BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c25615_g1_i1 len=1303 path=[450:0-146 767:147-160 781:161-184
5806:185-193 951:194-222 980:223-274 5861:275-279 1305:280-312
1338:313-321 3628:322-384 5912:385-386 5914:387-475 5058:476-477
3779:478-515 83:516-545 6009:546-613 5199:614-623 6062:624-652
6091:653-661 5508:662-662 1630:663-693 3993:694-766 4064:767-773
1560:774-806 4778:807-854 4151:855-913 1273:914-920 1280:921-997
4291:998-1080 224:1081-1127 1005:1128-1197 5562:1198-1302]

Length=1303
                                                                      Score     E

gb|AAB62589.1|  chalcone synthase-A                                     739   0.0      Ipomoea purpurea
gb|AAB62590.1|  chalcone synthase-A                                     736   0.0      Ipomoea purpurea
sp|P48397.2|CHSA_IPOPU  RecName: Full=Chalcone synthase A; AltNam...    735   0.0      Ipomoea purpurea
gb|AAB02620.1|  chalcone synthase A                                     735   0.0      Ipomoea purpurea
gb|AAB62583.1|  chalcone synthase-A                                     733   0.0      Ipomoea purpurea
gb|AAB62587.1|  chalcone synthase-A                                     732   0.0      Ipomoea purpurea
gb|AAB62588.1|  chalcone synthase-A                                     731   0.0      Ipomoea purpurea
sp|P48398.1|CHSB_IPOPU  RecName: Full=Chalcone synthase B; AltNam...    715   0.0      Ipomoea purpurea
sp|P48394.1|CHSB_IPOCO  RecName: Full=Chalcone synthase B; AltNam...    689   0.0      Ipomoea cordatotriloba
sp|P48402.1|CHSB_IPOTF  RecName: Full=Chalcone synthase B; AltNam...    688   0.0      Ipomoea trifida
sp|P48400.1|CHSA_IPOPL  RecName: Full=Chalcone synthase A; AltNam...    685   0.0      Ipomoea platensis
sp|P48399.1|CHSC_IPOPU  RecName: Full=Chalcone synthase C; AltNam...    682   0.0      Ipomoea purpurea
sp|P48395.1|CHSA_IPONI  RecName: Full=Chalcone synthase A; AltNam...    675   0.0      Ipomoea nil [qian niu]
sp|P48396.1|CHSB_IPONI  RecName: Full=Chalcone synthase B; AltNam...    671   0.0      Ipomoea nil [qian niu]
sp|P48401.1|CHSA_IPOTF  RecName: Full=Chalcone synthase A; AltNam...    671   0.0      Ipomoea trifida
sp|P48403.1|CHSA_IPOTR  RecName: Full=Chalcone synthase A; AltNam...    664   0.0      Ipomoea triloba
sp|P48404.1|CHSB_IPOTR  RecName: Full=Chalcone synthase B; AltNam...    663   0.0      Ipomoea triloba
sp|P48393.1|CHSA_IPOCO  RecName: Full=Chalcone synthase A; AltNam...    659   0.0      Ipomoea cordatotriloba
ref|XP_006355706.1|  PREDICTED: chalcone synthase B-like                553   0.0      
sp|P22924.1|CHSB_PETHY  RecName: Full=Chalcone synthase B; AltNam...    551   0.0      Petunia x hybrida [garden petunia]
ref|XP_004239898.1|  PREDICTED: chalcone synthase B                     548   0.0      
gb|AGW24283.1|  chalcone synthase                                       546   0.0      
sp|P22928.2|CHSJ_PETHY  RecName: Full=Chalcone synthase J; AltNam...    545   0.0      Petunia x hybrida [garden petunia]
gb|AIY22756.1|  chalcone synthase                                       544   0.0      
emb|CAA64452.1|  naringenin-chalcone synthase                           544   0.0      Juglans nigra x Juglans regia
emb|CAA64366.1|  naringenin-chalcone synthase                           543   0.0      Juglans nigra x Juglans regia
gb|AIV99854.1|  chalcone synthase                                       543   0.0      
gb|AIY22757.1|  chalcone synthase                                       542   0.0      
gb|ABM63466.1|  aromatic polyketide synthase                            541   0.0      Hypericum hookerianum
gb|AEK80412.1|  type III polyketide synthase                            541   0.0      
gb|ABS52573.1|  chalcone synthase                                       541   0.0      Gossypium hirsutum [American cotton]
gb|KDP20327.1|  hypothetical protein JCGZ_06413                         541   0.0      
gb|ADD74168.1|  chalcone synthase                                       541   0.0      
ref|XP_009616637.1|  PREDICTED: chalcone synthase 2                     541   0.0      
gb|AFU52909.1|  chalcone synthase                                       540   0.0      
sp|Q9FUB7.1|CHSY_HYPAN  RecName: Full=Chalcone synthase; AltName:...    540   0.0      Hypericum androsaemum
ref|XP_006489796.1|  PREDICTED: chalcone synthase 1-like                540   0.0      
ref|XP_010264056.1|  PREDICTED: chalcone synthase 1                     540   0.0      
gb|AAL67805.1|AF461105_1  chalcone synthase                             540   0.0      Hypericum perforatum
gb|KHG25969.1|  Chalcone synthase 1                                     540   0.0      
ref|XP_002264019.1|  PREDICTED: chalcone synthase 2                     540   0.0      Vitis vinifera
dbj|BAO58434.1|  chalcone synthase                                      539   0.0      
gb|ACV72638.1|  chalcone synthase 1                                     539   0.0      Gossypium hirsutum [American cotton]
gb|ACH56521.1|  chalcone synthase                                       539   0.0      Gossypium hirsutum [American cotton]
ref|XP_009774927.1|  PREDICTED: chalcone synthase 2                     539   0.0      
ref|XP_007034442.1|  Chalcone and stilbene synthase family protein      539   0.0      
emb|CAC88858.1|  chalcone synthase                                      539   0.0      Rhododendron simsii
gb|AEO96989.1|  chalcone synthase                                       539   0.0      
gb|AFM74036.1|  chalcone synthase                                       539   0.0      
gb|AFC37242.1|  chalcone synthase 1                                     538   0.0      
dbj|BAI66465.1|  chalcone synthase                                      538   0.0      Camellia japonica [common camellia]
ref|XP_011020681.1|  PREDICTED: chalcone synthase 1                     538   0.0      
sp|P48386.1|CHS1_CAMSI  RecName: Full=Chalcone synthase 1; AltNam...    538   0.0      Camellia sinensis [black tea]
gb|AHK22740.1|  chalcone synthase                                       538   0.0      
sp|O82144.1|CHSY_HYDMC  RecName: Full=Chalcone synthase; AltName:...    538   0.0      Hydrangea macrophylla
ref|XP_006420608.1|  hypothetical protein CICLE_v10005133mg             538   0.0      
gb|ADD74167.1|  chalcone synthase                                       538   0.0      
gb|AFE56210.1|  chalcone synthase                                       538   0.0      
ref|XP_010023738.1|  PREDICTED: chalcone synthase 1                     538   0.0      
gb|AGV53049.1|  chalcone synthase                                       537   0.0      
gb|AIC75908.1|  chalcone synthase                                       537   0.0      
gb|AGI02994.1|  chalcone synthase                                       537   0.0      
gb|AEO96985.1|  chalcone synthase                                       536   0.0      
gb|AIA22214.1|  chalcone synthase                                       536   0.0      
gb|AAM00232.1|AF358432_1  root-specific chalcone synthase               536   0.0      Senna alata [bajagua]
emb|CAC19808.1|  chalcone synthase                                      536   0.0      Humulus lupulus [common hop]
gb|ADW11243.1|  chalcone synthase 2                                     536   0.0      
gb|AAM00230.1|AF358430_1  root-specific chalcone synthase               536   0.0      Senna alata [bajagua]
gb|AGW22222.1|  chalcone synthase                                       536   0.0      
gb|ACE60221.1|  chalcone synthase                                       536   0.0      Abelmoschus manihot [aibika]
gb|AGH13332.1|  chalcone synthase                                       535   0.0      
gb|AAO13091.1|  chalcone synthase                                       535   0.0      Camellia sinensis [black tea]
ref|XP_002299282.1|  naregenin-chalcone synthase family protein         535   0.0      Populus trichocarpa [western balsam poplar]
ref|XP_011034457.1|  PREDICTED: chalcone synthase 1-like                535   0.0      
sp|Q43163.1|CHSB_SOLTU  RecName: Full=Chalcone synthase 1B; AltNa...    534   0.0      Solanum tuberosum [potatoes]
sp|P48387.1|CHS2_CAMSI  RecName: Full=Chalcone synthase 2; AltNam...    534   0.0      Camellia sinensis [black tea]
sp|Q9ZRS4.1|CHSY_CATRO  RecName: Full=Chalcone synthase; AltName:...    534   0.0      Catharanthus roseus [chatas]
dbj|BAC10998.1|  chalcone synthase                                      533   0.0      Nierembergia sp. NB17
gb|AIB06736.1|  chalcone synthases-1                                    533   0.0      
ref|XP_002518132.1|  Chalcone synthase, putative                        533   0.0      Ricinus communis
ref|XP_002299281.2|  naregenin-chalcone synthase family protein         533   0.0      Populus trichocarpa [western balsam poplar]
sp|O22046.1|CHSE_IPONI  RecName: Full=Chalcone synthase E; AltNam...    533   0.0      Ipomoea nil [qian niu]
gb|AGM46641.1|  chalcone synthase protein                               533   0.0      
sp|P06515.1|CHSY_ANTMA  RecName: Full=Chalcone synthase; AltName:...    533   0.0      Antirrhinum majus [garden snapdragon]
ref|XP_011034458.1|  PREDICTED: chalcone synthase 1-like                533   0.0      
ref|XP_002303821.2|  naregenin-chalcone synthase family protein         533   0.0      Populus trichocarpa [western balsam poplar]
ref|XP_011091402.1|  PREDICTED: chalcone synthase                       533   0.0      
ref|NP_001275296.1|  chalcone synthase 2                                532   0.0      
ref|XP_011034455.1|  PREDICTED: chalcone synthase 1-like                532   0.0      
ref|XP_003553986.1|  PREDICTED: chalcone synthase-like                  532   0.0      
gb|AEP17003.1|  chalcone synthase                                       532   0.0      
ref|NP_001234036.1|  chalcone synthase 2                                532   0.0      
ref|XP_002303820.1|  naregenin-chalcone synthase family protein         532   0.0      Populus trichocarpa [western balsam poplar]
emb|CAK19318.1|  naringenin-chalcone synthase                           532   0.0      Humulus lupulus [common hop]
gb|ACN30003.1|  chalcone synthase                                       532   0.0      Vitis rotundifolia [fox grape]
sp|Q9XJ58.1|CHS1_CITSI  RecName: Full=Chalcone synthase 1; AltNam...    531   0.0      Citrus sinensis [apfelsine]
gb|AHA61354.1|  chalcone synthase                                       531   0.0      
gb|AFC37244.1|  chalcone synthase 3                                     531   0.0      
gb|EPS72180.1|  chalcone synthase                                       531   0.0      
emb|CAK19319.1|  naringenin-chalcone synthase                           531   0.0      Humulus lupulus [common hop]
sp|O22047.1|CHSE_IPOPU  RecName: Full=Chalcone synthase E; AltNam...    531   0.0      Ipomoea purpurea
dbj|BAA19548.1|  chalcone synthase                                      530   0.0      Perilla frutescens [beefsteak-mint]
gb|AEN83501.1|  chalcone synthase                                       531   0.0      
ref|XP_011020677.1|  PREDICTED: chalcone synthase 1-like isoform X1     531   0.0      
dbj|BAE45039.1|  chalcone synthase                                      531   0.0      Gentiana triflora
ref|NP_001275352.1|  chalcone synthase 1A                               530   0.0      
sp|Q9ZRR8.1|CHS1_CASGL  RecName: Full=Chalcone synthase; AltName:...    530   0.0      Casuarina glauca
ref|XP_011020680.1|  PREDICTED: chalcone synthase 1-like isoform X2     530   0.0      
gb|AAN76184.1|  chalcone synthase                                       530   0.0      Hydrangea macrophylla
emb|CAK19317.1|  naringenin-chalcone synthase                           530   0.0      Humulus lupulus [common hop]
dbj|BAB92996.1|  chalcone synthase                                      530   0.0      Malus domestica [apple tree]
ref|XP_009764938.1|  PREDICTED: chalcone synthase A                     530   0.0      
ref|XP_007032052.1|  Chalcone and stilbene synthase family protein      530   0.0      
gb|ACS12837.1|  chalcone synthase                                       530   0.0      Nicotiana alata [flowering tobacco]
gb|AFJ44312.1|  chalcone synthase                                       530   0.0      
sp|P48388.1|CHS3_CAMSI  RecName: Full=Chalcone synthase 3; AltNam...    530   0.0      Camellia sinensis [black tea]
sp|Q9AU11.1|PKS1_RUBID  RecName: Full=Polyketide synthase 1; Shor...    530   0.0      Rubus idaeus [European raspberry]
gb|AGU70032.1|  chalcone synthase                                       529   0.0      
dbj|BAD34456.1|  chalcone synthase                                      529   0.0      Eustoma exaltatum subsp. russellianum [bluebells]
gb|ABE01413.1|  chalcone synthase                                       529   0.0      Anthurium andraeanum [flamingo-lily]
gb|AGI02993.1|  chalcone synthase                                       529   0.0      
ref|XP_008380609.1|  PREDICTED: polyketide synthase 5                   529   0.0      
dbj|BAM17286.1|  chalcone synthase                                      529   0.0      
ref|XP_008797107.1|  PREDICTED: chalcone synthase 1                     529   0.0      
gb|AAX63402.1|  chalcone synthase                                       529   0.0      Solanum pinnatisectum
dbj|BAM17288.1|  chalcone synthase                                      529   0.0      
sp|O04111.1|CHSY_PERFR  RecName: Full=Chalcone synthase; AltName:...    529   0.0      Perilla frutescens [beefsteak-mint]
sp|Q8RVK9.1|CHS_CANSA  RecName: Full=Naringenin-chalcone synthase       528   0.0      Cannabis sativa [marijuana]
ref|XP_007161599.1|  hypothetical protein PHAVU_001G083000g             528   0.0      
gb|ABY68457.1|  chalcone synthase                                       528   0.0      Ipomoea batatas [batate]
gb|AEJ88217.1|  chalcone synthase                                       528   0.0      
dbj|BAO58433.1|  chalcone synthase                                      528   0.0      
emb|CAJ44127.1|  chalcone synthase                                      528   0.0      Misopates orontium
gb|AHK07000.1|  chalcone synthase                                       528   0.0      
ref|XP_008380608.1|  PREDICTED: polyketide synthase 5-like              528   0.0      
gb|AGE84303.1|  chalcone synthase                                       528   0.0      
gb|ABF68864.1|  chalcone synthase                                       528   0.0      Cardamine matthioli
gb|AFQ92052.1|  chalcone synthase                                       528   0.0      
gb|ACM17224.1|  naringenin-chalcone synthase                            528   0.0      Humulus lupulus [common hop]
ref|XP_010929491.1|  PREDICTED: chalcone synthase 2                     528   0.0      
gb|AAM90652.1|AF400567_1  chalcone synthase 6                           528   0.0      Rubus idaeus [European raspberry]
gb|ABM66532.1|  chalcone synthase                                       528   0.0      Glycyrrhiza uralensis [Chinese licorice]
gb|ABF68860.1|  chalcone synthase                                       528   0.0      Cardamine uliginosa
gb|AEO36981.1|  chalcone synthase                                       528   0.0      
sp|P08894.1|CHSA_PETHY  RecName: Full=Chalcone synthase A; AltNam...    528   0.0      Petunia x hybrida [garden petunia]
ref|XP_004504355.1|  PREDICTED: chalcone synthase 1-like                528   0.0      
ref|XP_010099135.1|  Chalcone synthase                                  528   0.0      
gb|AAG43356.1|AF144538_1  chalcone synthase                             528   0.0      Cardamine penzesii
dbj|BAB84112.1|  chalcone synthase                                      528   0.0      Vitis vinifera
ref|XP_007157043.1|  hypothetical protein PHAVU_002G038700g             527   0.0      
gb|AEC13058.1|  chalcone synthase protein                               527   0.0      
gb|ABI79305.1|  chalcone synthase                                       527   0.0      Pyrus communis
ref|XP_009376347.1|  PREDICTED: polyketide synthase 5                   527   0.0      
ref|XP_007223025.1|  hypothetical protein PRUPE_ppa006888mg             527   0.0      
gb|AGI02996.1|  chalcone synthase                                       527   0.0      
gb|AHZ97870.1|  chalcone synthase                                       527   0.0      
gb|AAP20864.1|  putative chalcone synthase                              527   0.0      Anthurium andraeanum [flamingo-lily]
dbj|BAM17287.1|  chalcone synthase                                      527   0.0      
sp|B0LDU6.1|PKS5_RUBID  RecName: Full=Polyketide synthase 5; Shor...    527   0.0      Rubus idaeus [European raspberry]
dbj|BAE17124.1|  chalcone synthase                                      527   0.0      Fragaria x ananassa
gb|ABF68859.1|  chalcone synthase                                       527   0.0      Cardamine acris
gb|ABF68916.1|  chalcone synthase                                       527   0.0      Cardamine asarifolia
gb|ADN93222.1|  chalcone synthase                                       526   0.0      
gb|ADN93223.1|  chalcone synthase                                       526   0.0      
gb|ABF68861.1|  chalcone synthase                                       527   0.0      Cardamine castellana
gb|AFK33946.1|  unknown                                                 527   0.0      
gb|ABF68883.1|  chalcone synthase                                       527   0.0      Cardamine amara subsp. amara
gb|ACT31917.1|  chalcone synthase                                       527   0.0      
gb|ABF68866.1|  chalcone synthase                                       527   0.0      Cardamine amara subsp. balcanica
gb|AFL72079.1|  chalcone synthase                                       527   0.0      
gb|ADN93218.1|  chalcone synthase                                       526   0.0      
gb|ABE03669.1|  chalcone synthase                                       527   0.0      Solms-laubachia stewartii
gb|ABF68865.1|  chalcone synthase                                       526   0.0      Cardamine apennina
dbj|BAA31259.1|  chalcone synthase                                      526   0.0      Vitis vinifera
sp|Q9SEP2.1|CHSY_CARAN  RecName: Full=Chalcone synthase; AltName:...    527   0.0      Cardamine amara
gb|AEF14414.1|  chalcone synthase                                       526   0.0      
ref|NP_001234033.1|  chalcone synthase 1                                526   0.0      
dbj|BAC87863.1|  chalcone synthase                                      526   0.0      Torenia hybrid cultivar
gb|ADF43042.1|  chalcone synthase 1 protein                             526   0.0      
emb|CAH61575.1|  chalcone synthase                                      526   0.0      Dictamnus albus
gb|AAK39112.1|AF358656_1  chalcone synthase                             526   0.0      Ipomoea purpurea
ref|XP_007223028.1|  hypothetical protein PRUPE_ppa006899mg             526   0.0      
gb|AHY35308.1|  chalcone synthase 1                                     526   0.0      
gb|AAK49457.1|  chalcone synthase                                       526   0.0      Nicotiana tabacum [American tobacco]
emb|CDX78547.1|  BnaA03g04590D                                          526   0.0      
gb|AFH68066.1|  chalcone synthase                                       526   0.0      
gb|AAT75302.1|  chalcone synthase                                       526   0.0      Camellia sinensis [black tea]
sp|Q9MB40.1|CHS3_IPOBA  RecName: Full=Chalcone synthase LF3; AltN...    526   0.0      Ipomoea batatas [batate]
gb|ABN80439.1|  chalcone synthase                                       526   0.0      Nicotiana benthamiana
ref|XP_010249317.1|  PREDICTED: chalcone synthase                       526   0.0      
ref|XP_008358057.1|  PREDICTED: polyketide synthase 5                   526   0.0      
gb|ADV29810.1|  chalcone synthase                                       526   0.0      
gb|ABE03648.1|  chalcone synthase                                       526   0.0      Solms-laubachia xerophyta
sp|O22045.1|CHSD_IPONI  RecName: Full=Chalcone synthase D; AltNam...    526   0.0      Ipomoea nil [qian niu]
dbj|BAB20074.1|  chalcone synthase                                      526   0.0      Torenia hybrid cultivar
gb|AAX16494.1|  chalcone synthase                                       526   0.0      Pyrus communis
gb|AAK39111.1|AF358655_1  chalcone synthase                             526   0.0      Ipomoea purpurea
gb|AFX71920.1|  CHS2 chalcone synthase                                  526   0.0      
emb|CAA32731.1|  chalcone synthase                                      526   0.0      Petunia x hybrida [garden petunia]
sp|P48392.1|CHS3_GERHY  RecName: Full=Chalcone synthase 3; AltNam...    526   0.0      Gerbera hybrid cultivar
ref|XP_009421018.1|  PREDICTED: chalcone synthase 2-like                526   0.0      
gb|AAK39114.1|AF358658_1  chalcone synthase                             526   0.0      Ipomoea purpurea
gb|ABF68913.1|  chalcone synthase                                       526   0.0      Cardamine asarifolia
gb|ABE03661.1|  chalcone synthase                                       526   0.0      Solms-laubachia minor
sp|P13417.1|CHS3_SINAL  RecName: Full=Chalcone synthase 3; AltNam...    526   0.0      Sinapis alba [bai jie]
gb|ABE03650.1|  chalcone synthase                                       526   0.0      Solms-laubachia lanata
gb|ABE03651.1|  chalcone synthase                                       526   0.0      Solms-laubachia pulcherrima
sp|Q9MB41.1|CHS2_IPOBA  RecName: Full=Chalcone synthase LF2; AltN...    526   0.0      Ipomoea batatas [batate]
gb|ABF68900.1|  chalcone synthase                                       526   0.0      Cardamine asarifolia
sp|P51090.1|CHSY_VITVI  RecName: Full=Chalcone synthase; AltName:...    526   0.0      Vitis vinifera
gb|ABM73434.1|  chalcone synthase                                       526   0.0      Aquilaria sinensis
sp|Q9FSB8.1|CHS2_RUTGR  RecName: Full=Chalcone synthase 2; AltNam...    526   0.0      Ruta graveolens
gb|AHB18370.1|  chalcone synthase 1                                     526   0.0      
sp|P48390.1|CHS1_GERHY  RecName: Full=Chalcone synthase 1; AltNam...    526   0.0      Gerbera hybrid cultivar
gb|ABB89213.1|  chalcone synthase                                       525   0.0      Sorbus aucuparia [European mountain ash]
ref|NP_001267879.1|  chalcone synthase                                  525   0.0      
gb|AGL50915.1|  chalcone synthase                                       525   0.0      
ref|XP_009619773.1|  PREDICTED: chalcone synthase 1B                    525   0.0      
gb|ABF68899.1|  chalcone synthase                                       525   0.0      Cardamine asarifolia
ref|XP_009370115.1|  PREDICTED: chalcone synthase-like                  525   0.0      
gb|ABF68901.1|  chalcone synthase                                       525   0.0      Cardamine asarifolia
dbj|BAD34457.1|  chalcone synthase                                      525   0.0      Eustoma exaltatum subsp. russellianum [bluebells]
ref|XP_004502226.1|  PREDICTED: chalcone synthase 1B-like               525   0.0      
gb|ABE03647.1|  chalcone synthase                                       525   0.0      Solms-laubachia eurycarpa
gb|AGZ15299.1|  chalcone synthase                                       525   0.0      
gb|AHZ30595.1|  chalcone synthase                                       525   0.0      
gb|ADZ54780.1|  naringenin-chalcone synthase                            525   0.0      
ref|XP_004306542.1|  PREDICTED: chalcone synthase 2-like                525   0.0      
ref|XP_009376346.1|  PREDICTED: chalcone synthase-like                  525   0.0      
ref|XP_003601647.1|  Chalcone synthase                                  525   0.0      
prf||1609233A  chalcone synthase 3                                      525   0.0   
gb|AAN05791.1|  chalcone synthase                                       525   0.0      Mazus pumilus [tokiwahaze]
gb|AFM29141.1|  chalcone synthase                                       525   0.0      
ref|XP_009353802.1|  PREDICTED: chalcone synthase-like                  525   0.0      
gb|ACS36661.1|  CHS4                                                    525   0.0      Vitis labrusca x Vitis vinifera [Labruscan grape]
ref|XP_009353801.1|  PREDICTED: chalcone synthase                       525   0.0      
ref|XP_006468926.1|  PREDICTED: chalcone synthase 2-like                525   0.0      
gb|AAM90651.1|AF400566_1  chalcone synthase 11                          525   0.0      Rubus idaeus [European raspberry]
sp|Q9MB37.1|CHS7_IPOBA  RecName: Full=Chalcone synthase DIII; Alt...    525   0.0      Ipomoea batatas [batate]
sp|Q9AU09.1|PKS3_RUBID  RecName: Full=Polyketide synthase 3; Shor...    525   0.0      Rubus idaeus [European raspberry]
gb|AAB36038.1|  chalcone synthase                                       525   0.0      Petunia x hybrida [garden petunia]
gb|AFJ49141.1|  CHS                                                     524   0.0      
ref|XP_008224580.1|  PREDICTED: polyketide synthase 5-like              525   0.0      
ref|XP_008808192.1|  PREDICTED: chalcone synthase C2                    525   0.0      
gb|ABF68855.1|  chalcone synthase                                       524   0.0      Cardamine alpina
gb|AHL69646.1|  chalcone synthase 1                                     524   0.0      
gb|ADZ45296.1|  chalcone synthase 2                                     524   0.0      
gb|ABP57071.1|  chalcone synthase                                       524   0.0      Solenostemon scutellarioides
gb|AAK39110.1|AF358654_1  chalcone synthase                             524   0.0      Ipomoea purpurea
dbj|BAC66467.1|  chalcone synthase                                      524   0.0      Rosa hybrid cultivar
ref|XP_008224578.1|  PREDICTED: polyketide synthase 5                   524   0.0      
gb|ABF68910.1|  chalcone synthase                                       524   0.0      Cardamine asarifolia
ref|XP_007157050.1|  hypothetical protein PHAVU_002G039100g             524   0.0      
gb|KDP41871.1|  hypothetical protein JCGZ_26889                         524   0.0      
gb|ABF68878.1|  chalcone synthase                                       524   0.0      Cardamine fialae
gb|AAM90650.1|AF400565_1  chalcone synthase 5                           524   0.0      Rubus idaeus [European raspberry]
gb|AAG43360.1|AF144542_1  chalcone synthase                             525   0.0      Ionopsidium abulense
ref|XP_010099134.1|  Chalcone synthase                                  524   0.0      
gb|AAF60297.1|AF233638_1  chalcone synthase                             524   0.0      Petunia x hybrida [garden petunia]
gb|EYU43821.1|  hypothetical protein MIMGU_mgv1a007904mg                524   0.0      
ref|XP_002303819.2|  naregenin-chalcone synthase family protein         524   0.0      Populus trichocarpa [western balsam poplar]
sp|Q9MB38.1|CHS6_IPOBA  RecName: Full=Chalcone synthase DII; AltN...    524   0.0      Ipomoea batatas [batate]
gb|ABF68903.1|  chalcone synthase                                       523   0.0      Cardamine asarifolia
gb|ADN93213.1|  chalcone synthase                                       523   0.0      
gb|ABW69675.1|  chalcone synthase D                                     524   0.0      Ipomoea purpurea
gb|ABF68925.1|  chalcone synthase                                       523   0.0      Cardamine x ferrarii
gb|ABE03664.1|  chalcone synthase                                       524   0.0      Solms-laubachia sp. JY-2006-2
gb|ABF68874.1|  chalcone synthase                                       523   0.0      Cardamine pratensis [cuckoo flower]
gb|KDO45963.1|  hypothetical protein CISIN_1g016330mg                   524   0.0      
gb|ADN93214.1|  chalcone synthase                                       523   0.0      
gb|AAM00231.1|AF358431_1  root-specific chalcone synthase               523   0.0      Senna alata [bajagua]
gb|ABF68927.1|  chalcone synthase                                       523   0.0      Cardamine x ferrarii
gb|ADN93221.1|  chalcone synthase                                       523   0.0      
gb|ABE03663.1|  chalcone synthase                                       523   0.0      Solms-laubachia xerophyta
gb|ABF68897.1|  chalcone synthase                                       523   0.0      Cardamine asarifolia
ref|XP_007157042.1|  hypothetical protein PHAVU_002G038600g             523   0.0      
gb|ADE59487.1|  type III polyketide synthase 3                          523   0.0      
gb|ABF68907.1|  chalcone synthase                                       523   0.0      Cardamine asarifolia
gb|ABF68896.1|  chalcone synthase                                       523   0.0      Cardamine hirsuta
gb|ABF68928.1|  chalcone synthase                                       523   0.0      
gb|ACQ41890.1|  chalcone synthase                                       523   0.0      
gb|ABF68856.1|  chalcone synthase                                       523   0.0      
gb|ABF68894.1|  chalcone synthase                                       523   0.0      
gb|AAG43359.1|AF144541_1  chalcone synthase                             523   0.0      
ref|XP_007158815.1|  hypothetical protein PHAVU_002G184300g             523   0.0      
gb|ADN93237.1|  chalcone synthase                                       523   0.0      
gb|AEW12813.1|  chalcone synthase                                       523   0.0      
gb|ADE18850.1|  chalcone synthase                                       523   0.0      
gb|ADN93205.1|  chalcone synthase                                       523   0.0      
gb|ADN93225.1|  chalcone synthase                                       522   0.0      
emb|CAA10131.1|  chalcone synthase                                      523   0.0      
ref|XP_004306543.1|  PREDICTED: chalcone synthase 2-like                523   0.0      
ref|XP_006446902.1|  hypothetical protein CICLE_v10015535mg             523   0.0      
gb|ADZ45298.1|  chalcone synthase 1                                     523   0.0      
emb|CAA05512.1|  chalcone synthase                                      523   0.0      
gb|ADN93207.1|  chalcone synthase                                       522   0.0      
gb|ABE03649.1|  chalcone synthase                                       523   0.0      
gb|AEU17693.1|  chalcone synthase-like protein                          523   0.0      
gb|ACX37403.1|  chalcone synthase                                       523   0.0      
ref|XP_003601648.1|  Chalcone synthase                                  523   0.0      
gb|ADY02639.1|  chalcone synthase                                       523   0.0      
gb|AGU91424.1|  chalcone synthase                                       523   0.0      
gb|ADZ45294.1|  chalcone synthase 3                                     523   0.0      
gb|ACJ54531.1|  chalcone synthase                                       523   0.0      
gb|AAG43348.1|AF144530_1  chalcone synthase                             523   0.0      
gb|ACB78187.1|  chalcone synthase                                       523   0.0      
gb|ACN41945.1|  chalcone synthase                                       523   0.0      
gb|AHL83549.1|  chalcone synthase                                       523   0.0      
gb|AID51449.1|  chalcone synthase 2                                     523   0.0      
gb|ABC86919.1|  chalcone synthase                                       523   0.0      
gb|ADE18842.1|  chalcone synthase                                       523   0.0      
gb|ABE03660.1|  chalcone synthase                                       523   0.0      
gb|ABE03655.1|  chalcone synthase                                       523   0.0      
ref|XP_009111334.1|  PREDICTED: chalcone synthase 3-like                523   0.0      
gb|ABF68868.1|  chalcone synthase                                       522   0.0      
gb|ABF68867.1|  chalcone synthase                                       522   0.0      
gb|AAF23583.1|AF112108_1  chalcone synthase                             523   0.0      
sp|P49440.1|CHSY_PHAVU  RecName: Full=Chalcone synthase 17; AltNa...    522   0.0      
ref|XP_006662967.1|  PREDICTED: chalcone synthase 1-like                523   0.0      
gb|AGC72951.1|  chalcone synthase                                       522   0.0      
gb|ABF59867.1|  chalcone synthase                                       522   0.0      
gb|ADN93215.1|  chalcone synthase                                       522   0.0      
sp|P23569.1|CHSY_PUEML  RecName: Full=Chalcone synthase; AltName:...    522   0.0      
gb|ADN93208.1|  chalcone synthase                                       522   0.0      
gb|AHJ80976.1|  chalcone synthase                                       522   0.0      
gb|ABD24222.1|  chalcone synthase                                       523   0.0      
sp|Q9FSB9.1|CHS1_RUTGR  RecName: Full=Chalcone synthase 1; AltNam...    522   0.0      
gb|ABF68909.1|  chalcone synthase                                       521   0.0      
gb|ABE03653.1|  chalcone synthase                                       522   0.0      
gb|ABE03654.1|  chalcone synthase                                       522   0.0      
sp|Q9MB36.1|CHS8_IPOBA  RecName: Full=Chalcone synthase DIV; AltN...    522   0.0      
ref|XP_009131369.1|  PREDICTED: chalcone synthase 3-like                522   0.0      
gb|AAX99413.1|  chalcone synthase                                       522   0.0      
gb|AHY35309.1|  chalcone synthase 2                                     522   0.0      
gb|ABE03652.1|  chalcone synthase                                       522   0.0      
ref|XP_009404732.1|  PREDICTED: chalcone synthase 2                     522   0.0      
sp|P17818.1|CHSY_MATIN  RecName: Full=Chalcone synthase; AltName:...    522   1e-180   
gb|ABF68892.1|  chalcone synthase                                       522   1e-180   
gb|ACM62742.1|  chalcone synthase                                       522   1e-180   
gb|ACH67480.1|  chalcone synthase                                       522   1e-180   
gb|ABF68893.1|  chalcone synthase                                       521   1e-180   
ref|XP_007157053.1|  hypothetical protein PHAVU_002G039300g             521   1e-180   
gb|ADN93236.1|  chalcone synthase                                       521   1e-180   
sp|P51081.1|CHSA_PEA  RecName: Full=Chalcone synthase 1A; AltName...    521   1e-180   
gb|ADN93249.1|  chalcone synthase                                       521   1e-180   
gb|ADZ45300.1|  chalcone synthase 1                                     521   1e-180   
gb|ABQ95964.1|  chalcone synthase                                       522   1e-180   
dbj|BAE17122.1|  chalcone synthase                                      521   1e-180   
gb|AAG43350.1|AF144532_1  chalcone synthase                             522   1e-180   
gb|AGC72966.1|  chalcone synthase                                       521   1e-180   
gb|ADN93238.1|  chalcone synthase                                       521   1e-180   
gb|ACN41948.1|  chalcone synthase                                       521   2e-180   
gb|ACT32034.1|  chalcone synthase                                       521   2e-180   
dbj|BAE17123.1|  chalcone synthase                                      521   2e-180   
gb|ABE03670.1|  chalcone synthase                                       521   2e-180   
gb|AAT96398.1|  chalcone synthase                                       521   2e-180   
ref|XP_009404102.1|  PREDICTED: chalcone synthase 2-like                521   2e-180   
gb|AAG43353.1|AF144535_1  chalcone synthase                             521   2e-180   
gb|ABF68858.1|  chalcone synthase                                       521   2e-180   
sp|P30075.2|CHS4_MEDSA  RecName: Full=Chalcone synthase 4; AltNam...    521   2e-180   
gb|ACN41946.1|  chalcone synthase                                       521   2e-180   
gb|ABF68880.1|  chalcone synthase                                       521   2e-180   
emb|CDX69618.1|  BnaA10g19670D                                          521   2e-180   
gb|ABF69124.1|  chalcone synthase                                       521   2e-180   
dbj|BAJ14519.1|  chalcone synthase 2                                    521   2e-180   
ref|XP_003621538.1|  Chalcone synthase                                  521   2e-180   
gb|ACN41942.1|  chalcone synthase                                       521   2e-180   
sp|Q9SEP4.1|CHSY_ARAAL  RecName: Full=Chalcone synthase; AltName:...    521   2e-180   
gb|ADN93206.1|  chalcone synthase                                       520   2e-180   
ref|XP_008224579.1|  PREDICTED: polyketide synthase 5-like              521   2e-180   
ref|XP_003537853.1|  PREDICTED: chalcone synthase                       521   2e-180   
ref|XP_003531225.1|  PREDICTED: chalcone synthase 1 isoform X1          521   3e-180   
ref|XP_003531219.1|  PREDICTED: chalcone synthase 5-like                521   3e-180   
gb|AAQ62588.1|  chalcone synthase CHS4                                  521   3e-180   
ref|XP_003524935.1|  PREDICTED: chalcone synthase                       521   3e-180   
gb|KHN12336.1|  Chalcone synthase 1                                     521   3e-180   
ref|NP_001068009.1|  Os11g0530600                                       521   3e-180   
gb|ADY02641.1|  chalcone synthase                                       521   3e-180   
gb|ABO21005.1|  chalcone synthase                                       521   3e-180   
gb|ADN93224.1|  chalcone synthase                                       520   3e-180   
gb|ABB30178.1|  chalcone synthase 1                                     520   3e-180   
ref|XP_008808809.1|  PREDICTED: chalcone synthase 3                     521   3e-180   
dbj|BAO58435.1|  chalcone synthase                                      521   3e-180   
sp|Q9MB39.1|CHS4_IPOBA  RecName: Full=Chalcone synthase LF4; AltN...    521   3e-180   
gb|ABF68871.1|  chalcone synthase                                       521   3e-180   
gb|AFU90825.1|  chalcone synthase                                       521   3e-180   
sp|A2ZEX7.1|CHS1_ORYSI  RecName: Full=Chalcone synthase 1; Short=...    521   3e-180   
ref|XP_006399896.1|  hypothetical protein EUTSA_v10013745mg             521   4e-180   
gb|ADN93232.1|  chalcone synthase                                       520   4e-180   
gb|AAC31912.1|  chalcone synthase A2                                    521   4e-180   
emb|CDY09836.1|  BnaC09g43250D                                          521   4e-180   
gb|ADN93234.1|  chalcone synthase                                       520   4e-180   
gb|ACN41943.1|  chalcone synthase                                       520   4e-180   
gb|ABQ95960.1|  chalcone synthase                                       521   4e-180   
gb|ABF68879.1|  chalcone synthase                                       520   4e-180   
gb|AGC72963.1|  chalcone synthase                                       520   4e-180   
gb|AFW98276.1|  chalone synthase                                        520   5e-180   
gb|ADE18840.1|  chalcone synthase                                       520   5e-180   
gb|AAO32821.1|  chalcone synthase                                       520   5e-180   
sp|Q9AU10.1|PKS2_RUBID  RecName: Full=Inactive polyketide synthas...    520   5e-180   
gb|AFK65634.1|  chalcone synthase 2                                     521   5e-180   
sp|O22652.1|CHSY_RAPSA  RecName: Full=Chalcone synthase; AltName:...    520   5e-180   
gb|ABE03659.1|  chalcone synthase                                       520   6e-180   
sp|Q01286.1|CHS1_PEA  RecName: Full=Chalcone synthase 1; AltName:...    520   6e-180   
gb|AAF23562.1|AF112087_1  chalcone synthase                             520   6e-180   
gb|ADN93228.1|  chalcone synthase                                       520   6e-180   
gb|ADN93216.1|  chalcone synthase                                       520   6e-180   
gb|KEH27375.1|  chalcone and stilbene synthase family protein           520   6e-180   
ref|XP_003517529.1|  PREDICTED: chalcone synthase 7                     520   6e-180   
gb|ABE03666.1|  chalcone synthase                                       520   6e-180   
gb|ADN93239.1|  chalcone synthase                                       520   6e-180   
gb|ADN93248.1|  chalcone synthase                                       520   6e-180   
gb|ADN93230.1|  chalcone synthase                                       520   6e-180   
ref|XP_010909688.1|  PREDICTED: chalcone synthase 3-like                520   6e-180   
ref|NP_001276296.1|  chalcone synthase                                  520   6e-180   
dbj|BAJ21532.1|  chalcone synthase type 2                               520   6e-180   
gb|ABG76200.1|  chalcone synthase                                       520   6e-180   
pdb|4WUM|A  Chain A, X-ray Crystal Structure Of Chalcone Synthase...    520   6e-180   
gb|ACN41949.1|  chalcone synthase                                       520   6e-180   
ref|XP_006585154.1|  PREDICTED: chalcone synthase 3-like isoform X2     520   7e-180   
gb|ADZ45297.1|  chalcone synthase 2                                     520   7e-180   
sp|P48385.2|CHSY_CALCH  RecName: Full=Chalcone synthase; AltName:...    520   7e-180   
sp|P51085.1|CHS3_TRISU  RecName: Full=Chalcone synthase 3; AltNam...    520   7e-180   
gb|KFK25629.1|  hypothetical protein AALP_AA8G139500                    520   7e-180   
gb|AAK39113.1|AF358657_1  chalcone synthase                             520   7e-180   
ref|NP_001268064.1|  chalcone synthase                                  522   8e-180   
gb|ADZ45299.1|  chalcone synthase 1                                     520   8e-180   
sp|Q9SML4.1|CHS1_CICAR  RecName: Full=Chalcone synthase 1; AltNam...    520   8e-180   
gb|ADE18852.1|  chalcone synthase                                       520   8e-180   
gb|AGC72947.1|  chalcone synthase                                       520   8e-180   
emb|CAP20328.1|  chalcone synthase                                      520   9e-180   
emb|CDX91090.1|  BnaC02g05070D                                          520   9e-180   
emb|CAD20740.1|  chalcone synthase                                      520   9e-180   
sp|O23882.1|CHS4_PEA  RecName: Full=Chalcone synthase 4; AltName:...    520   1e-179   
gb|AAF23571.1|AF112096_1  chalcone synthase                             520   1e-179   
gb|AIM48929.1|  chalcone synthase                                       520   1e-179   
ref|WP_039310897.1|  hypothetical protein                               518   1e-179   
dbj|BAA75310.1|  Chalcone synthase                                      519   1e-179   
gb|ABE03665.1|  chalcone synthase                                       519   1e-179   
sp|P51082.1|CHSB_PEA  RecName: Full=Chalcone synthase 1B; AltName...    519   1e-179   
gb|AFU90824.1|  chalcone synthase                                       519   1e-179   
gb|AAF23566.1|AF112091_1  chalcone synthase                             519   1e-179   
sp|P30074.1|CHS2_MEDSA  RecName: Full=Chalcone synthase 2; AltNam...    519   1e-179   
sp|Q9MB33.1|CHS1_IPOBA  RecName: Full=Chalcone synthase LF1; AltN...    519   1e-179   
sp|P51083.1|CHS1_TRISU  RecName: Full=Chalcone synthase 1; AltNam...    519   1e-179   
gb|KHN25612.1|  Chalcone synthase 7                                     519   2e-179   
gb|ACN41947.1|  chalcone synthase                                       519   2e-179   
gb|AGC72954.1|  chalcone synthase                                       519   2e-179   
gb|ACN41944.1|  chalcone synthase                                       519   2e-179   
gb|ADN93241.1|  chalcone synthase                                       518   2e-179   
gb|ADE18849.1|  chalcone synthase                                       519   2e-179   
sp|P51088.1|CHS6_TRISU  RecName: Full=Chalcone synthase 6; AltNam...    519   2e-179   
dbj|BAK08888.1|  chalcone synthase 2                                    519   2e-179   
sp|O23883.1|CHS3_PEA  RecName: Full=Chalcone synthase 3; AltName:...    519   2e-179   
gb|ADN93231.1|  chalcone synthase                                       518   2e-179   
ref|XP_003592044.1|  Chalcone synthase                                  519   2e-179   
gb|ABF68924.1|  chalcone synthase                                       518   2e-179   
gb|KEH27376.1|  chalcone and stilbene synthase family protein           519   2e-179   
gb|ADN93235.1|  chalcone synthase                                       518   2e-179   
gb|ADE18851.1|  chalcone synthase                                       518   2e-179   
ref|XP_002321081.1|  chalcone synthase family protein                   519   2e-179   
ref|XP_003533807.1|  PREDICTED: chalcone synthase 6                     518   2e-179   
ref|NP_196897.1|  chalcone synthase                                     519   2e-179   
sp|P13416.1|CHS1_SINAL  RecName: Full=Chalcone synthase 1; AltNam...    518   2e-179   
dbj|BAD89858.1|  mutant protein of chalcone synthase                    518   2e-179   
gb|ADN93245.1|  chalcone synthase                                       518   2e-179   
gb|ABQ95961.1|  chalcone synthase                                       518   3e-179   
gb|ADN93226.1|  chalcone synthase                                       518   3e-179   
gb|AAZ23746.1|  chalcone synthase family protein                        518   3e-179   
gb|AGC72960.1|  chalcone synthase                                       518   3e-179   
gb|AAU43217.1|  chalcone synthase                                       518   3e-179   
gb|ADE18833.1|  chalcone synthase                                       518   3e-179   
gb|ABQ95962.1|  chalcone synthase                                       518   3e-179   
gb|AAC31914.1|  chalcone synthase B2                                    518   3e-179   
gb|AHC07953.1|  chalcone synthase                                       518   3e-179   
gb|ADN93240.1|  chalcone synthase                                       518   3e-179   
sp|O23884.1|CHS5_PEA  RecName: Full=Chalcone synthase 5; AltName:...    518   3e-179   
sp|P51075.2|CHSY_BETPN  RecName: Full=Chalcone synthase; AltName:...    518   3e-179   
sp|P51087.1|CHS5_TRISU  RecName: Full=Chalcone synthase 5; AltNam...    518   3e-179   
gb|AAO67373.1|  chalcone synthase                                       518   3e-179   
gb|ADE18838.1|  chalcone synthase                                       518   4e-179   
ref|XP_003621530.1|  Chalcone synthase                                  518   4e-179   
ref|XP_003531223.1|  PREDICTED: chalcone synthase 1                     518   4e-179   
gb|AAM65314.1|  chalcone synthase (naringenin-chalcone synthase) ...    518   4e-179   
pdb|1I89|A  Chain A, Chalcone Synthase (G256l)                          518   4e-179   
gb|AAZ23741.1|  chalcone synthase family protein                        518   4e-179   
gb|ADZ45295.1|  chalcone synthase 3                                     518   5e-179   
gb|AAZ23762.1|  chalcone synthase family protein                        518   5e-179   
gb|ADN93227.1|  chalcone synthase                                       517   5e-179   
gb|ABA62606.1|  chalcone synthase                                       518   5e-179   
sp|P51084.1|CHS2_TRISU  RecName: Full=Chalcone synthase 2; AltNam...    518   5e-179   
ref|XP_009121714.1|  PREDICTED: chalcone synthase 1                     518   5e-179   
gb|ABA62605.1|  chalcone synthase                                       518   5e-179   
gb|EYU43822.1|  hypothetical protein MIMGU_mgv1a007937mg                518   6e-179   
gb|ADN93246.1|  chalcone synthase                                       517   6e-179   
gb|ADN93212.1|  chalcone synthase                                       517   6e-179   
dbj|BAF49290.1|  chalcone synthase                                      517   6e-179   
sp|P30077.1|CHS9_MEDSA  RecName: Full=Chalcone synthase 9; AltNam...    517   6e-179   
ref|XP_003621532.1|  Chalcone synthase                                  517   6e-179   
gb|ADE18853.1|  chalcone synthase                                       517   6e-179   



>gb|AAB62589.1| chalcone synthase-A [Ipomoea purpurea]
Length=396

 Score =   739 bits (1909),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 358/382 (94%), Positives = 369/382 (97%), Gaps = 1/382 (0%)
 Frame = +1

Query  64    MSTTVTVLTDTCRSRRAKRFEGDAKILAIGTAIPANWVDQTTYPDFYFRITNSEHLLEHK  243
             MSTTVTVLTDT  S RAKR EGDAKILAIGTA PANWVDQTTYPDFYFRITNSEHLLEHK
Sbjct  1     MSTTVTVLTDTW-SHRAKRLEGDAKILAIGTATPANWVDQTTYPDFYFRITNSEHLLEHK  59

Query  244   EKFRRICNKSKIRKRHLVITEELLKKNPNLCTYNEASLNTRQDILVSEVPKLGKEAAMKA  423
             EKFRRICNKSKI KRHLVITEELLKKNPNLCTYNEASLNTRQDILVSEVPKLGKEAAMKA
Sbjct  60    EKFRRICNKSKIMKRHLVITEELLKKNPNLCTYNEASLNTRQDILVSEVPKLGKEAAMKA  119

Query  424   IKEWGRPISEITHLVFCTSSGVDMPGADFQLAKLLGLSSSVKRLMMYQQGCNAGAAMLRL  603
             IKEWGRPISEITHLVFCT+SGVDMPGADFQL KLLGL+SSVKRLMMYQQGCNAGAAMLRL
Sbjct  120   IKEWGRPISEITHLVFCTTSGVDMPGADFQLTKLLGLNSSVKRLMMYQQGCNAGAAMLRL  179

Query  604   AKDLAENNKGARVLVVCSEVMLNVFRGPSLEQEDNLLAQCLFGDGSAAVIVGTEPRPGLE  783
             AKDLAENNKG+RVLVVCSEVML+VFRGPSL+QEDNLLAQCLFGDGSAAVIVGTEPRPGLE
Sbjct  180   AKDLAENNKGSRVLVVCSEVMLSVFRGPSLQQEDNLLAQCLFGDGSAAVIVGTEPRPGLE  239

Query  784   TPLFELVSAAQTTIPDTDSHLKLHLREMGLTFHCSKAVPSLITQNVEDCLVKAFEPFGIS  963
             TPLFELVSAAQTTIPDTDSHLKLHLREMGLTFHCSKAVPSLITQN+EDCLVKAFEPFGIS
Sbjct  240   TPLFELVSAAQTTIPDTDSHLKLHLREMGLTFHCSKAVPSLITQNIEDCLVKAFEPFGIS  299

Query  964   DWNSIFWILHPGGIAILDRVEEKLGLEPEKLRASKDVLSEYGNLTSACVLFILDEMRKKS  1143
             DWNSIFWILHPGG AILD VEEKLGLEPEKLRAS+DVLS+YGNLTSACVLFILDE+RKKS
Sbjct  300   DWNSIFWILHPGGNAILDGVEEKLGLEPEKLRASRDVLSQYGNLTSACVLFILDEVRKKS  359

Query  1144  KKDEEMTTGEGLEWGVVFVVCP  1209
             KK ++MTTGEGLEWGVVF   P
Sbjct  360   KKQQQMTTGEGLEWGVVFGFGP  381



>gb|AAB62590.1| chalcone synthase-A [Ipomoea purpurea]
Length=396

 Score =   736 bits (1901),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 357/382 (93%), Positives = 368/382 (96%), Gaps = 1/382 (0%)
 Frame = +1

Query  64    MSTTVTVLTDTCRSRRAKRFEGDAKILAIGTAIPANWVDQTTYPDFYFRITNSEHLLEHK  243
             MSTT+TVLTDT  S RAKR EGDAKILAIGTA PANWVDQTTYPDFYFRITNSEHLLEHK
Sbjct  1     MSTTITVLTDTW-SHRAKRLEGDAKILAIGTATPANWVDQTTYPDFYFRITNSEHLLEHK  59

Query  244   EKFRRICNKSKIRKRHLVITEELLKKNPNLCTYNEASLNTRQDILVSEVPKLGKEAAMKA  423
             EKF+RICNKSKI KRHLVITEELLKKNPNLCTYNEASLNTRQDILVSEVPKLGKEAAMKA
Sbjct  60    EKFKRICNKSKIMKRHLVITEELLKKNPNLCTYNEASLNTRQDILVSEVPKLGKEAAMKA  119

Query  424   IKEWGRPISEITHLVFCTSSGVDMPGADFQLAKLLGLSSSVKRLMMYQQGCNAGAAMLRL  603
             IKEWGRPISEITHLVFCT+SGVDMPGADFQL KLLGL+SSVKRLMMYQQGCNAGAAMLRL
Sbjct  120   IKEWGRPISEITHLVFCTTSGVDMPGADFQLTKLLGLNSSVKRLMMYQQGCNAGAAMLRL  179

Query  604   AKDLAENNKGARVLVVCSEVMLNVFRGPSLEQEDNLLAQCLFGDGSAAVIVGTEPRPGLE  783
             AKDLAENNKGARVLVVCSEVML+VFRGPSL+QEDNLLAQCLFGDGSAAVIVGTEPRPGLE
Sbjct  180   AKDLAENNKGARVLVVCSEVMLSVFRGPSLQQEDNLLAQCLFGDGSAAVIVGTEPRPGLE  239

Query  784   TPLFELVSAAQTTIPDTDSHLKLHLREMGLTFHCSKAVPSLITQNVEDCLVKAFEPFGIS  963
             TPLFELVSAAQTTIPDTD HLKLHLREMGLTFHCSKAVPSLITQNVEDCLVKAFEPFGIS
Sbjct  240   TPLFELVSAAQTTIPDTDFHLKLHLREMGLTFHCSKAVPSLITQNVEDCLVKAFEPFGIS  299

Query  964   DWNSIFWILHPGGIAILDRVEEKLGLEPEKLRASKDVLSEYGNLTSACVLFILDEMRKKS  1143
             DWNSIFWILHPGG AILD VEEKLGLEPEKLRAS+DVLS+YGNLTSACVLFILDE+RKKS
Sbjct  300   DWNSIFWILHPGGNAILDGVEEKLGLEPEKLRASRDVLSQYGNLTSACVLFILDEVRKKS  359

Query  1144  KKDEEMTTGEGLEWGVVFVVCP  1209
             KK ++MTTGEGLEWGVVF   P
Sbjct  360   KKQQQMTTGEGLEWGVVFGFGP  381



>sp|P48397.2|CHSA_IPOPU RecName: Full=Chalcone synthase A; AltName: Full=Naringenin-chalcone 
synthase A; Short=CHS-A [Ipomoea purpurea]
 gb|AAB62582.1| chalcone synthase-A [Ipomoea purpurea]
 gb|AAB62584.1| chalcone synthase-A [Ipomoea purpurea]
 gb|AAB62585.1| chalcone synthase-A [Ipomoea purpurea]
 gb|AAB62586.1| chalcone synthase-A [Ipomoea purpurea]
Length=396

 Score =   735 bits (1898),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 357/382 (93%), Positives = 368/382 (96%), Gaps = 1/382 (0%)
 Frame = +1

Query  64    MSTTVTVLTDTCRSRRAKRFEGDAKILAIGTAIPANWVDQTTYPDFYFRITNSEHLLEHK  243
             MSTTVTVLTDT  S RAKR EGDAKILAIGTA PANWVDQTTYPDFYFRITNSEHLLEHK
Sbjct  1     MSTTVTVLTDTW-SHRAKRLEGDAKILAIGTATPANWVDQTTYPDFYFRITNSEHLLEHK  59

Query  244   EKFRRICNKSKIRKRHLVITEELLKKNPNLCTYNEASLNTRQDILVSEVPKLGKEAAMKA  423
             EKFRRICNKSKI KRHLVITEELLKKNPNLCTYNEASLNTRQDILVSEVPKLGK+AAMKA
Sbjct  60    EKFRRICNKSKIMKRHLVITEELLKKNPNLCTYNEASLNTRQDILVSEVPKLGKDAAMKA  119

Query  424   IKEWGRPISEITHLVFCTSSGVDMPGADFQLAKLLGLSSSVKRLMMYQQGCNAGAAMLRL  603
             IKEWGRPISEITHLVFCT+SGVDMPGADFQL KLLGL+SSVKRLMMYQQGCNAGAAMLRL
Sbjct  120   IKEWGRPISEITHLVFCTTSGVDMPGADFQLTKLLGLNSSVKRLMMYQQGCNAGAAMLRL  179

Query  604   AKDLAENNKGARVLVVCSEVMLNVFRGPSLEQEDNLLAQCLFGDGSAAVIVGTEPRPGLE  783
             AKDLAENNKG RVLVVCSEVML+VFRGPSL+QEDNLLAQCLFGDG+AAVIVGTEPRPGLE
Sbjct  180   AKDLAENNKGGRVLVVCSEVMLSVFRGPSLQQEDNLLAQCLFGDGAAAVIVGTEPRPGLE  239

Query  784   TPLFELVSAAQTTIPDTDSHLKLHLREMGLTFHCSKAVPSLITQNVEDCLVKAFEPFGIS  963
             TPLFELVSAAQTTIPDTDS+LKL LREMGLTFHCSKAVPSLITQNVEDCLVKAFEPFGIS
Sbjct  240   TPLFELVSAAQTTIPDTDSYLKLQLREMGLTFHCSKAVPSLITQNVEDCLVKAFEPFGIS  299

Query  964   DWNSIFWILHPGGIAILDRVEEKLGLEPEKLRASKDVLSEYGNLTSACVLFILDEMRKKS  1143
             DWNSIFWILHPGG AILD VEEKLGLEPEKLRAS+DVLS+YGNLTSACVLFILDE+RKKS
Sbjct  300   DWNSIFWILHPGGNAILDGVEEKLGLEPEKLRASRDVLSQYGNLTSACVLFILDEVRKKS  359

Query  1144  KKDEEMTTGEGLEWGVVFVVCP  1209
             KKDE+MTTGEGLEWGVVF   P
Sbjct  360   KKDEQMTTGEGLEWGVVFGFGP  381



>gb|AAB02620.1| chalcone synthase A [Ipomoea purpurea]
 gb|AAB62591.1| chalcone synthase-A [Ipomoea purpurea]
Length=396

 Score =   735 bits (1898),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 357/382 (93%), Positives = 368/382 (96%), Gaps = 1/382 (0%)
 Frame = +1

Query  64    MSTTVTVLTDTCRSRRAKRFEGDAKILAIGTAIPANWVDQTTYPDFYFRITNSEHLLEHK  243
             MSTTVTVLTDT  S RAKR EGDAKILAIGTA PANWVDQTTYPDFYFRITNSEHLLEHK
Sbjct  1     MSTTVTVLTDTW-SHRAKRLEGDAKILAIGTATPANWVDQTTYPDFYFRITNSEHLLEHK  59

Query  244   EKFRRICNKSKIRKRHLVITEELLKKNPNLCTYNEASLNTRQDILVSEVPKLGKEAAMKA  423
             EKFRRICNKSKI KRHLVITEELLKKNPNLCTYNEASLNTRQDILVSEVPKLGKEAAMKA
Sbjct  60    EKFRRICNKSKIMKRHLVITEELLKKNPNLCTYNEASLNTRQDILVSEVPKLGKEAAMKA  119

Query  424   IKEWGRPISEITHLVFCTSSGVDMPGADFQLAKLLGLSSSVKRLMMYQQGCNAGAAMLRL  603
             IKEWGRPISEITHLVFCT+SGVDMPGADFQL KLLGL+SSVKRLMMYQQGCNAGAAMLRL
Sbjct  120   IKEWGRPISEITHLVFCTTSGVDMPGADFQLTKLLGLNSSVKRLMMYQQGCNAGAAMLRL  179

Query  604   AKDLAENNKGARVLVVCSEVMLNVFRGPSLEQEDNLLAQCLFGDGSAAVIVGTEPRPGLE  783
             AKDLAENNKGARVLVVCSEVML+VFRGPSL+QEDNLLAQCLFGDGSAAVIVGTEPRPGLE
Sbjct  180   AKDLAENNKGARVLVVCSEVMLSVFRGPSLQQEDNLLAQCLFGDGSAAVIVGTEPRPGLE  239

Query  784   TPLFELVSAAQTTIPDTDSHLKLHLREMGLTFHCSKAVPSLITQNVEDCLVKAFEPFGIS  963
             TPLFELVSAAQTTIPDTDS+LKL LREMGLTFHCSKAVPSLITQN+EDCLVKAFEPFGIS
Sbjct  240   TPLFELVSAAQTTIPDTDSYLKLQLREMGLTFHCSKAVPSLITQNIEDCLVKAFEPFGIS  299

Query  964   DWNSIFWILHPGGIAILDRVEEKLGLEPEKLRASKDVLSEYGNLTSACVLFILDEMRKKS  1143
             DWNSIFWILHPGG AILD VEEKLGLEPEKLRAS+DVLS+YGNLTSACVLFILDE+RKKS
Sbjct  300   DWNSIFWILHPGGNAILDGVEEKLGLEPEKLRASRDVLSQYGNLTSACVLFILDEVRKKS  359

Query  1144  KKDEEMTTGEGLEWGVVFVVCP  1209
             KK ++MTTGEGLEWGVVF   P
Sbjct  360   KKQQQMTTGEGLEWGVVFGFGP  381



>gb|AAB62583.1| chalcone synthase-A [Ipomoea purpurea]
Length=396

 Score =   733 bits (1893),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 356/382 (93%), Positives = 367/382 (96%), Gaps = 1/382 (0%)
 Frame = +1

Query  64    MSTTVTVLTDTCRSRRAKRFEGDAKILAIGTAIPANWVDQTTYPDFYFRITNSEHLLEHK  243
             MSTTVTVLTDT  S RAKR EGDAKILAIGTA PANWVDQTTYPDFYFRITNSEHLLEHK
Sbjct  1     MSTTVTVLTDTW-SHRAKRLEGDAKILAIGTATPANWVDQTTYPDFYFRITNSEHLLEHK  59

Query  244   EKFRRICNKSKIRKRHLVITEELLKKNPNLCTYNEASLNTRQDILVSEVPKLGKEAAMKA  423
             EKFRRICNKSKI KRHLVITEELLKKNPNLCTYNEASLNTRQDILVSEVPKLGK+AAMKA
Sbjct  60    EKFRRICNKSKIMKRHLVITEELLKKNPNLCTYNEASLNTRQDILVSEVPKLGKDAAMKA  119

Query  424   IKEWGRPISEITHLVFCTSSGVDMPGADFQLAKLLGLSSSVKRLMMYQQGCNAGAAMLRL  603
             IKEWGRPISEITHLVFCT+SGVDMPGADFQL KLLGL+SSVKRLMMYQQGCNAGAAMLRL
Sbjct  120   IKEWGRPISEITHLVFCTTSGVDMPGADFQLTKLLGLNSSVKRLMMYQQGCNAGAAMLRL  179

Query  604   AKDLAENNKGARVLVVCSEVMLNVFRGPSLEQEDNLLAQCLFGDGSAAVIVGTEPRPGLE  783
             AKDLAENNKG RVLVVCSEVML+VFRGPSL+QEDNLLAQCLFGDG+ AVIVGTEPRPGLE
Sbjct  180   AKDLAENNKGGRVLVVCSEVMLSVFRGPSLQQEDNLLAQCLFGDGAGAVIVGTEPRPGLE  239

Query  784   TPLFELVSAAQTTIPDTDSHLKLHLREMGLTFHCSKAVPSLITQNVEDCLVKAFEPFGIS  963
             TPLFELVSAAQTTIPDTDS+LKL LREMGLTFHCSKAVPSLITQNVEDCLVKAFEPFGIS
Sbjct  240   TPLFELVSAAQTTIPDTDSYLKLQLREMGLTFHCSKAVPSLITQNVEDCLVKAFEPFGIS  299

Query  964   DWNSIFWILHPGGIAILDRVEEKLGLEPEKLRASKDVLSEYGNLTSACVLFILDEMRKKS  1143
             DWNSIFWILHPGG AILD VEEKLGLEPEKLRAS+DVLS+YGNLTSACVLFILDE+RKKS
Sbjct  300   DWNSIFWILHPGGNAILDGVEEKLGLEPEKLRASRDVLSQYGNLTSACVLFILDEVRKKS  359

Query  1144  KKDEEMTTGEGLEWGVVFVVCP  1209
             KKDE+MTTGEGLEWGVVF   P
Sbjct  360   KKDEQMTTGEGLEWGVVFGFGP  381



>gb|AAB62587.1| chalcone synthase-A [Ipomoea purpurea]
Length=396

 Score =   732 bits (1890),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 356/382 (93%), Positives = 366/382 (96%), Gaps = 1/382 (0%)
 Frame = +1

Query  64    MSTTVTVLTDTCRSRRAKRFEGDAKILAIGTAIPANWVDQTTYPDFYFRITNSEHLLEHK  243
             MSTT+TVLTDT  S RAKR EGDAKILAIGTA PANWVDQTTYPDFYFRITNSEHL EHK
Sbjct  1     MSTTITVLTDTW-SHRAKRLEGDAKILAIGTATPANWVDQTTYPDFYFRITNSEHLHEHK  59

Query  244   EKFRRICNKSKIRKRHLVITEELLKKNPNLCTYNEASLNTRQDILVSEVPKLGKEAAMKA  423
             EKF+RICNKSKI KRHLVITEELLKKNPNLCTYNEASLNTRQDILVSEVPKLGKEAAMKA
Sbjct  60    EKFKRICNKSKIMKRHLVITEELLKKNPNLCTYNEASLNTRQDILVSEVPKLGKEAAMKA  119

Query  424   IKEWGRPISEITHLVFCTSSGVDMPGADFQLAKLLGLSSSVKRLMMYQQGCNAGAAMLRL  603
             IKEWGRPISEITHLVFCT+SGVDMPGADFQL KLLGL+SSVKRLMMYQQGCNAGAAMLRL
Sbjct  120   IKEWGRPISEITHLVFCTTSGVDMPGADFQLTKLLGLNSSVKRLMMYQQGCNAGAAMLRL  179

Query  604   AKDLAENNKGARVLVVCSEVMLNVFRGPSLEQEDNLLAQCLFGDGSAAVIVGTEPRPGLE  783
             AKDLAENNKG RVLVVCSEVML+VFRGPSL+QEDNLLAQCLFGDGSAAVIVGTEPRPGLE
Sbjct  180   AKDLAENNKGGRVLVVCSEVMLSVFRGPSLQQEDNLLAQCLFGDGSAAVIVGTEPRPGLE  239

Query  784   TPLFELVSAAQTTIPDTDSHLKLHLREMGLTFHCSKAVPSLITQNVEDCLVKAFEPFGIS  963
             TPLFELVSAAQTTIPDTDS+LKL LREMGLTFHCSKAVPSLITQNVEDCLVKAFEPFGIS
Sbjct  240   TPLFELVSAAQTTIPDTDSYLKLQLREMGLTFHCSKAVPSLITQNVEDCLVKAFEPFGIS  299

Query  964   DWNSIFWILHPGGIAILDRVEEKLGLEPEKLRASKDVLSEYGNLTSACVLFILDEMRKKS  1143
             DWNSIFWILHPGG AILD VEEKLGLE EKLRAS+DVLS+YGNLTSACVLFILDEMRKKS
Sbjct  300   DWNSIFWILHPGGNAILDGVEEKLGLEAEKLRASRDVLSQYGNLTSACVLFILDEMRKKS  359

Query  1144  KKDEEMTTGEGLEWGVVFVVCP  1209
             KKDE+MTTGEGLEWGVVF   P
Sbjct  360   KKDEQMTTGEGLEWGVVFGFGP  381



>gb|AAB62588.1| chalcone synthase-A [Ipomoea purpurea]
Length=396

 Score =   731 bits (1886),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 352/382 (92%), Positives = 368/382 (96%), Gaps = 1/382 (0%)
 Frame = +1

Query  64    MSTTVTVLTDTCRSRRAKRFEGDAKILAIGTAIPANWVDQTTYPDFYFRITNSEHLLEHK  243
             MSTT+TVLTDT  S RAKR EGDAKILAIGTA PANWVDQTTYPDFYFRITNS+HLLEHK
Sbjct  1     MSTTITVLTDTW-SHRAKRLEGDAKILAIGTATPANWVDQTTYPDFYFRITNSQHLLEHK  59

Query  244   EKFRRICNKSKIRKRHLVITEELLKKNPNLCTYNEASLNTRQDILVSEVPKLGKEAAMKA  423
             EKF+RICNKSKI KRHL+ITEELLKKNPNLCTYNEASLNTRQDILVSEVPKLGK+AAMKA
Sbjct  60    EKFKRICNKSKIMKRHLLITEELLKKNPNLCTYNEASLNTRQDILVSEVPKLGKDAAMKA  119

Query  424   IKEWGRPISEITHLVFCTSSGVDMPGADFQLAKLLGLSSSVKRLMMYQQGCNAGAAMLRL  603
             IKEWGRPISEITHLVFCT+SGVDMPGADFQL KLLGL+SSVKRLMMYQQGCNAGAAMLRL
Sbjct  120   IKEWGRPISEITHLVFCTTSGVDMPGADFQLTKLLGLNSSVKRLMMYQQGCNAGAAMLRL  179

Query  604   AKDLAENNKGARVLVVCSEVMLNVFRGPSLEQEDNLLAQCLFGDGSAAVIVGTEPRPGLE  783
             AKDLAENNKGARVLVVCSEVML+VFRGPSL+QEDNLLAQCLFGDGSAAVIVGTEPRPGLE
Sbjct  180   AKDLAENNKGARVLVVCSEVMLSVFRGPSLQQEDNLLAQCLFGDGSAAVIVGTEPRPGLE  239

Query  784   TPLFELVSAAQTTIPDTDSHLKLHLREMGLTFHCSKAVPSLITQNVEDCLVKAFEPFGIS  963
             TPLFELVSAAQTTIPDTDS+LKL LREMGLTFHCSKAVPSLITQN+EDCLVKAFEPFGIS
Sbjct  240   TPLFELVSAAQTTIPDTDSYLKLQLREMGLTFHCSKAVPSLITQNIEDCLVKAFEPFGIS  299

Query  964   DWNSIFWILHPGGIAILDRVEEKLGLEPEKLRASKDVLSEYGNLTSACVLFILDEMRKKS  1143
             DWNSIFWILHPGG AILD VEEKLGLEPEKLRAS+DVLS+YGNLTSACVLFILDE+RKKS
Sbjct  300   DWNSIFWILHPGGNAILDGVEEKLGLEPEKLRASRDVLSQYGNLTSACVLFILDEVRKKS  359

Query  1144  KKDEEMTTGEGLEWGVVFVVCP  1209
             KK ++MTTGEGLEWGVVF   P
Sbjct  360   KKQQQMTTGEGLEWGVVFGFGP  381



>sp|P48398.1|CHSB_IPOPU RecName: Full=Chalcone synthase B; AltName: Full=Naringenin-chalcone 
synthase B; Short=CHS-B [Ipomoea purpurea]
 gb|AAC49030.1| chalcone synthase [Ipomoea purpurea]
Length=396

 Score =   715 bits (1845),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 338/382 (88%), Positives = 364/382 (95%), Gaps = 1/382 (0%)
 Frame = +1

Query  64    MSTTVTVLTDTCRSRRAKRFEGDAKILAIGTAIPANWVDQTTYPDFYFRITNSEHLLEHK  243
             MSTTVTVLTDT  SRRAKR EGDAKILAIGTA PA+WVDQTTYPDFYFRITNS+HLLEHK
Sbjct  1     MSTTVTVLTDTW-SRRAKRLEGDAKILAIGTATPASWVDQTTYPDFYFRITNSQHLLEHK  59

Query  244   EKFRRICNKSKIRKRHLVITEELLKKNPNLCTYNEASLNTRQDILVSEVPKLGKEAAMKA  423
             EKFRRICNKSKIRKRHLV+TEELLKKNPNLCTYNE SLNTRQDILVSEVPKLGKEAAMKA
Sbjct  60    EKFRRICNKSKIRKRHLVLTEELLKKNPNLCTYNETSLNTRQDILVSEVPKLGKEAAMKA  119

Query  424   IKEWGRPISEITHLVFCTSSGVDMPGADFQLAKLLGLSSSVKRLMMYQQGCNAGAAMLRL  603
             IKEWGRPISEITHLVFCT+SGVDMPGADFQL KLLGL+SSVKRLMMYQQGCNAGAAMLRL
Sbjct  120   IKEWGRPISEITHLVFCTTSGVDMPGADFQLTKLLGLNSSVKRLMMYQQGCNAGAAMLRL  179

Query  604   AKDLAENNKGARVLVVCSEVMLNVFRGPSLEQEDNLLAQCLFGDGSAAVIVGTEPRPGLE  783
             AKDLAE+NKG RVLVVC+E+ +N+FRGPSLEQ+DNLLAQCLFGDG+AA+IV  +PRPGLE
Sbjct  180   AKDLAESNKGGRVLVVCAEITINIFRGPSLEQDDNLLAQCLFGDGAAAMIVAADPRPGLE  239

Query  784   TPLFELVSAAQTTIPDTDSHLKLHLREMGLTFHCSKAVPSLITQNVEDCLVKAFEPFGIS  963
             TPLFELVS+AQT +P+TDSHLKLHLREMGLTFHCSKAVPS++ +NVEDCLVKAFEP+GIS
Sbjct  240   TPLFELVSSAQTIVPNTDSHLKLHLREMGLTFHCSKAVPSVLAENVEDCLVKAFEPYGIS  299

Query  964   DWNSIFWILHPGGIAILDRVEEKLGLEPEKLRASKDVLSEYGNLTSACVLFILDEMRKKS  1143
             DWNSIFW+ HPGG AI+DRVEE+LGL PEKLRAS+DVLSEYGNLTSACVLFILDEMRKKS
Sbjct  300   DWNSIFWVFHPGGNAIVDRVEERLGLGPEKLRASRDVLSEYGNLTSACVLFILDEMRKKS  359

Query  1144  KKDEEMTTGEGLEWGVVFVVCP  1209
             KKDE+MTTGEGLEWGVVF   P
Sbjct  360   KKDEQMTTGEGLEWGVVFGFGP  381



>sp|P48394.1|CHSB_IPOCO RecName: Full=Chalcone synthase B; AltName: Full=Naringenin-chalcone 
synthase B; Short=CHS-B, partial [Ipomoea cordatotriloba]
 gb|AAC49027.1| chalcone synthase, partial [Ipomoea cordatotriloba]
Length=363

 Score =   689 bits (1777),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 328/364 (90%), Positives = 350/364 (96%), Gaps = 1/364 (0%)
 Frame = +1

Query  64    MSTTVTVLTDTCRSRRAKRFEGDAKILAIGTAIPANWVDQTTYPDFYFRITNSEHLLEHK  243
             M TTVTVLTDT  SRR KRFEG AKILAIGTA PANWVDQTTYPDFYFRITNS+HLL+HK
Sbjct  1     MCTTVTVLTDTW-SRREKRFEGHAKILAIGTATPANWVDQTTYPDFYFRITNSQHLLDHK  59

Query  244   EKFRRICNKSKIRKRHLVITEELLKKNPNLCTYNEASLNTRQDILVSEVPKLGKEAAMKA  423
             EKFRRICNKSKIRKRH+++TEELLKKNPNLCTYN+ASLNTRQDILVSEVPKLGKEAAMKA
Sbjct  60    EKFRRICNKSKIRKRHMILTEELLKKNPNLCTYNDASLNTRQDILVSEVPKLGKEAAMKA  119

Query  424   IKEWGRPISEITHLVFCTSSGVDMPGADFQLAKLLGLSSSVKRLMMYQQGCNAGAAMLRL  603
             IKEWGRPISEITHLVFCT+SGVDMPGADFQL KLLGL+SSVKRLMMYQQGCNAGAAMLRL
Sbjct  120   IKEWGRPISEITHLVFCTTSGVDMPGADFQLTKLLGLNSSVKRLMMYQQGCNAGAAMLRL  179

Query  604   AKDLAENNKGARVLVVCSEVMLNVFRGPSLEQEDNLLAQCLFGDGSAAVIVGTEPRPGLE  783
             AKD+AENNKGARVLVVCSEVML+VFRGPSL+QEDNLLAQCLFGDGSAA+IVGT+PRPGLE
Sbjct  180   AKDVAENNKGARVLVVCSEVMLSVFRGPSLQQEDNLLAQCLFGDGSAALIVGTDPRPGLE  239

Query  784   TPLFELVSAAQTTIPDTDSHLKLHLREMGLTFHCSKAVPSLITQNVEDCLVKAFEPFGIS  963
             TPLFEL+SAAQT IP+TDSHLKLH+REMGLTFHCSKAVP+ ITQNVEDCLVKAFEP+GIS
Sbjct  240   TPLFELISAAQTIIPNTDSHLKLHVREMGLTFHCSKAVPTFITQNVEDCLVKAFEPYGIS  299

Query  964   DWNSIFWILHPGGIAILDRVEEKLGLEPEKLRASKDVLSEYGNLTSACVLFILDEMRKKS  1143
             DWNSIFW+LHPGG AI+D VEE LGL PEKLRAS+DVLS YGNLTSACVLFILDE+RKKS
Sbjct  300   DWNSIFWVLHPGGNAIVDGVEETLGLAPEKLRASRDVLSGYGNLTSACVLFILDEVRKKS  359

Query  1144  KKDE  1155
             KKDE
Sbjct  360   KKDE  363



>sp|P48402.1|CHSB_IPOTF RecName: Full=Chalcone synthase B; AltName: Full=Naringenin-chalcone 
synthase B; Short=CHS-B, partial [Ipomoea trifida]
 gb|AAC49033.1| chalcone synthase, partial [Ipomoea trifida]
Length=366

 Score =   688 bits (1776),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 329/367 (90%), Positives = 351/367 (96%), Gaps = 3/367 (1%)
 Frame = +1

Query  64    MSTTVTVLTDTCRSRRAKRFE--GDAKILAIGTAIPANWVDQTTYPDFYFRITNSEHLLE  237
             MST VT+LTDT  SRRAKRFE  G AKILAIGTA PANWVDQTTYPDFYFRITNS+HLLE
Sbjct  1     MSTAVTMLTDTW-SRRAKRFEIEGYAKILAIGTATPANWVDQTTYPDFYFRITNSQHLLE  59

Query  238   HKEKFRRICNKSKIRKRHLVITEELLKKNPNLCTYNEASLNTRQDILVSEVPKLGKEAAM  417
             HKEKFRRICNKS IRKRH+V+TEELLKKNPNLCTYN+ASLNTRQDILVSEVPKLGKEAAM
Sbjct  60    HKEKFRRICNKSNIRKRHMVLTEELLKKNPNLCTYNDASLNTRQDILVSEVPKLGKEAAM  119

Query  418   KAIKEWGRPISEITHLVFCTSSGVDMPGADFQLAKLLGLSSSVKRLMMYQQGCNAGAAML  597
             KAIK WGRPISEITHLVFCT+SGVDMPGADFQL KLLGL+SSVKRLMMYQQGCNAGAAML
Sbjct  120   KAIKVWGRPISEITHLVFCTTSGVDMPGADFQLTKLLGLNSSVKRLMMYQQGCNAGAAML  179

Query  598   RLAKDLAENNKGARVLVVCSEVMLNVFRGPSLEQEDNLLAQCLFGDGSAAVIVGTEPRPG  777
             RLAKDLAENNKGARVLVVCSEVML+VFRGPSL+QEDNLLAQCLFGDGSAA+I+GT+PRPG
Sbjct  180   RLAKDLAENNKGARVLVVCSEVMLSVFRGPSLQQEDNLLAQCLFGDGSAAIIIGTDPRPG  239

Query  778   LETPLFELVSAAQTTIPDTDSHLKLHLREMGLTFHCSKAVPSLITQNVEDCLVKAFEPFG  957
             LETPLFEL+SAAQT IPDTDSHLKLH+REMGLTFHCSKAVP+ ITQNVEDCLVKAFEP+G
Sbjct  240   LETPLFELISAAQTIIPDTDSHLKLHVREMGLTFHCSKAVPTFITQNVEDCLVKAFEPYG  299

Query  958   ISDWNSIFWILHPGGIAILDRVEEKLGLEPEKLRASKDVLSEYGNLTSACVLFILDEMRK  1137
             ISDWNSIFW+LHPGG AI++ VEE LGL PEKLRAS+DVLSEYGNLTSACVLFILDE+RK
Sbjct  300   ISDWNSIFWVLHPGGNAIVEGVEETLGLAPEKLRASRDVLSEYGNLTSACVLFILDEVRK  359

Query  1138  KSKKDEE  1158
             KSKKDE+
Sbjct  360   KSKKDEQ  366



>sp|P48400.1|CHSA_IPOPL RecName: Full=Chalcone synthase A; AltName: Full=Naringenin-chalcone 
synthase A; Short=CHS-A, partial [Ipomoea platensis]
 gb|AAA62497.1| chalcone synthase, partial [Ipomoea platensis]
Length=362

 Score =   685 bits (1767),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 333/365 (91%), Positives = 347/365 (95%), Gaps = 3/365 (1%)
 Frame = +1

Query  64    MSTTVTVLTDTCRSRRAKRFEGDAKILAIGTAIPANWVDQTTYPDFYFRITNSEHLLEHK  243
             MSTTV  L DT  SRRAKRFEG AKILA+GTA PANWVDQTTYPDFYFRITNSEHLLEHK
Sbjct  1     MSTTV--LPDTW-SRRAKRFEGHAKILAVGTATPANWVDQTTYPDFYFRITNSEHLLEHK  57

Query  244   EKFRRICNKSKIRKRHLVITEELLKKNPNLCTYNEASLNTRQDILVSEVPKLGKEAAMKA  423
             EKFRRICNKSKIRKRHLV+TEELLKKNPNLCTYNE SLNTRQD LVSEVPKLGKEAAMKA
Sbjct  58    EKFRRICNKSKIRKRHLVLTEELLKKNPNLCTYNETSLNTRQDTLVSEVPKLGKEAAMKA  117

Query  424   IKEWGRPISEITHLVFCTSSGVDMPGADFQLAKLLGLSSSVKRLMMYQQGCNAGAAMLRL  603
             IKEWGRPISEITHLVFCT+SGVDMPGADFQL KLLGL+ SVKRLMMYQQGCNAGAAMLRL
Sbjct  118   IKEWGRPISEITHLVFCTTSGVDMPGADFQLTKLLGLNISVKRLMMYQQGCNAGAAMLRL  177

Query  604   AKDLAENNKGARVLVVCSEVMLNVFRGPSLEQEDNLLAQCLFGDGSAAVIVGTEPRPGLE  783
             AKDLAENNKGARVLVVCSEV L+VFRGPSL+QEDNLLAQCLFGDGSAAVIVGT+PRPGLE
Sbjct  178   AKDLAENNKGARVLVVCSEVTLSVFRGPSLQQEDNLLAQCLFGDGSAAVIVGTDPRPGLE  237

Query  784   TPLFELVSAAQTTIPDTDSHLKLHLREMGLTFHCSKAVPSLITQNVEDCLVKAFEPFGIS  963
             TPLFELVS+AQT IPDTDSHLKLHL EMGLTFHCSKAVPSLITQNVEDCLVKAFEPFGIS
Sbjct  238   TPLFELVSSAQTIIPDTDSHLKLHLLEMGLTFHCSKAVPSLITQNVEDCLVKAFEPFGIS  297

Query  964   DWNSIFWILHPGGIAILDRVEEKLGLEPEKLRASKDVLSEYGNLTSACVLFILDEMRKKS  1143
             DWNSIFWILHPGG AILDRVEE+LGL PEKLRAS+DVLSEYGNLTSACVLFILD +R+KS
Sbjct  298   DWNSIFWILHPGGNAILDRVEERLGLGPEKLRASRDVLSEYGNLTSACVLFILDLVRRKS  357

Query  1144  KKDEE  1158
             KK ++
Sbjct  358   KKQQQ  362



>sp|P48399.1|CHSC_IPOPU RecName: Full=Chalcone synthase C; AltName: Full=Naringenin-chalcone 
synthase C; Short=CHS-C, partial [Ipomoea purpurea]
 gb|AAC49031.1| chalcone synthase, partial [Ipomoea purpurea]
Length=352

 Score =   682 bits (1760),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 329/351 (94%), Positives = 340/351 (97%), Gaps = 1/351 (0%)
 Frame = +1

Query  64    MSTTVTVLTDTCRSRRAKRFEGDAKILAIGTAIPANWVDQTTYPDFYFRITNSEHLLEHK  243
             MST VT+LTDT  +RR KRF+G AKILAIGTAIPANWVDQTTYPDFYFRITNSEHLLE+K
Sbjct  1     MSTAVTILTDTW-TRREKRFDGHAKILAIGTAIPANWVDQTTYPDFYFRITNSEHLLEYK  59

Query  244   EKFRRICNKSKIRKRHLVITEELLKKNPNLCTYNEASLNTRQDILVSEVPKLGKEAAMKA  423
             EKFRRICNKSKIRKRHLVITEELLKKNPNLCTYN+ASLNTRQDILVSEVPKLGKEAAMKA
Sbjct  60    EKFRRICNKSKIRKRHLVITEELLKKNPNLCTYNDASLNTRQDILVSEVPKLGKEAAMKA  119

Query  424   IKEWGRPISEITHLVFCTSSGVDMPGADFQLAKLLGLSSSVKRLMMYQQGCNAGAAMLRL  603
             IKEWGRPISEITHLVFCTSSGVDMPGADFQLAKLLGLSSSV RLMMYQQGCNAGA MLRL
Sbjct  120   IKEWGRPISEITHLVFCTSSGVDMPGADFQLAKLLGLSSSVNRLMMYQQGCNAGAVMLRL  179

Query  604   AKDLAENNKGARVLVVCSEVMLNVFRGPSLEQEDNLLAQCLFGDGSAAVIVGTEPRPGLE  783
             AKDLAENNKG RVLVVCSEVML+VFRGPSL+QEDNLLAQCLFGDGSAAVIVGTEPRPGLE
Sbjct  180   AKDLAENNKGGRVLVVCSEVMLSVFRGPSLQQEDNLLAQCLFGDGSAAVIVGTEPRPGLE  239

Query  784   TPLFELVSAAQTTIPDTDSHLKLHLREMGLTFHCSKAVPSLITQNVEDCLVKAFEPFGIS  963
             TPLFELVSAAQTTIPDTDS+LKL LREMGLTFHCSKAVPSLITQN+EDCLVKAFEPFGIS
Sbjct  240   TPLFELVSAAQTTIPDTDSYLKLQLREMGLTFHCSKAVPSLITQNIEDCLVKAFEPFGIS  299

Query  964   DWNSIFWILHPGGIAILDRVEEKLGLEPEKLRASKDVLSEYGNLTSACVLF  1116
             DWNSIFWILHPGG AILD VEEKLGLEPEKLRAS+DVLS+YGNLTSACVLF
Sbjct  300   DWNSIFWILHPGGNAILDGVEEKLGLEPEKLRASRDVLSQYGNLTSACVLF  350



>sp|P48395.1|CHSA_IPONI RecName: Full=Chalcone synthase A; AltName: Full=Naringenin-chalcone 
synthase A; Short=CHS-A, partial [Ipomoea nil]
 gb|AAC49028.1| chalcone synthase, partial [Ipomoea nil]
Length=344

 Score =   675 bits (1742),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 329/343 (96%), Positives = 333/343 (97%), Gaps = 1/343 (0%)
 Frame = +1

Query  79    TVLTDTCRSRRAKRFEGDAKILAIGTAIPANWVDQTTYPDFYFRITNSEHLLEHKEKFRR  258
             T+LT+T  +RR KR EG AKILAIGTAIPANWVDQTTYPDFYFRITNSEHLLEHKEKFRR
Sbjct  3     TILTNTW-TRREKRIEGHAKILAIGTAIPANWVDQTTYPDFYFRITNSEHLLEHKEKFRR  61

Query  259   ICNKSKIRKRHLVITEELLKKNPNLCTYNEASLNTRQDILVSEVPKLGKEAAMKAIKEWG  438
             ICNKSKIRKRHLVITEELLKKNPNLCTYNEASLNTRQDILVSEVPKLGKEAAMKAIKEWG
Sbjct  62    ICNKSKIRKRHLVITEELLKKNPNLCTYNEASLNTRQDILVSEVPKLGKEAAMKAIKEWG  121

Query  439   RPISEITHLVFCTSSGVDMPGADFQLAKLLGLSSSVKRLMMYQQGCNAGAAMLRLAKDLA  618
             RPISEITHLVFCTSSGVDMPGADFQLAKLLGLSSSV RLMMYQQGCNAGAAMLRLAKDLA
Sbjct  122   RPISEITHLVFCTSSGVDMPGADFQLAKLLGLSSSVNRLMMYQQGCNAGAAMLRLAKDLA  181

Query  619   ENNKGARVLVVCSEVMLNVFRGPSLEQEDNLLAQCLFGDGSAAVIVGTEPRPGLETPLFE  798
             ENNKG RVLVVCSEVMLNVFRGPSLEQED LLAQCLFGDGSAAVIVGTEPRPGLETPLFE
Sbjct  182   ENNKGGRVLVVCSEVMLNVFRGPSLEQEDYLLAQCLFGDGSAAVIVGTEPRPGLETPLFE  241

Query  799   LVSAAQTTIPDTDSHLKLHLREMGLTFHCSKAVPSLITQNVEDCLVKAFEPFGISDWNSI  978
             LVSAAQTTIPDTDSHLKLHLREMGLTFHCSKAVPSLITQNVED LVKAFEPFGISDWNSI
Sbjct  242   LVSAAQTTIPDTDSHLKLHLREMGLTFHCSKAVPSLITQNVEDYLVKAFEPFGISDWNSI  301

Query  979   FWILHPGGIAILDRVEEKLGLEPEKLRASKDVLSEYGNLTSAC  1107
             FWILHPGGIAILDRVEEKLGLEPEKLRAS+DVLSE GNLTSAC
Sbjct  302   FWILHPGGIAILDRVEEKLGLEPEKLRASRDVLSESGNLTSAC  344



>sp|P48396.1|CHSB_IPONI RecName: Full=Chalcone synthase B; AltName: Full=Naringenin-chalcone 
synthase B; Short=CHS-B, partial [Ipomoea nil]
 gb|AAC49029.1| chalcone synthase, partial [Ipomoea nil]
Length=363

 Score =   671 bits (1732),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 316/364 (87%), Positives = 343/364 (94%), Gaps = 1/364 (0%)
 Frame = +1

Query  64    MSTTVTVLTDTCRSRRAKRFEGDAKILAIGTAIPANWVDQTTYPDFYFRITNSEHLLEHK  243
             MST + VLTDT  S RAK+ EGDAKI AIGTA PANWVDQTTYPDFYFRITNS+HLLEHK
Sbjct  1     MSTILNVLTDTW-SPRAKKLEGDAKIWAIGTATPANWVDQTTYPDFYFRITNSQHLLEHK  59

Query  244   EKFRRICNKSKIRKRHLVITEELLKKNPNLCTYNEASLNTRQDILVSEVPKLGKEAAMKA  423
             EKFRRICNKSKIRKRHLV+TEELLKKNPNLCTYNE SLNTRQDILV+EVPKLGKEAAMKA
Sbjct  60    EKFRRICNKSKIRKRHLVLTEELLKKNPNLCTYNETSLNTRQDILVAEVPKLGKEAAMKA  119

Query  424   IKEWGRPISEITHLVFCTSSGVDMPGADFQLAKLLGLSSSVKRLMMYQQGCNAGAAMLRL  603
             IKEWGRPISEITHLVFCT+SGVDMPGADFQL KLLGL+SSVKRLMMYQQGCNAGAAMLRL
Sbjct  120   IKEWGRPISEITHLVFCTTSGVDMPGADFQLTKLLGLNSSVKRLMMYQQGCNAGAAMLRL  179

Query  604   AKDLAENNKGARVLVVCSEVMLNVFRGPSLEQEDNLLAQCLFGDGSAAVIVGTEPRPGLE  783
             AKDLAE+NKG RVLVVC+E+ +N+FRGPSLEQ+DNLLAQCLFGDG+AA+IV  +PRPGLE
Sbjct  180   AKDLAESNKGGRVLVVCAEITINIFRGPSLEQDDNLLAQCLFGDGAAAMIVAADPRPGLE  239

Query  784   TPLFELVSAAQTTIPDTDSHLKLHLREMGLTFHCSKAVPSLITQNVEDCLVKAFEPFGIS  963
             TPLFELVS+AQT +P+TDSHLKLHLREMGLTFHCSKAVPS++ +NVEDCLVKAFEP+GIS
Sbjct  240   TPLFELVSSAQTIVPNTDSHLKLHLREMGLTFHCSKAVPSVLAENVEDCLVKAFEPYGIS  299

Query  964   DWNSIFWILHPGGIAILDRVEEKLGLEPEKLRASKDVLSEYGNLTSACVLFILDEMRKKS  1143
             DWNSIFW+ HPGG AI+DRVEE+LGL PEK RAS+DVLSEYGNLTSACVLF LDEMRKKS
Sbjct  300   DWNSIFWVFHPGGNAIVDRVEERLGLGPEKFRASRDVLSEYGNLTSACVLFTLDEMRKKS  359

Query  1144  KKDE  1155
             KKDE
Sbjct  360   KKDE  363



>sp|P48401.1|CHSA_IPOTF RecName: Full=Chalcone synthase A; AltName: Full=Naringenin-chalcone 
synthase A; Short=CHS-A, partial [Ipomoea trifida]
 gb|AAC49032.1| chalcone synthase, partial [Ipomoea trifida]
Length=362

 Score =   671 bits (1730),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 318/366 (87%), Positives = 344/366 (94%), Gaps = 5/366 (1%)
 Frame = +1

Query  64    MSTTVTV-LTDTCRSRRAKRFEGDAKILAIGTAIPANWVDQTTYPDFYFRITNSEHLLEH  240
             MS T TV LTD      AKRFEG AK+LAIGTA P NWVDQ TYPDFYFRITNSEHLLEH
Sbjct  1     MSPTATVQLTDDT----AKRFEGHAKLLAIGTATPTNWVDQATYPDFYFRITNSEHLLEH  56

Query  241   KEKFRRICNKSKIRKRHLVITEELLKKNPNLCTYNEASLNTRQDILVSEVPKLGKEAAMK  420
             KEKFRRICNKSKIRKRHLV+T+ELLKKNPNLCTYN+ASLNTRQDILVSEVPKLGKEAAMK
Sbjct  57    KEKFRRICNKSKIRKRHLVLTKELLKKNPNLCTYNDASLNTRQDILVSEVPKLGKEAAMK  116

Query  421   AIKEWGRPISEITHLVFCTSSGVDMPGADFQLAKLLGLSSSVKRLMMYQQGCNAGAAMLR  600
             AIKEWGRPISEITHLVFCT+SGVDMPGADFQL KLLGL+SSVKRLMMYQQGCNAGAAMLR
Sbjct  117   AIKEWGRPISEITHLVFCTTSGVDMPGADFQLTKLLGLNSSVKRLMMYQQGCNAGAAMLR  176

Query  601   LAKDLAENNKGARVLVVCSEVMLNVFRGPSLEQEDNLLAQCLFGDGSAAVIVGTEPRPGL  780
             L KDLAENNKGARVLVVCSE+ +N+FRGPSLEQ+DNLLAQCLFGDGSAA+IVG +PRPGL
Sbjct  177   LVKDLAENNKGARVLVVCSEITINIFRGPSLEQDDNLLAQCLFGDGSAAMIVGKDPRPGL  236

Query  781   ETPLFELVSAAQTTIPDTDSHLKLHLREMGLTFHCSKAVPSLITQNVEDCLVKAFEPFGI  960
             ETPLFELVS+AQT +P+TDSHLKLHLREMGLTFHCS+AVPS++ +NVEDCLVKAFEP+GI
Sbjct  237   ETPLFELVSSAQTIVPNTDSHLKLHLREMGLTFHCSRAVPSVLAENVEDCLVKAFEPYGI  296

Query  961   SDWNSIFWILHPGGIAILDRVEEKLGLEPEKLRASKDVLSEYGNLTSACVLFILDEMRKK  1140
             SDWNSIFW+ HPGG AI+DRVEE+LGL PE+LRAS+DVLSEYGNLTSACVLFILDEMRKK
Sbjct  297   SDWNSIFWVFHPGGNAIVDRVEERLGLGPERLRASRDVLSEYGNLTSACVLFILDEMRKK  356

Query  1141  SKKDEE  1158
             SKKDE+
Sbjct  357   SKKDEQ  362



>sp|P48403.1|CHSA_IPOTR RecName: Full=Chalcone synthase A; AltName: Full=Naringenin-chalcone 
synthase A; Short=CHS-A, partial [Ipomoea triloba]
 gb|AAC49034.1| chalcone synthase, partial [Ipomoea triloba]
Length=362

 Score =   664 bits (1712),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 316/366 (86%), Positives = 342/366 (93%), Gaps = 5/366 (1%)
 Frame = +1

Query  64    MSTTVTV-LTDTCRSRRAKRFEGDAKILAIGTAIPANWVDQTTYPDFYFRITNSEHLLEH  240
             MS TVTV LTD      AKRFEG AK+LAIGTA P NWVDQ TYPDFYFRITNSE LLEH
Sbjct  1     MSPTVTVQLTDDT----AKRFEGHAKLLAIGTATPTNWVDQATYPDFYFRITNSERLLEH  56

Query  241   KEKFRRICNKSKIRKRHLVITEELLKKNPNLCTYNEASLNTRQDILVSEVPKLGKEAAMK  420
             KEKFRRICNKSKIR RHLV+TEELLKK+PNLCTYN+ASLNTRQDILVSEVPKLGKEAAMK
Sbjct  57    KEKFRRICNKSKIRFRHLVLTEELLKKSPNLCTYNDASLNTRQDILVSEVPKLGKEAAMK  116

Query  421   AIKEWGRPISEITHLVFCTSSGVDMPGADFQLAKLLGLSSSVKRLMMYQQGCNAGAAMLR  600
             AIKEWGRPISEITHLVFCT+SGVDMPGADFQL KLLGL+SSVKRLMMYQQGCNAGAAMLR
Sbjct  117   AIKEWGRPISEITHLVFCTTSGVDMPGADFQLTKLLGLNSSVKRLMMYQQGCNAGAAMLR  176

Query  601   LAKDLAENNKGARVLVVCSEVMLNVFRGPSLEQEDNLLAQCLFGDGSAAVIVGTEPRPGL  780
             L KDLAENNKGARVLVVCSE+ +N+FRGPSLEQ+DNLLAQCLFGDGSAA+IVG +PRPGL
Sbjct  177   LVKDLAENNKGARVLVVCSEITINIFRGPSLEQDDNLLAQCLFGDGSAAMIVGKDPRPGL  236

Query  781   ETPLFELVSAAQTTIPDTDSHLKLHLREMGLTFHCSKAVPSLITQNVEDCLVKAFEPFGI  960
             ETPLFELVS+AQT +P+TDSHLKL LREMGLTFHCS+AVPS++ +NVEDCLVKAFEP+GI
Sbjct  237   ETPLFELVSSAQTIVPNTDSHLKLTLREMGLTFHCSRAVPSVLAENVEDCLVKAFEPYGI  296

Query  961   SDWNSIFWILHPGGIAILDRVEEKLGLEPEKLRASKDVLSEYGNLTSACVLFILDEMRKK  1140
             SDWNSIFW+ HPGG AI+DRVEE+LGL PE+LRAS+DVLSEYGNLTSACVLFILDEMRKK
Sbjct  297   SDWNSIFWVFHPGGYAIVDRVEERLGLGPERLRASRDVLSEYGNLTSACVLFILDEMRKK  356

Query  1141  SKKDEE  1158
             SKKDE+
Sbjct  357   SKKDEQ  362



>sp|P48404.1|CHSB_IPOTR RecName: Full=Chalcone synthase B; AltName: Full=Naringenin-chalcone 
synthase B; Short=CHS-B, partial [Ipomoea triloba]
 gb|AAC49035.1| chalcone synthase, partial [Ipomoea triloba]
Length=366

 Score =   663 bits (1711),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 314/367 (86%), Positives = 346/367 (94%), Gaps = 3/367 (1%)
 Frame = +1

Query  64    MSTTVTVLTDTCRSRRAKRFE--GDAKILAIGTAIPANWVDQTTYPDFYFRITNSEHLLE  237
             MSTTVTVLTDT   RRAKRFE  G AKILAIGTA PANWVDQTTYPDFYFRITNS+HLLE
Sbjct  1     MSTTVTVLTDTW-GRRAKRFEIEGYAKILAIGTATPANWVDQTTYPDFYFRITNSQHLLE  59

Query  238   HKEKFRRICNKSKIRKRHLVITEELLKKNPNLCTYNEASLNTRQDILVSEVPKLGKEAAM  417
             HKEKFRRICNKSKIRKRHLV+TEELL+KNP+LCTYNE SLNTRQDILVSEVPKLGKEAAM
Sbjct  60    HKEKFRRICNKSKIRKRHLVLTEELLQKNPSLCTYNETSLNTRQDILVSEVPKLGKEAAM  119

Query  418   KAIKEWGRPISEITHLVFCTSSGVDMPGADFQLAKLLGLSSSVKRLMMYQQGCNAGAAML  597
             KAIKEWGRPISEITHLVFCT+SGVDMPGADF+L KLLGL+SSVKRLMMYQQGCNAGAAML
Sbjct  120   KAIKEWGRPISEITHLVFCTTSGVDMPGADFRLTKLLGLNSSVKRLMMYQQGCNAGAAML  179

Query  598   RLAKDLAENNKGARVLVVCSEVMLNVFRGPSLEQEDNLLAQCLFGDGSAAVIVGTEPRPG  777
             RLAKDLAE+NKG R+LVVCSE+ +N+FRGPSLEQ+DNLLAQCLFGDGSAA+IVGT+PRP 
Sbjct  180   RLAKDLAESNKGGRILVVCSEITINIFRGPSLEQDDNLLAQCLFGDGSAAMIVGTDPRPD  239

Query  778   LETPLFELVSAAQTTIPDTDSHLKLHLREMGLTFHCSKAVPSLITQNVEDCLVKAFEPFG  957
             LETPLFELVS+AQT +P+TDSHLKL LREMGLTFHCS+AVPS++ +NVEDCLVKAFEP+G
Sbjct  240   LETPLFELVSSAQTIVPNTDSHLKLTLREMGLTFHCSRAVPSVLAENVEDCLVKAFEPYG  299

Query  958   ISDWNSIFWILHPGGIAILDRVEEKLGLEPEKLRASKDVLSEYGNLTSACVLFILDEMRK  1137
             ISDWNSIFW+ HPGG AI+DRVEE+LGL  ++ RAS+DVLSEYGNLTSACVLFILDE+R 
Sbjct  300   ISDWNSIFWVFHPGGNAIVDRVEERLGLGAQRFRASRDVLSEYGNLTSACVLFILDEVRN  359

Query  1138  KSKKDEE  1158
             KSKK+E+
Sbjct  360   KSKKNEQ  366



>sp|P48393.1|CHSA_IPOCO RecName: Full=Chalcone synthase A; AltName: Full=Naringenin-chalcone 
synthase A; Short=CHS-A, partial [Ipomoea cordatotriloba]
 gb|AAC49026.1| chalcone synthase, partial [Ipomoea cordatotriloba]
Length=361

 Score =   659 bits (1699),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 314/365 (86%), Positives = 340/365 (93%), Gaps = 5/365 (1%)
 Frame = +1

Query  64    MSTTVTV-LTDTCRSRRAKRFEGDAKILAIGTAIPANWVDQTTYPDFYFRITNSEHLLEH  240
             M+ TVTV LTD      AKRFEG AK+LAIGTA P NWVDQ TYPDFYFRITNSEHLLEH
Sbjct  1     MTPTVTVQLTDDT----AKRFEGHAKLLAIGTATPTNWVDQATYPDFYFRITNSEHLLEH  56

Query  241   KEKFRRICNKSKIRKRHLVITEELLKKNPNLCTYNEASLNTRQDILVSEVPKLGKEAAMK  420
             KEKFRRICNKSKIRKRHLV+TEELLK+NPNLCTYN+ASLNTRQDILVSEVPKLGKEAAMK
Sbjct  57    KEKFRRICNKSKIRKRHLVLTEELLKENPNLCTYNDASLNTRQDILVSEVPKLGKEAAMK  116

Query  421   AIKEWGRPISEITHLVFCTSSGVDMPGADFQLAKLLGLSSSVKRLMMYQQGCNAGAAMLR  600
             AIKEWGRPISEITHLVFCT+SGVDMPGADFQL KLLGL+SSVKRLMMYQQGCNAGAAMLR
Sbjct  117   AIKEWGRPISEITHLVFCTTSGVDMPGADFQLTKLLGLNSSVKRLMMYQQGCNAGAAMLR  176

Query  601   LAKDLAENNKGARVLVVCSEVMLNVFRGPSLEQEDNLLAQCLFGDGSAAVIVGTEPRPGL  780
             L K LAENNKGARVLVVCS + +N+FRGPSLEQ+DNLLAQCLFGDGSAA+I G +PRPGL
Sbjct  177   LVKGLAENNKGARVLVVCSGITINIFRGPSLEQDDNLLAQCLFGDGSAAMIDGKDPRPGL  236

Query  781   ETPLFELVSAAQTTIPDTDSHLKLHLREMGLTFHCSKAVPSLITQNVEDCLVKAFEPFGI  960
             ETPLFELVS+AQT +P+TDSHLKLHLREMGLTFHCS+AVPS++ +NVEDCLVKAFEP+GI
Sbjct  237   ETPLFELVSSAQTIVPNTDSHLKLHLREMGLTFHCSRAVPSVLAENVEDCLVKAFEPYGI  296

Query  961   SDWNSIFWILHPGGIAILDRVEEKLGLEPEKLRASKDVLSEYGNLTSACVLFILDEMRKK  1140
             SDWNSIFW+ HPGG AI+DRVEE+ GL PE+LRAS+DVLSEYGNLTSACVLFILDEMRKK
Sbjct  297   SDWNSIFWVFHPGGNAIVDRVEERSGLGPERLRASRDVLSEYGNLTSACVLFILDEMRKK  356

Query  1141  SKKDE  1155
             SKKDE
Sbjct  357   SKKDE  361



>ref|XP_006355706.1| PREDICTED: chalcone synthase B-like [Solanum tuberosum]
Length=392

 Score =   553 bits (1426),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 258/368 (70%), Positives = 310/368 (84%), Gaps = 0/368 (0%)
 Frame = +1

Query  106   RRAKRFEGDAKILAIGTAIPANWVDQTTYPDFYFRITNSEHLLEHKEKFRRICNKSKIRK  285
             R  +R EG AKILAIGTA P +WVDQT+YPD+YF++TNSEHL++ KEKFRRIC+++ IRK
Sbjct  11    RVHERAEGPAKILAIGTATPFHWVDQTSYPDYYFKVTNSEHLVDLKEKFRRICSRTMIRK  70

Query  286   RHLVITEELLKKNPNLCTYNEASLNTRQDILVSEVPKLGKEAAMKAIKEWGRPISEITHL  465
             RH+++TEE+LKKNPNLC+YN  SL+ RQDILVSE+PKLGKEAA+ AI EW +P S+ITHL
Sbjct  71    RHMLLTEEILKKNPNLCSYNGPSLDIRQDILVSEIPKLGKEAALMAIDEWAQPKSKITHL  130

Query  466   VFCTSSGVDMPGADFQLAKLLGLSSSVKRLMMYQQGCNAGAAMLRLAKDLAENNKGARVL  645
             VFCT SGVDMPGAD+QL KLLGLS SV+RLMMYQQGC AG  MLRLAKDLAENNKGARVL
Sbjct  131   VFCTRSGVDMPGADYQLIKLLGLSPSVQRLMMYQQGCFAGGTMLRLAKDLAENNKGARVL  190

Query  646   VVCSEVMLNVFRGPSLEQEDNLLAQCLFGDGSAAVIVGTEPRPGLETPLFELVSAAQTTI  825
             VVC+E     FRGPS    DNL+AQ LFGDG+ AVI+G++P+ GLE P+FE+VSAAQT +
Sbjct  191   VVCAESSAIGFRGPSEAHPDNLIAQALFGDGAVAVIIGSDPKMGLERPIFEIVSAAQTFV  250

Query  826   PDTDSHLKLHLREMGLTFHCSKAVPSLITQNVEDCLVKAFEPFGISDWNSIFWILHPGGI  1005
             P+ D HL LHLREMGLTFHC++ VP  I +NVE CL+KAFEP GISDWNS+FWILHPGG 
Sbjct  251   PNGDCHLALHLREMGLTFHCTRDVPPTIAKNVESCLIKAFEPLGISDWNSVFWILHPGGN  310

Query  1006  AILDRVEEKLGLEPEKLRASKDVLSEYGNLTSACVLFILDEMRKKSKKDEEMTTGEGLEW  1185
             AI+D+VE  LGLEP+KLRA++++L EYGNL+SACVLFILDE+RKKS +    TTG+GL+ 
Sbjct  311   AIVDQVESTLGLEPDKLRATRNILREYGNLSSACVLFILDEIRKKSARYGLKTTGDGLDL  370

Query  1186  GVVFVVCP  1209
             GV+    P
Sbjct  371   GVLLSFGP  378



>sp|P22924.1|CHSB_PETHY RecName: Full=Chalcone synthase B; AltName: Full=Naringenin-chalcone 
synthase B [Petunia x hybrida]
 emb|CAA32732.1| chalcone synthase [Petunia x hybrida]
Length=392

 Score =   551 bits (1421),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 258/366 (70%), Positives = 309/366 (84%), Gaps = 0/366 (0%)
 Frame = +1

Query  112   AKRFEGDAKILAIGTAIPANWVDQTTYPDFYFRITNSEHLLEHKEKFRRICNKSKIRKRH  291
             A+R EG AKILAIGTA P +WVDQ +YPD+YFR+TNS+HL++ KEKFRRIC+K+ I+KRH
Sbjct  13    AQRAEGPAKILAIGTATPFHWVDQNSYPDYYFRVTNSQHLVDLKEKFRRICSKTMIKKRH  72

Query  292   LVITEELLKKNPNLCTYNEASLNTRQDILVSEVPKLGKEAAMKAIKEWGRPISEITHLVF  471
             + +TEELL+KNP LC++NE SL+ RQDILVSE+PKLGKEAA+KAI EWG+P S ITHLVF
Sbjct  73    MFLTEELLRKNPTLCSHNEPSLDIRQDILVSEIPKLGKEAALKAIGEWGQPKSTITHLVF  132

Query  472   CTSSGVDMPGADFQLAKLLGLSSSVKRLMMYQQGCNAGAAMLRLAKDLAENNKGARVLVV  651
             CT SGVDMPGAD QL KLLGLS SV+RLMMYQQGC AG  MLRLAKDLAENNKGARVLVV
Sbjct  133   CTRSGVDMPGADCQLVKLLGLSPSVQRLMMYQQGCFAGGTMLRLAKDLAENNKGARVLVV  192

Query  652   CSEVMLNVFRGPSLEQEDNLLAQCLFGDGSAAVIVGTEPRPGLETPLFELVSAAQTTIPD  831
             C+E     FRGPS    DNL+AQ LFGDG+AA+I+G++P+PGLE P+FE+ SAAQT +P+
Sbjct  193   CAESSAIGFRGPSEANVDNLIAQALFGDGAAALIIGSDPKPGLERPVFEIFSAAQTFVPN  252

Query  832   TDSHLKLHLREMGLTFHCSKAVPSLITQNVEDCLVKAFEPFGISDWNSIFWILHPGGIAI  1011
              D HL LHLREMGLTFHC+K VP  I +NVE CL+KAFEP GISDWNS+FWILHPGG AI
Sbjct  253   GDCHLALHLREMGLTFHCTKDVPPTIAKNVESCLIKAFEPLGISDWNSLFWILHPGGNAI  312

Query  1012  LDRVEEKLGLEPEKLRASKDVLSEYGNLTSACVLFILDEMRKKSKKDEEMTTGEGLEWGV  1191
             +D+VE  LGL PEKLRA++++LSEYGNL+SAC LFILDE+RKKS ++   T+G+GL+ GV
Sbjct  313   VDQVESTLGLGPEKLRATRNILSEYGNLSSACCLFILDEIRKKSAREGMRTSGDGLDLGV  372

Query  1192  VFVVCP  1209
             +    P
Sbjct  373   LLSFGP  378



>ref|XP_004239898.1| PREDICTED: chalcone synthase B [Solanum lycopersicum]
Length=392

 Score =   548 bits (1413),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 254/369 (69%), Positives = 308/369 (83%), Gaps = 0/369 (0%)
 Frame = +1

Query  103   SRRAKRFEGDAKILAIGTAIPANWVDQTTYPDFYFRITNSEHLLEHKEKFRRICNKSKIR  282
              R  +R EG AKILAIGTA P +WVDQT+YPD+YF++TN+EHL++ KEKFRRIC+++ IR
Sbjct  10    GRVHERAEGPAKILAIGTATPFHWVDQTSYPDYYFKVTNNEHLVDLKEKFRRICSRTMIR  69

Query  283   KRHLVITEELLKKNPNLCTYNEASLNTRQDILVSEVPKLGKEAAMKAIKEWGRPISEITH  462
             KRH+++TEE+LKKNPNLC+YN  SL+ RQDILVSE+PKLGKEAA++AI EW +P S ITH
Sbjct  70    KRHMLLTEEILKKNPNLCSYNGPSLDIRQDILVSEIPKLGKEAALRAIDEWAQPKSNITH  129

Query  463   LVFCTSSGVDMPGADFQLAKLLGLSSSVKRLMMYQQGCNAGAAMLRLAKDLAENNKGARV  642
             LVFCT SGVDMPGAD+QL  LLGLS SV+R MMYQQGC AG  MLRLAKDLAENNKGARV
Sbjct  130   LVFCTRSGVDMPGADYQLINLLGLSPSVQRFMMYQQGCFAGGTMLRLAKDLAENNKGARV  189

Query  643   LVVCSEVMLNVFRGPSLEQEDNLLAQCLFGDGSAAVIVGTEPRPGLETPLFELVSAAQTT  822
             LVVC+E     FRGPS    DNL+AQ LFGDG+ AVI+G++P+ GLE P+FE+VSA QT 
Sbjct  190   LVVCAESSAIGFRGPSEAYPDNLIAQALFGDGAVAVIIGSDPKMGLERPVFEIVSAGQTF  249

Query  823   IPDTDSHLKLHLREMGLTFHCSKAVPSLITQNVEDCLVKAFEPFGISDWNSIFWILHPGG  1002
             +P+ D HL LHLREMGLTFHC++ VP  I +NVE CL+KAFEP GISDWNS+FWILHPGG
Sbjct  250   VPNGDCHLALHLREMGLTFHCTRDVPPAIAKNVESCLIKAFEPLGISDWNSVFWILHPGG  309

Query  1003  IAILDRVEEKLGLEPEKLRASKDVLSEYGNLTSACVLFILDEMRKKSKKDEEMTTGEGLE  1182
              AI+D+VE  LGLEP++LRA++++L EYGNL+SACVLFILDE+RKKS +D   TTG+GL+
Sbjct  310   NAIVDQVENILGLEPDRLRATRNILREYGNLSSACVLFILDEIRKKSARDGLKTTGDGLD  369

Query  1183  WGVVFVVCP  1209
              GV+    P
Sbjct  370   LGVLLSFGP  378



>gb|AGW24283.1| chalcone synthase [Melastoma malabathricum]
Length=391

 Score =   546 bits (1406),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 254/368 (69%), Positives = 308/368 (84%), Gaps = 0/368 (0%)
 Frame = +1

Query  106   RRAKRFEGDAKILAIGTAIPANWVDQTTYPDFYFRITNSEHLLEHKEKFRRICNKSKIRK  285
             RR++R EG A ILAIGTA P N VDQ+TYPD+YFRITNSEH  E KEKF+R+C+KS I+K
Sbjct  8     RRSQRAEGPATILAIGTATPPNCVDQSTYPDYYFRITNSEHKAELKEKFQRMCDKSMIKK  67

Query  286   RHLVITEELLKKNPNLCTYNEASLNTRQDILVSEVPKLGKEAAMKAIKEWGRPISEITHL  465
             R++ +TEE+LK+NP++C Y   SL+ RQD++V EVPKLGKEAA KAIKEWG+P S+ITHL
Sbjct  68    RYMYLTEEILKENPSVCAYEAPSLDARQDMVVVEVPKLGKEAAAKAIKEWGQPKSKITHL  127

Query  466   VFCTSSGVDMPGADFQLAKLLGLSSSVKRLMMYQQGCNAGAAMLRLAKDLAENNKGARVL  645
             VFCT+SGVDMPGAD+QL KLLGL  SVKRLMMYQQGC AG  +LRLAKDLAENNKGARVL
Sbjct  128   VFCTTSGVDMPGADYQLTKLLGLRPSVKRLMMYQQGCFAGGTVLRLAKDLAENNKGARVL  187

Query  646   VVCSEVMLNVFRGPSLEQEDNLLAQCLFGDGSAAVIVGTEPRPGLETPLFELVSAAQTTI  825
             VVCSE+    FRGPS    D+L+ Q LFGDG+ A+I+G++P PG+E P+FELVSAAQT +
Sbjct  188   VVCSEITAVTFRGPSESHLDSLVGQALFGDGAGAIIIGSDPIPGVEKPMFELVSAAQTIL  247

Query  826   PDTDSHLKLHLREMGLTFHCSKAVPSLITQNVEDCLVKAFEPFGISDWNSIFWILHPGGI  1005
             PD+D  +  HLRE+GLTFH  K VP LI++NVE  LV+AF+P GISDWNS+FWI HPGG 
Sbjct  248   PDSDGAIDGHLREVGLTFHLLKDVPGLISKNVEKSLVEAFQPLGISDWNSLFWIAHPGGP  307

Query  1006  AILDRVEEKLGLEPEKLRASKDVLSEYGNLTSACVLFILDEMRKKSKKDEEMTTGEGLEW  1185
             AILD+VEEKLGL+PEK+RA++ VLS+YGN++SACVLFILDEMR+ SK++   TTGEGLEW
Sbjct  308   AILDQVEEKLGLKPEKMRATRQVLSDYGNMSSACVLFILDEMRRSSKQNGFKTTGEGLEW  367

Query  1186  GVVFVVCP  1209
             GV+F   P
Sbjct  368   GVLFGFGP  375



>sp|P22928.2|CHSJ_PETHY RecName: Full=Chalcone synthase J; AltName: Full=Naringenin-chalcone 
synthase J [Petunia x hybrida]
 emb|CAA32737.1| chalcone synthase [Petunia x hybrida]
Length=389

 Score =   545 bits (1404),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 257/368 (70%), Positives = 309/368 (84%), Gaps = 0/368 (0%)
 Frame = +1

Query  106   RRAKRFEGDAKILAIGTAIPANWVDQTTYPDFYFRITNSEHLLEHKEKFRRICNKSKIRK  285
             RRA+R EG A I+AIGTA P+N VDQ+TYPD+YFRITNSEH  E KEKF+R+C+KS I+K
Sbjct  8     RRAQRAEGPATIMAIGTATPSNCVDQSTYPDYYFRITNSEHKTELKEKFQRMCDKSMIKK  67

Query  286   RHLVITEELLKKNPNLCTYNEASLNTRQDILVSEVPKLGKEAAMKAIKEWGRPISEITHL  465
             R++ +TEE+LK+NPN+C Y   SL+ RQDI+V EVPKLGKEAA KAIKEWG+P S+ITHL
Sbjct  68    RYMHLTEEILKENPNICEYMAPSLDARQDIVVVEVPKLGKEAAQKAIKEWGQPKSKITHL  127

Query  466   VFCTSSGVDMPGADFQLAKLLGLSSSVKRLMMYQQGCNAGAAMLRLAKDLAENNKGARVL  645
             VFCT+SGVDMPGAD+QL KLLGL SSVKRLMMYQQGC AG  +LRLAKDLAENNKGARVL
Sbjct  128   VFCTTSGVDMPGADYQLTKLLGLRSSVKRLMMYQQGCFAGGTVLRLAKDLAENNKGARVL  187

Query  646   VVCSEVMLNVFRGPSLEQEDNLLAQCLFGDGSAAVIVGTEPRPGLETPLFELVSAAQTTI  825
             VVCSE+    FRGP+    D+L+ Q LFGDG+AA+I+G++P PG+E PLFELVSA+QT +
Sbjct  188   VVCSEITAVTFRGPNDTHLDSLVGQALFGDGAAAIIIGSDPLPGVERPLFELVSASQTLL  247

Query  826   PDTDSHLKLHLREMGLTFHCSKAVPSLITQNVEDCLVKAFEPFGISDWNSIFWILHPGGI  1005
             PD++  +  HLRE+GLTFH  K VP LI++N++  LV+AF+P GISDWNSIFWI HPGG 
Sbjct  248   PDSEGAIDGHLREVGLTFHLLKDVPGLISKNIQKSLVEAFQPLGISDWNSIFWIAHPGGP  307

Query  1006  AILDRVEEKLGLEPEKLRASKDVLSEYGNLTSACVLFILDEMRKKSKKDEEMTTGEGLEW  1185
             AILD+VE KLGL+PEKLRA++ VLSEYGN++SACVLFILDEMRK S K+   TTGEGLEW
Sbjct  308   AILDQVELKLGLKPEKLRATRHVLSEYGNMSSACVLFILDEMRKASSKEGLGTTGEGLEW  367

Query  1186  GVVFVVCP  1209
             GV+F   P
Sbjct  368   GVLFGFGP  375



>gb|AIY22756.1| chalcone synthase [Iochroma cyaneum]
Length=389

 Score =   544 bits (1401),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 252/368 (68%), Positives = 309/368 (84%), Gaps = 0/368 (0%)
 Frame = +1

Query  106   RRAKRFEGDAKILAIGTAIPANWVDQTTYPDFYFRITNSEHLLEHKEKFRRICNKSKIRK  285
             RRA+R +G A I+AIGTA P+N VDQ+TYPD+YFRITNSEH+ E KEKF+R+C+KS I+K
Sbjct  8     RRAQRAKGPATIMAIGTATPSNCVDQSTYPDYYFRITNSEHMTELKEKFKRMCDKSMIKK  67

Query  286   RHLVITEELLKKNPNLCTYNEASLNTRQDILVSEVPKLGKEAAMKAIKEWGRPISEITHL  465
             R++ +TEE+LK+NPN+C Y   SL+ RQDI+V EVPKLGKEAA KAIKEWG+P S+ITHL
Sbjct  68    RYMHLTEEILKENPNICEYMAPSLDARQDIVVVEVPKLGKEAAQKAIKEWGQPKSKITHL  127

Query  466   VFCTSSGVDMPGADFQLAKLLGLSSSVKRLMMYQQGCNAGAAMLRLAKDLAENNKGARVL  645
             VFCT+SGVDMPGAD+QL KLLGL  SVKRLMMYQQGC AG  ++RLAKDLAENNKGARVL
Sbjct  128   VFCTTSGVDMPGADYQLTKLLGLRPSVKRLMMYQQGCFAGGTVIRLAKDLAENNKGARVL  187

Query  646   VVCSEVMLNVFRGPSLEQEDNLLAQCLFGDGSAAVIVGTEPRPGLETPLFELVSAAQTTI  825
             VVCSE+    FRGPS    D+++ Q LFGDG+AA+I+G++P PG+E PLFELVSAAQT +
Sbjct  188   VVCSEITAVTFRGPSDTHLDSMVGQALFGDGAAAIIIGSDPLPGVERPLFELVSAAQTLL  247

Query  826   PDTDSHLKLHLREMGLTFHCSKAVPSLITQNVEDCLVKAFEPFGISDWNSIFWILHPGGI  1005
             PD++  +  HLRE+GLTFH  K VP LI++N+E  L++AF+P GISDWNS+FWI HPGG 
Sbjct  248   PDSEGAIDGHLREVGLTFHLLKDVPGLISKNIEKSLIEAFQPLGISDWNSVFWIAHPGGP  307

Query  1006  AILDRVEEKLGLEPEKLRASKDVLSEYGNLTSACVLFILDEMRKKSKKDEEMTTGEGLEW  1185
             AILD+VE KLGL+PEKLRA++ VLS+YGN++SACVLFILDEMRK S K+   TTGEGL+W
Sbjct  308   AILDQVELKLGLKPEKLRATRQVLSDYGNMSSACVLFILDEMRKASAKEGLSTTGEGLDW  367

Query  1186  GVVFVVCP  1209
             GV+F   P
Sbjct  368   GVLFGFGP  375



>emb|CAA64452.1| naringenin-chalcone synthase [Juglans nigra x Juglans regia]
Length=389

 Score =   544 bits (1401),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 256/368 (70%), Positives = 305/368 (83%), Gaps = 0/368 (0%)
 Frame = +1

Query  106   RRAKRFEGDAKILAIGTAIPANWVDQTTYPDFYFRITNSEHLLEHKEKFRRICNKSKIRK  285
             RRA+R EG A ++AIGTA P N VDQ+ YPD+YFRITNSEH  E KEKF+R+C KS I+K
Sbjct  8     RRAQRAEGPATVMAIGTATPPNCVDQSAYPDYYFRITNSEHKTELKEKFKRMCEKSMIKK  67

Query  286   RHLVITEELLKKNPNLCTYNEASLNTRQDILVSEVPKLGKEAAMKAIKEWGRPISEITHL  465
             R++ +TEE+LK+NPN+C Y  +SL+ RQD++V EVPKLGKEAA KAIKEWG+P S+ITHL
Sbjct  68    RYMHLTEEILKENPNVCAYMASSLDARQDMVVVEVPKLGKEAATKAIKEWGQPKSKITHL  127

Query  466   VFCTSSGVDMPGADFQLAKLLGLSSSVKRLMMYQQGCNAGAAMLRLAKDLAENNKGARVL  645
             VFCT+SGVDMPGAD+QL KLLGL  SVKRLMMYQQGC AG  +LRLAKDLAENNKGARVL
Sbjct  128   VFCTTSGVDMPGADYQLTKLLGLRPSVKRLMMYQQGCFAGGTVLRLAKDLAENNKGARVL  187

Query  646   VVCSEVMLNVFRGPSLEQEDNLLAQCLFGDGSAAVIVGTEPRPGLETPLFELVSAAQTTI  825
             VVCSE+    FRGPS    D+L+ Q LFGDG+AA+IVG +P PG+E PLFELVSAAQT +
Sbjct  188   VVCSEITAVTFRGPSDTHLDSLVGQALFGDGAAALIVGADPVPGVEKPLFELVSAAQTIL  247

Query  826   PDTDSHLKLHLREMGLTFHCSKAVPSLITQNVEDCLVKAFEPFGISDWNSIFWILHPGGI  1005
             PD+D  +  HLRE+GLTFH  K VP LI++N+E  LV+AF+P GI+DWNS+FWI HPGG 
Sbjct  248   PDSDGAIDGHLREVGLTFHLLKDVPGLISKNIEKSLVEAFQPLGITDWNSLFWIAHPGGP  307

Query  1006  AILDRVEEKLGLEPEKLRASKDVLSEYGNLTSACVLFILDEMRKKSKKDEEMTTGEGLEW  1185
             AILD+VE KL L+PEKLRA++ VLSEYGN++SACVLFILDEMRKKS +D   TTGEGLEW
Sbjct  308   AILDQVESKLELKPEKLRATRHVLSEYGNMSSACVLFILDEMRKKSAEDRLKTTGEGLEW  367

Query  1186  GVVFVVCP  1209
             GV+F   P
Sbjct  368   GVLFGFGP  375



>emb|CAA64366.1| naringenin-chalcone synthase [Juglans nigra x Juglans regia]
Length=389

 Score =   543 bits (1400),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 255/364 (70%), Positives = 304/364 (84%), Gaps = 0/364 (0%)
 Frame = +1

Query  106   RRAKRFEGDAKILAIGTAIPANWVDQTTYPDFYFRITNSEHLLEHKEKFRRICNKSKIRK  285
             RRA+R EG A ++AIGTA P N VDQ+ YPD+YFRITNSEH  E KEKF+R+C KS I+K
Sbjct  8     RRAQRAEGPATVMAIGTATPPNCVDQSAYPDYYFRITNSEHKTELKEKFKRMCGKSMIKK  67

Query  286   RHLVITEELLKKNPNLCTYNEASLNTRQDILVSEVPKLGKEAAMKAIKEWGRPISEITHL  465
             R++ +TEE+LK+NPN+C Y  +SL+ RQD++V EVPKLGKEAA KAIKEWG+P S+ITHL
Sbjct  68    RYMHLTEEILKENPNVCAYMASSLDARQDMVVVEVPKLGKEAATKAIKEWGQPKSKITHL  127

Query  466   VFCTSSGVDMPGADFQLAKLLGLSSSVKRLMMYQQGCNAGAAMLRLAKDLAENNKGARVL  645
             VFCT+SGVDMPGAD+QL KLLGL  SVKRLMMYQQGC AG  +LRLAKDLAENNKGARVL
Sbjct  128   VFCTTSGVDMPGADYQLTKLLGLRPSVKRLMMYQQGCFAGGTVLRLAKDLAENNKGARVL  187

Query  646   VVCSEVMLNVFRGPSLEQEDNLLAQCLFGDGSAAVIVGTEPRPGLETPLFELVSAAQTTI  825
             VVCSE+    FRGPS    D+L+ Q LFGDG+AA+IVG +P PG+E PLFELVSAAQT +
Sbjct  188   VVCSEITAVTFRGPSDTHLDSLVGQALFGDGAAALIVGADPVPGVEKPLFELVSAAQTIL  247

Query  826   PDTDSHLKLHLREMGLTFHCSKAVPSLITQNVEDCLVKAFEPFGISDWNSIFWILHPGGI  1005
             PD+D  +  HLRE+GLTFH  K VP LI++N+E  LV+AF+P GI+DWNS+FWI HPGG 
Sbjct  248   PDSDGAIDGHLREVGLTFHLLKDVPGLISKNIEKSLVEAFQPLGITDWNSLFWIAHPGGP  307

Query  1006  AILDRVEEKLGLEPEKLRASKDVLSEYGNLTSACVLFILDEMRKKSKKDEEMTTGEGLEW  1185
             AILD+VE KL L+PEKLRA++ VLSEYGN++SACVLFILDEMRKKS +D   TTGEGLEW
Sbjct  308   AILDQVESKLELKPEKLRATRHVLSEYGNMSSACVLFILDEMRKKSAEDRLKTTGEGLEW  367

Query  1186  GVVF  1197
             GV+F
Sbjct  368   GVLF  371



>gb|AIV99854.1| chalcone synthase [Iochroma calycinum]
 gb|AIY22758.1| chalcone synthase [Iochroma calycinum]
Length=389

 Score =   543 bits (1400),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 252/368 (68%), Positives = 309/368 (84%), Gaps = 0/368 (0%)
 Frame = +1

Query  106   RRAKRFEGDAKILAIGTAIPANWVDQTTYPDFYFRITNSEHLLEHKEKFRRICNKSKIRK  285
             RRA+R +G A I+AIGTA P+N VDQ+TYPD+YFRITNSEH+ E KEKF+R+C+KS I+K
Sbjct  8     RRAQRAKGPATIMAIGTATPSNCVDQSTYPDYYFRITNSEHMTELKEKFKRMCDKSMIKK  67

Query  286   RHLVITEELLKKNPNLCTYNEASLNTRQDILVSEVPKLGKEAAMKAIKEWGRPISEITHL  465
             R++ +TEE+LK+NPN+C Y   SL+ RQDI+V EVPKLGKEAA KAIKEWG+P S+ITHL
Sbjct  68    RYMHLTEEILKENPNICEYMAPSLDARQDIVVVEVPKLGKEAAQKAIKEWGQPKSKITHL  127

Query  466   VFCTSSGVDMPGADFQLAKLLGLSSSVKRLMMYQQGCNAGAAMLRLAKDLAENNKGARVL  645
             VFCT+SGVDMPGAD+QL KLLGL  SVKRLMMYQQGC AG  ++RLAKDLAENNKGARVL
Sbjct  128   VFCTTSGVDMPGADYQLTKLLGLRPSVKRLMMYQQGCFAGGTVIRLAKDLAENNKGARVL  187

Query  646   VVCSEVMLNVFRGPSLEQEDNLLAQCLFGDGSAAVIVGTEPRPGLETPLFELVSAAQTTI  825
             VVCSE+    FRGPS    D+++ Q LFGDG+AA+I+G++P PG+E PLFELVSAAQT +
Sbjct  188   VVCSEITAVTFRGPSDTHLDSMVGQALFGDGAAAIIIGSDPLPGVERPLFELVSAAQTLL  247

Query  826   PDTDSHLKLHLREMGLTFHCSKAVPSLITQNVEDCLVKAFEPFGISDWNSIFWILHPGGI  1005
             PD++  +  HLRE+GLTFH  K VP LI+QN+E  L++AF+P GISDWNS+FWI HPGG 
Sbjct  248   PDSEGAIDGHLREVGLTFHLLKDVPGLISQNIEKSLIEAFQPLGISDWNSVFWIAHPGGP  307

Query  1006  AILDRVEEKLGLEPEKLRASKDVLSEYGNLTSACVLFILDEMRKKSKKDEEMTTGEGLEW  1185
             AILD+VE KLGL+PEKLRA++ VLS+YGN++SACVLFILDE+RK S K+   TTGEGL+W
Sbjct  308   AILDQVELKLGLKPEKLRATRQVLSDYGNMSSACVLFILDEIRKASAKEGLSTTGEGLDW  367

Query  1186  GVVFVVCP  1209
             GV+F   P
Sbjct  368   GVLFGFGP  375



>gb|AIY22757.1| chalcone synthase [Iochroma cyaneum]
Length=389

 Score =   542 bits (1396),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 251/368 (68%), Positives = 308/368 (84%), Gaps = 0/368 (0%)
 Frame = +1

Query  106   RRAKRFEGDAKILAIGTAIPANWVDQTTYPDFYFRITNSEHLLEHKEKFRRICNKSKIRK  285
             RRA+R +G A I+AIGTA P+N VDQ+TYPD+YFRITNSEH+ E KEKF+R+C+KS I+K
Sbjct  8     RRAQRAKGPATIMAIGTATPSNCVDQSTYPDYYFRITNSEHMTELKEKFKRMCDKSMIKK  67

Query  286   RHLVITEELLKKNPNLCTYNEASLNTRQDILVSEVPKLGKEAAMKAIKEWGRPISEITHL  465
             R++ +TEE+LK+NPN+C Y   SL+ RQDI+V EVPKLGKEAA KAIKEWG+P S+ITHL
Sbjct  68    RYMHLTEEILKENPNICEYMAPSLDARQDIVVVEVPKLGKEAAQKAIKEWGQPKSKITHL  127

Query  466   VFCTSSGVDMPGADFQLAKLLGLSSSVKRLMMYQQGCNAGAAMLRLAKDLAENNKGARVL  645
             VFCT+SGVDMPGAD+QL KLLGL  SVKRLMMYQQGC AG  ++RLAKDLAENNKGARVL
Sbjct  128   VFCTTSGVDMPGADYQLTKLLGLRPSVKRLMMYQQGCFAGGTVIRLAKDLAENNKGARVL  187

Query  646   VVCSEVMLNVFRGPSLEQEDNLLAQCLFGDGSAAVIVGTEPRPGLETPLFELVSAAQTTI  825
             VVCSE+    FRGPS    D+++ Q LFGDG+AA+I+G++P PG+E PLFELVS AQT +
Sbjct  188   VVCSEITAVTFRGPSDTHLDSMVGQALFGDGAAAIIIGSDPLPGVERPLFELVSTAQTLL  247

Query  826   PDTDSHLKLHLREMGLTFHCSKAVPSLITQNVEDCLVKAFEPFGISDWNSIFWILHPGGI  1005
             PD++  +  HLRE+GLTFH  K VP LI++N+E  L++AF+P GISDWNS+FWI HPGG 
Sbjct  248   PDSEGAIDGHLREVGLTFHLLKDVPGLISKNIEKSLIEAFQPLGISDWNSVFWIAHPGGP  307

Query  1006  AILDRVEEKLGLEPEKLRASKDVLSEYGNLTSACVLFILDEMRKKSKKDEEMTTGEGLEW  1185
             AILD+VE KLGL+PEKLRA++ VLS+YGN++SACVLFILDEMRK S K+   TTGEGL+W
Sbjct  308   AILDQVELKLGLKPEKLRATRQVLSDYGNMSSACVLFILDEMRKASAKEGLSTTGEGLDW  367

Query  1186  GVVFVVCP  1209
             GV+F   P
Sbjct  368   GVLFGFGP  375



>gb|ABM63466.1| aromatic polyketide synthase [Hypericum hookerianum]
Length=390

 Score =   541 bits (1394),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 252/368 (68%), Positives = 307/368 (83%), Gaps = 0/368 (0%)
 Frame = +1

Query  106   RRAKRFEGDAKILAIGTAIPANWVDQTTYPDFYFRITNSEHLLEHKEKFRRICNKSKIRK  285
             R+A+R EG A ++AIGTA+P N VDQ TYPD+YFRITNSEH  E KEKF+R+C+KS+I+K
Sbjct  8     RKAQRAEGPATVMAIGTAVPPNCVDQATYPDYYFRITNSEHKAELKEKFQRMCDKSQIKK  67

Query  286   RHLVITEELLKKNPNLCTYNEASLNTRQDILVSEVPKLGKEAAMKAIKEWGRPISEITHL  465
             R++ + EE+LK+NPN+C Y   SL+ RQDI+V EVPKLGKEAA+KAIKEWG+P S+ITHL
Sbjct  68    RYMYLNEEVLKENPNMCAYMAPSLDARQDIVVVEVPKLGKEAAVKAIKEWGQPKSKITHL  127

Query  466   VFCTSSGVDMPGADFQLAKLLGLSSSVKRLMMYQQGCNAGAAMLRLAKDLAENNKGARVL  645
             VFCT+SGVDMPGAD+QL KLLGL  SVKRLMMYQQGC AG  +LRLAKDLAENNKGARVL
Sbjct  128   VFCTTSGVDMPGADYQLTKLLGLRPSVKRLMMYQQGCFAGGTVLRLAKDLAENNKGARVL  187

Query  646   VVCSEVMLNVFRGPSLEQEDNLLAQCLFGDGSAAVIVGTEPRPGLETPLFELVSAAQTTI  825
             VVCSE+    FRGP+    D+L+ Q LFGDG+AA+I+G++P P +E PLFELVSAAQT +
Sbjct  188   VVCSEITAVTFRGPTDTHLDSLVGQALFGDGAAAIIIGSDPIPEVEKPLFELVSAAQTIL  247

Query  826   PDTDSHLKLHLREMGLTFHCSKAVPSLITQNVEDCLVKAFEPFGISDWNSIFWILHPGGI  1005
             PD++  +  HLRE+GLTFH  K VP LI++NVE  L +AF+P GISDWNS+FWI HPGG 
Sbjct  248   PDSEGAIDGHLREVGLTFHLLKDVPGLISKNVEKSLTEAFKPLGISDWNSLFWIAHPGGP  307

Query  1006  AILDRVEEKLGLEPEKLRASKDVLSEYGNLTSACVLFILDEMRKKSKKDEEMTTGEGLEW  1185
             AILD+VE KL L+PEKLRA++ VLSEYGN++SACVLFILDEMR+KSK+D   TTGEG+EW
Sbjct  308   AILDQVEAKLSLKPEKLRATRHVLSEYGNMSSACVLFILDEMRRKSKQDGLKTTGEGIEW  367

Query  1186  GVVFVVCP  1209
             GV+F   P
Sbjct  368   GVLFGFGP  375



>gb|AEK80412.1| type III polyketide synthase [Acer maximowiczianum]
Length=390

 Score =   541 bits (1394),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 252/368 (68%), Positives = 306/368 (83%), Gaps = 0/368 (0%)
 Frame = +1

Query  106   RRAKRFEGDAKILAIGTAIPANWVDQTTYPDFYFRITNSEHLLEHKEKFRRICNKSKIRK  285
             R+A+R +G A ILAIGTA P N VDQ+ YPD+YFRITNSEH  E KEKF+R+C+KS I+K
Sbjct  8     RKAQRAQGPATILAIGTATPPNCVDQSEYPDYYFRITNSEHKTELKEKFKRMCDKSMIKK  67

Query  286   RHLVITEELLKKNPNLCTYNEASLNTRQDILVSEVPKLGKEAAMKAIKEWGRPISEITHL  465
             R++ +TEE+LK+NPN+C Y   SL+ RQD++V E+PKLGKEAA KAIKEWG+P S+ITHL
Sbjct  68    RYMYLTEEILKENPNVCAYEAPSLDARQDMVVVEIPKLGKEAATKAIKEWGQPKSKITHL  127

Query  466   VFCTSSGVDMPGADFQLAKLLGLSSSVKRLMMYQQGCNAGAAMLRLAKDLAENNKGARVL  645
             VFCT+SGVDMPGAD+QL KLLGL  SVKRLMMYQQGC AG  +LRLAKDLAENN GARVL
Sbjct  128   VFCTTSGVDMPGADYQLTKLLGLRPSVKRLMMYQQGCFAGGTVLRLAKDLAENNIGARVL  187

Query  646   VVCSEVMLNVFRGPSLEQEDNLLAQCLFGDGSAAVIVGTEPRPGLETPLFELVSAAQTTI  825
             VVCSE+    FRGPS    D+L+ Q LFGDG+AA+I+G++P PG+E P++ELVSAAQT +
Sbjct  188   VVCSEITAVTFRGPSDTHLDSLVGQALFGDGAAAIIIGSDPLPGIEKPMYELVSAAQTIL  247

Query  826   PDTDSHLKLHLREMGLTFHCSKAVPSLITQNVEDCLVKAFEPFGISDWNSIFWILHPGGI  1005
             PD+D  +  HLRE+GLTFH  K VP LI++N+E  LV+AF+P GISDWNSIFWI HPGG 
Sbjct  248   PDSDGAIDGHLREVGLTFHLLKDVPGLISKNIEKSLVEAFKPLGISDWNSIFWIAHPGGP  307

Query  1006  AILDRVEEKLGLEPEKLRASKDVLSEYGNLTSACVLFILDEMRKKSKKDEEMTTGEGLEW  1185
             AILD+VE KLGL+PEK+RA++ VLSE+GN++SACVLFILDEMRKKS +D   TTGEGLEW
Sbjct  308   AILDQVEAKLGLKPEKMRATRHVLSEFGNMSSACVLFILDEMRKKSAEDGLKTTGEGLEW  367

Query  1186  GVVFVVCP  1209
             GV+F   P
Sbjct  368   GVLFGFGP  375



>gb|ABS52573.1| chalcone synthase [Gossypium hirsutum]
 gb|AEO96990.1| chalcone synthase [Gossypium hirsutum]
 gb|KHF97262.1| Chalcone synthase 1 [Gossypium arboreum]
 gb|KHG14487.1| Chalcone synthase 1 [Gossypium arboreum]
 gb|KHG14899.1| Chalcone synthase 1 [Gossypium arboreum]
Length=389

 Score =   541 bits (1393),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 253/368 (69%), Positives = 305/368 (83%), Gaps = 0/368 (0%)
 Frame = +1

Query  106   RRAKRFEGDAKILAIGTAIPANWVDQTTYPDFYFRITNSEHLLEHKEKFRRICNKSKIRK  285
             R+A+R +G A +LAIGT+ P N VDQ+TYPD+YFRITNSEH  E KEKF+R+C KS I+K
Sbjct  8     RKAQRAQGPATVLAIGTSTPPNCVDQSTYPDYYFRITNSEHKTELKEKFKRMCEKSMIKK  67

Query  286   RHLVITEELLKKNPNLCTYNEASLNTRQDILVSEVPKLGKEAAMKAIKEWGRPISEITHL  465
             R++ +TEE+LK+NPN+C Y   SL+ RQD++V EVPKLGKEAA KAIKEWG+P S+ITHL
Sbjct  68    RYMYLTEEILKENPNVCEYMAPSLDARQDMVVVEVPKLGKEAATKAIKEWGQPKSKITHL  127

Query  466   VFCTSSGVDMPGADFQLAKLLGLSSSVKRLMMYQQGCNAGAAMLRLAKDLAENNKGARVL  645
             VFCT+SGVDMPGAD+QL KLLGL  SVKRLMMYQQGC AG  +LR+AKDLAENNKGARVL
Sbjct  128   VFCTTSGVDMPGADYQLTKLLGLRPSVKRLMMYQQGCFAGGTVLRVAKDLAENNKGARVL  187

Query  646   VVCSEVMLNVFRGPSLEQEDNLLAQCLFGDGSAAVIVGTEPRPGLETPLFELVSAAQTTI  825
             VVCSE+    FRGPS    D+L+ Q LFGDG+AAVI+G +P P +E P+FELVSAAQT +
Sbjct  188   VVCSEITAVTFRGPSDTHLDSLVGQALFGDGAAAVIIGADPVPEIEKPMFELVSAAQTIL  247

Query  826   PDTDSHLKLHLREMGLTFHCSKAVPSLITQNVEDCLVKAFEPFGISDWNSIFWILHPGGI  1005
             PD+D  +  HLRE+GLTFH  K VP LI++N+E  LV+AF+P GISDWNS+FWI HPGG 
Sbjct  248   PDSDGAIDGHLREVGLTFHLLKDVPGLISKNIEKSLVEAFQPLGISDWNSLFWIAHPGGP  307

Query  1006  AILDRVEEKLGLEPEKLRASKDVLSEYGNLTSACVLFILDEMRKKSKKDEEMTTGEGLEW  1185
             AILD+VE KL L+PEKLRA++ VLSEYGN++SACVLFILDEMRKKS++D   TTGEGLEW
Sbjct  308   AILDQVEAKLALKPEKLRATRHVLSEYGNMSSACVLFILDEMRKKSREDGLQTTGEGLEW  367

Query  1186  GVVFVVCP  1209
             GV+F   P
Sbjct  368   GVLFGFGP  375



>gb|KDP20327.1| hypothetical protein JCGZ_06413 [Jatropha curcas]
 gb|AIC83903.1| chalcone synthase [Jatropha curcas]
Length=389

 Score =   541 bits (1393),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 254/368 (69%), Positives = 309/368 (84%), Gaps = 0/368 (0%)
 Frame = +1

Query  106   RRAKRFEGDAKILAIGTAIPANWVDQTTYPDFYFRITNSEHLLEHKEKFRRICNKSKIRK  285
             R+A+R +G A +LAIGTA P+N VDQ+TYPD+YFRITNSEH +E KEKF+R+C+KS I+K
Sbjct  8     RKAQRAQGPATVLAIGTATPSNCVDQSTYPDYYFRITNSEHKVELKEKFKRMCDKSMIKK  67

Query  286   RHLVITEELLKKNPNLCTYNEASLNTRQDILVSEVPKLGKEAAMKAIKEWGRPISEITHL  465
             R++ +TE++LK+NPN+C Y   SL+ RQDI+V E+PKLGKEAA+KAIKEWG+P S+ITHL
Sbjct  68    RYMHLTEDILKENPNICEYMAPSLDARQDIVVVEIPKLGKEAAVKAIKEWGQPKSKITHL  127

Query  466   VFCTSSGVDMPGADFQLAKLLGLSSSVKRLMMYQQGCNAGAAMLRLAKDLAENNKGARVL  645
             VFCT+SGVDMPGAD+QL KLLGL  SVKRLMMYQQGC AG  +LRLAKDLAENNKGARVL
Sbjct  128   VFCTTSGVDMPGADYQLTKLLGLRPSVKRLMMYQQGCFAGGTVLRLAKDLAENNKGARVL  187

Query  646   VVCSEVMLNVFRGPSLEQEDNLLAQCLFGDGSAAVIVGTEPRPGLETPLFELVSAAQTTI  825
             VVCSE+    FRGPS    D+L+ Q LFGDG+AAVIVG++P P LE PLFELVSAAQT +
Sbjct  188   VVCSEITAVTFRGPSDTHLDSLVGQALFGDGAAAVIVGSDPVPELEKPLFELVSAAQTIL  247

Query  826   PDTDSHLKLHLREMGLTFHCSKAVPSLITQNVEDCLVKAFEPFGISDWNSIFWILHPGGI  1005
             PD+D  +  HLRE+GLTFH  K VP LI++N+E  LV+AF+P GISDWNS+FWI HPGG 
Sbjct  248   PDSDGAIDGHLREVGLTFHLLKDVPGLISKNIEKSLVEAFKPLGISDWNSLFWIAHPGGP  307

Query  1006  AILDRVEEKLGLEPEKLRASKDVLSEYGNLTSACVLFILDEMRKKSKKDEEMTTGEGLEW  1185
             AILD+VE KLGL+PEKL +++ +LSEYGN++SACVLFILDE+RKKS K+   TTGEGLEW
Sbjct  308   AILDQVEAKLGLKPEKLASTRHILSEYGNMSSACVLFILDEVRKKSAKEGLKTTGEGLEW  367

Query  1186  GVVFVVCP  1209
             GV+F   P
Sbjct  368   GVLFGFGP  375



>gb|ADD74168.1| chalcone synthase [Nelumbo nucifera]
Length=389

 Score =   541 bits (1393),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 256/367 (70%), Positives = 304/367 (83%), Gaps = 0/367 (0%)
 Frame = +1

Query  109   RAKRFEGDAKILAIGTAIPANWVDQTTYPDFYFRITNSEHLLEHKEKFRRICNKSKIRKR  288
             +A+R EG A ++AIGTA P N VDQ+TYPD+YFRITNSEH  E KEKF+R+C KS I+KR
Sbjct  9     KAQRAEGPATVMAIGTATPPNCVDQSTYPDYYFRITNSEHKTELKEKFKRMCEKSMIKKR  68

Query  289   HLVITEELLKKNPNLCTYNEASLNTRQDILVSEVPKLGKEAAMKAIKEWGRPISEITHLV  468
             ++ +TEE+LK+NPN+C Y   SL+ RQD++V EVPKLGKEAA KAIKEWG+P S+ITHLV
Sbjct  69    YMHLTEEILKENPNVCAYMAPSLDARQDMVVVEVPKLGKEAATKAIKEWGQPKSKITHLV  128

Query  469   FCTSSGVDMPGADFQLAKLLGLSSSVKRLMMYQQGCNAGAAMLRLAKDLAENNKGARVLV  648
             FCT+SGVDMPGAD+QL KLLGL  SVKRLMMYQQGC AG  +LRLAKDLAENN+GARVLV
Sbjct  129   FCTTSGVDMPGADYQLTKLLGLRPSVKRLMMYQQGCFAGGTVLRLAKDLAENNRGARVLV  188

Query  649   VCSEVMLNVFRGPSLEQEDNLLAQCLFGDGSAAVIVGTEPRPGLETPLFELVSAAQTTIP  828
             VCSE+    FRGPS    D+L+ Q LFGDG+AAVIVG +P PG+E PLFELVSAAQT +P
Sbjct  189   VCSELTAVTFRGPSDTHLDSLVGQALFGDGAAAVIVGADPVPGVEKPLFELVSAAQTILP  248

Query  829   DTDSHLKLHLREMGLTFHCSKAVPSLITQNVEDCLVKAFEPFGISDWNSIFWILHPGGIA  1008
             D+   +  HLRE+GLTFH  K VP LI++N+E  LV+AF+P GISDWNSIFWI HPGG A
Sbjct  249   DSHGAIDGHLREVGLTFHLLKDVPGLISKNIEKSLVEAFQPLGISDWNSIFWIAHPGGPA  308

Query  1009  ILDRVEEKLGLEPEKLRASKDVLSEYGNLTSACVLFILDEMRKKSKKDEEMTTGEGLEWG  1188
             ILD+VEEKL L+PEKLRA++ +LSEYGN++SACVLFILDEMRKKS +D   TTGEGLEWG
Sbjct  309   ILDQVEEKLALKPEKLRATRHILSEYGNMSSACVLFILDEMRKKSIEDGLKTTGEGLEWG  368

Query  1189  VVFVVCP  1209
             V+F   P
Sbjct  369   VLFGFGP  375



>ref|XP_009616637.1| PREDICTED: chalcone synthase 2 [Nicotiana tomentosiformis]
Length=389

 Score =   541 bits (1393),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 251/368 (68%), Positives = 308/368 (84%), Gaps = 0/368 (0%)
 Frame = +1

Query  106   RRAKRFEGDAKILAIGTAIPANWVDQTTYPDFYFRITNSEHLLEHKEKFRRICNKSKIRK  285
             RRA+R +G A I+AIGTA P+N VDQ+TYPD+YFR+TNSEH+ E KEKF+R+C+KS I+K
Sbjct  8     RRAQRAKGPATIMAIGTATPSNCVDQSTYPDYYFRVTNSEHMTELKEKFKRMCDKSMIKK  67

Query  286   RHLVITEELLKKNPNLCTYNEASLNTRQDILVSEVPKLGKEAAMKAIKEWGRPISEITHL  465
             R++ +TEE+LK+NPN+C Y   SL+ RQDI+V E+PKLGKEAA KAIKEWG+P S+ITHL
Sbjct  68    RYMHLTEEILKENPNICEYMAPSLDARQDIVVVEIPKLGKEAAQKAIKEWGQPKSKITHL  127

Query  466   VFCTSSGVDMPGADFQLAKLLGLSSSVKRLMMYQQGCNAGAAMLRLAKDLAENNKGARVL  645
             VFCT+SGVDMPGAD+QL KLLGL  SVKRLMMYQQGC AG  +LRLAKDLAENNKGARVL
Sbjct  128   VFCTTSGVDMPGADYQLTKLLGLRPSVKRLMMYQQGCFAGGTVLRLAKDLAENNKGARVL  187

Query  646   VVCSEVMLNVFRGPSLEQEDNLLAQCLFGDGSAAVIVGTEPRPGLETPLFELVSAAQTTI  825
             VVCSE+    FRGPS    D+++ Q LFGDG+AA+I+G++P PG+E PLFELVSAAQT +
Sbjct  188   VVCSEITAVTFRGPSDTHLDSMVGQALFGDGAAAIIIGSDPVPGVERPLFELVSAAQTLL  247

Query  826   PDTDSHLKLHLREMGLTFHCSKAVPSLITQNVEDCLVKAFEPFGISDWNSIFWILHPGGI  1005
             PD+D  +  HLRE+GLTFH  K VP LI++N+E  L++AF+P G+SDWNSIFWI HPGG 
Sbjct  248   PDSDGAIDGHLREVGLTFHLLKDVPGLISKNIEKSLMEAFQPLGLSDWNSIFWIAHPGGP  307

Query  1006  AILDRVEEKLGLEPEKLRASKDVLSEYGNLTSACVLFILDEMRKKSKKDEEMTTGEGLEW  1185
             AILD+VE  LGL+PEKLRA++ VLS+YGN++SACVLFILDEMRK S K+   TTGEGL+W
Sbjct  308   AILDQVELTLGLKPEKLRATRQVLSDYGNMSSACVLFILDEMRKTSAKEGFGTTGEGLDW  367

Query  1186  GVVFVVCP  1209
             GV+F   P
Sbjct  368   GVLFGFGP  375



>gb|AFU52909.1| chalcone synthase [Hypericum sampsonii]
Length=390

 Score =   540 bits (1392),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 252/368 (68%), Positives = 307/368 (83%), Gaps = 0/368 (0%)
 Frame = +1

Query  106   RRAKRFEGDAKILAIGTAIPANWVDQTTYPDFYFRITNSEHLLEHKEKFRRICNKSKIRK  285
             R+A+R EG A ++AIGTA+P N VDQ TYPD+YFRITNSEH  E KEKF+R+C+KS+I+K
Sbjct  8     RKAQRAEGPATVMAIGTAVPPNCVDQATYPDYYFRITNSEHKAELKEKFQRMCDKSQIKK  67

Query  286   RHLVITEELLKKNPNLCTYNEASLNTRQDILVSEVPKLGKEAAMKAIKEWGRPISEITHL  465
             R++ + EE+LK+NPN+C Y   SL+ RQDI+V EVPKLGKEAA+KAIKEWG+P S+ITHL
Sbjct  68    RYMYLNEEVLKENPNMCAYMAPSLDARQDIVVVEVPKLGKEAAVKAIKEWGQPKSKITHL  127

Query  466   VFCTSSGVDMPGADFQLAKLLGLSSSVKRLMMYQQGCNAGAAMLRLAKDLAENNKGARVL  645
             VFCT+SGVDMPGAD+QL KLLGL  SVKRLMMYQQGC AG  +LRLAKDLAENNKGARVL
Sbjct  128   VFCTTSGVDMPGADYQLTKLLGLRPSVKRLMMYQQGCFAGGTVLRLAKDLAENNKGARVL  187

Query  646   VVCSEVMLNVFRGPSLEQEDNLLAQCLFGDGSAAVIVGTEPRPGLETPLFELVSAAQTTI  825
             VVCSE+    FRGP+    D+L+ Q LFGDG+AA+I+G++P P +E PLFELVSAAQT +
Sbjct  188   VVCSEITAVTFRGPTDTHLDSLVGQALFGDGAAAIIIGSDPIPEVEKPLFELVSAAQTIL  247

Query  826   PDTDSHLKLHLREMGLTFHCSKAVPSLITQNVEDCLVKAFEPFGISDWNSIFWILHPGGI  1005
             PD++  +  HLRE+GLTFH  K VP LI++NVE  L +AF+P GISDWNS+FWI HPGG 
Sbjct  248   PDSEGAIDGHLREVGLTFHLLKDVPGLISKNVEKSLTEAFKPLGISDWNSLFWIAHPGGP  307

Query  1006  AILDRVEEKLGLEPEKLRASKDVLSEYGNLTSACVLFILDEMRKKSKKDEEMTTGEGLEW  1185
             AILD+VE KL L+PEKLRA++ VLSEYGN++SACVLFILDEMR+KSK+D   TTGEG+EW
Sbjct  308   AILDQVEAKLSLKPEKLRATRHVLSEYGNMSSACVLFILDEMRRKSKEDGLKTTGEGIEW  367

Query  1186  GVVFVVCP  1209
             GV+F   P
Sbjct  368   GVLFGFGP  375



>sp|Q9FUB7.1|CHSY_HYPAN RecName: Full=Chalcone synthase; AltName: Full=Naringenin-chalcone 
synthase [Hypericum androsaemum]
 gb|AAG30295.1|AF315345_1 chalcone synthase [Hypericum androsaemum]
Length=390

 Score =   540 bits (1392),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 252/368 (68%), Positives = 307/368 (83%), Gaps = 0/368 (0%)
 Frame = +1

Query  106   RRAKRFEGDAKILAIGTAIPANWVDQTTYPDFYFRITNSEHLLEHKEKFRRICNKSKIRK  285
             R+A+R EG A ++AIGTA+P N VDQ TYPD+YFRITNSEH  E KEKF+R+C+KS+I+K
Sbjct  8     RKAQRAEGPATVMAIGTAVPPNCVDQATYPDYYFRITNSEHKAELKEKFQRMCDKSQIKK  67

Query  286   RHLVITEELLKKNPNLCTYNEASLNTRQDILVSEVPKLGKEAAMKAIKEWGRPISEITHL  465
             R++ + EE+LK+NPN+C Y   SL+ RQDI+V EVPKLGKEAA+KAIKEWG+P S+ITHL
Sbjct  68    RYMYLNEEVLKENPNMCAYMAPSLDARQDIVVVEVPKLGKEAAVKAIKEWGQPKSKITHL  127

Query  466   VFCTSSGVDMPGADFQLAKLLGLSSSVKRLMMYQQGCNAGAAMLRLAKDLAENNKGARVL  645
             VFCT+SGVDMPGAD+QL KLLGL  SVKRLMMYQQGC AG  +LRLAKDLAENNKGARVL
Sbjct  128   VFCTTSGVDMPGADYQLTKLLGLRPSVKRLMMYQQGCFAGGTVLRLAKDLAENNKGARVL  187

Query  646   VVCSEVMLNVFRGPSLEQEDNLLAQCLFGDGSAAVIVGTEPRPGLETPLFELVSAAQTTI  825
             VVCSE+    FRGP+    D+L+ Q LFGDG+AA+I+G++P P +E PLFELVSAAQT +
Sbjct  188   VVCSEITAVTFRGPTDTHLDSLVGQALFGDGAAAIIIGSDPIPEVEKPLFELVSAAQTIL  247

Query  826   PDTDSHLKLHLREMGLTFHCSKAVPSLITQNVEDCLVKAFEPFGISDWNSIFWILHPGGI  1005
             PD++  +  HLRE+GLTFH  K VP LI++NVE  L +AF+P GISDWNS+FWI HPGG 
Sbjct  248   PDSEGAIDGHLREVGLTFHLLKDVPGLISKNVEKSLTEAFKPLGISDWNSLFWIAHPGGP  307

Query  1006  AILDRVEEKLGLEPEKLRASKDVLSEYGNLTSACVLFILDEMRKKSKKDEEMTTGEGLEW  1185
             AILD+VE KL L+PEKLRA++ VLSEYGN++SACVLFILDEMR+KSK+D   TTGEG+EW
Sbjct  308   AILDQVEAKLSLKPEKLRATRHVLSEYGNMSSACVLFILDEMRRKSKEDGLKTTGEGIEW  367

Query  1186  GVVFVVCP  1209
             GV+F   P
Sbjct  368   GVLFGFGP  375



>ref|XP_006489796.1| PREDICTED: chalcone synthase 1-like [Citrus sinensis]
Length=390

 Score =   540 bits (1391),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 251/368 (68%), Positives = 305/368 (83%), Gaps = 0/368 (0%)
 Frame = +1

Query  106   RRAKRFEGDAKILAIGTAIPANWVDQTTYPDFYFRITNSEHLLEHKEKFRRICNKSKIRK  285
             R+A+R EG A I+AIGTA P N VDQ+TYPD+YFRITNSEH+ + KEKF+R+C+KS I+K
Sbjct  8     RKAQRAEGPATIMAIGTATPPNCVDQSTYPDYYFRITNSEHMTDLKEKFKRMCDKSMIKK  67

Query  286   RHLVITEELLKKNPNLCTYNEASLNTRQDILVSEVPKLGKEAAMKAIKEWGRPISEITHL  465
             R++ +TEE+LK+NPN+C Y   SL+TRQD++V EVP+LGKEAA KAIKEWG+P S+ITHL
Sbjct  68    RYMYLTEEILKENPNVCAYMAPSLDTRQDMVVVEVPRLGKEAATKAIKEWGQPKSKITHL  127

Query  466   VFCTSSGVDMPGADFQLAKLLGLSSSVKRLMMYQQGCNAGAAMLRLAKDLAENNKGARVL  645
             VFCT+SGVDMPGAD++L KLLGL  SVKRLMMYQQGC AG  +LRLAKDLAENNKGARVL
Sbjct  128   VFCTTSGVDMPGADYRLTKLLGLRPSVKRLMMYQQGCFAGGTVLRLAKDLAENNKGARVL  187

Query  646   VVCSEVMLNVFRGPSLEQEDNLLAQCLFGDGSAAVIVGTEPRPGLETPLFELVSAAQTTI  825
             VVCSE+    FRGPS    D+L+ Q LFGDG+AA+I+G +P P +E P+FELVS AQT +
Sbjct  188   VVCSEITAVTFRGPSDTHLDSLVGQALFGDGAAAIIIGADPIPEIEKPMFELVSTAQTIL  247

Query  826   PDTDSHLKLHLREMGLTFHCSKAVPSLITQNVEDCLVKAFEPFGISDWNSIFWILHPGGI  1005
             PD+D  +  HLRE+GLTFH  K VP LI++N++  L +AF+P GISDWNSIFWI HPGG 
Sbjct  248   PDSDGSIDGHLREVGLTFHLLKDVPGLISKNIQKSLTEAFKPLGISDWNSIFWIAHPGGP  307

Query  1006  AILDRVEEKLGLEPEKLRASKDVLSEYGNLTSACVLFILDEMRKKSKKDEEMTTGEGLEW  1185
              ILD+VEEKLGL+PEKLRA++ VLSEYGN++SACVLFILDEMRKKS +D   T GEGLEW
Sbjct  308   TILDQVEEKLGLKPEKLRATRHVLSEYGNMSSACVLFILDEMRKKSAEDGLETAGEGLEW  367

Query  1186  GVVFVVCP  1209
             GV+F   P
Sbjct  368   GVLFGFGP  375



>ref|XP_010264056.1| PREDICTED: chalcone synthase 1 [Nelumbo nucifera]
 gb|ADD74169.1| chalcone synthase [Nelumbo nucifera]
 gb|ADD74170.1| chalcone synthase [Nelumbo nucifera]
 gb|ADD74171.1| chalcone synthase [Nelumbo nucifera]
 gb|ADD74172.1| chalcone synthase [Nelumbo nucifera]
Length=389

 Score =   540 bits (1391),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 256/368 (70%), Positives = 305/368 (83%), Gaps = 0/368 (0%)
 Frame = +1

Query  106   RRAKRFEGDAKILAIGTAIPANWVDQTTYPDFYFRITNSEHLLEHKEKFRRICNKSKIRK  285
             R+A+R EG A ++AIGTA P N VDQ+TYPD+YFRITNSEH  E KEKF+R+C KS I+K
Sbjct  8     RKAQRAEGPATVMAIGTANPPNCVDQSTYPDYYFRITNSEHKTELKEKFKRMCEKSMIKK  67

Query  286   RHLVITEELLKKNPNLCTYNEASLNTRQDILVSEVPKLGKEAAMKAIKEWGRPISEITHL  465
             R++ +TEE+LK+NPN+C Y  +SL+ RQD++V EVPKLGKEAA KAIKEWG+P S+ITHL
Sbjct  68    RYMHLTEEILKENPNICEYMASSLDARQDMVVVEVPKLGKEAATKAIKEWGQPKSKITHL  127

Query  466   VFCTSSGVDMPGADFQLAKLLGLSSSVKRLMMYQQGCNAGAAMLRLAKDLAENNKGARVL  645
             VFCT+SGVDMPGAD+QL KLLGL  SVKRLMMYQQGC AG  +LRLAKDLAENN+GARVL
Sbjct  128   VFCTTSGVDMPGADYQLTKLLGLRPSVKRLMMYQQGCFAGGTVLRLAKDLAENNRGARVL  187

Query  646   VVCSEVMLNVFRGPSLEQEDNLLAQCLFGDGSAAVIVGTEPRPGLETPLFELVSAAQTTI  825
             VVCSE+    FRGPS    D+L+ Q LFGDG+AAVIVG +P PG+E PLFELVSAAQT +
Sbjct  188   VVCSELTAVTFRGPSDTHLDSLVGQALFGDGAAAVIVGADPVPGVEKPLFELVSAAQTIL  247

Query  826   PDTDSHLKLHLREMGLTFHCSKAVPSLITQNVEDCLVKAFEPFGISDWNSIFWILHPGGI  1005
             PD+   +  HLRE+GLTFH  K VP LI++N+E  LV+AF+P GISDWNSIFWI HPGG 
Sbjct  248   PDSHGAIDGHLREVGLTFHLLKDVPGLISKNIEKSLVEAFQPLGISDWNSIFWIAHPGGP  307

Query  1006  AILDRVEEKLGLEPEKLRASKDVLSEYGNLTSACVLFILDEMRKKSKKDEEMTTGEGLEW  1185
             AILD+VEEKL L+PEKL A++ +LSEYGN++SACVLFILDEMRKKS +D   TTGEGLEW
Sbjct  308   AILDQVEEKLALKPEKLSATRHILSEYGNMSSACVLFILDEMRKKSIEDGLKTTGEGLEW  367

Query  1186  GVVFVVCP  1209
             GV+F   P
Sbjct  368   GVLFGFGP  375



>gb|AAL67805.1|AF461105_1 chalcone synthase [Hypericum perforatum]
Length=389

 Score =   540 bits (1390),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 250/368 (68%), Positives = 308/368 (84%), Gaps = 0/368 (0%)
 Frame = +1

Query  106   RRAKRFEGDAKILAIGTAIPANWVDQTTYPDFYFRITNSEHLLEHKEKFRRICNKSKIRK  285
             R+A+R EG A ++AIGTA+P N VDQ TYPD+YFRITNSEH  E KEKF+R+C+KS+I+K
Sbjct  8     RKAQRAEGPATVMAIGTAVPPNCVDQATYPDYYFRITNSEHKAELKEKFQRMCDKSQIKK  67

Query  286   RHLVITEELLKKNPNLCTYNEASLNTRQDILVSEVPKLGKEAAMKAIKEWGRPISEITHL  465
             R++ + EE+LK+NPN+C Y   SL+ RQDI+V EVPKLGKEAA+KAIKEWG+P S+ITHL
Sbjct  68    RYMYLNEEILKENPNMCAYMAPSLDARQDIVVVEVPKLGKEAAVKAIKEWGQPKSKITHL  127

Query  466   VFCTSSGVDMPGADFQLAKLLGLSSSVKRLMMYQQGCNAGAAMLRLAKDLAENNKGARVL  645
             VFCT+SGVDMPGAD+QL KLLGL  SVKRLMMYQQGC AG  +LRLAKDLAENNKGARVL
Sbjct  128   VFCTTSGVDMPGADYQLTKLLGLRPSVKRLMMYQQGCFAGGTVLRLAKDLAENNKGARVL  187

Query  646   VVCSEVMLNVFRGPSLEQEDNLLAQCLFGDGSAAVIVGTEPRPGLETPLFELVSAAQTTI  825
             VVCSE+    FRGP+    D+L+ Q LFGDG+A++I+G++P P +E PLFELVSA+QT +
Sbjct  188   VVCSEITAVTFRGPTDTHLDSLVGQALFGDGAASIIIGSDPIPEVEKPLFELVSASQTIL  247

Query  826   PDTDSHLKLHLREMGLTFHCSKAVPSLITQNVEDCLVKAFEPFGISDWNSIFWILHPGGI  1005
             PD++  +  H+RE+GLTFH  K VP LI++NVE  L +AF+P GISDWNS+FWI HPGG 
Sbjct  248   PDSEGAIDGHIREVGLTFHLLKDVPGLISKNVEKSLTEAFKPLGISDWNSLFWIAHPGGP  307

Query  1006  AILDRVEEKLGLEPEKLRASKDVLSEYGNLTSACVLFILDEMRKKSKKDEEMTTGEGLEW  1185
             AILD+VEEKL L+PEKLRA++ VLSEYGN++SACVLFILDEMR+KSK+D   TTGEG+EW
Sbjct  308   AILDQVEEKLSLKPEKLRATRHVLSEYGNMSSACVLFILDEMRRKSKEDGLKTTGEGIEW  367

Query  1186  GVVFVVCP  1209
             GV+F   P
Sbjct  368   GVLFGFGP  375



>gb|KHG25969.1| Chalcone synthase 1 [Gossypium arboreum]
Length=389

 Score =   540 bits (1390),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 254/368 (69%), Positives = 304/368 (83%), Gaps = 0/368 (0%)
 Frame = +1

Query  106   RRAKRFEGDAKILAIGTAIPANWVDQTTYPDFYFRITNSEHLLEHKEKFRRICNKSKIRK  285
             R+A+R EG A +LAIGT+ P N VDQ+TYPD+YFRITNSEH  E KEKF+R+C KS I+K
Sbjct  8     RKAQRAEGPATVLAIGTSTPPNCVDQSTYPDYYFRITNSEHKTELKEKFKRMCEKSMIKK  67

Query  286   RHLVITEELLKKNPNLCTYNEASLNTRQDILVSEVPKLGKEAAMKAIKEWGRPISEITHL  465
             R++ +TEE+LK+NPN+C Y   SL+ RQD++V EVPKLGKEAA KAIKEWG+P S+ITHL
Sbjct  68    RYMYLTEEILKENPNVCEYMAPSLDARQDMVVVEVPKLGKEAATKAIKEWGQPKSKITHL  127

Query  466   VFCTSSGVDMPGADFQLAKLLGLSSSVKRLMMYQQGCNAGAAMLRLAKDLAENNKGARVL  645
             VFCT+SGVDMPGAD+QL KLLGL  SVKRLMMYQQGC AG  +LR+AKDLAENNKGARVL
Sbjct  128   VFCTTSGVDMPGADYQLTKLLGLRPSVKRLMMYQQGCFAGGTVLRVAKDLAENNKGARVL  187

Query  646   VVCSEVMLNVFRGPSLEQEDNLLAQCLFGDGSAAVIVGTEPRPGLETPLFELVSAAQTTI  825
             VVCSE+    FRGP+    D+L+ Q LFGDG+AAVIVG +P P +E P+FELVSAAQT +
Sbjct  188   VVCSEITAVTFRGPNDTHLDSLVGQALFGDGAAAVIVGADPLPEIEKPMFELVSAAQTIL  247

Query  826   PDTDSHLKLHLREMGLTFHCSKAVPSLITQNVEDCLVKAFEPFGISDWNSIFWILHPGGI  1005
             PD+D  +  HLRE+GLTFH  K VP LI++N+E  L +AF+P GISDWNS+FWI HPGG 
Sbjct  248   PDSDGAIDGHLREVGLTFHLLKDVPGLISKNIEKSLAEAFQPLGISDWNSLFWIAHPGGP  307

Query  1006  AILDRVEEKLGLEPEKLRASKDVLSEYGNLTSACVLFILDEMRKKSKKDEEMTTGEGLEW  1185
             AILD+VE KL L+PEKLRA++ VLSEYGN++SACVLFILDEMRKKSK+D   TTGEGLEW
Sbjct  308   AILDQVEAKLALKPEKLRATRHVLSEYGNMSSACVLFILDEMRKKSKEDGLGTTGEGLEW  367

Query  1186  GVVFVVCP  1209
             GV+F   P
Sbjct  368   GVLFGFGP  375



>ref|XP_002264019.1| PREDICTED: chalcone synthase 2 [Vitis vinifera]
 dbj|BAB84111.1| chalcone synthase [Vitis vinifera]
 emb|CAN75038.1| hypothetical protein VITISV_030544 [Vitis vinifera]
Length=389

 Score =   540 bits (1390),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 254/368 (69%), Positives = 305/368 (83%), Gaps = 0/368 (0%)
 Frame = +1

Query  106   RRAKRFEGDAKILAIGTAIPANWVDQTTYPDFYFRITNSEHLLEHKEKFRRICNKSKIRK  285
             R A+R EG A ++AIGTA P N VDQ+TYPD+YFRITNSEH  E KEKF+R+C+KS I+K
Sbjct  8     RNAQRAEGPATVMAIGTATPPNCVDQSTYPDYYFRITNSEHKTELKEKFKRMCDKSMIKK  67

Query  286   RHLVITEELLKKNPNLCTYNEASLNTRQDILVSEVPKLGKEAAMKAIKEWGRPISEITHL  465
             R++ +TEE+LK+NPN+C Y  ASL+ RQD++V EVPKLGKEAA KAIKEWG+P S+ITHL
Sbjct  68    RYMHLTEEILKENPNVCEYMAASLDARQDMVVVEVPKLGKEAAAKAIKEWGQPKSKITHL  127

Query  466   VFCTSSGVDMPGADFQLAKLLGLSSSVKRLMMYQQGCNAGAAMLRLAKDLAENNKGARVL  645
             VFCT+SGVDMPGAD+QL KLLGL  SVKR MMYQQGC AG  +LRLAKDLAENNKGARVL
Sbjct  128   VFCTTSGVDMPGADYQLTKLLGLRPSVKRFMMYQQGCFAGGTVLRLAKDLAENNKGARVL  187

Query  646   VVCSEVMLNVFRGPSLEQEDNLLAQCLFGDGSAAVIVGTEPRPGLETPLFELVSAAQTTI  825
             VVCSE+    FRGPS    D+L+ Q LFGDG+AAVIVG++P PG+E P+FELVSAAQT +
Sbjct  188   VVCSEITAVTFRGPSDTHLDSLVGQALFGDGAAAVIVGSDPIPGVEKPMFELVSAAQTIL  247

Query  826   PDTDSHLKLHLREMGLTFHCSKAVPSLITQNVEDCLVKAFEPFGISDWNSIFWILHPGGI  1005
             PD+D  +  HLRE+GLTFH  K VP LI++N+E  L +AF+P GI DWNSIFWI HPGG 
Sbjct  248   PDSDGAIDGHLREVGLTFHLLKDVPGLISKNIEKSLNEAFQPLGIKDWNSIFWIAHPGGP  307

Query  1006  AILDRVEEKLGLEPEKLRASKDVLSEYGNLTSACVLFILDEMRKKSKKDEEMTTGEGLEW  1185
             AILD+VEEKL L+PEKLR+++ VLSEYGN++SACVLFILDEMR+KS ++   TTGEGLEW
Sbjct  308   AILDQVEEKLALKPEKLRSTRHVLSEYGNMSSACVLFILDEMRRKSAEEGLKTTGEGLEW  367

Query  1186  GVVFVVCP  1209
             GV+F   P
Sbjct  368   GVLFGFGP  375



>dbj|BAO58434.1| chalcone synthase [Vaccinium ashei]
Length=389

 Score =   539 bits (1389),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 252/368 (68%), Positives = 307/368 (83%), Gaps = 0/368 (0%)
 Frame = +1

Query  106   RRAKRFEGDAKILAIGTAIPANWVDQTTYPDFYFRITNSEHLLEHKEKFRRICNKSKIRK  285
             R+A R EG A +LAIGTA PA+ V+Q TYPD+YFR+TNSEH  E KEKF+R+C+KS+I+K
Sbjct  8     RKAMRAEGPATVLAIGTATPAHCVEQATYPDYYFRVTNSEHKAELKEKFQRMCDKSQIKK  67

Query  286   RHLVITEELLKKNPNLCTYNEASLNTRQDILVSEVPKLGKEAAMKAIKEWGRPISEITHL  465
             R++ +TEE+LK+NPN+C Y   SL+ RQD++V E+PKLGKEAA+KAIKEWG+P S+ITHL
Sbjct  68    RYMYLTEEILKENPNVCAYMAPSLDARQDMVVVEIPKLGKEAAVKAIKEWGQPKSKITHL  127

Query  466   VFCTSSGVDMPGADFQLAKLLGLSSSVKRLMMYQQGCNAGAAMLRLAKDLAENNKGARVL  645
             VFCT+SGVDMPGAD+QL KLLGL  SVKRLMMYQQGC AG  +LRLAKDLAENNKGARVL
Sbjct  128   VFCTTSGVDMPGADYQLTKLLGLRPSVKRLMMYQQGCFAGGTVLRLAKDLAENNKGARVL  187

Query  646   VVCSEVMLNVFRGPSLEQEDNLLAQCLFGDGSAAVIVGTEPRPGLETPLFELVSAAQTTI  825
             VVCSE+    FRGPS    D+L+ Q LFGDG+AA+IVG +P P +E PLFE+VSAAQT +
Sbjct  188   VVCSEITAVTFRGPSDSHLDSLVGQALFGDGAAAIIVGADPIPEVEKPLFEVVSAAQTIL  247

Query  826   PDTDSHLKLHLREMGLTFHCSKAVPSLITQNVEDCLVKAFEPFGISDWNSIFWILHPGGI  1005
             PD+D  +  HLRE+GLTFH  K VP LI++N+E  LV+AF+P GISDWNSIFWI HPGG 
Sbjct  248   PDSDGAIDGHLREVGLTFHLLKDVPGLISKNIEKSLVEAFQPLGISDWNSIFWIAHPGGP  307

Query  1006  AILDRVEEKLGLEPEKLRASKDVLSEYGNLTSACVLFILDEMRKKSKKDEEMTTGEGLEW  1185
             AILD+VE+KL L+PEKLRA++ VLSEYGN++SACVLFI+DEMRKKS +D   TTGEGL+W
Sbjct  308   AILDQVEQKLALKPEKLRATRHVLSEYGNMSSACVLFIMDEMRKKSAEDGFKTTGEGLDW  367

Query  1186  GVVFVVCP  1209
             GV+F   P
Sbjct  368   GVLFGFGP  375



>gb|ACV72638.1| chalcone synthase 1 [Gossypium hirsutum]
Length=389

 Score =   539 bits (1389),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 252/368 (68%), Positives = 304/368 (83%), Gaps = 0/368 (0%)
 Frame = +1

Query  106   RRAKRFEGDAKILAIGTAIPANWVDQTTYPDFYFRITNSEHLLEHKEKFRRICNKSKIRK  285
             R+A+R +G A +LAIGT+ P N VDQ+TYPD+YF ITNSEH  E KEKF+R+C KS I+K
Sbjct  8     RKAQRAQGPATVLAIGTSTPPNCVDQSTYPDYYFHITNSEHKTELKEKFKRMCEKSMIKK  67

Query  286   RHLVITEELLKKNPNLCTYNEASLNTRQDILVSEVPKLGKEAAMKAIKEWGRPISEITHL  465
             R++ +TEE+LK+NPN+C Y   SL+ RQD++V EVPKLGKEAA KAIKEWG+P S+ITHL
Sbjct  68    RYMYLTEEILKENPNVCEYMAPSLDARQDMVVVEVPKLGKEAATKAIKEWGQPKSKITHL  127

Query  466   VFCTSSGVDMPGADFQLAKLLGLSSSVKRLMMYQQGCNAGAAMLRLAKDLAENNKGARVL  645
             VFCT+SGVDMPGAD+QL KLLGL  SVKRLMMYQQGC AG  +LR+AKDLAENNKGARVL
Sbjct  128   VFCTTSGVDMPGADYQLTKLLGLRPSVKRLMMYQQGCFAGGTVLRVAKDLAENNKGARVL  187

Query  646   VVCSEVMLNVFRGPSLEQEDNLLAQCLFGDGSAAVIVGTEPRPGLETPLFELVSAAQTTI  825
             VVCSE+    FRGPS    D+L+ Q LFGDG+AAVI+G +P P +E P+FELVSAAQT +
Sbjct  188   VVCSEITAVTFRGPSDTHLDSLVGQALFGDGAAAVIIGADPMPEIEKPMFELVSAAQTIL  247

Query  826   PDTDSHLKLHLREMGLTFHCSKAVPSLITQNVEDCLVKAFEPFGISDWNSIFWILHPGGI  1005
             PD+D  +  HLRE+GLTFH  K VP LI++N+E  LV+AF+P GISDWNS+FWI HPGG 
Sbjct  248   PDSDGAIDGHLREVGLTFHLLKDVPGLISKNIEKSLVEAFQPLGISDWNSLFWIAHPGGP  307

Query  1006  AILDRVEEKLGLEPEKLRASKDVLSEYGNLTSACVLFILDEMRKKSKKDEEMTTGEGLEW  1185
             AILD+VE KL L+PEKLRA++ VLSEYGN++SACVLFILDEMRKKS++D   TTGEGLEW
Sbjct  308   AILDQVEAKLALKPEKLRATRHVLSEYGNMSSACVLFILDEMRKKSREDGLQTTGEGLEW  367

Query  1186  GVVFVVCP  1209
             GV+F   P
Sbjct  368   GVLFGFGP  375



>gb|ACH56521.1| chalcone synthase [Gossypium hirsutum]
 gb|AEO96988.1| chalcone synthase [Gossypium hirsutum]
Length=389

 Score =   539 bits (1389),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 251/368 (68%), Positives = 304/368 (83%), Gaps = 0/368 (0%)
 Frame = +1

Query  106   RRAKRFEGDAKILAIGTAIPANWVDQTTYPDFYFRITNSEHLLEHKEKFRRICNKSKIRK  285
             R+A+R +G A +LAIGT+ P N VDQ+TYPD+YFRITNSEH  E KEKF+R+C KS I+K
Sbjct  8     RKAQRAQGPATVLAIGTSTPPNCVDQSTYPDYYFRITNSEHKTELKEKFKRMCEKSMIKK  67

Query  286   RHLVITEELLKKNPNLCTYNEASLNTRQDILVSEVPKLGKEAAMKAIKEWGRPISEITHL  465
             R++ +TEE+LK+NPN+C Y   SL+ RQD++V EVPKLGKEAA KAIKEWG+P S+ITHL
Sbjct  68    RYMYLTEEILKENPNVCEYMAPSLDARQDMVVVEVPKLGKEAATKAIKEWGQPKSKITHL  127

Query  466   VFCTSSGVDMPGADFQLAKLLGLSSSVKRLMMYQQGCNAGAAMLRLAKDLAENNKGARVL  645
             VFCT+SGVDMPGAD+QL KLLGL  SVKRLMMYQQGC AG  +LR+AKDLAENNKGARVL
Sbjct  128   VFCTTSGVDMPGADYQLTKLLGLRPSVKRLMMYQQGCFAGGTVLRVAKDLAENNKGARVL  187

Query  646   VVCSEVMLNVFRGPSLEQEDNLLAQCLFGDGSAAVIVGTEPRPGLETPLFELVSAAQTTI  825
             VVCSE+    FRGPS    D+L+ Q LFGDG+AAVI+G +P P +E P+FE+VS AQT +
Sbjct  188   VVCSEITAVTFRGPSDTHLDSLVGQALFGDGAAAVIIGADPMPEIEKPMFEIVSVAQTIL  247

Query  826   PDTDSHLKLHLREMGLTFHCSKAVPSLITQNVEDCLVKAFEPFGISDWNSIFWILHPGGI  1005
             PD+D  +  HLRE+GLTFH  K VP LI++N+E  LV+AF+P GISDWNS+FWI HPGG 
Sbjct  248   PDSDGAIDGHLREVGLTFHLLKDVPGLISKNIEKSLVEAFQPLGISDWNSLFWIAHPGGP  307

Query  1006  AILDRVEEKLGLEPEKLRASKDVLSEYGNLTSACVLFILDEMRKKSKKDEEMTTGEGLEW  1185
             AILD+VE KL L+PEKLRA++ VLSEYGN++SACVLFILDEMRKKS++D   TTGEGLEW
Sbjct  308   AILDQVEAKLALKPEKLRATRHVLSEYGNMSSACVLFILDEMRKKSREDGLQTTGEGLEW  367

Query  1186  GVVFVVCP  1209
             GV+F   P
Sbjct  368   GVLFGFGP  375



>ref|XP_009774927.1| PREDICTED: chalcone synthase 2 [Nicotiana sylvestris]
Length=389

 Score =   539 bits (1389),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 250/368 (68%), Positives = 309/368 (84%), Gaps = 0/368 (0%)
 Frame = +1

Query  106   RRAKRFEGDAKILAIGTAIPANWVDQTTYPDFYFRITNSEHLLEHKEKFRRICNKSKIRK  285
             RRA+R +G A I+AIGTA P+N VDQ+TYPD+YFR+TNSEH++E KEKF+R+C+KS I+K
Sbjct  8     RRAQRAKGPATIMAIGTATPSNCVDQSTYPDYYFRVTNSEHMIELKEKFKRMCDKSMIKK  67

Query  286   RHLVITEELLKKNPNLCTYNEASLNTRQDILVSEVPKLGKEAAMKAIKEWGRPISEITHL  465
             R++ +TEE+LK+NPN+C Y   SL+ RQDI+V E+PKLGKEAA KAIKEWG+P S+ITHL
Sbjct  68    RYMHLTEEILKENPNICEYMAPSLDARQDIVVVEIPKLGKEAAQKAIKEWGQPKSKITHL  127

Query  466   VFCTSSGVDMPGADFQLAKLLGLSSSVKRLMMYQQGCNAGAAMLRLAKDLAENNKGARVL  645
             VFCT+SGVDMPGAD+QL KLLGL  SVKRLMMYQQGC AG  +LRLAKDLAENNKGARVL
Sbjct  128   VFCTTSGVDMPGADYQLTKLLGLRPSVKRLMMYQQGCFAGGTVLRLAKDLAENNKGARVL  187

Query  646   VVCSEVMLNVFRGPSLEQEDNLLAQCLFGDGSAAVIVGTEPRPGLETPLFELVSAAQTTI  825
             VVCSE+    FRGPS    D+++ Q LFGDG+AA+I+G++  PG+E PLFELVS+AQT +
Sbjct  188   VVCSEITAVTFRGPSDTHVDSMVGQALFGDGAAAIIIGSDLVPGVERPLFELVSSAQTLL  247

Query  826   PDTDSHLKLHLREMGLTFHCSKAVPSLITQNVEDCLVKAFEPFGISDWNSIFWILHPGGI  1005
             PD+D  +  HLRE+GLTFH  K VP LI++N+E  L++AF+P G+SDWNSIFWI HPGG 
Sbjct  248   PDSDGAIDGHLREVGLTFHLLKDVPGLISKNIEKSLMEAFQPLGLSDWNSIFWIAHPGGP  307

Query  1006  AILDRVEEKLGLEPEKLRASKDVLSEYGNLTSACVLFILDEMRKKSKKDEEMTTGEGLEW  1185
             AILD+VE KLGL+PEKLRA++ VLS+YGN++SACVLFILDEMRK S K+   TTGEGL+W
Sbjct  308   AILDQVELKLGLKPEKLRATRQVLSDYGNMSSACVLFILDEMRKASAKEGLGTTGEGLDW  367

Query  1186  GVVFVVCP  1209
             GV+F   P
Sbjct  368   GVLFGFGP  375



>ref|XP_007034442.1| Chalcone and stilbene synthase family protein [Theobroma cacao]
 gb|EOY05368.1| Chalcone and stilbene synthase family protein [Theobroma cacao]
Length=389

 Score =   539 bits (1389),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 251/368 (68%), Positives = 304/368 (83%), Gaps = 0/368 (0%)
 Frame = +1

Query  106   RRAKRFEGDAKILAIGTAIPANWVDQTTYPDFYFRITNSEHLLEHKEKFRRICNKSKIRK  285
             R+A+R EG A +LAIGT+ P N VDQ+TYPD+YFRITNSEH  E KEKF+R+C KS I++
Sbjct  8     RKAQRAEGPATVLAIGTSTPPNCVDQSTYPDYYFRITNSEHKTELKEKFKRMCEKSMIKR  67

Query  286   RHLVITEELLKKNPNLCTYNEASLNTRQDILVSEVPKLGKEAAMKAIKEWGRPISEITHL  465
             R++ +TEE+LK+NPN+C Y   SL+ RQD++V EVPKLGKEAA +AIKEWG+P S+ITHL
Sbjct  68    RYMYLTEEILKENPNICAYMATSLDARQDMVVVEVPKLGKEAATRAIKEWGQPKSKITHL  127

Query  466   VFCTSSGVDMPGADFQLAKLLGLSSSVKRLMMYQQGCNAGAAMLRLAKDLAENNKGARVL  645
             VFCT+SGVDMPGAD+QL KLLGL  SVKRLMMYQQGC AG  +LR+AKDLAENNKGARVL
Sbjct  128   VFCTTSGVDMPGADYQLTKLLGLRPSVKRLMMYQQGCFAGGTVLRVAKDLAENNKGARVL  187

Query  646   VVCSEVMLNVFRGPSLEQEDNLLAQCLFGDGSAAVIVGTEPRPGLETPLFELVSAAQTTI  825
             VVCSE+    FRGPS    D+L+ Q LFGDG+AAVI+G +P P +E P+FELVSAAQT +
Sbjct  188   VVCSEITAVTFRGPSDTHLDSLVGQALFGDGAAAVIIGADPVPEIEKPMFELVSAAQTIL  247

Query  826   PDTDSHLKLHLREMGLTFHCSKAVPSLITQNVEDCLVKAFEPFGISDWNSIFWILHPGGI  1005
             PD+D  +  HLRE+GLTFH  K VP LI++N+E  L +AF+P GISDWNS+FWI HPGG 
Sbjct  248   PDSDGAIDGHLREVGLTFHLLKDVPGLISKNIEKSLAEAFQPLGISDWNSLFWIAHPGGP  307

Query  1006  AILDRVEEKLGLEPEKLRASKDVLSEYGNLTSACVLFILDEMRKKSKKDEEMTTGEGLEW  1185
             AILD+VE KL L+PEKLRA++ VLSEYGN++SACVLFILDEMRKKS++D   TTGEGLEW
Sbjct  308   AILDQVEAKLALKPEKLRATRHVLSEYGNMSSACVLFILDEMRKKSREDGLKTTGEGLEW  367

Query  1186  GVVFVVCP  1209
             GV+F   P
Sbjct  368   GVLFGFGP  375



>emb|CAC88858.1| chalcone synthase [Rhododendron simsii]
Length=389

 Score =   539 bits (1388),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 255/368 (69%), Positives = 305/368 (83%), Gaps = 0/368 (0%)
 Frame = +1

Query  106   RRAKRFEGDAKILAIGTAIPANWVDQTTYPDFYFRITNSEHLLEHKEKFRRICNKSKIRK  285
             RRA+R EG A ++AIGTA P+N VDQ+TYPDFYFRITNSEH  E KEKF+R+C+KS I+K
Sbjct  8     RRAQRAEGPATVMAIGTATPSNCVDQSTYPDFYFRITNSEHKAELKEKFQRMCDKSMIKK  67

Query  286   RHLVITEELLKKNPNLCTYNEASLNTRQDILVSEVPKLGKEAAMKAIKEWGRPISEITHL  465
             R++ +TEE+LK+NP++C Y   SL+ RQD++V EVPKLGKEAA KAIKEWG+P S+ITHL
Sbjct  68    RYMYLTEEILKENPSVCEYMAPSLDARQDMVVVEVPKLGKEAATKAIKEWGQPKSKITHL  127

Query  466   VFCTSSGVDMPGADFQLAKLLGLSSSVKRLMMYQQGCNAGAAMLRLAKDLAENNKGARVL  645
             VFCT+SGVDMPGAD+QL KLLGL  SVKRLMMYQQGC AG  +LRLAKDLAENNKGARVL
Sbjct  128   VFCTTSGVDMPGADYQLTKLLGLRPSVKRLMMYQQGCFAGGTVLRLAKDLAENNKGARVL  187

Query  646   VVCSEVMLNVFRGPSLEQEDNLLAQCLFGDGSAAVIVGTEPRPGLETPLFELVSAAQTTI  825
             VVCSE+    FRGPS    D+L+ Q LFGDG+AA+IVG +P P +E PLFELVSAAQT +
Sbjct  188   VVCSEITAVTFRGPSDTHLDSLVGQALFGDGAAAIIVGADPVPEVEKPLFELVSAAQTIL  247

Query  826   PDTDSHLKLHLREMGLTFHCSKAVPSLITQNVEDCLVKAFEPFGISDWNSIFWILHPGGI  1005
             PD+D  +  HLRE+GLTFH  K VP LI++N+E  L +AF+P GISDWNSIFWI HPGG 
Sbjct  248   PDSDGAIDGHLREVGLTFHLLKDVPGLISKNIEKALTEAFQPLGISDWNSIFWIAHPGGP  307

Query  1006  AILDRVEEKLGLEPEKLRASKDVLSEYGNLTSACVLFILDEMRKKSKKDEEMTTGEGLEW  1185
             AILD+VE KL L+PEKLRA++ VLSEYGN++SACVLFILDEMR+KS ++   TTGEGLEW
Sbjct  308   AILDQVELKLSLKPEKLRATRHVLSEYGNMSSACVLFILDEMRRKSAEEGLKTTGEGLEW  367

Query  1186  GVVFVVCP  1209
             GV+F   P
Sbjct  368   GVLFGFGP  375



>gb|AEO96989.1| chalcone synthase [Gossypium hirsutum]
Length=389

 Score =   539 bits (1388),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 251/368 (68%), Positives = 306/368 (83%), Gaps = 0/368 (0%)
 Frame = +1

Query  106   RRAKRFEGDAKILAIGTAIPANWVDQTTYPDFYFRITNSEHLLEHKEKFRRICNKSKIRK  285
             R+A+R +G A +LAIGT+ P N VDQ+TYPD+YFRITNSEH  E KEKF+R+C KS I+K
Sbjct  8     RKAQRAQGPATVLAIGTSTPPNCVDQSTYPDYYFRITNSEHKTELKEKFKRMCEKSMIKK  67

Query  286   RHLVITEELLKKNPNLCTYNEASLNTRQDILVSEVPKLGKEAAMKAIKEWGRPISEITHL  465
             R++ +TEE+LK+NPN+C Y E SL+ RQD++V EVPKLGKEAA +AIKEWG+P S+ITHL
Sbjct  68    RYMFLTEEILKENPNVCAYMEPSLDARQDMVVVEVPKLGKEAAARAIKEWGQPKSKITHL  127

Query  466   VFCTSSGVDMPGADFQLAKLLGLSSSVKRLMMYQQGCNAGAAMLRLAKDLAENNKGARVL  645
             VFCT+SGVDMPGAD+QL KLLGL  SVKRLMMYQQGC AG  +LR+AKDLAENN+GARVL
Sbjct  128   VFCTTSGVDMPGADYQLTKLLGLRPSVKRLMMYQQGCFAGGTVLRVAKDLAENNEGARVL  187

Query  646   VVCSEVMLNVFRGPSLEQEDNLLAQCLFGDGSAAVIVGTEPRPGLETPLFELVSAAQTTI  825
             VVCSE+    FRGPS    D+L+ Q LFGDG+AAVI+G++P P +E PLFELVSAAQT +
Sbjct  188   VVCSEITAVTFRGPSDTHLDSLVGQALFGDGAAAVIIGSDPIPEIEKPLFELVSAAQTIL  247

Query  826   PDTDSHLKLHLREMGLTFHCSKAVPSLITQNVEDCLVKAFEPFGISDWNSIFWILHPGGI  1005
             PD+D  +  HLRE+GLTFH  K VP LI++N+E  LV+AF+P GI+DWNS+FWI HPGG 
Sbjct  248   PDSDGAIDGHLREVGLTFHLLKDVPGLISKNIEKSLVEAFQPLGITDWNSLFWIAHPGGP  307

Query  1006  AILDRVEEKLGLEPEKLRASKDVLSEYGNLTSACVLFILDEMRKKSKKDEEMTTGEGLEW  1185
             AILD+VE KL L+PEKLRA++ VLSEYGN++SACVLFILDEMR KS++D   TTGEGLEW
Sbjct  308   AILDQVEAKLALKPEKLRATRHVLSEYGNMSSACVLFILDEMRNKSREDGVQTTGEGLEW  367

Query  1186  GVVFVVCP  1209
             GV+F   P
Sbjct  368   GVLFGFGP  375



>gb|AFM74036.1| chalcone synthase [Acer palmatum]
Length=390

 Score =   539 bits (1388),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 250/368 (68%), Positives = 306/368 (83%), Gaps = 0/368 (0%)
 Frame = +1

Query  106   RRAKRFEGDAKILAIGTAIPANWVDQTTYPDFYFRITNSEHLLEHKEKFRRICNKSKIRK  285
             R+A+R +G A ILAIGTA P N VDQ+ YPD+YFRITNSEH  E KEKF+R+C KS I+K
Sbjct  8     RKAQRAQGPATILAIGTATPPNCVDQSEYPDYYFRITNSEHKTELKEKFKRMCEKSMIKK  67

Query  286   RHLVITEELLKKNPNLCTYNEASLNTRQDILVSEVPKLGKEAAMKAIKEWGRPISEITHL  465
             R++ +TEE+LK+NPN+C Y   SL+ RQD++V E+PKLGKEAA KAIKEWG+P S+ITHL
Sbjct  68    RYMYLTEEILKENPNVCAYEAPSLDARQDMVVVEIPKLGKEAATKAIKEWGQPKSKITHL  127

Query  466   VFCTSSGVDMPGADFQLAKLLGLSSSVKRLMMYQQGCNAGAAMLRLAKDLAENNKGARVL  645
             VFC++SGVDMPGAD+QL KLLGL  SVKRLMMYQQGC AG  +LRLAKDLAENN GARVL
Sbjct  128   VFCSTSGVDMPGADYQLTKLLGLRPSVKRLMMYQQGCFAGGTVLRLAKDLAENNTGARVL  187

Query  646   VVCSEVMLNVFRGPSLEQEDNLLAQCLFGDGSAAVIVGTEPRPGLETPLFELVSAAQTTI  825
             VVCSE+    FRGPS    D+L+ Q LFGDG+AA+I+G++P+PG+E P++ELVSAAQT +
Sbjct  188   VVCSEITAVTFRGPSDTHLDSLVGQALFGDGAAAIIIGSDPQPGIEKPMYELVSAAQTIL  247

Query  826   PDTDSHLKLHLREMGLTFHCSKAVPSLITQNVEDCLVKAFEPFGISDWNSIFWILHPGGI  1005
             PD+D  +  HLRE+GLTFH  K VP LI++N+E  LV+AF+P GISDWNSIFWI +PGG 
Sbjct  248   PDSDGAIDGHLREVGLTFHLLKDVPGLISKNIEKSLVEAFKPLGISDWNSIFWIAYPGGP  307

Query  1006  AILDRVEEKLGLEPEKLRASKDVLSEYGNLTSACVLFILDEMRKKSKKDEEMTTGEGLEW  1185
             AILD+VE KLGL+PEK+RA++ VLSE+GN++SACVLFILDEMRKKS +D   TTGEGLEW
Sbjct  308   AILDQVEAKLGLKPEKMRATRHVLSEFGNMSSACVLFILDEMRKKSAEDGLRTTGEGLEW  367

Query  1186  GVVFVVCP  1209
             GV+F   P
Sbjct  368   GVLFGFGP  375



>gb|AFC37242.1| chalcone synthase 1 [Camellia chekiangoleosa]
Length=389

 Score =   538 bits (1387),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 255/368 (69%), Positives = 303/368 (82%), Gaps = 0/368 (0%)
 Frame = +1

Query  106   RRAKRFEGDAKILAIGTAIPANWVDQTTYPDFYFRITNSEHLLEHKEKFRRICNKSKIRK  285
             RRA+R EG A ++AIGTA P N VDQ+TYPD+YFRITNSEH  E KEKF+R+C+KS I+K
Sbjct  8     RRAQRAEGPATVMAIGTATPPNCVDQSTYPDYYFRITNSEHKAELKEKFKRMCDKSMIKK  67

Query  286   RHLVITEELLKKNPNLCTYNEASLNTRQDILVSEVPKLGKEAAMKAIKEWGRPISEITHL  465
             R++ +TEE+LK+NP +C Y   SL+ RQD++V EVPKLGKEAA KAIKEWG+P S+ITHL
Sbjct  68    RYMYLTEEILKENPQVCEYMAPSLDARQDMVVVEVPKLGKEAATKAIKEWGQPKSKITHL  127

Query  466   VFCTSSGVDMPGADFQLAKLLGLSSSVKRLMMYQQGCNAGAAMLRLAKDLAENNKGARVL  645
             VFCT+SGVDMPGAD+QL KLLGL  SVKRLMMYQQGC AG  +LRLAKDLAENNKGARVL
Sbjct  128   VFCTTSGVDMPGADYQLTKLLGLRPSVKRLMMYQQGCFAGGTVLRLAKDLAENNKGARVL  187

Query  646   VVCSEVMLNVFRGPSLEQEDNLLAQCLFGDGSAAVIVGTEPRPGLETPLFELVSAAQTTI  825
             VVCSE+    FRGPS    D+L+ Q LFGDG+AA+IVG++P P +E PLFELVSAAQT +
Sbjct  188   VVCSEITAVTFRGPSDTHLDSLVGQALFGDGAAAIIVGSDPIPEIEKPLFELVSAAQTIL  247

Query  826   PDTDSHLKLHLREMGLTFHCSKAVPSLITQNVEDCLVKAFEPFGISDWNSIFWILHPGGI  1005
             PD+D  +  HLRE+GLTFH  K VP LI++N+E  L +AF+P GISDWNS+FWI HPGG 
Sbjct  248   PDSDGAIDGHLREVGLTFHLLKDVPGLISKNIEKSLAEAFQPLGISDWNSLFWIAHPGGP  307

Query  1006  AILDRVEEKLGLEPEKLRASKDVLSEYGNLTSACVLFILDEMRKKSKKDEEMTTGEGLEW  1185
             AILD+VE KLGL+ EKLRA++ VLSEYGN++SACVLFILDEMRKKS  D   TTGEGLEW
Sbjct  308   AILDQVELKLGLKEEKLRATRHVLSEYGNMSSACVLFILDEMRKKSAADGLKTTGEGLEW  367

Query  1186  GVVFVVCP  1209
             GV+F   P
Sbjct  368   GVLFGFGP  375



>dbj|BAI66465.1| chalcone synthase [Camellia japonica]
 gb|ADZ28512.1| chalcone synthase [Camellia nitidissima]
Length=389

 Score =   538 bits (1387),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 255/368 (69%), Positives = 303/368 (82%), Gaps = 0/368 (0%)
 Frame = +1

Query  106   RRAKRFEGDAKILAIGTAIPANWVDQTTYPDFYFRITNSEHLLEHKEKFRRICNKSKIRK  285
             RRA+R EG A ++AIGTA P N VDQ+TYPD+YFRITNSEH  E KEKF+R+C+KS I+K
Sbjct  8     RRAQRAEGPATVMAIGTATPPNCVDQSTYPDYYFRITNSEHKAELKEKFKRMCDKSMIKK  67

Query  286   RHLVITEELLKKNPNLCTYNEASLNTRQDILVSEVPKLGKEAAMKAIKEWGRPISEITHL  465
             R++ +TEE+LK+NP +C Y   SL+ RQD++V EVPKLGKEAA KAIKEWG+P S+ITHL
Sbjct  68    RYMYLTEEILKENPQVCEYMAPSLDARQDMVVVEVPKLGKEAATKAIKEWGQPKSKITHL  127

Query  466   VFCTSSGVDMPGADFQLAKLLGLSSSVKRLMMYQQGCNAGAAMLRLAKDLAENNKGARVL  645
             VFCT+SGVDMPGAD+QL KLLGL  SVKRLMMYQQGC AG  +LRLAKDLAENNKGARVL
Sbjct  128   VFCTTSGVDMPGADYQLTKLLGLRPSVKRLMMYQQGCFAGGTVLRLAKDLAENNKGARVL  187

Query  646   VVCSEVMLNVFRGPSLEQEDNLLAQCLFGDGSAAVIVGTEPRPGLETPLFELVSAAQTTI  825
             VVCSE+    FRGPS    D+L+ Q LFGDG+AA+IVG++P P +E PLFELVSAAQT +
Sbjct  188   VVCSEITAVTFRGPSDTHLDSLVGQALFGDGAAAIIVGSDPIPEVEKPLFELVSAAQTIL  247

Query  826   PDTDSHLKLHLREMGLTFHCSKAVPSLITQNVEDCLVKAFEPFGISDWNSIFWILHPGGI  1005
             PD+D  +  HLRE+GLTFH  K VP LI++N+E  L +AF+P GISDWNS+FWI HPGG 
Sbjct  248   PDSDGAIDGHLREVGLTFHLLKDVPGLISKNIEKSLAEAFQPLGISDWNSLFWIAHPGGP  307

Query  1006  AILDRVEEKLGLEPEKLRASKDVLSEYGNLTSACVLFILDEMRKKSKKDEEMTTGEGLEW  1185
             AILD+VE KLGL+ EKLRA++ VLSEYGN++SACVLFILDEMRKKS  D   TTGEGLEW
Sbjct  308   AILDQVELKLGLKEEKLRATRHVLSEYGNMSSACVLFILDEMRKKSAADGLKTTGEGLEW  367

Query  1186  GVVFVVCP  1209
             GV+F   P
Sbjct  368   GVLFGFGP  375



>ref|XP_011020681.1| PREDICTED: chalcone synthase 1 [Populus euphratica]
Length=391

 Score =   538 bits (1386),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 253/368 (69%), Positives = 305/368 (83%), Gaps = 0/368 (0%)
 Frame = +1

Query  106   RRAKRFEGDAKILAIGTAIPANWVDQTTYPDFYFRITNSEHLLEHKEKFRRICNKSKIRK  285
             R+++R EG A I+AIGT+ P N VDQ+TYPD+YFRITNSEH  E KEKF+R+C KS I+K
Sbjct  8     RKSQRAEGPATIMAIGTSTPPNCVDQSTYPDYYFRITNSEHKAELKEKFKRMCEKSMIKK  67

Query  286   RHLVITEELLKKNPNLCTYNEASLNTRQDILVSEVPKLGKEAAMKAIKEWGRPISEITHL  465
             R++ +TEE+LK+NP++C Y   SL+ RQD++V EVPKLGKEAA KAIKEWG+P S+ITHL
Sbjct  68    RYMYLTEEILKENPSVCAYMAPSLDARQDMVVVEVPKLGKEAATKAIKEWGQPKSKITHL  127

Query  466   VFCTSSGVDMPGADFQLAKLLGLSSSVKRLMMYQQGCNAGAAMLRLAKDLAENNKGARVL  645
             VFCT+SGVDMPGAD+QL KLLGL SSVKR MMYQQGC AG  +LRLAKDLAENNKGARVL
Sbjct  128   VFCTTSGVDMPGADYQLTKLLGLRSSVKRFMMYQQGCFAGGTVLRLAKDLAENNKGARVL  187

Query  646   VVCSEVMLNVFRGPSLEQEDNLLAQCLFGDGSAAVIVGTEPRPGLETPLFELVSAAQTTI  825
             VVCSE+    FRGPS    D+L+ Q LFGDG+AA+I+G++P  G+E PLFELVSAAQT +
Sbjct  188   VVCSEITAVTFRGPSDTHLDSLVGQALFGDGAAALIIGSDPVVGVEKPLFELVSAAQTIL  247

Query  826   PDTDSHLKLHLREMGLTFHCSKAVPSLITQNVEDCLVKAFEPFGISDWNSIFWILHPGGI  1005
             PD+D  +  HLRE+GLTFH  K VP LI++NVE  L +AF+P GISDWNS+FWI HPGG 
Sbjct  248   PDSDGAIDGHLREVGLTFHLLKDVPGLISKNVEKSLTEAFKPLGISDWNSLFWIAHPGGP  307

Query  1006  AILDRVEEKLGLEPEKLRASKDVLSEYGNLTSACVLFILDEMRKKSKKDEEMTTGEGLEW  1185
             AILD+VE KLGL+PEKLRA++ VLSEYGN++SACVLFILDEMRKKS +D   +TGEGLEW
Sbjct  308   AILDQVEAKLGLKPEKLRATRHVLSEYGNMSSACVLFILDEMRKKSAEDGLQSTGEGLEW  367

Query  1186  GVVFVVCP  1209
             GV+F   P
Sbjct  368   GVLFGFGP  375



>sp|P48386.1|CHS1_CAMSI RecName: Full=Chalcone synthase 1; AltName: Full=Naringenin-chalcone 
synthase 1 [Camellia sinensis]
 dbj|BAA05640.1| chalcone synthase [Camellia sinensis]
 gb|AGI02992.1| chalcone synthase [Camellia sinensis]
Length=389

 Score =   538 bits (1386),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 255/368 (69%), Positives = 303/368 (82%), Gaps = 0/368 (0%)
 Frame = +1

Query  106   RRAKRFEGDAKILAIGTAIPANWVDQTTYPDFYFRITNSEHLLEHKEKFRRICNKSKIRK  285
             RRA+R EG A ++AIGTA P N VDQ+TYPD+YFRITNSEH  E KEKF+R+C+KS I+K
Sbjct  8     RRAQRAEGPATVMAIGTATPPNCVDQSTYPDYYFRITNSEHKAELKEKFKRMCDKSMIKK  67

Query  286   RHLVITEELLKKNPNLCTYNEASLNTRQDILVSEVPKLGKEAAMKAIKEWGRPISEITHL  465
             R++ +TEE+LK+NP +C Y   SL+ RQD++V EVPKLGKEAA KAIKEWG+P S+ITHL
Sbjct  68    RYMYLTEEILKENPQVCEYMAPSLDARQDMVVVEVPKLGKEAATKAIKEWGQPKSKITHL  127

Query  466   VFCTSSGVDMPGADFQLAKLLGLSSSVKRLMMYQQGCNAGAAMLRLAKDLAENNKGARVL  645
             VFCT+SGVDMPGAD+QL KLLGL  SVKRLMMYQQGC AG  +LRLAKDLAENNKGARVL
Sbjct  128   VFCTTSGVDMPGADYQLTKLLGLRPSVKRLMMYQQGCFAGGTVLRLAKDLAENNKGARVL  187

Query  646   VVCSEVMLNVFRGPSLEQEDNLLAQCLFGDGSAAVIVGTEPRPGLETPLFELVSAAQTTI  825
             VVCSE+    FRGPS    D+L+ Q LFGDG+AA+IVG++P P +E PLFELVSAAQT +
Sbjct  188   VVCSEITAVTFRGPSDTHLDSLVGQALFGDGAAAIIVGSDPIPEVEKPLFELVSAAQTIL  247

Query  826   PDTDSHLKLHLREMGLTFHCSKAVPSLITQNVEDCLVKAFEPFGISDWNSIFWILHPGGI  1005
             PD+D  +  HLRE+GLTFH  K VP LI++N+E  L +AF+P GISDWNS+FWI HPGG 
Sbjct  248   PDSDGAIDGHLREVGLTFHLLKDVPGLISKNIEKSLAEAFQPLGISDWNSLFWIAHPGGP  307

Query  1006  AILDRVEEKLGLEPEKLRASKDVLSEYGNLTSACVLFILDEMRKKSKKDEEMTTGEGLEW  1185
             AILD+VE KLGL+ EKLRA++ VLSEYGN++SACVLFILDEMRKKS  D   TTGEGLEW
Sbjct  308   AILDQVELKLGLKEEKLRATRHVLSEYGNMSSACVLFILDEMRKKSAADGLKTTGEGLEW  367

Query  1186  GVVFVVCP  1209
             GV+F   P
Sbjct  368   GVLFGFGP  375



>gb|AHK22740.1| chalcone synthase [Nicotiana tabacum]
Length=389

 Score =   538 bits (1386),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 250/368 (68%), Positives = 308/368 (84%), Gaps = 0/368 (0%)
 Frame = +1

Query  106   RRAKRFEGDAKILAIGTAIPANWVDQTTYPDFYFRITNSEHLLEHKEKFRRICNKSKIRK  285
             RRA+R +G A I+AIGTA P+N VDQ+TYPD+YFR+TNSEH+ E KEKF+R+C+KS I+K
Sbjct  8     RRAQRAKGPATIMAIGTATPSNCVDQSTYPDYYFRVTNSEHMTELKEKFKRMCDKSMIKK  67

Query  286   RHLVITEELLKKNPNLCTYNEASLNTRQDILVSEVPKLGKEAAMKAIKEWGRPISEITHL  465
             R++ +TEE+LK+NPN+C Y   SL+ RQDI+V E+PKLGKEAA KAIKEWG+P S+ITHL
Sbjct  68    RYMHLTEEILKENPNICEYMAPSLDARQDIVVVEIPKLGKEAAQKAIKEWGQPKSKITHL  127

Query  466   VFCTSSGVDMPGADFQLAKLLGLSSSVKRLMMYQQGCNAGAAMLRLAKDLAENNKGARVL  645
             VFCT+SGVDMPGAD+QL KLLGL  SVKRLMMYQQGC AG  +LRLAKDLAENNKGARVL
Sbjct  128   VFCTTSGVDMPGADYQLTKLLGLRPSVKRLMMYQQGCFAGGTVLRLAKDLAENNKGARVL  187

Query  646   VVCSEVMLNVFRGPSLEQEDNLLAQCLFGDGSAAVIVGTEPRPGLETPLFELVSAAQTTI  825
             VVCSE+    FRGPS    D+++ Q LFGDG+AA+I+G++  PG+E PLFELVS+AQT +
Sbjct  188   VVCSEITAVTFRGPSDTHVDSMVGQALFGDGAAAIIIGSDLVPGVERPLFELVSSAQTLL  247

Query  826   PDTDSHLKLHLREMGLTFHCSKAVPSLITQNVEDCLVKAFEPFGISDWNSIFWILHPGGI  1005
             PD+D  +  HLRE+GLTFH  K VP LI++N+E  L++AF+P G+SDWNSIFWI HPGG 
Sbjct  248   PDSDGAIDGHLREVGLTFHLLKDVPGLISKNIEKSLMEAFQPLGLSDWNSIFWIAHPGGP  307

Query  1006  AILDRVEEKLGLEPEKLRASKDVLSEYGNLTSACVLFILDEMRKKSKKDEEMTTGEGLEW  1185
             AILD+VE KLGL+PEKLRA++ VLS+YGN++SACVLFILDEMRK S K+   TTGEGL+W
Sbjct  308   AILDQVELKLGLKPEKLRATRQVLSDYGNMSSACVLFILDEMRKASAKEGLGTTGEGLDW  367

Query  1186  GVVFVVCP  1209
             GV+F   P
Sbjct  368   GVLFGFGP  375



>sp|O82144.1|CHSY_HYDMC RecName: Full=Chalcone synthase; AltName: Full=Naringenin-chalcone 
synthase [Hydrangea macrophylla]
 dbj|BAA32732.1| chalcone synthase [Hydrangea macrophylla]
Length=389

 Score =   538 bits (1386),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 250/368 (68%), Positives = 306/368 (83%), Gaps = 0/368 (0%)
 Frame = +1

Query  106   RRAKRFEGDAKILAIGTAIPANWVDQTTYPDFYFRITNSEHLLEHKEKFRRICNKSKIRK  285
             R+A+R EG A ILAIGTA P N+VDQ+TYPDFYFR+TNSEH  E K KF+R+C+ S+I+K
Sbjct  8     RKAQRAEGPATILAIGTATPPNYVDQSTYPDFYFRVTNSEHKKELKAKFQRMCDNSQIKK  67

Query  286   RHLVITEELLKKNPNLCTYNEASLNTRQDILVSEVPKLGKEAAMKAIKEWGRPISEITHL  465
             R++ +TEE+LK+NPN+C Y   SL+ RQD++V E+PKLGKEAA +AIKEWG+P S+ITHL
Sbjct  68    RYMHLTEEILKENPNICAYMAPSLDARQDMVVVEIPKLGKEAATRAIKEWGQPKSKITHL  127

Query  466   VFCTSSGVDMPGADFQLAKLLGLSSSVKRLMMYQQGCNAGAAMLRLAKDLAENNKGARVL  645
             VFCT+SGVDMPGAD+QL KLLGL  SVKRLMMYQQGC AG  +LRLAKDLAENNKGARVL
Sbjct  128   VFCTTSGVDMPGADYQLTKLLGLRPSVKRLMMYQQGCFAGGTVLRLAKDLAENNKGARVL  187

Query  646   VVCSEVMLNVFRGPSLEQEDNLLAQCLFGDGSAAVIVGTEPRPGLETPLFELVSAAQTTI  825
             VVCSE+    FRGPS    D+L+ Q LFGDG+AAVI+G++P P +E PLFE+VSAAQT +
Sbjct  188   VVCSEITAVTFRGPSDTHLDSLVGQALFGDGAAAVIIGSDPMPEVEKPLFEIVSAAQTIL  247

Query  826   PDTDSHLKLHLREMGLTFHCSKAVPSLITQNVEDCLVKAFEPFGISDWNSIFWILHPGGI  1005
             PD+D  +  HLRE+GLTFH  K VP LI++N+E  LV+AF P  ISDWNSIFWI HPGG 
Sbjct  248   PDSDGAIDGHLREVGLTFHLLKDVPGLISKNIEKSLVEAFRPLDISDWNSIFWIAHPGGP  307

Query  1006  AILDRVEEKLGLEPEKLRASKDVLSEYGNLTSACVLFILDEMRKKSKKDEEMTTGEGLEW  1185
             AILD+VE+KL L+PEKLRA+++VLS+YGN++SACVLFI+DEMRK S ++  MTTGEGLEW
Sbjct  308   AILDQVEKKLALKPEKLRATRNVLSDYGNMSSACVLFIMDEMRKNSAEEGLMTTGEGLEW  367

Query  1186  GVVFVVCP  1209
             GV+F   P
Sbjct  368   GVLFGFGP  375



>ref|XP_006420608.1| hypothetical protein CICLE_v10005133mg [Citrus clementina]
 gb|ESR33848.1| hypothetical protein CICLE_v10005133mg [Citrus clementina]
Length=390

 Score =   538 bits (1386),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 250/368 (68%), Positives = 305/368 (83%), Gaps = 0/368 (0%)
 Frame = +1

Query  106   RRAKRFEGDAKILAIGTAIPANWVDQTTYPDFYFRITNSEHLLEHKEKFRRICNKSKIRK  285
             R+A+R +G A I+AIGTA P N VDQ+TYPD+YFRITNSEH+ + KEKF+R+C+KS I+K
Sbjct  8     RKAQRAQGPATIMAIGTATPPNCVDQSTYPDYYFRITNSEHMTDLKEKFKRMCDKSMIKK  67

Query  286   RHLVITEELLKKNPNLCTYNEASLNTRQDILVSEVPKLGKEAAMKAIKEWGRPISEITHL  465
             R++ +TEE+LK+NPN+C Y   SL+TRQD++V EVP+LGKEAA +AIKEWG+P S+ITHL
Sbjct  68    RYMYLTEEILKENPNVCAYMAPSLDTRQDMVVVEVPRLGKEAATEAIKEWGQPKSKITHL  127

Query  466   VFCTSSGVDMPGADFQLAKLLGLSSSVKRLMMYQQGCNAGAAMLRLAKDLAENNKGARVL  645
             VFCT+SGVDMPGAD++L KLLGL  SVKRLMMYQQGC AG  +LRLAKDLAENNKGARVL
Sbjct  128   VFCTTSGVDMPGADYRLTKLLGLRPSVKRLMMYQQGCFAGGTVLRLAKDLAENNKGARVL  187

Query  646   VVCSEVMLNVFRGPSLEQEDNLLAQCLFGDGSAAVIVGTEPRPGLETPLFELVSAAQTTI  825
             VVCSE+    FRGPS    D+L+ Q LFGDG+AA+I+G +P P +E P+FELVS AQT +
Sbjct  188   VVCSEITAVTFRGPSDTHLDSLVGQALFGDGAAAIIIGADPIPEIEKPMFELVSTAQTIL  247

Query  826   PDTDSHLKLHLREMGLTFHCSKAVPSLITQNVEDCLVKAFEPFGISDWNSIFWILHPGGI  1005
             PD+D  +  HLRE GLTFH  K VP LI++N++  L +AF+P GISDWNSIFWI HPGG 
Sbjct  248   PDSDGSIDGHLREAGLTFHLLKDVPGLISKNIQKSLTEAFKPLGISDWNSIFWIAHPGGP  307

Query  1006  AILDRVEEKLGLEPEKLRASKDVLSEYGNLTSACVLFILDEMRKKSKKDEEMTTGEGLEW  1185
             AILD+VEEKLGL+PEKLRA++ VLSEYGN++SACVLFILDEMRKKS +D   T GEGLEW
Sbjct  308   AILDQVEEKLGLKPEKLRATRHVLSEYGNMSSACVLFILDEMRKKSAEDGLETAGEGLEW  367

Query  1186  GVVFVVCP  1209
             GV+F   P
Sbjct  368   GVLFGFGP  375



>gb|ADD74167.1| chalcone synthase [Nelumbo nucifera]
Length=389

 Score =   538 bits (1385),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 255/368 (69%), Positives = 304/368 (83%), Gaps = 0/368 (0%)
 Frame = +1

Query  106   RRAKRFEGDAKILAIGTAIPANWVDQTTYPDFYFRITNSEHLLEHKEKFRRICNKSKIRK  285
             R+A+R EG A ++AIGTA P N VDQ+TYPD+YFRITNSEH  E KEKF+R+C KS I+K
Sbjct  8     RKAQRAEGPATVMAIGTANPPNCVDQSTYPDYYFRITNSEHKTELKEKFKRMCEKSMIKK  67

Query  286   RHLVITEELLKKNPNLCTYNEASLNTRQDILVSEVPKLGKEAAMKAIKEWGRPISEITHL  465
             R++ +TEE+LK+NPN+C Y  +SL+ RQD++V EVPKLGKEAA KAIKEWG+P S+ITHL
Sbjct  68    RYMHLTEEILKENPNICEYMASSLDARQDMVVVEVPKLGKEAATKAIKEWGQPKSKITHL  127

Query  466   VFCTSSGVDMPGADFQLAKLLGLSSSVKRLMMYQQGCNAGAAMLRLAKDLAENNKGARVL  645
             VFCT+SGVDMPGAD+QL KLLGL  SVKRLMMYQQGC AG  +LRLAKDLAENN+GARVL
Sbjct  128   VFCTTSGVDMPGADYQLTKLLGLRPSVKRLMMYQQGCFAGGTVLRLAKDLAENNRGARVL  187

Query  646   VVCSEVMLNVFRGPSLEQEDNLLAQCLFGDGSAAVIVGTEPRPGLETPLFELVSAAQTTI  825
             VVCSE+    FRGPS    D+L+ Q LFGDG+AAVIVG +P PG+E PLFELVSAAQT +
Sbjct  188   VVCSELTAVTFRGPSDTHLDSLVGQALFGDGAAAVIVGADPVPGVEKPLFELVSAAQTIL  247

Query  826   PDTDSHLKLHLREMGLTFHCSKAVPSLITQNVEDCLVKAFEPFGISDWNSIFWILHPGGI  1005
             PD+   +  HLRE+GLTFH  K VP LI++N+E  LV+AF+P GISDWNSIFWI HPGG 
Sbjct  248   PDSHGAIDGHLREVGLTFHLLKDVPGLISKNIEKSLVEAFQPLGISDWNSIFWIAHPGGP  307

Query  1006  AILDRVEEKLGLEPEKLRASKDVLSEYGNLTSACVLFILDEMRKKSKKDEEMTTGEGLEW  1185
             AILD+VEEKL L+PEKL  ++ +LSEYGN++SACVLFILDEMRKKS +D   TTGEGLEW
Sbjct  308   AILDQVEEKLALKPEKLSPTRHILSEYGNMSSACVLFILDEMRKKSIEDGLKTTGEGLEW  367

Query  1186  GVVFVVCP  1209
             GV+F   P
Sbjct  368   GVLFGFGP  375



>gb|AFE56210.1| chalcone synthase [Camellia sinensis]
Length=389

 Score =   538 bits (1385),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 254/368 (69%), Positives = 303/368 (82%), Gaps = 0/368 (0%)
 Frame = +1

Query  106   RRAKRFEGDAKILAIGTAIPANWVDQTTYPDFYFRITNSEHLLEHKEKFRRICNKSKIRK  285
             RRA+R EG A ++AIGTA P N VDQ+TYPD+YFRITNSEH  E KEKF+R+C+KS I+K
Sbjct  8     RRAQRAEGPATVMAIGTATPPNCVDQSTYPDYYFRITNSEHKAELKEKFKRMCDKSMIKK  67

Query  286   RHLVITEELLKKNPNLCTYNEASLNTRQDILVSEVPKLGKEAAMKAIKEWGRPISEITHL  465
             R++ +TEE+LK+NP +C Y   SL+ RQD++V EVPKLGKEAA KAIKEWG+P S+ITHL
Sbjct  68    RYMYLTEEILKENPQVCEYMAPSLDARQDMVVVEVPKLGKEAATKAIKEWGQPKSKITHL  127

Query  466   VFCTSSGVDMPGADFQLAKLLGLSSSVKRLMMYQQGCNAGAAMLRLAKDLAENNKGARVL  645
             VFCT+SGVDMPGAD+QL KLLGL  SVKRLMMYQQGC AG  +LRLAKDLAENNKGARVL
Sbjct  128   VFCTTSGVDMPGADYQLTKLLGLRPSVKRLMMYQQGCFAGGTVLRLAKDLAENNKGARVL  187

Query  646   VVCSEVMLNVFRGPSLEQEDNLLAQCLFGDGSAAVIVGTEPRPGLETPLFELVSAAQTTI  825
             VVCSE+    FRGPS    D+L+ Q LFGDG+AA+IVG++P P +E PLFELVSAAQT +
Sbjct  188   VVCSEITAVTFRGPSDTHLDSLVGQALFGDGAAAIIVGSDPIPEVEKPLFELVSAAQTIL  247

Query  826   PDTDSHLKLHLREMGLTFHCSKAVPSLITQNVEDCLVKAFEPFGISDWNSIFWILHPGGI  1005
             PD+D  +  HLRE+GLTFH  K VP LI++N+E  L +AF+P GISDWNS+FWI HPGG 
Sbjct  248   PDSDGAIDGHLREVGLTFHLLKDVPGLISKNIEKSLAEAFQPLGISDWNSLFWIAHPGGP  307

Query  1006  AILDRVEEKLGLEPEKLRASKDVLSEYGNLTSACVLFILDEMRKKSKKDEEMTTGEGLEW  1185
             AILD+VE KLGL+ EKLRA++ VLSEYGN++SACVLFILDEMRK+S  D   TTGEGLEW
Sbjct  308   AILDQVELKLGLKEEKLRATRHVLSEYGNMSSACVLFILDEMRKRSAADGLKTTGEGLEW  367

Query  1186  GVVFVVCP  1209
             GV+F   P
Sbjct  368   GVLFGFGP  375



>ref|XP_010023738.1| PREDICTED: chalcone synthase 1 [Eucalyptus grandis]
 gb|KCW60095.1| hypothetical protein EUGRSUZ_H02828 [Eucalyptus grandis]
Length=391

 Score =   538 bits (1385),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 252/368 (68%), Positives = 303/368 (82%), Gaps = 0/368 (0%)
 Frame = +1

Query  106   RRAKRFEGDAKILAIGTAIPANWVDQTTYPDFYFRITNSEHLLEHKEKFRRICNKSKIRK  285
             RRA+R EG A I+AIGTA P N VDQ+ YPD+YFRITNSEH  E KEKF+R+C KS I+K
Sbjct  8     RRAQRAEGPATIMAIGTATPPNCVDQSAYPDYYFRITNSEHKTELKEKFKRMCEKSMIKK  67

Query  286   RHLVITEELLKKNPNLCTYNEASLNTRQDILVSEVPKLGKEAAMKAIKEWGRPISEITHL  465
             R++ +TE++LK+NPN+C Y   SL+ RQD++V EVPKLGKEAA+KAIKEWG+P S++THL
Sbjct  68    RYMHLTEDILKENPNICAYMAPSLDARQDMVVVEVPKLGKEAAVKAIKEWGQPKSKVTHL  127

Query  466   VFCTSSGVDMPGADFQLAKLLGLSSSVKRLMMYQQGCNAGAAMLRLAKDLAENNKGARVL  645
             +FCT+SGVDMPGAD+QL KLLGL  SVKR MMYQQGC AG  +LRLAKDLAENNKGARVL
Sbjct  128   IFCTTSGVDMPGADYQLTKLLGLRPSVKRYMMYQQGCFAGGTVLRLAKDLAENNKGARVL  187

Query  646   VVCSEVMLNVFRGPSLEQEDNLLAQCLFGDGSAAVIVGTEPRPGLETPLFELVSAAQTTI  825
             VVCSE+    FRGP+    D+L+ Q LFGDG+AAVIVG +P PG+E P+FELVS AQT +
Sbjct  188   VVCSEITAVTFRGPTDTHLDSLVGQALFGDGAAAVIVGADPVPGVEKPMFELVSTAQTIL  247

Query  826   PDTDSHLKLHLREMGLTFHCSKAVPSLITQNVEDCLVKAFEPFGISDWNSIFWILHPGGI  1005
             PD+D  +  HLRE+GLTFH  K VP LI++N+E  LV+AF+P GISDWNS+FWI HPGG 
Sbjct  248   PDSDGAIDGHLREVGLTFHLLKDVPGLISKNIEKSLVEAFQPLGISDWNSLFWIAHPGGP  307

Query  1006  AILDRVEEKLGLEPEKLRASKDVLSEYGNLTSACVLFILDEMRKKSKKDEEMTTGEGLEW  1185
             AILD+VEEKL L+ EKLRA++ VLSEYGN++SACVLFILDEMRKKS +D   TTGEGLEW
Sbjct  308   AILDQVEEKLKLKAEKLRATRHVLSEYGNMSSACVLFILDEMRKKSTEDGLKTTGEGLEW  367

Query  1186  GVVFVVCP  1209
             GV+F   P
Sbjct  368   GVLFGFGP  375



>gb|AGV53049.1| chalcone synthase [Actinidia chinensis]
Length=389

 Score =   537 bits (1384),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 254/368 (69%), Positives = 303/368 (82%), Gaps = 0/368 (0%)
 Frame = +1

Query  106   RRAKRFEGDAKILAIGTAIPANWVDQTTYPDFYFRITNSEHLLEHKEKFRRICNKSKIRK  285
             RRA+R EG A I+AIGT+ P N VDQ+ YPD+YFRITNSEH  E KEKFRR+C KS I+ 
Sbjct  8     RRAQRAEGLATIMAIGTSTPPNCVDQSEYPDYYFRITNSEHKTELKEKFRRMCEKSMIKM  67

Query  286   RHLVITEELLKKNPNLCTYNEASLNTRQDILVSEVPKLGKEAAMKAIKEWGRPISEITHL  465
             R++ +TEE+LK+NPN+C Y   SL+ RQD++V E+PKLGKEAA+KAIKEWG+P S+ITHL
Sbjct  68    RYMYLTEEILKENPNVCAYMAPSLDARQDMVVVEIPKLGKEAAVKAIKEWGQPKSKITHL  127

Query  466   VFCTSSGVDMPGADFQLAKLLGLSSSVKRLMMYQQGCNAGAAMLRLAKDLAENNKGARVL  645
             VFCT+SGVDMPGAD+QL KLLGL  SVKRLMMYQQGC AG  +LRLAKDLAENNKGARVL
Sbjct  128   VFCTTSGVDMPGADYQLTKLLGLRPSVKRLMMYQQGCFAGGTVLRLAKDLAENNKGARVL  187

Query  646   VVCSEVMLNVFRGPSLEQEDNLLAQCLFGDGSAAVIVGTEPRPGLETPLFELVSAAQTTI  825
             VVCSE+    FRGPS    D+L+ Q LFGDG+AAVIVG +P P +E P+FELVSAAQT +
Sbjct  188   VVCSEITAVTFRGPSDTHLDSLVGQALFGDGAAAVIVGADPIPEVEKPMFELVSAAQTIL  247

Query  826   PDTDSHLKLHLREMGLTFHCSKAVPSLITQNVEDCLVKAFEPFGISDWNSIFWILHPGGI  1005
             PD+D  +  HLRE+GLTFH  K VP LI++N+E  L +AF+P GISDWNS+FWI HPGG 
Sbjct  248   PDSDGAIDGHLREVGLTFHLLKDVPGLISKNIEKSLAEAFKPLGISDWNSLFWIAHPGGP  307

Query  1006  AILDRVEEKLGLEPEKLRASKDVLSEYGNLTSACVLFILDEMRKKSKKDEEMTTGEGLEW  1185
             AILD+VE+KL L+PEKLRA++ VLSEYGN++SACVLFILDEMRKKS +D   TTGEGLEW
Sbjct  308   AILDQVEQKLALKPEKLRATRHVLSEYGNMSSACVLFILDEMRKKSAEDGLKTTGEGLEW  367

Query  1186  GVVFVVCP  1209
             GV+F   P
Sbjct  368   GVLFGFGP  375



>gb|AIC75908.1| chalcone synthase [Hibiscus cannabinus]
Length=389

 Score =   537 bits (1383),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 251/368 (68%), Positives = 304/368 (83%), Gaps = 0/368 (0%)
 Frame = +1

Query  106   RRAKRFEGDAKILAIGTAIPANWVDQTTYPDFYFRITNSEHLLEHKEKFRRICNKSKIRK  285
             R+A+R EG A +LAIGT+ P N VDQ+TYPDFYFR+T SEH  E KEKF+R+C KS I+K
Sbjct  8     RKAQRAEGPATVLAIGTSTPPNCVDQSTYPDFYFRVTKSEHKAELKEKFKRMCEKSMIKK  67

Query  286   RHLVITEELLKKNPNLCTYNEASLNTRQDILVSEVPKLGKEAAMKAIKEWGRPISEITHL  465
             R++ +TE++LK+NPN+C Y   SL+ RQD++V EVPK GKEAA +AIKEWG+P S+ITHL
Sbjct  68    RYMYLTEDILKENPNVCEYMAPSLDARQDMVVVEVPKFGKEAATRAIKEWGQPKSKITHL  127

Query  466   VFCTSSGVDMPGADFQLAKLLGLSSSVKRLMMYQQGCNAGAAMLRLAKDLAENNKGARVL  645
             VFCT+SGVDMPGAD+QL KLLGL  SVKRLMMYQQGC AG  +LR+AKDLAENNKGARVL
Sbjct  128   VFCTTSGVDMPGADYQLTKLLGLRPSVKRLMMYQQGCFAGGTVLRVAKDLAENNKGARVL  187

Query  646   VVCSEVMLNVFRGPSLEQEDNLLAQCLFGDGSAAVIVGTEPRPGLETPLFELVSAAQTTI  825
             VVCSE+    FRGPS    D+L+ Q LFGDG+AAVI+G++P  G+E PLFELVSAAQT +
Sbjct  188   VVCSEITAVTFRGPSDTHLDSLVGQALFGDGAAAVIIGSDPVDGIEKPLFELVSAAQTIL  247

Query  826   PDTDSHLKLHLREMGLTFHCSKAVPSLITQNVEDCLVKAFEPFGISDWNSIFWILHPGGI  1005
             PD+D  +  HLRE+GLTFH  K VP LI++N+E  LV+AF+P GI+DWNS+FWI HPGG 
Sbjct  248   PDSDGAIDGHLREVGLTFHLLKDVPGLISKNIEKSLVEAFQPLGITDWNSLFWIAHPGGP  307

Query  1006  AILDRVEEKLGLEPEKLRASKDVLSEYGNLTSACVLFILDEMRKKSKKDEEMTTGEGLEW  1185
             AILD+VE KL L+PEKLRA++ VLSEYGN++SACVLFILDEMRKKSK+D   TTGEGLEW
Sbjct  308   AILDQVEAKLALKPEKLRATRHVLSEYGNMSSACVLFILDEMRKKSKEDGVQTTGEGLEW  367

Query  1186  GVVFVVCP  1209
             GV+F   P
Sbjct  368   GVLFGFGP  375



>gb|AGI02994.1| chalcone synthase [Camellia sinensis]
Length=389

 Score =   537 bits (1383),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 254/368 (69%), Positives = 303/368 (82%), Gaps = 0/368 (0%)
 Frame = +1

Query  106   RRAKRFEGDAKILAIGTAIPANWVDQTTYPDFYFRITNSEHLLEHKEKFRRICNKSKIRK  285
             RRA+R EG A ++AIGTA P N VDQ+TYPD+YFRITNSEH  E KEKF+R+C+KS I+K
Sbjct  8     RRAQRAEGPATVMAIGTATPPNCVDQSTYPDYYFRITNSEHKAELKEKFKRMCDKSMIKK  67

Query  286   RHLVITEELLKKNPNLCTYNEASLNTRQDILVSEVPKLGKEAAMKAIKEWGRPISEITHL  465
             R++ +TEE+LK+NP +C Y   SL+ RQD++V EVPKLGKEAA KAIKEWG+P S+ITHL
Sbjct  68    RYMYLTEEILKENPQVCEYMAPSLDARQDMVVVEVPKLGKEAATKAIKEWGQPKSKITHL  127

Query  466   VFCTSSGVDMPGADFQLAKLLGLSSSVKRLMMYQQGCNAGAAMLRLAKDLAENNKGARVL  645
             VFCT+SGVDMPGAD+QL KLLGL  SVKRLMMYQQGC AG  +LRLAKDLAENNKGARVL
Sbjct  128   VFCTTSGVDMPGADYQLTKLLGLRPSVKRLMMYQQGCFAGGTVLRLAKDLAENNKGARVL  187

Query  646   VVCSEVMLNVFRGPSLEQEDNLLAQCLFGDGSAAVIVGTEPRPGLETPLFELVSAAQTTI  825
             VVCSE+    FRGPS    D+L+ Q LFGDG+AA+IVG++P P +E PLFELVSAAQT +
Sbjct  188   VVCSEITAVTFRGPSDTHLDSLVGQALFGDGAAAIIVGSDPIPEVEKPLFELVSAAQTIL  247

Query  826   PDTDSHLKLHLREMGLTFHCSKAVPSLITQNVEDCLVKAFEPFGISDWNSIFWILHPGGI  1005
             PD+D  +  HLRE+GLTFH  K VP LI++N+E  L +AF+P GISDWNS+FWI HPGG 
Sbjct  248   PDSDGAIDGHLREVGLTFHLLKDVPGLISKNIEKSLAEAFQPLGISDWNSLFWIAHPGGP  307

Query  1006  AILDRVEEKLGLEPEKLRASKDVLSEYGNLTSACVLFILDEMRKKSKKDEEMTTGEGLEW  1185
             AILD+VE KLGL+ EKLRA++ VLSEYGN++SACVLFILDEMRK+S  D   TTGEGLEW
Sbjct  308   AILDQVELKLGLKEEKLRATRHVLSEYGNMSSACVLFILDEMRKESAADGLKTTGEGLEW  367

Query  1186  GVVFVVCP  1209
             GV+F   P
Sbjct  368   GVLFGFGP  375



>gb|AEO96985.1| chalcone synthase [Gossypium hirsutum]
Length=389

 Score =   536 bits (1382),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 253/368 (69%), Positives = 303/368 (82%), Gaps = 0/368 (0%)
 Frame = +1

Query  106   RRAKRFEGDAKILAIGTAIPANWVDQTTYPDFYFRITNSEHLLEHKEKFRRICNKSKIRK  285
             R+A+R EG A +LAIGT+ P N VDQ+TYPD+YFRITNSEH  E KEKF+R+C KS I+K
Sbjct  8     RKAQRAEGPATVLAIGTSTPPNCVDQSTYPDYYFRITNSEHKTELKEKFKRMCEKSMIKK  67

Query  286   RHLVITEELLKKNPNLCTYNEASLNTRQDILVSEVPKLGKEAAMKAIKEWGRPISEITHL  465
             R++ +TEE+LK+NPN+C Y   SL+ RQD++V EVP+LGKEAA KAIKEWG+P S+ITHL
Sbjct  68    RYMYLTEEILKENPNVCEYMAPSLDARQDMVVVEVPRLGKEAATKAIKEWGQPKSKITHL  127

Query  466   VFCTSSGVDMPGADFQLAKLLGLSSSVKRLMMYQQGCNAGAAMLRLAKDLAENNKGARVL  645
             VFCT+SGVDMPGAD+QL KLLGL  SVKRLMMYQQGC AG  +LR+AKDLAENNKGARVL
Sbjct  128   VFCTTSGVDMPGADYQLTKLLGLRPSVKRLMMYQQGCFAGGTVLRVAKDLAENNKGARVL  187

Query  646   VVCSEVMLNVFRGPSLEQEDNLLAQCLFGDGSAAVIVGTEPRPGLETPLFELVSAAQTTI  825
             VVCSE+    FRGPS    D+L+ Q LFGDG+AAVIVG +P   +E P+FELVSAAQT +
Sbjct  188   VVCSEITAVTFRGPSDTHLDSLVGQALFGDGAAAVIVGADPLSEIEKPMFELVSAAQTIL  247

Query  826   PDTDSHLKLHLREMGLTFHCSKAVPSLITQNVEDCLVKAFEPFGISDWNSIFWILHPGGI  1005
             PD+D  +  HLRE+GLTFH  K VP LI++N+E  L +AF+P GISDWNS+FWI HPGG 
Sbjct  248   PDSDGAIDGHLREVGLTFHLLKDVPGLISKNIEKSLAEAFQPLGISDWNSLFWIAHPGGP  307

Query  1006  AILDRVEEKLGLEPEKLRASKDVLSEYGNLTSACVLFILDEMRKKSKKDEEMTTGEGLEW  1185
             AILD+VE KL L+PEKLRA++ VLSEYGN++SACVLFILDEMRKKSK+D   TTGEGLEW
Sbjct  308   AILDQVEAKLALKPEKLRATRHVLSEYGNMSSACVLFILDEMRKKSKEDGLGTTGEGLEW  367

Query  1186  GVVFVVCP  1209
             GV+F   P
Sbjct  368   GVLFGFGP  375



>gb|AIA22214.1| chalcone synthase [Hibiscus cannabinus]
Length=389

 Score =   536 bits (1382),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 251/368 (68%), Positives = 304/368 (83%), Gaps = 0/368 (0%)
 Frame = +1

Query  106   RRAKRFEGDAKILAIGTAIPANWVDQTTYPDFYFRITNSEHLLEHKEKFRRICNKSKIRK  285
             R+A+R EG A +LAIGT+ P N VDQ+TYPDFYFR+T SEH  E KEKF+R+C KS I+K
Sbjct  8     RKAQRAEGPATVLAIGTSTPPNCVDQSTYPDFYFRVTKSEHKAELKEKFKRMCEKSMIKK  67

Query  286   RHLVITEELLKKNPNLCTYNEASLNTRQDILVSEVPKLGKEAAMKAIKEWGRPISEITHL  465
             R++ +TE++LK+NPN+C Y   SL+ RQD++V EVPKLGKEAA +AIKEWG+P S+ITHL
Sbjct  68    RYMYLTEDILKENPNVCEYKAPSLDARQDMVVVEVPKLGKEAATRAIKEWGQPKSKITHL  127

Query  466   VFCTSSGVDMPGADFQLAKLLGLSSSVKRLMMYQQGCNAGAAMLRLAKDLAENNKGARVL  645
             VFCT+SGVDMPGAD+QL KLLGL  SVKRLMMYQQGC AG  +LR+AKDLAENNKGARVL
Sbjct  128   VFCTTSGVDMPGADYQLTKLLGLRPSVKRLMMYQQGCFAGGTVLRVAKDLAENNKGARVL  187

Query  646   VVCSEVMLNVFRGPSLEQEDNLLAQCLFGDGSAAVIVGTEPRPGLETPLFELVSAAQTTI  825
             VVCSE+    FRGPS    D+L+ Q LFGDG+AAVI+G++P  G+E PLFELVSAAQT +
Sbjct  188   VVCSEITAVTFRGPSDTHLDSLVGQALFGDGAAAVIIGSDPVDGIEKPLFELVSAAQTIL  247

Query  826   PDTDSHLKLHLREMGLTFHCSKAVPSLITQNVEDCLVKAFEPFGISDWNSIFWILHPGGI  1005
             PD+D  +  HLRE+GLTF   K VP LI++N+E  LV+AF+P GI+DWNS+FWI HPGG 
Sbjct  248   PDSDGAIDGHLREVGLTFRLLKDVPGLISKNIEKSLVEAFQPLGITDWNSLFWIAHPGGP  307

Query  1006  AILDRVEEKLGLEPEKLRASKDVLSEYGNLTSACVLFILDEMRKKSKKDEEMTTGEGLEW  1185
             AILD+VE KL L+PEKLRA++ VLSEYGN++SACVLFILDEMRKKSK+D   TTGEGLEW
Sbjct  308   AILDQVEAKLALKPEKLRATRHVLSEYGNMSSACVLFILDEMRKKSKEDGVQTTGEGLEW  367

Query  1186  GVVFVVCP  1209
             GV+F   P
Sbjct  368   GVLFGFGP  375



>gb|AAM00232.1|AF358432_1 root-specific chalcone synthase [Senna alata]
Length=389

 Score =   536 bits (1382),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 251/368 (68%), Positives = 306/368 (83%), Gaps = 0/368 (0%)
 Frame = +1

Query  106   RRAKRFEGDAKILAIGTAIPANWVDQTTYPDFYFRITNSEHLLEHKEKFRRICNKSKIRK  285
             R+A+R EG A ++AIGTA PAN VDQ+TYPD+YFRITNSEH+ E KEKF+R+C+KS I+K
Sbjct  8     RKAQRAEGAATVMAIGTATPANCVDQSTYPDYYFRITNSEHMTELKEKFQRMCDKSMIKK  67

Query  286   RHLVITEELLKKNPNLCTYNEASLNTRQDILVSEVPKLGKEAAMKAIKEWGRPISEITHL  465
             R++ +TEE+LK+NPN+C Y   S++ RQDI+V EVPKLGKEAA KAIKEWG+P S+ITHL
Sbjct  68    RYMHLTEEILKENPNMCAYMAPSIDARQDIVVLEVPKLGKEAATKAIKEWGQPKSKITHL  127

Query  466   VFCTSSGVDMPGADFQLAKLLGLSSSVKRLMMYQQGCNAGAAMLRLAKDLAENNKGARVL  645
             +FCT+SGVDMPGAD+QL KLLGL  SVKR MMYQQGC AG  +LRLAKDLAENNKGARVL
Sbjct  128   IFCTTSGVDMPGADYQLTKLLGLRPSVKRYMMYQQGCFAGGTVLRLAKDLAENNKGARVL  187

Query  646   VVCSEVMLNVFRGPSLEQEDNLLAQCLFGDGSAAVIVGTEPRPGLETPLFELVSAAQTTI  825
             VVCSE+    FRGPS    D+L+ Q LFGDG+AAVIVG++P P +E PLFELV  AQT +
Sbjct  188   VVCSEITAVTFRGPSDTHLDSLVGQALFGDGAAAVIVGSDPIPEVEKPLFELVWTAQTIL  247

Query  826   PDTDSHLKLHLREMGLTFHCSKAVPSLITQNVEDCLVKAFEPFGISDWNSIFWILHPGGI  1005
             PD++  +  HLRE+GLTFH  K VP LI++N+E  LV+AF+P GISD+NSIFWI HPGG 
Sbjct  248   PDSEGAIDGHLREVGLTFHLLKDVPGLISKNIEKALVEAFKPLGISDYNSIFWIAHPGGP  307

Query  1006  AILDRVEEKLGLEPEKLRASKDVLSEYGNLTSACVLFILDEMRKKSKKDEEMTTGEGLEW  1185
             AILD+VE KLGL+PEK++A++ VLSEYGN++SACVLFI+DEMR+KS KD   TTGEGLEW
Sbjct  308   AILDQVEAKLGLKPEKMQATRHVLSEYGNMSSACVLFIMDEMRRKSTKDGLGTTGEGLEW  367

Query  1186  GVVFVVCP  1209
             GV+F   P
Sbjct  368   GVLFGFGP  375



>emb|CAC19808.1| chalcone synthase [Humulus lupulus]
Length=389

 Score =   536 bits (1381),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 254/368 (69%), Positives = 303/368 (82%), Gaps = 0/368 (0%)
 Frame = +1

Query  106   RRAKRFEGDAKILAIGTAIPANWVDQTTYPDFYFRITNSEHLLEHKEKFRRICNKSKIRK  285
             R+A+R EG A ILAIGTA PAN + Q+ YPD+YFRITNSEH  E KEKF+R+C KS IRK
Sbjct  8     RKAQRAEGPATILAIGTATPANCILQSEYPDYYFRITNSEHKTELKEKFKRMCGKSMIRK  67

Query  286   RHLVITEELLKKNPNLCTYNEASLNTRQDILVSEVPKLGKEAAMKAIKEWGRPISEITHL  465
             R++ +TEE+LK+NPNLC Y   SL+ RQD++V EVPKLGKEAA KAIKEWG+P SEITH+
Sbjct  68    RYMHLTEEILKENPNLCAYEAPSLDARQDMVVVEVPKLGKEAATKAIKEWGQPKSEITHV  127

Query  466   VFCTSSGVDMPGADFQLAKLLGLSSSVKRLMMYQQGCNAGAAMLRLAKDLAENNKGARVL  645
             VFCT+SGVDMPGAD+QL KLLGL  SVKRLMMYQQGC AG  +LR+AKDLAENNKGARVL
Sbjct  128   VFCTTSGVDMPGADYQLTKLLGLRPSVKRLMMYQQGCFAGGTVLRVAKDLAENNKGARVL  187

Query  646   VVCSEVMLNVFRGPSLEQEDNLLAQCLFGDGSAAVIVGTEPRPGLETPLFELVSAAQTTI  825
             VVCSE+    FRGP+    D+L+AQ LFGDGSAA+I+G +P P +E P+FELVSAAQT +
Sbjct  188   VVCSEITAVTFRGPNDTHLDSLVAQALFGDGSAALIIGADPIPEIEKPIFELVSAAQTIL  247

Query  826   PDTDSHLKLHLREMGLTFHCSKAVPSLITQNVEDCLVKAFEPFGISDWNSIFWILHPGGI  1005
             PD+D  +  HLRE+GLTFH  K VP LI++N+E  LV+AF+P GISDWNS+FWI HPGG 
Sbjct  248   PDSDGAIDGHLREVGLTFHLLKDVPGLISKNIEKSLVEAFKPLGISDWNSLFWITHPGGP  307

Query  1006  AILDRVEEKLGLEPEKLRASKDVLSEYGNLTSACVLFILDEMRKKSKKDEEMTTGEGLEW  1185
             AILD+VE KLGL+PEKLRA++ VL EYGN++SACVLFILDEMR+K  +D   TTGEGLEW
Sbjct  308   AILDQVESKLGLKPEKLRATRHVLGEYGNMSSACVLFILDEMRRKCAEDGVKTTGEGLEW  367

Query  1186  GVVFVVCP  1209
             GV+F   P
Sbjct  368   GVLFGFGP  375



>gb|ADW11243.1| chalcone synthase 2 [Camellia chekiangoleosa]
 gb|AFC37243.1| chalcone synthase 2 [Camellia chekiangoleosa]
Length=389

 Score =   536 bits (1381),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 254/368 (69%), Positives = 303/368 (82%), Gaps = 0/368 (0%)
 Frame = +1

Query  106   RRAKRFEGDAKILAIGTAIPANWVDQTTYPDFYFRITNSEHLLEHKEKFRRICNKSKIRK  285
             RRA+R EG A ++AIGTA P N VDQ+TYPD+YFRITNSEH  E KEKF+R+C+KS I+K
Sbjct  8     RRAQRAEGPATVMAIGTATPPNCVDQSTYPDYYFRITNSEHKTELKEKFQRMCDKSMIKK  67

Query  286   RHLVITEELLKKNPNLCTYNEASLNTRQDILVSEVPKLGKEAAMKAIKEWGRPISEITHL  465
             R++ +TEE+LK+NPN+C Y   SL+ RQD++V EVPKLGKEAA KAIKEWG+P S+ITHL
Sbjct  68    RYMYLTEEILKENPNVCAYMAPSLDARQDMVVVEVPKLGKEAATKAIKEWGQPKSKITHL  127

Query  466   VFCTSSGVDMPGADFQLAKLLGLSSSVKRLMMYQQGCNAGAAMLRLAKDLAENNKGARVL  645
             VFCT+SGVDMPGAD+QL KLLGL  SVKRLMMYQQGC AG  +LRLAKDLAENNKGARVL
Sbjct  128   VFCTTSGVDMPGADYQLTKLLGLRPSVKRLMMYQQGCFAGGTVLRLAKDLAENNKGARVL  187

Query  646   VVCSEVMLNVFRGPSLEQEDNLLAQCLFGDGSAAVIVGTEPRPGLETPLFELVSAAQTTI  825
             VVCSE+    FRGPS    D+L+ Q LFGDG+AA+IVG++P P +E PLFELVSAAQT +
Sbjct  188   VVCSEITAVTFRGPSDAHLDSLVGQALFGDGAAAIIVGSDPIPEVEKPLFELVSAAQTIL  247

Query  826   PDTDSHLKLHLREMGLTFHCSKAVPSLITQNVEDCLVKAFEPFGISDWNSIFWILHPGGI  1005
             PD+D  +  HLRE+GLTFH  K VP LI++NVE  L +AF+P  I+DWNS+FWI HPGG 
Sbjct  248   PDSDGAIDGHLREVGLTFHLLKDVPGLISKNVEKSLNEAFQPLNITDWNSLFWIAHPGGP  307

Query  1006  AILDRVEEKLGLEPEKLRASKDVLSEYGNLTSACVLFILDEMRKKSKKDEEMTTGEGLEW  1185
             AILD+VE KL L+PEKLRA++ VLSEYGN++SACVLFILDEMRK S K+   TTGEGLEW
Sbjct  308   AILDQVELKLALKPEKLRATRHVLSEYGNMSSACVLFILDEMRKSSAKEGLKTTGEGLEW  367

Query  1186  GVVFVVCP  1209
             GV+F   P
Sbjct  368   GVLFGFGP  375



>gb|AAM00230.1|AF358430_1 root-specific chalcone synthase [Senna alata]
Length=389

 Score =   536 bits (1381),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 250/368 (68%), Positives = 306/368 (83%), Gaps = 0/368 (0%)
 Frame = +1

Query  106   RRAKRFEGDAKILAIGTAIPANWVDQTTYPDFYFRITNSEHLLEHKEKFRRICNKSKIRK  285
             R+A+R EG A ++AIGTA PAN V+Q+TYPD+YFR+TNSEH+ E KEKF+R+C+KS I+K
Sbjct  8     RKAQRAEGAATVMAIGTATPANCVEQSTYPDYYFRVTNSEHMTELKEKFQRMCDKSMIKK  67

Query  286   RHLVITEELLKKNPNLCTYNEASLNTRQDILVSEVPKLGKEAAMKAIKEWGRPISEITHL  465
             R++ +TEE+LK+NPN+C Y   S++ RQDI+V EVPKLGKEAA KAIKEWG+P S+ITHL
Sbjct  68    RYMHLTEEILKENPNMCAYMAPSIDARQDIVVLEVPKLGKEAATKAIKEWGQPKSKITHL  127

Query  466   VFCTSSGVDMPGADFQLAKLLGLSSSVKRLMMYQQGCNAGAAMLRLAKDLAENNKGARVL  645
             +FCT+SGVDMPGAD+QL KLLGL  SVKR MMYQQGC AG  +LRLAKDLAENNKGARVL
Sbjct  128   IFCTTSGVDMPGADYQLTKLLGLRPSVKRYMMYQQGCFAGGTVLRLAKDLAENNKGARVL  187

Query  646   VVCSEVMLNVFRGPSLEQEDNLLAQCLFGDGSAAVIVGTEPRPGLETPLFELVSAAQTTI  825
             VVCSE+    FRGPS    D+L+ Q LFGDG+AAVIVG++P P +ETPLFELV  AQT +
Sbjct  188   VVCSEITAVTFRGPSDTHLDSLVGQALFGDGAAAVIVGSDPIPQVETPLFELVWTAQTIL  247

Query  826   PDTDSHLKLHLREMGLTFHCSKAVPSLITQNVEDCLVKAFEPFGISDWNSIFWILHPGGI  1005
             PD++  +  HLRE+GLTFH  K VP LI++N+E  LV+AF P GISD+NSIFWI HPGG 
Sbjct  248   PDSEGAIDGHLREVGLTFHLLKDVPGLISKNIEKALVEAFNPLGISDYNSIFWIAHPGGP  307

Query  1006  AILDRVEEKLGLEPEKLRASKDVLSEYGNLTSACVLFILDEMRKKSKKDEEMTTGEGLEW  1185
             AILD+VE KLGL+PEK++A++ VLSEYGN++SACVLFI+DEMR+KS KD   TTGEGLEW
Sbjct  308   AILDQVEAKLGLKPEKMQATRHVLSEYGNMSSACVLFIMDEMRRKSTKDGLGTTGEGLEW  367

Query  1186  GVVFVVCP  1209
             GV+F   P
Sbjct  368   GVLFGFGP  375



>gb|AGW22222.1| chalcone synthase [Abelmoschus esculentus]
Length=389

 Score =   536 bits (1380),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 252/368 (68%), Positives = 304/368 (83%), Gaps = 0/368 (0%)
 Frame = +1

Query  106   RRAKRFEGDAKILAIGTAIPANWVDQTTYPDFYFRITNSEHLLEHKEKFRRICNKSKIRK  285
             R+A+R EG A +LAIGT+ P N VDQ+TYPD+YFRIT+SEH  E KEKF+R+C KS I+K
Sbjct  8     RKAQRAEGPATVLAIGTSTPPNCVDQSTYPDYYFRITSSEHKTELKEKFKRMCEKSMIKK  67

Query  286   RHLVITEELLKKNPNLCTYNEASLNTRQDILVSEVPKLGKEAAMKAIKEWGRPISEITHL  465
             R++ +TEE+LK+NPN+C Y   SL+ RQD++V EVPKLGKEAA KAIKEWG+P S+ITHL
Sbjct  68    RYMYLTEEILKENPNVCEYMAPSLDARQDMVVVEVPKLGKEAATKAIKEWGQPKSKITHL  127

Query  466   VFCTSSGVDMPGADFQLAKLLGLSSSVKRLMMYQQGCNAGAAMLRLAKDLAENNKGARVL  645
             VFCT+SGVDMPGAD+QL KLLGL  SVKRLMMYQQGC AG  +LR+AKDLAENNKGARVL
Sbjct  128   VFCTTSGVDMPGADYQLTKLLGLRPSVKRLMMYQQGCFAGGTVLRVAKDLAENNKGARVL  187

Query  646   VVCSEVMLNVFRGPSLEQEDNLLAQCLFGDGSAAVIVGTEPRPGLETPLFELVSAAQTTI  825
             VVCSE+    FRGPS    D+L+ Q LFGDG+AAVI+G +P P +E P+FELVSAAQT +
Sbjct  188   VVCSEITAVTFRGPSDTHLDSLVGQALFGDGAAAVIIGADPIPEIEKPMFELVSAAQTIL  247

Query  826   PDTDSHLKLHLREMGLTFHCSKAVPSLITQNVEDCLVKAFEPFGISDWNSIFWILHPGGI  1005
             PD+D  +  HLRE+GLTFH  K VP LI++N+E  LV+AF+P GISDWNS+FWI HPGG 
Sbjct  248   PDSDGAIDGHLREVGLTFHLLKDVPGLISKNIEKSLVEAFQPLGISDWNSLFWIAHPGGP  307

Query  1006  AILDRVEEKLGLEPEKLRASKDVLSEYGNLTSACVLFILDEMRKKSKKDEEMTTGEGLEW  1185
             AILD+VE KL L+PEKLRA++ VLSEYGN++SACVLFILDEMRK SK++   TTGEGLEW
Sbjct  308   AILDQVEAKLALKPEKLRATRHVLSEYGNMSSACVLFILDEMRKSSKENGLGTTGEGLEW  367

Query  1186  GVVFVVCP  1209
             GV+F   P
Sbjct  368   GVLFGFGP  375



>gb|ACE60221.1| chalcone synthase [Abelmoschus manihot]
Length=389

 Score =   536 bits (1380),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 252/368 (68%), Positives = 303/368 (82%), Gaps = 0/368 (0%)
 Frame = +1

Query  106   RRAKRFEGDAKILAIGTAIPANWVDQTTYPDFYFRITNSEHLLEHKEKFRRICNKSKIRK  285
             R+A+R EG A +LAIGT+ P N VDQ+TYPD+YFRIT SEH  E KEKF+R+C KS I+K
Sbjct  8     RKAQRAEGPATVLAIGTSTPPNCVDQSTYPDYYFRITKSEHKTELKEKFKRMCEKSMIKK  67

Query  286   RHLVITEELLKKNPNLCTYNEASLNTRQDILVSEVPKLGKEAAMKAIKEWGRPISEITHL  465
             R++ +TEE+LK+NPN+C Y   SL+ RQD++V EVPKLGKEAA KAIKEWG+P S+ITHL
Sbjct  68    RYMYLTEEILKENPNVCEYMAPSLDARQDMVVVEVPKLGKEAATKAIKEWGQPKSKITHL  127

Query  466   VFCTSSGVDMPGADFQLAKLLGLSSSVKRLMMYQQGCNAGAAMLRLAKDLAENNKGARVL  645
             VFCT+SGVDMPGAD+QL KLLGL  SVKRLMMYQQGC AG  +LR+AKDLAENNKGARVL
Sbjct  128   VFCTTSGVDMPGADYQLTKLLGLRPSVKRLMMYQQGCFAGGTVLRVAKDLAENNKGARVL  187

Query  646   VVCSEVMLNVFRGPSLEQEDNLLAQCLFGDGSAAVIVGTEPRPGLETPLFELVSAAQTTI  825
             VVCSE+    FRGPS    D+L+ Q LFGDG+AAVI+G +P P +E P+FELVSAAQT +
Sbjct  188   VVCSEITAVTFRGPSDTHLDSLVGQALFGDGAAAVIIGADPIPEIEKPMFELVSAAQTIL  247

Query  826   PDTDSHLKLHLREMGLTFHCSKAVPSLITQNVEDCLVKAFEPFGISDWNSIFWILHPGGI  1005
             PD+D  +  HLRE+GLTFH  K VP LI++N+E  LV+AF+P GISDWNS+FWI HPGG 
Sbjct  248   PDSDGAIDGHLREVGLTFHLLKDVPGLISKNIEKSLVEAFQPLGISDWNSLFWIAHPGGP  307

Query  1006  AILDRVEEKLGLEPEKLRASKDVLSEYGNLTSACVLFILDEMRKKSKKDEEMTTGEGLEW  1185
             AILD+VE KL L+PEKLRA++ VLSEYGN++SACVLFILDEMRK SK++   TTGEGLEW
Sbjct  308   AILDQVEAKLALKPEKLRATRHVLSEYGNMSSACVLFILDEMRKSSKENGLGTTGEGLEW  367

Query  1186  GVVFVVCP  1209
             GV+F   P
Sbjct  368   GVLFGFGP  375



>gb|AGH13332.1| chalcone synthase [Rhus chinensis]
Length=390

 Score =   535 bits (1378),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 252/368 (68%), Positives = 303/368 (82%), Gaps = 0/368 (0%)
 Frame = +1

Query  106   RRAKRFEGDAKILAIGTAIPANWVDQTTYPDFYFRITNSEHLLEHKEKFRRICNKSKIRK  285
             R+A+R EG A ++AIGTA P N VDQ+TYPD+YFRITNSEH  E KEKF+R+C KS I+K
Sbjct  8     RKAQRAEGPATVMAIGTATPPNCVDQSTYPDYYFRITNSEHKTELKEKFKRMCEKSMIKK  67

Query  286   RHLVITEELLKKNPNLCTYNEASLNTRQDILVSEVPKLGKEAAMKAIKEWGRPISEITHL  465
             R++ +TEE+LK+NP +C Y   SL+ RQD++V EVPKLGKEAA KAIKEWG+P S+ITHL
Sbjct  68    RYMYLTEEILKENPAVCEYMAPSLDARQDMVVVEVPKLGKEAATKAIKEWGQPKSKITHL  127

Query  466   VFCTSSGVDMPGADFQLAKLLGLSSSVKRLMMYQQGCNAGAAMLRLAKDLAENNKGARVL  645
             VFCT+SGVDMPGAD+QL KLLGL  SVKR MMYQQGC AG  +LRLAKDLAENNKGARVL
Sbjct  128   VFCTTSGVDMPGADYQLTKLLGLRPSVKRYMMYQQGCFAGGTVLRLAKDLAENNKGARVL  187

Query  646   VVCSEVMLNVFRGPSLEQEDNLLAQCLFGDGSAAVIVGTEPRPGLETPLFELVSAAQTTI  825
             VVCSE+    FRGP+    D+L+ Q LFGDG+AAVIVG++P PG+E P+FELVS AQT +
Sbjct  188   VVCSEITAVTFRGPTDTHLDSLVGQALFGDGAAAVIVGSDPVPGVEKPMFELVSTAQTIL  247

Query  826   PDTDSHLKLHLREMGLTFHCSKAVPSLITQNVEDCLVKAFEPFGISDWNSIFWILHPGGI  1005
             PD+D  +  HLRE+GLTFH  K VP LI++N+E  LV+AF+P GISDWNS+FWI HPGG 
Sbjct  248   PDSDGAIDGHLREVGLTFHLLKDVPGLISKNIEKSLVEAFQPLGISDWNSLFWIAHPGGP  307

Query  1006  AILDRVEEKLGLEPEKLRASKDVLSEYGNLTSACVLFILDEMRKKSKKDEEMTTGEGLEW  1185
             AILD+VE KLGL+ EKLRA++ VLSEYGN++SACVLFILDEMRKKS ++   TTGEGLEW
Sbjct  308   AILDQVEIKLGLKEEKLRATRHVLSEYGNMSSACVLFILDEMRKKSTENGLKTTGEGLEW  367

Query  1186  GVVFVVCP  1209
             GV+F   P
Sbjct  368   GVLFGFGP  375



>gb|AAO13091.1| chalcone synthase [Camellia sinensis]
Length=389

 Score =   535 bits (1378),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 254/368 (69%), Positives = 302/368 (82%), Gaps = 0/368 (0%)
 Frame = +1

Query  106   RRAKRFEGDAKILAIGTAIPANWVDQTTYPDFYFRITNSEHLLEHKEKFRRICNKSKIRK  285
             RRA+R EG A ++AIGTA P N VDQ+TYPD+YFRITNSEH  E KEKF+R+C+KS I+K
Sbjct  8     RRAQRAEGPATVMAIGTATPPNCVDQSTYPDYYFRITNSEHKAELKEKFKRMCDKSMIKK  67

Query  286   RHLVITEELLKKNPNLCTYNEASLNTRQDILVSEVPKLGKEAAMKAIKEWGRPISEITHL  465
             R++ +TEE+LK+NP +C Y   SL+ RQD++V EVPKLGKEAA KAIKEWG+P S+ITHL
Sbjct  68    RYMYLTEEILKENPQVCGYMAPSLDARQDMVVVEVPKLGKEAATKAIKEWGQPKSKITHL  127

Query  466   VFCTSSGVDMPGADFQLAKLLGLSSSVKRLMMYQQGCNAGAAMLRLAKDLAENNKGARVL  645
             VFCT+SGVDMPGAD+QL KLLGL  SVKRLMMYQQGC AG  +LRLAKDLAENNKGARVL
Sbjct  128   VFCTTSGVDMPGADYQLTKLLGLRPSVKRLMMYQQGCFAGGTVLRLAKDLAENNKGARVL  187

Query  646   VVCSEVMLNVFRGPSLEQEDNLLAQCLFGDGSAAVIVGTEPRPGLETPLFELVSAAQTTI  825
             VVCS +    FRGPS    D+L+ Q LFGDG+AA+IVG++P P +E PLFELVSAAQT +
Sbjct  188   VVCSGITAVTFRGPSDTHLDSLVGQALFGDGAAAIIVGSDPIPEVENPLFELVSAAQTIL  247

Query  826   PDTDSHLKLHLREMGLTFHCSKAVPSLITQNVEDCLVKAFEPFGISDWNSIFWILHPGGI  1005
             PD+D  +  HLRE+GLTFH  K VP LI++N+E  L +AF+P GISDWNS+FWI HPGG 
Sbjct  248   PDSDGAIDGHLREVGLTFHLLKDVPGLISKNIEKSLAEAFQPLGISDWNSLFWIAHPGGP  307

Query  1006  AILDRVEEKLGLEPEKLRASKDVLSEYGNLTSACVLFILDEMRKKSKKDEEMTTGEGLEW  1185
             AILD+VE KLGL+ EKLRA++ VLSEYGN++SACVLFILDEMRKKS  D   TTGEGLEW
Sbjct  308   AILDQVELKLGLKEEKLRATRHVLSEYGNMSSACVLFILDEMRKKSAADGLKTTGEGLEW  367

Query  1186  GVVFVVCP  1209
             GV+F   P
Sbjct  368   GVLFGFGP  375



>ref|XP_002299282.1| naregenin-chalcone synthase family protein [Populus trichocarpa]
 gb|ABK95125.1| unknown [Populus trichocarpa]
 gb|EEE84087.1| naregenin-chalcone synthase family protein [Populus trichocarpa]
Length=390

 Score =   535 bits (1378),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 252/368 (68%), Positives = 305/368 (83%), Gaps = 0/368 (0%)
 Frame = +1

Query  106   RRAKRFEGDAKILAIGTAIPANWVDQTTYPDFYFRITNSEHLLEHKEKFRRICNKSKIRK  285
             R+A+R EG A ILAIGT+ P N VDQ+TYPD+YFRITNSEH +E KEKF+R+C KS I+K
Sbjct  8     RKAQRAEGPAVILAIGTSTPPNCVDQSTYPDYYFRITNSEHKVELKEKFKRMCEKSMIKK  67

Query  286   RHLVITEELLKKNPNLCTYNEASLNTRQDILVSEVPKLGKEAAMKAIKEWGRPISEITHL  465
             R++ +TEE+LK+NP++C Y   SL+ RQD++V EVPKLGKEAA KAIKEWG+P S+ITHL
Sbjct  68    RYMHLTEEILKENPSVCEYMAPSLDARQDMVVVEVPKLGKEAAAKAIKEWGQPKSKITHL  127

Query  466   VFCTSSGVDMPGADFQLAKLLGLSSSVKRLMMYQQGCNAGAAMLRLAKDLAENNKGARVL  645
             VFCT+SGVDMPGAD+QL KLLGL SSVKR MMYQQGC AG  +LRLAKDLAENNKGARVL
Sbjct  128   VFCTTSGVDMPGADYQLTKLLGLRSSVKRFMMYQQGCFAGGTVLRLAKDLAENNKGARVL  187

Query  646   VVCSEVMLNVFRGPSLEQEDNLLAQCLFGDGSAAVIVGTEPRPGLETPLFELVSAAQTTI  825
             VVCSE+    FRGPS    D+L+ Q LFGDG+AA+I+G++P  G+E PLFELVSAAQT +
Sbjct  188   VVCSEITAVTFRGPSDTHLDSLVGQALFGDGAAAIIIGSDPVLGVEKPLFELVSAAQTIL  247

Query  826   PDTDSHLKLHLREMGLTFHCSKAVPSLITQNVEDCLVKAFEPFGISDWNSIFWILHPGGI  1005
             PD+D  +  HLRE+GLTFH  K VP LI++N+E  L +AF+P GISDWNS+FWI HPGG 
Sbjct  248   PDSDGAIDGHLREVGLTFHLLKDVPGLISKNIEKSLTEAFKPLGISDWNSLFWIAHPGGP  307

Query  1006  AILDRVEEKLGLEPEKLRASKDVLSEYGNLTSACVLFILDEMRKKSKKDEEMTTGEGLEW  1185
             AILD+VE KL L+PEKLRA++ VL++YGN++SACVLFILDEMRKKS KD   +TGEGLEW
Sbjct  308   AILDQVEAKLELKPEKLRATRQVLADYGNMSSACVLFILDEMRKKSAKDGLKSTGEGLEW  367

Query  1186  GVVFVVCP  1209
             GV+F   P
Sbjct  368   GVLFGFGP  375



>ref|XP_011034457.1| PREDICTED: chalcone synthase 1-like [Populus euphratica]
Length=390

 Score =   535 bits (1377),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 251/368 (68%), Positives = 303/368 (82%), Gaps = 0/368 (0%)
 Frame = +1

Query  106   RRAKRFEGDAKILAIGTAIPANWVDQTTYPDFYFRITNSEHLLEHKEKFRRICNKSKIRK  285
             R+A+R EG A ILAIGT+ P N VDQ+TYPD+YFRITNSEH +E KEKF+R+C KS I+K
Sbjct  8     RKAQRAEGPAAILAIGTSTPPNCVDQSTYPDYYFRITNSEHKVELKEKFKRMCEKSMIKK  67

Query  286   RHLVITEELLKKNPNLCTYNEASLNTRQDILVSEVPKLGKEAAMKAIKEWGRPISEITHL  465
             R++ +TEE+LK+NP++C Y   SL+ RQD++V EVPKLGKEAA KAIKEWG+P S+ITHL
Sbjct  68    RYMHLTEEILKENPSICEYRAPSLDARQDMVVVEVPKLGKEAAAKAIKEWGQPKSKITHL  127

Query  466   VFCTSSGVDMPGADFQLAKLLGLSSSVKRLMMYQQGCNAGAAMLRLAKDLAENNKGARVL  645
             VFCT+SGVDMPGAD+QL KLLGL  SVKR MMYQQGC AG  +LRLAKDLAENNKGARVL
Sbjct  128   VFCTTSGVDMPGADYQLTKLLGLRPSVKRFMMYQQGCFAGGTVLRLAKDLAENNKGARVL  187

Query  646   VVCSEVMLNVFRGPSLEQEDNLLAQCLFGDGSAAVIVGTEPRPGLETPLFELVSAAQTTI  825
             VVCSE+    FRGPS    D+L+ Q LFGDG+AA+I+G +P P +E PLFELVSAAQT +
Sbjct  188   VVCSEITAVTFRGPSDTHLDSLVGQALFGDGAAAIIIGADPVPAIEKPLFELVSAAQTIL  247

Query  826   PDTDSHLKLHLREMGLTFHCSKAVPSLITQNVEDCLVKAFEPFGISDWNSIFWILHPGGI  1005
             PD+D  +  HLRE+GLTFH  K VP LI++NVE  L +AF+P GISDWNS+FWI HPGG 
Sbjct  248   PDSDGAIDGHLREVGLTFHLLKDVPGLISKNVEKSLTEAFKPLGISDWNSLFWIAHPGGP  307

Query  1006  AILDRVEEKLGLEPEKLRASKDVLSEYGNLTSACVLFILDEMRKKSKKDEEMTTGEGLEW  1185
             AILD+VE KL L+PEKLRA++ VL++YGN++SACVLFILDEMRKKS +D   +TGEGLEW
Sbjct  308   AILDQVEAKLELKPEKLRATRQVLADYGNMSSACVLFILDEMRKKSAEDGLKSTGEGLEW  367

Query  1186  GVVFVVCP  1209
             GV+F   P
Sbjct  368   GVLFGFGP  375



>sp|Q43163.1|CHSB_SOLTU RecName: Full=Chalcone synthase 1B; AltName: Full=Naringenin-chalcone 
synthase 1B [Solanum tuberosum]
 gb|AAB67735.1| chalcone synthase 1b [Solanum tuberosum]
Length=389

 Score =   534 bits (1376),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 253/368 (69%), Positives = 306/368 (83%), Gaps = 0/368 (0%)
 Frame = +1

Query  106   RRAKRFEGDAKILAIGTAIPANWVDQTTYPDFYFRITNSEHLLEHKEKFRRICNKSKIRK  285
             R+A+R EG A ILAIGT+ P+N VDQ+TYPD+YFRITNSEH  E KEKF+R+C+KS I+K
Sbjct  8     RKAQRAEGPATILAIGTSTPSNCVDQSTYPDYYFRITNSEHKTELKEKFKRMCDKSMIKK  67

Query  286   RHLVITEELLKKNPNLCTYNEASLNTRQDILVSEVPKLGKEAAMKAIKEWGRPISEITHL  465
             R++ +TEE+LK+NPN+C Y   SL+ RQDI+V EVPKLGKEAA KAIKEWG+P S+ITHL
Sbjct  68    RYMHLTEEILKENPNMCAYMAPSLDARQDIVVVEVPKLGKEAAQKAIKEWGQPKSKITHL  127

Query  466   VFCTSSGVDMPGADFQLAKLLGLSSSVKRLMMYQQGCNAGAAMLRLAKDLAENNKGARVL  645
             VFCT+SGVDMPG D+QLAKLLGL  SVKRLMMYQQGC AG  +LRLAKDLAENNKGARVL
Sbjct  128   VFCTTSGVDMPGCDYQLAKLLGLRPSVKRLMMYQQGCFAGGTVLRLAKDLAENNKGARVL  187

Query  646   VVCSEVMLNVFRGPSLEQEDNLLAQCLFGDGSAAVIVGTEPRPGLETPLFELVSAAQTTI  825
             VVCSE+    FRGPS    D+L+ Q LFGDG+AA+I+G++P  G+E PLFELVSAAQT +
Sbjct  188   VVCSEITAVTFRGPSESHLDSLVGQALFGDGAAAIIMGSDPIIGVERPLFELVSAAQTLV  247

Query  826   PDTDSHLKLHLREMGLTFHCSKAVPSLITQNVEDCLVKAFEPFGISDWNSIFWILHPGGI  1005
             PD++  +  HLRE+GLTFH  K VP LI++N+E  L++AF+P GISDWNS+FWI HPGG 
Sbjct  248   PDSEGAIDGHLREVGLTFHLLKDVPGLISKNIEKSLLEAFQPLGISDWNSLFWIAHPGGP  307

Query  1006  AILDRVEEKLGLEPEKLRASKDVLSEYGNLTSACVLFILDEMRKKSKKDEEMTTGEGLEW  1185
             AILD+VE KLGL+ EKLRA+++VLS YGN++SACVLFILDEMRK S K+   TTGEGLEW
Sbjct  308   AILDQVELKLGLKQEKLRATREVLSNYGNMSSACVLFILDEMRKASTKEGLGTTGEGLEW  367

Query  1186  GVVFVVCP  1209
             GV+F   P
Sbjct  368   GVLFGFGP  375



>sp|P48387.1|CHS2_CAMSI RecName: Full=Chalcone synthase 2; AltName: Full=Naringenin-chalcone 
synthase 2 [Camellia sinensis]
 dbj|BAA05641.1| chalcone synthase [Camellia sinensis]
 gb|AGI02995.1| chalcone synthase [Camellia sinensis]
Length=389

 Score =   534 bits (1375),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 252/368 (68%), Positives = 302/368 (82%), Gaps = 0/368 (0%)
 Frame = +1

Query  106   RRAKRFEGDAKILAIGTAIPANWVDQTTYPDFYFRITNSEHLLEHKEKFRRICNKSKIRK  285
             RRA+R EG A ++AIGTA P N VDQ+TYPD+YFRITNSEH  E KEKF+R+C+KS I+K
Sbjct  8     RRAQRAEGPATVMAIGTATPPNCVDQSTYPDYYFRITNSEHKTELKEKFQRMCDKSMIKK  67

Query  286   RHLVITEELLKKNPNLCTYNEASLNTRQDILVSEVPKLGKEAAMKAIKEWGRPISEITHL  465
             R++ +TEE+LK+NPN+C Y   SL+ RQD++V EVPKLGKEAA KAIKEWG+P S+ITHL
Sbjct  68    RYMYLTEEILKENPNVCAYMAPSLDARQDMVVVEVPKLGKEAATKAIKEWGQPKSKITHL  127

Query  466   VFCTSSGVDMPGADFQLAKLLGLSSSVKRLMMYQQGCNAGAAMLRLAKDLAENNKGARVL  645
             VFCT+SGVDMPGAD+QL KLLGL  SVKRLMMYQQGC AG  +LRLAKDLAENNKGARVL
Sbjct  128   VFCTTSGVDMPGADYQLTKLLGLRPSVKRLMMYQQGCFAGGTVLRLAKDLAENNKGARVL  187

Query  646   VVCSEVMLNVFRGPSLEQEDNLLAQCLFGDGSAAVIVGTEPRPGLETPLFELVSAAQTTI  825
             VVCSE+    FRGPS    D+L+ Q LFGDG+AA+IVG++P P +E PLFELVSAAQT +
Sbjct  188   VVCSEITAVTFRGPSDAHLDSLVGQALFGDGAAAIIVGSDPIPEVEKPLFELVSAAQTIL  247

Query  826   PDTDSHLKLHLREMGLTFHCSKAVPSLITQNVEDCLVKAFEPFGISDWNSIFWILHPGGI  1005
             PD+D  +  HLRE+GLTFH  K VP LI++N+E  L +AF+P  I+DWNS+FWI HPGG 
Sbjct  248   PDSDGAIDGHLREVGLTFHLLKDVPGLISKNIEKSLNEAFQPLNITDWNSLFWIAHPGGP  307

Query  1006  AILDRVEEKLGLEPEKLRASKDVLSEYGNLTSACVLFILDEMRKKSKKDEEMTTGEGLEW  1185
             AILD+VE KL L+PEKLRA++ VLSEYGN++SACVLFILDEMRK S K    TTGEGL+W
Sbjct  308   AILDQVELKLALKPEKLRATRHVLSEYGNMSSACVLFILDEMRKSSAKKGLKTTGEGLDW  367

Query  1186  GVVFVVCP  1209
             GV+F   P
Sbjct  368   GVLFGFGP  375



>sp|Q9ZRS4.1|CHSY_CATRO RecName: Full=Chalcone synthase; AltName: Full=Naringenin-chalcone 
synthase [Catharanthus roseus]
 emb|CAA10511.1| chalcone synthase [Catharanthus roseus]
Length=389

 Score =   534 bits (1375),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 253/368 (69%), Positives = 303/368 (82%), Gaps = 0/368 (0%)
 Frame = +1

Query  106   RRAKRFEGDAKILAIGTAIPANWVDQTTYPDFYFRITNSEHLLEHKEKFRRICNKSKIRK  285
             R A+R +G A +LAIGT+ P+N VDQ+TYPD+YFRITNSEH  E KEKF+R+C KS I+K
Sbjct  8     RNAQRAQGPATVLAIGTSTPSNCVDQSTYPDYYFRITNSEHKTELKEKFKRMCEKSMIKK  67

Query  286   RHLVITEELLKKNPNLCTYNEASLNTRQDILVSEVPKLGKEAAMKAIKEWGRPISEITHL  465
             R++ +TEE+L++NPN+C Y   SL+ RQ+I+V EVPKLGKEAA KAIKEWG+  S+ITHL
Sbjct  68    RYMHLTEEILQENPNICAYMAPSLDARQNIVVVEVPKLGKEAAQKAIKEWGQSKSKITHL  127

Query  466   VFCTSSGVDMPGADFQLAKLLGLSSSVKRLMMYQQGCNAGAAMLRLAKDLAENNKGARVL  645
             VFCT+SGVDMPGAD+QL KLLGL SSVKRLMMYQQGC AG  +LRLAKDLAENNKGARVL
Sbjct  128   VFCTTSGVDMPGADYQLTKLLGLRSSVKRLMMYQQGCFAGGTVLRLAKDLAENNKGARVL  187

Query  646   VVCSEVMLNVFRGPSLEQEDNLLAQCLFGDGSAAVIVGTEPRPGLETPLFELVSAAQTTI  825
             VVCSE+    FRGPS    D+L+ Q LFGDG+AA+IVG++P P +E PLFELVSAAQT +
Sbjct  188   VVCSEITAVTFRGPSESHLDSLVGQALFGDGAAAIIVGSDPIPEIERPLFELVSAAQTLL  247

Query  826   PDTDSHLKLHLREMGLTFHCSKAVPSLITQNVEDCLVKAFEPFGISDWNSIFWILHPGGI  1005
             PD+   +  HLRE+GLTFH  K VP LI++N+   L +AF+P GISDWNSIFWI HPGG 
Sbjct  248   PDSHGAIDGHLREVGLTFHLLKDVPGLISKNIGKALDEAFQPLGISDWNSIFWIAHPGGP  307

Query  1006  AILDRVEEKLGLEPEKLRASKDVLSEYGNLTSACVLFILDEMRKKSKKDEEMTTGEGLEW  1185
             AILD+VEEKLGL+PEKLRA++ VLSEYGN++SACVLFILDEMRK S +D   TTGEGLEW
Sbjct  308   AILDQVEEKLGLKPEKLRATRHVLSEYGNMSSACVLFILDEMRKASARDGLSTTGEGLEW  367

Query  1186  GVVFVVCP  1209
             GV+F   P
Sbjct  368   GVLFGFGP  375



>dbj|BAC10998.1| chalcone synthase [Nierembergia sp. NB17]
Length=389

 Score =   533 bits (1374),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 253/368 (69%), Positives = 303/368 (82%), Gaps = 0/368 (0%)
 Frame = +1

Query  106   RRAKRFEGDAKILAIGTAIPANWVDQTTYPDFYFRITNSEHLLEHKEKFRRICNKSKIRK  285
             RR++R  G A I+AIGTA P+N VDQTTYPDFYFRITNSEH  E KEKF+R+C+KS I+K
Sbjct  8     RRSQRAIGPATIMAIGTATPSNCVDQTTYPDFYFRITNSEHKTELKEKFQRMCDKSMIKK  67

Query  286   RHLVITEELLKKNPNLCTYNEASLNTRQDILVSEVPKLGKEAAMKAIKEWGRPISEITHL  465
             R++ +TEE+LK+NP++C Y   SL+ RQDI+V EVPKLGKEAA KAIKEWG+P S+ITHL
Sbjct  68    RYMYLTEEILKENPSMCEYMAPSLDARQDIVVVEVPKLGKEAAQKAIKEWGQPKSKITHL  127

Query  466   VFCTSSGVDMPGADFQLAKLLGLSSSVKRLMMYQQGCNAGAAMLRLAKDLAENNKGARVL  645
             VFCT+SGVDMPG D+QL KLLGL SSVKR MMYQQGC AG  +LRLAKDLAENNKGARVL
Sbjct  128   VFCTTSGVDMPGCDYQLTKLLGLKSSVKRFMMYQQGCFAGGTVLRLAKDLAENNKGARVL  187

Query  646   VVCSEVMLNVFRGPSLEQEDNLLAQCLFGDGSAAVIVGTEPRPGLETPLFELVSAAQTTI  825
             VVCSE+    FRGPS    D+L+ Q LFGDG+AA+I+G++P P +E PLFELVSA+QT +
Sbjct  188   VVCSEITAVTFRGPSDAHLDSLVGQALFGDGAAAIIIGSDPLPEVERPLFELVSASQTLL  247

Query  826   PDTDSHLKLHLREMGLTFHCSKAVPSLITQNVEDCLVKAFEPFGISDWNSIFWILHPGGI  1005
             PD+   +  HLRE+GLTFH  K VP LI++N+E  LV+AF+P GISDWNSIFWI HPGG 
Sbjct  248   PDSHGAIDGHLREVGLTFHLLKDVPGLISKNIEKSLVEAFQPLGISDWNSIFWIAHPGGP  307

Query  1006  AILDRVEEKLGLEPEKLRASKDVLSEYGNLTSACVLFILDEMRKKSKKDEEMTTGEGLEW  1185
             AILD+VE KLGL+PEKLRA++ VLSEYGN++SACVLFILDEMRK S K    +TGEGL+W
Sbjct  308   AILDQVELKLGLKPEKLRATRQVLSEYGNMSSACVLFILDEMRKTSSKMGLGSTGEGLDW  367

Query  1186  GVVFVVCP  1209
             GV+F   P
Sbjct  368   GVLFGFGP  375



>gb|AIB06736.1| chalcone synthases-1 [Mangifera indica]
Length=390

 Score =   533 bits (1374),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 253/368 (69%), Positives = 304/368 (83%), Gaps = 0/368 (0%)
 Frame = +1

Query  106   RRAKRFEGDAKILAIGTAIPANWVDQTTYPDFYFRITNSEHLLEHKEKFRRICNKSKIRK  285
             R+A+R EG A I+AIGTA P N VDQ+TYPD+YFRITNSEH  E KEKF+R+C KS I+K
Sbjct  8     RKAQRAEGPATIMAIGTANPPNCVDQSTYPDYYFRITNSEHKTELKEKFKRMCEKSMIKK  67

Query  286   RHLVITEELLKKNPNLCTYNEASLNTRQDILVSEVPKLGKEAAMKAIKEWGRPISEITHL  465
             R++ +TEE+LK+NP +C Y   SL+ RQD++V EVPKLGKEAA KAIKEWG+P S+ITHL
Sbjct  68    RYMYLTEEILKENPAICEYMAPSLDARQDMVVVEVPKLGKEAAAKAIKEWGQPKSKITHL  127

Query  466   VFCTSSGVDMPGADFQLAKLLGLSSSVKRLMMYQQGCNAGAAMLRLAKDLAENNKGARVL  645
             VFCT+SGVDMPGAD+QL KLLGL  SVKR MMYQQGC AG  +LRLAKDLAENNKGARVL
Sbjct  128   VFCTTSGVDMPGADYQLTKLLGLRPSVKRYMMYQQGCFAGGTVLRLAKDLAENNKGARVL  187

Query  646   VVCSEVMLNVFRGPSLEQEDNLLAQCLFGDGSAAVIVGTEPRPGLETPLFELVSAAQTTI  825
             VVCSE+    FRGPS    D+L+ Q LFGDG+AA+IVG++P P +E P+FELVSAAQT +
Sbjct  188   VVCSEITAVTFRGPSDTHLDSLVGQALFGDGAAALIVGSDPIPEVEKPMFELVSAAQTIL  247

Query  826   PDTDSHLKLHLREMGLTFHCSKAVPSLITQNVEDCLVKAFEPFGISDWNSIFWILHPGGI  1005
             PD+D  +  HLRE+GLTFH  K VP LI++N+E  LV+AF+P GISDWNS+FWI HPGG 
Sbjct  248   PDSDGAIDGHLREVGLTFHLLKDVPGLISKNIEKSLVEAFQPLGISDWNSLFWIAHPGGP  307

Query  1006  AILDRVEEKLGLEPEKLRASKDVLSEYGNLTSACVLFILDEMRKKSKKDEEMTTGEGLEW  1185
             AILD+VE KLGL+ EKLRA++ VLSEYGN++SACVLFILD+MRKKSK++   TTGEGLEW
Sbjct  308   AILDQVEVKLGLKEEKLRATRHVLSEYGNMSSACVLFILDDMRKKSKENGLKTTGEGLEW  367

Query  1186  GVVFVVCP  1209
             GV+F   P
Sbjct  368   GVLFGFGP  375



>ref|XP_002518132.1| Chalcone synthase, putative [Ricinus communis]
 gb|EEF44265.1| Chalcone synthase, putative [Ricinus communis]
Length=390

 Score =   533 bits (1374),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 249/368 (68%), Positives = 302/368 (82%), Gaps = 0/368 (0%)
 Frame = +1

Query  106   RRAKRFEGDAKILAIGTAIPANWVDQTTYPDFYFRITNSEHLLEHKEKFRRICNKSKIRK  285
             RR +R EG A +LAIGT  P N VDQ+TYPD+YFR+TNSEH  E KEKF+R+C+KS I+K
Sbjct  8     RRTQRAEGPATVLAIGTVTPTNSVDQSTYPDYYFRVTNSEHKTELKEKFKRMCDKSMIKK  67

Query  286   RHLVITEELLKKNPNLCTYNEASLNTRQDILVSEVPKLGKEAAMKAIKEWGRPISEITHL  465
             R++ +TEE+LK+NPN+C Y   SL+ RQDI+V EVPKLGKEAA+KAIKEWG+P S+ITHL
Sbjct  68    RYMHLTEEMLKENPNICAYMAPSLDARQDIVVVEVPKLGKEAAVKAIKEWGQPKSKITHL  127

Query  466   VFCTSSGVDMPGADFQLAKLLGLSSSVKRLMMYQQGCNAGAAMLRLAKDLAENNKGARVL  645
             VFCT+SGVDMPGAD+QL KLLGL  S+KRLMMYQQGC AG  +LRLAKDLAENNKGARVL
Sbjct  128   VFCTTSGVDMPGADYQLTKLLGLRPSIKRLMMYQQGCFAGGTVLRLAKDLAENNKGARVL  187

Query  646   VVCSEVMLNVFRGPSLEQEDNLLAQCLFGDGSAAVIVGTEPRPGLETPLFELVSAAQTTI  825
             VVCSE+    FRGPS    D+L+ Q LFGDG+AAVIVG++P P +E PL+ELV  AQT +
Sbjct  188   VVCSELTAVTFRGPSDTHLDSLVGQALFGDGAAAVIVGSDPVPNVEKPLYELVFTAQTIL  247

Query  826   PDTDSHLKLHLREMGLTFHCSKAVPSLITQNVEDCLVKAFEPFGISDWNSIFWILHPGGI  1005
             PD+D  +  HLRE+GLTFH  K VP LI++N+E  LV+AF+P GISDWNSIFWI HPGG 
Sbjct  248   PDSDGAIDGHLREVGLTFHLLKDVPGLISKNIEKSLVEAFQPLGISDWNSIFWIAHPGGP  307

Query  1006  AILDRVEEKLGLEPEKLRASKDVLSEYGNLTSACVLFILDEMRKKSKKDEEMTTGEGLEW  1185
             AILD+VE KLGLEP KL+A++ +LSE+GN++SACVLFI+D MRKKS +D   +TGEGLEW
Sbjct  308   AILDQVEAKLGLEPNKLQATRHILSEFGNMSSACVLFIMDYMRKKSAEDGLESTGEGLEW  367

Query  1186  GVVFVVCP  1209
             GV+F   P
Sbjct  368   GVLFGFGP  375



>ref|XP_002299281.2| naregenin-chalcone synthase family protein [Populus trichocarpa]
 gb|EEE84086.2| naregenin-chalcone synthase family protein [Populus trichocarpa]
Length=391

 Score =   533 bits (1374),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 251/368 (68%), Positives = 305/368 (83%), Gaps = 0/368 (0%)
 Frame = +1

Query  106   RRAKRFEGDAKILAIGTAIPANWVDQTTYPDFYFRITNSEHLLEHKEKFRRICNKSKIRK  285
             R+A+R EG A ILAIGT+ P N VDQ+TYPD+YFRITNSEH +E KEKF+R+C KS I+K
Sbjct  8     RKAQRAEGPATILAIGTSTPPNCVDQSTYPDYYFRITNSEHKVELKEKFKRMCEKSMIKK  67

Query  286   RHLVITEELLKKNPNLCTYNEASLNTRQDILVSEVPKLGKEAAMKAIKEWGRPISEITHL  465
             R++ +TEE+LK+NP++C Y   SL+ RQD++V EVPKLGKEAA KAIKEWG+P S+ITHL
Sbjct  68    RYMHLTEEILKENPSVCEYMAPSLDARQDMVVVEVPKLGKEAAAKAIKEWGQPKSKITHL  127

Query  466   VFCTSSGVDMPGADFQLAKLLGLSSSVKRLMMYQQGCNAGAAMLRLAKDLAENNKGARVL  645
             VFCT+SGVDMPGAD+QL KLLGL SSVKR MMYQQGC AG  +LRLAKDLAENNKGARVL
Sbjct  128   VFCTTSGVDMPGADYQLTKLLGLRSSVKRFMMYQQGCFAGGTVLRLAKDLAENNKGARVL  187

Query  646   VVCSEVMLNVFRGPSLEQEDNLLAQCLFGDGSAAVIVGTEPRPGLETPLFELVSAAQTTI  825
             VVCSE+    FRGPS    D+L+ Q LFGDG+AA+I+G++P  G+E PLFELVSAAQT +
Sbjct  188   VVCSEITAVTFRGPSDTHLDSLVGQALFGDGAAAIIIGSDPVLGVEKPLFELVSAAQTIL  247

Query  826   PDTDSHLKLHLREMGLTFHCSKAVPSLITQNVEDCLVKAFEPFGISDWNSIFWILHPGGI  1005
             PD++  +  HLRE+GLTFH  K VP LI++N+E  L +AF+P GISDWNS+FWI HPGG 
Sbjct  248   PDSEGAIDGHLREVGLTFHLLKDVPGLISKNIEKSLTEAFKPLGISDWNSLFWIAHPGGP  307

Query  1006  AILDRVEEKLGLEPEKLRASKDVLSEYGNLTSACVLFILDEMRKKSKKDEEMTTGEGLEW  1185
             AILD+VE KL L+PEKLRA++ VL++YGN++SACVLFILDEMRKKS KD   +TGEGLEW
Sbjct  308   AILDQVEAKLELKPEKLRATRQVLADYGNMSSACVLFILDEMRKKSAKDGLKSTGEGLEW  367

Query  1186  GVVFVVCP  1209
             GV+F   P
Sbjct  368   GVLFGFGP  375



>sp|O22046.1|CHSE_IPONI RecName: Full=Chalcone synthase E; AltName: Full=Naringenin-chalcone 
synthase E; Short=CHS-E [Ipomoea nil]
 dbj|BAA21788.1| chalcone synthase [Ipomoea nil]
 dbj|BAA87338.1| chalcone synthase [Ipomoea nil]
Length=389

 Score =   533 bits (1373),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 250/368 (68%), Positives = 303/368 (82%), Gaps = 0/368 (0%)
 Frame = +1

Query  106   RRAKRFEGDAKILAIGTAIPANWVDQTTYPDFYFRITNSEHLLEHKEKFRRICNKSKIRK  285
             R+A+R +G A I+AIGT+ P N VDQ+TYPD+YFRITNSEHL+E KEKF+R+C KS I+K
Sbjct  8     RKAQRAQGPATIMAIGTSTPQNCVDQSTYPDYYFRITNSEHLVELKEKFKRMCEKSMIKK  67

Query  286   RHLVITEELLKKNPNLCTYNEASLNTRQDILVSEVPKLGKEAAMKAIKEWGRPISEITHL  465
             R++ +TEE+LK+NPN+C Y   SL+ RQDI+V EVPKLGKEAA KAIKEWG+P S+ITHL
Sbjct  68    RYMYLTEEILKENPNICAYMAPSLDARQDIVVVEVPKLGKEAAQKAIKEWGQPKSKITHL  127

Query  466   VFCTSSGVDMPGADFQLAKLLGLSSSVKRLMMYQQGCNAGAAMLRLAKDLAENNKGARVL  645
             VFCT+SGVDMPGAD+QL KLLGL  SVKR MMYQQGC AG  ++RLAKDLAENNKGARVL
Sbjct  128   VFCTTSGVDMPGADYQLTKLLGLQPSVKRFMMYQQGCFAGGTVIRLAKDLAENNKGARVL  187

Query  646   VVCSEVMLNVFRGPSLEQEDNLLAQCLFGDGSAAVIVGTEPRPGLETPLFELVSAAQTTI  825
             VVCSE+    FRGPS    D+L+ Q LFGDG+AA+I+G++P P LE PLF+LVSAAQT +
Sbjct  188   VVCSEITAVTFRGPSDAHLDSLVGQALFGDGAAALIIGSDPDPDLERPLFQLVSAAQTIL  247

Query  826   PDTDSHLKLHLREMGLTFHCSKAVPSLITQNVEDCLVKAFEPFGISDWNSIFWILHPGGI  1005
             PD+   +  HLRE+GLTFH  K VP LI++++E  L +AF+P GI DWNS+FWI HPGG 
Sbjct  248   PDSGGAIDGHLREVGLTFHLLKDVPGLISKHIEKSLNEAFQPLGIHDWNSLFWIAHPGGP  307

Query  1006  AILDRVEEKLGLEPEKLRASKDVLSEYGNLTSACVLFILDEMRKKSKKDEEMTTGEGLEW  1185
             AILD+VEEKL L+PEKLRA++ VLSEYGN++SACVLFILDEMRK S K+   TTGEGLEW
Sbjct  308   AILDQVEEKLELKPEKLRATRHVLSEYGNMSSACVLFILDEMRKASSKEGLNTTGEGLEW  367

Query  1186  GVVFVVCP  1209
             GV+F   P
Sbjct  368   GVLFGFGP  375



>gb|AGM46641.1| chalcone synthase protein, partial [Apium graveolens]
Length=384

 Score =   533 bits (1372),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 252/368 (68%), Positives = 300/368 (82%), Gaps = 0/368 (0%)
 Frame = +1

Query  106   RRAKRFEGDAKILAIGTAIPANWVDQTTYPDFYFRITNSEHLLEHKEKFRRICNKSKIRK  285
             R   R  G A +LAIGTA P+N VDQ  YPD+YFRITNSEH+ E KEKF+R+C KS I+K
Sbjct  4     RNPHRAPGPATVLAIGTATPSNCVDQAAYPDYYFRITNSEHMTELKEKFKRMCEKSMIKK  63

Query  286   RHLVITEELLKKNPNLCTYNEASLNTRQDILVSEVPKLGKEAAMKAIKEWGRPISEITHL  465
             R++ +TEE+LK+NPN+C Y   SL+ RQDI+V EVPKLGKEAA KAIKEWG+P S+ITHL
Sbjct  64    RYMHLTEEILKENPNMCAYMAPSLDARQDIVVVEVPKLGKEAAEKAIKEWGQPKSKITHL  123

Query  466   VFCTSSGVDMPGADFQLAKLLGLSSSVKRLMMYQQGCNAGAAMLRLAKDLAENNKGARVL  645
             VFCT+SGVDMPGAD+QL KLLGL  SVKRLMMYQQGC AG  +LRLAKDLAENNKGARVL
Sbjct  124   VFCTTSGVDMPGADYQLTKLLGLRPSVKRLMMYQQGCFAGGTVLRLAKDLAENNKGARVL  183

Query  646   VVCSEVMLNVFRGPSLEQEDNLLAQCLFGDGSAAVIVGTEPRPGLETPLFELVSAAQTTI  825
             VVCSE+    FRGP+    D+L+ Q LFGDG+AAVIVG++P P +E PLFELVSAAQT +
Sbjct  184   VVCSEITAVTFRGPTDTHLDSLVGQALFGDGAAAVIVGSDPVPEVERPLFELVSAAQTIL  243

Query  826   PDTDSHLKLHLREMGLTFHCSKAVPSLITQNVEDCLVKAFEPFGISDWNSIFWILHPGGI  1005
             PD++  +  HLRE+GLTFH  K VP LI++N+E  L++AF+P GISDWNSIFWI HPGG 
Sbjct  244   PDSEGAIDGHLREVGLTFHLLKDVPGLISKNIEKSLIEAFQPLGISDWNSIFWIAHPGGP  303

Query  1006  AILDRVEEKLGLEPEKLRASKDVLSEYGNLTSACVLFILDEMRKKSKKDEEMTTGEGLEW  1185
             AILD+VE KLGL+PEKLRA+  VLS+YGN++SACVLFILDEMRK S +D   TTGEGL+W
Sbjct  304   AILDQVEAKLGLKPEKLRATSHVLSDYGNMSSACVLFILDEMRKTSAEDGLATTGEGLDW  363

Query  1186  GVVFVVCP  1209
             GV+F   P
Sbjct  364   GVLFGFGP  371



>sp|P06515.1|CHSY_ANTMA RecName: Full=Chalcone synthase; AltName: Full=Naringenin-chalcone 
synthase [Antirrhinum majus]
 emb|CAA27338.1| chalcone synthase [Antirrhinum majus]
 dbj|BAM29290.1| chalcone synthase [Antirrhinum majus]
 dbj|BAM29291.1| chalcone synthase [Antirrhinum majus]
 dbj|BAM29292.1| chalcone synthase [Antirrhinum majus]
Length=390

 Score =   533 bits (1372),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 248/368 (67%), Positives = 304/368 (83%), Gaps = 0/368 (0%)
 Frame = +1

Query  106   RRAKRFEGDAKILAIGTAIPANWVDQTTYPDFYFRITNSEHLLEHKEKFRRICNKSKIRK  285
             RRA+R EG A +LAIGTA PAN VDQ+TYPD+YFRITNSEH+ E KEKF+R+C+KS I++
Sbjct  8     RRAQRAEGPATVLAIGTATPANCVDQSTYPDYYFRITNSEHMTELKEKFKRMCDKSNIKR  67

Query  286   RHLVITEELLKKNPNLCTYNEASLNTRQDILVSEVPKLGKEAAMKAIKEWGRPISEITHL  465
             R++ +TEE+LK+NP +C Y   SL+ RQDI+V EVP+LGKEAA KAIKEWG+P S+ITHL
Sbjct  68    RYMHLTEEILKENPAMCEYMAPSLDARQDIVVVEVPRLGKEAAQKAIKEWGQPKSKITHL  127

Query  466   VFCTSSGVDMPGADFQLAKLLGLSSSVKRLMMYQQGCNAGAAMLRLAKDLAENNKGARVL  645
             VFCT+SGVDMPGAD+QL KLLGL  SVKR MMYQQGC AG  +LR+AKDLAENN GARVL
Sbjct  128   VFCTTSGVDMPGADYQLTKLLGLRPSVKRFMMYQQGCFAGGTVLRMAKDLAENNAGARVL  187

Query  646   VVCSEVMLNVFRGPSLEQEDNLLAQCLFGDGSAAVIVGTEPRPGLETPLFELVSAAQTTI  825
             VVCSE+    FRGP+    D+L+ Q LFGDG+AAVIVG++P  G+E PLF++V+AAQT +
Sbjct  188   VVCSEITAVTFRGPADTHLDSLVGQALFGDGAAAVIVGSDPVVGVERPLFQIVTAAQTLL  247

Query  826   PDTDSHLKLHLREMGLTFHCSKAVPSLITQNVEDCLVKAFEPFGISDWNSIFWILHPGGI  1005
             PD+   +  HLRE+GLTFH  K VP LI++N+E  L +AF+P GISDWNS+FWI HPGG 
Sbjct  248   PDSHGAIDGHLREVGLTFHLLKDVPGLISKNIEKSLKEAFDPLGISDWNSVFWIAHPGGP  307

Query  1006  AILDRVEEKLGLEPEKLRASKDVLSEYGNLTSACVLFILDEMRKKSKKDEEMTTGEGLEW  1185
             AILD+VEEKLGL+PEKLR+++ VLSEYGN++SACVLFILDEMRK S K+   TTGEGL+W
Sbjct  308   AILDQVEEKLGLKPEKLRSTRQVLSEYGNMSSACVLFILDEMRKSSAKEGMSTTGEGLDW  367

Query  1186  GVVFVVCP  1209
             GV+F   P
Sbjct  368   GVLFGFGP  375



>ref|XP_011034458.1| PREDICTED: chalcone synthase 1-like [Populus euphratica]
Length=399

 Score =   533 bits (1373),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 250/364 (69%), Positives = 303/364 (83%), Gaps = 0/364 (0%)
 Frame = +1

Query  106   RRAKRFEGDAKILAIGTAIPANWVDQTTYPDFYFRITNSEHLLEHKEKFRRICNKSKIRK  285
             R+A+R EG A ILAIGT+ P N VDQ+TYPD+YFRITNSEH +E KEKF+R+C KS I+K
Sbjct  8     RKAQRAEGPATILAIGTSTPPNCVDQSTYPDYYFRITNSEHKVELKEKFKRMCEKSMIKK  67

Query  286   RHLVITEELLKKNPNLCTYNEASLNTRQDILVSEVPKLGKEAAMKAIKEWGRPISEITHL  465
             R++ +TEE+LK+NP++C Y   SL+ RQD++V EVPKLGKEAA+KAIKEWG+P S+ITHL
Sbjct  68    RYMHLTEEILKENPSVCEYMAPSLDARQDMVVVEVPKLGKEAAVKAIKEWGQPKSKITHL  127

Query  466   VFCTSSGVDMPGADFQLAKLLGLSSSVKRLMMYQQGCNAGAAMLRLAKDLAENNKGARVL  645
             VFCT+SGVDMPGAD+QL KLLGL  SVKR MMYQQGC AG  +LRLAKDLAENNKGARVL
Sbjct  128   VFCTTSGVDMPGADYQLTKLLGLRPSVKRFMMYQQGCFAGGTVLRLAKDLAENNKGARVL  187

Query  646   VVCSEVMLNVFRGPSLEQEDNLLAQCLFGDGSAAVIVGTEPRPGLETPLFELVSAAQTTI  825
             VVCSE+    FRGPS    D+L+ Q LFGDG+AA+I+G +P P +E PLFELVSAAQT +
Sbjct  188   VVCSEITAVTFRGPSDTHLDSLVGQALFGDGAAAIIIGADPVPAIEKPLFELVSAAQTIL  247

Query  826   PDTDSHLKLHLREMGLTFHCSKAVPSLITQNVEDCLVKAFEPFGISDWNSIFWILHPGGI  1005
             PD+D  +  HLRE+GLTFH  K VP LI++NVE  L +AF+P GISDWNS+FWI HPGG 
Sbjct  248   PDSDGAIDGHLREVGLTFHLLKDVPGLISKNVEKSLTEAFKPLGISDWNSLFWIAHPGGP  307

Query  1006  AILDRVEEKLGLEPEKLRASKDVLSEYGNLTSACVLFILDEMRKKSKKDEEMTTGEGLEW  1185
             AILD+VE KL L+PEKLRA++ VL++YGN++SACVLFILDEMRKKS +D   +TGEGLEW
Sbjct  308   AILDQVEAKLELKPEKLRATRQVLADYGNMSSACVLFILDEMRKKSAEDGLKSTGEGLEW  367

Query  1186  GVVF  1197
             GV+F
Sbjct  368   GVLF  371



>ref|XP_002303821.2| naregenin-chalcone synthase family protein [Populus trichocarpa]
 gb|EEE78800.2| naregenin-chalcone synthase family protein [Populus trichocarpa]
Length=391

 Score =   533 bits (1372),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 250/368 (68%), Positives = 304/368 (83%), Gaps = 0/368 (0%)
 Frame = +1

Query  106   RRAKRFEGDAKILAIGTAIPANWVDQTTYPDFYFRITNSEHLLEHKEKFRRICNKSKIRK  285
             R+++R EG A I+AIGT+ P N VDQ+TYP++YFRITNSEH  E KEKF+R+C KS I+K
Sbjct  8     RKSQRAEGPATIMAIGTSTPPNCVDQSTYPEYYFRITNSEHKAELKEKFKRMCEKSMIKK  67

Query  286   RHLVITEELLKKNPNLCTYNEASLNTRQDILVSEVPKLGKEAAMKAIKEWGRPISEITHL  465
             R++ +TEE+LK+NP++C Y   SL+ RQD++V EVPKLGKEAA KAIKEWG+P S+ITHL
Sbjct  68    RYMYLTEEILKENPSVCEYMAPSLDARQDMVVVEVPKLGKEAATKAIKEWGQPKSKITHL  127

Query  466   VFCTSSGVDMPGADFQLAKLLGLSSSVKRLMMYQQGCNAGAAMLRLAKDLAENNKGARVL  645
             VFCT+SGVDMPGAD+QL KLLGL SSVKR MMYQQGC AG  +LRLAKDLAENNKGARVL
Sbjct  128   VFCTTSGVDMPGADYQLTKLLGLRSSVKRFMMYQQGCFAGGTVLRLAKDLAENNKGARVL  187

Query  646   VVCSEVMLNVFRGPSLEQEDNLLAQCLFGDGSAAVIVGTEPRPGLETPLFELVSAAQTTI  825
             VVCSE+    FRGPS    D+L+ Q LFGDG+AA+++G++P  G+E PLFELVSAAQT +
Sbjct  188   VVCSEITAVTFRGPSDTHLDSLVGQALFGDGAAALVIGSDPVIGVEKPLFELVSAAQTIL  247

Query  826   PDTDSHLKLHLREMGLTFHCSKAVPSLITQNVEDCLVKAFEPFGISDWNSIFWILHPGGI  1005
             PD+D  +  HLRE+GLTFH  K VP LI++NVE  L +AF+P GISDWNS+FWI HPGG 
Sbjct  248   PDSDGAIDGHLREVGLTFHLLKDVPGLISKNVEKSLTEAFKPLGISDWNSLFWIAHPGGP  307

Query  1006  AILDRVEEKLGLEPEKLRASKDVLSEYGNLTSACVLFILDEMRKKSKKDEEMTTGEGLEW  1185
             AILD+VE KL L+PEKLRA++ VLSEYGN++SACVLFILDEMRKKS +D   +TGEGLEW
Sbjct  308   AILDQVEAKLALKPEKLRATRHVLSEYGNMSSACVLFILDEMRKKSAEDGLQSTGEGLEW  367

Query  1186  GVVFVVCP  1209
             GV+F   P
Sbjct  368   GVLFGFGP  375



>ref|XP_011091402.1| PREDICTED: chalcone synthase [Sesamum indicum]
Length=390

 Score =   533 bits (1372),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 251/368 (68%), Positives = 301/368 (82%), Gaps = 0/368 (0%)
 Frame = +1

Query  106   RRAKRFEGDAKILAIGTAIPANWVDQTTYPDFYFRITNSEHLLEHKEKFRRICNKSKIRK  285
             RRA+R EG A +LAIGTA P N VDQ+TYPD+YFRIT+SEH  E KEKF+R+C KS I+K
Sbjct  8     RRAQRAEGPATVLAIGTATPTNCVDQSTYPDYYFRITDSEHKTELKEKFKRMCEKSMIKK  67

Query  286   RHLVITEELLKKNPNLCTYNEASLNTRQDILVSEVPKLGKEAAMKAIKEWGRPISEITHL  465
             R++ +TEE+LK+NPN+C Y   SL+ RQDI+V EVPKLGKEAA KAIKEWG+P S+ITHL
Sbjct  68    RYMYLTEEILKENPNICAYMAPSLDARQDIVVVEVPKLGKEAAQKAIKEWGQPKSKITHL  127

Query  466   VFCTSSGVDMPGADFQLAKLLGLSSSVKRLMMYQQGCNAGAAMLRLAKDLAENNKGARVL  645
             VFCT+SGVDMPGAD+QL KLLGL  SVKR MMYQQGC AG  +LR+AKDLAENN GARVL
Sbjct  128   VFCTTSGVDMPGADYQLTKLLGLRPSVKRFMMYQQGCFAGGTVLRMAKDLAENNAGARVL  187

Query  646   VVCSEVMLNVFRGPSLEQEDNLLAQCLFGDGSAAVIVGTEPRPGLETPLFELVSAAQTTI  825
             VVCSE+    FRGPS    D+L+ Q LFGDG+AAVIVG++P  G+E PLF++VSAAQT +
Sbjct  188   VVCSEITAVTFRGPSDSHLDSLVGQALFGDGAAAVIVGSDPVVGVERPLFQIVSAAQTLL  247

Query  826   PDTDSHLKLHLREMGLTFHCSKAVPSLITQNVEDCLVKAFEPFGISDWNSIFWILHPGGI  1005
             PD+   +  HLRE+GLTFH  K VP LI++N+E  L +AFEP GISDWNSIFWI HPGG 
Sbjct  248   PDSHGAIDGHLREVGLTFHLLKDVPGLISKNIEKSLKEAFEPLGISDWNSIFWIAHPGGP  307

Query  1006  AILDRVEEKLGLEPEKLRASKDVLSEYGNLTSACVLFILDEMRKKSKKDEEMTTGEGLEW  1185
             AILD+VEEKL L+PEKLR+++ VLSEYGN++SACVLFILDEMRK S K+   +TGEGL+W
Sbjct  308   AILDQVEEKLALKPEKLRSTRHVLSEYGNMSSACVLFILDEMRKSSAKEGMNSTGEGLDW  367

Query  1186  GVVFVVCP  1209
             GV+F   P
Sbjct  368   GVLFGFGP  375



>ref|NP_001275296.1| chalcone synthase 2 [Solanum tuberosum]
 sp|Q43188.1|CHS2_SOLTU RecName: Full=Chalcone synthase 2; AltName: Full=Naringenin-chalcone 
synthase 2 [Solanum tuberosum]
 gb|AAB05239.1| chalcone synthase 2 [Solanum tuberosum]
Length=389

 Score =   532 bits (1371),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 248/368 (67%), Positives = 306/368 (83%), Gaps = 0/368 (0%)
 Frame = +1

Query  106   RRAKRFEGDAKILAIGTAIPANWVDQTTYPDFYFRITNSEHLLEHKEKFRRICNKSKIRK  285
             R+A+R +G A I+AIGTA P+N VDQ+TYPD+YFRITNSEH+ E KEKF+R+C+KS I K
Sbjct  8     RKAQRAKGPATIMAIGTATPSNCVDQSTYPDYYFRITNSEHMTELKEKFKRMCDKSMINK  67

Query  286   RHLVITEELLKKNPNLCTYNEASLNTRQDILVSEVPKLGKEAAMKAIKEWGRPISEITHL  465
             R++ +TEE+LK+NPN+C Y   SL+ RQDI+V EVPKLGKEAA KAIKEWG+P S+ITH+
Sbjct  68    RYMHLTEEILKENPNICEYMAPSLDARQDIVVVEVPKLGKEAAQKAIKEWGQPKSKITHV  127

Query  466   VFCTSSGVDMPGADFQLAKLLGLSSSVKRLMMYQQGCNAGAAMLRLAKDLAENNKGARVL  645
             VFCT+SGVDMPGAD+QL KLLGL  SVKRLMMYQQGC AG  ++RLAKDLAENNKGARVL
Sbjct  128   VFCTTSGVDMPGADYQLTKLLGLRPSVKRLMMYQQGCFAGGTVIRLAKDLAENNKGARVL  187

Query  646   VVCSEVMLNVFRGPSLEQEDNLLAQCLFGDGSAAVIVGTEPRPGLETPLFELVSAAQTTI  825
             VVCSE+    F GPS    D+++ Q LFGDG+AA+I+G++P P +E PLFELVSAAQT +
Sbjct  188   VVCSEITAVTFSGPSDTHLDSMVGQALFGDGAAAMIIGSDPLPEVERPLFELVSAAQTLL  247

Query  826   PDTDSHLKLHLREMGLTFHCSKAVPSLITQNVEDCLVKAFEPFGISDWNSIFWILHPGGI  1005
             PD++  +  HLRE+GLTFH  K VP LI++N+E  L++AF+P GISDWNSIFWI HPGG 
Sbjct  248   PDSEGAIDGHLREVGLTFHLLKDVPGLISKNIEKSLIEAFQPLGISDWNSIFWIAHPGGP  307

Query  1006  AILDRVEEKLGLEPEKLRASKDVLSEYGNLTSACVLFILDEMRKKSKKDEEMTTGEGLEW  1185
             AILD+VE KLGL+PEKL+A++ VLS+YGN++SACVLFILDEMRK S K+   TTGEGL+W
Sbjct  308   AILDQVELKLGLKPEKLQATRQVLSDYGNMSSACVLFILDEMRKASSKEGLSTTGEGLDW  367

Query  1186  GVVFVVCP  1209
             GV+F   P
Sbjct  368   GVLFGFGP  375



>ref|XP_011034455.1| PREDICTED: chalcone synthase 1-like [Populus euphratica]
Length=391

 Score =   532 bits (1371),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 251/368 (68%), Positives = 303/368 (82%), Gaps = 0/368 (0%)
 Frame = +1

Query  106   RRAKRFEGDAKILAIGTAIPANWVDQTTYPDFYFRITNSEHLLEHKEKFRRICNKSKIRK  285
             R+A+R EG A ILAIGT+ P N VDQ TYPD+YFRITNSEH +E KEKF+R+C KS I+K
Sbjct  8     RKAQRAEGPATILAIGTSTPPNCVDQCTYPDYYFRITNSEHKVELKEKFKRMCEKSMIKK  67

Query  286   RHLVITEELLKKNPNLCTYNEASLNTRQDILVSEVPKLGKEAAMKAIKEWGRPISEITHL  465
             R++ +TEE+LK+NP++C Y   SL+ RQD++V EVPKLGKEAA+KAIKEWG+P S+ITHL
Sbjct  68    RYMHLTEEILKENPSVCEYMAPSLDARQDMVVVEVPKLGKEAAVKAIKEWGQPKSKITHL  127

Query  466   VFCTSSGVDMPGADFQLAKLLGLSSSVKRLMMYQQGCNAGAAMLRLAKDLAENNKGARVL  645
             VFCT+SGVDMPGAD+QL KLLGL  SVKR MMYQQGC AG  +LRLAKDLAENNKGARVL
Sbjct  128   VFCTTSGVDMPGADYQLTKLLGLRPSVKRFMMYQQGCFAGGTVLRLAKDLAENNKGARVL  187

Query  646   VVCSEVMLNVFRGPSLEQEDNLLAQCLFGDGSAAVIVGTEPRPGLETPLFELVSAAQTTI  825
             VVCSE+    FRGPS    D+L+ Q LFGDG+AA+I+G +P P +E PLFELVSAAQT +
Sbjct  188   VVCSEITAVTFRGPSDTHLDSLVGQALFGDGAAAIIIGADPVPAIEKPLFELVSAAQTIL  247

Query  826   PDTDSHLKLHLREMGLTFHCSKAVPSLITQNVEDCLVKAFEPFGISDWNSIFWILHPGGI  1005
             PD+D  +  HLRE+GLTFH  K VP LI++NVE  L +AF+P GISDWNS+FWI HPGG 
Sbjct  248   PDSDGAIDGHLREVGLTFHLLKDVPGLISKNVEKSLTEAFKPLGISDWNSLFWIAHPGGP  307

Query  1006  AILDRVEEKLGLEPEKLRASKDVLSEYGNLTSACVLFILDEMRKKSKKDEEMTTGEGLEW  1185
             AILD+VE KL L+PEKLRA++ VL++YGN++SACVLFILDEMRKKS +D   +TGEGLEW
Sbjct  308   AILDQVEAKLELKPEKLRATRQVLADYGNMSSACVLFILDEMRKKSAEDGLKSTGEGLEW  367

Query  1186  GVVFVVCP  1209
             GV+F   P
Sbjct  368   GVLFGFGP  375



>ref|XP_003553986.1| PREDICTED: chalcone synthase-like [Glycine max]
Length=391

 Score =   532 bits (1371),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 248/368 (67%), Positives = 303/368 (82%), Gaps = 0/368 (0%)
 Frame = +1

Query  106   RRAKRFEGDAKILAIGTAIPANWVDQTTYPDFYFRITNSEHLLEHKEKFRRICNKSKIRK  285
             R A+R  G A ILA GTA P+N V Q  YPD+YFRITNSEH+ + KEKF+R+C KS I+K
Sbjct  8     RNAQRSHGPATILAFGTATPSNCVSQADYPDYYFRITNSEHMTDLKEKFKRMCEKSMIKK  67

Query  286   RHLVITEELLKKNPNLCTYNEASLNTRQDILVSEVPKLGKEAAMKAIKEWGRPISEITHL  465
             R++ +TEE LK+NPN+C Y   SL+ RQD++V EVPKLGK+AA KAIKEWG+P S+ITHL
Sbjct  68    RYMHLTEEFLKENPNMCEYMAPSLDVRQDVVVMEVPKLGKQAATKAIKEWGQPKSKITHL  127

Query  466   VFCTSSGVDMPGADFQLAKLLGLSSSVKRLMMYQQGCNAGAAMLRLAKDLAENNKGARVL  645
             VFCT+SGVDMPGAD+QL KLLGL  SVKRLMMYQQGC AG  +LRLAKDLAENNKGARVL
Sbjct  128   VFCTTSGVDMPGADYQLTKLLGLRPSVKRLMMYQQGCFAGGTVLRLAKDLAENNKGARVL  187

Query  646   VVCSEVMLNVFRGPSLEQEDNLLAQCLFGDGSAAVIVGTEPRPGLETPLFELVSAAQTTI  825
             VVCSE+    FRGPS    D+L+ Q LFGDG+AA+I+G++P P +E P+FE++SAAQT +
Sbjct  188   VVCSEITAVTFRGPSDTHLDSLVGQALFGDGAAALIIGSDPDPAVERPIFEMISAAQTIL  247

Query  826   PDTDSHLKLHLREMGLTFHCSKAVPSLITQNVEDCLVKAFEPFGISDWNSIFWILHPGGI  1005
             PD+D  +  HLRE+GLTFH  K VP +I++N+E  LV+AFEP GISDWNSIFWI HPGG 
Sbjct  248   PDSDGAIDGHLREVGLTFHLLKDVPGIISKNIEKSLVEAFEPIGISDWNSIFWIAHPGGP  307

Query  1006  AILDRVEEKLGLEPEKLRASKDVLSEYGNLTSACVLFILDEMRKKSKKDEEMTTGEGLEW  1185
             AILD+VEEKL L+PEKL++++ VLSEYGN++SACVLFILDEMRKKSK++ + TTGEGLEW
Sbjct  308   AILDQVEEKLRLKPEKLQSTRHVLSEYGNMSSACVLFILDEMRKKSKEEGKSTTGEGLEW  367

Query  1186  GVVFVVCP  1209
             GV+F   P
Sbjct  368   GVLFGFGP  375



>gb|AEP17003.1| chalcone synthase [Vitis vinifera]
Length=389

 Score =   532 bits (1371),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 252/368 (68%), Positives = 303/368 (82%), Gaps = 0/368 (0%)
 Frame = +1

Query  106   RRAKRFEGDAKILAIGTAIPANWVDQTTYPDFYFRITNSEHLLEHKEKFRRICNKSKIRK  285
             R A+R EG A ++AIGTA P N VDQ+TYPD+YFRITNSEH  E KEKF+R+C+KS I+K
Sbjct  8     RNAQRAEGPATVMAIGTATPPNCVDQSTYPDYYFRITNSEHKTELKEKFKRMCDKSMIKK  67

Query  286   RHLVITEELLKKNPNLCTYNEASLNTRQDILVSEVPKLGKEAAMKAIKEWGRPISEITHL  465
             R++ +TEE+LK+NPN+C Y  ASL+ RQD++V EVPKLGKEAA KAIKEWG+P S+ITHL
Sbjct  68    RYMHLTEEILKENPNVCEYMAASLDARQDMVVVEVPKLGKEAAAKAIKEWGQPKSKITHL  127

Query  466   VFCTSSGVDMPGADFQLAKLLGLSSSVKRLMMYQQGCNAGAAMLRLAKDLAENNKGARVL  645
             VFCT+SGVDMPGAD+QL KLLGL  SVKR MMYQQGC AG  +LRLAKDLAENNKGARVL
Sbjct  128   VFCTTSGVDMPGADYQLTKLLGLRPSVKRFMMYQQGCFAGGTVLRLAKDLAENNKGARVL  187

Query  646   VVCSEVMLNVFRGPSLEQEDNLLAQCLFGDGSAAVIVGTEPRPGLETPLFELVSAAQTTI  825
             VVCSE+    FRGPS    D+L+ Q LFGDG+AAVIVG++P PG+E P+FELVSAAQT +
Sbjct  188   VVCSEITAVTFRGPSDTHLDSLVGQALFGDGAAAVIVGSDPIPGVEKPMFELVSAAQTIL  247

Query  826   PDTDSHLKLHLREMGLTFHCSKAVPSLITQNVEDCLVKAFEPFGISDWNSIFWILHPGGI  1005
             PD+D  +  HLRE+GLTFH  K VP LI++N+E  L +AF+P GI DWNSIFWI HPGG 
Sbjct  248   PDSDGAIDGHLREVGLTFHLLKDVPGLISKNIEKSLNEAFQPLGIKDWNSIFWIAHPGGP  307

Query  1006  AILDRVEEKLGLEPEKLRASKDVLSEYGNLTSACVLFILDEMRKKSKKDEEMTTGEGLEW  1185
             AILD+VEEKL L+PEKLR+++ VLSE GN++SACVLFILDEMR+KS ++   TTGEG EW
Sbjct  308   AILDQVEEKLALKPEKLRSTRHVLSECGNMSSACVLFILDEMRRKSAEEGLKTTGEGPEW  367

Query  1186  GVVFVVCP  1209
             GV+F   P
Sbjct  368   GVLFGFGP  375



>ref|NP_001234036.1| chalcone synthase 2 [Solanum lycopersicum]
 sp|P23419.2|CHS2_SOLLC RecName: Full=Chalcone synthase 2; AltName: Full=Naringenin-chalcone 
synthase 2 [Solanum lycopersicum]
 emb|CAA38981.1| chalcone synthase [Solanum lycopersicum]
 gb|AEK99072.1| chalcone synthase [Solanum lycopersicum]
Length=389

 Score =   532 bits (1370),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 249/368 (68%), Positives = 305/368 (83%), Gaps = 0/368 (0%)
 Frame = +1

Query  106   RRAKRFEGDAKILAIGTAIPANWVDQTTYPDFYFRITNSEHLLEHKEKFRRICNKSKIRK  285
             RRA+R +G A I+AIGTA P+N VDQ+TYPD+YFRITNSEH+ E KEKF+R+C+KS I K
Sbjct  8     RRAQRAKGPATIMAIGTATPSNCVDQSTYPDYYFRITNSEHMTELKEKFKRMCDKSMINK  67

Query  286   RHLVITEELLKKNPNLCTYNEASLNTRQDILVSEVPKLGKEAAMKAIKEWGRPISEITHL  465
             R++ +TEE+LK+NPN+C Y   SL+ RQDI+V EVPKLGKEAA KAIKEWG+P S+ITH+
Sbjct  68    RYMHLTEEILKENPNICEYMAPSLDARQDIVVVEVPKLGKEAAQKAIKEWGQPKSKITHV  127

Query  466   VFCTSSGVDMPGADFQLAKLLGLSSSVKRLMMYQQGCNAGAAMLRLAKDLAENNKGARVL  645
             VFCT+SGVDMPGAD+QL KLLGL  SVKRLMMYQQGC AG  ++RLAKDLAENNKGARVL
Sbjct  128   VFCTTSGVDMPGADYQLTKLLGLRPSVKRLMMYQQGCFAGGTVIRLAKDLAENNKGARVL  187

Query  646   VVCSEVMLNVFRGPSLEQEDNLLAQCLFGDGSAAVIVGTEPRPGLETPLFELVSAAQTTI  825
             VVCSE+    FRGPS    D+++ Q LFGD +AA+I+G++P P +E PLFELVSAAQT +
Sbjct  188   VVCSEITAVTFRGPSDTHLDSMVGQALFGDRAAAMIIGSDPLPEVERPLFELVSAAQTLL  247

Query  826   PDTDSHLKLHLREMGLTFHCSKAVPSLITQNVEDCLVKAFEPFGISDWNSIFWILHPGGI  1005
             PD++  +  HLRE+GLTFH  K VP LI++N+E  L++AF+P GISDWNSIFWI HPGG 
Sbjct  248   PDSEGAIDGHLREVGLTFHLLKDVPGLISKNIEKSLIEAFQPLGISDWNSIFWIAHPGGP  307

Query  1006  AILDRVEEKLGLEPEKLRASKDVLSEYGNLTSACVLFILDEMRKKSKKDEEMTTGEGLEW  1185
             AILD+VE KL L+PEKLRA++ VLS+YGN++SACVLFILDEMRK S K+   TTGEGL+W
Sbjct  308   AILDQVELKLSLKPEKLRATRQVLSDYGNMSSACVLFILDEMRKASSKEGLSTTGEGLDW  367

Query  1186  GVVFVVCP  1209
             GV+F   P
Sbjct  368   GVLFGFGP  375



>ref|XP_002303820.1| naregenin-chalcone synthase family protein [Populus trichocarpa]
 gb|EEE78799.1| naregenin-chalcone synthase family protein [Populus trichocarpa]
Length=391

 Score =   532 bits (1370),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 250/368 (68%), Positives = 302/368 (82%), Gaps = 0/368 (0%)
 Frame = +1

Query  106   RRAKRFEGDAKILAIGTAIPANWVDQTTYPDFYFRITNSEHLLEHKEKFRRICNKSKIRK  285
             R+ +R EG A I+AIGT+ P N VDQ+ YPD+YFRITNSEH  E KEKF+R+C KS I+K
Sbjct  8     RKTQRAEGPATIMAIGTSTPPNCVDQSAYPDYYFRITNSEHKAELKEKFKRMCEKSMIKK  67

Query  286   RHLVITEELLKKNPNLCTYNEASLNTRQDILVSEVPKLGKEAAMKAIKEWGRPISEITHL  465
             R++ +TEE+LK+NP++C Y   SL+ RQD++V EVP+LGKEAA KAIKEWG+P S+ITHL
Sbjct  68    RYMYLTEEILKENPSVCEYMAPSLDARQDMVVVEVPRLGKEAATKAIKEWGQPKSKITHL  127

Query  466   VFCTSSGVDMPGADFQLAKLLGLSSSVKRLMMYQQGCNAGAAMLRLAKDLAENNKGARVL  645
             VFCT+SGVDMPGAD+QL KLLGL SSVKR MMYQQGC AG  +LRLAKDLAENNKGARVL
Sbjct  128   VFCTTSGVDMPGADYQLTKLLGLRSSVKRFMMYQQGCFAGGTVLRLAKDLAENNKGARVL  187

Query  646   VVCSEVMLNVFRGPSLEQEDNLLAQCLFGDGSAAVIVGTEPRPGLETPLFELVSAAQTTI  825
             VVCSE+    FRGPS    D+L+ Q LFGDG+AA+I+G++P  G+E PLFELVSAAQT +
Sbjct  188   VVCSEITAVTFRGPSDTHLDSLVGQALFGDGAAALIIGSDPVIGVEKPLFELVSAAQTIL  247

Query  826   PDTDSHLKLHLREMGLTFHCSKAVPSLITQNVEDCLVKAFEPFGISDWNSIFWILHPGGI  1005
             PD+D  +  HLRE+GLTFH  K VP LI++NVE  L +AF+P GISDWNS+FWI HPGG 
Sbjct  248   PDSDGAIDGHLREVGLTFHLLKDVPGLISKNVEKSLTEAFKPLGISDWNSLFWIAHPGGP  307

Query  1006  AILDRVEEKLGLEPEKLRASKDVLSEYGNLTSACVLFILDEMRKKSKKDEEMTTGEGLEW  1185
             AILD+VE KL L+PEKLRA++ VLSEYGN++SACVLFILDEMRKKS +D   +TGEGLEW
Sbjct  308   AILDQVEAKLALKPEKLRATRHVLSEYGNMSSACVLFILDEMRKKSAEDGLQSTGEGLEW  367

Query  1186  GVVFVVCP  1209
             GV+F   P
Sbjct  368   GVLFGFGP  375



>emb|CAK19318.1| naringenin-chalcone synthase [Humulus lupulus]
Length=389

 Score =   532 bits (1370),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 251/368 (68%), Positives = 302/368 (82%), Gaps = 0/368 (0%)
 Frame = +1

Query  106   RRAKRFEGDAKILAIGTAIPANWVDQTTYPDFYFRITNSEHLLEHKEKFRRICNKSKIRK  285
             R+A+R EG A ILAIGTA PAN + Q+ YPD+YFRITNSEH  E KEKF+R+C+KS IRK
Sbjct  8     RKAQRAEGPATILAIGTATPANCILQSEYPDYYFRITNSEHKTELKEKFKRMCDKSMIRK  67

Query  286   RHLVITEELLKKNPNLCTYNEASLNTRQDILVSEVPKLGKEAAMKAIKEWGRPISEITHL  465
             R++ +TEE+LK+NPNLC Y   SL+ RQD++V EVPKLGKEAA KAIKEWG+P S+ITH+
Sbjct  68    RYMHLTEEILKENPNLCAYEAPSLDARQDMVVVEVPKLGKEAATKAIKEWGQPKSKITHV  127

Query  466   VFCTSSGVDMPGADFQLAKLLGLSSSVKRLMMYQQGCNAGAAMLRLAKDLAENNKGARVL  645
             VFCT+SGVDMPGAD+QL KLLGL  SVKRLMMYQQGC AG  +LR+AKDLAENNKGARVL
Sbjct  128   VFCTTSGVDMPGADYQLTKLLGLRPSVKRLMMYQQGCFAGGTVLRVAKDLAENNKGARVL  187

Query  646   VVCSEVMLNVFRGPSLEQEDNLLAQCLFGDGSAAVIVGTEPRPGLETPLFELVSAAQTTI  825
             VVCSE+    FRGP+    D+L+ Q LFGDGSAA+I+G +P P +E P+FELVSAAQT +
Sbjct  188   VVCSEITAVTFRGPNDTHLDSLVGQALFGDGSAALIIGADPTPEIEKPIFELVSAAQTIL  247

Query  826   PDTDSHLKLHLREMGLTFHCSKAVPSLITQNVEDCLVKAFEPFGISDWNSIFWILHPGGI  1005
             PD+D  +  HLRE+GLTFH  K VP LI++N+E  LV+AF+P GISDWNS+FWI HPGG 
Sbjct  248   PDSDGAIDGHLREVGLTFHLLKDVPGLISKNIEKSLVEAFKPLGISDWNSLFWIAHPGGP  307

Query  1006  AILDRVEEKLGLEPEKLRASKDVLSEYGNLTSACVLFILDEMRKKSKKDEEMTTGEGLEW  1185
             AILD+VE KL L+PEKLRA++ VL EYGN++SACVLFILDEMR+K  +D   TTGEGLEW
Sbjct  308   AILDQVESKLALKPEKLRATRHVLGEYGNMSSACVLFILDEMRRKCAEDGLKTTGEGLEW  367

Query  1186  GVVFVVCP  1209
             GV+F   P
Sbjct  368   GVLFGFGP  375



>gb|ACN30003.1| chalcone synthase [Vitis rotundifolia]
Length=393

 Score =   532 bits (1370),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 252/368 (68%), Positives = 302/368 (82%), Gaps = 0/368 (0%)
 Frame = +1

Query  106   RRAKRFEGDAKILAIGTAIPANWVDQTTYPDFYFRITNSEHLLEHKEKFRRICNKSKIRK  285
             R A+R EG A ++AIGTA P N VDQ+TYPD+YFRITNSEH  E KEKF+R+C+KS I+K
Sbjct  8     RNAQRAEGPATVMAIGTATPPNCVDQSTYPDYYFRITNSEHKTELKEKFKRMCDKSMIKK  67

Query  286   RHLVITEELLKKNPNLCTYNEASLNTRQDILVSEVPKLGKEAAMKAIKEWGRPISEITHL  465
             R++ +TEE+LK+NPN+C Y   SL+ RQD++V EVPKLGKEAA KAIKEWG+P S+ITHL
Sbjct  68    RYMHLTEEILKENPNVCAYMAPSLDARQDMVVVEVPKLGKEAAAKAIKEWGQPKSKITHL  127

Query  466   VFCTSSGVDMPGADFQLAKLLGLSSSVKRLMMYQQGCNAGAAMLRLAKDLAENNKGARVL  645
             VFCT+SGVDMPGAD+QL KLLGL  SVKRLMMYQQGC AG  +LRLAKDLAENN GARVL
Sbjct  128   VFCTTSGVDMPGADYQLTKLLGLKPSVKRLMMYQQGCFAGGTVLRLAKDLAENNAGARVL  187

Query  646   VVCSEVMLNVFRGPSLEQEDNLLAQCLFGDGSAAVIVGTEPRPGLETPLFELVSAAQTTI  825
             VVCSE+    FRGPS    D+L+ Q LFGDG+AA+I+G +P   +E PLFELVSAAQT +
Sbjct  188   VVCSEITAVTFRGPSDTHLDSLVGQALFGDGAAAIIIGADPDTKIERPLFELVSAAQTIL  247

Query  826   PDTDSHLKLHLREMGLTFHCSKAVPSLITQNVEDCLVKAFEPFGISDWNSIFWILHPGGI  1005
             PD+D  +  HLRE+GLTFH  K VP LI++N+E  LV+AF P GISDWNS+FWI HPGG 
Sbjct  248   PDSDGAIDGHLREVGLTFHLLKDVPGLISKNIEKSLVEAFNPIGISDWNSLFWIAHPGGP  307

Query  1006  AILDRVEEKLGLEPEKLRASKDVLSEYGNLTSACVLFILDEMRKKSKKDEEMTTGEGLEW  1185
             AILD+VE KLGL+ EKLRA++ VLSEYGN++SACVLFILDEMRKKS ++ + TTGEGLEW
Sbjct  308   AILDQVELKLGLKEEKLRATRHVLSEYGNMSSACVLFILDEMRKKSIEEGKGTTGEGLEW  367

Query  1186  GVVFVVCP  1209
             GV+F   P
Sbjct  368   GVLFGFGP  375



>sp|Q9XJ58.1|CHS1_CITSI RecName: Full=Chalcone synthase 1; AltName: Full=Naringenin-chalcone 
synthase 1 [Citrus sinensis]
 dbj|BAA81663.1| chalcone synthase [Citrus sinensis]
Length=389

 Score =   531 bits (1369),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 249/368 (68%), Positives = 304/368 (83%), Gaps = 1/368 (0%)
 Frame = +1

Query  106   RRAKRFEGDAKILAIGTAIPANWVDQTTYPDFYFRITNSEHLLEHKEKFRRICNKSKIRK  285
             R+A+R +G A I+AIGTA P N VDQ+TYPD+YFRITNSEH+ + KEKF+R+C+KS I+K
Sbjct  8     RKAQRAQGPATIMAIGTATPPNCVDQSTYPDYYFRITNSEHMTDLKEKFKRMCDKSMIKK  67

Query  286   RHLVITEELLKKNPNLCTYNEASLNTRQDILVSEVPKLGKEAAMKAIKEWGRPISEITHL  465
             R++ +TEE+LK+NPN+C Y   SL+TRQD++V EVP+LGK AA +AIKEWG+P S+ITHL
Sbjct  68    RYMYLTEEILKENPNVCAYMAPSLDTRQDMVVVEVPRLGK-AATEAIKEWGQPKSKITHL  126

Query  466   VFCTSSGVDMPGADFQLAKLLGLSSSVKRLMMYQQGCNAGAAMLRLAKDLAENNKGARVL  645
             VFCT+SGVDMPGAD++L KLLGL  SVKRLMMYQQGC AG  +LRLAKDLAENNKGARVL
Sbjct  127   VFCTTSGVDMPGADYRLTKLLGLRPSVKRLMMYQQGCFAGGTVLRLAKDLAENNKGARVL  186

Query  646   VVCSEVMLNVFRGPSLEQEDNLLAQCLFGDGSAAVIVGTEPRPGLETPLFELVSAAQTTI  825
             VVCSE+    FRGPS    D+L+ Q LFGDG+AA+I+G +P P +E P+FELVS AQT +
Sbjct  187   VVCSEITAVTFRGPSDTHLDSLVGQALFGDGAAAIIIGADPIPEIEKPMFELVSTAQTIL  246

Query  826   PDTDSHLKLHLREMGLTFHCSKAVPSLITQNVEDCLVKAFEPFGISDWNSIFWILHPGGI  1005
             PD+D  +  HLRE GLTFH  K VP LI++N++  L +AF+P GISDWNSIFWI HPGG 
Sbjct  247   PDSDGSIDGHLREAGLTFHLLKDVPGLISKNIQKSLTEAFKPLGISDWNSIFWIAHPGGP  306

Query  1006  AILDRVEEKLGLEPEKLRASKDVLSEYGNLTSACVLFILDEMRKKSKKDEEMTTGEGLEW  1185
             AILD+VEEKLGL+PEKLRA++ VLSEYGN++SACVLFILDEMRKKS +D   T GEGLEW
Sbjct  307   AILDQVEEKLGLKPEKLRATRHVLSEYGNMSSACVLFILDEMRKKSAEDGLETAGEGLEW  366

Query  1186  GVVFVVCP  1209
             GV+F   P
Sbjct  367   GVLFGFGP  374



>gb|AHA61354.1| chalcone synthase [Phyllanthus emblica]
Length=390

 Score =   531 bits (1369),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 247/368 (67%), Positives = 305/368 (83%), Gaps = 0/368 (0%)
 Frame = +1

Query  106   RRAKRFEGDAKILAIGTAIPANWVDQTTYPDFYFRITNSEHLLEHKEKFRRICNKSKIRK  285
             R+A+R  G A ++AIGTA+P N VDQ+TYPD+YFRITNSEH  E KEKF+R+C+KS I+K
Sbjct  8     RKAQRASGPATVMAIGTAVPPNCVDQSTYPDYYFRITNSEHKTELKEKFQRMCDKSMIKK  67

Query  286   RHLVITEELLKKNPNLCTYNEASLNTRQDILVSEVPKLGKEAAMKAIKEWGRPISEITHL  465
             R++ + EE+LK+NPN+C Y   SL+ RQDI+V E+PKLGKEAA+KAIKEWG+P S+ITHL
Sbjct  68    RYMYLNEEILKENPNICAYMAPSLDARQDIVVVEIPKLGKEAAVKAIKEWGQPKSKITHL  127

Query  466   VFCTSSGVDMPGADFQLAKLLGLSSSVKRLMMYQQGCNAGAAMLRLAKDLAENNKGARVL  645
             VFCT+SGVDMPGAD+QL KLLGL  SVKRLMMYQQGC AG  +LRLAKDLAENNKGARVL
Sbjct  128   VFCTTSGVDMPGADYQLTKLLGLKPSVKRLMMYQQGCFAGGTVLRLAKDLAENNKGARVL  187

Query  646   VVCSEVMLNVFRGPSLEQEDNLLAQCLFGDGSAAVIVGTEPRPGLETPLFELVSAAQTTI  825
             VVCSE+    FRGPS    D+L+   LFGDG+AA+IVG++P P +E PLFE+VSAAQT +
Sbjct  188   VVCSEITAVTFRGPSDTHLDSLVGPGLFGDGAAAIIVGSDPIPEVEKPLFEVVSAAQTIL  247

Query  826   PDTDSHLKLHLREMGLTFHCSKAVPSLITQNVEDCLVKAFEPFGISDWNSIFWILHPGGI  1005
             PD+D  +  HLRE+GLTFH  K VP LI++NVE  LV+AF+P  I DWNS+FWI HPGG 
Sbjct  248   PDSDGAIDGHLREVGLTFHLLKDVPGLISKNVEKSLVEAFQPLNIQDWNSLFWIAHPGGP  307

Query  1006  AILDRVEEKLGLEPEKLRASKDVLSEYGNLTSACVLFILDEMRKKSKKDEEMTTGEGLEW  1185
             AIL++VE KLGL+PEKL+A++ +L++YGN++SACVLFILDEMRKKSK++   TTGEGLEW
Sbjct  308   AILNQVEAKLGLKPEKLKATRQILADYGNMSSACVLFILDEMRKKSKEEGFQTTGEGLEW  367

Query  1186  GVVFVVCP  1209
             GV+F   P
Sbjct  368   GVLFGFGP  375



>gb|AFC37244.1| chalcone synthase 3 [Camellia chekiangoleosa]
Length=389

 Score =   531 bits (1369),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 252/368 (68%), Positives = 303/368 (82%), Gaps = 0/368 (0%)
 Frame = +1

Query  106   RRAKRFEGDAKILAIGTAIPANWVDQTTYPDFYFRITNSEHLLEHKEKFRRICNKSKIRK  285
             RRA+R +G A +LAIGTA P N VDQ+TYPD+YFRITNSEH +E KEKF+R+C+KS I+K
Sbjct  8     RRAQRAQGPATVLAIGTATPPNCVDQSTYPDYYFRITNSEHKVELKEKFKRMCDKSMIKK  67

Query  286   RHLVITEELLKKNPNLCTYNEASLNTRQDILVSEVPKLGKEAAMKAIKEWGRPISEITHL  465
             R++ +TEE+LK+NP +C Y   SL+ RQD++V EVPKLGKEAA KAIKEWG+P S+ITHL
Sbjct  68    RYMYLTEEILKENPQVCEYMAPSLDARQDMVVVEVPKLGKEAATKAIKEWGQPKSKITHL  127

Query  466   VFCTSSGVDMPGADFQLAKLLGLSSSVKRLMMYQQGCNAGAAMLRLAKDLAENNKGARVL  645
             VFCT+SGVDMPGAD+QL KLLGL  SVKRLMMYQQGC AG  +LRLAKDL ENNKGARVL
Sbjct  128   VFCTTSGVDMPGADYQLTKLLGLRPSVKRLMMYQQGCFAGGTVLRLAKDLVENNKGARVL  187

Query  646   VVCSEVMLNVFRGPSLEQEDNLLAQCLFGDGSAAVIVGTEPRPGLETPLFELVSAAQTTI  825
             VVCSE+    FRGPS    D+L+ Q LFGDG+AA+I+G++P P +E PLFELVSAAQT +
Sbjct  188   VVCSEITAVTFRGPSDTHLDSLVGQSLFGDGAAAIIIGSDPIPEVEKPLFELVSAAQTIL  247

Query  826   PDTDSHLKLHLREMGLTFHCSKAVPSLITQNVEDCLVKAFEPFGISDWNSIFWILHPGGI  1005
             P +D  +  HLRE+GLTFH  + VP LI+ NVE  LV+AF+P GISDWNS+FWI HPGG 
Sbjct  248   PGSDGAIDGHLREVGLTFHLLRDVPRLISMNVEKSLVEAFQPLGISDWNSLFWIAHPGGP  307

Query  1006  AILDRVEEKLGLEPEKLRASKDVLSEYGNLTSACVLFILDEMRKKSKKDEEMTTGEGLEW  1185
             AILD+VE KLGL+ EKLRA++ VLSEYGN++SACVLFILDEMRKKS ++   TTGEGLEW
Sbjct  308   AILDQVELKLGLKEEKLRATRHVLSEYGNMSSACVLFILDEMRKKSAEEGLKTTGEGLEW  367

Query  1186  GVVFVVCP  1209
             GV+F   P
Sbjct  368   GVLFGFGP  375



>gb|EPS72180.1| chalcone synthase [Genlisea aurea]
Length=390

 Score =   531 bits (1369),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 244/368 (66%), Positives = 304/368 (83%), Gaps = 0/368 (0%)
 Frame = +1

Query  106   RRAKRFEGDAKILAIGTAIPANWVDQTTYPDFYFRITNSEHLLEHKEKFRRICNKSKIRK  285
             RRA+R EG A +LAIGTA PAN V+Q TYPD+YFRITNSEH+ E K+KF+R+C+KS I++
Sbjct  8     RRAQRAEGPAAVLAIGTATPANCVEQATYPDYYFRITNSEHMTELKDKFKRMCDKSMIKR  67

Query  286   RHLVITEELLKKNPNLCTYNEASLNTRQDILVSEVPKLGKEAAMKAIKEWGRPISEITHL  465
             R++ +TEE+LK+NP++C Y   SL+ RQDI+V EVP+LGKEAA KAIKEWG+P S+ITH+
Sbjct  68    RYMYLTEEILKENPDMCAYMSPSLDARQDIVVVEVPRLGKEAAQKAIKEWGQPKSKITHV  127

Query  466   VFCTSSGVDMPGADFQLAKLLGLSSSVKRLMMYQQGCNAGAAMLRLAKDLAENNKGARVL  645
             +FCT+SGVDMPGAD+QL KLLGL  SV+R M+YQQGC AG  +LR+AKDLAENN+GARVL
Sbjct  128   IFCTTSGVDMPGADYQLVKLLGLRPSVRRTMLYQQGCFAGGTVLRVAKDLAENNRGARVL  187

Query  646   VVCSEVMLNVFRGPSLEQEDNLLAQCLFGDGSAAVIVGTEPRPGLETPLFELVSAAQTTI  825
             VVCSE+    FRGPS    D+L+ Q LFGDG+AAVIVG++P  G+E PLF++VSAAQT +
Sbjct  188   VVCSEITAVTFRGPSESSLDSLVGQALFGDGAAAVIVGSDPIVGVERPLFQMVSAAQTIL  247

Query  826   PDTDSHLKLHLREMGLTFHCSKAVPSLITQNVEDCLVKAFEPFGISDWNSIFWILHPGGI  1005
             PD+D  +  HLRE+GLTFH  K VP +I++N+E  L +AFEP GISDWNS+FWI HPGG 
Sbjct  248   PDSDGAIDGHLREVGLTFHLLKDVPGIISKNIEKSLKEAFEPLGISDWNSLFWIAHPGGP  307

Query  1006  AILDRVEEKLGLEPEKLRASKDVLSEYGNLTSACVLFILDEMRKKSKKDEEMTTGEGLEW  1185
             AILD+VE KL L+PEK+RA++ VL+EYGN++SACVLFILDEMRK S KD   TTGEGLEW
Sbjct  308   AILDQVEAKLALKPEKMRATRRVLAEYGNMSSACVLFILDEMRKSSAKDGANTTGEGLEW  367

Query  1186  GVVFVVCP  1209
             GV+F   P
Sbjct  368   GVLFGFGP  375



>emb|CAK19319.1| naringenin-chalcone synthase [Humulus lupulus]
Length=389

 Score =   531 bits (1368),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 251/368 (68%), Positives = 302/368 (82%), Gaps = 0/368 (0%)
 Frame = +1

Query  106   RRAKRFEGDAKILAIGTAIPANWVDQTTYPDFYFRITNSEHLLEHKEKFRRICNKSKIRK  285
             R+A+R EG A ILAIGTA PAN + Q+ YPD+YFRITNSEH  E KEKF+R+C+KS IRK
Sbjct  8     RKAQRAEGPATILAIGTATPANCILQSEYPDYYFRITNSEHKTELKEKFKRMCDKSMIRK  67

Query  286   RHLVITEELLKKNPNLCTYNEASLNTRQDILVSEVPKLGKEAAMKAIKEWGRPISEITHL  465
             R++ +TEE+LK+NPNLC Y   SL+ RQD++V EVPKLGKEAA KAIKEWG+P S+ITH+
Sbjct  68    RYMHLTEEILKENPNLCAYEAPSLDARQDMVVVEVPKLGKEAATKAIKEWGQPKSKITHV  127

Query  466   VFCTSSGVDMPGADFQLAKLLGLSSSVKRLMMYQQGCNAGAAMLRLAKDLAENNKGARVL  645
             VFCT+SGVDMPGAD+QL KLLGL  SVKRLMMYQQGC AG  +LR+AKDLAENNKGARVL
Sbjct  128   VFCTTSGVDMPGADYQLTKLLGLRPSVKRLMMYQQGCFAGGTVLRVAKDLAENNKGARVL  187

Query  646   VVCSEVMLNVFRGPSLEQEDNLLAQCLFGDGSAAVIVGTEPRPGLETPLFELVSAAQTTI  825
             VVCSE+    FRGP+    D+L+ Q LFGDGSAA+I+G +P P +E P+FELVSAAQT +
Sbjct  188   VVCSEITAVTFRGPNDTHLDSLVGQALFGDGSAALIIGADPIPEIEKPIFELVSAAQTIL  247

Query  826   PDTDSHLKLHLREMGLTFHCSKAVPSLITQNVEDCLVKAFEPFGISDWNSIFWILHPGGI  1005
             PD+D  +  HLRE+GLTFH  K VP LI++N+E  LV+AF+P GISDWNS+FWI HPGG 
Sbjct  248   PDSDGAIDGHLREVGLTFHLLKDVPGLISKNIEKSLVEAFKPLGISDWNSLFWIAHPGGP  307

Query  1006  AILDRVEEKLGLEPEKLRASKDVLSEYGNLTSACVLFILDEMRKKSKKDEEMTTGEGLEW  1185
             AILD+VE KL L+PEKLRA++ VL EYGN++SACVLFILDEMR+K  +D   TTGEGLEW
Sbjct  308   AILDQVESKLALKPEKLRATRHVLGEYGNMSSACVLFILDEMRRKCAEDGLKTTGEGLEW  367

Query  1186  GVVFVVCP  1209
             GV+F   P
Sbjct  368   GVLFGFGP  375



>sp|O22047.1|CHSE_IPOPU RecName: Full=Chalcone synthase E; AltName: Full=Naringenin-chalcone 
synthase E; Short=CHS-E [Ipomoea purpurea]
 dbj|BAA21789.1| chalcone synthase [Ipomoea purpurea]
 dbj|BAA87337.1| chalcone synthase [Ipomoea purpurea]
Length=389

 Score =   531 bits (1367),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 249/368 (68%), Positives = 302/368 (82%), Gaps = 0/368 (0%)
 Frame = +1

Query  106   RRAKRFEGDAKILAIGTAIPANWVDQTTYPDFYFRITNSEHLLEHKEKFRRICNKSKIRK  285
             R+A+R +G A I+AIGT+ P N VDQ+TYPD+YFRITNSEHL+E KEKF+R+C KS I+K
Sbjct  8     RKAQRAQGPATIMAIGTSTPQNCVDQSTYPDYYFRITNSEHLVELKEKFKRMCEKSMIKK  67

Query  286   RHLVITEELLKKNPNLCTYNEASLNTRQDILVSEVPKLGKEAAMKAIKEWGRPISEITHL  465
             R++ +TEE+L +NPN+C Y   SL+ RQDI+V EVPKLGKEAA KAIKEWG+P S+ITHL
Sbjct  68    RYMYLTEEILTENPNICAYMAPSLDARQDIVVVEVPKLGKEAAQKAIKEWGQPKSKITHL  127

Query  466   VFCTSSGVDMPGADFQLAKLLGLSSSVKRLMMYQQGCNAGAAMLRLAKDLAENNKGARVL  645
             VFCT+SGVDMPGAD+QL KLLGL  SVKR MMYQQGC AG  ++RLAKDLAENNKGARVL
Sbjct  128   VFCTTSGVDMPGADYQLTKLLGLQPSVKRFMMYQQGCFAGGTVIRLAKDLAENNKGARVL  187

Query  646   VVCSEVMLNVFRGPSLEQEDNLLAQCLFGDGSAAVIVGTEPRPGLETPLFELVSAAQTTI  825
             VVCSE+    FRGPS    D+L+ Q LFGDG+AA+I+G++P P LE PLF+LVSAAQT +
Sbjct  188   VVCSEITAVTFRGPSDAHLDSLVGQALFGDGAAALIIGSDPDPDLERPLFQLVSAAQTIL  247

Query  826   PDTDSHLKLHLREMGLTFHCSKAVPSLITQNVEDCLVKAFEPFGISDWNSIFWILHPGGI  1005
             PD+   +  HLRE+GLTFH  K VP LI++++E  L +AF+P GI DWNS+FWI HPGG 
Sbjct  248   PDSGGAIDGHLREVGLTFHLLKDVPGLISKHIEKSLNEAFQPLGIRDWNSLFWIAHPGGP  307

Query  1006  AILDRVEEKLGLEPEKLRASKDVLSEYGNLTSACVLFILDEMRKKSKKDEEMTTGEGLEW  1185
             AILD+VEEKL L+PEKLRA++ VLSEYGN++SACVLFILDEMRK S K+   TTGEGLEW
Sbjct  308   AILDQVEEKLELKPEKLRATRHVLSEYGNMSSACVLFILDEMRKASSKEGLNTTGEGLEW  367

Query  1186  GVVFVVCP  1209
             GV+F   P
Sbjct  368   GVLFGFGP  375



>dbj|BAA19548.1| chalcone synthase [Perilla frutescens]
Length=379

 Score =   530 bits (1366),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 250/368 (68%), Positives = 298/368 (81%), Gaps = 0/368 (0%)
 Frame = +1

Query  106   RRAKRFEGDAKILAIGTAIPANWVDQTTYPDFYFRITNSEHLLEHKEKFRRICNKSKIRK  285
             RRA+R EG A +LAIGTA P N VDQ+TYPD+YFRITNSEH  + KEKF+R+C KS IRK
Sbjct  8     RRAQRAEGPATVLAIGTATPENCVDQSTYPDYYFRITNSEHRTDLKEKFKRMCEKSMIRK  67

Query  286   RHLVITEELLKKNPNLCTYNEASLNTRQDILVSEVPKLGKEAAMKAIKEWGRPISEITHL  465
             R++ +TEE LK+NPN+  Y   SL+ RQDI+V EVPKLGKEAA KAIKEWG+P S+ITHL
Sbjct  68    RYMHLTEEFLKENPNMTAYMAPSLDARQDIVVVEVPKLGKEAAQKAIKEWGQPKSKITHL  127

Query  466   VFCTSSGVDMPGADFQLAKLLGLSSSVKRLMMYQQGCNAGAAMLRLAKDLAENNKGARVL  645
             VFCT+SGVDMPGAD+QL KLLGL  SVKR MMYQQGC AG  +LR+AKDLAENN GARVL
Sbjct  128   VFCTTSGVDMPGADYQLTKLLGLRPSVKRFMMYQQGCYAGGTVLRMAKDLAENNAGARVL  187

Query  646   VVCSEVMLNVFRGPSLEQEDNLLAQCLFGDGSAAVIVGTEPRPGLETPLFELVSAAQTTI  825
             VVCSE+    FRGPS    D+L+ Q LFGDG+AAVIVG++P  G+E PLF+LVSAAQT +
Sbjct  188   VVCSEITAVTFRGPSESHLDSLVGQALFGDGAAAVIVGSDPVVGVERPLFQLVSAAQTIL  247

Query  826   PDTDSHLKLHLREMGLTFHCSKAVPSLITQNVEDCLVKAFEPFGISDWNSIFWILHPGGI  1005
             PD+D  +  HLRE+GLTFH  K VP LI++N+E  L +AF P GISDWNS+FWI HPGG 
Sbjct  248   PDSDGAIDGHLREVGLTFHLLKDVPGLISKNIEKSLKEAFGPLGISDWNSVFWIAHPGGP  307

Query  1006  AILDRVEEKLGLEPEKLRASKDVLSEYGNLTSACVLFILDEMRKKSKKDEEMTTGEGLEW  1185
             AILD+VE KLGL+PEKLR+++ VL EYGN++SACVLFILDEMRK S K+   +TGEGL+W
Sbjct  308   AILDQVEAKLGLKPEKLRSTRHVLGEYGNMSSACVLFILDEMRKSSAKEGMSSTGEGLDW  367

Query  1186  GVVFVVCP  1209
             GV+F   P
Sbjct  368   GVLFGFGP  375



>gb|AEN83501.1| chalcone synthase [Solanum tuberosum]
Length=389

 Score =   531 bits (1367),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 251/368 (68%), Positives = 305/368 (83%), Gaps = 0/368 (0%)
 Frame = +1

Query  106   RRAKRFEGDAKILAIGTAIPANWVDQTTYPDFYFRITNSEHLLEHKEKFRRICNKSKIRK  285
             R+A+R EG A ILAIGT+ P+N VDQ+TYPD+YFRITNSEH  E KEKF+R+C+KS I+K
Sbjct  8     RKAQRAEGPATILAIGTSTPSNCVDQSTYPDYYFRITNSEHKTELKEKFKRMCDKSMIKK  67

Query  286   RHLVITEELLKKNPNLCTYNEASLNTRQDILVSEVPKLGKEAAMKAIKEWGRPISEITHL  465
             R++ +TEE+LK+NPN+C Y   SL+ RQDI+V EVPKLGKEAA KAIKEWG+P S+ITHL
Sbjct  68    RYMHLTEEILKENPNMCAYMAPSLDARQDIVVVEVPKLGKEAAQKAIKEWGQPKSKITHL  127

Query  466   VFCTSSGVDMPGADFQLAKLLGLSSSVKRLMMYQQGCNAGAAMLRLAKDLAENNKGARVL  645
             VFCT+SGVDMPG D+QLAKLLGL  SVKRLMMYQQGC AG  +LRLAKDLAENNKGARVL
Sbjct  128   VFCTTSGVDMPGCDYQLAKLLGLRPSVKRLMMYQQGCFAGGTVLRLAKDLAENNKGARVL  187

Query  646   VVCSEVMLNVFRGPSLEQEDNLLAQCLFGDGSAAVIVGTEPRPGLETPLFELVSAAQTTI  825
             VVCSE+    FRGPS    D+L+ Q LFGDG+AA+I+G++P  G+E PLFELVSAAQT +
Sbjct  188   VVCSEITAVTFRGPSESHLDSLVGQALFGDGAAAIIMGSDPIIGVERPLFELVSAAQTLV  247

Query  826   PDTDSHLKLHLREMGLTFHCSKAVPSLITQNVEDCLVKAFEPFGISDWNSIFWILHPGGI  1005
             PD++  +  HLRE+GLTFH  K VP LI++N+E  L++AF+P GISDWNS+FWI HPGG 
Sbjct  248   PDSEGAIDGHLREVGLTFHLLKDVPGLISKNIEKSLLEAFQPLGISDWNSLFWIAHPGGP  307

Query  1006  AILDRVEEKLGLEPEKLRASKDVLSEYGNLTSACVLFILDEMRKKSKKDEEMTTGEGLEW  1185
             AILD+VE KLGL+ EKLRA+++VLS YGN++SACVLFILDE+RK S  +   TTGEGLEW
Sbjct  308   AILDQVELKLGLKQEKLRATREVLSNYGNMSSACVLFILDEVRKASTNEGLGTTGEGLEW  367

Query  1186  GVVFVVCP  1209
             GV+F   P
Sbjct  368   GVLFGFGP  375



>ref|XP_011020677.1| PREDICTED: chalcone synthase 1-like isoform X1 [Populus euphratica]
 ref|XP_011020678.1| PREDICTED: chalcone synthase 1-like isoform X1 [Populus euphratica]
 ref|XP_011020679.1| PREDICTED: chalcone synthase 1-like isoform X1 [Populus euphratica]
Length=391

 Score =   531 bits (1367),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 250/368 (68%), Positives = 301/368 (82%), Gaps = 0/368 (0%)
 Frame = +1

Query  106   RRAKRFEGDAKILAIGTAIPANWVDQTTYPDFYFRITNSEHLLEHKEKFRRICNKSKIRK  285
             R+ +R EG A I+AIGT+ P N VDQ+TYPD+YFRITNSEH  E KEKF+R+C KS I+K
Sbjct  8     RKGQRAEGPATIMAIGTSTPPNCVDQSTYPDYYFRITNSEHKAELKEKFKRMCEKSMIKK  67

Query  286   RHLVITEELLKKNPNLCTYNEASLNTRQDILVSEVPKLGKEAAMKAIKEWGRPISEITHL  465
             R++ +TE++LK+NPN+C Y   SL+ RQD++V EVPKLGKEAA KAIKEWG+  S+ITHL
Sbjct  68    RYMYLTEDILKENPNVCAYMAPSLDARQDMVVVEVPKLGKEAATKAIKEWGQSKSKITHL  127

Query  466   VFCTSSGVDMPGADFQLAKLLGLSSSVKRLMMYQQGCNAGAAMLRLAKDLAENNKGARVL  645
             VFCT+SGVDMPGAD+QL KLLGL  SVKR MMYQQGC AG  +LRLAKD AENNKGARVL
Sbjct  128   VFCTTSGVDMPGADYQLTKLLGLRPSVKRFMMYQQGCFAGGTVLRLAKDHAENNKGARVL  187

Query  646   VVCSEVMLNVFRGPSLEQEDNLLAQCLFGDGSAAVIVGTEPRPGLETPLFELVSAAQTTI  825
             VVCSE+    FRGPS    D+L+ Q LFGDG+AA+I+G++P  G+E PLFELVSAAQT +
Sbjct  188   VVCSEITAVTFRGPSDTHLDSLVGQALFGDGAAALIIGSDPVVGVEKPLFELVSAAQTIL  247

Query  826   PDTDSHLKLHLREMGLTFHCSKAVPSLITQNVEDCLVKAFEPFGISDWNSIFWILHPGGI  1005
             PD+D  +  HLRE+GLTFH  K VP LI++NVE  L +AF+P GISDWNS+FWI HPGG 
Sbjct  248   PDSDGAIDGHLREVGLTFHLLKDVPGLISKNVEKSLTEAFKPLGISDWNSLFWIAHPGGP  307

Query  1006  AILDRVEEKLGLEPEKLRASKDVLSEYGNLTSACVLFILDEMRKKSKKDEEMTTGEGLEW  1185
             AILD+VE KLGL+PEKLRA++ VLSEYGN++SACVLFILDEMRKKS +D   +TGEGLEW
Sbjct  308   AILDQVEAKLGLKPEKLRATRHVLSEYGNMSSACVLFILDEMRKKSAEDGLQSTGEGLEW  367

Query  1186  GVVFVVCP  1209
             GV+F   P
Sbjct  368   GVLFGFGP  375



>dbj|BAE45039.1| chalcone synthase [Gentiana triflora]
Length=389

 Score =   531 bits (1367),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 248/368 (67%), Positives = 301/368 (82%), Gaps = 0/368 (0%)
 Frame = +1

Query  106   RRAKRFEGDAKILAIGTAIPANWVDQTTYPDFYFRITNSEHLLEHKEKFRRICNKSKIRK  285
             R+A+R EG A +LAIGTA P N VDQ+TYPD+YFRIT+SEH  E KEKF+R+C KS IRK
Sbjct  8     RKAQRAEGPATVLAIGTATPVNCVDQSTYPDYYFRITDSEHKTELKEKFKRMCEKSMIRK  67

Query  286   RHLVITEELLKKNPNLCTYNEASLNTRQDILVSEVPKLGKEAAMKAIKEWGRPISEITHL  465
             R++ +TE++LK+NPN+C Y   SL+ RQDI+V EVPKLGKEAA KAIKEWG+P S+ITHL
Sbjct  68    RYMHLTEDILKENPNMCAYMAPSLDARQDIVVVEVPKLGKEAAQKAIKEWGQPKSKITHL  127

Query  466   VFCTSSGVDMPGADFQLAKLLGLSSSVKRLMMYQQGCNAGAAMLRLAKDLAENNKGARVL  645
             VFCT+SGVDMPGAD+Q+ KLLGL SSVKR MMYQQGC AG  +LR+AKDLAENN+GARVL
Sbjct  128   VFCTTSGVDMPGADYQITKLLGLRSSVKRFMMYQQGCFAGGTVLRMAKDLAENNRGARVL  187

Query  646   VVCSEVMLNVFRGPSLEQEDNLLAQCLFGDGSAAVIVGTEPRPGLETPLFELVSAAQTTI  825
             VVCSE+    FRGPS    D+L+ Q LFGDG+AA+IVG++P P LE PLF++VSAAQT +
Sbjct  188   VVCSEITAVTFRGPSESHLDSLVGQALFGDGAAAIIVGSDPIPDLERPLFQIVSAAQTLL  247

Query  826   PDTDSHLKLHLREMGLTFHCSKAVPSLITQNVEDCLVKAFEPFGISDWNSIFWILHPGGI  1005
             PD+   +  HLRE+GLTFH  K VP LI++++E  L +AF+P GISDWNSIFWI HPGG 
Sbjct  248   PDSHGAIDGHLREVGLTFHLLKDVPGLISKHIEKSLKEAFDPIGISDWNSIFWIAHPGGP  307

Query  1006  AILDRVEEKLGLEPEKLRASKDVLSEYGNLTSACVLFILDEMRKKSKKDEEMTTGEGLEW  1185
             AILD+VEE LGLE +KLRA++ VL+EYGN++SACVLFILDEMRK S KD   TTGEG +W
Sbjct  308   AILDQVEETLGLEAQKLRATRHVLAEYGNMSSACVLFILDEMRKTSAKDGATTTGEGQDW  367

Query  1186  GVVFVVCP  1209
             GV+F   P
Sbjct  368   GVLFGFGP  375



>ref|NP_001275352.1| chalcone synthase 1A [Solanum tuberosum]
 sp|Q41436.1|CHSA_SOLTU RecName: Full=Chalcone synthase 1A; AltName: Full=Naringenin-chalcone 
synthase 1A [Solanum tuberosum]
 gb|AAB67734.1| chalcone synthase 1a [Solanum tuberosum]
Length=389

 Score =   530 bits (1366),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 251/368 (68%), Positives = 304/368 (83%), Gaps = 0/368 (0%)
 Frame = +1

Query  106   RRAKRFEGDAKILAIGTAIPANWVDQTTYPDFYFRITNSEHLLEHKEKFRRICNKSKIRK  285
             R+A+R EG A ILAIGT+ P+N VDQ+TYPD+YFRITNSEH  E KEKF+R+C+KS I+K
Sbjct  8     RKAQRAEGPATILAIGTSTPSNCVDQSTYPDYYFRITNSEHKTELKEKFKRMCDKSMIKK  67

Query  286   RHLVITEELLKKNPNLCTYNEASLNTRQDILVSEVPKLGKEAAMKAIKEWGRPISEITHL  465
             R++ +TEE+LK+NPN+C Y   SL+ RQDI+V EVPKLGKEAA KAIKEWG+P S+ITHL
Sbjct  68    RYMHLTEEILKENPNMCAYMAPSLDARQDIVVVEVPKLGKEAAQKAIKEWGQPKSKITHL  127

Query  466   VFCTSSGVDMPGADFQLAKLLGLSSSVKRLMMYQQGCNAGAAMLRLAKDLAENNKGARVL  645
             VFCT+SGVDMPG D+QLAKLLGL  SVKRLMMYQQGC  G  +LRLAKDLAENNKGARVL
Sbjct  128   VFCTTSGVDMPGCDYQLAKLLGLRPSVKRLMMYQQGCFVGGTVLRLAKDLAENNKGARVL  187

Query  646   VVCSEVMLNVFRGPSLEQEDNLLAQCLFGDGSAAVIVGTEPRPGLETPLFELVSAAQTTI  825
             VVCSE+    FRGPS    D+L+ Q LFGDG+AA+I+G++P  G+E PLFELVSAAQT +
Sbjct  188   VVCSEITAVTFRGPSESHLDSLVGQALFGDGAAAIIMGSDPIIGVERPLFELVSAAQTLV  247

Query  826   PDTDSHLKLHLREMGLTFHCSKAVPSLITQNVEDCLVKAFEPFGISDWNSIFWILHPGGI  1005
             PD++  +  HLRE+GLTFH  K VP LI++N+E  L++AF+P GISDWNS+FWI HPGG 
Sbjct  248   PDSEGAIDGHLREVGLTFHLLKDVPGLISKNIEKSLLEAFQPLGISDWNSLFWIAHPGGP  307

Query  1006  AILDRVEEKLGLEPEKLRASKDVLSEYGNLTSACVLFILDEMRKKSKKDEEMTTGEGLEW  1185
             AILD+VE KLGL+ EKLRA+++VLS YGN++SACVLFILDEMRK S  +   TTGEGLEW
Sbjct  308   AILDQVELKLGLKQEKLRATREVLSNYGNMSSACVLFILDEMRKASTNEGLGTTGEGLEW  367

Query  1186  GVVFVVCP  1209
             GV+F   P
Sbjct  368   GVLFGFGP  375



>sp|Q9ZRR8.1|CHS1_CASGL RecName: Full=Chalcone synthase; AltName: Full=Naringenin-chalcone 
synthase [Casuarina glauca]
 emb|CAA10641.1| chalcone synthase [Casuarina glauca]
Length=389

 Score =   530 bits (1366),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 247/368 (67%), Positives = 304/368 (83%), Gaps = 0/368 (0%)
 Frame = +1

Query  106   RRAKRFEGDAKILAIGTAIPANWVDQTTYPDFYFRITNSEHLLEHKEKFRRICNKSKIRK  285
             R+A+R EG A +LAIGTA P N +DQ+TYPD+YFRITNSEH  E KEKF+R+C+KS I+K
Sbjct  8     RKAQRAEGPATVLAIGTATPPNCLDQSTYPDYYFRITNSEHKTELKEKFQRMCDKSMIKK  67

Query  286   RHLVITEELLKKNPNLCTYNEASLNTRQDILVSEVPKLGKEAAMKAIKEWGRPISEITHL  465
             R++ +TEE+LK++PN+C Y   SL+ RQD++V E+PKLGKEAA+KAIKEWG+P S+ITHL
Sbjct  68    RYMYLTEEILKEHPNMCAYMAPSLDARQDMVVVEIPKLGKEAAVKAIKEWGQPKSKITHL  127

Query  466   VFCTSSGVDMPGADFQLAKLLGLSSSVKRLMMYQQGCNAGAAMLRLAKDLAENNKGARVL  645
             VFCT+SGVDMPGAD+QL KLLGL  SVKRLMMYQQGC AG  +LRLAKDLAENN+GARVL
Sbjct  128   VFCTTSGVDMPGADYQLTKLLGLRPSVKRLMMYQQGCFAGGTVLRLAKDLAENNRGARVL  187

Query  646   VVCSEVMLNVFRGPSLEQEDNLLAQCLFGDGSAAVIVGTEPRPGLETPLFELVSAAQTTI  825
             VVCSE+    FRGPS    D+L+ Q LFGDG+AA+IVG +P P +E PLFE+VS AQT +
Sbjct  188   VVCSEITAVTFRGPSDTHLDSLVGQALFGDGAAAIIVGADPLPEVEKPLFEVVSTAQTIL  247

Query  826   PDTDSHLKLHLREMGLTFHCSKAVPSLITQNVEDCLVKAFEPFGISDWNSIFWILHPGGI  1005
             PD+D  +  HLRE+G+TFH  K VP LI++N+E  LV+AF+P GISDWNS+FWI HPGG 
Sbjct  248   PDSDGAIDGHLREVGVTFHLLKDVPGLISKNIEKSLVEAFQPLGISDWNSLFWIAHPGGP  307

Query  1006  AILDRVEEKLGLEPEKLRASKDVLSEYGNLTSACVLFILDEMRKKSKKDEEMTTGEGLEW  1185
             AILD+VEEKL L+PEKL A++ VLSEYGN++SACVLFILDEMR+KS +    TTGEGL+W
Sbjct  308   AILDQVEEKLALKPEKLGATRHVLSEYGNMSSACVLFILDEMRRKSAEKGLKTTGEGLDW  367

Query  1186  GVVFVVCP  1209
             GV+F   P
Sbjct  368   GVLFGFGP  375



>ref|XP_011020680.1| PREDICTED: chalcone synthase 1-like isoform X2 [Populus euphratica]
Length=391

 Score =   530 bits (1366),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 250/368 (68%), Positives = 301/368 (82%), Gaps = 0/368 (0%)
 Frame = +1

Query  106   RRAKRFEGDAKILAIGTAIPANWVDQTTYPDFYFRITNSEHLLEHKEKFRRICNKSKIRK  285
             R+ +R EG A I+AIGT+ P N VDQ+TYPD+YFRITNSEH  E KEKF+R+C KS I+K
Sbjct  8     RKGQRAEGPATIMAIGTSTPPNCVDQSTYPDYYFRITNSEHKAELKEKFKRMCEKSMIKK  67

Query  286   RHLVITEELLKKNPNLCTYNEASLNTRQDILVSEVPKLGKEAAMKAIKEWGRPISEITHL  465
             R++ +TE++LK+NPN+C Y   SL+ RQD++V EVPKLGKEAA KAIKEWG+  S+ITHL
Sbjct  68    RYMYLTEDILKENPNVCAYMAPSLDARQDMVVVEVPKLGKEAATKAIKEWGQSKSKITHL  127

Query  466   VFCTSSGVDMPGADFQLAKLLGLSSSVKRLMMYQQGCNAGAAMLRLAKDLAENNKGARVL  645
             VFCT+SGVDMPGAD+QL KLLGL  SVKR MMYQQGC AG  +LRLAKD AENNKGARVL
Sbjct  128   VFCTTSGVDMPGADYQLTKLLGLRPSVKRFMMYQQGCFAGGTVLRLAKDHAENNKGARVL  187

Query  646   VVCSEVMLNVFRGPSLEQEDNLLAQCLFGDGSAAVIVGTEPRPGLETPLFELVSAAQTTI  825
             VVCSE+    FRGPS    D+L+ Q LFGDG+AA+I+G++P  G+E PLFELVSAAQT +
Sbjct  188   VVCSEITAVTFRGPSDTHLDSLVGQALFGDGAAALIIGSDPVVGVEKPLFELVSAAQTIL  247

Query  826   PDTDSHLKLHLREMGLTFHCSKAVPSLITQNVEDCLVKAFEPFGISDWNSIFWILHPGGI  1005
             PD+D  +  HLRE+GLTFH  K VP LI++NVE  L +AF+P GISDWNS+FWI HPGG 
Sbjct  248   PDSDGAIDGHLREVGLTFHLLKDVPGLISKNVEKSLTEAFKPLGISDWNSLFWIAHPGGP  307

Query  1006  AILDRVEEKLGLEPEKLRASKDVLSEYGNLTSACVLFILDEMRKKSKKDEEMTTGEGLEW  1185
             AILD+VE KLGL+PEKLRA++ VLSEYGN++SACVLFILDEMRKKS +D   +TGEGLEW
Sbjct  308   AILDQVEAKLGLKPEKLRATRHVLSEYGNMSSACVLFILDEMRKKSAEDGLQSTGEGLEW  367

Query  1186  GVVFVVCP  1209
             GV+F   P
Sbjct  368   GVLFGFGP  375



>gb|AAN76184.1| chalcone synthase [Hydrangea macrophylla]
Length=389

 Score =   530 bits (1365),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 249/368 (68%), Positives = 302/368 (82%), Gaps = 0/368 (0%)
 Frame = +1

Query  106   RRAKRFEGDAKILAIGTAIPANWVDQTTYPDFYFRITNSEHLLEHKEKFRRICNKSKIRK  285
             R+A+R EG A ILAIGTA P N+VDQ+TYPDFYFR+TNSEH  E K KF+R+CN S+I+K
Sbjct  8     RKAQRAEGPATILAIGTATPPNYVDQSTYPDFYFRVTNSEHKKELKAKFQRMCNNSQIKK  67

Query  286   RHLVITEELLKKNPNLCTYNEASLNTRQDILVSEVPKLGKEAAMKAIKEWGRPISEITHL  465
              ++ +TEE+LK NPN+C Y   SL+ RQD++V E+PKLGKEAA +AIKEWG+P S+ITHL
Sbjct  68    CYMHLTEEILKLNPNICAYMVPSLDARQDMVVVEIPKLGKEAATRAIKEWGQPKSKITHL  127

Query  466   VFCTSSGVDMPGADFQLAKLLGLSSSVKRLMMYQQGCNAGAAMLRLAKDLAENNKGARVL  645
             VFCT+SGVDMPGAD+QL KLLGL  SVKRLMMYQQGC AG  +LRLAKDLAENNKGARVL
Sbjct  128   VFCTTSGVDMPGADYQLTKLLGLRPSVKRLMMYQQGCFAGGTVLRLAKDLAENNKGARVL  187

Query  646   VVCSEVMLNVFRGPSLEQEDNLLAQCLFGDGSAAVIVGTEPRPGLETPLFELVSAAQTTI  825
             VVCSE+    FRGPS    D+L+ Q LFGDG+ AVI+G++P P +E PLFE+VSAAQT +
Sbjct  188   VVCSEITAVTFRGPSDTHLDSLVGQALFGDGARAVIIGSDPMPEVEKPLFEIVSAAQTIL  247

Query  826   PDTDSHLKLHLREMGLTFHCSKAVPSLITQNVEDCLVKAFEPFGISDWNSIFWILHPGGI  1005
             PD+D  +  HLRE+GLTFH  K VP LI++N+E  LV+AF P  ISDWNSIFWI HPGG 
Sbjct  248   PDSDGAIDGHLREVGLTFHLLKDVPGLISKNIEKSLVEAFRPLDISDWNSIFWIAHPGGP  307

Query  1006  AILDRVEEKLGLEPEKLRASKDVLSEYGNLTSACVLFILDEMRKKSKKDEEMTTGEGLEW  1185
             AILD+VE+KL L+PEKLRA+++VLS+YGN++SACVLFI+DEMRK S  +  MTTGEGLEW
Sbjct  308   AILDQVEKKLALKPEKLRATRNVLSDYGNMSSACVLFIMDEMRKNSVYEGLMTTGEGLEW  367

Query  1186  GVVFVVCP  1209
             GV+F   P
Sbjct  368   GVLFGFGP  375



>emb|CAK19317.1| naringenin-chalcone synthase [Humulus lupulus]
Length=389

 Score =   530 bits (1365),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 251/368 (68%), Positives = 301/368 (82%), Gaps = 0/368 (0%)
 Frame = +1

Query  106   RRAKRFEGDAKILAIGTAIPANWVDQTTYPDFYFRITNSEHLLEHKEKFRRICNKSKIRK  285
             R+A+R EG A ILAIGTA PAN + Q+ YPD+YFRITNSEH  E KEKF+R+C+KS IRK
Sbjct  8     RKAQRAEGPATILAIGTATPANCILQSEYPDYYFRITNSEHKTELKEKFKRMCDKSMIRK  67

Query  286   RHLVITEELLKKNPNLCTYNEASLNTRQDILVSEVPKLGKEAAMKAIKEWGRPISEITHL  465
             R++ +TEE+LK+NPNLC Y   SL+ RQD++V EVPKLGKEAA KAIKEWG+P S+ITH+
Sbjct  68    RYMHLTEEILKENPNLCAYEAPSLDARQDMVVVEVPKLGKEAATKAIKEWGQPKSKITHV  127

Query  466   VFCTSSGVDMPGADFQLAKLLGLSSSVKRLMMYQQGCNAGAAMLRLAKDLAENNKGARVL  645
             VFCT+SGVDMPGAD+QL KLLGL  SVKRLMMYQQGC AG  +LR+AKDLAENNKGARVL
Sbjct  128   VFCTTSGVDMPGADYQLTKLLGLRPSVKRLMMYQQGCFAGGTVLRVAKDLAENNKGARVL  187

Query  646   VVCSEVMLNVFRGPSLEQEDNLLAQCLFGDGSAAVIVGTEPRPGLETPLFELVSAAQTTI  825
             VVCSE+    FRGP+    D+L+ Q LFGDGSAA+I+G +P P +E P FELVSAAQT +
Sbjct  188   VVCSEITAVTFRGPNDTHLDSLVGQALFGDGSAALIIGADPIPEIEKPTFELVSAAQTIL  247

Query  826   PDTDSHLKLHLREMGLTFHCSKAVPSLITQNVEDCLVKAFEPFGISDWNSIFWILHPGGI  1005
             PD+D  +  HLRE+GLTFH  K VP LI++N+E  LV+AF+P GISDWNS+FWI HPGG 
Sbjct  248   PDSDGAIDGHLREVGLTFHLLKDVPGLISKNIEKSLVEAFKPLGISDWNSLFWIAHPGGP  307

Query  1006  AILDRVEEKLGLEPEKLRASKDVLSEYGNLTSACVLFILDEMRKKSKKDEEMTTGEGLEW  1185
             AILD+VE KL L+PEKLRA++ VL EYGN++SACVLFILDEMR+K  +D   TTGEGLEW
Sbjct  308   AILDQVESKLALKPEKLRATRHVLGEYGNMSSACVLFILDEMRRKCAEDGLKTTGEGLEW  367

Query  1186  GVVFVVCP  1209
             GV+F   P
Sbjct  368   GVLFGFGP  375



>dbj|BAB92996.1| chalcone synthase [Malus domestica]
 gb|ACJ54532.1| chalcone synthase [Malus domestica]
Length=391

 Score =   530 bits (1365),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 248/368 (67%), Positives = 304/368 (83%), Gaps = 0/368 (0%)
 Frame = +1

Query  106   RRAKRFEGDAKILAIGTAIPANWVDQTTYPDFYFRITNSEHLLEHKEKFRRICNKSKIRK  285
             R+A+R EG A ++AIGTA P+N VDQ TYPD+YFRITNSEH +E KEKF+R+C+KS I+K
Sbjct  8     RKAQRAEGPATVMAIGTATPSNCVDQATYPDYYFRITNSEHKVELKEKFQRMCDKSMIKK  67

Query  286   RHLVITEELLKKNPNLCTYNEASLNTRQDILVSEVPKLGKEAAMKAIKEWGRPISEITHL  465
             R++ +TEE+LK+NP++C Y   S++ RQD++V EVPKLGKEAA+KAIKEWG+P S+ITHL
Sbjct  68    RYMYLTEEILKENPSVCEYMAPSIDARQDMVVVEVPKLGKEAAIKAIKEWGQPKSKITHL  127

Query  466   VFCTSSGVDMPGADFQLAKLLGLSSSVKRLMMYQQGCNAGAAMLRLAKDLAENNKGARVL  645
             VFCT+SGVDMPGAD+QL KLLGL  SVKRLMMYQQGC AG  +LRLAKDLAENNKGARVL
Sbjct  128   VFCTTSGVDMPGADYQLTKLLGLRPSVKRLMMYQQGCFAGGTVLRLAKDLAENNKGARVL  187

Query  646   VVCSEVMLNVFRGPSLEQEDNLLAQCLFGDGSAAVIVGTEPRPGLETPLFELVSAAQTTI  825
             VVCSE+    FRGPS    D+L+ Q LFGDG+AAVI+G +P P +E PLFELVSAAQT +
Sbjct  188   VVCSEITAVTFRGPSDTHLDSLVGQALFGDGAAAVIIGADPVPEVEKPLFELVSAAQTIL  247

Query  826   PDTDSHLKLHLREMGLTFHCSKAVPSLITQNVEDCLVKAFEPFGISDWNSIFWILHPGGI  1005
             PD+D  +  HLRE+GLTFH  K VP LI++N+E  L +AF+P GISDWNS+FWI HPGG 
Sbjct  248   PDSDGAIDGHLREVGLTFHLLKDVPGLISKNIEKSLNEAFKPIGISDWNSLFWIAHPGGP  307

Query  1006  AILDRVEEKLGLEPEKLRASKDVLSEYGNLTSACVLFILDEMRKKSKKDEEMTTGEGLEW  1185
             AILD+VE KL L+PEKL A++ VLS+YGN++SACVLFILDE+R+KS +    TTGEGLEW
Sbjct  308   AILDQVEAKLALKPEKLEATRQVLSDYGNMSSACVLFILDEVRRKSAEKGLKTTGEGLEW  367

Query  1186  GVVFVVCP  1209
             GV+F   P
Sbjct  368   GVLFGFGP  375



>ref|XP_009764938.1| PREDICTED: chalcone synthase A [Nicotiana sylvestris]
Length=389

 Score =   530 bits (1364),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 250/368 (68%), Positives = 303/368 (82%), Gaps = 0/368 (0%)
 Frame = +1

Query  106   RRAKRFEGDAKILAIGTAIPANWVDQTTYPDFYFRITNSEHLLEHKEKFRRICNKSKIRK  285
             RRA+R EG A ++AIGTA P+N VDQ+TYPD+YFRITNSEH  E KEKF+R+C KS I+K
Sbjct  8     RRAQRAEGPATVMAIGTATPSNCVDQSTYPDYYFRITNSEHKTELKEKFKRMCEKSMIKK  67

Query  286   RHLVITEELLKKNPNLCTYNEASLNTRQDILVSEVPKLGKEAAMKAIKEWGRPISEITHL  465
             R++ +TEE+LK+NPN+C Y   SL+ RQDI+V EVPKLGKEAA KAIKEWG+P S+I+HL
Sbjct  68    RYMHLTEEILKENPNICAYMAPSLDARQDIVVVEVPKLGKEAAQKAIKEWGQPKSKISHL  127

Query  466   VFCTSSGVDMPGADFQLAKLLGLSSSVKRLMMYQQGCNAGAAMLRLAKDLAENNKGARVL  645
             VFCT+SGVDMPG D+QL KLLGL  SVKR MMYQQGC AG  +LR+AKDLAENNKGARVL
Sbjct  128   VFCTTSGVDMPGCDYQLTKLLGLRPSVKRFMMYQQGCFAGGTVLRMAKDLAENNKGARVL  187

Query  646   VVCSEVMLNVFRGPSLEQEDNLLAQCLFGDGSAAVIVGTEPRPGLETPLFELVSAAQTTI  825
             VVCSE+    FRGP+    D+L+ Q LFGDG+AAVIVG++P P +E PLFELVSAAQT +
Sbjct  188   VVCSEITAVTFRGPNDTHLDSLVGQALFGDGAAAVIVGSDPIPDVERPLFELVSAAQTLL  247

Query  826   PDTDSHLKLHLREMGLTFHCSKAVPSLITQNVEDCLVKAFEPFGISDWNSIFWILHPGGI  1005
             PD++  +  HLRE+GLTFH  K VP LI++N+E  LV+AF+P GISDWNS+FWI HPGG 
Sbjct  248   PDSEGAIDGHLREVGLTFHLLKDVPGLISKNIEKSLVEAFQPLGISDWNSLFWIAHPGGP  307

Query  1006  AILDRVEEKLGLEPEKLRASKDVLSEYGNLTSACVLFILDEMRKKSKKDEEMTTGEGLEW  1185
             AILD+VE KLGL+ EKL+A+++VLS YGN++SACVLFILDEMRK S K+   TTGEGLEW
Sbjct  308   AILDQVELKLGLKQEKLKATRNVLSNYGNMSSACVLFILDEMRKASAKEGLGTTGEGLEW  367

Query  1186  GVVFVVCP  1209
             GV+F   P
Sbjct  368   GVLFGFGP  375



>ref|XP_007032052.1| Chalcone and stilbene synthase family protein [Theobroma cacao]
 gb|EOY02978.1| Chalcone and stilbene synthase family protein [Theobroma cacao]
Length=395

 Score =   530 bits (1365),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 250/368 (68%), Positives = 302/368 (82%), Gaps = 0/368 (0%)
 Frame = +1

Query  106   RRAKRFEGDAKILAIGTAIPANWVDQTTYPDFYFRITNSEHLLEHKEKFRRICNKSKIRK  285
             R+A+R +G A +LAIGTA P N V Q  YPD+YFRITNSEHL E KEKF+R+C+KS I+K
Sbjct  10    RKAQRAQGPATVLAIGTATPPNCVSQADYPDYYFRITNSEHLTELKEKFKRMCDKSMIKK  69

Query  286   RHLVITEELLKKNPNLCTYNEASLNTRQDILVSEVPKLGKEAAMKAIKEWGRPISEITHL  465
             R++ +TEE+LK+NPN+C Y  +SL+ RQD++V EVPKLGKEAA KAIKEWG+P S+ITHL
Sbjct  70    RYMYLTEEILKENPNMCAYMASSLDARQDMVVVEVPKLGKEAATKAIKEWGQPKSKITHL  129

Query  466   VFCTSSGVDMPGADFQLAKLLGLSSSVKRLMMYQQGCNAGAAMLRLAKDLAENNKGARVL  645
             VFCT+SGVDMPGAD+QL KLLGL  SVKRLMMYQQGC AG  +LR+AKDLAENNKGARVL
Sbjct  130   VFCTTSGVDMPGADYQLTKLLGLRPSVKRLMMYQQGCFAGGTVLRVAKDLAENNKGARVL  189

Query  646   VVCSEVMLNVFRGPSLEQEDNLLAQCLFGDGSAAVIVGTEPRPGLETPLFELVSAAQTTI  825
             VVCSE+    FRGPS    D+L+ Q LFGDG+AA+IVG +P   +E PLFELVSAAQT +
Sbjct  190   VVCSEITAVTFRGPSDTHLDSLVGQALFGDGAAAIIVGADPDTKIERPLFELVSAAQTIL  249

Query  826   PDTDSHLKLHLREMGLTFHCSKAVPSLITQNVEDCLVKAFEPFGISDWNSIFWILHPGGI  1005
             PD+D  +  HLRE+GLTFH  K VP LI++NVE  LV+AF P GI+DWNSIFWI HPGG 
Sbjct  250   PDSDGAIDGHLREVGLTFHLLKDVPGLISKNVEKSLVEAFSPIGINDWNSIFWIAHPGGP  309

Query  1006  AILDRVEEKLGLEPEKLRASKDVLSEYGNLTSACVLFILDEMRKKSKKDEEMTTGEGLEW  1185
             AILD+VE KLGL+ EKL+A++ VLSE+GN++SACVLFILDEMRK+S +  + TTGEGLEW
Sbjct  310   AILDQVEAKLGLKEEKLKATRHVLSEFGNMSSACVLFILDEMRKQSLEQGKPTTGEGLEW  369

Query  1186  GVVFVVCP  1209
             GV+F   P
Sbjct  370   GVLFGFGP  377



>gb|ACS12837.1| chalcone synthase [Nicotiana alata]
Length=389

 Score =   530 bits (1364),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 249/368 (68%), Positives = 303/368 (82%), Gaps = 0/368 (0%)
 Frame = +1

Query  106   RRAKRFEGDAKILAIGTAIPANWVDQTTYPDFYFRITNSEHLLEHKEKFRRICNKSKIRK  285
             RRA+R EG A ++AIGTA P+N VDQ+TYPD+YFRITNSEH  E KEKF+R+C KS I+K
Sbjct  8     RRAQRAEGPATVMAIGTATPSNCVDQSTYPDYYFRITNSEHKTELKEKFKRMCEKSMIKK  67

Query  286   RHLVITEELLKKNPNLCTYNEASLNTRQDILVSEVPKLGKEAAMKAIKEWGRPISEITHL  465
             R++ +TEE+LK+NPN+C Y   SL+ RQDI+V EVPKLGKEAA KAIKEWG+P S+ITHL
Sbjct  68    RYMHLTEEILKENPNICAYMAPSLDARQDIVVVEVPKLGKEAAQKAIKEWGQPKSKITHL  127

Query  466   VFCTSSGVDMPGADFQLAKLLGLSSSVKRLMMYQQGCNAGAAMLRLAKDLAENNKGARVL  645
             VFCT+SGVDMPG D+QL KLLGL  SVKR MMYQQGC AG  +LR+AKDLAENNKGARVL
Sbjct  128   VFCTTSGVDMPGCDYQLTKLLGLRPSVKRFMMYQQGCFAGGTVLRMAKDLAENNKGARVL  187

Query  646   VVCSEVMLNVFRGPSLEQEDNLLAQCLFGDGSAAVIVGTEPRPGLETPLFELVSAAQTTI  825
             VVCSE+    FRGP+    D+L+ Q LFGDG+AA+I+G++P P +E PLFELVSAAQT +
Sbjct  188   VVCSEITAVTFRGPNDTHLDSLVGQALFGDGAAAIIIGSDPIPEVERPLFELVSAAQTLL  247

Query  826   PDTDSHLKLHLREMGLTFHCSKAVPSLITQNVEDCLVKAFEPFGISDWNSIFWILHPGGI  1005
             PD++  +  HLRE+GLTFH  K VP LI++N+E  LV+AF+P GISDWNS+FWI HPGG 
Sbjct  248   PDSEGAIDGHLREVGLTFHLLKDVPGLISKNIEKSLVEAFQPLGISDWNSLFWIAHPGGP  307

Query  1006  AILDRVEEKLGLEPEKLRASKDVLSEYGNLTSACVLFILDEMRKKSKKDEEMTTGEGLEW  1185
             AILD+VE KLGL+ EKL+A+++VLS YGN++SACVLFILDEMRK S K+   TTGEGLEW
Sbjct  308   AILDQVELKLGLKQEKLKATRNVLSNYGNMSSACVLFILDEMRKASAKEGLGTTGEGLEW  367

Query  1186  GVVFVVCP  1209
             GV+F   P
Sbjct  368   GVLFGFGP  375



>gb|AFJ44312.1| chalcone synthase [Lonicera japonica]
Length=389

 Score =   530 bits (1364),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 248/368 (67%), Positives = 302/368 (82%), Gaps = 0/368 (0%)
 Frame = +1

Query  106   RRAKRFEGDAKILAIGTAIPANWVDQTTYPDFYFRITNSEHLLEHKEKFRRICNKSKIRK  285
             R+A+R EG A ++AIGT+ P N V Q+ YPD+YFRITNSEH  E KEKF+R+C KS IRK
Sbjct  8     RKAQRAEGPATVMAIGTSTPPNCVYQSAYPDYYFRITNSEHKTELKEKFKRMCEKSMIRK  67

Query  286   RHLVITEELLKKNPNLCTYNEASLNTRQDILVSEVPKLGKEAAMKAIKEWGRPISEITHL  465
             R++ +TEE LK+NP++C Y   SL+ RQD++V EVP+LGKEAA KAIKEWG+P S+ITHL
Sbjct  68    RYMYLTEEFLKENPSMCEYMAPSLDARQDMVVVEVPRLGKEAATKAIKEWGQPKSKITHL  127

Query  466   VFCTSSGVDMPGADFQLAKLLGLSSSVKRLMMYQQGCNAGAAMLRLAKDLAENNKGARVL  645
             VFCT+SGVDMPGAD+QL KLLGL SSVKRLMMYQQGC AG  +LRLAKDLAENNKGARVL
Sbjct  128   VFCTTSGVDMPGADYQLTKLLGLRSSVKRLMMYQQGCFAGGTVLRLAKDLAENNKGARVL  187

Query  646   VVCSEVMLNVFRGPSLEQEDNLLAQCLFGDGSAAVIVGTEPRPGLETPLFELVSAAQTTI  825
             VVCSE+    FRGPS    D+L+ Q LFGDG+AA+I+G++P P +E PLFELVSA+QT +
Sbjct  188   VVCSEITAVTFRGPSDTHLDSLVGQALFGDGAAAMIIGSDPVPKVEKPLFELVSASQTIL  247

Query  826   PDTDSHLKLHLREMGLTFHCSKAVPSLITQNVEDCLVKAFEPFGISDWNSIFWILHPGGI  1005
             PD+D  +  HLRE+GLTFH  K VP LI++N+E  LV+AF+P GISDWNSIFWI HPGG 
Sbjct  248   PDSDGAIDGHLREVGLTFHLLKDVPGLISKNIEKSLVEAFKPLGISDWNSIFWIAHPGGP  307

Query  1006  AILDRVEEKLGLEPEKLRASKDVLSEYGNLTSACVLFILDEMRKKSKKDEEMTTGEGLEW  1185
             AILD+VE+KL L+PEK+ A++ VLSEYGN++SACVLFI+DEMRKKS  +   TTGEGLEW
Sbjct  308   AILDQVEKKLALKPEKMGATRHVLSEYGNMSSACVLFIMDEMRKKSANEGLKTTGEGLEW  367

Query  1186  GVVFVVCP  1209
             GV+F   P
Sbjct  368   GVLFGFGP  375



>sp|P48388.1|CHS3_CAMSI RecName: Full=Chalcone synthase 3; AltName: Full=Naringenin-chalcone 
synthase 3 [Camellia sinensis]
 dbj|BAA05642.1| chalcone synthase [Camellia sinensis]
Length=389

 Score =   530 bits (1364),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 253/367 (69%), Positives = 302/367 (82%), Gaps = 0/367 (0%)
 Frame = +1

Query  109   RAKRFEGDAKILAIGTAIPANWVDQTTYPDFYFRITNSEHLLEHKEKFRRICNKSKIRKR  288
             RA+R  G A +LAIGTA P N VDQ+TYPD+YFRITNSEH +E KEKF+R+C+KS I+KR
Sbjct  9     RAQRARGPATVLAIGTATPPNCVDQSTYPDYYFRITNSEHKVELKEKFKRMCDKSMIKKR  68

Query  289   HLVITEELLKKNPNLCTYNEASLNTRQDILVSEVPKLGKEAAMKAIKEWGRPISEITHLV  468
             ++ +TEE+LK+NP +C Y   SL+ RQD++V EVPKLGKEAA KAIKEWG+P S+ITHLV
Sbjct  69    YMYLTEEILKENPLVCEYMAPSLDARQDMVVVEVPKLGKEAATKAIKEWGQPKSKITHLV  128

Query  469   FCTSSGVDMPGADFQLAKLLGLSSSVKRLMMYQQGCNAGAAMLRLAKDLAENNKGARVLV  648
             FCT+SGVDMPGAD+QL KLLGL  SVKRLMMYQQGC AG  +LRLAKDLAENNKGARVLV
Sbjct  129   FCTTSGVDMPGADYQLTKLLGLRPSVKRLMMYQQGCFAGGTVLRLAKDLAENNKGARVLV  188

Query  649   VCSEVMLNVFRGPSLEQEDNLLAQCLFGDGSAAVIVGTEPRPGLETPLFELVSAAQTTIP  828
             VCSE+    FRGPS    D+L+ Q LFGDG+AA+I+G++P P +E PLFELVSAAQT +P
Sbjct  189   VCSEITAVTFRGPSDTHLDSLVGQSLFGDGAAAIIIGSDPIPEVEKPLFELVSAAQTILP  248

Query  829   DTDSHLKLHLREMGLTFHCSKAVPSLITQNVEDCLVKAFEPFGISDWNSIFWILHPGGIA  1008
              +D  +  HLRE+GLTFH  K VP LI+ NVE  LV+AF+P GISDWNS+FWI HPGG A
Sbjct  249   SSDGAIDGHLREVGLTFHLLKDVPRLISMNVEKSLVEAFQPLGISDWNSLFWIAHPGGPA  308

Query  1009  ILDRVEEKLGLEPEKLRASKDVLSEYGNLTSACVLFILDEMRKKSKKDEEMTTGEGLEWG  1188
             ILD+VE KLGL+ EKLRA++ VLSEYGN++SACVLFILDEMRKKS ++   TTGEGLEWG
Sbjct  309   ILDQVELKLGLKEEKLRATRHVLSEYGNMSSACVLFILDEMRKKSAEEGLKTTGEGLEWG  368

Query  1189  VVFVVCP  1209
             V+F   P
Sbjct  369   VLFGFGP  375



>sp|Q9AU11.1|PKS1_RUBID RecName: Full=Polyketide synthase 1; Short=RiPKS1; AltName: Full=Naringenin-chalcone 
synthase PKS1 [Rubus idaeus]
 gb|AAK15174.1|AF292367_1 aromatic polyketide synthase [Rubus idaeus]
 gb|ACF72868.1| aromatic polyketide synthase [Rubus idaeus]
Length=391

 Score =   530 bits (1364),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 248/368 (67%), Positives = 303/368 (82%), Gaps = 0/368 (0%)
 Frame = +1

Query  106   RRAKRFEGDAKILAIGTAIPANWVDQTTYPDFYFRITNSEHLLEHKEKFRRICNKSKIRK  285
             R+A+R EG A ILAIGTA P N VDQ+TYPD+YFRIT SEH  E KEKF+R+C+KS I+K
Sbjct  8     RKAQRAEGPATILAIGTATPPNCVDQSTYPDYYFRITKSEHKTELKEKFQRMCDKSMIKK  67

Query  286   RHLVITEELLKKNPNLCTYNEASLNTRQDILVSEVPKLGKEAAMKAIKEWGRPISEITHL  465
             R++ +TEE+LK+NP++C Y   SL+ RQD++V E+PKLGKEAA KAIKEWG+P S+ITHL
Sbjct  68    RYMYLTEEILKENPSMCEYMAPSLDARQDMVVVEIPKLGKEAATKAIKEWGQPKSKITHL  127

Query  466   VFCTSSGVDMPGADFQLAKLLGLSSSVKRLMMYQQGCNAGAAMLRLAKDLAENNKGARVL  645
             VFCT+SGVDMPGAD+QL KLLGL  SVKRLMMYQQGC AG  +LRLAKDLAENNKGARVL
Sbjct  128   VFCTTSGVDMPGADYQLTKLLGLRPSVKRLMMYQQGCFAGGTVLRLAKDLAENNKGARVL  187

Query  646   VVCSEVMLNVFRGPSLEQEDNLLAQCLFGDGSAAVIVGTEPRPGLETPLFELVSAAQTTI  825
             VVCSE+    FRGPS    D+L+ Q LFGDG+AA+IVG++P P +E PLFELVSAAQT +
Sbjct  188   VVCSEITAVTFRGPSDTHLDSLVGQALFGDGAAAIIVGSDPLPDIERPLFELVSAAQTIL  247

Query  826   PDTDSHLKLHLREMGLTFHCSKAVPSLITQNVEDCLVKAFEPFGISDWNSIFWILHPGGI  1005
             PD+D  +  HLRE+GLTFH  K VP LI++N+E  L +AF+P  I+DWNS+FWI HPGG 
Sbjct  248   PDSDGAIDGHLREVGLTFHLLKDVPGLISKNIEKSLNEAFKPLDITDWNSLFWIAHPGGP  307

Query  1006  AILDRVEEKLGLEPEKLRASKDVLSEYGNLTSACVLFILDEMRKKSKKDEEMTTGEGLEW  1185
             AILD+VE KLGL+PEKL A++++LSEYGN++SACVLFILDE+R+KS  +   TTGEGLEW
Sbjct  308   AILDQVEAKLGLKPEKLEATRNILSEYGNMSSACVLFILDEVRRKSVANGHKTTGEGLEW  367

Query  1186  GVVFVVCP  1209
             GV+F   P
Sbjct  368   GVLFGFGP  375



>gb|AGU70032.1| chalcone synthase [Solanum tuberosum]
Length=389

 Score =   529 bits (1363),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 251/368 (68%), Positives = 304/368 (83%), Gaps = 0/368 (0%)
 Frame = +1

Query  106   RRAKRFEGDAKILAIGTAIPANWVDQTTYPDFYFRITNSEHLLEHKEKFRRICNKSKIRK  285
             R+A+R EG A ILAIGT+ P+N VDQ+TYPD+YFRITNSEH  E KEKF+R+C+KS I+K
Sbjct  8     RKAQRAEGPATILAIGTSTPSNCVDQSTYPDYYFRITNSEHKTELKEKFKRMCDKSMIKK  67

Query  286   RHLVITEELLKKNPNLCTYNEASLNTRQDILVSEVPKLGKEAAMKAIKEWGRPISEITHL  465
             R++ +TEE+LK+NPN+C Y   SL+ RQDI+V EVPKLGKEAA KAIKEWG+P S+ITHL
Sbjct  68    RYMHLTEEILKENPNMCAYMAPSLDARQDIVVVEVPKLGKEAAQKAIKEWGQPKSKITHL  127

Query  466   VFCTSSGVDMPGADFQLAKLLGLSSSVKRLMMYQQGCNAGAAMLRLAKDLAENNKGARVL  645
             VFCT+SGVDMPG D+QLAKLLGL  SVKRLMMYQQGC AG  +LRLAKDLAENNKGARVL
Sbjct  128   VFCTTSGVDMPGCDYQLAKLLGLRPSVKRLMMYQQGCFAGGTVLRLAKDLAENNKGARVL  187

Query  646   VVCSEVMLNVFRGPSLEQEDNLLAQCLFGDGSAAVIVGTEPRPGLETPLFELVSAAQTTI  825
             VVCSE+    FRGPS    D+L+ Q LFGDG+AA+I+G++P  G+E PLFELVSAAQT +
Sbjct  188   VVCSEITAVTFRGPSESHLDSLVGQALFGDGAAAIIMGSDPIIGVERPLFELVSAAQTLV  247

Query  826   PDTDSHLKLHLREMGLTFHCSKAVPSLITQNVEDCLVKAFEPFGISDWNSIFWILHPGGI  1005
             PD++  +  HLRE+GLTFH  K VP LI++N+E  L +AF+P GISDWNS+FWI HPGG 
Sbjct  248   PDSEGAIDGHLREVGLTFHLLKDVPGLISKNIEKSLQEAFQPLGISDWNSLFWIAHPGGP  307

Query  1006  AILDRVEEKLGLEPEKLRASKDVLSEYGNLTSACVLFILDEMRKKSKKDEEMTTGEGLEW  1185
             AILD+VE KLGL+ EKLRA+++VLS YGN++SACVLFILDE+RK S  +   TTGEGLEW
Sbjct  308   AILDQVELKLGLKQEKLRATREVLSNYGNMSSACVLFILDEVRKASTNEGLGTTGEGLEW  367

Query  1186  GVVFVVCP  1209
             GV+F   P
Sbjct  368   GVLFGFGP  375



>dbj|BAD34456.1| chalcone synthase [Eustoma grandiflorum]
Length=389

 Score =   529 bits (1363),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 249/368 (68%), Positives = 301/368 (82%), Gaps = 0/368 (0%)
 Frame = +1

Query  106   RRAKRFEGDAKILAIGTAIPANWVDQTTYPDFYFRITNSEHLLEHKEKFRRICNKSKIRK  285
             RRA+R EG A ++AIGTA P N VDQ+TY D+YF+ITNSEH+ E KEKF+R+C+KS IR+
Sbjct  8     RRAQRAEGPATLMAIGTATPPNCVDQSTYSDYYFKITNSEHMTELKEKFKRMCDKSMIRQ  67

Query  286   RHLVITEELLKKNPNLCTYNEASLNTRQDILVSEVPKLGKEAAMKAIKEWGRPISEITHL  465
             R++ +TEE LK+NPN+  Y   SL+ RQDI+V EVPKLGK+AA+KAIKEWG+P S+ITHL
Sbjct  68    RYMHLTEEYLKENPNVSAYMAPSLDARQDIVVMEVPKLGKDAALKAIKEWGQPKSKITHL  127

Query  466   VFCTSSGVDMPGADFQLAKLLGLSSSVKRLMMYQQGCNAGAAMLRLAKDLAENNKGARVL  645
             +FCT+SGVDMPGAD+QL KLLGL  SVKR MMYQQGC AG  +LRLAKDLAENNK ARVL
Sbjct  128   IFCTTSGVDMPGADYQLTKLLGLRPSVKRTMMYQQGCFAGGTVLRLAKDLAENNKDARVL  187

Query  646   VVCSEVMLNVFRGPSLEQEDNLLAQCLFGDGSAAVIVGTEPRPGLETPLFELVSAAQTTI  825
             VVCSE+    FRGP     D+L+ Q LFGDG+AA+I+G++P PG+E PLF+LVSAAQT +
Sbjct  188   VVCSEITAVTFRGPCETHLDSLVGQALFGDGAAAIIIGSDPIPGVERPLFQLVSAAQTIL  247

Query  826   PDTDSHLKLHLREMGLTFHCSKAVPSLITQNVEDCLVKAFEPFGISDWNSIFWILHPGGI  1005
             P++D  ++ HLRE GLTFH  K VP LI++N+   L +AFEP GISDWNS+FWI HPGG 
Sbjct  248   PESDGAIEGHLRETGLTFHLLKDVPGLISKNIMKSLEEAFEPLGISDWNSVFWIAHPGGP  307

Query  1006  AILDRVEEKLGLEPEKLRASKDVLSEYGNLTSACVLFILDEMRKKSKKDEEMTTGEGLEW  1185
             AILD+VE KLGLEPEKLRA++ VLSEYGN++SACVLFILDEMRK S KD   TTGEGLEW
Sbjct  308   AILDQVEVKLGLEPEKLRATRHVLSEYGNMSSACVLFILDEMRKASAKDGLSTTGEGLEW  367

Query  1186  GVVFVVCP  1209
             GV+F   P
Sbjct  368   GVLFGFGP  375



>gb|ABE01413.1| chalcone synthase [Anthurium andraeanum]
Length=391

 Score =   529 bits (1363),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 246/368 (67%), Positives = 304/368 (83%), Gaps = 0/368 (0%)
 Frame = +1

Query  106   RRAKRFEGDAKILAIGTAIPANWVDQTTYPDFYFRITNSEHLLEHKEKFRRICNKSKIRK  285
             R+A+R +G A ILAIGTA+P N VDQ+TYPD+YFRITNSEH +E KEKFRR+C KS I+K
Sbjct  10    RKAQRADGPATILAIGTAVPPNAVDQSTYPDYYFRITNSEHQVELKEKFRRMCEKSMIKK  69

Query  286   RHLVITEELLKKNPNLCTYNEASLNTRQDILVSEVPKLGKEAAMKAIKEWGRPISEITHL  465
             RH+ +TEE+LK+NPN+C Y   SL+ RQD++V EVP+LGKEAA +AIKEWG+P S+ITHL
Sbjct  70    RHMYLTEEILKENPNMCAYMAPSLDARQDMVVVEVPRLGKEAATRAIKEWGQPKSKITHL  129

Query  466   VFCTSSGVDMPGADFQLAKLLGLSSSVKRLMMYQQGCNAGAAMLRLAKDLAENNKGARVL  645
             VFCT+SGVDMPGAD+QLAKLLGL  SVKRLMMYQQGC AG  +LRLAKDLAENN+GARVL
Sbjct  130   VFCTTSGVDMPGADYQLAKLLGLRPSVKRLMMYQQGCFAGGTVLRLAKDLAENNRGARVL  189

Query  646   VVCSEVMLNVFRGPSLEQEDNLLAQCLFGDGSAAVIVGTEPRPGLETPLFELVSAAQTTI  825
             V+CSEV    FRGPS    D+L+ Q LFGDG++A++VG +P  G+E P+F++VSAAQT +
Sbjct  190   VICSEVTAVTFRGPSESHLDSLVGQALFGDGASALVVGADPVEGVERPIFQVVSAAQTIL  249

Query  826   PDTDSHLKLHLREMGLTFHCSKAVPSLITQNVEDCLVKAFEPFGISDWNSIFWILHPGGI  1005
             PD+   +  HLRE+GLTFH  K VP LI++N++  LV+AFEP GISDWNS+FWI HPGG 
Sbjct  250   PDSHGAIDGHLREVGLTFHLLKDVPGLISKNIDKSLVEAFEPLGISDWNSLFWIAHPGGP  309

Query  1006  AILDRVEEKLGLEPEKLRASKDVLSEYGNLTSACVLFILDEMRKKSKKDEEMTTGEGLEW  1185
             AILD+VE+KL L+ EKL A++ VLSEYGN++SACV FILDEMRK+S ++   TTGEGLEW
Sbjct  310   AILDQVEDKLRLQSEKLGATRRVLSEYGNMSSACVHFILDEMRKRSAEEGRGTTGEGLEW  369

Query  1186  GVVFVVCP  1209
             GV+F   P
Sbjct  370   GVLFGFGP  377



>gb|AGI02993.1| chalcone synthase [Camellia sinensis]
Length=389

 Score =   529 bits (1363),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 253/367 (69%), Positives = 302/367 (82%), Gaps = 0/367 (0%)
 Frame = +1

Query  109   RAKRFEGDAKILAIGTAIPANWVDQTTYPDFYFRITNSEHLLEHKEKFRRICNKSKIRKR  288
             RA+R  G A +LAIGTA P N VDQ+TYPD+YFRITNSEH +E KEKF+R+C+KS I+KR
Sbjct  9     RAQRARGPATVLAIGTATPPNCVDQSTYPDYYFRITNSEHKVELKEKFKRMCDKSMIKKR  68

Query  289   HLVITEELLKKNPNLCTYNEASLNTRQDILVSEVPKLGKEAAMKAIKEWGRPISEITHLV  468
             ++ +TEE+LK+NP +C Y   SL+ RQD++V EVPKLGKEAA KAIKEWG+P S+ITHLV
Sbjct  69    YMYLTEEILKENPLVCEYVAPSLDARQDMVVVEVPKLGKEAATKAIKEWGQPKSKITHLV  128

Query  469   FCTSSGVDMPGADFQLAKLLGLSSSVKRLMMYQQGCNAGAAMLRLAKDLAENNKGARVLV  648
             FCT+SGVDMPGAD+QL KLLGL  SVKRLMMYQQGC AG  +LRLAKDLAENNKGARVLV
Sbjct  129   FCTTSGVDMPGADYQLTKLLGLRPSVKRLMMYQQGCFAGGTVLRLAKDLAENNKGARVLV  188

Query  649   VCSEVMLNVFRGPSLEQEDNLLAQCLFGDGSAAVIVGTEPRPGLETPLFELVSAAQTTIP  828
             VCSE+    FRGPS    D+L+ Q LFGDG+AA+I+G++P P +E PLFELVSAAQT +P
Sbjct  189   VCSEITAVTFRGPSDTHLDSLVGQSLFGDGAAAIIIGSDPIPEVEKPLFELVSAAQTILP  248

Query  829   DTDSHLKLHLREMGLTFHCSKAVPSLITQNVEDCLVKAFEPFGISDWNSIFWILHPGGIA  1008
              +D  +  HLRE+GLTFH  K VP LI+ NVE  LV+AF+P GISDWNS+FWI HPGG A
Sbjct  249   SSDGAIDGHLREVGLTFHLLKDVPRLISMNVEKSLVEAFQPLGISDWNSLFWIAHPGGPA  308

Query  1009  ILDRVEEKLGLEPEKLRASKDVLSEYGNLTSACVLFILDEMRKKSKKDEEMTTGEGLEWG  1188
             ILD+VE KLGL+ EKLRA++ VLSEYGN++SACVLFILDEMRKKS ++   TTGEGLEWG
Sbjct  309   ILDQVELKLGLKEEKLRATRHVLSEYGNMSSACVLFILDEMRKKSAEEGLKTTGEGLEWG  368

Query  1189  VVFVVCP  1209
             V+F   P
Sbjct  369   VLFGFGP  375



>ref|XP_008380609.1| PREDICTED: polyketide synthase 5 [Malus domestica]
 gb|AAX16492.1| chalcone synthase [Malus domestica]
 gb|ACJ54530.1| chalcone synthase [Malus domestica]
Length=391

 Score =   529 bits (1363),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 248/368 (67%), Positives = 303/368 (82%), Gaps = 0/368 (0%)
 Frame = +1

Query  106   RRAKRFEGDAKILAIGTAIPANWVDQTTYPDFYFRITNSEHLLEHKEKFRRICNKSKIRK  285
             R+A+R EG A ++AIGTA P+N VDQ TYPD+YFRITNSEH +E KEKF+R+C+KS I+K
Sbjct  8     RKAQRAEGPATVMAIGTATPSNCVDQATYPDYYFRITNSEHKVELKEKFQRMCDKSMIKK  67

Query  286   RHLVITEELLKKNPNLCTYNEASLNTRQDILVSEVPKLGKEAAMKAIKEWGRPISEITHL  465
             R++ +TEE+LK+NP++C Y   S++ RQD++V EVPKLGKEAA KAIKEWG+P S+ITHL
Sbjct  68    RYMYLTEEILKENPSVCEYMAPSIDARQDMVVVEVPKLGKEAATKAIKEWGQPKSKITHL  127

Query  466   VFCTSSGVDMPGADFQLAKLLGLSSSVKRLMMYQQGCNAGAAMLRLAKDLAENNKGARVL  645
             VFCT+SGVDMPGAD+QL KLLGL  SVKRLMMYQQGC AG  +LRLAKDLAENNKGARVL
Sbjct  128   VFCTTSGVDMPGADYQLTKLLGLRPSVKRLMMYQQGCFAGGTVLRLAKDLAENNKGARVL  187

Query  646   VVCSEVMLNVFRGPSLEQEDNLLAQCLFGDGSAAVIVGTEPRPGLETPLFELVSAAQTTI  825
             VVCSE+    FRGPS    D+L+ Q LFGDG+AAVI+G +P P +E PLFELVSAAQT +
Sbjct  188   VVCSEITAVTFRGPSDTHLDSLVGQALFGDGAAAVIIGADPVPEVEKPLFELVSAAQTIL  247

Query  826   PDTDSHLKLHLREMGLTFHCSKAVPSLITQNVEDCLVKAFEPFGISDWNSIFWILHPGGI  1005
             PD+D  +  HLRE+GLTFH  K VP LI++N+E  L +AF+P GISDWNS+FWI HPGG 
Sbjct  248   PDSDGAIDGHLREVGLTFHLLKDVPGLISKNIEKSLNEAFKPIGISDWNSLFWIAHPGGP  307

Query  1006  AILDRVEEKLGLEPEKLRASKDVLSEYGNLTSACVLFILDEMRKKSKKDEEMTTGEGLEW  1185
             AILD+VE KL L+PEKL A++ VLS+YGN++SACVLFILDE+R+KS +    TTGEGLEW
Sbjct  308   AILDQVEAKLALKPEKLEATRQVLSDYGNMSSACVLFILDEVRRKSAEKGLKTTGEGLEW  367

Query  1186  GVVFVVCP  1209
             GV+F   P
Sbjct  368   GVLFGFGP  375



>dbj|BAM17286.1| chalcone synthase [Petunia x hybrida]
Length=389

 Score =   529 bits (1363),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 249/368 (68%), Positives = 303/368 (82%), Gaps = 0/368 (0%)
 Frame = +1

Query  106   RRAKRFEGDAKILAIGTAIPANWVDQTTYPDFYFRITNSEHLLEHKEKFRRICNKSKIRK  285
             R+A+R EG A ++AIGTA P N VDQ+TYPD+YFRITNSEH  E KEKF+R+C KS I+K
Sbjct  8     RKAQRAEGPATVMAIGTATPTNCVDQSTYPDYYFRITNSEHKTELKEKFKRMCEKSMIKK  67

Query  286   RHLVITEELLKKNPNLCTYNEASLNTRQDILVSEVPKLGKEAAMKAIKEWGRPISEITHL  465
             R++ +TEE+LK+NP++C Y   SL+ RQDI+V EVPKLGKEAA KAIKEWG+P S+ITHL
Sbjct  68    RYMHLTEEILKENPSMCEYMAPSLDARQDIVVVEVPKLGKEAAQKAIKEWGQPKSKITHL  127

Query  466   VFCTSSGVDMPGADFQLAKLLGLSSSVKRLMMYQQGCNAGAAMLRLAKDLAENNKGARVL  645
             VFCT+SGVDMPG D+QL KLLGL  SVKRLMMYQQGC AG  +LRLAKDLAENNKGARVL
Sbjct  128   VFCTTSGVDMPGCDYQLTKLLGLRPSVKRLMMYQQGCFAGGTVLRLAKDLAENNKGARVL  187

Query  646   VVCSEVMLNVFRGPSLEQEDNLLAQCLFGDGSAAVIVGTEPRPGLETPLFELVSAAQTTI  825
             VVCSE+    FRGP+    D+L+ Q LFGDG+ A+I+G++P PG+E PLFELVSAAQT +
Sbjct  188   VVCSEITAVTFRGPNDTHLDSLVGQALFGDGAGAIIIGSDPIPGVERPLFELVSAAQTLL  247

Query  826   PDTDSHLKLHLREMGLTFHCSKAVPSLITQNVEDCLVKAFEPFGISDWNSIFWILHPGGI  1005
             PD+   +  HLRE+GLTFH  K VP LI++N+E  L +AF+P GISDWNS+FWI HPGG 
Sbjct  248   PDSHGAIDGHLREVGLTFHLLKDVPGLISKNIEKSLEEAFKPLGISDWNSLFWIAHPGGP  307

Query  1006  AILDRVEEKLGLEPEKLRASKDVLSEYGNLTSACVLFILDEMRKKSKKDEEMTTGEGLEW  1185
             AILD+VE KLGL+PEKL+A+++VLS+YGN++SACVLFILDEMRK S K+   TTGEGLEW
Sbjct  308   AILDQVEIKLGLKPEKLKATRNVLSDYGNMSSACVLFILDEMRKASAKEGLGTTGEGLEW  367

Query  1186  GVVFVVCP  1209
             GV+F   P
Sbjct  368   GVLFGFGP  375



>ref|XP_008797107.1| PREDICTED: chalcone synthase 1 [Phoenix dactylifera]
Length=392

 Score =   529 bits (1362),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 248/368 (67%), Positives = 299/368 (81%), Gaps = 0/368 (0%)
 Frame = +1

Query  106   RRAKRFEGDAKILAIGTAIPANWVDQTTYPDFYFRITNSEHLLEHKEKFRRICNKSKIRK  285
             R ++R EG A ILAIGTA PAN V Q  YPD+YFRIT SEHL + KEKF+R+C+KS IRK
Sbjct  8     RSSQRAEGPATILAIGTATPANVVYQADYPDYYFRITKSEHLTDLKEKFKRMCDKSMIRK  67

Query  286   RHLVITEELLKKNPNLCTYNEASLNTRQDILVSEVPKLGKEAAMKAIKEWGRPISEITHL  465
             R++ + EE+LK+NPN+C Y   SL+ RQD++V EVPKLGKEAA+KAIKEWG+P S ITHL
Sbjct  68    RYMHLNEEILKENPNVCAYMAPSLDARQDMVVVEVPKLGKEAAVKAIKEWGQPKSRITHL  127

Query  466   VFCTSSGVDMPGADFQLAKLLGLSSSVKRLMMYQQGCNAGAAMLRLAKDLAENNKGARVL  645
             VFCT+SGVDMPGAD+QL KLLGL  SV RLMMYQQGC AG  +LRLAKDLAENN+GARVL
Sbjct  128   VFCTTSGVDMPGADYQLTKLLGLRPSVNRLMMYQQGCFAGGTVLRLAKDLAENNRGARVL  187

Query  646   VVCSEVMLNVFRGPSLEQEDNLLAQCLFGDGSAAVIVGTEPRPGLETPLFELVSAAQTTI  825
             VVCSE+    FRGPS    D+L+ Q LFGDG+AA+I+G +P P +E PLF+LVSA+QT +
Sbjct  188   VVCSEITAVTFRGPSESHLDSLVGQALFGDGAAAIIIGADPDPAIERPLFQLVSASQTIL  247

Query  826   PDTDSHLKLHLREMGLTFHCSKAVPSLITQNVEDCLVKAFEPFGISDWNSIFWILHPGGI  1005
             PD++  +  HLRE+GLTFH  K VP LI++NVE  L +AF P GISDWNSIFWI HPGG 
Sbjct  248   PDSEGAIDGHLREVGLTFHLLKDVPGLISKNVEKSLAEAFAPLGISDWNSIFWIAHPGGP  307

Query  1006  AILDRVEEKLGLEPEKLRASKDVLSEYGNLTSACVLFILDEMRKKSKKDEEMTTGEGLEW  1185
             AILD+VE KLGLE EK+RA++ VLSEYGN++SACVLFILDEMR++S +D + TTGEGLEW
Sbjct  308   AILDQVEAKLGLEKEKMRATRHVLSEYGNMSSACVLFILDEMRRRSAEDGKATTGEGLEW  367

Query  1186  GVVFVVCP  1209
             GV+F   P
Sbjct  368   GVLFGFGP  375



>gb|AAX63402.1| chalcone synthase [Solanum pinnatisectum]
Length=389

 Score =   529 bits (1362),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 250/368 (68%), Positives = 303/368 (82%), Gaps = 0/368 (0%)
 Frame = +1

Query  106   RRAKRFEGDAKILAIGTAIPANWVDQTTYPDFYFRITNSEHLLEHKEKFRRICNKSKIRK  285
             R+A+R EG A ILAIGT+ P+N VDQ+TYPD+YFRITNSEH  E KEKF+R+ +KS I+K
Sbjct  8     RKAQRAEGPATILAIGTSTPSNCVDQSTYPDYYFRITNSEHKTELKEKFKRMSDKSMIKK  67

Query  286   RHLVITEELLKKNPNLCTYNEASLNTRQDILVSEVPKLGKEAAMKAIKEWGRPISEITHL  465
             R++ +TEE+LK+NPN+C Y   SL+ RQDI+V EVPKLGKEAA KAIKEWG+P S+ITHL
Sbjct  68    RYMHLTEEILKENPNMCAYMAPSLDARQDIVVVEVPKLGKEAAQKAIKEWGQPKSKITHL  127

Query  466   VFCTSSGVDMPGADFQLAKLLGLSSSVKRLMMYQQGCNAGAAMLRLAKDLAENNKGARVL  645
             VFCT+SGVDMPG D+QL KLLGL  SVKRLMMYQQGC AG  +LRLAKDLAENNKGARVL
Sbjct  128   VFCTTSGVDMPGCDYQLTKLLGLRPSVKRLMMYQQGCFAGGTVLRLAKDLAENNKGARVL  187

Query  646   VVCSEVMLNVFRGPSLEQEDNLLAQCLFGDGSAAVIVGTEPRPGLETPLFELVSAAQTTI  825
             VVCSE+    FRGP+    D+L+ Q LFGDG+AA+I+G++P   +E PLFELVSAAQ  +
Sbjct  188   VVCSEITAVTFRGPNESHLDSLVGQALFGDGAAAIIIGSDPIISVERPLFELVSAAQALV  247

Query  826   PDTDSHLKLHLREMGLTFHCSKAVPSLITQNVEDCLVKAFEPFGISDWNSIFWILHPGGI  1005
             PD++  +  HLRE+GLTFH  K VP LI++N+E  LV+AF+P GISDWNS+FWI HPGG 
Sbjct  248   PDSEGAIDGHLREVGLTFHLLKDVPGLISKNIEKSLVEAFQPIGISDWNSLFWIAHPGGP  307

Query  1006  AILDRVEEKLGLEPEKLRASKDVLSEYGNLTSACVLFILDEMRKKSKKDEEMTTGEGLEW  1185
             AILD+VE KLGL+PEKLRA+++VLS YGN++SACVLFILDEMRK S K+   TTGEGLEW
Sbjct  308   AILDQVELKLGLKPEKLRATREVLSNYGNMSSACVLFILDEMRKASTKEGLGTTGEGLEW  367

Query  1186  GVVFVVCP  1209
             GV+F   P
Sbjct  368   GVLFGFGP  375



>dbj|BAM17288.1| chalcone synthase [Petunia x hybrida]
Length=389

 Score =   529 bits (1362),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 249/368 (68%), Positives = 303/368 (82%), Gaps = 0/368 (0%)
 Frame = +1

Query  106   RRAKRFEGDAKILAIGTAIPANWVDQTTYPDFYFRITNSEHLLEHKEKFRRICNKSKIRK  285
             R+A+R EG A ++AIGTA P+N VDQ+TYPDFYFRITNSEH  + KEKF+R+C KS I+K
Sbjct  8     RKAQRAEGPATVMAIGTATPSNCVDQSTYPDFYFRITNSEHKTDLKEKFKRMCEKSMIKK  67

Query  286   RHLVITEELLKKNPNLCTYNEASLNTRQDILVSEVPKLGKEAAMKAIKEWGRPISEITHL  465
             R++ +TEE+LK+NP++C Y   SL+ RQDI+V EVPKLGKEAA KAIKEWG+P S+ITHL
Sbjct  68    RYMHLTEEILKENPSMCEYMAPSLDARQDIVVVEVPKLGKEAAQKAIKEWGQPKSKITHL  127

Query  466   VFCTSSGVDMPGADFQLAKLLGLSSSVKRLMMYQQGCNAGAAMLRLAKDLAENNKGARVL  645
             VFCT+SGVDMPG D+QL KLLGL  SVKRLMMYQQGC AG  +LRLAKDLAENNKGARVL
Sbjct  128   VFCTTSGVDMPGCDYQLTKLLGLRPSVKRLMMYQQGCFAGGTVLRLAKDLAENNKGARVL  187

Query  646   VVCSEVMLNVFRGPSLEQEDNLLAQCLFGDGSAAVIVGTEPRPGLETPLFELVSAAQTTI  825
             VVCSE+    FRGP+    D+L+ Q LFGDG+ A+I+G++P PG+E PLFELVSAAQT +
Sbjct  188   VVCSEITAVTFRGPNDTHLDSLVGQALFGDGAGAIIIGSDPIPGVERPLFELVSAAQTLL  247

Query  826   PDTDSHLKLHLREMGLTFHCSKAVPSLITQNVEDCLVKAFEPFGISDWNSIFWILHPGGI  1005
             PD+   +  HLRE+GLTFH  K VP LI++N+E  L +AF+P GISDWNS+FWI HPGG 
Sbjct  248   PDSHGAIDGHLREVGLTFHLLKDVPGLISKNIEKSLEEAFKPLGISDWNSLFWIAHPGGP  307

Query  1006  AILDRVEEKLGLEPEKLRASKDVLSEYGNLTSACVLFILDEMRKKSKKDEEMTTGEGLEW  1185
             AILD+VE KLGL+PEKL+A+++VLS YGN++SACVLFILDEMRK S K+   TTGEGLEW
Sbjct  308   AILDQVEIKLGLKPEKLKATRNVLSNYGNMSSACVLFILDEMRKASAKEGLETTGEGLEW  367

Query  1186  GVVFVVCP  1209
             GV+F   P
Sbjct  368   GVLFGFGP  375



>sp|O04111.1|CHSY_PERFR RecName: Full=Chalcone synthase; AltName: Full=Naringenin-chalcone 
synthase [Perilla frutescens]
 dbj|BAA19656.1| chalcone synthase [Perilla frutescens]
Length=391

 Score =   529 bits (1362),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 249/368 (68%), Positives = 298/368 (81%), Gaps = 0/368 (0%)
 Frame = +1

Query  106   RRAKRFEGDAKILAIGTAIPANWVDQTTYPDFYFRITNSEHLLEHKEKFRRICNKSKIRK  285
             RRA+R EG A ++AIGTA P N VDQ+TYPD+YFRITNSEH  + KEKF+R+C KS IRK
Sbjct  8     RRAQRAEGPATVMAIGTATPENCVDQSTYPDYYFRITNSEHRTDLKEKFKRMCEKSMIRK  67

Query  286   RHLVITEELLKKNPNLCTYNEASLNTRQDILVSEVPKLGKEAAMKAIKEWGRPISEITHL  465
             R++ +TEE LK+NPN+  Y   SL+ RQDI+V EVPKLGKEAA KAIKEWG+P S+ITHL
Sbjct  68    RYMHLTEEFLKENPNMTAYMAPSLDARQDIVVVEVPKLGKEAAQKAIKEWGQPKSKITHL  127

Query  466   VFCTSSGVDMPGADFQLAKLLGLSSSVKRLMMYQQGCNAGAAMLRLAKDLAENNKGARVL  645
             VFCT+SGVDMPGAD+QL KLLGL  SVKR MMYQQGC AG  +LR+AKDLAENN GARVL
Sbjct  128   VFCTTSGVDMPGADYQLTKLLGLRPSVKRFMMYQQGCFAGGTVLRMAKDLAENNAGARVL  187

Query  646   VVCSEVMLNVFRGPSLEQEDNLLAQCLFGDGSAAVIVGTEPRPGLETPLFELVSAAQTTI  825
             VVCSE+    FRGPS    D+L+ Q LFGDG+AAVIVG++P  G+E PLF+LVSAAQT +
Sbjct  188   VVCSEITAVTFRGPSESHLDSLVGQALFGDGAAAVIVGSDPVVGVERPLFQLVSAAQTIL  247

Query  826   PDTDSHLKLHLREMGLTFHCSKAVPSLITQNVEDCLVKAFEPFGISDWNSIFWILHPGGI  1005
             PD+D  +  HLRE+GLTFH  K VP LI++N+E  L +AF P GISDWNS+FWI HPGG 
Sbjct  248   PDSDGAIDGHLREVGLTFHLLKDVPGLISKNIEKSLKEAFGPLGISDWNSVFWIAHPGGP  307

Query  1006  AILDRVEEKLGLEPEKLRASKDVLSEYGNLTSACVLFILDEMRKKSKKDEEMTTGEGLEW  1185
             AILD+VE KLGL+PEKLR+++ VL EYGN++SACVLFILDEMRK S K+   +TGEGL+W
Sbjct  308   AILDQVEAKLGLKPEKLRSTRHVLGEYGNMSSACVLFILDEMRKSSAKEGMSSTGEGLDW  367

Query  1186  GVVFVVCP  1209
             GV+F   P
Sbjct  368   GVLFGFGP  375



>sp|Q8RVK9.1|CHS_CANSA RecName: Full=Naringenin-chalcone synthase [Cannabis sativa]
 gb|AAL92879.1| chalcone synthase [Cannabis sativa]
Length=389

 Score =   528 bits (1361),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 253/368 (69%), Positives = 302/368 (82%), Gaps = 0/368 (0%)
 Frame = +1

Query  106   RRAKRFEGDAKILAIGTAIPANWVDQTTYPDFYFRITNSEHLLEHKEKFRRICNKSKIRK  285
             R+A+R EG A I+AIGTA PAN V Q+ YPD+YFRITNSEH  E KEKF+R+C+KS IRK
Sbjct  8     RKAQRAEGPATIMAIGTATPANCVLQSEYPDYYFRITNSEHKTELKEKFKRMCDKSMIRK  67

Query  286   RHLVITEELLKKNPNLCTYNEASLNTRQDILVSEVPKLGKEAAMKAIKEWGRPISEITHL  465
             R++ +TEE+LK+NPNLC Y   SL+ RQD++V EVPKLGKEAA KAIKEWG+P S+ITHL
Sbjct  68    RYMHLTEEILKENPNLCAYEAPSLDARQDMVVVEVPKLGKEAATKAIKEWGQPKSKITHL  127

Query  466   VFCTSSGVDMPGADFQLAKLLGLSSSVKRLMMYQQGCNAGAAMLRLAKDLAENNKGARVL  645
             VFCT+SGVDMPGAD+QL KLLGL  SVKRLMMYQQGC AG  +LRLAKDLAENNKGARVL
Sbjct  128   VFCTTSGVDMPGADYQLTKLLGLRPSVKRLMMYQQGCFAGGTVLRLAKDLAENNKGARVL  187

Query  646   VVCSEVMLNVFRGPSLEQEDNLLAQCLFGDGSAAVIVGTEPRPGLETPLFELVSAAQTTI  825
             VVCSE+    FRGP+    D+L+ Q LFGDGSAA+IVG++P P +E P+FELVSAAQT +
Sbjct  188   VVCSEITAVTFRGPNDTHLDSLVGQALFGDGSAALIVGSDPIPEVEKPIFELVSAAQTIL  247

Query  826   PDTDSHLKLHLREMGLTFHCSKAVPSLITQNVEDCLVKAFEPFGISDWNSIFWILHPGGI  1005
             PD+D  +  HLRE+GLTFH  K VP LI++N+E  L +AF+P GISDWNS+FWI HPGG 
Sbjct  248   PDSDGAIDGHLREVGLTFHLLKDVPGLISKNIEKSLNEAFKPLGISDWNSLFWIAHPGGP  307

Query  1006  AILDRVEEKLGLEPEKLRASKDVLSEYGNLTSACVLFILDEMRKKSKKDEEMTTGEGLEW  1185
             AILD+VE KL L+ EKLRA++ VLSEYGN++SACVLFILDEMR+K  +D   TTGEGLEW
Sbjct  308   AILDQVESKLALKTEKLRATRHVLSEYGNMSSACVLFILDEMRRKCVEDGLNTTGEGLEW  367

Query  1186  GVVFVVCP  1209
             GV+F   P
Sbjct  368   GVLFGFGP  375



>ref|XP_007161599.1| hypothetical protein PHAVU_001G083000g [Phaseolus vulgaris]
 gb|ESW33593.1| hypothetical protein PHAVU_001G083000g [Phaseolus vulgaris]
Length=391

 Score =   528 bits (1361),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 248/368 (67%), Positives = 301/368 (82%), Gaps = 0/368 (0%)
 Frame = +1

Query  106   RRAKRFEGDAKILAIGTAIPANWVDQTTYPDFYFRITNSEHLLEHKEKFRRICNKSKIRK  285
             R A+R  G A ILA GTA P+N + Q  YPD+YFRITNSEH+ + KEKF+R+C KS I+K
Sbjct  8     RNAQRSHGPATILAFGTATPSNCISQADYPDYYFRITNSEHMTDLKEKFKRMCEKSMIKK  67

Query  286   RHLVITEELLKKNPNLCTYNEASLNTRQDILVSEVPKLGKEAAMKAIKEWGRPISEITHL  465
             R++ +TEE LK+NPN+C Y   SL+ RQDI+V EVPKLGKEAA KAIKEWG+P S+ITHL
Sbjct  68    RYMHLTEEFLKENPNMCAYMAPSLDARQDIVVVEVPKLGKEAARKAIKEWGQPKSKITHL  127

Query  466   VFCTSSGVDMPGADFQLAKLLGLSSSVKRLMMYQQGCNAGAAMLRLAKDLAENNKGARVL  645
             VFCT+SGVDMPGAD+QL KLLGL SSVKRLMMYQQGC AG  +LRLAKDLAENNKGARVL
Sbjct  128   VFCTTSGVDMPGADYQLTKLLGLRSSVKRLMMYQQGCFAGGTVLRLAKDLAENNKGARVL  187

Query  646   VVCSEVMLNVFRGPSLEQEDNLLAQCLFGDGSAAVIVGTEPRPGLETPLFELVSAAQTTI  825
             VVCSE+    FRGPS    D+L+ Q LFGDG+AA+I+G +P   +E P+FELVSAAQT +
Sbjct  188   VVCSEITAVTFRGPSDAHLDSLVGQALFGDGAAAMIIGADPDRSVERPIFELVSAAQTIL  247

Query  826   PDTDSHLKLHLREMGLTFHCSKAVPSLITQNVEDCLVKAFEPFGISDWNSIFWILHPGGI  1005
             PD+D  +  HLRE+GLTFH  K VP +I++N+E  L +AF P GI+DWNSIFW+ HPGG 
Sbjct  248   PDSDGAIDGHLREVGLTFHLLKDVPGIISKNIEKSLTEAFAPIGINDWNSIFWVAHPGGP  307

Query  1006  AILDRVEEKLGLEPEKLRASKDVLSEYGNLTSACVLFILDEMRKKSKKDEEMTTGEGLEW  1185
             AILD+VEEKL L+PEKLR+++ VLSEYGN++SACVLFILDEMRKKSK++E+ +TGEGLEW
Sbjct  308   AILDQVEEKLRLKPEKLRSTRHVLSEYGNMSSACVLFILDEMRKKSKEEEKGSTGEGLEW  367

Query  1186  GVVFVVCP  1209
             GV+F   P
Sbjct  368   GVLFGFGP  375



>gb|ABY68457.1| chalcone synthase [Ipomoea batatas]
Length=393

 Score =   528 bits (1361),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 253/368 (69%), Positives = 300/368 (82%), Gaps = 1/368 (0%)
 Frame = +1

Query  106   RRAKRFEGDAKILAIGTAIPANWVDQTTYPDFYFRITNSEHLLEHKEKFRRICNKSKIRK  285
             R+A+R EG A ILAIGTA PAN V+Q+TYPD+YFRITNSEH  E KEKF+R+C+KS I K
Sbjct  8     RKAQRAEGPATILAIGTATPANCVNQSTYPDYYFRITNSEHKTELKEKFQRMCDKSMITK  67

Query  286   RHLVITEELLKKNPNLCTYNEASLNTRQDILVSEVPKLGKEAAMKAIKEWGRPISEITHL  465
             R++ +TEE+LK+NP++C Y   SL+ RQDI V EVPKLGKEAA  AIKEWG+P S+ITH+
Sbjct  68    RYMHLTEEILKENPSVCEYMAPSLDARQDIAVVEVPKLGKEAAQSAIKEWGQPKSKITHV  127

Query  466   VFCTSSGVDMPGADFQLAKLLGLSSSVKRLMMYQQGCNAGAAMLRLAKDLAENNKGARVL  645
             VFCT+SGVDMPGAD+QL KLLGL  SVKRLMMYQQGC AG  +LRLAKDLAENNKGARVL
Sbjct  128   VFCTTSGVDMPGADYQLTKLLGLCPSVKRLMMYQQGCFAGGTVLRLAKDLAENNKGARVL  187

Query  646   VVCSEVMLNVFRGPSLEQEDNLLAQCLFGDGSAAVIVGTEPRPGLETPLFELVSAAQTTI  825
             +VCSE+ +  FRGPS    D+L+ Q LFGDG+AAVIVG +P P  E PLF+LVSAAQT  
Sbjct  188   IVCSEITVVTFRGPSETHLDSLVGQALFGDGAAAVIVGADPTPA-EKPLFQLVSAAQTLA  246

Query  826   PDTDSHLKLHLREMGLTFHCSKAVPSLITQNVEDCLVKAFEPFGISDWNSIFWILHPGGI  1005
             PD+   +  HLRE+GLTFH  K VPS+++ N+E CL +AF P GISDWNS+FWI HPGG 
Sbjct  247   PDSCGAIDGHLREVGLTFHLLKDVPSVVSNNIEKCLFEAFNPLGISDWNSVFWIAHPGGP  306

Query  1006  AILDRVEEKLGLEPEKLRASKDVLSEYGNLTSACVLFILDEMRKKSKKDEEMTTGEGLEW  1185
             AILD+VE+KLGL+PEKLRA++ VLSEYGN++SACVLFILDEMRK S  D   TTGEGLEW
Sbjct  307   AILDQVEDKLGLKPEKLRATRHVLSEYGNMSSACVLFILDEMRKASSNDGLGTTGEGLEW  366

Query  1186  GVVFVVCP  1209
             GV+F   P
Sbjct  367   GVLFGFGP  374



>gb|AEJ88217.1| chalcone synthase [Prunus persica]
Length=391

 Score =   528 bits (1361),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 246/368 (67%), Positives = 303/368 (82%), Gaps = 0/368 (0%)
 Frame = +1

Query  106   RRAKRFEGDAKILAIGTAIPANWVDQTTYPDFYFRITNSEHLLEHKEKFRRICNKSKIRK  285
             R+A+R EG A +LAIGTA P N VDQ TYPD+YFRITNSEH  E KEKF+R+C+KS I+K
Sbjct  8     RKAQRAEGPATVLAIGTATPPNCVDQATYPDYYFRITNSEHKTELKEKFQRMCDKSMIKK  67

Query  286   RHLVITEELLKKNPNLCTYNEASLNTRQDILVSEVPKLGKEAAMKAIKEWGRPISEITHL  465
             R++ +TEE+LK+NP++C Y   SL+ RQD++V E+PKLGKEAA KAIKEWG+P S+ITHL
Sbjct  68    RYMYLTEEILKENPSMCEYMAPSLDARQDMVVVEIPKLGKEAATKAIKEWGQPKSKITHL  127

Query  466   VFCTSSGVDMPGADFQLAKLLGLSSSVKRLMMYQQGCNAGAAMLRLAKDLAENNKGARVL  645
             VFCT+SGVDMPGAD+QL KLLGL SSVKRLMMYQQGC AG  +LRLAKDLAENN+GARVL
Sbjct  128   VFCTTSGVDMPGADYQLTKLLGLRSSVKRLMMYQQGCFAGGTVLRLAKDLAENNRGARVL  187

Query  646   VVCSEVMLNVFRGPSLEQEDNLLAQCLFGDGSAAVIVGTEPRPGLETPLFELVSAAQTTI  825
             VVCSE+    FRGPS    D+L+ Q LFGDG+AA+IVG++P P +E PLFE+VSAAQT +
Sbjct  188   VVCSEITAVTFRGPSDTHLDSLVGQALFGDGAAAIIVGSDPIPEIEKPLFEVVSAAQTIL  247

Query  826   PDTDSHLKLHLREMGLTFHCSKAVPSLITQNVEDCLVKAFEPFGISDWNSIFWILHPGGI  1005
             PD+D  +  HLRE+GLTFH  K VP LI++N+E  L +AF+P GISDWNS+FWI HPGG 
Sbjct  248   PDSDGAIDGHLREVGLTFHLLKDVPGLISKNIEKSLNEAFQPLGISDWNSLFWIAHPGGP  307

Query  1006  AILDRVEEKLGLEPEKLRASKDVLSEYGNLTSACVLFILDEMRKKSKKDEEMTTGEGLEW  1185
             AILD+VE KL L+PEKL A++ +LSEYGN++SACVLFILDE+RK++ K    TTG+GL+W
Sbjct  308   AILDQVESKLALKPEKLEATRHILSEYGNMSSACVLFILDEVRKRATKKGLKTTGDGLDW  367

Query  1186  GVVFVVCP  1209
             GV+F   P
Sbjct  368   GVLFGFGP  375



>dbj|BAO58433.1| chalcone synthase [Vaccinium ashei]
Length=389

 Score =   528 bits (1361),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 251/368 (68%), Positives = 300/368 (82%), Gaps = 0/368 (0%)
 Frame = +1

Query  106   RRAKRFEGDAKILAIGTAIPANWVDQTTYPDFYFRITNSEHLLEHKEKFRRICNKSKIRK  285
             R+A+R  G A ++AIGTA P N VDQ+TYPDFYFRITNSEH  E KEKF+R+C+KS I+K
Sbjct  8     RKAQRAAGPATVMAIGTATPPNCVDQSTYPDFYFRITNSEHKTELKEKFQRMCDKSMIKK  67

Query  286   RHLVITEELLKKNPNLCTYNEASLNTRQDILVSEVPKLGKEAAMKAIKEWGRPISEITHL  465
             R++ + EE+LK+NP +C Y   SL+ RQD++V EVPKLGKEAA KAIKEWG+P S+ITHL
Sbjct  68    RYMYLNEEILKENPGVCEYMAPSLDARQDMVVVEVPKLGKEAATKAIKEWGQPKSKITHL  127

Query  466   VFCTSSGVDMPGADFQLAKLLGLSSSVKRLMMYQQGCNAGAAMLRLAKDLAENNKGARVL  645
             VFCT+SGVDMPGAD+QL KLLGL  SVKRLMMYQQGC AG  +LRLAKDLAENNKGARVL
Sbjct  128   VFCTTSGVDMPGADYQLTKLLGLRPSVKRLMMYQQGCFAGGTVLRLAKDLAENNKGARVL  187

Query  646   VVCSEVMLNVFRGPSLEQEDNLLAQCLFGDGSAAVIVGTEPRPGLETPLFELVSAAQTTI  825
             VVCSE+    FRGPS    D+L+ Q LFGDG+AA+IVG +P P +E PLFELVSAAQT +
Sbjct  188   VVCSEITAVTFRGPSDTHLDSLVGQALFGDGAAAIIVGADPIPEVEKPLFELVSAAQTIL  247

Query  826   PDTDSHLKLHLREMGLTFHCSKAVPSLITQNVEDCLVKAFEPFGISDWNSIFWILHPGGI  1005
             PD++  +  HLRE+GLTFH  K VP LI++N+E  L +AF+P GISDWNSIFWI HPGG 
Sbjct  248   PDSEGAIDGHLREVGLTFHLLKDVPGLISKNIEKALTEAFQPLGISDWNSIFWIAHPGGP  307

Query  1006  AILDRVEEKLGLEPEKLRASKDVLSEYGNLTSACVLFILDEMRKKSKKDEEMTTGEGLEW  1185
             AILD+VE K  L+PEKLRA++ VLSEYGN++SACVLFILDEMRKKS ++   TTGEGLEW
Sbjct  308   AILDQVELKCNLKPEKLRATRHVLSEYGNMSSACVLFILDEMRKKSAEEGLKTTGEGLEW  367

Query  1186  GVVFVVCP  1209
             GV+F   P
Sbjct  368   GVLFGFGP  375



>emb|CAJ44127.1| chalcone synthase [Misopates orontium]
Length=390

 Score =   528 bits (1361),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 247/368 (67%), Positives = 302/368 (82%), Gaps = 0/368 (0%)
 Frame = +1

Query  106   RRAKRFEGDAKILAIGTAIPANWVDQTTYPDFYFRITNSEHLLEHKEKFRRICNKSKIRK  285
             RRA+R EG A +LAIGTA PAN VDQ+TYPD+YFRITNSEH+ + KEKF+R+C KS I+K
Sbjct  8     RRAQRAEGPATVLAIGTATPANCVDQSTYPDYYFRITNSEHMTDLKEKFKRMCEKSMIKK  67

Query  286   RHLVITEELLKKNPNLCTYNEASLNTRQDILVSEVPKLGKEAAMKAIKEWGRPISEITHL  465
             R++ +TEE+LK+NP +C Y   SL+ RQDI+V EVP+LGKEAA KAIKEWG+P S+ITHL
Sbjct  68    RYMHLTEEILKENPAMCEYMAPSLDARQDIVVVEVPRLGKEAAQKAIKEWGQPKSKITHL  127

Query  466   VFCTSSGVDMPGADFQLAKLLGLSSSVKRLMMYQQGCNAGAAMLRLAKDLAENNKGARVL  645
             VFCT+SGVDMPGAD+QL KLLGL  SVKR MMYQQGC AG  +LR+AKDLAENN GARVL
Sbjct  128   VFCTTSGVDMPGADYQLTKLLGLRPSVKRFMMYQQGCFAGGTVLRMAKDLAENNAGARVL  187

Query  646   VVCSEVMLNVFRGPSLEQEDNLLAQCLFGDGSAAVIVGTEPRPGLETPLFELVSAAQTTI  825
             VVCSE+    FRGP+    D+L+ Q LFGDG+AAVIVG++P  G+E PLF+LV+AAQT +
Sbjct  188   VVCSEITAVTFRGPADTHLDSLVGQALFGDGAAAVIVGSDPVVGVERPLFQLVTAAQTLL  247

Query  826   PDTDSHLKLHLREMGLTFHCSKAVPSLITQNVEDCLVKAFEPFGISDWNSIFWILHPGGI  1005
             PD+   +  HLRE+GLTFH  K VP LI++++E  L +AF+P GISDWNS+FWI HPGG 
Sbjct  248   PDSHGAIDGHLREVGLTFHLLKDVPGLISKHIEKSLKEAFDPLGISDWNSVFWIAHPGGP  307

Query  1006  AILDRVEEKLGLEPEKLRASKDVLSEYGNLTSACVLFILDEMRKKSKKDEEMTTGEGLEW  1185
             AILD+VEEKLGL+PEKLR+++ VLSEYGN++SACVLFILDEMRK S K+   TTGEG +W
Sbjct  308   AILDQVEEKLGLKPEKLRSTRHVLSEYGNMSSACVLFILDEMRKSSTKEGMSTTGEGFDW  367

Query  1186  GVVFVVCP  1209
             GV+F   P
Sbjct  368   GVLFGFGP  375



>gb|AHK07000.1| chalcone synthase [Olea europaea]
 gb|AHK07001.1| chalcone synthase [Olea europaea]
Length=390

 Score =   528 bits (1360),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 249/368 (68%), Positives = 301/368 (82%), Gaps = 0/368 (0%)
 Frame = +1

Query  106   RRAKRFEGDAKILAIGTAIPANWVDQTTYPDFYFRITNSEHLLEHKEKFRRICNKSKIRK  285
             RRA+R EG A I+AIGTA P+N V Q+TYPD+YFRITNSEH  E KEKF+R+C+KS IRK
Sbjct  8     RRAQRAEGPATIMAIGTATPSNCVYQSTYPDYYFRITNSEHKTELKEKFKRMCDKSMIRK  67

Query  286   RHLVITEELLKKNPNLCTYNEASLNTRQDILVSEVPKLGKEAAMKAIKEWGRPISEITHL  465
             R++ +TEE+LK+N ++C Y   SL+ RQDI+V EVPKLGKEAA KAIKEWG+P S+ITHL
Sbjct  68    RYMHLTEEILKENRHICEYKAPSLDARQDIVVVEVPKLGKEAAQKAIKEWGQPKSKITHL  127

Query  466   VFCTSSGVDMPGADFQLAKLLGLSSSVKRLMMYQQGCNAGAAMLRLAKDLAENNKGARVL  645
             +FCT+SGVDMPGAD+QL KLLGL  SVKR MMYQQGC AG  +LR+AKDLAENNKGARVL
Sbjct  128   IFCTTSGVDMPGADYQLTKLLGLRPSVKRFMMYQQGCFAGGTVLRMAKDLAENNKGARVL  187

Query  646   VVCSEVMLNVFRGPSLEQEDNLLAQCLFGDGSAAVIVGTEPRPGLETPLFELVSAAQTTI  825
             VVCSE+    FRGP     D+L+ Q LFGDG+AAVIVG++P  G+E PLF+LVSAAQT +
Sbjct  188   VVCSEITAVTFRGPDDTHLDSLVGQALFGDGAAAVIVGSDPVIGVERPLFQLVSAAQTIL  247

Query  826   PDTDSHLKLHLREMGLTFHCSKAVPSLITQNVEDCLVKAFEPFGISDWNSIFWILHPGGI  1005
             PD++  +  HLRE+GLTFH  K VP LI++N+E  L +AF+P GISDWNSIFWI HPGG 
Sbjct  248   PDSEGAIDGHLREVGLTFHLLKDVPGLISKNIEKSLTEAFQPLGISDWNSIFWIAHPGGP  307

Query  1006  AILDRVEEKLGLEPEKLRASKDVLSEYGNLTSACVLFILDEMRKKSKKDEEMTTGEGLEW  1185
             AILD+VEEKL L PEKLR+++ VLSEYGN++SACVLFILDEMRK + K+   TTGEGL+W
Sbjct  308   AILDQVEEKLALNPEKLRSTRHVLSEYGNMSSACVLFILDEMRKSATKEGMTTTGEGLDW  367

Query  1186  GVVFVVCP  1209
             GV+F   P
Sbjct  368   GVLFGFGP  375



>ref|XP_008380608.1| PREDICTED: polyketide synthase 5-like [Malus domestica]
Length=389

 Score =   528 bits (1360),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 249/368 (68%), Positives = 300/368 (82%), Gaps = 0/368 (0%)
 Frame = +1

Query  106   RRAKRFEGDAKILAIGTAIPANWVDQTTYPDFYFRITNSEHLLEHKEKFRRICNKSKIRK  285
             R+A+R EG A +LAIGTA P+N VDQ TYPD+YFRITNSEH  E KEKF+R+C+KS I+K
Sbjct  8     RKAQRAEGPATVLAIGTATPSNCVDQATYPDYYFRITNSEHKTELKEKFQRMCDKSMIKK  67

Query  286   RHLVITEELLKKNPNLCTYNEASLNTRQDILVSEVPKLGKEAAMKAIKEWGRPISEITHL  465
             R++ +TEE+LK+NP +C Y   SL+ RQD++V EVP+LGKEAA KAIKEWG+P S+ITHL
Sbjct  68    RYMYLTEEILKENPTVCEYMAPSLDARQDMVVVEVPRLGKEAATKAIKEWGQPKSKITHL  127

Query  466   VFCTSSGVDMPGADFQLAKLLGLSSSVKRLMMYQQGCNAGAAMLRLAKDLAENNKGARVL  645
             VFCT+SGVDMPGAD+QL KLLGL  SVKRLMMYQQGC AG  +LRLAKDLAENNKGARVL
Sbjct  128   VFCTTSGVDMPGADYQLTKLLGLRPSVKRLMMYQQGCFAGGTVLRLAKDLAENNKGARVL  187

Query  646   VVCSEVMLNVFRGPSLEQEDNLLAQCLFGDGSAAVIVGTEPRPGLETPLFELVSAAQTTI  825
             VVCSE+    FRGPS    D+L+ Q LFGDG+AAVI+G +P P +E PLFELVSAAQT +
Sbjct  188   VVCSEITAVTFRGPSDTHLDSLVGQALFGDGAAAVIIGADPLPEVEKPLFELVSAAQTIL  247

Query  826   PDTDSHLKLHLREMGLTFHCSKAVPSLITQNVEDCLVKAFEPFGISDWNSIFWILHPGGI  1005
             PD+D  +  HLRE+GLTFH  K VP LI++N+E  L +AF+P GISDWNS+FWI HPGG 
Sbjct  248   PDSDGAIDGHLREVGLTFHLLKDVPGLISKNIEKSLNEAFKPIGISDWNSLFWIAHPGGP  307

Query  1006  AILDRVEEKLGLEPEKLRASKDVLSEYGNLTSACVLFILDEMRKKSKKDEEMTTGEGLEW  1185
             AILD+VE KL L+PEKL A++ VLS YGN++SACVLFILDE+R+KS +    TTGEGLEW
Sbjct  308   AILDQVESKLALKPEKLEATRQVLSNYGNMSSACVLFILDEVRRKSAEKGLKTTGEGLEW  367

Query  1186  GVVFVVCP  1209
             GV+F   P
Sbjct  368   GVLFGFGP  375



>gb|AGE84303.1| chalcone synthase [Malus domestica]
Length=389

 Score =   528 bits (1360),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 249/368 (68%), Positives = 300/368 (82%), Gaps = 0/368 (0%)
 Frame = +1

Query  106   RRAKRFEGDAKILAIGTAIPANWVDQTTYPDFYFRITNSEHLLEHKEKFRRICNKSKIRK  285
             R+A+R EG A +LAIGTA P+N VDQ TYPD+YFRITNSEH  E KEKF+R+C+KS I+K
Sbjct  8     RKAQRAEGPATVLAIGTATPSNCVDQATYPDYYFRITNSEHKTELKEKFQRMCDKSMIKK  67

Query  286   RHLVITEELLKKNPNLCTYNEASLNTRQDILVSEVPKLGKEAAMKAIKEWGRPISEITHL  465
             R++ +TEE+LK+NP +C Y   SL+ RQD++V EVP+LGKEAA KAIKEWG+P S+ITHL
Sbjct  68    RYMYLTEEILKENPTVCEYMAPSLDARQDMVVVEVPRLGKEAATKAIKEWGQPKSKITHL  127

Query  466   VFCTSSGVDMPGADFQLAKLLGLSSSVKRLMMYQQGCNAGAAMLRLAKDLAENNKGARVL  645
             VFCT+SGVDMPGAD+QL KLLGL  SVKRLMMYQQGC AG  +LRLAKDLAENNKGARVL
Sbjct  128   VFCTTSGVDMPGADYQLTKLLGLRPSVKRLMMYQQGCFAGGTVLRLAKDLAENNKGARVL  187

Query  646   VVCSEVMLNVFRGPSLEQEDNLLAQCLFGDGSAAVIVGTEPRPGLETPLFELVSAAQTTI  825
             VVCSE+    FRGPS    D+L+ Q LFGDG+AAVI+G +P P +E PLFELVSAAQT +
Sbjct  188   VVCSEITAVTFRGPSDTHLDSLVGQALFGDGAAAVIIGADPLPEVEKPLFELVSAAQTIL  247

Query  826   PDTDSHLKLHLREMGLTFHCSKAVPSLITQNVEDCLVKAFEPFGISDWNSIFWILHPGGI  1005
             PD+D  +  HLRE+GLTFH  K VP LI++N+E  L +AF+P GISDWNS+FWI HPGG 
Sbjct  248   PDSDGAIDGHLREVGLTFHLLKDVPGLISKNIEKSLNEAFKPIGISDWNSLFWIAHPGGP  307

Query  1006  AILDRVEEKLGLEPEKLRASKDVLSEYGNLTSACVLFILDEMRKKSKKDEEMTTGEGLEW  1185
             AILD+VE KL L+PEKL A++ VLS YGN++SACVLFILDE+R+KS +    TTGEGLEW
Sbjct  308   AILDQVESKLALKPEKLEATRQVLSNYGNMSSACVLFILDEVRRKSTEKGLRTTGEGLEW  367

Query  1186  GVVFVVCP  1209
             GV+F   P
Sbjct  368   GVLFGFGP  375



>gb|ABF68864.1| chalcone synthase, partial [Cardamine matthioli]
Length=388

 Score =   528 bits (1360),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 251/369 (68%), Positives = 302/369 (82%), Gaps = 1/369 (0%)
 Frame = +1

Query  106   RRAKRFEGDAKILAIGTAIPANWVDQTTYPDFYFRITNSEHLLEHKEKFRRICNKSKIRK  285
             R+A+R +G A ILAIGTA PAN+V Q  YPD+YFRITNSEH+ + KEKF+R+C+KS IRK
Sbjct  13    RKAQRADGPAGILAIGTANPANYVIQAEYPDYYFRITNSEHMTDLKEKFKRMCDKSTIRK  72

Query  286   RHLVITEELLKKNPNLCTYNEASLNTRQDILVSEVPKLGKEAAMKAIKEWGRPISEITHL  465
             RH+ +TEE LK+NPN+C Y   SL+ RQDI+V EVPKLGKEAA+KAIKEWG+P S+ITHL
Sbjct  73    RHMHVTEEFLKENPNMCAYMAPSLDARQDIVVVEVPKLGKEAAVKAIKEWGQPKSKITHL  132

Query  466   VFCTSSGVDMPGADFQLAKLLGLSSSVKRLMMYQQGCNAGAAMLRLAKDLAENNKGARVL  645
             VFCT+SGVDMPGAD+QL KLLGL  SVKRLMMYQQGC AG  +LRLAKDLAENN+GARVL
Sbjct  133   VFCTTSGVDMPGADYQLTKLLGLRPSVKRLMMYQQGCFAGGTVLRLAKDLAENNRGARVL  192

Query  646   VVCSEVMLNVFRGPSLEQEDNLLAQCLFGDGSAAVIVGTEPRPGL-ETPLFELVSAAQTT  822
             VVCSE+    FRGPS    D+L+ Q LF DG+AA+IVG++P   + E P+FE+VSAAQT 
Sbjct  193   VVCSEITAVTFRGPSETHLDSLVGQALFSDGAAALIVGSDPDTSVGEKPIFEMVSAAQTI  252

Query  823   IPDTDSHLKLHLREMGLTFHCSKAVPSLITQNVEDCLVKAFEPFGISDWNSIFWILHPGG  1002
             +PD+D  +  HLRE+GLTFH  K VP LI++N+E  L +AF+P GISDWNSIFWI HPGG
Sbjct  253   LPDSDGAIDGHLREVGLTFHLLKDVPGLISKNIEKSLDEAFKPLGISDWNSIFWIAHPGG  312

Query  1003  IAILDRVEEKLGLEPEKLRASKDVLSEYGNLTSACVLFILDEMRKKSKKDEEMTTGEGLE  1182
              AILD+VE KLGL+ EK+RA++ V+ EYGN++SACVLFILDEMRKKS KD   TTGEGLE
Sbjct  313   PAILDQVEIKLGLKEEKMRATRHVMREYGNMSSACVLFILDEMRKKSAKDGVATTGEGLE  372

Query  1183  WGVVFVVCP  1209
             WGV+F   P
Sbjct  373   WGVLFGFGP  381



>gb|AFQ92052.1| chalcone synthase [Pyrus pyrifolia]
 gb|AGL81345.1| chalcone synthase [Pyrus communis]
Length=391

 Score =   528 bits (1360),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 247/368 (67%), Positives = 303/368 (82%), Gaps = 0/368 (0%)
 Frame = +1

Query  106   RRAKRFEGDAKILAIGTAIPANWVDQTTYPDFYFRITNSEHLLEHKEKFRRICNKSKIRK  285
             R+A+R EG A ++AIGT+ P+N VDQ TYPD+YFRITNSEH +E KEKF+R+C+KS I+K
Sbjct  8     RKAQRAEGPATVMAIGTSTPSNCVDQATYPDYYFRITNSEHKVELKEKFQRMCDKSMIKK  67

Query  286   RHLVITEELLKKNPNLCTYNEASLNTRQDILVSEVPKLGKEAAMKAIKEWGRPISEITHL  465
             R++ +TEE+LK+NP++C Y   S++ RQD++V EVPKLGKEAA KAIKEWG+P S+ITHL
Sbjct  68    RYMYLTEEILKENPSVCEYMAPSIDARQDMVVVEVPKLGKEAATKAIKEWGQPKSKITHL  127

Query  466   VFCTSSGVDMPGADFQLAKLLGLSSSVKRLMMYQQGCNAGAAMLRLAKDLAENNKGARVL  645
             VFCT+SGVDMPGAD+QL KLLGL  SVKRLMMYQQGC AG  +LRLAKDLAENNKGARVL
Sbjct  128   VFCTTSGVDMPGADYQLTKLLGLRPSVKRLMMYQQGCFAGGTVLRLAKDLAENNKGARVL  187

Query  646   VVCSEVMLNVFRGPSLEQEDNLLAQCLFGDGSAAVIVGTEPRPGLETPLFELVSAAQTTI  825
             VVCSE+    FRGPS    D+L+ Q LFGDG+AAVI+G +P P +E PLFELVSAAQT +
Sbjct  188   VVCSEITAVTFRGPSDTHLDSLVGQALFGDGAAAVIIGADPVPEVEKPLFELVSAAQTIL  247

Query  826   PDTDSHLKLHLREMGLTFHCSKAVPSLITQNVEDCLVKAFEPFGISDWNSIFWILHPGGI  1005
             PD+D  +  HLRE+GLTFH  K VP LI++N+E  L +AF+P GISDWNS+FWI HPGG 
Sbjct  248   PDSDGAIDGHLREVGLTFHLLKDVPGLISKNIEKSLNEAFKPIGISDWNSLFWIAHPGGP  307

Query  1006  AILDRVEEKLGLEPEKLRASKDVLSEYGNLTSACVLFILDEMRKKSKKDEEMTTGEGLEW  1185
             AILD+VE KL L+PEKL A++ VLS+YGN++SACVLFILDE+R+KS +    TTGEGLEW
Sbjct  308   AILDQVEAKLALKPEKLEATRQVLSDYGNMSSACVLFILDEVRRKSAEKGLKTTGEGLEW  367

Query  1186  GVVFVVCP  1209
             GV+F   P
Sbjct  368   GVLFGFGP  375



>gb|ACM17224.1| naringenin-chalcone synthase [Humulus lupulus]
Length=389

 Score =   528 bits (1360),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 250/368 (68%), Positives = 301/368 (82%), Gaps = 0/368 (0%)
 Frame = +1

Query  106   RRAKRFEGDAKILAIGTAIPANWVDQTTYPDFYFRITNSEHLLEHKEKFRRICNKSKIRK  285
             R+A+R EG A ILAIGTA PAN + Q+ YPD+YFRITNSEH  E KEKF+R+C+KS IRK
Sbjct  8     RKAQRAEGPATILAIGTATPANCILQSEYPDYYFRITNSEHKTELKEKFKRMCDKSMIRK  67

Query  286   RHLVITEELLKKNPNLCTYNEASLNTRQDILVSEVPKLGKEAAMKAIKEWGRPISEITHL  465
             R++ +TEE+LK+NPNLC Y   SL+ RQD++V EVPKLGKEAA KAIKEWG+P S+ITH+
Sbjct  68    RYMHLTEEILKENPNLCAYEAPSLDARQDMVVVEVPKLGKEAATKAIKEWGQPKSKITHV  127

Query  466   VFCTSSGVDMPGADFQLAKLLGLSSSVKRLMMYQQGCNAGAAMLRLAKDLAENNKGARVL  645
             VFCT+SGVDMPGAD+QL KLLGL  SVKRLMMYQQGC AG  +LR+AKDLAENNKGARVL
Sbjct  128   VFCTTSGVDMPGADYQLTKLLGLRPSVKRLMMYQQGCFAGGTVLRVAKDLAENNKGARVL  187

Query  646   VVCSEVMLNVFRGPSLEQEDNLLAQCLFGDGSAAVIVGTEPRPGLETPLFELVSAAQTTI  825
             VVCSE+    FRGP+     +L+ Q LFGDGSAA+I+G +P P +E P+FELVSAAQT +
Sbjct  188   VVCSEITAVTFRGPNDTHLGSLVGQALFGDGSAALIIGADPIPEIEKPVFELVSAAQTIL  247

Query  826   PDTDSHLKLHLREMGLTFHCSKAVPSLITQNVEDCLVKAFEPFGISDWNSIFWILHPGGI  1005
             PD+D  +  HLRE+GLTFH  K VP LI++N+E  LV+AF+P GISDWNS+FWI HPGG 
Sbjct  248   PDSDGAIDGHLREVGLTFHLLKDVPGLISKNIEKSLVEAFKPLGISDWNSLFWIAHPGGP  307

Query  1006  AILDRVEEKLGLEPEKLRASKDVLSEYGNLTSACVLFILDEMRKKSKKDEEMTTGEGLEW  1185
             AILD+VE KL L+PEKLRA++ VL EYGN++SACVLFILDEMR+K  +D   TTGEGLEW
Sbjct  308   AILDQVESKLALKPEKLRATRHVLGEYGNMSSACVLFILDEMRRKCAEDGLKTTGEGLEW  367

Query  1186  GVVFVVCP  1209
             GV+F   P
Sbjct  368   GVLFGFGP  375



>ref|XP_010929491.1| PREDICTED: chalcone synthase 2 [Elaeis guineensis]
Length=394

 Score =   528 bits (1360),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 247/368 (67%), Positives = 301/368 (82%), Gaps = 0/368 (0%)
 Frame = +1

Query  106   RRAKRFEGDAKILAIGTAIPANWVDQTTYPDFYFRITNSEHLLEHKEKFRRICNKSKIRK  285
             R ++R EG A ILAIGTA PAN V Q  YPD+YFRIT SEHL + KEKF+R+C+KS IRK
Sbjct  10    RSSQRAEGPATILAIGTATPANVVYQADYPDYYFRITKSEHLTDLKEKFKRMCDKSMIRK  69

Query  286   RHLVITEELLKKNPNLCTYNEASLNTRQDILVSEVPKLGKEAAMKAIKEWGRPISEITHL  465
             R++ ++EE+LK+NPN+C Y   SL+ RQD++V EVPKLGKEAA+KAIKEWG+P S+ITHL
Sbjct  70    RYMHLSEEILKENPNICAYMAPSLDARQDVVVVEVPKLGKEAAVKAIKEWGQPKSKITHL  129

Query  466   VFCTSSGVDMPGADFQLAKLLGLSSSVKRLMMYQQGCNAGAAMLRLAKDLAENNKGARVL  645
             VFCT+SGVDMPGAD+QL KLLGL  SV RLMMYQQGC AG  +LRLAKDLAENN+GARVL
Sbjct  130   VFCTTSGVDMPGADYQLTKLLGLRPSVNRLMMYQQGCFAGGTVLRLAKDLAENNRGARVL  189

Query  646   VVCSEVMLNVFRGPSLEQEDNLLAQCLFGDGSAAVIVGTEPRPGLETPLFELVSAAQTTI  825
             VVCSE+    FRGPS    D+L+ Q LFGDG+AA+IVG +P P +E PLF+LVSA+QT +
Sbjct  190   VVCSEITAVTFRGPSESHLDSLVGQALFGDGAAAIIVGADPDPAIERPLFQLVSASQTIL  249

Query  826   PDTDSHLKLHLREMGLTFHCSKAVPSLITQNVEDCLVKAFEPFGISDWNSIFWILHPGGI  1005
             PD++  +  HLRE+GLTFH  K VP LI++N+   LV+AF P GISDWNSIFWI HPGG 
Sbjct  250   PDSEGAIDGHLREVGLTFHLLKDVPGLISKNIHKSLVEAFVPLGISDWNSIFWIAHPGGP  309

Query  1006  AILDRVEEKLGLEPEKLRASKDVLSEYGNLTSACVLFILDEMRKKSKKDEEMTTGEGLEW  1185
             AILD+VE KLGLE EK+RA++ VLSEYGN++SACVLFILDEMR++S ++ + TTGEGLEW
Sbjct  310   AILDQVEAKLGLEKEKMRATRHVLSEYGNMSSACVLFILDEMRRRSAEEGKATTGEGLEW  369

Query  1186  GVVFVVCP  1209
             GV+F   P
Sbjct  370   GVLFGFGP  377



>gb|AAM90652.1|AF400567_1 chalcone synthase 6 [Rubus idaeus]
Length=391

 Score =   528 bits (1360),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 248/368 (67%), Positives = 301/368 (82%), Gaps = 0/368 (0%)
 Frame = +1

Query  106   RRAKRFEGDAKILAIGTAIPANWVDQTTYPDFYFRITNSEHLLEHKEKFRRICNKSKIRK  285
             R+A+R EG A ILAIGTA P N VDQ+TYPD+YFRIT SEH  E KEKF+R+C+KS I+K
Sbjct  8     RKAQRAEGPATILAIGTATPPNCVDQSTYPDYYFRITKSEHKTELKEKFQRMCDKSMIKK  67

Query  286   RHLVITEELLKKNPNLCTYNEASLNTRQDILVSEVPKLGKEAAMKAIKEWGRPISEITHL  465
             R++ +TEE+LK+NP++C Y   SL+ RQD++V E+PKLGKEAA KAIKEWG+P S+ITHL
Sbjct  68    RYMYLTEEILKENPSMCEYMAPSLDARQDMVVVEIPKLGKEAATKAIKEWGQPKSKITHL  127

Query  466   VFCTSSGVDMPGADFQLAKLLGLSSSVKRLMMYQQGCNAGAAMLRLAKDLAENNKGARVL  645
             VFCT+SGVDMPGAD+QL KLLGL  SVKRLMMYQQGC AG  +LRLAKDLAENNKGARVL
Sbjct  128   VFCTTSGVDMPGADYQLTKLLGLRPSVKRLMMYQQGCFAGGTVLRLAKDLAENNKGARVL  187

Query  646   VVCSEVMLNVFRGPSLEQEDNLLAQCLFGDGSAAVIVGTEPRPGLETPLFELVSAAQTTI  825
             VVCSE+    FRGPS    D+L+ Q LFGDG+AA+IVG +P P +E PLFELVSAAQT +
Sbjct  188   VVCSEITAVTFRGPSDTHLDSLVGQALFGDGAAAIIVGADPLPEIERPLFELVSAAQTIL  247

Query  826   PDTDSHLKLHLREMGLTFHCSKAVPSLITQNVEDCLVKAFEPFGISDWNSIFWILHPGGI  1005
             PD+D  +  HLRE+GLTFH  K VP LI++N+E  L +AF+P  I+DWNS+FWI HPGG 
Sbjct  248   PDSDGAIDGHLREVGLTFHLLKDVPGLISKNIEKSLNEAFKPLDITDWNSLFWIAHPGGP  307

Query  1006  AILDRVEEKLGLEPEKLRASKDVLSEYGNLTSACVLFILDEMRKKSKKDEEMTTGEGLEW  1185
             AILD+VE KLGL+PEKL A++ +LSEYGN++SACVLFILDE+R+KS  +   TTGEGLEW
Sbjct  308   AILDQVEAKLGLKPEKLEATRHILSEYGNMSSACVLFILDEVRRKSAANGHKTTGEGLEW  367

Query  1186  GVVFVVCP  1209
             GV+F   P
Sbjct  368   GVLFGFGP  375



>gb|ABM66532.1| chalcone synthase [Glycyrrhiza uralensis]
Length=389

 Score =   528 bits (1360),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 244/368 (66%), Positives = 304/368 (83%), Gaps = 0/368 (0%)
 Frame = +1

Query  106   RRAKRFEGDAKILAIGTAIPANWVDQTTYPDFYFRITNSEHLLEHKEKFRRICNKSKIRK  285
             R+A+R EG A ILAIGTA P N VDQ+TYPDFYF+ITNSEH  E KEKF+R+C+KS I+K
Sbjct  8     RKAQRAEGPANILAIGTANPPNCVDQSTYPDFYFKITNSEHKTELKEKFQRMCDKSMIKK  67

Query  286   RHLVITEELLKKNPNLCTYNEASLNTRQDILVSEVPKLGKEAAMKAIKEWGRPISEITHL  465
             R++ +TEE+LK+NPN+C Y   SL+ RQD++V EVP+LGKEAA+KAIKEWG+P S+ITHL
Sbjct  68    RYMYLTEEILKENPNICAYMAPSLDARQDMVVVEVPRLGKEAAVKAIKEWGQPKSKITHL  127

Query  466   VFCTSSGVDMPGADFQLAKLLGLSSSVKRLMMYQQGCNAGAAMLRLAKDLAENNKGARVL  645
             +FCT+SGVDMPGAD+QL KLLGL   VKR MMYQQGC+AG  +LRLAKDLAENNKGARVL
Sbjct  128   IFCTTSGVDMPGADYQLTKLLGLRPYVKRYMMYQQGCSAGGTVLRLAKDLAENNKGARVL  187

Query  646   VVCSEVMLNVFRGPSLEQEDNLLAQCLFGDGSAAVIVGTEPRPGLETPLFELVSAAQTTI  825
             VVCSE+    FRGP+    D+L+ Q LFGDG+AAVIVG++P P +E P+FELV  AQT  
Sbjct  188   VVCSEITAVTFRGPTDTHLDSLVGQALFGDGAAAVIVGSDPVPEIEKPIFELVWTAQTIA  247

Query  826   PDTDSHLKLHLREMGLTFHCSKAVPSLITQNVEDCLVKAFEPFGISDWNSIFWILHPGGI  1005
             PD++  +  HLRE+GLTFH  K VP ++++N++  L +AF+P GISD+NSIFWI HPGG 
Sbjct  248   PDSEGAIDGHLREVGLTFHLLKDVPGIVSKNIDKALTEAFQPLGISDYNSIFWIAHPGGP  307

Query  1006  AILDRVEEKLGLEPEKLRASKDVLSEYGNLTSACVLFILDEMRKKSKKDEEMTTGEGLEW  1185
             AILD+VE+KL L+PEK++A++DVLS+YGN++SACVLFILDEMRKKS +D   TTGEGLEW
Sbjct  308   AILDQVEQKLALKPEKMKATRDVLSDYGNMSSACVLFILDEMRKKSAQDGLKTTGEGLEW  367

Query  1186  GVVFVVCP  1209
             GV+F   P
Sbjct  368   GVLFGFGP  375



>gb|ABF68860.1| chalcone synthase, partial [Cardamine uliginosa]
 gb|ABF68862.1| chalcone synthase, partial [Cardamine granulosa]
 gb|ABF68870.1| chalcone synthase, partial [Cardamine tenera]
Length=388

 Score =   528 bits (1359),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 251/369 (68%), Positives = 302/369 (82%), Gaps = 1/369 (0%)
 Frame = +1

Query  106   RRAKRFEGDAKILAIGTAIPANWVDQTTYPDFYFRITNSEHLLEHKEKFRRICNKSKIRK  285
             R+A+R +G A ILAIGTA PAN+V Q  YPD+YFRITNSEH+ + KEKF+R+C+KS IRK
Sbjct  13    RKAQRADGPAGILAIGTANPANYVIQAEYPDYYFRITNSEHMTDLKEKFKRMCDKSTIRK  72

Query  286   RHLVITEELLKKNPNLCTYNEASLNTRQDILVSEVPKLGKEAAMKAIKEWGRPISEITHL  465
             RH+ +TEE LK+NPN+C Y   SL+ RQDI+V EVPKLGKEAA+KAIKEWG+P S+ITHL
Sbjct  73    RHMHVTEEFLKENPNMCAYMAPSLDARQDIVVVEVPKLGKEAAVKAIKEWGQPKSKITHL  132

Query  466   VFCTSSGVDMPGADFQLAKLLGLSSSVKRLMMYQQGCNAGAAMLRLAKDLAENNKGARVL  645
             VFCT+SGVDMPGAD+QL KLLGL  SVKRLMMYQQGC AG  +LRLAKDLAENN+GARVL
Sbjct  133   VFCTTSGVDMPGADYQLTKLLGLRPSVKRLMMYQQGCFAGGTVLRLAKDLAENNRGARVL  192

Query  646   VVCSEVMLNVFRGPSLEQEDNLLAQCLFGDGSAAVIVGTEPRPGL-ETPLFELVSAAQTT  822
             VVCSE+    FRGPS    D+L+ Q LF DG+AA+IVG++P   + E P+FE+VSAAQT 
Sbjct  193   VVCSEITAVTFRGPSDTHLDSLVGQALFSDGAAALIVGSDPDTSVGEKPIFEMVSAAQTI  252

Query  823   IPDTDSHLKLHLREMGLTFHCSKAVPSLITQNVEDCLVKAFEPFGISDWNSIFWILHPGG  1002
             +PD+D  +  HLRE+GLTFH  K VP LI++N+E  L +AF+P GISDWNSIFWI HPGG
Sbjct  253   LPDSDGAIDGHLREVGLTFHLLKDVPGLISKNIEKSLDEAFKPLGISDWNSIFWIAHPGG  312

Query  1003  IAILDRVEEKLGLEPEKLRASKDVLSEYGNLTSACVLFILDEMRKKSKKDEEMTTGEGLE  1182
              AILD+VE KLGL+ EK+RA++ V+ EYGN++SACVLFILDEMRKKS KD   TTGEGLE
Sbjct  313   PAILDQVEIKLGLKEEKMRATRHVMREYGNMSSACVLFILDEMRKKSAKDGVATTGEGLE  372

Query  1183  WGVVFVVCP  1209
             WGV+F   P
Sbjct  373   WGVLFGFGP  381



>gb|AEO36981.1| chalcone synthase [Dimocarpus longan]
Length=393

 Score =   528 bits (1360),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 249/368 (68%), Positives = 303/368 (82%), Gaps = 0/368 (0%)
 Frame = +1

Query  106   RRAKRFEGDAKILAIGTAIPANWVDQTTYPDFYFRITNSEHLLEHKEKFRRICNKSKIRK  285
             R+A+R EG A ILAIGTA PAN V Q  YPD+YFRITNSEH+ E KEKF+R+C+KS I+K
Sbjct  8     RKAQRAEGPANILAIGTATPANCVLQADYPDYYFRITNSEHMTELKEKFQRMCDKSMIKK  67

Query  286   RHLVITEELLKKNPNLCTYNEASLNTRQDILVSEVPKLGKEAAMKAIKEWGRPISEITHL  465
             R++ +TE++LK+NPN+C Y   S++ RQDI+V EVPKLGKEAA KAIKEWG+P S+ITHL
Sbjct  68    RYMHLTEDILKENPNMCAYMAPSIDARQDIVVVEVPKLGKEAAQKAIKEWGQPKSKITHL  127

Query  466   VFCTSSGVDMPGADFQLAKLLGLSSSVKRLMMYQQGCNAGAAMLRLAKDLAENNKGARVL  645
             VFCT+SGVDMPGAD+QL KLLGL  SVKRLMMYQQGC AG  +LRLAKDLAENNKGARVL
Sbjct  128   VFCTTSGVDMPGADYQLTKLLGLRPSVKRLMMYQQGCFAGGTVLRLAKDLAENNKGARVL  187

Query  646   VVCSEVMLNVFRGPSLEQEDNLLAQCLFGDGSAAVIVGTEPRPGLETPLFELVSAAQTTI  825
             VVCSE+    FRGP+    D+L+ Q LFGDG+AAVI+G +P   +E PLF+LVSAAQT +
Sbjct  188   VVCSEITAVTFRGPTDTHLDSLVGQALFGDGAAAVIIGADPDTSIERPLFQLVSAAQTIL  247

Query  826   PDTDSHLKLHLREMGLTFHCSKAVPSLITQNVEDCLVKAFEPFGISDWNSIFWILHPGGI  1005
             PD+D  +  HLRE+GLTFH  K VP LI++N+E  LV+AF P GI+DWNSIFWI HPGG 
Sbjct  248   PDSDGAIDGHLREVGLTFHLLKDVPGLISKNIEKSLVEAFTPIGINDWNSIFWIAHPGGP  307

Query  1006  AILDRVEEKLGLEPEKLRASKDVLSEYGNLTSACVLFILDEMRKKSKKDEEMTTGEGLEW  1185
             AILD+VE KLGL+ EKLRA++ VLSEYGN++SACVLFILDEMR+K  ++ ++TTGEGL+W
Sbjct  308   AILDQVEAKLGLKEEKLRATRHVLSEYGNMSSACVLFILDEMRRKCLEEGKLTTGEGLDW  367

Query  1186  GVVFVVCP  1209
             GV+F   P
Sbjct  368   GVLFGFGP  375



>sp|P08894.1|CHSA_PETHY RecName: Full=Chalcone synthase A; AltName: Full=Naringenin-chalcone 
synthase A [Petunia x hybrida]
 emb|CAA27718.1| unnamed protein product [Petunia x hybrida]
Length=389

 Score =   528 bits (1359),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 248/368 (67%), Positives = 303/368 (82%), Gaps = 0/368 (0%)
 Frame = +1

Query  106   RRAKRFEGDAKILAIGTAIPANWVDQTTYPDFYFRITNSEHLLEHKEKFRRICNKSKIRK  285
             R+A+R EG A ++AIGTA P N VDQ+TYPD+YFRITNSEH  + KEKF+R+C KS I+K
Sbjct  8     RKAQRAEGPATVMAIGTATPTNCVDQSTYPDYYFRITNSEHKTDLKEKFKRMCEKSMIKK  67

Query  286   RHLVITEELLKKNPNLCTYNEASLNTRQDILVSEVPKLGKEAAMKAIKEWGRPISEITHL  465
             R++ +TEE+LK+NP++C Y   SL+ RQDI+V EVPKLGKEAA KAIKEWG+P S+ITHL
Sbjct  68    RYMHLTEEILKENPSMCEYMAPSLDARQDIVVVEVPKLGKEAAQKAIKEWGQPKSKITHL  127

Query  466   VFCTSSGVDMPGADFQLAKLLGLSSSVKRLMMYQQGCNAGAAMLRLAKDLAENNKGARVL  645
             VFCT+SGVDMPG D+QL KLLGL  SVKRLMMYQQGC AG  +LRLAKDLAENNKGARVL
Sbjct  128   VFCTTSGVDMPGCDYQLTKLLGLRPSVKRLMMYQQGCFAGGTVLRLAKDLAENNKGARVL  187

Query  646   VVCSEVMLNVFRGPSLEQEDNLLAQCLFGDGSAAVIVGTEPRPGLETPLFELVSAAQTTI  825
             VVCSE+    FRGP+    D+L+ Q LFGDG+ A+I+G++P PG+E PLFELVSAAQT +
Sbjct  188   VVCSEITAVTFRGPNDTHLDSLVGQALFGDGAGAIIIGSDPIPGVERPLFELVSAAQTLL  247

Query  826   PDTDSHLKLHLREMGLTFHCSKAVPSLITQNVEDCLVKAFEPFGISDWNSIFWILHPGGI  1005
             PD+   +  HLRE+GLTFH  K VP LI++N+E  L +AF+P GISDWNS+FWI HPGG 
Sbjct  248   PDSHGAIDGHLREVGLTFHLLKDVPGLISKNIEKSLEEAFKPLGISDWNSLFWIAHPGGP  307

Query  1006  AILDRVEEKLGLEPEKLRASKDVLSEYGNLTSACVLFILDEMRKKSKKDEEMTTGEGLEW  1185
             AILD+VE KLGL+PEKL+A+++VLS+YGN++SACVLFILDEMRK S K+   TTGEGLEW
Sbjct  308   AILDQVEIKLGLKPEKLKATRNVLSDYGNMSSACVLFILDEMRKASAKEGLGTTGEGLEW  367

Query  1186  GVVFVVCP  1209
             GV+F   P
Sbjct  368   GVLFGFGP  375



>ref|XP_004504355.1| PREDICTED: chalcone synthase 1-like [Cicer arietinum]
Length=389

 Score =   528 bits (1359),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 247/368 (67%), Positives = 302/368 (82%), Gaps = 0/368 (0%)
 Frame = +1

Query  106   RRAKRFEGDAKILAIGTAIPANWVDQTTYPDFYFRITNSEHLLEHKEKFRRICNKSKIRK  285
             R+A+R EG A ++AIGTA P N++DQ+ YPD+YFR+TNSEH  E KEKF+R+C KS I+K
Sbjct  8     RKAQRAEGPATVMAIGTATPPNFIDQSDYPDYYFRVTNSEHKTELKEKFKRMCEKSMIKK  67

Query  286   RHLVITEELLKKNPNLCTYNEASLNTRQDILVSEVPKLGKEAAMKAIKEWGRPISEITHL  465
             R++ +TEE+LK+NPN+C Y   SL+ RQD++V EVPKLGKEAA KAIKEWG+P S+ITHL
Sbjct  68    RYMYLTEEILKENPNVCAYMAPSLDARQDMVVVEVPKLGKEAATKAIKEWGQPKSKITHL  127

Query  466   VFCTSSGVDMPGADFQLAKLLGLSSSVKRLMMYQQGCNAGAAMLRLAKDLAENNKGARVL  645
             VFCT+SGVDMPGAD+QL KLLGL  SVKR MMYQQGC AG  +LRLAKDLAENNKGARVL
Sbjct  128   VFCTTSGVDMPGADYQLTKLLGLRPSVKRYMMYQQGCFAGGTVLRLAKDLAENNKGARVL  187

Query  646   VVCSEVMLNVFRGPSLEQEDNLLAQCLFGDGSAAVIVGTEPRPGLETPLFELVSAAQTTI  825
             VVCSE+    FRGP+    D+L+ Q LFGDG+AAVIVG++P P +E PLFELV  AQT +
Sbjct  188   VVCSEITAVTFRGPNDTHLDSLVGQALFGDGAAAVIVGSDPLPDVERPLFELVWTAQTIL  247

Query  826   PDTDSHLKLHLREMGLTFHCSKAVPSLITQNVEDCLVKAFEPFGISDWNSIFWILHPGGI  1005
             PD++  +  HLRE+GLTFH  K VP LI++N+E  LV+AF+P GISD+NSIFWI HPGG 
Sbjct  248   PDSEGAIDGHLREVGLTFHLLKDVPGLISKNIEKALVEAFKPLGISDYNSIFWIAHPGGP  307

Query  1006  AILDRVEEKLGLEPEKLRASKDVLSEYGNLTSACVLFILDEMRKKSKKDEEMTTGEGLEW  1185
             AILD+VE+KLGL+PEKL A++ VLSEYGN++SACVLFILD MR KSK++   TTGEGLEW
Sbjct  308   AILDQVEDKLGLKPEKLEATRHVLSEYGNMSSACVLFILDAMRNKSKENGLATTGEGLEW  367

Query  1186  GVVFVVCP  1209
             GV+F   P
Sbjct  368   GVLFGFGP  375



>ref|XP_010099135.1| Chalcone synthase [Morus notabilis]
 gb|EXB76929.1| Chalcone synthase [Morus notabilis]
Length=389

 Score =   528 bits (1359),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 246/368 (67%), Positives = 302/368 (82%), Gaps = 0/368 (0%)
 Frame = +1

Query  106   RRAKRFEGDAKILAIGTAIPANWVDQTTYPDFYFRITNSEHLLEHKEKFRRICNKSKIRK  285
             R+A+R EG A I+AIGTA P N +DQ++YPD+YFRITNSEH  E KEKF+R+C KS+I+K
Sbjct  8     RKAQRAEGPATIMAIGTATPPNCIDQSSYPDYYFRITNSEHKTELKEKFKRMCEKSQIKK  67

Query  286   RHLVITEELLKKNPNLCTYNEASLNTRQDILVSEVPKLGKEAAMKAIKEWGRPISEITHL  465
             R++ + EE+LK+NPN+C Y   SL+ RQD++V EVPKLGKEAA KAIKEWG+P S+ITHL
Sbjct  68    RYMYLHEEILKENPNICAYMAPSLDARQDMVVVEVPKLGKEAATKAIKEWGQPKSKITHL  127

Query  466   VFCTSSGVDMPGADFQLAKLLGLSSSVKRLMMYQQGCNAGAAMLRLAKDLAENNKGARVL  645
             VFCT+SGVDMPGAD+QL KLLGL  SVKRLMMYQQGC AG  +LRLAKDLAENNKGARVL
Sbjct  128   VFCTTSGVDMPGADYQLTKLLGLRPSVKRLMMYQQGCFAGGTVLRLAKDLAENNKGARVL  187

Query  646   VVCSEVMLNVFRGPSLEQEDNLLAQCLFGDGSAAVIVGTEPRPGLETPLFELVSAAQTTI  825
             VVCSE+    FRGPS    D+L+ Q LFGDG+AA+I+G +P P +E P+F+LVSAAQT +
Sbjct  188   VVCSEITAVTFRGPSDTHLDSLVGQALFGDGAAAMIIGADPIPEVEKPIFQLVSAAQTIL  247

Query  826   PDTDSHLKLHLREMGLTFHCSKAVPSLITQNVEDCLVKAFEPFGISDWNSIFWILHPGGI  1005
             PD++  +  HLRE+GLTFH  K VP LI++N++  L +AF+P GISDWNSIFWI HPGG 
Sbjct  248   PDSEGAIDGHLREVGLTFHLLKDVPGLISKNIDKSLTEAFKPLGISDWNSIFWIAHPGGP  307

Query  1006  AILDRVEEKLGLEPEKLRASKDVLSEYGNLTSACVLFILDEMRKKSKKDEEMTTGEGLEW  1185
             AILD+VE K GL+PEKLRA++ VLSEYGN++SACV+FILDEMR+K  +D   TTGEGLEW
Sbjct  308   AILDQVEAKCGLKPEKLRATRHVLSEYGNMSSACVVFILDEMRRKGAEDGLKTTGEGLEW  367

Query  1186  GVVFVVCP  1209
             GV+F   P
Sbjct  368   GVLFGFGP  375



>gb|AAG43356.1|AF144538_1 chalcone synthase [Cardamine penzesii]
Length=395

 Score =   528 bits (1359),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 251/369 (68%), Positives = 302/369 (82%), Gaps = 1/369 (0%)
 Frame = +1

Query  106   RRAKRFEGDAKILAIGTAIPANWVDQTTYPDFYFRITNSEHLLEHKEKFRRICNKSKIRK  285
             R+A+R +G A ILAIGTA PAN+V Q  YPD+YFRITNSEH+ + KEKF+R+C+KS IRK
Sbjct  13    RKAQRADGPAGILAIGTANPANYVIQAEYPDYYFRITNSEHMTDLKEKFKRMCDKSTIRK  72

Query  286   RHLVITEELLKKNPNLCTYNEASLNTRQDILVSEVPKLGKEAAMKAIKEWGRPISEITHL  465
             RH+ +TEE LK+NPN+C Y   SL+ RQDI+V EVPKLGKEAA+KAIKEWG+P S+ITHL
Sbjct  73    RHMHVTEEFLKENPNMCAYMAPSLDARQDIVVVEVPKLGKEAAVKAIKEWGQPKSKITHL  132

Query  466   VFCTSSGVDMPGADFQLAKLLGLSSSVKRLMMYQQGCNAGAAMLRLAKDLAENNKGARVL  645
             VFCT+SGVDMPGAD+QL KLLGL  SVKRLMMYQQGC AG  +LRLAKDLAENN+GARVL
Sbjct  133   VFCTTSGVDMPGADYQLTKLLGLRPSVKRLMMYQQGCFAGGTVLRLAKDLAENNRGARVL  192

Query  646   VVCSEVMLNVFRGPSLEQEDNLLAQCLFGDGSAAVIVGTEPRPGL-ETPLFELVSAAQTT  822
             VVCSE+    FRGPS    D+L+ Q LF DG+AA+IVG++P   + E P+FE+VSAAQT 
Sbjct  193   VVCSEITAVTFRGPSDTHLDSLVGQALFSDGAAALIVGSDPDTSVGEKPIFEMVSAAQTI  252

Query  823   IPDTDSHLKLHLREMGLTFHCSKAVPSLITQNVEDCLVKAFEPFGISDWNSIFWILHPGG  1002
             +PD+D  +  HLRE+GLTFH  K VP LI++N+E  L +AF+P GISDWNSIFWI HPGG
Sbjct  253   LPDSDGAIDGHLREVGLTFHLLKDVPGLISKNIEKSLDEAFKPLGISDWNSIFWIAHPGG  312

Query  1003  IAILDRVEEKLGLEPEKLRASKDVLSEYGNLTSACVLFILDEMRKKSKKDEEMTTGEGLE  1182
              AILD+VE KLGL+ EK+RA++ V+ EYGN++SACVLFILDEMRKKS KD   TTGEGLE
Sbjct  313   PAILDQVEIKLGLKEEKMRATRHVMREYGNMSSACVLFILDEMRKKSAKDGVATTGEGLE  372

Query  1183  WGVVFVVCP  1209
             WGV+F   P
Sbjct  373   WGVLFGFGP  381



>dbj|BAB84112.1| chalcone synthase [Vitis vinifera]
Length=393

 Score =   528 bits (1359),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 250/368 (68%), Positives = 302/368 (82%), Gaps = 0/368 (0%)
 Frame = +1

Query  106   RRAKRFEGDAKILAIGTAIPANWVDQTTYPDFYFRITNSEHLLEHKEKFRRICNKSKIRK  285
             R+++R EG A +LAIGTA PAN V Q  YPD+YFRITNSEH+ E KEKF+R+C KS I K
Sbjct  8     RKSQRAEGPATVLAIGTATPANCVYQADYPDYYFRITNSEHMTELKEKFKRMCEKSMINK  67

Query  286   RHLVITEELLKKNPNLCTYNEASLNTRQDILVSEVPKLGKEAAMKAIKEWGRPISEITHL  465
             R++ +TEE+LK+NPN+C Y   SL+ RQD++V EVPKLGKEAA+KAIKEWG+P S+ITHL
Sbjct  68    RYMHLTEEILKENPNVCAYMAPSLDARQDMVVVEVPKLGKEAAVKAIKEWGQPKSKITHL  127

Query  466   VFCTSSGVDMPGADFQLAKLLGLSSSVKRLMMYQQGCNAGAAMLRLAKDLAENNKGARVL  645
             VFCT+SGVDMPGAD+QL KLLGL  SVKRLMMYQQGC AG  +LRLAKDLAENN GARVL
Sbjct  128   VFCTTSGVDMPGADYQLTKLLGLKPSVKRLMMYQQGCFAGGTVLRLAKDLAENNAGARVL  187

Query  646   VVCSEVMLNVFRGPSLEQEDNLLAQCLFGDGSAAVIVGTEPRPGLETPLFELVSAAQTTI  825
             VVCSE+    FRGPS    D+L+ Q LFGDG+AA+I+G +P   +E PLFELVSAAQT +
Sbjct  188   VVCSEITAVTFRGPSDTHLDSLVGQALFGDGAAAIIIGADPDTKIERPLFELVSAAQTIL  247

Query  826   PDTDSHLKLHLREMGLTFHCSKAVPSLITQNVEDCLVKAFEPFGISDWNSIFWILHPGGI  1005
             PD++  +  HLRE+GLTFH  K VP LI++N+E  LV+AF+P GISDWNS+FWI HPGG 
Sbjct  248   PDSEGAIDGHLREVGLTFHLLKDVPGLISKNIEKSLVEAFKPIGISDWNSLFWIAHPGGP  307

Query  1006  AILDRVEEKLGLEPEKLRASKDVLSEYGNLTSACVLFILDEMRKKSKKDEEMTTGEGLEW  1185
             AILD+VE KLGL+ EKLRA++ VLSEYGN++SACVLFILDEMRKKS ++ + TTGEGLEW
Sbjct  308   AILDQVELKLGLKEEKLRATRHVLSEYGNMSSACVLFILDEMRKKSIEEGKGTTGEGLEW  367

Query  1186  GVVFVVCP  1209
             GV+F   P
Sbjct  368   GVLFGFGP  375



>ref|XP_007157043.1| hypothetical protein PHAVU_002G038700g [Phaseolus vulgaris]
 gb|ESW29037.1| hypothetical protein PHAVU_002G038700g [Phaseolus vulgaris]
Length=389

 Score =   527 bits (1358),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 246/368 (67%), Positives = 303/368 (82%), Gaps = 0/368 (0%)
 Frame = +1

Query  106   RRAKRFEGDAKILAIGTAIPANWVDQTTYPDFYFRITNSEHLLEHKEKFRRICNKSKIRK  285
             R+A+R EG A ILAIGTA P+N VDQ+TYPD+YFRITNSEH+ + KEKF+R+C+KS I+K
Sbjct  8     RQAQRAEGPATILAIGTATPSNCVDQSTYPDYYFRITNSEHMTDLKEKFQRMCDKSMIKK  67

Query  286   RHLVITEELLKKNPNLCTYNEASLNTRQDILVSEVPKLGKEAAMKAIKEWGRPISEITHL  465
             R++ + EE+LK+NPN+C Y   SL+ RQDI+V EVPKLGKEAA+KAIKEWG+P S+ITHL
Sbjct  68    RYMHLDEEILKENPNMCAYMAPSLDARQDIVVVEVPKLGKEAAVKAIKEWGQPKSKITHL  127

Query  466   VFCTSSGVDMPGADFQLAKLLGLSSSVKRLMMYQQGCNAGAAMLRLAKDLAENNKGARVL  645
             +FCT+SGVDMPGAD+QL KLLGL   VKR MMYQQGC AG  +LRLAKDLAENNKGARVL
Sbjct  128   IFCTTSGVDMPGADYQLTKLLGLRPYVKRYMMYQQGCFAGGTVLRLAKDLAENNKGARVL  187

Query  646   VVCSEVMLNVFRGPSLEQEDNLLAQCLFGDGSAAVIVGTEPRPGLETPLFELVSAAQTTI  825
             VVCSE+    FRGPS    D+L+ Q LFGDG+AAVIVG++P P +E PLFELV  AQT  
Sbjct  188   VVCSEITAVTFRGPSDTHLDSLVGQALFGDGAAAVIVGSDPIPQIEKPLFELVWTAQTIA  247

Query  826   PDTDSHLKLHLREMGLTFHCSKAVPSLITQNVEDCLVKAFEPFGISDWNSIFWILHPGGI  1005
             PD+D  +  HLRE+GLTFH  K VP ++++N+E  L +AF P  ISD+NSIFWI HPGG 
Sbjct  248   PDSDGAIDGHLREVGLTFHLLKDVPGIVSKNIEKALFEAFNPLNISDYNSIFWIAHPGGP  307

Query  1006  AILDRVEEKLGLEPEKLRASKDVLSEYGNLTSACVLFILDEMRKKSKKDEEMTTGEGLEW  1185
             AILD+VE+KLGL+PEK++A++DVLS+YGN++SACVLFILDEMR+KS ++   TTGEGLEW
Sbjct  308   AILDQVEQKLGLKPEKMKATRDVLSDYGNMSSACVLFILDEMRRKSAENGLKTTGEGLEW  367

Query  1186  GVVFVVCP  1209
             GV+F   P
Sbjct  368   GVLFGFGP  375



>gb|AEC13058.1| chalcone synthase protein [Rosa chinensis]
Length=389

 Score =   527 bits (1358),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 246/368 (67%), Positives = 302/368 (82%), Gaps = 0/368 (0%)
 Frame = +1

Query  106   RRAKRFEGDAKILAIGTAIPANWVDQTTYPDFYFRITNSEHLLEHKEKFRRICNKSKIRK  285
             R+A+R EG A +LAIGTA P N +DQ+TYPD+YFRIT SEH  E KEKF+R+C+KS I+K
Sbjct  8     RKAQRAEGPATVLAIGTATPPNCIDQSTYPDYYFRITKSEHKAELKEKFQRMCDKSMIKK  67

Query  286   RHLVITEELLKKNPNLCTYNEASLNTRQDILVSEVPKLGKEAAMKAIKEWGRPISEITHL  465
             R++ +TEE+LK+NP++C Y   SL+ RQD++V E+PKLGKEAA KAIKEWG+P S+ITHL
Sbjct  68    RYMYLTEEILKENPSMCEYMAPSLDARQDMVVVEIPKLGKEAATKAIKEWGQPKSKITHL  127

Query  466   VFCTSSGVDMPGADFQLAKLLGLSSSVKRLMMYQQGCNAGAAMLRLAKDLAENNKGARVL  645
             VFCT+SGVDMPGAD+QL KLLGL  SVKRLMMYQQGC AG  +LRLAKDLAENNKGARVL
Sbjct  128   VFCTTSGVDMPGADYQLTKLLGLRPSVKRLMMYQQGCFAGGTVLRLAKDLAENNKGARVL  187

Query  646   VVCSEVMLNVFRGPSLEQEDNLLAQCLFGDGSAAVIVGTEPRPGLETPLFELVSAAQTTI  825
             VVCSE+    FRGPS    D+L+ Q LFGDG+AA+IVG++P P +E PLFELVSAAQT +
Sbjct  188   VVCSEITAVTFRGPSDTHLDSLVGQALFGDGAAAIIVGSDPLPEVEKPLFELVSAAQTIL  247

Query  826   PDTDSHLKLHLREMGLTFHCSKAVPSLITQNVEDCLVKAFEPFGISDWNSIFWILHPGGI  1005
             PD+D  +  HLRE+GLTFH  K VP LI++N+E  L +AF+P  I+DWNS+FWI HPGG 
Sbjct  248   PDSDGAIDGHLREVGLTFHLLKDVPGLISKNIEKSLNEAFKPLNITDWNSLFWIAHPGGP  307

Query  1006  AILDRVEEKLGLEPEKLRASKDVLSEYGNLTSACVLFILDEMRKKSKKDEEMTTGEGLEW  1185
             AILD+VE KLGL+PEKL A++ +LSEYGN++SACVLFILDE+R+KS  +   TTGEGLEW
Sbjct  308   AILDQVEAKLGLKPEKLEATRHILSEYGNMSSACVLFILDEVRRKSAANGHKTTGEGLEW  367

Query  1186  GVVFVVCP  1209
             GV+F   P
Sbjct  368   GVLFGFGP  375



>gb|ABI79305.1| chalcone synthase [Pyrus communis]
Length=389

 Score =   527 bits (1358),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 246/368 (67%), Positives = 304/368 (83%), Gaps = 0/368 (0%)
 Frame = +1

Query  106   RRAKRFEGDAKILAIGTAIPANWVDQTTYPDFYFRITNSEHLLEHKEKFRRICNKSKIRK  285
             R+A+R EG A ++AIGT+ P+N VDQ TYPD+YFRITNSEH +E KEKF+R+C+KS I+K
Sbjct  8     RKAQRAEGPATVMAIGTSTPSNCVDQATYPDYYFRITNSEHRVELKEKFQRMCDKSMIKK  67

Query  286   RHLVITEELLKKNPNLCTYNEASLNTRQDILVSEVPKLGKEAAMKAIKEWGRPISEITHL  465
             R++ +TEE+LK+NP++C Y   S++ RQD++V EVPKLGKEAA KAIKEWG+P S+ITHL
Sbjct  68    RYMYLTEEILKENPSVCEYMAPSIDARQDMVVVEVPKLGKEAATKAIKEWGQPKSKITHL  127

Query  466   VFCTSSGVDMPGADFQLAKLLGLSSSVKRLMMYQQGCNAGAAMLRLAKDLAENNKGARVL  645
             VFCT+SGVDMPGAD+QL KLLGL  SVKRLMMYQQGC AG  +LRLAKDLAENNKGARVL
Sbjct  128   VFCTTSGVDMPGADYQLTKLLGLRPSVKRLMMYQQGCFAGGTVLRLAKDLAENNKGARVL  187

Query  646   VVCSEVMLNVFRGPSLEQEDNLLAQCLFGDGSAAVIVGTEPRPGLETPLFELVSAAQTTI  825
             VVCSE+    FRGPS    D+L+ Q LFGDG+AAVI+GT+P P +E PLFELVSAAQT +
Sbjct  188   VVCSEITAVTFRGPSDTHLDSLVGQALFGDGAAAVIIGTDPVPEVEKPLFELVSAAQTIL  247

Query  826   PDTDSHLKLHLREMGLTFHCSKAVPSLITQNVEDCLVKAFEPFGISDWNSIFWILHPGGI  1005
             PD+D  +  HLRE+GLTFH  K VP LI++++E  L +AF+P GISDWNS+FWI HPGG 
Sbjct  248   PDSDGAIDGHLREVGLTFHLLKDVPGLISKSIEKSLNEAFKPIGISDWNSLFWIAHPGGP  307

Query  1006  AILDRVEEKLGLEPEKLRASKDVLSEYGNLTSACVLFILDEMRKKSKKDEEMTTGEGLEW  1185
             AILD+VE KL L+P+KL A++ VLS+YGN++SACVLFILDE+R+KS +    TTGEGLEW
Sbjct  308   AILDQVEAKLALKPQKLEATRQVLSDYGNMSSACVLFILDEVRRKSAEKGLKTTGEGLEW  367

Query  1186  GVVFVVCP  1209
             GV+F   P
Sbjct  368   GVLFGFGP  375



>ref|XP_009376347.1| PREDICTED: polyketide synthase 5 [Pyrus x bretschneideri]
Length=391

 Score =   527 bits (1358),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 247/368 (67%), Positives = 303/368 (82%), Gaps = 0/368 (0%)
 Frame = +1

Query  106   RRAKRFEGDAKILAIGTAIPANWVDQTTYPDFYFRITNSEHLLEHKEKFRRICNKSKIRK  285
             R+A+R EG A ++AIGT+ P+N VDQ TYPD+YFRITNSEH +E KEKF+R+C+KS I+K
Sbjct  8     RKAQRAEGPATVMAIGTSTPSNCVDQATYPDYYFRITNSEHKVELKEKFQRMCDKSMIKK  67

Query  286   RHLVITEELLKKNPNLCTYNEASLNTRQDILVSEVPKLGKEAAMKAIKEWGRPISEITHL  465
             R++ +TEE+LK+NP++C Y   S++ RQD++V EVPKLGKEAA KAIKEWG+P S+ITHL
Sbjct  68    RYMYLTEEILKENPSVCEYMAPSIDARQDMVVVEVPKLGKEAATKAIKEWGQPKSKITHL  127

Query  466   VFCTSSGVDMPGADFQLAKLLGLSSSVKRLMMYQQGCNAGAAMLRLAKDLAENNKGARVL  645
             VFCT+SGVDMPGAD+QL KLLGL  SVKRLMMYQQGC AG  +LRLAKDLAENNKGARVL
Sbjct  128   VFCTTSGVDMPGADYQLTKLLGLRPSVKRLMMYQQGCFAGGTVLRLAKDLAENNKGARVL  187

Query  646   VVCSEVMLNVFRGPSLEQEDNLLAQCLFGDGSAAVIVGTEPRPGLETPLFELVSAAQTTI  825
             VVCSE+    FRGPS    D+L+ Q LFGDG+AAVI+G +P P +E PLFELVSAAQT +
Sbjct  188   VVCSEITAVTFRGPSDTHLDSLVGQALFGDGAAAVIIGADPVPEVEKPLFELVSAAQTIL  247

Query  826   PDTDSHLKLHLREMGLTFHCSKAVPSLITQNVEDCLVKAFEPFGISDWNSIFWILHPGGI  1005
             PD+D  +  HLRE+GLTFH  K VP LI++N+E  L +AF+P GISDWNS+FWI HPGG 
Sbjct  248   PDSDGAIDGHLREVGLTFHLLKDVPGLISKNIEKSLNEAFKPIGISDWNSLFWIAHPGGP  307

Query  1006  AILDRVEEKLGLEPEKLRASKDVLSEYGNLTSACVLFILDEMRKKSKKDEEMTTGEGLEW  1185
             AILD+VE KL L+PEKL A++ VLS+YGN++SACVLFILDE+R+KS +    TTGEGLEW
Sbjct  308   AILDQVEAKLALKPEKLEATRRVLSDYGNMSSACVLFILDEVRRKSAEKGLKTTGEGLEW  367

Query  1186  GVVFVVCP  1209
             GV+F   P
Sbjct  368   GVLFGFGP  375



>ref|XP_007223025.1| hypothetical protein PRUPE_ppa006888mg [Prunus persica]
 gb|EMJ24224.1| hypothetical protein PRUPE_ppa006888mg [Prunus persica]
 gb|AJA79072.1| chalcone synthase [Prunus persica]
 gb|AJA79077.1| chalcone synthase [Prunus persica]
Length=391

 Score =   527 bits (1358),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 247/368 (67%), Positives = 301/368 (82%), Gaps = 0/368 (0%)
 Frame = +1

Query  106   RRAKRFEGDAKILAIGTAIPANWVDQTTYPDFYFRITNSEHLLEHKEKFRRICNKSKIRK  285
             R+A+R EG A +LAIGTA P N VDQ TYPD+YFRITNSEH  E KEKF+R+C+KS I+K
Sbjct  8     RKAQRAEGPATVLAIGTATPPNCVDQATYPDYYFRITNSEHKAELKEKFQRMCDKSMIKK  67

Query  286   RHLVITEELLKKNPNLCTYNEASLNTRQDILVSEVPKLGKEAAMKAIKEWGRPISEITHL  465
             R++ +TEE+LK+NP +C Y   SL+ RQD++V E+PKLGKEAA KAIKEWG+P S+ITHL
Sbjct  68    RYMYLTEEILKENPTMCEYMAPSLDARQDMVVVEIPKLGKEAATKAIKEWGQPKSKITHL  127

Query  466   VFCTSSGVDMPGADFQLAKLLGLSSSVKRLMMYQQGCNAGAAMLRLAKDLAENNKGARVL  645
             VFCT+SGVDMPGAD+QL KLLGL  SVKRLMMYQQGC AG  +LRLAKDLAENNKGARVL
Sbjct  128   VFCTTSGVDMPGADYQLTKLLGLRPSVKRLMMYQQGCFAGGTVLRLAKDLAENNKGARVL  187

Query  646   VVCSEVMLNVFRGPSLEQEDNLLAQCLFGDGSAAVIVGTEPRPGLETPLFELVSAAQTTI  825
             VVCSE+    FRGPS    D+L+ Q LFGDG+AAVIVG +P P +E PLFE+VSAAQT +
Sbjct  188   VVCSEITAVTFRGPSDTHLDSLVGQALFGDGAAAVIVGADPIPEIEKPLFEVVSAAQTIL  247

Query  826   PDTDSHLKLHLREMGLTFHCSKAVPSLITQNVEDCLVKAFEPFGISDWNSIFWILHPGGI  1005
             PD+D  +  HLRE+GLTFH  K VP LI++N+E  L +AF+P GISDWNS+FWI HPGG 
Sbjct  248   PDSDGAIDGHLREVGLTFHLLKDVPGLISKNIEKSLNEAFQPLGISDWNSLFWIAHPGGP  307

Query  1006  AILDRVEEKLGLEPEKLRASKDVLSEYGNLTSACVLFILDEMRKKSKKDEEMTTGEGLEW  1185
             AILD+VE KLGL+PEKL A++ +LSEYGN++SACVLFILDE+RK++ +    TTG+GL+W
Sbjct  308   AILDQVESKLGLKPEKLEATRHILSEYGNMSSACVLFILDEVRKRAAEKGLKTTGDGLDW  367

Query  1186  GVVFVVCP  1209
             GV+F   P
Sbjct  368   GVLFGFGP  375



>gb|AGI02996.1| chalcone synthase [Camellia sinensis]
Length=389

 Score =   527 bits (1357),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 252/367 (69%), Positives = 301/367 (82%), Gaps = 0/367 (0%)
 Frame = +1

Query  109   RAKRFEGDAKILAIGTAIPANWVDQTTYPDFYFRITNSEHLLEHKEKFRRICNKSKIRKR  288
             RA+R  G A +LAIGTA P N VDQ+TYPD+YFRITNSEH +E KEKF+R+C+KS I+KR
Sbjct  9     RAQRARGPATVLAIGTATPPNCVDQSTYPDYYFRITNSEHKVELKEKFKRMCDKSMIKKR  68

Query  289   HLVITEELLKKNPNLCTYNEASLNTRQDILVSEVPKLGKEAAMKAIKEWGRPISEITHLV  468
             ++ +TEE+LK+NP +C Y   SL+ RQD++V EVPKLGKEAA KAIKEWG+P S+ITHLV
Sbjct  69    YMYLTEEILKENPLVCEYVAPSLDARQDMVVVEVPKLGKEAATKAIKEWGQPKSKITHLV  128

Query  469   FCTSSGVDMPGADFQLAKLLGLSSSVKRLMMYQQGCNAGAAMLRLAKDLAENNKGARVLV  648
             FCT+SGVDMPGAD+QL KLLGL  SVKRLMMYQQGC AG  +LRLAKDLAENNKGARVLV
Sbjct  129   FCTTSGVDMPGADYQLTKLLGLRPSVKRLMMYQQGCFAGGTVLRLAKDLAENNKGARVLV  188

Query  649   VCSEVMLNVFRGPSLEQEDNLLAQCLFGDGSAAVIVGTEPRPGLETPLFELVSAAQTTIP  828
             VCSE+    FRGPS    D+L+ Q LFGDG+AA+I+G++P P +E PLFELVSAAQT +P
Sbjct  189   VCSEITAVTFRGPSDTHLDSLVGQSLFGDGAAAIIIGSDPIPEVEKPLFELVSAAQTILP  248

Query  829   DTDSHLKLHLREMGLTFHCSKAVPSLITQNVEDCLVKAFEPFGISDWNSIFWILHPGGIA  1008
              +D  +  HLRE+GLTFH  K VP LI+ NVE  LV+AF+P GISDWN +FWI HPGG A
Sbjct  249   SSDGAIDGHLREVGLTFHLLKDVPRLISMNVEKSLVEAFQPLGISDWNPLFWIAHPGGPA  308

Query  1009  ILDRVEEKLGLEPEKLRASKDVLSEYGNLTSACVLFILDEMRKKSKKDEEMTTGEGLEWG  1188
             ILD+VE KLGL+ EKLRA++ VLSEYGN++SACVLFILDEMRKKS ++   TTGEGLEWG
Sbjct  309   ILDQVELKLGLKEEKLRATRHVLSEYGNMSSACVLFILDEMRKKSAEEGLKTTGEGLEWG  368

Query  1189  VVFVVCP  1209
             V+F   P
Sbjct  369   VLFGFGP  375



>gb|AHZ97870.1| chalcone synthase [Punica granatum]
Length=398

 Score =   527 bits (1358),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 249/368 (68%), Positives = 298/368 (81%), Gaps = 0/368 (0%)
 Frame = +1

Query  106   RRAKRFEGDAKILAIGTAIPANWVDQTTYPDFYFRITNSEHLLEHKEKFRRICNKSKIRK  285
             R+A+R  G A +LAIGTA P+N V Q  YPD+YFRITNSEH  E KEKF+R+C KS I+K
Sbjct  13    RKAQRASGPATVLAIGTATPSNCVSQADYPDYYFRITNSEHKTELKEKFKRMCEKSMIKK  72

Query  286   RHLVITEELLKKNPNLCTYNEASLNTRQDILVSEVPKLGKEAAMKAIKEWGRPISEITHL  465
             R++ +TEE LK+NPN+C Y   SL+ RQDI+V EVPKLGKEAA KAIKEWG+P S+ITHL
Sbjct  73    RYMHLTEEFLKENPNMCAYMATSLDARQDIVVVEVPKLGKEAASKAIKEWGQPKSKITHL  132

Query  466   VFCTSSGVDMPGADFQLAKLLGLSSSVKRLMMYQQGCNAGAAMLRLAKDLAENNKGARVL  645
             +FCT+SGVDMPGAD+QL KLLGL  SVKR MMYQQGC AG  +LRLAKDLAENNKGARVL
Sbjct  133   IFCTTSGVDMPGADYQLTKLLGLRPSVKRFMMYQQGCFAGGTVLRLAKDLAENNKGARVL  192

Query  646   VVCSEVMLNVFRGPSLEQEDNLLAQCLFGDGSAAVIVGTEPRPGLETPLFELVSAAQTTI  825
             VVCSE+    FRGPS    D+L+ Q LFGDG+AAVIVG +P   +E PL++LVSAAQT +
Sbjct  193   VVCSEITAVTFRGPSDTHLDSLVGQALFGDGAAAVIVGADPDTKIERPLYQLVSAAQTIL  252

Query  826   PDTDSHLKLHLREMGLTFHCSKAVPSLITQNVEDCLVKAFEPFGISDWNSIFWILHPGGI  1005
             PD+D  +  HLRE+GLTFH  K VP LI++N+E  LV+AF P GI+DWNSIFWI HPGG 
Sbjct  253   PDSDGAIDGHLREVGLTFHLLKDVPGLISKNIEKSLVEAFTPIGINDWNSIFWIAHPGGP  312

Query  1006  AILDRVEEKLGLEPEKLRASKDVLSEYGNLTSACVLFILDEMRKKSKKDEEMTTGEGLEW  1185
             AILD+VE KLGL+ EK+RA++ VLSEYGN++SACVLFILDEMRKKS K+ + TTGEGL+W
Sbjct  313   AILDQVEAKLGLKEEKMRATRHVLSEYGNMSSACVLFILDEMRKKSLKEGKATTGEGLDW  372

Query  1186  GVVFVVCP  1209
             GV+F   P
Sbjct  373   GVLFGFGP  380



>gb|AAP20864.1| putative chalcone synthase [Anthurium andraeanum]
Length=391

 Score =   527 bits (1358),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 245/368 (67%), Positives = 304/368 (83%), Gaps = 0/368 (0%)
 Frame = +1

Query  106   RRAKRFEGDAKILAIGTAIPANWVDQTTYPDFYFRITNSEHLLEHKEKFRRICNKSKIRK  285
             R+A+R +G A ILAIGTA+P N VDQ+TYPD+YFRITNSEH +E KEKFRR+C KS I+K
Sbjct  10    RKAQRADGPATILAIGTAVPPNAVDQSTYPDYYFRITNSEHQVELKEKFRRMCEKSMIKK  69

Query  286   RHLVITEELLKKNPNLCTYNEASLNTRQDILVSEVPKLGKEAAMKAIKEWGRPISEITHL  465
             RH+ +TEE+LK+NP++C Y   SL+ RQD++V EVP+LGKEAA +AIKEWG+P S+ITHL
Sbjct  70    RHMYLTEEILKENPSMCAYMAPSLDARQDMVVVEVPRLGKEAATRAIKEWGQPKSKITHL  129

Query  466   VFCTSSGVDMPGADFQLAKLLGLSSSVKRLMMYQQGCNAGAAMLRLAKDLAENNKGARVL  645
             VFCT+SGVDMPGAD+QLAKLLGL  SVKRLMMYQQGC AG  +LRLAKDLAENN+GARVL
Sbjct  130   VFCTTSGVDMPGADYQLAKLLGLRPSVKRLMMYQQGCFAGGTVLRLAKDLAENNRGARVL  189

Query  646   VVCSEVMLNVFRGPSLEQEDNLLAQCLFGDGSAAVIVGTEPRPGLETPLFELVSAAQTTI  825
             V+CSEV    FRGPS    D+L+ Q LFGDG++A++VG +P  G+E P+F++VSAAQT +
Sbjct  190   VICSEVTAVTFRGPSESHLDSLVGQALFGDGASALVVGADPVEGVERPIFQVVSAAQTIL  249

Query  826   PDTDSHLKLHLREMGLTFHCSKAVPSLITQNVEDCLVKAFEPFGISDWNSIFWILHPGGI  1005
             PD+   +  HLRE+GLTFH  K VP LI++N++  LV+AFEP GISDWNS+FWI HPGG 
Sbjct  250   PDSHGAIDGHLREVGLTFHLLKDVPGLISKNIDKSLVEAFEPLGISDWNSLFWIAHPGGP  309

Query  1006  AILDRVEEKLGLEPEKLRASKDVLSEYGNLTSACVLFILDEMRKKSKKDEEMTTGEGLEW  1185
             AILD+VE+KL L+ EKL A++ VLSEYGN++SACV FILDEMRK+S ++   TTGEGLEW
Sbjct  310   AILDQVEDKLRLQSEKLGATRRVLSEYGNMSSACVHFILDEMRKRSAEEGRGTTGEGLEW  369

Query  1186  GVVFVVCP  1209
             GV+F   P
Sbjct  370   GVLFGFGP  377



>dbj|BAM17287.1| chalcone synthase [Petunia x hybrida]
Length=389

 Score =   527 bits (1357),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 248/368 (67%), Positives = 302/368 (82%), Gaps = 0/368 (0%)
 Frame = +1

Query  106   RRAKRFEGDAKILAIGTAIPANWVDQTTYPDFYFRITNSEHLLEHKEKFRRICNKSKIRK  285
             R+A+R EG A ++AIGTA P N VDQ+TYPD+YFRITNSEH  + KEKF+R+C KS I+K
Sbjct  8     RKAQRAEGPATVMAIGTATPTNCVDQSTYPDYYFRITNSEHKTDLKEKFKRMCEKSMIKK  67

Query  286   RHLVITEELLKKNPNLCTYNEASLNTRQDILVSEVPKLGKEAAMKAIKEWGRPISEITHL  465
             R++ +TEE+LK+NP++C Y   SL+ RQDI+V EVPKLGKEAA KAIKEWG+P S+ITHL
Sbjct  68    RYMHLTEEILKENPSMCEYMAPSLDARQDIVVVEVPKLGKEAAQKAIKEWGQPKSKITHL  127

Query  466   VFCTSSGVDMPGADFQLAKLLGLSSSVKRLMMYQQGCNAGAAMLRLAKDLAENNKGARVL  645
             VFCT+SGVDMPG D+QL KLLGL  SVKRLMMYQQGC AG  +LRLAKDLAENNKGARVL
Sbjct  128   VFCTTSGVDMPGCDYQLTKLLGLRPSVKRLMMYQQGCFAGGTVLRLAKDLAENNKGARVL  187

Query  646   VVCSEVMLNVFRGPSLEQEDNLLAQCLFGDGSAAVIVGTEPRPGLETPLFELVSAAQTTI  825
             VVCSE+    FRGP+    D+L+ Q LFGDG+ A+I+G++P PG+E PLFELVSAAQT +
Sbjct  188   VVCSEITAVTFRGPNDTHLDSLVGQALFGDGAGAIIIGSDPIPGVERPLFELVSAAQTLL  247

Query  826   PDTDSHLKLHLREMGLTFHCSKAVPSLITQNVEDCLVKAFEPFGISDWNSIFWILHPGGI  1005
             PD+   +  HLRE+GLTFH  K VP LI++N+E  L +AF+P GISDWNS+FWI HPGG 
Sbjct  248   PDSHGAIDGHLREVGLTFHLLKDVPGLISKNIEKSLEEAFKPLGISDWNSLFWIAHPGGP  307

Query  1006  AILDRVEEKLGLEPEKLRASKDVLSEYGNLTSACVLFILDEMRKKSKKDEEMTTGEGLEW  1185
             AILD+VE KLGL+PEKL+A+++VLS YGN++SACVLFILDEMRK S K+   TTGEGLEW
Sbjct  308   AILDQVEIKLGLKPEKLKATRNVLSNYGNMSSACVLFILDEMRKASAKEGLGTTGEGLEW  367

Query  1186  GVVFVVCP  1209
             GV+F   P
Sbjct  368   GVLFGFGP  375



>sp|B0LDU6.1|PKS5_RUBID RecName: Full=Polyketide synthase 5; Short=RiPKS5; AltName: Full=Naringenin-chalcone 
synthase PKS5 [Rubus idaeus]
 gb|ABV54603.1| polyketide synthase 5 [Rubus idaeus]
Length=391

 Score =   527 bits (1357),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 246/368 (67%), Positives = 302/368 (82%), Gaps = 0/368 (0%)
 Frame = +1

Query  106   RRAKRFEGDAKILAIGTAIPANWVDQTTYPDFYFRITNSEHLLEHKEKFRRICNKSKIRK  285
             R+A+R EG A +LAIGTA P N +DQ+TYPD+YFRITNSEH  E KEKF+R+C+KS I+K
Sbjct  8     RKAQRAEGPATVLAIGTATPPNCIDQSTYPDYYFRITNSEHKTELKEKFQRMCDKSMIKK  67

Query  286   RHLVITEELLKKNPNLCTYNEASLNTRQDILVSEVPKLGKEAAMKAIKEWGRPISEITHL  465
             R++ +TEE+LK+NP++C Y   SL+ RQD++V E+PKLGKEAA KAIKEWG+P S+ITHL
Sbjct  68    RYMYLTEEILKENPSMCEYMAPSLDARQDMVVVEIPKLGKEAATKAIKEWGQPKSKITHL  127

Query  466   VFCTSSGVDMPGADFQLAKLLGLSSSVKRLMMYQQGCNAGAAMLRLAKDLAENNKGARVL  645
             VFCT+SGVDMPGAD+QL KLLGL  SVKRLMMYQQGC AG  +LRLAKDLAENN+GARVL
Sbjct  128   VFCTTSGVDMPGADYQLTKLLGLRPSVKRLMMYQQGCFAGGTVLRLAKDLAENNRGARVL  187

Query  646   VVCSEVMLNVFRGPSLEQEDNLLAQCLFGDGSAAVIVGTEPRPGLETPLFELVSAAQTTI  825
             VVCSE+    FRGPS    D+L+ Q LFGDG+AA+IVG +P P +E PLFELVSAAQT +
Sbjct  188   VVCSEIXAVTFRGPSDTHLDSLVGQALFGDGAAAIIVGADPLPKIERPLFELVSAAQTIL  247

Query  826   PDTDSHLKLHLREMGLTFHCSKAVPSLITQNVEDCLVKAFEPFGISDWNSIFWILHPGGI  1005
             PD+D  +  HLRE+GLTFH  K VP LI++N+E  L +AF+P  I+DWNS+FWI HPGG 
Sbjct  248   PDSDGAIDGHLREVGLTFHLLKDVPGLISKNIEKSLNEAFKPLDITDWNSLFWIAHPGGP  307

Query  1006  AILDRVEEKLGLEPEKLRASKDVLSEYGNLTSACVLFILDEMRKKSKKDEEMTTGEGLEW  1185
             AILD+VE KLGL+PEKL A++ +LSEYGN++SACVLFILDE+R+KS  +   TTGEGLEW
Sbjct  308   AILDQVETKLGLKPEKLEATRHILSEYGNMSSACVLFILDEVRRKSATNGLKTTGEGLEW  367

Query  1186  GVVFVVCP  1209
             GV+F   P
Sbjct  368   GVLFGFGP  375



>dbj|BAE17124.1| chalcone synthase [Fragaria x ananassa]
Length=389

 Score =   527 bits (1357),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 245/368 (67%), Positives = 303/368 (82%), Gaps = 0/368 (0%)
 Frame = +1

Query  106   RRAKRFEGDAKILAIGTAIPANWVDQTTYPDFYFRITNSEHLLEHKEKFRRICNKSKIRK  285
             R+A+R EG A +LAIGTA P N +DQ+TYPD+YFRITNSEH  E KEKF+R+C+KS I+K
Sbjct  8     RKAQRAEGPATVLAIGTATPPNCIDQSTYPDYYFRITNSEHKAELKEKFQRMCDKSMIKK  67

Query  286   RHLVITEELLKKNPNLCTYNEASLNTRQDILVSEVPKLGKEAAMKAIKEWGRPISEITHL  465
             R++ +TEE+LK+NP++C Y   SL+ RQD++V E+PKLGKEAA+KAIKEWG+P S+ITHL
Sbjct  68    RYMYLTEEILKENPSMCEYMAPSLDARQDMVVVEIPKLGKEAAVKAIKEWGQPKSKITHL  127

Query  466   VFCTSSGVDMPGADFQLAKLLGLSSSVKRLMMYQQGCNAGAAMLRLAKDLAENNKGARVL  645
             VFCT+SGVDMPGAD+QL KLLGL  SVKRLMMYQQGC AG  +LRLAKDLAENN+GARVL
Sbjct  128   VFCTTSGVDMPGADYQLTKLLGLRPSVKRLMMYQQGCFAGGTVLRLAKDLAENNRGARVL  187

Query  646   VVCSEVMLNVFRGPSLEQEDNLLAQCLFGDGSAAVIVGTEPRPGLETPLFELVSAAQTTI  825
             VVCSE+    FRGPS    D+L+ Q LFGDG+AA+IVG++P P +E PLFELVSAAQT +
Sbjct  188   VVCSEITAVTFRGPSDTHLDSLVGQALFGDGAAAIIVGSDPLPEVERPLFELVSAAQTIL  247

Query  826   PDTDSHLKLHLREMGLTFHCSKAVPSLITQNVEDCLVKAFEPFGISDWNSIFWILHPGGI  1005
             PD+D  +  HLRE+GLTFH  K VP LI++N+E  L +AF+P  I+DWNS+FWI HPGG 
Sbjct  248   PDSDGAIDGHLREVGLTFHLLKDVPGLISKNIEKSLNEAFKPLNITDWNSLFWIAHPGGP  307

Query  1006  AILDRVEEKLGLEPEKLRASKDVLSEYGNLTSACVLFILDEMRKKSKKDEEMTTGEGLEW  1185
             AILD+VE KL L+PEKL A++ +LSEYGN++SACVLFILDE+R+KS  +   TTGEGLEW
Sbjct  308   AILDQVEAKLALKPEKLEATRHILSEYGNMSSACVLFILDEVRRKSAANGHKTTGEGLEW  367

Query  1186  GVVFVVCP  1209
             GV+F   P
Sbjct  368   GVLFGFGP  375



>gb|ABF68859.1| chalcone synthase, partial [Cardamine acris]
 gb|ABF68863.1| chalcone synthase, partial [Cardamine pratensis]
 gb|ABF68872.1| chalcone synthase, partial [Cardamine acris]
 gb|ABF68877.1| chalcone synthase, partial [Cardamine crassifolia]
Length=388

 Score =   527 bits (1357),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 250/369 (68%), Positives = 302/369 (82%), Gaps = 1/369 (0%)
 Frame = +1

Query  106   RRAKRFEGDAKILAIGTAIPANWVDQTTYPDFYFRITNSEHLLEHKEKFRRICNKSKIRK  285
             R+A+R +G A ILAIGTA PAN+V Q  YPD+YFRITNSEH+ + KEKF+R+C+KS IRK
Sbjct  13    RKAQRADGPAGILAIGTANPANYVIQAEYPDYYFRITNSEHMTDLKEKFKRMCDKSTIRK  72

Query  286   RHLVITEELLKKNPNLCTYNEASLNTRQDILVSEVPKLGKEAAMKAIKEWGRPISEITHL  465
             RH+ +TEE LK+NPN+C Y   SL+ RQDI+V EVPKLGKEAA+KAIKEWG+P S+ITHL
Sbjct  73    RHMHVTEEFLKENPNMCAYMAPSLDARQDIVVVEVPKLGKEAAVKAIKEWGQPKSKITHL  132

Query  466   VFCTSSGVDMPGADFQLAKLLGLSSSVKRLMMYQQGCNAGAAMLRLAKDLAENNKGARVL  645
             VFCT+SGVDMPGAD+QL KLLGL  SVKRLMMYQQGC AG  +LRLAKDLAENN+GARVL
Sbjct  133   VFCTTSGVDMPGADYQLTKLLGLRPSVKRLMMYQQGCFAGGTVLRLAKDLAENNRGARVL  192

Query  646   VVCSEVMLNVFRGPSLEQEDNLLAQCLFGDGSAAVIVGTEPRPGL-ETPLFELVSAAQTT  822
             VVCSE+    FRGPS    D+L+ Q LF DG+AA+IVG++P   + E P+FE+VSAAQT 
Sbjct  193   VVCSEITAVTFRGPSDTHLDSLVGQALFSDGAAALIVGSDPDTSVGEKPIFEMVSAAQTI  252

Query  823   IPDTDSHLKLHLREMGLTFHCSKAVPSLITQNVEDCLVKAFEPFGISDWNSIFWILHPGG  1002
             +PD+D  +  HLRE+GLTFH  K VP LI++N+E  L +AF+P GISDWNS+FWI HPGG
Sbjct  253   LPDSDGAIDGHLREVGLTFHLLKDVPGLISKNIEKSLDEAFKPLGISDWNSLFWIAHPGG  312

Query  1003  IAILDRVEEKLGLEPEKLRASKDVLSEYGNLTSACVLFILDEMRKKSKKDEEMTTGEGLE  1182
              AILD+VE KLGL+ EK+RA++ V+ EYGN++SACVLFILDEMRKKS KD   TTGEGLE
Sbjct  313   PAILDQVEIKLGLKEEKMRATRHVMREYGNMSSACVLFILDEMRKKSAKDGVATTGEGLE  372

Query  1183  WGVVFVVCP  1209
             WGV+F   P
Sbjct  373   WGVLFGFGP  381



>gb|ABF68916.1| chalcone synthase, partial [Cardamine asarifolia]
Length=386

 Score =   527 bits (1357),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 250/369 (68%), Positives = 302/369 (82%), Gaps = 1/369 (0%)
 Frame = +1

Query  106   RRAKRFEGDAKILAIGTAIPANWVDQTTYPDFYFRITNSEHLLEHKEKFRRICNKSKIRK  285
             R+A+R +G A ILAIGTA PAN+V Q  YPD+YFRITNSEH+ + KEKF+R+C+KS IRK
Sbjct  13    RKAQRADGPAGILAIGTANPANYVIQAEYPDYYFRITNSEHMTDLKEKFKRMCDKSTIRK  72

Query  286   RHLVITEELLKKNPNLCTYNEASLNTRQDILVSEVPKLGKEAAMKAIKEWGRPISEITHL  465
             RH+ +TEE LK+NPN+C Y   SL+ RQDI+V EVPKLGKEAA+KAIKEWG+P S+ITHL
Sbjct  73    RHMHVTEEFLKENPNMCAYMAPSLDARQDIVVVEVPKLGKEAAVKAIKEWGQPKSKITHL  132

Query  466   VFCTSSGVDMPGADFQLAKLLGLSSSVKRLMMYQQGCNAGAAMLRLAKDLAENNKGARVL  645
             VFCT+SGVDMPGAD+QL KLLGL  SVKRLMMYQQGC AG  +LRLAKDLAENN+GARVL
Sbjct  133   VFCTTSGVDMPGADYQLTKLLGLRPSVKRLMMYQQGCFAGGTVLRLAKDLAENNRGARVL  192

Query  646   VVCSEVMLNVFRGPSLEQEDNLLAQCLFGDGSAAVIVGTEPRPGL-ETPLFELVSAAQTT  822
             VVCSE+    FRGPS    D+L+ Q LF DG+AA+IVG++P   + E P+FE+VSAAQT 
Sbjct  193   VVCSEITAVTFRGPSDTHLDSLVGQALFSDGAAALIVGSDPDTSVGEKPIFEMVSAAQTI  252

Query  823   IPDTDSHLKLHLREMGLTFHCSKAVPSLITQNVEDCLVKAFEPFGISDWNSIFWILHPGG  1002
             +PD+D  +  HLRE+GLTFH  K VP LI++N+E  L +AF+P GISDWNS+FWI HPGG
Sbjct  253   LPDSDGAIDGHLREVGLTFHLLKDVPGLISKNIEKSLDEAFKPLGISDWNSLFWIAHPGG  312

Query  1003  IAILDRVEEKLGLEPEKLRASKDVLSEYGNLTSACVLFILDEMRKKSKKDEEMTTGEGLE  1182
              AILD+VE KLGL+ EK+RA++ V+ EYGN++SACVLFILDEMRKKS KD   TTGEGLE
Sbjct  313   PAILDQVEIKLGLKEEKMRATRHVMREYGNMSSACVLFILDEMRKKSAKDGVATTGEGLE  372

Query  1183  WGVVFVVCP  1209
             WGV+F   P
Sbjct  373   WGVLFGFGP  381



>gb|ADN93222.1| chalcone synthase [Cardamine impatiens]
Length=376

 Score =   526 bits (1356),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 250/369 (68%), Positives = 302/369 (82%), Gaps = 1/369 (0%)
 Frame = +1

Query  106   RRAKRFEGDAKILAIGTAIPANWVDQTTYPDFYFRITNSEHLLEHKEKFRRICNKSKIRK  285
             R+A+R +G A ILAIGTA PAN+V Q  YPD+YFRITNSEH+ + KEKF+R+C+KS IRK
Sbjct  6     RKAQRADGPAGILAIGTANPANYVIQAEYPDYYFRITNSEHMTDLKEKFKRMCDKSTIRK  65

Query  286   RHLVITEELLKKNPNLCTYNEASLNTRQDILVSEVPKLGKEAAMKAIKEWGRPISEITHL  465
             RH+ +TEE LK+NPN+C Y   SL+ RQDI+V EVPKLGKEAA+KAIKEWG+P S+ITHL
Sbjct  66    RHMHVTEEFLKENPNMCAYMAPSLDARQDIVVVEVPKLGKEAAVKAIKEWGQPKSKITHL  125

Query  466   VFCTSSGVDMPGADFQLAKLLGLSSSVKRLMMYQQGCNAGAAMLRLAKDLAENNKGARVL  645
             VFCT+SGVDMPGAD+QL KLLGL  SVKRLMMYQQGC AG  +LRLAKDLAENN+GARVL
Sbjct  126   VFCTTSGVDMPGADYQLTKLLGLRPSVKRLMMYQQGCFAGGTVLRLAKDLAENNRGARVL  185

Query  646   VVCSEVMLNVFRGPSLEQEDNLLAQCLFGDGSAAVIVGTEPRPGL-ETPLFELVSAAQTT  822
             VVCSE+    FRGPS    D+L+ Q LF DG+AA+IVG++P   + E P+FE+VSAAQT 
Sbjct  186   VVCSEITAVTFRGPSDTHLDSLVGQALFSDGAAALIVGSDPDTSVGEKPIFEMVSAAQTI  245

Query  823   IPDTDSHLKLHLREMGLTFHCSKAVPSLITQNVEDCLVKAFEPFGISDWNSIFWILHPGG  1002
             +PD+D  +  HLRE+GLTFH  K VP LI++N+E  L +AF+P GISDWNS+FWI HPGG
Sbjct  246   LPDSDGAIDGHLREVGLTFHLLKDVPGLISKNIEKSLDEAFKPLGISDWNSLFWIAHPGG  305

Query  1003  IAILDRVEEKLGLEPEKLRASKDVLSEYGNLTSACVLFILDEMRKKSKKDEEMTTGEGLE  1182
              AILD+VE KLGL+ EK+RA++ V+ EYGN++SACVLFILDEMRKKS KD   TTGEGLE
Sbjct  306   PAILDQVEIKLGLKEEKMRATRHVMREYGNMSSACVLFILDEMRKKSAKDGVATTGEGLE  365

Query  1183  WGVVFVVCP  1209
             WGV+F   P
Sbjct  366   WGVLFGFGP  374



>gb|ADN93223.1| chalcone synthase [Cardamine microzyga]
Length=376

 Score =   526 bits (1356),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 250/369 (68%), Positives = 302/369 (82%), Gaps = 1/369 (0%)
 Frame = +1

Query  106   RRAKRFEGDAKILAIGTAIPANWVDQTTYPDFYFRITNSEHLLEHKEKFRRICNKSKIRK  285
             R+A+R +G A ILAIGTA PAN+V Q  YPD+YFRITNSEH+ + KEKF+R+C+KS IRK
Sbjct  6     RKAQRADGPAGILAIGTANPANYVIQAEYPDYYFRITNSEHMTDLKEKFKRMCDKSTIRK  65

Query  286   RHLVITEELLKKNPNLCTYNEASLNTRQDILVSEVPKLGKEAAMKAIKEWGRPISEITHL  465
             RH+ +TEE LK+NPN+C Y   SL+ RQDI+V EVPKLGKEAA+KAIKEWG+P S+ITHL
Sbjct  66    RHMHVTEEFLKENPNMCAYMAPSLDVRQDIVVVEVPKLGKEAAVKAIKEWGQPKSKITHL  125

Query  466   VFCTSSGVDMPGADFQLAKLLGLSSSVKRLMMYQQGCNAGAAMLRLAKDLAENNKGARVL  645
             VFCT+SGVDMPGAD+QL KLLGL  SVKRLMMYQQGC AG  +LRLAKDLAENN+GARVL
Sbjct  126   VFCTTSGVDMPGADYQLTKLLGLRPSVKRLMMYQQGCFAGGTVLRLAKDLAENNRGARVL  185

Query  646   VVCSEVMLNVFRGPSLEQEDNLLAQCLFGDGSAAVIVGTEPRPGL-ETPLFELVSAAQTT  822
             VVCSE+    FRGPS    D+L+ Q LF DG+AA+IVG++P   + E P+FE+VSAAQT 
Sbjct  186   VVCSEITAVTFRGPSDTHLDSLVGQALFSDGAAALIVGSDPDTSVGEKPIFEMVSAAQTI  245

Query  823   IPDTDSHLKLHLREMGLTFHCSKAVPSLITQNVEDCLVKAFEPFGISDWNSIFWILHPGG  1002
             +PD+D  +  HLRE+GLTFH  K VP LI++N+E  L +AF+P GISDWNS+FWI HPGG
Sbjct  246   LPDSDGAIDGHLREVGLTFHLLKDVPGLISKNIEKSLDEAFKPLGISDWNSLFWIAHPGG  305

Query  1003  IAILDRVEEKLGLEPEKLRASKDVLSEYGNLTSACVLFILDEMRKKSKKDEEMTTGEGLE  1182
              AILD+VE KLGL+ EK+RA++ V+ EYGN++SACVLFILDEMRKKS KD   TTGEGLE
Sbjct  306   PAILDQVEIKLGLKEEKMRATRHVMREYGNMSSACVLFILDEMRKKSAKDGVATTGEGLE  365

Query  1183  WGVVFVVCP  1209
             WGV+F   P
Sbjct  366   WGVLFGFGP  374



>gb|ABF68861.1| chalcone synthase, partial [Cardamine castellana]
Length=388

 Score =   527 bits (1357),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 250/369 (68%), Positives = 302/369 (82%), Gaps = 1/369 (0%)
 Frame = +1

Query  106   RRAKRFEGDAKILAIGTAIPANWVDQTTYPDFYFRITNSEHLLEHKEKFRRICNKSKIRK  285
             R+A+R +G A ILAIGTA PAN+V Q  YPD+YFRITNSEH+ + KEKF+R+C+KS IRK
Sbjct  13    RKAQRADGPAGILAIGTANPANYVIQAEYPDYYFRITNSEHMTDLKEKFKRMCDKSTIRK  72

Query  286   RHLVITEELLKKNPNLCTYNEASLNTRQDILVSEVPKLGKEAAMKAIKEWGRPISEITHL  465
             RH+ +TEE LK+NPN+C Y   SL+ RQDI+V EVPKLGKEAA+KAIKEWG+P S+ITHL
Sbjct  73    RHMHVTEEFLKENPNMCAYMAPSLDARQDIVVVEVPKLGKEAAVKAIKEWGQPKSKITHL  132

Query  466   VFCTSSGVDMPGADFQLAKLLGLSSSVKRLMMYQQGCNAGAAMLRLAKDLAENNKGARVL  645
             VFCT+SGVDMPGAD+QL KLLGL  SVKRLMMYQQGC AG  +LRLAKDLAENN+GARVL
Sbjct  133   VFCTTSGVDMPGADYQLTKLLGLRPSVKRLMMYQQGCFAGGTVLRLAKDLAENNRGARVL  192

Query  646   VVCSEVMLNVFRGPSLEQEDNLLAQCLFGDGSAAVIVGTEPRPGL-ETPLFELVSAAQTT  822
             VVCSE+    FRGPS    D+L+ Q LF DG+AA+IVG++P   + E P+FE+VSAAQT 
Sbjct  193   VVCSEITAVTFRGPSETHLDSLVGQALFSDGAAALIVGSDPDTSVGEKPIFEMVSAAQTI  252

Query  823   IPDTDSHLKLHLREMGLTFHCSKAVPSLITQNVEDCLVKAFEPFGISDWNSIFWILHPGG  1002
             +PD+D  +  HLRE+GLTFH  K VP LI++N+E  L +AF+P GISDWNS+FWI HPGG
Sbjct  253   LPDSDGAIDGHLREVGLTFHLLKDVPGLISKNIEKSLDEAFKPLGISDWNSLFWIAHPGG  312

Query  1003  IAILDRVEEKLGLEPEKLRASKDVLSEYGNLTSACVLFILDEMRKKSKKDEEMTTGEGLE  1182
              AILD+VE KLGL+ EK+RA++ V+ EYGN++SACVLFILDEMRKKS KD   TTGEGLE
Sbjct  313   PAILDQVEIKLGLKEEKMRATRHVMREYGNMSSACVLFILDEMRKKSAKDGVATTGEGLE  372

Query  1183  WGVVFVVCP  1209
             WGV+F   P
Sbjct  373   WGVLFGFGP  381



>gb|AFK33946.1| unknown [Lotus japonicus]
Length=389

 Score =   527 bits (1357),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 246/368 (67%), Positives = 304/368 (83%), Gaps = 0/368 (0%)
 Frame = +1

Query  106   RRAKRFEGDAKILAIGTAIPANWVDQTTYPDFYFRITNSEHLLEHKEKFRRICNKSKIRK  285
             R+A+R EG A ILAIGTA P N VDQ+TYPDFYF+ITNSEH+ E KEKF+R+C+KS I+K
Sbjct  8     RKAQRAEGPATILAIGTANPPNCVDQSTYPDFYFKITNSEHMTELKEKFQRMCDKSMIKK  67

Query  286   RHLVITEELLKKNPNLCTYNEASLNTRQDILVSEVPKLGKEAAMKAIKEWGRPISEITHL  465
             R++ + EE+LK+NPNLC Y   SL+ RQD++V EVP+LGKEAA KAIKEWG+P S+ITHL
Sbjct  68    RYMYLNEEILKENPNLCAYMAPSLDARQDMVVVEVPRLGKEAATKAIKEWGQPKSKITHL  127

Query  466   VFCTSSGVDMPGADFQLAKLLGLSSSVKRLMMYQQGCNAGAAMLRLAKDLAENNKGARVL  645
             +FCT+SGVDMPGAD+QL KLLGL  SVKR MMYQQGC AG  +LRLAKDLAENNKGARVL
Sbjct  128   IFCTTSGVDMPGADYQLTKLLGLRPSVKRYMMYQQGCFAGGTVLRLAKDLAENNKGARVL  187

Query  646   VVCSEVMLNVFRGPSLEQEDNLLAQCLFGDGSAAVIVGTEPRPGLETPLFELVSAAQTTI  825
             VVCSE+    FRGP+    D+L+ Q LFGDG+AAVIVG++P P +E PLFELV  AQT  
Sbjct  188   VVCSEITAVTFRGPNDTHLDSLVGQALFGDGAAAVIVGSDPVPEIEKPLFELVWTAQTIA  247

Query  826   PDTDSHLKLHLREMGLTFHCSKAVPSLITQNVEDCLVKAFEPFGISDWNSIFWILHPGGI  1005
             PD+D  +  HLRE+GLTFH  K VP ++++N++  LV+AF+P  ISD+NSIFWI HPGG 
Sbjct  248   PDSDGAIDGHLREVGLTFHLLKDVPGIVSKNIDKTLVEAFQPLNISDYNSIFWIAHPGGP  307

Query  1006  AILDRVEEKLGLEPEKLRASKDVLSEYGNLTSACVLFILDEMRKKSKKDEEMTTGEGLEW  1185
             AILD+VE+KLGL+PEK++A+++VLS+YGN++SACVLFILDEMRKKS ++   TTGEGLEW
Sbjct  308   AILDQVEQKLGLKPEKMKATRNVLSDYGNMSSACVLFILDEMRKKSAENGLKTTGEGLEW  367

Query  1186  GVVFVVCP  1209
             GV+F   P
Sbjct  368   GVLFGFGP  375



>gb|ABF68883.1| chalcone synthase, partial [Cardamine amara subsp. amara]
 gb|ABF68884.1| chalcone synthase, partial [Cardamine amara subsp. amara]
 gb|ABF68885.1| chalcone synthase, partial [Cardamine amara subsp. amara]
 gb|ABF68887.1| chalcone synthase, partial [Cardamine amara subsp. amara]
 gb|ABF68890.1| chalcone synthase, partial [Cardamine amara subsp. amara]
 gb|ABF68891.1| chalcone synthase, partial [Cardamine amara subsp. amara]
 gb|ABF68912.1| chalcone synthase, partial [Cardamine asarifolia]
 gb|ABF68914.1| chalcone synthase, partial [Cardamine asarifolia]
 gb|ABF68915.1| chalcone synthase, partial [Cardamine asarifolia]
 gb|ABF68920.1| chalcone synthase, partial [Cardamine asarifolia]
 gb|ABF68921.1| chalcone synthase, partial [Cardamine asarifolia]
 gb|ABF68922.1| chalcone synthase, partial [Cardamine asarifolia]
 gb|ABF68923.1| chalcone synthase, partial [Cardamine asarifolia]
 gb|ABF68929.1| chalcone synthase, partial [Cardamine x ferrarii]
 gb|ABF68930.1| chalcone synthase, partial [Cardamine x ferrarii]
 gb|ABF68931.1| chalcone synthase, partial [Cardamine x ferrarii]
 gb|ABF68932.1| chalcone synthase, partial [Cardamine x ferrarii]
 gb|ABF68933.1| chalcone synthase, partial [Cardamine x ferrarii]
 gb|ABF68935.1| chalcone synthase, partial [Cardamine x ferrarii]
 gb|ABF68938.1| chalcone synthase, partial [Cardamine x ferrarii]
Length=387

 Score =   527 bits (1357),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 250/369 (68%), Positives = 302/369 (82%), Gaps = 1/369 (0%)
 Frame = +1

Query  106   RRAKRFEGDAKILAIGTAIPANWVDQTTYPDFYFRITNSEHLLEHKEKFRRICNKSKIRK  285
             R+A+R +G A ILAIGTA PAN+V Q  YPD+YFRITNSEH+ + KEKF+R+C+KS IRK
Sbjct  13    RKAQRADGPAGILAIGTANPANYVIQAEYPDYYFRITNSEHMTDLKEKFKRMCDKSTIRK  72

Query  286   RHLVITEELLKKNPNLCTYNEASLNTRQDILVSEVPKLGKEAAMKAIKEWGRPISEITHL  465
             RH+ +TEE LK+NPN+C Y   SL+ RQDI+V EVPKLGKEAA+KAIKEWG+P S+ITHL
Sbjct  73    RHMHVTEEFLKENPNMCAYMAPSLDARQDIVVVEVPKLGKEAAVKAIKEWGQPKSKITHL  132

Query  466   VFCTSSGVDMPGADFQLAKLLGLSSSVKRLMMYQQGCNAGAAMLRLAKDLAENNKGARVL  645
             VFCT+SGVDMPGAD+QL KLLGL  SVKRLMMYQQGC AG  +LRLAKDLAENN+GARVL
Sbjct  133   VFCTTSGVDMPGADYQLTKLLGLRPSVKRLMMYQQGCFAGGTVLRLAKDLAENNRGARVL  192

Query  646   VVCSEVMLNVFRGPSLEQEDNLLAQCLFGDGSAAVIVGTEPRPGL-ETPLFELVSAAQTT  822
             VVCSE+    FRGPS    D+L+ Q LF DG+AA+IVG++P   + E P+FE+VSAAQT 
Sbjct  193   VVCSEITAVTFRGPSDTHLDSLVGQALFSDGAAALIVGSDPDTSVGEKPIFEMVSAAQTI  252

Query  823   IPDTDSHLKLHLREMGLTFHCSKAVPSLITQNVEDCLVKAFEPFGISDWNSIFWILHPGG  1002
             +PD+D  +  HLRE+GLTFH  K VP LI++N+E  L +AF+P GISDWNS+FWI HPGG
Sbjct  253   LPDSDGAIDGHLREVGLTFHLLKDVPGLISKNIEKSLDEAFKPLGISDWNSLFWIAHPGG  312

Query  1003  IAILDRVEEKLGLEPEKLRASKDVLSEYGNLTSACVLFILDEMRKKSKKDEEMTTGEGLE  1182
              AILD+VE KLGL+ EK+RA++ V+ EYGN++SACVLFILDEMRKKS KD   TTGEGLE
Sbjct  313   PAILDQVEIKLGLKEEKMRATRHVMREYGNMSSACVLFILDEMRKKSAKDGVATTGEGLE  372

Query  1183  WGVVFVVCP  1209
             WGV+F   P
Sbjct  373   WGVLFGFGP  381



>gb|ACT31917.1| chalcone synthase [Ipomoea batatas]
Length=393

 Score =   527 bits (1357),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 253/368 (69%), Positives = 299/368 (81%), Gaps = 1/368 (0%)
 Frame = +1

Query  106   RRAKRFEGDAKILAIGTAIPANWVDQTTYPDFYFRITNSEHLLEHKEKFRRICNKSKIRK  285
             R+A+R EG A ILAIGTA PAN V+Q+TYPD+YFRITNSEH  E KEKF+R+C+KS I K
Sbjct  8     RKAQRAEGPATILAIGTATPANCVNQSTYPDYYFRITNSEHKTELKEKFQRMCDKSMITK  67

Query  286   RHLVITEELLKKNPNLCTYNEASLNTRQDILVSEVPKLGKEAAMKAIKEWGRPISEITHL  465
             R++ +TEE+LK+NP+ C Y   SL+ RQDI V EVPKLGKEAA  AIKEWG+P S+ITH+
Sbjct  68    RYMHLTEEILKENPSFCEYMAPSLDARQDIAVVEVPKLGKEAAQSAIKEWGQPKSKITHV  127

Query  466   VFCTSSGVDMPGADFQLAKLLGLSSSVKRLMMYQQGCNAGAAMLRLAKDLAENNKGARVL  645
             VFCT+SGVDMPGAD QL KLLGL  SVKRLMMYQQGC AG  +LRLAKDLAENNKGARVL
Sbjct  128   VFCTTSGVDMPGADHQLTKLLGLRPSVKRLMMYQQGCFAGGTVLRLAKDLAENNKGARVL  187

Query  646   VVCSEVMLNVFRGPSLEQEDNLLAQCLFGDGSAAVIVGTEPRPGLETPLFELVSAAQTTI  825
             +VCSE+ +  FRGPS    D+L+ Q LFGDG+AAVIVG +P P +E PLF+LVSAAQT  
Sbjct  188   IVCSEITVVTFRGPSETHLDSLVGQALFGDGAAAVIVGADPTP-VEKPLFQLVSAAQTLA  246

Query  826   PDTDSHLKLHLREMGLTFHCSKAVPSLITQNVEDCLVKAFEPFGISDWNSIFWILHPGGI  1005
             PD+   +  HLRE+GLTFH  K VPS+++ N+E CL +AF P GISDWNS+FWI HPGG 
Sbjct  247   PDSCGAIDGHLREVGLTFHLLKDVPSVVSNNIEKCLFEAFNPLGISDWNSVFWIAHPGGP  306

Query  1006  AILDRVEEKLGLEPEKLRASKDVLSEYGNLTSACVLFILDEMRKKSKKDEEMTTGEGLEW  1185
             AILD+VE+KLGL+PEKLRA++ VLSEYGN++SACVLFILDEMRK S  D   TTGEGLEW
Sbjct  307   AILDQVEDKLGLKPEKLRATRHVLSEYGNMSSACVLFILDEMRKASSNDGLGTTGEGLEW  366

Query  1186  GVVFVVCP  1209
             GV+F   P
Sbjct  367   GVLFGFGP  374



>gb|ABF68866.1| chalcone synthase, partial [Cardamine amara subsp. balcanica]
 gb|ABF68873.1| chalcone synthase, partial [Cardamine wiedmanniana]
 gb|ABF68875.1| chalcone synthase, partial [Cardamine amara subsp. opicii]
 gb|ABF68876.1| chalcone synthase, partial [Cardamine amara subsp. pyrenaea]
 gb|ABF68886.1| chalcone synthase, partial [Cardamine amara subsp. amara]
 gb|ABF68888.1| chalcone synthase, partial [Cardamine amara subsp. amara]
 gb|ABF68889.1| chalcone synthase, partial [Cardamine amara subsp. amara]
 gb|ABF68917.1| chalcone synthase, partial [Cardamine asarifolia]
 gb|ABF68918.1| chalcone synthase, partial [Cardamine asarifolia]
 gb|ABF68919.1| chalcone synthase, partial [Cardamine asarifolia]
 gb|ABF68934.1| chalcone synthase, partial [Cardamine x ferrarii]
 gb|ABF68936.1| chalcone synthase, partial [Cardamine x ferrarii]
 gb|ABF68937.1| chalcone synthase, partial [Cardamine x ferrarii]
 gb|ABF68939.1| chalcone synthase, partial [Cardamine x ferrarii]
 gb|ABF68940.1| chalcone synthase, partial [Cardamine x ferrarii]
 gb|ABF68941.1| chalcone synthase, partial [Cardamine x ferrarii]
 gb|ABF68942.1| chalcone synthase, partial [Cardamine x ferrarii]
 gb|ABF68943.1| chalcone synthase, partial [Cardamine x ferrarii]
 gb|ABF68944.1| chalcone synthase, partial [Cardamine x ferrarii]
 gb|ABF68945.1| chalcone synthase, partial [Cardamine x ferrarii]
 gb|ABF68946.1| chalcone synthase, partial [Cardamine x ferrarii]
 gb|ABF68947.1| chalcone synthase, partial [Cardamine x ferrarii]
 gb|ABF68948.1| chalcone synthase, partial [Cardamine x ferrarii]
Length=388

 Score =   527 bits (1357),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 250/369 (68%), Positives = 302/369 (82%), Gaps = 1/369 (0%)
 Frame = +1

Query  106   RRAKRFEGDAKILAIGTAIPANWVDQTTYPDFYFRITNSEHLLEHKEKFRRICNKSKIRK  285
             R+A+R +G A ILAIGTA PAN+V Q  YPD+YFRITNSEH+ + KEKF+R+C+KS IRK
Sbjct  13    RKAQRADGPAGILAIGTANPANYVIQAEYPDYYFRITNSEHMTDLKEKFKRMCDKSTIRK  72

Query  286   RHLVITEELLKKNPNLCTYNEASLNTRQDILVSEVPKLGKEAAMKAIKEWGRPISEITHL  465
             RH+ +TEE LK+NPN+C Y   SL+ RQDI+V EVPKLGKEAA+KAIKEWG+P S+ITHL
Sbjct  73    RHMHVTEEFLKENPNMCAYMAPSLDARQDIVVVEVPKLGKEAAVKAIKEWGQPKSKITHL  132

Query  466   VFCTSSGVDMPGADFQLAKLLGLSSSVKRLMMYQQGCNAGAAMLRLAKDLAENNKGARVL  645
             VFCT+SGVDMPGAD+QL KLLGL  SVKRLMMYQQGC AG  +LRLAKDLAENN+GARVL
Sbjct  133   VFCTTSGVDMPGADYQLTKLLGLRPSVKRLMMYQQGCFAGGTVLRLAKDLAENNRGARVL  192

Query  646   VVCSEVMLNVFRGPSLEQEDNLLAQCLFGDGSAAVIVGTEPRPGL-ETPLFELVSAAQTT  822
             VVCSE+    FRGPS    D+L+ Q LF DG+AA+IVG++P   + E P+FE+VSAAQT 
Sbjct  193   VVCSEITAVTFRGPSDTHLDSLVGQALFSDGAAALIVGSDPDTSVGEKPIFEMVSAAQTI  252

Query  823   IPDTDSHLKLHLREMGLTFHCSKAVPSLITQNVEDCLVKAFEPFGISDWNSIFWILHPGG  1002
             +PD+D  +  HLRE+GLTFH  K VP LI++N+E  L +AF+P GISDWNS+FWI HPGG
Sbjct  253   LPDSDGAIDGHLREVGLTFHLLKDVPGLISKNIEKSLDEAFKPLGISDWNSLFWIAHPGG  312

Query  1003  IAILDRVEEKLGLEPEKLRASKDVLSEYGNLTSACVLFILDEMRKKSKKDEEMTTGEGLE  1182
              AILD+VE KLGL+ EK+RA++ V+ EYGN++SACVLFILDEMRKKS KD   TTGEGLE
Sbjct  313   PAILDQVEIKLGLKEEKMRATRHVMREYGNMSSACVLFILDEMRKKSAKDGVATTGEGLE  372

Query  1183  WGVVFVVCP  1209
             WGV+F   P
Sbjct  373   WGVLFGFGP  381



>gb|AFL72079.1| chalcone synthase [Agastache rugosa]
Length=391

 Score =   527 bits (1357),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 250/368 (68%), Positives = 298/368 (81%), Gaps = 0/368 (0%)
 Frame = +1

Query  106   RRAKRFEGDAKILAIGTAIPANWVDQTTYPDFYFRITNSEHLLEHKEKFRRICNKSKIRK  285
             RRA+R EG A +LAIGTA+P N VDQ+TYPD+YFRITNSEH  + KEKF R+C KS I+K
Sbjct  8     RRAQRAEGPATVLAIGTAVPTNCVDQSTYPDYYFRITNSEHKTDLKEKFVRMCEKSMIKK  67

Query  286   RHLVITEELLKKNPNLCTYNEASLNTRQDILVSEVPKLGKEAAMKAIKEWGRPISEITHL  465
             R++ +TEE LK+NPN+  Y   SL+ RQDI+V EVPKLGKEAA KAIKEWG+  S+ITHL
Sbjct  68    RYMHLTEEYLKENPNITAYMAPSLDARQDIVVVEVPKLGKEAAQKAIKEWGQSKSKITHL  127

Query  466   VFCTSSGVDMPGADFQLAKLLGLSSSVKRLMMYQQGCNAGAAMLRLAKDLAENNKGARVL  645
             VFCT+SGVDMPGAD+QL KLLGL  SVKR MMYQQGC AG  +LR+AKDLAENN GARVL
Sbjct  128   VFCTTSGVDMPGADYQLTKLLGLRPSVKRFMMYQQGCFAGGTVLRMAKDLAENNAGARVL  187

Query  646   VVCSEVMLNVFRGPSLEQEDNLLAQCLFGDGSAAVIVGTEPRPGLETPLFELVSAAQTTI  825
             VVCSE+    FRGPS    D+L+ Q LFGDG+AAVIVG++P  G+E PLFELVSAAQT +
Sbjct  188   VVCSEITAVTFRGPSESHLDSLVGQALFGDGAAAVIVGSDPVVGVERPLFELVSAAQTIL  247

Query  826   PDTDSHLKLHLREMGLTFHCSKAVPSLITQNVEDCLVKAFEPFGISDWNSIFWILHPGGI  1005
             PD+D  +  HLRE+GLTFH  K VP LI++N+E  L +AF P GISDWNS+FWI HPGG 
Sbjct  248   PDSDGAIDGHLREVGLTFHLLKDVPGLISKNIEKSLKEAFAPLGISDWNSVFWIAHPGGP  307

Query  1006  AILDRVEEKLGLEPEKLRASKDVLSEYGNLTSACVLFILDEMRKKSKKDEEMTTGEGLEW  1185
             AIL++VE KLGL+PEKLR+++ VLSEYGN++SACVLFILDEMRK S K+   TTGEGL+W
Sbjct  308   AILNQVEAKLGLKPEKLRSTRHVLSEYGNMSSACVLFILDEMRKSSAKEGLSTTGEGLDW  367

Query  1186  GVVFVVCP  1209
             GV+F   P
Sbjct  368   GVLFGFGP  375



>gb|ADN93218.1| chalcone synthase [Lepidium niloticum]
Length=376

 Score =   526 bits (1355),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 249/369 (67%), Positives = 302/369 (82%), Gaps = 1/369 (0%)
 Frame = +1

Query  106   RRAKRFEGDAKILAIGTAIPANWVDQTTYPDFYFRITNSEHLLEHKEKFRRICNKSKIRK  285
             R+A+R +G A ILAIGTA P N+V Q  YPD+YFRITNSEH+ E KEKF+R+C+KS IRK
Sbjct  6     RKAQRADGPAAILAIGTANPDNYVIQAEYPDYYFRITNSEHMTELKEKFQRMCDKSMIRK  65

Query  286   RHLVITEELLKKNPNLCTYNEASLNTRQDILVSEVPKLGKEAAMKAIKEWGRPISEITHL  465
             RH+ +TEE LK+NPN+C Y   SL+ RQDI+V EVPKLGKEAA+KAIKEWG+P S+ITH+
Sbjct  66    RHMHLTEEFLKENPNMCAYMAPSLDARQDIVVVEVPKLGKEAAVKAIKEWGQPKSKITHV  125

Query  466   VFCTSSGVDMPGADFQLAKLLGLSSSVKRLMMYQQGCNAGAAMLRLAKDLAENNKGARVL  645
             VFCT+SGVDMPGAD+QL KLLGL  SVKRLMMYQQGC AG  +LRLAKDLAENN+GARVL
Sbjct  126   VFCTTSGVDMPGADYQLTKLLGLRPSVKRLMMYQQGCFAGGTVLRLAKDLAENNRGARVL  185

Query  646   VVCSEVMLNVFRGPSLEQEDNLLAQCLFGDGSAAVIVGTEPRPGL-ETPLFELVSAAQTT  822
             VVCSE+    FRGPS    D+L+ Q LF DG+AA+IVG++P P + E P+FE+VSAAQT 
Sbjct  186   VVCSEITAVTFRGPSDTHLDSLVGQALFSDGAAALIVGSDPDPSVGEKPIFEMVSAAQTI  245

Query  823   IPDTDSHLKLHLREMGLTFHCSKAVPSLITQNVEDCLVKAFEPFGISDWNSIFWILHPGG  1002
             +PD+D  +  HLRE+GLTFH  K VP LI++N+E  L +AF+P GISDWNSIFW+ HPGG
Sbjct  246   LPDSDGAIDGHLREVGLTFHLLKDVPGLISKNIEKSLDEAFKPLGISDWNSIFWVAHPGG  305

Query  1003  IAILDRVEEKLGLEPEKLRASKDVLSEYGNLTSACVLFILDEMRKKSKKDEEMTTGEGLE  1182
              AILD+VE KLGL+ E++ A++ VLSEYGN++SACVLFILDEMR+KS KD   TTGEGLE
Sbjct  306   PAILDQVEIKLGLKAERMSATRHVLSEYGNMSSACVLFILDEMRRKSAKDGVATTGEGLE  365

Query  1183  WGVVFVVCP  1209
             WGV+F   P
Sbjct  366   WGVLFGFGP  374



>gb|ABE03669.1| chalcone synthase [Solms-laubachia stewartii]
Length=390

 Score =   527 bits (1357),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 250/369 (68%), Positives = 304/369 (82%), Gaps = 1/369 (0%)
 Frame = +1

Query  106   RRAKRFEGDAKILAIGTAIPANWVDQTTYPDFYFRITNSEHLLEHKEKFRRICNKSKIRK  285
             R+A+R +G A ILAIGTA PAN V Q+ YPD+YFRITNSEH+ + KEKF+R+C+KS IRK
Sbjct  12    RKAQRADGPAGILAIGTANPANHVIQSEYPDYYFRITNSEHMTDLKEKFQRMCDKSMIRK  71

Query  286   RHLVITEELLKKNPNLCTYNEASLNTRQDILVSEVPKLGKEAAMKAIKEWGRPISEITHL  465
             RH+ +TEE LK+NPN+C Y  +SL+ RQDI+V EVPKLGKEAA++AIKEWG+P S+ITHL
Sbjct  72    RHMHLTEEFLKENPNMCAYMASSLDARQDIVVVEVPKLGKEAAVRAIKEWGQPKSKITHL  131

Query  466   VFCTSSGVDMPGADFQLAKLLGLSSSVKRLMMYQQGCNAGAAMLRLAKDLAENNKGARVL  645
             VFCT+SGVDMPGAD+QL KLLGL  SVKRLMMYQQGC AG  +LRLAKDLAENN+GARVL
Sbjct  132   VFCTTSGVDMPGADYQLTKLLGLRPSVKRLMMYQQGCFAGGTVLRLAKDLAENNRGARVL  191

Query  646   VVCSEVMLNVFRGPSLEQEDNLLAQCLFGDGSAAVIVGTEPRPGL-ETPLFELVSAAQTT  822
             VVCSE+    FRGPS    D+L+ Q LF DG+AA+IVG++P   + E P+FE+VSAAQT 
Sbjct  192   VVCSEITAVTFRGPSDTHLDSLVGQALFSDGAAALIVGSDPDTSVGEKPIFEMVSAAQTI  251

Query  823   IPDTDSHLKLHLREMGLTFHCSKAVPSLITQNVEDCLVKAFEPFGISDWNSIFWILHPGG  1002
             +PD+D  +  HLRE+GLTFH  K VP LI++N+E  L +AF+P GISDWNS+FWI HPGG
Sbjct  252   LPDSDGAIDGHLREVGLTFHLLKDVPGLISKNIEKSLEEAFKPLGISDWNSLFWIAHPGG  311

Query  1003  IAILDRVEEKLGLEPEKLRASKDVLSEYGNLTSACVLFILDEMRKKSKKDEEMTTGEGLE  1182
              AILD+VE KLGL+ EK+RA++ VLSEYGN++SACVLFILDEMRKKS +D   TTGEGLE
Sbjct  312   PAILDQVEIKLGLKAEKMRATRHVLSEYGNMSSACVLFILDEMRKKSAEDSVATTGEGLE  371

Query  1183  WGVVFVVCP  1209
             WGV+F   P
Sbjct  372   WGVLFGFGP  380



>gb|ABF68865.1| chalcone synthase, partial [Cardamine apennina]
Length=388

 Score =   526 bits (1356),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 250/369 (68%), Positives = 302/369 (82%), Gaps = 1/369 (0%)
 Frame = +1

Query  106   RRAKRFEGDAKILAIGTAIPANWVDQTTYPDFYFRITNSEHLLEHKEKFRRICNKSKIRK  285
             R+A+R +G A ILAIGTA PAN+V Q  YPD+YFRITNSEH+ + KEKF+R+C+KS IRK
Sbjct  13    RKAQRADGPAGILAIGTANPANYVIQAEYPDYYFRITNSEHMTDLKEKFKRMCDKSTIRK  72

Query  286   RHLVITEELLKKNPNLCTYNEASLNTRQDILVSEVPKLGKEAAMKAIKEWGRPISEITHL  465
             RH+ +TEE LK+NPN+C Y   SL+ RQDI+V EVPKLGKEAA+KAIKEWG+P S+ITHL
Sbjct  73    RHMHVTEEFLKENPNMCAYMAPSLDARQDIVVVEVPKLGKEAAVKAIKEWGQPKSKITHL  132

Query  466   VFCTSSGVDMPGADFQLAKLLGLSSSVKRLMMYQQGCNAGAAMLRLAKDLAENNKGARVL  645
             VFCT+SGVDMPGAD+QL KLLGL  SVKRLMMYQQGC AG  +LRLAKDLAENN+GARVL
Sbjct  133   VFCTTSGVDMPGADYQLTKLLGLRPSVKRLMMYQQGCFAGGTVLRLAKDLAENNRGARVL  192

Query  646   VVCSEVMLNVFRGPSLEQEDNLLAQCLFGDGSAAVIVGTEPRPGL-ETPLFELVSAAQTT  822
             VVCSE+    FRGPS    D+L+ Q LF DG+AA+IVG++P   + E P+FE+VSAAQT 
Sbjct  193   VVCSEITAVTFRGPSETHLDSLVGQALFSDGAAALIVGSDPDTSVGEKPIFEMVSAAQTI  252

Query  823   IPDTDSHLKLHLREMGLTFHCSKAVPSLITQNVEDCLVKAFEPFGISDWNSIFWILHPGG  1002
             +PD+D  +  HLRE+GLTFH  K VP LI++N+E  L +AF+P GISDWNS+FWI HPGG
Sbjct  253   LPDSDGAIDGHLREVGLTFHLLKDVPGLISKNIEKSLDEAFKPLGISDWNSLFWIAHPGG  312

Query  1003  IAILDRVEEKLGLEPEKLRASKDVLSEYGNLTSACVLFILDEMRKKSKKDEEMTTGEGLE  1182
              AILD+VE KLGL+ EK+RA++ V+ EYGN++SACVLFILDEMRKKS KD   TTGEGLE
Sbjct  313   PAILDQVEIKLGLKEEKMRATRHVMREYGNMSSACVLFILDEMRKKSAKDGVATTGEGLE  372

Query  1183  WGVVFVVCP  1209
             WGV+F   P
Sbjct  373   WGVLFGFGP  381



>dbj|BAA31259.1| chalcone synthase [Vitis vinifera]
Length=393

 Score =   526 bits (1356),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 250/368 (68%), Positives = 301/368 (82%), Gaps = 0/368 (0%)
 Frame = +1

Query  106   RRAKRFEGDAKILAIGTAIPANWVDQTTYPDFYFRITNSEHLLEHKEKFRRICNKSKIRK  285
             R+A+R EG A +LAIGTA PAN V Q  YPD+YFRITNSEH+ E KEKF+R+C KS I K
Sbjct  8     RKAQRAEGPATVLAIGTATPANCVYQADYPDYYFRITNSEHMTELKEKFKRMCEKSMINK  67

Query  286   RHLVITEELLKKNPNLCTYNEASLNTRQDILVSEVPKLGKEAAMKAIKEWGRPISEITHL  465
             R++ +TEE+LK+NPN+C Y   SL+ RQD++V EVPKLGKEAA+KAIKEWG+P S+ITHL
Sbjct  68    RYMHLTEEILKENPNVCAYMAPSLDARQDMVVVEVPKLGKEAAVKAIKEWGQPKSKITHL  127

Query  466   VFCTSSGVDMPGADFQLAKLLGLSSSVKRLMMYQQGCNAGAAMLRLAKDLAENNKGARVL  645
             VFCT+SGVDMPGAD+QL KLLGL  SVKRLMMYQQGC AG  +LRLAKDLAENN G+RVL
Sbjct  128   VFCTTSGVDMPGADYQLTKLLGLKPSVKRLMMYQQGCFAGGTVLRLAKDLAENNAGSRVL  187

Query  646   VVCSEVMLNVFRGPSLEQEDNLLAQCLFGDGSAAVIVGTEPRPGLETPLFELVSAAQTTI  825
             VVCSE+    FRGPS    D+L+ Q LFGDG+AAVI+G +P   +E PLFELVSAAQT +
Sbjct  188   VVCSEITAVTFRGPSDTHLDSLVGQALFGDGAAAVIIGADPDTKIERPLFELVSAAQTIL  247

Query  826   PDTDSHLKLHLREMGLTFHCSKAVPSLITQNVEDCLVKAFEPFGISDWNSIFWILHPGGI  1005
             PD++  +  HLRE+GLTFH  K VP LI++N+E  LV+AF P GISDWNS+FWI HPGG 
Sbjct  248   PDSEGAIDGHLREVGLTFHLLKDVPGLISKNIEKSLVEAFTPIGISDWNSLFWIAHPGGP  307

Query  1006  AILDRVEEKLGLEPEKLRASKDVLSEYGNLTSACVLFILDEMRKKSKKDEEMTTGEGLEW  1185
             AILD+VE KLGL+ EKLRA++ VLSEYGN++SACVLFILDEMRKKS ++ + +TGEGLEW
Sbjct  308   AILDQVELKLGLKEEKLRATRHVLSEYGNMSSACVLFILDEMRKKSIEEGKASTGEGLEW  367

Query  1186  GVVFVVCP  1209
             GV+F   P
Sbjct  368   GVLFGFGP  375



>sp|Q9SEP2.1|CHSY_CARAN RecName: Full=Chalcone synthase; AltName: Full=Naringenin-chalcone 
synthase [Cardamine amara]
 gb|AAF23560.1|AF112085_1 chalcone synthase [Cardamine amara]
Length=395

 Score =   527 bits (1357),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 250/369 (68%), Positives = 302/369 (82%), Gaps = 1/369 (0%)
 Frame = +1

Query  106   RRAKRFEGDAKILAIGTAIPANWVDQTTYPDFYFRITNSEHLLEHKEKFRRICNKSKIRK  285
             R+A+R +G A ILAIGTA PAN+V Q  YPD+YFRITNSEH+ + KEKF+R+C+KS IRK
Sbjct  13    RKAQRADGPAGILAIGTANPANYVIQAEYPDYYFRITNSEHMTDLKEKFKRMCDKSTIRK  72

Query  286   RHLVITEELLKKNPNLCTYNEASLNTRQDILVSEVPKLGKEAAMKAIKEWGRPISEITHL  465
             RH+ +TEE LK+NPN+C Y   SL+ RQDI+V EVPKLGKEAA+KAIKEWG+P S+ITHL
Sbjct  73    RHMHVTEEFLKENPNMCAYMAPSLDARQDIVVVEVPKLGKEAAVKAIKEWGQPKSKITHL  132

Query  466   VFCTSSGVDMPGADFQLAKLLGLSSSVKRLMMYQQGCNAGAAMLRLAKDLAENNKGARVL  645
             VFCT+SGVDMPGAD+QL KLLGL  SVKRLMMYQQGC AG  +LRLAKDLAENN+GARVL
Sbjct  133   VFCTTSGVDMPGADYQLTKLLGLRPSVKRLMMYQQGCFAGGTVLRLAKDLAENNRGARVL  192

Query  646   VVCSEVMLNVFRGPSLEQEDNLLAQCLFGDGSAAVIVGTEPRPGL-ETPLFELVSAAQTT  822
             VVCSE+    FRGPS    D+L+ Q LF DG+AA+IVG++P   + E P+FE+VSAAQT 
Sbjct  193   VVCSEITAVTFRGPSDTHLDSLVGQALFSDGAAALIVGSDPDTSVGEKPIFEMVSAAQTI  252

Query  823   IPDTDSHLKLHLREMGLTFHCSKAVPSLITQNVEDCLVKAFEPFGISDWNSIFWILHPGG  1002
             +PD+D  +  HLRE+GLTFH  K VP LI++N+E  L +AF+P GISDWNS+FWI HPGG
Sbjct  253   LPDSDGAIDGHLREVGLTFHLLKDVPGLISKNIEKSLDEAFKPLGISDWNSLFWIAHPGG  312

Query  1003  IAILDRVEEKLGLEPEKLRASKDVLSEYGNLTSACVLFILDEMRKKSKKDEEMTTGEGLE  1182
              AILD+VE KLGL+ EK+RA++ V+ EYGN++SACVLFILDEMRKKS KD   TTGEGLE
Sbjct  313   PAILDQVEIKLGLKEEKMRATRHVMREYGNMSSACVLFILDEMRKKSAKDGVATTGEGLE  372

Query  1183  WGVVFVVCP  1209
             WGV+F   P
Sbjct  373   WGVLFGFGP  381



>gb|AEF14414.1| chalcone synthase [Onobrychis viciifolia]
Length=389

 Score =   526 bits (1356),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 248/368 (67%), Positives = 304/368 (83%), Gaps = 0/368 (0%)
 Frame = +1

Query  106   RRAKRFEGDAKILAIGTAIPANWVDQTTYPDFYFRITNSEHLLEHKEKFRRICNKSKIRK  285
             R+A+R EG A +LAIGTA P+N V Q+ YPDFYFRITNSEH  E KEKF+R+C+KS I+K
Sbjct  8     RKAQRAEGPATVLAIGTATPSNCVVQSEYPDFYFRITNSEHKTELKEKFKRMCDKSMIKK  67

Query  286   RHLVITEELLKKNPNLCTYNEASLNTRQDILVSEVPKLGKEAAMKAIKEWGRPISEITHL  465
             R++ +TEE+LK+NP++C Y   SL+ RQD++V EVPKLGKEAA KAIKEWG+P S+ITHL
Sbjct  68    RYMHLTEEILKENPSMCEYMAPSLDARQDMVVVEVPKLGKEAATKAIKEWGQPKSKITHL  127

Query  466   VFCTSSGVDMPGADFQLAKLLGLSSSVKRLMMYQQGCNAGAAMLRLAKDLAENNKGARVL  645
             +FCT+SGVDMPGAD+QL KLLGL  SVKR MMYQQGC AG  +LRLAKDLAENNKGARVL
Sbjct  128   IFCTTSGVDMPGADYQLTKLLGLRPSVKRYMMYQQGCLAGGTVLRLAKDLAENNKGARVL  187

Query  646   VVCSEVMLNVFRGPSLEQEDNLLAQCLFGDGSAAVIVGTEPRPGLETPLFELVSAAQTTI  825
             VVCSE+    FRGP+    D+L+ Q LFGDG+AAVIVG++P P +E PLFELV  AQT +
Sbjct  188   VVCSEITAVTFRGPTDTHLDSLVGQALFGDGAAAVIVGSDPLPEIEKPLFELVWTAQTIL  247

Query  826   PDTDSHLKLHLREMGLTFHCSKAVPSLITQNVEDCLVKAFEPFGISDWNSIFWILHPGGI  1005
             PD++  +  HLRE+GLTFH  K VP LI++N+E  LV+AF+P GISD+NSIFWI HPGG 
Sbjct  248   PDSEGAIDGHLREVGLTFHLLKDVPGLISKNIEKALVEAFQPLGISDYNSIFWIAHPGGP  307

Query  1006  AILDRVEEKLGLEPEKLRASKDVLSEYGNLTSACVLFILDEMRKKSKKDEEMTTGEGLEW  1185
             AILD+VE KLGL+PEK++A++ VLSEYGN++SACVLFILDEMR+KSK++   TTGEGLEW
Sbjct  308   AILDQVEVKLGLKPEKMQATRHVLSEYGNMSSACVLFILDEMRRKSKENGLATTGEGLEW  367

Query  1186  GVVFVVCP  1209
             GV+F   P
Sbjct  368   GVLFGFGP  375



>ref|NP_001234033.1| chalcone synthase 1 [Solanum lycopersicum]
 sp|P23418.2|CHS1_SOLLC RecName: Full=Chalcone synthase 1; AltName: Full=Naringenin-chalcone 
synthase 1 [Solanum lycopersicum]
 emb|CAA38980.1| chalcone synthase [Solanum lycopersicum]
Length=389

 Score =   526 bits (1356),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 248/368 (67%), Positives = 302/368 (82%), Gaps = 0/368 (0%)
 Frame = +1

Query  106   RRAKRFEGDAKILAIGTAIPANWVDQTTYPDFYFRITNSEHLLEHKEKFRRICNKSKIRK  285
             R+A+R EG A ILAIGT+ P+N VDQ+TYPD+YFRITNSEH  E KEKF+R+C+KS I+K
Sbjct  8     RKAQRAEGPATILAIGTSTPSNCVDQSTYPDYYFRITNSEHKTELKEKFKRMCDKSMIKK  67

Query  286   RHLVITEELLKKNPNLCTYNEASLNTRQDILVSEVPKLGKEAAMKAIKEWGRPISEITHL  465
             R++ +TEE+LK+NPN+C Y   SL+ RQDI+V EVPKLGK    KAIKEWG+P S+ITHL
Sbjct  68    RYMHLTEEILKENPNMCAYMAPSLDARQDIVVVEVPKLGKRGTQKAIKEWGQPKSKITHL  127

Query  466   VFCTSSGVDMPGADFQLAKLLGLSSSVKRLMMYQQGCNAGAAMLRLAKDLAENNKGARVL  645
             VFCT+SGVDMP  D+QLAKLL +  SVKRLMMYQQGC AG  +LRLAKDLAENNKGARVL
Sbjct  128   VFCTTSGVDMPACDYQLAKLLPVRPSVKRLMMYQQGCFAGGTVLRLAKDLAENNKGARVL  187

Query  646   VVCSEVMLNVFRGPSLEQEDNLLAQCLFGDGSAAVIVGTEPRPGLETPLFELVSAAQTTI  825
             VVCSE+    FRGPS    D+L+ Q LFGDG+AA+I+G++P  G+E PLFELVSAAQT +
Sbjct  188   VVCSEITAVTFRGPSESHLDSLVGQALFGDGAAAIIIGSDPIIGVERPLFELVSAAQTLV  247

Query  826   PDTDSHLKLHLREMGLTFHCSKAVPSLITQNVEDCLVKAFEPFGISDWNSIFWILHPGGI  1005
             PD++  +  HLRE+GLTFH  K VP LI++N+E  L++AF+P GISDWNS+FWI HPGG 
Sbjct  248   PDSEGAIDGHLREVGLTFHLLKDVPGLISKNIEKSLLEAFQPLGISDWNSLFWIAHPGGP  307

Query  1006  AILDRVEEKLGLEPEKLRASKDVLSEYGNLTSACVLFILDEMRKKSKKDEEMTTGEGLEW  1185
             AILD+VE KLGL+PEKLRA+++VLS YGN++SACVLFILDEMRK S K+   TTGEGLEW
Sbjct  308   AILDQVELKLGLKPEKLRATREVLSNYGNMSSACVLFILDEMRKASTKEGLGTTGEGLEW  367

Query  1186  GVVFVVCP  1209
             GV+F   P
Sbjct  368   GVLFGFGP  375



>dbj|BAC87863.1| chalcone synthase [Torenia hybrid cultivar]
Length=391

 Score =   526 bits (1356),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 250/368 (68%), Positives = 299/368 (81%), Gaps = 1/368 (0%)
 Frame = +1

Query  106   RRAKRFEGDAKILAIGTAIPANWVDQTTYPDFYFRITNSEHLLEHKEKFRRICNKSKIRK  285
             RRA+R EG A ILAIGT+ P N VDQ+TYPD+YFRITNSEH+ E K+KF R+C KS I+K
Sbjct  8     RRAQRAEGAATILAIGTSTPQNCVDQSTYPDYYFRITNSEHMTELKDKFTRMCEKSMIKK  67

Query  286   RHLVITEELLKKNPNLCTYNEASLNTRQDILVSEVPKLGKEAAMKAIKEWGRPISEITHL  465
             R++ +TE+ LK+NPN+C Y E SL+ RQDI+V EVPKLGKEAA KAIKEWG+P S+ITHL
Sbjct  68    RYMHLTEDYLKQNPNICAYMEPSLDARQDIVVVEVPKLGKEAAQKAIKEWGQPKSKITHL  127

Query  466   VFCTSSGVDMPGADFQLAKLLGLSSSVKRLMMYQQGCNAGAAMLRLAKDLAENNKGARVL  645
             VFCT+SGVDMPGAD+QL KLLGL  SVKR MMYQQGC AG  +LR+AKDLAENN GARVL
Sbjct  128   VFCTTSGVDMPGADYQLTKLLGLRPSVKRFMMYQQGCFAGGTVLRMAKDLAENNAGARVL  187

Query  646   VVCSEVMLNVFRGPSLEQEDNLLAQCLFGDGSAAVIVGTEPRPGLETPLFELVSAAQTTI  825
             VVCSE+    FRGPS    D+L+ Q LFGDG+AAVIVG++P   +E PLF+LVSAAQT +
Sbjct  188   VVCSEITAVTFRGPSDAHLDSLVGQALFGDGAAAVIVGSDPT-DVERPLFQLVSAAQTIL  246

Query  826   PDTDSHLKLHLREMGLTFHCSKAVPSLITQNVEDCLVKAFEPFGISDWNSIFWILHPGGI  1005
             PD+D  +  HLRE+GLTFH  K VP LI++N+E  L +AF+P GI DWNSIFWI HPGG 
Sbjct  247   PDSDGAIDGHLREVGLTFHLLKDVPGLISKNIEKSLKEAFDPLGIDDWNSIFWIAHPGGP  306

Query  1006  AILDRVEEKLGLEPEKLRASKDVLSEYGNLTSACVLFILDEMRKKSKKDEEMTTGEGLEW  1185
             AILD+VE KL L+P+KLRA++ VLSEYGN++SACVLFILDEMRK S K+   TTGEGL+W
Sbjct  307   AILDQVEAKLALKPDKLRATRHVLSEYGNMSSACVLFILDEMRKASAKEGTSTTGEGLDW  366

Query  1186  GVVFVVCP  1209
             GV+F   P
Sbjct  367   GVLFGFGP  374



>gb|ADF43042.1| chalcone synthase 1 protein [Brassica rapa subsp. rapa]
 emb|CDX70528.1| BnaC03g06120D [Brassica napus]
Length=396

 Score =   526 bits (1356),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 250/369 (68%), Positives = 302/369 (82%), Gaps = 1/369 (0%)
 Frame = +1

Query  106   RRAKRFEGDAKILAIGTAIPANWVDQTTYPDFYFRITNSEHLLEHKEKFRRICNKSKIRK  285
             R+A+R +G A ILAIGTA PAN V Q  YPD+YFRITNSEH+ + KEKF+R+C+KS IRK
Sbjct  14    RKAQRADGPAGILAIGTANPANHVIQAEYPDYYFRITNSEHMTDLKEKFKRMCDKSMIRK  73

Query  286   RHLVITEELLKKNPNLCTYNEASLNTRQDILVSEVPKLGKEAAMKAIKEWGRPISEITHL  465
             RH+ +TEE LK+NPN+C Y   SL+ RQDI+V EVPKLGKEAA+KAIKEWG+P S+ITH+
Sbjct  74    RHMHLTEEFLKENPNMCAYMAPSLDVRQDIVVVEVPKLGKEAAVKAIKEWGQPKSKITHV  133

Query  466   VFCTSSGVDMPGADFQLAKLLGLSSSVKRLMMYQQGCNAGAAMLRLAKDLAENNKGARVL  645
             VFCT+SGVDMPGAD+QL KLLGL  SVKRLMMYQQGC AG  +LRLAKDLAENN+GARVL
Sbjct  134   VFCTTSGVDMPGADYQLTKLLGLRPSVKRLMMYQQGCFAGGTVLRLAKDLAENNRGARVL  193

Query  646   VVCSEVMLNVFRGPSLEQEDNLLAQCLFGDGSAAVIVGTEPRPGL-ETPLFELVSAAQTT  822
             VVCSE+    FRGPS    D+L+ Q LF DG+AA+IVG++P   + E P+FE+VSAAQT 
Sbjct  194   VVCSEITAVTFRGPSDTHLDSLVGQALFSDGAAALIVGSDPDASVGEKPIFEMVSAAQTI  253

Query  823   IPDTDSHLKLHLREMGLTFHCSKAVPSLITQNVEDCLVKAFEPFGISDWNSIFWILHPGG  1002
             +PD+D  +  HLRE+GLTFH  K VP LI++N+E  L +AF+P GISDWNS+FWI HPGG
Sbjct  254   LPDSDGAIDGHLREVGLTFHLLKDVPGLISKNIEKSLEEAFKPLGISDWNSLFWIAHPGG  313

Query  1003  IAILDRVEEKLGLEPEKLRASKDVLSEYGNLTSACVLFILDEMRKKSKKDEEMTTGEGLE  1182
              AILD VE+KLGL+ EK+RA++ VLSEYGN++SACVLFILDEMR+KS KD   TTGEGLE
Sbjct  314   PAILDEVEKKLGLKAEKMRATRQVLSEYGNMSSACVLFILDEMRRKSAKDGVATTGEGLE  373

Query  1183  WGVVFVVCP  1209
             WGV+F   P
Sbjct  374   WGVLFGFGP  382



>emb|CAH61575.1| chalcone synthase [Dictamnus albus]
Length=391

 Score =   526 bits (1356),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 248/367 (68%), Positives = 302/367 (82%), Gaps = 0/367 (0%)
 Frame = +1

Query  109   RAKRFEGDAKILAIGTAIPANWVDQTTYPDFYFRITNSEHLLEHKEKFRRICNKSKIRKR  288
             +AKR EG A ILAIGTA PAN V+Q  YPD+YFRIT SEH+ E KEKF+R+C+KS I+KR
Sbjct  9     KAKRAEGPATILAIGTATPANSVNQADYPDYYFRITKSEHMTELKEKFKRMCDKSMIKKR  68

Query  289   HLVITEELLKKNPNLCTYNEASLNTRQDILVSEVPKLGKEAAMKAIKEWGRPISEITHLV  468
             ++ +TE++LK+NPN+C Y   SL+ RQD++V EVPKLGKEAA KAIKEWG+P S+ITHLV
Sbjct  69    YMHLTEDILKENPNMCAYMAPSLDARQDVVVVEVPKLGKEAATKAIKEWGQPKSKITHLV  128

Query  469   FCTSSGVDMPGADFQLAKLLGLSSSVKRLMMYQQGCNAGAAMLRLAKDLAENNKGARVLV  648
             FCT+SGVDMPGAD+QL KLLGL  SVKRLMMYQQGC AG  +LRLAKDLAENNKGARVLV
Sbjct  129   FCTTSGVDMPGADYQLTKLLGLRPSVKRLMMYQQGCFAGGTVLRLAKDLAENNKGARVLV  188

Query  649   VCSEVMLNVFRGPSLEQEDNLLAQCLFGDGSAAVIVGTEPRPGLETPLFELVSAAQTTIP  828
             VCSE+    FRGP+    D+L+ Q LFGDG+AA+IVG +P   +E PL++LVSA+QT +P
Sbjct  189   VCSEITAVTFRGPADTHLDSLVGQALFGDGAAALIVGADPDTTVERPLYQLVSASQTILP  248

Query  829   DTDSHLKLHLREMGLTFHCSKAVPSLITQNVEDCLVKAFEPFGISDWNSIFWILHPGGIA  1008
             D+D  +  HLRE+GLTFH  K VP LI++N+E  LV+AF P GI+DWNSIFWI HPGG A
Sbjct  249   DSDGAIDGHLREVGLTFHLLKDVPGLISKNIEKSLVEAFSPIGINDWNSIFWIAHPGGPA  308

Query  1009  ILDRVEEKLGLEPEKLRASKDVLSEYGNLTSACVLFILDEMRKKSKKDEEMTTGEGLEWG  1188
             ILD+VEEKLGL+ EKLRA++ VLSEYGN++SACVLFILDEMRKK  ++ + TTGEGL+WG
Sbjct  309   ILDQVEEKLGLKEEKLRATRHVLSEYGNMSSACVLFILDEMRKKCVEEGKATTGEGLDWG  368

Query  1189  VVFVVCP  1209
             V+F   P
Sbjct  369   VLFGFGP  375



>gb|AAK39112.1|AF358656_1 chalcone synthase, partial [Ipomoea purpurea]
Length=368

 Score =   526 bits (1354),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 247/362 (68%), Positives = 300/362 (83%), Gaps = 1/362 (0%)
 Frame = +1

Query  106   RRAKRFEGDAKILAIGTAIPANWVDQTTYPDFYFRITNSEHLLEHKEKFRRICNKSKIRK  285
             R+A+R EG A ILAIGTA PAN VDQ+TYPD+YFRITNS+H+ + K+KF+R+C+KS I K
Sbjct  8     RKAQRAEGPATILAIGTATPANCVDQSTYPDYYFRITNSDHMTDLKQKFQRMCDKSMITK  67

Query  286   RHLVITEELLKKNPNLCTYNEASLNTRQDILVSEVPKLGKEAAMKAIKEWGRPISEITHL  465
             R++ +TEE+LK+NP+ C Y   SL+ RQDI+V EVPKLGKEAA  AIKEWG+P S+ITH+
Sbjct  68    RYMHLTEEILKENPSFCEYMAPSLDARQDIVVVEVPKLGKEAAQSAIKEWGQPKSKITHV  127

Query  466   VFCTSSGVDMPGADFQLAKLLGLSSSVKRLMMYQQGCNAGAAMLRLAKDLAENNKGARVL  645
             +FCT+SGVDMPGAD+QL KLLGL  SVKRLMMYQQGC AG  +LR+AKDLAENNKGARVL
Sbjct  128   IFCTTSGVDMPGADYQLTKLLGLRPSVKRLMMYQQGCFAGGTVLRVAKDLAENNKGARVL  187

Query  646   VVCSEVMLNVFRGPSLEQEDNLLAQCLFGDGSAAVIVGTEPRPGLETPLFELVSAAQTTI  825
             VVCSE+ +  FRGP+    D+L+ Q LFGDG+AA+IVG++P P +E PLF+LVSAAQT  
Sbjct  188   VVCSEITVVTFRGPNETHLDSLVGQALFGDGAAAIIVGSDPTP-VEKPLFQLVSAAQTLA  246

Query  826   PDTDSHLKLHLREMGLTFHCSKAVPSLITQNVEDCLVKAFEPFGISDWNSIFWILHPGGI  1005
             PD+   +  HLRE+GLTFH  K VPS+++ N+E CL +AF P GISDWNSIFWI HPGG 
Sbjct  247   PDSCGAIDGHLREVGLTFHLLKDVPSIVSNNIEKCLSEAFNPLGISDWNSIFWIAHPGGP  306

Query  1006  AILDRVEEKLGLEPEKLRASKDVLSEYGNLTSACVLFILDEMRKKSKKDEEMTTGEGLEW  1185
             AILD+VE+KLGL+PEKLRA++ VLSEYGN++SACVLFILDEMRK S  D   TTGEGLEW
Sbjct  307   AILDQVEDKLGLKPEKLRATRHVLSEYGNMSSACVLFILDEMRKASSNDGLGTTGEGLEW  366

Query  1186  GV  1191
             GV
Sbjct  367   GV  368



>ref|XP_007223028.1| hypothetical protein PRUPE_ppa006899mg [Prunus persica]
 gb|EMJ24227.1| hypothetical protein PRUPE_ppa006899mg [Prunus persica]
Length=391

 Score =   526 bits (1356),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 245/368 (67%), Positives = 303/368 (82%), Gaps = 0/368 (0%)
 Frame = +1

Query  106   RRAKRFEGDAKILAIGTAIPANWVDQTTYPDFYFRITNSEHLLEHKEKFRRICNKSKIRK  285
             R+A+R EG A +LAIGTA P N VDQ TYPD+YFRITNSEH  E KEKF+R+C+KS I+K
Sbjct  8     RKAQRAEGPATVLAIGTATPPNCVDQATYPDYYFRITNSEHKTELKEKFQRMCDKSMIKK  67

Query  286   RHLVITEELLKKNPNLCTYNEASLNTRQDILVSEVPKLGKEAAMKAIKEWGRPISEITHL  465
             R++ +TEE+LK+NP++C Y   SL+ RQD++V E+PKLGKEAA KAIKEWG+P S+ITHL
Sbjct  68    RYMYLTEEILKENPSMCEYMAPSLDARQDMVVVEIPKLGKEAATKAIKEWGQPKSKITHL  127

Query  466   VFCTSSGVDMPGADFQLAKLLGLSSSVKRLMMYQQGCNAGAAMLRLAKDLAENNKGARVL  645
             VFCT+SGVDMPGAD+QL KLLGL SSVKRLMMYQQGC AG  +LRLAKDLAENN+GARVL
Sbjct  128   VFCTTSGVDMPGADYQLTKLLGLRSSVKRLMMYQQGCFAGGTVLRLAKDLAENNRGARVL  187

Query  646   VVCSEVMLNVFRGPSLEQEDNLLAQCLFGDGSAAVIVGTEPRPGLETPLFELVSAAQTTI  825
             VVCSE+    FRGPS    D+L+ Q LFGDG+AA+IVG++P P +E PLFE+VSAAQT +
Sbjct  188   VVCSEITAVTFRGPSDTHLDSLVGQALFGDGAAAIIVGSDPIPEIEKPLFEVVSAAQTIL  247

Query  826   PDTDSHLKLHLREMGLTFHCSKAVPSLITQNVEDCLVKAFEPFGISDWNSIFWILHPGGI  1005
             PD+D  +  HLRE+GLTFH  K VP LI++N+E  L +AF+P GISDWNS+FWI HPGG 
Sbjct  248   PDSDGAIDGHLREVGLTFHLLKDVPGLISKNIEKSLNEAFQPLGISDWNSLFWIAHPGGP  307

Query  1006  AILDRVEEKLGLEPEKLRASKDVLSEYGNLTSACVLFILDEMRKKSKKDEEMTTGEGLEW  1185
             AILD+VE KL L+PEKL A++ +LSEYGN++SACVLFILDE+RK++ +    TTG+GL+W
Sbjct  308   AILDQVESKLSLKPEKLEATRHILSEYGNMSSACVLFILDEVRKRAAEKGLKTTGDGLDW  367

Query  1186  GVVFVVCP  1209
             GV+F   P
Sbjct  368   GVLFGFGP  375



>gb|AHY35308.1| chalcone synthase 1 [Morus notabilis]
Length=389

 Score =   526 bits (1355),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 245/368 (67%), Positives = 301/368 (82%), Gaps = 0/368 (0%)
 Frame = +1

Query  106   RRAKRFEGDAKILAIGTAIPANWVDQTTYPDFYFRITNSEHLLEHKEKFRRICNKSKIRK  285
             R+A+R EG   I+AIGTA P N +DQ++YPD+YFRITNSEH  E KEKF+R+C KS+I+K
Sbjct  8     RKAQRAEGPVTIMAIGTATPPNCIDQSSYPDYYFRITNSEHKTELKEKFKRMCEKSQIKK  67

Query  286   RHLVITEELLKKNPNLCTYNEASLNTRQDILVSEVPKLGKEAAMKAIKEWGRPISEITHL  465
             R++ + EE+LK+NPN+C Y   SL+ RQD++V EVPKLGKEAA KAIKEWG+P S+ITHL
Sbjct  68    RYMYLHEEILKENPNICAYMAPSLDARQDMVVVEVPKLGKEAATKAIKEWGQPKSKITHL  127

Query  466   VFCTSSGVDMPGADFQLAKLLGLSSSVKRLMMYQQGCNAGAAMLRLAKDLAENNKGARVL  645
             VFCT+SGVDMPGAD+QL KLLGL  SVKRLMMYQQGC AG  +LRLAKDLAENNKGARVL
Sbjct  128   VFCTTSGVDMPGADYQLTKLLGLRPSVKRLMMYQQGCFAGGTVLRLAKDLAENNKGARVL  187

Query  646   VVCSEVMLNVFRGPSLEQEDNLLAQCLFGDGSAAVIVGTEPRPGLETPLFELVSAAQTTI  825
             VVCSE+    FRGPS    D+L+ Q LFGDG+AA+I+G +P P +E P+ +LVSAAQT +
Sbjct  188   VVCSEITAVTFRGPSDTHLDSLVGQALFGDGAAAMIIGADPIPEVEKPILQLVSAAQTIL  247

Query  826   PDTDSHLKLHLREMGLTFHCSKAVPSLITQNVEDCLVKAFEPFGISDWNSIFWILHPGGI  1005
             PD++  +  HLRE+GLTFH  K VP LI++N++  L +AF+PFGISDWNSIFWI HPGG 
Sbjct  248   PDSEGAIDGHLREVGLTFHLLKDVPGLISKNIDKSLTEAFKPFGISDWNSIFWIAHPGGP  307

Query  1006  AILDRVEEKLGLEPEKLRASKDVLSEYGNLTSACVLFILDEMRKKSKKDEEMTTGEGLEW  1185
             AILD+VE K GL+PEKLRA++ VLSEYGN++SACV+FILDEMR+K  +D   TTGEGLEW
Sbjct  308   AILDQVEAKCGLKPEKLRATRHVLSEYGNMSSACVVFILDEMRRKGAEDGLKTTGEGLEW  367

Query  1186  GVVFVVCP  1209
             GV+F   P
Sbjct  368   GVLFGFGP  375



>gb|AAK49457.1| chalcone synthase [Nicotiana tabacum]
Length=389

 Score =   526 bits (1355),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 249/368 (68%), Positives = 302/368 (82%), Gaps = 0/368 (0%)
 Frame = +1

Query  106   RRAKRFEGDAKILAIGTAIPANWVDQTTYPDFYFRITNSEHLLEHKEKFRRICNKSKIRK  285
             RRA+  EG A ++AIGTA P+N VDQ+TYPD+YFRITNSEH +E KEKF+R+C KS I+K
Sbjct  8     RRAQCAEGPATVMAIGTATPSNCVDQSTYPDYYFRITNSEHKVELKEKFKRMCEKSMIKK  67

Query  286   RHLVITEELLKKNPNLCTYNEASLNTRQDILVSEVPKLGKEAAMKAIKEWGRPISEITHL  465
             R++ +TEE+LK+NPN+C Y   SL+ RQDI+V EVPKLGKEAA KAIKEWG+P S+ITHL
Sbjct  68    RYMHLTEEILKENPNICAYMAPSLDARQDIVVVEVPKLGKEAAQKAIKEWGQPKSKITHL  127

Query  466   VFCTSSGVDMPGADFQLAKLLGLSSSVKRLMMYQQGCNAGAAMLRLAKDLAENNKGARVL  645
             VFCT+SGVDMPG D+QL KLLGL  SVKR MMYQQGC AG  +LR+AKDLAENNKGARVL
Sbjct  128   VFCTTSGVDMPGCDYQLTKLLGLRPSVKRFMMYQQGCFAGGTVLRMAKDLAENNKGARVL  187

Query  646   VVCSEVMLNVFRGPSLEQEDNLLAQCLFGDGSAAVIVGTEPRPGLETPLFELVSAAQTTI  825
             VVCSE+    FRGP+    D+L+ Q LFGDG+AAVI+G++P P +E PLFELVSAAQT +
Sbjct  188   VVCSEITAVTFRGPNDTHLDSLVGQALFGDGAAAVIIGSDPIPEVERPLFELVSAAQTLL  247

Query  826   PDTDSHLKLHLREMGLTFHCSKAVPSLITQNVEDCLVKAFEPFGISDWNSIFWILHPGGI  1005
             PD++  +  HLRE+GLTFH  K VP LI++N+E  LV+AF+P GISDWNS+FWI HPGG 
Sbjct  248   PDSEGAIDGHLREVGLTFHLLKDVPGLISKNIEKSLVEAFQPLGISDWNSLFWIAHPGGP  307

Query  1006  AILDRVEEKLGLEPEKLRASKDVLSEYGNLTSACVLFILDEMRKKSKKDEEMTTGEGLEW  1185
             AILD+VE KLGL+ EKL+A++ VLS YGN++SACVLFILDEMRK S K+   TTGEGLEW
Sbjct  308   AILDQVELKLGLKQEKLKATRKVLSNYGNMSSACVLFILDEMRKASAKEGLGTTGEGLEW  367

Query  1186  GVVFVVCP  1209
             GV+F   P
Sbjct  368   GVLFGFGP  375



>emb|CDX78547.1| BnaA03g04590D [Brassica napus]
Length=394

 Score =   526 bits (1356),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 250/369 (68%), Positives = 302/369 (82%), Gaps = 1/369 (0%)
 Frame = +1

Query  106   RRAKRFEGDAKILAIGTAIPANWVDQTTYPDFYFRITNSEHLLEHKEKFRRICNKSKIRK  285
             R+A+R +G A ILAIGTA PAN V Q  YPD+YFRITNSEH+ + KEKF+R+C+KS IRK
Sbjct  12    RKAQRADGPAGILAIGTANPANHVIQAEYPDYYFRITNSEHMTDLKEKFKRMCDKSMIRK  71

Query  286   RHLVITEELLKKNPNLCTYNEASLNTRQDILVSEVPKLGKEAAMKAIKEWGRPISEITHL  465
             RH+ +TEE LK+NPN+C Y   SL+ RQDI+V EVPKLGKEAA+KAIKEWG+P S+ITH+
Sbjct  72    RHMHLTEEFLKENPNMCAYMAPSLDVRQDIVVVEVPKLGKEAAVKAIKEWGQPKSKITHV  131

Query  466   VFCTSSGVDMPGADFQLAKLLGLSSSVKRLMMYQQGCNAGAAMLRLAKDLAENNKGARVL  645
             VFCT+SGVDMPGAD+QL KLLGL  SVKRLMMYQQGC AG  +LRLAKDLAENN+GARVL
Sbjct  132   VFCTTSGVDMPGADYQLTKLLGLRPSVKRLMMYQQGCFAGGTVLRLAKDLAENNRGARVL  191

Query  646   VVCSEVMLNVFRGPSLEQEDNLLAQCLFGDGSAAVIVGTEPRPGL-ETPLFELVSAAQTT  822
             VVCSE+    FRGPS    D+L+ Q LF DG+AA+IVG++P   + E P+FE+VSAAQT 
Sbjct  192   VVCSEITAVTFRGPSDTHLDSLVGQALFSDGAAALIVGSDPDASVGEKPIFEMVSAAQTI  251

Query  823   IPDTDSHLKLHLREMGLTFHCSKAVPSLITQNVEDCLVKAFEPFGISDWNSIFWILHPGG  1002
             +PD+D  +  HLRE+GLTFH  K VP LI++N+E  L +AF+P GISDWNS+FWI HPGG
Sbjct  252   LPDSDGAIDGHLREVGLTFHLLKDVPGLISKNIEKSLEEAFKPLGISDWNSLFWIAHPGG  311

Query  1003  IAILDRVEEKLGLEPEKLRASKDVLSEYGNLTSACVLFILDEMRKKSKKDEEMTTGEGLE  1182
              AILD VE+KLGL+ EK+RA++ VLSEYGN++SACVLFILDEMR+KS KD   TTGEGLE
Sbjct  312   PAILDEVEKKLGLKAEKMRATRQVLSEYGNMSSACVLFILDEMRRKSAKDGVATTGEGLE  371

Query  1183  WGVVFVVCP  1209
             WGV+F   P
Sbjct  372   WGVLFGFGP  380



>gb|AFH68066.1| chalcone synthase [Pyrus pyrifolia]
Length=389

 Score =   526 bits (1355),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 246/368 (67%), Positives = 303/368 (82%), Gaps = 0/368 (0%)
 Frame = +1

Query  106   RRAKRFEGDAKILAIGTAIPANWVDQTTYPDFYFRITNSEHLLEHKEKFRRICNKSKIRK  285
             R+A+R EG A ++AIGT+ P+N VDQ TYPD+YFRITNSEH +E KEKF+R+C+KS I+K
Sbjct  8     RKAQRAEGPATVMAIGTSTPSNCVDQATYPDYYFRITNSEHKVELKEKFQRMCDKSMIKK  67

Query  286   RHLVITEELLKKNPNLCTYNEASLNTRQDILVSEVPKLGKEAAMKAIKEWGRPISEITHL  465
             R++ +TEE+LK+NP++C Y   S++ RQD++V +VPKLGKEAA KAIKEWG+P S+ITHL
Sbjct  68    RYMYLTEEILKENPSVCEYMAPSIDARQDMVVVKVPKLGKEAATKAIKEWGQPKSKITHL  127

Query  466   VFCTSSGVDMPGADFQLAKLLGLSSSVKRLMMYQQGCNAGAAMLRLAKDLAENNKGARVL  645
             VFCT+SGVDMPGAD+QL KLLGL  SVKRLMMYQQGC AG  +LRLAKDLAENNKGARVL
Sbjct  128   VFCTTSGVDMPGADYQLTKLLGLRPSVKRLMMYQQGCFAGGTVLRLAKDLAENNKGARVL  187

Query  646   VVCSEVMLNVFRGPSLEQEDNLLAQCLFGDGSAAVIVGTEPRPGLETPLFELVSAAQTTI  825
             VVCSE+    FRGPS    D+L+ Q LFGDG+AAVI+G +P P +E PLFELVSAAQT +
Sbjct  188   VVCSEITAVTFRGPSDTHLDSLVGQALFGDGAAAVIIGADPVPEVEKPLFELVSAAQTIL  247

Query  826   PDTDSHLKLHLREMGLTFHCSKAVPSLITQNVEDCLVKAFEPFGISDWNSIFWILHPGGI  1005
             PD+D  +  HLRE+GLTFH  K VP LI++N+E  L +AF+P GISDWNS+FWI HPGG 
Sbjct  248   PDSDGAIDGHLREVGLTFHLLKDVPGLISKNIEKSLNEAFKPIGISDWNSLFWIAHPGGP  307

Query  1006  AILDRVEEKLGLEPEKLRASKDVLSEYGNLTSACVLFILDEMRKKSKKDEEMTTGEGLEW  1185
             AILD+VE KL L+PEKL A++ VLS+YGN++SACVLFILDE+R+KS +    TTGEGLEW
Sbjct  308   AILDQVEAKLALKPEKLEATRQVLSDYGNMSSACVLFILDEVRRKSAEKGLKTTGEGLEW  367

Query  1186  GVVFVVCP  1209
             GV+F   P
Sbjct  368   GVLFGFGP  375



>gb|AAT75302.1| chalcone synthase [Camellia sinensis]
Length=389

 Score =   526 bits (1355),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 252/367 (69%), Positives = 301/367 (82%), Gaps = 0/367 (0%)
 Frame = +1

Query  109   RAKRFEGDAKILAIGTAIPANWVDQTTYPDFYFRITNSEHLLEHKEKFRRICNKSKIRKR  288
             RA+R  G A +LAIGTA P N VDQ+TYPD+YFRITNSEH +E KEKF+R+C+KS  +KR
Sbjct  9     RAQRARGPATVLAIGTATPPNCVDQSTYPDYYFRITNSEHKVELKEKFKRMCDKSMNKKR  68

Query  289   HLVITEELLKKNPNLCTYNEASLNTRQDILVSEVPKLGKEAAMKAIKEWGRPISEITHLV  468
             ++ +TEE+LK+NP +C Y   SL+ RQD++V EVPKLGKEAA KAIKEWG+P S+ITHLV
Sbjct  69    YMYLTEEILKENPLVCEYMAPSLDARQDMVVVEVPKLGKEAATKAIKEWGQPKSKITHLV  128

Query  469   FCTSSGVDMPGADFQLAKLLGLSSSVKRLMMYQQGCNAGAAMLRLAKDLAENNKGARVLV  648
             FCT+SGVDMPGAD+QL KLLGL  SVKRLMMYQQGC AG  +LRLAKDLAENNKGARVLV
Sbjct  129   FCTTSGVDMPGADYQLTKLLGLRPSVKRLMMYQQGCFAGGTVLRLAKDLAENNKGARVLV  188

Query  649   VCSEVMLNVFRGPSLEQEDNLLAQCLFGDGSAAVIVGTEPRPGLETPLFELVSAAQTTIP  828
             VCSE+    FRGPS    D+L+ Q LFGDG+AA+I+G++P P +E PLFELVSAAQT +P
Sbjct  189   VCSEITAVTFRGPSDTHLDSLVGQSLFGDGAAAIIIGSDPIPEVEKPLFELVSAAQTILP  248

Query  829   DTDSHLKLHLREMGLTFHCSKAVPSLITQNVEDCLVKAFEPFGISDWNSIFWILHPGGIA  1008
              +D  +  HLRE+GLTFH  K VP LI+ NVE  LV+AF+P GISDWNS+FWI HPGG A
Sbjct  249   SSDGAIDGHLREVGLTFHLLKDVPRLISMNVEKSLVEAFQPLGISDWNSLFWIAHPGGPA  308

Query  1009  ILDRVEEKLGLEPEKLRASKDVLSEYGNLTSACVLFILDEMRKKSKKDEEMTTGEGLEWG  1188
             ILD+VE KLGL+ EKLRA++ VLSEYGN++SACVLFILDEMRKKS ++   TTGEGLEWG
Sbjct  309   ILDQVELKLGLKEEKLRATRHVLSEYGNMSSACVLFILDEMRKKSAEEGLKTTGEGLEWG  368

Query  1189  VVFVVCP  1209
             V+F   P
Sbjct  369   VLFGFGP  375



>sp|Q9MB40.1|CHS3_IPOBA RecName: Full=Chalcone synthase LF3; AltName: Full=Naringenin-chalcone 
synthase LF3 [Ipomoea batatas]
 dbj|BAA90328.1| chalcone synthase CHS-LF3 [Ipomoea batatas]
Length=388

 Score =   526 bits (1355),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 252/368 (68%), Positives = 298/368 (81%), Gaps = 1/368 (0%)
 Frame = +1

Query  106   RRAKRFEGDAKILAIGTAIPANWVDQTTYPDFYFRITNSEHLLEHKEKFRRICNKSKIRK  285
             R+A+R EG A ILAIGTA PAN V+Q+TYPD+YFRITNSEH  E KEKF+R+C+KS I K
Sbjct  8     RKAQRAEGPATILAIGTATPANCVNQSTYPDYYFRITNSEHKTELKEKFQRMCDKSMITK  67

Query  286   RHLVITEELLKKNPNLCTYNEASLNTRQDILVSEVPKLGKEAAMKAIKEWGRPISEITHL  465
             R++ +TEE+LK+NP+ C Y   SL+ RQDI V EVPKLGKEAA  AIK WG+P S+ITH+
Sbjct  68    RYMHLTEEILKENPSFCEYMAPSLDARQDIAVVEVPKLGKEAAQSAIKGWGQPKSKITHV  127

Query  466   VFCTSSGVDMPGADFQLAKLLGLSSSVKRLMMYQQGCNAGAAMLRLAKDLAENNKGARVL  645
             VFCT+SGVDMPGAD+QL KLLGL  SVKRLMMYQQGC AG  +LRLAKDLAENNKGARVL
Sbjct  128   VFCTTSGVDMPGADYQLTKLLGLRPSVKRLMMYQQGCFAGGTVLRLAKDLAENNKGARVL  187

Query  646   VVCSEVMLNVFRGPSLEQEDNLLAQCLFGDGSAAVIVGTEPRPGLETPLFELVSAAQTTI  825
             +VCSE+ +  FRGPS    D+L+ Q LFGDG+AAVIVG +P P  E PLF+LVSAAQT  
Sbjct  188   IVCSEITVVTFRGPSEAHLDSLVGQALFGDGAAAVIVGADPTPA-EKPLFQLVSAAQTLA  246

Query  826   PDTDSHLKLHLREMGLTFHCSKAVPSLITQNVEDCLVKAFEPFGISDWNSIFWILHPGGI  1005
             PD+   +  HLRE+GLTFH  K VPS+++ N+E CL +AF P GISDWNS+FWI HPGG 
Sbjct  247   PDSCGAIDGHLREVGLTFHLLKDVPSVVSNNIEKCLFEAFNPLGISDWNSVFWIAHPGGP  306

Query  1006  AILDRVEEKLGLEPEKLRASKDVLSEYGNLTSACVLFILDEMRKKSKKDEEMTTGEGLEW  1185
             AILD+VE+KLGL+PEKLRA++ VLSEYGN++SACVLFILDEMRK S  D   TTGEGLEW
Sbjct  307   AILDQVEDKLGLKPEKLRATRHVLSEYGNMSSACVLFILDEMRKASSNDGLGTTGEGLEW  366

Query  1186  GVVFVVCP  1209
             GV+F   P
Sbjct  367   GVLFGFGP  374



>gb|ABN80439.1| chalcone synthase [Nicotiana benthamiana]
Length=389

 Score =   526 bits (1355),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 248/368 (67%), Positives = 301/368 (82%), Gaps = 0/368 (0%)
 Frame = +1

Query  106   RRAKRFEGDAKILAIGTAIPANWVDQTTYPDFYFRITNSEHLLEHKEKFRRICNKSKIRK  285
             RRA+R EG A ++AIGTA P N VDQ+TYPD+YFRITNSEH  E KEKF+R+C KS I+K
Sbjct  8     RRAQRAEGPATVMAIGTATPFNCVDQSTYPDYYFRITNSEHKTELKEKFKRMCEKSMIKK  67

Query  286   RHLVITEELLKKNPNLCTYNEASLNTRQDILVSEVPKLGKEAAMKAIKEWGRPISEITHL  465
             R++ +TEE+LK+NPN+C Y   SL+ RQDI+V EVPKLGKEAA KAIKEWG+P S+ITHL
Sbjct  68    RYMHLTEEILKENPNICAYMAPSLDARQDIVVVEVPKLGKEAAQKAIKEWGQPKSKITHL  127

Query  466   VFCTSSGVDMPGADFQLAKLLGLSSSVKRLMMYQQGCNAGAAMLRLAKDLAENNKGARVL  645
             VFCT+SGVDMPG D+QL KLLGL  SVKR MMYQQGC AG  +LR+AKDLAENNKGARVL
Sbjct  128   VFCTTSGVDMPGCDYQLTKLLGLRPSVKRFMMYQQGCFAGGTVLRMAKDLAENNKGARVL  187

Query  646   VVCSEVMLNVFRGPSLEQEDNLLAQCLFGDGSAAVIVGTEPRPGLETPLFELVSAAQTTI  825
             VVCSE+    FRGP+    D+L+ Q LFGDG+AAVI+G++P P +E PLF+LVSAAQT +
Sbjct  188   VVCSEITAVTFRGPNDTHLDSLVGQALFGDGAAAVIIGSDPIPEVERPLFQLVSAAQTLL  247

Query  826   PDTDSHLKLHLREMGLTFHCSKAVPSLITQNVEDCLVKAFEPFGISDWNSIFWILHPGGI  1005
             PD++  +  HLRE+GLTFH  K VP LI++N+E  LV+AF+P GISDWNS+FWI HPGG 
Sbjct  248   PDSEGAIDGHLREVGLTFHLLKDVPGLISKNIEKSLVEAFQPLGISDWNSLFWIAHPGGP  307

Query  1006  AILDRVEEKLGLEPEKLRASKDVLSEYGNLTSACVLFILDEMRKKSKKDEEMTTGEGLEW  1185
             AILD+VE KLGL  EKL+A+++VL+ YGN++SACVLFILDEMRK S K+   TTGEGLEW
Sbjct  308   AILDQVELKLGLNQEKLKATRNVLTNYGNMSSACVLFILDEMRKASAKEGLGTTGEGLEW  367

Query  1186  GVVFVVCP  1209
             GV+F   P
Sbjct  368   GVLFGFGP  375



>ref|XP_010249317.1| PREDICTED: chalcone synthase [Nelumbo nucifera]
Length=393

 Score =   526 bits (1355),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 250/368 (68%), Positives = 298/368 (81%), Gaps = 0/368 (0%)
 Frame = +1

Query  106   RRAKRFEGDAKILAIGTAIPANWVDQTTYPDFYFRITNSEHLLEHKEKFRRICNKSKIRK  285
             R A+R +G A +LAIGTA PAN V Q  YPD+YFRITNSEH  E KEKF+R+C KS I+K
Sbjct  8     RNAQRAQGPATVLAIGTATPANCVYQADYPDYYFRITNSEHKTELKEKFKRMCEKSMIKK  67

Query  286   RHLVITEELLKKNPNLCTYNEASLNTRQDILVSEVPKLGKEAAMKAIKEWGRPISEITHL  465
             R++ +TEE+LK+NPN+C Y   SL+ RQD++V EVPKLGKEAA KAIKEWG+P S+ITHL
Sbjct  68    RYMHLTEEILKENPNICAYMAPSLDARQDMVVVEVPKLGKEAASKAIKEWGQPKSKITHL  127

Query  466   VFCTSSGVDMPGADFQLAKLLGLSSSVKRLMMYQQGCNAGAAMLRLAKDLAENNKGARVL  645
             VFCT+SGVDMPGAD+QL KLLGL  SVKR MMYQQGC AG  +LRLAKDLAENN GARVL
Sbjct  128   VFCTTSGVDMPGADYQLTKLLGLRPSVKRFMMYQQGCFAGGTVLRLAKDLAENNAGARVL  187

Query  646   VVCSEVMLNVFRGPSLEQEDNLLAQCLFGDGSAAVIVGTEPRPGLETPLFELVSAAQTTI  825
             VVCSE+    FRGPS    D+L+ Q LFGDG+AAVIVG +P   +E PLF+LVSAAQT +
Sbjct  188   VVCSEITAVTFRGPSDTHLDSLVGQALFGDGAAAVIVGADPDTSIERPLFQLVSAAQTIL  247

Query  826   PDTDSHLKLHLREMGLTFHCSKAVPSLITQNVEDCLVKAFEPFGISDWNSIFWILHPGGI  1005
             PD+   +  HLRE+GLTFH  K VP LI++N+E  LV+AF P G+SDWNS+FWI HPGG 
Sbjct  248   PDSHGAIDGHLREVGLTFHLLKDVPGLISKNIEKSLVEAFTPIGVSDWNSLFWIAHPGGP  307

Query  1006  AILDRVEEKLGLEPEKLRASKDVLSEYGNLTSACVLFILDEMRKKSKKDEEMTTGEGLEW  1185
             AILD+VEEKLGL+ EKLRA+++VLSEYGN++SACVLFILDEMRKKS ++   TTGEGLEW
Sbjct  308   AILDQVEEKLGLKEEKLRATRNVLSEYGNMSSACVLFILDEMRKKSVEEGRATTGEGLEW  367

Query  1186  GVVFVVCP  1209
             GV+F   P
Sbjct  368   GVLFGFGP  375



>ref|XP_008358057.1| PREDICTED: polyketide synthase 5 [Malus domestica]
 gb|AAY45748.1| chalcone synthase [Malus domestica]
 gb|ACJ54533.1| chalcone synthase [Malus domestica]
 gb|ACN25139.1| chalcone sythase [Malus hybrid cultivar]
Length=389

 Score =   526 bits (1355),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 248/368 (67%), Positives = 300/368 (82%), Gaps = 0/368 (0%)
 Frame = +1

Query  106   RRAKRFEGDAKILAIGTAIPANWVDQTTYPDFYFRITNSEHLLEHKEKFRRICNKSKIRK  285
             R+A+R EG A +LAIGTA P N VDQ TYPD+YFRITNSEH  E KEKF+R+C+KS I+ 
Sbjct  8     RKAQRAEGPATVLAIGTATPPNCVDQATYPDYYFRITNSEHKTELKEKFQRMCDKSMIKT  67

Query  286   RHLVITEELLKKNPNLCTYNEASLNTRQDILVSEVPKLGKEAAMKAIKEWGRPISEITHL  465
             R++ +TEE+LK+NP +C Y   SL+ RQD++V EVP+LGKEAA KAIKEWG+P S+ITHL
Sbjct  68    RYMYLTEEILKENPTVCEYMAPSLDARQDMVVVEVPRLGKEAATKAIKEWGQPKSKITHL  127

Query  466   VFCTSSGVDMPGADFQLAKLLGLSSSVKRLMMYQQGCNAGAAMLRLAKDLAENNKGARVL  645
             VFCT+SGVDMPGAD+QL KLLGL  SVKRLMMYQQGC AG  +LRLAKDLAENNKGARVL
Sbjct  128   VFCTTSGVDMPGADYQLTKLLGLRPSVKRLMMYQQGCFAGGTVLRLAKDLAENNKGARVL  187

Query  646   VVCSEVMLNVFRGPSLEQEDNLLAQCLFGDGSAAVIVGTEPRPGLETPLFELVSAAQTTI  825
             VVCSE+    FRGPS    D+L+ Q LFGDG+AAVI+G++P P +E PLFELVSAAQT +
Sbjct  188   VVCSEITAVTFRGPSDTHLDSLVGQALFGDGAAAVIIGSDPVPEVEKPLFELVSAAQTIL  247

Query  826   PDTDSHLKLHLREMGLTFHCSKAVPSLITQNVEDCLVKAFEPFGISDWNSIFWILHPGGI  1005
             PD+D  +  HLRE+GLTFH  K VP LI++N+E  L +AF+P GISDWNS+FWI HPGG 
Sbjct  248   PDSDGAIDGHLREVGLTFHLLKDVPGLISKNIEKSLNEAFKPIGISDWNSLFWIAHPGGP  307

Query  1006  AILDRVEEKLGLEPEKLRASKDVLSEYGNLTSACVLFILDEMRKKSKKDEEMTTGEGLEW  1185
             AILD+VE KL L+PEKL A++ VLS+YGN++SACVLFILDE+R+KS +    TTGEGLEW
Sbjct  308   AILDQVESKLALKPEKLEATRQVLSDYGNMSSACVLFILDEVRRKSAEKGLKTTGEGLEW  367

Query  1186  GVVFVVCP  1209
             GV+F   P
Sbjct  368   GVLFGFGP  375



>gb|ADV29810.1| chalcone synthase [Malus toringoides]
Length=389

 Score =   526 bits (1355),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 248/368 (67%), Positives = 300/368 (82%), Gaps = 0/368 (0%)
 Frame = +1

Query  106   RRAKRFEGDAKILAIGTAIPANWVDQTTYPDFYFRITNSEHLLEHKEKFRRICNKSKIRK  285
             R+A+R EG A + AIGTA P N VDQ TYPD+YFRITNSEH  E KEKF+R+C+KS I+K
Sbjct  8     RKAQRAEGPATVFAIGTATPPNCVDQATYPDYYFRITNSEHKAELKEKFQRMCDKSMIKK  67

Query  286   RHLVITEELLKKNPNLCTYNEASLNTRQDILVSEVPKLGKEAAMKAIKEWGRPISEITHL  465
             R++ +TEE+LK+NP++C Y   SL+ RQD++V EVP+LGKEAA KAIKEWG+P S+ITHL
Sbjct  68    RYMYLTEEILKENPSVCEYMAPSLDARQDMVVVEVPRLGKEAATKAIKEWGQPKSKITHL  127

Query  466   VFCTSSGVDMPGADFQLAKLLGLSSSVKRLMMYQQGCNAGAAMLRLAKDLAENNKGARVL  645
             VFCT+SGVDMPGAD+QL KLLGL  SVKRLMMYQQGC AG  +LRLAKDLAENNKGARVL
Sbjct  128   VFCTTSGVDMPGADYQLTKLLGLRPSVKRLMMYQQGCFAGGTVLRLAKDLAENNKGARVL  187

Query  646   VVCSEVMLNVFRGPSLEQEDNLLAQCLFGDGSAAVIVGTEPRPGLETPLFELVSAAQTTI  825
             VVCSE+    FRGPS    D+L+ Q LFGDG+AAVI+G +P P +E PLFELVSAAQT +
Sbjct  188   VVCSEITAVTFRGPSDTHLDSLVGQALFGDGAAAVIIGADPVPEVEKPLFELVSAAQTIL  247

Query  826   PDTDSHLKLHLREMGLTFHCSKAVPSLITQNVEDCLVKAFEPFGISDWNSIFWILHPGGI  1005
             PD+D  +  HLRE+GLTFH  K VP LI++N+E  L +AF+P GISDWNS+FWI HPGG 
Sbjct  248   PDSDGAIDGHLREVGLTFHLLKDVPGLISKNIEKSLNEAFKPIGISDWNSLFWIAHPGGP  307

Query  1006  AILDRVEEKLGLEPEKLRASKDVLSEYGNLTSACVLFILDEMRKKSKKDEEMTTGEGLEW  1185
             AILD+VE KL L+PEKL A++ VLS+YGN++SACVLFILDE+R+KS +    TTGEGLEW
Sbjct  308   AILDQVEAKLALKPEKLEATRQVLSDYGNMSSACVLFILDEVRRKSAEKGLETTGEGLEW  367

Query  1186  GVVFVVCP  1209
             GV+F   P
Sbjct  368   GVLFGFGP  375



>gb|ABE03648.1| chalcone synthase [Solms-laubachia xerophyta]
Length=389

 Score =   526 bits (1355),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 250/369 (68%), Positives = 303/369 (82%), Gaps = 1/369 (0%)
 Frame = +1

Query  106   RRAKRFEGDAKILAIGTAIPANWVDQTTYPDFYFRITNSEHLLEHKEKFRRICNKSKIRK  285
             R+A+R +G A ILAIGTA PAN V Q+ YPD+YFRITNSEH+ + KEKF+R+C+KS IRK
Sbjct  12    RKAQRADGPAGILAIGTANPANHVIQSEYPDYYFRITNSEHMTDLKEKFQRMCDKSMIRK  71

Query  286   RHLVITEELLKKNPNLCTYNEASLNTRQDILVSEVPKLGKEAAMKAIKEWGRPISEITHL  465
             RH+ +TEE LK+NPN+C Y   SL+ RQDI+V EVPKLGKEAA++AIKEWG+P S+ITHL
Sbjct  72    RHMHLTEEFLKENPNMCAYMAPSLDARQDIVVVEVPKLGKEAAVRAIKEWGQPKSKITHL  131

Query  466   VFCTSSGVDMPGADFQLAKLLGLSSSVKRLMMYQQGCNAGAAMLRLAKDLAENNKGARVL  645
             VFCT+SGVDMPGAD+QL KLLGL  SVKRLMMYQQGC AG  +LRLAKDLAENN+GARVL
Sbjct  132   VFCTTSGVDMPGADYQLTKLLGLRPSVKRLMMYQQGCFAGGTVLRLAKDLAENNRGARVL  191

Query  646   VVCSEVMLNVFRGPSLEQEDNLLAQCLFGDGSAAVIVGTEPRPGL-ETPLFELVSAAQTT  822
             VVCSE+    FRGPS    D+L+ Q LF DG+AA+IVG++P   + E P+FE+VSAAQT 
Sbjct  192   VVCSEITAVTFRGPSDTHLDSLVGQALFSDGAAALIVGSDPDTSVGEKPIFEMVSAAQTI  251

Query  823   IPDTDSHLKLHLREMGLTFHCSKAVPSLITQNVEDCLVKAFEPFGISDWNSIFWILHPGG  1002
             +PD+D  +  HLRE+GLTFH  K VP LI++N+E  L +AF+P GISDWNS+FWI HPGG
Sbjct  252   LPDSDGAIDGHLREVGLTFHLLKDVPGLISKNIEKSLEEAFKPLGISDWNSLFWIAHPGG  311

Query  1003  IAILDRVEEKLGLEPEKLRASKDVLSEYGNLTSACVLFILDEMRKKSKKDEEMTTGEGLE  1182
              AILD+VE KLGL+ EK+RA++ VLSEYGN++SACVLFILDEMRKKS +D   TTGEGLE
Sbjct  312   PAILDQVEIKLGLKAEKMRATRHVLSEYGNMSSACVLFILDEMRKKSAEDSVATTGEGLE  371

Query  1183  WGVVFVVCP  1209
             WGV+F   P
Sbjct  372   WGVLFGFGP  380



>sp|O22045.1|CHSD_IPONI RecName: Full=Chalcone synthase D; AltName: Full=Naringenin-chalcone 
synthase D; Short=CHS-D [Ipomoea nil]
 dbj|BAA21787.1| chalcone synthase [Ipomoea nil]
 dbj|BAA87336.1| chalcone synthase [Ipomoea nil]
 dbj|BAH28850.1| chalcone synthase [Ipomoea nil]
 dbj|BAH28851.1| chalcone synthase [Ipomoea nil]
Length=388

 Score =   526 bits (1355),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 248/368 (67%), Positives = 301/368 (82%), Gaps = 1/368 (0%)
 Frame = +1

Query  106   RRAKRFEGDAKILAIGTAIPANWVDQTTYPDFYFRITNSEHLLEHKEKFRRICNKSKIRK  285
             R+A+R EG A ILAIGTA PAN VDQ+TYPD+YFRITNS+H+ + K+KF+R+C+KS I K
Sbjct  8     RKAQRAEGPATILAIGTATPANCVDQSTYPDYYFRITNSDHMTDLKQKFQRMCDKSMITK  67

Query  286   RHLVITEELLKKNPNLCTYNEASLNTRQDILVSEVPKLGKEAAMKAIKEWGRPISEITHL  465
             R++ +TEE+LK+NP+ C Y   SL+ RQDI+V EVPKLGKEAA  AIKEWG+P S+ITH+
Sbjct  68    RYMHLTEEILKENPSFCEYMAPSLDARQDIVVVEVPKLGKEAAQSAIKEWGQPKSKITHV  127

Query  466   VFCTSSGVDMPGADFQLAKLLGLSSSVKRLMMYQQGCNAGAAMLRLAKDLAENNKGARVL  645
             +FCT+SGVDMPGAD+QL KLLGL  SVKRLMMYQQGC AG  +LR+AKDLAENNK ARVL
Sbjct  128   IFCTTSGVDMPGADYQLTKLLGLRPSVKRLMMYQQGCFAGGTVLRVAKDLAENNKAARVL  187

Query  646   VVCSEVMLNVFRGPSLEQEDNLLAQCLFGDGSAAVIVGTEPRPGLETPLFELVSAAQTTI  825
             VVCSE+ +  FRGP+    D+L+ Q LFGDG+AA+IVG++P P  E PLF+LVSAAQT  
Sbjct  188   VVCSEITVVTFRGPNETHLDSLVGQALFGDGAAAIIVGSDPTPA-EKPLFQLVSAAQTLA  246

Query  826   PDTDSHLKLHLREMGLTFHCSKAVPSLITQNVEDCLVKAFEPFGISDWNSIFWILHPGGI  1005
             PD+   +  HLRE+GLTFH  K VPS+++ N+E CL +AF P GISDWNSIFWI HPGG 
Sbjct  247   PDSCGAIDGHLREVGLTFHLLKDVPSIVSNNIEKCLSEAFNPLGISDWNSIFWIAHPGGP  306

Query  1006  AILDRVEEKLGLEPEKLRASKDVLSEYGNLTSACVLFILDEMRKKSKKDEEMTTGEGLEW  1185
             AILD+VE+KLGL+PEKLRA++ VLSEYGN++SACVLFILDEMRK S  D   TTGEGLEW
Sbjct  307   AILDQVEDKLGLKPEKLRATRHVLSEYGNMSSACVLFILDEMRKASSNDGLGTTGEGLEW  366

Query  1186  GVVFVVCP  1209
             GV+F   P
Sbjct  367   GVLFGFGP  374



>dbj|BAB20074.1| chalcone synthase [Torenia hybrid cultivar]
Length=388

 Score =   526 bits (1355),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 248/368 (67%), Positives = 302/368 (82%), Gaps = 1/368 (0%)
 Frame = +1

Query  106   RRAKRFEGDAKILAIGTAIPANWVDQTTYPDFYFRITNSEHLLEHKEKFRRICNKSKIRK  285
             RRA+R EG A ILAIGT+ PAN VDQ+TYPD+YFRITNSEH+ E KEKF+R+C KS I+K
Sbjct  8     RRAQRAEGPATILAIGTSTPANCVDQSTYPDYYFRITNSEHMTELKEKFKRMCEKSMIKK  67

Query  286   RHLVITEELLKKNPNLCTYNEASLNTRQDILVSEVPKLGKEAAMKAIKEWGRPISEITHL  465
             R++ +TE+ LK+NPN+C Y   SL+ RQDI+V EVPKLGKEAA KAIKEWG+P S+ITHL
Sbjct  68    RYMHLTEDYLKENPNVCAYMAPSLDARQDIVVVEVPKLGKEAAQKAIKEWGQPKSKITHL  127

Query  466   VFCTSSGVDMPGADFQLAKLLGLSSSVKRLMMYQQGCNAGAAMLRLAKDLAENNKGARVL  645
             +FCT+SGVDMPGAD+QL KLLGL  SVKR MMYQQGC AG  +LR+AKDLAENN GARVL
Sbjct  128   IFCTTSGVDMPGADYQLTKLLGLRPSVKRFMMYQQGCFAGGTVLRMAKDLAENNAGARVL  187

Query  646   VVCSEVMLNVFRGPSLEQEDNLLAQCLFGDGSAAVIVGTEPRPGLETPLFELVSAAQTTI  825
             VVCSE+    FRGPS    D+L+ Q LFGDG+AAVIVG++P   +E PLF++VSAAQT +
Sbjct  188   VVCSEITAVTFRGPSESHLDSLVGQALFGDGAAAVIVGSDPM-SVERPLFQMVSAAQTIL  246

Query  826   PDTDSHLKLHLREMGLTFHCSKAVPSLITQNVEDCLVKAFEPFGISDWNSIFWILHPGGI  1005
             PD++  +  HLRE+GLTFH  K VP +I++N+E  L +AF+P GISDWNSIFW  HPGG 
Sbjct  247   PDSEGAIDGHLREVGLTFHLLKDVPGIISKNIEKSLKEAFDPLGISDWNSIFWNAHPGGP  306

Query  1006  AILDRVEEKLGLEPEKLRASKDVLSEYGNLTSACVLFILDEMRKKSKKDEEMTTGEGLEW  1185
             AILD+VEEKLGL+P+KLRA++ VLSEYGN++SACVLFILDEMRK S K+   +TGEGL+W
Sbjct  307   AILDQVEEKLGLKPDKLRATRTVLSEYGNMSSACVLFILDEMRKASAKEGLGSTGEGLDW  366

Query  1186  GVVFVVCP  1209
             GV+F   P
Sbjct  367   GVLFGFGP  374



>gb|AAX16494.1| chalcone synthase [Pyrus communis]
Length=391

 Score =   526 bits (1355),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 246/368 (67%), Positives = 302/368 (82%), Gaps = 0/368 (0%)
 Frame = +1

Query  106   RRAKRFEGDAKILAIGTAIPANWVDQTTYPDFYFRITNSEHLLEHKEKFRRICNKSKIRK  285
             R+A+R EG A ++AIGT+ P+N VDQ TYPD+YFRITNSEH +E KEKF+R+C+KS I+K
Sbjct  8     RKAQRAEGPATVMAIGTSTPSNCVDQATYPDYYFRITNSEHKVELKEKFQRMCDKSMIKK  67

Query  286   RHLVITEELLKKNPNLCTYNEASLNTRQDILVSEVPKLGKEAAMKAIKEWGRPISEITHL  465
             R++ +TEE+LK+NP++C Y   S++ RQD++V EVPKLGKEAA KAIKEWG+P S+ITHL
Sbjct  68    RYMYLTEEILKENPSVCEYMAPSIDARQDMVVVEVPKLGKEAATKAIKEWGQPKSKITHL  127

Query  466   VFCTSSGVDMPGADFQLAKLLGLSSSVKRLMMYQQGCNAGAAMLRLAKDLAENNKGARVL  645
             VFCT+SGVDMPGAD+QL KLLGL  SVKRLMMYQQGC AG  +LRLAKDLAENNKGARVL
Sbjct  128   VFCTTSGVDMPGADYQLTKLLGLRPSVKRLMMYQQGCFAGGTVLRLAKDLAENNKGARVL  187

Query  646   VVCSEVMLNVFRGPSLEQEDNLLAQCLFGDGSAAVIVGTEPRPGLETPLFELVSAAQTTI  825
             VVCSE+    FRGPS    D+L+ Q LFGDG+AAVI+G +P P +E PLFELVS AQT +
Sbjct  188   VVCSEITAVTFRGPSDTHLDSLVGQALFGDGAAAVIIGADPVPEVEKPLFELVSTAQTIL  247

Query  826   PDTDSHLKLHLREMGLTFHCSKAVPSLITQNVEDCLVKAFEPFGISDWNSIFWILHPGGI  1005
             PD+D  +  HLRE+GLTFH  K VP LI++N+E  L +AF+P GISDWNS+FWI HPGG 
Sbjct  248   PDSDGAIDGHLREVGLTFHLLKDVPGLISKNIEKSLNEAFKPIGISDWNSLFWIAHPGGP  307

Query  1006  AILDRVEEKLGLEPEKLRASKDVLSEYGNLTSACVLFILDEMRKKSKKDEEMTTGEGLEW  1185
             AILD+VE KL L+PEKL A++ VLS+YGN++SACVLFILDE+R+KS +    TTGEGLEW
Sbjct  308   AILDQVEAKLALKPEKLEATRQVLSDYGNMSSACVLFILDEVRRKSAEKGLKTTGEGLEW  367

Query  1186  GVVFVVCP  1209
             GV+F   P
Sbjct  368   GVLFGFGP  375



>gb|AAK39111.1|AF358655_1 chalcone synthase [Ipomoea purpurea]
 gb|AAK39115.1|AF358659_1 chalcone synthase [Ipomoea purpurea]
 dbj|BAA20387.1| chalcone synthase [Ipomoea purpurea]
 dbj|BAA36224.1| chalcone synthase [Ipomoea purpurea]
Length=388

 Score =   526 bits (1355),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 248/368 (67%), Positives = 302/368 (82%), Gaps = 1/368 (0%)
 Frame = +1

Query  106   RRAKRFEGDAKILAIGTAIPANWVDQTTYPDFYFRITNSEHLLEHKEKFRRICNKSKIRK  285
             R+A+R EG A ILAIGTA PAN VDQ+TYPD+YFRIT S+H+ + K+KF+R+C+KS I K
Sbjct  8     RKAQRAEGPATILAIGTATPANCVDQSTYPDYYFRITKSDHMTDLKQKFQRMCDKSMITK  67

Query  286   RHLVITEELLKKNPNLCTYNEASLNTRQDILVSEVPKLGKEAAMKAIKEWGRPISEITHL  465
             R++ +TEE+LK+NP+ C Y   SL+ RQDI+V EVPKLGKEAA  AIKEWG+P S+ITH+
Sbjct  68    RYMHLTEEILKENPSFCEYMAPSLDARQDIVVVEVPKLGKEAAQSAIKEWGQPKSKITHV  127

Query  466   VFCTSSGVDMPGADFQLAKLLGLSSSVKRLMMYQQGCNAGAAMLRLAKDLAENNKGARVL  645
             +FCT+SGVDMPGAD+QL KLLGL  SVKRLMMYQQGC AG  +LR+AKDLAENNKGARVL
Sbjct  128   IFCTTSGVDMPGADYQLTKLLGLRPSVKRLMMYQQGCFAGGTVLRVAKDLAENNKGARVL  187

Query  646   VVCSEVMLNVFRGPSLEQEDNLLAQCLFGDGSAAVIVGTEPRPGLETPLFELVSAAQTTI  825
             VVCSE+ +  FRGP+    D+L+ Q LFGDG+AA+IVG++P P +E PLF+LVSAAQT  
Sbjct  188   VVCSEITVVTFRGPNETHLDSLVGQALFGDGAAAIIVGSDPTP-VEKPLFQLVSAAQTLA  246

Query  826   PDTDSHLKLHLREMGLTFHCSKAVPSLITQNVEDCLVKAFEPFGISDWNSIFWILHPGGI  1005
             PD+   +  HLRE+GLTFH  K VPS+++ N+E CL +AF P GISDWNSIFWI HPGG 
Sbjct  247   PDSCGAIDGHLREVGLTFHLLKDVPSIVSNNIEKCLSEAFNPLGISDWNSIFWIAHPGGP  306

Query  1006  AILDRVEEKLGLEPEKLRASKDVLSEYGNLTSACVLFILDEMRKKSKKDEEMTTGEGLEW  1185
             AILD+VE+KLGL+PEKLRA++ VLSEYGN++SACVLFILDEMRK S  D   TTGEGLEW
Sbjct  307   AILDQVEDKLGLKPEKLRATRHVLSEYGNMSSACVLFILDEMRKASSNDGLGTTGEGLEW  366

Query  1186  GVVFVVCP  1209
             GV+F   P
Sbjct  367   GVLFGFGP  374



>gb|AFX71920.1| CHS2 chalcone synthase [Malus domestica]
Length=389

 Score =   526 bits (1355),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 248/368 (67%), Positives = 299/368 (81%), Gaps = 0/368 (0%)
 Frame = +1

Query  106   RRAKRFEGDAKILAIGTAIPANWVDQTTYPDFYFRITNSEHLLEHKEKFRRICNKSKIRK  285
             R+A+R EG A +LAIGTA P+N VDQ TYPD+YFRITNSEH  E KEKF+R+C+KS I+K
Sbjct  8     RKAQRAEGPATVLAIGTATPSNCVDQATYPDYYFRITNSEHKTELKEKFQRMCDKSMIKK  67

Query  286   RHLVITEELLKKNPNLCTYNEASLNTRQDILVSEVPKLGKEAAMKAIKEWGRPISEITHL  465
             R++ +TEE+LK+NP +C Y   SL+ RQD++V EVP+LGKEAA KAIKEWG+P S+ITHL
Sbjct  68    RYMYLTEEILKENPTVCEYMAPSLDARQDMVVVEVPRLGKEAATKAIKEWGQPKSKITHL  127

Query  466   VFCTSSGVDMPGADFQLAKLLGLSSSVKRLMMYQQGCNAGAAMLRLAKDLAENNKGARVL  645
             VFCT+SGVDMPGAD+QL KLLGL   VKRLMMYQQGC AG  +LRLAKDLAENNKGARVL
Sbjct  128   VFCTTSGVDMPGADYQLTKLLGLRPYVKRLMMYQQGCFAGGTVLRLAKDLAENNKGARVL  187

Query  646   VVCSEVMLNVFRGPSLEQEDNLLAQCLFGDGSAAVIVGTEPRPGLETPLFELVSAAQTTI  825
             VVCSE+    FRGPS    D+L+ Q LFGDG+AAVI+G +P P +E PLFELVSAAQT +
Sbjct  188   VVCSEITAVTFRGPSDTHLDSLVGQALFGDGAAAVIIGADPLPEVEKPLFELVSAAQTIL  247

Query  826   PDTDSHLKLHLREMGLTFHCSKAVPSLITQNVEDCLVKAFEPFGISDWNSIFWILHPGGI  1005
             PD+D  +  HLRE+GLTFH  K VP LI++N+E  L +AF+P GISDWNS+FWI HPGG 
Sbjct  248   PDSDGAIDGHLREVGLTFHLLKDVPGLISKNIEKSLNEAFKPIGISDWNSLFWIAHPGGP  307

Query  1006  AILDRVEEKLGLEPEKLRASKDVLSEYGNLTSACVLFILDEMRKKSKKDEEMTTGEGLEW  1185
             AILD+VE KL L+PEKL A++ VLS YGN++SACVLFILDE+R+KS +    TTGEGLEW
Sbjct  308   AILDQVESKLALKPEKLEATRQVLSNYGNMSSACVLFILDEVRRKSTEKGLRTTGEGLEW  367

Query  1186  GVVFVVCP  1209
             GV+F   P
Sbjct  368   GVLFGFGP  375



>emb|CAA32731.1| chalcone synthase [Petunia x hybrida]
Length=389

 Score =   526 bits (1354),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 247/368 (67%), Positives = 302/368 (82%), Gaps = 0/368 (0%)
 Frame = +1

Query  106   RRAKRFEGDAKILAIGTAIPANWVDQTTYPDFYFRITNSEHLLEHKEKFRRICNKSKIRK  285
             R+A+R EG A ++AIGTA P N VDQ+TYPD+YFRITNSEH  + KEKF+R+C KS I+K
Sbjct  8     RKAQRAEGPATVMAIGTATPTNCVDQSTYPDYYFRITNSEHKTDLKEKFKRMCEKSMIKK  67

Query  286   RHLVITEELLKKNPNLCTYNEASLNTRQDILVSEVPKLGKEAAMKAIKEWGRPISEITHL  465
             R++ +TEE+LK+NP++C Y   SL+ RQDI+V EVPKLGKEAA KAIKEWG+P S+ITHL
Sbjct  68    RYMHLTEEILKENPSMCEYMAPSLDARQDIVVVEVPKLGKEAAQKAIKEWGQPKSKITHL  127

Query  466   VFCTSSGVDMPGADFQLAKLLGLSSSVKRLMMYQQGCNAGAAMLRLAKDLAENNKGARVL  645
              FCT+SGVDMPG D+QL KLLGL  SVKRLMMYQQGC AG  +LRLAKDLAENNKGARVL
Sbjct  128   FFCTTSGVDMPGCDYQLTKLLGLRPSVKRLMMYQQGCFAGGTVLRLAKDLAENNKGARVL  187

Query  646   VVCSEVMLNVFRGPSLEQEDNLLAQCLFGDGSAAVIVGTEPRPGLETPLFELVSAAQTTI  825
             VVCSE+    FRGP+    D+L+ Q LFGDG+ A+I+G++P PG+E PLFELVSAAQT +
Sbjct  188   VVCSEITAVTFRGPNDTHLDSLVGQALFGDGAGAIIIGSDPIPGVERPLFELVSAAQTLL  247

Query  826   PDTDSHLKLHLREMGLTFHCSKAVPSLITQNVEDCLVKAFEPFGISDWNSIFWILHPGGI  1005
             PD+   +  HLRE+GLTFH  K VP LI++N+E  L +AF+P GISDWNS+FWI HPGG 
Sbjct  248   PDSHGAIDGHLREVGLTFHLLKDVPGLISKNIEKSLEEAFKPLGISDWNSLFWIAHPGGP  307

Query  1006  AILDRVEEKLGLEPEKLRASKDVLSEYGNLTSACVLFILDEMRKKSKKDEEMTTGEGLEW  1185
             AILD+VE KLGL+PEKL+A+++VLS+YGN++SACVLFILDEMRK S K+   TTGEGLEW
Sbjct  308   AILDQVEIKLGLKPEKLKATRNVLSDYGNMSSACVLFILDEMRKASAKEGLGTTGEGLEW  367

Query  1186  GVVFVVCP  1209
             GV+F   P
Sbjct  368   GVLFGFGP  375



>sp|P48392.1|CHS3_GERHY RecName: Full=Chalcone synthase 3; AltName: Full=Naringenin-chalcone 
synthase 3 [Gerbera hybrid cultivar]
 emb|CAA86220.1| chalcone synthase [Gerbera hybrid cultivar]
Length=403

 Score =   526 bits (1356),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 253/382 (66%), Positives = 307/382 (80%), Gaps = 1/382 (0%)
 Frame = +1

Query  64    MSTTVTVLTDTCRSRRAKRFEGDAKILAIGTAIPANWVDQTTYPDFYFRITNSEHLLEHK  243
             M+T+  V+ D    R+A+R EG A ILAIGTA PAN V Q  YPD+YFR+T SEH+++ K
Sbjct  1     MATSPAVI-DVETIRKAQRAEGPATILAIGTATPANCVYQADYPDYYFRVTESEHMVDLK  59

Query  244   EKFRRICNKSKIRKRHLVITEELLKKNPNLCTYNEASLNTRQDILVSEVPKLGKEAAMKA  423
             EKF+R+C+KS IRKR++ ITEE LK+NP++C +   SL+ RQD++V EVPKLGKEAA KA
Sbjct  60    EKFQRMCDKSMIRKRYMHITEEFLKENPSMCKFMAPSLDARQDLVVVEVPKLGKEAATKA  119

Query  424   IKEWGRPISEITHLVFCTSSGVDMPGADFQLAKLLGLSSSVKRLMMYQQGCNAGAAMLRL  603
             IKEWG P S+ITHLVFCT+SGVDMPGAD+QL KLLGL  SVKRLMMYQQGC AG  +LRL
Sbjct  120   IKEWGFPKSKITHLVFCTTSGVDMPGADYQLTKLLGLRPSVKRLMMYQQGCFAGGTVLRL  179

Query  604   AKDLAENNKGARVLVVCSEVMLNVFRGPSLEQEDNLLAQCLFGDGSAAVIVGTEPRPGLE  783
             AKDLAENNKGARVLVVCSE+    FRGP+    D+L+ Q LFGDG+AAVI+G++P   +E
Sbjct  180   AKDLAENNKGARVLVVCSEITAVTFRGPNEGHLDSLVGQALFGDGAAAVIIGSDPDLSVE  239

Query  784   TPLFELVSAAQTTIPDTDSHLKLHLREMGLTFHCSKAVPSLITQNVEDCLVKAFEPFGIS  963
              PLFE+VSAAQT +PD++  +  HL+E+GLTFH  K VP+LI +N+E  L++AF P  I+
Sbjct  240   RPLFEMVSAAQTILPDSEGAIDGHLKEVGLTFHLLKDVPALIAKNIEKALIQAFSPLNIN  299

Query  964   DWNSIFWILHPGGIAILDRVEEKLGLEPEKLRASKDVLSEYGNLTSACVLFILDEMRKKS  1143
             DWNSIFWI HPGG AILD+VE KLGL  EKLRAS+ VLSEYGN++SACVLFILDEMRKKS
Sbjct  300   DWNSIFWIAHPGGPAILDQVEFKLGLREEKLRASRHVLSEYGNMSSACVLFILDEMRKKS  359

Query  1144  KKDEEMTTGEGLEWGVVFVVCP  1209
              KD + TTGEGLEWGV+F   P
Sbjct  360   IKDGKTTTGEGLEWGVLFGFGP  381



>ref|XP_009421018.1| PREDICTED: chalcone synthase 2-like [Musa acuminata subsp. malaccensis]
Length=392

 Score =   526 bits (1355),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 244/368 (66%), Positives = 299/368 (81%), Gaps = 0/368 (0%)
 Frame = +1

Query  106   RRAKRFEGDAKILAIGTAIPANWVDQTTYPDFYFRITNSEHLLEHKEKFRRICNKSKIRK  285
             R+++R EG A +LAIGTA P N + Q  YPD+YFRIT SEHL E KEKF+R+C+KS IRK
Sbjct  8     RQSQRAEGSATVLAIGTATPVNVLYQADYPDYYFRITKSEHLTELKEKFKRMCDKSMIRK  67

Query  286   RHLVITEELLKKNPNLCTYNEASLNTRQDILVSEVPKLGKEAAMKAIKEWGRPISEITHL  465
             R++ I EE+LK+NPN+C Y   SL+ RQDI+V EVPKLGKEAA+KAIKEWG+P S+ITHL
Sbjct  68    RYMHINEEILKENPNVCAYMAPSLDARQDIVVVEVPKLGKEAAVKAIKEWGQPKSKITHL  127

Query  466   VFCTSSGVDMPGADFQLAKLLGLSSSVKRLMMYQQGCNAGAAMLRLAKDLAENNKGARVL  645
             VFCT+SGVDMPGAD+QL KLLGL  SV R MMYQQGC AG  +LR+AKDLAENN+GARVL
Sbjct  128   VFCTTSGVDMPGADYQLTKLLGLRPSVNRFMMYQQGCFAGGTVLRMAKDLAENNRGARVL  187

Query  646   VVCSEVMLNVFRGPSLEQEDNLLAQCLFGDGSAAVIVGTEPRPGLETPLFELVSAAQTTI  825
             VVCSE+    FRGPS    D+L+ Q LFGDG+AA+IVG +P P  E P+F+LVSA+QT +
Sbjct  188   VVCSEITAVTFRGPSESHLDSLVGQALFGDGAAAIIVGADPDPATEKPIFQLVSASQTIL  247

Query  826   PDTDSHLKLHLREMGLTFHCSKAVPSLITQNVEDCLVKAFEPFGISDWNSIFWILHPGGI  1005
             PD++  +  HLRE+GLTFH  K VP LI++N+E  L +AF+P GISDWNSIFWI HPGG 
Sbjct  248   PDSEGAIDGHLREVGLTFHLLKDVPGLISKNIERSLAEAFKPLGISDWNSIFWIAHPGGP  307

Query  1006  AILDRVEEKLGLEPEKLRASKDVLSEYGNLTSACVLFILDEMRKKSKKDEEMTTGEGLEW  1185
             AILD+VE KLGLE EK++A+++VL EYGN++SACVLFILDEMRK+S +D + TTGEGLEW
Sbjct  308   AILDQVEAKLGLEKEKMKATREVLKEYGNMSSACVLFILDEMRKRSAEDGKATTGEGLEW  367

Query  1186  GVVFVVCP  1209
             GV+F   P
Sbjct  368   GVLFGFGP  375



>gb|AAK39114.1|AF358658_1 chalcone synthase [Ipomoea purpurea]
Length=388

 Score =   526 bits (1354),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 247/368 (67%), Positives = 303/368 (82%), Gaps = 1/368 (0%)
 Frame = +1

Query  106   RRAKRFEGDAKILAIGTAIPANWVDQTTYPDFYFRITNSEHLLEHKEKFRRICNKSKIRK  285
             R+A+R EG A ILAIGTA PAN VDQ+TYPD+YFRIT S+H+ + K+KF+R+C+KS I K
Sbjct  8     RKAQRAEGPATILAIGTATPANCVDQSTYPDYYFRITKSDHMTDLKQKFQRMCDKSMITK  67

Query  286   RHLVITEELLKKNPNLCTYNEASLNTRQDILVSEVPKLGKEAAMKAIKEWGRPISEITHL  465
             R++ +TEE+LK+NP+ C Y   SL+ RQDI+V EVPKLGKEAA  AIKEWG+P S+ITH+
Sbjct  68    RYMHLTEEILKENPSFCEYMAPSLDARQDIVVVEVPKLGKEAAQSAIKEWGQPKSKITHV  127

Query  466   VFCTSSGVDMPGADFQLAKLLGLSSSVKRLMMYQQGCNAGAAMLRLAKDLAENNKGARVL  645
             +FCT+SGVDMPGAD+QL KLLGL  SVKRLMMYQQGC AG  +LR+AKDLAENNKGARVL
Sbjct  128   IFCTTSGVDMPGADYQLTKLLGLRPSVKRLMMYQQGCFAGGTVLRVAKDLAENNKGARVL  187

Query  646   VVCSEVMLNVFRGPSLEQEDNLLAQCLFGDGSAAVIVGTEPRPGLETPLFELVSAAQTTI  825
             VVCSE+ +  FRGP+    D+L+ Q LFGDG+AA+IVG++P P +E PLF+LVSAAQT  
Sbjct  188   VVCSEITVVTFRGPNETHLDSLVGQALFGDGAAAIIVGSDPTP-VEKPLFQLVSAAQTLA  246

Query  826   PDTDSHLKLHLREMGLTFHCSKAVPSLITQNVEDCLVKAFEPFGISDWNSIFWILHPGGI  1005
             PD+   +  HLRE+GLTFH  K VPS+++ N+E CL +AF P GISDWNSIFWI HPGG 
Sbjct  247   PDSCGAIDGHLREVGLTFHLLKDVPSIVSNNIEKCLSEAFNPLGISDWNSIFWIAHPGGP  306

Query  1006  AILDRVEEKLGLEPEKLRASKDVLSEYGNLTSACVLFILDEMRKKSKKDEEMTTGEGLEW  1185
             AILD+VE+KLGL+PEKLRA++ VLSEYGN++SACVLFILDEMRK +  D   TTGEGLEW
Sbjct  307   AILDQVEDKLGLKPEKLRATRHVLSEYGNMSSACVLFILDEMRKAASNDGLGTTGEGLEW  366

Query  1186  GVVFVVCP  1209
             GV+F + P
Sbjct  367   GVLFGLGP  374



>gb|ABF68913.1| chalcone synthase, partial [Cardamine asarifolia]
Length=387

 Score =   526 bits (1354),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 249/369 (67%), Positives = 302/369 (82%), Gaps = 1/369 (0%)
 Frame = +1

Query  106   RRAKRFEGDAKILAIGTAIPANWVDQTTYPDFYFRITNSEHLLEHKEKFRRICNKSKIRK  285
             R+A+R +G A ILAIGTA PAN+V Q  YPD+YFRITNSEH+ + KEKF+R+C+KS IRK
Sbjct  13    RKAQRADGPAGILAIGTANPANYVIQAEYPDYYFRITNSEHMTDLKEKFKRMCDKSTIRK  72

Query  286   RHLVITEELLKKNPNLCTYNEASLNTRQDILVSEVPKLGKEAAMKAIKEWGRPISEITHL  465
             RH+ +TEE LK+NPN+C Y   SL+ RQDI+V EVPKLGKEAA+KAIKEWG+P S+ITHL
Sbjct  73    RHMHVTEEFLKENPNMCAYMAPSLDARQDIVVVEVPKLGKEAAVKAIKEWGQPKSKITHL  132

Query  466   VFCTSSGVDMPGADFQLAKLLGLSSSVKRLMMYQQGCNAGAAMLRLAKDLAENNKGARVL  645
             VFCT+SGVDMPGAD+QL KLLGL  SVKRLMMYQQGC AG  +LRLAKDL+ENN+GARVL
Sbjct  133   VFCTTSGVDMPGADYQLTKLLGLRPSVKRLMMYQQGCFAGGTVLRLAKDLSENNRGARVL  192

Query  646   VVCSEVMLNVFRGPSLEQEDNLLAQCLFGDGSAAVIVGTEPRPGL-ETPLFELVSAAQTT  822
             VVCSE+    FRGPS    D+L+ Q LF DG+AA+IVG++P   + E P+FE+VSAAQT 
Sbjct  193   VVCSEITAVTFRGPSDTHLDSLVGQALFSDGAAALIVGSDPDTSVGEKPIFEMVSAAQTI  252

Query  823   IPDTDSHLKLHLREMGLTFHCSKAVPSLITQNVEDCLVKAFEPFGISDWNSIFWILHPGG  1002
             +PD+D  +  HLRE+GLTFH  K VP LI++N+E  L +AF+P GISDWNS+FWI HPGG
Sbjct  253   LPDSDGAIDGHLREVGLTFHLLKDVPGLISKNIEKSLDEAFKPLGISDWNSLFWIAHPGG  312

Query  1003  IAILDRVEEKLGLEPEKLRASKDVLSEYGNLTSACVLFILDEMRKKSKKDEEMTTGEGLE  1182
              AILD+VE KLGL+ EK+RA++ V+ EYGN++SACVLFILDEMRKKS KD   TTGEGLE
Sbjct  313   PAILDQVEIKLGLKEEKMRATRHVMREYGNMSSACVLFILDEMRKKSAKDGVATTGEGLE  372

Query  1183  WGVVFVVCP  1209
             WGV+F   P
Sbjct  373   WGVLFGFGP  381



>gb|ABE03661.1| chalcone synthase [Solms-laubachia minor]
Length=382

 Score =   526 bits (1354),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 250/369 (68%), Positives = 303/369 (82%), Gaps = 1/369 (0%)
 Frame = +1

Query  106   RRAKRFEGDAKILAIGTAIPANWVDQTTYPDFYFRITNSEHLLEHKEKFRRICNKSKIRK  285
             R+A+R +G A ILAIGTA PAN V Q+ YPD+YFRITNSEH+ + KEKF+R+C+KS IRK
Sbjct  12    RKAQRADGPAGILAIGTANPANHVIQSEYPDYYFRITNSEHMTDLKEKFQRMCDKSMIRK  71

Query  286   RHLVITEELLKKNPNLCTYNEASLNTRQDILVSEVPKLGKEAAMKAIKEWGRPISEITHL  465
             RH+ +TEE LK+NPN+C Y   SL+ RQDI+V EVPKLGKEAA++AIKEWG+P S+ITHL
Sbjct  72    RHMHLTEEFLKENPNMCAYMAPSLDARQDIVVVEVPKLGKEAAVRAIKEWGQPKSKITHL  131

Query  466   VFCTSSGVDMPGADFQLAKLLGLSSSVKRLMMYQQGCNAGAAMLRLAKDLAENNKGARVL  645
             VFCT+SGVDMPGAD+QL KLLGL  SVKRLMMYQQGC AG  +LRLAKDLA+NN+GARVL
Sbjct  132   VFCTTSGVDMPGADYQLTKLLGLRPSVKRLMMYQQGCFAGGTVLRLAKDLAZNNRGARVL  191

Query  646   VVCSEVMLNVFRGPSLEQEDNLLAQCLFGDGSAAVIVGTEPRPGL-ETPLFELVSAAQTT  822
             VVCSE+    FRGPS    D+L+ Q LF DG+AA+IVG++P   + E P+FELVSAAQT 
Sbjct  192   VVCSEITAVTFRGPSDTHLDSLVGQALFSDGAAALIVGSDPDTSVGEKPIFELVSAAQTI  251

Query  823   IPDTDSHLKLHLREMGLTFHCSKAVPSLITQNVEDCLVKAFEPFGISDWNSIFWILHPGG  1002
             +PD+D  +  HLRE+GLTFH  K VP LI++N+E  L +AF+P GISDWNS+FWI HPGG
Sbjct  252   LPDSDGAIDGHLREVGLTFHLLKDVPGLISKNIEKSLEEAFKPLGISDWNSLFWIAHPGG  311

Query  1003  IAILDRVEEKLGLEPEKLRASKDVLSEYGNLTSACVLFILDEMRKKSKKDEEMTTGEGLE  1182
              AILD+VE KLGL+ EK+RA++ VLSEYGN++SACVLFILDEMRKKS +D   TTGEGLE
Sbjct  312   PAILDQVEIKLGLKAEKMRATRHVLSEYGNMSSACVLFILDEMRKKSAEDSVATTGEGLE  371

Query  1183  WGVVFVVCP  1209
             WGV+F   P
Sbjct  372   WGVLFGFGP  380



>sp|P13417.1|CHS3_SINAL RecName: Full=Chalcone synthase 3; AltName: Full=Naringenin-chalcone 
synthase 3 [Sinapis alba]
 emb|CAA32495.1| unnamed protein product [Sinapis alba]
Length=395

 Score =   526 bits (1355),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 250/369 (68%), Positives = 302/369 (82%), Gaps = 1/369 (0%)
 Frame = +1

Query  106   RRAKRFEGDAKILAIGTAIPANWVDQTTYPDFYFRITNSEHLLEHKEKFRRICNKSKIRK  285
             R+A+R +G A ILAIGTA PAN V Q  YPD+YFRITNSEH+ + KEKF+R+C+KS IRK
Sbjct  13    RKAQRADGPAGILAIGTANPANHVIQAEYPDYYFRITNSEHMTDLKEKFKRMCDKSTIRK  72

Query  286   RHLVITEELLKKNPNLCTYNEASLNTRQDILVSEVPKLGKEAAMKAIKEWGRPISEITHL  465
             RH+ +TEE LK NPN+C Y   SL+ RQDI+V EVPKLGKEAA+KAIKEWG+P S+ITH+
Sbjct  73    RHMHLTEEFLKDNPNMCAYMAPSLDARQDIVVVEVPKLGKEAAVKAIKEWGQPKSKITHV  132

Query  466   VFCTSSGVDMPGADFQLAKLLGLSSSVKRLMMYQQGCNAGAAMLRLAKDLAENNKGARVL  645
             VFCT+SGVDMPGAD+QL KLLGL  SVKRLMMYQQGC AG  +LRLAKDLAENN+GARVL
Sbjct  133   VFCTTSGVDMPGADYQLTKLLGLRPSVKRLMMYQQGCFAGGTVLRLAKDLAENNRGARVL  192

Query  646   VVCSEVMLNVFRGPSLEQEDNLLAQCLFGDGSAAVIVGTEPRPGL-ETPLFELVSAAQTT  822
             VVCSE+    FRGPS    D+L+ Q LF DG+AA+IVG++P   + E P+FE+VSAAQT 
Sbjct  193   VVCSEITAVTFRGPSDTHLDSLVGQALFSDGAAAIIVGSDPDTSVGEKPIFEMVSAAQTI  252

Query  823   IPDTDSHLKLHLREMGLTFHCSKAVPSLITQNVEDCLVKAFEPFGISDWNSIFWILHPGG  1002
             +PD+D  +  HLRE+GLTFH  K VP LI++N+E  L +AF+P GISDWNS+FWI HPGG
Sbjct  253   LPDSDGAIDGHLREVGLTFHLLKDVPGLISKNIEKSLDEAFKPLGISDWNSLFWIAHPGG  312

Query  1003  IAILDRVEEKLGLEPEKLRASKDVLSEYGNLTSACVLFILDEMRKKSKKDEEMTTGEGLE  1182
              AILD VE+KLGL+ EK+RA++ VLSEYGN++SACVLFILDEMR+KSK+D   TTGEGLE
Sbjct  313   PAILDDVEKKLGLKAEKMRATRHVLSEYGNMSSACVLFILDEMRRKSKEDGVATTGEGLE  372

Query  1183  WGVVFVVCP  1209
             WGV+F   P
Sbjct  373   WGVLFGFGP  381



>gb|ABE03650.1| chalcone synthase [Solms-laubachia lanata]
 gb|ABE03656.1| chalcone synthase [Solms-laubachia baiogoinensis]
 gb|ABE03658.1| chalcone synthase [Solms-laubachia linearis]
Length=390

 Score =   526 bits (1354),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 250/369 (68%), Positives = 303/369 (82%), Gaps = 1/369 (0%)
 Frame = +1

Query  106   RRAKRFEGDAKILAIGTAIPANWVDQTTYPDFYFRITNSEHLLEHKEKFRRICNKSKIRK  285
             R+A+R +G A ILAIGTA PAN V Q+ YPD+YFRITNSEH+ + KEKF+R+C+KS IRK
Sbjct  12    RKAQRADGPAGILAIGTANPANHVIQSEYPDYYFRITNSEHMTDLKEKFQRMCDKSMIRK  71

Query  286   RHLVITEELLKKNPNLCTYNEASLNTRQDILVSEVPKLGKEAAMKAIKEWGRPISEITHL  465
             RH+ +TEE LK+NPN+C Y   SL+ RQDI+V EVPKLGKEAA++AIKEWG+P S+ITHL
Sbjct  72    RHMHLTEEFLKENPNMCAYMAPSLDARQDIVVVEVPKLGKEAAVRAIKEWGQPKSKITHL  131

Query  466   VFCTSSGVDMPGADFQLAKLLGLSSSVKRLMMYQQGCNAGAAMLRLAKDLAENNKGARVL  645
             VFCT+SGVDMPGAD+QL KLLGL  SVKRLMMYQQGC AG  +LRLAKDLAENN+GARVL
Sbjct  132   VFCTTSGVDMPGADYQLTKLLGLRPSVKRLMMYQQGCFAGGTVLRLAKDLAENNRGARVL  191

Query  646   VVCSEVMLNVFRGPSLEQEDNLLAQCLFGDGSAAVIVGTEPRPGL-ETPLFELVSAAQTT  822
             VVCSE+    FRGPS    D+L+ Q LF DG+AA+IVG++P   + E P+FE+VSAAQT 
Sbjct  192   VVCSEITAVTFRGPSDTHLDSLVGQALFSDGAAALIVGSDPDTSVGEKPIFEMVSAAQTI  251

Query  823   IPDTDSHLKLHLREMGLTFHCSKAVPSLITQNVEDCLVKAFEPFGISDWNSIFWILHPGG  1002
             +PD+D  +  HLRE+GLTFH  K VP LI++N+E  L +AF+P GISDWNS+FWI HPGG
Sbjct  252   LPDSDGAIDGHLREVGLTFHLLKDVPGLISKNIEKSLEEAFKPLGISDWNSLFWIAHPGG  311

Query  1003  IAILDRVEEKLGLEPEKLRASKDVLSEYGNLTSACVLFILDEMRKKSKKDEEMTTGEGLE  1182
              AILD+VE KLGL+ EK+RA++ VLSEYGN++SACVLFILDEMRKKS +D   TTGEGLE
Sbjct  312   PAILDQVEIKLGLKAEKMRATRHVLSEYGNMSSACVLFILDEMRKKSAEDSVATTGEGLE  371

Query  1183  WGVVFVVCP  1209
             WGV+F   P
Sbjct  372   WGVLFGFGP  380



>gb|ABE03651.1| chalcone synthase [Solms-laubachia pulcherrima]
Length=390

 Score =   526 bits (1354),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 250/369 (68%), Positives = 303/369 (82%), Gaps = 1/369 (0%)
 Frame = +1

Query  106   RRAKRFEGDAKILAIGTAIPANWVDQTTYPDFYFRITNSEHLLEHKEKFRRICNKSKIRK  285
             R+A+R +G A ILAIGTA PAN V Q+ YPD+YFRITNSEH+ + KEKF+R+C+KS IRK
Sbjct  12    RKAQRADGPAGILAIGTANPANHVIQSEYPDYYFRITNSEHMTDLKEKFQRMCDKSMIRK  71

Query  286   RHLVITEELLKKNPNLCTYNEASLNTRQDILVSEVPKLGKEAAMKAIKEWGRPISEITHL  465
             RH+ +TEE LK+NPN+C Y   SL+ RQDI+V EVPKLGKEAA++AIKEWG+P S+ITHL
Sbjct  72    RHMHLTEEFLKENPNMCAYMAPSLDARQDIVVVEVPKLGKEAAVRAIKEWGQPKSKITHL  131

Query  466   VFCTSSGVDMPGADFQLAKLLGLSSSVKRLMMYQQGCNAGAAMLRLAKDLAENNKGARVL  645
             VFCT+SGVDMPGAD+QL KLLGL  SVKRLMMYQQGC AG  +LRLAKDLAENN+GARVL
Sbjct  132   VFCTTSGVDMPGADYQLTKLLGLRPSVKRLMMYQQGCFAGGTVLRLAKDLAENNRGARVL  191

Query  646   VVCSEVMLNVFRGPSLEQEDNLLAQCLFGDGSAAVIVGTEPRPGL-ETPLFELVSAAQTT  822
             VVCSE+    FRGPS    D+L+ Q LF DG+AA+IVG++P   + E P+FE+VSAAQT 
Sbjct  192   VVCSEITAVTFRGPSDTHLDSLVGQALFSDGAAALIVGSDPDTSVGEKPIFEMVSAAQTI  251

Query  823   IPDTDSHLKLHLREMGLTFHCSKAVPSLITQNVEDCLVKAFEPFGISDWNSIFWILHPGG  1002
             +PD+D  +  HLRE+GLTFH  K VP LI++N+E  L +AF+P GISDWNS+FWI HPGG
Sbjct  252   LPDSDGAIDGHLREVGLTFHLLKDVPGLISKNIEKSLQEAFKPLGISDWNSLFWIAHPGG  311

Query  1003  IAILDRVEEKLGLEPEKLRASKDVLSEYGNLTSACVLFILDEMRKKSKKDEEMTTGEGLE  1182
              AILD+VE KLGL+ EK+RA++ VLSEYGN++SACVLFILDEMRKKS +D   TTGEGLE
Sbjct  312   PAILDQVEIKLGLKAEKMRATRHVLSEYGNMSSACVLFILDEMRKKSAEDSVATTGEGLE  371

Query  1183  WGVVFVVCP  1209
             WGV+F   P
Sbjct  372   WGVLFGFGP  380



>sp|Q9MB41.1|CHS2_IPOBA RecName: Full=Chalcone synthase LF2; AltName: Full=Naringenin-chalcone 
synthase LF2 [Ipomoea batatas]
 dbj|BAA90327.1| chalcone synthase CHS-LF2 [Ipomoea batatas]
Length=393

 Score =   526 bits (1354),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 252/368 (68%), Positives = 298/368 (81%), Gaps = 1/368 (0%)
 Frame = +1

Query  106   RRAKRFEGDAKILAIGTAIPANWVDQTTYPDFYFRITNSEHLLEHKEKFRRICNKSKIRK  285
             R+A+R EG A ILAIGT  PAN V+Q+TYPD+YFRITNSEH  E KEKF+R+C+KS I K
Sbjct  8     RKAQRAEGPATILAIGTVTPANCVNQSTYPDYYFRITNSEHKTELKEKFQRMCDKSMITK  67

Query  286   RHLVITEELLKKNPNLCTYNEASLNTRQDILVSEVPKLGKEAAMKAIKEWGRPISEITHL  465
             R++ +TEE+LK+NP+ C Y   SL+ RQDI V EVPKLGKEAA  AIKEWG+P S+ITH+
Sbjct  68    RYMHLTEEILKENPSFCEYMAPSLDARQDIAVVEVPKLGKEAAQSAIKEWGQPKSKITHV  127

Query  466   VFCTSSGVDMPGADFQLAKLLGLSSSVKRLMMYQQGCNAGAAMLRLAKDLAENNKGARVL  645
             VFCT+SGVDMPGAD+QL KLLGLS SVKRLMMYQQGC AG  +LRLAKDLAENNKGARVL
Sbjct  128   VFCTTSGVDMPGADYQLTKLLGLSPSVKRLMMYQQGCFAGGTVLRLAKDLAENNKGARVL  187

Query  646   VVCSEVMLNVFRGPSLEQEDNLLAQCLFGDGSAAVIVGTEPRPGLETPLFELVSAAQTTI  825
             +VCSE+ +  FRGPS    D+L+ Q LFGDG+AAVIVG +P P  E PLF+LVSAAQT  
Sbjct  188   IVCSEITVVTFRGPSETHLDSLVGQALFGDGAAAVIVGADPTPA-EKPLFQLVSAAQTLA  246

Query  826   PDTDSHLKLHLREMGLTFHCSKAVPSLITQNVEDCLVKAFEPFGISDWNSIFWILHPGGI  1005
             PD+   +  HLRE+GLTFH  K VPS+++ N+E CL +AF P GISDWNS+FWI HPGG 
Sbjct  247   PDSCGAIDGHLREVGLTFHLLKDVPSVVSNNIEKCLFEAFNPLGISDWNSVFWIAHPGGP  306

Query  1006  AILDRVEEKLGLEPEKLRASKDVLSEYGNLTSACVLFILDEMRKKSKKDEEMTTGEGLEW  1185
             AILD+VE+KLGL+PEKLRA++ VLSEYGN++SACVLFILDEMRK S      TTGEGLEW
Sbjct  307   AILDQVEDKLGLKPEKLRATRHVLSEYGNMSSACVLFILDEMRKASSNAGLGTTGEGLEW  366

Query  1186  GVVFVVCP  1209
             GV+F   P
Sbjct  367   GVLFGFGP  374



>gb|ABF68900.1| chalcone synthase, partial [Cardamine asarifolia]
Length=386

 Score =   526 bits (1354),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 249/369 (67%), Positives = 301/369 (82%), Gaps = 1/369 (0%)
 Frame = +1

Query  106   RRAKRFEGDAKILAIGTAIPANWVDQTTYPDFYFRITNSEHLLEHKEKFRRICNKSKIRK  285
             R+A+R +G A I AIGTA PAN+V Q  YPD+YFRITNSEH+ + KEKF+R+C+KS IRK
Sbjct  13    RKAQRADGPAGIFAIGTANPANYVIQAEYPDYYFRITNSEHMTDLKEKFKRMCDKSTIRK  72

Query  286   RHLVITEELLKKNPNLCTYNEASLNTRQDILVSEVPKLGKEAAMKAIKEWGRPISEITHL  465
             RH+ +TEE LK+NPN+C Y   SL+ RQDI+V EVPKLGKEAA+KAIKEWG+P S+ITHL
Sbjct  73    RHMHVTEEFLKENPNMCAYMAPSLDARQDIVVVEVPKLGKEAAVKAIKEWGQPKSKITHL  132

Query  466   VFCTSSGVDMPGADFQLAKLLGLSSSVKRLMMYQQGCNAGAAMLRLAKDLAENNKGARVL  645
             VFCT+SGVDMPGAD+QL KLLGL  SVKRLMMYQQGC AG  +LRLAKDLAENN+GARVL
Sbjct  133   VFCTTSGVDMPGADYQLTKLLGLRPSVKRLMMYQQGCFAGGTVLRLAKDLAENNRGARVL  192

Query  646   VVCSEVMLNVFRGPSLEQEDNLLAQCLFGDGSAAVIVGTEPRPGL-ETPLFELVSAAQTT  822
             VVCSE+    FRGPS    D+L+ Q LF DG+AA+IVG++P   + E P+FE+VSAAQT 
Sbjct  193   VVCSEITAVTFRGPSDTHLDSLVGQALFSDGAAALIVGSDPDTSVGEKPIFEMVSAAQTI  252

Query  823   IPDTDSHLKLHLREMGLTFHCSKAVPSLITQNVEDCLVKAFEPFGISDWNSIFWILHPGG  1002
             +PD+D  +  HLRE+GLTFH  K VP LI++N+E  L +AF+P GISDWNS+FWI HPGG
Sbjct  253   LPDSDGAIDGHLREVGLTFHLLKDVPGLISKNIEKSLDEAFKPLGISDWNSLFWIAHPGG  312

Query  1003  IAILDRVEEKLGLEPEKLRASKDVLSEYGNLTSACVLFILDEMRKKSKKDEEMTTGEGLE  1182
              AILD+VE KLGL+ EK+RA++ V+ EYGN++SACVLFILDEMRKKS KD   TTGEGLE
Sbjct  313   PAILDQVEIKLGLKEEKMRATRHVMREYGNMSSACVLFILDEMRKKSAKDGVATTGEGLE  372

Query  1183  WGVVFVVCP  1209
             WGV+F   P
Sbjct  373   WGVLFGFGP  381



>sp|P51090.1|CHSY_VITVI RecName: Full=Chalcone synthase; AltName: Full=Naringenin-chalcone 
synthase [Vitis vinifera]
 emb|CAA53583.1| chalcone synthase [Vitis vinifera]
 gb|ADG35962.1| chalcone synthase [Vitis hybrid cultivar]
Length=393

 Score =   526 bits (1354),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 250/368 (68%), Positives = 300/368 (82%), Gaps = 0/368 (0%)
 Frame = +1

Query  106   RRAKRFEGDAKILAIGTAIPANWVDQTTYPDFYFRITNSEHLLEHKEKFRRICNKSKIRK  285
             R+A+R EG A +LAIGTA PAN V Q  YPD+YFRITNSEH+ E KEKF+R+C KS I K
Sbjct  8     RKAQRAEGPATVLAIGTATPANCVYQADYPDYYFRITNSEHMTELKEKFKRMCEKSMINK  67

Query  286   RHLVITEELLKKNPNLCTYNEASLNTRQDILVSEVPKLGKEAAMKAIKEWGRPISEITHL  465
             R++ +TEE+LK+NPN+C Y   SL+ RQD++V EVPKLGKEAA KAIKEWG+P S+ITHL
Sbjct  68    RYMHLTEEILKENPNVCAYMAPSLDARQDMVVVEVPKLGKEAAAKAIKEWGQPKSKITHL  127

Query  466   VFCTSSGVDMPGADFQLAKLLGLSSSVKRLMMYQQGCNAGAAMLRLAKDLAENNKGARVL  645
             VFCT+SGVDMPGAD+QL KLLGL  SVKRLMMYQQGC AG  +LRLAKDLAENN G+RVL
Sbjct  128   VFCTTSGVDMPGADYQLTKLLGLKPSVKRLMMYQQGCFAGGTVLRLAKDLAENNAGSRVL  187

Query  646   VVCSEVMLNVFRGPSLEQEDNLLAQCLFGDGSAAVIVGTEPRPGLETPLFELVSAAQTTI  825
             VVCSE+    FRGPS    D+L+ Q LFGDG+AAVI+G +P   +E PLFELVSAAQT +
Sbjct  188   VVCSEITAVTFRGPSDTHLDSLVGQALFGDGAAAVIIGADPDTKIELPLFELVSAAQTIL  247

Query  826   PDTDSHLKLHLREMGLTFHCSKAVPSLITQNVEDCLVKAFEPFGISDWNSIFWILHPGGI  1005
             PD++  +  HLRE+GLTFH  K VP LI++N+E  LV+AF P GISDWNS+FWI HPGG 
Sbjct  248   PDSEGAIDGHLREVGLTFHLLKDVPGLISKNIEKSLVEAFTPIGISDWNSLFWIAHPGGP  307

Query  1006  AILDRVEEKLGLEPEKLRASKDVLSEYGNLTSACVLFILDEMRKKSKKDEEMTTGEGLEW  1185
             AILD+VE KLGL+ EKLRA++ VLSEYGN++SACVLFILDEMRKKS ++ + +TGEGLEW
Sbjct  308   AILDQVELKLGLKEEKLRATRHVLSEYGNMSSACVLFILDEMRKKSIEEGKGSTGEGLEW  367

Query  1186  GVVFVVCP  1209
             GV+F   P
Sbjct  368   GVLFGFGP  375



>gb|ABM73434.1| chalcone synthase [Aquilaria sinensis]
Length=394

 Score =   526 bits (1354),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 245/368 (67%), Positives = 304/368 (83%), Gaps = 0/368 (0%)
 Frame = +1

Query  106   RRAKRFEGDAKILAIGTAIPANWVDQTTYPDFYFRITNSEHLLEHKEKFRRICNKSKIRK  285
             R+A+R EG A +LAIGTA+P N + Q  YPD+YFR+TNSEH+ E KEKF+R+C+KS I+K
Sbjct  9     RKARRAEGPATVLAIGTAVPNNCLLQADYPDYYFRVTNSEHMTELKEKFKRMCDKSMIKK  68

Query  286   RHLVITEELLKKNPNLCTYNEASLNTRQDILVSEVPKLGKEAAMKAIKEWGRPISEITHL  465
             R++ +TEE+LK+NP++  Y   SL+ RQDI+V E+PKLGKEAA KAIKEWG+P S+ITH+
Sbjct  69    RYMHVTEEVLKENPSMADYWSPSLDARQDIVVVEIPKLGKEAAQKAIKEWGQPKSKITHV  128

Query  466   VFCTSSGVDMPGADFQLAKLLGLSSSVKRLMMYQQGCNAGAAMLRLAKDLAENNKGARVL  645
             VFCT+SGVDMPGAD+QL KLLGL  SVKRLMMYQQGC AG  +LRLAKDLAENNKGARVL
Sbjct  129   VFCTTSGVDMPGADYQLTKLLGLRPSVKRLMMYQQGCFAGGTVLRLAKDLAENNKGARVL  188

Query  646   VVCSEVMLNVFRGPSLEQEDNLLAQCLFGDGSAAVIVGTEPRPGLETPLFELVSAAQTTI  825
             VVCSE+    FRGPS    D+++ Q LFGDG+AA+IVG++P   +E PLFEL+SAAQT +
Sbjct  189   VVCSEITAVTFRGPSETHLDSMVGQALFGDGAAAIIVGSDPDTRIERPLFELISAAQTIL  248

Query  826   PDTDSHLKLHLREMGLTFHCSKAVPSLITQNVEDCLVKAFEPFGISDWNSIFWILHPGGI  1005
             PD+D  +  HLRE+GLTFH  K VP LI++N+E  LV+AF P GISDWNSI+WI HPGG 
Sbjct  249   PDSDGAIDGHLREVGLTFHLLKDVPGLISKNIEKSLVEAFTPIGISDWNSIYWIAHPGGP  308

Query  1006  AILDRVEEKLGLEPEKLRASKDVLSEYGNLTSACVLFILDEMRKKSKKDEEMTTGEGLEW  1185
             AILD+VE+KLGL+ EKLRA++ +LSEYGN++SACVLFILDEMRKKS ++ + TTGEGLEW
Sbjct  309   AILDQVEQKLGLKQEKLRATRHILSEYGNMSSACVLFILDEMRKKSLEEGKATTGEGLEW  368

Query  1186  GVVFVVCP  1209
             GV+F   P
Sbjct  369   GVLFGFGP  376



>sp|Q9FSB8.1|CHS2_RUTGR RecName: Full=Chalcone synthase 2; AltName: Full=Naringenin-chalcone 
synthase 2 [Ruta graveolens]
 emb|CAC14060.1| putative chalcone synthase [Ruta graveolens]
Length=393

 Score =   526 bits (1354),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 245/368 (67%), Positives = 299/368 (81%), Gaps = 0/368 (0%)
 Frame = +1

Query  106   RRAKRFEGDAKILAIGTAIPANWVDQTTYPDFYFRITNSEHLLEHKEKFRRICNKSKIRK  285
             R+A+R +G A +LAIGTA PAN+V Q  YPD+YFRIT SEH+ E KEKF+R+C+KS IRK
Sbjct  10    RKAQRADGPAAVLAIGTATPANYVTQADYPDYYFRITKSEHMTELKEKFKRMCDKSMIRK  69

Query  286   RHLVITEELLKKNPNLCTYNEASLNTRQDILVSEVPKLGKEAAMKAIKEWGRPISEITHL  465
             R++ +TE++LK+NPN+C Y   SL+ RQDI+V EVPKLGKEAA+KAIKEWG+P S+ITHL
Sbjct  70    RYMYLTEDILKENPNMCAYMAPSLDARQDIVVVEVPKLGKEAAVKAIKEWGQPKSKITHL  129

Query  466   VFCTSSGVDMPGADFQLAKLLGLSSSVKRLMMYQQGCNAGAAMLRLAKDLAENNKGARVL  645
             +FCT+SGVDMPG D+QL KLLGL  SVKR MMYQQGC AG  +LRLAKDLAENN+GARVL
Sbjct  130   IFCTTSGVDMPGCDYQLTKLLGLRPSVKRFMMYQQGCFAGGTVLRLAKDLAENNRGARVL  189

Query  646   VVCSEVMLNVFRGPSLEQEDNLLAQCLFGDGSAAVIVGTEPRPGLETPLFELVSAAQTTI  825
             VVCSE+    FRGP+    D+L+ Q LFGDG+AAVIVG +P   +E PL++LVSAAQT +
Sbjct  190   VVCSEITAVTFRGPADTHLDSLVGQALFGDGAAAVIVGADPNESIERPLYQLVSAAQTIL  249

Query  826   PDTDSHLKLHLREMGLTFHCSKAVPSLITQNVEDCLVKAFEPFGISDWNSIFWILHPGGI  1005
             PD+D  +  HLRE+GLTFH  K VP LI++N+E  L +AF P GISDWNSIFWI HPGG 
Sbjct  250   PDSDGAIDGHLREVGLTFHLLKDVPGLISKNIEKSLKEAFGPIGISDWNSIFWIAHPGGP  309

Query  1006  AILDRVEEKLGLEPEKLRASKDVLSEYGNLTSACVLFILDEMRKKSKKDEEMTTGEGLEW  1185
             AILD+VE KLGL+ EKLRA++ VLSEYGN++SACVLFILDEMRKK  ++   TTGEGL+W
Sbjct  310   AILDQVEAKLGLKEEKLRATRQVLSEYGNMSSACVLFILDEMRKKCAEEGRATTGEGLDW  369

Query  1186  GVVFVVCP  1209
             GV+F   P
Sbjct  370   GVLFGFGP  377



>gb|AHB18370.1| chalcone synthase 1 [Musa acuminata AAA Group]
Length=392

 Score =   526 bits (1354),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 243/375 (65%), Positives = 302/375 (81%), Gaps = 0/375 (0%)
 Frame = +1

Query  85    LTDTCRSRRAKRFEGDAKILAIGTAIPANWVDQTTYPDFYFRITNSEHLLEHKEKFRRIC  264
             + D    RR++R EG A +LAIGTA PAN + Q  YPD+YFRIT S+HL E KEKF+R+C
Sbjct  1     MADLQEIRRSQRAEGPAAVLAIGTATPANVLYQADYPDYYFRITKSDHLTELKEKFKRMC  60

Query  265   NKSKIRKRHLVITEELLKKNPNLCTYNEASLNTRQDILVSEVPKLGKEAAMKAIKEWGRP  444
             +KS IRKR++ + EE+LK+NPN+C Y   SL+ RQDI+V E+PKLGKEAA+KAIKEWG+P
Sbjct  61    DKSMIRKRYMHLNEEILKENPNICAYMAPSLDARQDIVVVEIPKLGKEAAVKAIKEWGQP  120

Query  445   ISEITHLVFCTSSGVDMPGADFQLAKLLGLSSSVKRLMMYQQGCNAGAAMLRLAKDLAEN  624
              S+ITHLVFCT+SGVDMPGAD+QL +LLGL  SV RLMMYQQGC AG  +LRLAKDLAEN
Sbjct  121   KSKITHLVFCTTSGVDMPGADYQLTRLLGLRPSVNRLMMYQQGCFAGGTVLRLAKDLAEN  180

Query  625   NKGARVLVVCSEVMLNVFRGPSLEQEDNLLAQCLFGDGSAAVIVGTEPRPGLETPLFELV  804
             N+GARVLVVCSE+    FRGPS    D+L+ Q LFGDG+AA+IVG +P P +E PLF++V
Sbjct  181   NRGARVLVVCSEITAVTFRGPSESHLDSLVGQALFGDGAAAIIVGADPDPAIERPLFQIV  240

Query  805   SAAQTTIPDTDSHLKLHLREMGLTFHCSKAVPSLITQNVEDCLVKAFEPFGISDWNSIFW  984
             SA+QT +PD++  +  HLRE+GLTFH  K VP LI++N+E  LV+AF+P GI DWNSIFW
Sbjct  241   SASQTIVPDSEGAIDGHLREVGLTFHLLKDVPGLISKNIEKSLVEAFKPLGIDDWNSIFW  300

Query  985   ILHPGGIAILDRVEEKLGLEPEKLRASKDVLSEYGNLTSACVLFILDEMRKKSKKDEEMT  1164
             I HPGG AILD+VE K+GL+ EK++A++ VLSEYGN++SACVLFILDEMR +S  D + T
Sbjct  301   IAHPGGPAILDQVEAKIGLQKEKMQATRRVLSEYGNMSSACVLFILDEMRNRSAADGKAT  360

Query  1165  TGEGLEWGVVFVVCP  1209
             TGEGLEWGV+F   P
Sbjct  361   TGEGLEWGVLFGFGP  375



>sp|P48390.1|CHS1_GERHY RecName: Full=Chalcone synthase 1; AltName: Full=Naringenin-chalcone 
synthase 1 [Gerbera hybrid cultivar]
 emb|CAA86218.1| chalcone synthase [Gerbera hybrid cultivar]
Length=398

 Score =   526 bits (1354),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 250/368 (68%), Positives = 297/368 (81%), Gaps = 0/368 (0%)
 Frame = +1

Query  106   RRAKRFEGDAKILAIGTAIPANWVDQTTYPDFYFRITNSEHLLEHKEKFRRICNKSKIRK  285
             R A+R EG A ILAIGTA PAN V Q  YPD+YFRIT SEH+++ KEKF+R+C+KS IRK
Sbjct  11    RDAQRAEGPATILAIGTATPANCVYQADYPDYYFRITKSEHMVDLKEKFKRMCDKSMIRK  70

Query  286   RHLVITEELLKKNPNLCTYNEASLNTRQDILVSEVPKLGKEAAMKAIKEWGRPISEITHL  465
             R++ ITEE LK+NPN+C Y   SL+ RQD++V EVPKLGKEAAMKAIKEWG P S+ITHL
Sbjct  71    RYMHITEEYLKQNPNMCAYMAPSLDVRQDLVVVEVPKLGKEAAMKAIKEWGHPKSKITHL  130

Query  466   VFCTSSGVDMPGADFQLAKLLGLSSSVKRLMMYQQGCNAGAAMLRLAKDLAENNKGARVL  645
             +FCT+SGVDMPGAD+QL KLLGL  SVKR MMYQQGC AG  +LRLAKDLAENNKGARVL
Sbjct  131   IFCTTSGVDMPGADYQLTKLLGLRPSVKRFMMYQQGCFAGGTVLRLAKDLAENNKGARVL  190

Query  646   VVCSEVMLNVFRGPSLEQEDNLLAQCLFGDGSAAVIVGTEPRPGLETPLFELVSAAQTTI  825
             VVCSE+    FRGP+    D+L+ Q LFGDG+AAVIVG++P    E PLFE+VSAAQT +
Sbjct  191   VVCSEITAVTFRGPNDTHLDSLVGQALFGDGAAAVIVGSDPDLTTERPLFEMVSAAQTIL  250

Query  826   PDTDSHLKLHLREMGLTFHCSKAVPSLITQNVEDCLVKAFEPFGISDWNSIFWILHPGGI  1005
             PD++  +  HLRE+GLTFH  K VP LI++N+E  L  AF P GI+DWNSIFWI HPGG 
Sbjct  251   PDSEGAIDGHLREVGLTFHLLKDVPGLISKNIEKALTTAFSPLGINDWNSIFWIAHPGGP  310

Query  1006  AILDRVEEKLGLEPEKLRASKDVLSEYGNLTSACVLFILDEMRKKSKKDEEMTTGEGLEW  1185
             AILD+VE KLGL+ EKLRA++ VLSEYGN++SACVLFI+DEMRKKS ++   TTGEGLEW
Sbjct  311   AILDQVELKLGLKEEKLRATRHVLSEYGNMSSACVLFIIDEMRKKSSENGAGTTGEGLEW  370

Query  1186  GVVFVVCP  1209
             GV+F   P
Sbjct  371   GVLFGFGP  378



>gb|ABB89213.1| chalcone synthase [Sorbus aucuparia]
Length=391

 Score =   525 bits (1353),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 247/368 (67%), Positives = 302/368 (82%), Gaps = 0/368 (0%)
 Frame = +1

Query  106   RRAKRFEGDAKILAIGTAIPANWVDQTTYPDFYFRITNSEHLLEHKEKFRRICNKSKIRK  285
             R+A+R EG A ++AIGTA P+N VDQ TYPD+YFRITNSEH +E KEKF+R+C+KS I+K
Sbjct  8     RKAQRAEGPATVMAIGTATPSNCVDQATYPDYYFRITNSEHKVELKEKFQRMCDKSMIKK  67

Query  286   RHLVITEELLKKNPNLCTYNEASLNTRQDILVSEVPKLGKEAAMKAIKEWGRPISEITHL  465
             R++ +TEE+LK+NP++C Y   S++ RQD++V EVPKLGKEAA KAIKEWG+P S+ITHL
Sbjct  68    RYMYLTEEILKENPSVCEYMAPSIDARQDMVVVEVPKLGKEAATKAIKEWGQPKSKITHL  127

Query  466   VFCTSSGVDMPGADFQLAKLLGLSSSVKRLMMYQQGCNAGAAMLRLAKDLAENNKGARVL  645
             VFCT+SGVDMPGAD+QL KLLGL  SVKRLMMYQQGC AG  +LRLAKDLAENNKGARVL
Sbjct  128   VFCTTSGVDMPGADYQLTKLLGLRPSVKRLMMYQQGCFAGGTVLRLAKDLAENNKGARVL  187

Query  646   VVCSEVMLNVFRGPSLEQEDNLLAQCLFGDGSAAVIVGTEPRPGLETPLFELVSAAQTTI  825
             VVCSE+    FRGPS    D+L+ Q LFGDG+AAVI+G +P   +E PLFELVSAAQT +
Sbjct  188   VVCSEITAVTFRGPSDTHLDSLVGQALFGDGAAAVIIGADPVTEVEKPLFELVSAAQTIL  247

Query  826   PDTDSHLKLHLREMGLTFHCSKAVPSLITQNVEDCLVKAFEPFGISDWNSIFWILHPGGI  1005
             PD+D  +  HLRE+GLTFH  K VP LI++N+E  L +AF+P GISDWNS+FWI HPGG 
Sbjct  248   PDSDGAIDGHLREVGLTFHLLKDVPGLISKNIEKSLNEAFKPVGISDWNSLFWIAHPGGP  307

Query  1006  AILDRVEEKLGLEPEKLRASKDVLSEYGNLTSACVLFILDEMRKKSKKDEEMTTGEGLEW  1185
             AILD+VE KL L+PEKL A++ VLS+YGN++SACVLFILDE+R+KS +    TTGEGLEW
Sbjct  308   AILDQVEAKLALKPEKLEATRQVLSDYGNMSSACVLFILDEVRRKSAEKGLKTTGEGLEW  367

Query  1186  GVVFVVCP  1209
             GV+F   P
Sbjct  368   GVLFGFGP  375



>ref|NP_001267879.1| chalcone synthase [Vitis vinifera]
 gb|ABM67586.1| chalcone synthase [Vitis vinifera]
Length=393

 Score =   525 bits (1353),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 250/368 (68%), Positives = 300/368 (82%), Gaps = 0/368 (0%)
 Frame = +1

Query  106   RRAKRFEGDAKILAIGTAIPANWVDQTTYPDFYFRITNSEHLLEHKEKFRRICNKSKIRK  285
             R+A+R EG A +LAIGTA PAN V Q  YPD+YFRITNSEH+ E KEKF+R+C KS I K
Sbjct  8     RKAQRAEGPATVLAIGTATPANCVYQADYPDYYFRITNSEHMTELKEKFKRMCEKSMINK  67

Query  286   RHLVITEELLKKNPNLCTYNEASLNTRQDILVSEVPKLGKEAAMKAIKEWGRPISEITHL  465
             R++ +TEE+LK+NPN+C Y   SL+ RQD++V EVPKLGKEAA KAIKEWG+P S+ITHL
Sbjct  68    RYMHLTEEILKENPNVCAYMAPSLDARQDMVVVEVPKLGKEAAAKAIKEWGQPKSKITHL  127

Query  466   VFCTSSGVDMPGADFQLAKLLGLSSSVKRLMMYQQGCNAGAAMLRLAKDLAENNKGARVL  645
             VFCT+SGVDMPGAD+QL KLLGL  SVKRLMMYQQGC AG  +LRLAKDLAENN G+RVL
Sbjct  128   VFCTTSGVDMPGADYQLTKLLGLKPSVKRLMMYQQGCFAGGTVLRLAKDLAENNAGSRVL  187

Query  646   VVCSEVMLNVFRGPSLEQEDNLLAQCLFGDGSAAVIVGTEPRPGLETPLFELVSAAQTTI  825
             VVCSE+    FRGPS    D+L+ Q LFGDG+AAVI+G +P   +E PLFELVSAAQT +
Sbjct  188   VVCSEITAVTFRGPSDTHLDSLVGQALFGDGAAAVIIGADPDTKIERPLFELVSAAQTIL  247

Query  826   PDTDSHLKLHLREMGLTFHCSKAVPSLITQNVEDCLVKAFEPFGISDWNSIFWILHPGGI  1005
             PD++  +  HLRE+GLTFH  K VP LI++N+E  LV+AF P GISDWNS+FWI HPGG 
Sbjct  248   PDSEGAIDGHLREVGLTFHLLKDVPGLISKNIEKSLVEAFTPIGISDWNSLFWIAHPGGP  307

Query  1006  AILDRVEEKLGLEPEKLRASKDVLSEYGNLTSACVLFILDEMRKKSKKDEEMTTGEGLEW  1185
             AILD+VE KLGL+ EKLRA++ VLSEYGN++SACVLFILDEMRKKS ++ + +TGEGLEW
Sbjct  308   AILDQVELKLGLKEEKLRATRHVLSEYGNMSSACVLFILDEMRKKSIEEGKGSTGEGLEW  367

Query  1186  GVVFVVCP  1209
             GV+F   P
Sbjct  368   GVLFGFGP  375



>gb|AGL50915.1| chalcone synthase [Pyrus communis]
Length=389

 Score =   525 bits (1353),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 247/368 (67%), Positives = 300/368 (82%), Gaps = 0/368 (0%)
 Frame = +1

Query  106   RRAKRFEGDAKILAIGTAIPANWVDQTTYPDFYFRITNSEHLLEHKEKFRRICNKSKIRK  285
             R+A+R EG A + AIGTA P N VDQ TYPD+YFRITNSEH  E KEKF+R+C+KS I+ 
Sbjct  8     RKAQRAEGPATVFAIGTATPPNCVDQATYPDYYFRITNSEHKTELKEKFQRMCDKSMIKT  67

Query  286   RHLVITEELLKKNPNLCTYNEASLNTRQDILVSEVPKLGKEAAMKAIKEWGRPISEITHL  465
             R++ +TEE+LK+NP++C Y   SL+ RQD++V EVP+LGKEAA KAIKEWG+P S+ITHL
Sbjct  68    RYMYLTEEILKENPSVCEYMAPSLDARQDMVVVEVPRLGKEAATKAIKEWGQPKSKITHL  127

Query  466   VFCTSSGVDMPGADFQLAKLLGLSSSVKRLMMYQQGCNAGAAMLRLAKDLAENNKGARVL  645
             VFCT+SGVDMPGAD+QL KLLGL  SVKRLMMYQQGC AG  +LRLAKDLAENNKGARVL
Sbjct  128   VFCTTSGVDMPGADYQLTKLLGLRPSVKRLMMYQQGCFAGGTVLRLAKDLAENNKGARVL  187

Query  646   VVCSEVMLNVFRGPSLEQEDNLLAQCLFGDGSAAVIVGTEPRPGLETPLFELVSAAQTTI  825
             VVCSE+    FRGPS    D+L+ Q LFGDG+AAVI+G++P P +E PLFELVSAAQT +
Sbjct  188   VVCSEITAVTFRGPSDTHLDSLVGQALFGDGAAAVIIGSDPVPEVEKPLFELVSAAQTIL  247

Query  826   PDTDSHLKLHLREMGLTFHCSKAVPSLITQNVEDCLVKAFEPFGISDWNSIFWILHPGGI  1005
             PD+D  +  HLRE+GLTFH  K VP LI++N+E  L +AF+P GISDWNS+FWI HPGG 
Sbjct  248   PDSDGAIDGHLREVGLTFHLLKDVPGLISKNIEKSLNEAFKPIGISDWNSLFWIAHPGGP  307

Query  1006  AILDRVEEKLGLEPEKLRASKDVLSEYGNLTSACVLFILDEMRKKSKKDEEMTTGEGLEW  1185
             AILD+VE KL L+PEKL A++ VLS+YGN++SACVLFILDE+R+KS +    TTGEGLEW
Sbjct  308   AILDQVESKLALKPEKLEATRQVLSDYGNMSSACVLFILDEVRRKSAEKGLKTTGEGLEW  367

Query  1186  GVVFVVCP  1209
             GV+F   P
Sbjct  368   GVLFGFGP  375



>ref|XP_009619773.1| PREDICTED: chalcone synthase 1B [Nicotiana tomentosiformis]
 gb|ACS12836.1| chalcone synthase [Nicotiana tomentosiformis]
Length=389

 Score =   525 bits (1353),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 249/368 (68%), Positives = 301/368 (82%), Gaps = 0/368 (0%)
 Frame = +1

Query  106   RRAKRFEGDAKILAIGTAIPANWVDQTTYPDFYFRITNSEHLLEHKEKFRRICNKSKIRK  285
             RRA+  EG A ++AIGTA P+N VDQ+TYPD+YFRITNSEH +E KEKF+R+C KS I+K
Sbjct  8     RRAQCAEGPATVMAIGTATPSNCVDQSTYPDYYFRITNSEHKVELKEKFKRMCEKSMIKK  67

Query  286   RHLVITEELLKKNPNLCTYNEASLNTRQDILVSEVPKLGKEAAMKAIKEWGRPISEITHL  465
             R++ +TEE+LK NPN+C Y   SL+ RQDI+V EVPKLGKEAA KAIKEWG+P S+ITHL
Sbjct  68    RYMHLTEEILKDNPNICAYMAPSLDARQDIVVVEVPKLGKEAAQKAIKEWGQPKSKITHL  127

Query  466   VFCTSSGVDMPGADFQLAKLLGLSSSVKRLMMYQQGCNAGAAMLRLAKDLAENNKGARVL  645
             VFCT+SGVDMPG D+QL KLLGL  SVKR MMYQQGC AG  +LR+AKDLAENNKGARVL
Sbjct  128   VFCTTSGVDMPGCDYQLTKLLGLRPSVKRFMMYQQGCFAGGTVLRMAKDLAENNKGARVL  187

Query  646   VVCSEVMLNVFRGPSLEQEDNLLAQCLFGDGSAAVIVGTEPRPGLETPLFELVSAAQTTI  825
             VVCSE+    FRGP+    D+L+ Q LFGDG+AAVI+G++P P +E PLFELVSAAQT +
Sbjct  188   VVCSEITAVTFRGPNDTHLDSLVGQALFGDGAAAVIIGSDPIPEVERPLFELVSAAQTLL  247

Query  826   PDTDSHLKLHLREMGLTFHCSKAVPSLITQNVEDCLVKAFEPFGISDWNSIFWILHPGGI  1005
             PD++  +  HLRE+GLTFH  K VP LI++N+E  LV+AF+P GISDWNS+FWI HPGG 
Sbjct  248   PDSEGAIDGHLREVGLTFHLLKDVPGLISKNIEKSLVEAFQPLGISDWNSLFWIAHPGGP  307

Query  1006  AILDRVEEKLGLEPEKLRASKDVLSEYGNLTSACVLFILDEMRKKSKKDEEMTTGEGLEW  1185
             AILD+VE KLGL+ EKL+A++ VLS YGN++SACVLFILDEMRK S K+   TTGEGLEW
Sbjct  308   AILDQVELKLGLKQEKLKATRKVLSNYGNMSSACVLFILDEMRKASAKEGLGTTGEGLEW  367

Query  1186  GVVFVVCP  1209
             GV+F   P
Sbjct  368   GVLFGFGP  375



>gb|ABF68899.1| chalcone synthase, partial [Cardamine asarifolia]
 gb|ABF68902.1| chalcone synthase, partial [Cardamine asarifolia]
Length=388

 Score =   525 bits (1353),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 249/369 (67%), Positives = 301/369 (82%), Gaps = 1/369 (0%)
 Frame = +1

Query  106   RRAKRFEGDAKILAIGTAIPANWVDQTTYPDFYFRITNSEHLLEHKEKFRRICNKSKIRK  285
             R+A+R +G A I AIGTA PAN+V Q  YPD+YFRITNSEH+ + KEKF+R+C+KS IRK
Sbjct  13    RKAQRADGPAGIFAIGTANPANYVIQAEYPDYYFRITNSEHMTDLKEKFKRMCDKSTIRK  72

Query  286   RHLVITEELLKKNPNLCTYNEASLNTRQDILVSEVPKLGKEAAMKAIKEWGRPISEITHL  465
             RH+ +TEE LK+NPN+C Y   SL+ RQDI+V EVPKLGKEAA+KAIKEWG+P S+ITHL
Sbjct  73    RHMHVTEEFLKENPNMCAYMAPSLDARQDIVVVEVPKLGKEAAVKAIKEWGQPKSKITHL  132

Query  466   VFCTSSGVDMPGADFQLAKLLGLSSSVKRLMMYQQGCNAGAAMLRLAKDLAENNKGARVL  645
             VFCT+SGVDMPGAD+QL KLLGL  SVKRLMMYQQGC AG  +LRLAKDLAENN+GARVL
Sbjct  133   VFCTTSGVDMPGADYQLTKLLGLRPSVKRLMMYQQGCFAGGTVLRLAKDLAENNRGARVL  192

Query  646   VVCSEVMLNVFRGPSLEQEDNLLAQCLFGDGSAAVIVGTEPRPGL-ETPLFELVSAAQTT  822
             VVCSE+    FRGPS    D+L+ Q LF DG+AA+IVG++P   + E P+FE+VSAAQT 
Sbjct  193   VVCSEITAVTFRGPSDTHLDSLVGQALFSDGAAALIVGSDPDTSVGEKPIFEMVSAAQTI  252

Query  823   IPDTDSHLKLHLREMGLTFHCSKAVPSLITQNVEDCLVKAFEPFGISDWNSIFWILHPGG  1002
             +PD+D  +  HLRE+GLTFH  K VP LI++N+E  L +AF+P GISDWNS+FWI HPGG
Sbjct  253   LPDSDGAIDGHLREVGLTFHLLKDVPGLISKNIEKSLDEAFKPLGISDWNSLFWIAHPGG  312

Query  1003  IAILDRVEEKLGLEPEKLRASKDVLSEYGNLTSACVLFILDEMRKKSKKDEEMTTGEGLE  1182
              AILD+VE KLGL+ EK+RA++ V+ EYGN++SACVLFILDEMRKKS KD   TTGEGLE
Sbjct  313   PAILDQVEIKLGLKEEKMRATRHVMREYGNMSSACVLFILDEMRKKSAKDGVATTGEGLE  372

Query  1183  WGVVFVVCP  1209
             WGV+F   P
Sbjct  373   WGVLFGFGP  381



>ref|XP_009370115.1| PREDICTED: chalcone synthase-like [Pyrus x bretschneideri]
Length=390

 Score =   525 bits (1353),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 247/368 (67%), Positives = 300/368 (82%), Gaps = 0/368 (0%)
 Frame = +1

Query  106   RRAKRFEGDAKILAIGTAIPANWVDQTTYPDFYFRITNSEHLLEHKEKFRRICNKSKIRK  285
             R+A+R EG A + AIGTA P N VDQ TYPD+YFRITNSEH  E KEKF+R+C+KS I+K
Sbjct  8     RKAQRAEGPATVFAIGTATPPNCVDQATYPDYYFRITNSEHKAELKEKFQRMCDKSMIKK  67

Query  286   RHLVITEELLKKNPNLCTYNEASLNTRQDILVSEVPKLGKEAAMKAIKEWGRPISEITHL  465
             R++ +TEE+LK+NP++C Y   SL+ RQD++V EVP+LGKEAA KAIKEWG+P S+ITHL
Sbjct  68    RYMYLTEEILKENPSVCEYMAPSLDARQDMVVVEVPRLGKEAATKAIKEWGQPKSKITHL  127

Query  466   VFCTSSGVDMPGADFQLAKLLGLSSSVKRLMMYQQGCNAGAAMLRLAKDLAENNKGARVL  645
             VFCT+SGVDMPGAD+QL KLLGL  SVKRLMMYQQGC AG  +LRLAKDLAENNKGARVL
Sbjct  128   VFCTTSGVDMPGADYQLTKLLGLRPSVKRLMMYQQGCFAGGTVLRLAKDLAENNKGARVL  187

Query  646   VVCSEVMLNVFRGPSLEQEDNLLAQCLFGDGSAAVIVGTEPRPGLETPLFELVSAAQTTI  825
             VVCSE+    FRGPS    D+L+ Q LFGDG+AAVI+G +P P +E PLFELVSAAQT +
Sbjct  188   VVCSEITAVTFRGPSDTHLDSLVGQALFGDGAAAVIIGADPVPEVEKPLFELVSAAQTIL  247

Query  826   PDTDSHLKLHLREMGLTFHCSKAVPSLITQNVEDCLVKAFEPFGISDWNSIFWILHPGGI  1005
             PD+D  +  HLRE+GLTFH  K VP LI++N+E  L +AF+P GISDWNS+FWI HPGG 
Sbjct  248   PDSDGAIDGHLREVGLTFHLLKDVPGLISKNIEKSLNEAFKPIGISDWNSLFWIAHPGGP  307

Query  1006  AILDRVEEKLGLEPEKLRASKDVLSEYGNLTSACVLFILDEMRKKSKKDEEMTTGEGLEW  1185
             AILD+VE KL L+PEKL A++ VLS+YGN++SACVLFILDE+R+KS +    T+GEGLEW
Sbjct  308   AILDQVEAKLALKPEKLEATRQVLSDYGNMSSACVLFILDEVRRKSAEKGLKTSGEGLEW  367

Query  1186  GVVFVVCP  1209
             GV+F   P
Sbjct  368   GVLFGFGP  375



>gb|ABF68901.1| chalcone synthase, partial [Cardamine asarifolia]
Length=382

 Score =   525 bits (1352),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 249/369 (67%), Positives = 301/369 (82%), Gaps = 1/369 (0%)
 Frame = +1

Query  106   RRAKRFEGDAKILAIGTAIPANWVDQTTYPDFYFRITNSEHLLEHKEKFRRICNKSKIRK  285
             R+A+R +G A I AIGTA PAN+V Q  YPD+YFRITNSEH+ + KEKF+R+C+KS IRK
Sbjct  13    RKAQRADGPAGIFAIGTANPANYVIQAEYPDYYFRITNSEHMTDLKEKFKRMCDKSTIRK  72

Query  286   RHLVITEELLKKNPNLCTYNEASLNTRQDILVSEVPKLGKEAAMKAIKEWGRPISEITHL  465
             RH+ +TEE LK+NPN+C Y   SL+ RQDI+V EVPKLGKEAA+KAIKEWG+P S+ITHL
Sbjct  73    RHMHVTEEFLKENPNMCAYMAPSLDARQDIVVVEVPKLGKEAAVKAIKEWGQPKSKITHL  132

Query  466   VFCTSSGVDMPGADFQLAKLLGLSSSVKRLMMYQQGCNAGAAMLRLAKDLAENNKGARVL  645
             VFCT+SGVDMPGAD+QL KLLGL  SVKRLMMYQQGC AG  +LRLAKDLAENN+GARVL
Sbjct  133   VFCTTSGVDMPGADYQLTKLLGLRPSVKRLMMYQQGCFAGGTVLRLAKDLAENNRGARVL  192

Query  646   VVCSEVMLNVFRGPSLEQEDNLLAQCLFGDGSAAVIVGTEPRPGL-ETPLFELVSAAQTT  822
             VVCSE+    FRGPS    D+L+ Q LF DG+AA+IVG++P   + E P+FE+VSAAQT 
Sbjct  193   VVCSEITAVTFRGPSDTHLDSLVGQALFSDGAAALIVGSDPDTSVGEKPIFEMVSAAQTI  252

Query  823   IPDTDSHLKLHLREMGLTFHCSKAVPSLITQNVEDCLVKAFEPFGISDWNSIFWILHPGG  1002
             +PD+D  +  HLRE+GLTFH  K VP LI++N+E  L +AF+P GISDWNS+FWI HPGG
Sbjct  253   LPDSDGAIDGHLREVGLTFHLLKDVPGLISKNIEKSLDEAFKPLGISDWNSLFWIAHPGG  312

Query  1003  IAILDRVEEKLGLEPEKLRASKDVLSEYGNLTSACVLFILDEMRKKSKKDEEMTTGEGLE  1182
              AILD+VE KLGL+ EK+RA++ V+ EYGN++SACVLFILDEMRKKS KD   TTGEGLE
Sbjct  313   PAILDQVEIKLGLKEEKMRATRHVMREYGNMSSACVLFILDEMRKKSAKDGVATTGEGLE  372

Query  1183  WGVVFVVCP  1209
             WGV+F   P
Sbjct  373   WGVLFGFGP  381



>dbj|BAD34457.1| chalcone synthase [Eustoma grandiflorum]
Length=389

 Score =   525 bits (1352),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 248/368 (67%), Positives = 300/368 (82%), Gaps = 0/368 (0%)
 Frame = +1

Query  106   RRAKRFEGDAKILAIGTAIPANWVDQTTYPDFYFRITNSEHLLEHKEKFRRICNKSKIRK  285
             RRA+R EG A ++AIGTA P N VDQ+TY D+YF+ITNSEH+ E KEKF+R+C+KS IR+
Sbjct  8     RRAQRAEGPATLMAIGTATPPNCVDQSTYSDYYFKITNSEHMTELKEKFKRMCDKSMIRQ  67

Query  286   RHLVITEELLKKNPNLCTYNEASLNTRQDILVSEVPKLGKEAAMKAIKEWGRPISEITHL  465
             R++ +TEE LK+N N+  Y   SL+ RQDI+V EVPKLGK+AA+KAIKEWG+P S+ITHL
Sbjct  68    RYMHLTEEYLKENLNVSAYMAPSLDARQDIVVMEVPKLGKDAALKAIKEWGQPKSKITHL  127

Query  466   VFCTSSGVDMPGADFQLAKLLGLSSSVKRLMMYQQGCNAGAAMLRLAKDLAENNKGARVL  645
             +FCT+SGVDMPGAD+QL KLLGL  SVKR MMYQQGC AG  +LRLAKDLAENNK ARVL
Sbjct  128   IFCTTSGVDMPGADYQLTKLLGLRPSVKRTMMYQQGCFAGGTVLRLAKDLAENNKDARVL  187

Query  646   VVCSEVMLNVFRGPSLEQEDNLLAQCLFGDGSAAVIVGTEPRPGLETPLFELVSAAQTTI  825
             VVCSE+    FRGP     D+L+ Q LFGDG+AA+I+G++P PG+E PLF+LVSAAQT +
Sbjct  188   VVCSEITAVTFRGPCETHLDSLVGQALFGDGAAAIIIGSDPIPGVERPLFQLVSAAQTIL  247

Query  826   PDTDSHLKLHLREMGLTFHCSKAVPSLITQNVEDCLVKAFEPFGISDWNSIFWILHPGGI  1005
             P++D  ++ HLRE GLTFH  K VP LI++N+   L +AFEP GISDWNS+FWI HPGG 
Sbjct  248   PESDGAIEGHLRETGLTFHLLKDVPGLISKNIMKSLEEAFEPLGISDWNSVFWIAHPGGP  307

Query  1006  AILDRVEEKLGLEPEKLRASKDVLSEYGNLTSACVLFILDEMRKKSKKDEEMTTGEGLEW  1185
             AILD+VE KLGLEPEKLRA++ VLSEYGN++SACVLFILDEMRK S KD   TTGEGLEW
Sbjct  308   AILDQVEVKLGLEPEKLRATRHVLSEYGNMSSACVLFILDEMRKASAKDGLSTTGEGLEW  367

Query  1186  GVVFVVCP  1209
             GV+F   P
Sbjct  368   GVLFGFGP  375



>ref|XP_004502226.1| PREDICTED: chalcone synthase 1B-like [Cicer arietinum]
Length=389

 Score =   525 bits (1352),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 249/368 (68%), Positives = 301/368 (82%), Gaps = 0/368 (0%)
 Frame = +1

Query  106   RRAKRFEGDAKILAIGTAIPANWVDQTTYPDFYFRITNSEHLLEHKEKFRRICNKSKIRK  285
             R+A+R EG A +LAIGTA P N VDQ+TY D+YFRITNSEH  E KEKF+R+C+KS I+K
Sbjct  8     RQAQRAEGPATVLAIGTATPQNCVDQSTYADYYFRITNSEHKTELKEKFKRMCDKSMIKK  67

Query  286   RHLVITEELLKKNPNLCTYNEASLNTRQDILVSEVPKLGKEAAMKAIKEWGRPISEITHL  465
             R++ +TEE+LK+NP LC Y   SL+ RQD++V EVPKLGKEAA KAIKEWG+P S ITHL
Sbjct  68    RYMHLTEEILKENPTLCEYMAPSLDARQDMVVVEVPKLGKEAATKAIKEWGQPKSRITHL  127

Query  466   VFCTSSGVDMPGADFQLAKLLGLSSSVKRLMMYQQGCNAGAAMLRLAKDLAENNKGARVL  645
             +FCT+SGVDMPGAD+QL KLLGL   VKR MMYQQGC AG  +LRLAKDLAENNKGARVL
Sbjct  128   IFCTTSGVDMPGADYQLTKLLGLRPYVKRYMMYQQGCFAGGTVLRLAKDLAENNKGARVL  187

Query  646   VVCSEVMLNVFRGPSLEQEDNLLAQCLFGDGSAAVIVGTEPRPGLETPLFELVSAAQTTI  825
             VVCSE+    FRGP+    D+L+ Q LFGDG+AAVIVG++P P +E PLFELV  AQT +
Sbjct  188   VVCSEITAVTFRGPNDTHLDSLVGQALFGDGAAAVIVGSDPLPQVEKPLFELVWTAQTIL  247

Query  826   PDTDSHLKLHLREMGLTFHCSKAVPSLITQNVEDCLVKAFEPFGISDWNSIFWILHPGGI  1005
             PD++  +  HLRE+GLTFH  K VP LI++N+E  LV+AFEP GISD+NSIFWI HPGG 
Sbjct  248   PDSEGAIDGHLREVGLTFHLLKDVPGLISKNIEKALVEAFEPLGISDYNSIFWIAHPGGP  307

Query  1006  AILDRVEEKLGLEPEKLRASKDVLSEYGNLTSACVLFILDEMRKKSKKDEEMTTGEGLEW  1185
             AILD+VE KLGL+PEK++A++ VLS+YGN++SACVLFILDEMR+KSK+D   TTGEGLEW
Sbjct  308   AILDQVEVKLGLKPEKMQATRQVLSDYGNMSSACVLFILDEMRRKSKEDGLGTTGEGLEW  367

Query  1186  GVVFVVCP  1209
             GV+F   P
Sbjct  368   GVLFGFGP  375



>gb|ABE03647.1| chalcone synthase [Solms-laubachia eurycarpa]
 gb|ABE03668.1| chalcone synthase [Solms-laubachia eurycarpa]
Length=390

 Score =   525 bits (1352),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 250/369 (68%), Positives = 302/369 (82%), Gaps = 1/369 (0%)
 Frame = +1

Query  106   RRAKRFEGDAKILAIGTAIPANWVDQTTYPDFYFRITNSEHLLEHKEKFRRICNKSKIRK  285
             R+A+R +G A ILAIGTA PAN V Q+ YPD+YFRITNSEH+ + KEKF+R+C+KS IRK
Sbjct  12    RKAQRADGPAGILAIGTANPANHVIQSEYPDYYFRITNSEHMTDLKEKFQRMCDKSMIRK  71

Query  286   RHLVITEELLKKNPNLCTYNEASLNTRQDILVSEVPKLGKEAAMKAIKEWGRPISEITHL  465
             RH+ +TEE LK+NPN+C Y   SL+ RQDI+V EVPKLGKEAA +AIKEWG+P S+ITHL
Sbjct  72    RHMHLTEEFLKENPNMCAYMAPSLDARQDIVVVEVPKLGKEAAARAIKEWGQPKSKITHL  131

Query  466   VFCTSSGVDMPGADFQLAKLLGLSSSVKRLMMYQQGCNAGAAMLRLAKDLAENNKGARVL  645
             VFCT+SGVDMPGAD+QL KLLGL  SVKRLMMYQQGC AG  +LRLAKDLAENN+GARVL
Sbjct  132   VFCTTSGVDMPGADYQLTKLLGLRPSVKRLMMYQQGCFAGGTVLRLAKDLAENNRGARVL  191

Query  646   VVCSEVMLNVFRGPSLEQEDNLLAQCLFGDGSAAVIVGTEPRPGL-ETPLFELVSAAQTT  822
             VVCSE+    FRGPS    D+L+ Q LF DG+AA+IVG++P   + E P+FE+VSAAQT 
Sbjct  192   VVCSEITAVTFRGPSDTHLDSLVGQALFSDGAAALIVGSDPDTSVGEKPIFEMVSAAQTI  251

Query  823   IPDTDSHLKLHLREMGLTFHCSKAVPSLITQNVEDCLVKAFEPFGISDWNSIFWILHPGG  1002
             +PD+D  +  HLRE+GLTFH  K VP LI++N+E  L +AF+P GISDWNS+FWI HPGG
Sbjct  252   LPDSDGAIDGHLREVGLTFHLLKDVPGLISKNIEKSLEEAFKPLGISDWNSLFWIAHPGG  311

Query  1003  IAILDRVEEKLGLEPEKLRASKDVLSEYGNLTSACVLFILDEMRKKSKKDEEMTTGEGLE  1182
              AILD+VE KLGL+ EK+RA++ VLSEYGN++SACVLFILDEMRKKS +D   TTGEGLE
Sbjct  312   PAILDQVEIKLGLKAEKMRATRHVLSEYGNMSSACVLFILDEMRKKSAEDSVATTGEGLE  371

Query  1183  WGVVFVVCP  1209
             WGV+F   P
Sbjct  372   WGVLFGFGP  380



>gb|AGZ15299.1| chalcone synthase [Pyrus x bretschneideri]
 gb|AGZ15300.1| chalcone synthase [Pyrus x bretschneideri]
Length=389

 Score =   525 bits (1352),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 247/368 (67%), Positives = 300/368 (82%), Gaps = 0/368 (0%)
 Frame = +1

Query  106   RRAKRFEGDAKILAIGTAIPANWVDQTTYPDFYFRITNSEHLLEHKEKFRRICNKSKIRK  285
             R+A+R EG A +LAIGT+ P N VDQ TYPD+YFRITNSEH  E KEKF+R+C+KS I+ 
Sbjct  8     RKAQRAEGPATVLAIGTSTPPNCVDQATYPDYYFRITNSEHKTELKEKFQRMCDKSMIKT  67

Query  286   RHLVITEELLKKNPNLCTYNEASLNTRQDILVSEVPKLGKEAAMKAIKEWGRPISEITHL  465
             R++ +TEE+LK+NP +C Y   SL+ RQD++V EVP+LGKEAA KAIKEWG+P S+ITHL
Sbjct  68    RYMYLTEEILKENPTVCEYMAPSLDARQDMVVVEVPRLGKEAATKAIKEWGQPKSKITHL  127

Query  466   VFCTSSGVDMPGADFQLAKLLGLSSSVKRLMMYQQGCNAGAAMLRLAKDLAENNKGARVL  645
             VFCT+SGVDMPGAD+QL KLLGL  SVKRLMMYQQGC AG  +LRLAKDLAENNKGARVL
Sbjct  128   VFCTTSGVDMPGADYQLTKLLGLRPSVKRLMMYQQGCFAGGTVLRLAKDLAENNKGARVL  187

Query  646   VVCSEVMLNVFRGPSLEQEDNLLAQCLFGDGSAAVIVGTEPRPGLETPLFELVSAAQTTI  825
             VVCSE+    FRGPS    D+L+ Q LFGDG+AAVI+G++P P +E PLFELVSAAQT +
Sbjct  188   VVCSEITAVTFRGPSDTHLDSLVGQALFGDGAAAVIIGSDPVPEVEKPLFELVSAAQTIL  247

Query  826   PDTDSHLKLHLREMGLTFHCSKAVPSLITQNVEDCLVKAFEPFGISDWNSIFWILHPGGI  1005
             PD+D  +  HLRE+GLTFH  K VP LI++N+E  L +AF+P GISDWNS+FWI HPGG 
Sbjct  248   PDSDGAIDGHLREVGLTFHLLKDVPGLISKNIEKSLNEAFKPIGISDWNSLFWIAHPGGP  307

Query  1006  AILDRVEEKLGLEPEKLRASKDVLSEYGNLTSACVLFILDEMRKKSKKDEEMTTGEGLEW  1185
             AILD+VE KL L+PEKL A++ VLS+YGN++SACVLFILDE+R+KS +    TTGEGLEW
Sbjct  308   AILDQVESKLALKPEKLEATRQVLSDYGNMSSACVLFILDEVRRKSAEKGLKTTGEGLEW  367

Query  1186  GVVFVVCP  1209
             GV+F   P
Sbjct  368   GVLFGFGP  375



>gb|AHZ30595.1| chalcone synthase, partial [Prunus domestica]
Length=375

 Score =   525 bits (1351),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 245/367 (67%), Positives = 300/367 (82%), Gaps = 0/367 (0%)
 Frame = +1

Query  109   RAKRFEGDAKILAIGTAIPANWVDQTTYPDFYFRITNSEHLLEHKEKFRRICNKSKIRKR  288
             +A+R EG A +LAIGTA P N VDQ TYPD+YFRITNSEH  E KEKF+R+C+KS I+KR
Sbjct  1     QAQRAEGPATVLAIGTATPPNCVDQATYPDYYFRITNSEHKTELKEKFQRMCDKSMIKKR  60

Query  289   HLVITEELLKKNPNLCTYNEASLNTRQDILVSEVPKLGKEAAMKAIKEWGRPISEITHLV  468
             ++ +TEE+LK+NP +C Y   SL+ RQD++V E+PKLGKEAA KAIKEWG+P S+ITHLV
Sbjct  61    YMYLTEEILKENPTMCEYMAPSLDARQDMVVVEIPKLGKEAATKAIKEWGQPKSKITHLV  120

Query  469   FCTSSGVDMPGADFQLAKLLGLSSSVKRLMMYQQGCNAGAAMLRLAKDLAENNKGARVLV  648
             FCT+SGVDMPGAD+QL KLLGL SSVKRLMMYQQGC AG  +LRLAKDLAENN+GARVLV
Sbjct  121   FCTTSGVDMPGADYQLTKLLGLRSSVKRLMMYQQGCFAGGTVLRLAKDLAENNRGARVLV  180

Query  649   VCSEVMLNVFRGPSLEQEDNLLAQCLFGDGSAAVIVGTEPRPGLETPLFELVSAAQTTIP  828
             VCSE+    FRGPS    D+L+ Q LFGDG+AA+IVG +P P +E PLFE+VSAAQT +P
Sbjct  181   VCSEITAVTFRGPSDTHLDSLVGQALFGDGAAAIIVGADPIPEIEKPLFEVVSAAQTILP  240

Query  829   DTDSHLKLHLREMGLTFHCSKAVPSLITQNVEDCLVKAFEPFGISDWNSIFWILHPGGIA  1008
             D+D  +  HLRE+GLTFH  K VP LI++N+E  L +AF+P GISDWNS+FWI HPGG A
Sbjct  241   DSDGAIDGHLREVGLTFHLLKDVPGLISKNIEKSLNEAFQPLGISDWNSLFWIAHPGGPA  300

Query  1009  ILDRVEEKLGLEPEKLRASKDVLSEYGNLTSACVLFILDEMRKKSKKDEEMTTGEGLEWG  1188
             ILD+VE KL L+PEKL A++ +LSEYGN++SACVLFILDE+RK++ K    TTG+GL+WG
Sbjct  301   ILDQVESKLALKPEKLEATRHILSEYGNMSSACVLFILDEVRKRATKKGLKTTGDGLDWG  360

Query  1189  VVFVVCP  1209
             V+F   P
Sbjct  361   VLFGFGP  367



>gb|ADZ54780.1| naringenin-chalcone synthase [Prunus avium]
Length=391

 Score =   525 bits (1352),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 244/368 (66%), Positives = 301/368 (82%), Gaps = 0/368 (0%)
 Frame = +1

Query  106   RRAKRFEGDAKILAIGTAIPANWVDQTTYPDFYFRITNSEHLLEHKEKFRRICNKSKIRK  285
             R+A+R EG A +LAIGT+ P N VDQ TYPD+YFRITNSEH  E KEKF+R+C+KS I+K
Sbjct  8     RKAQRAEGPATVLAIGTSNPPNCVDQATYPDYYFRITNSEHKTELKEKFQRMCDKSMIKK  67

Query  286   RHLVITEELLKKNPNLCTYNEASLNTRQDILVSEVPKLGKEAAMKAIKEWGRPISEITHL  465
             R++ +TEE+LK+NP +C Y   SL+ RQD++V E+PKLGKEAA KAIKEWG+P S+ITHL
Sbjct  68    RYMYLTEEILKENPTMCEYMAPSLDARQDMVVVEIPKLGKEAATKAIKEWGQPKSKITHL  127

Query  466   VFCTSSGVDMPGADFQLAKLLGLSSSVKRLMMYQQGCNAGAAMLRLAKDLAENNKGARVL  645
             VFCT+SGVDMPGAD+QL KLLGL SSVKRLMMYQQGC AG  +LRLAKDLAENN+GARVL
Sbjct  128   VFCTTSGVDMPGADYQLTKLLGLRSSVKRLMMYQQGCFAGGTVLRLAKDLAENNRGARVL  187

Query  646   VVCSEVMLNVFRGPSLEQEDNLLAQCLFGDGSAAVIVGTEPRPGLETPLFELVSAAQTTI  825
             VVCSE+    FRGPS    D+L+ Q LFGDG+AA+IVG +P P +E PLFE+VSAAQT +
Sbjct  188   VVCSEITAVTFRGPSDTHLDSLVGQALFGDGAAAIIVGADPIPEIEKPLFEVVSAAQTIL  247

Query  826   PDTDSHLKLHLREMGLTFHCSKAVPSLITQNVEDCLVKAFEPFGISDWNSIFWILHPGGI  1005
             PD+D  +  HLRE+GLTFH  K VP LI++N++  L +AF+P GISDWNS+FWI HPGG 
Sbjct  248   PDSDGAIDGHLREVGLTFHLLKDVPGLISKNIZKSLNEAFQPLGISDWNSLFWIAHPGGP  307

Query  1006  AILDRVEEKLGLEPEKLRASKDVLSEYGNLTSACVLFILDEMRKKSKKDEEMTTGEGLEW  1185
             AILD+VE KL L+PEKL A++ +LSEYGN++SACVLFILDE+RK++ K    TTG+GL+W
Sbjct  308   AILDQVESKLALKPEKLEATRHILSEYGNMSSACVLFILDEVRKRATKKGLKTTGDGLDW  367

Query  1186  GVVFVVCP  1209
             GV+F   P
Sbjct  368   GVLFGFGP  375



>ref|XP_004306542.1| PREDICTED: chalcone synthase 2-like [Fragaria vesca subsp. vesca]
Length=389

 Score =   525 bits (1352),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 244/368 (66%), Positives = 302/368 (82%), Gaps = 0/368 (0%)
 Frame = +1

Query  106   RRAKRFEGDAKILAIGTAIPANWVDQTTYPDFYFRITNSEHLLEHKEKFRRICNKSKIRK  285
             R+A+R EG A +LAIGTA P N +DQ+TYPD+YFRITNSEH  E KEKF+R+C+KS I+K
Sbjct  8     RKAQRAEGPATVLAIGTATPPNCIDQSTYPDYYFRITNSEHKAELKEKFQRMCDKSMIKK  67

Query  286   RHLVITEELLKKNPNLCTYNEASLNTRQDILVSEVPKLGKEAAMKAIKEWGRPISEITHL  465
             R++ +TEE+LK+NP++C Y   SL+ RQD++V E+PKLGK+AA+KAIKEWG+P S ITHL
Sbjct  68    RYMYLTEEILKENPSMCEYMAPSLDARQDMVVVEIPKLGKDAAVKAIKEWGQPKSRITHL  127

Query  466   VFCTSSGVDMPGADFQLAKLLGLSSSVKRLMMYQQGCNAGAAMLRLAKDLAENNKGARVL  645
             VFCT+SGVDMPGAD+QL KLLGL  SVKRLMMYQQGC AG  +LRLAKDLAENN+GARVL
Sbjct  128   VFCTTSGVDMPGADYQLTKLLGLRPSVKRLMMYQQGCFAGGTVLRLAKDLAENNRGARVL  187

Query  646   VVCSEVMLNVFRGPSLEQEDNLLAQCLFGDGSAAVIVGTEPRPGLETPLFELVSAAQTTI  825
             VVCSE+    FRGPS    D+L+ Q LFGDG+AA+IVG++P P +E PLFELVSAAQT +
Sbjct  188   VVCSEITAVTFRGPSDTHLDSLVGQALFGDGAAAIIVGSDPLPEVERPLFELVSAAQTIL  247

Query  826   PDTDSHLKLHLREMGLTFHCSKAVPSLITQNVEDCLVKAFEPFGISDWNSIFWILHPGGI  1005
             PD+D  +  HLRE+GLTFH  K VP LI++N+E  L +AF+P  I+DWNS+FWI HPGG 
Sbjct  248   PDSDGAIDGHLREVGLTFHLLKDVPGLISKNIEKSLNEAFKPLNITDWNSLFWIAHPGGP  307

Query  1006  AILDRVEEKLGLEPEKLRASKDVLSEYGNLTSACVLFILDEMRKKSKKDEEMTTGEGLEW  1185
             AILD+VE KL L+PEKL A++ +LSEYGN++SACVLFILDE+R+KS  +   TTGEGLEW
Sbjct  308   AILDQVEAKLALKPEKLEATRHILSEYGNMSSACVLFILDEVRRKSAANGHKTTGEGLEW  367

Query  1186  GVVFVVCP  1209
             GV+F   P
Sbjct  368   GVLFGFGP  375



>ref|XP_009376346.1| PREDICTED: chalcone synthase-like [Pyrus x bretschneideri]
 gb|ADP09376.1| chalcone synthase [Pyrus pyrifolia]
 gb|AGV40323.1| chalcone synthase [Pyrus x bretschneideri]
Length=389

 Score =   525 bits (1352),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 247/368 (67%), Positives = 300/368 (82%), Gaps = 0/368 (0%)
 Frame = +1

Query  106   RRAKRFEGDAKILAIGTAIPANWVDQTTYPDFYFRITNSEHLLEHKEKFRRICNKSKIRK  285
             R+A+R EG A +LAIGT+ P N VDQ TYPD+YFRITNSEH  E KEKF+R+C+KS I+ 
Sbjct  8     RKAQRAEGPATVLAIGTSTPPNCVDQATYPDYYFRITNSEHKTELKEKFQRMCDKSMIKT  67

Query  286   RHLVITEELLKKNPNLCTYNEASLNTRQDILVSEVPKLGKEAAMKAIKEWGRPISEITHL  465
             R++ +TEE+LK+NP +C Y   SL+ RQD++V EVP+LGKEAA KAIKEWG+P S+ITHL
Sbjct  68    RYMYLTEEILKENPTVCEYMAPSLDARQDMVVVEVPRLGKEAATKAIKEWGQPKSKITHL  127

Query  466   VFCTSSGVDMPGADFQLAKLLGLSSSVKRLMMYQQGCNAGAAMLRLAKDLAENNKGARVL  645
             VFCT+SGVDMPGAD+QL KLLGL  SVKRLMMYQQGC AG  +LRLAKDLAENNKGARVL
Sbjct  128   VFCTTSGVDMPGADYQLTKLLGLRPSVKRLMMYQQGCFAGGTVLRLAKDLAENNKGARVL  187

Query  646   VVCSEVMLNVFRGPSLEQEDNLLAQCLFGDGSAAVIVGTEPRPGLETPLFELVSAAQTTI  825
             VVCSE+    FRGPS    D+L+ Q LFGDG+AAVI+G++P P +E PLFELVSAAQT +
Sbjct  188   VVCSEITAVTFRGPSDTHLDSLVGQALFGDGAAAVIIGSDPVPEVEKPLFELVSAAQTIL  247

Query  826   PDTDSHLKLHLREMGLTFHCSKAVPSLITQNVEDCLVKAFEPFGISDWNSIFWILHPGGI  1005
             PD+D  +  HLRE+GLTFH  K VP LI++N+E  L +AF+P GISDWNS+FWI HPGG 
Sbjct  248   PDSDGAIDGHLREVGLTFHLLKDVPGLISKNIEKSLNEAFKPIGISDWNSLFWIAHPGGP  307

Query  1006  AILDRVEEKLGLEPEKLRASKDVLSEYGNLTSACVLFILDEMRKKSKKDEEMTTGEGLEW  1185
             AILD+VE KL L+PEKL A++ VLS+YGN++SACVLFILDE+R+KS +    TTGEGLEW
Sbjct  308   AILDQVESKLALKPEKLEATRQVLSDYGNMSSACVLFILDEVRRKSAEKGLKTTGEGLEW  367

Query  1186  GVVFVVCP  1209
             GV+F   P
Sbjct  368   GVLFGFGP  375



>ref|XP_003601647.1| Chalcone synthase [Medicago truncatula]
 gb|AES71898.1| chalcone and stilbene synthase family protein [Medicago truncatula]
Length=389

 Score =   525 bits (1352),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 246/368 (67%), Positives = 302/368 (82%), Gaps = 0/368 (0%)
 Frame = +1

Query  106   RRAKRFEGDAKILAIGTAIPANWVDQTTYPDFYFRITNSEHLLEHKEKFRRICNKSKIRK  285
             R+A+R +G A +LAIGTA P N VDQ+TYPD+YFRITNSEH  E KEKF+R+C+KS I+K
Sbjct  8     RQAQRADGPATVLAIGTATPQNCVDQSTYPDYYFRITNSEHKTELKEKFQRMCDKSMIKK  67

Query  286   RHLVITEELLKKNPNLCTYNEASLNTRQDILVSEVPKLGKEAAMKAIKEWGRPISEITHL  465
             R++ +TEE+LK+NP++C Y   SL+ RQD++V EVP+LGKEAA KAIKEWG+P S+ITHL
Sbjct  68    RYMYLTEEILKENPSVCEYMAPSLDARQDMVVVEVPRLGKEAATKAIKEWGQPKSKITHL  127

Query  466   VFCTSSGVDMPGADFQLAKLLGLSSSVKRLMMYQQGCNAGAAMLRLAKDLAENNKGARVL  645
             +FCT+SGVDMPGAD+QL KLLGL   VKR MMYQQGC AG  +LRLAKDLAENNKGARVL
Sbjct  128   IFCTTSGVDMPGADYQLTKLLGLRPYVKRYMMYQQGCFAGGTVLRLAKDLAENNKGARVL  187

Query  646   VVCSEVMLNVFRGPSLEQEDNLLAQCLFGDGSAAVIVGTEPRPGLETPLFELVSAAQTTI  825
             VVCSE+    FRGPS    D+L+ Q LFGDG+AAVIVG++P P +E PLFELV  AQT +
Sbjct  188   VVCSEITAVTFRGPSDTHLDSLVGQALFGDGAAAVIVGSDPLPQVEKPLFELVWTAQTIL  247

Query  826   PDTDSHLKLHLREMGLTFHCSKAVPSLITQNVEDCLVKAFEPFGISDWNSIFWILHPGGI  1005
             PD++  +  HLRE+GLTFH  K VP LI++N+E  L +AF+P GISD+NSIFWI HPGG 
Sbjct  248   PDSEGAIDGHLREVGLTFHLLKDVPGLISKNIEKALAEAFQPLGISDYNSIFWIAHPGGP  307

Query  1006  AILDRVEEKLGLEPEKLRASKDVLSEYGNLTSACVLFILDEMRKKSKKDEEMTTGEGLEW  1185
             AILD+VE KL L+PEK++A++ VLSEYGN++SACVLFILDEMR+KSK+D   TTGEGLEW
Sbjct  308   AILDQVEAKLSLKPEKMQATRHVLSEYGNMSSACVLFILDEMRRKSKEDGLATTGEGLEW  367

Query  1186  GVVFVVCP  1209
             GV+F   P
Sbjct  368   GVLFGFGP  375



>prf||1609233A chalcone synthase 3
Length=395

 Score =   525 bits (1352),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 250/369 (68%), Positives = 302/369 (82%), Gaps = 1/369 (0%)
 Frame = +1

Query  106   RRAKRFEGDAKILAIGTAIPANWVDQTTYPDFYFRITNSEHLLEHKEKFRRICNKSKIRK  285
             R+A+R +G A ILAIGTA PAN V Q  YPD+YFRITNSEH+ + KEKF+R+C+KS IRK
Sbjct  13    RKAQRADGPAGILAIGTANPANHVIQAEYPDYYFRITNSEHMTDLKEKFKRMCDKSTIRK  72

Query  286   RHLVITEELLKKNPNLCTYNEASLNTRQDILVSEVPKLGKEAAMKAIKEWGRPISEITHL  465
             RH+ +TEE LK NPN+C Y   SL+ RQDI+V EVPKLGKEAA+KAIKEWG+P S+ITH+
Sbjct  73    RHMHLTEEFLKDNPNMCAYMAPSLDARQDIVVVEVPKLGKEAAVKAIKEWGQPKSKITHV  132

Query  466   VFCTSSGVDMPGADFQLAKLLGLSSSVKRLMMYQQGCNAGAAMLRLAKDLAENNKGARVL  645
             VFCT+SGVDMPGAD+QL KLLGL  SVKRLMMYQQGC AG  +LRLAKDLAENN+GARVL
Sbjct  133   VFCTTSGVDMPGADYQLTKLLGLRPSVKRLMMYQQGCFAGGTVLRLAKDLAENNRGARVL  192

Query  646   VVCSEVMLNVFRGPSLEQEDNLLAQCLFGDGSAAVIVGTEPRPGL-ETPLFELVSAAQTT  822
             VVCSE+    FRGPS    D+L+ Q LF DG+AA+IVG++P   + E P+FE+VSAAQT 
Sbjct  193   VVCSEITAVTFRGPSDTHLDSLVGQALFSDGAAALIVGSDPDTSVGEKPIFEMVSAAQTI  252

Query  823   IPDTDSHLKLHLREMGLTFHCSKAVPSLITQNVEDCLVKAFEPFGISDWNSIFWILHPGG  1002
             +PD+D  +  HLRE+GLTFH  K VP LI++N+E  L +AF+P GISDWNS+FWI HPGG
Sbjct  253   LPDSDGAIDGHLREVGLTFHLLKDVPGLISKNIEKSLDEAFKPLGISDWNSLFWIAHPGG  312

Query  1003  IAILDRVEEKLGLEPEKLRASKDVLSEYGNLTSACVLFILDEMRKKSKKDEEMTTGEGLE  1182
              AILD VE+KLGL+ EK+RA++ VLSEYGN++SACVLFILDEMR+KSK+D   TTGEGLE
Sbjct  313   PAILDDVEKKLGLKAEKMRATRHVLSEYGNMSSACVLFILDEMRRKSKEDGVATTGEGLE  372

Query  1183  WGVVFVVCP  1209
             WGV+F   P
Sbjct  373   WGVLFGFGP  381



>gb|AAN05791.1| chalcone synthase [Mazus pumilus]
Length=392

 Score =   525 bits (1352),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 245/368 (67%), Positives = 301/368 (82%), Gaps = 0/368 (0%)
 Frame = +1

Query  106   RRAKRFEGDAKILAIGTAIPANWVDQTTYPDFYFRITNSEHLLEHKEKFRRICNKSKIRK  285
             RRA+R EG A +LAIGTA P+N VDQ+TYPD+YFRITNSEH+ + KEKF+R+C KS I+K
Sbjct  9     RRAQRAEGPATVLAIGTATPSNCVDQSTYPDYYFRITNSEHMTDLKEKFKRMCEKSYIKK  68

Query  286   RHLVITEELLKKNPNLCTYNEASLNTRQDILVSEVPKLGKEAAMKAIKEWGRPISEITHL  465
             R++ +TEE+LK+NPN+C Y   SL+ RQDI+V E+PKLGKEAA KAIKEWG+P S+ITHL
Sbjct  69    RYMHLTEEILKENPNMCAYMAPSLDARQDIVVVEIPKLGKEAAQKAIKEWGQPKSKITHL  128

Query  466   VFCTSSGVDMPGADFQLAKLLGLSSSVKRLMMYQQGCNAGAAMLRLAKDLAENNKGARVL  645
             VFCT+SGVDMPGAD+QL KLLGL  SVKR MMYQQGC AG  +LR+AKDLAENN GARVL
Sbjct  129   VFCTTSGVDMPGADYQLTKLLGLRPSVKRFMMYQQGCFAGGTVLRMAKDLAENNAGARVL  188

Query  646   VVCSEVMLNVFRGPSLEQEDNLLAQCLFGDGSAAVIVGTEPRPGLETPLFELVSAAQTTI  825
             VVCSE+    FRGPS    D+L+ Q LFGDG+AAVIVG++P  G+E PLF++VSAAQT +
Sbjct  189   VVCSEITAVTFRGPSDSHLDSLVGQALFGDGAAAVIVGSDPIVGVERPLFQIVSAAQTLL  248

Query  826   PDTDSHLKLHLREMGLTFHCSKAVPSLITQNVEDCLVKAFEPFGISDWNSIFWILHPGGI  1005
             PD+   +  HLRE+GLTFH  K VP LI++++E  L +AF+P GISDWNSIFWI HPGG 
Sbjct  249   PDSHGAIDGHLREVGLTFHLLKDVPGLISKHIEKSLKEAFDPLGISDWNSIFWIAHPGGP  308

Query  1006  AILDRVEEKLGLEPEKLRASKDVLSEYGNLTSACVLFILDEMRKKSKKDEEMTTGEGLEW  1185
             AILD+VE  L L+PEK+RA++ VLS+YGN++SACVLFILDEMRK S K+   +TGEGL+W
Sbjct  309   AILDQVESVLALKPEKMRATRQVLSDYGNMSSACVLFILDEMRKASAKEGMGSTGEGLDW  368

Query  1186  GVVFVVCP  1209
             GV+F   P
Sbjct  369   GVLFGFGP  376



>gb|AFM29141.1| chalcone synthase, partial [Lycium barbarum]
Length=383

 Score =   525 bits (1351),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 253/368 (69%), Positives = 306/368 (83%), Gaps = 0/368 (0%)
 Frame = +1

Query  106   RRAKRFEGDAKILAIGTAIPANWVDQTTYPDFYFRITNSEHLLEHKEKFRRICNKSKIRK  285
             R+A+R EG A ++AIGTA P+N VDQ+TYPD+YFRIT+SEH  E KEKF+R+C+KS I+K
Sbjct  8     RKAQRAEGPATVMAIGTATPSNCVDQSTYPDYYFRITDSEHKTELKEKFKRMCDKSMIKK  67

Query  286   RHLVITEELLKKNPNLCTYNEASLNTRQDILVSEVPKLGKEAAMKAIKEWGRPISEITHL  465
             R++ +TEE+LK+NPN+C Y   SL+ RQDI+V EVPKLGKEAA KAIKEWG+P S+ITHL
Sbjct  68    RYMHLTEEILKENPNMCAYMAPSLDARQDIVVVEVPKLGKEAAQKAIKEWGQPKSKITHL  127

Query  466   VFCTSSGVDMPGADFQLAKLLGLSSSVKRLMMYQQGCNAGAAMLRLAKDLAENNKGARVL  645
             VFCT+SGVDMPG D+QLAKLLGL  SVKRLMMYQQGC AG  +LRLAKDLAENNKGARVL
Sbjct  128   VFCTTSGVDMPGCDYQLAKLLGLRPSVKRLMMYQQGCFAGGTVLRLAKDLAENNKGARVL  187

Query  646   VVCSEVMLNVFRGPSLEQEDNLLAQCLFGDGSAAVIVGTEPRPGLETPLFELVSAAQTTI  825
             VVCSE+    FRGPS    D+L+ Q LFGDG+AA+I+G++P PG+E PLFELVSAAQT +
Sbjct  188   VVCSEITAVTFRGPSESHLDSLVGQALFGDGAAAIIMGSDPIPGVERPLFELVSAAQTLL  247

Query  826   PDTDSHLKLHLREMGLTFHCSKAVPSLITQNVEDCLVKAFEPFGISDWNSIFWILHPGGI  1005
             PD++  +  HLRE+GLTFH  K VP LI++N+E  LV+AF+P GISDWNS+FWI HPGG 
Sbjct  248   PDSEGAIDGHLREVGLTFHLLKDVPGLISKNIEKSLVEAFQPLGISDWNSLFWIAHPGGP  307

Query  1006  AILDRVEEKLGLEPEKLRASKDVLSEYGNLTSACVLFILDEMRKKSKKDEEMTTGEGLEW  1185
             AILD+VE KL L+PEKLRA++DVLS YGN++SACVLFILDEMRK S K+   TTGEGL W
Sbjct  308   AILDQVELKLALKPEKLRATRDVLSNYGNMSSACVLFILDEMRKASAKEGLGTTGEGLGW  367

Query  1186  GVVFVVCP  1209
             GV+F   P
Sbjct  368   GVLFGFGP  375



>ref|XP_009353802.1| PREDICTED: chalcone synthase-like [Pyrus x bretschneideri]
Length=390

 Score =   525 bits (1352),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 247/368 (67%), Positives = 300/368 (82%), Gaps = 0/368 (0%)
 Frame = +1

Query  106   RRAKRFEGDAKILAIGTAIPANWVDQTTYPDFYFRITNSEHLLEHKEKFRRICNKSKIRK  285
             R+A+R EG A + AIGTA P N VDQ TYPD+YFRITNSEH  E KEKF+R+C+KS I+K
Sbjct  8     RKAQRAEGPATVFAIGTATPPNCVDQATYPDYYFRITNSEHKAELKEKFQRMCDKSMIKK  67

Query  286   RHLVITEELLKKNPNLCTYNEASLNTRQDILVSEVPKLGKEAAMKAIKEWGRPISEITHL  465
             R++ +TEE+LK+NP++C Y   SL+ RQD++V EVP+LGKEAA KAIKEWG+P S+ITHL
Sbjct  68    RYMYLTEEILKENPSVCEYVAPSLDARQDMVVVEVPRLGKEAATKAIKEWGQPKSKITHL  127

Query  466   VFCTSSGVDMPGADFQLAKLLGLSSSVKRLMMYQQGCNAGAAMLRLAKDLAENNKGARVL  645
             VFCT+SGVDMPGAD+QL KLLGL  SVKRLMMYQQGC AG  +LRLAKDLAENNKGARVL
Sbjct  128   VFCTTSGVDMPGADYQLTKLLGLRPSVKRLMMYQQGCFAGGTVLRLAKDLAENNKGARVL  187

Query  646   VVCSEVMLNVFRGPSLEQEDNLLAQCLFGDGSAAVIVGTEPRPGLETPLFELVSAAQTTI  825
             VVCSE+    FRGPS    D+L+ Q LFGDG+AAVI+G +P P +E PLFELVSAAQT +
Sbjct  188   VVCSEITAVTFRGPSDTHLDSLVGQALFGDGAAAVIIGADPVPEVEKPLFELVSAAQTIL  247

Query  826   PDTDSHLKLHLREMGLTFHCSKAVPSLITQNVEDCLVKAFEPFGISDWNSIFWILHPGGI  1005
             PD+D  +  HLRE+GLTFH  K VP LI++N+E  L +AF+P GISDWNS+FWI HPGG 
Sbjct  248   PDSDGAIDGHLREVGLTFHLLKDVPGLISKNIEKSLNEAFKPIGISDWNSLFWIAHPGGP  307

Query  1006  AILDRVEEKLGLEPEKLRASKDVLSEYGNLTSACVLFILDEMRKKSKKDEEMTTGEGLEW  1185
             AILD+VE KL L+PEKL A++ VLS+YGN++SACVLFILDE+R+KS +    T+GEGLEW
Sbjct  308   AILDQVEAKLALKPEKLEATRQVLSDYGNMSSACVLFILDEVRRKSAEKGLKTSGEGLEW  367

Query  1186  GVVFVVCP  1209
             GV+F   P
Sbjct  368   GVLFGFGP  375



>gb|ACS36661.1| CHS4 [Vitis labrusca x Vitis vinifera]
Length=393

 Score =   525 bits (1352),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 249/368 (68%), Positives = 300/368 (82%), Gaps = 0/368 (0%)
 Frame = +1

Query  106   RRAKRFEGDAKILAIGTAIPANWVDQTTYPDFYFRITNSEHLLEHKEKFRRICNKSKIRK  285
             R+A+R EG A +LAIGTA PAN V Q  YPD+YFRITNSEH+ E KEKF+R+C KS I K
Sbjct  8     RKAQRAEGPATVLAIGTATPANCVYQADYPDYYFRITNSEHMTELKEKFKRMCEKSMINK  67

Query  286   RHLVITEELLKKNPNLCTYNEASLNTRQDILVSEVPKLGKEAAMKAIKEWGRPISEITHL  465
             R++ +TEE+LK+NPN+C Y   SL+ RQD++V EVPKLGKEAA+KAIKEWG+P S+ITHL
Sbjct  68    RYMHLTEEILKENPNVCAYMAPSLDARQDMVVVEVPKLGKEAAVKAIKEWGQPKSKITHL  127

Query  466   VFCTSSGVDMPGADFQLAKLLGLSSSVKRLMMYQQGCNAGAAMLRLAKDLAENNKGARVL  645
             VFCT+SGVDMPGAD+QL KLLGL  SVKRLMMYQQGC AG  +LRLAKDLAENN G+RVL
Sbjct  128   VFCTTSGVDMPGADYQLTKLLGLKPSVKRLMMYQQGCFAGGTVLRLAKDLAENNAGSRVL  187

Query  646   VVCSEVMLNVFRGPSLEQEDNLLAQCLFGDGSAAVIVGTEPRPGLETPLFELVSAAQTTI  825
             VVC E+    FRGPS    D+L+ Q LFGDG+AAVI+G +P   +E PLFELVSAAQT +
Sbjct  188   VVCPEITAVTFRGPSDTHLDSLVGQALFGDGAAAVIIGADPDTKIERPLFELVSAAQTIL  247

Query  826   PDTDSHLKLHLREMGLTFHCSKAVPSLITQNVEDCLVKAFEPFGISDWNSIFWILHPGGI  1005
             PD++  +  HLRE+GLTFH  K VP LI++N+E  LV+AF P GISDWNS+FWI HPGG 
Sbjct  248   PDSEGAIDGHLREVGLTFHLLKDVPGLISKNIEKSLVEAFTPIGISDWNSLFWIAHPGGP  307

Query  1006  AILDRVEEKLGLEPEKLRASKDVLSEYGNLTSACVLFILDEMRKKSKKDEEMTTGEGLEW  1185
             AILD+VE KLGL+ EKLRA++ VLSEYGN++SACVLFILDEMRKKS ++ + +TGEGLEW
Sbjct  308   AILDQVELKLGLKEEKLRATRHVLSEYGNMSSACVLFILDEMRKKSIEEGKASTGEGLEW  367

Query  1186  GVVFVVCP  1209
             GV+F   P
Sbjct  368   GVLFGFGP  375



>ref|XP_009353801.1| PREDICTED: chalcone synthase [Pyrus x bretschneideri]
Length=389

 Score =   525 bits (1351),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 247/368 (67%), Positives = 300/368 (82%), Gaps = 0/368 (0%)
 Frame = +1

Query  106   RRAKRFEGDAKILAIGTAIPANWVDQTTYPDFYFRITNSEHLLEHKEKFRRICNKSKIRK  285
             R+A+R EG A + AIGTA P N VDQ TYPD+YFRITNSEH  E KEKF+R+C+KS I+K
Sbjct  8     RKAQRAEGPATVFAIGTATPPNCVDQATYPDYYFRITNSEHKAELKEKFQRMCDKSMIKK  67

Query  286   RHLVITEELLKKNPNLCTYNEASLNTRQDILVSEVPKLGKEAAMKAIKEWGRPISEITHL  465
             R++ +TEE+LK+NP++C Y   SL+ RQD++V EVP+LGKEAA KAIKEWG+P S+ITHL
Sbjct  68    RYMYLTEEILKENPSVCEYMAPSLDARQDMVVVEVPRLGKEAATKAIKEWGQPKSKITHL  127

Query  466   VFCTSSGVDMPGADFQLAKLLGLSSSVKRLMMYQQGCNAGAAMLRLAKDLAENNKGARVL  645
             VFCT+SGVDMPGAD+QL KLLGL  SVKRLMMYQQGC AG  +LRLAKDLAENNKGARVL
Sbjct  128   VFCTTSGVDMPGADYQLTKLLGLRPSVKRLMMYQQGCFAGGTVLRLAKDLAENNKGARVL  187

Query  646   VVCSEVMLNVFRGPSLEQEDNLLAQCLFGDGSAAVIVGTEPRPGLETPLFELVSAAQTTI  825
             VVCSE+    FRGPS    D+L+ Q LFGDG+AAVI+G +P P +E PLFELVSAAQT +
Sbjct  188   VVCSEITAVTFRGPSDTHLDSLVGQALFGDGAAAVIIGADPVPEVEKPLFELVSAAQTIL  247

Query  826   PDTDSHLKLHLREMGLTFHCSKAVPSLITQNVEDCLVKAFEPFGISDWNSIFWILHPGGI  1005
             PD+D  +  HLRE+GLTFH  K VP LI++++E  L +AF+P GISDWNS+FWI HPGG 
Sbjct  248   PDSDGAIDGHLREVGLTFHLLKDVPGLISKSIEKSLNEAFKPIGISDWNSLFWIAHPGGP  307

Query  1006  AILDRVEEKLGLEPEKLRASKDVLSEYGNLTSACVLFILDEMRKKSKKDEEMTTGEGLEW  1185
             AILD+VE KL L+PEKL A++ VLS+YGN++SACVLFILDE+R+KS +    TTGEGLEW
Sbjct  308   AILDQVEAKLALKPEKLEATRQVLSDYGNMSSACVLFILDEVRRKSAEKGLKTTGEGLEW  367

Query  1186  GVVFVVCP  1209
             GV+F   P
Sbjct  368   GVLFGFGP  375



>ref|XP_006468926.1| PREDICTED: chalcone synthase 2-like [Citrus sinensis]
 gb|ACB47461.1| chalcone synthase [Citrus sinensis]
Length=391

 Score =   525 bits (1351),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 244/368 (66%), Positives = 299/368 (81%), Gaps = 0/368 (0%)
 Frame = +1

Query  106   RRAKRFEGDAKILAIGTAIPANWVDQTTYPDFYFRITNSEHLLEHKEKFRRICNKSKIRK  285
             R A+R +G A +LAIGTA PA+ V+Q  YPD+YFRIT SEH+ E KEKF+R+C+KS I+K
Sbjct  8     RNAQRADGPATVLAIGTATPAHSVNQADYPDYYFRITKSEHMTELKEKFKRMCDKSMIKK  67

Query  286   RHLVITEELLKKNPNLCTYNEASLNTRQDILVSEVPKLGKEAAMKAIKEWGRPISEITHL  465
             R++ +TEE+LK+NPN+C Y   SL+ RQDI+V EVPKLGKEAA KAIKEWG+P S+ITHL
Sbjct  68    RYMYLTEEILKENPNMCAYMAPSLDARQDIVVVEVPKLGKEAATKAIKEWGQPKSKITHL  127

Query  466   VFCTSSGVDMPGADFQLAKLLGLSSSVKRLMMYQQGCNAGAAMLRLAKDLAENNKGARVL  645
             +FCT+SGVDMPGAD+QL KLLGL  SVKR MMYQQGC AG  +LRLAKDLAENNKGARVL
Sbjct  128   IFCTTSGVDMPGADYQLTKLLGLRPSVKRFMMYQQGCFAGGTVLRLAKDLAENNKGARVL  187

Query  646   VVCSEVMLNVFRGPSLEQEDNLLAQCLFGDGSAAVIVGTEPRPGLETPLFELVSAAQTTI  825
             VVCSE+    FRGP+    D+L+ Q LFGDG+AAVIVG +P   +E PL++LVS +QT +
Sbjct  188   VVCSEITAVTFRGPADTHLDSLVGQALFGDGAAAVIVGADPDTSVERPLYQLVSTSQTIL  247

Query  826   PDTDSHLKLHLREMGLTFHCSKAVPSLITQNVEDCLVKAFEPFGISDWNSIFWILHPGGI  1005
             PD+D  +  HLRE+GLTFH  K VP LI++N+E  L +AF P GISDWNSIFWI HPGG 
Sbjct  248   PDSDGAIDGHLREVGLTFHLLKDVPGLISKNIEKSLSEAFAPVGISDWNSIFWIAHPGGP  307

Query  1006  AILDRVEEKLGLEPEKLRASKDVLSEYGNLTSACVLFILDEMRKKSKKDEEMTTGEGLEW  1185
             AILD+VE KLGL+ EKL+A++ VLSEYGN++SACVLFILDEMRKKS ++ + TTGEGL+W
Sbjct  308   AILDQVESKLGLKEEKLKATRQVLSEYGNMSSACVLFILDEMRKKSAEEAKATTGEGLDW  367

Query  1186  GVVFVVCP  1209
             GV+F   P
Sbjct  368   GVLFGFGP  375



>gb|AAM90651.1|AF400566_1 chalcone synthase 11 [Rubus idaeus]
Length=391

 Score =   525 bits (1351),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 245/368 (67%), Positives = 300/368 (82%), Gaps = 0/368 (0%)
 Frame = +1

Query  106   RRAKRFEGDAKILAIGTAIPANWVDQTTYPDFYFRITNSEHLLEHKEKFRRICNKSKIRK  285
             R+A+R EG A +LAIGTA P N +DQ+TYPD+YFRITNSEH  E KEKF+R+C+KS I+K
Sbjct  8     RKAQRAEGPATVLAIGTATPPNCIDQSTYPDYYFRITNSEHKTELKEKFQRMCDKSMIKK  67

Query  286   RHLVITEELLKKNPNLCTYNEASLNTRQDILVSEVPKLGKEAAMKAIKEWGRPISEITHL  465
             R++ +TEE+LK+NP++C Y   SL+ RQD++V E+PKLGKEAA KAIKEWG+P S+ITHL
Sbjct  68    RYMYLTEEILKENPSMCEYMAPSLDARQDMVVVEIPKLGKEAATKAIKEWGQPKSKITHL  127

Query  466   VFCTSSGVDMPGADFQLAKLLGLSSSVKRLMMYQQGCNAGAAMLRLAKDLAENNKGARVL  645
             VFCT+SGVDMPGAD+QL KLLGL  SVKRLMMY QGC AG  +LRLAKDLAENN+GARVL
Sbjct  128   VFCTTSGVDMPGADYQLTKLLGLRPSVKRLMMYHQGCFAGGTVLRLAKDLAENNRGARVL  187

Query  646   VVCSEVMLNVFRGPSLEQEDNLLAQCLFGDGSAAVIVGTEPRPGLETPLFELVSAAQTTI  825
             VVCSE+    FRGPS    D+L+ Q LFGDG+AA+IVG +P P +E PLFELVSAAQT +
Sbjct  188   VVCSEITAVTFRGPSDTHLDSLVGQALFGDGAAAIIVGADPLPKIERPLFELVSAAQTIL  247

Query  826   PDTDSHLKLHLREMGLTFHCSKAVPSLITQNVEDCLVKAFEPFGISDWNSIFWILHPGGI  1005
             PD+D  +  HLRE+GLTFH  K VP LI+ N+E  L +AF+P  I+DWNS+FWI HPGG 
Sbjct  248   PDSDGAIDGHLREVGLTFHLLKDVPGLISNNIEKSLNEAFKPLDITDWNSLFWIAHPGGP  307

Query  1006  AILDRVEEKLGLEPEKLRASKDVLSEYGNLTSACVLFILDEMRKKSKKDEEMTTGEGLEW  1185
             AILD+VE KLGL+PEKL A++ +LSEYGN++SACVLFILDE+R+KS  +   TTGEGLEW
Sbjct  308   AILDQVETKLGLKPEKLEATRHILSEYGNMSSACVLFILDEVRRKSATNGLKTTGEGLEW  367

Query  1186  GVVFVVCP  1209
             GV+F   P
Sbjct  368   GVLFGFGP  375



>sp|Q9MB37.1|CHS7_IPOBA RecName: Full=Chalcone synthase DIII; AltName: Full=Naringenin-chalcone 
synthase DIII [Ipomoea batatas]
 dbj|BAA90331.1| chalcone synthase CHS-DIII [Ipomoea batatas]
Length=393

 Score =   525 bits (1351),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 252/368 (68%), Positives = 297/368 (81%), Gaps = 1/368 (0%)
 Frame = +1

Query  106   RRAKRFEGDAKILAIGTAIPANWVDQTTYPDFYFRITNSEHLLEHKEKFRRICNKSKIRK  285
             R+AKR EG A ILAIGTA PAN V+Q+TYPD+YFRITNSEH  E KEKF+R+C+KS I K
Sbjct  8     RKAKRAEGPATILAIGTATPANCVNQSTYPDYYFRITNSEHKTELKEKFQRMCDKSMITK  67

Query  286   RHLVITEELLKKNPNLCTYNEASLNTRQDILVSEVPKLGKEAAMKAIKEWGRPISEITHL  465
             R++ +TEE+LK+NP+ C Y   SL+ RQDI V EVPKLGKEAA  AIKEWG+P S+ITH+
Sbjct  68    RYMHLTEEILKENPSFCEYMAPSLDARQDIAVVEVPKLGKEAAQSAIKEWGQPKSKITHV  127

Query  466   VFCTSSGVDMPGADFQLAKLLGLSSSVKRLMMYQQGCNAGAAMLRLAKDLAENNKGARVL  645
              FCT+SGVDMPGAD+QL KLLGL  SVKRLMMYQQGC AG  +LRLAKDLAENNKGARVL
Sbjct  128   FFCTTSGVDMPGADYQLTKLLGLRPSVKRLMMYQQGCFAGGTVLRLAKDLAENNKGARVL  187

Query  646   VVCSEVMLNVFRGPSLEQEDNLLAQCLFGDGSAAVIVGTEPRPGLETPLFELVSAAQTTI  825
             +VCSE+ +  FRGPS    D+L+ Q LFGDG+AAVIVG +P P  E PLF+LVSAAQT  
Sbjct  188   IVCSEITVVTFRGPSETHLDSLVGQALFGDGAAAVIVGADPTPA-EKPLFQLVSAAQTLA  246

Query  826   PDTDSHLKLHLREMGLTFHCSKAVPSLITQNVEDCLVKAFEPFGISDWNSIFWILHPGGI  1005
             PD+   +  HLRE+GLTFH  K VPS+++ N+E CL +AF P GISDWNS+FWI HPGG 
Sbjct  247   PDSCGAIDGHLREVGLTFHLLKDVPSVVSNNIEKCLFEAFNPLGISDWNSVFWIAHPGGP  306

Query  1006  AILDRVEEKLGLEPEKLRASKDVLSEYGNLTSACVLFILDEMRKKSKKDEEMTTGEGLEW  1185
             AILD+VE+KLGL+PEKLRA++ VLSEYGN++SACVLFILDEMRK S      TTGEGLEW
Sbjct  307   AILDQVEDKLGLKPEKLRATRHVLSEYGNMSSACVLFILDEMRKASSNAGLGTTGEGLEW  366

Query  1186  GVVFVVCP  1209
             GV+F   P
Sbjct  367   GVLFGFGP  374



>sp|Q9AU09.1|PKS3_RUBID RecName: Full=Polyketide synthase 3; Short=RiPKS3; AltName: Full=Naringenin-chalcone 
synthase PKS3 [Rubus idaeus]
 gb|AAK15176.1|AF292369_1 aromatic polyketide synthase [Rubus idaeus]
Length=391

 Score =   525 bits (1351),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 246/368 (67%), Positives = 302/368 (82%), Gaps = 0/368 (0%)
 Frame = +1

Query  106   RRAKRFEGDAKILAIGTAIPANWVDQTTYPDFYFRITNSEHLLEHKEKFRRICNKSKIRK  285
             R+A+R EG A ILAIGTA P N VDQ+TYPD+YFRIT SEH  E KEKF+R+C+KS+I+K
Sbjct  8     RKAQRAEGPATILAIGTATPPNCVDQSTYPDYYFRITKSEHRTELKEKFQRMCDKSRIKK  67

Query  286   RHLVITEELLKKNPNLCTYNEASLNTRQDILVSEVPKLGKEAAMKAIKEWGRPISEITHL  465
             R++ +TEE+LK+NP++C Y   SL+ RQD++V E+PKLGKEAA KAIKEWG+  S+ITHL
Sbjct  68    RYMYLTEEILKENPSMCEYMAPSLDARQDMVVVEIPKLGKEAATKAIKEWGQLKSKITHL  127

Query  466   VFCTSSGVDMPGADFQLAKLLGLSSSVKRLMMYQQGCNAGAAMLRLAKDLAENNKGARVL  645
             VFCT+SGVDMPGAD+QL KLLGL  SVKRLMMYQQGC AG  +LRLAKDLAENNKGARVL
Sbjct  128   VFCTTSGVDMPGADYQLTKLLGLRPSVKRLMMYQQGCFAGGTVLRLAKDLAENNKGARVL  187

Query  646   VVCSEVMLNVFRGPSLEQEDNLLAQCLFGDGSAAVIVGTEPRPGLETPLFELVSAAQTTI  825
              VCSE+    FRGPS    D+L+ Q LFGDG+AA+IVG++P P +E PLFELVSAAQT +
Sbjct  188   AVCSEITAVTFRGPSDTHLDSLVGQALFGDGAAAIIVGSDPLPDIERPLFELVSAAQTIL  247

Query  826   PDTDSHLKLHLREMGLTFHCSKAVPSLITQNVEDCLVKAFEPFGISDWNSIFWILHPGGI  1005
             PD+D  +  HLRE+GLTFH  K VP LI++N+E  L +AF+P  I+DWNS+FWI HPGG 
Sbjct  248   PDSDGAIDGHLREVGLTFHLLKDVPGLISKNIEKSLNEAFKPLDITDWNSLFWIAHPGGP  307

Query  1006  AILDRVEEKLGLEPEKLRASKDVLSEYGNLTSACVLFILDEMRKKSKKDEEMTTGEGLEW  1185
             AILD+VE KLGL+PEKL A++++LSEYGN++SACVLFILDE+R+KS  +   TTGEGLEW
Sbjct  308   AILDQVEAKLGLKPEKLEATRNILSEYGNMSSACVLFILDEVRRKSVANGHKTTGEGLEW  367

Query  1186  GVVFVVCP  1209
             GV+F   P
Sbjct  368   GVLFGFGP  375



>gb|AAB36038.1| chalcone synthase [Petunia x hybrida]
Length=389

 Score =   525 bits (1351),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 247/368 (67%), Positives = 302/368 (82%), Gaps = 0/368 (0%)
 Frame = +1

Query  106   RRAKRFEGDAKILAIGTAIPANWVDQTTYPDFYFRITNSEHLLEHKEKFRRICNKSKIRK  285
             R+A+R EG A ++AIGTA P N VDQ+TYPD+YFRITNSEH  + KEKF+R+C KS I+K
Sbjct  8     RKAQRCEGPATVMAIGTATPTNCVDQSTYPDYYFRITNSEHKTDLKEKFKRMCEKSMIKK  67

Query  286   RHLVITEELLKKNPNLCTYNEASLNTRQDILVSEVPKLGKEAAMKAIKEWGRPISEITHL  465
             R++ +TEE+LK+NP++C Y   SL+ RQDI+V EVPKLGKEAA KAIKEWG+P S+ITHL
Sbjct  68    RYMHLTEEILKENPSMCEYMAPSLDARQDIVVVEVPKLGKEAAQKAIKEWGQPKSKITHL  127

Query  466   VFCTSSGVDMPGADFQLAKLLGLSSSVKRLMMYQQGCNAGAAMLRLAKDLAENNKGARVL  645
             VFCT+SGVDMPG D+QL KLLGL  SVKRLMMYQQGC AG  +LRL KDLAENNKGARVL
Sbjct  128   VFCTTSGVDMPGCDYQLTKLLGLRPSVKRLMMYQQGCFAGGTVLRLRKDLAENNKGARVL  187

Query  646   VVCSEVMLNVFRGPSLEQEDNLLAQCLFGDGSAAVIVGTEPRPGLETPLFELVSAAQTTI  825
             VVCSE+    FRGP+    D+L+ Q LFGDG+ A+I+G++P PG+E PLFELVSAAQT +
Sbjct  188   VVCSEITAVTFRGPNDTHLDSLVGQALFGDGAGAIIIGSDPIPGVERPLFELVSAAQTLL  247

Query  826   PDTDSHLKLHLREMGLTFHCSKAVPSLITQNVEDCLVKAFEPFGISDWNSIFWILHPGGI  1005
             PD+   +  HLRE+GLTFH  K VP LI++N+E  L +AF+P GISDWNS+FWI HPGG 
Sbjct  248   PDSHGAIDGHLREVGLTFHLLKDVPGLISKNIEKSLEEAFKPLGISDWNSLFWIAHPGGP  307

Query  1006  AILDRVEEKLGLEPEKLRASKDVLSEYGNLTSACVLFILDEMRKKSKKDEEMTTGEGLEW  1185
             AILD+VE KLGL+PEKL+A+++VLS+YGN++SACVLFILDEMRK S K+   TTGEGLEW
Sbjct  308   AILDQVEIKLGLKPEKLKATRNVLSDYGNMSSACVLFILDEMRKASAKEGLGTTGEGLEW  367

Query  1186  GVVFVVCP  1209
             GV+F   P
Sbjct  368   GVLFGFGP  375



>gb|AFJ49141.1| CHS [Prunus persica]
Length=379

 Score =   524 bits (1350),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 246/368 (67%), Positives = 300/368 (82%), Gaps = 0/368 (0%)
 Frame = +1

Query  106   RRAKRFEGDAKILAIGTAIPANWVDQTTYPDFYFRITNSEHLLEHKEKFRRICNKSKIRK  285
             R+A+R EG A +LAIGTA P N VDQ TYPD+YFRITNSEH  E KEKF+R+C+KS I+K
Sbjct  8     RKAQRAEGPATVLAIGTATPPNCVDQATYPDYYFRITNSEHKAELKEKFQRMCDKSMIKK  67

Query  286   RHLVITEELLKKNPNLCTYNEASLNTRQDILVSEVPKLGKEAAMKAIKEWGRPISEITHL  465
             R++ +TEE+LK+NP +C Y   SL+ RQD++V E+PKLGKEAA KAIKEWG+P S+ITHL
Sbjct  68    RYMYLTEEILKENPTMCEYMAPSLDARQDVVVVEIPKLGKEAATKAIKEWGQPKSKITHL  127

Query  466   VFCTSSGVDMPGADFQLAKLLGLSSSVKRLMMYQQGCNAGAAMLRLAKDLAENNKGARVL  645
             VFCT+SGVDMPGAD+QL KLLGL  SVKRLMMYQQGC AG  +LRL KDLAENNKGARVL
Sbjct  128   VFCTTSGVDMPGADYQLTKLLGLRPSVKRLMMYQQGCFAGGTVLRLVKDLAENNKGARVL  187

Query  646   VVCSEVMLNVFRGPSLEQEDNLLAQCLFGDGSAAVIVGTEPRPGLETPLFELVSAAQTTI  825
             VVCSE+    FRGPS    D+L+ Q LFGDG+AAVIVG +P P +E PLFE+VSAAQT +
Sbjct  188   VVCSEITAVTFRGPSDTHLDSLVGQALFGDGAAAVIVGADPIPEIEKPLFEVVSAAQTIL  247

Query  826   PDTDSHLKLHLREMGLTFHCSKAVPSLITQNVEDCLVKAFEPFGISDWNSIFWILHPGGI  1005
             PD+D  +  HLRE+GLTFH  K VP LI++N+E  L +AF+P GISDWNS+FWI HPGG 
Sbjct  248   PDSDGAIDGHLREVGLTFHLLKDVPGLISKNIEKSLNEAFQPLGISDWNSLFWIAHPGGP  307

Query  1006  AILDRVEEKLGLEPEKLRASKDVLSEYGNLTSACVLFILDEMRKKSKKDEEMTTGEGLEW  1185
             AILD+VE KLGL+PEKL A++ +LSEYGN++SACVLFILDE+RK++ +    TTG+GL+W
Sbjct  308   AILDQVESKLGLKPEKLEATRHILSEYGNMSSACVLFILDEVRKRAAEKGLKTTGDGLDW  367

Query  1186  GVVFVVCP  1209
             GV+F   P
Sbjct  368   GVLFGFGP  375



>ref|XP_008224580.1| PREDICTED: polyketide synthase 5-like [Prunus mume]
Length=391

 Score =   525 bits (1351),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 243/368 (66%), Positives = 302/368 (82%), Gaps = 0/368 (0%)
 Frame = +1

Query  106   RRAKRFEGDAKILAIGTAIPANWVDQTTYPDFYFRITNSEHLLEHKEKFRRICNKSKIRK  285
             R+A+R EG A +LAIGTA P N VDQ TYPD+YFRITNS+H  E KEKF+R+C+KS I+K
Sbjct  8     RKAQRAEGPATVLAIGTATPPNCVDQATYPDYYFRITNSQHKTELKEKFQRMCDKSMIKK  67

Query  286   RHLVITEELLKKNPNLCTYNEASLNTRQDILVSEVPKLGKEAAMKAIKEWGRPISEITHL  465
             R++ +TE++LK+NP++C Y   SL+ RQD++V E+PKLGKEAA KAIKEWG+P S+ITHL
Sbjct  68    RYMYLTEDILKENPSMCEYMAPSLDARQDMVVVEIPKLGKEAATKAIKEWGQPKSKITHL  127

Query  466   VFCTSSGVDMPGADFQLAKLLGLSSSVKRLMMYQQGCNAGAAMLRLAKDLAENNKGARVL  645
             VFCT+SGVDMPGAD+QL KLLGL SSVKRLMMYQQGC AG  +LRLAKDLAENN+GARVL
Sbjct  128   VFCTTSGVDMPGADYQLTKLLGLRSSVKRLMMYQQGCFAGGTVLRLAKDLAENNRGARVL  187

Query  646   VVCSEVMLNVFRGPSLEQEDNLLAQCLFGDGSAAVIVGTEPRPGLETPLFELVSAAQTTI  825
             VVCSE+    FRGP+    D+L+ Q LFGDG+AA+IVG +P P +E PLFE+VSAAQT +
Sbjct  188   VVCSEITAVTFRGPNDTHLDSLVGQALFGDGAAAIIVGADPIPEIEKPLFEVVSAAQTIL  247

Query  826   PDTDSHLKLHLREMGLTFHCSKAVPSLITQNVEDCLVKAFEPFGISDWNSIFWILHPGGI  1005
             PD+D  +  HLRE+GLTFH  K VP LI++N+E  L +AF+P GISDWNS+FWI HPGG 
Sbjct  248   PDSDGAIDGHLREVGLTFHLLKDVPGLISKNIEKSLNEAFQPLGISDWNSLFWIAHPGGP  307

Query  1006  AILDRVEEKLGLEPEKLRASKDVLSEYGNLTSACVLFILDEMRKKSKKDEEMTTGEGLEW  1185
             AILD+VE KL L+PEKL A++ +LSEYGN++SACVLFILDE+RK++ K    TTG+GL+W
Sbjct  308   AILDQVESKLALKPEKLEATRHILSEYGNMSSACVLFILDEVRKRATKKGLKTTGDGLDW  367

Query  1186  GVVFVVCP  1209
             GV+F   P
Sbjct  368   GVLFGFGP  375



>ref|XP_008808192.1| PREDICTED: chalcone synthase C2 [Phoenix dactylifera]
Length=392

 Score =   525 bits (1351),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 245/368 (67%), Positives = 299/368 (81%), Gaps = 0/368 (0%)
 Frame = +1

Query  106   RRAKRFEGDAKILAIGTAIPANWVDQTTYPDFYFRITNSEHLLEHKEKFRRICNKSKIRK  285
             RR++R +G A ILAIGTA PAN V Q  YPD+YFRIT SEHL + KEKF+R+C+KS IRK
Sbjct  8     RRSQRSDGPATILAIGTATPANAVYQADYPDYYFRITKSEHLTDLKEKFKRMCDKSMIRK  67

Query  286   RHLVITEELLKKNPNLCTYNEASLNTRQDILVSEVPKLGKEAAMKAIKEWGRPISEITHL  465
             R++ + EE+LK+NP++C Y   SL+ RQD++V EVP+LGKEAA KAIKEWG+P S ITHL
Sbjct  68    RYMHLNEEILKENPHICAYMAPSLDARQDMVVVEVPRLGKEAAAKAIKEWGQPKSRITHL  127

Query  466   VFCTSSGVDMPGADFQLAKLLGLSSSVKRLMMYQQGCNAGAAMLRLAKDLAENNKGARVL  645
             VFCT+SGVDMPGAD+QL KLLGL  SV RLMMYQQGC AG  +LR+AKDLAENN+GARVL
Sbjct  128   VFCTTSGVDMPGADYQLTKLLGLRPSVNRLMMYQQGCFAGGTVLRVAKDLAENNRGARVL  187

Query  646   VVCSEVMLNVFRGPSLEQEDNLLAQCLFGDGSAAVIVGTEPRPGLETPLFELVSAAQTTI  825
             VVCSE+    FRGPS    D+L+ Q LFGDG+AAVI+G +P P +E PLF+LVSA+QT +
Sbjct  188   VVCSEITAVTFRGPSESHLDSLVGQALFGDGAAAVIIGADPDPAVERPLFQLVSASQTIL  247

Query  826   PDTDSHLKLHLREMGLTFHCSKAVPSLITQNVEDCLVKAFEPFGISDWNSIFWILHPGGI  1005
             PD++  +  HLRE+GLTFH  K VP LI++N+   LV+AF P GISDWNSIFWI HPGG 
Sbjct  248   PDSEGAIDGHLREVGLTFHLLKDVPGLISKNIGKSLVEAFAPLGISDWNSIFWIAHPGGP  307

Query  1006  AILDRVEEKLGLEPEKLRASKDVLSEYGNLTSACVLFILDEMRKKSKKDEEMTTGEGLEW  1185
             AILD+VE KLGLE EK+RA++ VLSEYGN++SACVLFILDEMRK+S +D + TTGEGL+W
Sbjct  308   AILDQVEAKLGLEKEKMRATRHVLSEYGNMSSACVLFILDEMRKRSAEDGKATTGEGLDW  367

Query  1186  GVVFVVCP  1209
             GV+F   P
Sbjct  368   GVLFGFGP  375



>gb|ABF68855.1| chalcone synthase, partial [Cardamine bellidifolia subsp. alpina]
 gb|ABF68882.1| chalcone synthase, partial [Cardamine resedifolia]
Length=388

 Score =   524 bits (1350),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 251/369 (68%), Positives = 301/369 (82%), Gaps = 1/369 (0%)
 Frame = +1

Query  106   RRAKRFEGDAKILAIGTAIPANWVDQTTYPDFYFRITNSEHLLEHKEKFRRICNKSKIRK  285
             R+A+R +G A ILAIGTA PAN V Q  YPD+YFRITNSEH+ + KEKF+R+C+KS IRK
Sbjct  13    RKAQRADGPAGILAIGTANPANHVIQAEYPDYYFRITNSEHMTDLKEKFKRMCDKSMIRK  72

Query  286   RHLVITEELLKKNPNLCTYNEASLNTRQDILVSEVPKLGKEAAMKAIKEWGRPISEITHL  465
             RH+ +TEE LK+N N+C Y   SL+ RQDI+V EVPKLGKEAA+KAIKEWG+P S+ITHL
Sbjct  73    RHMHLTEEFLKENANMCAYMAPSLDARQDIVVVEVPKLGKEAAVKAIKEWGQPKSKITHL  132

Query  466   VFCTSSGVDMPGADFQLAKLLGLSSSVKRLMMYQQGCNAGAAMLRLAKDLAENNKGARVL  645
             VFCT+SGVDMPGAD+QL KLLGL  SVKRLMMYQQGC AG  +LRLAKDLAENN+GARVL
Sbjct  133   VFCTTSGVDMPGADYQLTKLLGLRPSVKRLMMYQQGCYAGGTVLRLAKDLAENNRGARVL  192

Query  646   VVCSEVMLNVFRGPSLEQEDNLLAQCLFGDGSAAVIVGTEPRPGL-ETPLFELVSAAQTT  822
             VVCSE+    FRGPS    D+L+ Q LF DG+AA+IVG++P   + E P+FE+VSAAQT 
Sbjct  193   VVCSEITAVTFRGPSDTHLDSLVGQALFSDGAAALIVGSDPDTSVGEKPIFEMVSAAQTI  252

Query  823   IPDTDSHLKLHLREMGLTFHCSKAVPSLITQNVEDCLVKAFEPFGISDWNSIFWILHPGG  1002
             +PD+D  +  HLRE+GLTFH  K VP LI++N+E  L +AF+P GISDWNS+FWI HPGG
Sbjct  253   LPDSDGAIDGHLREVGLTFHLLKDVPGLISKNIEKSLDEAFKPLGISDWNSLFWIAHPGG  312

Query  1003  IAILDRVEEKLGLEPEKLRASKDVLSEYGNLTSACVLFILDEMRKKSKKDEEMTTGEGLE  1182
              AILD+VE KLGL+ EK+RA++ VLSEYGN++SACVLFILDEMRKKS KD   TTGEGLE
Sbjct  313   PAILDQVEIKLGLKAEKMRATRHVLSEYGNMSSACVLFILDEMRKKSAKDGVATTGEGLE  372

Query  1183  WGVVFVVCP  1209
             WGV+F   P
Sbjct  373   WGVLFGFGP  381



>gb|AHL69646.1| chalcone synthase 1 [Phyllanthus emblica]
Length=390

 Score =   524 bits (1350),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 243/368 (66%), Positives = 302/368 (82%), Gaps = 0/368 (0%)
 Frame = +1

Query  106   RRAKRFEGDAKILAIGTAIPANWVDQTTYPDFYFRITNSEHLLEHKEKFRRICNKSKIRK  285
             R+A+R  G A ++AIGTA+P N VDQ+TYPD+YFRITNSEH  E KEKF+R+C+KS I+K
Sbjct  8     RKAQRASGPATVMAIGTAVPPNCVDQSTYPDYYFRITNSEHKTEPKEKFQRMCDKSMIKK  67

Query  286   RHLVITEELLKKNPNLCTYNEASLNTRQDILVSEVPKLGKEAAMKAIKEWGRPISEITHL  465
             R++ + EE+LK+NP++C Y   SL+ RQDI+V E+PKLGKEAA+KAIKEWG+P S+ITHL
Sbjct  68    RYMYLNEEILKENPDICAYMAPSLDARQDIVVVEIPKLGKEAAVKAIKEWGQPKSKITHL  127

Query  466   VFCTSSGVDMPGADFQLAKLLGLSSSVKRLMMYQQGCNAGAAMLRLAKDLAENNKGARVL  645
             VFCT+SGVDMPGAD+QL KLLGL   VKRLMMYQQGC AG  +LRLAKDLAE+NK ARVL
Sbjct  128   VFCTTSGVDMPGADYQLTKLLGLKPPVKRLMMYQQGCFAGGTVLRLAKDLAEDNKAARVL  187

Query  646   VVCSEVMLNVFRGPSLEQEDNLLAQCLFGDGSAAVIVGTEPRPGLETPLFELVSAAQTTI  825
             VVCSE+    FRGPS    D+L+ Q LFGDG+AA+IVG++P P +E P+FELVSAAQT +
Sbjct  188   VVCSEITAVTFRGPSDTHLDSLVGQALFGDGAAAIIVGSDPIPEVEKPMFELVSAAQTIL  247

Query  826   PDTDSHLKLHLREMGLTFHCSKAVPSLITQNVEDCLVKAFEPFGISDWNSIFWILHPGGI  1005
             PD+D  +  HLRE+GLTFH  K VP LI++N+E  LV+AF+P  I+DWNS+FWI HPGG 
Sbjct  248   PDSDGAIDGHLREVGLTFHLLKDVPGLISKNIEKSLVEAFKPLNINDWNSLFWIAHPGGP  307

Query  1006  AILDRVEEKLGLEPEKLRASKDVLSEYGNLTSACVLFILDEMRKKSKKDEEMTTGEGLEW  1185
             AILD+VE KLGL+PEKL+A++ VL+ YGN++SACVLFI+DEMRKKS +    TTGEGLEW
Sbjct  308   AILDQVEAKLGLKPEKLKATRQVLAGYGNMSSACVLFIMDEMRKKSVEGGLQTTGEGLEW  367

Query  1186  GVVFVVCP  1209
             GV+F   P
Sbjct  368   GVLFGFGP  375



>gb|ADZ45296.1| chalcone synthase 2 [Glycyrrhiza uralensis]
Length=390

 Score =   524 bits (1350),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 250/382 (65%), Positives = 307/382 (80%), Gaps = 6/382 (2%)
 Frame = +1

Query  64    MSTTVTVLTDTCRSRRAKRFEGDAKILAIGTAIPANWVDQTTYPDFYFRITNSEHLLEHK  243
             M+TTV  +      R+A+R EG A +LAIGTA P N V+Q++YPD+YFRITNSEH  E K
Sbjct  1     MATTVGEI------RKAQRAEGPATVLAIGTATPPNCVEQSSYPDYYFRITNSEHKTELK  54

Query  244   EKFRRICNKSKIRKRHLVITEELLKKNPNLCTYNEASLNTRQDILVSEVPKLGKEAAMKA  423
             EKF+R+C KS I+KR++ +TEE+LK+NPN+C Y   SL+ RQD++V EVPKLGKEAA KA
Sbjct  55    EKFKRMCEKSMIKKRYMHLTEEILKENPNICGYMAPSLDARQDMVVVEVPKLGKEAATKA  114

Query  424   IKEWGRPISEITHLVFCTSSGVDMPGADFQLAKLLGLSSSVKRLMMYQQGCNAGAAMLRL  603
             IKEWG+P S+ITHL+FCT+SGVDMPGAD+QL KLLGL   VKR MMYQQGC AG  +LRL
Sbjct  115   IKEWGQPKSKITHLIFCTTSGVDMPGADYQLTKLLGLRPYVKRYMMYQQGCFAGGTVLRL  174

Query  604   AKDLAENNKGARVLVVCSEVMLNVFRGPSLEQEDNLLAQCLFGDGSAAVIVGTEPRPGLE  783
             AKDLAENNKGARVLVVCSE+    FRGP+    D+L+ Q LFGDG+AAVIVG++P P +E
Sbjct  175   AKDLAENNKGARVLVVCSEITAVTFRGPTDTHLDSLVGQALFGDGAAAVIVGSDPVPEVE  234

Query  784   TPLFELVSAAQTTIPDTDSHLKLHLREMGLTFHCSKAVPSLITQNVEDCLVKAFEPFGIS  963
              PLFELV  AQT +PD++  +  HLRE+GLTFH  K VP LI++N+E  LV+AF+P  IS
Sbjct  235   KPLFELVWTAQTILPDSEGAIDGHLREVGLTFHLLKDVPGLISKNIEKALVEAFQPLNIS  294

Query  964   DWNSIFWILHPGGIAILDRVEEKLGLEPEKLRASKDVLSEYGNLTSACVLFILDEMRKKS  1143
             D+NSIFWI HPGG AILD+VE KLGL+PEK+ A++ VLSEYGN++SACVLFILDEMR+KS
Sbjct  295   DYNSIFWIAHPGGPAILDQVEAKLGLKPEKMEATRHVLSEYGNMSSACVLFILDEMRRKS  354

Query  1144  KKDEEMTTGEGLEWGVVFVVCP  1209
             K++   TTGEGLEWGV+F   P
Sbjct  355   KENGLATTGEGLEWGVLFGFGP  376



>gb|ABP57071.1| chalcone synthase [Solenostemon scutellarioides]
 gb|ABP57072.1| chalcone synthase [Solenostemon scutellarioides]
Length=390

 Score =   524 bits (1350),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 248/368 (67%), Positives = 298/368 (81%), Gaps = 0/368 (0%)
 Frame = +1

Query  106   RRAKRFEGDAKILAIGTAIPANWVDQTTYPDFYFRITNSEHLLEHKEKFRRICNKSKIRK  285
             RRA+R EG A +LAIGT+ P+N VDQ+TYPD+YFRITNSEH  + KEKF+R+C KS IRK
Sbjct  8     RRAQRAEGPATVLAIGTSTPSNCVDQSTYPDYYFRITNSEHKTDLKEKFKRMCEKSMIRK  67

Query  286   RHLVITEELLKKNPNLCTYNEASLNTRQDILVSEVPKLGKEAAMKAIKEWGRPISEITHL  465
             R++ +TEE LK+NPN+  Y   SL+ RQDI+V EVPKLGKEAA KAIKEWG+P S+ITHL
Sbjct  68    RYMHLTEEFLKENPNMTAYMAPSLDARQDIVVVEVPKLGKEAAQKAIKEWGQPKSKITHL  127

Query  466   VFCTSSGVDMPGADFQLAKLLGLSSSVKRLMMYQQGCNAGAAMLRLAKDLAENNKGARVL  645
             VFCT+SGVDMPGAD+QL KLLGL  SVKR MMYQQGC AG  +LR+AKDLAENN GARVL
Sbjct  128   VFCTTSGVDMPGADYQLTKLLGLRPSVKRFMMYQQGCFAGGTVLRMAKDLAENNAGARVL  187

Query  646   VVCSEVMLNVFRGPSLEQEDNLLAQCLFGDGSAAVIVGTEPRPGLETPLFELVSAAQTTI  825
             VVCSE+    FRGPS    D+L+ Q LFGDG+AAVIVG++P  G+E PLF+LVSAAQT +
Sbjct  188   VVCSEITAVTFRGPSDSHLDSLVGQALFGDGAAAVIVGSDPVVGVERPLFQLVSAAQTIL  247

Query  826   PDTDSHLKLHLREMGLTFHCSKAVPSLITQNVEDCLVKAFEPFGISDWNSIFWILHPGGI  1005
             PD+D  +  HLRE+GLTFH  K VP LI++N+E  L +AF P GI+DWNS+FWI HPGG 
Sbjct  248   PDSDGAIDGHLREVGLTFHLLKDVPGLISKNIEKSLKEAFGPLGITDWNSVFWIAHPGGP  307

Query  1006  AILDRVEEKLGLEPEKLRASKDVLSEYGNLTSACVLFILDEMRKKSKKDEEMTTGEGLEW  1185
             AILD+VE KL L PEKLR+++ VLSEYGN++SACVLFILDEMRK S K+   +TGEGL+W
Sbjct  308   AILDQVEAKLRLTPEKLRSTRHVLSEYGNMSSACVLFILDEMRKTSAKEGLNSTGEGLDW  367

Query  1186  GVVFVVCP  1209
             GV+F   P
Sbjct  368   GVLFGFGP  375



>gb|AAK39110.1|AF358654_1 chalcone synthase [Ipomoea purpurea]
Length=388

 Score =   524 bits (1350),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 247/368 (67%), Positives = 301/368 (82%), Gaps = 1/368 (0%)
 Frame = +1

Query  106   RRAKRFEGDAKILAIGTAIPANWVDQTTYPDFYFRITNSEHLLEHKEKFRRICNKSKIRK  285
             R+A+R EG A ILAIGTA PAN VDQ+TYPD+YFRIT S+H+ + K+KF+R+C+KS I K
Sbjct  8     RKAQRAEGPATILAIGTATPANCVDQSTYPDYYFRITKSDHMTDLKQKFQRMCDKSMITK  67

Query  286   RHLVITEELLKKNPNLCTYNEASLNTRQDILVSEVPKLGKEAAMKAIKEWGRPISEITHL  465
             R++ +TEE+LK+NP+ C Y   SL+ RQDI+V EVPKLGKEAA  AIKEWG+P S+ITH+
Sbjct  68    RYMHLTEEILKENPSFCEYMAPSLDARQDIVVVEVPKLGKEAAQSAIKEWGQPKSKITHV  127

Query  466   VFCTSSGVDMPGADFQLAKLLGLSSSVKRLMMYQQGCNAGAAMLRLAKDLAENNKGARVL  645
             +FCT+SGVDMPGAD+QL KLLGL  SVKRLMMYQQGC AG  +LR+AKDL ENNKGARVL
Sbjct  128   IFCTTSGVDMPGADYQLTKLLGLRPSVKRLMMYQQGCFAGGTVLRVAKDLVENNKGARVL  187

Query  646   VVCSEVMLNVFRGPSLEQEDNLLAQCLFGDGSAAVIVGTEPRPGLETPLFELVSAAQTTI  825
             VVCSE+ +  FRGP+    D+L+ Q LFGDG+AA+IVG++P P +E PLF+LVSAAQT  
Sbjct  188   VVCSEITVVTFRGPNETHLDSLVGQALFGDGAAAIIVGSDPTP-VEEPLFQLVSAAQTLA  246

Query  826   PDTDSHLKLHLREMGLTFHCSKAVPSLITQNVEDCLVKAFEPFGISDWNSIFWILHPGGI  1005
             PD+   +  HLRE+GLTFH  K VPS+++ N+E CL +AF P GISDWNSIFWI HPGG 
Sbjct  247   PDSCGAIDGHLREVGLTFHLLKDVPSIVSNNIEKCLSEAFNPLGISDWNSIFWIAHPGGP  306

Query  1006  AILDRVEEKLGLEPEKLRASKDVLSEYGNLTSACVLFILDEMRKKSKKDEEMTTGEGLEW  1185
             AILD+VE+KLGL+PEKLRA++ VLSEYGN++SACVLFILDEMRK S  D   TTGEGLEW
Sbjct  307   AILDQVEDKLGLKPEKLRATRHVLSEYGNMSSACVLFILDEMRKASSNDGLGTTGEGLEW  366

Query  1186  GVVFVVCP  1209
             GV+F   P
Sbjct  367   GVLFGFGP  374



>dbj|BAC66467.1| chalcone synthase [Rosa hybrid cultivar 'Kardinal']
Length=389

 Score =   524 bits (1350),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 245/368 (67%), Positives = 300/368 (82%), Gaps = 0/368 (0%)
 Frame = +1

Query  106   RRAKRFEGDAKILAIGTAIPANWVDQTTYPDFYFRITNSEHLLEHKEKFRRICNKSKIRK  285
             R+A+R EG A +LAIGTA P N +DQ+TYPD+YFRIT SEH  E KEKF+R+C+KS I+K
Sbjct  8     RKAQRAEGPATVLAIGTATPPNCIDQSTYPDYYFRITKSEHKAELKEKFQRMCDKSMIKK  67

Query  286   RHLVITEELLKKNPNLCTYNEASLNTRQDILVSEVPKLGKEAAMKAIKEWGRPISEITHL  465
             R++ +TEE+LK+NP++C Y   SL+ RQD++V E+PKLGKEAA KAIKEWG+P S+ITHL
Sbjct  68    RYMYLTEEILKENPSMCEYMAPSLDARQDMVVVEIPKLGKEAATKAIKEWGQPKSKITHL  127

Query  466   VFCTSSGVDMPGADFQLAKLLGLSSSVKRLMMYQQGCNAGAAMLRLAKDLAENNKGARVL  645
             VFCT+SGVDMPGAD+QL KLLGL  SVKRLMMYQQGC AG  +LRLAKDLAENNKGARVL
Sbjct  128   VFCTTSGVDMPGADYQLTKLLGLRPSVKRLMMYQQGCFAGGTVLRLAKDLAENNKGARVL  187

Query  646   VVCSEVMLNVFRGPSLEQEDNLLAQCLFGDGSAAVIVGTEPRPGLETPLFELVSAAQTTI  825
             VVCSE+    FRGPS    D+L+ Q LFGDG+AA+IVG +P P +E P FELVSAAQT +
Sbjct  188   VVCSEITAVTFRGPSDTHLDSLVGQALFGDGAAAIIVGADPLPEVEKPSFELVSAAQTIL  247

Query  826   PDTDSHLKLHLREMGLTFHCSKAVPSLITQNVEDCLVKAFEPFGISDWNSIFWILHPGGI  1005
             PD+D  +  HLRE+GLTFH  K VP LI++N+E  L +AF+P  I+DWNS+FWI HPGG 
Sbjct  248   PDSDGAIDGHLREVGLTFHLLKDVPGLISKNIEKSLNEAFKPLNITDWNSLFWIAHPGGP  307

Query  1006  AILDRVEEKLGLEPEKLRASKDVLSEYGNLTSACVLFILDEMRKKSKKDEEMTTGEGLEW  1185
             AILD+VE KLGL+PEKL A++ +LSEYGN++SACVLFILDE+R+KS  +   TTGEGLEW
Sbjct  308   AILDQVEAKLGLKPEKLEATRHILSEYGNMSSACVLFILDEVRRKSAANGHKTTGEGLEW  367

Query  1186  GVVFVVCP  1209
             GV+F   P
Sbjct  368   GVLFGFGP  375



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 3368954703288