSKKQQQMTTGEGLEW  1199
             AILD VE KLGL PEKLRA+R VL +YGN++SACVLFILDE+R+K  +    TTGEGLEW
Sbjct  308   AILDQVESKLGLKPEKLRATRHVLGEYGNMSSACVLFILDEMRRKCAEDGVKTTGEGLEW  367

Query  1200  GVLFGFGPGLTIDTVVIRSVPI  1265
             GVLFGFGPGLT++TVV+ SV I
Sbjct  368   GVLFGFGPGLTVETVVLHSVGI  389



>ref|XP_002299281.2| naregenin-chalcone synthase family protein [Populus trichocarpa]
 gb|EEE84086.2| naregenin-chalcone synthase family protein [Populus trichocarpa]
Length=391

 Score =   551 bits (1420),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 261/381 (69%), Positives = 315/381 (83%), Gaps = 0/381 (0%)
 Frame = +3

Query  120   HRAKRLEGDAKILAIGTATPANWVDQTTYPDFYFRITNSQHLLEHKEKFRRICNKSKIMK  299
              +A+R EG A ILAIGT+TP N VDQ+TYPD+YFRITNS+H +E KEKF+R+C KS I K
Sbjct  8     RKAQRAEGPATILAIGTSTPPNCVDQSTYPDYYFRITNSEHKVELKEKFKRMCEKSMIKK  67

Query  300   RHLVLTEELLKKHPNLCTYNEASLNTRQDILVSGVPKLGKEAAMKAIKEWGRPISEITHL  479
             R++ LTEE+LK++P++C Y   SL+ RQD++V  VPKLGKEAA KAIKEWG+P S+ITHL
Sbjct  68    RYMHLTEEILKENPSVCEYMAPSLDARQDMVVVEVPKLGKEAAAKAIKEWGQPKSKITHL  127

Query  480   VFCTTSGVDMPGADFQLTKLLGLNSSVKRLMMYQQGCNAGAAMLRLAKDLAENNKGARVL  659
             VFCTTSGVDMPGAD+QLTKLLGL SSVKR MMYQQGC AG  +LRLAKDLAENNKGARVL
Sbjct  128   VFCTTSGVDMPGADYQLTKLLGLRSSVKRFMMYQQGCFAGGTVLRLAKDLAENNKGARVL  187

Query  660   VVCSEVMLSVFRGPSLQQEDNLLAQCLFGDGSAAVIVGTEPRPGLETPLFELVSSAQTII  839
             VVCSE+    FRGPS    D+L+ Q LFGDG+AA+I+G++P  G+E PLFELVS+AQTI+
Sbjct  188   VVCSEITAVTFRGPSDTHLDSLVGQALFGDGAAAIIIGSDPVLGVEKPLFELVSAAQTIL  247

Query  840   PDTDSHLKLQLREMGLTFHCSKAVPSLITQNVEDCLVKAFEPFGISDWNSIFWILHPGGN  1019
             PD++  +   LRE+GLTFH  K VP LI++N+E  L +AF+P GISDWNS+FWI HPGG 
Sbjct  248   PDSEGAIDGHLREVGLTFHLLKDVPGLISKNIEKSLTEAFKPLGISDWNSLFWIAHPGGP  307

Query  1020  AILDGVEEKLGLDPEKLRASRDVLSQYGNLTSACVLFILDEVRKKSKKQQQMTTGEGLEW  1199
             AILD VE KL L PEKLRA+R VL+ YGN++SACVLFILDE+RKKS K    +TGEGLEW
Sbjct  308   AILDQVEAKLELKPEKLRATRQVLADYGNMSSACVLFILDEMRKKSAKDGLKSTGEGLEW  367

Query  1200  GVLFGFGPGLTIDTVVIRSVP  1262
             GVLFGFGPGLT++TVV+ S+P
Sbjct  368   GVLFGFGPGLTVETVVLHSLP  388



>gb|AAX16494.1| chalcone synthase [Pyrus communis]
Length=391

 Score =   551 bits (1420),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 260/380 (68%), Positives = 314/380 (83%), Gaps = 0/380 (0%)
 Frame = +3

Query  120   HRAKRLEGDAKILAIGTATPANWVDQTTYPDFYFRITNSQHLLEHKEKFRRICNKSKIMK  299
              +A+R EG A ++AIGT+TP+N VDQ TYPD+YFRITNS+H +E KEKF+R+C+KS I K
Sbjct  8     RKAQRAEGPATVMAIGTSTPSNCVDQATYPDYYFRITNSEHKVELKEKFQRMCDKSMIKK  67

Query  300   RHLVLTEELLKKHPNLCTYNEASLNTRQDILVSGVPKLGKEAAMKAIKEWGRPISEITHL  479
             R++ LTEE+LK++P++C Y   S++ RQD++V  VPKLGKEAA KAIKEWG+P S+ITHL
Sbjct  68    RYMYLTEEILKENPSVCEYMAPSIDARQDMVVVEVPKLGKEAATKAIKEWGQPKSKITHL  127

Query  480   VFCTTSGVDMPGADFQLTKLLGLNSSVKRLMMYQQGCNAGAAMLRLAKDLAENNKGARVL  659
             VFCTTSGVDMPGAD+QLTKLLGL  SVKRLMMYQQGC AG  +LRLAKDLAENNKGARVL
Sbjct  128   VFCTTSGVDMPGADYQLTKLLGLRPSVKRLMMYQQGCFAGGTVLRLAKDLAENNKGARVL  187

Query  660   VVCSEVMLSVFRGPSLQQEDNLLAQCLFGDGSAAVIVGTEPRPGLETPLFELVSSAQTII  839
             VVCSE+    FRGPS    D+L+ Q LFGDG+AAVI+G +P P +E PLFELVS+AQTI+
Sbjct  188   VVCSEITAVTFRGPSDTHLDSLVGQALFGDGAAAVIIGADPVPEVEKPLFELVSTAQTIL  247

Query  840   PDTDSHLKLQLREMGLTFHCSKAVPSLITQNVEDCLVKAFEPFGISDWNSIFWILHPGGN  1019
             PD+D  +   LRE+GLTFH  K VP LI++N+E  L +AF+P GISDWNS+FWI HPGG 
Sbjct  248   PDSDGAIDGHLREVGLTFHLLKDVPGLISKNIEKSLNEAFKPIGISDWNSLFWIAHPGGP  307

Query  1020  AILDGVEEKLGLDPEKLRASRDVLSQYGNLTSACVLFILDEVRKKSKKQQQMTTGEGLEW  1199
             AILD VE KL L PEKL A+R VLS YGN++SACVLFILDEVR+KS ++   TTGEGLEW
Sbjct  308   AILDQVEAKLALKPEKLEATRQVLSDYGNMSSACVLFILDEVRRKSAEKGLKTTGEGLEW  367

Query  1200  GVLFGFGPGLTIDTVVIRSV  1259
             GVLFGFGPGLT++TVV+ SV
Sbjct  368   GVLFGFGPGLTVETVVLHSV  387



>ref|XP_007223025.1| hypothetical protein PRUPE_ppa006888mg [Prunus persica]
 gb|EMJ24224.1| hypothetical protein PRUPE_ppa006888mg [Prunus persica]
 gb|AJA79072.1| chalcone synthase [Prunus persica]
 gb|AJA79077.1| chalcone synthase [Prunus persica]
Length=391

 Score =   551 bits (1420),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 260/383 (68%), Positives = 315/383 (82%), Gaps = 0/383 (0%)
 Frame = +3

Query  120   HRAKRLEGDAKILAIGTATPANWVDQTTYPDFYFRITNSQHLLEHKEKFRRICNKSKIMK  299
              +A+R EG A +LAIGTATP N VDQ TYPD+YFRITNS+H  E KEKF+R+C+KS I K
Sbjct  8     RKAQRAEGPATVLAIGTATPPNCVDQATYPDYYFRITNSEHKAELKEKFQRMCDKSMIKK  67

Query  300   RHLVLTEELLKKHPNLCTYNEASLNTRQDILVSGVPKLGKEAAMKAIKEWGRPISEITHL  479
             R++ LTEE+LK++P +C Y   SL+ RQD++V  +PKLGKEAA KAIKEWG+P S+ITHL
Sbjct  68    RYMYLTEEILKENPTMCEYMAPSLDARQDMVVVEIPKLGKEAATKAIKEWGQPKSKITHL  127

Query  480   VFCTTSGVDMPGADFQLTKLLGLNSSVKRLMMYQQGCNAGAAMLRLAKDLAENNKGARVL  659
             VFCTTSGVDMPGAD+QLTKLLGL  SVKRLMMYQQGC AG  +LRLAKDLAENNKGARVL
Sbjct  128   VFCTTSGVDMPGADYQLTKLLGLRPSVKRLMMYQQGCFAGGTVLRLAKDLAENNKGARVL  187

Query  660   VVCSEVMLSVFRGPSLQQEDNLLAQCLFGDGSAAVIVGTEPRPGLETPLFELVSSAQTII  839
             VVCSE+    FRGPS    D+L+ Q LFGDG+AAVIVG +P P +E PLFE+VS+AQTI+
Sbjct  188   VVCSEITAVTFRGPSDTHLDSLVGQALFGDGAAAVIVGADPIPEIEKPLFEVVSAAQTIL  247

Query  840   PDTDSHLKLQLREMGLTFHCSKAVPSLITQNVEDCLVKAFEPFGISDWNSIFWILHPGGN  1019
             PD+D  +   LRE+GLTFH  K VP LI++N+E  L +AF+P GISDWNS+FWI HPGG 
Sbjct  248   PDSDGAIDGHLREVGLTFHLLKDVPGLISKNIEKSLNEAFQPLGISDWNSLFWIAHPGGP  307

Query  1020  AILDGVEEKLGLDPEKLRASRDVLSQYGNLTSACVLFILDEVRKKSKKQQQMTTGEGLEW  1199
             AILD VE KLGL PEKL A+R +LS+YGN++SACVLFILDEVRK++ ++   TTG+GL+W
Sbjct  308   AILDQVESKLGLKPEKLEATRHILSEYGNMSSACVLFILDEVRKRAAEKGLKTTGDGLDW  367

Query  1200  GVLFGFGPGLTIDTVVIRSVPIN  1268
             GVLFGFGPGLT++TVV+ SV +N
Sbjct  368   GVLFGFGPGLTVETVVLHSVGLN  390



>sp|O22046.1|CHSE_IPONI RecName: Full=Chalcone synthase E; AltName: Full=Naringenin-chalcone 
synthase E; Short=CHS-E [Ipomoea nil]
 dbj|BAA21788.1| chalcone synthase [Ipomoea nil]
 dbj|BAA87338.1| chalcone synthase [Ipomoea nil]
Length=389

 Score =   551 bits (1420),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 260/379 (69%), Positives = 314/379 (83%), Gaps = 0/379 (0%)
 Frame = +3

Query  123   RAKRLEGDAKILAIGTATPANWVDQTTYPDFYFRITNSQHLLEHKEKFRRICNKSKIMKR  302
             +A+R +G A I+AIGT+TP N VDQ+TYPD+YFRITNS+HL+E KEKF+R+C KS I KR
Sbjct  9     KAQRAQGPATIMAIGTSTPQNCVDQSTYPDYYFRITNSEHLVELKEKFKRMCEKSMIKKR  68

Query  303   HLVLTEELLKKHPNLCTYNEASLNTRQDILVSGVPKLGKEAAMKAIKEWGRPISEITHLV  482
             ++ LTEE+LK++PN+C Y   SL+ RQDI+V  VPKLGKEAA KAIKEWG+P S+ITHLV
Sbjct  69    YMYLTEEILKENPNICAYMAPSLDARQDIVVVEVPKLGKEAAQKAIKEWGQPKSKITHLV  128

Query  483   FCTTSGVDMPGADFQLTKLLGLNSSVKRLMMYQQGCNAGAAMLRLAKDLAENNKGARVLV  662
             FCTTSGVDMPGAD+QLTKLLGL  SVKR MMYQQGC AG  ++RLAKDLAENNKGARVLV
Sbjct  129   FCTTSGVDMPGADYQLTKLLGLQPSVKRFMMYQQGCFAGGTVIRLAKDLAENNKGARVLV  188

Query  663   VCSEVMLSVFRGPSLQQEDNLLAQCLFGDGSAAVIVGTEPRPGLETPLFELVSSAQTIIP  842
             VCSE+    FRGPS    D+L+ Q LFGDG+AA+I+G++P P LE PLF+LVS+AQTI+P
Sbjct  189   VCSEITAVTFRGPSDAHLDSLVGQALFGDGAAALIIGSDPDPDLERPLFQLVSAAQTILP  248

Query  843   DTDSHLKLQLREMGLTFHCSKAVPSLITQNVEDCLVKAFEPFGISDWNSIFWILHPGGNA  1022
             D+   +   LRE+GLTFH  K VP LI++++E  L +AF+P GI DWNS+FWI HPGG A
Sbjct  249   DSGGAIDGHLREVGLTFHLLKDVPGLISKHIEKSLNEAFQPLGIHDWNSLFWIAHPGGPA  308

Query  1023  ILDGVEEKLGLDPEKLRASRDVLSQYGNLTSACVLFILDEVRKKSKKQQQMTTGEGLEWG  1202
             ILD VEEKL L PEKLRA+R VLS+YGN++SACVLFILDE+RK S K+   TTGEGLEWG
Sbjct  309   ILDQVEEKLELKPEKLRATRHVLSEYGNMSSACVLFILDEMRKASSKEGLNTTGEGLEWG  368

Query  1203  VLFGFGPGLTIDTVVIRSV  1259
             VLFGFGPGLT++TVV+ SV
Sbjct  369   VLFGFGPGLTVETVVLHSV  387



>gb|AGI02994.1| chalcone synthase [Camellia sinensis]
Length=389

 Score =   551 bits (1420),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 262/380 (69%), Positives = 313/380 (82%), Gaps = 0/380 (0%)
 Frame = +3

Query  120   HRAKRLEGDAKILAIGTATPANWVDQTTYPDFYFRITNSQHLLEHKEKFRRICNKSKIMK  299
              RA+R EG A ++AIGTATP N VDQ+TYPD+YFRITNS+H  E KEKF+R+C+KS I K
Sbjct  8     RRAQRAEGPATVMAIGTATPPNCVDQSTYPDYYFRITNSEHKAELKEKFKRMCDKSMIKK  67

Query  300   RHLVLTEELLKKHPNLCTYNEASLNTRQDILVSGVPKLGKEAAMKAIKEWGRPISEITHL  479
             R++ LTEE+LK++P +C Y   SL+ RQD++V  VPKLGKEAA KAIKEWG+P S+ITHL
Sbjct  68    RYMYLTEEILKENPQVCEYMAPSLDARQDMVVVEVPKLGKEAATKAIKEWGQPKSKITHL  127

Query  480   VFCTTSGVDMPGADFQLTKLLGLNSSVKRLMMYQQGCNAGAAMLRLAKDLAENNKGARVL  659
             VFCTTSGVDMPGAD+QLTKLLGL  SVKRLMMYQQGC AG  +LRLAKDLAENNKGARVL
Sbjct  128   VFCTTSGVDMPGADYQLTKLLGLRPSVKRLMMYQQGCFAGGTVLRLAKDLAENNKGARVL  187

Query  660   VVCSEVMLSVFRGPSLQQEDNLLAQCLFGDGSAAVIVGTEPRPGLETPLFELVSSAQTII  839
             VVCSE+    FRGPS    D+L+ Q LFGDG+AA+IVG++P P +E PLFELVS+AQTI+
Sbjct  188   VVCSEITAVTFRGPSDTHLDSLVGQALFGDGAAAIIVGSDPIPEVEKPLFELVSAAQTIL  247

Query  840   PDTDSHLKLQLREMGLTFHCSKAVPSLITQNVEDCLVKAFEPFGISDWNSIFWILHPGGN  1019
             PD+D  +   LRE+GLTFH  K VP LI++N+E  L +AF+P GISDWNS+FWI HPGG 
Sbjct  248   PDSDGAIDGHLREVGLTFHLLKDVPGLISKNIEKSLAEAFQPLGISDWNSLFWIAHPGGP  307

Query  1020  AILDGVEEKLGLDPEKLRASRDVLSQYGNLTSACVLFILDEVRKKSKKQQQMTTGEGLEW  1199
             AILD VE KLGL  EKLRA+R VLS+YGN++SACVLFILDE+RK+S      TTGEGLEW
Sbjct  308   AILDQVELKLGLKEEKLRATRHVLSEYGNMSSACVLFILDEMRKESAADGLKTTGEGLEW  367

Query  1200  GVLFGFGPGLTIDTVVIRSV  1259
             GVLFGFGPGLT++TVV+ S+
Sbjct  368   GVLFGFGPGLTVETVVLHSL  387



>ref|NP_001275296.1| chalcone synthase 2 [Solanum tuberosum]
 sp|Q43188.1|CHS2_SOLTU RecName: Full=Chalcone synthase 2; AltName: Full=Naringenin-chalcone 
synthase 2 [Solanum tuberosum]
 gb|AAB05239.1| chalcone synthase 2 [Solanum tuberosum]
Length=389

 Score =   551 bits (1419),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 258/380 (68%), Positives = 317/380 (83%), Gaps = 0/380 (0%)
 Frame = +3

Query  120   HRAKRLEGDAKILAIGTATPANWVDQTTYPDFYFRITNSQHLLEHKEKFRRICNKSKIMK  299
              +A+R +G A I+AIGTATP+N VDQ+TYPD+YFRITNS+H+ E KEKF+R+C+KS I K
Sbjct  8     RKAQRAKGPATIMAIGTATPSNCVDQSTYPDYYFRITNSEHMTELKEKFKRMCDKSMINK  67

Query  300   RHLVLTEELLKKHPNLCTYNEASLNTRQDILVSGVPKLGKEAAMKAIKEWGRPISEITHL  479
             R++ LTEE+LK++PN+C Y   SL+ RQDI+V  VPKLGKEAA KAIKEWG+P S+ITH+
Sbjct  68    RYMHLTEEILKENPNICEYMAPSLDARQDIVVVEVPKLGKEAAQKAIKEWGQPKSKITHV  127

Query  480   VFCTTSGVDMPGADFQLTKLLGLNSSVKRLMMYQQGCNAGAAMLRLAKDLAENNKGARVL  659
             VFCTTSGVDMPGAD+QLTKLLGL  SVKRLMMYQQGC AG  ++RLAKDLAENNKGARVL
Sbjct  128   VFCTTSGVDMPGADYQLTKLLGLRPSVKRLMMYQQGCFAGGTVIRLAKDLAENNKGARVL  187

Query  660   VVCSEVMLSVFRGPSLQQEDNLLAQCLFGDGSAAVIVGTEPRPGLETPLFELVSSAQTII  839
             VVCSE+    F GPS    D+++ Q LFGDG+AA+I+G++P P +E PLFELVS+AQT++
Sbjct  188   VVCSEITAVTFSGPSDTHLDSMVGQALFGDGAAAMIIGSDPLPEVERPLFELVSAAQTLL  247

Query  840   PDTDSHLKLQLREMGLTFHCSKAVPSLITQNVEDCLVKAFEPFGISDWNSIFWILHPGGN  1019
             PD++  +   LRE+GLTFH  K VP LI++N+E  L++AF+P GISDWNSIFWI HPGG 
Sbjct  248   PDSEGAIDGHLREVGLTFHLLKDVPGLISKNIEKSLIEAFQPLGISDWNSIFWIAHPGGP  307

Query  1020  AILDGVEEKLGLDPEKLRASRDVLSQYGNLTSACVLFILDEVRKKSKKQQQMTTGEGLEW  1199
             AILD VE KLGL PEKL+A+R VLS YGN++SACVLFILDE+RK S K+   TTGEGL+W
Sbjct  308   AILDQVELKLGLKPEKLQATRQVLSDYGNMSSACVLFILDEMRKASSKEGLSTTGEGLDW  367

Query  1200  GVLFGFGPGLTIDTVVIRSV  1259
             GVLFGFGPGLT++TVV+ SV
Sbjct  368   GVLFGFGPGLTVETVVLHSV  387



>ref|XP_002299282.1| naregenin-chalcone synthase family protein [Populus trichocarpa]
 gb|ABK95125.1| unknown [Populus trichocarpa]
 gb|EEE84087.1| naregenin-chalcone synthase family protein [Populus trichocarpa]
Length=390

 Score =   551 bits (1419),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 262/380 (69%), Positives = 314/380 (83%), Gaps = 0/380 (0%)
 Frame = +3

Query  120   HRAKRLEGDAKILAIGTATPANWVDQTTYPDFYFRITNSQHLLEHKEKFRRICNKSKIMK  299
              +A+R EG A ILAIGT+TP N VDQ+TYPD+YFRITNS+H +E KEKF+R+C KS I K
Sbjct  8     RKAQRAEGPAVILAIGTSTPPNCVDQSTYPDYYFRITNSEHKVELKEKFKRMCEKSMIKK  67

Query  300   RHLVLTEELLKKHPNLCTYNEASLNTRQDILVSGVPKLGKEAAMKAIKEWGRPISEITHL  479
             R++ LTEE+LK++P++C Y   SL+ RQD++V  VPKLGKEAA KAIKEWG+P S+ITHL
Sbjct  68    RYMHLTEEILKENPSVCEYMAPSLDARQDMVVVEVPKLGKEAAAKAIKEWGQPKSKITHL  127

Query  480   VFCTTSGVDMPGADFQLTKLLGLNSSVKRLMMYQQGCNAGAAMLRLAKDLAENNKGARVL  659
             VFCTTSGVDMPGAD+QLTKLLGL SSVKR MMYQQGC AG  +LRLAKDLAENNKGARVL
Sbjct  128   VFCTTSGVDMPGADYQLTKLLGLRSSVKRFMMYQQGCFAGGTVLRLAKDLAENNKGARVL  187

Query  660   VVCSEVMLSVFRGPSLQQEDNLLAQCLFGDGSAAVIVGTEPRPGLETPLFELVSSAQTII  839
             VVCSE+    FRGPS    D+L+ Q LFGDG+AA+I+G++P  G+E PLFELVS+AQTI+
Sbjct  188   VVCSEITAVTFRGPSDTHLDSLVGQALFGDGAAAIIIGSDPVLGVEKPLFELVSAAQTIL  247

Query  840   PDTDSHLKLQLREMGLTFHCSKAVPSLITQNVEDCLVKAFEPFGISDWNSIFWILHPGGN  1019
             PD+D  +   LRE+GLTFH  K VP LI++N+E  L +AF+P GISDWNS+FWI HPGG 
Sbjct  248   PDSDGAIDGHLREVGLTFHLLKDVPGLISKNIEKSLTEAFKPLGISDWNSLFWIAHPGGP  307

Query  1020  AILDGVEEKLGLDPEKLRASRDVLSQYGNLTSACVLFILDEVRKKSKKQQQMTTGEGLEW  1199
             AILD VE KL L PEKLRA+R VL+ YGN++SACVLFILDE+RKKS K    +TGEGLEW
Sbjct  308   AILDQVEAKLELKPEKLRATRQVLADYGNMSSACVLFILDEMRKKSAKDGLKSTGEGLEW  367

Query  1200  GVLFGFGPGLTIDTVVIRSV  1259
             GVLFGFGPGLT++TVV+ SV
Sbjct  368   GVLFGFGPGLTVETVVLHSV  387



>gb|ABI79305.1| chalcone synthase [Pyrus communis]
Length=389

 Score =   551 bits (1419),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 259/380 (68%), Positives = 315/380 (83%), Gaps = 0/380 (0%)
 Frame = +3

Query  120   HRAKRLEGDAKILAIGTATPANWVDQTTYPDFYFRITNSQHLLEHKEKFRRICNKSKIMK  299
              +A+R EG A ++AIGT+TP+N VDQ TYPD+YFRITNS+H +E KEKF+R+C+KS I K
Sbjct  8     RKAQRAEGPATVMAIGTSTPSNCVDQATYPDYYFRITNSEHRVELKEKFQRMCDKSMIKK  67

Query  300   RHLVLTEELLKKHPNLCTYNEASLNTRQDILVSGVPKLGKEAAMKAIKEWGRPISEITHL  479
             R++ LTEE+LK++P++C Y   S++ RQD++V  VPKLGKEAA KAIKEWG+P S+ITHL
Sbjct  68    RYMYLTEEILKENPSVCEYMAPSIDARQDMVVVEVPKLGKEAATKAIKEWGQPKSKITHL  127

Query  480   VFCTTSGVDMPGADFQLTKLLGLNSSVKRLMMYQQGCNAGAAMLRLAKDLAENNKGARVL  659
             VFCTTSGVDMPGAD+QLTKLLGL  SVKRLMMYQQGC AG  +LRLAKDLAENNKGARVL
Sbjct  128   VFCTTSGVDMPGADYQLTKLLGLRPSVKRLMMYQQGCFAGGTVLRLAKDLAENNKGARVL  187

Query  660   VVCSEVMLSVFRGPSLQQEDNLLAQCLFGDGSAAVIVGTEPRPGLETPLFELVSSAQTII  839
             VVCSE+    FRGPS    D+L+ Q LFGDG+AAVI+GT+P P +E PLFELVS+AQTI+
Sbjct  188   VVCSEITAVTFRGPSDTHLDSLVGQALFGDGAAAVIIGTDPVPEVEKPLFELVSAAQTIL  247

Query  840   PDTDSHLKLQLREMGLTFHCSKAVPSLITQNVEDCLVKAFEPFGISDWNSIFWILHPGGN  1019
             PD+D  +   LRE+GLTFH  K VP LI++++E  L +AF+P GISDWNS+FWI HPGG 
Sbjct  248   PDSDGAIDGHLREVGLTFHLLKDVPGLISKSIEKSLNEAFKPIGISDWNSLFWIAHPGGP  307

Query  1020  AILDGVEEKLGLDPEKLRASRDVLSQYGNLTSACVLFILDEVRKKSKKQQQMTTGEGLEW  1199
             AILD VE KL L P+KL A+R VLS YGN++SACVLFILDEVR+KS ++   TTGEGLEW
Sbjct  308   AILDQVEAKLALKPQKLEATRQVLSDYGNMSSACVLFILDEVRRKSAEKGLKTTGEGLEW  367

Query  1200  GVLFGFGPGLTIDTVVIRSV  1259
             GVLFGFGPGLT++TVV+ SV
Sbjct  368   GVLFGFGPGLTVETVVLHSV  387



>ref|XP_011034455.1| PREDICTED: chalcone synthase 1-like [Populus euphratica]
Length=391

 Score =   551 bits (1419),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 261/381 (69%), Positives = 313/381 (82%), Gaps = 0/381 (0%)
 Frame = +3

Query  120   HRAKRLEGDAKILAIGTATPANWVDQTTYPDFYFRITNSQHLLEHKEKFRRICNKSKIMK  299
              +A+R EG A ILAIGT+TP N VDQ TYPD+YFRITNS+H +E KEKF+R+C KS I K
Sbjct  8     RKAQRAEGPATILAIGTSTPPNCVDQCTYPDYYFRITNSEHKVELKEKFKRMCEKSMIKK  67

Query  300   RHLVLTEELLKKHPNLCTYNEASLNTRQDILVSGVPKLGKEAAMKAIKEWGRPISEITHL  479
             R++ LTEE+LK++P++C Y   SL+ RQD++V  VPKLGKEAA+KAIKEWG+P S+ITHL
Sbjct  68    RYMHLTEEILKENPSVCEYMAPSLDARQDMVVVEVPKLGKEAAVKAIKEWGQPKSKITHL  127

Query  480   VFCTTSGVDMPGADFQLTKLLGLNSSVKRLMMYQQGCNAGAAMLRLAKDLAENNKGARVL  659
             VFCTTSGVDMPGAD+QLTKLLGL  SVKR MMYQQGC AG  +LRLAKDLAENNKGARVL
Sbjct  128   VFCTTSGVDMPGADYQLTKLLGLRPSVKRFMMYQQGCFAGGTVLRLAKDLAENNKGARVL  187

Query  660   VVCSEVMLSVFRGPSLQQEDNLLAQCLFGDGSAAVIVGTEPRPGLETPLFELVSSAQTII  839
             VVCSE+    FRGPS    D+L+ Q LFGDG+AA+I+G +P P +E PLFELVS+AQTI+
Sbjct  188   VVCSEITAVTFRGPSDTHLDSLVGQALFGDGAAAIIIGADPVPAIEKPLFELVSAAQTIL  247

Query  840   PDTDSHLKLQLREMGLTFHCSKAVPSLITQNVEDCLVKAFEPFGISDWNSIFWILHPGGN  1019
             PD+D  +   LRE+GLTFH  K VP LI++NVE  L +AF+P GISDWNS+FWI HPGG 
Sbjct  248   PDSDGAIDGHLREVGLTFHLLKDVPGLISKNVEKSLTEAFKPLGISDWNSLFWIAHPGGP  307

Query  1020  AILDGVEEKLGLDPEKLRASRDVLSQYGNLTSACVLFILDEVRKKSKKQQQMTTGEGLEW  1199
             AILD VE KL L PEKLRA+R VL+ YGN++SACVLFILDE+RKKS +    +TGEGLEW
Sbjct  308   AILDQVEAKLELKPEKLRATRQVLADYGNMSSACVLFILDEMRKKSAEDGLKSTGEGLEW  367

Query  1200  GVLFGFGPGLTIDTVVIRSVP  1262
             GVLFGFGPGLT++TVV+ S+P
Sbjct  368   GVLFGFGPGLTVETVVLHSLP  388



>ref|XP_007223028.1| hypothetical protein PRUPE_ppa006899mg [Prunus persica]
 gb|EMJ24227.1| hypothetical protein PRUPE_ppa006899mg [Prunus persica]
Length=391

 Score =   551 bits (1419),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 258/383 (67%), Positives = 317/383 (83%), Gaps = 0/383 (0%)
 Frame = +3

Query  120   HRAKRLEGDAKILAIGTATPANWVDQTTYPDFYFRITNSQHLLEHKEKFRRICNKSKIMK  299
              +A+R EG A +LAIGTATP N VDQ TYPD+YFRITNS+H  E KEKF+R+C+KS I K
Sbjct  8     RKAQRAEGPATVLAIGTATPPNCVDQATYPDYYFRITNSEHKTELKEKFQRMCDKSMIKK  67

Query  300   RHLVLTEELLKKHPNLCTYNEASLNTRQDILVSGVPKLGKEAAMKAIKEWGRPISEITHL  479
             R++ LTEE+LK++P++C Y   SL+ RQD++V  +PKLGKEAA KAIKEWG+P S+ITHL
Sbjct  68    RYMYLTEEILKENPSMCEYMAPSLDARQDMVVVEIPKLGKEAATKAIKEWGQPKSKITHL  127

Query  480   VFCTTSGVDMPGADFQLTKLLGLNSSVKRLMMYQQGCNAGAAMLRLAKDLAENNKGARVL  659
             VFCTTSGVDMPGAD+QLTKLLGL SSVKRLMMYQQGC AG  +LRLAKDLAENN+GARVL
Sbjct  128   VFCTTSGVDMPGADYQLTKLLGLRSSVKRLMMYQQGCFAGGTVLRLAKDLAENNRGARVL  187

Query  660   VVCSEVMLSVFRGPSLQQEDNLLAQCLFGDGSAAVIVGTEPRPGLETPLFELVSSAQTII  839
             VVCSE+    FRGPS    D+L+ Q LFGDG+AA+IVG++P P +E PLFE+VS+AQTI+
Sbjct  188   VVCSEITAVTFRGPSDTHLDSLVGQALFGDGAAAIIVGSDPIPEIEKPLFEVVSAAQTIL  247

Query  840   PDTDSHLKLQLREMGLTFHCSKAVPSLITQNVEDCLVKAFEPFGISDWNSIFWILHPGGN  1019
             PD+D  +   LRE+GLTFH  K VP LI++N+E  L +AF+P GISDWNS+FWI HPGG 
Sbjct  248   PDSDGAIDGHLREVGLTFHLLKDVPGLISKNIEKSLNEAFQPLGISDWNSLFWIAHPGGP  307

Query  1020  AILDGVEEKLGLDPEKLRASRDVLSQYGNLTSACVLFILDEVRKKSKKQQQMTTGEGLEW  1199
             AILD VE KL L PEKL A+R +LS+YGN++SACVLFILDEVRK++ ++   TTG+GL+W
Sbjct  308   AILDQVESKLSLKPEKLEATRHILSEYGNMSSACVLFILDEVRKRAAEKGLKTTGDGLDW  367

Query  1200  GVLFGFGPGLTIDTVVIRSVPIN  1268
             GVLFGFGPGLT++TVV+ SV +N
Sbjct  368   GVLFGFGPGLTVETVVLHSVGLN  390



>ref|XP_009376347.1| PREDICTED: polyketide synthase 5 [Pyrus x bretschneideri]
Length=391

 Score =   551 bits (1419),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 260/380 (68%), Positives = 314/380 (83%), Gaps = 0/380 (0%)
 Frame = +3

Query  120   HRAKRLEGDAKILAIGTATPANWVDQTTYPDFYFRITNSQHLLEHKEKFRRICNKSKIMK  299
              +A+R EG A ++AIGT+TP+N VDQ TYPD+YFRITNS+H +E KEKF+R+C+KS I K
Sbjct  8     RKAQRAEGPATVMAIGTSTPSNCVDQATYPDYYFRITNSEHKVELKEKFQRMCDKSMIKK  67

Query  300   RHLVLTEELLKKHPNLCTYNEASLNTRQDILVSGVPKLGKEAAMKAIKEWGRPISEITHL  479
             R++ LTEE+LK++P++C Y   S++ RQD++V  VPKLGKEAA KAIKEWG+P S+ITHL
Sbjct  68    RYMYLTEEILKENPSVCEYMAPSIDARQDMVVVEVPKLGKEAATKAIKEWGQPKSKITHL  127

Query  480   VFCTTSGVDMPGADFQLTKLLGLNSSVKRLMMYQQGCNAGAAMLRLAKDLAENNKGARVL  659
             VFCTTSGVDMPGAD+QLTKLLGL  SVKRLMMYQQGC AG  +LRLAKDLAENNKGARVL
Sbjct  128   VFCTTSGVDMPGADYQLTKLLGLRPSVKRLMMYQQGCFAGGTVLRLAKDLAENNKGARVL  187

Query  660   VVCSEVMLSVFRGPSLQQEDNLLAQCLFGDGSAAVIVGTEPRPGLETPLFELVSSAQTII  839
             VVCSE+    FRGPS    D+L+ Q LFGDG+AAVI+G +P P +E PLFELVS+AQTI+
Sbjct  188   VVCSEITAVTFRGPSDTHLDSLVGQALFGDGAAAVIIGADPVPEVEKPLFELVSAAQTIL  247

Query  840   PDTDSHLKLQLREMGLTFHCSKAVPSLITQNVEDCLVKAFEPFGISDWNSIFWILHPGGN  1019
             PD+D  +   LRE+GLTFH  K VP LI++N+E  L +AF+P GISDWNS+FWI HPGG 
Sbjct  248   PDSDGAIDGHLREVGLTFHLLKDVPGLISKNIEKSLNEAFKPIGISDWNSLFWIAHPGGP  307

Query  1020  AILDGVEEKLGLDPEKLRASRDVLSQYGNLTSACVLFILDEVRKKSKKQQQMTTGEGLEW  1199
             AILD VE KL L PEKL A+R VLS YGN++SACVLFILDEVR+KS ++   TTGEGLEW
Sbjct  308   AILDQVEAKLALKPEKLEATRRVLSDYGNMSSACVLFILDEVRRKSAEKGLKTTGEGLEW  367

Query  1200  GVLFGFGPGLTIDTVVIRSV  1259
             GVLFGFGPGLT++TVV+ SV
Sbjct  368   GVLFGFGPGLTVETVVLHSV  387



>sp|P48388.1|CHS3_CAMSI RecName: Full=Chalcone synthase 3; AltName: Full=Naringenin-chalcone 
synthase 3 [Camellia sinensis]
 dbj|BAA05642.1| chalcone synthase [Camellia sinensis]
Length=389

 Score =   550 bits (1418),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 265/384 (69%), Positives = 316/384 (82%), Gaps = 2/384 (1%)
 Frame = +3

Query  108   DTWSHRAKRLEGDAKILAIGTATPANWVDQTTYPDFYFRITNSQHLLEHKEKFRRICNKS  287
             D W  RA+R  G A +LAIGTATP N VDQ+TYPD+YFRITNS+H +E KEKF+R+C+KS
Sbjct  6     DVW--RAQRARGPATVLAIGTATPPNCVDQSTYPDYYFRITNSEHKVELKEKFKRMCDKS  63

Query  288   KIMKRHLVLTEELLKKHPNLCTYNEASLNTRQDILVSGVPKLGKEAAMKAIKEWGRPISE  467
              I KR++ LTEE+LK++P +C Y   SL+ RQD++V  VPKLGKEAA KAIKEWG+P S+
Sbjct  64    MIKKRYMYLTEEILKENPLVCEYMAPSLDARQDMVVVEVPKLGKEAATKAIKEWGQPKSK  123

Query  468   ITHLVFCTTSGVDMPGADFQLTKLLGLNSSVKRLMMYQQGCNAGAAMLRLAKDLAENNKG  647
             ITHLVFCTTSGVDMPGAD+QLTKLLGL  SVKRLMMYQQGC AG  +LRLAKDLAENNKG
Sbjct  124   ITHLVFCTTSGVDMPGADYQLTKLLGLRPSVKRLMMYQQGCFAGGTVLRLAKDLAENNKG  183

Query  648   ARVLVVCSEVMLSVFRGPSLQQEDNLLAQCLFGDGSAAVIVGTEPRPGLETPLFELVSSA  827
             ARVLVVCSE+    FRGPS    D+L+ Q LFGDG+AA+I+G++P P +E PLFELVS+A
Sbjct  184   ARVLVVCSEITAVTFRGPSDTHLDSLVGQSLFGDGAAAIIIGSDPIPEVEKPLFELVSAA  243

Query  828   QTIIPDTDSHLKLQLREMGLTFHCSKAVPSLITQNVEDCLVKAFEPFGISDWNSIFWILH  1007
             QTI+P +D  +   LRE+GLTFH  K VP LI+ NVE  LV+AF+P GISDWNS+FWI H
Sbjct  244   QTILPSSDGAIDGHLREVGLTFHLLKDVPRLISMNVEKSLVEAFQPLGISDWNSLFWIAH  303

Query  1008  PGGNAILDGVEEKLGLDPEKLRASRDVLSQYGNLTSACVLFILDEVRKKSKKQQQMTTGE  1187
             PGG AILD VE KLGL  EKLRA+R VLS+YGN++SACVLFILDE+RKKS ++   TTGE
Sbjct  304   PGGPAILDQVELKLGLKEEKLRATRHVLSEYGNMSSACVLFILDEMRKKSAEEGLKTTGE  363

Query  1188  GLEWGVLFGFGPGLTIDTVVIRSV  1259
             GLEWGVLFGFGPGLT++TVV+ S+
Sbjct  364   GLEWGVLFGFGPGLTVETVVLHSL  387



>gb|AGM46641.1| chalcone synthase protein, partial [Apium graveolens]
Length=384

 Score =   550 bits (1417),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 262/377 (69%), Positives = 310/377 (82%), Gaps = 0/377 (0%)
 Frame = +3

Query  132   RLEGDAKILAIGTATPANWVDQTTYPDFYFRITNSQHLLEHKEKFRRICNKSKIMKRHLV  311
             R  G A +LAIGTATP+N VDQ  YPD+YFRITNS+H+ E KEKF+R+C KS I KR++ 
Sbjct  8     RAPGPATVLAIGTATPSNCVDQAAYPDYYFRITNSEHMTELKEKFKRMCEKSMIKKRYMH  67

Query  312   LTEELLKKHPNLCTYNEASLNTRQDILVSGVPKLGKEAAMKAIKEWGRPISEITHLVFCT  491
             LTEE+LK++PN+C Y   SL+ RQDI+V  VPKLGKEAA KAIKEWG+P S+ITHLVFCT
Sbjct  68    LTEEILKENPNMCAYMAPSLDARQDIVVVEVPKLGKEAAEKAIKEWGQPKSKITHLVFCT  127

Query  492   TSGVDMPGADFQLTKLLGLNSSVKRLMMYQQGCNAGAAMLRLAKDLAENNKGARVLVVCS  671
             TSGVDMPGAD+QLTKLLGL  SVKRLMMYQQGC AG  +LRLAKDLAENNKGARVLVVCS
Sbjct  128   TSGVDMPGADYQLTKLLGLRPSVKRLMMYQQGCFAGGTVLRLAKDLAENNKGARVLVVCS  187

Query  672   EVMLSVFRGPSLQQEDNLLAQCLFGDGSAAVIVGTEPRPGLETPLFELVSSAQTIIPDTD  851
             E+    FRGP+    D+L+ Q LFGDG+AAVIVG++P P +E PLFELVS+AQTI+PD++
Sbjct  188   EITAVTFRGPTDTHLDSLVGQALFGDGAAAVIVGSDPVPEVERPLFELVSAAQTILPDSE  247

Query  852   SHLKLQLREMGLTFHCSKAVPSLITQNVEDCLVKAFEPFGISDWNSIFWILHPGGNAILD  1031
               +   LRE+GLTFH  K VP LI++N+E  L++AF+P GISDWNSIFWI HPGG AILD
Sbjct  248   GAIDGHLREVGLTFHLLKDVPGLISKNIEKSLIEAFQPLGISDWNSIFWIAHPGGPAILD  307

Query  1032  GVEEKLGLDPEKLRASRDVLSQYGNLTSACVLFILDEVRKKSKKQQQMTTGEGLEWGVLF  1211
              VE KLGL PEKLRA+  VLS YGN++SACVLFILDE+RK S +    TTGEGL+WGVLF
Sbjct  308   QVEAKLGLKPEKLRATSHVLSDYGNMSSACVLFILDEMRKTSAEDGLATTGEGLDWGVLF  367

Query  1212  GFGPGLTIDTVVIRSVP  1262
             GFGPGLT++TVV+ SVP
Sbjct  368   GFGPGLTVETVVLHSVP  384



>sp|Q9AU11.1|PKS1_RUBID RecName: Full=Polyketide synthase 1; Short=RiPKS1; AltName: Full=Naringenin-chalcone 
synthase PKS1 [Rubus idaeus]
 gb|AAK15174.1|AF292367_1 aromatic polyketide synthase [Rubus idaeus]
 gb|ACF72868.1| aromatic polyketide synthase [Rubus idaeus]
Length=391

 Score =   550 bits (1418),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 260/380 (68%), Positives = 313/380 (82%), Gaps = 0/380 (0%)
 Frame = +3

Query  120   HRAKRLEGDAKILAIGTATPANWVDQTTYPDFYFRITNSQHLLEHKEKFRRICNKSKIMK  299
              +A+R EG A ILAIGTATP N VDQ+TYPD+YFRIT S+H  E KEKF+R+C+KS I K
Sbjct  8     RKAQRAEGPATILAIGTATPPNCVDQSTYPDYYFRITKSEHKTELKEKFQRMCDKSMIKK  67

Query  300   RHLVLTEELLKKHPNLCTYNEASLNTRQDILVSGVPKLGKEAAMKAIKEWGRPISEITHL  479
             R++ LTEE+LK++P++C Y   SL+ RQD++V  +PKLGKEAA KAIKEWG+P S+ITHL
Sbjct  68    RYMYLTEEILKENPSMCEYMAPSLDARQDMVVVEIPKLGKEAATKAIKEWGQPKSKITHL  127

Query  480   VFCTTSGVDMPGADFQLTKLLGLNSSVKRLMMYQQGCNAGAAMLRLAKDLAENNKGARVL  659
             VFCTTSGVDMPGAD+QLTKLLGL  SVKRLMMYQQGC AG  +LRLAKDLAENNKGARVL
Sbjct  128   VFCTTSGVDMPGADYQLTKLLGLRPSVKRLMMYQQGCFAGGTVLRLAKDLAENNKGARVL  187

Query  660   VVCSEVMLSVFRGPSLQQEDNLLAQCLFGDGSAAVIVGTEPRPGLETPLFELVSSAQTII  839
             VVCSE+    FRGPS    D+L+ Q LFGDG+AA+IVG++P P +E PLFELVS+AQTI+
Sbjct  188   VVCSEITAVTFRGPSDTHLDSLVGQALFGDGAAAIIVGSDPLPDIERPLFELVSAAQTIL  247

Query  840   PDTDSHLKLQLREMGLTFHCSKAVPSLITQNVEDCLVKAFEPFGISDWNSIFWILHPGGN  1019
             PD+D  +   LRE+GLTFH  K VP LI++N+E  L +AF+P  I+DWNS+FWI HPGG 
Sbjct  248   PDSDGAIDGHLREVGLTFHLLKDVPGLISKNIEKSLNEAFKPLDITDWNSLFWIAHPGGP  307

Query  1020  AILDGVEEKLGLDPEKLRASRDVLSQYGNLTSACVLFILDEVRKKSKKQQQMTTGEGLEW  1199
             AILD VE KLGL PEKL A+R++LS+YGN++SACVLFILDEVR+KS      TTGEGLEW
Sbjct  308   AILDQVEAKLGLKPEKLEATRNILSEYGNMSSACVLFILDEVRRKSVANGHKTTGEGLEW  367

Query  1200  GVLFGFGPGLTIDTVVIRSV  1259
             GVLFGFGPGLT++TVV+ SV
Sbjct  368   GVLFGFGPGLTVETVVLHSV  387



>ref|XP_007161599.1| hypothetical protein PHAVU_001G083000g [Phaseolus vulgaris]
 gb|ESW33593.1| hypothetical protein PHAVU_001G083000g [Phaseolus vulgaris]
Length=391

 Score =   550 bits (1418),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 258/380 (68%), Positives = 314/380 (83%), Gaps = 0/380 (0%)
 Frame = +3

Query  126   AKRLEGDAKILAIGTATPANWVDQTTYPDFYFRITNSQHLLEHKEKFRRICNKSKIMKRH  305
             A+R  G A ILA GTATP+N + Q  YPD+YFRITNS+H+ + KEKF+R+C KS I KR+
Sbjct  10    AQRSHGPATILAFGTATPSNCISQADYPDYYFRITNSEHMTDLKEKFKRMCEKSMIKKRY  69

Query  306   LVLTEELLKKHPNLCTYNEASLNTRQDILVSGVPKLGKEAAMKAIKEWGRPISEITHLVF  485
             + LTEE LK++PN+C Y   SL+ RQDI+V  VPKLGKEAA KAIKEWG+P S+ITHLVF
Sbjct  70    MHLTEEFLKENPNMCAYMAPSLDARQDIVVVEVPKLGKEAARKAIKEWGQPKSKITHLVF  129

Query  486   CTTSGVDMPGADFQLTKLLGLNSSVKRLMMYQQGCNAGAAMLRLAKDLAENNKGARVLVV  665
             CTTSGVDMPGAD+QLTKLLGL SSVKRLMMYQQGC AG  +LRLAKDLAENNKGARVLVV
Sbjct  130   CTTSGVDMPGADYQLTKLLGLRSSVKRLMMYQQGCFAGGTVLRLAKDLAENNKGARVLVV  189

Query  666   CSEVMLSVFRGPSLQQEDNLLAQCLFGDGSAAVIVGTEPRPGLETPLFELVSSAQTIIPD  845
             CSE+    FRGPS    D+L+ Q LFGDG+AA+I+G +P   +E P+FELVS+AQTI+PD
Sbjct  190   CSEITAVTFRGPSDAHLDSLVGQALFGDGAAAMIIGADPDRSVERPIFELVSAAQTILPD  249

Query  846   TDSHLKLQLREMGLTFHCSKAVPSLITQNVEDCLVKAFEPFGISDWNSIFWILHPGGNAI  1025
             +D  +   LRE+GLTFH  K VP +I++N+E  L +AF P GI+DWNSIFW+ HPGG AI
Sbjct  250   SDGAIDGHLREVGLTFHLLKDVPGIISKNIEKSLTEAFAPIGINDWNSIFWVAHPGGPAI  309

Query  1026  LDGVEEKLGLDPEKLRASRDVLSQYGNLTSACVLFILDEVRKKSKKQQQMTTGEGLEWGV  1205
             LD VEEKL L PEKLR++R VLS+YGN++SACVLFILDE+RKKSK++++ +TGEGLEWGV
Sbjct  310   LDQVEEKLRLKPEKLRSTRHVLSEYGNMSSACVLFILDEMRKKSKEEEKGSTGEGLEWGV  369

Query  1206  LFGFGPGLTIDTVVIRSVPI  1265
             LFGFGPGLT++TVV+ SVP+
Sbjct  370   LFGFGPGLTVETVVLHSVPL  389



>gb|AGI02993.1| chalcone synthase [Camellia sinensis]
Length=389

 Score =   550 bits (1417),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 265/384 (69%), Positives = 316/384 (82%), Gaps = 2/384 (1%)
 Frame = +3

Query  108   DTWSHRAKRLEGDAKILAIGTATPANWVDQTTYPDFYFRITNSQHLLEHKEKFRRICNKS  287
             D W  RA+R  G A +LAIGTATP N VDQ+TYPD+YFRITNS+H +E KEKF+R+C+KS
Sbjct  6     DVW--RAQRARGPATVLAIGTATPPNCVDQSTYPDYYFRITNSEHKVELKEKFKRMCDKS  63

Query  288   KIMKRHLVLTEELLKKHPNLCTYNEASLNTRQDILVSGVPKLGKEAAMKAIKEWGRPISE  467
              I KR++ LTEE+LK++P +C Y   SL+ RQD++V  VPKLGKEAA KAIKEWG+P S+
Sbjct  64    MIKKRYMYLTEEILKENPLVCEYVAPSLDARQDMVVVEVPKLGKEAATKAIKEWGQPKSK  123

Query  468   ITHLVFCTTSGVDMPGADFQLTKLLGLNSSVKRLMMYQQGCNAGAAMLRLAKDLAENNKG  647
             ITHLVFCTTSGVDMPGAD+QLTKLLGL  SVKRLMMYQQGC AG  +LRLAKDLAENNKG
Sbjct  124   ITHLVFCTTSGVDMPGADYQLTKLLGLRPSVKRLMMYQQGCFAGGTVLRLAKDLAENNKG  183

Query  648   ARVLVVCSEVMLSVFRGPSLQQEDNLLAQCLFGDGSAAVIVGTEPRPGLETPLFELVSSA  827
             ARVLVVCSE+    FRGPS    D+L+ Q LFGDG+AA+I+G++P P +E PLFELVS+A
Sbjct  184   ARVLVVCSEITAVTFRGPSDTHLDSLVGQSLFGDGAAAIIIGSDPIPEVEKPLFELVSAA  243

Query  828   QTIIPDTDSHLKLQLREMGLTFHCSKAVPSLITQNVEDCLVKAFEPFGISDWNSIFWILH  1007
             QTI+P +D  +   LRE+GLTFH  K VP LI+ NVE  LV+AF+P GISDWNS+FWI H
Sbjct  244   QTILPSSDGAIDGHLREVGLTFHLLKDVPRLISMNVEKSLVEAFQPLGISDWNSLFWIAH  303

Query  1008  PGGNAILDGVEEKLGLDPEKLRASRDVLSQYGNLTSACVLFILDEVRKKSKKQQQMTTGE  1187
             PGG AILD VE KLGL  EKLRA+R VLS+YGN++SACVLFILDE+RKKS ++   TTGE
Sbjct  304   PGGPAILDQVELKLGLKEEKLRATRHVLSEYGNMSSACVLFILDEMRKKSAEEGLKTTGE  363

Query  1188  GLEWGVLFGFGPGLTIDTVVIRSV  1259
             GLEWGVLFGFGPGLT++TVV+ S+
Sbjct  364   GLEWGVLFGFGPGLTVETVVLHSL  387



>ref|XP_008224580.1| PREDICTED: polyketide synthase 5-like [Prunus mume]
Length=391

 Score =   550 bits (1417),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 258/383 (67%), Positives = 316/383 (83%), Gaps = 0/383 (0%)
 Frame = +3

Query  120   HRAKRLEGDAKILAIGTATPANWVDQTTYPDFYFRITNSQHLLEHKEKFRRICNKSKIMK  299
              +A+R EG A +LAIGTATP N VDQ TYPD+YFRITNSQH  E KEKF+R+C+KS I K
Sbjct  8     RKAQRAEGPATVLAIGTATPPNCVDQATYPDYYFRITNSQHKTELKEKFQRMCDKSMIKK  67

Query  300   RHLVLTEELLKKHPNLCTYNEASLNTRQDILVSGVPKLGKEAAMKAIKEWGRPISEITHL  479
             R++ LTE++LK++P++C Y   SL+ RQD++V  +PKLGKEAA KAIKEWG+P S+ITHL
Sbjct  68    RYMYLTEDILKENPSMCEYMAPSLDARQDMVVVEIPKLGKEAATKAIKEWGQPKSKITHL  127

Query  480   VFCTTSGVDMPGADFQLTKLLGLNSSVKRLMMYQQGCNAGAAMLRLAKDLAENNKGARVL  659
             VFCTTSGVDMPGAD+QLTKLLGL SSVKRLMMYQQGC AG  +LRLAKDLAENN+GARVL
Sbjct  128   VFCTTSGVDMPGADYQLTKLLGLRSSVKRLMMYQQGCFAGGTVLRLAKDLAENNRGARVL  187

Query  660   VVCSEVMLSVFRGPSLQQEDNLLAQCLFGDGSAAVIVGTEPRPGLETPLFELVSSAQTII  839
             VVCSE+    FRGP+    D+L+ Q LFGDG+AA+IVG +P P +E PLFE+VS+AQTI+
Sbjct  188   VVCSEITAVTFRGPNDTHLDSLVGQALFGDGAAAIIVGADPIPEIEKPLFEVVSAAQTIL  247

Query  840   PDTDSHLKLQLREMGLTFHCSKAVPSLITQNVEDCLVKAFEPFGISDWNSIFWILHPGGN  1019
             PD+D  +   LRE+GLTFH  K VP LI++N+E  L +AF+P GISDWNS+FWI HPGG 
Sbjct  248   PDSDGAIDGHLREVGLTFHLLKDVPGLISKNIEKSLNEAFQPLGISDWNSLFWIAHPGGP  307

Query  1020  AILDGVEEKLGLDPEKLRASRDVLSQYGNLTSACVLFILDEVRKKSKKQQQMTTGEGLEW  1199
             AILD VE KL L PEKL A+R +LS+YGN++SACVLFILDEVRK++ K+   TTG+GL+W
Sbjct  308   AILDQVESKLALKPEKLEATRHILSEYGNMSSACVLFILDEVRKRATKKGLKTTGDGLDW  367

Query  1200  GVLFGFGPGLTIDTVVIRSVPIN  1268
             GVLFGFGPGLT++TVV+ SV +N
Sbjct  368   GVLFGFGPGLTVETVVLHSVGLN  390



>gb|AFK33946.1| unknown [Lotus japonicus]
Length=389

 Score =   550 bits (1417),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 260/382 (68%), Positives = 315/382 (82%), Gaps = 0/382 (0%)
 Frame = +3

Query  120   HRAKRLEGDAKILAIGTATPANWVDQTTYPDFYFRITNSQHLLEHKEKFRRICNKSKIMK  299
              +A+R EG A ILAIGTA P N VDQ+TYPDFYF+ITNS+H+ E KEKF+R+C+KS I K
Sbjct  8     RKAQRAEGPATILAIGTANPPNCVDQSTYPDFYFKITNSEHMTELKEKFQRMCDKSMIKK  67

Query  300   RHLVLTEELLKKHPNLCTYNEASLNTRQDILVSGVPKLGKEAAMKAIKEWGRPISEITHL  479
             R++ L EE+LK++PNLC Y   SL+ RQD++V  VP+LGKEAA KAIKEWG+P S+ITHL
Sbjct  68    RYMYLNEEILKENPNLCAYMAPSLDARQDMVVVEVPRLGKEAATKAIKEWGQPKSKITHL  127

Query  480   VFCTTSGVDMPGADFQLTKLLGLNSSVKRLMMYQQGCNAGAAMLRLAKDLAENNKGARVL  659
             +FCTTSGVDMPGAD+QLTKLLGL  SVKR MMYQQGC AG  +LRLAKDLAENNKGARVL
Sbjct  128   IFCTTSGVDMPGADYQLTKLLGLRPSVKRYMMYQQGCFAGGTVLRLAKDLAENNKGARVL  187

Query  660   VVCSEVMLSVFRGPSLQQEDNLLAQCLFGDGSAAVIVGTEPRPGLETPLFELVSSAQTII  839
             VVCSE+    FRGP+    D+L+ Q LFGDG+AAVIVG++P P +E PLFELV +AQTI 
Sbjct  188   VVCSEITAVTFRGPNDTHLDSLVGQALFGDGAAAVIVGSDPVPEIEKPLFELVWTAQTIA  247

Query  840   PDTDSHLKLQLREMGLTFHCSKAVPSLITQNVEDCLVKAFEPFGISDWNSIFWILHPGGN  1019
             PD+D  +   LRE+GLTFH  K VP ++++N++  LV+AF+P  ISD+NSIFWI HPGG 
Sbjct  248   PDSDGAIDGHLREVGLTFHLLKDVPGIVSKNIDKTLVEAFQPLNISDYNSIFWIAHPGGP  307

Query  1020  AILDGVEEKLGLDPEKLRASRDVLSQYGNLTSACVLFILDEVRKKSKKQQQMTTGEGLEW  1199
             AILD VE+KLGL PEK++A+R+VLS YGN++SACVLFILDE+RKKS +    TTGEGLEW
Sbjct  308   AILDQVEQKLGLKPEKMKATRNVLSDYGNMSSACVLFILDEMRKKSAENGLKTTGEGLEW  367

Query  1200  GVLFGFGPGLTIDTVVIRSVPI  1265
             GVLFGFGPGLTI+TVV+RSV I
Sbjct  368   GVLFGFGPGLTIETVVLRSVAI  389



>gb|ADV29810.1| chalcone synthase [Malus toringoides]
Length=389

 Score =   550 bits (1416),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 261/380 (69%), Positives = 311/380 (82%), Gaps = 0/380 (0%)
 Frame = +3

Query  120   HRAKRLEGDAKILAIGTATPANWVDQTTYPDFYFRITNSQHLLEHKEKFRRICNKSKIMK  299
              +A+R EG A + AIGTATP N VDQ TYPD+YFRITNS+H  E KEKF+R+C+KS I K
Sbjct  8     RKAQRAEGPATVFAIGTATPPNCVDQATYPDYYFRITNSEHKAELKEKFQRMCDKSMIKK  67

Query  300   RHLVLTEELLKKHPNLCTYNEASLNTRQDILVSGVPKLGKEAAMKAIKEWGRPISEITHL  479
             R++ LTEE+LK++P++C Y   SL+ RQD++V  VP+LGKEAA KAIKEWG+P S+ITHL
Sbjct  68    RYMYLTEEILKENPSVCEYMAPSLDARQDMVVVEVPRLGKEAATKAIKEWGQPKSKITHL  127

Query  480   VFCTTSGVDMPGADFQLTKLLGLNSSVKRLMMYQQGCNAGAAMLRLAKDLAENNKGARVL  659
             VFCTTSGVDMPGAD+QLTKLLGL  SVKRLMMYQQGC AG  +LRLAKDLAENNKGARVL
Sbjct  128   VFCTTSGVDMPGADYQLTKLLGLRPSVKRLMMYQQGCFAGGTVLRLAKDLAENNKGARVL  187

Query  660   VVCSEVMLSVFRGPSLQQEDNLLAQCLFGDGSAAVIVGTEPRPGLETPLFELVSSAQTII  839
             VVCSE+    FRGPS    D+L+ Q LFGDG+AAVI+G +P P +E PLFELVS+AQTI+
Sbjct  188   VVCSEITAVTFRGPSDTHLDSLVGQALFGDGAAAVIIGADPVPEVEKPLFELVSAAQTIL  247

Query  840   PDTDSHLKLQLREMGLTFHCSKAVPSLITQNVEDCLVKAFEPFGISDWNSIFWILHPGGN  1019
             PD+D  +   LRE+GLTFH  K VP LI++N+E  L +AF+P GISDWNS+FWI HPGG 
Sbjct  248   PDSDGAIDGHLREVGLTFHLLKDVPGLISKNIEKSLNEAFKPIGISDWNSLFWIAHPGGP  307

Query  1020  AILDGVEEKLGLDPEKLRASRDVLSQYGNLTSACVLFILDEVRKKSKKQQQMTTGEGLEW  1199
             AILD VE KL L PEKL A+R VLS YGN++SACVLFILDEVR+KS ++   TTGEGLEW
Sbjct  308   AILDQVEAKLALKPEKLEATRQVLSDYGNMSSACVLFILDEVRRKSAEKGLETTGEGLEW  367

Query  1200  GVLFGFGPGLTIDTVVIRSV  1259
             GVLFGFGPGLT++TVV+ SV
Sbjct  368   GVLFGFGPGLTVETVVLHSV  387



>gb|AFX71920.1| CHS2 chalcone synthase [Malus domestica]
Length=389

 Score =   550 bits (1416),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 261/380 (69%), Positives = 311/380 (82%), Gaps = 0/380 (0%)
 Frame = +3

Query  120   HRAKRLEGDAKILAIGTATPANWVDQTTYPDFYFRITNSQHLLEHKEKFRRICNKSKIMK  299
              +A+R EG A +LAIGTATP+N VDQ TYPD+YFRITNS+H  E KEKF+R+C+KS I K
Sbjct  8     RKAQRAEGPATVLAIGTATPSNCVDQATYPDYYFRITNSEHKTELKEKFQRMCDKSMIKK  67

Query  300   RHLVLTEELLKKHPNLCTYNEASLNTRQDILVSGVPKLGKEAAMKAIKEWGRPISEITHL  479
             R++ LTEE+LK++P +C Y   SL+ RQD++V  VP+LGKEAA KAIKEWG+P S+ITHL
Sbjct  68    RYMYLTEEILKENPTVCEYMAPSLDARQDMVVVEVPRLGKEAATKAIKEWGQPKSKITHL  127

Query  480   VFCTTSGVDMPGADFQLTKLLGLNSSVKRLMMYQQGCNAGAAMLRLAKDLAENNKGARVL  659
             VFCTTSGVDMPGAD+QLTKLLGL   VKRLMMYQQGC AG  +LRLAKDLAENNKGARVL
Sbjct  128   VFCTTSGVDMPGADYQLTKLLGLRPYVKRLMMYQQGCFAGGTVLRLAKDLAENNKGARVL  187

Query  660   VVCSEVMLSVFRGPSLQQEDNLLAQCLFGDGSAAVIVGTEPRPGLETPLFELVSSAQTII  839
             VVCSE+    FRGPS    D+L+ Q LFGDG+AAVI+G +P P +E PLFELVS+AQTI+
Sbjct  188   VVCSEITAVTFRGPSDTHLDSLVGQALFGDGAAAVIIGADPLPEVEKPLFELVSAAQTIL  247

Query  840   PDTDSHLKLQLREMGLTFHCSKAVPSLITQNVEDCLVKAFEPFGISDWNSIFWILHPGGN  1019
             PD+D  +   LRE+GLTFH  K VP LI++N+E  L +AF+P GISDWNS+FWI HPGG 
Sbjct  248   PDSDGAIDGHLREVGLTFHLLKDVPGLISKNIEKSLNEAFKPIGISDWNSLFWIAHPGGP  307

Query  1020  AILDGVEEKLGLDPEKLRASRDVLSQYGNLTSACVLFILDEVRKKSKKQQQMTTGEGLEW  1199
             AILD VE KL L PEKL A+R VLS YGN++SACVLFILDEVR+KS ++   TTGEGLEW
Sbjct  308   AILDQVESKLALKPEKLEATRQVLSNYGNMSSACVLFILDEVRRKSTEKGLRTTGEGLEW  367

Query  1200  GVLFGFGPGLTIDTVVIRSV  1259
             GVLFGFGPGLT++TVV+ SV
Sbjct  368   GVLFGFGPGLTVETVVLHSV  387



>ref|XP_004504355.1| PREDICTED: chalcone synthase 1-like [Cicer arietinum]
Length=389

 Score =   550 bits (1416),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 259/380 (68%), Positives = 314/380 (83%), Gaps = 0/380 (0%)
 Frame = +3

Query  120   HRAKRLEGDAKILAIGTATPANWVDQTTYPDFYFRITNSQHLLEHKEKFRRICNKSKIMK  299
              +A+R EG A ++AIGTATP N++DQ+ YPD+YFR+TNS+H  E KEKF+R+C KS I K
Sbjct  8     RKAQRAEGPATVMAIGTATPPNFIDQSDYPDYYFRVTNSEHKTELKEKFKRMCEKSMIKK  67

Query  300   RHLVLTEELLKKHPNLCTYNEASLNTRQDILVSGVPKLGKEAAMKAIKEWGRPISEITHL  479
             R++ LTEE+LK++PN+C Y   SL+ RQD++V  VPKLGKEAA KAIKEWG+P S+ITHL
Sbjct  68    RYMYLTEEILKENPNVCAYMAPSLDARQDMVVVEVPKLGKEAATKAIKEWGQPKSKITHL  127

Query  480   VFCTTSGVDMPGADFQLTKLLGLNSSVKRLMMYQQGCNAGAAMLRLAKDLAENNKGARVL  659
             VFCTTSGVDMPGAD+QLTKLLGL  SVKR MMYQQGC AG  +LRLAKDLAENNKGARVL
Sbjct  128   VFCTTSGVDMPGADYQLTKLLGLRPSVKRYMMYQQGCFAGGTVLRLAKDLAENNKGARVL  187

Query  660   VVCSEVMLSVFRGPSLQQEDNLLAQCLFGDGSAAVIVGTEPRPGLETPLFELVSSAQTII  839
             VVCSE+    FRGP+    D+L+ Q LFGDG+AAVIVG++P P +E PLFELV +AQTI+
Sbjct  188   VVCSEITAVTFRGPNDTHLDSLVGQALFGDGAAAVIVGSDPLPDVERPLFELVWTAQTIL  247

Query  840   PDTDSHLKLQLREMGLTFHCSKAVPSLITQNVEDCLVKAFEPFGISDWNSIFWILHPGGN  1019
             PD++  +   LRE+GLTFH  K VP LI++N+E  LV+AF+P GISD+NSIFWI HPGG 
Sbjct  248   PDSEGAIDGHLREVGLTFHLLKDVPGLISKNIEKALVEAFKPLGISDYNSIFWIAHPGGP  307

Query  1020  AILDGVEEKLGLDPEKLRASRDVLSQYGNLTSACVLFILDEVRKKSKKQQQMTTGEGLEW  1199
             AILD VE+KLGL PEKL A+R VLS+YGN++SACVLFILD +R KSK+    TTGEGLEW
Sbjct  308   AILDQVEDKLGLKPEKLEATRHVLSEYGNMSSACVLFILDAMRNKSKENGLATTGEGLEW  367

Query  1200  GVLFGFGPGLTIDTVVIRSV  1259
             GVLFGFGPGLT++TVV+RSV
Sbjct  368   GVLFGFGPGLTVETVVLRSV  387



>gb|AEO36981.1| chalcone synthase [Dimocarpus longan]
Length=393

 Score =   550 bits (1416),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 261/383 (68%), Positives = 316/383 (83%), Gaps = 0/383 (0%)
 Frame = +3

Query  120   HRAKRLEGDAKILAIGTATPANWVDQTTYPDFYFRITNSQHLLEHKEKFRRICNKSKIMK  299
              +A+R EG A ILAIGTATPAN V Q  YPD+YFRITNS+H+ E KEKF+R+C+KS I K
Sbjct  8     RKAQRAEGPANILAIGTATPANCVLQADYPDYYFRITNSEHMTELKEKFQRMCDKSMIKK  67

Query  300   RHLVLTEELLKKHPNLCTYNEASLNTRQDILVSGVPKLGKEAAMKAIKEWGRPISEITHL  479
             R++ LTE++LK++PN+C Y   S++ RQDI+V  VPKLGKEAA KAIKEWG+P S+ITHL
Sbjct  68    RYMHLTEDILKENPNMCAYMAPSIDARQDIVVVEVPKLGKEAAQKAIKEWGQPKSKITHL  127

Query  480   VFCTTSGVDMPGADFQLTKLLGLNSSVKRLMMYQQGCNAGAAMLRLAKDLAENNKGARVL  659
             VFCTTSGVDMPGAD+QLTKLLGL  SVKRLMMYQQGC AG  +LRLAKDLAENNKGARVL
Sbjct  128   VFCTTSGVDMPGADYQLTKLLGLRPSVKRLMMYQQGCFAGGTVLRLAKDLAENNKGARVL  187

Query  660   VVCSEVMLSVFRGPSLQQEDNLLAQCLFGDGSAAVIVGTEPRPGLETPLFELVSSAQTII  839
             VVCSE+    FRGP+    D+L+ Q LFGDG+AAVI+G +P   +E PLF+LVS+AQTI+
Sbjct  188   VVCSEITAVTFRGPTDTHLDSLVGQALFGDGAAAVIIGADPDTSIERPLFQLVSAAQTIL  247

Query  840   PDTDSHLKLQLREMGLTFHCSKAVPSLITQNVEDCLVKAFEPFGISDWNSIFWILHPGGN  1019
             PD+D  +   LRE+GLTFH  K VP LI++N+E  LV+AF P GI+DWNSIFWI HPGG 
Sbjct  248   PDSDGAIDGHLREVGLTFHLLKDVPGLISKNIEKSLVEAFTPIGINDWNSIFWIAHPGGP  307

Query  1020  AILDGVEEKLGLDPEKLRASRDVLSQYGNLTSACVLFILDEVRKKSKKQQQMTTGEGLEW  1199
             AILD VE KLGL  EKLRA+R VLS+YGN++SACVLFILDE+R+K  ++ ++TTGEGL+W
Sbjct  308   AILDQVEAKLGLKEEKLRATRHVLSEYGNMSSACVLFILDEMRRKCLEEGKLTTGEGLDW  367

Query  1200  GVLFGFGPGLTIDTVVIRSVPIN  1268
             GVLFGFGPGLT++TVV+ SVPI 
Sbjct  368   GVLFGFGPGLTVETVVLPSVPIQ  390



>gb|AIB06736.1| chalcone synthases-1 [Mangifera indica]
Length=390

 Score =   550 bits (1416),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 261/380 (69%), Positives = 313/380 (82%), Gaps = 0/380 (0%)
 Frame = +3

Query  120   HRAKRLEGDAKILAIGTATPANWVDQTTYPDFYFRITNSQHLLEHKEKFRRICNKSKIMK  299
              +A+R EG A I+AIGTA P N VDQ+TYPD+YFRITNS+H  E KEKF+R+C KS I K
Sbjct  8     RKAQRAEGPATIMAIGTANPPNCVDQSTYPDYYFRITNSEHKTELKEKFKRMCEKSMIKK  67

Query  300   RHLVLTEELLKKHPNLCTYNEASLNTRQDILVSGVPKLGKEAAMKAIKEWGRPISEITHL  479
             R++ LTEE+LK++P +C Y   SL+ RQD++V  VPKLGKEAA KAIKEWG+P S+ITHL
Sbjct  68    RYMYLTEEILKENPAICEYMAPSLDARQDMVVVEVPKLGKEAAAKAIKEWGQPKSKITHL  127

Query  480   VFCTTSGVDMPGADFQLTKLLGLNSSVKRLMMYQQGCNAGAAMLRLAKDLAENNKGARVL  659
             VFCTTSGVDMPGAD+QLTKLLGL  SVKR MMYQQGC AG  +LRLAKDLAENNKGARVL
Sbjct  128   VFCTTSGVDMPGADYQLTKLLGLRPSVKRYMMYQQGCFAGGTVLRLAKDLAENNKGARVL  187

Query  660   VVCSEVMLSVFRGPSLQQEDNLLAQCLFGDGSAAVIVGTEPRPGLETPLFELVSSAQTII  839
             VVCSE+    FRGPS    D+L+ Q LFGDG+AA+IVG++P P +E P+FELVS+AQTI+
Sbjct  188   VVCSEITAVTFRGPSDTHLDSLVGQALFGDGAAALIVGSDPIPEVEKPMFELVSAAQTIL  247

Query  840   PDTDSHLKLQLREMGLTFHCSKAVPSLITQNVEDCLVKAFEPFGISDWNSIFWILHPGGN  1019
             PD+D  +   LRE+GLTFH  K VP LI++N+E  LV+AF+P GISDWNS+FWI HPGG 
Sbjct  248   PDSDGAIDGHLREVGLTFHLLKDVPGLISKNIEKSLVEAFQPLGISDWNSLFWIAHPGGP  307

Query  1020  AILDGVEEKLGLDPEKLRASRDVLSQYGNLTSACVLFILDEVRKKSKKQQQMTTGEGLEW  1199
             AILD VE KLGL  EKLRA+R VLS+YGN++SACVLFILD++RKKSK+    TTGEGLEW
Sbjct  308   AILDQVEVKLGLKEEKLRATRHVLSEYGNMSSACVLFILDDMRKKSKENGLKTTGEGLEW  367

Query  1200  GVLFGFGPGLTIDTVVIRSV  1259
             GVLFGFGPGL+++TVV+ SV
Sbjct  368   GVLFGFGPGLSVETVVLHSV  387



>ref|XP_002303821.2| naregenin-chalcone synthase family protein [Populus trichocarpa]
 gb|EEE78800.2| naregenin-chalcone synthase family protein [Populus trichocarpa]
Length=391

 Score =   550 bits (1416),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 259/380 (68%), Positives = 314/380 (83%), Gaps = 0/380 (0%)
 Frame = +3

Query  120   HRAKRLEGDAKILAIGTATPANWVDQTTYPDFYFRITNSQHLLEHKEKFRRICNKSKIMK  299
              +++R EG A I+AIGT+TP N VDQ+TYP++YFRITNS+H  E KEKF+R+C KS I K
Sbjct  8     RKSQRAEGPATIMAIGTSTPPNCVDQSTYPEYYFRITNSEHKAELKEKFKRMCEKSMIKK  67

Query  300   RHLVLTEELLKKHPNLCTYNEASLNTRQDILVSGVPKLGKEAAMKAIKEWGRPISEITHL  479
             R++ LTEE+LK++P++C Y   SL+ RQD++V  VPKLGKEAA KAIKEWG+P S+ITHL
Sbjct  68    RYMYLTEEILKENPSVCEYMAPSLDARQDMVVVEVPKLGKEAATKAIKEWGQPKSKITHL  127

Query  480   VFCTTSGVDMPGADFQLTKLLGLNSSVKRLMMYQQGCNAGAAMLRLAKDLAENNKGARVL  659
             VFCTTSGVDMPGAD+QLTKLLGL SSVKR MMYQQGC AG  +LRLAKDLAENNKGARVL
Sbjct  128   VFCTTSGVDMPGADYQLTKLLGLRSSVKRFMMYQQGCFAGGTVLRLAKDLAENNKGARVL  187

Query  660   VVCSEVMLSVFRGPSLQQEDNLLAQCLFGDGSAAVIVGTEPRPGLETPLFELVSSAQTII  839
             VVCSE+    FRGPS    D+L+ Q LFGDG+AA+++G++P  G+E PLFELVS+AQTI+
Sbjct  188   VVCSEITAVTFRGPSDTHLDSLVGQALFGDGAAALVIGSDPVIGVEKPLFELVSAAQTIL  247

Query  840   PDTDSHLKLQLREMGLTFHCSKAVPSLITQNVEDCLVKAFEPFGISDWNSIFWILHPGGN  1019
             PD+D  +   LRE+GLTFH  K VP LI++NVE  L +AF+P GISDWNS+FWI HPGG 
Sbjct  248   PDSDGAIDGHLREVGLTFHLLKDVPGLISKNVEKSLTEAFKPLGISDWNSLFWIAHPGGP  307

Query  1020  AILDGVEEKLGLDPEKLRASRDVLSQYGNLTSACVLFILDEVRKKSKKQQQMTTGEGLEW  1199
             AILD VE KL L PEKLRA+R VLS+YGN++SACVLFILDE+RKKS +    +TGEGLEW
Sbjct  308   AILDQVEAKLALKPEKLRATRHVLSEYGNMSSACVLFILDEMRKKSAEDGLQSTGEGLEW  367

Query  1200  GVLFGFGPGLTIDTVVIRSV  1259
             GVLFGFGPGLT++TVV+ SV
Sbjct  368   GVLFGFGPGLTVETVVLHSV  387



>sp|Q43163.1|CHSB_SOLTU RecName: Full=Chalcone synthase 1B; AltName: Full=Naringenin-chalcone 
synthase 1B [Solanum tuberosum]
 gb|AAB67735.1| chalcone synthase 1b [Solanum tuberosum]
Length=389

 Score =   549 bits (1415),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 261/380 (69%), Positives = 315/380 (83%), Gaps = 0/380 (0%)
 Frame = +3

Query  120   HRAKRLEGDAKILAIGTATPANWVDQTTYPDFYFRITNSQHLLEHKEKFRRICNKSKIMK  299
              +A+R EG A ILAIGT+TP+N VDQ+TYPD+YFRITNS+H  E KEKF+R+C+KS I K
Sbjct  8     RKAQRAEGPATILAIGTSTPSNCVDQSTYPDYYFRITNSEHKTELKEKFKRMCDKSMIKK  67

Query  300   RHLVLTEELLKKHPNLCTYNEASLNTRQDILVSGVPKLGKEAAMKAIKEWGRPISEITHL  479
             R++ LTEE+LK++PN+C Y   SL+ RQDI+V  VPKLGKEAA KAIKEWG+P S+ITHL
Sbjct  68    RYMHLTEEILKENPNMCAYMAPSLDARQDIVVVEVPKLGKEAAQKAIKEWGQPKSKITHL  127

Query  480   VFCTTSGVDMPGADFQLTKLLGLNSSVKRLMMYQQGCNAGAAMLRLAKDLAENNKGARVL  659
             VFCTTSGVDMPG D+QL KLLGL  SVKRLMMYQQGC AG  +LRLAKDLAENNKGARVL
Sbjct  128   VFCTTSGVDMPGCDYQLAKLLGLRPSVKRLMMYQQGCFAGGTVLRLAKDLAENNKGARVL  187

Query  660   VVCSEVMLSVFRGPSLQQEDNLLAQCLFGDGSAAVIVGTEPRPGLETPLFELVSSAQTII  839
             VVCSE+    FRGPS    D+L+ Q LFGDG+AA+I+G++P  G+E PLFELVS+AQT++
Sbjct  188   VVCSEITAVTFRGPSESHLDSLVGQALFGDGAAAIIMGSDPIIGVERPLFELVSAAQTLV  247

Query  840   PDTDSHLKLQLREMGLTFHCSKAVPSLITQNVEDCLVKAFEPFGISDWNSIFWILHPGGN  1019
             PD++  +   LRE+GLTFH  K VP LI++N+E  L++AF+P GISDWNS+FWI HPGG 
Sbjct  248   PDSEGAIDGHLREVGLTFHLLKDVPGLISKNIEKSLLEAFQPLGISDWNSLFWIAHPGGP  307

Query  1020  AILDGVEEKLGLDPEKLRASRDVLSQYGNLTSACVLFILDEVRKKSKKQQQMTTGEGLEW  1199
             AILD VE KLGL  EKLRA+R+VLS YGN++SACVLFILDE+RK S K+   TTGEGLEW
Sbjct  308   AILDQVELKLGLKQEKLRATREVLSNYGNMSSACVLFILDEMRKASTKEGLGTTGEGLEW  367

Query  1200  GVLFGFGPGLTIDTVVIRSV  1259
             GVLFGFGPGLT++TVV+ SV
Sbjct  368   GVLFGFGPGLTVETVVLHSV  387



>ref|XP_002518132.1| Chalcone synthase, putative [Ricinus communis]
 gb|EEF44265.1| Chalcone synthase, putative [Ricinus communis]
Length=390

 Score =   549 bits (1415),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 258/379 (68%), Positives = 314/379 (83%), Gaps = 0/379 (0%)
 Frame = +3

Query  123   RAKRLEGDAKILAIGTATPANWVDQTTYPDFYFRITNSQHLLEHKEKFRRICNKSKIMKR  302
             R +R EG A +LAIGT TP N VDQ+TYPD+YFR+TNS+H  E KEKF+R+C+KS I KR
Sbjct  9     RTQRAEGPATVLAIGTVTPTNSVDQSTYPDYYFRVTNSEHKTELKEKFKRMCDKSMIKKR  68

Query  303   HLVLTEELLKKHPNLCTYNEASLNTRQDILVSGVPKLGKEAAMKAIKEWGRPISEITHLV  482
             ++ LTEE+LK++PN+C Y   SL+ RQDI+V  VPKLGKEAA+KAIKEWG+P S+ITHLV
Sbjct  69    YMHLTEEMLKENPNICAYMAPSLDARQDIVVVEVPKLGKEAAVKAIKEWGQPKSKITHLV  128

Query  483   FCTTSGVDMPGADFQLTKLLGLNSSVKRLMMYQQGCNAGAAMLRLAKDLAENNKGARVLV  662
             FCTTSGVDMPGAD+QLTKLLGL  S+KRLMMYQQGC AG  +LRLAKDLAENNKGARVLV
Sbjct  129   FCTTSGVDMPGADYQLTKLLGLRPSIKRLMMYQQGCFAGGTVLRLAKDLAENNKGARVLV  188

Query  663   VCSEVMLSVFRGPSLQQEDNLLAQCLFGDGSAAVIVGTEPRPGLETPLFELVSSAQTIIP  842
             VCSE+    FRGPS    D+L+ Q LFGDG+AAVIVG++P P +E PL+ELV +AQTI+P
Sbjct  189   VCSELTAVTFRGPSDTHLDSLVGQALFGDGAAAVIVGSDPVPNVEKPLYELVFTAQTILP  248

Query  843   DTDSHLKLQLREMGLTFHCSKAVPSLITQNVEDCLVKAFEPFGISDWNSIFWILHPGGNA  1022
             D+D  +   LRE+GLTFH  K VP LI++N+E  LV+AF+P GISDWNSIFWI HPGG A
Sbjct  249   DSDGAIDGHLREVGLTFHLLKDVPGLISKNIEKSLVEAFQPLGISDWNSIFWIAHPGGPA  308

Query  1023  ILDGVEEKLGLDPEKLRASRDVLSQYGNLTSACVLFILDEVRKKSKKQQQMTTGEGLEWG  1202
             ILD VE KLGL+P KL+A+R +LS++GN++SACVLFI+D +RKKS +    +TGEGLEWG
Sbjct  309   ILDQVEAKLGLEPNKLQATRHILSEFGNMSSACVLFIMDYMRKKSAEDGLESTGEGLEWG  368

Query  1203  VLFGFGPGLTIDTVVIRSV  1259
             VLFGFGPGLT++TVV+ SV
Sbjct  369   VLFGFGPGLTVETVVLHSV  387



>gb|AAO13091.1| chalcone synthase [Camellia sinensis]
Length=389

 Score =   549 bits (1415),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 262/380 (69%), Positives = 312/380 (82%), Gaps = 0/380 (0%)
 Frame = +3

Query  120   HRAKRLEGDAKILAIGTATPANWVDQTTYPDFYFRITNSQHLLEHKEKFRRICNKSKIMK  299
              RA+R EG A ++AIGTATP N VDQ+TYPD+YFRITNS+H  E KEKF+R+C+KS I K
Sbjct  8     RRAQRAEGPATVMAIGTATPPNCVDQSTYPDYYFRITNSEHKAELKEKFKRMCDKSMIKK  67

Query  300   RHLVLTEELLKKHPNLCTYNEASLNTRQDILVSGVPKLGKEAAMKAIKEWGRPISEITHL  479
             R++ LTEE+LK++P +C Y   SL+ RQD++V  VPKLGKEAA KAIKEWG+P S+ITHL
Sbjct  68    RYMYLTEEILKENPQVCGYMAPSLDARQDMVVVEVPKLGKEAATKAIKEWGQPKSKITHL  127

Query  480   VFCTTSGVDMPGADFQLTKLLGLNSSVKRLMMYQQGCNAGAAMLRLAKDLAENNKGARVL  659
             VFCTTSGVDMPGAD+QLTKLLGL  SVKRLMMYQQGC AG  +LRLAKDLAENNKGARVL
Sbjct  128   VFCTTSGVDMPGADYQLTKLLGLRPSVKRLMMYQQGCFAGGTVLRLAKDLAENNKGARVL  187

Query  660   VVCSEVMLSVFRGPSLQQEDNLLAQCLFGDGSAAVIVGTEPRPGLETPLFELVSSAQTII  839
             VVCS +    FRGPS    D+L+ Q LFGDG+AA+IVG++P P +E PLFELVS+AQTI+
Sbjct  188   VVCSGITAVTFRGPSDTHLDSLVGQALFGDGAAAIIVGSDPIPEVENPLFELVSAAQTIL  247

Query  840   PDTDSHLKLQLREMGLTFHCSKAVPSLITQNVEDCLVKAFEPFGISDWNSIFWILHPGGN  1019
             PD+D  +   LRE+GLTFH  K VP LI++N+E  L +AF+P GISDWNS+FWI HPGG 
Sbjct  248   PDSDGAIDGHLREVGLTFHLLKDVPGLISKNIEKSLAEAFQPLGISDWNSLFWIAHPGGP  307

Query  1020  AILDGVEEKLGLDPEKLRASRDVLSQYGNLTSACVLFILDEVRKKSKKQQQMTTGEGLEW  1199
             AILD VE KLGL  EKLRA+R VLS+YGN++SACVLFILDE+RKKS      TTGEGLEW
Sbjct  308   AILDQVELKLGLKEEKLRATRHVLSEYGNMSSACVLFILDEMRKKSAADGLKTTGEGLEW  367

Query  1200  GVLFGFGPGLTIDTVVIRSV  1259
             GVLFGFGPGLT++TVV+ S+
Sbjct  368   GVLFGFGPGLTVETVVLHSL  387



>sp|Q9XJ58.1|CHS1_CITSI RecName: Full=Chalcone synthase 1; AltName: Full=Naringenin-chalcone 
synthase 1 [Citrus sinensis]
 dbj|BAA81663.1| chalcone synthase [Citrus sinensis]
Length=389

 Score =   549 bits (1415),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 259/380 (68%), Positives = 315/380 (83%), Gaps = 1/380 (0%)
 Frame = +3

Query  120   HRAKRLEGDAKILAIGTATPANWVDQTTYPDFYFRITNSQHLLEHKEKFRRICNKSKIMK  299
              +A+R +G A I+AIGTATP N VDQ+TYPD+YFRITNS+H+ + KEKF+R+C+KS I K
Sbjct  8     RKAQRAQGPATIMAIGTATPPNCVDQSTYPDYYFRITNSEHMTDLKEKFKRMCDKSMIKK  67

Query  300   RHLVLTEELLKKHPNLCTYNEASLNTRQDILVSGVPKLGKEAAMKAIKEWGRPISEITHL  479
             R++ LTEE+LK++PN+C Y   SL+TRQD++V  VP+LGK AA +AIKEWG+P S+ITHL
Sbjct  68    RYMYLTEEILKENPNVCAYMAPSLDTRQDMVVVEVPRLGK-AATEAIKEWGQPKSKITHL  126

Query  480   VFCTTSGVDMPGADFQLTKLLGLNSSVKRLMMYQQGCNAGAAMLRLAKDLAENNKGARVL  659
             VFCTTSGVDMPGAD++LTKLLGL  SVKRLMMYQQGC AG  +LRLAKDLAENNKGARVL
Sbjct  127   VFCTTSGVDMPGADYRLTKLLGLRPSVKRLMMYQQGCFAGGTVLRLAKDLAENNKGARVL  186

Query  660   VVCSEVMLSVFRGPSLQQEDNLLAQCLFGDGSAAVIVGTEPRPGLETPLFELVSSAQTII  839
             VVCSE+    FRGPS    D+L+ Q LFGDG+AA+I+G +P P +E P+FELVS+AQTI+
Sbjct  187   VVCSEITAVTFRGPSDTHLDSLVGQALFGDGAAAIIIGADPIPEIEKPMFELVSTAQTIL  246

Query  840   PDTDSHLKLQLREMGLTFHCSKAVPSLITQNVEDCLVKAFEPFGISDWNSIFWILHPGGN  1019
             PD+D  +   LRE GLTFH  K VP LI++N++  L +AF+P GISDWNSIFWI HPGG 
Sbjct  247   PDSDGSIDGHLREAGLTFHLLKDVPGLISKNIQKSLTEAFKPLGISDWNSIFWIAHPGGP  306

Query  1020  AILDGVEEKLGLDPEKLRASRDVLSQYGNLTSACVLFILDEVRKKSKKQQQMTTGEGLEW  1199
             AILD VEEKLGL PEKLRA+R VLS+YGN++SACVLFILDE+RKKS +    T GEGLEW
Sbjct  307   AILDQVEEKLGLKPEKLRATRHVLSEYGNMSSACVLFILDEMRKKSAEDGLETAGEGLEW  366

Query  1200  GVLFGFGPGLTIDTVVIRSV  1259
             GVLFGFGPGLT++TVV+ SV
Sbjct  367   GVLFGFGPGLTVETVVLHSV  386



>sp|Q9MB37.1|CHS7_IPOBA RecName: Full=Chalcone synthase DIII; AltName: Full=Naringenin-chalcone 
synthase DIII [Ipomoea batatas]
 dbj|BAA90331.1| chalcone synthase CHS-DIII [Ipomoea batatas]
Length=393

 Score =   549 bits (1415),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 264/381 (69%), Positives = 311/381 (82%), Gaps = 1/381 (0%)
 Frame = +3

Query  123   RAKRLEGDAKILAIGTATPANWVDQTTYPDFYFRITNSQHLLEHKEKFRRICNKSKIMKR  302
             +AKR EG A ILAIGTATPAN V+Q+TYPD+YFRITNS+H  E KEKF+R+C+KS I KR
Sbjct  9     KAKRAEGPATILAIGTATPANCVNQSTYPDYYFRITNSEHKTELKEKFQRMCDKSMITKR  68

Query  303   HLVLTEELLKKHPNLCTYNEASLNTRQDILVSGVPKLGKEAAMKAIKEWGRPISEITHLV  482
             ++ LTEE+LK++P+ C Y   SL+ RQDI V  VPKLGKEAA  AIKEWG+P S+ITH+ 
Sbjct  69    YMHLTEEILKENPSFCEYMAPSLDARQDIAVVEVPKLGKEAAQSAIKEWGQPKSKITHVF  128

Query  483   FCTTSGVDMPGADFQLTKLLGLNSSVKRLMMYQQGCNAGAAMLRLAKDLAENNKGARVLV  662
             FCTTSGVDMPGAD+QLTKLLGL  SVKRLMMYQQGC AG  +LRLAKDLAENNKGARVL+
Sbjct  129   FCTTSGVDMPGADYQLTKLLGLRPSVKRLMMYQQGCFAGGTVLRLAKDLAENNKGARVLI  188

Query  663   VCSEVMLSVFRGPSLQQEDNLLAQCLFGDGSAAVIVGTEPRPGLETPLFELVSSAQTIIP  842
             VCSE+ +  FRGPS    D+L+ Q LFGDG+AAVIVG +P P  E PLF+LVS+AQT+ P
Sbjct  189   VCSEITVVTFRGPSETHLDSLVGQALFGDGAAAVIVGADPTPA-EKPLFQLVSAAQTLAP  247

Query  843   DTDSHLKLQLREMGLTFHCSKAVPSLITQNVEDCLVKAFEPFGISDWNSIFWILHPGGNA  1022
             D+   +   LRE+GLTFH  K VPS+++ N+E CL +AF P GISDWNS+FWI HPGG A
Sbjct  248   DSCGAIDGHLREVGLTFHLLKDVPSVVSNNIEKCLFEAFNPLGISDWNSVFWIAHPGGPA  307

Query  1023  ILDGVEEKLGLDPEKLRASRDVLSQYGNLTSACVLFILDEVRKKSKKQQQMTTGEGLEWG  1202
             ILD VE+KLGL PEKLRA+R VLS+YGN++SACVLFILDE+RK S      TTGEGLEWG
Sbjct  308   ILDQVEDKLGLKPEKLRATRHVLSEYGNMSSACVLFILDEMRKASSNAGLGTTGEGLEWG  367

Query  1203  VLFGFGPGLTIDTVVIRSVPI  1265
             VLFGFGPGLTI+TVV+ SVPI
Sbjct  368   VLFGFGPGLTIETVVLHSVPI  388



>gb|ABB89213.1| chalcone synthase [Sorbus aucuparia]
Length=391

 Score =   549 bits (1415),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 260/380 (68%), Positives = 313/380 (82%), Gaps = 0/380 (0%)
 Frame = +3

Query  120   HRAKRLEGDAKILAIGTATPANWVDQTTYPDFYFRITNSQHLLEHKEKFRRICNKSKIMK  299
              +A+R EG A ++AIGTATP+N VDQ TYPD+YFRITNS+H +E KEKF+R+C+KS I K
Sbjct  8     RKAQRAEGPATVMAIGTATPSNCVDQATYPDYYFRITNSEHKVELKEKFQRMCDKSMIKK  67

Query  300   RHLVLTEELLKKHPNLCTYNEASLNTRQDILVSGVPKLGKEAAMKAIKEWGRPISEITHL  479
             R++ LTEE+LK++P++C Y   S++ RQD++V  VPKLGKEAA KAIKEWG+P S+ITHL
Sbjct  68    RYMYLTEEILKENPSVCEYMAPSIDARQDMVVVEVPKLGKEAATKAIKEWGQPKSKITHL  127

Query  480   VFCTTSGVDMPGADFQLTKLLGLNSSVKRLMMYQQGCNAGAAMLRLAKDLAENNKGARVL  659
             VFCTTSGVDMPGAD+QLTKLLGL  SVKRLMMYQQGC AG  +LRLAKDLAENNKGARVL
Sbjct  128   VFCTTSGVDMPGADYQLTKLLGLRPSVKRLMMYQQGCFAGGTVLRLAKDLAENNKGARVL  187

Query  660   VVCSEVMLSVFRGPSLQQEDNLLAQCLFGDGSAAVIVGTEPRPGLETPLFELVSSAQTII  839
             VVCSE+    FRGPS    D+L+ Q LFGDG+AAVI+G +P   +E PLFELVS+AQTI+
Sbjct  188   VVCSEITAVTFRGPSDTHLDSLVGQALFGDGAAAVIIGADPVTEVEKPLFELVSAAQTIL  247

Query  840   PDTDSHLKLQLREMGLTFHCSKAVPSLITQNVEDCLVKAFEPFGISDWNSIFWILHPGGN  1019
             PD+D  +   LRE+GLTFH  K VP LI++N+E  L +AF+P GISDWNS+FWI HPGG 
Sbjct  248   PDSDGAIDGHLREVGLTFHLLKDVPGLISKNIEKSLNEAFKPVGISDWNSLFWIAHPGGP  307

Query  1020  AILDGVEEKLGLDPEKLRASRDVLSQYGNLTSACVLFILDEVRKKSKKQQQMTTGEGLEW  1199
             AILD VE KL L PEKL A+R VLS YGN++SACVLFILDEVR+KS ++   TTGEGLEW
Sbjct  308   AILDQVEAKLALKPEKLEATRQVLSDYGNMSSACVLFILDEVRRKSAEKGLKTTGEGLEW  367

Query  1200  GVLFGFGPGLTIDTVVIRSV  1259
             GVLFGFGPGLT++TVV+ SV
Sbjct  368   GVLFGFGPGLTVETVVLHSV  387



>ref|XP_006468926.1| PREDICTED: chalcone synthase 2-like [Citrus sinensis]
 gb|ACB47461.1| chalcone synthase [Citrus sinensis]
Length=391

 Score =   549 bits (1415),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 257/381 (67%), Positives = 313/381 (82%), Gaps = 0/381 (0%)
 Frame = +3

Query  126   AKRLEGDAKILAIGTATPANWVDQTTYPDFYFRITNSQHLLEHKEKFRRICNKSKIMKRH  305
             A+R +G A +LAIGTATPA+ V+Q  YPD+YFRIT S+H+ E KEKF+R+C+KS I KR+
Sbjct  10    AQRADGPATVLAIGTATPAHSVNQADYPDYYFRITKSEHMTELKEKFKRMCDKSMIKKRY  69

Query  306   LVLTEELLKKHPNLCTYNEASLNTRQDILVSGVPKLGKEAAMKAIKEWGRPISEITHLVF  485
             + LTEE+LK++PN+C Y   SL+ RQDI+V  VPKLGKEAA KAIKEWG+P S+ITHL+F
Sbjct  70    MYLTEEILKENPNMCAYMAPSLDARQDIVVVEVPKLGKEAATKAIKEWGQPKSKITHLIF  129

Query  486   CTTSGVDMPGADFQLTKLLGLNSSVKRLMMYQQGCNAGAAMLRLAKDLAENNKGARVLVV  665
             CTTSGVDMPGAD+QLTKLLGL  SVKR MMYQQGC AG  +LRLAKDLAENNKGARVLVV
Sbjct  130   CTTSGVDMPGADYQLTKLLGLRPSVKRFMMYQQGCFAGGTVLRLAKDLAENNKGARVLVV  189

Query  666   CSEVMLSVFRGPSLQQEDNLLAQCLFGDGSAAVIVGTEPRPGLETPLFELVSSAQTIIPD  845
             CSE+    FRGP+    D+L+ Q LFGDG+AAVIVG +P   +E PL++LVS++QTI+PD
Sbjct  190   CSEITAVTFRGPADTHLDSLVGQALFGDGAAAVIVGADPDTSVERPLYQLVSTSQTILPD  249

Query  846   TDSHLKLQLREMGLTFHCSKAVPSLITQNVEDCLVKAFEPFGISDWNSIFWILHPGGNAI  1025
             +D  +   LRE+GLTFH  K VP LI++N+E  L +AF P GISDWNSIFWI HPGG AI
Sbjct  250   SDGAIDGHLREVGLTFHLLKDVPGLISKNIEKSLSEAFAPVGISDWNSIFWIAHPGGPAI  309

Query  1026  LDGVEEKLGLDPEKLRASRDVLSQYGNLTSACVLFILDEVRKKSKKQQQMTTGEGLEWGV  1205
             LD VE KLGL  EKL+A+R VLS+YGN++SACVLFILDE+RKKS ++ + TTGEGL+WGV
Sbjct  310   LDQVESKLGLKEEKLKATRQVLSEYGNMSSACVLFILDEMRKKSAEEAKATTGEGLDWGV  369

Query  1206  LFGFGPGLTIDTVVIRSVPIN  1268
             LFGFGPGLT++TVV+ SVPI 
Sbjct  370   LFGFGPGLTVETVVLHSVPIK  390



>gb|AAM90652.1|AF400567_1 chalcone synthase 6 [Rubus idaeus]
Length=391

 Score =   549 bits (1415),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 260/379 (69%), Positives = 311/379 (82%), Gaps = 0/379 (0%)
 Frame = +3

Query  123   RAKRLEGDAKILAIGTATPANWVDQTTYPDFYFRITNSQHLLEHKEKFRRICNKSKIMKR  302
             +A+R EG A ILAIGTATP N VDQ+TYPD+YFRIT S+H  E KEKF+R+C+KS I KR
Sbjct  9     KAQRAEGPATILAIGTATPPNCVDQSTYPDYYFRITKSEHKTELKEKFQRMCDKSMIKKR  68

Query  303   HLVLTEELLKKHPNLCTYNEASLNTRQDILVSGVPKLGKEAAMKAIKEWGRPISEITHLV  482
             ++ LTEE+LK++P++C Y   SL+ RQD++V  +PKLGKEAA KAIKEWG+P S+ITHLV
Sbjct  69    YMYLTEEILKENPSMCEYMAPSLDARQDMVVVEIPKLGKEAATKAIKEWGQPKSKITHLV  128

Query  483   FCTTSGVDMPGADFQLTKLLGLNSSVKRLMMYQQGCNAGAAMLRLAKDLAENNKGARVLV  662
             FCTTSGVDMPGAD+QLTKLLGL  SVKRLMMYQQGC AG  +LRLAKDLAENNKGARVLV
Sbjct  129   FCTTSGVDMPGADYQLTKLLGLRPSVKRLMMYQQGCFAGGTVLRLAKDLAENNKGARVLV  188

Query  663   VCSEVMLSVFRGPSLQQEDNLLAQCLFGDGSAAVIVGTEPRPGLETPLFELVSSAQTIIP  842
             VCSE+    FRGPS    D+L+ Q LFGDG+AA+IVG +P P +E PLFELVS+AQTI+P
Sbjct  189   VCSEITAVTFRGPSDTHLDSLVGQALFGDGAAAIIVGADPLPEIERPLFELVSAAQTILP  248

Query  843   DTDSHLKLQLREMGLTFHCSKAVPSLITQNVEDCLVKAFEPFGISDWNSIFWILHPGGNA  1022
             D+D  +   LRE+GLTFH  K VP LI++N+E  L +AF+P  I+DWNS+FWI HPGG A
Sbjct  249   DSDGAIDGHLREVGLTFHLLKDVPGLISKNIEKSLNEAFKPLDITDWNSLFWIAHPGGPA  308

Query  1023  ILDGVEEKLGLDPEKLRASRDVLSQYGNLTSACVLFILDEVRKKSKKQQQMTTGEGLEWG  1202
             ILD VE KLGL PEKL A+R +LS+YGN++SACVLFILDEVR+KS      TTGEGLEWG
Sbjct  309   ILDQVEAKLGLKPEKLEATRHILSEYGNMSSACVLFILDEVRRKSAANGHKTTGEGLEWG  368

Query  1203  VLFGFGPGLTIDTVVIRSV  1259
             VLFGFGPGLT++TVV+ SV
Sbjct  369   VLFGFGPGLTVETVVLHSV  387



>ref|XP_008358057.1| PREDICTED: polyketide synthase 5 [Malus domestica]
 gb|AAY45748.1| chalcone synthase [Malus domestica]
 gb|ACJ54533.1| chalcone synthase [Malus domestica]
 gb|ACN25139.1| chalcone sythase [Malus hybrid cultivar]
Length=389

 Score =   549 bits (1415),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 261/380 (69%), Positives = 311/380 (82%), Gaps = 0/380 (0%)
 Frame = +3

Query  120   HRAKRLEGDAKILAIGTATPANWVDQTTYPDFYFRITNSQHLLEHKEKFRRICNKSKIMK  299
              +A+R EG A +LAIGTATP N VDQ TYPD+YFRITNS+H  E KEKF+R+C+KS I  
Sbjct  8     RKAQRAEGPATVLAIGTATPPNCVDQATYPDYYFRITNSEHKTELKEKFQRMCDKSMIKT  67

Query  300   RHLVLTEELLKKHPNLCTYNEASLNTRQDILVSGVPKLGKEAAMKAIKEWGRPISEITHL  479
             R++ LTEE+LK++P +C Y   SL+ RQD++V  VP+LGKEAA KAIKEWG+P S+ITHL
Sbjct  68    RYMYLTEEILKENPTVCEYMAPSLDARQDMVVVEVPRLGKEAATKAIKEWGQPKSKITHL  127

Query  480   VFCTTSGVDMPGADFQLTKLLGLNSSVKRLMMYQQGCNAGAAMLRLAKDLAENNKGARVL  659
             VFCTTSGVDMPGAD+QLTKLLGL  SVKRLMMYQQGC AG  +LRLAKDLAENNKGARVL
Sbjct  128   VFCTTSGVDMPGADYQLTKLLGLRPSVKRLMMYQQGCFAGGTVLRLAKDLAENNKGARVL  187

Query  660   VVCSEVMLSVFRGPSLQQEDNLLAQCLFGDGSAAVIVGTEPRPGLETPLFELVSSAQTII  839
             VVCSE+    FRGPS    D+L+ Q LFGDG+AAVI+G++P P +E PLFELVS+AQTI+
Sbjct  188   VVCSEITAVTFRGPSDTHLDSLVGQALFGDGAAAVIIGSDPVPEVEKPLFELVSAAQTIL  247

Query  840   PDTDSHLKLQLREMGLTFHCSKAVPSLITQNVEDCLVKAFEPFGISDWNSIFWILHPGGN  1019
             PD+D  +   LRE+GLTFH  K VP LI++N+E  L +AF+P GISDWNS+FWI HPGG 
Sbjct  248   PDSDGAIDGHLREVGLTFHLLKDVPGLISKNIEKSLNEAFKPIGISDWNSLFWIAHPGGP  307

Query  1020  AILDGVEEKLGLDPEKLRASRDVLSQYGNLTSACVLFILDEVRKKSKKQQQMTTGEGLEW  1199
             AILD VE KL L PEKL A+R VLS YGN++SACVLFILDEVR+KS ++   TTGEGLEW
Sbjct  308   AILDQVESKLALKPEKLEATRQVLSDYGNMSSACVLFILDEVRRKSAEKGLKTTGEGLEW  367

Query  1200  GVLFGFGPGLTIDTVVIRSV  1259
             GVLFGFGPGLT++TVV+ SV
Sbjct  368   GVLFGFGPGLTVETVVLHSV  387



>gb|AHK07000.1| chalcone synthase [Olea europaea]
 gb|AHK07001.1| chalcone synthase [Olea europaea]
Length=390

 Score =   549 bits (1414),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 259/382 (68%), Positives = 316/382 (83%), Gaps = 0/382 (0%)
 Frame = +3

Query  123   RAKRLEGDAKILAIGTATPANWVDQTTYPDFYFRITNSQHLLEHKEKFRRICNKSKIMKR  302
             RA+R EG A I+AIGTATP+N V Q+TYPD+YFRITNS+H  E KEKF+R+C+KS I KR
Sbjct  9     RAQRAEGPATIMAIGTATPSNCVYQSTYPDYYFRITNSEHKTELKEKFKRMCDKSMIRKR  68

Query  303   HLVLTEELLKKHPNLCTYNEASLNTRQDILVSGVPKLGKEAAMKAIKEWGRPISEITHLV  482
             ++ LTEE+LK++ ++C Y   SL+ RQDI+V  VPKLGKEAA KAIKEWG+P S+ITHL+
Sbjct  69    YMHLTEEILKENRHICEYKAPSLDARQDIVVVEVPKLGKEAAQKAIKEWGQPKSKITHLI  128

Query  483   FCTTSGVDMPGADFQLTKLLGLNSSVKRLMMYQQGCNAGAAMLRLAKDLAENNKGARVLV  662
             FCTTSGVDMPGAD+QLTKLLGL  SVKR MMYQQGC AG  +LR+AKDLAENNKGARVLV
Sbjct  129   FCTTSGVDMPGADYQLTKLLGLRPSVKRFMMYQQGCFAGGTVLRMAKDLAENNKGARVLV  188

Query  663   VCSEVMLSVFRGPSLQQEDNLLAQCLFGDGSAAVIVGTEPRPGLETPLFELVSSAQTIIP  842
             VCSE+    FRGP     D+L+ Q LFGDG+AAVIVG++P  G+E PLF+LVS+AQTI+P
Sbjct  189   VCSEITAVTFRGPDDTHLDSLVGQALFGDGAAAVIVGSDPVIGVERPLFQLVSAAQTILP  248

Query  843   DTDSHLKLQLREMGLTFHCSKAVPSLITQNVEDCLVKAFEPFGISDWNSIFWILHPGGNA  1022
             D++  +   LRE+GLTFH  K VP LI++N+E  L +AF+P GISDWNSIFWI HPGG A
Sbjct  249   DSEGAIDGHLREVGLTFHLLKDVPGLISKNIEKSLTEAFQPLGISDWNSIFWIAHPGGPA  308

Query  1023  ILDGVEEKLGLDPEKLRASRDVLSQYGNLTSACVLFILDEVRKKSKKQQQMTTGEGLEWG  1202
             ILD VEEKL L+PEKLR++R VLS+YGN++SACVLFILDE+RK + K+   TTGEGL+WG
Sbjct  309   ILDQVEEKLALNPEKLRSTRHVLSEYGNMSSACVLFILDEMRKSATKEGMTTTGEGLDWG  368

Query  1203  VLFGFGPGLTIDTVVIRSVPIN  1268
             VLFGFGPGLT++TVV+ S P+N
Sbjct  369   VLFGFGPGLTVETVVLHSEPLN  390



>gb|ABY68457.1| chalcone synthase [Ipomoea batatas]
Length=393

 Score =   549 bits (1415),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 264/381 (69%), Positives = 313/381 (82%), Gaps = 1/381 (0%)
 Frame = +3

Query  123   RAKRLEGDAKILAIGTATPANWVDQTTYPDFYFRITNSQHLLEHKEKFRRICNKSKIMKR  302
             +A+R EG A ILAIGTATPAN V+Q+TYPD+YFRITNS+H  E KEKF+R+C+KS I KR
Sbjct  9     KAQRAEGPATILAIGTATPANCVNQSTYPDYYFRITNSEHKTELKEKFQRMCDKSMITKR  68

Query  303   HLVLTEELLKKHPNLCTYNEASLNTRQDILVSGVPKLGKEAAMKAIKEWGRPISEITHLV  482
             ++ LTEE+LK++P++C Y   SL+ RQDI V  VPKLGKEAA  AIKEWG+P S+ITH+V
Sbjct  69    YMHLTEEILKENPSVCEYMAPSLDARQDIAVVEVPKLGKEAAQSAIKEWGQPKSKITHVV  128

Query  483   FCTTSGVDMPGADFQLTKLLGLNSSVKRLMMYQQGCNAGAAMLRLAKDLAENNKGARVLV  662
             FCTTSGVDMPGAD+QLTKLLGL  SVKRLMMYQQGC AG  +LRLAKDLAENNKGARVL+
Sbjct  129   FCTTSGVDMPGADYQLTKLLGLCPSVKRLMMYQQGCFAGGTVLRLAKDLAENNKGARVLI  188

Query  663   VCSEVMLSVFRGPSLQQEDNLLAQCLFGDGSAAVIVGTEPRPGLETPLFELVSSAQTIIP  842
             VCSE+ +  FRGPS    D+L+ Q LFGDG+AAVIVG +P P  E PLF+LVS+AQT+ P
Sbjct  189   VCSEITVVTFRGPSETHLDSLVGQALFGDGAAAVIVGADPTPA-EKPLFQLVSAAQTLAP  247

Query  843   DTDSHLKLQLREMGLTFHCSKAVPSLITQNVEDCLVKAFEPFGISDWNSIFWILHPGGNA  1022
             D+   +   LRE+GLTFH  K VPS+++ N+E CL +AF P GISDWNS+FWI HPGG A
Sbjct  248   DSCGAIDGHLREVGLTFHLLKDVPSVVSNNIEKCLFEAFNPLGISDWNSVFWIAHPGGPA  307

Query  1023  ILDGVEEKLGLDPEKLRASRDVLSQYGNLTSACVLFILDEVRKKSKKQQQMTTGEGLEWG  1202
             ILD VE+KLGL PEKLRA+R VLS+YGN++SACVLFILDE+RK S      TTGEGLEWG
Sbjct  308   ILDQVEDKLGLKPEKLRATRHVLSEYGNMSSACVLFILDEMRKASSNDGLGTTGEGLEWG  367

Query  1203  VLFGFGPGLTIDTVVIRSVPI  1265
             VLFGFGPGLTI+TVV+ SVPI
Sbjct  368   VLFGFGPGLTIETVVLHSVPI  388



>ref|XP_009764938.1| PREDICTED: chalcone synthase A [Nicotiana sylvestris]
Length=389

 Score =   549 bits (1414),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 260/380 (68%), Positives = 314/380 (83%), Gaps = 0/380 (0%)
 Frame = +3

Query  120   HRAKRLEGDAKILAIGTATPANWVDQTTYPDFYFRITNSQHLLEHKEKFRRICNKSKIMK  299
              RA+R EG A ++AIGTATP+N VDQ+TYPD+YFRITNS+H  E KEKF+R+C KS I K
Sbjct  8     RRAQRAEGPATVMAIGTATPSNCVDQSTYPDYYFRITNSEHKTELKEKFKRMCEKSMIKK  67

Query  300   RHLVLTEELLKKHPNLCTYNEASLNTRQDILVSGVPKLGKEAAMKAIKEWGRPISEITHL  479
             R++ LTEE+LK++PN+C Y   SL+ RQDI+V  VPKLGKEAA KAIKEWG+P S+I+HL
Sbjct  68    RYMHLTEEILKENPNICAYMAPSLDARQDIVVVEVPKLGKEAAQKAIKEWGQPKSKISHL  127

Query  480   VFCTTSGVDMPGADFQLTKLLGLNSSVKRLMMYQQGCNAGAAMLRLAKDLAENNKGARVL  659
             VFCTTSGVDMPG D+QLTKLLGL  SVKR MMYQQGC AG  +LR+AKDLAENNKGARVL
Sbjct  128   VFCTTSGVDMPGCDYQLTKLLGLRPSVKRFMMYQQGCFAGGTVLRMAKDLAENNKGARVL  187

Query  660   VVCSEVMLSVFRGPSLQQEDNLLAQCLFGDGSAAVIVGTEPRPGLETPLFELVSSAQTII  839
             VVCSE+    FRGP+    D+L+ Q LFGDG+AAVIVG++P P +E PLFELVS+AQT++
Sbjct  188   VVCSEITAVTFRGPNDTHLDSLVGQALFGDGAAAVIVGSDPIPDVERPLFELVSAAQTLL  247

Query  840   PDTDSHLKLQLREMGLTFHCSKAVPSLITQNVEDCLVKAFEPFGISDWNSIFWILHPGGN  1019
             PD++  +   LRE+GLTFH  K VP LI++N+E  LV+AF+P GISDWNS+FWI HPGG 
Sbjct  248   PDSEGAIDGHLREVGLTFHLLKDVPGLISKNIEKSLVEAFQPLGISDWNSLFWIAHPGGP  307

Query  1020  AILDGVEEKLGLDPEKLRASRDVLSQYGNLTSACVLFILDEVRKKSKKQQQMTTGEGLEW  1199
             AILD VE KLGL  EKL+A+R+VLS YGN++SACVLFILDE+RK S K+   TTGEGLEW
Sbjct  308   AILDQVELKLGLKQEKLKATRNVLSNYGNMSSACVLFILDEMRKASAKEGLGTTGEGLEW  367

Query  1200  GVLFGFGPGLTIDTVVIRSV  1259
             GVLFGFGPGLT++TVV+ SV
Sbjct  368   GVLFGFGPGLTVETVVLHSV  387



>gb|AHA61354.1| chalcone synthase [Phyllanthus emblica]
Length=390

 Score =   549 bits (1414),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 258/381 (68%), Positives = 314/381 (82%), Gaps = 0/381 (0%)
 Frame = +3

Query  120   HRAKRLEGDAKILAIGTATPANWVDQTTYPDFYFRITNSQHLLEHKEKFRRICNKSKIMK  299
              +A+R  G A ++AIGTA P N VDQ+TYPD+YFRITNS+H  E KEKF+R+C+KS I K
Sbjct  8     RKAQRASGPATVMAIGTAVPPNCVDQSTYPDYYFRITNSEHKTELKEKFQRMCDKSMIKK  67

Query  300   RHLVLTEELLKKHPNLCTYNEASLNTRQDILVSGVPKLGKEAAMKAIKEWGRPISEITHL  479
             R++ L EE+LK++PN+C Y   SL+ RQDI+V  +PKLGKEAA+KAIKEWG+P S+ITHL
Sbjct  68    RYMYLNEEILKENPNICAYMAPSLDARQDIVVVEIPKLGKEAAVKAIKEWGQPKSKITHL  127

Query  480   VFCTTSGVDMPGADFQLTKLLGLNSSVKRLMMYQQGCNAGAAMLRLAKDLAENNKGARVL  659
             VFCTTSGVDMPGAD+QLTKLLGL  SVKRLMMYQQGC AG  +LRLAKDLAENNKGARVL
Sbjct  128   VFCTTSGVDMPGADYQLTKLLGLKPSVKRLMMYQQGCFAGGTVLRLAKDLAENNKGARVL  187

Query  660   VVCSEVMLSVFRGPSLQQEDNLLAQCLFGDGSAAVIVGTEPRPGLETPLFELVSSAQTII  839
             VVCSE+    FRGPS    D+L+   LFGDG+AA+IVG++P P +E PLFE+VS+AQTI+
Sbjct  188   VVCSEITAVTFRGPSDTHLDSLVGPGLFGDGAAAIIVGSDPIPEVEKPLFEVVSAAQTIL  247

Query  840   PDTDSHLKLQLREMGLTFHCSKAVPSLITQNVEDCLVKAFEPFGISDWNSIFWILHPGGN  1019
             PD+D  +   LRE+GLTFH  K VP LI++NVE  LV+AF+P  I DWNS+FWI HPGG 
Sbjct  248   PDSDGAIDGHLREVGLTFHLLKDVPGLISKNVEKSLVEAFQPLNIQDWNSLFWIAHPGGP  307

Query  1020  AILDGVEEKLGLDPEKLRASRDVLSQYGNLTSACVLFILDEVRKKSKKQQQMTTGEGLEW  1199
             AIL+ VE KLGL PEKL+A+R +L+ YGN++SACVLFILDE+RKKSK++   TTGEGLEW
Sbjct  308   AILNQVEAKLGLKPEKLKATRQILADYGNMSSACVLFILDEMRKKSKEEGFQTTGEGLEW  367

Query  1200  GVLFGFGPGLTIDTVVIRSVP  1262
             GVLFGFGPGLT++TVV+ SVP
Sbjct  368   GVLFGFGPGLTVETVVLHSVP  388



>sp|O22047.1|CHSE_IPOPU RecName: Full=Chalcone synthase E; AltName: Full=Naringenin-chalcone 
synthase E; Short=CHS-E [Ipomoea purpurea]
 dbj|BAA21789.1| chalcone synthase [Ipomoea purpurea]
 dbj|BAA87337.1| chalcone synthase [Ipomoea purpurea]
Length=389

 Score =   549 bits (1414),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 259/379 (68%), Positives = 313/379 (83%), Gaps = 0/379 (0%)
 Frame = +3

Query  123   RAKRLEGDAKILAIGTATPANWVDQTTYPDFYFRITNSQHLLEHKEKFRRICNKSKIMKR  302
             +A+R +G A I+AIGT+TP N VDQ+TYPD+YFRITNS+HL+E KEKF+R+C KS I KR
Sbjct  9     KAQRAQGPATIMAIGTSTPQNCVDQSTYPDYYFRITNSEHLVELKEKFKRMCEKSMIKKR  68

Query  303   HLVLTEELLKKHPNLCTYNEASLNTRQDILVSGVPKLGKEAAMKAIKEWGRPISEITHLV  482
             ++ LTEE+L ++PN+C Y   SL+ RQDI+V  VPKLGKEAA KAIKEWG+P S+ITHLV
Sbjct  69    YMYLTEEILTENPNICAYMAPSLDARQDIVVVEVPKLGKEAAQKAIKEWGQPKSKITHLV  128

Query  483   FCTTSGVDMPGADFQLTKLLGLNSSVKRLMMYQQGCNAGAAMLRLAKDLAENNKGARVLV  662
             FCTTSGVDMPGAD+QLTKLLGL  SVKR MMYQQGC AG  ++RLAKDLAENNKGARVLV
Sbjct  129   FCTTSGVDMPGADYQLTKLLGLQPSVKRFMMYQQGCFAGGTVIRLAKDLAENNKGARVLV  188

Query  663   VCSEVMLSVFRGPSLQQEDNLLAQCLFGDGSAAVIVGTEPRPGLETPLFELVSSAQTIIP  842
             VCSE+    FRGPS    D+L+ Q LFGDG+AA+I+G++P P LE PLF+LVS+AQTI+P
Sbjct  189   VCSEITAVTFRGPSDAHLDSLVGQALFGDGAAALIIGSDPDPDLERPLFQLVSAAQTILP  248

Query  843   DTDSHLKLQLREMGLTFHCSKAVPSLITQNVEDCLVKAFEPFGISDWNSIFWILHPGGNA  1022
             D+   +   LRE+GLTFH  K VP LI++++E  L +AF+P GI DWNS+FWI HPGG A
Sbjct  249   DSGGAIDGHLREVGLTFHLLKDVPGLISKHIEKSLNEAFQPLGIRDWNSLFWIAHPGGPA  308

Query  1023  ILDGVEEKLGLDPEKLRASRDVLSQYGNLTSACVLFILDEVRKKSKKQQQMTTGEGLEWG  1202
             ILD VEEKL L PEKLRA+R VLS+YGN++SACVLFILDE+RK S K+   TTGEGLEWG
Sbjct  309   ILDQVEEKLELKPEKLRATRHVLSEYGNMSSACVLFILDEMRKASSKEGLNTTGEGLEWG  368

Query  1203  VLFGFGPGLTIDTVVIRSV  1259
             VLFGFGPGLT++TVV+ SV
Sbjct  369   VLFGFGPGLTVETVVLHSV  387



>ref|XP_009353802.1| PREDICTED: chalcone synthase-like [Pyrus x bretschneideri]
Length=390

 Score =   549 bits (1414),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 260/380 (68%), Positives = 311/380 (82%), Gaps = 0/380 (0%)
 Frame = +3

Query  120   HRAKRLEGDAKILAIGTATPANWVDQTTYPDFYFRITNSQHLLEHKEKFRRICNKSKIMK  299
              +A+R EG A + AIGTATP N VDQ TYPD+YFRITNS+H  E KEKF+R+C+KS I K
Sbjct  8     RKAQRAEGPATVFAIGTATPPNCVDQATYPDYYFRITNSEHKAELKEKFQRMCDKSMIKK  67

Query  300   RHLVLTEELLKKHPNLCTYNEASLNTRQDILVSGVPKLGKEAAMKAIKEWGRPISEITHL  479
             R++ LTEE+LK++P++C Y   SL+ RQD++V  VP+LGKEAA KAIKEWG+P S+ITHL
Sbjct  68    RYMYLTEEILKENPSVCEYVAPSLDARQDMVVVEVPRLGKEAATKAIKEWGQPKSKITHL  127

Query  480   VFCTTSGVDMPGADFQLTKLLGLNSSVKRLMMYQQGCNAGAAMLRLAKDLAENNKGARVL  659
             VFCTTSGVDMPGAD+QLTKLLGL  SVKRLMMYQQGC AG  +LRLAKDLAENNKGARVL
Sbjct  128   VFCTTSGVDMPGADYQLTKLLGLRPSVKRLMMYQQGCFAGGTVLRLAKDLAENNKGARVL  187

Query  660   VVCSEVMLSVFRGPSLQQEDNLLAQCLFGDGSAAVIVGTEPRPGLETPLFELVSSAQTII  839
             VVCSE+    FRGPS    D+L+ Q LFGDG+AAVI+G +P P +E PLFELVS+AQTI+
Sbjct  188   VVCSEITAVTFRGPSDTHLDSLVGQALFGDGAAAVIIGADPVPEVEKPLFELVSAAQTIL  247

Query  840   PDTDSHLKLQLREMGLTFHCSKAVPSLITQNVEDCLVKAFEPFGISDWNSIFWILHPGGN  1019
             PD+D  +   LRE+GLTFH  K VP LI++N+E  L +AF+P GISDWNS+FWI HPGG 
Sbjct  248   PDSDGAIDGHLREVGLTFHLLKDVPGLISKNIEKSLNEAFKPIGISDWNSLFWIAHPGGP  307

Query  1020  AILDGVEEKLGLDPEKLRASRDVLSQYGNLTSACVLFILDEVRKKSKKQQQMTTGEGLEW  1199
             AILD VE KL L PEKL A+R VLS YGN++SACVLFILDEVR+KS ++   T+GEGLEW
Sbjct  308   AILDQVEAKLALKPEKLEATRQVLSDYGNMSSACVLFILDEVRRKSAEKGLKTSGEGLEW  367

Query  1200  GVLFGFGPGLTIDTVVIRSV  1259
             GVLFGFGPGLT++TVV+ SV
Sbjct  368   GVLFGFGPGLTVETVVLHSV  387



>gb|ACN30003.1| chalcone synthase [Vitis rotundifolia]
Length=393

 Score =   549 bits (1414),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 261/378 (69%), Positives = 313/378 (83%), Gaps = 0/378 (0%)
 Frame = +3

Query  126   AKRLEGDAKILAIGTATPANWVDQTTYPDFYFRITNSQHLLEHKEKFRRICNKSKIMKRH  305
             A+R EG A ++AIGTATP N VDQ+TYPD+YFRITNS+H  E KEKF+R+C+KS I KR+
Sbjct  10    AQRAEGPATVMAIGTATPPNCVDQSTYPDYYFRITNSEHKTELKEKFKRMCDKSMIKKRY  69

Query  306   LVLTEELLKKHPNLCTYNEASLNTRQDILVSGVPKLGKEAAMKAIKEWGRPISEITHLVF  485
             + LTEE+LK++PN+C Y   SL+ RQD++V  VPKLGKEAA KAIKEWG+P S+ITHLVF
Sbjct  70    MHLTEEILKENPNVCAYMAPSLDARQDMVVVEVPKLGKEAAAKAIKEWGQPKSKITHLVF  129

Query  486   CTTSGVDMPGADFQLTKLLGLNSSVKRLMMYQQGCNAGAAMLRLAKDLAENNKGARVLVV  665
             CTTSGVDMPGAD+QLTKLLGL  SVKRLMMYQQGC AG  +LRLAKDLAENN GARVLVV
Sbjct  130   CTTSGVDMPGADYQLTKLLGLKPSVKRLMMYQQGCFAGGTVLRLAKDLAENNAGARVLVV  189

Query  666   CSEVMLSVFRGPSLQQEDNLLAQCLFGDGSAAVIVGTEPRPGLETPLFELVSSAQTIIPD  845
             CSE+    FRGPS    D+L+ Q LFGDG+AA+I+G +P   +E PLFELVS+AQTI+PD
Sbjct  190   CSEITAVTFRGPSDTHLDSLVGQALFGDGAAAIIIGADPDTKIERPLFELVSAAQTILPD  249

Query  846   TDSHLKLQLREMGLTFHCSKAVPSLITQNVEDCLVKAFEPFGISDWNSIFWILHPGGNAI  1025
             +D  +   LRE+GLTFH  K VP LI++N+E  LV+AF P GISDWNS+FWI HPGG AI
Sbjct  250   SDGAIDGHLREVGLTFHLLKDVPGLISKNIEKSLVEAFNPIGISDWNSLFWIAHPGGPAI  309

Query  1026  LDGVEEKLGLDPEKLRASRDVLSQYGNLTSACVLFILDEVRKKSKKQQQMTTGEGLEWGV  1205
             LD VE KLGL  EKLRA+R VLS+YGN++SACVLFILDE+RKKS ++ + TTGEGLEWGV
Sbjct  310   LDQVELKLGLKEEKLRATRHVLSEYGNMSSACVLFILDEMRKKSIEEGKGTTGEGLEWGV  369

Query  1206  LFGFGPGLTIDTVVIRSV  1259
             LFGFGPGLT++TVV+ S+
Sbjct  370   LFGFGPGLTVETVVLHSL  387



>gb|AEN83501.1| chalcone synthase [Solanum tuberosum]
Length=389

 Score =   549 bits (1414),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 261/380 (69%), Positives = 314/380 (83%), Gaps = 0/380 (0%)
 Frame = +3

Query  120   HRAKRLEGDAKILAIGTATPANWVDQTTYPDFYFRITNSQHLLEHKEKFRRICNKSKIMK  299
              +A+R EG A ILAIGT+TP+N VDQ+TYPD+YFRITNS+H  E KEKF+R+C+KS I K
Sbjct  8     RKAQRAEGPATILAIGTSTPSNCVDQSTYPDYYFRITNSEHKTELKEKFKRMCDKSMIKK  67

Query  300   RHLVLTEELLKKHPNLCTYNEASLNTRQDILVSGVPKLGKEAAMKAIKEWGRPISEITHL  479
             R++ LTEE+LK++PN+C Y   SL+ RQDI+V  VPKLGKEAA KAIKEWG+P S+ITHL
Sbjct  68    RYMHLTEEILKENPNMCAYMAPSLDARQDIVVVEVPKLGKEAAQKAIKEWGQPKSKITHL  127

Query  480   VFCTTSGVDMPGADFQLTKLLGLNSSVKRLMMYQQGCNAGAAMLRLAKDLAENNKGARVL  659
             VFCTTSGVDMPG D+QL KLLGL  SVKRLMMYQQGC AG  +LRLAKDLAENNKGARVL
Sbjct  128   VFCTTSGVDMPGCDYQLAKLLGLRPSVKRLMMYQQGCFAGGTVLRLAKDLAENNKGARVL  187

Query  660   VVCSEVMLSVFRGPSLQQEDNLLAQCLFGDGSAAVIVGTEPRPGLETPLFELVSSAQTII  839
             VVCSE+    FRGPS    D+L+ Q LFGDG+AA+I+G++P  G+E PLFELVS+AQT++
Sbjct  188   VVCSEITAVTFRGPSESHLDSLVGQALFGDGAAAIIMGSDPIIGVERPLFELVSAAQTLV  247

Query  840   PDTDSHLKLQLREMGLTFHCSKAVPSLITQNVEDCLVKAFEPFGISDWNSIFWILHPGGN  1019
             PD++  +   LRE+GLTFH  K VP LI++N+E  L++AF+P GISDWNS+FWI HPGG 
Sbjct  248   PDSEGAIDGHLREVGLTFHLLKDVPGLISKNIEKSLLEAFQPLGISDWNSLFWIAHPGGP  307

Query  1020  AILDGVEEKLGLDPEKLRASRDVLSQYGNLTSACVLFILDEVRKKSKKQQQMTTGEGLEW  1199
             AILD VE KLGL  EKLRA+R+VLS YGN++SACVLFILDEVRK S  +   TTGEGLEW
Sbjct  308   AILDQVELKLGLKQEKLRATREVLSNYGNMSSACVLFILDEVRKASTNEGLGTTGEGLEW  367

Query  1200  GVLFGFGPGLTIDTVVIRSV  1259
             GVLFGFGPGLT++TVV+ SV
Sbjct  368   GVLFGFGPGLTVETVVLHSV  387



>ref|XP_009370115.1| PREDICTED: chalcone synthase-like [Pyrus x bretschneideri]
Length=390

 Score =   549 bits (1414),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 260/380 (68%), Positives = 311/380 (82%), Gaps = 0/380 (0%)
 Frame = +3

Query  120   HRAKRLEGDAKILAIGTATPANWVDQTTYPDFYFRITNSQHLLEHKEKFRRICNKSKIMK  299
              +A+R EG A + AIGTATP N VDQ TYPD+YFRITNS+H  E KEKF+R+C+KS I K
Sbjct  8     RKAQRAEGPATVFAIGTATPPNCVDQATYPDYYFRITNSEHKAELKEKFQRMCDKSMIKK  67

Query  300   RHLVLTEELLKKHPNLCTYNEASLNTRQDILVSGVPKLGKEAAMKAIKEWGRPISEITHL  479
             R++ LTEE+LK++P++C Y   SL+ RQD++V  VP+LGKEAA KAIKEWG+P S+ITHL
Sbjct  68    RYMYLTEEILKENPSVCEYMAPSLDARQDMVVVEVPRLGKEAATKAIKEWGQPKSKITHL  127

Query  480   VFCTTSGVDMPGADFQLTKLLGLNSSVKRLMMYQQGCNAGAAMLRLAKDLAENNKGARVL  659
             VFCTTSGVDMPGAD+QLTKLLGL  SVKRLMMYQQGC AG  +LRLAKDLAENNKGARVL
Sbjct  128   VFCTTSGVDMPGADYQLTKLLGLRPSVKRLMMYQQGCFAGGTVLRLAKDLAENNKGARVL  187

Query  660   VVCSEVMLSVFRGPSLQQEDNLLAQCLFGDGSAAVIVGTEPRPGLETPLFELVSSAQTII  839
             VVCSE+    FRGPS    D+L+ Q LFGDG+AAVI+G +P P +E PLFELVS+AQTI+
Sbjct  188   VVCSEITAVTFRGPSDTHLDSLVGQALFGDGAAAVIIGADPVPEVEKPLFELVSAAQTIL  247

Query  840   PDTDSHLKLQLREMGLTFHCSKAVPSLITQNVEDCLVKAFEPFGISDWNSIFWILHPGGN  1019
             PD+D  +   LRE+GLTFH  K VP LI++N+E  L +AF+P GISDWNS+FWI HPGG 
Sbjct  248   PDSDGAIDGHLREVGLTFHLLKDVPGLISKNIEKSLNEAFKPIGISDWNSLFWIAHPGGP  307

Query  1020  AILDGVEEKLGLDPEKLRASRDVLSQYGNLTSACVLFILDEVRKKSKKQQQMTTGEGLEW  1199
             AILD VE KL L PEKL A+R VLS YGN++SACVLFILDEVR+KS ++   T+GEGLEW
Sbjct  308   AILDQVEAKLALKPEKLEATRQVLSDYGNMSSACVLFILDEVRRKSAEKGLKTSGEGLEW  367

Query  1200  GVLFGFGPGLTIDTVVIRSV  1259
             GVLFGFGPGLT++TVV+ SV
Sbjct  368   GVLFGFGPGLTVETVVLHSV  387



>gb|AHZ97870.1| chalcone synthase [Punica granatum]
Length=398

 Score =   549 bits (1414),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 260/381 (68%), Positives = 311/381 (82%), Gaps = 0/381 (0%)
 Frame = +3

Query  123   RAKRLEGDAKILAIGTATPANWVDQTTYPDFYFRITNSQHLLEHKEKFRRICNKSKIMKR  302
             +A+R  G A +LAIGTATP+N V Q  YPD+YFRITNS+H  E KEKF+R+C KS I KR
Sbjct  14    KAQRASGPATVLAIGTATPSNCVSQADYPDYYFRITNSEHKTELKEKFKRMCEKSMIKKR  73

Query  303   HLVLTEELLKKHPNLCTYNEASLNTRQDILVSGVPKLGKEAAMKAIKEWGRPISEITHLV  482
             ++ LTEE LK++PN+C Y   SL+ RQDI+V  VPKLGKEAA KAIKEWG+P S+ITHL+
Sbjct  74    YMHLTEEFLKENPNMCAYMATSLDARQDIVVVEVPKLGKEAASKAIKEWGQPKSKITHLI  133

Query  483   FCTTSGVDMPGADFQLTKLLGLNSSVKRLMMYQQGCNAGAAMLRLAKDLAENNKGARVLV  662
             FCTTSGVDMPGAD+QLTKLLGL  SVKR MMYQQGC AG  +LRLAKDLAENNKGARVLV
Sbjct  134   FCTTSGVDMPGADYQLTKLLGLRPSVKRFMMYQQGCFAGGTVLRLAKDLAENNKGARVLV  193

Query  663   VCSEVMLSVFRGPSLQQEDNLLAQCLFGDGSAAVIVGTEPRPGLETPLFELVSSAQTIIP  842
             VCSE+    FRGPS    D+L+ Q LFGDG+AAVIVG +P   +E PL++LVS+AQTI+P
Sbjct  194   VCSEITAVTFRGPSDTHLDSLVGQALFGDGAAAVIVGADPDTKIERPLYQLVSAAQTILP  253

Query  843   DTDSHLKLQLREMGLTFHCSKAVPSLITQNVEDCLVKAFEPFGISDWNSIFWILHPGGNA  1022
             D+D  +   LRE+GLTFH  K VP LI++N+E  LV+AF P GI+DWNSIFWI HPGG A
Sbjct  254   DSDGAIDGHLREVGLTFHLLKDVPGLISKNIEKSLVEAFTPIGINDWNSIFWIAHPGGPA  313

Query  1023  ILDGVEEKLGLDPEKLRASRDVLSQYGNLTSACVLFILDEVRKKSKKQQQMTTGEGLEWG  1202
             ILD VE KLGL  EK+RA+R VLS+YGN++SACVLFILDE+RKKS K+ + TTGEGL+WG
Sbjct  314   ILDQVEAKLGLKEEKMRATRHVLSEYGNMSSACVLFILDEMRKKSLKEGKATTGEGLDWG  373

Query  1203  VLFGFGPGLTIDTVVIRSVPI  1265
             VLFGFGPGLT++T+V+ SVPI
Sbjct  374   VLFGFGPGLTVETLVLHSVPI  394



>gb|ACS12837.1| chalcone synthase [Nicotiana alata]
Length=389

 Score =   548 bits (1413),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 259/380 (68%), Positives = 314/380 (83%), Gaps = 0/380 (0%)
 Frame = +3

Query  120   HRAKRLEGDAKILAIGTATPANWVDQTTYPDFYFRITNSQHLLEHKEKFRRICNKSKIMK  299
              RA+R EG A ++AIGTATP+N VDQ+TYPD+YFRITNS+H  E KEKF+R+C KS I K
Sbjct  8     RRAQRAEGPATVMAIGTATPSNCVDQSTYPDYYFRITNSEHKTELKEKFKRMCEKSMIKK  67

Query  300   RHLVLTEELLKKHPNLCTYNEASLNTRQDILVSGVPKLGKEAAMKAIKEWGRPISEITHL  479
             R++ LTEE+LK++PN+C Y   SL+ RQDI+V  VPKLGKEAA KAIKEWG+P S+ITHL
Sbjct  68    RYMHLTEEILKENPNICAYMAPSLDARQDIVVVEVPKLGKEAAQKAIKEWGQPKSKITHL  127

Query  480   VFCTTSGVDMPGADFQLTKLLGLNSSVKRLMMYQQGCNAGAAMLRLAKDLAENNKGARVL  659
             VFCTTSGVDMPG D+QLTKLLGL  SVKR MMYQQGC AG  +LR+AKDLAENNKGARVL
Sbjct  128   VFCTTSGVDMPGCDYQLTKLLGLRPSVKRFMMYQQGCFAGGTVLRMAKDLAENNKGARVL  187

Query  660   VVCSEVMLSVFRGPSLQQEDNLLAQCLFGDGSAAVIVGTEPRPGLETPLFELVSSAQTII  839
             VVCSE+    FRGP+    D+L+ Q LFGDG+AA+I+G++P P +E PLFELVS+AQT++
Sbjct  188   VVCSEITAVTFRGPNDTHLDSLVGQALFGDGAAAIIIGSDPIPEVERPLFELVSAAQTLL  247

Query  840   PDTDSHLKLQLREMGLTFHCSKAVPSLITQNVEDCLVKAFEPFGISDWNSIFWILHPGGN  1019
             PD++  +   LRE+GLTFH  K VP LI++N+E  LV+AF+P GISDWNS+FWI HPGG 
Sbjct  248   PDSEGAIDGHLREVGLTFHLLKDVPGLISKNIEKSLVEAFQPLGISDWNSLFWIAHPGGP  307

Query  1020  AILDGVEEKLGLDPEKLRASRDVLSQYGNLTSACVLFILDEVRKKSKKQQQMTTGEGLEW  1199
             AILD VE KLGL  EKL+A+R+VLS YGN++SACVLFILDE+RK S K+   TTGEGLEW
Sbjct  308   AILDQVELKLGLKQEKLKATRNVLSNYGNMSSACVLFILDEMRKASAKEGLGTTGEGLEW  367

Query  1200  GVLFGFGPGLTIDTVVIRSV  1259
             GVLFGFGPGLT++TVV+ SV
Sbjct  368   GVLFGFGPGLTVETVVLHSV  387



>gb|AEC13058.1| chalcone synthase protein [Rosa chinensis]
Length=389

 Score =   548 bits (1413),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 258/379 (68%), Positives = 312/379 (82%), Gaps = 0/379 (0%)
 Frame = +3

Query  123   RAKRLEGDAKILAIGTATPANWVDQTTYPDFYFRITNSQHLLEHKEKFRRICNKSKIMKR  302
             +A+R EG A +LAIGTATP N +DQ+TYPD+YFRIT S+H  E KEKF+R+C+KS I KR
Sbjct  9     KAQRAEGPATVLAIGTATPPNCIDQSTYPDYYFRITKSEHKAELKEKFQRMCDKSMIKKR  68

Query  303   HLVLTEELLKKHPNLCTYNEASLNTRQDILVSGVPKLGKEAAMKAIKEWGRPISEITHLV  482
             ++ LTEE+LK++P++C Y   SL+ RQD++V  +PKLGKEAA KAIKEWG+P S+ITHLV
Sbjct  69    YMYLTEEILKENPSMCEYMAPSLDARQDMVVVEIPKLGKEAATKAIKEWGQPKSKITHLV  128

Query  483   FCTTSGVDMPGADFQLTKLLGLNSSVKRLMMYQQGCNAGAAMLRLAKDLAENNKGARVLV  662
             FCTTSGVDMPGAD+QLTKLLGL  SVKRLMMYQQGC AG  +LRLAKDLAENNKGARVLV
Sbjct  129   FCTTSGVDMPGADYQLTKLLGLRPSVKRLMMYQQGCFAGGTVLRLAKDLAENNKGARVLV  188

Query  663   VCSEVMLSVFRGPSLQQEDNLLAQCLFGDGSAAVIVGTEPRPGLETPLFELVSSAQTIIP  842
             VCSE+    FRGPS    D+L+ Q LFGDG+AA+IVG++P P +E PLFELVS+AQTI+P
Sbjct  189   VCSEITAVTFRGPSDTHLDSLVGQALFGDGAAAIIVGSDPLPEVEKPLFELVSAAQTILP  248

Query  843   DTDSHLKLQLREMGLTFHCSKAVPSLITQNVEDCLVKAFEPFGISDWNSIFWILHPGGNA  1022
             D+D  +   LRE+GLTFH  K VP LI++N+E  L +AF+P  I+DWNS+FWI HPGG A
Sbjct  249   DSDGAIDGHLREVGLTFHLLKDVPGLISKNIEKSLNEAFKPLNITDWNSLFWIAHPGGPA  308

Query  1023  ILDGVEEKLGLDPEKLRASRDVLSQYGNLTSACVLFILDEVRKKSKKQQQMTTGEGLEWG  1202
             ILD VE KLGL PEKL A+R +LS+YGN++SACVLFILDEVR+KS      TTGEGLEWG
Sbjct  309   ILDQVEAKLGLKPEKLEATRHILSEYGNMSSACVLFILDEVRRKSAANGHKTTGEGLEWG  368

Query  1203  VLFGFGPGLTIDTVVIRSV  1259
             VLFGFGPGLT++TVV+ SV
Sbjct  369   VLFGFGPGLTVETVVLHSV  387



>sp|Q9MB41.1|CHS2_IPOBA RecName: Full=Chalcone synthase LF2; AltName: Full=Naringenin-chalcone 
synthase LF2 [Ipomoea batatas]
 dbj|BAA90327.1| chalcone synthase CHS-LF2 [Ipomoea batatas]
Length=393

 Score =   548 bits (1413),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 263/381 (69%), Positives = 312/381 (82%), Gaps = 1/381 (0%)
 Frame = +3

Query  123   RAKRLEGDAKILAIGTATPANWVDQTTYPDFYFRITNSQHLLEHKEKFRRICNKSKIMKR  302
             +A+R EG A ILAIGT TPAN V+Q+TYPD+YFRITNS+H  E KEKF+R+C+KS I KR
Sbjct  9     KAQRAEGPATILAIGTVTPANCVNQSTYPDYYFRITNSEHKTELKEKFQRMCDKSMITKR  68

Query  303   HLVLTEELLKKHPNLCTYNEASLNTRQDILVSGVPKLGKEAAMKAIKEWGRPISEITHLV  482
             ++ LTEE+LK++P+ C Y   SL+ RQDI V  VPKLGKEAA  AIKEWG+P S+ITH+V
Sbjct  69    YMHLTEEILKENPSFCEYMAPSLDARQDIAVVEVPKLGKEAAQSAIKEWGQPKSKITHVV  128

Query  483   FCTTSGVDMPGADFQLTKLLGLNSSVKRLMMYQQGCNAGAAMLRLAKDLAENNKGARVLV  662
             FCTTSGVDMPGAD+QLTKLLGL+ SVKRLMMYQQGC AG  +LRLAKDLAENNKGARVL+
Sbjct  129   FCTTSGVDMPGADYQLTKLLGLSPSVKRLMMYQQGCFAGGTVLRLAKDLAENNKGARVLI  188

Query  663   VCSEVMLSVFRGPSLQQEDNLLAQCLFGDGSAAVIVGTEPRPGLETPLFELVSSAQTIIP  842
             VCSE+ +  FRGPS    D+L+ Q LFGDG+AAVIVG +P P  E PLF+LVS+AQT+ P
Sbjct  189   VCSEITVVTFRGPSETHLDSLVGQALFGDGAAAVIVGADPTPA-EKPLFQLVSAAQTLAP  247

Query  843   DTDSHLKLQLREMGLTFHCSKAVPSLITQNVEDCLVKAFEPFGISDWNSIFWILHPGGNA  1022
             D+   +   LRE+GLTFH  K VPS+++ N+E CL +AF P GISDWNS+FWI HPGG A
Sbjct  248   DSCGAIDGHLREVGLTFHLLKDVPSVVSNNIEKCLFEAFNPLGISDWNSVFWIAHPGGPA  307

Query  1023  ILDGVEEKLGLDPEKLRASRDVLSQYGNLTSACVLFILDEVRKKSKKQQQMTTGEGLEWG  1202
             ILD VE+KLGL PEKLRA+R VLS+YGN++SACVLFILDE+RK S      TTGEGLEWG
Sbjct  308   ILDQVEDKLGLKPEKLRATRHVLSEYGNMSSACVLFILDEMRKASSNAGLGTTGEGLEWG  367

Query  1203  VLFGFGPGLTIDTVVIRSVPI  1265
             VLFGFGPGLTI+TVV+ SVPI
Sbjct  368   VLFGFGPGLTIETVVLHSVPI  388



>gb|AFC37244.1| chalcone synthase 3 [Camellia chekiangoleosa]
Length=389

 Score =   548 bits (1413),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 261/380 (69%), Positives = 314/380 (83%), Gaps = 0/380 (0%)
 Frame = +3

Query  120   HRAKRLEGDAKILAIGTATPANWVDQTTYPDFYFRITNSQHLLEHKEKFRRICNKSKIMK  299
              RA+R +G A +LAIGTATP N VDQ+TYPD+YFRITNS+H +E KEKF+R+C+KS I K
Sbjct  8     RRAQRAQGPATVLAIGTATPPNCVDQSTYPDYYFRITNSEHKVELKEKFKRMCDKSMIKK  67

Query  300   RHLVLTEELLKKHPNLCTYNEASLNTRQDILVSGVPKLGKEAAMKAIKEWGRPISEITHL  479
             R++ LTEE+LK++P +C Y   SL+ RQD++V  VPKLGKEAA KAIKEWG+P S+ITHL
Sbjct  68    RYMYLTEEILKENPQVCEYMAPSLDARQDMVVVEVPKLGKEAATKAIKEWGQPKSKITHL  127

Query  480   VFCTTSGVDMPGADFQLTKLLGLNSSVKRLMMYQQGCNAGAAMLRLAKDLAENNKGARVL  659
             VFCTTSGVDMPGAD+QLTKLLGL  SVKRLMMYQQGC AG  +LRLAKDL ENNKGARVL
Sbjct  128   VFCTTSGVDMPGADYQLTKLLGLRPSVKRLMMYQQGCFAGGTVLRLAKDLVENNKGARVL  187

Query  660   VVCSEVMLSVFRGPSLQQEDNLLAQCLFGDGSAAVIVGTEPRPGLETPLFELVSSAQTII  839
             VVCSE+    FRGPS    D+L+ Q LFGDG+AA+I+G++P P +E PLFELVS+AQTI+
Sbjct  188   VVCSEITAVTFRGPSDTHLDSLVGQSLFGDGAAAIIIGSDPIPEVEKPLFELVSAAQTIL  247

Query  840   PDTDSHLKLQLREMGLTFHCSKAVPSLITQNVEDCLVKAFEPFGISDWNSIFWILHPGGN  1019
             P +D  +   LRE+GLTFH  + VP LI+ NVE  LV+AF+P GISDWNS+FWI HPGG 
Sbjct  248   PGSDGAIDGHLREVGLTFHLLRDVPRLISMNVEKSLVEAFQPLGISDWNSLFWIAHPGGP  307

Query  1020  AILDGVEEKLGLDPEKLRASRDVLSQYGNLTSACVLFILDEVRKKSKKQQQMTTGEGLEW  1199
             AILD VE KLGL  EKLRA+R VLS+YGN++SACVLFILDE+RKKS ++   TTGEGLEW
Sbjct  308   AILDQVELKLGLKEEKLRATRHVLSEYGNMSSACVLFILDEMRKKSAEEGLKTTGEGLEW  367

Query  1200  GVLFGFGPGLTIDTVVIRSV  1259
             GVLFGFGPGLT++TVV+ S+
Sbjct  368   GVLFGFGPGLTVETVVLHSL  387



>gb|AGZ15299.1| chalcone synthase [Pyrus x bretschneideri]
 gb|AGZ15300.1| chalcone synthase [Pyrus x bretschneideri]
Length=389

 Score =   548 bits (1413),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 260/380 (68%), Positives = 311/380 (82%), Gaps = 0/380 (0%)
 Frame = +3

Query  120   HRAKRLEGDAKILAIGTATPANWVDQTTYPDFYFRITNSQHLLEHKEKFRRICNKSKIMK  299
              +A+R EG A +LAIGT+TP N VDQ TYPD+YFRITNS+H  E KEKF+R+C+KS I  
Sbjct  8     RKAQRAEGPATVLAIGTSTPPNCVDQATYPDYYFRITNSEHKTELKEKFQRMCDKSMIKT  67

Query  300   RHLVLTEELLKKHPNLCTYNEASLNTRQDILVSGVPKLGKEAAMKAIKEWGRPISEITHL  479
             R++ LTEE+LK++P +C Y   SL+ RQD++V  VP+LGKEAA KAIKEWG+P S+ITHL
Sbjct  68    RYMYLTEEILKENPTVCEYMAPSLDARQDMVVVEVPRLGKEAATKAIKEWGQPKSKITHL  127

Query  480   VFCTTSGVDMPGADFQLTKLLGLNSSVKRLMMYQQGCNAGAAMLRLAKDLAENNKGARVL  659
             VFCTTSGVDMPGAD+QLTKLLGL  SVKRLMMYQQGC AG  +LRLAKDLAENNKGARVL
Sbjct  128   VFCTTSGVDMPGADYQLTKLLGLRPSVKRLMMYQQGCFAGGTVLRLAKDLAENNKGARVL  187

Query  660   VVCSEVMLSVFRGPSLQQEDNLLAQCLFGDGSAAVIVGTEPRPGLETPLFELVSSAQTII  839
             VVCSE+    FRGPS    D+L+ Q LFGDG+AAVI+G++P P +E PLFELVS+AQTI+
Sbjct  188   VVCSEITAVTFRGPSDTHLDSLVGQALFGDGAAAVIIGSDPVPEVEKPLFELVSAAQTIL  247

Query  840   PDTDSHLKLQLREMGLTFHCSKAVPSLITQNVEDCLVKAFEPFGISDWNSIFWILHPGGN  1019
             PD+D  +   LRE+GLTFH  K VP LI++N+E  L +AF+P GISDWNS+FWI HPGG 
Sbjct  248   PDSDGAIDGHLREVGLTFHLLKDVPGLISKNIEKSLNEAFKPIGISDWNSLFWIAHPGGP  307

Query  1020  AILDGVEEKLGLDPEKLRASRDVLSQYGNLTSACVLFILDEVRKKSKKQQQMTTGEGLEW  1199
             AILD VE KL L PEKL A+R VLS YGN++SACVLFILDEVR+KS ++   TTGEGLEW
Sbjct  308   AILDQVESKLALKPEKLEATRQVLSDYGNMSSACVLFILDEVRRKSAEKGLKTTGEGLEW  367

Query  1200  GVLFGFGPGLTIDTVVIRSV  1259
             GVLFGFGPGLT++TVV+ SV
Sbjct  368   GVLFGFGPGLTVETVVLHSV  387



>ref|XP_002303820.1| naregenin-chalcone synthase family protein [Populus trichocarpa]
 gb|EEE78799.1| naregenin-chalcone synthase family protein [Populus trichocarpa]
Length=391

 Score =   548 bits (1413),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 259/380 (68%), Positives = 312/380 (82%), Gaps = 0/380 (0%)
 Frame = +3

Query  120   HRAKRLEGDAKILAIGTATPANWVDQTTYPDFYFRITNSQHLLEHKEKFRRICNKSKIMK  299
              + +R EG A I+AIGT+TP N VDQ+ YPD+YFRITNS+H  E KEKF+R+C KS I K
Sbjct  8     RKTQRAEGPATIMAIGTSTPPNCVDQSAYPDYYFRITNSEHKAELKEKFKRMCEKSMIKK  67

Query  300   RHLVLTEELLKKHPNLCTYNEASLNTRQDILVSGVPKLGKEAAMKAIKEWGRPISEITHL  479
             R++ LTEE+LK++P++C Y   SL+ RQD++V  VP+LGKEAA KAIKEWG+P S+ITHL
Sbjct  68    RYMYLTEEILKENPSVCEYMAPSLDARQDMVVVEVPRLGKEAATKAIKEWGQPKSKITHL  127

Query  480   VFCTTSGVDMPGADFQLTKLLGLNSSVKRLMMYQQGCNAGAAMLRLAKDLAENNKGARVL  659
             VFCTTSGVDMPGAD+QLTKLLGL SSVKR MMYQQGC AG  +LRLAKDLAENNKGARVL
Sbjct  128   VFCTTSGVDMPGADYQLTKLLGLRSSVKRFMMYQQGCFAGGTVLRLAKDLAENNKGARVL  187

Query  660   VVCSEVMLSVFRGPSLQQEDNLLAQCLFGDGSAAVIVGTEPRPGLETPLFELVSSAQTII  839
             VVCSE+    FRGPS    D+L+ Q LFGDG+AA+I+G++P  G+E PLFELVS+AQTI+
Sbjct  188   VVCSEITAVTFRGPSDTHLDSLVGQALFGDGAAALIIGSDPVIGVEKPLFELVSAAQTIL  247

Query  840   PDTDSHLKLQLREMGLTFHCSKAVPSLITQNVEDCLVKAFEPFGISDWNSIFWILHPGGN  1019
             PD+D  +   LRE+GLTFH  K VP LI++NVE  L +AF+P GISDWNS+FWI HPGG 
Sbjct  248   PDSDGAIDGHLREVGLTFHLLKDVPGLISKNVEKSLTEAFKPLGISDWNSLFWIAHPGGP  307

Query  1020  AILDGVEEKLGLDPEKLRASRDVLSQYGNLTSACVLFILDEVRKKSKKQQQMTTGEGLEW  1199
             AILD VE KL L PEKLRA+R VLS+YGN++SACVLFILDE+RKKS +    +TGEGLEW
Sbjct  308   AILDQVEAKLALKPEKLRATRHVLSEYGNMSSACVLFILDEMRKKSAEDGLQSTGEGLEW  367

Query  1200  GVLFGFGPGLTIDTVVIRSV  1259
             GVLFGFGPGLT++TVV+ SV
Sbjct  368   GVLFGFGPGLTVETVVLHSV  387



>ref|XP_010929491.1| PREDICTED: chalcone synthase 2 [Elaeis guineensis]
Length=394

 Score =   548 bits (1413),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 256/381 (67%), Positives = 316/381 (83%), Gaps = 0/381 (0%)
 Frame = +3

Query  126   AKRLEGDAKILAIGTATPANWVDQTTYPDFYFRITNSQHLLEHKEKFRRICNKSKIMKRH  305
             ++R EG A ILAIGTATPAN V Q  YPD+YFRIT S+HL + KEKF+R+C+KS I KR+
Sbjct  12    SQRAEGPATILAIGTATPANVVYQADYPDYYFRITKSEHLTDLKEKFKRMCDKSMIRKRY  71

Query  306   LVLTEELLKKHPNLCTYNEASLNTRQDILVSGVPKLGKEAAMKAIKEWGRPISEITHLVF  485
             + L+EE+LK++PN+C Y   SL+ RQD++V  VPKLGKEAA+KAIKEWG+P S+ITHLVF
Sbjct  72    MHLSEEILKENPNICAYMAPSLDARQDVVVVEVPKLGKEAAVKAIKEWGQPKSKITHLVF  131

Query  486   CTTSGVDMPGADFQLTKLLGLNSSVKRLMMYQQGCNAGAAMLRLAKDLAENNKGARVLVV  665
             CTTSGVDMPGAD+QLTKLLGL  SV RLMMYQQGC AG  +LRLAKDLAENN+GARVLVV
Sbjct  132   CTTSGVDMPGADYQLTKLLGLRPSVNRLMMYQQGCFAGGTVLRLAKDLAENNRGARVLVV  191

Query  666   CSEVMLSVFRGPSLQQEDNLLAQCLFGDGSAAVIVGTEPRPGLETPLFELVSSAQTIIPD  845
             CSE+    FRGPS    D+L+ Q LFGDG+AA+IVG +P P +E PLF+LVS++QTI+PD
Sbjct  192   CSEITAVTFRGPSESHLDSLVGQALFGDGAAAIIVGADPDPAIERPLFQLVSASQTILPD  251

Query  846   TDSHLKLQLREMGLTFHCSKAVPSLITQNVEDCLVKAFEPFGISDWNSIFWILHPGGNAI  1025
             ++  +   LRE+GLTFH  K VP LI++N+   LV+AF P GISDWNSIFWI HPGG AI
Sbjct  252   SEGAIDGHLREVGLTFHLLKDVPGLISKNIHKSLVEAFVPLGISDWNSIFWIAHPGGPAI  311

Query  1026  LDGVEEKLGLDPEKLRASRDVLSQYGNLTSACVLFILDEVRKKSKKQQQMTTGEGLEWGV  1205
             LD VE KLGL+ EK+RA+R VLS+YGN++SACVLFILDE+R++S ++ + TTGEGLEWGV
Sbjct  312   LDQVEAKLGLEKEKMRATRHVLSEYGNMSSACVLFILDEMRRRSAEEGKATTGEGLEWGV  371

Query  1206  LFGFGPGLTIDTVVIRSVPIN  1268
             LFGFGPGLT++TVV+ S+PI+
Sbjct  372   LFGFGPGLTVETVVLHSLPIS  392



>ref|XP_009353801.1| PREDICTED: chalcone synthase [Pyrus x bretschneideri]
Length=389

 Score =   548 bits (1413),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 260/380 (68%), Positives = 311/380 (82%), Gaps = 0/380 (0%)
 Frame = +3

Query  120   HRAKRLEGDAKILAIGTATPANWVDQTTYPDFYFRITNSQHLLEHKEKFRRICNKSKIMK  299
              +A+R EG A + AIGTATP N VDQ TYPD+YFRITNS+H  E KEKF+R+C+KS I K
Sbjct  8     RKAQRAEGPATVFAIGTATPPNCVDQATYPDYYFRITNSEHKAELKEKFQRMCDKSMIKK  67

Query  300   RHLVLTEELLKKHPNLCTYNEASLNTRQDILVSGVPKLGKEAAMKAIKEWGRPISEITHL  479
             R++ LTEE+LK++P++C Y   SL+ RQD++V  VP+LGKEAA KAIKEWG+P S+ITHL
Sbjct  68    RYMYLTEEILKENPSVCEYMAPSLDARQDMVVVEVPRLGKEAATKAIKEWGQPKSKITHL  127

Query  480   VFCTTSGVDMPGADFQLTKLLGLNSSVKRLMMYQQGCNAGAAMLRLAKDLAENNKGARVL  659
             VFCTTSGVDMPGAD+QLTKLLGL  SVKRLMMYQQGC AG  +LRLAKDLAENNKGARVL
Sbjct  128   VFCTTSGVDMPGADYQLTKLLGLRPSVKRLMMYQQGCFAGGTVLRLAKDLAENNKGARVL  187

Query  660   VVCSEVMLSVFRGPSLQQEDNLLAQCLFGDGSAAVIVGTEPRPGLETPLFELVSSAQTII  839
             VVCSE+    FRGPS    D+L+ Q LFGDG+AAVI+G +P P +E PLFELVS+AQTI+
Sbjct  188   VVCSEITAVTFRGPSDTHLDSLVGQALFGDGAAAVIIGADPVPEVEKPLFELVSAAQTIL  247

Query  840   PDTDSHLKLQLREMGLTFHCSKAVPSLITQNVEDCLVKAFEPFGISDWNSIFWILHPGGN  1019
             PD+D  +   LRE+GLTFH  K VP LI++++E  L +AF+P GISDWNS+FWI HPGG 
Sbjct  248   PDSDGAIDGHLREVGLTFHLLKDVPGLISKSIEKSLNEAFKPIGISDWNSLFWIAHPGGP  307

Query  1020  AILDGVEEKLGLDPEKLRASRDVLSQYGNLTSACVLFILDEVRKKSKKQQQMTTGEGLEW  1199
             AILD VE KL L PEKL A+R VLS YGN++SACVLFILDEVR+KS ++   TTGEGLEW
Sbjct  308   AILDQVEAKLALKPEKLEATRQVLSDYGNMSSACVLFILDEVRRKSAEKGLKTTGEGLEW  367

Query  1200  GVLFGFGPGLTIDTVVIRSV  1259
             GVLFGFGPGLT++TVV+ SV
Sbjct  368   GVLFGFGPGLTVETVVLHSV  387



>gb|AEU17693.1| chalcone synthase-like protein [Curcuma longa]
Length=396

 Score =   548 bits (1413),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 252/383 (66%), Positives = 315/383 (82%), Gaps = 0/383 (0%)
 Frame = +3

Query  120   HRAKRLEGDAKILAIGTATPANWVDQTTYPDFYFRITNSQHLLEHKEKFRRICNKSKIMK  299
              +++R EG A +LAIGTATP N V Q  YPD+YFRIT S+HL+E KEKF+R+C+KS I K
Sbjct  9     RKSQRAEGPAAVLAIGTATPPNVVYQADYPDYYFRITRSEHLVELKEKFKRMCDKSMIRK  68

Query  300   RHLVLTEELLKKHPNLCTYNEASLNTRQDILVSGVPKLGKEAAMKAIKEWGRPISEITHL  479
             RH+ LTEE+L+++P +C Y EASL+ RQDI+V  VP+LGKEAA+KAIKEWG+P S+ITHL
Sbjct  69    RHMYLTEEILRENPKMCAYMEASLDARQDIVVVEVPRLGKEAAVKAIKEWGQPKSKITHL  128

Query  480   VFCTTSGVDMPGADFQLTKLLGLNSSVKRLMMYQQGCNAGAAMLRLAKDLAENNKGARVL  659
             VFCTTSGVDMPGAD+QLTKLLGL  SV R MMYQQGC AG  ++RLAKDLAENN+GARVL
Sbjct  129   VFCTTSGVDMPGADYQLTKLLGLRPSVNRFMMYQQGCFAGGTVIRLAKDLAENNRGARVL  188

Query  660   VVCSEVMLSVFRGPSLQQEDNLLAQCLFGDGSAAVIVGTEPRPGLETPLFELVSSAQTII  839
             VVCSE+    FRGPS    D+++ Q LF DG+ A+IVG +P P  E PLFELVS++QTI+
Sbjct  189   VVCSEITAVTFRGPSDSHLDSMVGQALFADGAGAIIVGADPDPATERPLFELVSASQTIL  248

Query  840   PDTDSHLKLQLREMGLTFHCSKAVPSLITQNVEDCLVKAFEPFGISDWNSIFWILHPGGN  1019
             PD++  +   LRE GLTFH  K VP LI++N+E  LV+AF+P GISDWNS+FWI HPGG 
Sbjct  249   PDSEGAIDGHLREAGLTFHLLKDVPGLISKNIEKSLVEAFKPLGISDWNSLFWIAHPGGP  308

Query  1020  AILDGVEEKLGLDPEKLRASRDVLSQYGNLTSACVLFILDEVRKKSKKQQQMTTGEGLEW  1199
             AILD VE KL LD +K++A+R+VLS+YGN++SACVLFILDE+R++S ++ + TTGEGLEW
Sbjct  309   AILDQVEAKLALDKDKMKATRNVLSEYGNMSSACVLFILDEMRRRSAEEGKATTGEGLEW  368

Query  1200  GVLFGFGPGLTIDTVVIRSVPIN  1268
             GVLFGFGPGLT++TVV+ SVPI+
Sbjct  369   GVLFGFGPGLTVETVVLHSVPIS  391



>gb|ACT31917.1| chalcone synthase [Ipomoea batatas]
Length=393

 Score =   548 bits (1413),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 264/381 (69%), Positives = 312/381 (82%), Gaps = 1/381 (0%)
 Frame = +3

Query  123   RAKRLEGDAKILAIGTATPANWVDQTTYPDFYFRITNSQHLLEHKEKFRRICNKSKIMKR  302
             +A+R EG A ILAIGTATPAN V+Q+TYPD+YFRITNS+H  E KEKF+R+C+KS I KR
Sbjct  9     KAQRAEGPATILAIGTATPANCVNQSTYPDYYFRITNSEHKTELKEKFQRMCDKSMITKR  68

Query  303   HLVLTEELLKKHPNLCTYNEASLNTRQDILVSGVPKLGKEAAMKAIKEWGRPISEITHLV  482
             ++ LTEE+LK++P+ C Y   SL+ RQDI V  VPKLGKEAA  AIKEWG+P S+ITH+V
Sbjct  69    YMHLTEEILKENPSFCEYMAPSLDARQDIAVVEVPKLGKEAAQSAIKEWGQPKSKITHVV  128

Query  483   FCTTSGVDMPGADFQLTKLLGLNSSVKRLMMYQQGCNAGAAMLRLAKDLAENNKGARVLV  662
             FCTTSGVDMPGAD QLTKLLGL  SVKRLMMYQQGC AG  +LRLAKDLAENNKGARVL+
Sbjct  129   FCTTSGVDMPGADHQLTKLLGLRPSVKRLMMYQQGCFAGGTVLRLAKDLAENNKGARVLI  188

Query  663   VCSEVMLSVFRGPSLQQEDNLLAQCLFGDGSAAVIVGTEPRPGLETPLFELVSSAQTIIP  842
             VCSE+ +  FRGPS    D+L+ Q LFGDG+AAVIVG +P P +E PLF+LVS+AQT+ P
Sbjct  189   VCSEITVVTFRGPSETHLDSLVGQALFGDGAAAVIVGADPTP-VEKPLFQLVSAAQTLAP  247

Query  843   DTDSHLKLQLREMGLTFHCSKAVPSLITQNVEDCLVKAFEPFGISDWNSIFWILHPGGNA  1022
             D+   +   LRE+GLTFH  K VPS+++ N+E CL +AF P GISDWNS+FWI HPGG A
Sbjct  248   DSCGAIDGHLREVGLTFHLLKDVPSVVSNNIEKCLFEAFNPLGISDWNSVFWIAHPGGPA  307

Query  1023  ILDGVEEKLGLDPEKLRASRDVLSQYGNLTSACVLFILDEVRKKSKKQQQMTTGEGLEWG  1202
             ILD VE+KLGL PEKLRA+R VLS+YGN++SACVLFILDE+RK S      TTGEGLEWG
Sbjct  308   ILDQVEDKLGLKPEKLRATRHVLSEYGNMSSACVLFILDEMRKASSNDGLGTTGEGLEWG  367

Query  1203  VLFGFGPGLTIDTVVIRSVPI  1265
             VLFGFGPGLTI+TVV+ SVPI
Sbjct  368   VLFGFGPGLTIETVVLHSVPI  388



>gb|ACQ41890.1| chalcone synthase [Citrus unshiu]
Length=391

 Score =   548 bits (1413),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 257/381 (67%), Positives = 312/381 (82%), Gaps = 0/381 (0%)
 Frame = +3

Query  126   AKRLEGDAKILAIGTATPANWVDQTTYPDFYFRITNSQHLLEHKEKFRRICNKSKIMKRH  305
             A+R +G A +LAIGTATPA+ V+Q  YPD+YFRIT S+H+ E KEKF+R+C+KS I KR+
Sbjct  10    AQRADGPATVLAIGTATPAHSVNQADYPDYYFRITKSEHMTELKEKFKRMCDKSMIKKRY  69

Query  306   LVLTEELLKKHPNLCTYNEASLNTRQDILVSGVPKLGKEAAMKAIKEWGRPISEITHLVF  485
             + LTEE+LK++PN+C Y   SL+ RQDI+V  VPKLGKEAA KAIKEWG+P S+ITHL+F
Sbjct  70    MYLTEEILKENPNMCAYMAPSLDARQDIVVVEVPKLGKEAATKAIKEWGQPKSKITHLIF  129

Query  486   CTTSGVDMPGADFQLTKLLGLNSSVKRLMMYQQGCNAGAAMLRLAKDLAENNKGARVLVV  665
             CTTSGVDMPGAD+QLTKLLGL  SVKR MMYQQGC AG  +LRLAKDLAENNKGARVLVV
Sbjct  130   CTTSGVDMPGADYQLTKLLGLRPSVKRFMMYQQGCFAGGTVLRLAKDLAENNKGARVLVV  189

Query  666   CSEVMLSVFRGPSLQQEDNLLAQCLFGDGSAAVIVGTEPRPGLETPLFELVSSAQTIIPD  845
             CSE+    FRGP+    D+L+ Q LFGDG+AAVIVG +P   +E PL++LVS++QTI+PD
Sbjct  190   CSEITAVTFRGPADTHLDSLVGQALFGDGAAAVIVGADPDTSVERPLYQLVSTSQTILPD  249

Query  846   TDSHLKLQLREMGLTFHCSKAVPSLITQNVEDCLVKAFEPFGISDWNSIFWILHPGGNAI  1025
             +D  +   LRE+GLTFH  K VP LI++N+E  L +AF P GISDWNSIFWI HPGG AI
Sbjct  250   SDGAIDGHLREVGLTFHLLKDVPGLISKNIEKSLSEAFAPLGISDWNSIFWIAHPGGPAI  309

Query  1026  LDGVEEKLGLDPEKLRASRDVLSQYGNLTSACVLFILDEVRKKSKKQQQMTTGEGLEWGV  1205
             LD VE KLGL  EKL+A+R VLS+YGN+ SACVLFILDE+RKKS ++ + TTGEGL+WGV
Sbjct  310   LDQVESKLGLKEEKLKATRQVLSEYGNMPSACVLFILDEMRKKSAEEAKATTGEGLDWGV  369

Query  1206  LFGFGPGLTIDTVVIRSVPIN  1268
             LFGFGPGLT++TVV+ SVPI 
Sbjct  370   LFGFGPGLTVETVVLHSVPIK  390



>gb|AGL50915.1| chalcone synthase [Pyrus communis]
Length=389

 Score =   548 bits (1412),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 260/380 (68%), Positives = 311/380 (82%), Gaps = 0/380 (0%)
 Frame = +3

Query  120   HRAKRLEGDAKILAIGTATPANWVDQTTYPDFYFRITNSQHLLEHKEKFRRICNKSKIMK  299
              +A+R EG A + AIGTATP N VDQ TYPD+YFRITNS+H  E KEKF+R+C+KS I  
Sbjct  8     RKAQRAEGPATVFAIGTATPPNCVDQATYPDYYFRITNSEHKTELKEKFQRMCDKSMIKT  67

Query  300   RHLVLTEELLKKHPNLCTYNEASLNTRQDILVSGVPKLGKEAAMKAIKEWGRPISEITHL  479
             R++ LTEE+LK++P++C Y   SL+ RQD++V  VP+LGKEAA KAIKEWG+P S+ITHL
Sbjct  68    RYMYLTEEILKENPSVCEYMAPSLDARQDMVVVEVPRLGKEAATKAIKEWGQPKSKITHL  127

Query  480   VFCTTSGVDMPGADFQLTKLLGLNSSVKRLMMYQQGCNAGAAMLRLAKDLAENNKGARVL  659
             VFCTTSGVDMPGAD+QLTKLLGL  SVKRLMMYQQGC AG  +LRLAKDLAENNKGARVL
Sbjct  128   VFCTTSGVDMPGADYQLTKLLGLRPSVKRLMMYQQGCFAGGTVLRLAKDLAENNKGARVL  187

Query  660   VVCSEVMLSVFRGPSLQQEDNLLAQCLFGDGSAAVIVGTEPRPGLETPLFELVSSAQTII  839
             VVCSE+    FRGPS    D+L+ Q LFGDG+AAVI+G++P P +E PLFELVS+AQTI+
Sbjct  188   VVCSEITAVTFRGPSDTHLDSLVGQALFGDGAAAVIIGSDPVPEVEKPLFELVSAAQTIL  247

Query  840   PDTDSHLKLQLREMGLTFHCSKAVPSLITQNVEDCLVKAFEPFGISDWNSIFWILHPGGN  1019
             PD+D  +   LRE+GLTFH  K VP LI++N+E  L +AF+P GISDWNS+FWI HPGG 
Sbjct  248   PDSDGAIDGHLREVGLTFHLLKDVPGLISKNIEKSLNEAFKPIGISDWNSLFWIAHPGGP  307

Query  1020  AILDGVEEKLGLDPEKLRASRDVLSQYGNLTSACVLFILDEVRKKSKKQQQMTTGEGLEW  1199
             AILD VE KL L PEKL A+R VLS YGN++SACVLFILDEVR+KS ++   TTGEGLEW
Sbjct  308   AILDQVESKLALKPEKLEATRQVLSDYGNMSSACVLFILDEVRRKSAEKGLKTTGEGLEW  367

Query  1200  GVLFGFGPGLTIDTVVIRSV  1259
             GVLFGFGPGLT++TVV+ SV
Sbjct  368   GVLFGFGPGLTVETVVLHSV  387



>gb|KDO45963.1| hypothetical protein CISIN_1g016330mg [Citrus sinensis]
Length=391

 Score =   548 bits (1412),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 256/381 (67%), Positives = 313/381 (82%), Gaps = 0/381 (0%)
 Frame = +3

Query  126   AKRLEGDAKILAIGTATPANWVDQTTYPDFYFRITNSQHLLEHKEKFRRICNKSKIMKRH  305
             A+R +G A +LAIGTATPA+ V+Q  YPD+YFRIT S+H+ E KEKF+R+C+KS I KR+
Sbjct  10    AQRADGPATVLAIGTATPAHSVNQADYPDYYFRITKSEHMTELKEKFKRMCDKSMIKKRY  69

Query  306   LVLTEELLKKHPNLCTYNEASLNTRQDILVSGVPKLGKEAAMKAIKEWGRPISEITHLVF  485
             + LTEE+LK++PN+C Y   SL+ RQDI+V  VPKLGKEAA KAIKEWG+P S+ITHL+F
Sbjct  70    MYLTEEILKENPNMCAYMAPSLDARQDIVVVEVPKLGKEAATKAIKEWGQPKSKITHLIF  129

Query  486   CTTSGVDMPGADFQLTKLLGLNSSVKRLMMYQQGCNAGAAMLRLAKDLAENNKGARVLVV  665
             CTTSGVDMPGAD+QLTKL+GL  SVKR MMYQQGC AG  +LRLAKDLAENNKGARVLVV
Sbjct  130   CTTSGVDMPGADYQLTKLIGLRPSVKRFMMYQQGCFAGGTVLRLAKDLAENNKGARVLVV  189

Query  666   CSEVMLSVFRGPSLQQEDNLLAQCLFGDGSAAVIVGTEPRPGLETPLFELVSSAQTIIPD  845
             CSE+    FRGP+    D+L+ Q LFGDG+AAVIVG +P   +E PL++LVS++QTI+PD
Sbjct  190   CSEITAVTFRGPADTHLDSLVGQALFGDGAAAVIVGADPDTSVERPLYQLVSTSQTILPD  249

Query  846   TDSHLKLQLREMGLTFHCSKAVPSLITQNVEDCLVKAFEPFGISDWNSIFWILHPGGNAI  1025
             +D  +   LRE+GLTFH  K VP LI++N+E  L +AF P GISDWNSIFWI HPGG AI
Sbjct  250   SDGAIDGHLREVGLTFHLLKDVPGLISKNIEKSLSEAFAPVGISDWNSIFWIAHPGGPAI  309

Query  1026  LDGVEEKLGLDPEKLRASRDVLSQYGNLTSACVLFILDEVRKKSKKQQQMTTGEGLEWGV  1205
             LD VE KLGL  EKL+A+R VLS+YGN++SACVLFILDE+RKKS ++ + TTGEGL+WGV
Sbjct  310   LDQVESKLGLKEEKLKATRQVLSEYGNMSSACVLFILDEMRKKSAEEAKATTGEGLDWGV  369

Query  1206  LFGFGPGLTIDTVVIRSVPIN  1268
             LFGFGPGLT++TVV+ SVPI 
Sbjct  370   LFGFGPGLTVETVVLHSVPIK  390



>sp|Q9ZRS4.1|CHSY_CATRO RecName: Full=Chalcone synthase; AltName: Full=Naringenin-chalcone 
synthase [Catharanthus roseus]
 emb|CAA10511.1| chalcone synthase [Catharanthus roseus]
Length=389

 Score =   548 bits (1412),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 261/380 (69%), Positives = 314/380 (83%), Gaps = 0/380 (0%)
 Frame = +3

Query  126   AKRLEGDAKILAIGTATPANWVDQTTYPDFYFRITNSQHLLEHKEKFRRICNKSKIMKRH  305
             A+R +G A +LAIGT+TP+N VDQ+TYPD+YFRITNS+H  E KEKF+R+C KS I KR+
Sbjct  10    AQRAQGPATVLAIGTSTPSNCVDQSTYPDYYFRITNSEHKTELKEKFKRMCEKSMIKKRY  69

Query  306   LVLTEELLKKHPNLCTYNEASLNTRQDILVSGVPKLGKEAAMKAIKEWGRPISEITHLVF  485
             + LTEE+L+++PN+C Y   SL+ RQ+I+V  VPKLGKEAA KAIKEWG+  S+ITHLVF
Sbjct  70    MHLTEEILQENPNICAYMAPSLDARQNIVVVEVPKLGKEAAQKAIKEWGQSKSKITHLVF  129

Query  486   CTTSGVDMPGADFQLTKLLGLNSSVKRLMMYQQGCNAGAAMLRLAKDLAENNKGARVLVV  665
             CTTSGVDMPGAD+QLTKLLGL SSVKRLMMYQQGC AG  +LRLAKDLAENNKGARVLVV
Sbjct  130   CTTSGVDMPGADYQLTKLLGLRSSVKRLMMYQQGCFAGGTVLRLAKDLAENNKGARVLVV  189

Query  666   CSEVMLSVFRGPSLQQEDNLLAQCLFGDGSAAVIVGTEPRPGLETPLFELVSSAQTIIPD  845
             CSE+    FRGPS    D+L+ Q LFGDG+AA+IVG++P P +E PLFELVS+AQT++PD
Sbjct  190   CSEITAVTFRGPSESHLDSLVGQALFGDGAAAIIVGSDPIPEIERPLFELVSAAQTLLPD  249

Query  846   TDSHLKLQLREMGLTFHCSKAVPSLITQNVEDCLVKAFEPFGISDWNSIFWILHPGGNAI  1025
             +   +   LRE+GLTFH  K VP LI++N+   L +AF+P GISDWNSIFWI HPGG AI
Sbjct  250   SHGAIDGHLREVGLTFHLLKDVPGLISKNIGKALDEAFQPLGISDWNSIFWIAHPGGPAI  309

Query  1026  LDGVEEKLGLDPEKLRASRDVLSQYGNLTSACVLFILDEVRKKSKKQQQMTTGEGLEWGV  1205
             LD VEEKLGL PEKLRA+R VLS+YGN++SACVLFILDE+RK S +    TTGEGLEWGV
Sbjct  310   LDQVEEKLGLKPEKLRATRHVLSEYGNMSSACVLFILDEMRKASARDGLSTTGEGLEWGV  369

Query  1206  LFGFGPGLTIDTVVIRSVPI  1265
             LFGFGPGLT++TVV+ SV +
Sbjct  370   LFGFGPGLTVETVVLHSVNV  389



>dbj|BAE17124.1| chalcone synthase [Fragaria x ananassa]
Length=389

 Score =   548 bits (1412),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 257/379 (68%), Positives = 313/379 (83%), Gaps = 0/379 (0%)
 Frame = +3

Query  123   RAKRLEGDAKILAIGTATPANWVDQTTYPDFYFRITNSQHLLEHKEKFRRICNKSKIMKR  302
             +A+R EG A +LAIGTATP N +DQ+TYPD+YFRITNS+H  E KEKF+R+C+KS I KR
Sbjct  9     KAQRAEGPATVLAIGTATPPNCIDQSTYPDYYFRITNSEHKAELKEKFQRMCDKSMIKKR  68

Query  303   HLVLTEELLKKHPNLCTYNEASLNTRQDILVSGVPKLGKEAAMKAIKEWGRPISEITHLV  482
             ++ LTEE+LK++P++C Y   SL+ RQD++V  +PKLGKEAA+KAIKEWG+P S+ITHLV
Sbjct  69    YMYLTEEILKENPSMCEYMAPSLDARQDMVVVEIPKLGKEAAVKAIKEWGQPKSKITHLV  128

Query  483   FCTTSGVDMPGADFQLTKLLGLNSSVKRLMMYQQGCNAGAAMLRLAKDLAENNKGARVLV  662
             FCTTSGVDMPGAD+QLTKLLGL  SVKRLMMYQQGC AG  +LRLAKDLAENN+GARVLV
Sbjct  129   FCTTSGVDMPGADYQLTKLLGLRPSVKRLMMYQQGCFAGGTVLRLAKDLAENNRGARVLV  188

Query  663   VCSEVMLSVFRGPSLQQEDNLLAQCLFGDGSAAVIVGTEPRPGLETPLFELVSSAQTIIP  842
             VCSE+    FRGPS    D+L+ Q LFGDG+AA+IVG++P P +E PLFELVS+AQTI+P
Sbjct  189   VCSEITAVTFRGPSDTHLDSLVGQALFGDGAAAIIVGSDPLPEVERPLFELVSAAQTILP  248

Query  843   DTDSHLKLQLREMGLTFHCSKAVPSLITQNVEDCLVKAFEPFGISDWNSIFWILHPGGNA  1022
             D+D  +   LRE+GLTFH  K VP LI++N+E  L +AF+P  I+DWNS+FWI HPGG A
Sbjct  249   DSDGAIDGHLREVGLTFHLLKDVPGLISKNIEKSLNEAFKPLNITDWNSLFWIAHPGGPA  308

Query  1023  ILDGVEEKLGLDPEKLRASRDVLSQYGNLTSACVLFILDEVRKKSKKQQQMTTGEGLEWG  1202
             ILD VE KL L PEKL A+R +LS+YGN++SACVLFILDEVR+KS      TTGEGLEWG
Sbjct  309   ILDQVEAKLALKPEKLEATRHILSEYGNMSSACVLFILDEVRRKSAANGHKTTGEGLEWG  368

Query  1203  VLFGFGPGLTIDTVVIRSV  1259
             VLFGFGPGLT++TVV+ SV
Sbjct  369   VLFGFGPGLTVETVVLHSV  387



>gb|AEF14414.1| chalcone synthase [Onobrychis viciifolia]
Length=389

 Score =   548 bits (1412),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 260/380 (68%), Positives = 316/380 (83%), Gaps = 0/380 (0%)
 Frame = +3

Query  120   HRAKRLEGDAKILAIGTATPANWVDQTTYPDFYFRITNSQHLLEHKEKFRRICNKSKIMK  299
              +A+R EG A +LAIGTATP+N V Q+ YPDFYFRITNS+H  E KEKF+R+C+KS I K
Sbjct  8     RKAQRAEGPATVLAIGTATPSNCVVQSEYPDFYFRITNSEHKTELKEKFKRMCDKSMIKK  67

Query  300   RHLVLTEELLKKHPNLCTYNEASLNTRQDILVSGVPKLGKEAAMKAIKEWGRPISEITHL  479
             R++ LTEE+LK++P++C Y   SL+ RQD++V  VPKLGKEAA KAIKEWG+P S+ITHL
Sbjct  68    RYMHLTEEILKENPSMCEYMAPSLDARQDMVVVEVPKLGKEAATKAIKEWGQPKSKITHL  127

Query  480   VFCTTSGVDMPGADFQLTKLLGLNSSVKRLMMYQQGCNAGAAMLRLAKDLAENNKGARVL  659
             +FCTTSGVDMPGAD+QLTKLLGL  SVKR MMYQQGC AG  +LRLAKDLAENNKGARVL
Sbjct  128   IFCTTSGVDMPGADYQLTKLLGLRPSVKRYMMYQQGCLAGGTVLRLAKDLAENNKGARVL  187

Query  660   VVCSEVMLSVFRGPSLQQEDNLLAQCLFGDGSAAVIVGTEPRPGLETPLFELVSSAQTII  839
             VVCSE+    FRGP+    D+L+ Q LFGDG+AAVIVG++P P +E PLFELV +AQTI+
Sbjct  188   VVCSEITAVTFRGPTDTHLDSLVGQALFGDGAAAVIVGSDPLPEIEKPLFELVWTAQTIL  247

Query  840   PDTDSHLKLQLREMGLTFHCSKAVPSLITQNVEDCLVKAFEPFGISDWNSIFWILHPGGN  1019
             PD++  +   LRE+GLTFH  K VP LI++N+E  LV+AF+P GISD+NSIFWI HPGG 
Sbjct  248   PDSEGAIDGHLREVGLTFHLLKDVPGLISKNIEKALVEAFQPLGISDYNSIFWIAHPGGP  307

Query  1020  AILDGVEEKLGLDPEKLRASRDVLSQYGNLTSACVLFILDEVRKKSKKQQQMTTGEGLEW  1199
             AILD VE KLGL PEK++A+R VLS+YGN++SACVLFILDE+R+KSK+    TTGEGLEW
Sbjct  308   AILDQVEVKLGLKPEKMQATRHVLSEYGNMSSACVLFILDEMRRKSKENGLATTGEGLEW  367

Query  1200  GVLFGFGPGLTIDTVVIRSV  1259
             GVLFGFGPGLT++TVV+RSV
Sbjct  368   GVLFGFGPGLTVETVVLRSV  387



>ref|XP_007157043.1| hypothetical protein PHAVU_002G038700g [Phaseolus vulgaris]
 gb|ESW29037.1| hypothetical protein PHAVU_002G038700g [Phaseolus vulgaris]
Length=389

 Score =   548 bits (1412),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 259/382 (68%), Positives = 314/382 (82%), Gaps = 0/382 (0%)
 Frame = +3

Query  120   HRAKRLEGDAKILAIGTATPANWVDQTTYPDFYFRITNSQHLLEHKEKFRRICNKSKIMK  299
              +A+R EG A ILAIGTATP+N VDQ+TYPD+YFRITNS+H+ + KEKF+R+C+KS I K
Sbjct  8     RQAQRAEGPATILAIGTATPSNCVDQSTYPDYYFRITNSEHMTDLKEKFQRMCDKSMIKK  67

Query  300   RHLVLTEELLKKHPNLCTYNEASLNTRQDILVSGVPKLGKEAAMKAIKEWGRPISEITHL  479
             R++ L EE+LK++PN+C Y   SL+ RQDI+V  VPKLGKEAA+KAIKEWG+P S+ITHL
Sbjct  68    RYMHLDEEILKENPNMCAYMAPSLDARQDIVVVEVPKLGKEAAVKAIKEWGQPKSKITHL  127

Query  480   VFCTTSGVDMPGADFQLTKLLGLNSSVKRLMMYQQGCNAGAAMLRLAKDLAENNKGARVL  659
             +FCTTSGVDMPGAD+QLTKLLGL   VKR MMYQQGC AG  +LRLAKDLAENNKGARVL
Sbjct  128   IFCTTSGVDMPGADYQLTKLLGLRPYVKRYMMYQQGCFAGGTVLRLAKDLAENNKGARVL  187

Query  660   VVCSEVMLSVFRGPSLQQEDNLLAQCLFGDGSAAVIVGTEPRPGLETPLFELVSSAQTII  839
             VVCSE+    FRGPS    D+L+ Q LFGDG+AAVIVG++P P +E PLFELV +AQTI 
Sbjct  188   VVCSEITAVTFRGPSDTHLDSLVGQALFGDGAAAVIVGSDPIPQIEKPLFELVWTAQTIA  247

Query  840   PDTDSHLKLQLREMGLTFHCSKAVPSLITQNVEDCLVKAFEPFGISDWNSIFWILHPGGN  1019
             PD+D  +   LRE+GLTFH  K VP ++++N+E  L +AF P  ISD+NSIFWI HPGG 
Sbjct  248   PDSDGAIDGHLREVGLTFHLLKDVPGIVSKNIEKALFEAFNPLNISDYNSIFWIAHPGGP  307

Query  1020  AILDGVEEKLGLDPEKLRASRDVLSQYGNLTSACVLFILDEVRKKSKKQQQMTTGEGLEW  1199
             AILD VE+KLGL PEK++A+RDVLS YGN++SACVLFILDE+R+KS +    TTGEGLEW
Sbjct  308   AILDQVEQKLGLKPEKMKATRDVLSDYGNMSSACVLFILDEMRRKSAENGLKTTGEGLEW  367

Query  1200  GVLFGFGPGLTIDTVVIRSVPI  1265
             GVLFGFGPGLTI+TVV+ SV +
Sbjct  368   GVLFGFGPGLTIETVVLHSVAV  389



>gb|AGI02996.1| chalcone synthase [Camellia sinensis]
Length=389

 Score =   548 bits (1411),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 264/384 (69%), Positives = 315/384 (82%), Gaps = 2/384 (1%)
 Frame = +3

Query  108   DTWSHRAKRLEGDAKILAIGTATPANWVDQTTYPDFYFRITNSQHLLEHKEKFRRICNKS  287
             D W  RA+R  G A +LAIGTATP N VDQ+TYPD+YFRITNS+H +E KEKF+R+C+KS
Sbjct  6     DVW--RAQRARGPATVLAIGTATPPNCVDQSTYPDYYFRITNSEHKVELKEKFKRMCDKS  63

Query  288   KIMKRHLVLTEELLKKHPNLCTYNEASLNTRQDILVSGVPKLGKEAAMKAIKEWGRPISE  467
              I KR++ LTEE+LK++P +C Y   SL+ RQD++V  VPKLGKEAA KAIKEWG+P S+
Sbjct  64    MIKKRYMYLTEEILKENPLVCEYVAPSLDARQDMVVVEVPKLGKEAATKAIKEWGQPKSK  123

Query  468   ITHLVFCTTSGVDMPGADFQLTKLLGLNSSVKRLMMYQQGCNAGAAMLRLAKDLAENNKG  647
             ITHLVFCTTSGVDMPGAD+QLTKLLGL  SVKRLMMYQQGC AG  +LRLAKDLAENNKG
Sbjct  124   ITHLVFCTTSGVDMPGADYQLTKLLGLRPSVKRLMMYQQGCFAGGTVLRLAKDLAENNKG  183

Query  648   ARVLVVCSEVMLSVFRGPSLQQEDNLLAQCLFGDGSAAVIVGTEPRPGLETPLFELVSSA  827
             ARVLVVCSE+    FRGPS    D+L+ Q LFGDG+AA+I+G++P P +E PLFELVS+A
Sbjct  184   ARVLVVCSEITAVTFRGPSDTHLDSLVGQSLFGDGAAAIIIGSDPIPEVEKPLFELVSAA  243

Query  828   QTIIPDTDSHLKLQLREMGLTFHCSKAVPSLITQNVEDCLVKAFEPFGISDWNSIFWILH  1007
             QTI+P +D  +   LRE+GLTFH  K VP LI+ NVE  LV+AF+P GISDWN +FWI H
Sbjct  244   QTILPSSDGAIDGHLREVGLTFHLLKDVPRLISMNVEKSLVEAFQPLGISDWNPLFWIAH  303

Query  1008  PGGNAILDGVEEKLGLDPEKLRASRDVLSQYGNLTSACVLFILDEVRKKSKKQQQMTTGE  1187
             PGG AILD VE KLGL  EKLRA+R VLS+YGN++SACVLFILDE+RKKS ++   TTGE
Sbjct  304   PGGPAILDQVELKLGLKEEKLRATRHVLSEYGNMSSACVLFILDEMRKKSAEEGLKTTGE  363

Query  1188  GLEWGVLFGFGPGLTIDTVVIRSV  1259
             GLEWGVLFGFGPGLT++TVV+ S+
Sbjct  364   GLEWGVLFGFGPGLTVETVVLHSL  387



>gb|AAX63402.1| chalcone synthase [Solanum pinnatisectum]
Length=389

 Score =   548 bits (1411),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 260/380 (68%), Positives = 314/380 (83%), Gaps = 0/380 (0%)
 Frame = +3

Query  120   HRAKRLEGDAKILAIGTATPANWVDQTTYPDFYFRITNSQHLLEHKEKFRRICNKSKIMK  299
              +A+R EG A ILAIGT+TP+N VDQ+TYPD+YFRITNS+H  E KEKF+R+ +KS I K
Sbjct  8     RKAQRAEGPATILAIGTSTPSNCVDQSTYPDYYFRITNSEHKTELKEKFKRMSDKSMIKK  67

Query  300   RHLVLTEELLKKHPNLCTYNEASLNTRQDILVSGVPKLGKEAAMKAIKEWGRPISEITHL  479
             R++ LTEE+LK++PN+C Y   SL+ RQDI+V  VPKLGKEAA KAIKEWG+P S+ITHL
Sbjct  68    RYMHLTEEILKENPNMCAYMAPSLDARQDIVVVEVPKLGKEAAQKAIKEWGQPKSKITHL  127

Query  480   VFCTTSGVDMPGADFQLTKLLGLNSSVKRLMMYQQGCNAGAAMLRLAKDLAENNKGARVL  659
             VFCTTSGVDMPG D+QLTKLLGL  SVKRLMMYQQGC AG  +LRLAKDLAENNKGARVL
Sbjct  128   VFCTTSGVDMPGCDYQLTKLLGLRPSVKRLMMYQQGCFAGGTVLRLAKDLAENNKGARVL  187

Query  660   VVCSEVMLSVFRGPSLQQEDNLLAQCLFGDGSAAVIVGTEPRPGLETPLFELVSSAQTII  839
             VVCSE+    FRGP+    D+L+ Q LFGDG+AA+I+G++P   +E PLFELVS+AQ ++
Sbjct  188   VVCSEITAVTFRGPNESHLDSLVGQALFGDGAAAIIIGSDPIISVERPLFELVSAAQALV  247

Query  840   PDTDSHLKLQLREMGLTFHCSKAVPSLITQNVEDCLVKAFEPFGISDWNSIFWILHPGGN  1019
             PD++  +   LRE+GLTFH  K VP LI++N+E  LV+AF+P GISDWNS+FWI HPGG 
Sbjct  248   PDSEGAIDGHLREVGLTFHLLKDVPGLISKNIEKSLVEAFQPIGISDWNSLFWIAHPGGP  307

Query  1020  AILDGVEEKLGLDPEKLRASRDVLSQYGNLTSACVLFILDEVRKKSKKQQQMTTGEGLEW  1199
             AILD VE KLGL PEKLRA+R+VLS YGN++SACVLFILDE+RK S K+   TTGEGLEW
Sbjct  308   AILDQVELKLGLKPEKLRATREVLSNYGNMSSACVLFILDEMRKASTKEGLGTTGEGLEW  367

Query  1200  GVLFGFGPGLTIDTVVIRSV  1259
             GVLFGFGPGLT++TVV+ SV
Sbjct  368   GVLFGFGPGLTVETVVLHSV  387



>ref|XP_008224578.1| PREDICTED: polyketide synthase 5 [Prunus mume]
Length=391

 Score =   548 bits (1412),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 257/383 (67%), Positives = 316/383 (83%), Gaps = 0/383 (0%)
 Frame = +3

Query  120   HRAKRLEGDAKILAIGTATPANWVDQTTYPDFYFRITNSQHLLEHKEKFRRICNKSKIMK  299
              +A+R EG A +LAIGTATP N VDQ TYPD+YFRITNS+H  E KEKF+R+C+KS I K
Sbjct  8     RKAQRAEGPATVLAIGTATPPNCVDQATYPDYYFRITNSEHKAELKEKFQRMCDKSMIKK  67

Query  300   RHLVLTEELLKKHPNLCTYNEASLNTRQDILVSGVPKLGKEAAMKAIKEWGRPISEITHL  479
             R++ LTE++LK++P++C Y   SL+ RQD++V  +PKLGKEAA KAIKEWG+P S+ITHL
Sbjct  68    RYMYLTEDILKENPSMCEYMAPSLDARQDMVVVEIPKLGKEAATKAIKEWGQPKSKITHL  127

Query  480   VFCTTSGVDMPGADFQLTKLLGLNSSVKRLMMYQQGCNAGAAMLRLAKDLAENNKGARVL  659
             VFCTTSGVDMPGAD+QLTKLLGL  SVKRLMMYQQGC AG  +LRLAKDLAENNKGARVL
Sbjct  128   VFCTTSGVDMPGADYQLTKLLGLRPSVKRLMMYQQGCFAGGTVLRLAKDLAENNKGARVL  187

Query  660   VVCSEVMLSVFRGPSLQQEDNLLAQCLFGDGSAAVIVGTEPRPGLETPLFELVSSAQTII  839
             VVCSE+    FRGPS    D+L+ Q LFGDG+AA+IVG +P P +E PLFE+VS+AQTI+
Sbjct  188   VVCSEITAVTFRGPSDTHLDSLVGQALFGDGAAAIIVGADPIPEIEKPLFEVVSAAQTIL  247

Query  840   PDTDSHLKLQLREMGLTFHCSKAVPSLITQNVEDCLVKAFEPFGISDWNSIFWILHPGGN  1019
             PD+D  +   LRE+GLTFH  K VP LI++N+E  L +AF+P GISDWNS+FWI HPGG 
Sbjct  248   PDSDGAIDGHLREVGLTFHLLKDVPGLISKNIEKSLNEAFQPLGISDWNSLFWIAHPGGP  307

Query  1020  AILDGVEEKLGLDPEKLRASRDVLSQYGNLTSACVLFILDEVRKKSKKQQQMTTGEGLEW  1199
             AILD VE KLGL PEKL A+R +LS++GN++SACVLFILDEVRK++ ++   TTG+GL+W
Sbjct  308   AILDQVESKLGLKPEKLEATRHILSEFGNMSSACVLFILDEVRKRAAEKGLKTTGDGLDW  367

Query  1200  GVLFGFGPGLTIDTVVIRSVPIN  1268
             GVLFGFGPGLT++TVV+ SV +N
Sbjct  368   GVLFGFGPGLTVETVVLHSVGLN  390



>dbj|BAM17288.1| chalcone synthase [Petunia x hybrida]
Length=389

 Score =   548 bits (1411),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 259/379 (68%), Positives = 314/379 (83%), Gaps = 0/379 (0%)
 Frame = +3

Query  123   RAKRLEGDAKILAIGTATPANWVDQTTYPDFYFRITNSQHLLEHKEKFRRICNKSKIMKR  302
             +A+R EG A ++AIGTATP+N VDQ+TYPDFYFRITNS+H  + KEKF+R+C KS I KR
Sbjct  9     KAQRAEGPATVMAIGTATPSNCVDQSTYPDFYFRITNSEHKTDLKEKFKRMCEKSMIKKR  68

Query  303   HLVLTEELLKKHPNLCTYNEASLNTRQDILVSGVPKLGKEAAMKAIKEWGRPISEITHLV  482
             ++ LTEE+LK++P++C Y   SL+ RQDI+V  VPKLGKEAA KAIKEWG+P S+ITHLV
Sbjct  69    YMHLTEEILKENPSMCEYMAPSLDARQDIVVVEVPKLGKEAAQKAIKEWGQPKSKITHLV  128

Query  483   FCTTSGVDMPGADFQLTKLLGLNSSVKRLMMYQQGCNAGAAMLRLAKDLAENNKGARVLV  662
             FCTTSGVDMPG D+QLTKLLGL  SVKRLMMYQQGC AG  +LRLAKDLAENNKGARVLV
Sbjct  129   FCTTSGVDMPGCDYQLTKLLGLRPSVKRLMMYQQGCFAGGTVLRLAKDLAENNKGARVLV  188

Query  663   VCSEVMLSVFRGPSLQQEDNLLAQCLFGDGSAAVIVGTEPRPGLETPLFELVSSAQTIIP  842
             VCSE+    FRGP+    D+L+ Q LFGDG+ A+I+G++P PG+E PLFELVS+AQT++P
Sbjct  189   VCSEITAVTFRGPNDTHLDSLVGQALFGDGAGAIIIGSDPIPGVERPLFELVSAAQTLLP  248

Query  843   DTDSHLKLQLREMGLTFHCSKAVPSLITQNVEDCLVKAFEPFGISDWNSIFWILHPGGNA  1022
             D+   +   LRE+GLTFH  K VP LI++N+E  L +AF+P GISDWNS+FWI HPGG A
Sbjct  249   DSHGAIDGHLREVGLTFHLLKDVPGLISKNIEKSLEEAFKPLGISDWNSLFWIAHPGGPA  308

Query  1023  ILDGVEEKLGLDPEKLRASRDVLSQYGNLTSACVLFILDEVRKKSKKQQQMTTGEGLEWG  1202
             ILD VE KLGL PEKL+A+R+VLS YGN++SACVLFILDE+RK S K+   TTGEGLEWG
Sbjct  309   ILDQVEIKLGLKPEKLKATRNVLSNYGNMSSACVLFILDEMRKASAKEGLETTGEGLEWG  368

Query  1203  VLFGFGPGLTIDTVVIRSV  1259
             VLFGFGPGLT++TVV+ SV
Sbjct  369   VLFGFGPGLTVETVVLHSV  387



>ref|XP_009376346.1| PREDICTED: chalcone synthase-like [Pyrus x bretschneideri]
 gb|ADP09376.1| chalcone synthase [Pyrus pyrifolia]
 gb|AGV40323.1| chalcone synthase [Pyrus x bretschneideri]
Length=389

 Score =   548 bits (1411),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 260/380 (68%), Positives = 311/380 (82%), Gaps = 0/380 (0%)
 Frame = +3

Query  120   HRAKRLEGDAKILAIGTATPANWVDQTTYPDFYFRITNSQHLLEHKEKFRRICNKSKIMK  299
              +A+R EG A +LAIGT+TP N VDQ TYPD+YFRITNS+H  E KEKF+R+C+KS I  
Sbjct  8     RKAQRAEGPATVLAIGTSTPPNCVDQATYPDYYFRITNSEHKTELKEKFQRMCDKSMIKT  67

Query  300   RHLVLTEELLKKHPNLCTYNEASLNTRQDILVSGVPKLGKEAAMKAIKEWGRPISEITHL  479
             R++ LTEE+LK++P +C Y   SL+ RQD++V  VP+LGKEAA KAIKEWG+P S+ITHL
Sbjct  68    RYMYLTEEILKENPTVCEYMAPSLDARQDMVVVEVPRLGKEAATKAIKEWGQPKSKITHL  127

Query  480   VFCTTSGVDMPGADFQLTKLLGLNSSVKRLMMYQQGCNAGAAMLRLAKDLAENNKGARVL  659
             VFCTTSGVDMPGAD+QLTKLLGL  SVKRLMMYQQGC AG  +LRLAKDLAENNKGARVL
Sbjct  128   VFCTTSGVDMPGADYQLTKLLGLRPSVKRLMMYQQGCFAGGTVLRLAKDLAENNKGARVL  187

Query  660   VVCSEVMLSVFRGPSLQQEDNLLAQCLFGDGSAAVIVGTEPRPGLETPLFELVSSAQTII  839
             VVCSE+    FRGPS    D+L+ Q LFGDG+AAVI+G++P P +E PLFELVS+AQTI+
Sbjct  188   VVCSEITAVTFRGPSDTHLDSLVGQALFGDGAAAVIIGSDPVPEVEKPLFELVSAAQTIL  247

Query  840   PDTDSHLKLQLREMGLTFHCSKAVPSLITQNVEDCLVKAFEPFGISDWNSIFWILHPGGN  1019
             PD+D  +   LRE+GLTFH  K VP LI++N+E  L +AF+P GISDWNS+FWI HPGG 
Sbjct  248   PDSDGAIDGHLREVGLTFHLLKDVPGLISKNIEKSLNEAFKPIGISDWNSLFWIAHPGGP  307

Query  1020  AILDGVEEKLGLDPEKLRASRDVLSQYGNLTSACVLFILDEVRKKSKKQQQMTTGEGLEW  1199
             AILD VE KL L PEKL A+R VLS YGN++SACVLFILDEVR+KS ++   TTGEGLEW
Sbjct  308   AILDQVESKLALKPEKLEATRQVLSDYGNMSSACVLFILDEVRRKSAEKGLKTTGEGLEW  367

Query  1200  GVLFGFGPGLTIDTVVIRSV  1259
             GVLFGFGPGLT++TVV+ SV
Sbjct  368   GVLFGFGPGLTVETVVLHSV  387



>gb|AFJ44312.1| chalcone synthase [Lonicera japonica]
Length=389

 Score =   548 bits (1411),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 257/380 (68%), Positives = 313/380 (82%), Gaps = 0/380 (0%)
 Frame = +3

Query  120   HRAKRLEGDAKILAIGTATPANWVDQTTYPDFYFRITNSQHLLEHKEKFRRICNKSKIMK  299
              +A+R EG A ++AIGT+TP N V Q+ YPD+YFRITNS+H  E KEKF+R+C KS I K
Sbjct  8     RKAQRAEGPATVMAIGTSTPPNCVYQSAYPDYYFRITNSEHKTELKEKFKRMCEKSMIRK  67

Query  300   RHLVLTEELLKKHPNLCTYNEASLNTRQDILVSGVPKLGKEAAMKAIKEWGRPISEITHL  479
             R++ LTEE LK++P++C Y   SL+ RQD++V  VP+LGKEAA KAIKEWG+P S+ITHL
Sbjct  68    RYMYLTEEFLKENPSMCEYMAPSLDARQDMVVVEVPRLGKEAATKAIKEWGQPKSKITHL  127

Query  480   VFCTTSGVDMPGADFQLTKLLGLNSSVKRLMMYQQGCNAGAAMLRLAKDLAENNKGARVL  659
             VFCTTSGVDMPGAD+QLTKLLGL SSVKRLMMYQQGC AG  +LRLAKDLAENNKGARVL
Sbjct  128   VFCTTSGVDMPGADYQLTKLLGLRSSVKRLMMYQQGCFAGGTVLRLAKDLAENNKGARVL  187

Query  660   VVCSEVMLSVFRGPSLQQEDNLLAQCLFGDGSAAVIVGTEPRPGLETPLFELVSSAQTII  839
             VVCSE+    FRGPS    D+L+ Q LFGDG+AA+I+G++P P +E PLFELVS++QTI+
Sbjct  188   VVCSEITAVTFRGPSDTHLDSLVGQALFGDGAAAMIIGSDPVPKVEKPLFELVSASQTIL  247

Query  840   PDTDSHLKLQLREMGLTFHCSKAVPSLITQNVEDCLVKAFEPFGISDWNSIFWILHPGGN  1019
             PD+D  +   LRE+GLTFH  K VP LI++N+E  LV+AF+P GISDWNSIFWI HPGG 
Sbjct  248   PDSDGAIDGHLREVGLTFHLLKDVPGLISKNIEKSLVEAFKPLGISDWNSIFWIAHPGGP  307

Query  1020  AILDGVEEKLGLDPEKLRASRDVLSQYGNLTSACVLFILDEVRKKSKKQQQMTTGEGLEW  1199
             AILD VE+KL L PEK+ A+R VLS+YGN++SACVLFI+DE+RKKS  +   TTGEGLEW
Sbjct  308   AILDQVEKKLALKPEKMGATRHVLSEYGNMSSACVLFIMDEMRKKSANEGLKTTGEGLEW  367

Query  1200  GVLFGFGPGLTIDTVVIRSV  1259
             GVLFGFGPGLT++TVV+ SV
Sbjct  368   GVLFGFGPGLTVETVVLHSV  387



>gb|AGU70032.1| chalcone synthase [Solanum tuberosum]
Length=389

 Score =   548 bits (1411),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 261/380 (69%), Positives = 313/380 (82%), Gaps = 0/380 (0%)
 Frame = +3

Query  120   HRAKRLEGDAKILAIGTATPANWVDQTTYPDFYFRITNSQHLLEHKEKFRRICNKSKIMK  299
              +A+R EG A ILAIGT+TP+N VDQ+TYPD+YFRITNS+H  E KEKF+R+C+KS I K
Sbjct  8     RKAQRAEGPATILAIGTSTPSNCVDQSTYPDYYFRITNSEHKTELKEKFKRMCDKSMIKK  67

Query  300   RHLVLTEELLKKHPNLCTYNEASLNTRQDILVSGVPKLGKEAAMKAIKEWGRPISEITHL  479
             R++ LTEE+LK++PN+C Y   SL+ RQDI+V  VPKLGKEAA KAIKEWG+P S+ITHL
Sbjct  68    RYMHLTEEILKENPNMCAYMAPSLDARQDIVVVEVPKLGKEAAQKAIKEWGQPKSKITHL  127

Query  480   VFCTTSGVDMPGADFQLTKLLGLNSSVKRLMMYQQGCNAGAAMLRLAKDLAENNKGARVL  659
             VFCTTSGVDMPG D+QL KLLGL  SVKRLMMYQQGC AG  +LRLAKDLAENNKGARVL
Sbjct  128   VFCTTSGVDMPGCDYQLAKLLGLRPSVKRLMMYQQGCFAGGTVLRLAKDLAENNKGARVL  187

Query  660   VVCSEVMLSVFRGPSLQQEDNLLAQCLFGDGSAAVIVGTEPRPGLETPLFELVSSAQTII  839
             VVCSE+    FRGPS    D+L+ Q LFGDG+AA+I+G++P  G+E PLFELVS+AQT++
Sbjct  188   VVCSEITAVTFRGPSESHLDSLVGQALFGDGAAAIIMGSDPIIGVERPLFELVSAAQTLV  247

Query  840   PDTDSHLKLQLREMGLTFHCSKAVPSLITQNVEDCLVKAFEPFGISDWNSIFWILHPGGN  1019
             PD++  +   LRE+GLTFH  K VP LI++N+E  L +AF+P GISDWNS+FWI HPGG 
Sbjct  248   PDSEGAIDGHLREVGLTFHLLKDVPGLISKNIEKSLQEAFQPLGISDWNSLFWIAHPGGP  307

Query  1020  AILDGVEEKLGLDPEKLRASRDVLSQYGNLTSACVLFILDEVRKKSKKQQQMTTGEGLEW  1199
             AILD VE KLGL  EKLRA+R+VLS YGN++SACVLFILDEVRK S  +   TTGEGLEW
Sbjct  308   AILDQVELKLGLKQEKLRATREVLSNYGNMSSACVLFILDEVRKASTNEGLGTTGEGLEW  367

Query  1200  GVLFGFGPGLTIDTVVIRSV  1259
             GVLFGFGPGLT++TVV+ SV
Sbjct  368   GVLFGFGPGLTVETVVLHSV  387



>gb|AAT75302.1| chalcone synthase [Camellia sinensis]
Length=389

 Score =   548 bits (1411),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 264/384 (69%), Positives = 315/384 (82%), Gaps = 2/384 (1%)
 Frame = +3

Query  108   DTWSHRAKRLEGDAKILAIGTATPANWVDQTTYPDFYFRITNSQHLLEHKEKFRRICNKS  287
             D W  RA+R  G A +LAIGTATP N VDQ+TYPD+YFRITNS+H +E KEKF+R+C+KS
Sbjct  6     DVW--RAQRARGPATVLAIGTATPPNCVDQSTYPDYYFRITNSEHKVELKEKFKRMCDKS  63

Query  288   KIMKRHLVLTEELLKKHPNLCTYNEASLNTRQDILVSGVPKLGKEAAMKAIKEWGRPISE  467
                KR++ LTEE+LK++P +C Y   SL+ RQD++V  VPKLGKEAA KAIKEWG+P S+
Sbjct  64    MNKKRYMYLTEEILKENPLVCEYMAPSLDARQDMVVVEVPKLGKEAATKAIKEWGQPKSK  123

Query  468   ITHLVFCTTSGVDMPGADFQLTKLLGLNSSVKRLMMYQQGCNAGAAMLRLAKDLAENNKG  647
             ITHLVFCTTSGVDMPGAD+QLTKLLGL  SVKRLMMYQQGC AG  +LRLAKDLAENNKG
Sbjct  124   ITHLVFCTTSGVDMPGADYQLTKLLGLRPSVKRLMMYQQGCFAGGTVLRLAKDLAENNKG  183

Query  648   ARVLVVCSEVMLSVFRGPSLQQEDNLLAQCLFGDGSAAVIVGTEPRPGLETPLFELVSSA  827
             ARVLVVCSE+    FRGPS    D+L+ Q LFGDG+AA+I+G++P P +E PLFELVS+A
Sbjct  184   ARVLVVCSEITAVTFRGPSDTHLDSLVGQSLFGDGAAAIIIGSDPIPEVEKPLFELVSAA  243

Query  828   QTIIPDTDSHLKLQLREMGLTFHCSKAVPSLITQNVEDCLVKAFEPFGISDWNSIFWILH  1007
             QTI+P +D  +   LRE+GLTFH  K VP LI+ NVE  LV+AF+P GISDWNS+FWI H
Sbjct  244   QTILPSSDGAIDGHLREVGLTFHLLKDVPRLISMNVEKSLVEAFQPLGISDWNSLFWIAH  303

Query  1008  PGGNAILDGVEEKLGLDPEKLRASRDVLSQYGNLTSACVLFILDEVRKKSKKQQQMTTGE  1187
             PGG AILD VE KLGL  EKLRA+R VLS+YGN++SACVLFILDE+RKKS ++   TTGE
Sbjct  304   PGGPAILDQVELKLGLKEEKLRATRHVLSEYGNMSSACVLFILDEMRKKSAEEGLKTTGE  363

Query  1188  GLEWGVLFGFGPGLTIDTVVIRSV  1259
             GLEWGVLFGFGPGLT++TVV+ S+
Sbjct  364   GLEWGVLFGFGPGLTVETVVLHSL  387



>sp|B0LDU6.1|PKS5_RUBID RecName: Full=Polyketide synthase 5; Short=RiPKS5; AltName: Full=Naringenin-chalcone 
synthase PKS5 [Rubus idaeus]
 gb|ABV54603.1| polyketide synthase 5 [Rubus idaeus]
Length=391

 Score =   548 bits (1411),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 258/383 (67%), Positives = 313/383 (82%), Gaps = 0/383 (0%)
 Frame = +3

Query  120   HRAKRLEGDAKILAIGTATPANWVDQTTYPDFYFRITNSQHLLEHKEKFRRICNKSKIMK  299
              +A+R EG A +LAIGTATP N +DQ+TYPD+YFRITNS+H  E KEKF+R+C+KS I K
Sbjct  8     RKAQRAEGPATVLAIGTATPPNCIDQSTYPDYYFRITNSEHKTELKEKFQRMCDKSMIKK  67

Query  300   RHLVLTEELLKKHPNLCTYNEASLNTRQDILVSGVPKLGKEAAMKAIKEWGRPISEITHL  479
             R++ LTEE+LK++P++C Y   SL+ RQD++V  +PKLGKEAA KAIKEWG+P S+ITHL
Sbjct  68    RYMYLTEEILKENPSMCEYMAPSLDARQDMVVVEIPKLGKEAATKAIKEWGQPKSKITHL  127

Query  480   VFCTTSGVDMPGADFQLTKLLGLNSSVKRLMMYQQGCNAGAAMLRLAKDLAENNKGARVL  659
             VFCTTSGVDMPGAD+QLTKLLGL  SVKRLMMYQQGC AG  +LRLAKDLAENN+GARVL
Sbjct  128   VFCTTSGVDMPGADYQLTKLLGLRPSVKRLMMYQQGCFAGGTVLRLAKDLAENNRGARVL  187

Query  660   VVCSEVMLSVFRGPSLQQEDNLLAQCLFGDGSAAVIVGTEPRPGLETPLFELVSSAQTII  839
             VVCSE+    FRGPS    D+L+ Q LFGDG+AA+IVG +P P +E PLFELVS+AQTI+
Sbjct  188   VVCSEIXAVTFRGPSDTHLDSLVGQALFGDGAAAIIVGADPLPKIERPLFELVSAAQTIL  247

Query  840   PDTDSHLKLQLREMGLTFHCSKAVPSLITQNVEDCLVKAFEPFGISDWNSIFWILHPGGN  1019
             PD+D  +   LRE+GLTFH  K VP LI++N+E  L +AF+P  I+DWNS+FWI HPGG 
Sbjct  248   PDSDGAIDGHLREVGLTFHLLKDVPGLISKNIEKSLNEAFKPLDITDWNSLFWIAHPGGP  307

Query  1020  AILDGVEEKLGLDPEKLRASRDVLSQYGNLTSACVLFILDEVRKKSKKQQQMTTGEGLEW  1199
             AILD VE KLGL PEKL A+R +LS+YGN++SACVLFILDEVR+KS      TTGEGLEW
Sbjct  308   AILDQVETKLGLKPEKLEATRHILSEYGNMSSACVLFILDEVRRKSATNGLKTTGEGLEW  367

Query  1200  GVLFGFGPGLTIDTVVIRSVPIN  1268
             GVLFGFGPGLT++TVV+ SV + 
Sbjct  368   GVLFGFGPGLTVETVVLHSVGVT  390



>dbj|BAC87863.1| chalcone synthase [Torenia hybrid cultivar]
Length=391

 Score =   548 bits (1411),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 261/381 (69%), Positives = 312/381 (82%), Gaps = 1/381 (0%)
 Frame = +3

Query  123   RAKRLEGDAKILAIGTATPANWVDQTTYPDFYFRITNSQHLLEHKEKFRRICNKSKIMKR  302
             RA+R EG A ILAIGT+TP N VDQ+TYPD+YFRITNS+H+ E K+KF R+C KS I KR
Sbjct  9     RAQRAEGAATILAIGTSTPQNCVDQSTYPDYYFRITNSEHMTELKDKFTRMCEKSMIKKR  68

Query  303   HLVLTEELLKKHPNLCTYNEASLNTRQDILVSGVPKLGKEAAMKAIKEWGRPISEITHLV  482
             ++ LTE+ LK++PN+C Y E SL+ RQDI+V  VPKLGKEAA KAIKEWG+P S+ITHLV
Sbjct  69    YMHLTEDYLKQNPNICAYMEPSLDARQDIVVVEVPKLGKEAAQKAIKEWGQPKSKITHLV  128

Query  483   FCTTSGVDMPGADFQLTKLLGLNSSVKRLMMYQQGCNAGAAMLRLAKDLAENNKGARVLV  662
             FCTTSGVDMPGAD+QLTKLLGL  SVKR MMYQQGC AG  +LR+AKDLAENN GARVLV
Sbjct  129   FCTTSGVDMPGADYQLTKLLGLRPSVKRFMMYQQGCFAGGTVLRMAKDLAENNAGARVLV  188

Query  663   VCSEVMLSVFRGPSLQQEDNLLAQCLFGDGSAAVIVGTEPRPGLETPLFELVSSAQTIIP  842
             VCSE+    FRGPS    D+L+ Q LFGDG+AAVIVG++P   +E PLF+LVS+AQTI+P
Sbjct  189   VCSEITAVTFRGPSDAHLDSLVGQALFGDGAAAVIVGSDPT-DVERPLFQLVSAAQTILP  247

Query  843   DTDSHLKLQLREMGLTFHCSKAVPSLITQNVEDCLVKAFEPFGISDWNSIFWILHPGGNA  1022
             D+D  +   LRE+GLTFH  K VP LI++N+E  L +AF+P GI DWNSIFWI HPGG A
Sbjct  248   DSDGAIDGHLREVGLTFHLLKDVPGLISKNIEKSLKEAFDPLGIDDWNSIFWIAHPGGPA  307

Query  1023  ILDGVEEKLGLDPEKLRASRDVLSQYGNLTSACVLFILDEVRKKSKKQQQMTTGEGLEWG  1202
             ILD VE KL L P+KLRA+R VLS+YGN++SACVLFILDE+RK S K+   TTGEGL+WG
Sbjct  308   ILDQVEAKLALKPDKLRATRHVLSEYGNMSSACVLFILDEMRKASAKEGTSTTGEGLDWG  367

Query  1203  VLFGFGPGLTIDTVVIRSVPI  1265
             VLFGFGPGLT++TVV+ SVP+
Sbjct  368   VLFGFGPGLTVETVVLHSVPL  388



>gb|ADZ54780.1| naringenin-chalcone synthase [Prunus avium]
Length=391

 Score =   548 bits (1411),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 256/383 (67%), Positives = 314/383 (82%), Gaps = 0/383 (0%)
 Frame = +3

Query  120   HRAKRLEGDAKILAIGTATPANWVDQTTYPDFYFRITNSQHLLEHKEKFRRICNKSKIMK  299
              +A+R EG A +LAIGT+ P N VDQ TYPD+YFRITNS+H  E KEKF+R+C+KS I K
Sbjct  8     RKAQRAEGPATVLAIGTSNPPNCVDQATYPDYYFRITNSEHKTELKEKFQRMCDKSMIKK  67

Query  300   RHLVLTEELLKKHPNLCTYNEASLNTRQDILVSGVPKLGKEAAMKAIKEWGRPISEITHL  479
             R++ LTEE+LK++P +C Y   SL+ RQD++V  +PKLGKEAA KAIKEWG+P S+ITHL
Sbjct  68    RYMYLTEEILKENPTMCEYMAPSLDARQDMVVVEIPKLGKEAATKAIKEWGQPKSKITHL  127

Query  480   VFCTTSGVDMPGADFQLTKLLGLNSSVKRLMMYQQGCNAGAAMLRLAKDLAENNKGARVL  659
             VFCTTSGVDMPGAD+QLTKLLGL SSVKRLMMYQQGC AG  +LRLAKDLAENN+GARVL
Sbjct  128   VFCTTSGVDMPGADYQLTKLLGLRSSVKRLMMYQQGCFAGGTVLRLAKDLAENNRGARVL  187

Query  660   VVCSEVMLSVFRGPSLQQEDNLLAQCLFGDGSAAVIVGTEPRPGLETPLFELVSSAQTII  839
             VVCSE+    FRGPS    D+L+ Q LFGDG+AA+IVG +P P +E PLFE+VS+AQTI+
Sbjct  188   VVCSEITAVTFRGPSDTHLDSLVGQALFGDGAAAIIVGADPIPEIEKPLFEVVSAAQTIL  247

Query  840   PDTDSHLKLQLREMGLTFHCSKAVPSLITQNVEDCLVKAFEPFGISDWNSIFWILHPGGN  1019
             PD+D  +   LRE+GLTFH  K VP LI++N++  L +AF+P GISDWNS+FWI HPGG 
Sbjct  248   PDSDGAIDGHLREVGLTFHLLKDVPGLISKNIZKSLNEAFQPLGISDWNSLFWIAHPGGP  307

Query  1020  AILDGVEEKLGLDPEKLRASRDVLSQYGNLTSACVLFILDEVRKKSKKQQQMTTGEGLEW  1199
             AILD VE KL L PEKL A+R +LS+YGN++SACVLFILDEVRK++ K+   TTG+GL+W
Sbjct  308   AILDQVESKLALKPEKLEATRHILSEYGNMSSACVLFILDEVRKRATKKGLKTTGDGLDW  367

Query  1200  GVLFGFGPGLTIDTVVIRSVPIN  1268
             GVLFGFGPGLT++TVV+ SV +N
Sbjct  368   GVLFGFGPGLTVETVVLHSVGLN  390



>dbj|BAM17286.1| chalcone synthase [Petunia x hybrida]
Length=389

 Score =   547 bits (1410),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 259/379 (68%), Positives = 313/379 (83%), Gaps = 0/379 (0%)
 Frame = +3

Query  123   RAKRLEGDAKILAIGTATPANWVDQTTYPDFYFRITNSQHLLEHKEKFRRICNKSKIMKR  302
             +A+R EG A ++AIGTATP N VDQ+TYPD+YFRITNS+H  E KEKF+R+C KS I KR
Sbjct  9     KAQRAEGPATVMAIGTATPTNCVDQSTYPDYYFRITNSEHKTELKEKFKRMCEKSMIKKR  68

Query  303   HLVLTEELLKKHPNLCTYNEASLNTRQDILVSGVPKLGKEAAMKAIKEWGRPISEITHLV  482
             ++ LTEE+LK++P++C Y   SL+ RQDI+V  VPKLGKEAA KAIKEWG+P S+ITHLV
Sbjct  69    YMHLTEEILKENPSMCEYMAPSLDARQDIVVVEVPKLGKEAAQKAIKEWGQPKSKITHLV  128

Query  483   FCTTSGVDMPGADFQLTKLLGLNSSVKRLMMYQQGCNAGAAMLRLAKDLAENNKGARVLV  662
             FCTTSGVDMPG D+QLTKLLGL  SVKRLMMYQQGC AG  +LRLAKDLAENNKGARVLV
Sbjct  129   FCTTSGVDMPGCDYQLTKLLGLRPSVKRLMMYQQGCFAGGTVLRLAKDLAENNKGARVLV  188

Query  663   VCSEVMLSVFRGPSLQQEDNLLAQCLFGDGSAAVIVGTEPRPGLETPLFELVSSAQTIIP  842
             VCSE+    FRGP+    D+L+ Q LFGDG+ A+I+G++P PG+E PLFELVS+AQT++P
Sbjct  189   VCSEITAVTFRGPNDTHLDSLVGQALFGDGAGAIIIGSDPIPGVERPLFELVSAAQTLLP  248

Query  843   DTDSHLKLQLREMGLTFHCSKAVPSLITQNVEDCLVKAFEPFGISDWNSIFWILHPGGNA  1022
             D+   +   LRE+GLTFH  K VP LI++N+E  L +AF+P GISDWNS+FWI HPGG A
Sbjct  249   DSHGAIDGHLREVGLTFHLLKDVPGLISKNIEKSLEEAFKPLGISDWNSLFWIAHPGGPA  308

Query  1023  ILDGVEEKLGLDPEKLRASRDVLSQYGNLTSACVLFILDEVRKKSKKQQQMTTGEGLEWG  1202
             ILD VE KLGL PEKL+A+R+VLS YGN++SACVLFILDE+RK S K+   TTGEGLEWG
Sbjct  309   ILDQVEIKLGLKPEKLKATRNVLSDYGNMSSACVLFILDEMRKASAKEGLGTTGEGLEWG  368

Query  1203  VLFGFGPGLTIDTVVIRSV  1259
             VLFGFGPGLT++TVV+ SV
Sbjct  369   VLFGFGPGLTVETVVLHSV  387



>emb|CAK19318.1| naringenin-chalcone synthase [Humulus lupulus]
Length=389

 Score =   547 bits (1410),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 260/382 (68%), Positives = 313/382 (82%), Gaps = 0/382 (0%)
 Frame = +3

Query  120   HRAKRLEGDAKILAIGTATPANWVDQTTYPDFYFRITNSQHLLEHKEKFRRICNKSKIMK  299
              +A+R EG A ILAIGTATPAN + Q+ YPD+YFRITNS+H  E KEKF+R+C+KS I K
Sbjct  8     RKAQRAEGPATILAIGTATPANCILQSEYPDYYFRITNSEHKTELKEKFKRMCDKSMIRK  67

Query  300   RHLVLTEELLKKHPNLCTYNEASLNTRQDILVSGVPKLGKEAAMKAIKEWGRPISEITHL  479
             R++ LTEE+LK++PNLC Y   SL+ RQD++V  VPKLGKEAA KAIKEWG+P S+ITH+
Sbjct  68    RYMHLTEEILKENPNLCAYEAPSLDARQDMVVVEVPKLGKEAATKAIKEWGQPKSKITHV  127

Query  480   VFCTTSGVDMPGADFQLTKLLGLNSSVKRLMMYQQGCNAGAAMLRLAKDLAENNKGARVL  659
             VFCTTSGVDMPGAD+QLTKLLGL  SVKRLMMYQQGC AG  +LR+AKDLAENNKGARVL
Sbjct  128   VFCTTSGVDMPGADYQLTKLLGLRPSVKRLMMYQQGCFAGGTVLRVAKDLAENNKGARVL  187

Query  660   VVCSEVMLSVFRGPSLQQEDNLLAQCLFGDGSAAVIVGTEPRPGLETPLFELVSSAQTII  839
             VVCSE+    FRGP+    D+L+ Q LFGDGSAA+I+G +P P +E P+FELVS+AQTI+
Sbjct  188   VVCSEITAVTFRGPNDTHLDSLVGQALFGDGSAALIIGADPTPEIEKPIFELVSAAQTIL  247

Query  840   PDTDSHLKLQLREMGLTFHCSKAVPSLITQNVEDCLVKAFEPFGISDWNSIFWILHPGGN  1019
             PD+D  +   LRE+GLTFH  K VP LI++N+E  LV+AF+P GISDWNS+FWI HPGG 
Sbjct  248   PDSDGAIDGHLREVGLTFHLLKDVPGLISKNIEKSLVEAFKPLGISDWNSLFWIAHPGGP  307

Query  1020  AILDGVEEKLGLDPEKLRASRDVLSQYGNLTSACVLFILDEVRKKSKKQQQMTTGEGLEW  1199
             AILD VE KL L PEKLRA+R VL +YGN++SACVLFILDE+R+K  +    TTGEGLEW
Sbjct  308   AILDQVESKLALKPEKLRATRHVLGEYGNMSSACVLFILDEMRRKCAEDGLKTTGEGLEW  367

Query  1200  GVLFGFGPGLTIDTVVIRSVPI  1265
             GVLFGFGPGLT++TVV+ SV I
Sbjct  368   GVLFGFGPGLTVETVVLHSVGI  389



>ref|XP_006446902.1| hypothetical protein CICLE_v10015535mg [Citrus clementina]
 sp|Q9XJ57.1|CHS2_CITSI RecName: Full=Chalcone synthase 2; AltName: Full=Naringenin-chalcone 
synthase 2 [Citrus sinensis]
 dbj|BAA81664.1| chalcone synthase [Citrus sinensis]
 gb|ESR60142.1| hypothetical protein CICLE_v10015535mg [Citrus clementina]
Length=391

 Score =   547 bits (1410),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 256/381 (67%), Positives = 313/381 (82%), Gaps = 0/381 (0%)
 Frame = +3

Query  126   AKRLEGDAKILAIGTATPANWVDQTTYPDFYFRITNSQHLLEHKEKFRRICNKSKIMKRH  305
             A+R +G A +LAIGTATPA+ V+Q  YPD+YFRIT S+H+ E KEKF+R+C+KS I KR+
Sbjct  10    AQRADGPATVLAIGTATPAHSVNQADYPDYYFRITKSEHMTELKEKFKRMCDKSMIKKRY  69

Query  306   LVLTEELLKKHPNLCTYNEASLNTRQDILVSGVPKLGKEAAMKAIKEWGRPISEITHLVF  485
             + LTEE+LK++PN+C Y   SL+ RQDI+V  VPKLGKEAA KAIKEWG+P S+ITHL+F
Sbjct  70    MYLTEEILKENPNMCAYMAPSLDARQDIVVVEVPKLGKEAATKAIKEWGQPKSKITHLIF  129

Query  486   CTTSGVDMPGADFQLTKLLGLNSSVKRLMMYQQGCNAGAAMLRLAKDLAENNKGARVLVV  665
             CTTSGVDMPGAD+QLTKL+GL  SVKR MMYQQGC AG  +LRLAKDLAENNKGARVLVV
Sbjct  130   CTTSGVDMPGADYQLTKLIGLRPSVKRFMMYQQGCFAGGTVLRLAKDLAENNKGARVLVV  189

Query  666   CSEVMLSVFRGPSLQQEDNLLAQCLFGDGSAAVIVGTEPRPGLETPLFELVSSAQTIIPD  845
             CSE+    FRGP+    D+L+ Q LFGDG+AAVIVG +P   +E PL++LVS++QTI+PD
Sbjct  190   CSEITAVTFRGPADTHLDSLVGQALFGDGAAAVIVGADPDTSVERPLYQLVSTSQTILPD  249

Query  846   TDSHLKLQLREMGLTFHCSKAVPSLITQNVEDCLVKAFEPFGISDWNSIFWILHPGGNAI  1025
             +D  +   LRE+GLTFH  K VP LI++N+E  L +AF P GISDWNSIFWI HPGG AI
Sbjct  250   SDGAIDGHLREVGLTFHLLKDVPGLISKNIEKSLSEAFAPLGISDWNSIFWIAHPGGPAI  309

Query  1026  LDGVEEKLGLDPEKLRASRDVLSQYGNLTSACVLFILDEVRKKSKKQQQMTTGEGLEWGV  1205
             LD VE KLGL  EKL+A+R VLS+YGN++SACVLFILDE+RKKS ++ + TTGEGL+WGV
Sbjct  310   LDQVESKLGLKGEKLKATRQVLSEYGNMSSACVLFILDEMRKKSVEEAKATTGEGLDWGV  369

Query  1206  LFGFGPGLTIDTVVIRSVPIN  1268
             LFGFGPGLT++TVV+ SVPI 
Sbjct  370   LFGFGPGLTVETVVLHSVPIK  390



>gb|ACX37403.1| chalcone synthase [Citrus maxima]
Length=391

 Score =   547 bits (1410),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 256/381 (67%), Positives = 313/381 (82%), Gaps = 0/381 (0%)
 Frame = +3

Query  126   AKRLEGDAKILAIGTATPANWVDQTTYPDFYFRITNSQHLLEHKEKFRRICNKSKIMKRH  305
             A+R +G A +LAIGTATPA+ V+Q  YPD+YFRIT S+H+ E KEKF+R+C+KS I KR+
Sbjct  10    AQRADGPATVLAIGTATPAHSVNQADYPDYYFRITKSEHMTELKEKFKRMCDKSMIKKRY  69

Query  306   LVLTEELLKKHPNLCTYNEASLNTRQDILVSGVPKLGKEAAMKAIKEWGRPISEITHLVF  485
             + LTEE+LK++PN+C Y   SL+ RQDI+V  VPKLGKEAA KAIKEWG+P S+ITHL+F
Sbjct  70    MYLTEEILKENPNMCAYMAPSLDARQDIVVVEVPKLGKEAATKAIKEWGQPKSKITHLIF  129

Query  486   CTTSGVDMPGADFQLTKLLGLNSSVKRLMMYQQGCNAGAAMLRLAKDLAENNKGARVLVV  665
             CTTSGVDMPGAD+QLTKLLGL  SVKR MMYQQGC AG  +LRLAKDLAENNKGARVLVV
Sbjct  130   CTTSGVDMPGADYQLTKLLGLRPSVKRFMMYQQGCFAGGTVLRLAKDLAENNKGARVLVV  189

Query  666   CSEVMLSVFRGPSLQQEDNLLAQCLFGDGSAAVIVGTEPRPGLETPLFELVSSAQTIIPD  845
             CSE+    FRGP+    D+L+ Q LFGDG+AAVIVG +P   +E PL++LVS++QTI+PD
Sbjct  190   CSEITAVTFRGPADTHLDSLVGQALFGDGAAAVIVGADPDTSVERPLYQLVSTSQTILPD  249

Query  846   TDSHLKLQLREMGLTFHCSKAVPSLITQNVEDCLVKAFEPFGISDWNSIFWILHPGGNAI  1025
             +D  +   LRE+GLTFH  K VP LI++N+E  L +AF P GISDW+SIFWI HPGG AI
Sbjct  250   SDGAIDGHLREVGLTFHLLKDVPGLISKNIEKSLSEAFAPVGISDWSSIFWIAHPGGPAI  309

Query  1026  LDGVEEKLGLDPEKLRASRDVLSQYGNLTSACVLFILDEVRKKSKKQQQMTTGEGLEWGV  1205
             LD VE KLGL  EKL+A+R VLS+YGN++SACVLFILDE+RKKS ++ + TTGEGL+WGV
Sbjct  310   LDQVESKLGLKEEKLKATRQVLSEYGNMSSACVLFILDEMRKKSAEEAKATTGEGLDWGV  369

Query  1206  LFGFGPGLTIDTVVIRSVPIN  1268
             LFGFGPGLT++TVV+ SVPI 
Sbjct  370   LFGFGPGLTVETVVLHSVPIK  390



>ref|XP_007157050.1| hypothetical protein PHAVU_002G039100g [Phaseolus vulgaris]
 gb|ESW29044.1| hypothetical protein PHAVU_002G039100g [Phaseolus vulgaris]
Length=389

 Score =   547 bits (1409),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 259/382 (68%), Positives = 314/382 (82%), Gaps = 0/382 (0%)
 Frame = +3

Query  120   HRAKRLEGDAKILAIGTATPANWVDQTTYPDFYFRITNSQHLLEHKEKFRRICNKSKIMK  299
              +A+R EG A ILAIGTATP+N VDQ+TYPD+YFRITNS+H+ + KEKF+R+C+KS I K
Sbjct  8     RQAQRAEGPATILAIGTATPSNCVDQSTYPDYYFRITNSEHMTDLKEKFQRMCDKSMIKK  67

Query  300   RHLVLTEELLKKHPNLCTYNEASLNTRQDILVSGVPKLGKEAAMKAIKEWGRPISEITHL  479
             R++ L EE+LK++PN+C Y   SL+ RQDI+V  VPKLGKEAA+KAIKEWG+P S+ITHL
Sbjct  68    RYMHLNEEILKENPNMCAYMAPSLDARQDIVVVEVPKLGKEAAVKAIKEWGQPKSKITHL  127

Query  480   VFCTTSGVDMPGADFQLTKLLGLNSSVKRLMMYQQGCNAGAAMLRLAKDLAENNKGARVL  659
             +FCTTSGVDMPGAD+QLTKLLGL   VKR MMYQQGC AG  +LRLAKDLAENNKGARVL
Sbjct  128   IFCTTSGVDMPGADYQLTKLLGLRPYVKRYMMYQQGCFAGGTVLRLAKDLAENNKGARVL  187

Query  660   VVCSEVMLSVFRGPSLQQEDNLLAQCLFGDGSAAVIVGTEPRPGLETPLFELVSSAQTII  839
             VVCSE+    FRGPS    D+L+ Q LFGDG+AAVIVG++P P +E PLFELV +AQTI 
Sbjct  188   VVCSEITAVTFRGPSDTHLDSLVGQALFGDGAAAVIVGSDPIPQIEKPLFELVWTAQTIA  247

Query  840   PDTDSHLKLQLREMGLTFHCSKAVPSLITQNVEDCLVKAFEPFGISDWNSIFWILHPGGN  1019
             PD+D  +   LRE+GLTFH  K VP ++++N+   L +AF P  ISD+NSIFWI HPGG 
Sbjct  248   PDSDGAIDGHLREVGLTFHLLKDVPGIVSKNIGKALFEAFNPLNISDYNSIFWIAHPGGP  307

Query  1020  AILDGVEEKLGLDPEKLRASRDVLSQYGNLTSACVLFILDEVRKKSKKQQQMTTGEGLEW  1199
             AILD VE+KLGL PEK++A+RDVLS YGN++SACVLFILDE+R+KS ++   TTGEGLEW
Sbjct  308   AILDQVEQKLGLKPEKMKATRDVLSDYGNMSSACVLFILDEMRRKSAEKGLKTTGEGLEW  367

Query  1200  GVLFGFGPGLTIDTVVIRSVPI  1265
             GVLFGFGPGLTI+TVV+ SV I
Sbjct  368   GVLFGFGPGLTIETVVLHSVAI  389



>sp|Q9FSB9.1|CHS1_RUTGR RecName: Full=Chalcone synthase 1; AltName: Full=Naringenin-chalcone 
synthase 1 [Ruta graveolens]
 emb|CAC14059.1| chalcone synthase [Ruta graveolens]
Length=393

 Score =   547 bits (1409),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 256/383 (67%), Positives = 313/383 (82%), Gaps = 0/383 (0%)
 Frame = +3

Query  120   HRAKRLEGDAKILAIGTATPANWVDQTTYPDFYFRITNSQHLLEHKEKFRRICNKSKIMK  299
              +A+R +G A +LAIGTATPAN+V Q  YPD+YFRIT S+H+ E KEKF+R+C+KS I K
Sbjct  10    RKAQRADGPAAVLAIGTATPANYVTQADYPDYYFRITKSEHMTELKEKFKRMCDKSMIRK  69

Query  300   RHLVLTEELLKKHPNLCTYNEASLNTRQDILVSGVPKLGKEAAMKAIKEWGRPISEITHL  479
             R++ LTE++LK++PN+C Y   SL+ RQDI+V  VPKLGKEAA+KAIKEWG+P S+ITHL
Sbjct  70    RYMHLTEDILKENPNMCAYMAPSLDARQDIVVVEVPKLGKEAAVKAIKEWGQPKSKITHL  129

Query  480   VFCTTSGVDMPGADFQLTKLLGLNSSVKRLMMYQQGCNAGAAMLRLAKDLAENNKGARVL  659
             +FCTTSGVDMPG D+QLTKLLGL  SVKR MMYQQGC AG  +LRLAKDLAENN+GARVL
Sbjct  130   IFCTTSGVDMPGCDYQLTKLLGLRPSVKRFMMYQQGCFAGGTVLRLAKDLAENNRGARVL  189

Query  660   VVCSEVMLSVFRGPSLQQEDNLLAQCLFGDGSAAVIVGTEPRPGLETPLFELVSSAQTII  839
             VVCSE+    FRGP+    D+L+ Q LFGDG+AAVIVG +P   +E PL++LVS+AQTI+
Sbjct  190   VVCSEITAVTFRGPADTHLDSLVGQALFGDGAAAVIVGADPDESIERPLYQLVSAAQTIL  249

Query  840   PDTDSHLKLQLREMGLTFHCSKAVPSLITQNVEDCLVKAFEPFGISDWNSIFWILHPGGN  1019
             PD+D  +   LRE+GLTFH  K VP LI++N+E  L +AF P GISDWNSIFWI HPGG 
Sbjct  250   PDSDGAIDGHLREVGLTFHLLKDVPGLISKNIEKSLKEAFGPIGISDWNSIFWIAHPGGP  309

Query  1020  AILDGVEEKLGLDPEKLRASRDVLSQYGNLTSACVLFILDEVRKKSKKQQQMTTGEGLEW  1199
             AILD VE KLGL  EKLRA+R VLS+YGN++SACVLFILDE+RK   ++ + TTGEGL+W
Sbjct  310   AILDQVEAKLGLKEEKLRATRQVLSEYGNMSSACVLFILDEMRKNCAEEGRATTGEGLDW  369

Query  1200  GVLFGFGPGLTIDTVVIRSVPIN  1268
             GVLFGFGPGLT++TVV+RSVPI 
Sbjct  370   GVLFGFGPGLTVETVVLRSVPIK  392



>gb|ACJ54531.1| chalcone synthase [Malus domestica]
Length=389

 Score =   546 bits (1408),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 260/380 (68%), Positives = 310/380 (82%), Gaps = 0/380 (0%)
 Frame = +3

Query  120   HRAKRLEGDAKILAIGTATPANWVDQTTYPDFYFRITNSQHLLEHKEKFRRICNKSKIMK  299
              +A+R EG A + AIGTATP N VDQ TYPD+YFRITNS+H  E KEKF+R+C+KS I K
Sbjct  8     RKAQRAEGPATVFAIGTATPPNCVDQATYPDYYFRITNSEHKAELKEKFQRMCDKSMIKK  67

Query  300   RHLVLTEELLKKHPNLCTYNEASLNTRQDILVSGVPKLGKEAAMKAIKEWGRPISEITHL  479
             R++ LTEE+LK++P++C Y   SL+ RQD++V  VP+LGKEAA KAIKEWG+P S+ITHL
Sbjct  68    RYMYLTEEILKENPSVCEYMAPSLDARQDMVVVEVPRLGKEAATKAIKEWGQPKSKITHL  127

Query  480   VFCTTSGVDMPGADFQLTKLLGLNSSVKRLMMYQQGCNAGAAMLRLAKDLAENNKGARVL  659
             VFCTTSGVDMPGAD+QLTKLLGL  SVKRLMMYQQGC AG  +LRLAKDLAENNKGARVL
Sbjct  128   VFCTTSGVDMPGADYQLTKLLGLRPSVKRLMMYQQGCFAGGTVLRLAKDLAENNKGARVL  187

Query  660   VVCSEVMLSVFRGPSLQQEDNLLAQCLFGDGSAAVIVGTEPRPGLETPLFELVSSAQTII  839
             VVCSE+    FRGPS    D+L+ Q LFGDG+AAVI+G +P P +E PLFELVS+AQTI+
Sbjct  188   VVCSEITAVTFRGPSDTHLDSLVGQALFGDGAAAVIIGADPVPEVEKPLFELVSAAQTIL  247

Query  840   PDTDSHLKLQLREMGLTFHCSKAVPSLITQNVEDCLVKAFEPFGISDWNSIFWILHPGGN  1019
              D+D  +   LRE+GLTFH  K VP LI++N+E  L +AF+P GISDWNS+FWI HPGG 
Sbjct  248   ADSDGAIDGHLREVGLTFHLLKDVPGLISKNIEKSLNEAFKPIGISDWNSLFWIAHPGGP  307

Query  1020  AILDGVEEKLGLDPEKLRASRDVLSQYGNLTSACVLFILDEVRKKSKKQQQMTTGEGLEW  1199
             AILD VE KL L PEKL A+R VLS YGN++SACVLFILDEVR+KS ++   TTGEGLEW
Sbjct  308   AILDQVEAKLALKPEKLEATRQVLSDYGNMSSACVLFILDEVRRKSAEKGLETTGEGLEW  367

Query  1200  GVLFGFGPGLTIDTVVIRSV  1259
             GVLFGFGPGLT++TVV+ SV
Sbjct  368   GVLFGFGPGLTVETVVLHSV  387



>gb|AAN76184.1| chalcone synthase [Hydrangea macrophylla]
Length=389

 Score =   546 bits (1408),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 259/380 (68%), Positives = 311/380 (82%), Gaps = 0/380 (0%)
 Frame = +3

Query  120   HRAKRLEGDAKILAIGTATPANWVDQTTYPDFYFRITNSQHLLEHKEKFRRICNKSKIMK  299
              +A+R EG A ILAIGTATP N+VDQ+TYPDFYFR+TNS+H  E K KF+R+CN S+I K
Sbjct  8     RKAQRAEGPATILAIGTATPPNYVDQSTYPDFYFRVTNSEHKKELKAKFQRMCNNSQIKK  67

Query  300   RHLVLTEELLKKHPNLCTYNEASLNTRQDILVSGVPKLGKEAAMKAIKEWGRPISEITHL  479
              ++ LTEE+LK +PN+C Y   SL+ RQD++V  +PKLGKEAA +AIKEWG+P S+ITHL
Sbjct  68    CYMHLTEEILKLNPNICAYMVPSLDARQDMVVVEIPKLGKEAATRAIKEWGQPKSKITHL  127

Query  480   VFCTTSGVDMPGADFQLTKLLGLNSSVKRLMMYQQGCNAGAAMLRLAKDLAENNKGARVL  659
             VFCTTSGVDMPGAD+QLTKLLGL  SVKRLMMYQQGC AG  +LRLAKDLAENNKGARVL
Sbjct  128   VFCTTSGVDMPGADYQLTKLLGLRPSVKRLMMYQQGCFAGGTVLRLAKDLAENNKGARVL  187

Query  660   VVCSEVMLSVFRGPSLQQEDNLLAQCLFGDGSAAVIVGTEPRPGLETPLFELVSSAQTII  839
             VVCSE+    FRGPS    D+L+ Q LFGDG+ AVI+G++P P +E PLFE+VS+AQTI+
Sbjct  188   VVCSEITAVTFRGPSDTHLDSLVGQALFGDGARAVIIGSDPMPEVEKPLFEIVSAAQTIL  247

Query  840   PDTDSHLKLQLREMGLTFHCSKAVPSLITQNVEDCLVKAFEPFGISDWNSIFWILHPGGN  1019
             PD+D  +   LRE+GLTFH  K VP LI++N+E  LV+AF P  ISDWNSIFWI HPGG 
Sbjct  248   PDSDGAIDGHLREVGLTFHLLKDVPGLISKNIEKSLVEAFRPLDISDWNSIFWIAHPGGP  307

Query  1020  AILDGVEEKLGLDPEKLRASRDVLSQYGNLTSACVLFILDEVRKKSKKQQQMTTGEGLEW  1199
             AILD VE+KL L PEKLRA+R+VLS YGN++SACVLFI+DE+RK S  +  MTTGEGLEW
Sbjct  308   AILDQVEKKLALKPEKLRATRNVLSDYGNMSSACVLFIMDEMRKNSVYEGLMTTGEGLEW  367

Query  1200  GVLFGFGPGLTIDTVVIRSV  1259
             GVLFGFGPGLT++TVV+  V
Sbjct  368   GVLFGFGPGLTVETVVLHGV  387



>gb|ABP57071.1| chalcone synthase [Solenostemon scutellarioides]
 gb|ABP57072.1| chalcone synthase [Solenostemon scutellarioides]
Length=390

 Score =   546 bits (1408),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 259/383 (68%), Positives = 313/383 (82%), Gaps = 0/383 (0%)
 Frame = +3

Query  120   HRAKRLEGDAKILAIGTATPANWVDQTTYPDFYFRITNSQHLLEHKEKFRRICNKSKIMK  299
              RA+R EG A +LAIGT+TP+N VDQ+TYPD+YFRITNS+H  + KEKF+R+C KS I K
Sbjct  8     RRAQRAEGPATVLAIGTSTPSNCVDQSTYPDYYFRITNSEHKTDLKEKFKRMCEKSMIRK  67

Query  300   RHLVLTEELLKKHPNLCTYNEASLNTRQDILVSGVPKLGKEAAMKAIKEWGRPISEITHL  479
             R++ LTEE LK++PN+  Y   SL+ RQDI+V  VPKLGKEAA KAIKEWG+P S+ITHL
Sbjct  68    RYMHLTEEFLKENPNMTAYMAPSLDARQDIVVVEVPKLGKEAAQKAIKEWGQPKSKITHL  127

Query  480   VFCTTSGVDMPGADFQLTKLLGLNSSVKRLMMYQQGCNAGAAMLRLAKDLAENNKGARVL  659
             VFCTTSGVDMPGAD+QLTKLLGL  SVKR MMYQQGC AG  +LR+AKDLAENN GARVL
Sbjct  128   VFCTTSGVDMPGADYQLTKLLGLRPSVKRFMMYQQGCFAGGTVLRMAKDLAENNAGARVL  187

Query  660   VVCSEVMLSVFRGPSLQQEDNLLAQCLFGDGSAAVIVGTEPRPGLETPLFELVSSAQTII  839
             VVCSE+    FRGPS    D+L+ Q LFGDG+AAVIVG++P  G+E PLF+LVS+AQTI+
Sbjct  188   VVCSEITAVTFRGPSDSHLDSLVGQALFGDGAAAVIVGSDPVVGVERPLFQLVSAAQTIL  247

Query  840   PDTDSHLKLQLREMGLTFHCSKAVPSLITQNVEDCLVKAFEPFGISDWNSIFWILHPGGN  1019
             PD+D  +   LRE+GLTFH  K VP LI++N+E  L +AF P GI+DWNS+FWI HPGG 
Sbjct  248   PDSDGAIDGHLREVGLTFHLLKDVPGLISKNIEKSLKEAFGPLGITDWNSVFWIAHPGGP  307

Query  1020  AILDGVEEKLGLDPEKLRASRDVLSQYGNLTSACVLFILDEVRKKSKKQQQMTTGEGLEW  1199
             AILD VE KL L PEKLR++R VLS+YGN++SACVLFILDE+RK S K+   +TGEGL+W
Sbjct  308   AILDQVEAKLRLTPEKLRSTRHVLSEYGNMSSACVLFILDEMRKTSAKEGLNSTGEGLDW  367

Query  1200  GVLFGFGPGLTIDTVVIRSVPIN  1268
             GVLFGFGPGLT++TVV+ SVP+N
Sbjct  368   GVLFGFGPGLTVETVVLHSVPLN  390



>emb|CAK19319.1| naringenin-chalcone synthase [Humulus lupulus]
Length=389

 Score =   546 bits (1407),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 260/382 (68%), Positives = 313/382 (82%), Gaps = 0/382 (0%)
 Frame = +3

Query  120   HRAKRLEGDAKILAIGTATPANWVDQTTYPDFYFRITNSQHLLEHKEKFRRICNKSKIMK  299
              +A+R EG A ILAIGTATPAN + Q+ YPD+YFRITNS+H  E KEKF+R+C+KS I K
Sbjct  8     RKAQRAEGPATILAIGTATPANCILQSEYPDYYFRITNSEHKTELKEKFKRMCDKSMIRK  67

Query  300   RHLVLTEELLKKHPNLCTYNEASLNTRQDILVSGVPKLGKEAAMKAIKEWGRPISEITHL  479
             R++ LTEE+LK++PNLC Y   SL+ RQD++V  VPKLGKEAA KAIKEWG+P S+ITH+
Sbjct  68    RYMHLTEEILKENPNLCAYEAPSLDARQDMVVVEVPKLGKEAATKAIKEWGQPKSKITHV  127

Query  480   VFCTTSGVDMPGADFQLTKLLGLNSSVKRLMMYQQGCNAGAAMLRLAKDLAENNKGARVL  659
             VFCTTSGVDMPGAD+QLTKLLGL  SVKRLMMYQQGC AG  +LR+AKDLAENNKGARVL
Sbjct  128   VFCTTSGVDMPGADYQLTKLLGLRPSVKRLMMYQQGCFAGGTVLRVAKDLAENNKGARVL  187

Query  660   VVCSEVMLSVFRGPSLQQEDNLLAQCLFGDGSAAVIVGTEPRPGLETPLFELVSSAQTII  839
             VVCSE+    FRGP+    D+L+ Q LFGDGSAA+I+G +P P +E P+FELVS+AQTI+
Sbjct  188   VVCSEITAVTFRGPNDTHLDSLVGQALFGDGSAALIIGADPIPEIEKPIFELVSAAQTIL  247

Query  840   PDTDSHLKLQLREMGLTFHCSKAVPSLITQNVEDCLVKAFEPFGISDWNSIFWILHPGGN  1019
             PD+D  +   LRE+GLTFH  K VP LI++N+E  LV+AF+P GISDWNS+FWI HPGG 
Sbjct  248   PDSDGAIDGHLREVGLTFHLLKDVPGLISKNIEKSLVEAFKPLGISDWNSLFWIAHPGGP  307

Query  1020  AILDGVEEKLGLDPEKLRASRDVLSQYGNLTSACVLFILDEVRKKSKKQQQMTTGEGLEW  1199
             AILD VE KL L PEKLRA+R VL +YGN++SACVLFILDE+R+K  +    TTGEGLEW
Sbjct  308   AILDQVESKLALKPEKLRATRHVLGEYGNMSSACVLFILDEMRRKCAEDGLKTTGEGLEW  367

Query  1200  GVLFGFGPGLTIDTVVIRSVPI  1265
             GVLFGFGPGLT++TVV+ SV I
Sbjct  368   GVLFGFGPGLTVETVVLHSVGI  389



>dbj|BAA31259.1| chalcone synthase [Vitis vinifera]
Length=393

 Score =   546 bits (1408),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 260/379 (69%), Positives = 313/379 (83%), Gaps = 0/379 (0%)
 Frame = +3

Query  123   RAKRLEGDAKILAIGTATPANWVDQTTYPDFYFRITNSQHLLEHKEKFRRICNKSKIMKR  302
             +A+R EG A +LAIGTATPAN V Q  YPD+YFRITNS+H+ E KEKF+R+C KS I KR
Sbjct  9     KAQRAEGPATVLAIGTATPANCVYQADYPDYYFRITNSEHMTELKEKFKRMCEKSMINKR  68

Query  303   HLVLTEELLKKHPNLCTYNEASLNTRQDILVSGVPKLGKEAAMKAIKEWGRPISEITHLV  482
             ++ LTEE+LK++PN+C Y   SL+ RQD++V  VPKLGKEAA+KAIKEWG+P S+ITHLV
Sbjct  69    YMHLTEEILKENPNVCAYMAPSLDARQDMVVVEVPKLGKEAAVKAIKEWGQPKSKITHLV  128

Query  483   FCTTSGVDMPGADFQLTKLLGLNSSVKRLMMYQQGCNAGAAMLRLAKDLAENNKGARVLV  662
             FCTTSGVDMPGAD+QLTKLLGL  SVKRLMMYQQGC AG  +LRLAKDLAENN G+RVLV
Sbjct  129   FCTTSGVDMPGADYQLTKLLGLKPSVKRLMMYQQGCFAGGTVLRLAKDLAENNAGSRVLV  188

Query  663   VCSEVMLSVFRGPSLQQEDNLLAQCLFGDGSAAVIVGTEPRPGLETPLFELVSSAQTIIP  842
             VCSE+    FRGPS    D+L+ Q LFGDG+AAVI+G +P   +E PLFELVS+AQTI+P
Sbjct  189   VCSEITAVTFRGPSDTHLDSLVGQALFGDGAAAVIIGADPDTKIERPLFELVSAAQTILP  248

Query  843   DTDSHLKLQLREMGLTFHCSKAVPSLITQNVEDCLVKAFEPFGISDWNSIFWILHPGGNA  1022
             D++  +   LRE+GLTFH  K VP LI++N+E  LV+AF P GISDWNS+FWI HPGG A
Sbjct  249   DSEGAIDGHLREVGLTFHLLKDVPGLISKNIEKSLVEAFTPIGISDWNSLFWIAHPGGPA  308

Query  1023  ILDGVEEKLGLDPEKLRASRDVLSQYGNLTSACVLFILDEVRKKSKKQQQMTTGEGLEWG  1202
             ILD VE KLGL  EKLRA+R VLS+YGN++SACVLFILDE+RKKS ++ + +TGEGLEWG
Sbjct  309   ILDQVELKLGLKEEKLRATRHVLSEYGNMSSACVLFILDEMRKKSIEEGKASTGEGLEWG  368

Query  1203  VLFGFGPGLTIDTVVIRSV  1259
             VLFGFGPGLT++TVV+ SV
Sbjct  369   VLFGFGPGLTVETVVLHSV  387



>ref|XP_004306542.1| PREDICTED: chalcone synthase 2-like [Fragaria vesca subsp. vesca]
Length=389

 Score =   546 bits (1407),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 256/379 (68%), Positives = 312/379 (82%), Gaps = 0/379 (0%)
 Frame = +3

Query  123   RAKRLEGDAKILAIGTATPANWVDQTTYPDFYFRITNSQHLLEHKEKFRRICNKSKIMKR  302
             +A+R EG A +LAIGTATP N +DQ+TYPD+YFRITNS+H  E KEKF+R+C+KS I KR
Sbjct  9     KAQRAEGPATVLAIGTATPPNCIDQSTYPDYYFRITNSEHKAELKEKFQRMCDKSMIKKR  68

Query  303   HLVLTEELLKKHPNLCTYNEASLNTRQDILVSGVPKLGKEAAMKAIKEWGRPISEITHLV  482
             ++ LTEE+LK++P++C Y   SL+ RQD++V  +PKLGK+AA+KAIKEWG+P S ITHLV
Sbjct  69    YMYLTEEILKENPSMCEYMAPSLDARQDMVVVEIPKLGKDAAVKAIKEWGQPKSRITHLV  128

Query  483   FCTTSGVDMPGADFQLTKLLGLNSSVKRLMMYQQGCNAGAAMLRLAKDLAENNKGARVLV  662
             FCTTSGVDMPGAD+QLTKLLGL  SVKRLMMYQQGC AG  +LRLAKDLAENN+GARVLV
Sbjct  129   FCTTSGVDMPGADYQLTKLLGLRPSVKRLMMYQQGCFAGGTVLRLAKDLAENNRGARVLV  188

Query  663   VCSEVMLSVFRGPSLQQEDNLLAQCLFGDGSAAVIVGTEPRPGLETPLFELVSSAQTIIP  842
             VCSE+    FRGPS    D+L+ Q LFGDG+AA+IVG++P P +E PLFELVS+AQTI+P
Sbjct  189   VCSEITAVTFRGPSDTHLDSLVGQALFGDGAAAIIVGSDPLPEVERPLFELVSAAQTILP  248

Query  843   DTDSHLKLQLREMGLTFHCSKAVPSLITQNVEDCLVKAFEPFGISDWNSIFWILHPGGNA  1022
             D+D  +   LRE+GLTFH  K VP LI++N+E  L +AF+P  I+DWNS+FWI HPGG A
Sbjct  249   DSDGAIDGHLREVGLTFHLLKDVPGLISKNIEKSLNEAFKPLNITDWNSLFWIAHPGGPA  308

Query  1023  ILDGVEEKLGLDPEKLRASRDVLSQYGNLTSACVLFILDEVRKKSKKQQQMTTGEGLEWG  1202
             ILD VE KL L PEKL A+R +LS+YGN++SACVLFILDEVR+KS      TTGEGLEWG
Sbjct  309   ILDQVEAKLALKPEKLEATRHILSEYGNMSSACVLFILDEVRRKSAANGHKTTGEGLEWG  368

Query  1203  VLFGFGPGLTIDTVVIRSV  1259
             VLFGFGPGLT++TVV+ SV
Sbjct  369   VLFGFGPGLTVETVVLHSV  387



>gb|ABN80439.1| chalcone synthase [Nicotiana benthamiana]
Length=389

 Score =   546 bits (1407),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 258/380 (68%), Positives = 314/380 (83%), Gaps = 0/380 (0%)
 Frame = +3

Query  120   HRAKRLEGDAKILAIGTATPANWVDQTTYPDFYFRITNSQHLLEHKEKFRRICNKSKIMK  299
              RA+R EG A ++AIGTATP N VDQ+TYPD+YFRITNS+H  E KEKF+R+C KS I K
Sbjct  8     RRAQRAEGPATVMAIGTATPFNCVDQSTYPDYYFRITNSEHKTELKEKFKRMCEKSMIKK  67

Query  300   RHLVLTEELLKKHPNLCTYNEASLNTRQDILVSGVPKLGKEAAMKAIKEWGRPISEITHL  479
             R++ LTEE+LK++PN+C Y   SL+ RQDI+V  VPKLGKEAA KAIKEWG+P S+ITHL
Sbjct  68    RYMHLTEEILKENPNICAYMAPSLDARQDIVVVEVPKLGKEAAQKAIKEWGQPKSKITHL  127

Query  480   VFCTTSGVDMPGADFQLTKLLGLNSSVKRLMMYQQGCNAGAAMLRLAKDLAENNKGARVL  659
             VFCTTSGVDMPG D+QLTKLLGL  SVKR MMYQQGC AG  +LR+AKDLAENNKGARVL
Sbjct  128   VFCTTSGVDMPGCDYQLTKLLGLRPSVKRFMMYQQGCFAGGTVLRMAKDLAENNKGARVL  187

Query  660   VVCSEVMLSVFRGPSLQQEDNLLAQCLFGDGSAAVIVGTEPRPGLETPLFELVSSAQTII  839
             VVCSE+    FRGP+    D+L+ Q LFGDG+AAVI+G++P P +E PLF+LVS+AQT++
Sbjct  188   VVCSEITAVTFRGPNDTHLDSLVGQALFGDGAAAVIIGSDPIPEVERPLFQLVSAAQTLL  247

Query  840   PDTDSHLKLQLREMGLTFHCSKAVPSLITQNVEDCLVKAFEPFGISDWNSIFWILHPGGN  1019
             PD++  +   LRE+GLTFH  K VP LI++N+E  LV+AF+P GISDWNS+FWI HPGG 
Sbjct  248   PDSEGAIDGHLREVGLTFHLLKDVPGLISKNIEKSLVEAFQPLGISDWNSLFWIAHPGGP  307

Query  1020  AILDGVEEKLGLDPEKLRASRDVLSQYGNLTSACVLFILDEVRKKSKKQQQMTTGEGLEW  1199
             AILD VE KLGL+ EKL+A+R+VL+ YGN++SACVLFILDE+RK S K+   TTGEGLEW
Sbjct  308   AILDQVELKLGLNQEKLKATRNVLTNYGNMSSACVLFILDEMRKASAKEGLGTTGEGLEW  367

Query  1200  GVLFGFGPGLTIDTVVIRSV  1259
             GVLFGFGPGLT++TVV+ SV
Sbjct  368   GVLFGFGPGLTVETVVLHSV  387



>gb|AHL83549.1| chalcone synthase [Morus alba var. multicaulis]
Length=393

 Score =   546 bits (1407),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 257/380 (68%), Positives = 310/380 (82%), Gaps = 0/380 (0%)
 Frame = +3

Query  123   RAKRLEGDAKILAIGTATPANWVDQTTYPDFYFRITNSQHLLEHKEKFRRICNKSKIMKR  302
             +A+R EG A +L+IGTATP N+V Q  YPD+YFRITNS H+ + K+KF+R+C KS I KR
Sbjct  12    KAQRSEGPATVLSIGTATPTNFVPQADYPDYYFRITNSDHMTDLKDKFKRMCEKSMITKR  71

Query  303   HLVLTEELLKKHPNLCTYNEASLNTRQDILVSGVPKLGKEAAMKAIKEWGRPISEITHLV  482
             H+ LTEE+LK++P +C Y   SL+ RQDI+V  VPKLGKEAA KAIKEWG+P S+ITHL+
Sbjct  72    HMYLTEEILKENPKMCEYMAPSLDARQDIVVVEVPKLGKEAAAKAIKEWGQPKSKITHLI  131

Query  483   FCTTSGVDMPGADFQLTKLLGLNSSVKRLMMYQQGCNAGAAMLRLAKDLAENNKGARVLV  662
             FCTTSGVDMPGAD+QLTKLLGL  SVKR MMYQQGC AG  +LRLAKDLAENNKGARVLV
Sbjct  132   FCTTSGVDMPGADYQLTKLLGLRPSVKRFMMYQQGCFAGGTVLRLAKDLAENNKGARVLV  191

Query  663   VCSEVMLSVFRGPSLQQEDNLLAQCLFGDGSAAVIVGTEPRPGLETPLFELVSSAQTIIP  842
             VCSE+    FRGPS    D+L+ Q LFGDG+AAVI+G +P   +E P+FELVS+AQTI+P
Sbjct  192   VCSEITAVTFRGPSHTHLDSLVGQALFGDGAAAVILGADPDTSVERPIFELVSAAQTILP  251

Query  843   DTDSHLKLQLREMGLTFHCSKAVPSLITQNVEDCLVKAFEPFGISDWNSIFWILHPGGNA  1022
             D++  +   LRE+GLTFH  K VP LI++N+E  LV+AF P GISDWNSIFWI HPGG A
Sbjct  252   DSEGAIDGHLREVGLTFHLLKDVPGLISKNIEKSLVEAFTPIGISDWNSIFWIAHPGGPA  311

Query  1023  ILDGVEEKLGLDPEKLRASRDVLSQYGNLTSACVLFILDEVRKKSKKQQQMTTGEGLEWG  1202
             ILD VE KLGL  EKL A+R VLS+YGN++SACVLFILDEVRKKS ++ + TTGEGLEWG
Sbjct  312   ILDQVEAKLGLKQEKLSATRHVLSEYGNMSSACVLFILDEVRKKSVEEGKATTGEGLEWG  371

Query  1203  VLFGFGPGLTIDTVVIRSVP  1262
             VLFGFGPGLT++T+V+ S+P
Sbjct  372   VLFGFGPGLTVETIVLHSLP  391



>gb|AAK39111.1|AF358655_1 chalcone synthase [Ipomoea purpurea]
 gb|AAK39115.1|AF358659_1 chalcone synthase [Ipomoea purpurea]
 dbj|BAA20387.1| chalcone synthase [Ipomoea purpurea]
 dbj|BAA36224.1| chalcone synthase [Ipomoea purpurea]
Length=388

 Score =   546 bits (1407),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 259/380 (68%), Positives = 313/380 (82%), Gaps = 1/380 (0%)
 Frame = +3

Query  123   RAKRLEGDAKILAIGTATPANWVDQTTYPDFYFRITNSQHLLEHKEKFRRICNKSKIMKR  302
             +A+R EG A ILAIGTATPAN VDQ+TYPD+YFRIT S H+ + K+KF+R+C+KS I KR
Sbjct  9     KAQRAEGPATILAIGTATPANCVDQSTYPDYYFRITKSDHMTDLKQKFQRMCDKSMITKR  68

Query  303   HLVLTEELLKKHPNLCTYNEASLNTRQDILVSGVPKLGKEAAMKAIKEWGRPISEITHLV  482
             ++ LTEE+LK++P+ C Y   SL+ RQDI+V  VPKLGKEAA  AIKEWG+P S+ITH++
Sbjct  69    YMHLTEEILKENPSFCEYMAPSLDARQDIVVVEVPKLGKEAAQSAIKEWGQPKSKITHVI  128

Query  483   FCTTSGVDMPGADFQLTKLLGLNSSVKRLMMYQQGCNAGAAMLRLAKDLAENNKGARVLV  662
             FCTTSGVDMPGAD+QLTKLLGL  SVKRLMMYQQGC AG  +LR+AKDLAENNKGARVLV
Sbjct  129   FCTTSGVDMPGADYQLTKLLGLRPSVKRLMMYQQGCFAGGTVLRVAKDLAENNKGARVLV  188

Query  663   VCSEVMLSVFRGPSLQQEDNLLAQCLFGDGSAAVIVGTEPRPGLETPLFELVSSAQTIIP  842
             VCSE+ +  FRGP+    D+L+ Q LFGDG+AA+IVG++P P +E PLF+LVS+AQT+ P
Sbjct  189   VCSEITVVTFRGPNETHLDSLVGQALFGDGAAAIIVGSDPTP-VEKPLFQLVSAAQTLAP  247

Query  843   DTDSHLKLQLREMGLTFHCSKAVPSLITQNVEDCLVKAFEPFGISDWNSIFWILHPGGNA  1022
             D+   +   LRE+GLTFH  K VPS+++ N+E CL +AF P GISDWNSIFWI HPGG A
Sbjct  248   DSCGAIDGHLREVGLTFHLLKDVPSIVSNNIEKCLSEAFNPLGISDWNSIFWIAHPGGPA  307

Query  1023  ILDGVEEKLGLDPEKLRASRDVLSQYGNLTSACVLFILDEVRKKSKKQQQMTTGEGLEWG  1202
             ILD VE+KLGL PEKLRA+R VLS+YGN++SACVLFILDE+RK S      TTGEGLEWG
Sbjct  308   ILDQVEDKLGLKPEKLRATRHVLSEYGNMSSACVLFILDEMRKASSNDGLGTTGEGLEWG  367

Query  1203  VLFGFGPGLTIDTVVIRSVP  1262
             VLFGFGPGLTI+TVV+ SVP
Sbjct  368   VLFGFGPGLTIETVVLHSVP  387



>ref|XP_010249317.1| PREDICTED: chalcone synthase [Nelumbo nucifera]
Length=393

 Score =   546 bits (1407),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 260/379 (69%), Positives = 311/379 (82%), Gaps = 0/379 (0%)
 Frame = +3

Query  126   AKRLEGDAKILAIGTATPANWVDQTTYPDFYFRITNSQHLLEHKEKFRRICNKSKIMKRH  305
             A+R +G A +LAIGTATPAN V Q  YPD+YFRITNS+H  E KEKF+R+C KS I KR+
Sbjct  10    AQRAQGPATVLAIGTATPANCVYQADYPDYYFRITNSEHKTELKEKFKRMCEKSMIKKRY  69

Query  306   LVLTEELLKKHPNLCTYNEASLNTRQDILVSGVPKLGKEAAMKAIKEWGRPISEITHLVF  485
             + LTEE+LK++PN+C Y   SL+ RQD++V  VPKLGKEAA KAIKEWG+P S+ITHLVF
Sbjct  70    MHLTEEILKENPNICAYMAPSLDARQDMVVVEVPKLGKEAASKAIKEWGQPKSKITHLVF  129

Query  486   CTTSGVDMPGADFQLTKLLGLNSSVKRLMMYQQGCNAGAAMLRLAKDLAENNKGARVLVV  665
             CTTSGVDMPGAD+QLTKLLGL  SVKR MMYQQGC AG  +LRLAKDLAENN GARVLVV
Sbjct  130   CTTSGVDMPGADYQLTKLLGLRPSVKRFMMYQQGCFAGGTVLRLAKDLAENNAGARVLVV  189

Query  666   CSEVMLSVFRGPSLQQEDNLLAQCLFGDGSAAVIVGTEPRPGLETPLFELVSSAQTIIPD  845
             CSE+    FRGPS    D+L+ Q LFGDG+AAVIVG +P   +E PLF+LVS+AQTI+PD
Sbjct  190   CSEITAVTFRGPSDTHLDSLVGQALFGDGAAAVIVGADPDTSIERPLFQLVSAAQTILPD  249

Query  846   TDSHLKLQLREMGLTFHCSKAVPSLITQNVEDCLVKAFEPFGISDWNSIFWILHPGGNAI  1025
             +   +   LRE+GLTFH  K VP LI++N+E  LV+AF P G+SDWNS+FWI HPGG AI
Sbjct  250   SHGAIDGHLREVGLTFHLLKDVPGLISKNIEKSLVEAFTPIGVSDWNSLFWIAHPGGPAI  309

Query  1026  LDGVEEKLGLDPEKLRASRDVLSQYGNLTSACVLFILDEVRKKSKKQQQMTTGEGLEWGV  1205
             LD VEEKLGL  EKLRA+R+VLS+YGN++SACVLFILDE+RKKS ++ + TTGEGLEWGV
Sbjct  310   LDQVEEKLGLKEEKLRATRNVLSEYGNMSSACVLFILDEMRKKSVEEGRATTGEGLEWGV  369

Query  1206  LFGFGPGLTIDTVVIRSVP  1262
             LFGFGPGLT++TVV+ S+P
Sbjct  370   LFGFGPGLTVETVVLHSLP  388



>dbj|BAO58433.1| chalcone synthase [Vaccinium ashei]
Length=389

 Score =   546 bits (1406),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 260/380 (68%), Positives = 311/380 (82%), Gaps = 0/380 (0%)
 Frame = +3

Query  120   HRAKRLEGDAKILAIGTATPANWVDQTTYPDFYFRITNSQHLLEHKEKFRRICNKSKIMK  299
              +A+R  G A ++AIGTATP N VDQ+TYPDFYFRITNS+H  E KEKF+R+C+KS I K
Sbjct  8     RKAQRAAGPATVMAIGTATPPNCVDQSTYPDFYFRITNSEHKTELKEKFQRMCDKSMIKK  67

Query  300   RHLVLTEELLKKHPNLCTYNEASLNTRQDILVSGVPKLGKEAAMKAIKEWGRPISEITHL  479
             R++ L EE+LK++P +C Y   SL+ RQD++V  VPKLGKEAA KAIKEWG+P S+ITHL
Sbjct  68    RYMYLNEEILKENPGVCEYMAPSLDARQDMVVVEVPKLGKEAATKAIKEWGQPKSKITHL  127

Query  480   VFCTTSGVDMPGADFQLTKLLGLNSSVKRLMMYQQGCNAGAAMLRLAKDLAENNKGARVL  659
             VFCTTSGVDMPGAD+QLTKLLGL  SVKRLMMYQQGC AG  +LRLAKDLAENNKGARVL
Sbjct  128   VFCTTSGVDMPGADYQLTKLLGLRPSVKRLMMYQQGCFAGGTVLRLAKDLAENNKGARVL  187

Query  660   VVCSEVMLSVFRGPSLQQEDNLLAQCLFGDGSAAVIVGTEPRPGLETPLFELVSSAQTII  839
             VVCSE+    FRGPS    D+L+ Q LFGDG+AA+IVG +P P +E PLFELVS+AQTI+
Sbjct  188   VVCSEITAVTFRGPSDTHLDSLVGQALFGDGAAAIIVGADPIPEVEKPLFELVSAAQTIL  247

Query  840   PDTDSHLKLQLREMGLTFHCSKAVPSLITQNVEDCLVKAFEPFGISDWNSIFWILHPGGN  1019
             PD++  +   LRE+GLTFH  K VP LI++N+E  L +AF+P GISDWNSIFWI HPGG 
Sbjct  248   PDSEGAIDGHLREVGLTFHLLKDVPGLISKNIEKALTEAFQPLGISDWNSIFWIAHPGGP  307

Query  1020  AILDGVEEKLGLDPEKLRASRDVLSQYGNLTSACVLFILDEVRKKSKKQQQMTTGEGLEW  1199
             AILD VE K  L PEKLRA+R VLS+YGN++SACVLFILDE+RKKS ++   TTGEGLEW
Sbjct  308   AILDQVELKCNLKPEKLRATRHVLSEYGNMSSACVLFILDEMRKKSAEEGLKTTGEGLEW  367

Query  1200  GVLFGFGPGLTIDTVVIRSV  1259
             GVLFGFGPGLT++TVV+ S+
Sbjct  368   GVLFGFGPGLTVETVVLHSL  387



>gb|ADZ45300.1| chalcone synthase 1 [Caragana arborescens]
Length=389

 Score =   546 bits (1406),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 256/382 (67%), Positives = 317/382 (83%), Gaps = 0/382 (0%)
 Frame = +3

Query  120   HRAKRLEGDAKILAIGTATPANWVDQTTYPDFYFRITNSQHLLEHKEKFRRICNKSKIMK  299
              +A+R EG A I AIGTA PA+ V+Q+TYPD+YFRITNS+H  E KEKF+RICNKS I +
Sbjct  8     RKAQRAEGPATIFAIGTANPADCVEQSTYPDYYFRITNSEHKTELKEKFQRICNKSMIKR  67

Query  300   RHLVLTEELLKKHPNLCTYNEASLNTRQDILVSGVPKLGKEAAMKAIKEWGRPISEITHL  479
             R++ LTEE+LK++PN+C YN  SL+ RQD++V  VP+LGKEAA+KAIKEWG+P S+ITHL
Sbjct  68    RYMYLTEEILKENPNVCAYNAPSLDARQDMVVVEVPRLGKEAAVKAIKEWGQPKSKITHL  127

Query  480   VFCTTSGVDMPGADFQLTKLLGLNSSVKRLMMYQQGCNAGAAMLRLAKDLAENNKGARVL  659
             +FCTTSGVDMPGAD+QLTKLLGL   VKR MMYQQGC AG  +LRLAKDLAENNKGARVL
Sbjct  128   IFCTTSGVDMPGADYQLTKLLGLRPYVKRYMMYQQGCFAGGTVLRLAKDLAENNKGARVL  187

Query  660   VVCSEVMLSVFRGPSLQQEDNLLAQCLFGDGSAAVIVGTEPRPGLETPLFELVSSAQTII  839
             VVCSEV    FRGPS    D+L+ Q LFGDG+AAVIVG++P P +E P+FELV +AQTI 
Sbjct  188   VVCSEVTAVTFRGPSETHLDSLVGQALFGDGAAAVIVGSDPVPEIEKPIFELVWTAQTIA  247

Query  840   PDTDSHLKLQLREMGLTFHCSKAVPSLITQNVEDCLVKAFEPFGISDWNSIFWILHPGGN  1019
             P+++  +   LRE+GLTFH  K VP ++++NV+  LV+AF+P GISD+NSIF I HPGG 
Sbjct  248   PNSEGAIDGHLREVGLTFHLLKDVPGIVSKNVDKALVEAFQPLGISDYNSIFXIAHPGGA  307

Query  1020  AILDGVEEKLGLDPEKLRASRDVLSQYGNLTSACVLFILDEVRKKSKKQQQMTTGEGLEW  1199
             AI+D VE+KL L PEK+RA+R+VLS+YGN++SACVLFILDE+R+KS ++   TTGEGL+W
Sbjct  308   AIIDQVEQKLDLKPEKMRATREVLSEYGNMSSACVLFILDEMRRKSSQEGLKTTGEGLDW  367

Query  1200  GVLFGFGPGLTIDTVVIRSVPI  1265
             GVLFGFGPGLTI+TVV+RSV I
Sbjct  368   GVLFGFGPGLTIETVVLRSVAI  389



>gb|ABM66532.1| chalcone synthase [Glycyrrhiza uralensis]
Length=389

 Score =   546 bits (1406),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 256/382 (67%), Positives = 314/382 (82%), Gaps = 0/382 (0%)
 Frame = +3

Query  120   HRAKRLEGDAKILAIGTATPANWVDQTTYPDFYFRITNSQHLLEHKEKFRRICNKSKIMK  299
              +A+R EG A ILAIGTA P N VDQ+TYPDFYF+ITNS+H  E KEKF+R+C+KS I K
Sbjct  8     RKAQRAEGPANILAIGTANPPNCVDQSTYPDFYFKITNSEHKTELKEKFQRMCDKSMIKK  67

Query  300   RHLVLTEELLKKHPNLCTYNEASLNTRQDILVSGVPKLGKEAAMKAIKEWGRPISEITHL  479
             R++ LTEE+LK++PN+C Y   SL+ RQD++V  VP+LGKEAA+KAIKEWG+P S+ITHL
Sbjct  68    RYMYLTEEILKENPNICAYMAPSLDARQDMVVVEVPRLGKEAAVKAIKEWGQPKSKITHL  127

Query  480   VFCTTSGVDMPGADFQLTKLLGLNSSVKRLMMYQQGCNAGAAMLRLAKDLAENNKGARVL  659
             +FCTTSGVDMPGAD+QLTKLLGL   VKR MMYQQGC+AG  +LRLAKDLAENNKGARVL
Sbjct  128   IFCTTSGVDMPGADYQLTKLLGLRPYVKRYMMYQQGCSAGGTVLRLAKDLAENNKGARVL  187

Query  660   VVCSEVMLSVFRGPSLQQEDNLLAQCLFGDGSAAVIVGTEPRPGLETPLFELVSSAQTII  839
             VVCSE+    FRGP+    D+L+ Q LFGDG+AAVIVG++P P +E P+FELV +AQTI 
Sbjct  188   VVCSEITAVTFRGPTDTHLDSLVGQALFGDGAAAVIVGSDPVPEIEKPIFELVWTAQTIA  247

Query  840   PDTDSHLKLQLREMGLTFHCSKAVPSLITQNVEDCLVKAFEPFGISDWNSIFWILHPGGN  1019
             PD++  +   LRE+GLTFH  K VP ++++N++  L +AF+P GISD+NSIFWI HPGG 
Sbjct  248   PDSEGAIDGHLREVGLTFHLLKDVPGIVSKNIDKALTEAFQPLGISDYNSIFWIAHPGGP  307

Query  1020  AILDGVEEKLGLDPEKLRASRDVLSQYGNLTSACVLFILDEVRKKSKKQQQMTTGEGLEW  1199
             AILD VE+KL L PEK++A+RDVLS YGN++SACVLFILDE+RKKS +    TTGEGLEW
Sbjct  308   AILDQVEQKLALKPEKMKATRDVLSDYGNMSSACVLFILDEMRKKSAQDGLKTTGEGLEW  367

Query  1200  GVLFGFGPGLTIDTVVIRSVPI  1265
             GVLFGFGPGLTI+TVV+ SV I
Sbjct  368   GVLFGFGPGLTIETVVLHSVAI  389



>dbj|BAM17287.1| chalcone synthase [Petunia x hybrida]
Length=389

 Score =   546 bits (1406),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 258/379 (68%), Positives = 313/379 (83%), Gaps = 0/379 (0%)
 Frame = +3

Query  123   RAKRLEGDAKILAIGTATPANWVDQTTYPDFYFRITNSQHLLEHKEKFRRICNKSKIMKR  302
             +A+R EG A ++AIGTATP N VDQ+TYPD+YFRITNS+H  + KEKF+R+C KS I KR
Sbjct  9     KAQRAEGPATVMAIGTATPTNCVDQSTYPDYYFRITNSEHKTDLKEKFKRMCEKSMIKKR  68

Query  303   HLVLTEELLKKHPNLCTYNEASLNTRQDILVSGVPKLGKEAAMKAIKEWGRPISEITHLV  482
             ++ LTEE+LK++P++C Y   SL+ RQDI+V  VPKLGKEAA KAIKEWG+P S+ITHLV
Sbjct  69    YMHLTEEILKENPSMCEYMAPSLDARQDIVVVEVPKLGKEAAQKAIKEWGQPKSKITHLV  128

Query  483   FCTTSGVDMPGADFQLTKLLGLNSSVKRLMMYQQGCNAGAAMLRLAKDLAENNKGARVLV  662
             FCTTSGVDMPG D+QLTKLLGL  SVKRLMMYQQGC AG  +LRLAKDLAENNKGARVLV
Sbjct  129   FCTTSGVDMPGCDYQLTKLLGLRPSVKRLMMYQQGCFAGGTVLRLAKDLAENNKGARVLV  188

Query  663   VCSEVMLSVFRGPSLQQEDNLLAQCLFGDGSAAVIVGTEPRPGLETPLFELVSSAQTIIP  842
             VCSE+    FRGP+    D+L+ Q LFGDG+ A+I+G++P PG+E PLFELVS+AQT++P
Sbjct  189   VCSEITAVTFRGPNDTHLDSLVGQALFGDGAGAIIIGSDPIPGVERPLFELVSAAQTLLP  248

Query  843   DTDSHLKLQLREMGLTFHCSKAVPSLITQNVEDCLVKAFEPFGISDWNSIFWILHPGGNA  1022
             D+   +   LRE+GLTFH  K VP LI++N+E  L +AF+P GISDWNS+FWI HPGG A
Sbjct  249   DSHGAIDGHLREVGLTFHLLKDVPGLISKNIEKSLEEAFKPLGISDWNSLFWIAHPGGPA  308

Query  1023  ILDGVEEKLGLDPEKLRASRDVLSQYGNLTSACVLFILDEVRKKSKKQQQMTTGEGLEWG  1202
             ILD VE KLGL PEKL+A+R+VLS YGN++SACVLFILDE+RK S K+   TTGEGLEWG
Sbjct  309   ILDQVEIKLGLKPEKLKATRNVLSNYGNMSSACVLFILDEMRKASAKEGLGTTGEGLEWG  368

Query  1203  VLFGFGPGLTIDTVVIRSV  1259
             VLFGFGPGLT++TVV+ SV
Sbjct  369   VLFGFGPGLTVETVVLHSV  387



>sp|O22045.1|CHSD_IPONI RecName: Full=Chalcone synthase D; AltName: Full=Naringenin-chalcone 
synthase D; Short=CHS-D [Ipomoea nil]
 dbj|BAA21787.1| chalcone synthase [Ipomoea nil]
 dbj|BAA87336.1| chalcone synthase [Ipomoea nil]
 dbj|BAH28850.1| chalcone synthase [Ipomoea nil]
 dbj|BAH28851.1| chalcone synthase [Ipomoea nil]
Length=388

 Score =   546 bits (1406),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 259/380 (68%), Positives = 312/380 (82%), Gaps = 1/380 (0%)
 Frame = +3

Query  123   RAKRLEGDAKILAIGTATPANWVDQTTYPDFYFRITNSQHLLEHKEKFRRICNKSKIMKR  302
             +A+R EG A ILAIGTATPAN VDQ+TYPD+YFRITNS H+ + K+KF+R+C+KS I KR
Sbjct  9     KAQRAEGPATILAIGTATPANCVDQSTYPDYYFRITNSDHMTDLKQKFQRMCDKSMITKR  68

Query  303   HLVLTEELLKKHPNLCTYNEASLNTRQDILVSGVPKLGKEAAMKAIKEWGRPISEITHLV  482
             ++ LTEE+LK++P+ C Y   SL+ RQDI+V  VPKLGKEAA  AIKEWG+P S+ITH++
Sbjct  69    YMHLTEEILKENPSFCEYMAPSLDARQDIVVVEVPKLGKEAAQSAIKEWGQPKSKITHVI  128

Query  483   FCTTSGVDMPGADFQLTKLLGLNSSVKRLMMYQQGCNAGAAMLRLAKDLAENNKGARVLV  662
             FCTTSGVDMPGAD+QLTKLLGL  SVKRLMMYQQGC AG  +LR+AKDLAENNK ARVLV
Sbjct  129   FCTTSGVDMPGADYQLTKLLGLRPSVKRLMMYQQGCFAGGTVLRVAKDLAENNKAARVLV  188

Query  663   VCSEVMLSVFRGPSLQQEDNLLAQCLFGDGSAAVIVGTEPRPGLETPLFELVSSAQTIIP  842
             VCSE+ +  FRGP+    D+L+ Q LFGDG+AA+IVG++P P  E PLF+LVS+AQT+ P
Sbjct  189   VCSEITVVTFRGPNETHLDSLVGQALFGDGAAAIIVGSDPTPA-EKPLFQLVSAAQTLAP  247

Query  843   DTDSHLKLQLREMGLTFHCSKAVPSLITQNVEDCLVKAFEPFGISDWNSIFWILHPGGNA  1022
             D+   +   LRE+GLTFH  K VPS+++ N+E CL +AF P GISDWNSIFWI HPGG A
Sbjct  248   DSCGAIDGHLREVGLTFHLLKDVPSIVSNNIEKCLSEAFNPLGISDWNSIFWIAHPGGPA  307

Query  1023  ILDGVEEKLGLDPEKLRASRDVLSQYGNLTSACVLFILDEVRKKSKKQQQMTTGEGLEWG  1202
             ILD VE+KLGL PEKLRA+R VLS+YGN++SACVLFILDE+RK S      TTGEGLEWG
Sbjct  308   ILDQVEDKLGLKPEKLRATRHVLSEYGNMSSACVLFILDEMRKASSNDGLGTTGEGLEWG  367

Query  1203  VLFGFGPGLTIDTVVIRSVP  1262
             VLFGFGPGLTI+TVV+ SVP
Sbjct  368   VLFGFGPGLTIETVVLHSVP  387



>ref|NP_001275352.1| chalcone synthase 1A [Solanum tuberosum]
 sp|Q41436.1|CHSA_SOLTU RecName: Full=Chalcone synthase 1A; AltName: Full=Naringenin-chalcone 
synthase 1A [Solanum tuberosum]
 gb|AAB67734.1| chalcone synthase 1a [Solanum tuberosum]
Length=389

 Score =   546 bits (1406),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 259/380 (68%), Positives = 313/380 (82%), Gaps = 0/380 (0%)
 Frame = +3

Query  120   HRAKRLEGDAKILAIGTATPANWVDQTTYPDFYFRITNSQHLLEHKEKFRRICNKSKIMK  299
              +A+R EG A ILAIGT+TP+N VDQ+TYPD+YFRITNS+H  E KEKF+R+C+KS I K
Sbjct  8     RKAQRAEGPATILAIGTSTPSNCVDQSTYPDYYFRITNSEHKTELKEKFKRMCDKSMIKK  67

Query  300   RHLVLTEELLKKHPNLCTYNEASLNTRQDILVSGVPKLGKEAAMKAIKEWGRPISEITHL  479
             R++ LTEE+LK++PN+C Y   SL+ RQDI+V  VPKLGKEAA KAIKEWG+P S+ITHL
Sbjct  68    RYMHLTEEILKENPNMCAYMAPSLDARQDIVVVEVPKLGKEAAQKAIKEWGQPKSKITHL  127

Query  480   VFCTTSGVDMPGADFQLTKLLGLNSSVKRLMMYQQGCNAGAAMLRLAKDLAENNKGARVL  659
             VFCTTSGVDMPG D+QL KLLGL  SVKRLMMYQQGC  G  +LRLAKDLAENNKGARVL
Sbjct  128   VFCTTSGVDMPGCDYQLAKLLGLRPSVKRLMMYQQGCFVGGTVLRLAKDLAENNKGARVL  187

Query  660   VVCSEVMLSVFRGPSLQQEDNLLAQCLFGDGSAAVIVGTEPRPGLETPLFELVSSAQTII  839
             VVCSE+    FRGPS    D+L+ Q LFGDG+AA+I+G++P  G+E PLFELVS+AQT++
Sbjct  188   VVCSEITAVTFRGPSESHLDSLVGQALFGDGAAAIIMGSDPIIGVERPLFELVSAAQTLV  247

Query  840   PDTDSHLKLQLREMGLTFHCSKAVPSLITQNVEDCLVKAFEPFGISDWNSIFWILHPGGN  1019
             PD++  +   LRE+GLTFH  K VP LI++N+E  L++AF+P GISDWNS+FWI HPGG 
Sbjct  248   PDSEGAIDGHLREVGLTFHLLKDVPGLISKNIEKSLLEAFQPLGISDWNSLFWIAHPGGP  307

Query  1020  AILDGVEEKLGLDPEKLRASRDVLSQYGNLTSACVLFILDEVRKKSKKQQQMTTGEGLEW  1199
             AILD VE KLGL  EKLRA+R+VLS YGN++SACVLFILDE+RK S  +   TTGEGLEW
Sbjct  308   AILDQVELKLGLKQEKLRATREVLSNYGNMSSACVLFILDEMRKASTNEGLGTTGEGLEW  367

Query  1200  GVLFGFGPGLTIDTVVIRSV  1259
             GVLFGFGPGLT++TVV+ SV
Sbjct  368   GVLFGFGPGLTVETVVLHSV  387



>dbj|BAC66467.1| chalcone synthase [Rosa hybrid cultivar 'Kardinal']
Length=389

 Score =   546 bits (1406),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 257/379 (68%), Positives = 310/379 (82%), Gaps = 0/379 (0%)
 Frame = +3

Query  123   RAKRLEGDAKILAIGTATPANWVDQTTYPDFYFRITNSQHLLEHKEKFRRICNKSKIMKR  302
             +A+R EG A +LAIGTATP N +DQ+TYPD+YFRIT S+H  E KEKF+R+C+KS I KR
Sbjct  9     KAQRAEGPATVLAIGTATPPNCIDQSTYPDYYFRITKSEHKAELKEKFQRMCDKSMIKKR  68

Query  303   HLVLTEELLKKHPNLCTYNEASLNTRQDILVSGVPKLGKEAAMKAIKEWGRPISEITHLV  482
             ++ LTEE+LK++P++C Y   SL+ RQD++V  +PKLGKEAA KAIKEWG+P S+ITHLV
Sbjct  69    YMYLTEEILKENPSMCEYMAPSLDARQDMVVVEIPKLGKEAATKAIKEWGQPKSKITHLV  128

Query  483   FCTTSGVDMPGADFQLTKLLGLNSSVKRLMMYQQGCNAGAAMLRLAKDLAENNKGARVLV  662
             FCTTSGVDMPGAD+QLTKLLGL  SVKRLMMYQQGC AG  +LRLAKDLAENNKGARVLV
Sbjct  129   FCTTSGVDMPGADYQLTKLLGLRPSVKRLMMYQQGCFAGGTVLRLAKDLAENNKGARVLV  188

Query  663   VCSEVMLSVFRGPSLQQEDNLLAQCLFGDGSAAVIVGTEPRPGLETPLFELVSSAQTIIP  842
             VCSE+    FRGPS    D+L+ Q LFGDG+AA+IVG +P P +E P FELVS+AQTI+P
Sbjct  189   VCSEITAVTFRGPSDTHLDSLVGQALFGDGAAAIIVGADPLPEVEKPSFELVSAAQTILP  248

Query  843   DTDSHLKLQLREMGLTFHCSKAVPSLITQNVEDCLVKAFEPFGISDWNSIFWILHPGGNA  1022
             D+D  +   LRE+GLTFH  K VP LI++N+E  L +AF+P  I+DWNS+FWI HPGG A
Sbjct  249   DSDGAIDGHLREVGLTFHLLKDVPGLISKNIEKSLNEAFKPLNITDWNSLFWIAHPGGPA  308

Query  1023  ILDGVEEKLGLDPEKLRASRDVLSQYGNLTSACVLFILDEVRKKSKKQQQMTTGEGLEWG  1202
             ILD VE KLGL PEKL A+R +LS+YGN++SACVLFILDEVR+KS      TTGEGLEWG
Sbjct  309   ILDQVEAKLGLKPEKLEATRHILSEYGNMSSACVLFILDEVRRKSAANGHKTTGEGLEWG  368

Query  1203  VLFGFGPGLTIDTVVIRSV  1259
             VLFGFGPGLT++TVV+ SV
Sbjct  369   VLFGFGPGLTVETVVLHSV  387



>gb|AAM00231.1|AF358431_1 root-specific chalcone synthase [Senna alata]
Length=390

 Score =   546 bits (1406),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 259/383 (68%), Positives = 314/383 (82%), Gaps = 0/383 (0%)
 Frame = +3

Query  120   HRAKRLEGDAKILAIGTATPANWVDQTTYPDFYFRITNSQHLLEHKEKFRRICNKSKIMK  299
              +A+R +G A +LAIGTATP N VDQ+TYPD+YFRITNS+H  E KEKF+R+C KS I K
Sbjct  8     RKAQRAQGPATVLAIGTATPPNCVDQSTYPDYYFRITNSEHKTELKEKFKRMCEKSMIKK  67

Query  300   RHLVLTEELLKKHPNLCTYNEASLNTRQDILVSGVPKLGKEAAMKAIKEWGRPISEITHL  479
             R++ LTE+LLK++PN+C Y   SL+ RQD++V  VPKLGKEAA KAIKEWG+P S+ITHL
Sbjct  68    RYMHLTEDLLKENPNMCAYMAPSLDARQDMVVVEVPKLGKEAATKAIKEWGQPKSKITHL  127

Query  480   VFCTTSGVDMPGADFQLTKLLGLNSSVKRLMMYQQGCNAGAAMLRLAKDLAENNKGARVL  659
             + CTTSGVDMPGAD+QLTKLLGL   VKR MMYQQGC AG  +LRLAKDLAENNKGARVL
Sbjct  128   IVCTTSGVDMPGADYQLTKLLGLRPYVKRYMMYQQGCFAGGTVLRLAKDLAENNKGARVL  187

Query  660   VVCSEVMLSVFRGPSLQQEDNLLAQCLFGDGSAAVIVGTEPRPGLETPLFELVSSAQTII  839
             VVCSE+    FRGPS    D+L+ Q LFGDG+AA+IVG++P P +E PLFELV +AQTI+
Sbjct  188   VVCSEITAVTFRGPSDTHLDSLVGQALFGDGAAAIIVGSDPLPEVEKPLFELVWTAQTIL  247

Query  840   PDTDSHLKLQLREMGLTFHCSKAVPSLITQNVEDCLVKAFEPFGISDWNSIFWILHPGGN  1019
             PD++  +   LRE+GLTFH  K VP LI++N+E  LV+AF+P GISD+NSIFWI HPGG 
Sbjct  248   PDSEGAIDGHLREVGLTFHLLKDVPGLISKNIEKALVEAFQPLGISDYNSIFWIAHPGGP  307

Query  1020  AILDGVEEKLGLDPEKLRASRDVLSQYGNLTSACVLFILDEVRKKSKKQQQMTTGEGLEW  1199
             AILD VE KL L PEK+RA+R VLS+YGN++SACVLFILDE+R+KS +    TTGEGLEW
Sbjct  308   AILDQVEAKLELKPEKMRATRHVLSEYGNMSSACVLFILDEMRRKSIQDGLETTGEGLEW  367

Query  1200  GVLFGFGPGLTIDTVVIRSVPIN  1268
             GVLFGFGPGLT++TVV+RSV +N
Sbjct  368   GVLFGFGPGLTVETVVLRSVAVN  390



>ref|XP_008797107.1| PREDICTED: chalcone synthase 1 [Phoenix dactylifera]
Length=392

 Score =   546 bits (1406),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 255/381 (67%), Positives = 313/381 (82%), Gaps = 0/381 (0%)
 Frame = +3

Query  126   AKRLEGDAKILAIGTATPANWVDQTTYPDFYFRITNSQHLLEHKEKFRRICNKSKIMKRH  305
             ++R EG A ILAIGTATPAN V Q  YPD+YFRIT S+HL + KEKF+R+C+KS I KR+
Sbjct  10    SQRAEGPATILAIGTATPANVVYQADYPDYYFRITKSEHLTDLKEKFKRMCDKSMIRKRY  69

Query  306   LVLTEELLKKHPNLCTYNEASLNTRQDILVSGVPKLGKEAAMKAIKEWGRPISEITHLVF  485
             + L EE+LK++PN+C Y   SL+ RQD++V  VPKLGKEAA+KAIKEWG+P S ITHLVF
Sbjct  70    MHLNEEILKENPNVCAYMAPSLDARQDMVVVEVPKLGKEAAVKAIKEWGQPKSRITHLVF  129

Query  486   CTTSGVDMPGADFQLTKLLGLNSSVKRLMMYQQGCNAGAAMLRLAKDLAENNKGARVLVV  665
             CTTSGVDMPGAD+QLTKLLGL  SV RLMMYQQGC AG  +LRLAKDLAENN+GARVLVV
Sbjct  130   CTTSGVDMPGADYQLTKLLGLRPSVNRLMMYQQGCFAGGTVLRLAKDLAENNRGARVLVV  189

Query  666   CSEVMLSVFRGPSLQQEDNLLAQCLFGDGSAAVIVGTEPRPGLETPLFELVSSAQTIIPD  845
             CSE+    FRGPS    D+L+ Q LFGDG+AA+I+G +P P +E PLF+LVS++QTI+PD
Sbjct  190   CSEITAVTFRGPSESHLDSLVGQALFGDGAAAIIIGADPDPAIERPLFQLVSASQTILPD  249

Query  846   TDSHLKLQLREMGLTFHCSKAVPSLITQNVEDCLVKAFEPFGISDWNSIFWILHPGGNAI  1025
             ++  +   LRE+GLTFH  K VP LI++NVE  L +AF P GISDWNSIFWI HPGG AI
Sbjct  250   SEGAIDGHLREVGLTFHLLKDVPGLISKNVEKSLAEAFAPLGISDWNSIFWIAHPGGPAI  309

Query  1026  LDGVEEKLGLDPEKLRASRDVLSQYGNLTSACVLFILDEVRKKSKKQQQMTTGEGLEWGV  1205
             LD VE KLGL+ EK+RA+R VLS+YGN++SACVLFILDE+R++S +  + TTGEGLEWGV
Sbjct  310   LDQVEAKLGLEKEKMRATRHVLSEYGNMSSACVLFILDEMRRRSAEDGKATTGEGLEWGV  369

Query  1206  LFGFGPGLTIDTVVIRSVPIN  1268
             LFGFGPGLT++TVV+ S+P++
Sbjct  370   LFGFGPGLTVETVVLHSLPVS  390



>sp|Q9MB40.1|CHS3_IPOBA RecName: Full=Chalcone synthase LF3; AltName: Full=Naringenin-chalcone 
synthase LF3 [Ipomoea batatas]
 dbj|BAA90328.1| chalcone synthase CHS-LF3 [Ipomoea batatas]
Length=388

 Score =   546 bits (1406),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 262/380 (69%), Positives = 310/380 (82%), Gaps = 1/380 (0%)
 Frame = +3

Query  123   RAKRLEGDAKILAIGTATPANWVDQTTYPDFYFRITNSQHLLEHKEKFRRICNKSKIMKR  302
             +A+R EG A ILAIGTATPAN V+Q+TYPD+YFRITNS+H  E KEKF+R+C+KS I KR
Sbjct  9     KAQRAEGPATILAIGTATPANCVNQSTYPDYYFRITNSEHKTELKEKFQRMCDKSMITKR  68

Query  303   HLVLTEELLKKHPNLCTYNEASLNTRQDILVSGVPKLGKEAAMKAIKEWGRPISEITHLV  482
             ++ LTEE+LK++P+ C Y   SL+ RQDI V  VPKLGKEAA  AIK WG+P S+ITH+V
Sbjct  69    YMHLTEEILKENPSFCEYMAPSLDARQDIAVVEVPKLGKEAAQSAIKGWGQPKSKITHVV  128

Query  483   FCTTSGVDMPGADFQLTKLLGLNSSVKRLMMYQQGCNAGAAMLRLAKDLAENNKGARVLV  662
             FCTTSGVDMPGAD+QLTKLLGL  SVKRLMMYQQGC AG  +LRLAKDLAENNKGARVL+
Sbjct  129   FCTTSGVDMPGADYQLTKLLGLRPSVKRLMMYQQGCFAGGTVLRLAKDLAENNKGARVLI  188

Query  663   VCSEVMLSVFRGPSLQQEDNLLAQCLFGDGSAAVIVGTEPRPGLETPLFELVSSAQTIIP  842
             VCSE+ +  FRGPS    D+L+ Q LFGDG+AAVIVG +P P  E PLF+LVS+AQT+ P
Sbjct  189   VCSEITVVTFRGPSEAHLDSLVGQALFGDGAAAVIVGADPTPA-EKPLFQLVSAAQTLAP  247

Query  843   DTDSHLKLQLREMGLTFHCSKAVPSLITQNVEDCLVKAFEPFGISDWNSIFWILHPGGNA  1022
             D+   +   LRE+GLTFH  K VPS+++ N+E CL +AF P GISDWNS+FWI HPGG A
Sbjct  248   DSCGAIDGHLREVGLTFHLLKDVPSVVSNNIEKCLFEAFNPLGISDWNSVFWIAHPGGPA  307

Query  1023  ILDGVEEKLGLDPEKLRASRDVLSQYGNLTSACVLFILDEVRKKSKKQQQMTTGEGLEWG  1202
             ILD VE+KLGL PEKLRA+R VLS+YGN++SACVLFILDE+RK S      TTGEGLEWG
Sbjct  308   ILDQVEDKLGLKPEKLRATRHVLSEYGNMSSACVLFILDEMRKASSNDGLGTTGEGLEWG  367

Query  1203  VLFGFGPGLTIDTVVIRSVP  1262
             VLFGFGPGLTI+TVV+ SVP
Sbjct  368   VLFGFGPGLTIETVVLHSVP  387



>sp|P08894.1|CHSA_PETHY RecName: Full=Chalcone synthase A; AltName: Full=Naringenin-chalcone 
synthase A [Petunia x hybrida]
 emb|CAA27718.1| unnamed protein product [Petunia x hybrida]
Length=389

 Score =   546 bits (1406),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 258/379 (68%), Positives = 313/379 (83%), Gaps = 0/379 (0%)
 Frame = +3

Query  123   RAKRLEGDAKILAIGTATPANWVDQTTYPDFYFRITNSQHLLEHKEKFRRICNKSKIMKR  302
             +A+R EG A ++AIGTATP N VDQ+TYPD+YFRITNS+H  + KEKF+R+C KS I KR
Sbjct  9     KAQRAEGPATVMAIGTATPTNCVDQSTYPDYYFRITNSEHKTDLKEKFKRMCEKSMIKKR  68

Query  303   HLVLTEELLKKHPNLCTYNEASLNTRQDILVSGVPKLGKEAAMKAIKEWGRPISEITHLV  482
             ++ LTEE+LK++P++C Y   SL+ RQDI+V  VPKLGKEAA KAIKEWG+P S+ITHLV
Sbjct  69    YMHLTEEILKENPSMCEYMAPSLDARQDIVVVEVPKLGKEAAQKAIKEWGQPKSKITHLV  128

Query  483   FCTTSGVDMPGADFQLTKLLGLNSSVKRLMMYQQGCNAGAAMLRLAKDLAENNKGARVLV  662
             FCTTSGVDMPG D+QLTKLLGL  SVKRLMMYQQGC AG  +LRLAKDLAENNKGARVLV
Sbjct  129   FCTTSGVDMPGCDYQLTKLLGLRPSVKRLMMYQQGCFAGGTVLRLAKDLAENNKGARVLV  188

Query  663   VCSEVMLSVFRGPSLQQEDNLLAQCLFGDGSAAVIVGTEPRPGLETPLFELVSSAQTIIP  842
             VCSE+    FRGP+    D+L+ Q LFGDG+ A+I+G++P PG+E PLFELVS+AQT++P
Sbjct  189   VCSEITAVTFRGPNDTHLDSLVGQALFGDGAGAIIIGSDPIPGVERPLFELVSAAQTLLP  248

Query  843   DTDSHLKLQLREMGLTFHCSKAVPSLITQNVEDCLVKAFEPFGISDWNSIFWILHPGGNA  1022
             D+   +   LRE+GLTFH  K VP LI++N+E  L +AF+P GISDWNS+FWI HPGG A
Sbjct  249   DSHGAIDGHLREVGLTFHLLKDVPGLISKNIEKSLEEAFKPLGISDWNSLFWIAHPGGPA  308

Query  1023  ILDGVEEKLGLDPEKLRASRDVLSQYGNLTSACVLFILDEVRKKSKKQQQMTTGEGLEWG  1202
             ILD VE KLGL PEKL+A+R+VLS YGN++SACVLFILDE+RK S K+   TTGEGLEWG
Sbjct  309   ILDQVEIKLGLKPEKLKATRNVLSDYGNMSSACVLFILDEMRKASAKEGLGTTGEGLEWG  368

Query  1203  VLFGFGPGLTIDTVVIRSV  1259
             VLFGFGPGLT++TVV+ SV
Sbjct  369   VLFGFGPGLTVETVVLHSV  387



>ref|XP_011020677.1| PREDICTED: chalcone synthase 1-like isoform X1 [Populus euphratica]
 ref|XP_011020678.1| PREDICTED: chalcone synthase 1-like isoform X1 [Populus euphratica]
 ref|XP_011020679.1| PREDICTED: chalcone synthase 1-like isoform X1 [Populus euphratica]
Length=391

 Score =   546 bits (1406),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 259/379 (68%), Positives = 311/379 (82%), Gaps = 0/379 (0%)
 Frame = +3

Query  123   RAKRLEGDAKILAIGTATPANWVDQTTYPDFYFRITNSQHLLEHKEKFRRICNKSKIMKR  302
             + +R EG A I+AIGT+TP N VDQ+TYPD+YFRITNS+H  E KEKF+R+C KS I KR
Sbjct  9     KGQRAEGPATIMAIGTSTPPNCVDQSTYPDYYFRITNSEHKAELKEKFKRMCEKSMIKKR  68

Query  303   HLVLTEELLKKHPNLCTYNEASLNTRQDILVSGVPKLGKEAAMKAIKEWGRPISEITHLV  482
             ++ LTE++LK++PN+C Y   SL+ RQD++V  VPKLGKEAA KAIKEWG+  S+ITHLV
Sbjct  69    YMYLTEDILKENPNVCAYMAPSLDARQDMVVVEVPKLGKEAATKAIKEWGQSKSKITHLV  128

Query  483   FCTTSGVDMPGADFQLTKLLGLNSSVKRLMMYQQGCNAGAAMLRLAKDLAENNKGARVLV  662
             FCTTSGVDMPGAD+QLTKLLGL  SVKR MMYQQGC AG  +LRLAKD AENNKGARVLV
Sbjct  129   FCTTSGVDMPGADYQLTKLLGLRPSVKRFMMYQQGCFAGGTVLRLAKDHAENNKGARVLV  188

Query  663   VCSEVMLSVFRGPSLQQEDNLLAQCLFGDGSAAVIVGTEPRPGLETPLFELVSSAQTIIP  842
             VCSE+    FRGPS    D+L+ Q LFGDG+AA+I+G++P  G+E PLFELVS+AQTI+P
Sbjct  189   VCSEITAVTFRGPSDTHLDSLVGQALFGDGAAALIIGSDPVVGVEKPLFELVSAAQTILP  248

Query  843   DTDSHLKLQLREMGLTFHCSKAVPSLITQNVEDCLVKAFEPFGISDWNSIFWILHPGGNA  1022
             D+D  +   LRE+GLTFH  K VP LI++NVE  L +AF+P GISDWNS+FWI HPGG A
Sbjct  249   DSDGAIDGHLREVGLTFHLLKDVPGLISKNVEKSLTEAFKPLGISDWNSLFWIAHPGGPA  308

Query  1023  ILDGVEEKLGLDPEKLRASRDVLSQYGNLTSACVLFILDEVRKKSKKQQQMTTGEGLEWG  1202
             ILD VE KLGL PEKLRA+R VLS+YGN++SACVLFILDE+RKKS +    +TGEGLEWG
Sbjct  309   ILDQVEAKLGLKPEKLRATRHVLSEYGNMSSACVLFILDEMRKKSAEDGLQSTGEGLEWG  368

Query  1203  VLFGFGPGLTIDTVVIRSV  1259
             VLFGFGPGLT++TVV+ SV
Sbjct  369   VLFGFGPGLTVETVVLHSV  387



>sp|Q9AU09.1|PKS3_RUBID RecName: Full=Polyketide synthase 3; Short=RiPKS3; AltName: Full=Naringenin-chalcone 
synthase PKS3 [Rubus idaeus]
 gb|AAK15176.1|AF292369_1 aromatic polyketide synthase [Rubus idaeus]
Length=391

 Score =   546 bits (1406),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 258/380 (68%), Positives = 312/380 (82%), Gaps = 0/380 (0%)
 Frame = +3

Query  120   HRAKRLEGDAKILAIGTATPANWVDQTTYPDFYFRITNSQHLLEHKEKFRRICNKSKIMK  299
              +A+R EG A ILAIGTATP N VDQ+TYPD+YFRIT S+H  E KEKF+R+C+KS+I K
Sbjct  8     RKAQRAEGPATILAIGTATPPNCVDQSTYPDYYFRITKSEHRTELKEKFQRMCDKSRIKK  67

Query  300   RHLVLTEELLKKHPNLCTYNEASLNTRQDILVSGVPKLGKEAAMKAIKEWGRPISEITHL  479
             R++ LTEE+LK++P++C Y   SL+ RQD++V  +PKLGKEAA KAIKEWG+  S+ITHL
Sbjct  68    RYMYLTEEILKENPSMCEYMAPSLDARQDMVVVEIPKLGKEAATKAIKEWGQLKSKITHL  127

Query  480   VFCTTSGVDMPGADFQLTKLLGLNSSVKRLMMYQQGCNAGAAMLRLAKDLAENNKGARVL  659
             VFCTTSGVDMPGAD+QLTKLLGL  SVKRLMMYQQGC AG  +LRLAKDLAENNKGARVL
Sbjct  128   VFCTTSGVDMPGADYQLTKLLGLRPSVKRLMMYQQGCFAGGTVLRLAKDLAENNKGARVL  187

Query  660   VVCSEVMLSVFRGPSLQQEDNLLAQCLFGDGSAAVIVGTEPRPGLETPLFELVSSAQTII  839
              VCSE+    FRGPS    D+L+ Q LFGDG+AA+IVG++P P +E PLFELVS+AQTI+
Sbjct  188   AVCSEITAVTFRGPSDTHLDSLVGQALFGDGAAAIIVGSDPLPDIERPLFELVSAAQTIL  247

Query  840   PDTDSHLKLQLREMGLTFHCSKAVPSLITQNVEDCLVKAFEPFGISDWNSIFWILHPGGN  1019
             PD+D  +   LRE+GLTFH  K VP LI++N+E  L +AF+P  I+DWNS+FWI HPGG 
Sbjct  248   PDSDGAIDGHLREVGLTFHLLKDVPGLISKNIEKSLNEAFKPLDITDWNSLFWIAHPGGP  307

Query  1020  AILDGVEEKLGLDPEKLRASRDVLSQYGNLTSACVLFILDEVRKKSKKQQQMTTGEGLEW  1199
             AILD VE KLGL PEKL A+R++LS+YGN++SACVLFILDEVR+KS      TTGEGLEW
Sbjct  308   AILDQVEAKLGLKPEKLEATRNILSEYGNMSSACVLFILDEVRRKSVANGHKTTGEGLEW  367

Query  1200  GVLFGFGPGLTIDTVVIRSV  1259
             GVLFGFGPGLT++TVV+ SV
Sbjct  368   GVLFGFGPGLTVETVVLHSV  387



>gb|AAX99413.1| chalcone synthase [Fragaria x ananassa]
Length=389

 Score =   545 bits (1405),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 256/379 (68%), Positives = 312/379 (82%), Gaps = 0/379 (0%)
 Frame = +3

Query  123   RAKRLEGDAKILAIGTATPANWVDQTTYPDFYFRITNSQHLLEHKEKFRRICNKSKIMKR  302
             +A+R EG A +LAIGTATP N +DQ+TYPD+YFRITNS+H  E KEKF+R+C+KS I KR
Sbjct  9     KAQRAEGPATVLAIGTATPPNCIDQSTYPDYYFRITNSEHKAELKEKFQRMCDKSMIKKR  68

Query  303   HLVLTEELLKKHPNLCTYNEASLNTRQDILVSGVPKLGKEAAMKAIKEWGRPISEITHLV  482
             ++ LTEE+LK++P++C Y   SL+ RQD++V  +PKLGKEAA+KAIKEWG+P S+ITHLV
Sbjct  69    YMYLTEEILKENPSMCEYMAPSLDARQDMVVVEIPKLGKEAAVKAIKEWGQPKSKITHLV  128

Query  483   FCTTSGVDMPGADFQLTKLLGLNSSVKRLMMYQQGCNAGAAMLRLAKDLAENNKGARVLV  662
              CTTSGVDMPGAD+QLTKLLGL  SVKRLMMYQQGC AG  +LRLAKDLAENN+GARVLV
Sbjct  129   SCTTSGVDMPGADYQLTKLLGLRPSVKRLMMYQQGCFAGGTVLRLAKDLAENNRGARVLV  188

Query  663   VCSEVMLSVFRGPSLQQEDNLLAQCLFGDGSAAVIVGTEPRPGLETPLFELVSSAQTIIP  842
             VCSE+    FRGPS    D+L+ Q LFGDG+AA+IVG++P P +E PLFELVS+AQTI+P
Sbjct  189   VCSEITAVTFRGPSDTHLDSLVGQALFGDGAAAIIVGSDPLPEVERPLFELVSTAQTILP  248

Query  843   DTDSHLKLQLREMGLTFHCSKAVPSLITQNVEDCLVKAFEPFGISDWNSIFWILHPGGNA  1022
             D+D  +   LRE+GLTFH  K VP LI++N+E  L +AF+P  I+DWNS+FWI HPGG A
Sbjct  249   DSDGAIDGHLREVGLTFHLLKDVPGLISKNIEKSLNEAFKPLNITDWNSLFWIAHPGGPA  308

Query  1023  ILDGVEEKLGLDPEKLRASRDVLSQYGNLTSACVLFILDEVRKKSKKQQQMTTGEGLEWG  1202
             ILD VE KL L PEKL A+R +LS+YGN++SACVLFILDEVR+KS      TTGEGLEWG
Sbjct  309   ILDQVEAKLALKPEKLEATRHILSEYGNMSSACVLFILDEVRRKSAANGHKTTGEGLEWG  368

Query  1203  VLFGFGPGLTIDTVVIRSV  1259
             VLFGFGPGLT++TVV+ SV
Sbjct  369   VLFGFGPGLTVETVVLHSV  387



>dbj|BAB84112.1| chalcone synthase [Vitis vinifera]
Length=393

 Score =   545 bits (1405),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 259/379 (68%), Positives = 314/379 (83%), Gaps = 0/379 (0%)
 Frame = +3

Query  123   RAKRLEGDAKILAIGTATPANWVDQTTYPDFYFRITNSQHLLEHKEKFRRICNKSKIMKR  302
             +++R EG A +LAIGTATPAN V Q  YPD+YFRITNS+H+ E KEKF+R+C KS I KR
Sbjct  9     KSQRAEGPATVLAIGTATPANCVYQADYPDYYFRITNSEHMTELKEKFKRMCEKSMINKR  68

Query  303   HLVLTEELLKKHPNLCTYNEASLNTRQDILVSGVPKLGKEAAMKAIKEWGRPISEITHLV  482
             ++ LTEE+LK++PN+C Y   SL+ RQD++V  VPKLGKEAA+KAIKEWG+P S+ITHLV
Sbjct  69    YMHLTEEILKENPNVCAYMAPSLDARQDMVVVEVPKLGKEAAVKAIKEWGQPKSKITHLV  128

Query  483   FCTTSGVDMPGADFQLTKLLGLNSSVKRLMMYQQGCNAGAAMLRLAKDLAENNKGARVLV  662
             FCTTSGVDMPGAD+QLTKLLGL  SVKRLMMYQQGC AG  +LRLAKDLAENN GARVLV
Sbjct  129   FCTTSGVDMPGADYQLTKLLGLKPSVKRLMMYQQGCFAGGTVLRLAKDLAENNAGARVLV  188

Query  663   VCSEVMLSVFRGPSLQQEDNLLAQCLFGDGSAAVIVGTEPRPGLETPLFELVSSAQTIIP  842
             VCSE+    FRGPS    D+L+ Q LFGDG+AA+I+G +P   +E PLFELVS+AQTI+P
Sbjct  189   VCSEITAVTFRGPSDTHLDSLVGQALFGDGAAAIIIGADPDTKIERPLFELVSAAQTILP  248

Query  843   DTDSHLKLQLREMGLTFHCSKAVPSLITQNVEDCLVKAFEPFGISDWNSIFWILHPGGNA  1022
             D++  +   LRE+GLTFH  K VP LI++N+E  LV+AF+P GISDWNS+FWI HPGG A
Sbjct  249   DSEGAIDGHLREVGLTFHLLKDVPGLISKNIEKSLVEAFKPIGISDWNSLFWIAHPGGPA  308

Query  1023  ILDGVEEKLGLDPEKLRASRDVLSQYGNLTSACVLFILDEVRKKSKKQQQMTTGEGLEWG  1202
             ILD VE KLGL  EKLRA+R VLS+YGN++SACVLFILDE+RKKS ++ + TTGEGLEWG
Sbjct  309   ILDQVELKLGLKEEKLRATRHVLSEYGNMSSACVLFILDEMRKKSIEEGKGTTGEGLEWG  368

Query  1203  VLFGFGPGLTIDTVVIRSV  1259
             VLFGFGPGLT++TVV+ S+
Sbjct  369   VLFGFGPGLTVETVVLHSL  387



>emb|CAK19317.1| naringenin-chalcone synthase [Humulus lupulus]
Length=389

 Score =   545 bits (1405),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 260/382 (68%), Positives = 312/382 (82%), Gaps = 0/382 (0%)
 Frame = +3

Query  120   HRAKRLEGDAKILAIGTATPANWVDQTTYPDFYFRITNSQHLLEHKEKFRRICNKSKIMK  299
              +A+R EG A ILAIGTATPAN + Q+ YPD+YFRITNS+H  E KEKF+R+C+KS I K
Sbjct  8     RKAQRAEGPATILAIGTATPANCILQSEYPDYYFRITNSEHKTELKEKFKRMCDKSMIRK  67

Query  300   RHLVLTEELLKKHPNLCTYNEASLNTRQDILVSGVPKLGKEAAMKAIKEWGRPISEITHL  479
             R++ LTEE+LK++PNLC Y   SL+ RQD++V  VPKLGKEAA KAIKEWG+P S+ITH+
Sbjct  68    RYMHLTEEILKENPNLCAYEAPSLDARQDMVVVEVPKLGKEAATKAIKEWGQPKSKITHV  127

Query  480   VFCTTSGVDMPGADFQLTKLLGLNSSVKRLMMYQQGCNAGAAMLRLAKDLAENNKGARVL  659
             VFCTTSGVDMPGAD+QLTKLLGL  SVKRLMMYQQGC AG  +LR+AKDLAENNKGARVL
Sbjct  128   VFCTTSGVDMPGADYQLTKLLGLRPSVKRLMMYQQGCFAGGTVLRVAKDLAENNKGARVL  187

Query  660   VVCSEVMLSVFRGPSLQQEDNLLAQCLFGDGSAAVIVGTEPRPGLETPLFELVSSAQTII  839
             VVCSE+    FRGP+    D+L+ Q LFGDGSAA+I+G +P P +E P FELVS+AQTI+
Sbjct  188   VVCSEITAVTFRGPNDTHLDSLVGQALFGDGSAALIIGADPIPEIEKPTFELVSAAQTIL  247

Query  840   PDTDSHLKLQLREMGLTFHCSKAVPSLITQNVEDCLVKAFEPFGISDWNSIFWILHPGGN  1019
             PD+D  +   LRE+GLTFH  K VP LI++N+E  LV+AF+P GISDWNS+FWI HPGG 
Sbjct  248   PDSDGAIDGHLREVGLTFHLLKDVPGLISKNIEKSLVEAFKPLGISDWNSLFWIAHPGGP  307

Query  1020  AILDGVEEKLGLDPEKLRASRDVLSQYGNLTSACVLFILDEVRKKSKKQQQMTTGEGLEW  1199
             AILD VE KL L PEKLRA+R VL +YGN++SACVLFILDE+R+K  +    TTGEGLEW
Sbjct  308   AILDQVESKLALKPEKLRATRHVLGEYGNMSSACVLFILDEMRRKCAEDGLKTTGEGLEW  367

Query  1200  GVLFGFGPGLTIDTVVIRSVPI  1265
             GVLFGFGPGLT++TVV+ SV I
Sbjct  368   GVLFGFGPGLTVETVVLHSVGI  389



>gb|AAN05791.1| chalcone synthase [Mazus pumilus]
Length=392

 Score =   545 bits (1405),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 256/381 (67%), Positives = 312/381 (82%), Gaps = 0/381 (0%)
 Frame = +3

Query  123   RAKRLEGDAKILAIGTATPANWVDQTTYPDFYFRITNSQHLLEHKEKFRRICNKSKIMKR  302
             RA+R EG A +LAIGTATP+N VDQ+TYPD+YFRITNS+H+ + KEKF+R+C KS I KR
Sbjct  10    RAQRAEGPATVLAIGTATPSNCVDQSTYPDYYFRITNSEHMTDLKEKFKRMCEKSYIKKR  69

Query  303   HLVLTEELLKKHPNLCTYNEASLNTRQDILVSGVPKLGKEAAMKAIKEWGRPISEITHLV  482
             ++ LTEE+LK++PN+C Y   SL+ RQDI+V  +PKLGKEAA KAIKEWG+P S+ITHLV
Sbjct  70    YMHLTEEILKENPNMCAYMAPSLDARQDIVVVEIPKLGKEAAQKAIKEWGQPKSKITHLV  129

Query  483   FCTTSGVDMPGADFQLTKLLGLNSSVKRLMMYQQGCNAGAAMLRLAKDLAENNKGARVLV  662
             FCTTSGVDMPGAD+QLTKLLGL  SVKR MMYQQGC AG  +LR+AKDLAENN GARVLV
Sbjct  130   FCTTSGVDMPGADYQLTKLLGLRPSVKRFMMYQQGCFAGGTVLRMAKDLAENNAGARVLV  189

Query  663   VCSEVMLSVFRGPSLQQEDNLLAQCLFGDGSAAVIVGTEPRPGLETPLFELVSSAQTIIP  842
             VCSE+    FRGPS    D+L+ Q LFGDG+AAVIVG++P  G+E PLF++VS+AQT++P
Sbjct  190   VCSEITAVTFRGPSDSHLDSLVGQALFGDGAAAVIVGSDPIVGVERPLFQIVSAAQTLLP  249

Query  843   DTDSHLKLQLREMGLTFHCSKAVPSLITQNVEDCLVKAFEPFGISDWNSIFWILHPGGNA  1022
             D+   +   LRE+GLTFH  K VP LI++++E  L +AF+P GISDWNSIFWI HPGG A
Sbjct  250   DSHGAIDGHLREVGLTFHLLKDVPGLISKHIEKSLKEAFDPLGISDWNSIFWIAHPGGPA  309

Query  1023  ILDGVEEKLGLDPEKLRASRDVLSQYGNLTSACVLFILDEVRKKSKKQQQMTTGEGLEWG  1202
             ILD VE  L L PEK+RA+R VLS YGN++SACVLFILDE+RK S K+   +TGEGL+WG
Sbjct  310   ILDQVESVLALKPEKMRATRQVLSDYGNMSSACVLFILDEMRKASAKEGMGSTGEGLDWG  369

Query  1203  VLFGFGPGLTIDTVVIRSVPI  1265
             VLFGFGPGLT++TVV+ SVP 
Sbjct  370   VLFGFGPGLTVETVVLHSVPF  390



>ref|XP_010099135.1| Chalcone synthase [Morus notabilis]
 gb|EXB76929.1| Chalcone synthase [Morus notabilis]
Length=389

 Score =   545 bits (1405),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 256/381 (67%), Positives = 313/381 (82%), Gaps = 0/381 (0%)
 Frame = +3

Query  123   RAKRLEGDAKILAIGTATPANWVDQTTYPDFYFRITNSQHLLEHKEKFRRICNKSKIMKR  302
             +A+R EG A I+AIGTATP N +DQ++YPD+YFRITNS+H  E KEKF+R+C KS+I KR
Sbjct  9     KAQRAEGPATIMAIGTATPPNCIDQSSYPDYYFRITNSEHKTELKEKFKRMCEKSQIKKR  68

Query  303   HLVLTEELLKKHPNLCTYNEASLNTRQDILVSGVPKLGKEAAMKAIKEWGRPISEITHLV  482
             ++ L EE+LK++PN+C Y   SL+ RQD++V  VPKLGKEAA KAIKEWG+P S+ITHLV
Sbjct  69    YMYLHEEILKENPNICAYMAPSLDARQDMVVVEVPKLGKEAATKAIKEWGQPKSKITHLV  128

Query  483   FCTTSGVDMPGADFQLTKLLGLNSSVKRLMMYQQGCNAGAAMLRLAKDLAENNKGARVLV  662
             FCTTSGVDMPGAD+QLTKLLGL  SVKRLMMYQQGC AG  +LRLAKDLAENNKGARVLV
Sbjct  129   FCTTSGVDMPGADYQLTKLLGLRPSVKRLMMYQQGCFAGGTVLRLAKDLAENNKGARVLV  188

Query  663   VCSEVMLSVFRGPSLQQEDNLLAQCLFGDGSAAVIVGTEPRPGLETPLFELVSSAQTIIP  842
             VCSE+    FRGPS    D+L+ Q LFGDG+AA+I+G +P P +E P+F+LVS+AQTI+P
Sbjct  189   VCSEITAVTFRGPSDTHLDSLVGQALFGDGAAAMIIGADPIPEVEKPIFQLVSAAQTILP  248

Query  843   DTDSHLKLQLREMGLTFHCSKAVPSLITQNVEDCLVKAFEPFGISDWNSIFWILHPGGNA  1022
             D++  +   LRE+GLTFH  K VP LI++N++  L +AF+P GISDWNSIFWI HPGG A
Sbjct  249   DSEGAIDGHLREVGLTFHLLKDVPGLISKNIDKSLTEAFKPLGISDWNSIFWIAHPGGPA  308

Query  1023  ILDGVEEKLGLDPEKLRASRDVLSQYGNLTSACVLFILDEVRKKSKKQQQMTTGEGLEWG  1202
             ILD VE K GL PEKLRA+R VLS+YGN++SACV+FILDE+R+K  +    TTGEGLEWG
Sbjct  309   ILDQVEAKCGLKPEKLRATRHVLSEYGNMSSACVVFILDEMRRKGAEDGLKTTGEGLEWG  368

Query  1203  VLFGFGPGLTIDTVVIRSVPI  1265
             VLFGFGPGLT++TVV+ SV I
Sbjct  369   VLFGFGPGLTVETVVLHSVAI  389



>gb|AAM90651.1|AF400566_1 chalcone synthase 11 [Rubus idaeus]
Length=391

 Score =   545 bits (1405),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 257/382 (67%), Positives = 311/382 (81%), Gaps = 0/382 (0%)
 Frame = +3

Query  123   RAKRLEGDAKILAIGTATPANWVDQTTYPDFYFRITNSQHLLEHKEKFRRICNKSKIMKR  302
             +A+R EG A +LAIGTATP N +DQ+TYPD+YFRITNS+H  E KEKF+R+C+KS I KR
Sbjct  9     KAQRAEGPATVLAIGTATPPNCIDQSTYPDYYFRITNSEHKTELKEKFQRMCDKSMIKKR  68

Query  303   HLVLTEELLKKHPNLCTYNEASLNTRQDILVSGVPKLGKEAAMKAIKEWGRPISEITHLV  482
             ++ LTEE+LK++P++C Y   SL+ RQD++V  +PKLGKEAA KAIKEWG+P S+ITHLV
Sbjct  69    YMYLTEEILKENPSMCEYMAPSLDARQDMVVVEIPKLGKEAATKAIKEWGQPKSKITHLV  128

Query  483   FCTTSGVDMPGADFQLTKLLGLNSSVKRLMMYQQGCNAGAAMLRLAKDLAENNKGARVLV  662
             FCTTSGVDMPGAD+QLTKLLGL  SVKRLMMY QGC AG  +LRLAKDLAENN+GARVLV
Sbjct  129   FCTTSGVDMPGADYQLTKLLGLRPSVKRLMMYHQGCFAGGTVLRLAKDLAENNRGARVLV  188

Query  663   VCSEVMLSVFRGPSLQQEDNLLAQCLFGDGSAAVIVGTEPRPGLETPLFELVSSAQTIIP  842
             VCSE+    FRGPS    D+L+ Q LFGDG+AA+IVG +P P +E PLFELVS+AQTI+P
Sbjct  189   VCSEITAVTFRGPSDTHLDSLVGQALFGDGAAAIIVGADPLPKIERPLFELVSAAQTILP  248

Query  843   DTDSHLKLQLREMGLTFHCSKAVPSLITQNVEDCLVKAFEPFGISDWNSIFWILHPGGNA  1022
             D+D  +   LRE+GLTFH  K VP LI+ N+E  L +AF+P  I+DWNS+FWI HPGG A
Sbjct  249   DSDGAIDGHLREVGLTFHLLKDVPGLISNNIEKSLNEAFKPLDITDWNSLFWIAHPGGPA  308

Query  1023  ILDGVEEKLGLDPEKLRASRDVLSQYGNLTSACVLFILDEVRKKSKKQQQMTTGEGLEWG  1202
             ILD VE KLGL PEKL A+R +LS+YGN++SACVLFILDEVR+KS      TTGEGLEWG
Sbjct  309   ILDQVETKLGLKPEKLEATRHILSEYGNMSSACVLFILDEVRRKSATNGLKTTGEGLEWG  368

Query  1203  VLFGFGPGLTIDTVVIRSVPIN  1268
             VLFGFGPGLT++TVV+ SV + 
Sbjct  369   VLFGFGPGLTVETVVLHSVGVT  390



>sp|Q9MB39.1|CHS4_IPOBA RecName: Full=Chalcone synthase LF4; AltName: Full=Naringenin-chalcone 
synthase LF4 [Ipomoea batatas]
 dbj|BAA90329.1| chalcone systhase CHS-LF4 [Ipomoea batatas]
Length=393

 Score =   545 bits (1405),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 261/381 (69%), Positives = 310/381 (81%), Gaps = 1/381 (0%)
 Frame = +3

Query  123   RAKRLEGDAKILAIGTATPANWVDQTTYPDFYFRITNSQHLLEHKEKFRRICNKSKIMKR  302
             +A+R EG A ILAIGT TPAN V+Q+TYPD+YFRITNS+H  E KE+F+R+C+KS I KR
Sbjct  9     KAQRAEGPATILAIGTVTPANCVNQSTYPDYYFRITNSEHKTELKERFQRMCDKSMITKR  68

Query  303   HLVLTEELLKKHPNLCTYNEASLNTRQDILVSGVPKLGKEAAMKAIKEWGRPISEITHLV  482
             ++ LTEE+LK++P+ C Y   SL+ RQDI V  VPKLGKEAA  AIKEWG+P S+ITH+V
Sbjct  69    YMHLTEEILKENPSFCEYMAPSLDARQDIAVVEVPKLGKEAAQSAIKEWGQPKSKITHVV  128

Query  483   FCTTSGVDMPGADFQLTKLLGLNSSVKRLMMYQQGCNAGAAMLRLAKDLAENNKGARVLV  662
             FCTTSGVDMPGAD+QLTKLLGL  SVKRLMMYQQGC AG  +LRLAKDLAENNKGARVL+
Sbjct  129   FCTTSGVDMPGADYQLTKLLGLRPSVKRLMMYQQGCFAGGTVLRLAKDLAENNKGARVLI  188

Query  663   VCSEVMLSVFRGPSLQQEDNLLAQCLFGDGSAAVIVGTEPRPGLETPLFELVSSAQTIIP  842
             VCSE+ +  FRGPS    D+L+ Q LFGDG+AAVIVG +P P  E PLF+LVS+AQ + P
Sbjct  189   VCSEITVVTFRGPSETHLDSLVGQALFGDGAAAVIVGADPTPA-EKPLFQLVSAAQNLAP  247

Query  843   DTDSHLKLQLREMGLTFHCSKAVPSLITQNVEDCLVKAFEPFGISDWNSIFWILHPGGNA  1022
             D+   +   LRE+GLTFH  K VPS+++ N+E CL +AF P GISDWNS+FWI HPGG A
Sbjct  248   DSCGAIDGHLREVGLTFHLLKDVPSVVSNNIEKCLFEAFNPLGISDWNSVFWIAHPGGPA  307

Query  1023  ILDGVEEKLGLDPEKLRASRDVLSQYGNLTSACVLFILDEVRKKSKKQQQMTTGEGLEWG  1202
             ILD VE+KLGL PEKLRA+R VLS+YGN++SACVLFILDE+RK S      TTGEGLEWG
Sbjct  308   ILDQVEDKLGLKPEKLRATRHVLSEYGNMSSACVLFILDEMRKASSNAGLGTTGEGLEWG  367

Query  1203  VLFGFGPGLTIDTVVIRSVPI  1265
             VLFGFGPGLTI+TVV+ SVPI
Sbjct  368   VLFGFGPGLTIETVVLHSVPI  388



>dbj|BAB20074.1| chalcone synthase [Torenia hybrid cultivar]
Length=388

 Score =   545 bits (1404),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 258/381 (68%), Positives = 313/381 (82%), Gaps = 1/381 (0%)
 Frame = +3

Query  120   HRAKRLEGDAKILAIGTATPANWVDQTTYPDFYFRITNSQHLLEHKEKFRRICNKSKIMK  299
              RA+R EG A ILAIGT+TPAN VDQ+TYPD+YFRITNS+H+ E KEKF+R+C KS I K
Sbjct  8     RRAQRAEGPATILAIGTSTPANCVDQSTYPDYYFRITNSEHMTELKEKFKRMCEKSMIKK  67

Query  300   RHLVLTEELLKKHPNLCTYNEASLNTRQDILVSGVPKLGKEAAMKAIKEWGRPISEITHL  479
             R++ LTE+ LK++PN+C Y   SL+ RQDI+V  VPKLGKEAA KAIKEWG+P S+ITHL
Sbjct  68    RYMHLTEDYLKENPNVCAYMAPSLDARQDIVVVEVPKLGKEAAQKAIKEWGQPKSKITHL  127

Query  480   VFCTTSGVDMPGADFQLTKLLGLNSSVKRLMMYQQGCNAGAAMLRLAKDLAENNKGARVL  659
             +FCTTSGVDMPGAD+QLTKLLGL  SVKR MMYQQGC AG  +LR+AKDLAENN GARVL
Sbjct  128   IFCTTSGVDMPGADYQLTKLLGLRPSVKRFMMYQQGCFAGGTVLRMAKDLAENNAGARVL  187

Query  660   VVCSEVMLSVFRGPSLQQEDNLLAQCLFGDGSAAVIVGTEPRPGLETPLFELVSSAQTII  839
             VVCSE+    FRGPS    D+L+ Q LFGDG+AAVIVG++P   +E PLF++VS+AQTI+
Sbjct  188   VVCSEITAVTFRGPSESHLDSLVGQALFGDGAAAVIVGSDPM-SVERPLFQMVSAAQTIL  246

Query  840   PDTDSHLKLQLREMGLTFHCSKAVPSLITQNVEDCLVKAFEPFGISDWNSIFWILHPGGN  1019
             PD++  +   LRE+GLTFH  K VP +I++N+E  L +AF+P GISDWNSIFW  HPGG 
Sbjct  247   PDSEGAIDGHLREVGLTFHLLKDVPGIISKNIEKSLKEAFDPLGISDWNSIFWNAHPGGP  306

Query  1020  AILDGVEEKLGLDPEKLRASRDVLSQYGNLTSACVLFILDEVRKKSKKQQQMTTGEGLEW  1199
             AILD VEEKLGL P+KLRA+R VLS+YGN++SACVLFILDE+RK S K+   +TGEGL+W
Sbjct  307   AILDQVEEKLGLKPDKLRATRTVLSEYGNMSSACVLFILDEMRKASAKEGLGSTGEGLDW  366

Query  1200  GVLFGFGPGLTIDTVVIRSVP  1262
             GVLFGFGPGLT++TVV+ S P
Sbjct  367   GVLFGFGPGLTVETVVLHSTP  387



>gb|AAK49457.1| chalcone synthase [Nicotiana tabacum]
Length=389

 Score =   545 bits (1404),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 259/380 (68%), Positives = 313/380 (82%), Gaps = 0/380 (0%)
 Frame = +3

Query  120   HRAKRLEGDAKILAIGTATPANWVDQTTYPDFYFRITNSQHLLEHKEKFRRICNKSKIMK  299
              RA+  EG A ++AIGTATP+N VDQ+TYPD+YFRITNS+H +E KEKF+R+C KS I K
Sbjct  8     RRAQCAEGPATVMAIGTATPSNCVDQSTYPDYYFRITNSEHKVELKEKFKRMCEKSMIKK  67

Query  300   RHLVLTEELLKKHPNLCTYNEASLNTRQDILVSGVPKLGKEAAMKAIKEWGRPISEITHL  479
             R++ LTEE+LK++PN+C Y   SL+ RQDI+V  VPKLGKEAA KAIKEWG+P S+ITHL
Sbjct  68    RYMHLTEEILKENPNICAYMAPSLDARQDIVVVEVPKLGKEAAQKAIKEWGQPKSKITHL  127

Query  480   VFCTTSGVDMPGADFQLTKLLGLNSSVKRLMMYQQGCNAGAAMLRLAKDLAENNKGARVL  659
             VFCTTSGVDMPG D+QLTKLLGL  SVKR MMYQQGC AG  +LR+AKDLAENNKGARVL
Sbjct  128   VFCTTSGVDMPGCDYQLTKLLGLRPSVKRFMMYQQGCFAGGTVLRMAKDLAENNKGARVL  187

Query  660   VVCSEVMLSVFRGPSLQQEDNLLAQCLFGDGSAAVIVGTEPRPGLETPLFELVSSAQTII  839
             VVCSE+    FRGP+    D+L+ Q LFGDG+AAVI+G++P P +E PLFELVS+AQT++
Sbjct  188   VVCSEITAVTFRGPNDTHLDSLVGQALFGDGAAAVIIGSDPIPEVERPLFELVSAAQTLL  247

Query  840   PDTDSHLKLQLREMGLTFHCSKAVPSLITQNVEDCLVKAFEPFGISDWNSIFWILHPGGN  1019
             PD++  +   LRE+GLTFH  K VP LI++N+E  LV+AF+P GISDWNS+FWI HPGG 
Sbjct  248   PDSEGAIDGHLREVGLTFHLLKDVPGLISKNIEKSLVEAFQPLGISDWNSLFWIAHPGGP  307

Query  1020  AILDGVEEKLGLDPEKLRASRDVLSQYGNLTSACVLFILDEVRKKSKKQQQMTTGEGLEW  1199
             AILD VE KLGL  EKL+A+R VLS YGN++SACVLFILDE+RK S K+   TTGEGLEW
Sbjct  308   AILDQVELKLGLKQEKLKATRKVLSNYGNMSSACVLFILDEMRKASAKEGLGTTGEGLEW  367

Query  1200  GVLFGFGPGLTIDTVVIRSV  1259
             GVLFGFGPGLT++TVV+ SV
Sbjct  368   GVLFGFGPGLTVETVVLHSV  387



>ref|XP_011020680.1| PREDICTED: chalcone synthase 1-like isoform X2 [Populus euphratica]
Length=391

 Score =   545 bits (1404),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 258/379 (68%), Positives = 311/379 (82%), Gaps = 0/379 (0%)
 Frame = +3

Query  123   RAKRLEGDAKILAIGTATPANWVDQTTYPDFYFRITNSQHLLEHKEKFRRICNKSKIMKR  302
             + +R EG A I+AIGT+TP N VDQ+TYPD+YFRITNS+H  E KEKF+R+C KS I KR
Sbjct  9     KGQRAEGPATIMAIGTSTPPNCVDQSTYPDYYFRITNSEHKAELKEKFKRMCEKSMIKKR  68

Query  303   HLVLTEELLKKHPNLCTYNEASLNTRQDILVSGVPKLGKEAAMKAIKEWGRPISEITHLV  482
             ++ LTE++LK++PN+C Y   SL+ RQD++V  VPKLGKEAA KAIKEWG+  S+ITHLV
Sbjct  69    YMYLTEDILKENPNVCAYMAPSLDARQDMVVVEVPKLGKEAATKAIKEWGQSKSKITHLV  128

Query  483   FCTTSGVDMPGADFQLTKLLGLNSSVKRLMMYQQGCNAGAAMLRLAKDLAENNKGARVLV  662
             FCTTSGVDMPGAD+QLTKLLGL  SVKR MMYQQGC AG  +LRLAKD AENNKGARVLV
Sbjct  129   FCTTSGVDMPGADYQLTKLLGLRPSVKRFMMYQQGCFAGGTVLRLAKDHAENNKGARVLV  188

Query  663   VCSEVMLSVFRGPSLQQEDNLLAQCLFGDGSAAVIVGTEPRPGLETPLFELVSSAQTIIP  842
             VCSE+    FRGPS    D+L+ Q LFGDG+AA+I+G++P  G+E PLFELVS+AQTI+P
Sbjct  189   VCSEITAVTFRGPSDTHLDSLVGQALFGDGAAALIIGSDPVVGVEKPLFELVSAAQTILP  248

Query  843   DTDSHLKLQLREMGLTFHCSKAVPSLITQNVEDCLVKAFEPFGISDWNSIFWILHPGGNA  1022
             D+D  +   LRE+GLTFH  K VP LI++NVE  L +AF+P GISDWNS+FWI HPGG A
Sbjct  249   DSDGAIDGHLREVGLTFHLLKDVPGLISKNVEKSLTEAFKPLGISDWNSLFWIAHPGGPA  308

Query  1023  ILDGVEEKLGLDPEKLRASRDVLSQYGNLTSACVLFILDEVRKKSKKQQQMTTGEGLEWG  1202
             ILD VE KLGL PEKLRA+R VLS+YGN++SACVLFILDE+RKKS +    +TGEGLEWG
Sbjct  309   ILDQVEAKLGLKPEKLRATRHVLSEYGNMSSACVLFILDEMRKKSAEDGLQSTGEGLEWG  368

Query  1203  VLFGFGPGLTIDTVVIRSV  1259
             VLFGFGPGL+++TVV+ SV
Sbjct  369   VLFGFGPGLSVETVVVHSV  387



>sp|P49440.1|CHSY_PHAVU RecName: Full=Chalcone synthase 17; AltName: Full=Naringenin-chalcone 
synthase 17 [Phaseolus vulgaris]
 emb|CAA29700.1| unnamed protein product [Phaseolus vulgaris]
Length=389

 Score =   545 bits (1404),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 258/382 (68%), Positives = 313/382 (82%), Gaps = 0/382 (0%)
 Frame = +3

Query  120   HRAKRLEGDAKILAIGTATPANWVDQTTYPDFYFRITNSQHLLEHKEKFRRICNKSKIMK  299
              +A+R EG A ILAIGTATP+N VDQ+TYPD+YFRITNS+H+ + KEKF+R+C+KS I K
Sbjct  8     RQAQRAEGPATILAIGTATPSNCVDQSTYPDYYFRITNSEHMTDLKEKFQRMCDKSMIKK  67

Query  300   RHLVLTEELLKKHPNLCTYNEASLNTRQDILVSGVPKLGKEAAMKAIKEWGRPISEITHL  479
             R++ L EE+LK++PN+C Y   SL+ RQDI+V  VPKLGKEAA+KAIKEWG+P S+ITHL
Sbjct  68    RYMHLNEEILKENPNMCAYMAPSLDARQDIVVVEVPKLGKEAAVKAIKEWGQPKSKITHL  127

Query  480   VFCTTSGVDMPGADFQLTKLLGLNSSVKRLMMYQQGCNAGAAMLRLAKDLAENNKGARVL  659
             +FCTTSGVDMPGAD+QLTKLLGL   VKR MMYQQGC AG  +LRLAKDLAENNKGARVL
Sbjct  128   IFCTTSGVDMPGADYQLTKLLGLRPYVKRYMMYQQGCFAGGTVLRLAKDLAENNKGARVL  187

Query  660   VVCSEVMLSVFRGPSLQQEDNLLAQCLFGDGSAAVIVGTEPRPGLETPLFELVSSAQTII  839
             VVCSE+    FRGPS    D+L+ Q LFGDG+AAVIVG++P P +E PLFELV +AQTI 
Sbjct  188   VVCSEITAVTFRGPSDTHLDSLVGQALFGDGAAAVIVGSDPIPQIEKPLFELVWTAQTIA  247

Query  840   PDTDSHLKLQLREMGLTFHCSKAVPSLITQNVEDCLVKAFEPFGISDWNSIFWILHPGGN  1019
             PD+D  +   LRE+GLTFH  K VP ++++N+   L +AF P  ISD+NSIFWI HPGG 
Sbjct  248   PDSDGAIDGHLREVGLTFHLLKDVPGIVSKNIGKALFEAFNPLNISDYNSIFWIAHPGGP  307

Query  1020  AILDGVEEKLGLDPEKLRASRDVLSQYGNLTSACVLFILDEVRKKSKKQQQMTTGEGLEW  1199
             AILD VE+KLGL PEK++A+RDVLS YGN++ ACVLFILDE+R+KS ++   TTGEGLEW
Sbjct  308   AILDQVEQKLGLKPEKMKATRDVLSDYGNMSGACVLFILDEMRRKSAEKGLKTTGEGLEW  367

Query  1200  GVLFGFGPGLTIDTVVIRSVPI  1265
             GVLFGFGPGLTI+TVV+ SV I
Sbjct  368   GVLFGFGPGLTIETVVLHSVAI  389



>gb|ACS36661.1| CHS4 [Vitis labrusca x Vitis vinifera]
Length=393

 Score =   545 bits (1404),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 260/379 (69%), Positives = 312/379 (82%), Gaps = 0/379 (0%)
 Frame = +3

Query  123   RAKRLEGDAKILAIGTATPANWVDQTTYPDFYFRITNSQHLLEHKEKFRRICNKSKIMKR  302
             +A+R EG A +LAIGTATPAN V Q  YPD+YFRITNS+H+ E KEKF+R+C KS I KR
Sbjct  9     KAQRAEGPATVLAIGTATPANCVYQADYPDYYFRITNSEHMTELKEKFKRMCEKSMINKR  68

Query  303   HLVLTEELLKKHPNLCTYNEASLNTRQDILVSGVPKLGKEAAMKAIKEWGRPISEITHLV  482
             ++ LTEE+LK++PN+C Y   SL+ RQD++V  VPKLGKEAA+KAIKEWG+P S+ITHLV
Sbjct  69    YMHLTEEILKENPNVCAYMAPSLDARQDMVVVEVPKLGKEAAVKAIKEWGQPKSKITHLV  128

Query  483   FCTTSGVDMPGADFQLTKLLGLNSSVKRLMMYQQGCNAGAAMLRLAKDLAENNKGARVLV  662
             FCTTSGVDMPGAD+QLTKLLGL  SVKRLMMYQQGC AG  +LRLAKDLAENN G+RVLV
Sbjct  129   FCTTSGVDMPGADYQLTKLLGLKPSVKRLMMYQQGCFAGGTVLRLAKDLAENNAGSRVLV  188

Query  663   VCSEVMLSVFRGPSLQQEDNLLAQCLFGDGSAAVIVGTEPRPGLETPLFELVSSAQTIIP  842
             VC E+    FRGPS    D+L+ Q LFGDG+AAVI+G +P   +E PLFELVS+AQTI+P
Sbjct  189   VCPEITAVTFRGPSDTHLDSLVGQALFGDGAAAVIIGADPDTKIERPLFELVSAAQTILP  248

Query  843   DTDSHLKLQLREMGLTFHCSKAVPSLITQNVEDCLVKAFEPFGISDWNSIFWILHPGGNA  1022
             D++  +   LRE+GLTFH  K VP LI++N+E  LV+AF P GISDWNS+FWI HPGG A
Sbjct  249   DSEGAIDGHLREVGLTFHLLKDVPGLISKNIEKSLVEAFTPIGISDWNSLFWIAHPGGPA  308

Query  1023  ILDGVEEKLGLDPEKLRASRDVLSQYGNLTSACVLFILDEVRKKSKKQQQMTTGEGLEWG  1202
             ILD VE KLGL  EKLRA+R VLS+YGN++SACVLFILDE+RKKS ++ + +TGEGLEWG
Sbjct  309   ILDQVELKLGLKEEKLRATRHVLSEYGNMSSACVLFILDEMRKKSIEEGKASTGEGLEWG  368

Query  1203  VLFGFGPGLTIDTVVIRSV  1259
             VLFGFGPGLTI+TVV+ SV
Sbjct  369   VLFGFGPGLTIETVVLHSV  387



>sp|Q8RVK9.1|CHS_CANSA RecName: Full=Naringenin-chalcone synthase [Cannabis sativa]
 gb|AAL92879.1| chalcone synthase [Cannabis sativa]
Length=389

 Score =   545 bits (1404),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 262/382 (69%), Positives = 313/382 (82%), Gaps = 0/382 (0%)
 Frame = +3

Query  120   HRAKRLEGDAKILAIGTATPANWVDQTTYPDFYFRITNSQHLLEHKEKFRRICNKSKIMK  299
              +A+R EG A I+AIGTATPAN V Q+ YPD+YFRITNS+H  E KEKF+R+C+KS I K
Sbjct  8     RKAQRAEGPATIMAIGTATPANCVLQSEYPDYYFRITNSEHKTELKEKFKRMCDKSMIRK  67

Query  300   RHLVLTEELLKKHPNLCTYNEASLNTRQDILVSGVPKLGKEAAMKAIKEWGRPISEITHL  479
             R++ LTEE+LK++PNLC Y   SL+ RQD++V  VPKLGKEAA KAIKEWG+P S+ITHL
Sbjct  68    RYMHLTEEILKENPNLCAYEAPSLDARQDMVVVEVPKLGKEAATKAIKEWGQPKSKITHL  127

Query  480   VFCTTSGVDMPGADFQLTKLLGLNSSVKRLMMYQQGCNAGAAMLRLAKDLAENNKGARVL  659
             VFCTTSGVDMPGAD+QLTKLLGL  SVKRLMMYQQGC AG  +LRLAKDLAENNKGARVL
Sbjct  128   VFCTTSGVDMPGADYQLTKLLGLRPSVKRLMMYQQGCFAGGTVLRLAKDLAENNKGARVL  187

Query  660   VVCSEVMLSVFRGPSLQQEDNLLAQCLFGDGSAAVIVGTEPRPGLETPLFELVSSAQTII  839
             VVCSE+    FRGP+    D+L+ Q LFGDGSAA+IVG++P P +E P+FELVS+AQTI+
Sbjct  188   VVCSEITAVTFRGPNDTHLDSLVGQALFGDGSAALIVGSDPIPEVEKPIFELVSAAQTIL  247

Query  840   PDTDSHLKLQLREMGLTFHCSKAVPSLITQNVEDCLVKAFEPFGISDWNSIFWILHPGGN  1019
             PD+D  +   LRE+GLTFH  K VP LI++N+E  L +AF+P GISDWNS+FWI HPGG 
Sbjct  248   PDSDGAIDGHLREVGLTFHLLKDVPGLISKNIEKSLNEAFKPLGISDWNSLFWIAHPGGP  307

Query  1020  AILDGVEEKLGLDPEKLRASRDVLSQYGNLTSACVLFILDEVRKKSKKQQQMTTGEGLEW  1199
             AILD VE KL L  EKLRA+R VLS+YGN++SACVLFILDE+R+K  +    TTGEGLEW
Sbjct  308   AILDQVESKLALKTEKLRATRHVLSEYGNMSSACVLFILDEMRRKCVEDGLNTTGEGLEW  367

Query  1200  GVLFGFGPGLTIDTVVIRSVPI  1265
             GVLFGFGPGLT++TVV+ SV I
Sbjct  368   GVLFGFGPGLTVETVVLHSVAI  389



>ref|XP_008224579.1| PREDICTED: polyketide synthase 5-like [Prunus mume]
Length=391

 Score =   545 bits (1404),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 254/383 (66%), Positives = 316/383 (83%), Gaps = 0/383 (0%)
 Frame = +3

Query  120   HRAKRLEGDAKILAIGTATPANWVDQTTYPDFYFRITNSQHLLEHKEKFRRICNKSKIMK  299
              +A+R EG A +LAIGTATP N ++Q TYPD+YFRITNS+H +E KEKF+R+C+KS I K
Sbjct  8     RKAQRAEGPATVLAIGTATPPNCIEQATYPDYYFRITNSEHKVELKEKFQRMCDKSMIKK  67

Query  300   RHLVLTEELLKKHPNLCTYNEASLNTRQDILVSGVPKLGKEAAMKAIKEWGRPISEITHL  479
             R++ LTE++LK++P++C Y   SL+ RQD++V  +PKLGKEAA KAIKEWG+P S+ITHL
Sbjct  68    RYMYLTEDILKENPSMCEYMAPSLDARQDMVVVEIPKLGKEAATKAIKEWGQPKSKITHL  127

Query  480   VFCTTSGVDMPGADFQLTKLLGLNSSVKRLMMYQQGCNAGAAMLRLAKDLAENNKGARVL  659
             VFCTTSGVDMPGAD+QLTKLLGL  SVKRLMMYQQGC AG  +LRLAKDLAENN+GARVL
Sbjct  128   VFCTTSGVDMPGADYQLTKLLGLRPSVKRLMMYQQGCFAGGTVLRLAKDLAENNRGARVL  187

Query  660   VVCSEVMLSVFRGPSLQQEDNLLAQCLFGDGSAAVIVGTEPRPGLETPLFELVSSAQTII  839
             VVCSE+    FRGP+    D+L+ Q LFGDG+AA+IVG +P P +E PLFE+VS+AQTI+
Sbjct  188   VVCSEITAVTFRGPNDTHLDSLVGQALFGDGAAAIIVGADPIPEIEKPLFEVVSAAQTIL  247

Query  840   PDTDSHLKLQLREMGLTFHCSKAVPSLITQNVEDCLVKAFEPFGISDWNSIFWILHPGGN  1019
             PD+D  +   LRE+GLTFH  K VP LI++N+E  L +AF+P GISDWNS+FWI HPGG 
Sbjct  248   PDSDGAIDGHLREVGLTFHLLKDVPGLISKNIEKSLNEAFQPLGISDWNSLFWIAHPGGP  307

Query  1020  AILDGVEEKLGLDPEKLRASRDVLSQYGNLTSACVLFILDEVRKKSKKQQQMTTGEGLEW  1199
             AILD VE KL L PEKL A+R +LS+YGN++SACVLFILDEVRK++ K+   TTG+GL+W
Sbjct  308   AILDQVESKLALKPEKLEATRHILSEYGNMSSACVLFILDEVRKRATKKGLKTTGDGLDW  367

Query  1200  GVLFGFGPGLTIDTVVIRSVPIN  1268
             GVLFGFGPGLT++TVV+ SV +N
Sbjct  368   GVLFGFGPGLTVETVVLHSVGLN  390



>gb|AAM90650.1|AF400565_1 chalcone synthase 5 [Rubus idaeus]
Length=391

 Score =   545 bits (1404),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 259/383 (68%), Positives = 311/383 (81%), Gaps = 0/383 (0%)
 Frame = +3

Query  120   HRAKRLEGDAKILAIGTATPANWVDQTTYPDFYFRITNSQHLLEHKEKFRRICNKSKIMK  299
              +A+R EG A ILAIGTATP N VDQ+TYPD+YFRIT S+H  E KEKF+R+C+KS I K
Sbjct  8     RKAQRAEGPATILAIGTATPPNCVDQSTYPDYYFRITKSEHKTELKEKFQRMCDKSMIKK  67

Query  300   RHLVLTEELLKKHPNLCTYNEASLNTRQDILVSGVPKLGKEAAMKAIKEWGRPISEITHL  479
             R++ LTEE+LK++P++C Y   SL+ RQD++V  +PKLGKEAA KAIKEWG+P S+ITHL
Sbjct  68    RYMYLTEEILKENPSMCEYMAPSLDARQDMVVVEIPKLGKEAATKAIKEWGQPKSKITHL  127

Query  480   VFCTTSGVDMPGADFQLTKLLGLNSSVKRLMMYQQGCNAGAAMLRLAKDLAENNKGARVL  659
             VFCTTSGVDMPGAD+QLTKLLGL  SVKRLMMYQQGC AG  +LRLAKDLAENN+GARVL
Sbjct  128   VFCTTSGVDMPGADYQLTKLLGLRPSVKRLMMYQQGCFAGGTVLRLAKDLAENNRGARVL  187

Query  660   VVCSEVMLSVFRGPSLQQEDNLLAQCLFGDGSAAVIVGTEPRPGLETPLFELVSSAQTII  839
             VVCSE+    FRGPS    D L+ Q LFGDG+AA+IVG +P P +E PLFELVS+AQTI+
Sbjct  188   VVCSEITAVTFRGPSDTHLDILVGQALFGDGAAAIIVGADPLPKIERPLFELVSAAQTIL  247

Query  840   PDTDSHLKLQLREMGLTFHCSKAVPSLITQNVEDCLVKAFEPFGISDWNSIFWILHPGGN  1019
             PD+D  +   LRE+GLTFH  K VP LI++N+E  L +AF+P  I+DWNS+FWI HPGG 
Sbjct  248   PDSDGAIDGHLREVGLTFHLLKDVPGLISKNIEKSLNEAFKPLDITDWNSLFWIAHPGGP  307

Query  1020  AILDGVEEKLGLDPEKLRASRDVLSQYGNLTSACVLFILDEVRKKSKKQQQMTTGEGLEW  1199
             AILD VE KLGL PEKL A+R +LS+YGN++SACVLFILDEVR+KS      TTGEGLEW
Sbjct  308   AILDQVETKLGLKPEKLEATRHILSEYGNMSSACVLFILDEVRRKSATNGLKTTGEGLEW  367

Query  1200  GVLFGFGPGLTIDTVVIRSVPIN  1268
             GVLFGFGPGLT++TVV+ SV + 
Sbjct  368   GVLFGFGPGLTVETVVLHSVGVT  390



>ref|NP_001267879.1| chalcone synthase [Vitis vinifera]
 gb|ABM67586.1| chalcone synthase [Vitis vinifera]
Length=393

 Score =   545 bits (1404),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 260/379 (69%), Positives = 312/379 (82%), Gaps = 0/379 (0%)
 Frame = +3

Query  123   RAKRLEGDAKILAIGTATPANWVDQTTYPDFYFRITNSQHLLEHKEKFRRICNKSKIMKR  302
             +A+R EG A +LAIGTATPAN V Q  YPD+YFRITNS+H+ E KEKF+R+C KS I KR
Sbjct  9     KAQRAEGPATVLAIGTATPANCVYQADYPDYYFRITNSEHMTELKEKFKRMCEKSMINKR  68

Query  303   HLVLTEELLKKHPNLCTYNEASLNTRQDILVSGVPKLGKEAAMKAIKEWGRPISEITHLV  482
             ++ LTEE+LK++PN+C Y   SL+ RQD++V  VPKLGKEAA KAIKEWG+P S+ITHLV
Sbjct  69    YMHLTEEILKENPNVCAYMAPSLDARQDMVVVEVPKLGKEAAAKAIKEWGQPKSKITHLV  128

Query  483   FCTTSGVDMPGADFQLTKLLGLNSSVKRLMMYQQGCNAGAAMLRLAKDLAENNKGARVLV  662
             FCTTSGVDMPGAD+QLTKLLGL  SVKRLMMYQQGC AG  +LRLAKDLAENN G+RVLV
Sbjct  129   FCTTSGVDMPGADYQLTKLLGLKPSVKRLMMYQQGCFAGGTVLRLAKDLAENNAGSRVLV  188

Query  663   VCSEVMLSVFRGPSLQQEDNLLAQCLFGDGSAAVIVGTEPRPGLETPLFELVSSAQTIIP  842
             VCSE+    FRGPS    D+L+ Q LFGDG+AAVI+G +P   +E PLFELVS+AQTI+P
Sbjct  189   VCSEITAVTFRGPSDTHLDSLVGQALFGDGAAAVIIGADPDTKIERPLFELVSAAQTILP  248

Query  843   DTDSHLKLQLREMGLTFHCSKAVPSLITQNVEDCLVKAFEPFGISDWNSIFWILHPGGNA  1022
             D++  +   LRE+GLTFH  K VP LI++N+E  LV+AF P GISDWNS+FWI HPGG A
Sbjct  249   DSEGAIDGHLREVGLTFHLLKDVPGLISKNIEKSLVEAFTPIGISDWNSLFWIAHPGGPA  308

Query  1023  ILDGVEEKLGLDPEKLRASRDVLSQYGNLTSACVLFILDEVRKKSKKQQQMTTGEGLEWG  1202
             ILD VE KLGL  EKLRA+R VLS+YGN++SACVLFILDE+RKKS ++ + +TGEGLEWG
Sbjct  309   ILDQVELKLGLKEEKLRATRHVLSEYGNMSSACVLFILDEMRKKSIEEGKGSTGEGLEWG  368

Query  1203  VLFGFGPGLTIDTVVIRSV  1259
             VLFGFGPGLT++TVV+ SV
Sbjct  369   VLFGFGPGLTVETVVLHSV  387



>ref|XP_004306543.1| PREDICTED: chalcone synthase 2-like [Fragaria vesca subsp. vesca]
Length=389

 Score =   545 bits (1403),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 255/379 (67%), Positives = 312/379 (82%), Gaps = 0/379 (0%)
 Frame = +3

Query  123   RAKRLEGDAKILAIGTATPANWVDQTTYPDFYFRITNSQHLLEHKEKFRRICNKSKIMKR  302
             +A+R EG A +LAIGTATP N +DQ+TYPD+YFRITNS+H  E KEKF+R+C+KS I KR
Sbjct  9     KAQRAEGPATVLAIGTATPPNCIDQSTYPDYYFRITNSEHKAELKEKFQRMCDKSMIKKR  68

Query  303   HLVLTEELLKKHPNLCTYNEASLNTRQDILVSGVPKLGKEAAMKAIKEWGRPISEITHLV  482
             ++ LTEE+LK++P++C Y   SL+ RQD++V  +PKLGKEAA+KAIKEWG+P S+ITHLV
Sbjct  69    YMYLTEEILKENPSMCEYMAPSLDARQDMVVVEIPKLGKEAAVKAIKEWGQPKSKITHLV  128

Query  483   FCTTSGVDMPGADFQLTKLLGLNSSVKRLMMYQQGCNAGAAMLRLAKDLAENNKGARVLV  662
             FCTTSGVDMPGAD+QLTKLLGL  SVKRLMMYQQGC AG  +LRLAKDLAENN+GARVLV
Sbjct  129   FCTTSGVDMPGADYQLTKLLGLRPSVKRLMMYQQGCFAGGTVLRLAKDLAENNRGARVLV  188

Query  663   VCSEVMLSVFRGPSLQQEDNLLAQCLFGDGSAAVIVGTEPRPGLETPLFELVSSAQTIIP  842
             VCSE+    FRGPS    D+L+ Q LFGDG+AA+IVG++P P +E PLFELVS+AQTI+P
Sbjct  189   VCSEITAVTFRGPSDTHLDSLVGQALFGDGAAAIIVGSDPLPEVERPLFELVSAAQTILP  248

Query  843   DTDSHLKLQLREMGLTFHCSKAVPSLITQNVEDCLVKAFEPFGISDWNSIFWILHPGGNA  1022
             D+D  +   LRE+GLTFH  K VP LI++N+E  L +AF+P  I+DWNS+FWI HPGG A
Sbjct  249   DSDGAIDGHLREVGLTFHLLKDVPGLISKNIEKSLNEAFKPLNITDWNSLFWIAHPGGPA  308

Query  1023  ILDGVEEKLGLDPEKLRASRDVLSQYGNLTSACVLFILDEVRKKSKKQQQMTTGEGLEWG  1202
             ILD VE KL L PEKL A+R +LS+YGN++SACVLFILDEVR++S      TTGEG EWG
Sbjct  309   ILDQVEAKLALKPEKLEATRHILSEYGNMSSACVLFILDEVRRRSAANGHKTTGEGKEWG  368

Query  1203  VLFGFGPGLTIDTVVIRSV  1259
             VLFGFGPGLT++TVV+ SV
Sbjct  369   VLFGFGPGLTVETVVLHSV  387



>gb|AHZ30595.1| chalcone synthase, partial [Prunus domestica]
Length=375

 Score =   544 bits (1402),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 256/375 (68%), Positives = 310/375 (83%), Gaps = 0/375 (0%)
 Frame = +3

Query  123   RAKRLEGDAKILAIGTATPANWVDQTTYPDFYFRITNSQHLLEHKEKFRRICNKSKIMKR  302
             +A+R EG A +LAIGTATP N VDQ TYPD+YFRITNS+H  E KEKF+R+C+KS I KR
Sbjct  1     QAQRAEGPATVLAIGTATPPNCVDQATYPDYYFRITNSEHKTELKEKFQRMCDKSMIKKR  60

Query  303   HLVLTEELLKKHPNLCTYNEASLNTRQDILVSGVPKLGKEAAMKAIKEWGRPISEITHLV  482
             ++ LTEE+LK++P +C Y   SL+ RQD++V  +PKLGKEAA KAIKEWG+P S+ITHLV
Sbjct  61    YMYLTEEILKENPTMCEYMAPSLDARQDMVVVEIPKLGKEAATKAIKEWGQPKSKITHLV  120

Query  483   FCTTSGVDMPGADFQLTKLLGLNSSVKRLMMYQQGCNAGAAMLRLAKDLAENNKGARVLV  662
             FCTTSGVDMPGAD+QLTKLLGL SSVKRLMMYQQGC AG  +LRLAKDLAENN+GARVLV
Sbjct  121   FCTTSGVDMPGADYQLTKLLGLRSSVKRLMMYQQGCFAGGTVLRLAKDLAENNRGARVLV  180

Query  663   VCSEVMLSVFRGPSLQQEDNLLAQCLFGDGSAAVIVGTEPRPGLETPLFELVSSAQTIIP  842
             VCSE+    FRGPS    D+L+ Q LFGDG+AA+IVG +P P +E PLFE+VS+AQTI+P
Sbjct  181   VCSEITAVTFRGPSDTHLDSLVGQALFGDGAAAIIVGADPIPEIEKPLFEVVSAAQTILP  240

Query  843   DTDSHLKLQLREMGLTFHCSKAVPSLITQNVEDCLVKAFEPFGISDWNSIFWILHPGGNA  1022
             D+D  +   LRE+GLTFH  K VP LI++N+E  L +AF+P GISDWNS+FWI HPGG A
Sbjct  241   DSDGAIDGHLREVGLTFHLLKDVPGLISKNIEKSLNEAFQPLGISDWNSLFWIAHPGGPA  300

Query  1023  ILDGVEEKLGLDPEKLRASRDVLSQYGNLTSACVLFILDEVRKKSKKQQQMTTGEGLEWG  1202
             ILD VE KL L PEKL A+R +LS+YGN++SACVLFILDEVRK++ K+   TTG+GL+WG
Sbjct  301   ILDQVESKLALKPEKLEATRHILSEYGNMSSACVLFILDEVRKRATKKGLKTTGDGLDWG  360

Query  1203  VLFGFGPGLTIDTVV  1247
             VLFGFGPGLT++TVV
Sbjct  361   VLFGFGPGLTVETVV  375



>sp|Q9MB36.1|CHS8_IPOBA RecName: Full=Chalcone synthase DIV; AltName: Full=Naringenin-chalcone 
synthase DIV [Ipomoea batatas]
 dbj|BAA90332.1| chalcone synthase CHS-DIV [Ipomoea batatas]
Length=388

 Score =   545 bits (1403),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 260/380 (68%), Positives = 310/380 (82%), Gaps = 1/380 (0%)
 Frame = +3

Query  123   RAKRLEGDAKILAIGTATPANWVDQTTYPDFYFRITNSQHLLEHKEKFRRICNKSKIMKR  302
             +A+R EG A ILAIGT TPAN V+Q+TYPD+YFRITNS+H  E KEKF+R+C+KS I KR
Sbjct  9     KAQRAEGPATILAIGTVTPANCVNQSTYPDYYFRITNSEHKTELKEKFQRMCDKSMITKR  68

Query  303   HLVLTEELLKKHPNLCTYNEASLNTRQDILVSGVPKLGKEAAMKAIKEWGRPISEITHLV  482
             ++ LTEE+LK++P+ C Y   SL+ RQDI V  VPKLGKEAA  AIKEWG+P S+ITH+V
Sbjct  69    YMHLTEEILKENPSFCEYMAPSLDARQDIAVVEVPKLGKEAAQSAIKEWGQPKSKITHVV  128

Query  483   FCTTSGVDMPGADFQLTKLLGLNSSVKRLMMYQQGCNAGAAMLRLAKDLAENNKGARVLV  662
             FCTTSG+DMPGAD+QLTKLLGL  SVKRLMMYQQGC AG  +LRLAKDLAENNKGARVL+
Sbjct  129   FCTTSGIDMPGADYQLTKLLGLRPSVKRLMMYQQGCFAGGTVLRLAKDLAENNKGARVLI  188

Query  663   VCSEVMLSVFRGPSLQQEDNLLAQCLFGDGSAAVIVGTEPRPGLETPLFELVSSAQTIIP  842
             VCSE+ +  FRGPS    D+L+ Q LFGDG+AAVIVG +P P  E PLF+LVS+AQT+ P
Sbjct  189   VCSEITVVTFRGPSETHLDSLVGQALFGDGAAAVIVGADPTPA-EKPLFQLVSAAQTLAP  247

Query  843   DTDSHLKLQLREMGLTFHCSKAVPSLITQNVEDCLVKAFEPFGISDWNSIFWILHPGGNA  1022
             ++   +   LRE+GLTFH  K VPS+++ N+E CL +AF P GISDWNS+FWI HPGG A
Sbjct  248   NSCGAIDGHLREVGLTFHLLKDVPSVVSNNIEKCLFEAFNPLGISDWNSVFWIAHPGGPA  307

Query  1023  ILDGVEEKLGLDPEKLRASRDVLSQYGNLTSACVLFILDEVRKKSKKQQQMTTGEGLEWG  1202
             ILD VE+KLGL PEKLRA+R VLS+YGN++SACVLFILDE+RK S      TTGEGLEWG
Sbjct  308   ILDQVEDKLGLKPEKLRATRHVLSEYGNMSSACVLFILDEMRKASSNAGLGTTGEGLEWG  367

Query  1203  VLFGFGPGLTIDTVVIRSVP  1262
             VLFGFGPGLTI+TVV+ SVP
Sbjct  368   VLFGFGPGLTIETVVLHSVP  387



>ref|XP_007157042.1| hypothetical protein PHAVU_002G038600g [Phaseolus vulgaris]
 gb|ESW29036.1| hypothetical protein PHAVU_002G038600g [Phaseolus vulgaris]
Length=389

 Score =   545 bits (1403),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 258/382 (68%), Positives = 313/382 (82%), Gaps = 0/382 (0%)
 Frame = +3

Query  120   HRAKRLEGDAKILAIGTATPANWVDQTTYPDFYFRITNSQHLLEHKEKFRRICNKSKIMK  299
              +A+R EG A ILAIGTATP+N VDQ+TYPD+YFRITNS+H+ + KEKF+R+C+KS I K
Sbjct  8     RQAQRAEGPATILAIGTATPSNCVDQSTYPDYYFRITNSEHMTDLKEKFQRMCDKSMIKK  67

Query  300   RHLVLTEELLKKHPNLCTYNEASLNTRQDILVSGVPKLGKEAAMKAIKEWGRPISEITHL  479
             R++ L EE+LK++PN+C Y   SL+ RQDI+V  VPKLGKEAA+KAIKEWG+P S+ITHL
Sbjct  68    RYMHLDEEILKENPNMCAYMAPSLDARQDIVVVEVPKLGKEAAVKAIKEWGQPKSKITHL  127

Query  480   VFCTTSGVDMPGADFQLTKLLGLNSSVKRLMMYQQGCNAGAAMLRLAKDLAENNKGARVL  659
             +FCTTSGVDMPGAD+QLTKLLGL   VKR MMYQQGC AG  +LRLAKDLAENNKGARVL
Sbjct  128   IFCTTSGVDMPGADYQLTKLLGLRPYVKRYMMYQQGCFAGGTVLRLAKDLAENNKGARVL  187

Query  660   VVCSEVMLSVFRGPSLQQEDNLLAQCLFGDGSAAVIVGTEPRPGLETPLFELVSSAQTII  839
             VVCSE+    FRGPS    D+L+ Q LFGDG+AAVIVG++P P +E PLFELV +AQTI 
Sbjct  188   VVCSEITAVTFRGPSDTHLDSLVGQALFGDGAAAVIVGSDPIPQIEKPLFELVWTAQTIA  247

Query  840   PDTDSHLKLQLREMGLTFHCSKAVPSLITQNVEDCLVKAFEPFGISDWNSIFWILHPGGN  1019
             PD+D  +   LRE+GLTFH  K VP ++++N+   L +AF P  ISD+NSIFWI HPGG 
Sbjct  248   PDSDGAIDGHLREVGLTFHLLKDVPGIVSKNIGKALFEAFNPLNISDYNSIFWIAHPGGP  307

Query  1020  AILDGVEEKLGLDPEKLRASRDVLSQYGNLTSACVLFILDEVRKKSKKQQQMTTGEGLEW  1199
             AILD VE+KLGL PEK++A+RDVLS YGN++SACVLFILDE+R+KS +    TTGEGLEW
Sbjct  308   AILDQVEQKLGLKPEKMKATRDVLSNYGNMSSACVLFILDEMRRKSVENGLKTTGEGLEW  367

Query  1200  GVLFGFGPGLTIDTVVIRSVPI  1265
             GVLFGFGPGLTI+TVV+ SV +
Sbjct  368   GVLFGFGPGLTIETVVLHSVAV  389



>ref|XP_007157053.1| hypothetical protein PHAVU_002G039300g [Phaseolus vulgaris]
 gb|ESW29047.1| hypothetical protein PHAVU_002G039300g [Phaseolus vulgaris]
Length=389

 Score =   545 bits (1403),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 257/382 (67%), Positives = 313/382 (82%), Gaps = 0/382 (0%)
 Frame = +3

Query  120   HRAKRLEGDAKILAIGTATPANWVDQTTYPDFYFRITNSQHLLEHKEKFRRICNKSKIMK  299
              + +R EG A ILAIGTATP+N VDQ+TYPD+YFRITNS+H+ + KEKF+R+C+KS I K
Sbjct  8     RQVQRAEGPATILAIGTATPSNCVDQSTYPDYYFRITNSEHMTDLKEKFQRMCDKSMIKK  67

Query  300   RHLVLTEELLKKHPNLCTYNEASLNTRQDILVSGVPKLGKEAAMKAIKEWGRPISEITHL  479
             R++ L EE+LK++PN+C Y   SL+ RQDI+V  VPKLGKEAA+KAIKEWG+P S+ITHL
Sbjct  68    RYMHLNEEILKENPNMCAYMAPSLDARQDIVVVEVPKLGKEAAVKAIKEWGQPKSKITHL  127

Query  480   VFCTTSGVDMPGADFQLTKLLGLNSSVKRLMMYQQGCNAGAAMLRLAKDLAENNKGARVL  659
             +FCTTSGVDMPGAD+QLTKLLGL   VKR MMYQQGC AG  +LR+AKDLAENNKGARVL
Sbjct  128   IFCTTSGVDMPGADYQLTKLLGLRPYVKRYMMYQQGCFAGGTVLRMAKDLAENNKGARVL  187

Query  660   VVCSEVMLSVFRGPSLQQEDNLLAQCLFGDGSAAVIVGTEPRPGLETPLFELVSSAQTII  839
             VVCSE+    FRGPS    D+L+ Q LFGDG+AAVIVG++P P +E PLFELV +AQTI 
Sbjct  188   VVCSEITAVTFRGPSDTHLDSLVGQALFGDGAAAVIVGSDPIPQIEKPLFELVWTAQTIA  247

Query  840   PDTDSHLKLQLREMGLTFHCSKAVPSLITQNVEDCLVKAFEPFGISDWNSIFWILHPGGN  1019
             PD+D  +   LRE+GLTFH  K VP ++++N+   L +AF P  ISD+NSIFWI HPGG 
Sbjct  248   PDSDGAIDGHLREVGLTFHLLKDVPGIVSKNIGKALFEAFNPLNISDYNSIFWIAHPGGP  307

Query  1020  AILDGVEEKLGLDPEKLRASRDVLSQYGNLTSACVLFILDEVRKKSKKQQQMTTGEGLEW  1199
             AILD VE+KLGL PEK++A+RDVLS YGN++SACVLFILDE+R+KS ++   TTGEGLEW
Sbjct  308   AILDQVEQKLGLKPEKMKATRDVLSDYGNMSSACVLFILDEMRRKSAEKGLKTTGEGLEW  367

Query  1200  GVLFGFGPGLTIDTVVIRSVPI  1265
             GVLFGFGPGLTI+TVV+ SV I
Sbjct  368   GVLFGFGPGLTIETVVLHSVAI  389



>ref|XP_009619773.1| PREDICTED: chalcone synthase 1B [Nicotiana tomentosiformis]
 gb|ACS12836.1| chalcone synthase [Nicotiana tomentosiformis]
Length=389

 Score =   545 bits (1403),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 259/380 (68%), Positives = 312/380 (82%), Gaps = 0/380 (0%)
 Frame = +3

Query  120   HRAKRLEGDAKILAIGTATPANWVDQTTYPDFYFRITNSQHLLEHKEKFRRICNKSKIMK  299
              RA+  EG A ++AIGTATP+N VDQ+TYPD+YFRITNS+H +E KEKF+R+C KS I K
Sbjct  8     RRAQCAEGPATVMAIGTATPSNCVDQSTYPDYYFRITNSEHKVELKEKFKRMCEKSMIKK  67

Query  300   RHLVLTEELLKKHPNLCTYNEASLNTRQDILVSGVPKLGKEAAMKAIKEWGRPISEITHL  479
             R++ LTEE+LK +PN+C Y   SL+ RQDI+V  VPKLGKEAA KAIKEWG+P S+ITHL
Sbjct  68    RYMHLTEEILKDNPNICAYMAPSLDARQDIVVVEVPKLGKEAAQKAIKEWGQPKSKITHL  127

Query  480   VFCTTSGVDMPGADFQLTKLLGLNSSVKRLMMYQQGCNAGAAMLRLAKDLAENNKGARVL  659
             VFCTTSGVDMPG D+QLTKLLGL  SVKR MMYQQGC AG  +LR+AKDLAENNKGARVL
Sbjct  128   VFCTTSGVDMPGCDYQLTKLLGLRPSVKRFMMYQQGCFAGGTVLRMAKDLAENNKGARVL  187

Query  660   VVCSEVMLSVFRGPSLQQEDNLLAQCLFGDGSAAVIVGTEPRPGLETPLFELVSSAQTII  839
             VVCSE+    FRGP+    D+L+ Q LFGDG+AAVI+G++P P +E PLFELVS+AQT++
Sbjct  188   VVCSEITAVTFRGPNDTHLDSLVGQALFGDGAAAVIIGSDPIPEVERPLFELVSAAQTLL  247

Query  840   PDTDSHLKLQLREMGLTFHCSKAVPSLITQNVEDCLVKAFEPFGISDWNSIFWILHPGGN  1019
             PD++  +   LRE+GLTFH  K VP LI++N+E  LV+AF+P GISDWNS+FWI HPGG 
Sbjct  248   PDSEGAIDGHLREVGLTFHLLKDVPGLISKNIEKSLVEAFQPLGISDWNSLFWIAHPGGP  307

Query  1020  AILDGVEEKLGLDPEKLRASRDVLSQYGNLTSACVLFILDEVRKKSKKQQQMTTGEGLEW  1199
             AILD VE KLGL  EKL+A+R VLS YGN++SACVLFILDE+RK S K+   TTGEGLEW
Sbjct  308   AILDQVELKLGLKQEKLKATRKVLSNYGNMSSACVLFILDEMRKASAKEGLGTTGEGLEW  367

Query  1200  GVLFGFGPGLTIDTVVIRSV  1259
             GVLFGFGPGLT++TVV+ SV
Sbjct  368   GVLFGFGPGLTVETVVLHSV  387



>sp|P23569.1|CHSY_PUEML RecName: Full=Chalcone synthase; AltName: Full=Naringenin-chalcone 
synthase [Pueraria montana var. lobata]
 dbj|BAA01075.1| chalcone synthase [Pueraria montana var. lobata]
 prf||2204192A chalcone synthase
Length=389

 Score =   545 bits (1403),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 257/382 (67%), Positives = 312/382 (82%), Gaps = 0/382 (0%)
 Frame = +3

Query  120   HRAKRLEGDAKILAIGTATPANWVDQTTYPDFYFRITNSQHLLEHKEKFRRICNKSKIMK  299
              +A+R EG A ILAIGTA P N VDQ+TYPD+YFRITNS+H+ E KEKF+R+C+KS I K
Sbjct  8     RQAQRAEGPATILAIGTANPPNCVDQSTYPDYYFRITNSEHMTELKEKFQRMCDKSMIKK  67

Query  300   RHLVLTEELLKKHPNLCTYNEASLNTRQDILVSGVPKLGKEAAMKAIKEWGRPISEITHL  479
             R++ LTEE+LK++PN+C Y   SL+ RQD++V  VPKLGKEAA KAIKEWG+P S+ITHL
Sbjct  68    RYMYLTEEILKENPNMCAYMAPSLDARQDMVVVEVPKLGKEAATKAIKEWGQPKSKITHL  127

Query  480   VFCTTSGVDMPGADFQLTKLLGLNSSVKRLMMYQQGCNAGAAMLRLAKDLAENNKGARVL  659
             +FCTTSGVDMPGAD+QLTK LGL   VKR MMYQQGC AG  +LRLAKDLAENNKGARVL
Sbjct  128   IFCTTSGVDMPGADYQLTKQLGLRPYVKRYMMYQQGCFAGGTVLRLAKDLAENNKGARVL  187

Query  660   VVCSEVMLSVFRGPSLQQEDNLLAQCLFGDGSAAVIVGTEPRPGLETPLFELVSSAQTII  839
             VVCSE+    FRGPS    D+L+ Q LFGDG+AAVIVG++P P +E PL+ELV +AQTI 
Sbjct  188   VVCSEITAVTFRGPSDTHLDSLVGQALFGDGAAAVIVGSDPIPQVEKPLYELVWTAQTIA  247

Query  840   PDTDSHLKLQLREMGLTFHCSKAVPSLITQNVEDCLVKAFEPFGISDWNSIFWILHPGGN  1019
             PD++  +   LRE+GLTFH  K VP ++++N++  L +AF P  ISD+NSIFWI HPGG 
Sbjct  248   PDSEGAIDGHLREVGLTFHLLKDVPGIVSKNIDKALFEAFNPLNISDYNSIFWIAHPGGP  307

Query  1020  AILDGVEEKLGLDPEKLRASRDVLSQYGNLTSACVLFILDEVRKKSKKQQQMTTGEGLEW  1199
             AILD VE+KLGL PEK++A+RDVLS YGN++SACVLFILDE+R+KS +    TTGEGLEW
Sbjct  308   AILDQVEQKLGLKPEKMKATRDVLSDYGNMSSACVLFILDEMRRKSAENGLKTTGEGLEW  367

Query  1200  GVLFGFGPGLTIDTVVIRSVPI  1265
             GVLFGFGPGLTI+TVV+RSV I
Sbjct  368   GVLFGFGPGLTIETVVLRSVAI  389



>ref|XP_007158815.1| hypothetical protein PHAVU_002G184300g [Phaseolus vulgaris]
 gb|ESW30809.1| hypothetical protein PHAVU_002G184300g [Phaseolus vulgaris]
Length=389

 Score =   545 bits (1403),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 259/382 (68%), Positives = 312/382 (82%), Gaps = 0/382 (0%)
 Frame = +3

Query  120   HRAKRLEGDAKILAIGTATPANWVDQTTYPDFYFRITNSQHLLEHKEKFRRICNKSKIMK  299
              +A+R EG A ILAIGTATP+N VDQ+TYPD+YFRITNS+H+ E KEKF+R+C+KS I K
Sbjct  8     RQAQRAEGPANILAIGTATPSNCVDQSTYPDYYFRITNSEHMTELKEKFQRMCDKSMIKK  67

Query  300   RHLVLTEELLKKHPNLCTYNEASLNTRQDILVSGVPKLGKEAAMKAIKEWGRPISEITHL  479
             R++ L EE+LK++PN+C Y   SL+ RQDI+V  VPKLGKEAA+KAIKEWG+P S+ITHL
Sbjct  68    RYMHLNEEILKENPNMCAYMAPSLDARQDIVVVEVPKLGKEAAVKAIKEWGQPKSKITHL  127

Query  480   VFCTTSGVDMPGADFQLTKLLGLNSSVKRLMMYQQGCNAGAAMLRLAKDLAENNKGARVL  659
             +FCTTSGVDMPGAD+QLTKLLGL   VKR MMYQQGC AG  +LRLAKDLAENNKGARVL
Sbjct  128   IFCTTSGVDMPGADYQLTKLLGLRPYVKRYMMYQQGCFAGGTVLRLAKDLAENNKGARVL  187

Query  660   VVCSEVMLSVFRGPSLQQEDNLLAQCLFGDGSAAVIVGTEPRPGLETPLFELVSSAQTII  839
             VVCSE+    FRGPS    D+L+ Q LFGDG+AAVIVG++P   +E PLFELV +AQTI 
Sbjct  188   VVCSEITAVTFRGPSDTHLDSLVGQALFGDGAAAVIVGSDPISQIEKPLFELVWTAQTIA  247

Query  840   PDTDSHLKLQLREMGLTFHCSKAVPSLITQNVEDCLVKAFEPFGISDWNSIFWILHPGGN  1019
             PD+D  +   LRE+GLTFH  K VP ++++N+   L +AF P  ISD+NSIFWI HPGG 
Sbjct  248   PDSDGAIDGHLREVGLTFHLLKDVPGIVSKNIGKALFEAFNPLNISDYNSIFWIAHPGGP  307

Query  1020  AILDGVEEKLGLDPEKLRASRDVLSQYGNLTSACVLFILDEVRKKSKKQQQMTTGEGLEW  1199
             AILD VE+KLGL PEK++A+RDVLS YGN++SACVLFILDE+R+KS +    TTGEGLEW
Sbjct  308   AILDQVEQKLGLKPEKMKATRDVLSDYGNMSSACVLFILDEMRRKSAENGLKTTGEGLEW  367

Query  1200  GVLFGFGPGLTIDTVVIRSVPI  1265
             GVLFGFGPGLTI+TVV+ SV I
Sbjct  368   GVLFGFGPGLTIETVVLHSVAI  389



>sp|P51090.1|CHSY_VITVI RecName: Full=Chalcone synthase; AltName: Full=Naringenin-chalcone 
synthase [Vitis vinifera]
 emb|CAA53583.1| chalcone synthase [Vitis vinifera]
 gb|ADG35962.1| chalcone synthase [Vitis hybrid cultivar]
Length=393

 Score =   545 bits (1403),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 260/379 (69%), Positives = 312/379 (82%), Gaps = 0/379 (0%)
 Frame = +3

Query  123   RAKRLEGDAKILAIGTATPANWVDQTTYPDFYFRITNSQHLLEHKEKFRRICNKSKIMKR  302
             +A+R EG A +LAIGTATPAN V Q  YPD+YFRITNS+H+ E KEKF+R+C KS I KR
Sbjct  9     KAQRAEGPATVLAIGTATPANCVYQADYPDYYFRITNSEHMTELKEKFKRMCEKSMINKR  68

Query  303   HLVLTEELLKKHPNLCTYNEASLNTRQDILVSGVPKLGKEAAMKAIKEWGRPISEITHLV  482
             ++ LTEE+LK++PN+C Y   SL+ RQD++V  VPKLGKEAA KAIKEWG+P S+ITHLV
Sbjct  69    YMHLTEEILKENPNVCAYMAPSLDARQDMVVVEVPKLGKEAAAKAIKEWGQPKSKITHLV  128

Query  483   FCTTSGVDMPGADFQLTKLLGLNSSVKRLMMYQQGCNAGAAMLRLAKDLAENNKGARVLV  662
             FCTTSGVDMPGAD+QLTKLLGL  SVKRLMMYQQGC AG  +LRLAKDLAENN G+RVLV
Sbjct  129   FCTTSGVDMPGADYQLTKLLGLKPSVKRLMMYQQGCFAGGTVLRLAKDLAENNAGSRVLV  188

Query  663   VCSEVMLSVFRGPSLQQEDNLLAQCLFGDGSAAVIVGTEPRPGLETPLFELVSSAQTIIP  842
             VCSE+    FRGPS    D+L+ Q LFGDG+AAVI+G +P   +E PLFELVS+AQTI+P
Sbjct  189   VCSEITAVTFRGPSDTHLDSLVGQALFGDGAAAVIIGADPDTKIELPLFELVSAAQTILP  248

Query  843   DTDSHLKLQLREMGLTFHCSKAVPSLITQNVEDCLVKAFEPFGISDWNSIFWILHPGGNA  1022
             D++  +   LRE+GLTFH  K VP LI++N+E  LV+AF P GISDWNS+FWI HPGG A
Sbjct  249   DSEGAIDGHLREVGLTFHLLKDVPGLISKNIEKSLVEAFTPIGISDWNSLFWIAHPGGPA  308

Query  1023  ILDGVEEKLGLDPEKLRASRDVLSQYGNLTSACVLFILDEVRKKSKKQQQMTTGEGLEWG  1202
             ILD VE KLGL  EKLRA+R VLS+YGN++SACVLFILDE+RKKS ++ + +TGEGLEWG
Sbjct  309   ILDQVELKLGLKEEKLRATRHVLSEYGNMSSACVLFILDEMRKKSIEEGKGSTGEGLEWG  368

Query  1203  VLFGFGPGLTIDTVVIRSV  1259
             VLFGFGPGLT++TVV+ SV
Sbjct  369   VLFGFGPGLTVETVVLHSV  387



>sp|P13417.1|CHS3_SINAL RecName: Full=Chalcone synthase 3; AltName: Full=Naringenin-chalcone 
synthase 3 [Sinapis alba]
 emb|CAA32495.1| unnamed protein product [Sinapis alba]
Length=395

 Score =   545 bits (1403),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 258/382 (68%), Positives = 314/382 (82%), Gaps = 1/382 (0%)
 Frame = +3

Query  123   RAKRLEGDAKILAIGTATPANWVDQTTYPDFYFRITNSQHLLEHKEKFRRICNKSKIMKR  302
             +A+R +G A ILAIGTA PAN V Q  YPD+YFRITNS+H+ + KEKF+R+C+KS I KR
Sbjct  14    KAQRADGPAGILAIGTANPANHVIQAEYPDYYFRITNSEHMTDLKEKFKRMCDKSTIRKR  73

Query  303   HLVLTEELLKKHPNLCTYNEASLNTRQDILVSGVPKLGKEAAMKAIKEWGRPISEITHLV  482
             H+ LTEE LK +PN+C Y   SL+ RQDI+V  VPKLGKEAA+KAIKEWG+P S+ITH+V
Sbjct  74    HMHLTEEFLKDNPNMCAYMAPSLDARQDIVVVEVPKLGKEAAVKAIKEWGQPKSKITHVV  133

Query  483   FCTTSGVDMPGADFQLTKLLGLNSSVKRLMMYQQGCNAGAAMLRLAKDLAENNKGARVLV  662
             FCTTSGVDMPGAD+QLTKLLGL  SVKRLMMYQQGC AG  +LRLAKDLAENN+GARVLV
Sbjct  134   FCTTSGVDMPGADYQLTKLLGLRPSVKRLMMYQQGCFAGGTVLRLAKDLAENNRGARVLV  193

Query  663   VCSEVMLSVFRGPSLQQEDNLLAQCLFGDGSAAVIVGTEPRPGL-ETPLFELVSSAQTII  839
             VCSE+    FRGPS    D+L+ Q LF DG+AA+IVG++P   + E P+FE+VS+AQTI+
Sbjct  194   VCSEITAVTFRGPSDTHLDSLVGQALFSDGAAAIIVGSDPDTSVGEKPIFEMVSAAQTIL  253

Query  840   PDTDSHLKLQLREMGLTFHCSKAVPSLITQNVEDCLVKAFEPFGISDWNSIFWILHPGGN  1019
             PD+D  +   LRE+GLTFH  K VP LI++N+E  L +AF+P GISDWNS+FWI HPGG 
Sbjct  254   PDSDGAIDGHLREVGLTFHLLKDVPGLISKNIEKSLDEAFKPLGISDWNSLFWIAHPGGP  313

Query  1020  AILDGVEEKLGLDPEKLRASRDVLSQYGNLTSACVLFILDEVRKKSKKQQQMTTGEGLEW  1199
             AILD VE+KLGL  EK+RA+R VLS+YGN++SACVLFILDE+R+KSK+    TTGEGLEW
Sbjct  314   AILDDVEKKLGLKAEKMRATRHVLSEYGNMSSACVLFILDEMRRKSKEDGVATTGEGLEW  373

Query  1200  GVLFGFGPGLTIDTVVIRSVPI  1265
             GVLFGFGPGLT++TVV+ SVP+
Sbjct  374   GVLFGFGPGLTVETVVLHSVPV  395



>gb|ADF43042.1| chalcone synthase 1 protein [Brassica rapa subsp. rapa]
 emb|CDX70528.1| BnaC03g06120D [Brassica napus]
Length=396

 Score =   545 bits (1403),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 258/382 (68%), Positives = 314/382 (82%), Gaps = 1/382 (0%)
 Frame = +3

Query  123   RAKRLEGDAKILAIGTATPANWVDQTTYPDFYFRITNSQHLLEHKEKFRRICNKSKIMKR  302
             +A+R +G A ILAIGTA PAN V Q  YPD+YFRITNS+H+ + KEKF+R+C+KS I KR
Sbjct  15    KAQRADGPAGILAIGTANPANHVIQAEYPDYYFRITNSEHMTDLKEKFKRMCDKSMIRKR  74

Query  303   HLVLTEELLKKHPNLCTYNEASLNTRQDILVSGVPKLGKEAAMKAIKEWGRPISEITHLV  482
             H+ LTEE LK++PN+C Y   SL+ RQDI+V  VPKLGKEAA+KAIKEWG+P S+ITH+V
Sbjct  75    HMHLTEEFLKENPNMCAYMAPSLDVRQDIVVVEVPKLGKEAAVKAIKEWGQPKSKITHVV  134

Query  483   FCTTSGVDMPGADFQLTKLLGLNSSVKRLMMYQQGCNAGAAMLRLAKDLAENNKGARVLV  662
             FCTTSGVDMPGAD+QLTKLLGL  SVKRLMMYQQGC AG  +LRLAKDLAENN+GARVLV
Sbjct  135   FCTTSGVDMPGADYQLTKLLGLRPSVKRLMMYQQGCFAGGTVLRLAKDLAENNRGARVLV  194

Query  663   VCSEVMLSVFRGPSLQQEDNLLAQCLFGDGSAAVIVGTEPRPGL-ETPLFELVSSAQTII  839
             VCSE+    FRGPS    D+L+ Q LF DG+AA+IVG++P   + E P+FE+VS+AQTI+
Sbjct  195   VCSEITAVTFRGPSDTHLDSLVGQALFSDGAAALIVGSDPDASVGEKPIFEMVSAAQTIL  254

Query  840   PDTDSHLKLQLREMGLTFHCSKAVPSLITQNVEDCLVKAFEPFGISDWNSIFWILHPGGN  1019
             PD+D  +   LRE+GLTFH  K VP LI++N+E  L +AF+P GISDWNS+FWI HPGG 
Sbjct  255   PDSDGAIDGHLREVGLTFHLLKDVPGLISKNIEKSLEEAFKPLGISDWNSLFWIAHPGGP  314

Query  1020  AILDGVEEKLGLDPEKLRASRDVLSQYGNLTSACVLFILDEVRKKSKKQQQMTTGEGLEW  1199
             AILD VE+KLGL  EK+RA+R VLS+YGN++SACVLFILDE+R+KS K    TTGEGLEW
Sbjct  315   AILDEVEKKLGLKAEKMRATRQVLSEYGNMSSACVLFILDEMRRKSAKDGVATTGEGLEW  374

Query  1200  GVLFGFGPGLTIDTVVIRSVPI  1265
             GVLFGFGPGLT++TVV+ SVP+
Sbjct  375   GVLFGFGPGLTVETVVLHSVPV  396



>gb|AAO32821.1| chalcone synthase [Arachis hypogaea]
 gb|ABZ80827.1| chalcone synthase [Arachis hypogaea]
Length=389

 Score =   544 bits (1402),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 257/381 (67%), Positives = 312/381 (82%), Gaps = 0/381 (0%)
 Frame = +3

Query  123   RAKRLEGDAKILAIGTATPANWVDQTTYPDFYFRITNSQHLLEHKEKFRRICNKSKIMKR  302
             +A+R EG A I+AIGTATP N VDQ+TYPD+YFRITNSQH+ E KEKF+R+C+KS I KR
Sbjct  9     KAQRAEGPATIMAIGTATPQNCVDQSTYPDYYFRITNSQHMTELKEKFQRMCDKSMIKKR  68

Query  303   HLVLTEELLKKHPNLCTYNEASLNTRQDILVSGVPKLGKEAAMKAIKEWGRPISEITHLV  482
             ++ LTEE+LK++PN+C Y   SL+ RQD++V  VP+LGKEAA KAIKEWG+P S+ITHL+
Sbjct  69    YMYLTEEILKENPNMCKYMAPSLDARQDMVVVEVPRLGKEAATKAIKEWGQPKSKITHLI  128

Query  483   FCTTSGVDMPGADFQLTKLLGLNSSVKRLMMYQQGCNAGAAMLRLAKDLAENNKGARVLV  662
             FCTTSGVDMPGAD+QLTKLLGL  SVKR MMYQQGC AG  +LRLAKDLAENNKGARVLV
Sbjct  129   FCTTSGVDMPGADYQLTKLLGLRPSVKRYMMYQQGCFAGGTVLRLAKDLAENNKGARVLV  188

Query  663   VCSEVMLSVFRGPSLQQEDNLLAQCLFGDGSAAVIVGTEPRPGLETPLFELVSSAQTIIP  842
             VCSE+    FRGPS    D+L+ Q LFGDG+AA+IVG++P P +E P+FELV +AQT+ P
Sbjct  189   VCSEITAVTFRGPSETHLDSLVGQALFGDGAAALIVGSDPLPQIEKPVFELVWTAQTLAP  248

Query  843   DTDSHLKLQLREMGLTFHCSKAVPSLITQNVEDCLVKAFEPFGISDWNSIFWILHPGGNA  1022
             D++  +   LRE+GLTFH  K VP ++++N+   L +AF+P GISD+NSIFWI HPGG A
Sbjct  249   DSEGAIDGHLREVGLTFHLLKDVPGIVSKNINKALTEAFDPLGISDYNSIFWIAHPGGPA  308

Query  1023  ILDGVEEKLGLDPEKLRASRDVLSQYGNLTSACVLFILDEVRKKSKKQQQMTTGEGLEWG  1202
             ILD VE+KL L P KLRA+RDVLS YGN++SACVLFILD +R KS +Q   TTGEGLEWG
Sbjct  309   ILDQVEDKLKLKPHKLRATRDVLSDYGNMSSACVLFILDHMRNKSLQQGLQTTGEGLEWG  368

Query  1203  VLFGFGPGLTIDTVVIRSVPI  1265
             VLFGFGPGLTI+TVV+ SV I
Sbjct  369   VLFGFGPGLTIETVVLHSVAI  389



>gb|EYU43821.1| hypothetical protein MIMGU_mgv1a007904mg [Erythranthe guttata]
Length=392

 Score =   544 bits (1402),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 259/382 (68%), Positives = 311/382 (81%), Gaps = 0/382 (0%)
 Frame = +3

Query  123   RAKRLEGDAKILAIGTATPANWVDQTTYPDFYFRITNSQHLLEHKEKFRRICNKSKIMKR  302
             RA+R EG A ILAIGTATPAN V+QT YPDFYFRITNS+H+ + KEKF+R+C KS+I KR
Sbjct  11    RAQRAEGPATILAIGTATPANCVEQTEYPDFYFRITNSEHMTDLKEKFQRMCEKSQIKKR  70

Query  303   HLVLTEELLKKHPNLCTYNEASLNTRQDILVSGVPKLGKEAAMKAIKEWGRPISEITHLV  482
             ++ LTEE+LK++PN+C Y   SL+ RQDI+V  VPKLGKEAA KAIKEWG+P S+ITHLV
Sbjct  71    YMHLTEEILKENPNMCAYMAPSLDARQDIVVVEVPKLGKEAAQKAIKEWGQPKSKITHLV  130

Query  483   FCTTSGVDMPGADFQLTKLLGLNSSVKRLMMYQQGCNAGAAMLRLAKDLAENNKGARVLV  662
             FCTTSGVDMPG D+QLTKLLGL  SVKR MMYQQGC AG  +LR+AKDLAENN GARVLV
Sbjct  131   FCTTSGVDMPGCDYQLTKLLGLRPSVKRFMMYQQGCFAGGTVLRMAKDLAENNAGARVLV  190

Query  663   VCSEVMLSVFRGPSLQQEDNLLAQCLFGDGSAAVIVGTEPRPGLETPLFELVSSAQTIIP  842
             VCSE+    FRGP+    D+L+ Q LFGDG+AAVIVG++P  G+E PLF+LVS+AQT++P
Sbjct  191   VCSEITAVTFRGPNGSHLDSLVGQALFGDGAAAVIVGSDPVVGVERPLFQLVSAAQTLLP  250

Query  843   DTDSHLKLQLREMGLTFHCSKAVPSLITQNVEDCLVKAFEPFGISDWNSIFWILHPGGNA  1022
             D+   +   LRE+GLTFH  K VP LI++++   L +AF+P GISDWNSIFWI HPGG A
Sbjct  251   DSHGAIDGHLREVGLTFHLLKDVPGLISKHIGKSLKEAFDPLGISDWNSIFWIAHPGGPA  310

Query  1023  ILDGVEEKLGLDPEKLRASRDVLSQYGNLTSACVLFILDEVRKKSKKQQQMTTGEGLEWG  1202
             ILD VE  L L PEKLR++R VLS+YGN++SACVLFILDE+RK S K+   TTGEGL WG
Sbjct  311   ILDQVESTLALKPEKLRSTRHVLSEYGNMSSACVLFILDEMRKSSAKEGMSTTGEGLNWG  370

Query  1203  VLFGFGPGLTIDTVVIRSVPIN  1268
             VLFGFGPGLT++TVV+ SV IN
Sbjct  371   VLFGFGPGLTVETVVLHSVAIN  392



>gb|ABC86919.1| chalcone synthase [Populus alba]
Length=396

 Score =   544 bits (1402),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 259/382 (68%), Positives = 311/382 (81%), Gaps = 0/382 (0%)
 Frame = +3

Query  120   HRAKRLEGDAKILAIGTATPANWVDQTTYPDFYFRITNSQHLLEHKEKFRRICNKSKIMK  299
              +A+R  G A ILAIG ATPAN V Q  YPD+YFRITNS+H+ E KEKF+R+C+KS I K
Sbjct  9     RKAQRASGPATILAIGKATPANCVSQADYPDYYFRITNSEHMTELKEKFKRMCDKSMIKK  68

Query  300   RHLVLTEELLKKHPNLCTYNEASLNTRQDILVSGVPKLGKEAAMKAIKEWGRPISEITHL  479
             R++ +TEE+LK++P++C Y   SL+ RQD++V  VPKLGKEAA KAIKEWGRP S+ITHL
Sbjct  69    RYMHITEEILKENPSMCEYMAPSLDARQDMVVVEVPKLGKEAATKAIKEWGRPKSKITHL  128

Query  480   VFCTTSGVDMPGADFQLTKLLGLNSSVKRLMMYQQGCNAGAAMLRLAKDLAENNKGARVL  659
             VFCTTSGVDMPGAD+QLTKLLGL  SVKRLMMYQQGC AG  +LRLAKDLAENNKG+RVL
Sbjct  129   VFCTTSGVDMPGADYQLTKLLGLRPSVKRLMMYQQGCFAGGTVLRLAKDLAENNKGSRVL  188

Query  660   VVCSEVMLSVFRGPSLQQEDNLLAQCLFGDGSAAVIVGTEPRPGLETPLFELVSSAQTII  839
             VVCSE+    FRGPS    D+++ Q LFGDG+AAVIVG +P   +E PLF+LVS+AQTI+
Sbjct  189   VVCSEITAVTFRGPSDTHLDSMVGQALFGDGAAAVIVGADPDTSIERPLFQLVSAAQTIL  248

Query  840   PDTDSHLKLQLREMGLTFHCSKAVPSLITQNVEDCLVKAFEPFGISDWNSIFWILHPGGN  1019
             PD D  +   LRE+GLTFH  K VP LI++N+E  LV+AF P GI+DWNSIFWI HPGG 
Sbjct  249   PDFDGAIDGHLREVGLTFHLLKDVPGLISRNIEKSLVEAFAPIGINDWNSIFWIAHPGGP  308

Query  1020  AILDGVEEKLGLDPEKLRASRDVLSQYGNLTSACVLFILDEVRKKSKKQQQMTTGEGLEW  1199
             AILD VE KL L  EKLRA+R+VLS YGN++SACVLFILDE+R KS ++ + TTGEGLEW
Sbjct  309   AILDQVEIKLDLKEEKLRATRNVLSDYGNMSSACVLFILDEMRNKSLEEGKSTTGEGLEW  368

Query  1200  GVLFGFGPGLTIDTVVIRSVPI  1265
             GVLFGFGPGLT++TVV+ SVP+
Sbjct  369   GVLFGFGPGLTVETVVLHSVPV  390



>emb|CAA05512.1| chalcone synthase [Digitalis lanata]
Length=386

 Score =   544 bits (1401),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 256/381 (67%), Positives = 313/381 (82%), Gaps = 0/381 (0%)
 Frame = +3

Query  123   RAKRLEGDAKILAIGTATPANWVDQTTYPDFYFRITNSQHLLEHKEKFRRICNKSKIMKR  302
             RA+R EG A ILAIGTATPAN VDQ+TYPD+YFRIT S+H+ E KEKF+R+C KS I KR
Sbjct  4     RAQRAEGPATILAIGTATPANCVDQSTYPDYYFRITKSEHMTELKEKFKRMCEKSMIKKR  63

Query  303   HLVLTEELLKKHPNLCTYNEASLNTRQDILVSGVPKLGKEAAMKAIKEWGRPISEITHLV  482
             ++ LTEE+L+++P++C Y   SL+ RQDI+V  VPKLGKEAA KAIKEWG+P S+ITHLV
Sbjct  64    YMHLTEEILQENPSMCEYMAPSLDARQDIVVVEVPKLGKEAAQKAIKEWGQPKSKITHLV  123

Query  483   FCTTSGVDMPGADFQLTKLLGLNSSVKRLMMYQQGCNAGAAMLRLAKDLAENNKGARVLV  662
             FCTTSGVDMPGAD+QLTKLLGL  SVKR MMYQQGC AG  +LR+AKDLAENN GARVLV
Sbjct  124   FCTTSGVDMPGADYQLTKLLGLRPSVKRFMMYQQGCFAGGTVLRMAKDLAENNAGARVLV  183

Query  663   VCSEVMLSVFRGPSLQQEDNLLAQCLFGDGSAAVIVGTEPRPGLETPLFELVSSAQTIIP  842
             VCSE+    FRGP     D+++ Q LFGDG+ A+IVG++P  G+E PLF++VS+AQT++P
Sbjct  184   VCSEITAVTFRGPVDTHLDSMVGQALFGDGAGALIVGSDPVVGVERPLFQVVSAAQTLLP  243

Query  843   DTDSHLKLQLREMGLTFHCSKAVPSLITQNVEDCLVKAFEPFGISDWNSIFWILHPGGNA  1022
             D+   +   LRE+GLTFH  K VP LI++N+E  L +AF+P GISDWNSIFWI HPGG A
Sbjct  244   DSHGAIDGHLREVGLTFHLLKDVPGLISKNIEKSLKEAFDPLGISDWNSIFWIAHPGGPA  303

Query  1023  ILDGVEEKLGLDPEKLRASRDVLSQYGNLTSACVLFILDEVRKKSKKQQQMTTGEGLEWG  1202
             ILD VE+KL L P+K+RA+R VLS+YGN++SACVLFILDE+RK S K+   TTGEGL+WG
Sbjct  304   ILDQVEDKLALKPDKMRATRHVLSEYGNMSSACVLFILDEMRKASAKEGVSTTGEGLDWG  363

Query  1203  VLFGFGPGLTIDTVVIRSVPI  1265
             VLFGFGPGLT++TVV+ SVPI
Sbjct  364   VLFGFGPGLTVETVVLHSVPI  384



>emb|CDX78547.1| BnaA03g04590D [Brassica napus]
Length=394

 Score =   544 bits (1402),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 258/382 (68%), Positives = 314/382 (82%), Gaps = 1/382 (0%)
 Frame = +3

Query  123   RAKRLEGDAKILAIGTATPANWVDQTTYPDFYFRITNSQHLLEHKEKFRRICNKSKIMKR  302
             +A+R +G A ILAIGTA PAN V Q  YPD+YFRITNS+H+ + KEKF+R+C+KS I KR
Sbjct  13    KAQRADGPAGILAIGTANPANHVIQAEYPDYYFRITNSEHMTDLKEKFKRMCDKSMIRKR  72

Query  303   HLVLTEELLKKHPNLCTYNEASLNTRQDILVSGVPKLGKEAAMKAIKEWGRPISEITHLV  482
             H+ LTEE LK++PN+C Y   SL+ RQDI+V  VPKLGKEAA+KAIKEWG+P S+ITH+V
Sbjct  73    HMHLTEEFLKENPNMCAYMAPSLDVRQDIVVVEVPKLGKEAAVKAIKEWGQPKSKITHVV  132

Query  483   FCTTSGVDMPGADFQLTKLLGLNSSVKRLMMYQQGCNAGAAMLRLAKDLAENNKGARVLV  662
             FCTTSGVDMPGAD+QLTKLLGL  SVKRLMMYQQGC AG  +LRLAKDLAENN+GARVLV
Sbjct  133   FCTTSGVDMPGADYQLTKLLGLRPSVKRLMMYQQGCFAGGTVLRLAKDLAENNRGARVLV  192

Query  663   VCSEVMLSVFRGPSLQQEDNLLAQCLFGDGSAAVIVGTEPRPGL-ETPLFELVSSAQTII  839
             VCSE+    FRGPS    D+L+ Q LF DG+AA+IVG++P   + E P+FE+VS+AQTI+
Sbjct  193   VCSEITAVTFRGPSDTHLDSLVGQALFSDGAAALIVGSDPDASVGEKPIFEMVSAAQTIL  252

Query  840   PDTDSHLKLQLREMGLTFHCSKAVPSLITQNVEDCLVKAFEPFGISDWNSIFWILHPGGN  1019
             PD+D  +   LRE+GLTFH  K VP LI++N+E  L +AF+P GISDWNS+FWI HPGG 
Sbjct  253   PDSDGAIDGHLREVGLTFHLLKDVPGLISKNIEKSLEEAFKPLGISDWNSLFWIAHPGGP  312

Query  1020  AILDGVEEKLGLDPEKLRASRDVLSQYGNLTSACVLFILDEVRKKSKKQQQMTTGEGLEW  1199
             AILD VE+KLGL  EK+RA+R VLS+YGN++SACVLFILDE+R+KS K    TTGEGLEW
Sbjct  313   AILDEVEKKLGLKAEKMRATRQVLSEYGNMSSACVLFILDEMRRKSAKDGVATTGEGLEW  372

Query  1200  GVLFGFGPGLTIDTVVIRSVPI  1265
             GVLFGFGPGLT++TVV+ SVP+
Sbjct  373   GVLFGFGPGLTVETVVLHSVPV  394



>gb|AFL72079.1| chalcone synthase [Agastache rugosa]
Length=391

 Score =   544 bits (1401),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 260/380 (68%), Positives = 308/380 (81%), Gaps = 0/380 (0%)
 Frame = +3

Query  123   RAKRLEGDAKILAIGTATPANWVDQTTYPDFYFRITNSQHLLEHKEKFRRICNKSKIMKR  302
             RA+R EG A +LAIGTA P N VDQ+TYPD+YFRITNS+H  + KEKF R+C KS I KR
Sbjct  9     RAQRAEGPATVLAIGTAVPTNCVDQSTYPDYYFRITNSEHKTDLKEKFVRMCEKSMIKKR  68

Query  303   HLVLTEELLKKHPNLCTYNEASLNTRQDILVSGVPKLGKEAAMKAIKEWGRPISEITHLV  482
             ++ LTEE LK++PN+  Y   SL+ RQDI+V  VPKLGKEAA KAIKEWG+  S+ITHLV
Sbjct  69    YMHLTEEYLKENPNITAYMAPSLDARQDIVVVEVPKLGKEAAQKAIKEWGQSKSKITHLV  128

Query  483   FCTTSGVDMPGADFQLTKLLGLNSSVKRLMMYQQGCNAGAAMLRLAKDLAENNKGARVLV  662
             FCTTSGVDMPGAD+QLTKLLGL  SVKR MMYQQGC AG  +LR+AKDLAENN GARVLV
Sbjct  129   FCTTSGVDMPGADYQLTKLLGLRPSVKRFMMYQQGCFAGGTVLRMAKDLAENNAGARVLV  188

Query  663   VCSEVMLSVFRGPSLQQEDNLLAQCLFGDGSAAVIVGTEPRPGLETPLFELVSSAQTIIP  842
             VCSE+    FRGPS    D+L+ Q LFGDG+AAVIVG++P  G+E PLFELVS+AQTI+P
Sbjct  189   VCSEITAVTFRGPSESHLDSLVGQALFGDGAAAVIVGSDPVVGVERPLFELVSAAQTILP  248

Query  843   DTDSHLKLQLREMGLTFHCSKAVPSLITQNVEDCLVKAFEPFGISDWNSIFWILHPGGNA  1022
             D+D  +   LRE+GLTFH  K VP LI++N+E  L +AF P GISDWNS+FWI HPGG A
Sbjct  249   DSDGAIDGHLREVGLTFHLLKDVPGLISKNIEKSLKEAFAPLGISDWNSVFWIAHPGGPA  308

Query  1023  ILDGVEEKLGLDPEKLRASRDVLSQYGNLTSACVLFILDEVRKKSKKQQQMTTGEGLEWG  1202
             IL+ VE KLGL PEKLR++R VLS+YGN++SACVLFILDE+RK S K+   TTGEGL+WG
Sbjct  309   ILNQVEAKLGLKPEKLRSTRHVLSEYGNMSSACVLFILDEMRKSSAKEGLSTTGEGLDWG  368

Query  1203  VLFGFGPGLTIDTVVIRSVP  1262
             VLFGFGPGLT++TVV+ SVP
Sbjct  369   VLFGFGPGLTVETVVLHSVP  388



>gb|ABD24222.1| chalcone synthase [Populus alba]
 gb|ABD24224.1| chalcone synthase [Populus alba]
 gb|ABD24225.1| chalcone synthase [Populus alba]
Length=396

 Score =   544 bits (1402),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 258/382 (68%), Positives = 312/382 (82%), Gaps = 0/382 (0%)
 Frame = +3

Query  120   HRAKRLEGDAKILAIGTATPANWVDQTTYPDFYFRITNSQHLLEHKEKFRRICNKSKIMK  299
              +A+R  G A ILAIG ATPAN V Q  YPD+YFRITNS+H+ E KEKF+R+C+KS I K
Sbjct  9     RKAQRASGPATILAIGKATPANCVSQADYPDYYFRITNSEHMTELKEKFKRMCDKSMIKK  68

Query  300   RHLVLTEELLKKHPNLCTYNEASLNTRQDILVSGVPKLGKEAAMKAIKEWGRPISEITHL  479
             R++ +TEE+LK++P++C Y   SL+ RQD++V  VPKLGKEAA KAIKEWG+P S+ITHL
Sbjct  69    RYMHITEEILKENPSMCEYMAPSLDARQDMVVVEVPKLGKEAATKAIKEWGQPKSKITHL  128

Query  480   VFCTTSGVDMPGADFQLTKLLGLNSSVKRLMMYQQGCNAGAAMLRLAKDLAENNKGARVL  659
             VFCTTSGVDMPGAD+QLTKLLGL  SVKRLMMYQQGC AG  +LRLAKDLAENNKG+RVL
Sbjct  129   VFCTTSGVDMPGADYQLTKLLGLRPSVKRLMMYQQGCFAGGTVLRLAKDLAENNKGSRVL  188

Query  660   VVCSEVMLSVFRGPSLQQEDNLLAQCLFGDGSAAVIVGTEPRPGLETPLFELVSSAQTII  839
             VVCSE+    FRGPS    D+++ Q LFGDG+AAVIVG +P   +E PLF+LVS+AQTI+
Sbjct  189   VVCSEITAVTFRGPSDTHLDSMVGQALFGDGAAAVIVGADPDTSIERPLFQLVSAAQTIL  248

Query  840   PDTDSHLKLQLREMGLTFHCSKAVPSLITQNVEDCLVKAFEPFGISDWNSIFWILHPGGN  1019
             PD+D  +   LRE+GLTFH  K VP LI++N+E  LV+AF P GI+DWNSIFWI HPGG 
Sbjct  249   PDSDGAIDGHLREVGLTFHLLKDVPGLISKNIEKSLVEAFAPIGINDWNSIFWIAHPGGP  308

Query  1020  AILDGVEEKLGLDPEKLRASRDVLSQYGNLTSACVLFILDEVRKKSKKQQQMTTGEGLEW  1199
             AILD VE KL L  EKLRA+R+VLS YGN++SACVLFILDE+R KS ++ + TTGEGLEW
Sbjct  309   AILDQVEIKLDLKEEKLRATRNVLSDYGNMSSACVLFILDEMRNKSLEEGKSTTGEGLEW  368

Query  1200  GVLFGFGPGLTIDTVVIRSVPI  1265
             GVLFGFGPGLT++TVV+ SVP+
Sbjct  369   GVLFGFGPGLTVETVVLHSVPV  390



>gb|ACB78187.1| chalcone synthase [Senna tora]
Length=390

 Score =   544 bits (1401),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 256/383 (67%), Positives = 315/383 (82%), Gaps = 0/383 (0%)
 Frame = +3

Query  120   HRAKRLEGDAKILAIGTATPANWVDQTTYPDFYFRITNSQHLLEHKEKFRRICNKSKIMK  299
              +A+R EG A ++AIGTATP N VDQ+ YPD+YFRIT S+H+ E KEKF+R+C+KS I K
Sbjct  8     RKAQRAEGPATVMAIGTATPPNCVDQSEYPDYYFRITQSEHMTELKEKFQRMCDKSMIKK  67

Query  300   RHLVLTEELLKKHPNLCTYNEASLNTRQDILVSGVPKLGKEAAMKAIKEWGRPISEITHL  479
             R++ +TE++LK++PN+C Y   SL+ RQD++V  VPKLGKEAA KAIKEWG+P S+ITHL
Sbjct  68    RYMHVTEDILKENPNMCAYMAPSLDARQDMVVVEVPKLGKEAATKAIKEWGQPKSKITHL  127

Query  480   VFCTTSGVDMPGADFQLTKLLGLNSSVKRLMMYQQGCNAGAAMLRLAKDLAENNKGARVL  659
             +FCTTSGVDMPGAD+QLTKLLGL   VKR MMYQQGC AG  +LRLAKDLAENNKGARVL
Sbjct  128   IFCTTSGVDMPGADYQLTKLLGLRPYVKRYMMYQQGCFAGGTVLRLAKDLAENNKGARVL  187

Query  660   VVCSEVMLSVFRGPSLQQEDNLLAQCLFGDGSAAVIVGTEPRPGLETPLFELVSSAQTII  839
             VVCSE+    FRGPS    D+L+ Q LFGDG+AAVIVG++P P +E PLFELV +AQTI+
Sbjct  188   VVCSEITAVTFRGPSDTHLDSLVGQALFGDGAAAVIVGSDPLPEIEKPLFELVWTAQTIL  247

Query  840   PDTDSHLKLQLREMGLTFHCSKAVPSLITQNVEDCLVKAFEPFGISDWNSIFWILHPGGN  1019
             PD++  +   LRE+GLTFH  K VP LI++N+E  LV+AF+P GISD+NSIFWI HPGG 
Sbjct  248   PDSEGAIDGHLREVGLTFHLLKDVPGLISKNIEKALVEAFQPLGISDYNSIFWIAHPGGP  307

Query  1020  AILDGVEEKLGLDPEKLRASRDVLSQYGNLTSACVLFILDEVRKKSKKQQQMTTGEGLEW  1199
             AILD VE KL L PEK+RA+R VLS+YGN++SACVLFILDE+R+KS +    TTGEGL+W
Sbjct  308   AILDQVEAKLELKPEKMRATRHVLSEYGNMSSACVLFILDEMRRKSIEDGLKTTGEGLDW  367

Query  1200  GVLFGFGPGLTIDTVVIRSVPIN  1268
             GVLFGFGPGLT++TVV+RSV +N
Sbjct  368   GVLFGFGPGLTVETVVLRSVGVN  390



>prf||1609233A chalcone synthase 3
Length=395

 Score =   544 bits (1401),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 258/382 (68%), Positives = 314/382 (82%), Gaps = 1/382 (0%)
 Frame = +3

Query  123   RAKRLEGDAKILAIGTATPANWVDQTTYPDFYFRITNSQHLLEHKEKFRRICNKSKIMKR  302
             +A+R +G A ILAIGTA PAN V Q  YPD+YFRITNS+H+ + KEKF+R+C+KS I KR
Sbjct  14    KAQRADGPAGILAIGTANPANHVIQAEYPDYYFRITNSEHMTDLKEKFKRMCDKSTIRKR  73

Query  303   HLVLTEELLKKHPNLCTYNEASLNTRQDILVSGVPKLGKEAAMKAIKEWGRPISEITHLV  482
             H+ LTEE LK +PN+C Y   SL+ RQDI+V  VPKLGKEAA+KAIKEWG+P S+ITH+V
Sbjct  74    HMHLTEEFLKDNPNMCAYMAPSLDARQDIVVVEVPKLGKEAAVKAIKEWGQPKSKITHVV  133

Query  483   FCTTSGVDMPGADFQLTKLLGLNSSVKRLMMYQQGCNAGAAMLRLAKDLAENNKGARVLV  662
             FCTTSGVDMPGAD+QLTKLLGL  SVKRLMMYQQGC AG  +LRLAKDLAENN+GARVLV
Sbjct  134   FCTTSGVDMPGADYQLTKLLGLRPSVKRLMMYQQGCFAGGTVLRLAKDLAENNRGARVLV  193

Query  663   VCSEVMLSVFRGPSLQQEDNLLAQCLFGDGSAAVIVGTEPRPGL-ETPLFELVSSAQTII  839
             VCSE+    FRGPS    D+L+ Q LF DG+AA+IVG++P   + E P+FE+VS+AQTI+
Sbjct  194   VCSEITAVTFRGPSDTHLDSLVGQALFSDGAAALIVGSDPDTSVGEKPIFEMVSAAQTIL  253

Query  840   PDTDSHLKLQLREMGLTFHCSKAVPSLITQNVEDCLVKAFEPFGISDWNSIFWILHPGGN  1019
             PD+D  +   LRE+GLTFH  K VP LI++N+E  L +AF+P GISDWNS+FWI HPGG 
Sbjct  254   PDSDGAIDGHLREVGLTFHLLKDVPGLISKNIEKSLDEAFKPLGISDWNSLFWIAHPGGP  313

Query  1020  AILDGVEEKLGLDPEKLRASRDVLSQYGNLTSACVLFILDEVRKKSKKQQQMTTGEGLEW  1199
             AILD VE+KLGL  EK+RA+R VLS+YGN++SACVLFILDE+R+KSK+    TTGEGLEW
Sbjct  314   AILDDVEKKLGLKAEKMRATRHVLSEYGNMSSACVLFILDEMRRKSKEDGVATTGEGLEW  373

Query  1200  GVLFGFGPGLTIDTVVIRSVPI  1265
             GVLFGFGPGLT++TVV+ SVP+
Sbjct  374   GVLFGFGPGLTVETVVLHSVPV  395



>gb|ABW69675.1| chalcone synthase D [Ipomoea purpurea]
Length=388

 Score =   544 bits (1401),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 258/380 (68%), Positives = 312/380 (82%), Gaps = 1/380 (0%)
 Frame = +3

Query  123   RAKRLEGDAKILAIGTATPANWVDQTTYPDFYFRITNSQHLLEHKEKFRRICNKSKIMKR  302
             +A+R EG A ILAIGTATPAN VDQ+TYPD+YFRIT S H+ + K+KF+R+C+KS I KR
Sbjct  9     KAQRAEGPATILAIGTATPANCVDQSTYPDYYFRITKSDHMTDLKQKFQRMCDKSMITKR  68

Query  303   HLVLTEELLKKHPNLCTYNEASLNTRQDILVSGVPKLGKEAAMKAIKEWGRPISEITHLV  482
             ++ LTEE+LK++P+ C Y   SL+ RQDI+V  VPKLGKEAA  AIKEWG+P S+ITH++
Sbjct  69    YMHLTEEILKENPSFCEYMAPSLDARQDIVVVEVPKLGKEAAQSAIKEWGQPKSKITHVI  128

Query  483   FCTTSGVDMPGADFQLTKLLGLNSSVKRLMMYQQGCNAGAAMLRLAKDLAENNKGARVLV  662
             FCTTSGVDMPGAD+QLTKLLGL  SVKRLMMYQQ C AG  +LR+AKDLAENNKGARVLV
Sbjct  129   FCTTSGVDMPGADYQLTKLLGLRPSVKRLMMYQQSCFAGGTVLRVAKDLAENNKGARVLV  188

Query  663   VCSEVMLSVFRGPSLQQEDNLLAQCLFGDGSAAVIVGTEPRPGLETPLFELVSSAQTIIP  842
             VCSE+ +  FRGP+    D+L+ Q LFGDG+AA+IVG++P P +E PLF+LVS+AQT+ P
Sbjct  189   VCSEITVVTFRGPNETHLDSLVGQALFGDGAAAIIVGSDPTP-VEKPLFQLVSAAQTLAP  247

Query  843   DTDSHLKLQLREMGLTFHCSKAVPSLITQNVEDCLVKAFEPFGISDWNSIFWILHPGGNA  1022
             D+   +   LRE+GLTFH  K VPS+++ N+E CL +AF P GISDWNSIFWI HPGG A
Sbjct  248   DSCGAIDGHLREVGLTFHLLKDVPSIVSNNIEKCLSEAFNPLGISDWNSIFWIAHPGGPA  307

Query  1023  ILDGVEEKLGLDPEKLRASRDVLSQYGNLTSACVLFILDEVRKKSKKQQQMTTGEGLEWG  1202
             ILD VE+KLGL PEKLRA+R VLS+YGN++SACVLFILDE+RK S      TTGEGLEWG
Sbjct  308   ILDQVEDKLGLKPEKLRATRHVLSEYGNMSSACVLFILDEMRKASSNDGLGTTGEGLEWG  367

Query  1203  VLFGFGPGLTIDTVVIRSVP  1262
             VLFGFGPGLTI+TVV+ SVP
Sbjct  368   VLFGFGPGLTIETVVLHSVP  387



>sp|Q9MB38.1|CHS6_IPOBA RecName: Full=Chalcone synthase DII; AltName: Full=Naringenin-chalcone 
synthase DII [Ipomoea batatas]
 dbj|BAA90330.1| chalcone synthase CHS-DII [Ipomoea batatas]
Length=393

 Score =   544 bits (1401),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 262/381 (69%), Positives = 311/381 (82%), Gaps = 1/381 (0%)
 Frame = +3

Query  123   RAKRLEGDAKILAIGTATPANWVDQTTYPDFYFRITNSQHLLEHKEKFRRICNKSKIMKR  302
             +A+R EG A ILAIGTATPAN V+Q+TYPD+YFRITNS+H  E KEKF+R+C+KS I KR
Sbjct  9     KAQRAEGPATILAIGTATPANCVNQSTYPDYYFRITNSEHKTELKEKFQRMCDKSMITKR  68

Query  303   HLVLTEELLKKHPNLCTYNEASLNTRQDILVSGVPKLGKEAAMKAIKEWGRPISEITHLV  482
             ++ LTEE+LK++P+ C Y   SL+ RQDI V  VPKLGKEAA  AIKEWG+P S+ITH+V
Sbjct  69    YMHLTEEILKENPSFCEYMAPSLDARQDIAVVEVPKLGKEAAQSAIKEWGQPKSKITHVV  128

Query  483   FCTTSGVDMPGADFQLTKLLGLNSSVKRLMMYQQGCNAGAAMLRLAKDLAENNKGARVLV  662
             FCTTSGVDMPGAD+QLTKLLGL  SVKRLMMYQQGC AG  +LRLAKDLAENNKGARVL+
Sbjct  129   FCTTSGVDMPGADYQLTKLLGLRPSVKRLMMYQQGCFAGGTVLRLAKDLAENNKGARVLI  188

Query  663   VCSEVMLSVFRGPSLQQEDNLLAQCLFGDGSAAVIVGTEPRPGLETPLFELVSSAQTIIP  842
             VCSE+ +  FRGPS    D+L+ Q LFGDG+AAVIVG +P P  E PLF+LVS+AQT+ P
Sbjct  189   VCSEITVVTFRGPSETHLDSLVGQALFGDGAAAVIVGADPTPA-EKPLFQLVSAAQTLAP  247

Query  843   DTDSHLKLQLREMGLTFHCSKAVPSLITQNVEDCLVKAFEPFGISDWNSIFWILHPGGNA  1022
             ++   +   LRE+GLTFH  K VPS+++ N+E CL +AF P GISDWNS+FWI HPGG A
Sbjct  248   NSCGAIDGHLREVGLTFHLLKDVPSVVSNNIEKCLFEAFNPLGISDWNSVFWIAHPGGPA  307

Query  1023  ILDGVEEKLGLDPEKLRASRDVLSQYGNLTSACVLFILDEVRKKSKKQQQMTTGEGLEWG  1202
             ILD VE+KLGL PEKLRA+R VLS+YGN++SACVLFILDE+RK S      TTGEGLEWG
Sbjct  308   ILDQVEDKLGLKPEKLRATRHVLSEYGNMSSACVLFILDEMRKASSNAGLGTTGEGLEWG  367

Query  1203  VLFGFGPGLTIDTVVIRSVPI  1265
             VLFGFGPGLTI+TVV+ SV I
Sbjct  368   VLFGFGPGLTIETVVLHSVLI  388



>emb|CAA32731.1| chalcone synthase [Petunia x hybrida]
Length=389

 Score =   544 bits (1401),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 257/379 (68%), Positives = 312/379 (82%), Gaps = 0/379 (0%)
 Frame = +3

Query  123   RAKRLEGDAKILAIGTATPANWVDQTTYPDFYFRITNSQHLLEHKEKFRRICNKSKIMKR  302
             +A+R EG A ++AIGTATP N VDQ+TYPD+YFRITNS+H  + KEKF+R+C KS I KR
Sbjct  9     KAQRAEGPATVMAIGTATPTNCVDQSTYPDYYFRITNSEHKTDLKEKFKRMCEKSMIKKR  68

Query  303   HLVLTEELLKKHPNLCTYNEASLNTRQDILVSGVPKLGKEAAMKAIKEWGRPISEITHLV  482
             ++ LTEE+LK++P++C Y   SL+ RQDI+V  VPKLGKEAA KAIKEWG+P S+ITHL 
Sbjct  69    YMHLTEEILKENPSMCEYMAPSLDARQDIVVVEVPKLGKEAAQKAIKEWGQPKSKITHLF  128

Query  483   FCTTSGVDMPGADFQLTKLLGLNSSVKRLMMYQQGCNAGAAMLRLAKDLAENNKGARVLV  662
             FCTTSGVDMPG D+QLTKLLGL  SVKRLMMYQQGC AG  +LRLAKDLAENNKGARVLV
Sbjct  129   FCTTSGVDMPGCDYQLTKLLGLRPSVKRLMMYQQGCFAGGTVLRLAKDLAENNKGARVLV  188

Query  663   VCSEVMLSVFRGPSLQQEDNLLAQCLFGDGSAAVIVGTEPRPGLETPLFELVSSAQTIIP  842
             VCSE+    FRGP+    D+L+ Q LFGDG+ A+I+G++P PG+E PLFELVS+AQT++P
Sbjct  189   VCSEITAVTFRGPNDTHLDSLVGQALFGDGAGAIIIGSDPIPGVERPLFELVSAAQTLLP  248

Query  843   DTDSHLKLQLREMGLTFHCSKAVPSLITQNVEDCLVKAFEPFGISDWNSIFWILHPGGNA  1022
             D+   +   LRE+GLTFH  K VP LI++N+E  L +AF+P GISDWNS+FWI HPGG A
Sbjct  249   DSHGAIDGHLREVGLTFHLLKDVPGLISKNIEKSLEEAFKPLGISDWNSLFWIAHPGGPA  308

Query  1023  ILDGVEEKLGLDPEKLRASRDVLSQYGNLTSACVLFILDEVRKKSKKQQQMTTGEGLEWG  1202
             ILD VE KLGL PEKL+A+R+VLS YGN++SACVLFILDE+RK S K+   TTGEGLEWG
Sbjct  309   ILDQVEIKLGLKPEKLKATRNVLSDYGNMSSACVLFILDEMRKASAKEGLGTTGEGLEWG  368

Query  1203  VLFGFGPGLTIDTVVIRSV  1259
             VLFGFGPGLT++TVV+ SV
Sbjct  369   VLFGFGPGLTVETVVLHSV  387



>gb|AAK39110.1|AF358654_1 chalcone synthase [Ipomoea purpurea]
Length=388

 Score =   543 bits (1400),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 258/380 (68%), Positives = 312/380 (82%), Gaps = 1/380 (0%)
 Frame = +3

Query  123   RAKRLEGDAKILAIGTATPANWVDQTTYPDFYFRITNSQHLLEHKEKFRRICNKSKIMKR  302
             +A+R EG A ILAIGTATPAN VDQ+TYPD+YFRIT S H+ + K+KF+R+C+KS I KR
Sbjct  9     KAQRAEGPATILAIGTATPANCVDQSTYPDYYFRITKSDHMTDLKQKFQRMCDKSMITKR  68

Query  303   HLVLTEELLKKHPNLCTYNEASLNTRQDILVSGVPKLGKEAAMKAIKEWGRPISEITHLV  482
             ++ LTEE+LK++P+ C Y   SL+ RQDI+V  VPKLGKEAA  AIKEWG+P S+ITH++
Sbjct  69    YMHLTEEILKENPSFCEYMAPSLDARQDIVVVEVPKLGKEAAQSAIKEWGQPKSKITHVI  128

Query  483   FCTTSGVDMPGADFQLTKLLGLNSSVKRLMMYQQGCNAGAAMLRLAKDLAENNKGARVLV  662
             FCTTSGVDMPGAD+QLTKLLGL  SVKRLMMYQQGC AG  +LR+AKDL ENNKGARVLV
Sbjct  129   FCTTSGVDMPGADYQLTKLLGLRPSVKRLMMYQQGCFAGGTVLRVAKDLVENNKGARVLV  188

Query  663   VCSEVMLSVFRGPSLQQEDNLLAQCLFGDGSAAVIVGTEPRPGLETPLFELVSSAQTIIP  842
             VCSE+ +  FRGP+    D+L+ Q LFGDG+AA+IVG++P P +E PLF+LVS+AQT+ P
Sbjct  189   VCSEITVVTFRGPNETHLDSLVGQALFGDGAAAIIVGSDPTP-VEEPLFQLVSAAQTLAP  247

Query  843   DTDSHLKLQLREMGLTFHCSKAVPSLITQNVEDCLVKAFEPFGISDWNSIFWILHPGGNA  1022
             D+   +   LRE+GLTFH  K VPS+++ N+E CL +AF P GISDWNSIFWI HPGG A
Sbjct  248   DSCGAIDGHLREVGLTFHLLKDVPSIVSNNIEKCLSEAFNPLGISDWNSIFWIAHPGGPA  307

Query  1023  ILDGVEEKLGLDPEKLRASRDVLSQYGNLTSACVLFILDEVRKKSKKQQQMTTGEGLEWG  1202
             ILD VE+KLGL PEKLRA+R VLS+YGN++SACVLFILDE+RK S      TTGEGLEWG
Sbjct  308   ILDQVEDKLGLKPEKLRATRHVLSEYGNMSSACVLFILDEMRKASSNDGLGTTGEGLEWG  367

Query  1203  VLFGFGPGLTIDTVVIRSVP  1262
             VLFGFGPGLTI+TVV+ SVP
Sbjct  368   VLFGFGPGLTIETVVLHSVP  387



>gb|ACT32034.1| chalcone synthase [Glycine soja]
Length=389

 Score =   543 bits (1400),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 255/382 (67%), Positives = 314/382 (82%), Gaps = 0/382 (0%)
 Frame = +3

Query  120   HRAKRLEGDAKILAIGTATPANWVDQTTYPDFYFRITNSQHLLEHKEKFRRICNKSKIMK  299
              +A+R EG A ILAIGTA P N VDQ+TYPD+YFRITNS+H+ E KEKF+R+C+KS I +
Sbjct  8     RQAQRAEGPATILAIGTANPPNCVDQSTYPDYYFRITNSEHMTELKEKFQRMCDKSMIKR  67

Query  300   RHLVLTEELLKKHPNLCTYNEASLNTRQDILVSGVPKLGKEAAMKAIKEWGRPISEITHL  479
             R++ L EE+LK++PN+C Y   SL+ RQD++V  VPKLGKEAA+KAIKEWG+P S+ITHL
Sbjct  68    RYMYLNEEILKENPNMCAYMAPSLDARQDMVVVEVPKLGKEAAVKAIKEWGQPKSKITHL  127

Query  480   VFCTTSGVDMPGADFQLTKLLGLNSSVKRLMMYQQGCNAGAAMLRLAKDLAENNKGARVL  659
             +FCTTSGVDMPGAD+QLTK LGL   VKR MMYQQGC AG  +LRLAKDLAENNKGARVL
Sbjct  128   IFCTTSGVDMPGADYQLTKQLGLRPYVKRYMMYQQGCFAGGTVLRLAKDLAENNKGARVL  187

Query  660   VVCSEVMLSVFRGPSLQQEDNLLAQCLFGDGSAAVIVGTEPRPGLETPLFELVSSAQTII  839
             VVCSE+    FRGPS  + D+L+ Q LFGDG+AAVIVG++P P +E PL+ELV +AQTI 
Sbjct  188   VVCSEITAVTFRGPSDTRLDSLVGQALFGDGAAAVIVGSDPIPQVEKPLYELVWTAQTIA  247

Query  840   PDTDSHLKLQLREMGLTFHCSKAVPSLITQNVEDCLVKAFEPFGISDWNSIFWILHPGGN  1019
             PD++  +   LRE+GLTFH  K VP ++++N++  L +AF P  ISD+NSIFWI HPGG 
Sbjct  248   PDSEGAIDGHLREVGLTFHLLKDVPGIVSKNIDKALFEAFNPLNISDYNSIFWIAHPGGP  307

Query  1020  AILDGVEEKLGLDPEKLRASRDVLSQYGNLTSACVLFILDEVRKKSKKQQQMTTGEGLEW  1199
             AILD VE+KLGL PEK++A+RDVLS+YGN++SACVLFILDE+R+KS +    TTGEGLEW
Sbjct  308   AILDQVEQKLGLKPEKMKATRDVLSEYGNMSSACVLFILDEMRRKSAENGLKTTGEGLEW  367

Query  1200  GVLFGFGPGLTIDTVVIRSVPI  1265
             GVLFGFGPGLTI+TVV+RSV I
Sbjct  368   GVLFGFGPGLTIETVVLRSVAI  389



>gb|AHY35308.1| chalcone synthase 1 [Morus notabilis]
Length=389

 Score =   543 bits (1400),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 255/381 (67%), Positives = 312/381 (82%), Gaps = 0/381 (0%)
 Frame = +3

Query  123   RAKRLEGDAKILAIGTATPANWVDQTTYPDFYFRITNSQHLLEHKEKFRRICNKSKIMKR  302
             +A+R EG   I+AIGTATP N +DQ++YPD+YFRITNS+H  E KEKF+R+C KS+I KR
Sbjct  9     KAQRAEGPVTIMAIGTATPPNCIDQSSYPDYYFRITNSEHKTELKEKFKRMCEKSQIKKR  68

Query  303   HLVLTEELLKKHPNLCTYNEASLNTRQDILVSGVPKLGKEAAMKAIKEWGRPISEITHLV  482
             ++ L EE+LK++PN+C Y   SL+ RQD++V  VPKLGKEAA KAIKEWG+P S+ITHLV
Sbjct  69    YMYLHEEILKENPNICAYMAPSLDARQDMVVVEVPKLGKEAATKAIKEWGQPKSKITHLV  128

Query  483   FCTTSGVDMPGADFQLTKLLGLNSSVKRLMMYQQGCNAGAAMLRLAKDLAENNKGARVLV  662
             FCTTSGVDMPGAD+QLTKLLGL  SVKRLMMYQQGC AG  +LRLAKDLAENNKGARVLV
Sbjct  129   FCTTSGVDMPGADYQLTKLLGLRPSVKRLMMYQQGCFAGGTVLRLAKDLAENNKGARVLV  188

Query  663   VCSEVMLSVFRGPSLQQEDNLLAQCLFGDGSAAVIVGTEPRPGLETPLFELVSSAQTIIP  842
             VCSE+    FRGPS    D+L+ Q LFGDG+AA+I+G +P P +E P+ +LVS+AQTI+P
Sbjct  189   VCSEITAVTFRGPSDTHLDSLVGQALFGDGAAAMIIGADPIPEVEKPILQLVSAAQTILP  248

Query  843   DTDSHLKLQLREMGLTFHCSKAVPSLITQNVEDCLVKAFEPFGISDWNSIFWILHPGGNA  1022
             D++  +   LRE+GLTFH  K VP LI++N++  L +AF+PFGISDWNSIFWI HPGG A
Sbjct  249   DSEGAIDGHLREVGLTFHLLKDVPGLISKNIDKSLTEAFKPFGISDWNSIFWIAHPGGPA  308

Query  1023  ILDGVEEKLGLDPEKLRASRDVLSQYGNLTSACVLFILDEVRKKSKKQQQMTTGEGLEWG  1202
             ILD VE K GL PEKLRA+R VLS+YGN++SACV+FILDE+R+K  +    TTGEGLEWG
Sbjct  309   ILDQVEAKCGLKPEKLRATRHVLSEYGNMSSACVVFILDEMRRKGAEDGLKTTGEGLEWG  368

Query  1203  VLFGFGPGLTIDTVVIRSVPI  1265
             VLFGFGPGLT++TVV+ SV I
Sbjct  369   VLFGFGPGLTVETVVLHSVAI  389



>sp|Q9MB33.1|CHS1_IPOBA RecName: Full=Chalcone synthase LF1; AltName: Full=Naringenin-chalcone 
synthase LF1 [Ipomoea batatas]
 dbj|BAA90486.1| chalcone synthase CHS-LF1 [Ipomoea batatas]
Length=393

 Score =   543 bits (1400),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 260/381 (68%), Positives = 310/381 (81%), Gaps = 1/381 (0%)
 Frame = +3

Query  123   RAKRLEGDAKILAIGTATPANWVDQTTYPDFYFRITNSQHLLEHKEKFRRICNKSKIMKR  302
             +A+R EG A ILAIGT TPAN V+Q+TYPD+YFRITNS+H  E KEKF+R+C+KS I KR
Sbjct  9     KAQRAEGPATILAIGTVTPANCVNQSTYPDYYFRITNSEHKTELKEKFQRMCDKSMITKR  68

Query  303   HLVLTEELLKKHPNLCTYNEASLNTRQDILVSGVPKLGKEAAMKAIKEWGRPISEITHLV  482
             ++ LTEE+LK++P+ C Y   SL+ RQDI V  VPKLGKEAA  AIKEWG+P S+ITH+V
Sbjct  69    YMHLTEEILKENPSFCEYMAPSLDARQDIAVVEVPKLGKEAAQSAIKEWGQPKSKITHVV  128

Query  483   FCTTSGVDMPGADFQLTKLLGLNSSVKRLMMYQQGCNAGAAMLRLAKDLAENNKGARVLV  662
             FCTTSG+DMPGAD+QLTKLLGL  SVKRLMMYQQGC AG  +LRLAKDLAENNKGARVL+
Sbjct  129   FCTTSGIDMPGADYQLTKLLGLRPSVKRLMMYQQGCFAGGTVLRLAKDLAENNKGARVLI  188

Query  663   VCSEVMLSVFRGPSLQQEDNLLAQCLFGDGSAAVIVGTEPRPGLETPLFELVSSAQTIIP  842
             VCSE+ +  FRGPS    D+L+ Q LFGDG+AAVIVG +P P  E PLF+LVS+AQT+ P
Sbjct  189   VCSEITVVTFRGPSETHLDSLVGQALFGDGAAAVIVGADPTPA-EKPLFQLVSAAQTLAP  247

Query  843   DTDSHLKLQLREMGLTFHCSKAVPSLITQNVEDCLVKAFEPFGISDWNSIFWILHPGGNA  1022
             ++   +   LRE+GLTFH  K VPS+++  +E CL +AF P GISDWNS+FWI HPGG A
Sbjct  248   NSCGAIDGHLREVGLTFHLLKDVPSVVSNKIEKCLFEAFNPLGISDWNSVFWIAHPGGPA  307

Query  1023  ILDGVEEKLGLDPEKLRASRDVLSQYGNLTSACVLFILDEVRKKSKKQQQMTTGEGLEWG  1202
             ILD VE+KLGL PEKLRA+R VLS+YGN++SACVLFILDE+RK S      TTGEGLEWG
Sbjct  308   ILDQVEDKLGLKPEKLRATRHVLSEYGNMSSACVLFILDEMRKASSNAGLGTTGEGLEWG  367

Query  1203  VLFGFGPGLTIDTVVIRSVPI  1265
             VLFGFGPGLTI+TVV+ SVPI
Sbjct  368   VLFGFGPGLTIETVVLHSVPI  388



>dbj|BAE17122.1| chalcone synthase [Fragaria x ananassa]
Length=389

 Score =   543 bits (1400),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 254/379 (67%), Positives = 312/379 (82%), Gaps = 0/379 (0%)
 Frame = +3

Query  123   RAKRLEGDAKILAIGTATPANWVDQTTYPDFYFRITNSQHLLEHKEKFRRICNKSKIMKR  302
             +A+R EG A +LAIGTATP N +DQ+TYPD+YFRITNS+H  E KEKF+R+C+KS I KR
Sbjct  9     KAQRAEGPATVLAIGTATPPNCIDQSTYPDYYFRITNSEHKAELKEKFQRMCDKSMIKKR  68

Query  303   HLVLTEELLKKHPNLCTYNEASLNTRQDILVSGVPKLGKEAAMKAIKEWGRPISEITHLV  482
             ++ LTEE+LK++P++C Y   SL+ RQD++V  +PKLGKEAA+KAIKEWG+P S+ITHLV
Sbjct  69    YMYLTEEILKENPSMCEYMAPSLDARQDMVVVEIPKLGKEAAVKAIKEWGQPKSKITHLV  128

Query  483   FCTTSGVDMPGADFQLTKLLGLNSSVKRLMMYQQGCNAGAAMLRLAKDLAENNKGARVLV  662
             FCTTSGVDMPGAD+QLTKLLGL  SVKRLMMYQQGC AG  +LRLAKDLAENN+GARVLV
Sbjct  129   FCTTSGVDMPGADYQLTKLLGLRPSVKRLMMYQQGCFAGGTVLRLAKDLAENNRGARVLV  188

Query  663   VCSEVMLSVFRGPSLQQEDNLLAQCLFGDGSAAVIVGTEPRPGLETPLFELVSSAQTIIP  842
             VCSE+    FRGPS    D+L+ Q LFGDG+AA+IVG++P P ++ PLFELVS+AQTI+P
Sbjct  189   VCSEITAVTFRGPSDTHLDSLVGQALFGDGAAAIIVGSDPLPEVDRPLFELVSAAQTILP  248

Query  843   DTDSHLKLQLREMGLTFHCSKAVPSLITQNVEDCLVKAFEPFGISDWNSIFWILHPGGNA  1022
             D+D  +   LRE+GLTFH  K VP LI++N+E  L +AF+P  I+DWNS+FWI HPGG A
Sbjct  249   DSDGAIDGHLREVGLTFHLLKDVPGLISKNIEKSLNEAFKPLNITDWNSLFWIAHPGGPA  308

Query  1023  ILDGVEEKLGLDPEKLRASRDVLSQYGNLTSACVLFILDEVRKKSKKQQQMTTGEGLEWG  1202
             ILD VE KL L PEKL A+R +LS+YGN++SACVLFILDEVR++S      TTGEG EWG
Sbjct  309   ILDQVEAKLALKPEKLEATRHILSEYGNMSSACVLFILDEVRRRSAANGHKTTGEGKEWG  368

Query  1203  VLFGFGPGLTIDTVVIRSV  1259
             VLFGFGPGLT++TVV+ SV
Sbjct  369   VLFGFGPGLTVETVVLHSV  387



>dbj|BAD34456.1| chalcone synthase [Eustoma grandiflorum]
Length=389

 Score =   543 bits (1399),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 257/381 (67%), Positives = 313/381 (82%), Gaps = 0/381 (0%)
 Frame = +3

Query  123   RAKRLEGDAKILAIGTATPANWVDQTTYPDFYFRITNSQHLLEHKEKFRRICNKSKIMKR  302
             RA+R EG A ++AIGTATP N VDQ+TY D+YF+ITNS+H+ E KEKF+R+C+KS I +R
Sbjct  9     RAQRAEGPATLMAIGTATPPNCVDQSTYSDYYFKITNSEHMTELKEKFKRMCDKSMIRQR  68

Query  303   HLVLTEELLKKHPNLCTYNEASLNTRQDILVSGVPKLGKEAAMKAIKEWGRPISEITHLV  482
             ++ LTEE LK++PN+  Y   SL+ RQDI+V  VPKLGK+AA+KAIKEWG+P S+ITHL+
Sbjct  69    YMHLTEEYLKENPNVSAYMAPSLDARQDIVVMEVPKLGKDAALKAIKEWGQPKSKITHLI  128

Query  483   FCTTSGVDMPGADFQLTKLLGLNSSVKRLMMYQQGCNAGAAMLRLAKDLAENNKGARVLV  662
             FCTTSGVDMPGAD+QLTKLLGL  SVKR MMYQQGC AG  +LRLAKDLAENNK ARVLV
Sbjct  129   FCTTSGVDMPGADYQLTKLLGLRPSVKRTMMYQQGCFAGGTVLRLAKDLAENNKDARVLV  188

Query  663   VCSEVMLSVFRGPSLQQEDNLLAQCLFGDGSAAVIVGTEPRPGLETPLFELVSSAQTIIP  842
             VCSE+    FRGP     D+L+ Q LFGDG+AA+I+G++P PG+E PLF+LVS+AQTI+P
Sbjct  189   VCSEITAVTFRGPCETHLDSLVGQALFGDGAAAIIIGSDPIPGVERPLFQLVSAAQTILP  248

Query  843   DTDSHLKLQLREMGLTFHCSKAVPSLITQNVEDCLVKAFEPFGISDWNSIFWILHPGGNA  1022
             ++D  ++  LRE GLTFH  K VP LI++N+   L +AFEP GISDWNS+FWI HPGG A
Sbjct  249   ESDGAIEGHLRETGLTFHLLKDVPGLISKNIMKSLEEAFEPLGISDWNSVFWIAHPGGPA  308

Query  1023  ILDGVEEKLGLDPEKLRASRDVLSQYGNLTSACVLFILDEVRKKSKKQQQMTTGEGLEWG  1202
             ILD VE KLGL+PEKLRA+R VLS+YGN++SACVLFILDE+RK S K    TTGEGLEWG
Sbjct  309   ILDQVEVKLGLEPEKLRATRHVLSEYGNMSSACVLFILDEMRKASAKDGLSTTGEGLEWG  368

Query  1203  VLFGFGPGLTIDTVVIRSVPI  1265
             VLFGFGPGLT++TVV+ SV I
Sbjct  369   VLFGFGPGLTVETVVLHSVSI  389



>gb|ACM17224.1| naringenin-chalcone synthase [Humulus lupulus]
Length=389

 Score =   543 bits (1399),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 259/382 (68%), Positives = 312/382 (82%), Gaps = 0/382 (0%)
 Frame = +3

Query  120   HRAKRLEGDAKILAIGTATPANWVDQTTYPDFYFRITNSQHLLEHKEKFRRICNKSKIMK  299
              +A+R EG A ILAIGTATPAN + Q+ YPD+YFRITNS+H  E KEKF+R+C+KS I K
Sbjct  8     RKAQRAEGPATILAIGTATPANCILQSEYPDYYFRITNSEHKTELKEKFKRMCDKSMIRK  67

Query  300   RHLVLTEELLKKHPNLCTYNEASLNTRQDILVSGVPKLGKEAAMKAIKEWGRPISEITHL  479
             R++ LTEE+LK++PNLC Y   SL+ RQD++V  VPKLGKEAA KAIKEWG+P S+ITH+
Sbjct  68    RYMHLTEEILKENPNLCAYEAPSLDARQDMVVVEVPKLGKEAATKAIKEWGQPKSKITHV  127

Query  480   VFCTTSGVDMPGADFQLTKLLGLNSSVKRLMMYQQGCNAGAAMLRLAKDLAENNKGARVL  659
             VFCTTSGVDMPGAD+QLTKLLGL  SVKRLMMYQQGC AG  +LR+AKDLAENNKGARVL
Sbjct  128   VFCTTSGVDMPGADYQLTKLLGLRPSVKRLMMYQQGCFAGGTVLRVAKDLAENNKGARVL  187

Query  660   VVCSEVMLSVFRGPSLQQEDNLLAQCLFGDGSAAVIVGTEPRPGLETPLFELVSSAQTII  839
             VVCSE+    FRGP+     +L+ Q LFGDGSAA+I+G +P P +E P+FELVS+AQTI+
Sbjct  188   VVCSEITAVTFRGPNDTHLGSLVGQALFGDGSAALIIGADPIPEIEKPVFELVSAAQTIL  247

Query  840   PDTDSHLKLQLREMGLTFHCSKAVPSLITQNVEDCLVKAFEPFGISDWNSIFWILHPGGN  1019
             PD+D  +   LRE+GLTFH  K VP LI++N+E  LV+AF+P GISDWNS+FWI HPGG 
Sbjct  248   PDSDGAIDGHLREVGLTFHLLKDVPGLISKNIEKSLVEAFKPLGISDWNSLFWIAHPGGP  307

Query  1020  AILDGVEEKLGLDPEKLRASRDVLSQYGNLTSACVLFILDEVRKKSKKQQQMTTGEGLEW  1199
             AILD VE KL L PEKLRA+R VL +YGN++SACVLFILDE+R+K  +    TTGEGLEW
Sbjct  308   AILDQVESKLALKPEKLRATRHVLGEYGNMSSACVLFILDEMRRKCAEDGLKTTGEGLEW  367

Query  1200  GVLFGFGPGLTIDTVVIRSVPI  1265
             GVLFGFGPGLT++TVV+ SV I
Sbjct  368   GVLFGFGPGLTVETVVLHSVGI  389



>dbj|BAE17123.1| chalcone synthase [Fragaria x ananassa]
Length=389

 Score =   543 bits (1399),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 255/379 (67%), Positives = 311/379 (82%), Gaps = 0/379 (0%)
 Frame = +3

Query  123   RAKRLEGDAKILAIGTATPANWVDQTTYPDFYFRITNSQHLLEHKEKFRRICNKSKIMKR  302
             +A+R EG A +LAIGTATP N +DQ+TYPD+YFRITNS+H  E KEKF+R+C+KS I KR
Sbjct  9     KAQRAEGPATVLAIGTATPPNCIDQSTYPDYYFRITNSEHKAELKEKFQRMCDKSMIKKR  68

Query  303   HLVLTEELLKKHPNLCTYNEASLNTRQDILVSGVPKLGKEAAMKAIKEWGRPISEITHLV  482
             ++ LTEE+LK++P++C Y   SL+ RQD++V  +PKLGKEAA+KAIKEWG+P S+ITHLV
Sbjct  69    YMYLTEEILKENPSMCEYMAPSLDARQDMVVVEIPKLGKEAAVKAIKEWGQPKSKITHLV  128

Query  483   FCTTSGVDMPGADFQLTKLLGLNSSVKRLMMYQQGCNAGAAMLRLAKDLAENNKGARVLV  662
             FCTTSGVDMPGAD+QLTKLLGL  SVKRLMMYQQGC AG  +LRLAKDLAENN+GARVLV
Sbjct  129   FCTTSGVDMPGADYQLTKLLGLRPSVKRLMMYQQGCFAGGTVLRLAKDLAENNRGARVLV  188

Query  663   VCSEVMLSVFRGPSLQQEDNLLAQCLFGDGSAAVIVGTEPRPGLETPLFELVSSAQTIIP  842
             VCSE     FRGPS    D+L+ Q LFGDG+AA+IVG++P P ++ PLFELVS+AQTI+P
Sbjct  189   VCSETTAVTFRGPSDTHLDSLVGQALFGDGAAAIIVGSDPLPEVDKPLFELVSAAQTILP  248

Query  843   DTDSHLKLQLREMGLTFHCSKAVPSLITQNVEDCLVKAFEPFGISDWNSIFWILHPGGNA  1022
             D+D  +   LRE+GLTFH  K VP LI++N+E  L +AF+P  I+DWNS+FWI HPGG A
Sbjct  249   DSDGAIDGHLREVGLTFHLLKDVPGLISKNIEKSLNEAFKPLNITDWNSLFWIAHPGGPA  308

Query  1023  ILDGVEEKLGLDPEKLRASRDVLSQYGNLTSACVLFILDEVRKKSKKQQQMTTGEGLEWG  1202
             ILD VE KL L  EKL A+R +LS+YGN++SACVLFILDEVR+KS      TTGEGLEWG
Sbjct  309   ILDQVEAKLALKSEKLEATRHILSEYGNMSSACVLFILDEVRRKSAANGHKTTGEGLEWG  368

Query  1203  VLFGFGPGLTIDTVVIRSV  1259
             VLFGFGPGLT++TVV+ SV
Sbjct  369   VLFGFGPGLTVETVVLHSV  387



>gb|ADZ45299.1| chalcone synthase 1 [Astragalus membranaceus]
Length=389

 Score =   543 bits (1399),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 256/382 (67%), Positives = 315/382 (82%), Gaps = 0/382 (0%)
 Frame = +3

Query  120   HRAKRLEGDAKILAIGTATPANWVDQTTYPDFYFRITNSQHLLEHKEKFRRICNKSKIMK  299
              +A+R EG A ILAIGTA P+N V+Q+TYPDFYFRITNS+H  E KEKF+R+C+KS I +
Sbjct  8     RKAQRAEGPATILAIGTANPSNCVEQSTYPDFYFRITNSEHKTELKEKFQRMCDKSMIKR  67

Query  300   RHLVLTEELLKKHPNLCTYNEASLNTRQDILVSGVPKLGKEAAMKAIKEWGRPISEITHL  479
             R++ LTEE+LK++P++C Y   SL+ RQD++V  VP+LGKEAA+KAIKEWG+P S+ITHL
Sbjct  68    RYMYLTEEILKENPSVCEYMAPSLDARQDMVVVEVPRLGKEAAVKAIKEWGQPKSKITHL  127

Query  480   VFCTTSGVDMPGADFQLTKLLGLNSSVKRLMMYQQGCNAGAAMLRLAKDLAENNKGARVL  659
             +FCTTSGVDMPGAD+QLTKLLGL   VKR MMYQQGC AG  +LRLAKDLAENNKGARVL
Sbjct  128   IFCTTSGVDMPGADYQLTKLLGLRPYVKRYMMYQQGCFAGGTVLRLAKDLAENNKGARVL  187

Query  660   VVCSEVMLSVFRGPSLQQEDNLLAQCLFGDGSAAVIVGTEPRPGLETPLFELVSSAQTII  839
             VVCSEV    FRGPS    D+L+ Q LFGDG+AA+IVG++P P +E P+FELV +AQTI 
Sbjct  188   VVCSEVTAVTFRGPSDTHLDSLVGQALFGDGAAALIVGSDPIPEIEKPIFELVWTAQTIA  247

Query  840   PDTDSHLKLQLREMGLTFHCSKAVPSLITQNVEDCLVKAFEPFGISDWNSIFWILHPGGN  1019
             PD++  +   LRE GLTFH  K VP ++++N++  LV+AF+P  ISD+NSIFWI HPGG 
Sbjct  248   PDSEGAIDGHLREAGLTFHLLKDVPGIVSKNIDKALVEAFQPLNISDYNSIFWIAHPGGP  307

Query  1020  AILDGVEEKLGLDPEKLRASRDVLSQYGNLTSACVLFILDEVRKKSKKQQQMTTGEGLEW  1199
             AILD VE+KL L PEK+RA+R+VLS+YGN++SACVLFILDE+RKKS +    TTGEGLEW
Sbjct  308   AILDQVEQKLALKPEKMRATREVLSEYGNMSSACVLFILDEMRKKSAQNGLKTTGEGLEW  367

Query  1200  GVLFGFGPGLTIDTVVIRSVPI  1265
             GVLFGFGPGLTI+TVV+RSV I
Sbjct  368   GVLFGFGPGLTIETVVLRSVAI  389



>gb|AAF60297.1|AF233638_1 chalcone synthase [Petunia x hybrida]
 gb|AGZ04577.1| chalcone synthase [Petunia x hybrida]
Length=389

 Score =   543 bits (1399),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 257/379 (68%), Positives = 311/379 (82%), Gaps = 0/379 (0%)
 Frame = +3

Query  123   RAKRLEGDAKILAIGTATPANWVDQTTYPDFYFRITNSQHLLEHKEKFRRICNKSKIMKR  302
             +A+R EG A ++AIGTATP N VDQ+TYPD+YFRITNS+H  + KEKF+R+C KS I KR
Sbjct  9     KAQRAEGPATVMAIGTATPTNCVDQSTYPDYYFRITNSEHKTDLKEKFKRMCEKSMIKKR  68

Query  303   HLVLTEELLKKHPNLCTYNEASLNTRQDILVSGVPKLGKEAAMKAIKEWGRPISEITHLV  482
             ++ LTEE+LK++P++C Y   SL+ RQDI+V  VPKLGKEAA KAIKEWG+P S+ITHLV
Sbjct  69    YMHLTEEILKENPSMCEYMAPSLDARQDIVVVEVPKLGKEAAQKAIKEWGQPKSKITHLV  128

Query  483   FCTTSGVDMPGADFQLTKLLGLNSSVKRLMMYQQGCNAGAAMLRLAKDLAENNKGARVLV  662
             FCTTSGVDMPG D+QLTKLLGL  SVKRLMMYQQGC AG  +LRLAKDLAENNKGARVLV
Sbjct  129   FCTTSGVDMPGCDYQLTKLLGLRPSVKRLMMYQQGCFAGGTVLRLAKDLAENNKGARVLV  188

Query  663   VCSEVMLSVFRGPSLQQEDNLLAQCLFGDGSAAVIVGTEPRPGLETPLFELVSSAQTIIP  842
             VCSE+    FRGP+    D+L+ Q LFGDG+ A+I+G++P PG+E PLFELVS+AQT++P
Sbjct  189   VCSEITAVTFRGPNDTHLDSLVGQALFGDGAGAIIIGSDPIPGVERPLFELVSAAQTLLP  248

Query  843   DTDSHLKLQLREMGLTFHCSKAVPSLITQNVEDCLVKAFEPFGISDWNSIFWILHPGGNA  1022
             D+   +   LRE+GLTFH  K VP LI++N+E  L +AF P  ISDWNS+FWI HPGG A
Sbjct  249   DSHGAIDGHLREVGLTFHLLKDVPGLISKNIEKSLEEAFRPLSISDWNSLFWIAHPGGPA  308

Query  1023  ILDGVEEKLGLDPEKLRASRDVLSQYGNLTSACVLFILDEVRKKSKKQQQMTTGEGLEWG  1202
             ILD VE KLGL PEKL+A+R+VLS YGN++SACVLFILDE+RK S K+   TTGEGLEWG
Sbjct  309   ILDQVEIKLGLKPEKLKATRNVLSNYGNMSSACVLFILDEMRKASAKEGLGTTGEGLEWG  368

Query  1203  VLFGFGPGLTIDTVVIRSV  1259
             VLFGFGPGLT++TVV+ SV
Sbjct  369   VLFGFGPGLTVETVVLHSV  387



>ref|XP_003537853.1| PREDICTED: chalcone synthase [Glycine max]
 gb|KHN35131.1| Chalcone synthase [Glycine soja]
Length=389

 Score =   543 bits (1399),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 255/382 (67%), Positives = 313/382 (82%), Gaps = 0/382 (0%)
 Frame = +3

Query  120   HRAKRLEGDAKILAIGTATPANWVDQTTYPDFYFRITNSQHLLEHKEKFRRICNKSKIMK  299
              +A+R EG A ILAIGTA P N VDQ+TYPD+YFRITNS+H+ E KEKF+R+C+KS I +
Sbjct  8     RQAQRAEGPATILAIGTANPPNCVDQSTYPDYYFRITNSEHMTELKEKFQRMCDKSMIKR  67

Query  300   RHLVLTEELLKKHPNLCTYNEASLNTRQDILVSGVPKLGKEAAMKAIKEWGRPISEITHL  479
             R++ L EE+LK++PN+C Y   SL+ RQD++V  VPKLGKEAA+KAIKEWG+P S+ITHL
Sbjct  68    RYMYLNEEILKENPNMCAYMAPSLDARQDMVVVEVPKLGKEAAVKAIKEWGQPKSKITHL  127

Query  480   VFCTTSGVDMPGADFQLTKLLGLNSSVKRLMMYQQGCNAGAAMLRLAKDLAENNKGARVL  659
             +FCTTSGVDMPGAD+QLTK LGL   VKR MMYQQGC AG  +LRLAKDLAENNKGARVL
Sbjct  128   IFCTTSGVDMPGADYQLTKQLGLRPYVKRYMMYQQGCFAGGTVLRLAKDLAENNKGARVL  187

Query  660   VVCSEVMLSVFRGPSLQQEDNLLAQCLFGDGSAAVIVGTEPRPGLETPLFELVSSAQTII  839
             VVCSE+    FRGPS    D+L+ Q LFGDG+AAVIVG++P P +E PL+ELV +AQTI 
Sbjct  188   VVCSEITAVTFRGPSDTHLDSLVGQALFGDGAAAVIVGSDPIPQVEKPLYELVWTAQTIA  247

Query  840   PDTDSHLKLQLREMGLTFHCSKAVPSLITQNVEDCLVKAFEPFGISDWNSIFWILHPGGN  1019
             PD++  +   LRE+GLTFH  K VP ++++N++  L +AF P  ISD+NSIFWI HPGG 
Sbjct  248   PDSEGAIDGHLREVGLTFHLLKDVPGIVSKNIDKALFEAFNPLNISDYNSIFWIAHPGGP  307

Query  1020  AILDGVEEKLGLDPEKLRASRDVLSQYGNLTSACVLFILDEVRKKSKKQQQMTTGEGLEW  1199
             AILD VE+KLGL PEK++A+RDVLS+YGN++SACVLFILDE+R+KS +    TTGEGLEW
Sbjct  308   AILDQVEQKLGLKPEKMKATRDVLSEYGNMSSACVLFILDEMRRKSAENGLKTTGEGLEW  367

Query  1200  GVLFGFGPGLTIDTVVIRSVPI  1265
             GVLFGFGPGLTI+TVV+RSV I
Sbjct  368   GVLFGFGPGLTIETVVLRSVAI  389



>gb|AAU43217.1| chalcone synthase [Arachis hypogaea]
Length=389

 Score =   543 bits (1399),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 256/381 (67%), Positives = 311/381 (82%), Gaps = 0/381 (0%)
 Frame = +3

Query  123   RAKRLEGDAKILAIGTATPANWVDQTTYPDFYFRITNSQHLLEHKEKFRRICNKSKIMKR  302
             +A+R EG A I+AIGTATP N VDQ+TYPD+YFR TNSQH+ E KEKF+R+C+KS I KR
Sbjct  9     KAQRAEGPATIMAIGTATPQNCVDQSTYPDYYFRTTNSQHMTELKEKFQRMCDKSMIKKR  68

Query  303   HLVLTEELLKKHPNLCTYNEASLNTRQDILVSGVPKLGKEAAMKAIKEWGRPISEITHLV  482
             ++ LTEE+LK++PN+C Y   SL+ RQD++V  VP+LGKEAA KAIKEWG+P S+ITHL+
Sbjct  69    YMYLTEEILKENPNMCKYMAPSLDARQDMVVVEVPRLGKEAATKAIKEWGQPKSKITHLI  128

Query  483   FCTTSGVDMPGADFQLTKLLGLNSSVKRLMMYQQGCNAGAAMLRLAKDLAENNKGARVLV  662
             FCTTSGVDMPGAD+QLTKLLGL  SVKR MMYQQGC AG  +LRLAKDLAENNKGARVLV
Sbjct  129   FCTTSGVDMPGADYQLTKLLGLRPSVKRYMMYQQGCFAGGTVLRLAKDLAENNKGARVLV  188

Query  663   VCSEVMLSVFRGPSLQQEDNLLAQCLFGDGSAAVIVGTEPRPGLETPLFELVSSAQTIIP  842
             VCSE+    FRGPS    D+L+ Q LFGDG+AA+IVG++P P +E P+FELV +AQT+ P
Sbjct  189   VCSEITAVTFRGPSETHLDSLVGQALFGDGAAALIVGSDPLPQIEKPVFELVWTAQTLAP  248

Query  843   DTDSHLKLQLREMGLTFHCSKAVPSLITQNVEDCLVKAFEPFGISDWNSIFWILHPGGNA  1022
             D++  +   LRE+GLTFH  K VP ++++N+   L +AF+P GISD+NSIFWI HPGG A
Sbjct  249   DSEGAIDGHLREVGLTFHLLKDVPGIVSKNINKALTEAFDPLGISDYNSIFWIAHPGGPA  308

Query  1023  ILDGVEEKLGLDPEKLRASRDVLSQYGNLTSACVLFILDEVRKKSKKQQQMTTGEGLEWG  1202
             ILD VE+KL L P KLRA+RDVLS YGN++SACVLFILD +R KS +Q   TTGEGLEWG
Sbjct  309   ILDQVEDKLKLKPHKLRATRDVLSDYGNMSSACVLFILDHMRNKSLQQGLQTTGEGLEWG  368

Query  1203  VLFGFGPGLTIDTVVIRSVPI  1265
             VLFGFGPGLTI+TVV+ SV I
Sbjct  369   VLFGFGPGLTIETVVLHSVAI  389



>gb|KDP41871.1| hypothetical protein JCGZ_26889 [Jatropha curcas]
Length=391

 Score =   543 bits (1399),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 257/380 (68%), Positives = 309/380 (81%), Gaps = 0/380 (0%)
 Frame = +3

Query  120   HRAKRLEGDAKILAIGTATPANWVDQTTYPDFYFRITNSQHLLEHKEKFRRICNKSKIMK  299
              +A+R EG A +LAIGTATPAN V Q  YPD+YFRIT S HL E KEKF+R+C+KS I K
Sbjct  10    RKAQRAEGPATVLAIGTATPANCVIQADYPDYYFRITKSDHLTELKEKFKRMCDKSMIKK  69

Query  300   RHLVLTEELLKKHPNLCTYNEASLNTRQDILVSGVPKLGKEAAMKAIKEWGRPISEITHL  479
             R++ L EE+LK++P++C Y E SL+ RQDI+V  VPKLGKEAA KAIKEWG+P S+ITHL
Sbjct  70    RYMYLNEEILKENPSMCAYWEPSLDARQDIVVVEVPKLGKEAAAKAIKEWGQPKSKITHL  129

Query  480   VFCTTSGVDMPGADFQLTKLLGLNSSVKRLMMYQQGCNAGAAMLRLAKDLAENNKGARVL  659
             +FCTTSGVDMPG D+QLTKLLGL  SVKR MMYQQGC AG  +LRLAKDLAENNKGARVL
Sbjct  130   IFCTTSGVDMPGCDYQLTKLLGLRPSVKRFMMYQQGCYAGGTVLRLAKDLAENNKGARVL  189

Query  660   VVCSEVMLSVFRGPSLQQEDNLLAQCLFGDGSAAVIVGTEPRPGLETPLFELVSSAQTII  839
             VVCSE+    FRGPS    D+L+ Q LFGDG+ A+IVG +P   +E PLFELVS+AQTI+
Sbjct  190   VVCSEITAVTFRGPSDTHLDSLVGQALFGDGAGALIVGADPDTSVERPLFELVSAAQTIL  249

Query  840   PDTDSHLKLQLREMGLTFHCSKAVPSLITQNVEDCLVKAFEPFGISDWNSIFWILHPGGN  1019
             PD+D  +   LRE+GLTFH  K VP LI++N+E  LV+AF P GI+DWNSIFWI HPGG 
Sbjct  250   PDSDGAIDGHLREVGLTFHLLKDVPGLISKNIEKSLVEAFTPIGINDWNSIFWIAHPGGP  309

Query  1020  AILDGVEEKLGLDPEKLRASRDVLSQYGNLTSACVLFILDEVRKKSKKQQQMTTGEGLEW  1199
             AILD VE KL L PEK++A+R VLS+YGN++SACVLFILDE+RKKS ++ + TTGEGLEW
Sbjct  310   AILDQVEAKLSLKPEKMKATRHVLSEYGNMSSACVLFILDEMRKKSIEEGKATTGEGLEW  369

Query  1200  GVLFGFGPGLTIDTVVIRSV  1259
             GVLFGFGPGLT++T+V+ SV
Sbjct  370   GVLFGFGPGLTVETIVLHSV  389



>gb|AAB36038.1| chalcone synthase [Petunia x hybrida]
Length=389

 Score =   543 bits (1399),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 257/379 (68%), Positives = 312/379 (82%), Gaps = 0/379 (0%)
 Frame = +3

Query  123   RAKRLEGDAKILAIGTATPANWVDQTTYPDFYFRITNSQHLLEHKEKFRRICNKSKIMKR  302
             +A+R EG A ++AIGTATP N VDQ+TYPD+YFRITNS+H  + KEKF+R+C KS I KR
Sbjct  9     KAQRCEGPATVMAIGTATPTNCVDQSTYPDYYFRITNSEHKTDLKEKFKRMCEKSMIKKR  68

Query  303   HLVLTEELLKKHPNLCTYNEASLNTRQDILVSGVPKLGKEAAMKAIKEWGRPISEITHLV  482
             ++ LTEE+LK++P++C Y   SL+ RQDI+V  VPKLGKEAA KAIKEWG+P S+ITHLV
Sbjct  69    YMHLTEEILKENPSMCEYMAPSLDARQDIVVVEVPKLGKEAAQKAIKEWGQPKSKITHLV  128

Query  483   FCTTSGVDMPGADFQLTKLLGLNSSVKRLMMYQQGCNAGAAMLRLAKDLAENNKGARVLV  662
             FCTTSGVDMPG D+QLTKLLGL  SVKRLMMYQQGC AG  +LRL KDLAENNKGARVLV
Sbjct  129   FCTTSGVDMPGCDYQLTKLLGLRPSVKRLMMYQQGCFAGGTVLRLRKDLAENNKGARVLV  188

Query  663   VCSEVMLSVFRGPSLQQEDNLLAQCLFGDGSAAVIVGTEPRPGLETPLFELVSSAQTIIP  842
             VCSE+    FRGP+    D+L+ Q LFGDG+ A+I+G++P PG+E PLFELVS+AQT++P
Sbjct  189   VCSEITAVTFRGPNDTHLDSLVGQALFGDGAGAIIIGSDPIPGVERPLFELVSAAQTLLP  248

Query  843   DTDSHLKLQLREMGLTFHCSKAVPSLITQNVEDCLVKAFEPFGISDWNSIFWILHPGGNA  1022
             D+   +   LRE+GLTFH  K VP LI++N+E  L +AF+P GISDWNS+FWI HPGG A
Sbjct  249   DSHGAIDGHLREVGLTFHLLKDVPGLISKNIEKSLEEAFKPLGISDWNSLFWIAHPGGPA  308

Query  1023  ILDGVEEKLGLDPEKLRASRDVLSQYGNLTSACVLFILDEVRKKSKKQQQMTTGEGLEWG  1202
             ILD VE KLGL PEKL+A+R+VLS YGN++SACVLFILDE+RK S K+   TTGEGLEWG
Sbjct  309   ILDQVEIKLGLKPEKLKATRNVLSDYGNMSSACVLFILDEMRKASAKEGLGTTGEGLEWG  368

Query  1203  VLFGFGPGLTIDTVVIRSV  1259
             VLFGFGPGLT++TVV+ SV
Sbjct  369   VLFGFGPGLTVETVVLHSV  387



>gb|AHB50476.1| putative stilbene synthase [Arachis hypogaea]
Length=389

 Score =   543 bits (1398),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 253/382 (66%), Positives = 314/382 (82%), Gaps = 0/382 (0%)
 Frame = +3

Query  120   HRAKRLEGDAKILAIGTATPANWVDQTTYPDFYFRITNSQHLLEHKEKFRRICNKSKIMK  299
              + +R EG A I+AIGTATP N VDQ+TYPD+YFRITNS+H+ + K+KF+R+C+KS I K
Sbjct  8     RKVQRAEGPATIMAIGTATPPNCVDQSTYPDYYFRITNSEHMSDLKKKFQRMCDKSMIKK  67

Query  300   RHLVLTEELLKKHPNLCTYNEASLNTRQDILVSGVPKLGKEAAMKAIKEWGRPISEITHL  479
             R++ LTEE+LK++PN+C Y   SL+ RQD++V  VP+LGKEAA KAIKEWG+P S+ITHL
Sbjct  68    RYMYLTEEMLKENPNMCAYMAPSLDARQDMVVVEVPRLGKEAATKAIKEWGQPKSKITHL  127

Query  480   VFCTTSGVDMPGADFQLTKLLGLNSSVKRLMMYQQGCNAGAAMLRLAKDLAENNKGARVL  659
             +FCTTSGVDMPGAD++LTKLLGL   VKR MMYQQGC AG  +LRLAKDLAENNKGARVL
Sbjct  128   IFCTTSGVDMPGADYRLTKLLGLRPYVKRYMMYQQGCFAGGTVLRLAKDLAENNKGARVL  187

Query  660   VVCSEVMLSVFRGPSLQQEDNLLAQCLFGDGSAAVIVGTEPRPGLETPLFELVSSAQTII  839
             VVCSE+    FRGPS    D+L+ Q LFGDG+AA+IVG++P P +E P+FELV +AQT+ 
Sbjct  188   VVCSEITAVTFRGPSETHLDSLVGQALFGDGAAALIVGSDPLPEIEKPIFELVWTAQTLA  247

Query  840   PDTDSHLKLQLREMGLTFHCSKAVPSLITQNVEDCLVKAFEPFGISDWNSIFWILHPGGN  1019
             PD++  +   LRE+GLTFH  K VPS++++N+   L +AF+P GISD+NSIFWI HPGG 
Sbjct  248   PDSEGAIDGHLREVGLTFHLLKDVPSIVSKNINKALTEAFDPLGISDYNSIFWIAHPGGP  307

Query  1020  AILDGVEEKLGLDPEKLRASRDVLSQYGNLTSACVLFILDEVRKKSKKQQQMTTGEGLEW  1199
             AILD VEEKL L PEK++A+RDVLS YGN++SACVLFILDE+RKKS ++   TTGEG EW
Sbjct  308   AILDQVEEKLNLKPEKMKATRDVLSNYGNMSSACVLFILDEMRKKSVEEGLKTTGEGFEW  367

Query  1200  GVLFGFGPGLTIDTVVIRSVPI  1265
             GVLFGFGPGLTI+TVV+RSV I
Sbjct  368   GVLFGFGPGLTIETVVLRSVAI  389



>dbj|BAK08888.1| chalcone synthase 2 [Dahlia pinnata]
Length=398

 Score =   543 bits (1399),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 256/379 (68%), Positives = 309/379 (82%), Gaps = 0/379 (0%)
 Frame = +3

Query  126   AKRLEGDAKILAIGTATPANWVDQTTYPDFYFRITNSQHLLEHKEKFRRICNKSKIMKRH  305
             A+R EG A ILAIGTATP N + Q  YPD+YFRITNS+H++E KEKF+R+C+KS I KR+
Sbjct  13    AQRAEGPATILAIGTATPPNCLYQADYPDYYFRITNSEHMVELKEKFKRMCDKSMIRKRY  72

Query  306   LVLTEELLKKHPNLCTYNEASLNTRQDILVSGVPKLGKEAAMKAIKEWGRPISEITHLVF  485
             + LTEE LK+HPN+C Y   SL+ RQD++V  VPKLGK+AA+KAIKEWG+P S+ITHL+F
Sbjct  73    MHLTEEYLKEHPNICEYMAPSLDARQDVVVVEVPKLGKDAAVKAIKEWGKPKSQITHLIF  132

Query  486   CTTSGVDMPGADFQLTKLLGLNSSVKRLMMYQQGCNAGAAMLRLAKDLAENNKGARVLVV  665
             CTTSGVDMPGAD+QLTKLLGL  SVKR MMYQQGC AG  +LRLAKDLAENNKGARVLVV
Sbjct  133   CTTSGVDMPGADYQLTKLLGLRPSVKRFMMYQQGCFAGGTVLRLAKDLAENNKGARVLVV  192

Query  666   CSEVMLSVFRGPSLQQEDNLLAQCLFGDGSAAVIVGTEPRPGLETPLFELVSSAQTIIPD  845
             CSE+    FRGP+    D+L+ Q LFGDG+AA+IVG++P    E PLF+++S+AQTI+PD
Sbjct  193   CSEITAVTFRGPTDTHLDSLVGQALFGDGAAALIVGSDPDLTTERPLFQMISAAQTILPD  252

Query  846   TDSHLKLQLREMGLTFHCSKAVPSLITQNVEDCLVKAFEPFGISDWNSIFWILHPGGNAI  1025
             ++  +   LRE+GLTFH  K VP LI +N+E  LV+AF P GISDWNSIFWI HPGG AI
Sbjct  253   SEGAIDGHLREVGLTFHLLKDVPGLIAKNIEKALVQAFSPLGISDWNSIFWIAHPGGPAI  312

Query  1026  LDGVEEKLGLDPEKLRASRDVLSQYGNLTSACVLFILDEVRKKSKKQQQMTTGEGLEWGV  1205
             LD VE KLGL  EK+RA+R VL +YGN++SACVLFILDEVRKKS +    TTGEGL+WGV
Sbjct  313   LDQVESKLGLKEEKMRATRHVLGEYGNMSSACVLFILDEVRKKSAEDGVGTTGEGLDWGV  372

Query  1206  LFGFGPGLTIDTVVIRSVP  1262
             LFGFGPGLT++TVV+ SVP
Sbjct  373   LFGFGPGLTVETVVLHSVP  391



>gb|AID69535.1| chalcone synthase [Phlomoides rotata]
Length=391

 Score =   543 bits (1399),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 254/381 (67%), Positives = 314/381 (82%), Gaps = 0/381 (0%)
 Frame = +3

Query  123   RAKRLEGDAKILAIGTATPANWVDQTTYPDFYFRITNSQHLLEHKEKFRRICNKSKIMKR  302
             RA+R EG A +LAIGTATP+N VDQ+TYPD+YFRITNS+H+ E KEKF+R+C KS I KR
Sbjct  9     RAQRAEGPATVLAIGTATPSNCVDQSTYPDYYFRITNSEHMTELKEKFKRMCEKSTINKR  68

Query  303   HLVLTEELLKKHPNLCTYNEASLNTRQDILVSGVPKLGKEAAMKAIKEWGRPISEITHLV  482
             ++ LTE+ LK++PN+C Y   SL+ RQD++V  VPKLGKEAA KAIKEWG+P S+ITHLV
Sbjct  69    YMHLTEDYLKENPNVCAYMAPSLDARQDLVVVEVPKLGKEAAQKAIKEWGQPKSKITHLV  128

Query  483   FCTTSGVDMPGADFQLTKLLGLNSSVKRLMMYQQGCNAGAAMLRLAKDLAENNKGARVLV  662
             FCTTSGVDMPGAD+QLTKLLGL  +VKR MMYQQGC+AG  +LRLAKDLAENN GARVL 
Sbjct  129   FCTTSGVDMPGADYQLTKLLGLRPAVKRFMMYQQGCSAGGTVLRLAKDLAENNAGARVLA  188

Query  663   VCSEVMLSVFRGPSLQQEDNLLAQCLFGDGSAAVIVGTEPRPGLETPLFELVSSAQTIIP  842
             VCSE+ +  FRGPS    DNL+ Q LFGDG+AAVIVG++P  G+E PLF+LVS+ QT++P
Sbjct  189   VCSEITVISFRGPSEDHLDNLVGQALFGDGAAAVIVGSDPVVGVERPLFQLVSTVQTLLP  248

Query  843   DTDSHLKLQLREMGLTFHCSKAVPSLITQNVEDCLVKAFEPFGISDWNSIFWILHPGGNA  1022
             D ++ +   LREMG+ F   K VP LI++++E  L +AF+P GISDWNSIFWI HPGG A
Sbjct  249   DCEASINGHLREMGIIFQILKDVPFLISEHIEKSLKEAFDPLGISDWNSIFWIAHPGGPA  308

Query  1023  ILDGVEEKLGLDPEKLRASRDVLSQYGNLTSACVLFILDEVRKKSKKQQQMTTGEGLEWG  1202
             IL+GVE KLGL+P+KLR+SR VLS+YGN+ SACVLF++DE+RK S  + + +TGEGL+WG
Sbjct  309   ILNGVEAKLGLEPDKLRSSRHVLSEYGNMLSACVLFVMDEMRKVSANEGRSSTGEGLDWG  368

Query  1203  VLFGFGPGLTIDTVVIRSVPI  1265
             VL GFGPGLTI+TVV+ SVPI
Sbjct  369   VLLGFGPGLTIETVVLHSVPI  389



>ref|XP_009111334.1| PREDICTED: chalcone synthase 3-like [Brassica rapa]
Length=393

 Score =   543 bits (1399),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 260/382 (68%), Positives = 315/382 (82%), Gaps = 1/382 (0%)
 Frame = +3

Query  123   RAKRLEGDAKILAIGTATPANWVDQTTYPDFYFRITNSQHLLEHKEKFRRICNKSKIMKR  302
             +A+R +G A ILAIGTA PAN V Q  YPD+YFRITNS+H+++ KEKF+R+C+KS I KR
Sbjct  12    KAQRADGPAGILAIGTANPANHVIQAEYPDYYFRITNSEHMIDLKEKFKRMCDKSGIRKR  71

Query  303   HLVLTEELLKKHPNLCTYNEASLNTRQDILVSGVPKLGKEAAMKAIKEWGRPISEITHLV  482
             H+ LTEE LK +PN+C Y   SL+ RQD++V  VPKLGKEAA+KAI EWG+P S ITHLV
Sbjct  72    HMHLTEEFLKDNPNMCAYMAPSLDVRQDLVVVEVPKLGKEAAVKAINEWGQPKSRITHLV  131

Query  483   FCTTSGVDMPGADFQLTKLLGLNSSVKRLMMYQQGCNAGAAMLRLAKDLAENNKGARVLV  662
             FCTTSGVDMPGAD+QLTKLLGL  SVKRLMMYQQGC AGA +LRLAKDLAENN+GARVLV
Sbjct  132   FCTTSGVDMPGADYQLTKLLGLCPSVKRLMMYQQGCFAGATVLRLAKDLAENNRGARVLV  191

Query  663   VCSEVMLSVFRGPSLQQEDNLLAQCLFGDGSAAVIVGTEPRPGL-ETPLFELVSSAQTII  839
             VCSE++   FRGPS    D+LL Q LF DG+AA++VG++P   + E P+FE+VS+AQTI+
Sbjct  192   VCSEIIALFFRGPSDTHLDSLLGQALFSDGAAALVVGSDPDISVGEKPIFEMVSAAQTIL  251

Query  840   PDTDSHLKLQLREMGLTFHCSKAVPSLITQNVEDCLVKAFEPFGISDWNSIFWILHPGGN  1019
             PD+D  + LQLRE GLTFH  K VP LI++N+E  L +AF+P GISDWNS+FWI HPGG 
Sbjct  252   PDSDGVINLQLREAGLTFHLLKHVPRLISKNIEKSLHEAFKPLGISDWNSLFWIAHPGGR  311

Query  1020  AILDGVEEKLGLDPEKLRASRDVLSQYGNLTSACVLFILDEVRKKSKKQQQMTTGEGLEW  1199
             AILD VE+KLGL  EKLRA+R VLS+YGN+TSACVLFILDE+R+KS +    TTGEGLEW
Sbjct  312   AILDEVEKKLGLKAEKLRATRHVLSEYGNMTSACVLFILDEMRRKSAEDGVATTGEGLEW  371

Query  1200  GVLFGFGPGLTIDTVVIRSVPI  1265
             GVLFGFGPGLT++T+V+ SVP+
Sbjct  372   GVLFGFGPGLTVETLVLHSVPL  393



>dbj|BAE45039.1| chalcone synthase [Gentiana triflora]
Length=389

 Score =   543 bits (1398),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 254/381 (67%), Positives = 313/381 (82%), Gaps = 0/381 (0%)
 Frame = +3

Query  123   RAKRLEGDAKILAIGTATPANWVDQTTYPDFYFRITNSQHLLEHKEKFRRICNKSKIMKR  302
             +A+R EG A +LAIGTATP N VDQ+TYPD+YFRIT+S+H  E KEKF+R+C KS I KR
Sbjct  9     KAQRAEGPATVLAIGTATPVNCVDQSTYPDYYFRITDSEHKTELKEKFKRMCEKSMIRKR  68

Query  303   HLVLTEELLKKHPNLCTYNEASLNTRQDILVSGVPKLGKEAAMKAIKEWGRPISEITHLV  482
             ++ LTE++LK++PN+C Y   SL+ RQDI+V  VPKLGKEAA KAIKEWG+P S+ITHLV
Sbjct  69    YMHLTEDILKENPNMCAYMAPSLDARQDIVVVEVPKLGKEAAQKAIKEWGQPKSKITHLV  128

Query  483   FCTTSGVDMPGADFQLTKLLGLNSSVKRLMMYQQGCNAGAAMLRLAKDLAENNKGARVLV  662
             FCTTSGVDMPGAD+Q+TKLLGL SSVKR MMYQQGC AG  +LR+AKDLAENN+GARVLV
Sbjct  129   FCTTSGVDMPGADYQITKLLGLRSSVKRFMMYQQGCFAGGTVLRMAKDLAENNRGARVLV  188

Query  663   VCSEVMLSVFRGPSLQQEDNLLAQCLFGDGSAAVIVGTEPRPGLETPLFELVSSAQTIIP  842
             VCSE+    FRGPS    D+L+ Q LFGDG+AA+IVG++P P LE PLF++VS+AQT++P
Sbjct  189   VCSEITAVTFRGPSESHLDSLVGQALFGDGAAAIIVGSDPIPDLERPLFQIVSAAQTLLP  248

Query  843   DTDSHLKLQLREMGLTFHCSKAVPSLITQNVEDCLVKAFEPFGISDWNSIFWILHPGGNA  1022
             D+   +   LRE+GLTFH  K VP LI++++E  L +AF+P GISDWNSIFWI HPGG A
Sbjct  249   DSHGAIDGHLREVGLTFHLLKDVPGLISKHIEKSLKEAFDPIGISDWNSIFWIAHPGGPA  308

Query  1023  ILDGVEEKLGLDPEKLRASRDVLSQYGNLTSACVLFILDEVRKKSKKQQQMTTGEGLEWG  1202
             ILD VEE LGL+ +KLRA+R VL++YGN++SACVLFILDE+RK S K    TTGEG +WG
Sbjct  309   ILDQVEETLGLEAQKLRATRHVLAEYGNMSSACVLFILDEMRKTSAKDGATTTGEGQDWG  368

Query  1203  VLFGFGPGLTIDTVVIRSVPI  1265
             VLFGFGPGLT++TVV+ SV +
Sbjct  369   VLFGFGPGLTVETVVLHSVSV  389



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 4125412501398