BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c25600_g2_i1 len=509 path=[9321:0-83 2872:84-140 7757:141-179
7795:180-218 7833:219-295 5117:296-315 12754:316-368 7980:369-372
7984:373-390 3716:391-414 12882:415-420 3746:421-478 3804:479-508]

Length=509
                                                                      Score     E

ref|XP_006473006.1|  PREDICTED: UDP-glycosyltransferase 85A2-like       154   3e-43   
ref|XP_002513937.1|  UDP-glucuronosyltransferase, putative              156   1e-41   Ricinus communis
ref|XP_006433961.1|  hypothetical protein CICLE_v10000958mg             155   3e-41   
ref|XP_010646820.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    154   3e-41   
ref|XP_010646819.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    154   4e-41   
emb|CBI38431.3|  unnamed protein product                                155   4e-41   
ref|XP_002262743.1|  PREDICTED: 7-deoxyloganetin glucosyltransferase    153   1e-40   Vitis vinifera
ref|XP_010039829.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    152   3e-40   
ref|XP_010534080.1|  PREDICTED: UDP-glycosyltransferase 85A2-like       152   4e-40   
ref|XP_010535401.1|  PREDICTED: UDP-glycosyltransferase 85A1-like...    152   4e-40   
emb|CBI29442.3|  unnamed protein product                                154   9e-40   
ref|XP_002513939.1|  UDP-glucuronosyltransferase, putative              147   3e-39   Ricinus communis
gb|KCW45339.1|  hypothetical protein EUGRSUZ_L009911                    142   3e-39   
gb|KFK44333.1|  hypothetical protein AALP_AA1G244500                    149   4e-39   
dbj|BAO51842.1|  UDP-glycosyltransferase 85A32                          149   4e-39   
gb|EYU19973.1|  hypothetical protein MIMGU_mgv1a005383mg                149   5e-39   
ref|XP_004252533.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    149   5e-39   
ref|XP_006360268.1|  PREDICTED: UDP-glycosyltransferase 85A2-like       148   9e-39   
ref|XP_002302305.1|  UDP-glucuronosyltransferase family protein         147   1e-38   Populus trichocarpa [western balsam poplar]
ref|NP_973885.1|  UDP-glucosyl transferase 85A5                         147   1e-38   Arabidopsis thaliana [mouse-ear cress]
gb|AAV32497.1|  UDP-glucuronosyltransferase                             147   2e-38   Arabidopsis thaliana [mouse-ear cress]
ref|XP_004252531.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    147   2e-38   
ref|XP_009612691.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    147   2e-38   
dbj|BAO51841.1|  UDP-glycosyltransferase 85A35                          147   2e-38   
ref|XP_010459992.1|  PREDICTED: UDP-glycosyltransferase 85A5            147   3e-38   
dbj|BAO51838.1|  UDP-glycosyltransferase 85A36                          146   4e-38   
ref|XP_011069754.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    146   4e-38   
ref|XP_011016634.1|  PREDICTED: 7-deoxyloganetin glucosyltransferase    146   4e-38   
ref|XP_006304493.1|  hypothetical protein CARUB_v10011262mg             146   4e-38   
ref|XP_008219456.1|  PREDICTED: UDP-glycosyltransferase 85A2-like       146   5e-38   
ref|XP_010477496.1|  PREDICTED: UDP-glycosyltransferase 85A5-like       146   5e-38   
gb|EYU19971.1|  hypothetical protein MIMGU_mgv1a024760mg                145   6e-38   
gb|EYU19972.1|  hypothetical protein MIMGU_mgv1a018325mg                144   6e-38   
gb|KCW45698.1|  hypothetical protein EUGRSUZ_L00502                     145   6e-38   
ref|XP_010039816.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    145   7e-38   
ref|XP_007222427.1|  hypothetical protein PRUPE_ppa004909mg             145   8e-38   
emb|CDO97426.1|  unnamed protein product                                145   9e-38   
dbj|BAO51839.1|  UDP-glycosyltransferase 85A34                          145   1e-37   
ref|XP_007018744.1|  UDP-glucosyl transferase 85A2                      145   1e-37   
gb|ADG65641.1|  glycosyltransferase                                     144   1e-37   
ref|XP_009791953.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    144   2e-37   
ref|XP_010060023.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    144   2e-37   
ref|XP_010060020.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    144   2e-37   
dbj|BAO51844.1|  UDP-glycosyltransferase 85A28                          144   3e-37   
ref|XP_009775754.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    144   3e-37   
gb|KDP41399.1|  hypothetical protein JCGZ_15806                         143   4e-37   
dbj|BAD93690.1|  glycosyltransferase                                    143   4e-37   Nicotiana tabacum [American tobacco]
ref|XP_009590778.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    143   4e-37   
ref|XP_008219314.1|  PREDICTED: UDP-glycosyltransferase 85A5-like       137   4e-37   
ref|XP_010676160.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    143   4e-37   
ref|XP_007047909.1|  UDP-glucosyl transferase 85A2                      143   6e-37   
ref|XP_002285770.1|  PREDICTED: 7-deoxyloganetin glucosyltransferase    142   7e-37   Vitis vinifera
ref|XP_007222664.1|  hypothetical protein PRUPE_ppa004979mg             142   8e-37   
ref|XP_010040274.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    142   8e-37   
ref|XP_002301060.1|  hypothetical protein POPTR_0002s09850g             142   9e-37   Populus trichocarpa [western balsam poplar]
ref|XP_010248035.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    142   1e-36   
ref|XP_007042920.1|  UDP-glucosyl transferase 85A2                      142   1e-36   
ref|XP_010060017.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    142   1e-36   
ref|XP_004237929.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    142   1e-36   
gb|KCW66541.1|  hypothetical protein EUGRSUZ_F00338                     142   1e-36   
ref|XP_010477499.1|  PREDICTED: LOW QUALITY PROTEIN: UDP-glycosyl...    142   2e-36   
dbj|BAG80547.1|  glycosyltransferase                                    142   2e-36   Lycium barbarum [goji berry]
ref|XP_007042919.1|  UDP-glycosyltransferase 85A1                       142   2e-36   
gb|KFK44331.1|  hypothetical protein AALP_AA1G244300                    141   2e-36   
ref|XP_002889182.1|  hypothetical protein ARALYDRAFT_476994             141   2e-36   
ref|XP_002893224.1|  UDP-glucosyl transferase 85A1                      141   2e-36   
ref|XP_006416206.1|  hypothetical protein EUTSA_v100074991mg            135   2e-36   
gb|AIL51400.1|  glycosyltransferase                                     141   2e-36   
ref|XP_010477498.1|  PREDICTED: LOW QUALITY PROTEIN: UDP-glycosyl...    141   2e-36   
dbj|BAG80542.1|  glycosyltransferase                                    141   3e-36   Lycium barbarum [goji berry]
ref|XP_010459994.1|  PREDICTED: UDP-glycosyltransferase 85A1-like       141   3e-36   
ref|XP_006363270.1|  PREDICTED: UDP-glycosyltransferase 85A3-like       140   3e-36   
ref|XP_006303659.1|  hypothetical protein CARUB_v10011698mg             140   3e-36   
gb|KDP41397.1|  hypothetical protein JCGZ_15804                         140   4e-36   
ref|NP_177950.1|  UDP-glucosyl transferase 85A4                         140   4e-36   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010098615.1|  UDP-glycosyltransferase 85A1                       140   4e-36   
ref|XP_010477497.1|  PREDICTED: UDP-glycosyltransferase 85A5-like       140   4e-36   
ref|XP_006416203.1|  hypothetical protein EUTSA_v10009957mg             142   4e-36   
ref|XP_009145344.1|  PREDICTED: UDP-glycosyltransferase 85A5-like       140   5e-36   
emb|CDY21360.1|  BnaA09g30670D                                          140   5e-36   
emb|CDP22240.1|  unnamed protein product                                134   5e-36   
ref|XP_010273031.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    140   6e-36   
ref|XP_010087621.1|  UDP-glycosyltransferase 85A1                       140   6e-36   
ref|XP_010498708.1|  PREDICTED: UDP-glycosyltransferase 85A1-like       140   6e-36   
ref|XP_007199087.1|  hypothetical protein PRUPE_ppa018904mg             134   7e-36   
ref|XP_002532877.1|  UDP-glucuronosyltransferase, putative              140   7e-36   Ricinus communis
ref|XP_006433960.1|  hypothetical protein CICLE_v10000925mg             140   7e-36   
ref|XP_011045673.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    140   7e-36   
ref|XP_006363269.1|  PREDICTED: UDP-glycosyltransferase 85A3-like       140   8e-36   
ref|XP_002285778.2|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    140   9e-36   Vitis vinifera
ref|XP_002885822.1|  hypothetical protein ARALYDRAFT_319356             140   9e-36   
ref|NP_001277170.1|  UDP-glycosyltransferase 85A2-like                  139   1e-35   
ref|XP_008359320.1|  PREDICTED: UDP-glycosyltransferase 85A2-like       139   1e-35   
ref|XP_011045674.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    139   1e-35   
emb|CAN65645.1|  hypothetical protein VITISV_012510                     140   1e-35   Vitis vinifera
sp|F8WLS6.1|UGT6_CATRO  RecName: Full=7-deoxyloganetin glucosyltr...    139   1e-35   
ref|XP_008343335.1|  PREDICTED: UDP-glycosyltransferase 85A2-like       133   1e-35   
gb|AID16084.1|  flavonoid 3-O-glucosyltransferase                       137   1e-35   
ref|XP_011009481.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    139   1e-35   
ref|XP_006304665.1|  hypothetical protein CARUB_v10011877mg             139   2e-35   
ref|XP_009612740.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    139   2e-35   
ref|XP_010459993.1|  PREDICTED: UDP-glycosyltransferase 85A3            139   2e-35   
ref|XP_010676201.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    139   2e-35   
ref|XP_006373048.1|  hypothetical protein POPTR_0017s079102g            133   2e-35   
ref|XP_002298702.2|  hypothetical protein POPTR_0001s32000g             139   2e-35   Populus trichocarpa [western balsam poplar]
ref|XP_003526577.1|  PREDICTED: UDP-glycosyltransferase 85A3-like       138   2e-35   
ref|XP_010040275.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    138   3e-35   
ref|XP_010060016.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    138   3e-35   
gb|KCW66549.1|  hypothetical protein EUGRSUZ_F003461                    132   3e-35   
ref|XP_002285767.1|  PREDICTED: 7-deoxyloganetin glucosyltransferase    138   3e-35   Vitis vinifera
ref|XP_007227225.1|  hypothetical protein PRUPE_ppa018697mg             138   3e-35   
ref|XP_009103240.1|  PREDICTED: UDP-glycosyltransferase 85A1-like       138   3e-35   
ref|XP_007222658.1|  hypothetical protein PRUPE_ppa004956mg             138   3e-35   
gb|KFK44335.1|  hypothetical protein AALP_AA1G244700                    138   3e-35   
ref|XP_009598263.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    132   4e-35   
ref|XP_008386105.1|  PREDICTED: UDP-glycosyltransferase 85A2-like       138   4e-35   
ref|XP_008219459.1|  PREDICTED: UDP-glycosyltransferase 85A2-like       138   4e-35   
ref|XP_006388604.1|  hypothetical protein POPTR_0140s002102g            132   4e-35   
gb|KFK44336.1|  hypothetical protein AALP_AA1G244800                    137   5e-35   
emb|CDP01078.1|  unnamed protein product                                137   5e-35   
ref|XP_010030928.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    137   5e-35   
ref|XP_004237927.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    137   5e-35   
gb|KCW56978.1|  hypothetical protein EUGRSUZ_I02655                     137   5e-35   
emb|CDP01076.1|  unnamed protein product                                137   6e-35   
ref|XP_004299647.1|  PREDICTED: UDP-glycosyltransferase 85A2-like       137   6e-35   
emb|CDY46645.1|  BnaA07g10510D                                          137   6e-35   
ref|NP_173656.1|  UDP-glycosyltransferase 85A1                          137   6e-35   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008219316.1|  PREDICTED: UDP-glycosyltransferase 85A2-like       137   6e-35   
ref|XP_009391314.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    137   7e-35   
ref|XP_009341754.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    137   7e-35   
ref|XP_004136284.1|  PREDICTED: UDP-glycosyltransferase 85A2-like       137   7e-35   
ref|XP_002323976.2|  hypothetical protein POPTR_0017s07920g             137   7e-35   Populus trichocarpa [western balsam poplar]
ref|XP_010040276.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    137   8e-35   
ref|XP_006472584.1|  PREDICTED: UDP-glycosyltransferase 85A2-like       137   8e-35   
ref|XP_006416204.1|  hypothetical protein EUTSA_v10007489mg             137   8e-35   
ref|XP_002323758.2|  hypothetical protein POPTR_0017s07930g             137   8e-35   Populus trichocarpa [western balsam poplar]
ref|XP_010064217.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    137   8e-35   
ref|XP_006363268.1|  PREDICTED: UDP-glycosyltransferase 85A1-like       137   9e-35   
gb|ABW96222.1|  glucosyltransferase                                     137   9e-35   Linum usitatissimum
ref|XP_004237928.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    137   1e-34   
ref|XP_011009478.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    137   1e-34   
ref|XP_008466222.1|  PREDICTED: UDP-glycosyltransferase 85A2            137   1e-34   
ref|XP_004252532.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    136   1e-34   
ref|XP_010910271.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    136   1e-34   
ref|XP_002285771.1|  PREDICTED: 7-deoxyloganetin glucosyltransferase    136   1e-34   Vitis vinifera
emb|CBI19181.3|  unnamed protein product                                137   1e-34   
ref|XP_006433964.1|  hypothetical protein CICLE_v10004031mg             137   1e-34   
ref|XP_002893223.1|  transcription factor/ transferase, transferr...    136   2e-34   
ref|XP_011009482.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    136   2e-34   
ref|XP_011016624.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    136   2e-34   
ref|XP_006307682.1|  hypothetical protein CARUB_v10009316mg             135   2e-34   
emb|CDY46643.1|  BnaA07g10530D                                          136   2e-34   
ref|XP_009103242.1|  PREDICTED: UDP-glycosyltransferase 85A3-like       136   2e-34   
ref|XP_006304973.1|  hypothetical protein CARUB_v10011467mg             136   2e-34   
gb|EAY87581.1|  hypothetical protein OsI_08991                          136   2e-34   Oryza sativa Indica Group [Indian rice]
ref|XP_009334337.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    136   2e-34   
ref|NP_001048165.1|  Os02g0755900                                       136   2e-34   Oryza sativa Japonica Group [Japonica rice]
ref|XP_008219468.1|  PREDICTED: UDP-glycosyltransferase 85A2-like       136   2e-34   
ref|XP_009145352.1|  PREDICTED: UDP-glycosyltransferase 85A7 isof...    135   2e-34   
ref|XP_006416205.1|  hypothetical protein EUTSA_v10007502mg             135   2e-34   
ref|XP_004237926.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    135   2e-34   
ref|XP_010498707.1|  PREDICTED: UDP-glycosyltransferase 85A5-like       135   2e-34   
emb|CDX91674.1|  BnaC08g05930D                                          135   2e-34   
ref|XP_006647925.1|  PREDICTED: UDP-glycosyltransferase 85A2-like       135   2e-34   
emb|CDP01480.1|  unnamed protein product                                135   2e-34   
gb|KDP41396.1|  hypothetical protein JCGZ_15803                         135   3e-34   
emb|CDY41486.1|  BnaA08g20880D                                          135   3e-34   
ref|XP_010676178.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    135   3e-34   
ref|XP_007141201.1|  hypothetical protein PHAVU_008G175600g             135   3e-34   
ref|XP_009145349.1|  PREDICTED: UDP-glycosyltransferase 85A7 isof...    135   3e-34   
emb|CDY67802.1|  BnaC05g50340D                                          135   3e-34   
gb|AFJ53003.1|  UDP-glycosyltransferase 1                               135   3e-34   
dbj|BAJ88498.1|  predicted protein                                      135   3e-34   
ref|XP_002513938.1|  UDP-glucuronosyltransferase, putative              135   3e-34   Ricinus communis
ref|XP_011031049.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    135   3e-34   
ref|XP_011031048.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    135   4e-34   
ref|XP_007226586.1|  hypothetical protein PRUPE_ppa023851mg             135   4e-34   
ref|XP_009341756.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    135   4e-34   
ref|XP_007151399.1|  hypothetical protein PHAVU_004G043300g             135   4e-34   
ref|XP_010521179.1|  PREDICTED: UDP-glycosyltransferase 85A3-like       135   4e-34   
ref|XP_007222804.1|  hypothetical protein PRUPE_ppa005043mg             135   4e-34   
ref|XP_002893222.1|  UDP-glucoronosyl/UDP-glucosyl transferase fa...    135   4e-34   
ref|XP_008219319.1|  PREDICTED: UDP-glycosyltransferase 85A2-like       135   5e-34   
ref|XP_002323974.2|  hypothetical protein POPTR_0017s07880g             135   5e-34   Populus trichocarpa [western balsam poplar]
ref|XP_010039907.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    135   5e-34   
emb|CDY62991.1|  BnaC07g48390D                                          134   6e-34   
ref|XP_010030029.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    134   6e-34   
gb|KDP41398.1|  hypothetical protein JCGZ_15805                         134   6e-34   
ref|XP_008219317.1|  PREDICTED: UDP-glycosyltransferase 85A2-like       134   6e-34   
emb|CDP01079.1|  unnamed protein product                                134   6e-34   
ref|XP_002300186.1|  hypothetical protein POPTR_0001s31950g             134   7e-34   Populus trichocarpa [western balsam poplar]
gb|AFJ52992.1|  UDP-glycosyltransferase 1                               134   7e-34   
ref|XP_007224069.1|  hypothetical protein PRUPE_ppa015357mg             134   7e-34   
ref|XP_006472583.1|  PREDICTED: UDP-glycosyltransferase 85A2-like       134   8e-34   
gb|KFK44329.1|  hypothetical protein AALP_AA1G244100                    134   8e-34   
ref|XP_010498706.1|  PREDICTED: UDP-glycosyltransferase 85A2-like       134   8e-34   
ref|XP_002454243.1|  hypothetical protein SORBIDRAFT_04g027420          134   9e-34   Sorghum bicolor [broomcorn]
gb|AID16086.1|  flavonol-3-O-glucoside L-rhamnosyltransferase           134   9e-34   
gb|KDO81005.1|  hypothetical protein CISIN_1g046355mg                   127   9e-34   
ref|XP_010676190.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    134   1e-33   
dbj|BAO51840.1|  UDP-glycosyltransferase 85K12                          134   1e-33   
ref|XP_006351765.1|  PREDICTED: UDP-glycosyltransferase 85A5-like       134   1e-33   
gb|AAV32498.1|  UDP-glucuronosyltransferase                             133   1e-33   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002893221.1|  UDP-glycosyltransferase                            133   1e-33   
gb|AAF87258.1|AC068562_5  Strong similarity to UDP-glucose glucos...    133   1e-33   Arabidopsis thaliana [mouse-ear cress]
ref|XP_004299648.1|  PREDICTED: UDP-glycosyltransferase 85A1-like       133   1e-33   
ref|XP_004237925.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    133   2e-33   
gb|EYU43443.1|  hypothetical protein MIMGU_mgv1a018722mg                133   2e-33   
ref|XP_008219318.1|  PREDICTED: UDP-glycosyltransferase 85A2-like       133   2e-33   
ref|XP_010320181.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    133   2e-33   
ref|XP_008219322.1|  PREDICTED: UDP-glycosyltransferase 85A2-like       133   2e-33   
ref|XP_010060018.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    133   2e-33   
ref|XP_004299646.1|  PREDICTED: UDP-glycosyltransferase 85A2-like       133   2e-33   
dbj|BAJ85429.1|  predicted protein                                      133   2e-33   
gb|KFK44332.1|  hypothetical protein AALP_AA1G244400                    133   2e-33   
ref|XP_008455233.1|  PREDICTED: UDP-glycosyltransferase 85A5-like       133   2e-33   
ref|XP_010647463.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    132   2e-33   
gb|KHN42553.1|  UDP-glycosyltransferase 85A2                            133   2e-33   
ref|XP_003544800.1|  PREDICTED: UDP-glycosyltransferase 85A2-like       133   2e-33   
ref|XP_002532878.1|  UDP-glucuronosyltransferase, putative              132   2e-33   Ricinus communis
gb|EMT18349.1|  Cytokinin-O-glucosyltransferase 2                       134   2e-33   
ref|XP_008219315.1|  PREDICTED: UDP-glycosyltransferase 85A2-like       132   3e-33   
gb|KCW66556.1|  hypothetical protein EUGRSUZ_F00355                     132   3e-33   
gb|ACU19718.1|  unknown                                                 129   3e-33   Glycine max [soybeans]
ref|XP_011003867.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    132   3e-33   
gb|ABK95289.1|  unknown                                                 132   3e-33   Populus trichocarpa [western balsam poplar]
ref|XP_010035387.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    132   3e-33   
ref|XP_004953968.1|  PREDICTED: UDP-glycosyltransferase 85A2-like       132   3e-33   
ref|XP_008219313.1|  PREDICTED: UDP-glycosyltransferase 85A2-like       132   3e-33   
gb|KCW73112.1|  hypothetical protein EUGRSUZ_E01563                     128   3e-33   
dbj|BAO51833.1|  UDP-glycosyltransferase 85K10                          132   3e-33   
ref|XP_006388803.1|  hypothetical protein POPTR_0098s003001g            127   3e-33   
ref|XP_010477495.1|  PREDICTED: UDP-glycosyltransferase 85A2-like       132   4e-33   
ref|XP_010459988.1|  PREDICTED: UDP-glycosyltransferase 85A2            132   4e-33   
ref|XP_007141200.1|  hypothetical protein PHAVU_008G175500g             132   4e-33   
ref|XP_010060022.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    132   5e-33   
emb|CDP21827.1|  unnamed protein product                                131   5e-33   
ref|XP_004305878.1|  PREDICTED: UDP-glycosyltransferase 85A2-like       132   5e-33   
gb|KHN13067.1|  UDP-glycosyltransferase 85A3                            132   5e-33   
ref|XP_009377931.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    132   6e-33   
ref|XP_002323978.2|  hypothetical protein POPTR_0017s07940g             132   6e-33   Populus trichocarpa [western balsam poplar]
ref|XP_008789349.1|  PREDICTED: UDP-glycosyltransferase 85A2-like...    132   6e-33   
ref|XP_008789350.1|  PREDICTED: UDP-glycosyltransferase 85A2-like...    132   6e-33   
gb|AFK34769.1|  unknown                                                 132   6e-33   
ref|XP_009413654.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    128   6e-33   
ref|XP_007047908.1|  UDP-glucosyl transferase 85A2                      132   6e-33   
gb|KCW66553.1|  hypothetical protein EUGRSUZ_F00351                     131   6e-33   
ref|XP_009350671.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    132   6e-33   
gb|KCW66555.1|  hypothetical protein EUGRSUZ_F00353                     131   7e-33   
ref|XP_003546715.1|  PREDICTED: UDP-glycosyltransferase 85A3            131   7e-33   
ref|XP_008808010.1|  PREDICTED: UDP-glycosyltransferase 85A5-like       125   7e-33   
emb|CBI23550.3|  unnamed protein product                                131   7e-33   
sp|F8WKW1.1|UGT2_GARJA  RecName: Full=7-deoxyloganetin glucosyltr...    131   7e-33   
emb|CDY14621.1|  BnaC02g24920D                                          131   7e-33   
ref|XP_003544799.1|  PREDICTED: UDP-glycosyltransferase 85A3-like       131   7e-33   
ref|XP_010060024.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    131   7e-33   
gb|KHN24338.1|  UDP-glycosyltransferase 85A3                            131   7e-33   
gb|KGN43728.1|  hypothetical protein Csa_7G063920                       128   8e-33   
ref|XP_003635298.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    131   9e-33   
gb|KGN43727.1|  hypothetical protein Csa_7G063420                       125   9e-33   
ref|XP_004172440.1|  PREDICTED: UDP-glycosyltransferase 85A4-like       125   1e-32   
emb|CDY38225.1|  BnaC05g17420D                                          131   1e-32   
ref|XP_004155505.1|  PREDICTED: UDP-glycosyltransferase 85A7-like       131   1e-32   
ref|XP_009341757.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    131   1e-32   
ref|XP_002268845.1|  PREDICTED: 7-deoxyloganetin glucosyltransferase    131   1e-32   Vitis vinifera
emb|CDP01072.1|  unnamed protein product                                130   1e-32   
gb|AHL38933.1|  glycosyltransferase                                     130   1e-32   
ref|XP_002306303.2|  hypothetical protein POPTR_0005s07500g             130   1e-32   Populus trichocarpa [western balsam poplar]
ref|XP_006307366.1|  hypothetical protein CARUB_v10008992mg             130   1e-32   
dbj|BAH56949.1|  AT1G22360                                              130   1e-32   Arabidopsis thaliana [mouse-ear cress]
ref|NP_173653.1|  UDP-glucosyl transferase 85A2                         130   1e-32   Arabidopsis thaliana [mouse-ear cress]
gb|AAL32657.1|  UDP-glucose glucosyltransferase                         130   1e-32   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008373175.1|  PREDICTED: UDP-glycosyltransferase 85A2-like       129   1e-32   
ref|NP_001031078.1|  UDP-glucosyl transferase 85A2                      130   2e-32   Arabidopsis thaliana [mouse-ear cress]
emb|CBI34065.3|  unnamed protein product                                125   2e-32   
ref|XP_003542333.1|  PREDICTED: UDP-glycosyltransferase 85A2-like       130   2e-32   
emb|CDP01073.1|  unnamed protein product                                130   2e-32   
ref|XP_006374018.1|  hypothetical protein POPTR_0016s13230g             126   2e-32   
ref|NP_173652.1|  UDP-glucosyl transferase 85A7                         130   2e-32   Arabidopsis thaliana [mouse-ear cress]
ref|XP_007216919.1|  hypothetical protein PRUPE_ppa018486mg             125   2e-32   
ref|XP_002323977.2|  hypothetical protein POPTR_0017s07900g             130   2e-32   
gb|KGN43735.1|  hypothetical protein Csa_7G063990                       125   2e-32   
ref|XP_008229792.1|  PREDICTED: UDP-glycosyltransferase 85A7-like       130   3e-32   
ref|XP_009128289.1|  PREDICTED: UDP-glycosyltransferase 85A4            130   3e-32   
ref|XP_007216637.1|  hypothetical protein PRUPE_ppb025266mg             124   4e-32   
ref|XP_006355135.1|  PREDICTED: UDP-glycosyltransferase 85A7-like       129   4e-32   
ref|XP_002263158.1|  PREDICTED: 7-deoxyloganetin glucosyltransferase    129   4e-32   
emb|CDY26859.1|  BnaA02g18840D                                          129   4e-32   
ref|XP_008455179.1|  PREDICTED: UDP-glycosyltransferase 85A5-like       129   5e-32   
ref|XP_007207189.1|  hypothetical protein PRUPE_ppa017055mg             129   5e-32   
ref|XP_010060021.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    129   5e-32   
emb|CDY46644.1|  BnaA07g10520D                                          127   5e-32   
gb|AFJ53004.1|  UDP-glycosyltransferase 1                               129   5e-32   
ref|XP_009377947.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    129   5e-32   
gb|KGN43726.1|  hypothetical protein Csa_7G062920                       126   5e-32   
ref|XP_002525852.1|  UDP-glucuronosyltransferase, putative              129   6e-32   
emb|CBI38430.3|  unnamed protein product                                130   6e-32   
ref|XP_008378362.1|  PREDICTED: UDP-glycosyltransferase 85A5-like       124   7e-32   
gb|KEH28097.1|  UDP-glucosyltransferase family protein                  129   7e-32   
dbj|BAJ99359.1|  predicted protein                                      129   7e-32   
ref|XP_004975278.1|  PREDICTED: UDP-glycosyltransferase 85A3-like       129   8e-32   
ref|XP_006390003.1|  hypothetical protein EUTSA_v10019687mg             129   8e-32   
ref|XP_002308831.2|  hypothetical protein POPTR_0006s02390g             128   8e-32   
gb|EYU18465.1|  hypothetical protein MIMGU_mgv1a006002mg                128   8e-32   
ref|XP_008455196.1|  PREDICTED: UDP-glycosyltransferase 85A5-like       128   8e-32   
gb|KGN43695.1|  hypothetical protein Csa_7G059660                       128   8e-32   
dbj|BAG80552.1|  UDP-glucose:glucosyltransferase                        128   9e-32   
ref|XP_003570607.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    128   9e-32   
ref|XP_008342456.1|  PREDICTED: UDP-glycosyltransferase 85A7-like       128   1e-31   
ref|XP_006388793.1|  hypothetical protein POPTR_0098s002201g            123   1e-31   
ref|XP_008353653.1|  PREDICTED: UDP-glycosyltransferase 85A7-like       128   1e-31   
emb|CAD27851.2|  glucosyltransferase                                    124   1e-31   
ref|XP_008350015.1|  PREDICTED: UDP-glycosyltransferase 85A2-like       127   1e-31   
ref|XP_008789348.1|  PREDICTED: UDP-glycosyltransferase 85A2-like...    128   1e-31   
ref|XP_008234165.1|  PREDICTED: UDP-glycosyltransferase 85A5-like       128   1e-31   
ref|XP_009145345.1|  PREDICTED: UDP-glycosyltransferase 85A2 isof...    128   1e-31   
ref|XP_006652346.1|  PREDICTED: UDP-glycosyltransferase 85A2-like       128   1e-31   
ref|XP_008808008.1|  PREDICTED: UDP-glycosyltransferase 85A2-like       128   1e-31   
ref|XP_009145346.1|  PREDICTED: UDP-glycosyltransferase 85A2 isof...    128   1e-31   
ref|XP_009145347.1|  PREDICTED: UDP-glycosyltransferase 85A2 isof...    128   1e-31   
ref|XP_010039826.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    122   1e-31   
ref|XP_008386104.1|  PREDICTED: UDP-glycosyltransferase 85A2-like       127   2e-31   
ref|XP_009387949.1|  PREDICTED: UDP-glycosyltransferase 85A2-like       124   2e-31   
ref|XP_007208223.1|  hypothetical protein PRUPE_ppa018343mg             127   2e-31   
emb|CDY21359.1|  BnaA09g30680D                                          127   2e-31   
ref|XP_008386293.1|  PREDICTED: UDP-glycosyltransferase 85A2-like       130   2e-31   
ref|XP_009341609.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    127   2e-31   
ref|XP_007207648.1|  hypothetical protein PRUPE_ppa021414mg             127   2e-31   
gb|ABK95502.1|  unknown                                                 122   2e-31   
ref|XP_009350108.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    127   2e-31   
gb|KDP29705.1|  hypothetical protein JCGZ_18640                         127   2e-31   
ref|XP_006426368.1|  hypothetical protein CICLE_v10025476mg             127   2e-31   
gb|KCW45697.1|  hypothetical protein EUGRSUZ_L00500                     122   2e-31   
ref|XP_004230580.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    127   2e-31   
ref|XP_008378324.1|  PREDICTED: UDP-glycosyltransferase 85A3-like       127   2e-31   
gb|KCW73111.1|  hypothetical protein EUGRSUZ_E01562                     127   3e-31   
ref|XP_010056397.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    127   3e-31   
ref|XP_002452527.1|  hypothetical protein SORBIDRAFT_04g027460          127   3e-31   
ref|XP_003570608.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    127   3e-31   
gb|KEH17174.1|  UDP-glucosyltransferase family protein                  127   3e-31   
ref|XP_009377934.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    127   3e-31   
ref|XP_011100190.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    127   3e-31   
ref|XP_003579567.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    127   3e-31   
gb|EMT03956.1|  Cytokinin-O-glucosyltransferase 2                       125   3e-31   
ref|XP_004136879.1|  PREDICTED: UDP-glycosyltransferase 85A2-like       127   3e-31   
ref|XP_010056400.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    127   3e-31   
ref|XP_004137057.1|  PREDICTED: UDP-glycosyltransferase 85A5-like       126   4e-31   
ref|XP_002525850.1|  UDP-glucuronosyltransferase, putative              126   4e-31   
ref|NP_173655.2|  UDP-glucosyl transferase 85A3                         126   5e-31   
ref|XP_010089824.1|  UDP-glycosyltransferase 85A1                       126   5e-31   
gb|AFW64426.1|  hypothetical protein ZEAMMB73_179381                    126   5e-31   
ref|XP_007227077.1|  hypothetical protein PRUPE_ppa016380mg             121   5e-31   
gb|AFW64425.1|  cytokinin-O-glucosyltransferase 2                       126   5e-31   
ref|XP_002323189.1|  hypothetical protein POPTR_0016s02190g             126   5e-31   
ref|XP_008224047.1|  PREDICTED: UDP-glycosyltransferase 85A5-like...    126   5e-31   
ref|XP_010248134.1|  PREDICTED: UDP-glycosyltransferase 85A5-like       120   6e-31   
ref|XP_010937418.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    126   6e-31   
ref|XP_008359346.1|  PREDICTED: UDP-glycosyltransferase 85A2-like       124   6e-31   
gb|EYU18464.1|  hypothetical protein MIMGU_mgv1a005689mg                126   6e-31   
ref|XP_008229481.1|  PREDICTED: UDP-glycosyltransferase 85A2-like       126   6e-31   
emb|CDP01087.1|  unnamed protein product                                126   6e-31   
ref|XP_008234175.1|  PREDICTED: UDP-glycosyltransferase 85A5-like       126   6e-31   
ref|XP_002268162.1|  PREDICTED: 7-deoxyloganetin glucosyltransferase    126   6e-31   
ref|XP_009370709.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    126   6e-31   
ref|XP_010027911.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    126   6e-31   
ref|NP_001277168.1|  UDP-glycosyltransferase 85A2-like                  126   6e-31   
ref|XP_008372493.1|  PREDICTED: UDP-glycosyltransferase 85A2-like       126   7e-31   
ref|XP_004305885.1|  PREDICTED: UDP-glycosyltransferase 85A3-like       126   7e-31   
gb|EEE57246.1|  hypothetical protein OsJ_07253                          126   7e-31   
dbj|BAD34262.1|  putative glucosyltransferase-10                        126   7e-31   
ref|XP_008380053.1|  PREDICTED: UDP-glycosyltransferase 85A5-like       125   8e-31   
ref|NP_001047223.2|  Os02g0578100                                       126   8e-31   
ref|XP_004297810.1|  PREDICTED: UDP-glycosyltransferase 85A1-like       125   8e-31   
ref|XP_008342462.1|  PREDICTED: UDP-glycosyltransferase 85A5-like       125   8e-31   
dbj|BAB86928.1|  glucosyltransferase-10                                 125   8e-31   
emb|CAN68409.1|  hypothetical protein VITISV_022913                     125   8e-31   
ref|XP_011092429.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    125   8e-31   
ref|XP_006649062.1|  PREDICTED: UDP-glycosyltransferase 85A2-like       125   9e-31   
ref|XP_007151400.1|  hypothetical protein PHAVU_004G043400g             125   9e-31   
ref|XP_008779905.1|  PREDICTED: UDP-glycosyltransferase 85A2-like       125   9e-31   
ref|XP_002891115.1|  predicted protein                                  125   9e-31   
gb|KGN43733.1|  hypothetical protein Csa_7G063970                       120   9e-31   
ref|XP_007224375.1|  hypothetical protein PRUPE_ppa021058mg             125   9e-31   
ref|XP_010056398.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    125   9e-31   
ref|XP_009110142.1|  PREDICTED: UDP-glycosyltransferase 85A5-like       125   9e-31   
ref|NP_001052946.1|  Os04g0451200                                       125   9e-31   
gb|EAY94339.1|  hypothetical protein OsI_16107                          125   1e-30   
ref|XP_008353241.1|  PREDICTED: UDP-glycosyltransferase 85A3-like       125   1e-30   
ref|XP_007047907.1|  UDP-glucosyl transferase 85A2                      125   1e-30   
tpg|DAA37525.1|  TPA: cytokinin-O-glucosyltransferase 2                 125   1e-30   
ref|XP_008234196.1|  PREDICTED: UDP-glycosyltransferase 85A5-like       125   1e-30   
ref|XP_008229795.1|  PREDICTED: UDP-glycosyltransferase 85A1-like       125   1e-30   
ref|XP_008804762.1|  PREDICTED: UDP-glycosyltransferase 85A2-like       125   1e-30   
gb|AFJ52993.1|  UDP-glycosyltransferase 1                               125   1e-30   
ref|XP_008229743.1|  PREDICTED: UDP-glycosyltransferase 85A1-like       125   1e-30   
ref|XP_008455180.1|  PREDICTED: UDP-glycosyltransferase 85A5-like       125   1e-30   
emb|CAH67108.1|  H0818E04.25                                            125   1e-30   
ref|XP_010112356.1|  UDP-glycosyltransferase 85A7                       125   1e-30   
ref|XP_003618663.1|  Cytokinin-O-glucosyltransferase                    125   1e-30   
ref|XP_007221625.1|  hypothetical protein PRUPE_ppb016872mg             120   2e-30   
ref|XP_004137048.1|  PREDICTED: UDP-glycosyltransferase 85A7-like       125   2e-30   
gb|KHN37678.1|  UDP-glycosyltransferase 85A4                            118   2e-30   
gb|ACB88211.1|  UFGT2                                                   125   2e-30   
ref|XP_009604519.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    125   2e-30   
gb|KDO64321.1|  hypothetical protein CISIN_1g010825mg                   125   2e-30   
ref|XP_006369792.1|  hypothetical protein POPTR_0001s31940g             121   2e-30   
ref|NP_001148091.1|  cytokinin-O-glucosyltransferase 2                  125   2e-30   
ref|XP_002271368.1|  PREDICTED: 7-deoxyloganetin glucosyltransferase    125   2e-30   
gb|KDP37429.1|  hypothetical protein JCGZ_07956                         125   2e-30   
ref|XP_003575222.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    125   2e-30   
ref|XP_008386170.1|  PREDICTED: UDP-glycosyltransferase 85A5-like       124   2e-30   
ref|XP_004308659.1|  PREDICTED: UDP-glycosyltransferase 85A2-like       124   2e-30   
gb|KDO35986.1|  hypothetical protein CISIN_1g029508mg                   120   2e-30   
dbj|BAF75889.1|  glucosyltransferase                                    124   2e-30   
gb|KCW45705.1|  hypothetical protein EUGRSUZ_L00511                     124   2e-30   
ref|XP_010267412.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    124   2e-30   
ref|XP_004289310.1|  PREDICTED: UDP-glycosyltransferase 85A2-like       124   2e-30   
ref|XP_004155440.1|  PREDICTED: LOW QUALITY PROTEIN: UDP-glycosyl...    124   2e-30   
gb|EMS46882.1|  UDP-glycosyltransferase 85A2                            125   2e-30   
ref|XP_008391265.1|  PREDICTED: UDP-glycosyltransferase 85A3-like       124   2e-30   
gb|KFK44334.1|  hypothetical protein AALP_AA1G244600                    124   2e-30   
ref|XP_010030926.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    127   2e-30   
gb|KDP33203.1|  hypothetical protein JCGZ_12725                         124   3e-30   
ref|XP_003545683.1|  PREDICTED: UDP-glycosyltransferase 85A2-like       124   3e-30   
ref|XP_003544801.1|  PREDICTED: UDP-glycosyltransferase 85A3-like       124   3e-30   
gb|EMT13628.1|  Cytokinin-O-glucosyltransferase 2                       127   3e-30   
gb|KDO36703.1|  hypothetical protein CISIN_1g029948mg                   119   3e-30   
ref|XP_008386313.1|  PREDICTED: UDP-glycosyltransferase 85A5-like       124   3e-30   
ref|XP_009103241.1|  PREDICTED: UDP-glycosyltransferase 85A1-like       124   4e-30   
ref|XP_007216904.1|  hypothetical protein PRUPE_ppa019305mg             118   4e-30   
ref|NP_001152029.1|  cytokinin-O-glucosyltransferase 2                  124   4e-30   
ref|XP_009380209.1|  PREDICTED: LOW QUALITY PROTEIN: 7-deoxylogan...    124   5e-30   
ref|XP_007146161.1|  hypothetical protein PHAVU_006G017500g             124   5e-30   
ref|XP_011014888.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    124   5e-30   
ref|XP_008245955.1|  PREDICTED: UDP-glycosyltransferase 85A2-like       120   5e-30   
ref|XP_009350672.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    123   5e-30   
ref|XP_003519003.1|  PREDICTED: UDP-glycosyltransferase 85A5-like       123   5e-30   
ref|XP_008455195.1|  PREDICTED: UDP-glycosyltransferase 85A5-like       123   5e-30   
gb|KDP33196.1|  hypothetical protein JCGZ_12718                         123   6e-30   
ref|XP_006593894.1|  PREDICTED: UDP-glycosyltransferase 85A5-like       123   6e-30   
gb|KHN41342.1|  UDP-glycosyltransferase 85A3                            123   6e-30   
ref|XP_006388801.1|  hypothetical protein POPTR_0098s002901g            122   6e-30   
gb|KHN33502.1|  UDP-glycosyltransferase 85A2                            123   6e-30   
ref|XP_003547073.1|  PREDICTED: UDP-glycosyltransferase 85A2-like       123   6e-30   
ref|XP_008378325.1|  PREDICTED: UDP-glycosyltransferase 85A5-like       123   6e-30   
ref|XP_002285779.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    123   7e-30   
ref|XP_007224968.1|  hypothetical protein PRUPE_ppa020820mg             123   7e-30   
emb|CDY62992.1|  BnaC07g48400D                                          123   7e-30   
gb|AFK33787.1|  unknown                                                 123   7e-30   
gb|AFK42095.1|  unknown                                                 118   7e-30   
ref|XP_009592743.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    123   7e-30   
ref|XP_008455194.1|  PREDICTED: UDP-glycosyltransferase 85A5-like       123   7e-30   
ref|XP_003615138.1|  Cytokinin-O-glucosyltransferase                    123   7e-30   
gb|ACJ84649.1|  unknown                                                 123   7e-30   
ref|XP_009790488.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    123   8e-30   
gb|AFK38894.1|  unknown                                                 123   8e-30   
gb|AFK37311.1|  unknown                                                 123   8e-30   
gb|ACK38187.1|  unknown                                                 119   8e-30   
ref|XP_011008563.1|  PREDICTED: uncharacterized protein LOC105113904    125   9e-30   
ref|XP_006429747.1|  hypothetical protein CICLE_v10013430mg             123   9e-30   
emb|CDP01479.1|  unnamed protein product                                122   1e-29   
ref|XP_007042950.1|  UDP-glycosyltransferase 85A1                       122   1e-29   
ref|XP_010937487.1|  PREDICTED: UDP-glycosyltransferase 85A5-like       118   1e-29   
ref|XP_010025429.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    122   1e-29   
ref|XP_010676225.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    122   1e-29   
ref|XP_006380941.1|  hypothetical protein POPTR_0006s02370g             122   1e-29   
ref|XP_006429745.1|  hypothetical protein CICLE_v10011540mg             122   1e-29   
gb|KCW62086.1|  hypothetical protein EUGRSUZ_H04754                     122   1e-29   
gb|KDO64318.1|  hypothetical protein CISIN_1g010684mg                   122   1e-29   
ref|XP_003618654.1|  Glucosyltransferase                                122   1e-29   
gb|KDO64319.1|  hypothetical protein CISIN_1g010684mg                   122   1e-29   
ref|XP_008224048.1|  PREDICTED: UDP-glycosyltransferase 85A2-like...    122   1e-29   
ref|XP_010937416.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    122   1e-29   
ref|XP_006853218.1|  hypothetical protein AMTR_s00038p00217680          122   1e-29   
ref|XP_010039828.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    122   1e-29   
gb|KHN33534.1|  UDP-glycosyltransferase 85A2                            122   1e-29   
ref|XP_004155500.1|  PREDICTED: UDP-glycosyltransferase 85A2-like       122   1e-29   
gb|ACU24374.1|  unknown                                                 122   2e-29   
ref|XP_008224049.1|  PREDICTED: UDP-glycosyltransferase 85A2-like...    122   2e-29   
ref|XP_007225655.1|  hypothetical protein PRUPE_ppa004945mg             122   2e-29   
gb|EMT15334.1|  Cytokinin-O-glucosyltransferase 2                       121   2e-29   
gb|ACD03253.1|  UDP-glycosyltransferase UGT85F13                        122   2e-29   
ref|XP_004303932.1|  PREDICTED: UDP-glycosyltransferase 85A1-like       121   2e-29   
ref|XP_008373154.1|  PREDICTED: UDP-glycosyltransferase 85A5-like       121   2e-29   
ref|XP_004953967.1|  PREDICTED: UDP-glycosyltransferase 85A2-like       121   2e-29   
ref|XP_007141191.1|  hypothetical protein PHAVU_008G174700g             121   2e-29   
ref|XP_003593141.1|  Cytokinin-O-glucosyltransferase                    121   2e-29   
ref|NP_001183028.1|  hypothetical protein                               121   3e-29   
gb|KDP33206.1|  hypothetical protein JCGZ_12728                         121   3e-29   
gb|KCW44218.1|  hypothetical protein EUGRSUZ_L023572                    116   3e-29   
gb|AIS39476.1|  flavonoid UDP-glucosyltransferase 10                    121   3e-29   
gb|KDP40913.1|  hypothetical protein JCGZ_24912                         119   3e-29   
ref|XP_006351766.1|  PREDICTED: UDP-glycosyltransferase 85A7-like       121   3e-29   
gb|KEH25039.1|  UDP-glycosyltransferase superfamily protein             117   4e-29   
emb|CDJ26664.1|  unnamed protein product                                121   4e-29   
gb|ADV71371.1|  glycosyltransferase GT14M03                             121   4e-29   
ref|XP_008391275.1|  PREDICTED: UDP-glycosyltransferase 85A3-like       120   5e-29   
ref|XP_007151396.1|  hypothetical protein PHAVU_004G043000g             120   5e-29   
ref|XP_002308830.2|  hypothetical protein POPTR_0006s02380g             120   5e-29   
ref|XP_008229473.1|  PREDICTED: UDP-glycosyltransferase 85A5-like       120   5e-29   



>ref|XP_006473006.1| PREDICTED: UDP-glycosyltransferase 85A2-like [Citrus sinensis]
Length=240

 Score =   154 bits (390),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 86/152 (57%), Positives = 110/152 (72%), Gaps = 1/152 (1%)
 Frame = +2

Query  53   VQRPHAVCIPYPAQGHICAMLKLAKLLHHRGFHITYVLTQLNYTHIMKARNFLPLTQSPT  232
            ++ PHAVCIPYPAQGHI  MLKLAK+LHH+GFHIT+V T+ N+  ++K+R    L   P+
Sbjct  8    IEMPHAVCIPYPAQGHINPMLKLAKILHHKGFHITFVNTEFNHKRLLKSRGPDSLNGLPS  67

Query  233  FRFETIPDGLPSRENPDTALDVADLCFSTGKNCYAPFMELIQRLNSTAsdvppvscvvsd  412
            FRFETIPDGLP  +  D   D+  LC+ST + C APF EL+ +LN  +S+VPPV+C+VSD
Sbjct  68   FRFETIPDGLPPTD-VDATQDIPSLCYSTTRTCLAPFKELLHKLNDPSSNVPPVTCIVSD  126

Query  413  tvMPFAVGATQELGVPVVLFWPLSAVASLMHI  508
             VM F V A +ELGVP VLFW  SA   L ++
Sbjct  127  GVMSFTVDAAEELGVPEVLFWTTSACGFLAYL  158



>ref|XP_002513937.1| UDP-glucuronosyltransferase, putative [Ricinus communis]
 gb|EEF48520.1| UDP-glucuronosyltransferase, putative [Ricinus communis]
Length=492

 Score =   156 bits (394),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 83/150 (55%), Positives = 108/150 (72%), Gaps = 1/150 (1%)
 Frame = +2

Query  62   PHAVCIPYPAQGHICAMLKLAKLLHHRGFHITYVLTQLNYTHIMKARNFLPLTQSPTFRF  241
            PHAVC+P+PAQGHI  MLKLAKLLH +GFHIT+V T+ N+  ++K+R    L   P+FRF
Sbjct  20   PHAVCVPFPAQGHINPMLKLAKLLHQKGFHITFVNTEYNHQRLLKSRGPDSLNGLPSFRF  79

Query  242  ETIPDGLPSRENPDTALDVADLCFSTGKNCYAPFMELIQRLNSTAsdvp-pvscvvsdtv  418
            ETIPDGLPS EN ++  DV  LC+ST +NC APF  L+ +LN++AS    PV+C+V D +
Sbjct  80   ETIPDGLPSSENANSTQDVPSLCYSTKRNCLAPFRYLLSKLNNSASSNVPPVTCIVFDCI  139

Query  419  MPFAVGATQELGVPVVLFWPLSAVASLMHI  508
            M F + A QELGVPVVLFW  S    + ++
Sbjct  140  MSFTLQAGQELGVPVVLFWTASVCGFMAYL  169



>ref|XP_006433961.1| hypothetical protein CICLE_v10000958mg [Citrus clementina]
 gb|ESR47201.1| hypothetical protein CICLE_v10000958mg [Citrus clementina]
Length=489

 Score =   155 bits (391),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 86/152 (57%), Positives = 110/152 (72%), Gaps = 1/152 (1%)
 Frame = +2

Query  53   VQRPHAVCIPYPAQGHICAMLKLAKLLHHRGFHITYVLTQLNYTHIMKARNFLPLTQSPT  232
            ++ PHAVCIPYPAQGHI  MLKLAK+LHH+GFHIT+V T+ N+  ++K+R    L   P+
Sbjct  8    IEMPHAVCIPYPAQGHINPMLKLAKILHHKGFHITFVNTEFNHKRLLKSRGPDSLNGLPS  67

Query  233  FRFETIPDGLPSRENPDTALDVADLCFSTGKNCYAPFMELIQRLNSTAsdvppvscvvsd  412
            FRFETIPDGLP  +  D   D+  LC+ST + C APF EL+ +LN  +S+VPPV+C+VSD
Sbjct  68   FRFETIPDGLPPTD-VDATQDIPSLCYSTTRTCLAPFKELLHKLNDPSSNVPPVTCIVSD  126

Query  413  tvMPFAVGATQELGVPVVLFWPLSAVASLMHI  508
             VM F V A +ELGVP VLFW  SA   L ++
Sbjct  127  GVMSFTVDAAEELGVPEVLFWTTSACGFLAYL  158



>ref|XP_010646820.1| PREDICTED: 7-deoxyloganetin glucosyltransferase isoform X2 [Vitis 
vinifera]
Length=480

 Score =   154 bits (390),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 81/147 (55%), Positives = 104/147 (71%), Gaps = 0/147 (0%)
 Frame = +2

Query  53   VQRPHAVCIPYPAQGHICAMLKLAKLLHHRGFHITYVLTQLNYTHIMKARNFLPLTQSPT  232
            V++PHAVCIPYP QGHI  ML LAKLLHHRGFHIT+V +  NY  ++K+R    L   P 
Sbjct  6    VEKPHAVCIPYPTQGHISPMLNLAKLLHHRGFHITFVHSHFNYARLIKSRGPSSLCGLPD  65

Query  233  FRFETIPDGLPSRENPDTALDVADLCFSTGKNCYAPFMELIQRLNSTAsdvppvscvvsd  412
            FRFE+IPDGLP  +NPD   D+  L  ST  NC+ PF  L+ +LNS A ++PPV+CV+ D
Sbjct  66   FRFESIPDGLPPPDNPDATQDIIALSISTANNCFIPFRNLLAKLNSGAPEIPPVTCVIYD  125

Query  413  tvMPFAVGATQELGVPVVLFWPLSAVA  493
             +M FA+ A Q++GVP V FW +SA +
Sbjct  126  GLMSFALEAAQQVGVPGVAFWTVSACS  152



>ref|XP_010646819.1| PREDICTED: 7-deoxyloganetin glucosyltransferase isoform X1 [Vitis 
vinifera]
Length=487

 Score =   154 bits (390),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 81/147 (55%), Positives = 104/147 (71%), Gaps = 0/147 (0%)
 Frame = +2

Query  53   VQRPHAVCIPYPAQGHICAMLKLAKLLHHRGFHITYVLTQLNYTHIMKARNFLPLTQSPT  232
            V++PHAVCIPYP QGHI  ML LAKLLHHRGFHIT+V +  NY  ++K+R    L   P 
Sbjct  6    VEKPHAVCIPYPTQGHISPMLNLAKLLHHRGFHITFVHSHFNYARLIKSRGPSSLCGLPD  65

Query  233  FRFETIPDGLPSRENPDTALDVADLCFSTGKNCYAPFMELIQRLNSTAsdvppvscvvsd  412
            FRFE+IPDGLP  +NPD   D+  L  ST  NC+ PF  L+ +LNS A ++PPV+CV+ D
Sbjct  66   FRFESIPDGLPPPDNPDATQDIIALSISTANNCFIPFRNLLAKLNSGAPEIPPVTCVIYD  125

Query  413  tvMPFAVGATQELGVPVVLFWPLSAVA  493
             +M FA+ A Q++GVP V FW +SA +
Sbjct  126  GLMSFALEAAQQVGVPGVAFWTVSACS  152



>emb|CBI38431.3| unnamed protein product [Vitis vinifera]
Length=575

 Score =   155 bits (392),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 81/147 (55%), Positives = 104/147 (71%), Gaps = 0/147 (0%)
 Frame = +2

Query  53   VQRPHAVCIPYPAQGHICAMLKLAKLLHHRGFHITYVLTQLNYTHIMKARNFLPLTQSPT  232
            V++PHAVCIPYP QGHI  ML LAKLLHHRGFHIT+V +  NY  ++K+R    L   P 
Sbjct  6    VEKPHAVCIPYPTQGHISPMLNLAKLLHHRGFHITFVHSHFNYARLIKSRGPSSLCGLPD  65

Query  233  FRFETIPDGLPSRENPDTALDVADLCFSTGKNCYAPFMELIQRLNSTAsdvppvscvvsd  412
            FRFE+IPDGLP  +NPD   D+  L  ST  NC+ PF  L+ +LNS A ++PPV+CV+ D
Sbjct  66   FRFESIPDGLPPPDNPDATQDIIALSISTANNCFIPFRNLLAKLNSGAPEIPPVTCVIYD  125

Query  413  tvMPFAVGATQELGVPVVLFWPLSAVA  493
             +M FA+ A Q++GVP V FW +SA +
Sbjct  126  GLMSFALEAAQQVGVPGVAFWTVSACS  152



>ref|XP_002262743.1| PREDICTED: 7-deoxyloganetin glucosyltransferase [Vitis vinifera]
Length=487

 Score =   153 bits (387),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 80/147 (54%), Positives = 103/147 (70%), Gaps = 0/147 (0%)
 Frame = +2

Query  53   VQRPHAVCIPYPAQGHICAMLKLAKLLHHRGFHITYVLTQLNYTHIMKARNFLPLTQSPT  232
            V++PHAVCIPYP QGHI  ML LAKLLHHRGFHIT+V +  NY  ++K+R    L   P 
Sbjct  6    VEKPHAVCIPYPTQGHISPMLNLAKLLHHRGFHITFVHSHFNYARLLKSRGPSSLRGLPD  65

Query  233  FRFETIPDGLPSRENPDTALDVADLCFSTGKNCYAPFMELIQRLNSTAsdvppvscvvsd  412
            FRFE+IPDGLP  +NPD   D+  L  ST  NC+ PF  L+ +LN  A ++PPV+CV+ D
Sbjct  66   FRFESIPDGLPPPDNPDATQDIIALSISTANNCFIPFRNLLAKLNGGAPEIPPVTCVIYD  125

Query  413  tvMPFAVGATQELGVPVVLFWPLSAVA  493
             +M FA+ A Q++GVP V FW +SA +
Sbjct  126  GLMSFALEAAQQVGVPGVAFWTVSACS  152



>ref|XP_010039829.1| PREDICTED: 7-deoxyloganetin glucosyltransferase-like [Eucalyptus 
grandis]
Length=487

 Score =   152 bits (384),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 83/154 (54%), Positives = 106/154 (69%), Gaps = 4/154 (3%)
 Frame = +2

Query  56   QRPHAVCIPYPAQGHICAMLKLAKLLHHRGFHITYVLTQLNYTHIMKARNFLPLTQSPTF  235
             +PHAV IPYPAQGHI  ++KLAK+LHHRGFHIT+V T+ N+  ++K+R    L  SP F
Sbjct  7    DKPHAVVIPYPAQGHINPIMKLAKILHHRGFHITFVHTEYNHKRLLKSRGLSSLDGSPRF  66

Query  236  RFETIPDGLP-SRENPDTALDVADLCFSTGKNCYAPFMELIQRLNSTAsdvp---pvscv  403
            RFETIPDGLP S  + D    +  LC ST KNC APFM+L+ RLN  + D      VSCV
Sbjct  67   RFETIPDGLPQSDSDEDVTQHIPSLCESTSKNCLAPFMDLLGRLNDKSVDDTEVPKVSCV  126

Query  404  vsdtvMPFAVGATQELGVPVVLFWPLSAVASLMH  505
            ++D  M FA+ A ++LGVP VLFW  SA  +L++
Sbjct  127  IADGGMSFALDAAEKLGVPGVLFWTPSACGALVY  160



>ref|XP_010534080.1| PREDICTED: UDP-glycosyltransferase 85A2-like [Tarenaya hassleriana]
Length=486

 Score =   152 bits (383),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 84/144 (58%), Positives = 105/144 (73%), Gaps = 1/144 (1%)
 Frame = +2

Query  56   QRPHAVCIPYPAQGHICAMLKLAKLLHHRGFHITYVLTQLNYTHIMKARNFLPLTQSPTF  235
            Q+PHAVC+PYPAQGHI  MLK+AKLLH RGFH+T+V T+ N+  ++++R    L + P+F
Sbjct  10   QKPHAVCVPYPAQGHINPMLKVAKLLHARGFHVTFVNTEFNHRRLLRSRGPHALDKLPSF  69

Query  236  RFETIPDGLPSRENPDTALDVADLCFSTGKNCYAPFMELIQRLNSTAsdvppvscvvsdt  415
            RFETIPDGLP  E  D   D+  LC ST KNC APF EL++R+N    ++PPVSCVVSD 
Sbjct  70   RFETIPDGLPETE-VDATQDIPALCDSTRKNCLAPFKELLRRINLAGGEIPPVSCVVSDG  128

Query  416  vMPFAVGATQELGVPVVLFWPLSA  487
             M F + A +ELGVP VLFW  SA
Sbjct  129  CMSFTLDAAEELGVPEVLFWTTSA  152



>ref|XP_010535401.1| PREDICTED: UDP-glycosyltransferase 85A1-like isoform X1 [Tarenaya 
hassleriana]
 ref|XP_010535409.1| PREDICTED: UDP-glycosyltransferase 85A1-like isoform X2 [Tarenaya 
hassleriana]
Length=487

 Score =   152 bits (383),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 82/150 (55%), Positives = 104/150 (69%), Gaps = 1/150 (1%)
 Frame = +2

Query  56   QRPHAVCIPYPAQGHICAMLKLAKLLHHRGFHITYVLTQLNYTHIMKARNFLPLTQSPTF  235
            Q+PHAVCIPYPAQGHI  M+K+AKLLH RGFH+T+V T+ N+   +++R    L    +F
Sbjct  10   QKPHAVCIPYPAQGHINPMMKVAKLLHARGFHVTFVNTEFNHRRFLRSRGPHALDGLRSF  69

Query  236  RFETIPDGLPSRENPDTALDVADLCFSTGKNCYAPFMELIQRLNSTAsdvppvscvvsdt  415
            RFETIPDGLP   + D   D+  LC ST KNC +PF EL+QRLN+T  D+P VSCVV D 
Sbjct  70   RFETIPDGLP-ESDLDATQDIPALCQSTMKNCLSPFRELLQRLNATGGDIPSVSCVVYDG  128

Query  416  vMPFAVGATQELGVPVVLFWPLSAVASLMH  505
             M FAV A  E G+P V+ W  SA  S+++
Sbjct  129  AMSFAVDAAAEFGIPAVMLWTFSASVSMLY  158



>emb|CBI29442.3| unnamed protein product [Vitis vinifera]
Length=848

 Score =   154 bits (388),  Expect = 9e-40, Method: Compositional matrix adjust.
 Identities = 80/147 (54%), Positives = 103/147 (70%), Gaps = 0/147 (0%)
 Frame = +2

Query  53   VQRPHAVCIPYPAQGHICAMLKLAKLLHHRGFHITYVLTQLNYTHIMKARNFLPLTQSPT  232
            V++PHAVCIPYP QGHI  ML LAKLLHHRGFHIT+V +  NY  ++K+R    L   P 
Sbjct  6    VEKPHAVCIPYPTQGHISPMLNLAKLLHHRGFHITFVHSHFNYARLLKSRGPSSLRGLPD  65

Query  233  FRFETIPDGLPSRENPDTALDVADLCFSTGKNCYAPFMELIQRLNSTAsdvppvscvvsd  412
            FRFE+IPDGLP  +NPD   D+  L  ST  NC+ PF  L+ +LN  A ++PPV+CV+ D
Sbjct  66   FRFESIPDGLPPPDNPDATQDIIALSISTANNCFIPFRNLLAKLNGGAPEIPPVTCVIYD  125

Query  413  tvMPFAVGATQELGVPVVLFWPLSAVA  493
             +M FA+ A Q++GVP V FW +SA +
Sbjct  126  GLMSFALEAAQQVGVPGVAFWTVSACS  152


 Score = 87.0 bits (214),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 59/122 (48%), Positives = 81/122 (66%), Gaps = 2/122 (2%)
 Frame = +2

Query  143  GFHITYVLTQLNYTHIMKARNFLPLTQSPTFRFETIPDGLPSRENPDTALDVADLCFSTG  322
            GFHIT+V T+ N+  ++++     +     FRFE IPDGLP   + D   DV  LC ST 
Sbjct  431  GFHITFVNTEFNHRRLIRSAGPDSVRGLVDFRFEAIPDGLPP-SDLDATQDVPALCDSTR  489

Query  323  KNCYAPFMELIQRLNSTAsdvppvscvvsdtvMPFAVGATQELGVPVVLFWPLSAVASLM  502
            KNC APF +L+ RLNS++ DVPPVSC++SD VM FA+ A +ELG+P V FW  SA + + 
Sbjct  490  KNCLAPFRDLLARLNSSS-DVPPVSCIISDGVMSFAIEAAEELGIPEVQFWTASACSFMG  548

Query  503  HI  508
            ++
Sbjct  549  YL  550



>ref|XP_002513939.1| UDP-glucuronosyltransferase, putative [Ricinus communis]
 gb|EEF48522.1| UDP-glucuronosyltransferase, putative [Ricinus communis]
Length=385

 Score =   147 bits (372),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 83/152 (55%), Positives = 107/152 (70%), Gaps = 1/152 (1%)
 Frame = +2

Query  53   VQRPHAVCIPYPAQGHICAMLKLAKLLHHRGFHITYVLTQLNYTHIMKARNFLPLTQSPT  232
            +++PHAVCIPYPAQGHI  MLKLAKLLHH+GFHIT+V T+ NY  ++K+R    L    +
Sbjct  7    LEKPHAVCIPYPAQGHINPMLKLAKLLHHKGFHITFVNTEYNYRRLLKSRGPDSLNGLSS  66

Query  233  FRFETIPDGLPSRENPDTALDVADLCFSTGKNCYAPFMELIQRLNSTAsdvppvscvvsd  412
            FRFETIPDGLP  +  D   D+  LC ST   C   F  ++ +LN+T+S+VPPVSC++SD
Sbjct  67   FRFETIPDGLPPTDT-DATQDIPSLCVSTKSTCLPHFKNILSKLNNTSSNVPPVSCIISD  125

Query  413  tvMPFAVGATQELGVPVVLFWPLSAVASLMHI  508
             VM F + A QELG+P VLFW  SA   L ++
Sbjct  126  GVMSFTLDAAQELGIPEVLFWTTSACGFLAYV  157



>gb|KCW45339.1| hypothetical protein EUGRSUZ_L009911, partial [Eucalyptus grandis]
Length=174

 Score =   142 bits (358),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 82/154 (53%), Positives = 106/154 (69%), Gaps = 2/154 (1%)
 Frame = +2

Query  53   VQRPHAVCIPYPAQGHICAMLKLAKLLHHRGFHITYVLTQLNYTHIMKARNFLPLTQSPT  232
            +Q+PHA+CIPYPAQGHI  ML LAKLLHHRGFH+T+V T+ N++ ++++R    L   P+
Sbjct  7    IQKPHALCIPYPAQGHINPMLNLAKLLHHRGFHVTFVNTEYNHSRLLRSRGPSSLDGLPS  66

Query  233  FRFETIPDGLPSRENPDTALDVADLCFSTGKNCYAPFMELIQRLN--STAsdvppvscvv  406
            FRF TIPDGLP  +  D   D+  LC ST K C   F +L++RLN  ST S  PPVSCVV
Sbjct  67   FRFRTIPDGLPPSDVADATQDIPALCQSTSKFCLPYFRDLLERLNEESTTSGSPPVSCVV  126

Query  407  sdtvMPFAVGATQELGVPVVLFWPLSAVASLMHI  508
            SD VM F + A + +GVP VLFW  SA   + ++
Sbjct  127  SDGVMSFTLDAAEAIGVPEVLFWTTSACGFMGYV  160



>gb|KFK44333.1| hypothetical protein AALP_AA1G244500 [Arabis alpina]
Length=483

 Score =   149 bits (375),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 83/144 (58%), Positives = 107/144 (74%), Gaps = 2/144 (1%)
 Frame = +2

Query  56   QRPHAVCIPYPAQGHICAMLKLAKLLHHRGFHITYVLTQLNYTHIMKARNFLPLTQSPTF  235
            Q+PH VC+PYPAQGHI  MLK+AKLLH +G H+T+V T  N+  ++++R    L   P+F
Sbjct  10   QKPHVVCVPYPAQGHINPMLKVAKLLHAKGLHVTFVNTVYNHNRLLRSRGPDALHGLPSF  69

Query  236  RFETIPDGLPSRENPDTALDVADLCFSTGKNCYAPFMELIQRLNSTAsdvppvscvvsdt  415
            +FE+IPDGLP  +  DT  D+  LC ST KNC APFMELI+R+NS   DVPP+SC+VSD 
Sbjct  70   QFESIPDGLPETDG-DTTQDIPALCVSTKKNCLAPFMELIRRINSGG-DVPPISCIVSDG  127

Query  416  vMPFAVGATQELGVPVVLFWPLSA  487
            +M F + A +ELGVP+VLFW LSA
Sbjct  128  IMSFTLDAAEELGVPIVLFWTLSA  151



>dbj|BAO51842.1| UDP-glycosyltransferase 85A32 [Ipomoea batatas]
Length=485

 Score =   149 bits (375),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 84/154 (55%), Positives = 103/154 (67%), Gaps = 2/154 (1%)
 Frame = +2

Query  50   EVQRPHAVCIPYPAQGHICAMLKLAKLLHHRGFHITYVLTQLNYTHIMKARNFLPLTQSP  229
            E+ +PHAVCIPYPAQGHI  MLKLAK+LHH+GFHIT+V T+ N+  + + R    L   P
Sbjct  7    ELDKPHAVCIPYPAQGHINPMLKLAKILHHKGFHITFVNTEFNHRRLERTRGPESLRGLP  66

Query  230  TFRFETIPDGLPSRENPDTALDVADLCFSTGKNCYAPFMELIQRLNSTAsdvp-pvscvv  406
            +FRFETIPDGLP   + D   D+  LC ST   C  PF +L+ RLN TA     PVSC+V
Sbjct  67   SFRFETIPDGLPV-SDADVTQDIPSLCESTSATCLGPFKDLLARLNDTAVSNAPPVSCIV  125

Query  407  sdtvMPFAVGATQELGVPVVLFWPLSAVASLMHI  508
            SD VM F V A +ELG+P VLFW  SA   L ++
Sbjct  126  SDGVMSFTVDAAEELGIPEVLFWTTSACGFLGYM  159



>gb|EYU19973.1| hypothetical protein MIMGU_mgv1a005383mg [Erythranthe guttata]
Length=486

 Score =   149 bits (375),  Expect = 5e-39, Method: Compositional matrix adjust.
 Identities = 85/150 (57%), Positives = 103/150 (69%), Gaps = 3/150 (2%)
 Frame = +2

Query  53   VQRPHAVCIPYPAQGHICAMLKLAKLLHHRGFHITYVLTQLNYTHIMKARNFLPLTQSPT  232
            V +PHAVCIP+PAQGHI  MLKLAKLLH+ GFHIT+V T+ N+  ++K+R    LT  P+
Sbjct  8    VHKPHAVCIPFPAQGHINPMLKLAKLLHNNGFHITFVNTEYNHHRLLKSRGPDSLTGLPS  67

Query  233  FRFETIPDGL--PSRENPDTALDVADLCFSTGKNCYAPFMELIQRLNSTAsdvp-pvscv  403
            FRFETIPDGL  PS ++ D   D+  LC ST   C APF +L+ +LN TAS     VSCV
Sbjct  68   FRFETIPDGLPPPSEDDADATQDIPSLCESTTNTCLAPFRDLLAKLNDTASSEVPHVSCV  127

Query  404  vsdtvMPFAVGATQELGVPVVLFWPLSAVA  493
            VSD VM F   A +ELG+P VLFW  SA  
Sbjct  128  VSDGVMSFTADAAEELGIPEVLFWTTSACG  157



>ref|XP_004252533.1| PREDICTED: 7-deoxyloganetin glucosyltransferase-like [Solanum 
lycopersicum]
Length=486

 Score =   149 bits (375),  Expect = 5e-39, Method: Compositional matrix adjust.
 Identities = 81/155 (52%), Positives = 107/155 (69%), Gaps = 3/155 (2%)
 Frame = +2

Query  50   EVQRPHAVCIPYPAQGHICAMLKLAKLLHHRGFHITYVLTQLNYTHIMKARNFLPLTQSP  229
            E+ +PHAVCIPYPAQGHI  MLKLAK+LHH+GFHIT+V T+ N+  ++K+R    L    
Sbjct  7    EINKPHAVCIPYPAQGHINPMLKLAKILHHKGFHITFVNTEFNHRRLLKSRGPHSLDGLS  66

Query  230  TFRFETIPDGLPSRENPDTALDVADLCFSTGKNCYAPFMELIQRLNSTAsdvpp--vscv  403
            +FRFETIPDGLP+  + D   D+  LC ST + C APF +L+ +LN T++      V+C+
Sbjct  67   SFRFETIPDGLPTC-DADATQDIPSLCKSTTETCLAPFRDLLAKLNGTSNTSNVPPVTCI  125

Query  404  vsdtvMPFAVGATQELGVPVVLFWPLSAVASLMHI  508
            VSD VM F + A QE+GVP VLFW  SA   L ++
Sbjct  126  VSDGVMSFTLAAAQEIGVPEVLFWTTSACGFLGYM  160



>ref|XP_006360268.1| PREDICTED: UDP-glycosyltransferase 85A2-like [Solanum tuberosum]
Length=486

 Score =   148 bits (373),  Expect = 9e-39, Method: Compositional matrix adjust.
 Identities = 80/156 (51%), Positives = 108/156 (69%), Gaps = 3/156 (2%)
 Frame = +2

Query  47   MEVQRPHAVCIPYPAQGHICAMLKLAKLLHHRGFHITYVLTQLNYTHIMKARNFLPLTQS  226
            +E+ +PHAVCIPYPAQGHI  MLKLAK+LHH+GFHIT+V T+ N+  ++K+R    L   
Sbjct  6    VELNKPHAVCIPYPAQGHINPMLKLAKILHHKGFHITFVNTEFNHRRLLKSRGPHSLDGL  65

Query  227  PTFRFETIPDGLPSRENPDTALDVADLCFSTGKNCYAPFMELIQRLNSTAsdvpp--vsc  400
             +FRFETIPDGLP+ +  D   D+  LC ST + C APF +L+ +LN T++      V+C
Sbjct  66   SSFRFETIPDGLPTCD-ADATQDIPSLCKSTTETCLAPFRDLLAKLNETSNTSNVPPVTC  124

Query  401  vvsdtvMPFAVGATQELGVPVVLFWPLSAVASLMHI  508
            +VSD +M F + A QE+GVP VLFW  SA   L ++
Sbjct  125  IVSDGIMSFTLAAAQEIGVPEVLFWTTSACGFLGYM  160



>ref|XP_002302305.1| UDP-glucuronosyltransferase family protein [Populus trichocarpa]
 gb|EEE81578.1| UDP-glucuronosyltransferase family protein [Populus trichocarpa]
Length=483

 Score =   147 bits (372),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 83/152 (55%), Positives = 103/152 (68%), Gaps = 2/152 (1%)
 Frame = +2

Query  53   VQRPHAVCIPYPAQGHICAMLKLAKLLHHRGFHITYVLTQLNYTHIMKARNFLPLTQSPT  232
            ++ PHAVCIPYPAQGHI  MLKLAKLLHH+GFHIT+V T+ N+  I+++R    L   P+
Sbjct  7    LENPHAVCIPYPAQGHINPMLKLAKLLHHKGFHITFVNTEYNHKRILRSRGLNSLDGLPS  66

Query  233  FRFETIPDGLPSRENPDTALDVADLCFSTGKNCYAPFMELIQRLNSTAsdvp-pvscvvs  409
            F+F+ IPDGLP   N D   D+  LC ST K C  PF +LI  LN T+S    PV+C+VS
Sbjct  67   FQFKAIPDGLPPTSN-DVTQDIPSLCESTSKTCMVPFKDLITNLNDTSSSNVPPVTCIVS  125

Query  410  dtvMPFAVGATQELGVPVVLFWPLSAVASLMH  505
            D VM F + A QELG+P VLFW  SA   L +
Sbjct  126  DGVMSFTLEAAQELGIPEVLFWTTSACGFLAY  157



>ref|NP_973885.1| UDP-glucosyl transferase 85A5 [Arabidopsis thaliana]
 sp|Q9LMF0.1|U85A5_ARATH RecName: Full=UDP-glycosyltransferase 85A5 [Arabidopsis thaliana]
 gb|AAF87255.1|AC068562_2 Strong similarity to UDP-glucose glucosyltransferase from Arabidopsis 
thaliana gb|AB016819 and contains a UDP-glucosyl transferase 
PF|00201 domain. ESTs gb|U74128, gb|AA713257 come 
from this gene [Arabidopsis thaliana]
 gb|AEE30235.1| UDP-glucosyl transferase 85A5 [Arabidopsis thaliana]
Length=479

 Score =   147 bits (371),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 87/151 (58%), Positives = 109/151 (72%), Gaps = 2/151 (1%)
 Frame = +2

Query  56   QRPHAVCIPYPAQGHICAMLKLAKLLHHRGFHITYVLTQLNYTHIMKARNFLPLTQSPTF  235
            Q+PH VCIP+PAQGHI  MLK+AKLL+ RGFH+T+V T  N+  ++++R    L   P+F
Sbjct  10   QKPHVVCIPFPAQGHINPMLKVAKLLYARGFHVTFVNTNYNHNRLIRSRGPNSLDGLPSF  69

Query  236  RFETIPDGLPSRENPDTALDVADLCFSTGKNCYAPFMELIQRLNSTAsdvppvscvvsdt  415
            RFE+IPDGLP  EN D   DV  LC ST KNC APF EL++R+N+T  DVPPVSC+VSD 
Sbjct  70   RFESIPDGLP-EENKDVMQDVPTLCESTMKNCLAPFKELLRRINTTK-DVPPVSCIVSDG  127

Query  416  vMPFAVGATQELGVPVVLFWPLSAVASLMHI  508
            VM F + A +ELGVP VLFW  SA   L ++
Sbjct  128  VMSFTLDAAEELGVPDVLFWTPSACGFLAYL  158



>gb|AAV32497.1| UDP-glucuronosyltransferase [Arabidopsis thaliana]
Length=483

 Score =   147 bits (371),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 87/151 (58%), Positives = 109/151 (72%), Gaps = 2/151 (1%)
 Frame = +2

Query  56   QRPHAVCIPYPAQGHICAMLKLAKLLHHRGFHITYVLTQLNYTHIMKARNFLPLTQSPTF  235
            Q+PH VCIP+PAQGHI  MLK+AKLL+ RGFH+T+V T  N+  ++++R    L   P+F
Sbjct  10   QKPHVVCIPFPAQGHINPMLKVAKLLYARGFHVTFVNTNYNHNRLIRSRGPNSLDGLPSF  69

Query  236  RFETIPDGLPSRENPDTALDVADLCFSTGKNCYAPFMELIQRLNSTAsdvppvscvvsdt  415
            RFE+IPDGLP  EN D   DV  LC ST KNC APF EL++R+N+T  DVPPVSC+VSD 
Sbjct  70   RFESIPDGLP-EENKDVMQDVPTLCESTMKNCLAPFKELLRRINTTK-DVPPVSCIVSDG  127

Query  416  vMPFAVGATQELGVPVVLFWPLSAVASLMHI  508
            VM F + A +ELGVP VLFW  SA   L ++
Sbjct  128  VMSFTLDAAEELGVPDVLFWTPSACGFLAYL  158



>ref|XP_004252531.1| PREDICTED: 7-deoxyloganetin glucosyltransferase-like [Solanum 
lycopersicum]
Length=486

 Score =   147 bits (371),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 80/156 (51%), Positives = 107/156 (69%), Gaps = 3/156 (2%)
 Frame = +2

Query  47   MEVQRPHAVCIPYPAQGHICAMLKLAKLLHHRGFHITYVLTQLNYTHIMKARNFLPLTQS  226
            +E+ +PHAVCIPYPAQGHI  MLKLAK+LHH+GFHIT+V T+ N+  ++K+R    L   
Sbjct  6    VELNKPHAVCIPYPAQGHINPMLKLAKILHHKGFHITFVNTEFNHRRLLKSRGPHSLDGL  65

Query  227  PTFRFETIPDGLPSRENPDTALDVADLCFSTGKNCYAPFMELIQRLNSTAsdvpp--vsc  400
             +FRFETIPDGLP+ +  D   D+  LC ST + C APF +L+ +LN T +      V+C
Sbjct  66   SSFRFETIPDGLPTCD-ADATQDIPSLCKSTTETCLAPFRDLLAKLNGTNNTSNVPPVTC  124

Query  401  vvsdtvMPFAVGATQELGVPVVLFWPLSAVASLMHI  508
            +VSD +M F + A QE+GVP VLFW  SA   L ++
Sbjct  125  IVSDGIMSFTLAAAQEIGVPEVLFWTTSACGFLGYM  160



>ref|XP_009612691.1| PREDICTED: 7-deoxyloganetin glucosyltransferase-like [Nicotiana 
tomentosiformis]
 dbj|BAD93689.1| glycosyltransferase [Nicotiana tabacum]
Length=485

 Score =   147 bits (370),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 85/154 (55%), Positives = 105/154 (68%), Gaps = 2/154 (1%)
 Frame = +2

Query  50   EVQRPHAVCIPYPAQGHICAMLKLAKLLHHRGFHITYVLTQLNYTHIMKARNFLPLTQSP  229
            E+ +PHAVCIPYPAQGHI  MLKLAK+LHH+GFHIT+V T+ N+  ++K+R    L    
Sbjct  7    ELTKPHAVCIPYPAQGHINPMLKLAKILHHKGFHITFVNTEFNHRRLLKSRGPDSLKGLS  66

Query  230  TFRFETIPDGLPSRENPDTALDVADLCFSTGKNCYAPFMELIQRLNSTAsdvp-pvscvv  406
            +FRFETIPDGLP  E  D   D+  LC ST   C APF +L+ +LN T +    PVSC+V
Sbjct  67   SFRFETIPDGLPPCE-ADATQDIPSLCESTTNTCLAPFRDLLAKLNDTNTSNVPPVSCIV  125

Query  407  sdtvMPFAVGATQELGVPVVLFWPLSAVASLMHI  508
            SD VM F + A QELGVP VLFW  SA   L ++
Sbjct  126  SDGVMSFTLAAAQELGVPEVLFWTTSACGFLGYM  159



>dbj|BAO51841.1| UDP-glycosyltransferase 85A35 [Humulus lupulus]
Length=487

 Score =   147 bits (370),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 87/152 (57%), Positives = 102/152 (67%), Gaps = 5/152 (3%)
 Frame = +2

Query  59   RPHAVCIPYPAQGHICAMLKLAKLLHHRGFHITYVLTQLNYTHIMKARNFLPLTQSPTFR  238
            +PHAVCIPYPAQGHI  MLKLAKLLH RGFHIT+V T  N+  I+K+R    L   P FR
Sbjct  6    KPHAVCIPYPAQGHINPMLKLAKLLHQRGFHITFVNTHFNHNRILKSRGPNSLDGLPDFR  65

Query  239  FETIPDGLPSRENP-DTALDVADLCFSTGKNCYAPFMELIQRLN----STAsdvppvscv  403
            FE+IPDGLP  EN  D   D+  LC ST K C  PF +L+ +LN    S+   VPPVSCV
Sbjct  66   FESIPDGLPPTENKADATQDIPSLCESTEKTCLDPFRKLLFQLNDASSSSGGAVPPVSCV  125

Query  404  vsdtvMPFAVGATQELGVPVVLFWPLSAVASL  499
            VSD  MPF + A +E G+PV LFW +SA   L
Sbjct  126  VSDAAMPFTLKAGEEFGIPVALFWTISACGLL  157



>ref|XP_010459992.1| PREDICTED: UDP-glycosyltransferase 85A5 [Camelina sativa]
Length=483

 Score =   147 bits (370),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 84/151 (56%), Positives = 107/151 (71%), Gaps = 1/151 (1%)
 Frame = +2

Query  56   QRPHAVCIPYPAQGHICAMLKLAKLLHHRGFHITYVLTQLNYTHIMKARNFLPLTQSPTF  235
            Q+PH VC+P+PAQGHI  MLK+AKLL+ RGFH+T+V T  N+  ++++R    L   P+F
Sbjct  10   QKPHVVCVPFPAQGHINPMLKVAKLLYARGFHVTFVNTVYNHNRLIRSRGPNALDGLPSF  69

Query  236  RFETIPDGLPSRENPDTALDVADLCFSTGKNCYAPFMELIQRLNSTAsdvppvscvvsdt  415
            RFE+IPDGLP   N D   DV  LC ST KNC APF EL++R+N T  DVPPVSC+VSD 
Sbjct  70   RFESIPDGLPEEPNKDVMQDVPPLCESTMKNCLAPFKELLRRIN-TGDDVPPVSCIVSDG  128

Query  416  vMPFAVGATQELGVPVVLFWPLSAVASLMHI  508
            VM F + A +ELGVP V+FW  SA   L ++
Sbjct  129  VMSFTLDAAEELGVPEVIFWTTSACGFLAYL  159



>dbj|BAO51838.1| UDP-glycosyltransferase 85A36 [Humulus lupulus]
Length=487

 Score =   146 bits (369),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 86/152 (57%), Positives = 102/152 (67%), Gaps = 5/152 (3%)
 Frame = +2

Query  59   RPHAVCIPYPAQGHICAMLKLAKLLHHRGFHITYVLTQLNYTHIMKARNFLPLTQSPTFR  238
            +PHAVCIPYPAQGHI  MLKLAKLLH RGFHIT+V T  N+  ++K+R    L   P FR
Sbjct  6    KPHAVCIPYPAQGHISPMLKLAKLLHQRGFHITFVNTHFNHNRLLKSRGPNSLDGLPDFR  65

Query  239  FETIPDGLPSRENP-DTALDVADLCFSTGKNCYAPFMELIQRLN----STAsdvppvscv  403
            FE+IPDGLP  EN  D   D+  LC ST K C  PF +L+ +LN    S+   VPPVSCV
Sbjct  66   FESIPDGLPPTENKADATQDIPSLCESTEKTCLDPFRKLLFQLNDASSSSGGAVPPVSCV  125

Query  404  vsdtvMPFAVGATQELGVPVVLFWPLSAVASL  499
            VSD  MPF + A +E G+PV LFW +SA   L
Sbjct  126  VSDASMPFTLKAGEEFGIPVALFWTISACGLL  157



>ref|XP_011069754.1| PREDICTED: 7-deoxyloganetin glucosyltransferase-like [Sesamum 
indicum]
Length=485

 Score =   146 bits (368),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 81/146 (55%), Positives = 101/146 (69%), Gaps = 1/146 (1%)
 Frame = +2

Query  53   VQRPHAVCIPYPAQGHICAMLKLAKLLHHRGFHITYVLTQLNYTHIMKARNFLPLTQSPT  232
            +++PHAVCIP+PAQGHI  MLKLAKLLHH GFHIT+V T+ N+  ++K+R    L   P+
Sbjct  7    LEKPHAVCIPFPAQGHINPMLKLAKLLHHNGFHITFVNTEYNHQRLLKSRGPSSLEGLPS  66

Query  233  FRFETIPDGLPSRENPDTALDVADLCFSTGKNCYAPFMELIQRLNSTAsdvp-pvscvvs  409
            FRFETIPDGLP  +  D   D+  LC ST   C APF +L+ +LN T S    PVSC+VS
Sbjct  67   FRFETIPDGLPPSDAADATQDIPSLCQSTTTTCLAPFRDLLAKLNDTGSSNVPPVSCIVS  126

Query  410  dtvMPFAVGATQELGVPVVLFWPLSA  487
            D VM F V A +ELG+P + FW  SA
Sbjct  127  DGVMSFTVEAAEELGIPEIFFWTPSA  152



>ref|XP_011016634.1| PREDICTED: 7-deoxyloganetin glucosyltransferase [Populus euphratica]
Length=483

 Score =   146 bits (368),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 84/152 (55%), Positives = 102/152 (67%), Gaps = 2/152 (1%)
 Frame = +2

Query  53   VQRPHAVCIPYPAQGHICAMLKLAKLLHHRGFHITYVLTQLNYTHIMKARNFLPLTQSPT  232
            ++ PHAVCIPYPAQGHI  MLKLAKLLHHRGFHIT+V T+ N+  I+++R    L   P+
Sbjct  7    LENPHAVCIPYPAQGHINPMLKLAKLLHHRGFHITFVNTEYNHKRILRSRGPNSLDGLPS  66

Query  233  FRFETIPDGLPSRENPDTALDVADLCFSTGKNCYAPFMELIQRLNSTAsdvp-pvscvvs  409
            F+F+ IPDGLP   N D   D+  LC ST K C  PF  LI  LN T+S    PV+C+VS
Sbjct  67   FQFKAIPDGLPPTSN-DVTQDIPSLCESTSKTCLVPFKNLITNLNDTSSSNVPPVTCIVS  125

Query  410  dtvMPFAVGATQELGVPVVLFWPLSAVASLMH  505
            D VM F + A QELG+P VLFW  SA   L +
Sbjct  126  DGVMSFTLEAAQELGIPEVLFWTTSACGFLAY  157



>ref|XP_006304493.1| hypothetical protein CARUB_v10011262mg [Capsella rubella]
 gb|EOA37391.1| hypothetical protein CARUB_v10011262mg [Capsella rubella]
Length=488

 Score =   146 bits (368),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 83/151 (55%), Positives = 105/151 (70%), Gaps = 2/151 (1%)
 Frame = +2

Query  56   QRPHAVCIPYPAQGHICAMLKLAKLLHHRGFHITYVLTQLNYTHIMKARNFLPLTQSPTF  235
            Q+PH VC+PYPAQGHI  M+K+AKLLH RGFH+T+V T  N+   +++R    L   P+F
Sbjct  10   QKPHVVCVPYPAQGHINPMMKVAKLLHARGFHVTFVNTIYNHKRFLRSRGSNALDGLPSF  69

Query  236  RFETIPDGLPSRENPDTALDVADLCFSTGKNCYAPFMELIQRLNSTAsdvppvscvvsdt  415
            RFE+IPDGLP   + DT  D+  LC ST KNC APF ELIQR+N+   +VPPVSC+VSD 
Sbjct  70   RFESIPDGLPET-DMDTTQDITALCESTMKNCLAPFQELIQRINA-GDNVPPVSCIVSDG  127

Query  416  vMPFAVGATQELGVPVVLFWPLSAVASLMHI  508
             M F +   +ELGVP VLFW  S  A L ++
Sbjct  128  CMSFTLDVAEELGVPEVLFWTTSGCAFLAYL  158



>ref|XP_008219456.1| PREDICTED: UDP-glycosyltransferase 85A2-like [Prunus mume]
Length=486

 Score =   146 bits (368),  Expect = 5e-38, Method: Compositional matrix adjust.
 Identities = 82/152 (54%), Positives = 108/152 (71%), Gaps = 2/152 (1%)
 Frame = +2

Query  53   VQRPHAVCIPYPAQGHICAMLKLAKLLHHRGFHITYVLTQLNYTHIMKARNFLPLTQSPT  232
             ++PHAVCIPYPAQGHI  MLKLAKLLH++GFHIT+V T+ N+  ++K+R    L   P+
Sbjct  7    TKKPHAVCIPYPAQGHITPMLKLAKLLHYKGFHITFVNTEFNHKRLLKSRGPNSLDGLPS  66

Query  233  FRFETIPDGLPSRENPDTALDVADLCFSTGKNCYAPFMELIQRLNSTAsdvppvscvvsd  412
            F+FETIPDGLP  ++  T  D+  LC ST KNC APF +L+ +LNS     PPV+C+VSD
Sbjct  67   FQFETIPDGLPPSDDNATQ-DIPSLCLSTSKNCLAPFGDLLSKLNSLP-HSPPVTCLVSD  124

Query  413  tvMPFAVGATQELGVPVVLFWPLSAVASLMHI  508
              M F++ A QE G+P VLF  +SA  SL ++
Sbjct  125  GGMTFSLDAAQEFGIPCVLFETMSACGSLGYL  156



>ref|XP_010477496.1| PREDICTED: UDP-glycosyltransferase 85A5-like [Camelina sativa]
Length=508

 Score =   146 bits (368),  Expect = 5e-38, Method: Compositional matrix adjust.
 Identities = 83/151 (55%), Positives = 107/151 (71%), Gaps = 2/151 (1%)
 Frame = +2

Query  56   QRPHAVCIPYPAQGHICAMLKLAKLLHHRGFHITYVLTQLNYTHIMKARNFLPLTQSPTF  235
            Q+PH VC+P+PAQGHI  MLK+AKLLH RGFH+T+V T  N+  ++++R    L   P+F
Sbjct  32   QKPHVVCVPFPAQGHINPMLKVAKLLHTRGFHVTFVNTIYNHKRLLRSRGPNALNGIPSF  91

Query  236  RFETIPDGLPSRENPDTALDVADLCFSTGKNCYAPFMELIQRLNSTAsdvppvscvvsdt  415
            R+E+IPDGLP   N D   DV  LC ST KNC APF EL++R+N TA DVPPVS +VSD 
Sbjct  92   RYESIPDGLP-ETNKDATQDVPPLCASTKKNCLAPFKELLRRIN-TADDVPPVSSIVSDG  149

Query  416  vMPFAVGATQELGVPVVLFWPLSAVASLMHI  508
            +M F + A +ELGVP V+FW  SA   L ++
Sbjct  150  IMSFTLDAAEELGVPDVVFWTTSACGFLAYL  180



>gb|EYU19971.1| hypothetical protein MIMGU_mgv1a024760mg [Erythranthe guttata]
Length=483

 Score =   145 bits (367),  Expect = 6e-38, Method: Compositional matrix adjust.
 Identities = 83/148 (56%), Positives = 103/148 (70%), Gaps = 3/148 (2%)
 Frame = +2

Query  59   RPHAVCIPYPAQGHICAMLKLAKLLHHRGFHITYVLTQLNYTHIMKARNFLPLTQSPTFR  238
            +PHAVCIP+PAQGHI  MLKLAKLLH+ GFHIT+V T+ N+  ++K+R    LT  P+FR
Sbjct  8    KPHAVCIPFPAQGHINPMLKLAKLLHNNGFHITFVNTEYNHHRLLKSRGPDSLTGLPSFR  67

Query  239  FETIPDGL--PSRENPDTALDVADLCFSTGKNCYAPFMELIQRLNSTAsdvp-pvscvvs  409
            FETIPDGL  PS ++ D   D+  LC ST   C APF +L+ +LN TAS    PVSC+VS
Sbjct  68   FETIPDGLPPPSEDDADATQDIPSLCESTTNTCLAPFRDLLAKLNDTASSEVPPVSCIVS  127

Query  410  dtvMPFAVGATQELGVPVVLFWPLSAVA  493
            D VM F   A +ELG+P +LFW  SA  
Sbjct  128  DGVMSFTADAAEELGIPEILFWTTSACG  155



>gb|EYU19972.1| hypothetical protein MIMGU_mgv1a018325mg [Erythranthe guttata]
Length=394

 Score =   144 bits (364),  Expect = 6e-38, Method: Compositional matrix adjust.
 Identities = 85/146 (58%), Positives = 102/146 (70%), Gaps = 3/146 (2%)
 Frame = +2

Query  59   RPHAVCIPYPAQGHICAMLKLAKLLHHRGFHITYVLTQLNYTHIMKARNFLPLTQSPTFR  238
            +PHAVCIP+PAQGHI  MLKLAKLLH+ GFHIT+V T  N+  ++K+R    LT  P+FR
Sbjct  9    KPHAVCIPFPAQGHINPMLKLAKLLHNNGFHITFVNTVYNHHRLLKSRGPDSLTGLPSFR  68

Query  239  FETIPDGL--PSRENPDTALDVADLCFSTGKNCYAPFMELIQRLNSTAsdvp-pvscvvs  409
            FETIPDGL  PS ++ D   D+  LC ST   C APF +L+ +LN TAS    PVSCVVS
Sbjct  69   FETIPDGLPPPSEDDADATQDIPSLCESTTNTCLAPFRDLLAKLNDTASSEVPPVSCVVS  128

Query  410  dtvMPFAVGATQELGVPVVLFWPLSA  487
            D VM F   A +ELG+P VLFW  SA
Sbjct  129  DGVMSFTADAAEELGIPEVLFWTTSA  154



>gb|KCW45698.1| hypothetical protein EUGRSUZ_L00502, partial [Eucalyptus grandis]
Length=479

 Score =   145 bits (367),  Expect = 6e-38, Method: Compositional matrix adjust.
 Identities = 82/154 (53%), Positives = 106/154 (69%), Gaps = 4/154 (3%)
 Frame = +2

Query  56   QRPHAVCIPYPAQGHICAMLKLAKLLHHRGFHITYVLTQLNYTHIMKARNFLPLTQSPTF  235
             +PHAV IPYPAQGHI  +LKLAK+LHHRGFHIT+V T+ N+  ++K+R    L  SP F
Sbjct  7    DKPHAVVIPYPAQGHINPILKLAKILHHRGFHITFVHTEYNHKPLLKSRGPSSLDGSPRF  66

Query  236  RFETIPDGLP-SRENPDTALDVADLCFSTGKNCYAPFMELIQRLNSTAsdvp---pvscv  403
            RF+TIPDGLP S  + D    +  LC ST KNC APFM+L+ RL+  + D      VSCV
Sbjct  67   RFKTIPDGLPQSDSDEDVTQHIPSLCESTSKNCLAPFMDLLGRLSDKSVDDTEVPKVSCV  126

Query  404  vsdtvMPFAVGATQELGVPVVLFWPLSAVASLMH  505
            ++D  M FA+ A ++LGVP VLFW  SA  +L++
Sbjct  127  IADGGMSFALDAAEKLGVPGVLFWTPSACGALVY  160



>ref|XP_010039816.1| PREDICTED: 7-deoxyloganetin glucosyltransferase-like [Eucalyptus 
grandis]
Length=487

 Score =   145 bits (367),  Expect = 7e-38, Method: Compositional matrix adjust.
 Identities = 82/154 (53%), Positives = 106/154 (69%), Gaps = 4/154 (3%)
 Frame = +2

Query  56   QRPHAVCIPYPAQGHICAMLKLAKLLHHRGFHITYVLTQLNYTHIMKARNFLPLTQSPTF  235
             +PHAV IPYPAQGHI  +LKLAK+LHHRGFHIT+V T+ N+  ++K+R    L  SP F
Sbjct  7    DKPHAVVIPYPAQGHINPILKLAKILHHRGFHITFVHTEYNHKPLLKSRGPSSLDGSPRF  66

Query  236  RFETIPDGLP-SRENPDTALDVADLCFSTGKNCYAPFMELIQRLNSTAsdvp---pvscv  403
            RF+TIPDGLP S  + D    +  LC ST KNC APFM+L+ RL+  + D      VSCV
Sbjct  67   RFKTIPDGLPQSDSDEDVTQHIPSLCESTSKNCLAPFMDLLGRLSDKSVDDTEVPKVSCV  126

Query  404  vsdtvMPFAVGATQELGVPVVLFWPLSAVASLMH  505
            ++D  M FA+ A ++LGVP VLFW  SA  +L++
Sbjct  127  IADGGMSFALDAAEKLGVPGVLFWTPSACGALVY  160



>ref|XP_007222427.1| hypothetical protein PRUPE_ppa004909mg [Prunus persica]
 gb|EMJ23626.1| hypothetical protein PRUPE_ppa004909mg [Prunus persica]
Length=486

 Score =   145 bits (366),  Expect = 8e-38, Method: Compositional matrix adjust.
 Identities = 82/152 (54%), Positives = 107/152 (70%), Gaps = 2/152 (1%)
 Frame = +2

Query  53   VQRPHAVCIPYPAQGHICAMLKLAKLLHHRGFHITYVLTQLNYTHIMKARNFLPLTQSPT  232
             ++PHAVCIPYPAQGHI  MLKLAKLLH++GFHIT+V T+ N+  ++K+R    L   P+
Sbjct  7    TKKPHAVCIPYPAQGHITPMLKLAKLLHYKGFHITFVNTEFNHKRLLKSRGPNSLDGLPS  66

Query  233  FRFETIPDGLPSRENPDTALDVADLCFSTGKNCYAPFMELIQRLNSTAsdvppvscvvsd  412
            F+FETIPDGLP  ++  T  D+  LC ST KNC APF +L+ +LNS     PPV+C+VSD
Sbjct  67   FQFETIPDGLPPSDDNATQ-DIPSLCLSTSKNCLAPFRDLLSKLNSLP-HSPPVTCLVSD  124

Query  413  tvMPFAVGATQELGVPVVLFWPLSAVASLMHI  508
              M F++ A QE G+P VLF   SA  SL ++
Sbjct  125  GGMTFSLDAAQEFGIPCVLFETTSACGSLGYL  156



>emb|CDO97426.1| unnamed protein product [Coffea canephora]
Length=487

 Score =   145 bits (366),  Expect = 9e-38, Method: Compositional matrix adjust.
 Identities = 83/147 (56%), Positives = 101/147 (69%), Gaps = 1/147 (1%)
 Frame = +2

Query  59   RPHAVCIPYPAQGHICAMLKLAKLLHHRGFHITYVLTQLNYTHIMKARNFLPLTQSPTFR  238
            +PHAVC+PYPAQGHI  MLKLAKLLHH+GFHIT+V T+ N+  ++K+R    L   P FR
Sbjct  10   KPHAVCVPYPAQGHINPMLKLAKLLHHKGFHITFVNTEYNHNRLLKSRGPNSLDGLPDFR  69

Query  239  FETIPDGLPSRENPDTALDVADLCFSTGKNCYAPFMELIQRLNSTAsdvppvscvvsdtv  418
            FETIPDGLP  +  D+  D+  LC ST K C APF  L+ RLN+ A DVPPV+C+VSD  
Sbjct  70   FETIPDGLPPND-ADSTQDIPSLCDSTSKTCLAPFSSLLSRLNNAAPDVPPVTCIVSDGC  128

Query  419  MPFAVGATQELGVPVVLFWPLSAVASL  499
            M F V A  + G+P  LFW  SA   L
Sbjct  129  MSFTVEAAHQFGLPEALFWTPSACGLL  155



>dbj|BAO51839.1| UDP-glycosyltransferase 85A34 [Humulus lupulus]
Length=487

 Score =   145 bits (365),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 86/152 (57%), Positives = 102/152 (67%), Gaps = 5/152 (3%)
 Frame = +2

Query  59   RPHAVCIPYPAQGHICAMLKLAKLLHHRGFHITYVLTQLNYTHIMKARNFLPLTQSPTFR  238
            +PHAVCIPYPAQGHI  MLKLAKLLH RGFHIT+V T  N+  ++K+R    L   P FR
Sbjct  6    KPHAVCIPYPAQGHINPMLKLAKLLHQRGFHITFVNTHFNHNRLLKSRGPNSLDGLPDFR  65

Query  239  FETIPDGLPSRENP-DTALDVADLCFSTGKNCYAPFMELIQRLN----STAsdvppvscv  403
            FE+IPDGLP  EN  D   D+  LC ST K C  PF +L+ +LN    S+   VPPVSCV
Sbjct  66   FESIPDGLPPTENKADATQDIPSLCESTEKTCLDPFRKLLFQLNDASSSSGGAVPPVSCV  125

Query  404  vsdtvMPFAVGATQELGVPVVLFWPLSAVASL  499
            VSD  MPF + A +E G+PV LFW +SA   L
Sbjct  126  VSDPAMPFTLTAGEEFGIPVALFWTISACGLL  157



>ref|XP_007018744.1| UDP-glucosyl transferase 85A2 [Theobroma cacao]
 gb|EOY15969.1| UDP-glucosyl transferase 85A2 [Theobroma cacao]
Length=487

 Score =   145 bits (365),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 86/152 (57%), Positives = 108/152 (71%), Gaps = 2/152 (1%)
 Frame = +2

Query  56   QRPHAVCIPYPAQGHICAMLKLAKLLHHRGFHITYVLTQLNYTHIMKARNFLPLTQSPTF  235
             +PHAVCIPYPAQGHI  MLKLAK+LHHRGFHIT+V T+ N+  ++KAR    L   P+F
Sbjct  8    DKPHAVCIPYPAQGHINPMLKLAKILHHRGFHITFVNTEFNHKRLLKARGPDALNGLPSF  67

Query  236  RFETIPDGLPSRENPDTALDVADLCFSTGKNCYAPFMELIQRLN-STAsdvppvscvvsd  412
            RFETIPDGLP  +  D   D+  LC ST K C   F +L+ +LN S++++VPPVSC+VSD
Sbjct  68   RFETIPDGLPPTD-VDATQDIPSLCESTRKTCLPHFKQLLHKLNDSSSANVPPVSCIVSD  126

Query  413  tvMPFAVGATQELGVPVVLFWPLSAVASLMHI  508
             VM F + A +ELGVP VLFW  SA   L ++
Sbjct  127  GVMSFTLDAAEELGVPEVLFWTTSACGFLGYV  158



>gb|ADG65641.1| glycosyltransferase [Withania somnifera]
Length=485

 Score =   144 bits (364),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 83/154 (54%), Positives = 105/154 (68%), Gaps = 2/154 (1%)
 Frame = +2

Query  50   EVQRPHAVCIPYPAQGHICAMLKLAKLLHHRGFHITYVLTQLNYTHIMKARNFLPLTQSP  229
            E Q+PHAVCIPYPAQGHI  ML+LAK+LH +GFHIT+V T+ N+  ++K+R    L    
Sbjct  7    ESQKPHAVCIPYPAQGHINPMLELAKILHQKGFHITFVNTEFNHRRLLKSRGPHALDGLS  66

Query  230  TFRFETIPDGLPSRENPDTALDVADLCFSTGKNCYAPFMELIQRLNSTAsdvp-pvscvv  406
            +FRFETIPDGLP  +  D   D+  LC ST K C  PF +L+ +LN+T +    PVSC+V
Sbjct  67   SFRFETIPDGLPPSD-ADATQDIPSLCESTTKTCLGPFRDLLAKLNNTYTSNVPPVSCIV  125

Query  407  sdtvMPFAVGATQELGVPVVLFWPLSAVASLMHI  508
            SD VM F + A QELGVP VLFW  SA   L ++
Sbjct  126  SDGVMTFTLAAAQELGVPEVLFWTTSACGFLGYM  159



>ref|XP_009791953.1| PREDICTED: 7-deoxyloganetin glucosyltransferase-like [Nicotiana 
sylvestris]
Length=484

 Score =   144 bits (364),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 81/152 (53%), Positives = 103/152 (68%), Gaps = 2/152 (1%)
 Frame = +2

Query  56   QRPHAVCIPYPAQGHICAMLKLAKLLHHRGFHITYVLTQLNYTHIMKARNFLPLTQSPTF  235
             +PHAVCIPYP QGHI  MLKLAK+LHH+GFHIT+V T+ N+  ++K+R    L   P+F
Sbjct  10   DKPHAVCIPYPCQGHINPMLKLAKILHHKGFHITFVNTEYNHRRLLKSRGPDSLNGFPSF  69

Query  236  RFETIPDGLPSRENPDTALDVADLCFSTGKNCYAPFMELIQRLNSTAsdvp-pvscvvsd  412
            RFETIPDGLP   + D   D+  LC ST   C  PF EL+ +LN+T+S     VSC+VSD
Sbjct  70   RFETIPDGLPPC-DADATQDIPSLCESTTTTCLGPFKELLAKLNTTSSSNVPRVSCIVSD  128

Query  413  tvMPFAVGATQELGVPVVLFWPLSAVASLMHI  508
              M F + A Q+LG+P VLFW  SA  SL ++
Sbjct  129  GCMSFTLDAAQDLGIPEVLFWTPSACGSLGYM  160



>ref|XP_010060023.1| PREDICTED: 7-deoxyloganetin glucosyltransferase-like [Eucalyptus 
grandis]
 gb|KCW66547.1| hypothetical protein EUGRSUZ_F00343 [Eucalyptus grandis]
Length=486

 Score =   144 bits (363),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 82/155 (53%), Positives = 106/155 (68%), Gaps = 2/155 (1%)
 Frame = +2

Query  50   EVQRPHAVCIPYPAQGHICAMLKLAKLLHHRGFHITYVLTQLNYTHIMKARNFLPLTQSP  229
            ++Q+PHAVCIPYPAQGHI  ML LAKLLHHRGFH+T+V T+ N++ ++++R    L   P
Sbjct  6    KIQKPHAVCIPYPAQGHINPMLNLAKLLHHRGFHVTFVNTEYNHSRLLRSRGPSSLDGLP  65

Query  230  TFRFETIPDGLPSRENPDTALDVADLCFSTGKNCYAPFMELIQRLN--STAsdvppvscv  403
            +FRF TIPDGLP  +  D   D+  LC ST K C   F +L++RLN  ST    PPVSCV
Sbjct  66   SFRFRTIPDGLPPSDVADATQDIPALCQSTSKFCLPYFRDLLERLNEESTTLGSPPVSCV  125

Query  404  vsdtvMPFAVGATQELGVPVVLFWPLSAVASLMHI  508
            VSD VM F + A + +GVP VLFW  SA   + ++
Sbjct  126  VSDGVMSFTLDAAEAIGVPEVLFWTTSACGFMGYV  160



>ref|XP_010060020.1| PREDICTED: 7-deoxyloganetin glucosyltransferase-like [Eucalyptus 
grandis]
Length=486

 Score =   144 bits (363),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 82/154 (53%), Positives = 105/154 (68%), Gaps = 2/154 (1%)
 Frame = +2

Query  53   VQRPHAVCIPYPAQGHICAMLKLAKLLHHRGFHITYVLTQLNYTHIMKARNFLPLTQSPT  232
            +Q+PHAVCIPYPAQGHI  ML LAKLLHHRGFH+T+V T+ N++ ++++R    L   P+
Sbjct  7    IQKPHAVCIPYPAQGHINPMLNLAKLLHHRGFHVTFVNTEYNHSRLLRSRGPSSLDGLPS  66

Query  233  FRFETIPDGLPSRENPDTALDVADLCFSTGKNCYAPFMELIQRLN--STAsdvppvscvv  406
            FRF TIPDGLP  +  D   D+  LC ST K C   F +L++RLN  ST S  PPVSCVV
Sbjct  67   FRFRTIPDGLPPSDVADATQDIPALCQSTSKFCLPYFRDLLERLNEESTTSGSPPVSCVV  126

Query  407  sdtvMPFAVGATQELGVPVVLFWPLSAVASLMHI  508
            SD  M F + A + +GVP VLFW  SA   + ++
Sbjct  127  SDGAMSFTLDAAEAIGVPEVLFWTTSACGFMGYV  160



>dbj|BAO51844.1| UDP-glycosyltransferase 85A28 [Vitis vinifera]
Length=473

 Score =   144 bits (362),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 82/152 (54%), Positives = 103/152 (68%), Gaps = 4/152 (3%)
 Frame = +2

Query  53   VQRPHAVCIPYPAQGHICAMLKLAKLLHHRGFHITYVLTQLNYTHIMKARNFLPLTQSPT  232
            +++PHAVCIPYPAQGHI  MLKLAKLLH RGF IT+V T+ N+T ++KA+    L   PT
Sbjct  4    MEKPHAVCIPYPAQGHINPMLKLAKLLHFRGFRITFVNTEFNHTRLLKAQGPNSLNGLPT  63

Query  233  FRFETIPDGLPSRENPDTALDVADLCFSTGKNCYAPFMELIQRLNSTAsdvppvscvvsd  412
            F+FETIPDGLP   N D   D+  LC ST KNC APF  L+ +LN      PPV+C+ SD
Sbjct  64   FQFETIPDGLPP-SNVDATQDIPSLCASTKKNCLAPFRRLLAKLNDRG---PPVTCIFSD  119

Query  413  tvMPFAVGATQELGVPVVLFWPLSAVASLMHI  508
             VM F + A QELG+P +L W  SA   + ++
Sbjct  120  AVMSFTLDAAQELGIPDLLLWTASACGFMAYV  151



>ref|XP_009775754.1| PREDICTED: 7-deoxyloganetin glucosyltransferase-like [Nicotiana 
sylvestris]
Length=485

 Score =   144 bits (362),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 82/154 (53%), Positives = 104/154 (68%), Gaps = 2/154 (1%)
 Frame = +2

Query  50   EVQRPHAVCIPYPAQGHICAMLKLAKLLHHRGFHITYVLTQLNYTHIMKARNFLPLTQSP  229
            E  +PHAVCIPYPAQGHI  MLKLAK+LHH+GFHIT+V T+ N+  ++K+R    L    
Sbjct  7    EFSKPHAVCIPYPAQGHINPMLKLAKILHHKGFHITFVNTEFNHRRLLKSRGPDSLKGLS  66

Query  230  TFRFETIPDGLPSRENPDTALDVADLCFSTGKNCYAPFMELIQRLNSTAsdvp-pvscvv  406
            +FRFETIPDGLP   + D   D+  LC ST   C  PF +L+ +LN+T +    PVSC+V
Sbjct  67   SFRFETIPDGLPPC-DADATQDIPSLCESTTNTCLGPFRDLLAKLNNTNTSNVPPVSCIV  125

Query  407  sdtvMPFAVGATQELGVPVVLFWPLSAVASLMHI  508
            SD VM F + A QELGVP +LFW  SA   L ++
Sbjct  126  SDGVMSFTLAAAQELGVPEILFWTTSACGFLGYM  159



>gb|KDP41399.1| hypothetical protein JCGZ_15806 [Jatropha curcas]
Length=487

 Score =   143 bits (361),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 81/153 (53%), Positives = 106/153 (69%), Gaps = 2/153 (1%)
 Frame = +2

Query  53   VQRPHAVCIPYPAQGHICAMLKLAKLLHHRGFHITYVLTQLNYTHIMKARNFLPLTQSPT  232
            +++PHAVCIPYPAQGHI  MLKLAKLLHH+GFHIT+V T+ N+  ++++R    +   P+
Sbjct  7    LEKPHAVCIPYPAQGHINPMLKLAKLLHHKGFHITFVHTEYNHKRLLRSRGSDSVIGLPS  66

Query  233  FRFETIPDGLPSRENPDTALDVADLCFSTGKNCYAPFMELIQRLNSTAsdvp-pvscvvs  409
            F+F TIPDGLP  ++ D   D+  LC ST K C APF  L+  LN T+S    PVSC+VS
Sbjct  67   FQFRTIPDGLPPTDS-DVTQDIPSLCQSTSKYCLAPFKNLLSELNDTSSSNVPPVSCIVS  125

Query  410  dtvMPFAVGATQELGVPVVLFWPLSAVASLMHI  508
            D VM F V A QEL +P+VLFW  SA   + ++
Sbjct  126  DGVMSFTVDAAQELCIPLVLFWTTSACGFMGYV  158



>dbj|BAD93690.1| glycosyltransferase [Nicotiana tabacum]
Length=485

 Score =   143 bits (361),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 82/154 (53%), Positives = 103/154 (67%), Gaps = 2/154 (1%)
 Frame = +2

Query  50   EVQRPHAVCIPYPAQGHICAMLKLAKLLHHRGFHITYVLTQLNYTHIMKARNFLPLTQSP  229
            E  +PHAVCIPYPAQGHI  MLKLAK+LHH+GFHIT+V T+ N+  ++K+R    L    
Sbjct  7    EFTKPHAVCIPYPAQGHINPMLKLAKILHHKGFHITFVNTEFNHRRLLKSRGPDSLKGLS  66

Query  230  TFRFETIPDGLPSRENPDTALDVADLCFSTGKNCYAPFMELIQRLNSTAsdvp-pvscvv  406
            +FRFETIPDGLP   + D   D+  LC ST   C  PF +L+ +LN T +    PVSC++
Sbjct  67   SFRFETIPDGLPPC-DADATQDIPSLCESTTNTCLGPFRDLLAKLNDTNTSNVPPVSCII  125

Query  407  sdtvMPFAVGATQELGVPVVLFWPLSAVASLMHI  508
            SD VM F + A QELGVP VLFW  SA   L ++
Sbjct  126  SDGVMSFTLAAAQELGVPEVLFWTTSACGFLGYM  159



>ref|XP_009590778.1| PREDICTED: 7-deoxyloganetin glucosyltransferase-like [Nicotiana 
tomentosiformis]
Length=485

 Score =   143 bits (361),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 82/154 (53%), Positives = 103/154 (67%), Gaps = 2/154 (1%)
 Frame = +2

Query  50   EVQRPHAVCIPYPAQGHICAMLKLAKLLHHRGFHITYVLTQLNYTHIMKARNFLPLTQSP  229
            E  +PHAVCIPYPAQGHI  MLKLAK+LHH+GFHIT+V T+ N+  ++K+R    L    
Sbjct  7    EFTKPHAVCIPYPAQGHINPMLKLAKILHHKGFHITFVNTEFNHRRLLKSRGPDSLKGLS  66

Query  230  TFRFETIPDGLPSRENPDTALDVADLCFSTGKNCYAPFMELIQRLNSTAsdvp-pvscvv  406
            +FRFETIPDGLP   + D   D+  LC ST   C  PF +L+ +LN T +    PVSC++
Sbjct  67   SFRFETIPDGLPPC-DADATQDIPSLCESTTNTCLGPFRDLLAKLNDTNTSNVPPVSCII  125

Query  407  sdtvMPFAVGATQELGVPVVLFWPLSAVASLMHI  508
            SD VM F + A QELGVP VLFW  SA   L ++
Sbjct  126  SDGVMSFTLAAAQELGVPEVLFWTTSACGFLGYM  159



>ref|XP_008219314.1| PREDICTED: UDP-glycosyltransferase 85A5-like [Prunus mume]
Length=189

 Score =   137 bits (345),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 81/152 (53%), Positives = 105/152 (69%), Gaps = 2/152 (1%)
 Frame = +2

Query  53   VQRPHAVCIPYPAQGHICAMLKLAKLLHHRGFHITYVLTQLNYTHIMKARNFLPLTQSPT  232
             ++PHAVCIPYPAQGHI  ML+L KLLH++GFHIT+V T+ N+  ++K+R    L   P+
Sbjct  7    TEKPHAVCIPYPAQGHITPMLQLTKLLHYKGFHITFVNTEFNHRRLLKSRGPNSLDGLPS  66

Query  233  FRFETIPDGLPSRENPDTALDVADLCFSTGKNCYAPFMELIQRLNSTAsdvppvscvvsd  412
            FRFETIPDGLP  +   T  DV  LC ST KNC APF +L+ +LNS   D PPV+C+VSD
Sbjct  67   FRFETIPDGLPPTDTNATQ-DVTALCVSTRKNCLAPFRDLLSKLNSLP-DSPPVTCIVSD  124

Query  413  tvMPFAVGATQELGVPVVLFWPLSAVASLMHI  508
              M F + A QELG+P V+F   SA   + ++
Sbjct  125  GGMIFTLDAAQELGIPEVIFQTPSACGLMCYL  156



>ref|XP_010676160.1| PREDICTED: 7-deoxyloganetin glucosyltransferase-like [Beta vulgaris 
subsp. vulgaris]
Length=483

 Score =   143 bits (361),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 81/148 (55%), Positives = 103/148 (70%), Gaps = 1/148 (1%)
 Frame = +2

Query  56   QRPHAVCIPYPAQGHICAMLKLAKLLHHRGFHITYVLTQLNYTHIMKARNFLPLTQSPTF  235
            Q+PHAVC+PYPAQGHI  ML+LAKLLH +GFHIT+V T+ N+  ++++R    +   P+F
Sbjct  8    QKPHAVCVPYPAQGHINPMLQLAKLLHSKGFHITFVNTEYNHNRLVRSRGPGAVANRPSF  67

Query  236  RFETIPDGLPSRENPDTALDVADLCFSTGKNCYAPFMELIQRLNSTAsdvppvscvvsdt  415
            RFETI DG+P  ++ D+  D+  LC ST K+C  PF  L+ RLN  A DVPPVSCVVSD 
Sbjct  68   RFETITDGMPPSDDVDSTQDIPSLCISTEKHCLGPFKRLLARLNE-AGDVPPVSCVVSDG  126

Query  416  vMPFAVGATQELGVPVVLFWPLSAVASL  499
             M F + A QELG+P VL W  SA   L
Sbjct  127  AMFFTIDAAQELGIPEVLLWTASACGFL  154



>ref|XP_007047909.1| UDP-glucosyl transferase 85A2 [Theobroma cacao]
 gb|EOX92066.1| UDP-glucosyl transferase 85A2 [Theobroma cacao]
Length=478

 Score =   143 bits (360),  Expect = 6e-37, Method: Compositional matrix adjust.
 Identities = 79/154 (51%), Positives = 111/154 (72%), Gaps = 2/154 (1%)
 Frame = +2

Query  47   MEVQRPHAVCIPYPAQGHICAMLKLAKLLHHRGFHITYVLTQLNYTHIMKARNFLPLTQS  226
            +E ++PHAVCIPYP+QGH+  M++LAKLLH RGFHIT+V T+ N+  +++++    +   
Sbjct  4    VETRKPHAVCIPYPSQGHVTPMMQLAKLLHSRGFHITFVNTEFNHRRLIRSKGPDSVKGL  63

Query  227  PTFRFETIPDGLPSRENPDTALDVADLCFSTGKNCYAPFMELIQRLNSTAsdvppvscvv  406
            P FRFETIP+GLP  +  D   DV  LC ST KNC APF+EL+ +LNS+A  VPPV+C++
Sbjct  64   PDFRFETIPEGLPPSDR-DATQDVPALCDSTRKNCLAPFLELLSKLNSSA-QVPPVTCII  121

Query  407  sdtvMPFAVGATQELGVPVVLFWPLSAVASLMHI  508
            SD VM FA+ A + LG+P V FW  SA + + ++
Sbjct  122  SDGVMSFAIKAAEVLGIPEVQFWTASACSFMGYL  155



>ref|XP_002285770.1| PREDICTED: 7-deoxyloganetin glucosyltransferase [Vitis vinifera]
Length=473

 Score =   142 bits (359),  Expect = 7e-37, Method: Compositional matrix adjust.
 Identities = 81/152 (53%), Positives = 103/152 (68%), Gaps = 4/152 (3%)
 Frame = +2

Query  53   VQRPHAVCIPYPAQGHICAMLKLAKLLHHRGFHITYVLTQLNYTHIMKARNFLPLTQSPT  232
            +++PHAVCIPYPAQGHI  MLK+AKLLH RGF IT+V T+ N+T ++KA+    L   PT
Sbjct  4    MEKPHAVCIPYPAQGHINPMLKVAKLLHFRGFRITFVNTEFNHTRLLKAQGPNSLNGLPT  63

Query  233  FRFETIPDGLPSRENPDTALDVADLCFSTGKNCYAPFMELIQRLNSTAsdvppvscvvsd  412
            F+FETIPDGLP   N D   D+  LC ST KNC APF  L+ +LN      PPV+C+ SD
Sbjct  64   FQFETIPDGLPP-SNVDATQDIPSLCASTKKNCLAPFRRLLAKLNDRG---PPVTCIFSD  119

Query  413  tvMPFAVGATQELGVPVVLFWPLSAVASLMHI  508
             VM F + A QELG+P +L W  SA   + ++
Sbjct  120  AVMSFTLDAAQELGIPDLLLWTASACGFMAYV  151



>ref|XP_007222664.1| hypothetical protein PRUPE_ppa004979mg [Prunus persica]
 gb|EMJ23863.1| hypothetical protein PRUPE_ppa004979mg [Prunus persica]
Length=483

 Score =   142 bits (359),  Expect = 8e-37, Method: Compositional matrix adjust.
 Identities = 80/152 (53%), Positives = 108/152 (71%), Gaps = 2/152 (1%)
 Frame = +2

Query  53   VQRPHAVCIPYPAQGHICAMLKLAKLLHHRGFHITYVLTQLNYTHIMKARNFLPLTQSPT  232
             ++PHAVCIPYPAQGHI  ML+LAKLLH++GFHIT+V T+ N+  ++K+R    L   P+
Sbjct  7    TEKPHAVCIPYPAQGHITPMLQLAKLLHYKGFHITFVHTEFNHRRLLKSRGPNSLDGLPS  66

Query  233  FRFETIPDGLPSRENPDTALDVADLCFSTGKNCYAPFMELIQRLNSTAsdvppvscvvsd  412
            F+FETIPDGLP   +P+   D+  LC ST KNC APF +L+ ++NS   D PPV+C+VSD
Sbjct  67   FQFETIPDGLPPT-DPNATQDITALCLSTSKNCLAPFRDLLSKVNSVP-DSPPVTCIVSD  124

Query  413  tvMPFAVGATQELGVPVVLFWPLSAVASLMHI  508
              M F + A QELG+P V+F  LSA   + ++
Sbjct  125  GGMTFTLDAAQELGIPEVIFETLSACGLMCYL  156



>ref|XP_010040274.1| PREDICTED: 7-deoxyloganetin glucosyltransferase-like [Eucalyptus 
grandis]
Length=486

 Score =   142 bits (359),  Expect = 8e-37, Method: Compositional matrix adjust.
 Identities = 82/154 (53%), Positives = 106/154 (69%), Gaps = 2/154 (1%)
 Frame = +2

Query  53   VQRPHAVCIPYPAQGHICAMLKLAKLLHHRGFHITYVLTQLNYTHIMKARNFLPLTQSPT  232
            +Q+PHA+CIPYPAQGHI  ML LAKLLHHRGFH+T+V T+ N++ ++++R    L   P+
Sbjct  7    IQKPHALCIPYPAQGHINPMLNLAKLLHHRGFHVTFVNTEYNHSRLLRSRGPSSLDGLPS  66

Query  233  FRFETIPDGLPSRENPDTALDVADLCFSTGKNCYAPFMELIQRLN--STAsdvppvscvv  406
            FRF TIPDGLP  +  D   D+  LC ST K C   F +L++RLN  ST S  PPVSCVV
Sbjct  67   FRFRTIPDGLPPSDVADATQDIPALCQSTSKFCLPYFRDLLERLNEESTTSGSPPVSCVV  126

Query  407  sdtvMPFAVGATQELGVPVVLFWPLSAVASLMHI  508
            SD VM F + A + +GVP VLFW  SA   + ++
Sbjct  127  SDGVMSFTLDAAEAIGVPEVLFWTTSACGFMGYV  160



>ref|XP_002301060.1| hypothetical protein POPTR_0002s09850g [Populus trichocarpa]
 gb|EEE80333.1| hypothetical protein POPTR_0002s09850g [Populus trichocarpa]
Length=505

 Score =   142 bits (359),  Expect = 9e-37, Method: Compositional matrix adjust.
 Identities = 80/150 (53%), Positives = 104/150 (69%), Gaps = 2/150 (1%)
 Frame = +2

Query  62   PHAVCIPYPAQGHICAMLKLAKLLHHRGFHITYVLTQLNYTHIMKARNFLPLTQSPTFRF  241
            PHAVC+P+PAQGHI  MLKLAK+LH + FHIT+V T+ N+  ++K+R    L   PTFRF
Sbjct  11   PHAVCLPFPAQGHINPMLKLAKILHRKDFHITFVNTEFNHRRLLKSRGLGSLDGLPTFRF  70

Query  242  ETIPDGLPSRENPDTALDVADLCFSTGKNCYAPFMELIQRLNSTAsdvp-pvscvvsdtv  418
            ETIPDGLP  +  D+   V  LC ST KNC APF +L+ RLN+T+S    PV+C+VSD +
Sbjct  71   ETIPDGLPPSD-ADSTQHVPSLCDSTKKNCLAPFRDLLSRLNNTSSSKVPPVTCIVSDCI  129

Query  419  MPFAVGATQELGVPVVLFWPLSAVASLMHI  508
            M F + A QELG+P VLFW  S    + ++
Sbjct  130  MSFTLKAAQELGIPNVLFWTASVCGFMSYL  159



>ref|XP_010248035.1| PREDICTED: 7-deoxyloganetin glucosyltransferase-like [Nelumbo 
nucifera]
Length=488

 Score =   142 bits (358),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 82/155 (53%), Positives = 105/155 (68%), Gaps = 5/155 (3%)
 Frame = +2

Query  53   VQRPHAVCIPYPAQGHICAMLKLAKLLHHRGFHITYVLTQLNYTHIMKARNFLPLTQSPT  232
            V++PHAVCIPYPAQGHI  MLKLAKLLH++GFH+T+V T+ N   ++K+R    +   P 
Sbjct  7    VEKPHAVCIPYPAQGHINPMLKLAKLLHYKGFHVTFVHTEYNLRRMVKSRGPDSIKGLPG  66

Query  233  FRFETIPDGLPSRENPDTALDVADLCFSTGKNCYAPFMELIQRLN--STAsdvppvscvv  406
            FRFETIPDGLP   + D   D+  LC ST   C  PF  L+ RLN  S + ++P V+C+V
Sbjct  67   FRFETIPDGLPP-SDVDATQDIPSLCDSTRNTCLVPFXSLLSRLNDSSNSDNIPLVTCIV  125

Query  407  sdtvMPFAVGATQELGVPVVLFWPLSAVA--SLMH  505
            SD VM F + A QELG+P VL WP SA +  S +H
Sbjct  126  SDGVMSFTLDAAQELGIPEVLLWPTSACSFMSFLH  160



>ref|XP_007042920.1| UDP-glucosyl transferase 85A2 [Theobroma cacao]
 gb|EOX98751.1| UDP-glucosyl transferase 85A2 [Theobroma cacao]
Length=519

 Score =   142 bits (358),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 82/151 (54%), Positives = 106/151 (70%), Gaps = 3/151 (2%)
 Frame = +2

Query  56   QRPHAVCIPYPAQGHICAMLKLAKLLHHRGFHITYVLTQLNYTHIMKARNFLPLTQSPTF  235
             +PHAVC+PYPAQGH+  MLK+AKLLH +GFHIT+V T+ N+  ++K+R    L   P F
Sbjct  8    NKPHAVCLPYPAQGHVNPMLKVAKLLHFKGFHITFVNTEYNHKRLLKSRGPNALDGVPDF  67

Query  236  RFETIPDGLPSRENPDTALDVADLCFSTGKNCYAPFMELIQRLNSTAsdvppvscvvsdt  415
            RFETIPDGLP   + D   D+  LC ST KNC APF +L+ +LNS+   VPPV+C+VSD 
Sbjct  68   RFETIPDGLPP-PDIDATQDIPALCDSTSKNCLAPFRQLLAKLNSSG--VPPVTCIVSDG  124

Query  416  vMPFAVGATQELGVPVVLFWPLSAVASLMHI  508
            VM F + A +ELG+P VLFW  SA   L ++
Sbjct  125  VMSFTLKAAEELGIPEVLFWTTSACGFLGYM  155



>ref|XP_010060017.1| PREDICTED: 7-deoxyloganetin glucosyltransferase-like [Eucalyptus 
grandis]
Length=486

 Score =   142 bits (357),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 82/154 (53%), Positives = 105/154 (68%), Gaps = 2/154 (1%)
 Frame = +2

Query  53   VQRPHAVCIPYPAQGHICAMLKLAKLLHHRGFHITYVLTQLNYTHIMKARNFLPLTQSPT  232
            +Q+PHAVCIP PAQGHI  ML LAKLLHHRGFH+T+V T+ N++ ++++R    L   P+
Sbjct  7    IQKPHAVCIPAPAQGHINPMLNLAKLLHHRGFHVTFVNTEYNHSRLLRSRGPSSLDGLPS  66

Query  233  FRFETIPDGLPSRENPDTALDVADLCFSTGKNCYAPFMELIQRLN--STAsdvppvscvv  406
            FRF TIPDGLP  +  D   D+  LC ST K C   F +L+QRLN  S AS  PPVSCVV
Sbjct  67   FRFRTIPDGLPPSDAADVTQDIPALCQSTSKLCLPYFRDLLQRLNEESAASGSPPVSCVV  126

Query  407  sdtvMPFAVGATQELGVPVVLFWPLSAVASLMHI  508
            SD +M F + A + +GVP VLFW  SA   + ++
Sbjct  127  SDGMMTFTLDAAEAIGVPEVLFWTASACGFMGYV  160



>ref|XP_004237929.1| PREDICTED: 7-deoxyloganetin glucosyltransferase-like [Solanum 
lycopersicum]
Length=482

 Score =   142 bits (357),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 81/152 (53%), Positives = 106/152 (70%), Gaps = 2/152 (1%)
 Frame = +2

Query  56   QRPHAVCIPYPAQGHICAMLKLAKLLHHRGFHITYVLTQLNYTHIMKARNFLPLTQSPTF  235
             +PHAVCIPYPAQGHI  MLKLAK+L+++GFHIT+V  + N+  ++K+R    L   P+F
Sbjct  8    DKPHAVCIPYPAQGHINPMLKLAKILNYKGFHITFVNNEYNHRRLLKSRGPDSLKGLPSF  67

Query  236  RFETIPDGLPSRENPDTALDVADLCFSTGKNCYAPFMELIQRLNST-Asdvppvscvvsd  412
            RFETIPDGLP  +  D+  D+  LC ST K C  PF EL+ +LN T +S+VP VSC++SD
Sbjct  68   RFETIPDGLPPCD-ADSTQDIPALCESTTKTCLGPFKELLAKLNDTCSSNVPTVSCIISD  126

Query  413  tvMPFAVGATQELGVPVVLFWPLSAVASLMHI  508
              M F + A QELG+P V FW  SA  SL ++
Sbjct  127  GCMSFTLAAAQELGIPEVFFWTPSACGSLGYL  158



>gb|KCW66541.1| hypothetical protein EUGRSUZ_F00338, partial [Eucalyptus grandis]
Length=478

 Score =   142 bits (357),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 82/154 (53%), Positives = 105/154 (68%), Gaps = 2/154 (1%)
 Frame = +2

Query  53   VQRPHAVCIPYPAQGHICAMLKLAKLLHHRGFHITYVLTQLNYTHIMKARNFLPLTQSPT  232
            +Q+PHAVCIP PAQGHI  ML LAKLLHHRGFH+T+V T+ N++ ++++R    L   P+
Sbjct  7    IQKPHAVCIPAPAQGHINPMLNLAKLLHHRGFHVTFVNTEYNHSRLLRSRGPSSLDGLPS  66

Query  233  FRFETIPDGLPSRENPDTALDVADLCFSTGKNCYAPFMELIQRLN--STAsdvppvscvv  406
            FRF TIPDGLP  +  D   D+  LC ST K C   F +L+QRLN  S AS  PPVSCVV
Sbjct  67   FRFRTIPDGLPPSDAADVTQDIPALCQSTSKLCLPYFRDLLQRLNEESAASGSPPVSCVV  126

Query  407  sdtvMPFAVGATQELGVPVVLFWPLSAVASLMHI  508
            SD +M F + A + +GVP VLFW  SA   + ++
Sbjct  127  SDGMMTFTLDAAEAIGVPEVLFWTASACGFMGYV  160



>ref|XP_010477499.1| PREDICTED: LOW QUALITY PROTEIN: UDP-glycosyltransferase 85A1 
[Camelina sativa]
Length=488

 Score =   142 bits (357),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 80/154 (52%), Positives = 105/154 (68%), Gaps = 2/154 (1%)
 Frame = +2

Query  47   MEVQRPHAVCIPYPAQGHICAMLKLAKLLHHRGFHITYVLTQLNYTHIMKARNFLPLTQS  226
            +  Q+PH VC+PYPAQGHI  M+K+AKLLH RGFH+T+V T  N+   +++   + L   
Sbjct  7    LNAQKPHVVCVPYPAQGHINPMMKVAKLLHARGFHVTFVNTVYNHNRFLRSHGSIALDGL  66

Query  227  PTFRFETIPDGLPSRENPDTALDVADLCFSTGKNCYAPFMELIQRLNSTAsdvppvscvv  406
             +FRFE+IPDGLP   + DT  D+  LC ST KNC  PF EL+QR+N+   D PPVSC++
Sbjct  67   HSFRFESIPDGLPET-DMDTTQDITALCESTMKNCLVPFQELLQRINA-GDDAPPVSCIL  124

Query  407  sdtvMPFAVGATQELGVPVVLFWPLSAVASLMHI  508
            SD VM F + A +ELGVP VLFW  S  A L ++
Sbjct  125  SDGVMSFTLDAAEELGVPEVLFWTTSGCAFLSYL  158



>dbj|BAG80547.1| glycosyltransferase [Lycium barbarum]
Length=490

 Score =   142 bits (357),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 81/155 (52%), Positives = 105/155 (68%), Gaps = 4/155 (3%)
 Frame = +2

Query  50   EVQRPHAVCIPYPAQGHICAMLKLAKLLHHRGFHITYVLTQLNYTHIMKARNFLPLTQSP  229
            ++ +PHAVCIPYPAQGHI  MLKLAK+LHH GFHIT+V T+ N+  ++K+R    +   P
Sbjct  8    DLDKPHAVCIPYPAQGHISPMLKLAKILHHNGFHITFVNTEHNHKRLLKSRGPDSVKGLP  67

Query  230  TFRFETIPDGLPSRENPDTALDVADLCFSTGKNCYAPFMELIQRLNSTAsdvp-pvscvv  406
            +F+FETIPDGLP  + PDT  D+  L  ST  +C  PF EL+ +LN+T+     PVSC+V
Sbjct  68   SFQFETIPDGLPPCD-PDTTQDIFSLSESTTNSCSGPFKELLTKLNNTSLSNVPPVSCIV  126

Query  407  sdtvMPFAVGATQELGVPVVLFWPLSAVA--SLMH  505
            SD  M F + A Q+LG+P V FW  SA    S MH
Sbjct  127  SDGAMSFTLAAAQDLGIPQVFFWTPSACGLLSYMH  161



>ref|XP_007042919.1| UDP-glycosyltransferase 85A1 [Theobroma cacao]
 gb|EOX98750.1| UDP-glycosyltransferase 85A1 [Theobroma cacao]
Length=488

 Score =   142 bits (357),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 75/153 (49%), Positives = 95/153 (62%), Gaps = 4/153 (3%)
 Frame = +2

Query  59   RPHAVCIPYPAQGHICAMLKLAKLLHHRGFHITYVLTQLNYTHIMKARNFLPLTQSPTFR  238
            +PHAVCIPYPAQGHI  MLKLAK LHH+GFHIT+V T+ NY  ++++R    +   P FR
Sbjct  9    KPHAVCIPYPAQGHINPMLKLAKFLHHKGFHITFVHTEYNYKRLLRSRGPNSVDGLPDFR  68

Query  239  FETIPDGLPSRENPDTALDVADLCFSTGKNCYAPFMELIQRLNSTAsdvppvscvvsdtv  418
            FE I DGLP   + D   D+  LC ST KNC APF +L+ +LN  A+    +  V S   
Sbjct  69   FEAIKDGLP-HTDADATQDIPSLCDSTSKNCLAPFRDLLYKLNDVAAASSSIPPVSSIVS  127

Query  419  ---MPFAVGATQELGVPVVLFWPLSAVASLMHI  508
               M F V A +E G+P VLFW  SA   L ++
Sbjct  128  DGGMSFTVKAAEEFGIPDVLFWTPSACGFLCYL  160



>gb|KFK44331.1| hypothetical protein AALP_AA1G244300 [Arabis alpina]
Length=483

 Score =   141 bits (356),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 81/144 (56%), Positives = 105/144 (73%), Gaps = 2/144 (1%)
 Frame = +2

Query  56   QRPHAVCIPYPAQGHICAMLKLAKLLHHRGFHITYVLTQLNYTHIMKARNFLPLTQSPTF  235
            ++PH VC+P+PAQGHI  MLK+AKLLH +GFH+T+V T  N+  ++++R    L   P+F
Sbjct  10   RKPHVVCVPHPAQGHINPMLKVAKLLHAKGFHVTFVNTIYNHNRLLRSRGPDALDGLPSF  69

Query  236  RFETIPDGLPSRENPDTALDVADLCFSTGKNCYAPFMELIQRLNSTAsdvppvscvvsdt  415
            RFE+IPDGLP  +  DT  D+  LC ST KNC APFMEL++R+N T  DVPPVSC++SD 
Sbjct  70   RFESIPDGLPESDG-DTTQDIPALCVSTTKNCLAPFMELLRRIN-TRDDVPPVSCIISDG  127

Query  416  vMPFAVGATQELGVPVVLFWPLSA  487
            VM F + A +ELGVP V FW  SA
Sbjct  128  VMSFTLDAAEELGVPDVFFWTPSA  151



>ref|XP_002889182.1| hypothetical protein ARALYDRAFT_476994 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH65441.1| hypothetical protein ARALYDRAFT_476994 [Arabidopsis lyrata subsp. 
lyrata]
Length=474

 Score =   141 bits (356),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 86/151 (57%), Positives = 104/151 (69%), Gaps = 2/151 (1%)
 Frame = +2

Query  56   QRPHAVCIPYPAQGHICAMLKLAKLLHHRGFHITYVLTQLNYTHIMKARNFLPLTQSPTF  235
            Q+ HAVCIPYPAQGHI  MLKLAKLLH RGFH+T+V T  N+  I+++R    L   P+F
Sbjct  10   QKRHAVCIPYPAQGHINPMLKLAKLLHARGFHVTFVNTDYNHRRILRSRGPHALEGLPSF  69

Query  236  RFETIPDGLPSRENPDTALDVADLCFSTGKNCYAPFMELIQRLNSTAsdvppvscvvsdt  415
            RFETIPDGLP  E  D   D+  L  ST  NC APF ELI RLNS  SD+PPV C+VSD 
Sbjct  70   RFETIPDGLPWTE-VDAKQDMLKLIDSTINNCLAPFKELILRLNS-GSDIPPVRCIVSDA  127

Query  416  vMPFAVGATQELGVPVVLFWPLSAVASLMHI  508
             M F + A +EL +PVVL W  SA A ++++
Sbjct  128  SMSFTIDAAEELKIPVVLLWTNSATALILYL  158



>ref|XP_002893224.1| UDP-glucosyl transferase 85A1 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH69483.1| UDP-glucosyl transferase 85A1 [Arabidopsis lyrata subsp. lyrata]
Length=486

 Score =   141 bits (356),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 80/151 (53%), Positives = 104/151 (69%), Gaps = 2/151 (1%)
 Frame = +2

Query  56   QRPHAVCIPYPAQGHICAMLKLAKLLHHRGFHITYVLTQLNYTHIMKARNFLPLTQSPTF  235
            Q+PH VC+PYPAQGHI  M+K+AKLLH RGFH+T+V T  N+   +++R    L   P+F
Sbjct  10   QKPHVVCVPYPAQGHINPMMKVAKLLHARGFHVTFVNTVYNHNRFLRSRGSNALEGLPSF  69

Query  236  RFETIPDGLPSRENPDTALDVADLCFSTGKNCYAPFMELIQRLNSTAsdvppvscvvsdt  415
            RFE+IPDGLP   + D   D+  LC ST KNC APF EL+Q++N+   +VPPVSC+VSD 
Sbjct  70   RFESIPDGLPET-DMDATQDITALCESTMKNCLAPFRELLQQINA-GDNVPPVSCIVSDG  127

Query  416  vMPFAVGATQELGVPVVLFWPLSAVASLMHI  508
             M F +   +ELGVP VLFW  S  A L ++
Sbjct  128  CMSFTLDVAEELGVPEVLFWTTSGCAFLAYL  158



>ref|XP_006416206.1| hypothetical protein EUTSA_v100074991mg, partial [Eutrema salsugineum]
 gb|ESQ34559.1| hypothetical protein EUTSA_v100074991mg, partial [Eutrema salsugineum]
Length=172

 Score =   135 bits (339),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 81/151 (54%), Positives = 104/151 (69%), Gaps = 2/151 (1%)
 Frame = +2

Query  56   QRPHAVCIPYPAQGHICAMLKLAKLLHHRGFHITYVLTQLNYTHIMKARNFLPLTQSPTF  235
            Q+PH VC+PYPAQGHI  MLK+AKLLH +GFH+T+V T  N+  ++++R    L   P+F
Sbjct  10   QKPHVVCVPYPAQGHINPMLKVAKLLHAKGFHVTFVNTIYNHNRLLRSRGPNALDGLPSF  69

Query  236  RFETIPDGLPSRENPDTALDVADLCFSTGKNCYAPFMELIQRLNSTAsdvppvscvvsdt  415
            RFE+IPDGLP  +  D   D+  LC ST KN  APF EL+ R+N+   DVPPVSC+VSD 
Sbjct  70   RFESIPDGLPEID-VDVTQDIPALCESTMKNGLAPFKELLGRINA-GDDVPPVSCIVSDG  127

Query  416  vMPFAVGATQELGVPVVLFWPLSAVASLMHI  508
             M F + A +ELGVP VLFW  SA   L ++
Sbjct  128  CMSFTLDAAEELGVPEVLFWTTSACGFLTYL  158



>gb|AIL51400.1| glycosyltransferase [Actinidia deliciosa]
Length=484

 Score =   141 bits (356),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 80/152 (53%), Positives = 105/152 (69%), Gaps = 2/152 (1%)
 Frame = +2

Query  56   QRPHAVCIPYPAQGHICAMLKLAKLLHHRGFHITYVLTQLNYTHIMKARNFLPLTQSPTF  235
            ++PHAVC+PYPAQGHI  MLKLAKLLH +GFH+T+V T+ N+  ++K+R    LT   +F
Sbjct  8    EKPHAVCLPYPAQGHITPMLKLAKLLHSKGFHVTFVNTEFNHKRLLKSRGPDSLTGLSSF  67

Query  236  RFETIPDGLPSRENPDTALDVADLCFSTGKNCYAPFMELIQRLNSTAsdvp-pvscvvsd  412
            RFETIPDGLP   + D    +  LC ST KNC  PF +L+ +LN+T S    PVSCVVSD
Sbjct  68   RFETIPDGLP-ESDLDATQFIPSLCESTRKNCLGPFRQLLGKLNNTVSSGVPPVSCVVSD  126

Query  413  tvMPFAVGATQELGVPVVLFWPLSAVASLMHI  508
             VM F++ A +ELG+P VLFW  S    + ++
Sbjct  127  GVMSFSLDAAEELGIPQVLFWTTSVCGFMAYV  158



>ref|XP_010477498.1| PREDICTED: LOW QUALITY PROTEIN: UDP-glycosyltransferase 85A3 
[Camelina sativa]
Length=531

 Score =   141 bits (356),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 80/153 (52%), Positives = 105/153 (69%), Gaps = 2/153 (1%)
 Frame = +2

Query  50   EVQRPHAVCIPYPAQGHICAMLKLAKLLHHRGFHITYVLTQLNYTHIMKARNFLPLTQSP  229
            + ++PH VC+P+PAQGHI  MLK+AKLLHHRGFH+T+V T  N+  ++++R    L + P
Sbjct  48   DAEKPHVVCVPFPAQGHINPMLKVAKLLHHRGFHVTFVNTVYNHNRLLRSRGPNALGRVP  107

Query  230  TFRFETIPDGLPSRENPDTALDVADLCFSTGKNCYAPFMELIQRLNSTAsdvppvscvvs  409
            +FRFE IPDGLP   + D   D+  LC ST KNC APF ELI+R+N T  DVPPVSC+VS
Sbjct  108  SFRFEAIPDGLPE-TDVDATQDIPALCESTMKNCLAPFKELIRRIN-TREDVPPVSCIVS  165

Query  410  dtvMPFAVGATQELGVPVVLFWPLSAVASLMHI  508
            D  M F +   +E GVP VLFW  S    + ++
Sbjct  166  DGAMGFTLDVAEEFGVPQVLFWTTSGCGFMAYL  198



>dbj|BAG80542.1| glycosyltransferase [Lycium barbarum]
Length=484

 Score =   141 bits (355),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 83/153 (54%), Positives = 107/153 (70%), Gaps = 2/153 (1%)
 Frame = +2

Query  50   EVQRPHAVCIPYPAQGHICAMLKLAKLLHHRGFHITYVLTQLNYTHIMKARNFLPLTQSP  229
            E+++PHAVCIP+PAQGHI  MLKLAK+LHH+GFHIT+V T+ N+  ++K+R    L    
Sbjct  7    ELKKPHAVCIPFPAQGHINPMLKLAKILHHKGFHITFVNTEYNHRRLLKSRGPNALNGLS  66

Query  230  TFRFETIPDGLPSRENPDTALDVADLCFSTGKNCYAPFMELIQRLNSTAsdvppvscvvs  409
            +FR+ETIPDGLP   + D   D+  LC ST   C  PF +L+ +LN+T  +VPPVSC+VS
Sbjct  67   SFRYETIPDGLPPC-DADATQDIPSLCESTTTTCLGPFKDLLAKLNNT-LEVPPVSCIVS  124

Query  410  dtvMPFAVGATQELGVPVVLFWPLSAVASLMHI  508
            D VM F   A QELGVP VLFW  SA   L ++
Sbjct  125  DGVMSFTFAAAQELGVPEVLFWTTSACGFLGYM  157



>ref|XP_010459994.1| PREDICTED: UDP-glycosyltransferase 85A1-like [Camelina sativa]
Length=513

 Score =   141 bits (356),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 82/154 (53%), Positives = 106/154 (69%), Gaps = 2/154 (1%)
 Frame = +2

Query  47   MEVQRPHAVCIPYPAQGHICAMLKLAKLLHHRGFHITYVLTQLNYTHIMKARNFLPLTQS  226
            +  Q+PH VC+PYPAQGHI  M+K+AKLLH RGFH+T+V T  N+   +++   + L   
Sbjct  32   LNAQKPHVVCVPYPAQGHINPMMKVAKLLHARGFHVTFVNTVYNHNRFLRSHGSIALDGL  91

Query  227  PTFRFETIPDGLPSRENPDTALDVADLCFSTGKNCYAPFMELIQRLNSTAsdvppvscvv  406
             +FRFE+IPDGLP   + DT  D+  LC ST KNC  PF EL+QR+N+   DVPPVSC+V
Sbjct  92   HSFRFESIPDGLPET-DMDTTQDITALCESTMKNCLVPFQELLQRINAR-DDVPPVSCIV  149

Query  407  sdtvMPFAVGATQELGVPVVLFWPLSAVASLMHI  508
            SD VM F + A +ELGVP VLFW  S  A L ++
Sbjct  150  SDGVMSFTLDAAEELGVPEVLFWTTSGCAFLTYL  183



>ref|XP_006363270.1| PREDICTED: UDP-glycosyltransferase 85A3-like [Solanum tuberosum]
Length=482

 Score =   140 bits (354),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 82/152 (54%), Positives = 107/152 (70%), Gaps = 2/152 (1%)
 Frame = +2

Query  56   QRPHAVCIPYPAQGHICAMLKLAKLLHHRGFHITYVLTQLNYTHIMKARNFLPLTQSPTF  235
             +PHAVCIPYPAQGHI  MLKLAK+L+H+GFHIT+V  + N+  ++K+R    L   P+F
Sbjct  8    NKPHAVCIPYPAQGHINPMLKLAKILNHKGFHITFVNNEYNHRRLLKSRGPDSLKGLPSF  67

Query  236  RFETIPDGLPSRENPDTALDVADLCFSTGKNCYAPFMELIQRLNST-Asdvppvscvvsd  412
            +FETIPDGLP  +  D+  D+A LC ST K C  PF EL+ +LN T +S+VPPVSC++SD
Sbjct  68   QFETIPDGLPPCD-ADSTQDIAALCESTTKTCLGPFKELLAKLNDTCSSNVPPVSCIISD  126

Query  413  tvMPFAVGATQELGVPVVLFWPLSAVASLMHI  508
              M F + A QELG+P V FW  SA   L ++
Sbjct  127  GCMSFTLAAAQELGIPEVFFWTPSACGLLGYM  158



>ref|XP_006303659.1| hypothetical protein CARUB_v10011698mg [Capsella rubella]
 gb|EOA36557.1| hypothetical protein CARUB_v10011698mg [Capsella rubella]
Length=483

 Score =   140 bits (354),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 81/151 (54%), Positives = 106/151 (70%), Gaps = 2/151 (1%)
 Frame = +2

Query  56   QRPHAVCIPYPAQGHICAMLKLAKLLHHRGFHITYVLTQLNYTHIMKARNFLPLTQSPTF  235
            Q+PH VC+P+PAQGHI  ML++AKLLH +GFH+T+  T  N+  ++++R    L   P+F
Sbjct  10   QKPHVVCVPFPAQGHINPMLQVAKLLHAKGFHVTFANTIYNHKRLLRSRGSNALNVLPSF  69

Query  236  RFETIPDGLPSRENPDTALDVADLCFSTGKNCYAPFMELIQRLNSTAsdvppvscvvsdt  415
            R+E+IPDGLP   N D   DV  LC ST KNC APF EL+ R+N TA DVPPVSC+VSD 
Sbjct  70   RYESIPDGLP-ETNKDATQDVPPLCASTKKNCLAPFKELLTRIN-TADDVPPVSCIVSDG  127

Query  416  vMPFAVGATQELGVPVVLFWPLSAVASLMHI  508
            +M F + A +ELGVP V+FW  SA   L ++
Sbjct  128  IMSFTLDAAEELGVPDVVFWTTSACGFLAYL  158



>gb|KDP41397.1| hypothetical protein JCGZ_15804 [Jatropha curcas]
Length=487

 Score =   140 bits (354),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 80/153 (52%), Positives = 105/153 (69%), Gaps = 2/153 (1%)
 Frame = +2

Query  53   VQRPHAVCIPYPAQGHICAMLKLAKLLHHRGFHITYVLTQLNYTHIMKARNFLPLTQSPT  232
            +++PHAVCI YPAQGHI  MLKLAKLLHH+GFHIT+V T+ N+  ++++R    +   P+
Sbjct  7    LEKPHAVCISYPAQGHINPMLKLAKLLHHKGFHITFVHTEYNHKRLLRSRGSDSVIGLPS  66

Query  233  FRFETIPDGLPSRENPDTALDVADLCFSTGKNCYAPFMELIQRLNSTAsdvp-pvscvvs  409
            F+F TIPDGLP  ++ D   D+  LC ST K C APF  L+  LN T+S    PVSC+VS
Sbjct  67   FQFRTIPDGLPPTDS-DVTQDIPSLCQSTSKYCLAPFKNLLSELNDTSSSNVPPVSCIVS  125

Query  410  dtvMPFAVGATQELGVPVVLFWPLSAVASLMHI  508
            D VM F V A QEL +P+VLFW  SA   + ++
Sbjct  126  DGVMSFTVDAAQELCIPLVLFWTTSACGFMGYV  158



>ref|NP_177950.1| UDP-glucosyl transferase 85A4 [Arabidopsis thaliana]
 sp|Q9M9E7.1|U85A4_ARATH RecName: Full=UDP-glycosyltransferase 85A4 [Arabidopsis thaliana]
 gb|AAF71803.1|AC013430_12 F3F9.19 [Arabidopsis thaliana]
 gb|AAM20493.1| UDP-glucose glucosyltransferase, putative [Arabidopsis thaliana]
 gb|AAN15561.1| UDP-glucose glucosyltransferase, putative [Arabidopsis thaliana]
 gb|AEE36089.1| UDP-glucosyl transferase 85A4 [Arabidopsis thaliana]
 gb|AHL38867.1| glycosyltransferase, partial [Arabidopsis thaliana]
Length=489

 Score =   140 bits (354),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 84/151 (56%), Positives = 106/151 (70%), Gaps = 2/151 (1%)
 Frame = +2

Query  56   QRPHAVCIPYPAQGHICAMLKLAKLLHHRGFHITYVLTQLNYTHIMKARNFLPLTQSPTF  235
            Q+PHA+CIPYPAQGHI  MLKLAKLLH RGFH+T+V T  N+  I+++R    L   P+F
Sbjct  10   QKPHAMCIPYPAQGHINPMLKLAKLLHARGFHVTFVNTDYNHRRILQSRGPHALNGLPSF  69

Query  236  RFETIPDGLPSRENPDTALDVADLCFSTGKNCYAPFMELIQRLNSTAsdvppvscvvsdt  415
            RFETIPDGLP   + D   D+  L  ST  NC APF +LI RLNS  SD+PPVSC++SD 
Sbjct  70   RFETIPDGLPWT-DVDAKQDMLKLIDSTINNCLAPFKDLILRLNS-GSDIPPVSCIISDA  127

Query  416  vMPFAVGATQELGVPVVLFWPLSAVASLMHI  508
             M F + A +EL +PVVL W  SA A ++++
Sbjct  128  SMSFTIDAAEELKIPVVLLWTNSATALILYL  158



>ref|XP_010098615.1| UDP-glycosyltransferase 85A1 [Morus notabilis]
 gb|EXB75354.1| UDP-glycosyltransferase 85A1 [Morus notabilis]
Length=481

 Score =   140 bits (354),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 77/149 (52%), Positives = 102/149 (68%), Gaps = 2/149 (1%)
 Frame = +2

Query  62   PHAVCIPYPAQGHICAMLKLAKLLHHRGFHITYVLTQLNYTHIMKARNFLPLTQSPTFRF  241
            PH VCIPYPAQGH+  M  LAKLLHH+GF++T+V T+ NY  ++++R    L   P+FRF
Sbjct  12   PHVVCIPYPAQGHVNPMTNLAKLLHHKGFYVTFVYTEFNYKRLLRSRGPNSLDGLPSFRF  71

Query  242  ETIPDGLPSRENPDTALDVADLCFSTGKNCYAPFMELIQRLNSTAsdvppvscvvsdtvM  421
            E+IPDGLP   + D   D+  LC ST KNC APF +L+ +LNS+  D+PPVS +VSD  M
Sbjct  72   ESIPDGLP-ESDADATQDIPSLCESTSKNCLAPFRQLLSKLNSSP-DIPPVSSIVSDGAM  129

Query  422  PFAVGATQELGVPVVLFWPLSAVASLMHI  508
             F + A +ELGVP V+ W  SA   L ++
Sbjct  130  TFTLEAARELGVPEVVLWTTSACGFLAYL  158



>ref|XP_010477497.1| PREDICTED: UDP-glycosyltransferase 85A5-like [Camelina sativa]
Length=486

 Score =   140 bits (354),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 82/151 (54%), Positives = 104/151 (69%), Gaps = 1/151 (1%)
 Frame = +2

Query  56   QRPHAVCIPYPAQGHICAMLKLAKLLHHRGFHITYVLTQLNYTHIMKARNFLPLTQSPTF  235
            Q+PH VCIP+PAQGHI  MLK+A LL+ RGFH+T+V T  N+  ++++R    L   P+F
Sbjct  13   QKPHVVCIPFPAQGHINPMLKVAILLYARGFHVTFVNTVYNHNRLIRSRGPNALEGLPSF  72

Query  236  RFETIPDGLPSRENPDTALDVADLCFSTGKNCYAPFMELIQRLNSTAsdvppvscvvsdt  415
            RFE+IPDGLP   N D   DV  LC ST KNC AP  EL++R+N T  DVPPVSC+VSD 
Sbjct  73   RFESIPDGLPEEPNKDIMQDVPSLCESTMKNCLAPLKELLRRIN-TGDDVPPVSCIVSDG  131

Query  416  vMPFAVGATQELGVPVVLFWPLSAVASLMHI  508
            VM F + A +ELGVP +L W  SA   L ++
Sbjct  132  VMSFTLDAAEELGVPEILLWTTSACGFLAYL  162



>ref|XP_006416203.1| hypothetical protein EUTSA_v10009957mg, partial [Eutrema salsugineum]
 gb|ESQ34556.1| hypothetical protein EUTSA_v10009957mg, partial [Eutrema salsugineum]
Length=759

 Score =   142 bits (359),  Expect = 4e-36, Method: Composition-based stats.
 Identities = 79/151 (52%), Positives = 107/151 (71%), Gaps = 2/151 (1%)
 Frame = +2

Query  56   QRPHAVCIPYPAQGHICAMLKLAKLLHHRGFHITYVLTQLNYTHIMKARNFLPLTQSPTF  235
            Q+PH VC+PYPAQGHI  MLK+AKLLH +GFH+T+V T  N+  ++++R    L   P+F
Sbjct  10   QKPHVVCVPYPAQGHINPMLKVAKLLHAKGFHVTFVNTVYNHNRLLRSRGPNALDGLPSF  69

Query  236  RFETIPDGLPSRENPDTALDVADLCFSTGKNCYAPFMELIQRLNSTAsdvppvscvvsdt  415
            +FE IPDGLP   + D   D+  LC ST KNC APF EL++++N+   DVPPVSC+VSD 
Sbjct  70   QFEAIPDGLP-ETDVDATQDIPALCESTMKNCLAPFKELLRQINAR-DDVPPVSCIVSDG  127

Query  416  vMPFAVGATQELGVPVVLFWPLSAVASLMHI  508
             M F + A +ELG+P VLFW  SA A++ ++
Sbjct  128  CMSFTLDAAEELGIPEVLFWTPSACATMAYL  158



>ref|XP_009145344.1| PREDICTED: UDP-glycosyltransferase 85A5-like [Brassica rapa]
Length=491

 Score =   140 bits (354),  Expect = 5e-36, Method: Compositional matrix adjust.
 Identities = 78/151 (52%), Positives = 105/151 (70%), Gaps = 2/151 (1%)
 Frame = +2

Query  56   QRPHAVCIPYPAQGHICAMLKLAKLLHHRGFHITYVLTQLNYTHIMKARNFLPLTQSPTF  235
            Q+PH VC+PYPAQGHI  MLK+AKLLH+RGFH+T+V    N+  ++++R    L + PTF
Sbjct  10   QKPHVVCVPYPAQGHIDPMLKVAKLLHNRGFHVTFVNNVYNHNRLLRSRGPNALDRIPTF  69

Query  236  RFETIPDGLPSRENPDTALDVADLCFSTGKNCYAPFMELIQRLNSTAsdvppvscvvsdt  415
            RFE+IPDGL   +  D   D+  LC +T KNC APF EL+QR+N    DV PVSC+V+D 
Sbjct  70   RFESIPDGLLETDG-DKMQDIPSLCEATMKNCLAPFKELLQRIN-VRDDVSPVSCIVADG  127

Query  416  vMPFAVGATQELGVPVVLFWPLSAVASLMHI  508
            +M F + A +ELG+P V+FW  SA   L ++
Sbjct  128  IMTFTLDAAEELGIPCVIFWTTSACGFLSYM  158



>emb|CDY21360.1| BnaA09g30670D [Brassica napus]
Length=491

 Score =   140 bits (354),  Expect = 5e-36, Method: Compositional matrix adjust.
 Identities = 78/151 (52%), Positives = 105/151 (70%), Gaps = 2/151 (1%)
 Frame = +2

Query  56   QRPHAVCIPYPAQGHICAMLKLAKLLHHRGFHITYVLTQLNYTHIMKARNFLPLTQSPTF  235
            Q+PH VC+PYPAQGHI  MLK+AKLLH+RGFH+T+V    N+  ++++R    L + PTF
Sbjct  10   QKPHVVCVPYPAQGHIDPMLKVAKLLHNRGFHVTFVNNVYNHNRLLRSRGPNALDRIPTF  69

Query  236  RFETIPDGLPSRENPDTALDVADLCFSTGKNCYAPFMELIQRLNSTAsdvppvscvvsdt  415
            RFE+IPDGL   +  D   D+  LC +T KNC APF EL+QR+N    DV PVSC+V+D 
Sbjct  70   RFESIPDGLLETDG-DKMQDIPSLCEATMKNCLAPFKELLQRIN-VRDDVSPVSCIVADG  127

Query  416  vMPFAVGATQELGVPVVLFWPLSAVASLMHI  508
            +M F + A +ELG+P V+FW  SA   L ++
Sbjct  128  IMTFTLDAAEELGIPCVIFWTTSACGFLSYM  158



>emb|CDP22240.1| unnamed protein product [Coffea canephora]
Length=176

 Score =   134 bits (337),  Expect = 5e-36, Method: Compositional matrix adjust.
 Identities = 85/157 (54%), Positives = 104/157 (66%), Gaps = 5/157 (3%)
 Frame = +2

Query  50   EVQRPHAVCIPYPAQGHICAMLKLAKLLHHRGFHITYVLTQLNYTHIMKARNFLPLTQSP  229
             +++PHA+CIPYP Q HI A LKLAKLLH +GFHIT+V T+ NY  I+KAR    L  + 
Sbjct  4    RMKKPHAICIPYPVQSHISATLKLAKLLHLKGFHITFVHTEYNYNRILKARGPKSLIGAA  63

Query  230  TFRFETIPDGLPSRENPDTALDVADLCFSTGKNCYAPFMELIQRLNSTAsdvpp---vsc  400
             F FETIPDGLP  EN D   DV  LC ST K CY PF  L+++LN+ AS       VSC
Sbjct  64   DFNFETIPDGLPPAENDDVTQDVFQLCLSTSKTCYVPFCNLLKKLNNRASMDDQFPPVSC  123

Query  401  vvsdtvMPFAVGATQELGVPVVLFWPLSA--VASLMH  505
            V+SD  M F + A +ELG+P +LFWP SA  V  L+H
Sbjct  124  VISDGFMSFTLEAAEELGIPNLLFWPFSALTVMCLLH  160



>ref|XP_010273031.1| PREDICTED: 7-deoxyloganetin glucosyltransferase-like [Nelumbo 
nucifera]
Length=483

 Score =   140 bits (353),  Expect = 6e-36, Method: Compositional matrix adjust.
 Identities = 80/153 (52%), Positives = 107/153 (70%), Gaps = 1/153 (1%)
 Frame = +2

Query  53   VQRPHAVCIPYPAQGHICAMLKLAKLLHHRGFHITYVLTQLNYTHIMKARNFLPLTQSPT  232
            V++PH VCIPYPAQGHI  MLKLAKLLH++GFH+T+V T+ N+  ++K+R    +   P 
Sbjct  7    VKKPHVVCIPYPAQGHINPMLKLAKLLHYKGFHVTFVNTEYNHRRLVKSRGPDSVKGLPG  66

Query  233  FRFETIPDGLPSRENPDTALDVADLCFSTGKNCYAPFMELIQRLN-STAsdvppvscvvs  409
            FRFETIPDGLP  ++ +    +  LC ST K C +PF  L+ +LN S++SD PPVSC+VS
Sbjct  67   FRFETIPDGLPHSDDIEATQHIPSLCDSTRKTCLSPFRNLLSKLNDSSSSDTPPVSCIVS  126

Query  410  dtvMPFAVGATQELGVPVVLFWPLSAVASLMHI  508
            D VM F + A QE G+P VLFW  SA   + ++
Sbjct  127  DGVMSFTLTAAQECGIPEVLFWTTSACGFMSYV  159



>ref|XP_010087621.1| UDP-glycosyltransferase 85A1 [Morus notabilis]
 gb|EXB29476.1| UDP-glycosyltransferase 85A1 [Morus notabilis]
Length=497

 Score =   140 bits (353),  Expect = 6e-36, Method: Compositional matrix adjust.
 Identities = 77/155 (50%), Positives = 108/155 (70%), Gaps = 2/155 (1%)
 Frame = +2

Query  47   MEVQRPHAVCIPYPAQGHICAMLKLAKLLHHRGFHITYVLTQLNYTHIMKARNFLPLTQS  226
            ++  +PH VC+PYP+QGH+  M++LAKLLH RGFH+T+V T+ N+  ++++R    +   
Sbjct  4    VDSSKPHVVCVPYPSQGHVNPMMQLAKLLHSRGFHVTFVNTEFNHNRLIRSRGADSVKGL  63

Query  227  PTFRFETIPDGLPSRENPDTALDVADLCFSTGKNCYAPFMELIQRLNSTA-sdvppvscv  403
            P FRFE IP+GLP R + D   DV  LC ST KNC APF EL+ +LNS A   VPPV+C+
Sbjct  64   PDFRFEAIPEGLP-RSDRDATQDVPALCDSTRKNCLAPFKELLLKLNSLAPEKVPPVTCI  122

Query  404  vsdtvMPFAVGATQELGVPVVLFWPLSAVASLMHI  508
            +SD VM FA+ A +ELG+P V FW  SA + + ++
Sbjct  123  ISDGVMSFAIKAGEELGIPEVQFWTASACSFMGYL  157



>ref|XP_010498708.1| PREDICTED: UDP-glycosyltransferase 85A1-like [Camelina sativa]
Length=518

 Score =   140 bits (353),  Expect = 6e-36, Method: Compositional matrix adjust.
 Identities = 81/154 (53%), Positives = 106/154 (69%), Gaps = 2/154 (1%)
 Frame = +2

Query  47   MEVQRPHAVCIPYPAQGHICAMLKLAKLLHHRGFHITYVLTQLNYTHIMKARNFLPLTQS  226
            +  Q+PH VC+PYP+QGHI  M+K+AKLLH RGFH+T+V T  N+   +++   + L   
Sbjct  37   LNAQKPHVVCVPYPSQGHINPMMKVAKLLHARGFHVTFVNTVYNHNRFLRSHGSISLDGL  96

Query  227  PTFRFETIPDGLPSRENPDTALDVADLCFSTGKNCYAPFMELIQRLNSTAsdvppvscvv  406
             +FRFE+IPDGLP   + DT  D+  LC ST KNC  PF EL+QR+N+   DVPPVSC+V
Sbjct  97   HSFRFESIPDGLPET-DMDTTQDITALCESTMKNCLVPFQELLQRINAR-DDVPPVSCIV  154

Query  407  sdtvMPFAVGATQELGVPVVLFWPLSAVASLMHI  508
            SD VM F + A +ELGVP VLFW  S  A L ++
Sbjct  155  SDGVMSFTLDAAEELGVPEVLFWTTSGCAFLTYL  188



>ref|XP_007199087.1| hypothetical protein PRUPE_ppa018904mg [Prunus persica]
 ref|XP_007201558.1| hypothetical protein PRUPE_ppa017826mg [Prunus persica]
 gb|EMJ00286.1| hypothetical protein PRUPE_ppa018904mg [Prunus persica]
 gb|EMJ02757.1| hypothetical protein PRUPE_ppa017826mg [Prunus persica]
Length=178

 Score =   134 bits (336),  Expect = 7e-36, Method: Compositional matrix adjust.
 Identities = 76/146 (52%), Positives = 98/146 (67%), Gaps = 2/146 (1%)
 Frame = +2

Query  56   QRPHAVCIPYPAQGHICAMLKLAKLLHHRGFHITYVLTQLNYTHIMKARNFLPLTQSPTF  235
            +RPHAVC+P+PAQGHI  M+KLAKLLHHRGFHIT+V ++ N+  I+K+R   PL  S  F
Sbjct  10   KRPHAVCLPFPAQGHISPMMKLAKLLHHRGFHITFVNSEDNHKRILKSRGPSPLHVSQDF  69

Query  236  RFETIPDGLPSRENPDTALDVADLCFSTGKNCYAPFMELIQRLNSTAsdvppvscvvsdt  415
             FE IPDGLP  +   T  D+  LC ST K C  PF  L+  L S    +P V+C+VS+ 
Sbjct  70   SFEAIPDGLPPTDANATQ-DIPSLCDSTSKTCLGPFRNLLANL-SLHKALPTVTCIVSNG  127

Query  416  vMPFAVGATQELGVPVVLFWPLSAVA  493
            VM FA+ A ++LG+PV LFW  S+  
Sbjct  128  VMSFAMKADEDLGIPVALFWTASSCG  153



>ref|XP_002532877.1| UDP-glucuronosyltransferase, putative [Ricinus communis]
 gb|EEF29506.1| UDP-glucuronosyltransferase, putative [Ricinus communis]
Length=471

 Score =   140 bits (352),  Expect = 7e-36, Method: Compositional matrix adjust.
 Identities = 78/152 (51%), Positives = 108/152 (71%), Gaps = 2/152 (1%)
 Frame = +2

Query  56   QRPHAVCIPYPAQGHICAMLKLAKLLHHRGFHITYVLTQLNYTHIMKARNFLPLTQSPTF  235
            ++PHAVC+PYP+QGH+  M++LAKLLH RGFHIT+V T  N+T ++++R    +   P F
Sbjct  7    RKPHAVCVPYPSQGHVTPMMQLAKLLHSRGFHITFVNTDFNHTRLIRSRGPDSVKGLPDF  66

Query  236  RFETIPDGLPSRENPDTALDVADLCFSTGKNCYAPFMELIQRLNST-Asdvppvscvvsd  412
            RFETIPDGLP     D   DV  LC ST KNC APF EL+ +LNS+ +++VPPVSC++SD
Sbjct  67   RFETIPDGLPP-STFDATQDVPSLCDSTRKNCLAPFKELVSKLNSSPSTEVPPVSCIISD  125

Query  413  tvMPFAVGATQELGVPVVLFWPLSAVASLMHI  508
             VM F + A ++L +P V FW  SA + + ++
Sbjct  126  GVMSFGIKAAEDLSIPQVQFWTASACSFMAYL  157



>ref|XP_006433960.1| hypothetical protein CICLE_v10000925mg [Citrus clementina]
 gb|ESR47200.1| hypothetical protein CICLE_v10000925mg [Citrus clementina]
Length=504

 Score =   140 bits (352),  Expect = 7e-36, Method: Compositional matrix adjust.
 Identities = 76/153 (50%), Positives = 104/153 (68%), Gaps = 3/153 (2%)
 Frame = +2

Query  56   QRPHAVCIPYPAQGHICAMLKLAKLLHHRGFHITYVLTQLNYTHIMKARNFLPLTQSPTF  235
            +RPHAVC+PYPAQGHI  M +LAKLLHH+GFHIT+V T+ N   ++K++    L   PTF
Sbjct  11   RRPHAVCVPYPAQGHINPMFQLAKLLHHKGFHITFVNTEFNQRRLLKSQGPDSLNAVPTF  70

Query  236  RFETIPDGLPSRENPDTALDVADLCFSTGKNCYAPFMELIQRLNSTAsdvpp--vscvvs  409
            RFETIPDGLP  ++ D   D+  LC ST + C APF EL+ RLN++A       V+C+VS
Sbjct  71   RFETIPDGLPPSDS-DATQDIPSLCDSTRRTCSAPFQELLTRLNNSALSNVNPPVTCIVS  129

Query  410  dtvMPFAVGATQELGVPVVLFWPLSAVASLMHI  508
            D  M F + A+++L +P VLF+  SA   + ++
Sbjct  130  DWSMGFTLKASKQLNIPNVLFFTASACGFMGYV  162



>ref|XP_011045673.1| PREDICTED: 7-deoxyloganetin glucosyltransferase-like [Populus 
euphratica]
Length=474

 Score =   140 bits (352),  Expect = 7e-36, Method: Compositional matrix adjust.
 Identities = 76/149 (51%), Positives = 103/149 (69%), Gaps = 2/149 (1%)
 Frame = +2

Query  59   RPHAVCIPYPAQGHICAMLKLAKLLHHRGFHITYVLTQLNYTHIMKARNFLPLTQSPTFR  238
            +PHAVC+P+PAQGHI  MLKLAK+LH  GFHIT+V T+ N+  ++++R    L   P F+
Sbjct  4    KPHAVCVPFPAQGHINPMLKLAKILHFNGFHITFVNTEYNHRRLLRSRGVSSLDGLPDFQ  63

Query  239  FETIPDGLPSRENPDTALDVADLCFSTGKNCYAPFMELIQRLNSTAsdvppvscvvsdtv  418
            FETIPDGLP  +  D+  D+  LC+ST K C APF +LI +LNS++  +P V+C+VSD V
Sbjct  64   FETIPDGLPPSD-ADSTQDILTLCYSTSKTCLAPFRDLISKLNSSS-VIPQVTCIVSDAV  121

Query  419  MPFAVGATQELGVPVVLFWPLSAVASLMH  505
            M F + A +E G+P  LFW  SA   L +
Sbjct  122  MNFTLDAAEEFGIPDALFWTPSACGVLGY  150



>ref|XP_006363269.1| PREDICTED: UDP-glycosyltransferase 85A3-like [Solanum tuberosum]
Length=485

 Score =   140 bits (352),  Expect = 8e-36, Method: Compositional matrix adjust.
 Identities = 81/154 (53%), Positives = 107/154 (69%), Gaps = 2/154 (1%)
 Frame = +2

Query  50   EVQRPHAVCIPYPAQGHICAMLKLAKLLHHRGFHITYVLTQLNYTHIMKARNFLPLTQSP  229
            E+ +PHAVCIPYPAQGHI  MLKLAK+ +H+GFHIT+V T+ N+  ++K+R    L   P
Sbjct  9    ELDKPHAVCIPYPAQGHINPMLKLAKIFNHKGFHITFVNTEYNHRRLLKSRGPDSLKGLP  68

Query  230  TFRFETIPDGLPSRENPDTALDVADLCFSTGKNCYAPFMELIQRLNST-Asdvppvscvv  406
            +FRFETIPDGLP  +  D+  D+  L  ST   C  PF EL+ +LN+T +S+VPPVSC+V
Sbjct  69   SFRFETIPDGLPPSD-ADSTQDIVSLGKSTTNTCLGPFKELLAKLNNTCSSNVPPVSCIV  127

Query  407  sdtvMPFAVGATQELGVPVVLFWPLSAVASLMHI  508
            SD  M F + A QELG+P + FW  SA   L ++
Sbjct  128  SDGCMSFTLAAAQELGIPEIFFWTPSACGLLGYM  161



>ref|XP_002285778.2| PREDICTED: 7-deoxyloganetin glucosyltransferase isoform X1 [Vitis 
vinifera]
Length=492

 Score =   140 bits (352),  Expect = 9e-36, Method: Compositional matrix adjust.
 Identities = 80/154 (52%), Positives = 103/154 (67%), Gaps = 4/154 (3%)
 Frame = +2

Query  47   MEVQRPHAVCIPYPAQGHICAMLKLAKLLHHRGFHITYVLTQLNYTHIMKARNFLPLTQS  226
            M  ++PHAVCIPYPAQGHI  MLKLAKLLH RGF IT+V T+ N+T ++ A+    L+  
Sbjct  21   MGSEKPHAVCIPYPAQGHINPMLKLAKLLHCRGFRITFVNTEFNHTRLLNAQGPNCLSGL  80

Query  227  PTFRFETIPDGLPSRENPDTALDVADLCFSTGKNCYAPFMELIQRLNSTAsdvppvscvv  406
            PTF+FETIPDGLP   + D   D+  LC ST KNC APF  L+ +LN      PPV+C+ 
Sbjct  81   PTFQFETIPDGLPP-SDVDATQDIPSLCVSTKKNCLAPFRRLLAKLNHDG---PPVTCIF  136

Query  407  sdtvMPFAVGATQELGVPVVLFWPLSAVASLMHI  508
            SD +M F + A QELG+P +L W  SA   + ++
Sbjct  137  SDAIMSFTLDAAQELGIPDLLLWTASACGFMAYV  170



>ref|XP_002885822.1| hypothetical protein ARALYDRAFT_319356 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH62081.1| hypothetical protein ARALYDRAFT_319356 [Arabidopsis lyrata subsp. 
lyrata]
Length=507

 Score =   140 bits (352),  Expect = 9e-36, Method: Compositional matrix adjust.
 Identities = 79/151 (52%), Positives = 105/151 (70%), Gaps = 2/151 (1%)
 Frame = +2

Query  56   QRPHAVCIPYPAQGHICAMLKLAKLLHHRGFHITYVLTQLNYTHIMKARNFLPLTQSPTF  235
            Q+PH VC+PYPAQGHI  MLKLAK+L+ RGFH+T+V T  N+  ++++R    L   P+F
Sbjct  10   QKPHVVCVPYPAQGHINPMLKLAKILYVRGFHVTFVNTIYNHNRLLRSRGPNALDGLPSF  69

Query  236  RFETIPDGLPSRENPDTALDVADLCFSTGKNCYAPFMELIQRLNSTAsdvppvscvvsdt  415
            RFE+IPDGLP   N D   D++ LC +  KNC  PF EL++R+NS   +VPPVSC+VSD 
Sbjct  70   RFESIPDGLPET-NVDATQDISALCDAVKKNCLTPFKELLRRINSQQ-NVPPVSCIVSDG  127

Query  416  vMPFAVGATQELGVPVVLFWPLSAVASLMHI  508
             M F + A +ELGVP VLFW  SA   + ++
Sbjct  128  TMSFTLDAAEELGVPEVLFWTTSACGFMAYL  158



>ref|NP_001277170.1| UDP-glycosyltransferase 85A2-like [Vitis vinifera]
 dbj|BAO51845.1| UDP-glycosyltransferase 85A30 [Vitis vinifera]
Length=484

 Score =   139 bits (351),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 78/154 (51%), Positives = 105/154 (68%), Gaps = 2/154 (1%)
 Frame = +2

Query  50   EVQRPHAVCIPYPAQGHICAMLKLAKLLHHRGFHITYVLTQLNYTHIMKARNFLPLTQSP  229
            E  RPHAVC+P+PAQGHI  M+KLAKLLHH+GFHIT+V T+ N+  ++K+R    L   P
Sbjct  5    EKPRPHAVCVPFPAQGHINPMMKLAKLLHHKGFHITFVNTEFNHQRLLKSRGPNSLRGLP  64

Query  230  TFRFETIPDGLPSRENPDTALDVADLCFSTGKNCYAPFMELIQRLNSTAsdvp-pvscvv  406
            +F+FETI DGLP  +  D   DV  LC ST  +C APF +L+ +LN T+S    PV+C+V
Sbjct  65   SFQFETIADGLPPSD-IDATQDVPSLCASTHNDCLAPFRDLLAKLNDTSSSKVPPVTCIV  123

Query  407  sdtvMPFAVGATQELGVPVVLFWPLSAVASLMHI  508
            SD +M F + A +ELG+P V FW  SA   + ++
Sbjct  124  SDGIMSFTLKAAEELGIPEVFFWTTSACGFMGYV  157



>ref|XP_008359320.1| PREDICTED: UDP-glycosyltransferase 85A2-like [Malus domestica]
Length=484

 Score =   139 bits (351),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 81/151 (54%), Positives = 103/151 (68%), Gaps = 2/151 (1%)
 Frame = +2

Query  56   QRPHAVCIPYPAQGHICAMLKLAKLLHHRGFHITYVLTQLNYTHIMKARNFLPLTQSPTF  235
            ++PHAVCIP+PAQGHI  ML +AKLLH +GFHIT+V TQ N+  ++K+R    L   P+F
Sbjct  8    EKPHAVCIPFPAQGHINPMLNVAKLLHFKGFHITFVNTQFNHKRLLKSRGSNSLDGLPSF  67

Query  236  RFETIPDGLPSRENPDTALDVADLCFSTGKNCYAPFMELIQRLNSTAsdvppvscvvsdt  415
            +FETIPDGLP   N +   D+  LC ST K C   F EL+ +LNS+  D P VSC+VSD 
Sbjct  68   QFETIPDGLPPT-NANVTQDIPSLCHSTKKTCLPHFRELLSKLNSS-RDSPSVSCIVSDG  125

Query  416  vMPFAVGATQELGVPVVLFWPLSAVASLMHI  508
            VM F + A QELG+P VLFW  SA   L ++
Sbjct  126  VMSFTLDAAQELGIPEVLFWTTSACGFLAYM  156



>ref|XP_011045674.1| PREDICTED: 7-deoxyloganetin glucosyltransferase-like [Populus 
euphratica]
Length=503

 Score =   139 bits (351),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 76/147 (52%), Positives = 102/147 (69%), Gaps = 2/147 (1%)
 Frame = +2

Query  59   RPHAVCIPYPAQGHICAMLKLAKLLHHRGFHITYVLTQLNYTHIMKARNFLPLTQSPTFR  238
            +PHAVC+P+PAQGHI  MLKLAK+LH  GFHIT+V T+ N+  ++++R    L   P F+
Sbjct  33   KPHAVCVPFPAQGHINPMLKLAKILHFNGFHITFVNTEYNHRRLLRSRGVSSLDGLPDFQ  92

Query  239  FETIPDGLPSRENPDTALDVADLCFSTGKNCYAPFMELIQRLNSTAsdvppvscvvsdtv  418
            FETIPDGLP   + D+  D+  LC+ST K C APF +LI +LNS++  +P V+C+VSD V
Sbjct  93   FETIPDGLPP-SDADSTQDILTLCYSTSKTCLAPFRDLISKLNSSS-VIPQVTCIVSDAV  150

Query  419  MPFAVGATQELGVPVVLFWPLSAVASL  499
            M F + A +E G+P  LFW  SA   L
Sbjct  151  MNFTLDAAEEFGIPDALFWTPSACGVL  177



>emb|CAN65645.1| hypothetical protein VITISV_012510 [Vitis vinifera]
Length=582

 Score =   140 bits (352),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 80/154 (52%), Positives = 103/154 (67%), Gaps = 4/154 (3%)
 Frame = +2

Query  47   MEVQRPHAVCIPYPAQGHICAMLKLAKLLHHRGFHITYVLTQLNYTHIMKARNFLPLTQS  226
            M  ++PHAVCIPYPAQGHI  MLKLAKLLH RGF IT+V T+ N+T ++ A+    L+  
Sbjct  1    MGSEKPHAVCIPYPAQGHINPMLKLAKLLHCRGFRITFVNTEFNHTRLLNAQGPNCLSGL  60

Query  227  PTFRFETIPDGLPSRENPDTALDVADLCFSTGKNCYAPFMELIQRLNSTAsdvppvscvv  406
            PTF+FETIPDGLP   + D   D+  LC ST KNC APF  L+ +LN      PPV+C+ 
Sbjct  61   PTFQFETIPDGLPP-SDVDATQDIPSLCVSTKKNCLAPFRRLLAKLNHDG---PPVTCIF  116

Query  407  sdtvMPFAVGATQELGVPVVLFWPLSAVASLMHI  508
            SD +M F + A QELG+P +L W  SA   + ++
Sbjct  117  SDAIMSFTLDAAQELGIPDLLLWTASACGFMAYV  150



>sp|F8WLS6.1|UGT6_CATRO RecName: Full=7-deoxyloganetin glucosyltransferase; AltName: 
Full=Iridoid 1-O-glucosyltransferase; AltName: Full=UDP-glucose 
glucosyltransferase 6; Short=CrUGT6; AltName: Full=UDP-glycosyltransferase 
85A23 [Catharanthus roseus]
 dbj|BAK55749.1| UDP-glucose iridoid glucosyltransferase [Catharanthus roseus]
Length=487

 Score =   139 bits (351),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 81/152 (53%), Positives = 105/152 (69%), Gaps = 2/152 (1%)
 Frame = +2

Query  56   QRPHAVCIPYPAQGHICAMLKLAKLLHHRGFHITYVLTQLNYTHIMKARNFLPLTQSPTF  235
            ++PHAVCIPYPAQGHI  MLKLAKLLH++GFHIT+V T+ N+  ++K+R    L    +F
Sbjct  11   KKPHAVCIPYPAQGHINPMLKLAKLLHYKGFHITFVNTEFNHKRLLKSRGSDSLKGLHSF  70

Query  236  RFETIPDGLPSRENPDTALDVADLCFSTGKNCYAPFMELIQRLNSTAsdvp-pvscvvsd  412
            +F+TIPDGLP  +  D   D+  LC ST  +C  PF +L+Q+LN T+S    PVSCVVSD
Sbjct  71   QFKTIPDGLPPSD-VDATQDIPSLCESTTTHCLVPFKQLLQKLNDTSSSEVPPVSCVVSD  129

Query  413  tvMPFAVGATQELGVPVVLFWPLSAVASLMHI  508
             VM F + A QEL +P VLFW  SA   L ++
Sbjct  130  AVMSFTISAAQELDIPEVLFWTPSACGVLGYM  161



>ref|XP_008343335.1| PREDICTED: UDP-glycosyltransferase 85A2-like [Malus domestica]
Length=176

 Score =   133 bits (335),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 79/151 (52%), Positives = 104/151 (69%), Gaps = 2/151 (1%)
 Frame = +2

Query  56   QRPHAVCIPYPAQGHICAMLKLAKLLHHRGFHITYVLTQLNYTHIMKARNFLPLTQSPTF  235
            ++PHAVC+P+PAQGHI  ML +AKLLH +GFHIT+V T+ N+  ++K+R    L   P+F
Sbjct  8    EKPHAVCVPFPAQGHINPMLNVAKLLHFKGFHITFVYTEFNHKRLLKSRGPNALDGLPSF  67

Query  236  RFETIPDGLPSRENPDTALDVADLCFSTGKNCYAPFMELIQRLNSTAsdvppvscvvsdt  415
            +FETIPDGLP  +  +   D+  LC ST K C   F EL+ ++NS+  D PPVSCVVSD 
Sbjct  68   QFETIPDGLPPTDA-NVTQDIPSLCHSTRKKCLPHFRELLSKVNSSP-DSPPVSCVVSDG  125

Query  416  vMPFAVGATQELGVPVVLFWPLSAVASLMHI  508
            VM F + A QELG+P VLFW  SA   L ++
Sbjct  126  VMSFTLDAAQELGIPEVLFWTTSACGFLAYM  156



>gb|AID16084.1| flavonoid 3-O-glucosyltransferase, partial [Morus alba]
Length=333

 Score =   137 bits (345),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 76/155 (49%), Positives = 107/155 (69%), Gaps = 2/155 (1%)
 Frame = +2

Query  47   MEVQRPHAVCIPYPAQGHICAMLKLAKLLHHRGFHITYVLTQLNYTHIMKARNFLPLTQS  226
            ++  +PH VC+PYP+QGH+  M++LAKLLH RGFH+T+V T+ N+  ++++R    +   
Sbjct  4    VDSSKPHVVCVPYPSQGHVNPMMQLAKLLHSRGFHVTFVNTEFNHNRLIRSRGADSVKGL  63

Query  227  PTFRFETIPDGLPSRENPDTALDVADLCFSTGKNCYAPFMELIQRLNSTA-sdvppvscv  403
            P FRFE IP+GLP  +  D   DV  LC ST KNC APF EL+ +LNS A   VPPV+C+
Sbjct  64   PDFRFEAIPEGLPPSDR-DATQDVPALCDSTRKNCLAPFKELLLKLNSLAPEKVPPVTCI  122

Query  404  vsdtvMPFAVGATQELGVPVVLFWPLSAVASLMHI  508
            +SD VM FA+ A +ELG+P V FW  SA + + ++
Sbjct  123  ISDGVMSFAIKAGEELGIPEVQFWTASACSFMGYL  157



>ref|XP_011009481.1| PREDICTED: 7-deoxyloganetin glucosyltransferase-like [Populus 
euphratica]
Length=482

 Score =   139 bits (350),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 76/148 (51%), Positives = 98/148 (66%), Gaps = 1/148 (1%)
 Frame = +2

Query  56   QRPHAVCIPYPAQGHICAMLKLAKLLHHRGFHITYVLTQLNYTHIMKARNFLPLTQSPTF  235
             +PHAVCIP+PAQGHI  MLKLAKLLH +GFHIT+V T+ N+  ++K+R    L   P F
Sbjct  8    NKPHAVCIPFPAQGHINPMLKLAKLLHFKGFHITFVNTEYNHKRLLKSRGSSSLDGLPDF  67

Query  236  RFETIPDGLPSRENPDTALDVADLCFSTGKNCYAPFMELIQRLNSTAsdvppvscvvsdt  415
             F+TIPDGLP  +  D   D+  LC ST   C APF +LI +LNS++  VP V+C++SD 
Sbjct  68   EFKTIPDGLPPSDIADATQDIPSLCDSTSTTCLAPFRDLIAKLNSSS-IVPQVTCIISDA  126

Query  416  vMPFAVGATQELGVPVVLFWPLSAVASL  499
             M F + A +E G+P  LFW  SA   L
Sbjct  127  CMSFTLDAAEEFGIPEALFWTPSACGVL  154



>ref|XP_006304665.1| hypothetical protein CARUB_v10011877mg [Capsella rubella]
 gb|EOA37563.1| hypothetical protein CARUB_v10011877mg [Capsella rubella]
Length=486

 Score =   139 bits (350),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 80/151 (53%), Positives = 103/151 (68%), Gaps = 2/151 (1%)
 Frame = +2

Query  56   QRPHAVCIPYPAQGHICAMLKLAKLLHHRGFHITYVLTQLNYTHIMKARNFLPLTQSPTF  235
            Q+PH VC+PYPAQGHI  MLK+AKLLH+RGFH+T+V T  N+  ++++R    L + P+F
Sbjct  10   QKPHVVCVPYPAQGHINPMLKVAKLLHNRGFHVTFVNTVYNHKRLIRSRGTDALGRVPSF  69

Query  236  RFETIPDGLPSRENPDTALDVADLCFSTGKNCYAPFMELIQRLNSTAsdvppvscvvsdt  415
            RFE IPDGLP   + D   D+  L  ST KNC APF ELI R+N T  DVPPVSC+V+D 
Sbjct  70   RFEAIPDGLPET-DVDATQDIPTLSESTEKNCLAPFKELIGRIN-TREDVPPVSCIVADG  127

Query  416  vMPFAVGATQELGVPVVLFWPLSAVASLMHI  508
             M F +   +ELGVP VLFW  S    + ++
Sbjct  128  AMSFTLDVAEELGVPEVLFWTPSGCGFMAYL  158



>ref|XP_009612740.1| PREDICTED: 7-deoxyloganetin glucosyltransferase-like [Nicotiana 
tomentosiformis]
Length=484

 Score =   139 bits (350),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 81/151 (54%), Positives = 105/151 (70%), Gaps = 2/151 (1%)
 Frame = +2

Query  59   RPHAVCIPYPAQGHICAMLKLAKLLHHRGFHITYVLTQLNYTHIMKARNFLPLTQSPTFR  238
            +PHAVCIPYP QGHI  MLKLAK+LHH+GFHIT+V T+ N+  ++K+R    L   P+FR
Sbjct  11   KPHAVCIPYPCQGHINPMLKLAKILHHKGFHITFVNTEYNHRRLLKSRGPDSLNGFPSFR  70

Query  239  FETIPDGLPSRENPDTALDVADLCFSTGKNCYAPFMELIQRLNS-TAsdvppvscvvsdt  415
            FETIPDGLP   + D   D+  LC ST   C  PF EL+ +LN+ ++S+VP VSC+VSD 
Sbjct  71   FETIPDGLPPC-DADATQDIPSLCESTTTTCLRPFKELLAKLNTISSSNVPRVSCIVSDG  129

Query  416  vMPFAVGATQELGVPVVLFWPLSAVASLMHI  508
             M F + A Q+LG+P VLFW  SA   L ++
Sbjct  130  CMSFTLDAAQDLGIPEVLFWTPSACGLLGYM  160



>ref|XP_010459993.1| PREDICTED: UDP-glycosyltransferase 85A3 [Camelina sativa]
Length=491

 Score =   139 bits (350),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 78/153 (51%), Positives = 104/153 (68%), Gaps = 2/153 (1%)
 Frame = +2

Query  50   EVQRPHAVCIPYPAQGHICAMLKLAKLLHHRGFHITYVLTQLNYTHIMKARNFLPLTQSP  229
            + ++PH VC+P+PAQGHI  MLK+AKLLHHRGFH+T+V T  N+  ++++R    L + P
Sbjct  8    DAEKPHVVCVPFPAQGHINPMLKVAKLLHHRGFHVTFVNTVYNHNRLLRSRGPNALGRVP  67

Query  230  TFRFETIPDGLPSRENPDTALDVADLCFSTGKNCYAPFMELIQRLNSTAsdvppvscvvs  409
            +FRFE IPDGLP   + D   D+  LC ST KN  APF ELI+R+N T  DVPPVS +VS
Sbjct  68   SFRFEAIPDGLPET-DVDATQDIPALCESTMKNFLAPFKELIRRIN-TREDVPPVSSIVS  125

Query  410  dtvMPFAVGATQELGVPVVLFWPLSAVASLMHI  508
            D  M F +   +E GVP+VLFW  S    + ++
Sbjct  126  DGAMGFTLDVAEEFGVPLVLFWTTSGCGFMAYL  158



>ref|XP_010676201.1| PREDICTED: 7-deoxyloganetin glucosyltransferase-like [Beta vulgaris 
subsp. vulgaris]
Length=482

 Score =   139 bits (349),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 77/145 (53%), Positives = 96/145 (66%), Gaps = 1/145 (1%)
 Frame = +2

Query  50   EVQRPHAVCIPYPAQGHICAMLKLAKLLHHRGFHITYVLTQLNYTHIMKARNFLPLTQSP  229
            + Q+PHAVCIPYPAQGHI  +LKLAKLLH +GFHIT+V T+ NY  ++++     L   P
Sbjct  5    QEQKPHAVCIPYPAQGHINPLLKLAKLLHSQGFHITFVHTEHNYNRLLRSHGSDALAGLP  64

Query  230  TFRFETIPDGLPSRENPDTALDVADLCFSTGKNCYAPFMELIQRLNSTAsdvppvscvvs  409
            TFRFE IPDGLP  E+PD   D+  L  ST   C  PF ELI RLN ++ DVP VSC+V+
Sbjct  65   TFRFEAIPDGLPPAEDPDAMQDIPSLSISTESRCLGPFKELINRLNESS-DVPQVSCIVA  123

Query  410  dtvMPFAVGATQELGVPVVLFWPLS  484
            D  M F + A +E  +P  L W  S
Sbjct  124  DMAMWFTLDAAKEFDIPEALLWAAS  148



>ref|XP_006373048.1| hypothetical protein POPTR_0017s079102g, partial [Populus trichocarpa]
 gb|ERP50845.1| hypothetical protein POPTR_0017s079102g, partial [Populus trichocarpa]
Length=182

 Score =   133 bits (334),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 74/148 (50%), Positives = 96/148 (65%), Gaps = 1/148 (1%)
 Frame = +2

Query  56   QRPHAVCIPYPAQGHICAMLKLAKLLHHRGFHITYVLTQLNYTHIMKARNFLPLTQSPTF  235
             +PHAVCIP+PAQGHI  MLKLAKLLH +GFHIT+V T+ N+  ++K+R    L   P F
Sbjct  8    NKPHAVCIPFPAQGHINPMLKLAKLLHFKGFHITFVNTEYNHRRLLKSRGSSSLDGLPDF  67

Query  236  RFETIPDGLPSRENPDTALDVADLCFSTGKNCYAPFMELIQRLNSTAsdvppvscvvsdt  415
            +F TIPDGLP  +  D   D+  LC  T   C APF +LI +LNS++  VP V+C++SD 
Sbjct  68   QFMTIPDGLPPSDIADATQDIPSLCDCTSTICLAPFRDLISKLNSSS-IVPQVTCIISDA  126

Query  416  vMPFAVGATQELGVPVVLFWPLSAVASL  499
             M F + A +E G+P  L W  SA   L
Sbjct  127  CMSFTLDAAEEFGIPEALLWTPSACGVL  154



>ref|XP_002298702.2| hypothetical protein POPTR_0001s32000g [Populus trichocarpa]
 gb|EEE83507.2| hypothetical protein POPTR_0001s32000g [Populus trichocarpa]
Length=474

 Score =   139 bits (349),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 75/150 (50%), Positives = 103/150 (69%), Gaps = 2/150 (1%)
 Frame = +2

Query  56   QRPHAVCIPYPAQGHICAMLKLAKLLHHRGFHITYVLTQLNYTHIMKARNFLPLTQSPTF  235
             +PHAVC+P+PAQGHI  MLKLAK+LH  GFHIT+V T+ N+  ++++R    L   P F
Sbjct  3    DKPHAVCVPFPAQGHINPMLKLAKILHFNGFHITFVNTEYNHRRLLRSRGASSLDGLPDF  62

Query  236  RFETIPDGLPSRENPDTALDVADLCFSTGKNCYAPFMELIQRLNSTAsdvppvscvvsdt  415
            +FETIPDGLP  +  D+  D+  LC+ST K C APF +LI +LNS++  +P V+C+VSD 
Sbjct  63   QFETIPDGLPPSD-ADSTQDILTLCYSTSKTCLAPFRDLIAKLNSSS-VIPQVTCIVSDA  120

Query  416  vMPFAVGATQELGVPVVLFWPLSAVASLMH  505
            +M F + A +E G+P  LFW  SA   L +
Sbjct  121  IMNFTLDAAEEFGIPDALFWTPSACGVLGY  150



>ref|XP_003526577.1| PREDICTED: UDP-glycosyltransferase 85A3-like [Glycine max]
 gb|KHN08945.1| UDP-glycosyltransferase 85A3 [Glycine soja]
Length=486

 Score =   138 bits (348),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 81/152 (53%), Positives = 104/152 (68%), Gaps = 2/152 (1%)
 Frame = +2

Query  53   VQRPHAVCIPYPAQGHICAMLKLAKLLHHRGFHITYVLTQLNYTHIMKARNFLPLTQSPT  232
            V++PHAVCIPYPAQGHI  MLKLAK+LH +GFHIT+V T+ N+  ++K+R    L   P+
Sbjct  9    VEKPHAVCIPYPAQGHITPMLKLAKVLHFKGFHITFVNTEFNHKRLLKSRGADSLNGFPS  68

Query  233  FRFETIPDGLPSRENPDTALDVADLCFSTGKNCYAPFMELIQRLNSTAsdvppvscvvsd  412
            FRFETIPDGLP   + D   D   LC S  K C  PF  L+ +LN  +  VPPVSC+VSD
Sbjct  69   FRFETIPDGLP-ESDVDATQDTPTLCESLRKTCLVPFRNLLAKLNH-SRHVPPVSCIVSD  126

Query  413  tvMPFAVGATQELGVPVVLFWPLSAVASLMHI  508
             VM F + A++ELG+P V FW +SA   L ++
Sbjct  127  GVMSFTLIASEELGIPEVFFWTISACGLLCYL  158



>ref|XP_010040275.1| PREDICTED: 7-deoxyloganetin glucosyltransferase-like [Eucalyptus 
grandis]
Length=486

 Score =   138 bits (348),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 78/154 (51%), Positives = 101/154 (66%), Gaps = 2/154 (1%)
 Frame = +2

Query  53   VQRPHAVCIPYPAQGHICAMLKLAKLLHHRGFHITYVLTQLNYTHIMKARNFLPLTQSPT  232
            +Q+PH VCIPYPAQGHI  ML LAKLLHHRGFH+T+V T+ N+  ++++R    L   P+
Sbjct  7    IQKPHVVCIPYPAQGHINPMLNLAKLLHHRGFHVTFVNTEYNHGRLLRSRGPSSLDGLPS  66

Query  233  FRFETIPDGLPSRENPDTALDVADLCFSTGKNCYAPFMELIQRLN--STAsdvppvscvv  406
            F+F TIPDGLP  +  D   D+  LC ST K C   F +L+QRLN  ST    P VSCVV
Sbjct  67   FQFRTIPDGLPPSDATDATQDIPALCQSTSKFCLPYFRDLLQRLNEESTTLGSPLVSCVV  126

Query  407  sdtvMPFAVGATQELGVPVVLFWPLSAVASLMHI  508
            SD  M F + A + +GVP VL W  SA + + ++
Sbjct  127  SDGGMTFTLDAAEAIGVPEVLIWTASACSFMGYV  160



>ref|XP_010060016.1| PREDICTED: 7-deoxyloganetin glucosyltransferase-like [Eucalyptus 
grandis]
Length=480

 Score =   138 bits (348),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 78/148 (53%), Positives = 100/148 (68%), Gaps = 3/148 (2%)
 Frame = +2

Query  56   QRPHAVCIPYPAQGHICAMLKLAKLLHHRGFHITYVLTQLNYTHIMKARNFLPLTQSPTF  235
            Q+PHAVCIP+PAQ HI AML LAKLLHHRGFH+T+V T+ N+  ++++R    L   P+F
Sbjct  3    QKPHAVCIPFPAQSHINAMLNLAKLLHHRGFHVTFVNTEYNHNRLLRSRGPSSLDGLPSF  62

Query  236  RFETIPDGLPSRENPDTALDVADLCFSTGKNCYAPFMELIQRLNSTAsdvpp--vscvvs  409
            RF TIPDGLP  ++ D   DV  LC ST K C   F +L++RLN  ++      VSCVVS
Sbjct  63   RFRTIPDGLPPSDD-DATQDVPALCQSTQKCCLPYFQDLLKRLNEESATSGSPPVSCVVS  121

Query  410  dtvMPFAVGATQELGVPVVLFWPLSAVA  493
            D    F + A + +GVP VLFWP+SA A
Sbjct  122  DGWTTFTLDAAEAVGVPEVLFWPISACA  149



>gb|KCW66549.1| hypothetical protein EUGRSUZ_F003461, partial [Eucalyptus grandis]
Length=174

 Score =   132 bits (332),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 77/154 (50%), Positives = 101/154 (66%), Gaps = 2/154 (1%)
 Frame = +2

Query  53   VQRPHAVCIPYPAQGHICAMLKLAKLLHHRGFHITYVLTQLNYTHIMKARNFLPLTQSPT  232
            +Q+PHAVCIPYPAQGHI  ML LAKLLHHRGFH+T+V T+ N++ ++ +R    L   P+
Sbjct  7    IQKPHAVCIPYPAQGHINPMLNLAKLLHHRGFHVTFVNTEYNHSRLLHSRGPSSLDGLPS  66

Query  233  FRFETIPDGLPSRENPDTALDVADLCFSTGKNCYAPFMELIQRLN--STAsdvppvscvv  406
            FRF TIP+GLP  +  D   D+  LC ST K C   F + ++RLN  ST    PPVSCVV
Sbjct  67   FRFRTIPNGLPPSDVADATQDIPALCQSTSKFCLPYFRDQLERLNEESTTLGSPPVSCVV  126

Query  407  sdtvMPFAVGATQELGVPVVLFWPLSAVASLMHI  508
            SD +M F + A + +GV  VLFW  S    + ++
Sbjct  127  SDGMMSFTLDAAKVIGVSEVLFWTTSVCGFMGYV  160



>ref|XP_002285767.1| PREDICTED: 7-deoxyloganetin glucosyltransferase [Vitis vinifera]
Length=476

 Score =   138 bits (347),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 80/151 (53%), Positives = 100/151 (66%), Gaps = 4/151 (3%)
 Frame = +2

Query  56   QRPHAVCIPYPAQGHICAMLKLAKLLHHRGFHITYVLTQLNYTHIMKARNFLPLTQSPTF  235
            ++PHAVCIPYPAQGHI  MLKLAK LH RGFHIT+V T+ N+  ++K+R    L   P+F
Sbjct  8    EKPHAVCIPYPAQGHINPMLKLAKFLHFRGFHITFVNTEYNHNRLLKSRGPDSLKGIPSF  67

Query  236  RFETIPDGLPSRENPDTALDVADLCFSTGKNCYAPFMELIQRLNSTAsdvppvscvvsdt  415
            +F+TIPDGLP   N D   D   LC ST K+C  PF +L+  LN      PPV+C+VSD 
Sbjct  68   QFKTIPDGLPP-SNVDATQDTPALCVSTTKHCLPPFRDLLSNLNHDG---PPVTCIVSDG  123

Query  416  vMPFAVGATQELGVPVVLFWPLSAVASLMHI  508
             M F + A QELGVP VLFW  SA   + ++
Sbjct  124  AMSFTLDAAQELGVPEVLFWTTSACGFMGYV  154



>ref|XP_007227225.1| hypothetical protein PRUPE_ppa018697mg [Prunus persica]
 gb|EMJ28424.1| hypothetical protein PRUPE_ppa018697mg [Prunus persica]
Length=483

 Score =   138 bits (347),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 80/151 (53%), Positives = 107/151 (71%), Gaps = 2/151 (1%)
 Frame = +2

Query  56   QRPHAVCIPYPAQGHICAMLKLAKLLHHRGFHITYVLTQLNYTHIMKARNFLPLTQSPTF  235
            ++PHAVCIPYPAQGHI  MLK+AKLLH++GFHIT+V T+ N+  ++K+R    L   P+F
Sbjct  8    EKPHAVCIPYPAQGHINPMLKVAKLLHYKGFHITFVNTEFNHKRLLKSRGPNSLDGLPSF  67

Query  236  RFETIPDGLPSRENPDTALDVADLCFSTGKNCYAPFMELIQRLNSTAsdvppvscvvsdt  415
            RFE IPDGLP  +   T  D+  LC+ST ++C   F EL+ +LNS+  D PPVSC+VSD 
Sbjct  68   RFENIPDGLPPTDASVTQ-DIPSLCYSTRRHCLPHFRELLSKLNSSP-DSPPVSCIVSDG  125

Query  416  vMPFAVGATQELGVPVVLFWPLSAVASLMHI  508
            VM F + A +ELG+P VLFW  SA   + ++
Sbjct  126  VMSFTLDAAEELGIPEVLFWTTSACGFMSYV  156



>ref|XP_009103240.1| PREDICTED: UDP-glycosyltransferase 85A1-like [Brassica rapa]
Length=490

 Score =   138 bits (347),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 77/151 (51%), Positives = 106/151 (70%), Gaps = 2/151 (1%)
 Frame = +2

Query  56   QRPHAVCIPYPAQGHICAMLKLAKLLHHRGFHITYVLTQLNYTHIMKARNFLPLTQSPTF  235
            ++PH +C+PYPAQGHI  MLK+AKLLH RGFH+T+V T  N+  ++++R    +   P+F
Sbjct  10   EKPHVICVPYPAQGHINPMLKVAKLLHARGFHVTFVNTVYNHNRLLRSRGPHAVEGLPSF  69

Query  236  RFETIPDGLPSRENPDTALDVADLCFSTGKNCYAPFMELIQRLNSTAsdvppvscvvsdt  415
            RFE+IPDGLP   + D   ++  LC ST KNC  PF EL+QR+N+   DVPPVSC+V+D 
Sbjct  70   RFESIPDGLPET-DVDVTQNITALCDSTMKNCLTPFNELLQRINA-GDDVPPVSCIVADG  127

Query  416  vMPFAVGATQELGVPVVLFWPLSAVASLMHI  508
             M F + A +ELGVP VLFW   A A ++++
Sbjct  128  CMSFTLDAAEELGVPEVLFWTTGASAFMIYL  158



>ref|XP_007222658.1| hypothetical protein PRUPE_ppa004956mg [Prunus persica]
 gb|EMJ23857.1| hypothetical protein PRUPE_ppa004956mg [Prunus persica]
Length=483

 Score =   138 bits (347),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 81/151 (54%), Positives = 105/151 (70%), Gaps = 2/151 (1%)
 Frame = +2

Query  56   QRPHAVCIPYPAQGHICAMLKLAKLLHHRGFHITYVLTQLNYTHIMKARNFLPLTQSPTF  235
            ++PHAVCIPYPAQGHI  ML+L KLLH++GFHIT+V T+ N+  ++K+R    L   P+F
Sbjct  8    KKPHAVCIPYPAQGHITPMLQLTKLLHYKGFHITFVNTEFNHRRLLKSRGPNSLDGLPSF  67

Query  236  RFETIPDGLPSRENPDTALDVADLCFSTGKNCYAPFMELIQRLNSTAsdvppvscvvsdt  415
            RFETIPDGLP  +   T  DV  LC ST KNC APF +L+ +LNS   D PPV+C+VSD 
Sbjct  68   RFETIPDGLPPTDINATQ-DVTALCVSTSKNCLAPFRDLLSKLNSLP-DSPPVTCIVSDG  125

Query  416  vMPFAVGATQELGVPVVLFWPLSAVASLMHI  508
             M F + A QELG+P V+   LSA   + ++
Sbjct  126  GMTFTLDAAQELGIPEVILQTLSACGFMCYL  156



>gb|KFK44335.1| hypothetical protein AALP_AA1G244700 [Arabis alpina]
Length=485

 Score =   138 bits (347),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 81/151 (54%), Positives = 105/151 (70%), Gaps = 2/151 (1%)
 Frame = +2

Query  56   QRPHAVCIPYPAQGHICAMLKLAKLLHHRGFHITYVLTQLNYTHIMKARNFLPLTQSPTF  235
            Q+PHAVC+PYPAQGHI  MLK+AKLLH RGFH+T+V T  N+  ++++R    L   P+F
Sbjct  10   QKPHAVCVPYPAQGHINPMLKVAKLLHARGFHVTFVNTIYNHNRLLRSRGANALDGLPSF  69

Query  236  RFETIPDGLPSRENPDTALDVADLCFSTGKNCYAPFMELIQRLNSTAsdvppvscvvsdt  415
            +FE+IPDGLP  +   T  D+  LC ST KNC  PF +L+Q++N+   DVPPVSC+VSD 
Sbjct  70   QFESIPDGLPETDAEATQ-DIPALCESTMKNCLTPFKDLLQQINAR-DDVPPVSCIVSDG  127

Query  416  vMPFAVGATQELGVPVVLFWPLSAVASLMHI  508
             M F + A  ELGVP VLFW  SA   L ++
Sbjct  128  CMSFTLDAADELGVPEVLFWTTSACGFLAYL  158



>ref|XP_009598263.1| PREDICTED: 7-deoxyloganetin glucosyltransferase-like, partial 
[Nicotiana tomentosiformis]
Length=174

 Score =   132 bits (331),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 78/147 (53%), Positives = 100/147 (68%), Gaps = 2/147 (1%)
 Frame = +2

Query  53   VQRPHAVCIPYPAQGHICAMLKLAKLLHHRGFHITYVLTQLNYTHIMKARNFLPLTQSPT  232
            + +PHAVCIP+PAQGHI  MLKLAKLLH RGFHI++V T+ N+  ++K+R    L+  P+
Sbjct  11   MSKPHAVCIPFPAQGHINPMLKLAKLLHLRGFHISFVNTEFNHRRLLKSRGPSALSGLPS  70

Query  233  FRFETIPDGLPSRENPDTALDVADLCFSTGKNCYAPFMELIQRLNSTAsdvppvscvvsd  412
            F FE+IPDGLP   N D   DV  LC S  K C APF +L+ RLN++  + PPVSC+VSD
Sbjct  71   FHFESIPDGLPP-SNEDATQDVPSLCESCKKLCLAPFRKLVTRLNNS-LNFPPVSCIVSD  128

Query  413  tvMPFAVGATQELGVPVVLFWPLSAVA  493
              M F    ++ELG+P V FW  S  A
Sbjct  129  AGMSFTHEVSKELGIPNVAFWTASGCA  155



>ref|XP_008386105.1| PREDICTED: UDP-glycosyltransferase 85A2-like [Malus domestica]
Length=483

 Score =   138 bits (347),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 80/152 (53%), Positives = 108/152 (71%), Gaps = 2/152 (1%)
 Frame = +2

Query  53   VQRPHAVCIPYPAQGHICAMLKLAKLLHHRGFHITYVLTQLNYTHIMKARNFLPLTQSPT  232
            +++PHAV IPYPAQGHI  ML+LAKLL+++GFHIT+V T+ N+  ++KAR    L   P+
Sbjct  7    IEKPHAVFIPYPAQGHINPMLQLAKLLNYKGFHITFVNTEFNHRRLLKARGPNSLDGLPS  66

Query  233  FRFETIPDGLPSRENPDTALDVADLCFSTGKNCYAPFMELIQRLNSTAsdvppvscvvsd  412
            FRFETIPDGLP+ +   T  D+  LCFST KNC  PF +L+ +LNS   + PPV+C+VSD
Sbjct  67   FRFETIPDGLPTTDVNATQ-DITALCFSTRKNCLEPFKDLLSKLNSLP-NSPPVTCIVSD  124

Query  413  tvMPFAVGATQELGVPVVLFWPLSAVASLMHI  508
              M F + A QELG+PVV+F   SA   + ++
Sbjct  125  GGMTFTLEAAQELGIPVVIFATASACGLMGYL  156



>ref|XP_008219459.1| PREDICTED: UDP-glycosyltransferase 85A2-like [Prunus mume]
Length=483

 Score =   138 bits (347),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 78/152 (51%), Positives = 104/152 (68%), Gaps = 2/152 (1%)
 Frame = +2

Query  53   VQRPHAVCIPYPAQGHICAMLKLAKLLHHRGFHITYVLTQLNYTHIMKARNFLPLTQSPT  232
             ++PHAVCIPYPAQGH+  ML+LAKLLH++GFHIT+V T+ N+  ++K+R    L   P 
Sbjct  7    TEKPHAVCIPYPAQGHVTPMLQLAKLLHYKGFHITFVHTEFNHRRLLKSRGPNSLDGLPF  66

Query  233  FRFETIPDGLPSRENPDTALDVADLCFSTGKNCYAPFMELIQRLNSTAsdvppvscvvsd  412
            FRFETIPDGLP  +   T  D+  LC ST KNC APF +L+ ++NS   D PPV+ +VSD
Sbjct  67   FRFETIPDGLPPTDANATQ-DITALCLSTSKNCLAPFRDLLSKVNSVP-DSPPVTSIVSD  124

Query  413  tvMPFAVGATQELGVPVVLFWPLSAVASLMHI  508
              M F + A QELG+P V+   LSA   + ++
Sbjct  125  GGMTFTLDAAQELGIPEVILETLSACGLMCYL  156



>ref|XP_006388604.1| hypothetical protein POPTR_0140s002102g, partial [Populus trichocarpa]
 gb|ERP47518.1| hypothetical protein POPTR_0140s002102g, partial [Populus trichocarpa]
Length=193

 Score =   132 bits (332),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 74/149 (50%), Positives = 102/149 (68%), Gaps = 1/149 (1%)
 Frame = +2

Query  59   RPHAVCIPYPAQGHICAMLKLAKLLHHRGFHITYVLTQLNYTHIMKARNFLPLTQSPTFR  238
            + HAVC+PYPAQGHI  MLK+AKLLHH+GFHIT+V ++ N+  ++K+R    L   P F+
Sbjct  9    KAHAVCVPYPAQGHITPMLKVAKLLHHKGFHITFVNSEYNHRRLLKSRGRNSLDVFPDFQ  68

Query  239  FETIPDGLPSRENPDTALDVADLCFSTGKNCYAPFMELIQRLNSTAsdvppvscvvsdtv  418
            FETIPDGL  + + D   D++ LC ST K C  PF +L+ +LNS ++ VPPV+C+V D  
Sbjct  69   FETIPDGLGDQLDADVTQDISFLCDSTSKACLDPFRQLLAKLNS-SNVVPPVTCIVVDNG  127

Query  419  MPFAVGATQELGVPVVLFWPLSAVASLMH  505
            M FA+   +EL +PVV F   SA  +L +
Sbjct  128  MSFALDVKEELQIPVVTFLTSSACGTLAY  156



>gb|KFK44336.1| hypothetical protein AALP_AA1G244800 [Arabis alpina]
Length=491

 Score =   137 bits (346),  Expect = 5e-35, Method: Compositional matrix adjust.
 Identities = 76/151 (50%), Positives = 105/151 (70%), Gaps = 2/151 (1%)
 Frame = +2

Query  56   QRPHAVCIPYPAQGHICAMLKLAKLLHHRGFHITYVLTQLNYTHIMKARNFLPLTQSPTF  235
            Q+PH VC+PYPAQGHI  M+K+AKL H RGFH+T+V T  N+  ++++R    +   P+F
Sbjct  10   QKPHVVCVPYPAQGHINPMMKVAKLFHIRGFHVTFVNTVYNHNRLLRSRGAHAVNGLPSF  69

Query  236  RFETIPDGLPSRENPDTALDVADLCFSTGKNCYAPFMELIQRLNSTAsdvppvscvvsdt  415
            RFE+IPDGLP   + D   D+  LC ST KNC  PF EL++++N+   DVPPVSC++SD 
Sbjct  70   RFESIPDGLPET-DVDVTQDITALCASTMKNCLTPFKELLRQINA-GDDVPPVSCILSDG  127

Query  416  vMPFAVGATQELGVPVVLFWPLSAVASLMHI  508
             M F + A +ELGVP VLFW +SA   + ++
Sbjct  128  CMSFTLDAAEELGVPEVLFWTVSACGFMAYL  158



>emb|CDP01078.1| unnamed protein product [Coffea canephora]
Length=501

 Score =   137 bits (346),  Expect = 5e-35, Method: Compositional matrix adjust.
 Identities = 76/149 (51%), Positives = 102/149 (68%), Gaps = 2/149 (1%)
 Frame = +2

Query  56   QRPHAVCIPYPAQGHICAMLKLAKLLHHRGFHITYVLTQLNYTHIMKARNFLPLTQSPTF  235
            ++PHAVCIP+PAQGHI  ML+LAKLLHH+GFHIT+V ++ N+  ++K+R    L   P F
Sbjct  9    KKPHAVCIPFPAQGHINPMLELAKLLHHKGFHITFVNSEFNHKRLLKSRGPDSLNGLPDF  68

Query  236  RFETIPDGLPSRENPDTALDVADLCFSTGKNCYAPFMELIQRLNSTAsdvp-pvscvvsd  412
            +F+TIPDGLP  +  D   D+A LC ST K+   PF EL+ RLN T+S    PVSC++SD
Sbjct  69   QFQTIPDGLPPSD-VDATQDIASLCESTDKHGLGPFRELLARLNDTSSSNVPPVSCIISD  127

Query  413  tvMPFAVGATQELGVPVVLFWPLSAVASL  499
              M F + A +ELG+P +  W  SA + L
Sbjct  128  AAMSFTLAAAEELGIPEIYLWTASACSYL  156



>ref|XP_010030928.1| PREDICTED: 7-deoxyloganetin glucosyltransferase-like [Eucalyptus 
grandis]
Length=486

 Score =   137 bits (346),  Expect = 5e-35, Method: Compositional matrix adjust.
 Identities = 76/153 (50%), Positives = 99/153 (65%), Gaps = 3/153 (2%)
 Frame = +2

Query  56   QRPHAVCIPYPAQGHICAMLKLAKLLHHRGFHITYVLTQLNYTHIMKARNFLPLTQSPTF  235
              PHAV IP+PAQGHI  +L LA++LHHRGFHIT+V T+ N+  ++K+R    L   P F
Sbjct  7    DNPHAVVIPFPAQGHINPILMLARILHHRGFHITFVHTEYNHKRLLKSRGLTSLDGLPRF  66

Query  236  RFETIPDGLPSRENPDTALDVADLCFSTGKNCYAPFMELIQRLNSTAsdvp---pvscvv  406
            RFETIPDG  S  + D    +  LC ST KNC  PFM+L+ RLN  + D      VSCV+
Sbjct  67   RFETIPDGPQSDSDEDVTQHIPSLCESTSKNCLVPFMDLLGRLNDKSVDDTEVPKVSCVI  126

Query  407  sdtvMPFAVGATQELGVPVVLFWPLSAVASLMH  505
            +D  M FA+ A ++L +P VLFW  SA  SL++
Sbjct  127  ADGGMSFALDAAEKLRLPGVLFWTPSACGSLVY  159



>ref|XP_004237927.1| PREDICTED: 7-deoxyloganetin glucosyltransferase-like [Solanum 
lycopersicum]
Length=488

 Score =   137 bits (346),  Expect = 5e-35, Method: Compositional matrix adjust.
 Identities = 78/151 (52%), Positives = 103/151 (68%), Gaps = 3/151 (2%)
 Frame = +2

Query  56   QRPHAVCIPYPAQGHICAMLKLAKLLHHRGFHITYVLTQLNYTHIMKARNFLPLTQSPTF  235
             +PHAVC+PYPAQGHI  MLKLAK+L+ +GFHIT+V T+ N+  ++K+R    L   P+F
Sbjct  10   DKPHAVCLPYPAQGHISPMLKLAKILNRKGFHITFVNTEHNHKRLLKSRGPDSLNGLPSF  69

Query  236  RFETIPDGLPSRENPDTALDVADLCFSTGKNCYAPFMELIQRLNSTAsdvppvscvvsdt  415
            RFE IPDGLP   +PD   D++ LC ST   C  PF EL+ +L +T  +VP VSC+VSD 
Sbjct  70   RFEAIPDGLPPC-DPDATQDISSLCKSTTTTCLGPFKELLAKLKNT--NVPRVSCIVSDG  126

Query  416  vMPFAVGATQELGVPVVLFWPLSAVASLMHI  508
             M F + A Q+LG+P VLFW  SA   L ++
Sbjct  127  SMSFTLSAAQDLGIPQVLFWTPSACGLLCYM  157



>gb|KCW56978.1| hypothetical protein EUGRSUZ_I02655 [Eucalyptus grandis]
Length=461

 Score =   137 bits (345),  Expect = 5e-35, Method: Compositional matrix adjust.
 Identities = 76/153 (50%), Positives = 99/153 (65%), Gaps = 3/153 (2%)
 Frame = +2

Query  56   QRPHAVCIPYPAQGHICAMLKLAKLLHHRGFHITYVLTQLNYTHIMKARNFLPLTQSPTF  235
              PHAV IP+PAQGHI  +L LA++LHHRGFHIT+V T+ N+  ++K+R    L   P F
Sbjct  7    DNPHAVVIPFPAQGHINPILMLARILHHRGFHITFVHTEYNHKRLLKSRGLTSLDGLPRF  66

Query  236  RFETIPDGLPSRENPDTALDVADLCFSTGKNCYAPFMELIQRLNSTAsdvp---pvscvv  406
            RFETIPDG  S  + D    +  LC ST KNC  PFM+L+ RLN  + D      VSCV+
Sbjct  67   RFETIPDGPQSDSDEDVTQHIPSLCESTSKNCLVPFMDLLGRLNDKSVDDTEVPKVSCVI  126

Query  407  sdtvMPFAVGATQELGVPVVLFWPLSAVASLMH  505
            +D  M FA+ A ++L +P VLFW  SA  SL++
Sbjct  127  ADGGMSFALDAAEKLRLPGVLFWTPSACGSLVY  159



>emb|CDP01076.1| unnamed protein product [Coffea canephora]
Length=481

 Score =   137 bits (346),  Expect = 6e-35, Method: Compositional matrix adjust.
 Identities = 81/152 (53%), Positives = 102/152 (67%), Gaps = 2/152 (1%)
 Frame = +2

Query  56   QRPHAVCIPYPAQGHICAMLKLAKLLHHRGFHITYVLTQLNYTHIMKARNFLPLTQSPTF  235
            ++PHAVCIPYPAQGHI  MLKLAKLLHH+GFHIT+V T+ N+  ++K+R    L   P F
Sbjct  8    EKPHAVCIPYPAQGHINPMLKLAKLLHHKGFHITFVNTEFNHKRLLKSRGPDALNGLPDF  67

Query  236  RFETIPDGLPSRENPDTALDVADLCFSTGKNCYAPFMELIQRLNSTAsdvp-pvscvvsd  412
            +F+ IPDGLP   + D   DV  LC ST  +C  PF +L+  LN T+S    PVSC+VSD
Sbjct  68   QFKAIPDGLPPS-DVDATQDVPSLCESTTTHCLGPFRDLLAELNDTSSSQVPPVSCIVSD  126

Query  413  tvMPFAVGATQELGVPVVLFWPLSAVASLMHI  508
             VM F + A  ELGVP +LFW  SA   L ++
Sbjct  127  GVMSFTLEAAAELGVPEILFWTPSACGFLGYM  158



>ref|XP_004299647.1| PREDICTED: UDP-glycosyltransferase 85A2-like [Fragaria vesca 
subsp. vesca]
Length=483

 Score =   137 bits (346),  Expect = 6e-35, Method: Compositional matrix adjust.
 Identities = 80/146 (55%), Positives = 103/146 (71%), Gaps = 2/146 (1%)
 Frame = +2

Query  56   QRPHAVCIPYPAQGHICAMLKLAKLLHHRGFHITYVLTQLNYTHIMKARNFLPLTQSPTF  235
            ++PHAVCIP+PAQGHI  MLKLAKLLHH+GFHIT+V T+ N+  ++K+R    L   P+F
Sbjct  6    EKPHAVCIPFPAQGHINPMLKLAKLLHHKGFHITFVNTEYNHKRLLKSRGPNSLDGLPSF  65

Query  236  RFETIPDGLPSRENPDTALDVADLCFSTGKNCYAPFMELIQRLNSTAsdvppvscvvsdt  415
             FETIPDGLP   + +   D+  LC ST   C   F +L+ +LNS++ ++PPVSC+VSD 
Sbjct  66   TFETIPDGLPPT-DANATQDILSLCVSTRTKCLPHFRDLLSKLNSSS-NIPPVSCIVSDG  123

Query  416  vMPFAVGATQELGVPVVLFWPLSAVA  493
            VM F V A QELG+P VLFW  SA  
Sbjct  124  VMSFTVEAAQELGIPEVLFWTTSACG  149



>emb|CDY46645.1| BnaA07g10510D [Brassica napus]
Length=458

 Score =   137 bits (345),  Expect = 6e-35, Method: Compositional matrix adjust.
 Identities = 77/151 (51%), Positives = 105/151 (70%), Gaps = 2/151 (1%)
 Frame = +2

Query  56   QRPHAVCIPYPAQGHICAMLKLAKLLHHRGFHITYVLTQLNYTHIMKARNFLPLTQSPTF  235
            ++PH +C+PYPAQGHI  MLK+AKLLH RGFH+T+V T  N+  ++++R    +   P+F
Sbjct  10   EKPHVICVPYPAQGHINPMLKVAKLLHARGFHVTFVNTVYNHNRLIRSRGPHAVEGLPSF  69

Query  236  RFETIPDGLPSRENPDTALDVADLCFSTGKNCYAPFMELIQRLNSTAsdvppvscvvsdt  415
            RFE+IPDGLP   + D   D+  LC ST KNC  PF EL+QR+N+   DVPPVSC+V+D 
Sbjct  70   RFESIPDGLPET-DVDVTQDITALCDSTMKNCLTPFKELLQRINA-GDDVPPVSCIVADG  127

Query  416  vMPFAVGATQELGVPVVLFWPLSAVASLMHI  508
             M F +   +ELGVP VLFW   A A ++++
Sbjct  128  CMSFTLEPAEELGVPEVLFWTTGASAFMIYL  158



>ref|NP_173656.1| UDP-glycosyltransferase 85A1 [Arabidopsis thaliana]
 sp|Q9SK82.1|U85A1_ARATH RecName: Full=UDP-glycosyltransferase 85A1; AltName: Full=Cytokinin-O-glucosyltransferase 
2; AltName: Full=Zeatin O-glucosyltransferase 
2; Short=AtZOG2 [Arabidopsis thaliana]
 gb|AAF18537.1|AC006551_23 Putative UDP-glucose glucosyltransferase [Arabidopsis thaliana]
 gb|AAL91228.1| putative UDP-glucose glucosyltransferase [Arabidopsis thaliana]
 gb|AAP49527.1| At1g22400 [Arabidopsis thaliana]
 gb|AEE30237.1| UDP-glycosyltransferase 85A1 [Arabidopsis thaliana]
 gb|AHL38930.1| glycosyltransferase, partial [Arabidopsis thaliana]
Length=489

 Score =   137 bits (346),  Expect = 6e-35, Method: Compositional matrix adjust.
 Identities = 78/151 (52%), Positives = 103/151 (68%), Gaps = 2/151 (1%)
 Frame = +2

Query  56   QRPHAVCIPYPAQGHICAMLKLAKLLHHRGFHITYVLTQLNYTHIMKARNFLPLTQSPTF  235
            Q+PH VC+PYPAQGHI  M+++AKLLH RGF++T+V T  N+   +++R    L   P+F
Sbjct  10   QKPHVVCVPYPAQGHINPMMRVAKLLHARGFYVTFVNTVYNHNRFLRSRGSNALDGLPSF  69

Query  236  RFETIPDGLPSRENPDTALDVADLCFSTGKNCYAPFMELIQRLNSTAsdvppvscvvsdt  415
            RFE+I DGLP   + D   D+  LC ST KNC APF EL+QR+N+   +VPPVSC+VSD 
Sbjct  70   RFESIADGLPET-DMDATQDITALCESTMKNCLAPFRELLQRINA-GDNVPPVSCIVSDG  127

Query  416  vMPFAVGATQELGVPVVLFWPLSAVASLMHI  508
             M F +   +ELGVP VLFW  S  A L ++
Sbjct  128  CMSFTLDVAEELGVPEVLFWTTSGCAFLAYL  158



>ref|XP_008219316.1| PREDICTED: UDP-glycosyltransferase 85A2-like [Prunus mume]
Length=483

 Score =   137 bits (345),  Expect = 6e-35, Method: Compositional matrix adjust.
 Identities = 81/152 (53%), Positives = 105/152 (69%), Gaps = 2/152 (1%)
 Frame = +2

Query  53   VQRPHAVCIPYPAQGHICAMLKLAKLLHHRGFHITYVLTQLNYTHIMKARNFLPLTQSPT  232
             ++PHAVCIPYPAQGHI  ML+L KLLH++GFHIT+V T+ N+  ++K+R    L   P+
Sbjct  7    TEKPHAVCIPYPAQGHITPMLQLTKLLHYKGFHITFVNTEFNHRRLLKSRGPNSLDGLPS  66

Query  233  FRFETIPDGLPSRENPDTALDVADLCFSTGKNCYAPFMELIQRLNSTAsdvppvscvvsd  412
            FRFETIPDGLP  +   T  DV  LC ST KNC APF +L+ +LNS   D PPV+C+VSD
Sbjct  67   FRFETIPDGLPPTDTNATQ-DVTALCVSTRKNCLAPFRDLLSKLNSLP-DSPPVTCIVSD  124

Query  413  tvMPFAVGATQELGVPVVLFWPLSAVASLMHI  508
              M F + A QELG+P V+F   SA   + ++
Sbjct  125  GGMIFTLDAAQELGIPEVIFQTPSACGLMCYL  156



>ref|XP_009391314.1| PREDICTED: 7-deoxyloganetin glucosyltransferase-like [Musa acuminata 
subsp. malaccensis]
Length=482

 Score =   137 bits (345),  Expect = 7e-35, Method: Compositional matrix adjust.
 Identities = 80/149 (54%), Positives = 101/149 (68%), Gaps = 1/149 (1%)
 Frame = +2

Query  62   PHAVCIPYPAQGHICAMLKLAKLLHHRGFHITYVLTQLNYTHIMKARNFLPLTQSPTFRF  241
            PHAVCIPYPAQGHI  MLKLAKLLH +GF IT+V T+ N+  ++ AR    L   P FRF
Sbjct  9    PHAVCIPYPAQGHITPMLKLAKLLHSKGFRITFVNTEYNHRRLLNARGPSALDGLPDFRF  68

Query  242  ETIPDGLPSRENPDTALDVADLCFSTGKNCYAPFMELIQRLNSTAsdvppvscvvsdtvM  421
            ETIPDGLP  ++ D   D+  LC ST   C  PF++L+  LN  +S+ PPVSC+VSD VM
Sbjct  69   ETIPDGLPPSDD-DATQDIPALCRSTMTTCLPPFLDLLSELNDPSSERPPVSCIVSDGVM  127

Query  422  PFAVGATQELGVPVVLFWPLSAVASLMHI  508
             F + A ++LG+P VLFW  SA   + +I
Sbjct  128  SFTLDAARQLGIPEVLFWTTSACGFMGYI  156



>ref|XP_009341754.1| PREDICTED: 7-deoxyloganetin glucosyltransferase-like [Pyrus x 
bretschneideri]
Length=485

 Score =   137 bits (345),  Expect = 7e-35, Method: Compositional matrix adjust.
 Identities = 81/151 (54%), Positives = 104/151 (69%), Gaps = 2/151 (1%)
 Frame = +2

Query  56   QRPHAVCIPYPAQGHICAMLKLAKLLHHRGFHITYVLTQLNYTHIMKARNFLPLTQSPTF  235
            ++PHAVCIP+PAQGHI  ML +AKLLH +GFHIT+V T+ N+  ++K+R    L   P+F
Sbjct  8    EKPHAVCIPFPAQGHINPMLNVAKLLHFKGFHITFVNTEFNHKRLLKSRGSNSLDGLPSF  67

Query  236  RFETIPDGLPSRENPDTALDVADLCFSTGKNCYAPFMELIQRLNSTAsdvppvscvvsdt  415
            +FETIPDGLP   N +   D+  LC ST K C   F EL+ +LNS+  D PPVSC+VSD 
Sbjct  68   QFETIPDGLPPT-NANVTQDIPSLCHSTKKTCLPHFRELLSKLNSSP-DSPPVSCIVSDG  125

Query  416  vMPFAVGATQELGVPVVLFWPLSAVASLMHI  508
            VM F + A QELG+P VLFW  SA   L ++
Sbjct  126  VMSFTLDAAQELGIPEVLFWTTSACGLLAYM  156



>ref|XP_004136284.1| PREDICTED: UDP-glycosyltransferase 85A2-like [Cucumis sativus]
 ref|XP_004167272.1| PREDICTED: UDP-glycosyltransferase 85A2-like [Cucumis sativus]
 gb|KGN60220.1| hypothetical protein Csa_3G889760 [Cucumis sativus]
Length=486

 Score =   137 bits (345),  Expect = 7e-35, Method: Compositional matrix adjust.
 Identities = 83/151 (55%), Positives = 102/151 (68%), Gaps = 2/151 (1%)
 Frame = +2

Query  56   QRPHAVCIPYPAQGHICAMLKLAKLLHHRGFHITYVLTQLNYTHIMKARNFLPLTQSPTF  235
            Q+PHAVCIPYPAQGHI  MLKLAKLLH  GFHIT+V T  N+  ++K+R    L    +F
Sbjct  9    QQPHAVCIPYPAQGHINPMLKLAKLLHSFGFHITFVNTDFNHRRLLKSRGPTALDGISSF  68

Query  236  RFETIPDGLPSRENPDTALDVADLCFSTGKNCYAPFMELIQRLNSTAsdvppvscvvsdt  415
            +FE+IPDGLP   + D   D+  LC ST + C  PF EL+ +LN    +VP VSC+VSD 
Sbjct  69   QFESIPDGLPPT-DVDATQDIPSLCQSTRRLCLQPFKELVSKLNCDP-NVPQVSCIVSDG  126

Query  416  vMPFAVGATQELGVPVVLFWPLSAVASLMHI  508
            VM F V A +ELGVPVVLFW  SA   L ++
Sbjct  127  VMSFTVDAAEELGVPVVLFWTTSACGFLAYL  157



>ref|XP_002323976.2| hypothetical protein POPTR_0017s07920g [Populus trichocarpa]
 gb|EEF04109.2| hypothetical protein POPTR_0017s07920g [Populus trichocarpa]
Length=482

 Score =   137 bits (345),  Expect = 7e-35, Method: Compositional matrix adjust.
 Identities = 74/149 (50%), Positives = 104/149 (70%), Gaps = 1/149 (1%)
 Frame = +2

Query  59   RPHAVCIPYPAQGHICAMLKLAKLLHHRGFHITYVLTQLNYTHIMKARNFLPLTQSPTFR  238
            + HAVC+PYPAQGHI  MLK+AKLLHH+GFHIT+V ++ N+  ++K+R    L   P F+
Sbjct  9    KAHAVCVPYPAQGHITPMLKVAKLLHHKGFHITFVNSEYNHRRLLKSRGRNSLDVLPDFQ  68

Query  239  FETIPDGLPSRENPDTALDVADLCFSTGKNCYAPFMELIQRLNSTAsdvppvscvvsdtv  418
            FETIPDGL  + + D   D + LC ST K C  PF +L+ +LNS++  VPPV+C+V+D+ 
Sbjct  69   FETIPDGLGDQIDVDVTQDTSFLCDSTSKACLDPFRQLLAKLNSSS-VVPPVTCIVADSG  127

Query  419  MPFAVGATQELGVPVVLFWPLSAVASLMH  505
            M FA+   +EL +PV+ FW  SA  +L +
Sbjct  128  MSFALDVKEELQIPVITFWTSSACGTLAY  156



>ref|XP_010040276.1| PREDICTED: 7-deoxyloganetin glucosyltransferase-like [Eucalyptus 
grandis]
Length=554

 Score =   137 bits (346),  Expect = 8e-35, Method: Compositional matrix adjust.
 Identities = 77/147 (52%), Positives = 96/147 (65%), Gaps = 3/147 (2%)
 Frame = +2

Query  59   RPHAVCIPYPAQGHICAMLKLAKLLHHRGFHITYVLTQLNYTHIMKARNFLPLTQSPTFR  238
            +PHAVCIP+PAQ HI AML LAKLLHHRGFH+T+V T+ N+  +M++R    L   P+FR
Sbjct  4    KPHAVCIPFPAQSHISAMLNLAKLLHHRGFHVTFVNTEYNHNRLMRSRGPSSLDGLPSFR  63

Query  239  FETIPDGLPSRENPDTALDVADLCFSTGKNCYAPFMELIQRLNSTAsdvpp--vscvvsd  412
            F TIPDGLP   N D   D+  LC ST K C   F +LI+RLN  +       VSCVVSD
Sbjct  64   FRTIPDGLPP-SNGDVTQDILSLCQSTQKCCLPHFQDLIERLNEESVMSGSPPVSCVVSD  122

Query  413  tvMPFAVGATQELGVPVVLFWPLSAVA  493
            + M F +   + + VP VLFWP+S  A
Sbjct  123  SSMTFTLDTAEAVSVPEVLFWPMSVCA  149



>ref|XP_006472584.1| PREDICTED: UDP-glycosyltransferase 85A2-like [Citrus sinensis]
Length=503

 Score =   137 bits (345),  Expect = 8e-35, Method: Compositional matrix adjust.
 Identities = 75/146 (51%), Positives = 100/146 (68%), Gaps = 3/146 (2%)
 Frame = +2

Query  56   QRPHAVCIPYPAQGHICAMLKLAKLLHHRGFHITYVLTQLNYTHIMKARNFLPLTQSPTF  235
            +RPHAVC+P+PAQGHI  M +LAKLLHH+GFHIT+V T+ N   ++K++    L   PTF
Sbjct  11   RRPHAVCVPHPAQGHINPMFQLAKLLHHKGFHITFVNTEFNQRRLLKSQGPDSLNAVPTF  70

Query  236  RFETIPDGLPSRENPDTALDVADLCFSTGKNCYAPFMELIQRLNSTAsdvpp--vscvvs  409
            RFETIPDGLP  +  D   D+  LC ST + C APF EL+ RLN++A       V+C+VS
Sbjct  71   RFETIPDGLPPSD-ADATQDIPSLCDSTKRTCSAPFQELLTRLNNSALSNVNPPVTCIVS  129

Query  410  dtvMPFAVGATQELGVPVVLFWPLSA  487
            D  M F + A+++L +P VLF+  SA
Sbjct  130  DWAMGFTLKASKQLNIPNVLFFTASA  155



>ref|XP_006416204.1| hypothetical protein EUTSA_v10007489mg [Eutrema salsugineum]
 gb|ESQ34557.1| hypothetical protein EUTSA_v10007489mg [Eutrema salsugineum]
Length=487

 Score =   137 bits (344),  Expect = 8e-35, Method: Compositional matrix adjust.
 Identities = 78/151 (52%), Positives = 104/151 (69%), Gaps = 2/151 (1%)
 Frame = +2

Query  56   QRPHAVCIPYPAQGHICAMLKLAKLLHHRGFHITYVLTQLNYTHIMKARNFLPLTQSPTF  235
            Q+PHAVC+P+PAQGHI  M+K+AKLLH +GFH+T+V T  N   ++++R    L   P+F
Sbjct  10   QKPHAVCVPFPAQGHINPMMKVAKLLHAKGFHVTFVNTVYNQNRLIRSRGQKALDGFPSF  69

Query  236  RFETIPDGLPSRENPDTALDVADLCFSTGKNCYAPFMELIQRLNSTAsdvppvscvvsdt  415
            RF++IPDGLP  +  D   DV  LC ST KNC  PF ELI+R+N    DVPPVSC+V+D 
Sbjct  70   RFKSIPDGLPEIDG-DKMQDVPSLCESTMKNCLTPFKELIRRIN-VEDDVPPVSCIVADG  127

Query  416  vMPFAVGATQELGVPVVLFWPLSAVASLMHI  508
            +M F +   +ELGVP VLFW  SA   + ++
Sbjct  128  LMTFTLDVAEELGVPEVLFWTTSACGFMAYL  158



>ref|XP_002323758.2| hypothetical protein POPTR_0017s07930g [Populus trichocarpa]
 gb|EEF03891.2| hypothetical protein POPTR_0017s07930g [Populus trichocarpa]
Length=482

 Score =   137 bits (344),  Expect = 8e-35, Method: Compositional matrix adjust.
 Identities = 75/148 (51%), Positives = 98/148 (66%), Gaps = 1/148 (1%)
 Frame = +2

Query  56   QRPHAVCIPYPAQGHICAMLKLAKLLHHRGFHITYVLTQLNYTHIMKARNFLPLTQSPTF  235
             +PHAVCIP+PAQGHI  MLKLAKLLH +GFHIT+V T+ N+  ++K+R    L   P F
Sbjct  8    NKPHAVCIPFPAQGHINPMLKLAKLLHFKGFHITFVNTEYNHRRLLKSRGSSSLDGLPEF  67

Query  236  RFETIPDGLPSRENPDTALDVADLCFSTGKNCYAPFMELIQRLNSTAsdvppvscvvsdt  415
            +F+TIPDGLP  +  D   D+  LC  T   C APF +LI +LNS++  VP V+C++SD 
Sbjct  68   QFKTIPDGLPPSDIADATQDIPSLCDCTSTTCLAPFRDLIAKLNSSS-IVPQVTCIISDA  126

Query  416  vMPFAVGATQELGVPVVLFWPLSAVASL  499
             M F + A +E G+P  LFW  SA   L
Sbjct  127  CMSFTLDAAEEFGIPEALFWTPSACGVL  154



>ref|XP_010064217.1| PREDICTED: 7-deoxyloganetin glucosyltransferase-like [Eucalyptus 
grandis]
Length=485

 Score =   137 bits (344),  Expect = 8e-35, Method: Compositional matrix adjust.
 Identities = 77/149 (52%), Positives = 101/149 (68%), Gaps = 3/149 (2%)
 Frame = +2

Query  53   VQRPHAVCIPYPAQGHICAMLKLAKLLHHRGFHITYVLTQLNYTHIMKARNFLPLTQSPT  232
            +Q+PHAVCIP PAQGHI  ML LAKLLH RGFH+T+V T+ N++ ++++R    L   P+
Sbjct  7    IQKPHAVCIPAPAQGHINPMLNLAKLLHCRGFHVTFVNTEYNHSRLLRSRGPSSLDGLPS  66

Query  233  FRFETIPDGLPSRENPDTALDVADLCFSTGKNCYAPFMELIQRLNSTAsdvpp--vscvv  406
            FRF TIPDGLP  +  DT  D+  LC ST + C   F +L++RLN  ++      VSCVV
Sbjct  67   FRFRTIPDGLPPSDG-DTTQDIPALCQSTQRCCLPYFQDLLKRLNEESATSGSPPVSCVV  125

Query  407  sdtvMPFAVGATQELGVPVVLFWPLSAVA  493
            SD  M F + A + +GVP VLFWP+SA A
Sbjct  126  SDITMTFTLDAAEAIGVPEVLFWPISACA  154



>ref|XP_006363268.1| PREDICTED: UDP-glycosyltransferase 85A1-like [Solanum tuberosum]
Length=492

 Score =   137 bits (344),  Expect = 9e-35, Method: Compositional matrix adjust.
 Identities = 77/152 (51%), Positives = 101/152 (66%), Gaps = 2/152 (1%)
 Frame = +2

Query  56   QRPHAVCIPYPAQGHICAMLKLAKLLHHRGFHITYVLTQLNYTHIMKARNFLPLTQSPTF  235
             +PHAVC+PYPAQGHI  MLKLAK+L+H+GFHIT+V T+ N   ++K+R    L   P+F
Sbjct  10   DKPHAVCLPYPAQGHISPMLKLAKILNHKGFHITFVNTEHNQKRLLKSRGPDGLKNLPSF  69

Query  236  RFETIPDGLPSRENPDTALDVADLCFSTGKNCYAPFMELIQRLNSTAsdvp-pvscvvsd  412
            RFE IPDGLP  +  D   D+  LC ST   C  PF EL+ +LN+T S    PVSC+VSD
Sbjct  70   RFEAIPDGLPPCD-ADATQDIIALCKSTDTTCLGPFRELLAKLNNTCSSKVPPVSCIVSD  128

Query  413  tvMPFAVGATQELGVPVVLFWPLSAVASLMHI  508
              + F + A QELG+P V FW  +A  +L ++
Sbjct  129  GSISFTLTAAQELGIPQVFFWTFAACGTLSYM  160



>gb|ABW96222.1| glucosyltransferase [Linum usitatissimum]
Length=491

 Score =   137 bits (344),  Expect = 9e-35, Method: Compositional matrix adjust.
 Identities = 82/156 (53%), Positives = 103/156 (66%), Gaps = 7/156 (4%)
 Frame = +2

Query  50   EVQRPHAVCIPYPAQGHICAMLKLAKLLHHRGFHITYVLTQLNYTHIMKARNFLPLTQSP  229
            E  +PHAVCIPYPAQGHI  MLKLAKLLHHRGFH+T+V T+ N+  + K++    ++  P
Sbjct  8    EKPKPHAVCIPYPAQGHITPMLKLAKLLHHRGFHVTFVNTEYNHNRLRKSQ---AVSDLP  64

Query  230  TFRFETIPDGLPSRENPDTALDVADLCFSTGKNCYAPFMELIQRLNSTAsdvpp---vsc  400
            +FRF TIPDGLP  ++ D   D+  LC ST + C   F EL+ +LN  AS       VSC
Sbjct  65   SFRFATIPDGLPPTDS-DVTQDIPSLCESTRRTCLPHFKELLAKLNDVASFEDGVPPVSC  123

Query  401  vvsdtvMPFAVGATQELGVPVVLFWPLSAVASLMHI  508
            VVSD VM F + A +ELGVP VLFW  SA   L ++
Sbjct  124  VVSDGVMSFTLDAAEELGVPEVLFWTTSACGFLGYM  159



>ref|XP_004237928.1| PREDICTED: 7-deoxyloganetin glucosyltransferase-like [Solanum 
lycopersicum]
Length=482

 Score =   137 bits (344),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 80/152 (53%), Positives = 106/152 (70%), Gaps = 2/152 (1%)
 Frame = +2

Query  56   QRPHAVCIPYPAQGHICAMLKLAKLLHHRGFHITYVLTQLNYTHIMKARNFLPLTQSPTF  235
             +PHAVCIPYPAQGHI  MLKLAK+L+++GFHIT+V  + N+  ++K+R    L   P+F
Sbjct  8    NKPHAVCIPYPAQGHINPMLKLAKILNYKGFHITFVNNEYNHRRLLKSRGPDSLKGLPSF  67

Query  236  RFETIPDGLPSRENPDTALDVADLCFSTGKNCYAPFMELIQRLNST-Asdvppvscvvsd  412
            +FETIPDGLP  +  D+  D+  LC ST K C  PF EL+ +LN T +S+VPPVSC++SD
Sbjct  68   QFETIPDGLPPCD-ADSTQDIPALCESTTKTCLGPFKELLAKLNDTCSSNVPPVSCIISD  126

Query  413  tvMPFAVGATQELGVPVVLFWPLSAVASLMHI  508
              M F + A QELG+P V FW  SA   L ++
Sbjct  127  GCMSFTLAAAQELGIPEVFFWTPSACGFLGYM  158



>ref|XP_011009478.1| PREDICTED: 7-deoxyloganetin glucosyltransferase-like [Populus 
euphratica]
 ref|XP_011009479.1| PREDICTED: 7-deoxyloganetin glucosyltransferase-like [Populus 
euphratica]
 ref|XP_011009480.1| PREDICTED: 7-deoxyloganetin glucosyltransferase-like [Populus 
euphratica]
Length=482

 Score =   137 bits (344),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 75/149 (50%), Positives = 103/149 (69%), Gaps = 1/149 (1%)
 Frame = +2

Query  59   RPHAVCIPYPAQGHICAMLKLAKLLHHRGFHITYVLTQLNYTHIMKARNFLPLTQSPTFR  238
            + HAVC+PYPAQGHI  MLK+AKLLHH+GFHIT+V ++ N+  ++K+R    L   P F+
Sbjct  9    KAHAVCLPYPAQGHITPMLKVAKLLHHKGFHITFVNSEYNHRRLLKSRGRNSLDVLPDFQ  68

Query  239  FETIPDGLPSRENPDTALDVADLCFSTGKNCYAPFMELIQRLNSTAsdvppvscvvsdtv  418
            FETIPDGL  + + D   D + LC ST K C  PF +L+ +LNS+ + VPPV+C+V+D  
Sbjct  69   FETIPDGLGDQLDADVTQDTSFLCDSTSKACLDPFRQLLAKLNSS-NVVPPVTCIVADGG  127

Query  419  MPFAVGATQELGVPVVLFWPLSAVASLMH  505
            M FA+    EL +PVV+FW  SA  +L +
Sbjct  128  MSFALDVKDELQIPVVIFWTSSACGTLAY  156



>ref|XP_008466222.1| PREDICTED: UDP-glycosyltransferase 85A2 [Cucumis melo]
Length=487

 Score =   137 bits (344),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 83/151 (55%), Positives = 101/151 (67%), Gaps = 2/151 (1%)
 Frame = +2

Query  56   QRPHAVCIPYPAQGHICAMLKLAKLLHHRGFHITYVLTQLNYTHIMKARNFLPLTQSPTF  235
            Q+PHAVCIPYPAQGHI  MLKLAKLLH  GFHIT+V T  N+  ++K+R    L    +F
Sbjct  9    QQPHAVCIPYPAQGHINPMLKLAKLLHSFGFHITFVNTDFNHRRLLKSRGPKALDGLSSF  68

Query  236  RFETIPDGLPSRENPDTALDVADLCFSTGKNCYAPFMELIQRLNSTAsdvppvscvvsdt  415
            RFE+IPDGLP  +  D   D+  LC ST + C  PF EL+ +LN    +VP VSC+VSD 
Sbjct  69   RFESIPDGLPPTD-VDATQDIPSLCQSTRQFCLQPFKELVSKLNCDP-NVPQVSCIVSDG  126

Query  416  vMPFAVGATQELGVPVVLFWPLSAVASLMHI  508
            VM F + A  ELGVPVVLFW  SA   L ++
Sbjct  127  VMSFTIDAADELGVPVVLFWTTSACGFLGYL  157



>ref|XP_004252532.1| PREDICTED: 7-deoxyloganetin glucosyltransferase-like [Solanum 
lycopersicum]
Length=484

 Score =   136 bits (343),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 75/156 (48%), Positives = 104/156 (67%), Gaps = 3/156 (2%)
 Frame = +2

Query  47   MEVQRPHAVCIPYPAQGHICAMLKLAKLLHHRGFHITYVLTQLNYTHIMKARNFLPLTQS  226
            +E+ +PHAVC+PYPAQGHI  MLKLAK+LHH+GFHIT+V T+  +  ++K+R    L   
Sbjct  6    VEINKPHAVCVPYPAQGHINPMLKLAKILHHKGFHITFVNTEFIHRRLLKSRGPHSLECL  65

Query  227  PTFRFETIPDGLPSRENPDTALDVADLCFSTGKNCYAPFMELIQRLNSTAsdvpp--vsc  400
             +FRFETIPDGLP+ +  D   D+  +C ST + C APF +L+ +LN T++      V+C
Sbjct  66   SSFRFETIPDGLPTCD-ADATQDIPSVCKSTTETCLAPFRDLLAKLNGTSNTSNVPPVTC  124

Query  401  vvsdtvMPFAVGATQELGVPVVLFWPLSAVASLMHI  508
            +VSD +M F + A QEL VP V  W  SA   L ++
Sbjct  125  IVSDGIMSFTLAAAQELAVPEVQLWTTSACGFLGYM  160



>ref|XP_010910271.1| PREDICTED: 7-deoxyloganetin glucosyltransferase-like [Elaeis 
guineensis]
Length=476

 Score =   136 bits (343),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 77/151 (51%), Positives = 100/151 (66%), Gaps = 1/151 (1%)
 Frame = +2

Query  56   QRPHAVCIPYPAQGHICAMLKLAKLLHHRGFHITYVLTQLNYTHIMKARNFLPLTQSPTF  235
            ++PHAVCIPYPAQGH+  +LKLAKLLH RGF+IT+V T  N+  ++++     L   P F
Sbjct  6    EKPHAVCIPYPAQGHVTPLLKLAKLLHVRGFYITFVNTHFNHNRLLRSGAISSLDSLPDF  65

Query  236  RFETIPDGLPSRENPDTALDVADLCFSTGKNCYAPFMELIQRLNSTAsdvppvscvvsdt  415
            RFE+IPDGLP  +  D   DV  LC S  KNC  PF +LI +LN  +S  P VSC+VSD 
Sbjct  66   RFESIPDGLPPSDE-DATQDVPSLCDSIPKNCLPPFRDLITKLNGPSSPTPKVSCIVSDG  124

Query  416  vMPFAVGATQELGVPVVLFWPLSAVASLMHI  508
            VM F + A +EL +P VLFW  SA   + ++
Sbjct  125  VMSFTLDAAKELQIPEVLFWTTSACGMMGYL  155



>ref|XP_002285771.1| PREDICTED: 7-deoxyloganetin glucosyltransferase [Vitis vinifera]
Length=476

 Score =   136 bits (343),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 81/152 (53%), Positives = 102/152 (67%), Gaps = 6/152 (4%)
 Frame = +2

Query  56   QRPHAVCIPYPAQGHICAMLKLAKLLHHRGFHITYVLTQLNYTHIMKARNFLPLTQSPTF  235
            ++PHAVCIPYPAQGHI  MLKLAK LH RGFHIT+V T+ N+  ++K+R    L   P+F
Sbjct  8    EKPHAVCIPYPAQGHINPMLKLAKFLHFRGFHITFVNTEYNHNRLLKSRGPDSLKGIPSF  67

Query  236  RFETIPDG-LPSRENPDTALDVADLCFSTGKNCYAPFMELIQRLNSTAsdvppvscvvsd  412
            +F+TIPDG LPS  N D   D+  LC ST K+C  PF +L+  LN      PPV+C+VSD
Sbjct  68   QFKTIPDGLLPS--NVDATQDIPALCVSTRKHCLPPFRDLLSNLNHDG---PPVTCIVSD  122

Query  413  tvMPFAVGATQELGVPVVLFWPLSAVASLMHI  508
              M F + A QELGVP VLFW  SA   + ++
Sbjct  123  GAMSFTLDAAQELGVPEVLFWTTSACGFMGYV  154



>emb|CBI19181.3| unnamed protein product [Vitis vinifera]
Length=654

 Score =   137 bits (346),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 80/151 (53%), Positives = 100/151 (66%), Gaps = 4/151 (3%)
 Frame = +2

Query  56   QRPHAVCIPYPAQGHICAMLKLAKLLHHRGFHITYVLTQLNYTHIMKARNFLPLTQSPTF  235
            ++PHAVCIPYPAQGHI  MLKLAK LH RGFHIT+V T+ N+  ++K+R    L   P+F
Sbjct  8    EKPHAVCIPYPAQGHINPMLKLAKFLHFRGFHITFVNTEYNHNRLLKSRGPDSLKGIPSF  67

Query  236  RFETIPDGLPSRENPDTALDVADLCFSTGKNCYAPFMELIQRLNSTAsdvppvscvvsdt  415
            +F+TIPDGLP   N D   D   LC ST K+C  PF +L+  LN      PPV+C+VSD 
Sbjct  68   QFKTIPDGLPP-SNVDATQDTPALCVSTTKHCLPPFRDLLSNLNHDG---PPVTCIVSDG  123

Query  416  vMPFAVGATQELGVPVVLFWPLSAVASLMHI  508
             M F + A QELGVP VLFW  SA   + ++
Sbjct  124  AMSFTLDAAQELGVPEVLFWTTSACGFMGYV  154


 Score =   115 bits (288),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 75/152 (49%), Positives = 92/152 (61%), Gaps = 26/152 (17%)
 Frame = +2

Query  56   QRPHAVCIPYPAQGHICAMLKLAKLLHHRGFHITYVLTQLNYTHIMKARNFLPLTQSPTF  235
            ++PHAVCIPYPAQGHI  MLKLAK LH RGFHIT+ +                    P+F
Sbjct  397  EKPHAVCIPYPAQGHINPMLKLAKFLHFRGFHITFGI--------------------PSF  436

Query  236  RFETIPDG-LPSRENPDTALDVADLCFSTGKNCYAPFMELIQRLNSTAsdvppvscvvsd  412
            +F+TIPDG LPS  N D   D+  LC ST K+C  PF +L+  LN      PPV+C+VSD
Sbjct  437  QFKTIPDGLLPS--NVDATQDIPALCVSTRKHCLPPFRDLLSNLNHDG---PPVTCIVSD  491

Query  413  tvMPFAVGATQELGVPVVLFWPLSAVASLMHI  508
              M F + A QELGVP VLFW  SA   + ++
Sbjct  492  GAMSFTLDAAQELGVPEVLFWTTSACGFMGYV  523



>ref|XP_006433964.1| hypothetical protein CICLE_v10004031mg [Citrus clementina]
 gb|ESR47204.1| hypothetical protein CICLE_v10004031mg [Citrus clementina]
Length=561

 Score =   137 bits (344),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 75/148 (51%), Positives = 100/148 (68%), Gaps = 3/148 (2%)
 Frame = +2

Query  56   QRPHAVCIPYPAQGHICAMLKLAKLLHHRGFHITYVLTQLNYTHIMKARNFLPLTQSPTF  235
            +RPHAVC+P+PAQGHI  M +LAKLLHH+GFHIT+V T+ N   ++K++    L   PTF
Sbjct  68   RRPHAVCVPHPAQGHINPMFQLAKLLHHKGFHITFVNTEFNQRRLLKSQGPDSLNAVPTF  127

Query  236  RFETIPDGLPSRENPDTALDVADLCFSTGKNCYAPFMELIQRLNSTAsdvpp--vscvvs  409
            RFETIPDGLP  +  D   D+  LC ST + C APF EL+ RLN++A       V+C+VS
Sbjct  128  RFETIPDGLPPSD-ADATQDIPSLCDSTRRTCSAPFQELLTRLNNSALSNVNPPVTCIVS  186

Query  410  dtvMPFAVGATQELGVPVVLFWPLSAVA  493
            D  M F + A+++L +P VLF+  SA  
Sbjct  187  DWAMGFTLKASKQLNIPNVLFFTASACG  214



>ref|XP_002893223.1| transcription factor/ transferase, transferring glycosyl groups 
[Arabidopsis lyrata subsp. lyrata]
 gb|EFH69482.1| transcription factor/ transferase, transferring glycosyl groups 
[Arabidopsis lyrata subsp. lyrata]
Length=491

 Score =   136 bits (343),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 79/151 (52%), Positives = 103/151 (68%), Gaps = 2/151 (1%)
 Frame = +2

Query  56   QRPHAVCIPYPAQGHICAMLKLAKLLHHRGFHITYVLTQLNYTHIMKARNFLPLTQSPTF  235
            Q+PH VC+PYPAQGHI  MLK+AKLLH RGFH+T+V T  N+  ++++R    L   P+F
Sbjct  10   QKPHVVCVPYPAQGHINPMLKVAKLLHVRGFHVTFVNTVYNHNRLLQSRGANALDGLPSF  69

Query  236  RFETIPDGLPSRENPDTALDVADLCFSTGKNCYAPFMELIQRLNSTAsdvppvscvvsdt  415
            RFE IPDGLP     D   D+  LC ST KNC  PF +L+Q++N T+ DVPPVSC+VSD 
Sbjct  70   RFECIPDGLPEN-GVDATQDIPALCESTMKNCLVPFKKLLQQIN-TSEDVPPVSCIVSDG  127

Query  416  vMPFAVGATQELGVPVVLFWPLSAVASLMHI  508
             M F +   +ELGVP V+FW  SA   + ++
Sbjct  128  SMSFTLDVVEELGVPEVIFWTPSACGFMAYL  158



>ref|XP_011009482.1| PREDICTED: 7-deoxyloganetin glucosyltransferase-like [Populus 
euphratica]
 ref|XP_011009483.1| PREDICTED: 7-deoxyloganetin glucosyltransferase-like [Populus 
euphratica]
Length=482

 Score =   136 bits (342),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 74/149 (50%), Positives = 103/149 (69%), Gaps = 1/149 (1%)
 Frame = +2

Query  59   RPHAVCIPYPAQGHICAMLKLAKLLHHRGFHITYVLTQLNYTHIMKARNFLPLTQSPTFR  238
            + HA+C+PYPAQGHI  MLK+AKLLHH+GFHIT+V ++ N+  ++K+R    L   P F+
Sbjct  9    KAHALCVPYPAQGHITPMLKVAKLLHHKGFHITFVNSEYNHRRLLKSRGRNSLDVLPDFQ  68

Query  239  FETIPDGLPSRENPDTALDVADLCFSTGKNCYAPFMELIQRLNSTAsdvppvscvvsdtv  418
            FETIPDGL  + + D   D + LC ST K C  PF +L+ +LNS+ + VPPV+C+V+D  
Sbjct  69   FETIPDGLGDQLDADVTQDTSFLCDSTSKACLDPFRQLLAKLNSS-NVVPPVTCIVADGG  127

Query  419  MPFAVGATQELGVPVVLFWPLSAVASLMH  505
            M FA+    EL +PVV+FW  SA  +L +
Sbjct  128  MSFALDVKDELQIPVVIFWTSSACGTLAY  156



>ref|XP_011016624.1| PREDICTED: 7-deoxyloganetin glucosyltransferase-like [Populus 
euphratica]
Length=505

 Score =   136 bits (342),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 76/150 (51%), Positives = 101/150 (67%), Gaps = 2/150 (1%)
 Frame = +2

Query  62   PHAVCIPYPAQGHICAMLKLAKLLHHRGFHITYVLTQLNYTHIMKARNFLPLTQSPTFRF  241
            PH VC+P+PAQGHI  MLKLAK+LH + FHIT+V T+ N+  ++++R    L    TFRF
Sbjct  11   PHVVCLPFPAQGHINPMLKLAKILHQKDFHITFVNTEFNHRRLLRSRGLDSLDGLSTFRF  70

Query  242  ETIPDGLPSRENPDTALDVADLCFSTGKNCYAPFMELIQRLNSTAsdvp-pvscvvsdtv  418
            ETIPDGLP  +  D+   V  LC ST KNC APF +L+ RLN+T+S    PV+C+VSD +
Sbjct  71   ETIPDGLPPSD-ADSTQHVPSLCDSTKKNCLAPFRDLLSRLNNTSSSKVPPVTCIVSDCI  129

Query  419  MPFAVGATQELGVPVVLFWPLSAVASLMHI  508
            M F + A QELG+P V FW  S    + ++
Sbjct  130  MSFTLKAAQELGIPNVFFWTASVCGFMSYL  159



>ref|XP_006307682.1| hypothetical protein CARUB_v10009316mg [Capsella rubella]
 gb|EOA40580.1| hypothetical protein CARUB_v10009316mg [Capsella rubella]
Length=406

 Score =   135 bits (340),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 78/144 (54%), Positives = 103/144 (72%), Gaps = 2/144 (1%)
 Frame = +2

Query  56   QRPHAVCIPYPAQGHICAMLKLAKLLHHRGFHITYVLTQLNYTHIMKARNFLPLTQSPTF  235
            Q+PH VC+PYPAQGHI  MLK+AKLL+ +GFH+T+V T  N+  ++++R    L   P+F
Sbjct  10   QKPHVVCVPYPAQGHINPMLKVAKLLYAKGFHVTFVNTVYNHNRLLRSRGPNALDGLPSF  69

Query  236  RFETIPDGLPSRENPDTALDVADLCFSTGKNCYAPFMELIQRLNSTAsdvppvscvvsdt  415
            RFE+IPDGLP  +  D   D   +C ST KNC APF +L++R+N+   DVPPVSC+VSD 
Sbjct  70   RFESIPDGLPETDG-DRTQDTPSVCVSTEKNCLAPFKKLLRRINN-GDDVPPVSCIVSDG  127

Query  416  vMPFAVGATQELGVPVVLFWPLSA  487
            VM F + A +ELGVP V+FW  SA
Sbjct  128  VMSFTLDAAEELGVPEVIFWTNSA  151



>emb|CDY46643.1| BnaA07g10530D [Brassica napus]
Length=491

 Score =   136 bits (342),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 81/152 (53%), Positives = 106/152 (70%), Gaps = 2/152 (1%)
 Frame = +2

Query  53   VQRPHAVCIPYPAQGHICAMLKLAKLLHHRGFHITYVLTQLNYTHIMKARNFLPLTQSPT  232
            VQ+PH VCIPYPAQGHI  MLK+AKLLH +GFH+T+V T  N+  ++++R    L   P+
Sbjct  9    VQKPHVVCIPYPAQGHINPMLKVAKLLHAKGFHVTFVNTIYNHKRLLRSRGPNALDGLPS  68

Query  233  FRFETIPDGLPSRENPDTALDVADLCFSTGKNCYAPFMELIQRLNSTAsdvppvscvvsd  412
            F+FE IPDGLP  E  D   D+  LC ST KNC  PF EL++++N+   DVPPVSC+VSD
Sbjct  69   FQFEAIPDGLPETE-VDATQDIPTLCESTMKNCLTPFKELLRQINARK-DVPPVSCIVSD  126

Query  413  tvMPFAVGATQELGVPVVLFWPLSAVASLMHI  508
             VM F + A +ELG+P VLFW  SA   + ++
Sbjct  127  GVMSFTLDAAEELGLPEVLFWTPSASGVMAYL  158



>ref|XP_009103242.1| PREDICTED: UDP-glycosyltransferase 85A3-like [Brassica rapa]
Length=491

 Score =   136 bits (342),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 80/152 (53%), Positives = 106/152 (70%), Gaps = 2/152 (1%)
 Frame = +2

Query  53   VQRPHAVCIPYPAQGHICAMLKLAKLLHHRGFHITYVLTQLNYTHIMKARNFLPLTQSPT  232
            VQ+PH VCIPYPAQGHI  MLK+AKLLH +GFH+T+V T  N+  ++++R    L   P+
Sbjct  9    VQKPHVVCIPYPAQGHINPMLKVAKLLHAKGFHVTFVNTIYNHKRLLRSRGPNALDGLPS  68

Query  233  FRFETIPDGLPSRENPDTALDVADLCFSTGKNCYAPFMELIQRLNSTAsdvppvscvvsd  412
            F+FE IPDGLP  E  D   D+  LC ST KNC  PF EL++++N+   DVPP+SC+VSD
Sbjct  69   FQFEAIPDGLPETE-VDATQDIPTLCESTMKNCLTPFKELLRQINARK-DVPPISCIVSD  126

Query  413  tvMPFAVGATQELGVPVVLFWPLSAVASLMHI  508
             VM F + A +ELG+P VLFW  SA   + ++
Sbjct  127  GVMSFTLDAAEELGLPEVLFWTPSASGVMAYL  158



>ref|XP_006304973.1| hypothetical protein CARUB_v10011467mg [Capsella rubella]
 gb|EOA37871.1| hypothetical protein CARUB_v10011467mg [Capsella rubella]
Length=483

 Score =   136 bits (342),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 79/151 (52%), Positives = 105/151 (70%), Gaps = 1/151 (1%)
 Frame = +2

Query  56   QRPHAVCIPYPAQGHICAMLKLAKLLHHRGFHITYVLTQLNYTHIMKARNFLPLTQSPTF  235
            Q+PH VC+P+PAQGHI  MLK+AKLL+ RGFH+T+V T  N+  ++++R    L   P+F
Sbjct  10   QKPHVVCVPFPAQGHINPMLKVAKLLYARGFHVTFVNTVYNHNRLIRSRGPNALDGLPSF  69

Query  236  RFETIPDGLPSRENPDTALDVADLCFSTGKNCYAPFMELIQRLNSTAsdvppvscvvsdt  415
            +FE+IPDGLP +   D    V  LC ST KNC APF EL++R+NS   D+PPVSC+VSD 
Sbjct  70   QFESIPDGLPEQPIKDVMQRVPPLCESTMKNCLAPFKELLRRINS-KDDIPPVSCIVSDG  128

Query  416  vMPFAVGATQELGVPVVLFWPLSAVASLMHI  508
            VM F + A +E G+P VLFW  SA   L ++
Sbjct  129  VMSFTLDAAEEFGIPEVLFWTTSACGFLAYL  159



>gb|EAY87581.1| hypothetical protein OsI_08991 [Oryza sativa Indica Group]
Length=485

 Score =   136 bits (342),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 73/149 (49%), Positives = 101/149 (68%), Gaps = 0/149 (0%)
 Frame = +2

Query  59   RPHAVCIPYPAQGHICAMLKLAKLLHHRGFHITYVLTQLNYTHIMKARNFLPLTQSPTFR  238
            +PHAVC+PYPAQGHI  ML +AKLLH RGF +T+V T+ N+  +++ R    +  +P FR
Sbjct  9    KPHAVCMPYPAQGHITPMLNVAKLLHARGFDVTFVNTEYNHARLVRTRGEAAVAGAPGFR  68

Query  239  FETIPDGLPSRENPDTALDVADLCFSTGKNCYAPFMELIQRLNSTAsdvppvscvvsdtv  418
            F TIPDGLP  ++ D   D+  LC ST + C APF  L+ +LN  A+  PPV+CVVSD V
Sbjct  69   FATIPDGLPPSDDDDVTQDIPSLCRSTKETCLAPFRRLLAQLNDPATGHPPVTCVVSDVV  128

Query  419  MPFAVGATQELGVPVVLFWPLSAVASLMH  505
            M F++ A +ELG+P V  W  S+++ L +
Sbjct  129  MGFSMAAAKELGLPYVQLWTASSISYLGY  157



>ref|XP_009334337.1| PREDICTED: 7-deoxyloganetin glucosyltransferase-like [Pyrus x 
bretschneideri]
 ref|XP_009334338.1| PREDICTED: 7-deoxyloganetin glucosyltransferase-like [Pyrus x 
bretschneideri]
Length=483

 Score =   136 bits (342),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 79/152 (52%), Positives = 108/152 (71%), Gaps = 2/152 (1%)
 Frame = +2

Query  53   VQRPHAVCIPYPAQGHICAMLKLAKLLHHRGFHITYVLTQLNYTHIMKARNFLPLTQSPT  232
            +++PHAV IPYPAQGHI  ML+LAKLL+++GFH T+V T+ N+  ++KAR    L    +
Sbjct  7    IEKPHAVFIPYPAQGHIIPMLQLAKLLNYKGFHTTFVNTEFNHRRLLKARGPNSLDGLSS  66

Query  233  FRFETIPDGLPSRENPDTALDVADLCFSTGKNCYAPFMELIQRLNSTAsdvppvscvvsd  412
            FRFETIPDGLP+ +   T  D+  LCFST KNC APF +L+ +LNS   + PPV+C+VSD
Sbjct  67   FRFETIPDGLPTTDVNATQ-DITALCFSTKKNCLAPFKDLLSKLNSLP-NSPPVTCIVSD  124

Query  413  tvMPFAVGATQELGVPVVLFWPLSAVASLMHI  508
              M F + A QELG+PVV+F   SA + + ++
Sbjct  125  GGMTFTLEAAQELGIPVVIFATASACSLMGYL  156



>ref|NP_001048165.1| Os02g0755900 [Oryza sativa Japonica Group]
 dbj|BAD17253.1| putative UDP-glucose glucosyltransferase1 [Oryza sativa Japonica 
Group]
 dbj|BAF10079.1| Os02g0755900 [Oryza sativa Japonica Group]
 gb|EAZ24674.1| hypothetical protein OsJ_08442 [Oryza sativa Japonica Group]
 dbj|BAG93535.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG97062.1| unnamed protein product [Oryza sativa Japonica Group]
Length=485

 Score =   136 bits (342),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 73/149 (49%), Positives = 101/149 (68%), Gaps = 0/149 (0%)
 Frame = +2

Query  59   RPHAVCIPYPAQGHICAMLKLAKLLHHRGFHITYVLTQLNYTHIMKARNFLPLTQSPTFR  238
            +PHAVC+PYPAQGHI  ML +AKLLH RGF +T+V T+ N+  +++ R    +  +P FR
Sbjct  9    KPHAVCMPYPAQGHITPMLNVAKLLHARGFDVTFVNTEYNHARLVRTRGEAAVAGAPGFR  68

Query  239  FETIPDGLPSRENPDTALDVADLCFSTGKNCYAPFMELIQRLNSTAsdvppvscvvsdtv  418
            F TIPDGLP  ++ D   D+  LC ST + C APF  L+ +LN  A+  PPV+CVVSD V
Sbjct  69   FATIPDGLPPSDDDDVTQDIPSLCRSTKETCLAPFRRLLAQLNDPATGHPPVTCVVSDVV  128

Query  419  MPFAVGATQELGVPVVLFWPLSAVASLMH  505
            M F++ A +ELG+P V  W  S+++ L +
Sbjct  129  MGFSMAAAKELGLPYVQLWTASSISYLGY  157



>ref|XP_008219468.1| PREDICTED: UDP-glycosyltransferase 85A2-like [Prunus mume]
Length=577

 Score =   136 bits (343),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 78/139 (56%), Positives = 99/139 (71%), Gaps = 2/139 (1%)
 Frame = +2

Query  56   QRPHAVCIPYPAQGHICAMLKLAKLLHHRGFHITYVLTQLNYTHIMKARNFLPLTQSPTF  235
            ++PHAVCIPYPAQGHI  ML+L KLLH++GFHIT+V T+ N+  ++K+R    L   P+F
Sbjct  8    EKPHAVCIPYPAQGHITPMLQLTKLLHYKGFHITFVNTEFNHRRLLKSRGPNSLDGLPSF  67

Query  236  RFETIPDGLPSRENPDTALDVADLCFSTGKNCYAPFMELIQRLNSTAsdvppvscvvsdt  415
            RFETIPDGLP  +   T  DV  LC ST KNC APF +L+ +LNS   D PPV+C+VS+ 
Sbjct  68   RFETIPDGLPPTDTNATQ-DVTALCVSTRKNCLAPFRDLLSKLNSLP-DSPPVTCIVSNG  125

Query  416  vMPFAVGATQELGVPVVLF  472
             M F   A QELG+P V+F
Sbjct  126  GMAFTFYAAQELGIPEVIF  144



>ref|XP_009145352.1| PREDICTED: UDP-glycosyltransferase 85A7 isoform X2 [Brassica 
rapa]
Length=434

 Score =   135 bits (341),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 77/146 (53%), Positives = 104/146 (71%), Gaps = 2/146 (1%)
 Frame = +2

Query  56   QRPHAVCIPYPAQGHICAMLKLAKLLHHRGFHITYVLTQLNYTHIMKARNFLPLTQSPTF  235
            Q+PH VC+P+PAQGHI  MLK+AKLLH +GFH+T+V T  N+  ++++R    L   P+F
Sbjct  10   QKPHVVCVPHPAQGHINPMLKVAKLLHAKGFHVTFVNTVYNHKRLLRSRGPNALDGFPSF  69

Query  236  RFETIPDGLPSRENPDTALDVADLCFSTGKNCYAPFMELIQRLNSTAsdvppvscvvsdt  415
            RFE+IPDGLP  +  +T  D+  LC ST  NC +PF +L++++N T  DVPPVSC+VSD 
Sbjct  70   RFESIPDGLPETDG-NTTQDIPSLCVSTMNNCLSPFKDLLRKIN-TGDDVPPVSCIVSDA  127

Query  416  vMPFAVGATQELGVPVVLFWPLSAVA  493
            VM F + A +ELGVP V+FW  SA  
Sbjct  128  VMSFTLDAAEELGVPDVVFWTASACG  153



>ref|XP_006416205.1| hypothetical protein EUTSA_v10007502mg [Eutrema salsugineum]
 gb|ESQ34558.1| hypothetical protein EUTSA_v10007502mg [Eutrema salsugineum]
Length=483

 Score =   135 bits (341),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 79/151 (52%), Positives = 105/151 (70%), Gaps = 2/151 (1%)
 Frame = +2

Query  56   QRPHAVCIPYPAQGHICAMLKLAKLLHHRGFHITYVLTQLNYTHIMKARNFLPLTQSPTF  235
            Q+PHAVC+P+PAQGHI  M K+AKLLH +GFH+T+V T  N+  ++++R    L   P+F
Sbjct  10   QKPHAVCVPFPAQGHIDPMQKVAKLLHAKGFHVTFVNTVYNHNRLLRSRGTNALDGFPSF  69

Query  236  RFETIPDGLPSRENPDTALDVADLCFSTGKNCYAPFMELIQRLNSTAsdvppvscvvsdt  415
            RFE+IPDGLP  +  D   D   LC +T KNC APF EL++R+N+   DVPPVSC+VSD 
Sbjct  70   RFESIPDGLPEIDG-DATQDPPSLCEATMKNCLAPFKELVRRINA-EDDVPPVSCIVSDG  127

Query  416  vMPFAVGATQELGVPVVLFWPLSAVASLMHI  508
            VM F +   +ELGVP VLFW  SA   + ++
Sbjct  128  VMSFTLDVAEELGVPEVLFWTTSACGFMAYL  158



>ref|XP_004237926.1| PREDICTED: 7-deoxyloganetin glucosyltransferase-like [Solanum 
lycopersicum]
Length=491

 Score =   135 bits (341),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 78/154 (51%), Positives = 105/154 (68%), Gaps = 2/154 (1%)
 Frame = +2

Query  50   EVQRPHAVCIPYPAQGHICAMLKLAKLLHHRGFHITYVLTQLNYTHIMKARNFLPLTQSP  229
            E+ +PHAVC+PYPAQGHI  MLKLAK+L+H+GFHIT+V T+ N+  ++K+R        P
Sbjct  7    ELDKPHAVCVPYPAQGHINPMLKLAKILNHKGFHITFVNTEYNHRRLLKSRGPHGFKNLP  66

Query  230  TFRFETIPDGLPSRENPDTALDVADLCFSTGKNCYAPFMELIQRLNST-Asdvppvscvv  406
            +FRFE IPDGLP  +  D   D+  LC ST   C  PF EL+ +LN+T +S VPPVSC+V
Sbjct  67   SFRFEAIPDGLPPCD-ADATQDIIALCKSTDTTCLGPFRELLAKLNNTCSSKVPPVSCIV  125

Query  407  sdtvMPFAVGATQELGVPVVLFWPLSAVASLMHI  508
            SD    + + A QELG+P V FW  +A  +L ++
Sbjct  126  SDGSNSYTLTAAQELGIPQVHFWTFAACGTLSYM  159



>ref|XP_010498707.1| PREDICTED: UDP-glycosyltransferase 85A5-like [Camelina sativa]
Length=486

 Score =   135 bits (341),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 78/151 (52%), Positives = 104/151 (69%), Gaps = 2/151 (1%)
 Frame = +2

Query  56   QRPHAVCIPYPAQGHICAMLKLAKLLHHRGFHITYVLTQLNYTHIMKARNFLPLTQSPTF  235
            Q+PH VC+P+ AQGHI  MLK+AK+LH +GFH+T+V T  N+  ++++R    L   P+F
Sbjct  10   QKPHVVCVPFAAQGHINPMLKVAKILHAKGFHVTFVNTNYNHRRLLRSRGPKALNGLPSF  69

Query  236  RFETIPDGLPSRENPDTALDVADLCFSTGKNCYAPFMELIQRLNSTAsdvppvscvvsdt  415
            ++E+IPDGLP   N D   D+  LC ST KNC APF EL++R+N TA DVPPVSC+VSD 
Sbjct  70   QYESIPDGLPET-NEDATQDIPLLCASTKKNCLAPFKELLRRIN-TAEDVPPVSCIVSDG  127

Query  416  vMPFAVGATQELGVPVVLFWPLSAVASLMHI  508
             M F + A +ELGVP V  W  SA   L ++
Sbjct  128  TMSFTLDAAEELGVPNVALWTTSACGFLAYL  158



>emb|CDX91674.1| BnaC08g05930D [Brassica napus]
Length=480

 Score =   135 bits (341),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 78/151 (52%), Positives = 104/151 (69%), Gaps = 2/151 (1%)
 Frame = +2

Query  56   QRPHAVCIPYPAQGHICAMLKLAKLLHHRGFHITYVLTQLNYTHIMKARNFLPLTQSPTF  235
            Q+PH VC+P+PAQGHI  M+K AKLLH +GFH+T+V    N+  ++++R    L   P+F
Sbjct  10   QKPHVVCVPFPAQGHINPMMKAAKLLHAKGFHVTFVNNVYNHNRLLRSRGAKALDGVPSF  69

Query  236  RFETIPDGLPSRENPDTALDVADLCFSTGKNCYAPFMELIQRLNSTAsdvppvscvvsdt  415
            RFE+IPDGL +  + D   DV  LC ST  NC APF EL+QR+N+   DVPPV+C+VSD 
Sbjct  70   RFESIPDGL-AETDGDRMQDVPSLCESTMTNCLAPFKELLQRINAR-DDVPPVTCIVSDG  127

Query  416  vMPFAVGATQELGVPVVLFWPLSAVASLMHI  508
            +M F + A +ELGVP VLFW  SA   L ++
Sbjct  128  LMTFTLDAAEELGVPNVLFWTTSACGFLAYL  158



>ref|XP_006647925.1| PREDICTED: UDP-glycosyltransferase 85A2-like [Oryza brachyantha]
Length=484

 Score =   135 bits (341),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 73/150 (49%), Positives = 100/150 (67%), Gaps = 0/150 (0%)
 Frame = +2

Query  56   QRPHAVCIPYPAQGHICAMLKLAKLLHHRGFHITYVLTQLNYTHIMKARNFLPLTQSPTF  235
            ++PHAVCIPYPAQGHI  ML +AKLLH RGF +T+V T+ N+  +++ R    +   P F
Sbjct  8    EKPHAVCIPYPAQGHITPMLNVAKLLHARGFDVTFVNTEYNHARLVRTRGEAAVAGIPGF  67

Query  236  RFETIPDGLPSRENPDTALDVADLCFSTGKNCYAPFMELIQRLNSTAsdvppvscvvsdt  415
            RF TIPDGLP  ++ D   D+  LC ST + C  PF  L+ +LN  A+  PPV+CVVSD 
Sbjct  68   RFATIPDGLPPSDDDDVTQDIPSLCRSTKETCLGPFRRLLAQLNDPATGHPPVTCVVSDV  127

Query  416  vMPFAVGATQELGVPVVLFWPLSAVASLMH  505
            VM F++ A +ELG+P V  W  S+++ L +
Sbjct  128  VMGFSMDAAKELGLPYVQLWTASSISYLAY  157



>emb|CDP01480.1| unnamed protein product [Coffea canephora]
Length=491

 Score =   135 bits (341),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 85/156 (54%), Positives = 104/156 (67%), Gaps = 5/156 (3%)
 Frame = +2

Query  53   VQRPHAVCIPYPAQGHICAMLKLAKLLHHRGFHITYVLTQLNYTHIMKARNFLPLTQSPT  232
            +++PHA+CIPYP Q HI A LKLAKLLH +GFHIT+V T+ NY  I+KAR    L  +  
Sbjct  5    MKKPHAICIPYPVQSHISATLKLAKLLHLKGFHITFVHTEYNYNRILKARGPKSLIGAAD  64

Query  233  FRFETIPDGLPSRENPDTALDVADLCFSTGKNCYAPFMELIQRLNSTAsdvpp---vscv  403
            F FETIPDGLP  EN D   DV  LC ST K CY PF  L+++LN+ AS       VSCV
Sbjct  65   FNFETIPDGLPPAENDDVTQDVFQLCLSTSKTCYVPFCNLLKKLNNRASMDDQFPPVSCV  124

Query  404  vsdtvMPFAVGATQELGVPVVLFWPLSA--VASLMH  505
            +SD  M F + A +ELG+P +LFWP SA  V  L+H
Sbjct  125  ISDGFMSFTLEAAEELGIPNLLFWPFSALTVMCLLH  160



>gb|KDP41396.1| hypothetical protein JCGZ_15803 [Jatropha curcas]
Length=472

 Score =   135 bits (341),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 75/145 (52%), Positives = 96/145 (66%), Gaps = 4/145 (3%)
 Frame = +2

Query  65   HAVCIPYPAQGHICAMLKLAKLLHHRGFHITYVLTQLNYTHIMKARNFLPLTQSPTFRFE  244
            HAVCIP+PAQGHI  MLKLAKLLH +GFHIT+V T+ N+  ++K+R    +    TFRFE
Sbjct  12   HAVCIPFPAQGHINPMLKLAKLLHRKGFHITFVNTEYNHQRLLKSRGSNSIDCLSTFRFE  71

Query  245  TIPDGLPSRENPDTALDVADLCFSTGKNCYAPFMELIQRLNSTAsdvppv----scvvsd  412
            TIPDGLP  ++ D+  DV  LC ST KNC  PF +L+ +LN   S         +C+VSD
Sbjct  72   TIPDGLPPSDHADSTQDVPSLCDSTKKNCLPPFRDLLFKLNDNTSSYSSKVPPVTCIVSD  131

Query  413  tvMPFAVGATQELGVPVVLFWPLSA  487
             VM F + A +EL +P+VL W  SA
Sbjct  132  PVMSFTIEAAKELEIPIVLSWTASA  156



>emb|CDY41486.1| BnaA08g20880D [Brassica napus]
Length=480

 Score =   135 bits (341),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 77/151 (51%), Positives = 105/151 (70%), Gaps = 2/151 (1%)
 Frame = +2

Query  56   QRPHAVCIPYPAQGHICAMLKLAKLLHHRGFHITYVLTQLNYTHIMKARNFLPLTQSPTF  235
            Q+PH +C+P+PAQGHI  MLK+AKLLH +GFH+T+V    N+  ++++R    L   P+F
Sbjct  10   QKPHVICVPFPAQGHINPMLKVAKLLHAKGFHVTFVNNVYNHNRLLRSRGPNALDGVPSF  69

Query  236  RFETIPDGLPSRENPDTALDVADLCFSTGKNCYAPFMELIQRLNSTAsdvppvscvvsdt  415
            RFE+IPDGLP  +  D   DV  LC ST KNC APF EL+QR+N+   D+PPVSC+VSD 
Sbjct  70   RFESIPDGLPETDG-DRTQDVPFLCESTMKNCLAPFKELLQRINAR-DDIPPVSCIVSDG  127

Query  416  vMPFAVGATQELGVPVVLFWPLSAVASLMHI  508
            +M F + A +EL VP ++FW  SA   L ++
Sbjct  128  LMTFTLDAAEELSVPNIIFWTTSACGFLAYL  158



>ref|XP_010676178.1| PREDICTED: 7-deoxyloganetin glucosyltransferase-like [Beta vulgaris 
subsp. vulgaris]
Length=484

 Score =   135 bits (341),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 79/148 (53%), Positives = 103/148 (70%), Gaps = 2/148 (1%)
 Frame = +2

Query  56   QRPHAVCIPYPAQGHICAMLKLAKLLHHRGFHITYVLTQLNYTHIMKARNFLPLTQSPTF  235
            Q+PHAVCIPYPAQGHI  ML+LAK+ H +GFHIT+V ++ N++ ++++R    L   P+F
Sbjct  10   QKPHAVCIPYPAQGHINPMLQLAKIFHFKGFHITFVNSEYNHSRLLRSRGPAALADRPSF  69

Query  236  RFETIPDGLPSRENPDTALDVADLCFSTGKNCYAPFMELIQRLNSTAsdvppvscvvsdt  415
            RF+TIPDGLP  +  D+  D++ LC ST ++C  PF ELI  LN  A DVPPVSC+VSD 
Sbjct  70   RFKTIPDGLPPTD-ADSTQDISLLCASTEQHCLGPFKELIAHLNE-AGDVPPVSCIVSDV  127

Query  416  vMPFAVGATQELGVPVVLFWPLSAVASL  499
             M F + A QE GVP V+ W  SA   L
Sbjct  128  SMFFTLNAAQEFGVPEVMLWTASACGLL  155



>ref|XP_007141201.1| hypothetical protein PHAVU_008G175600g [Phaseolus vulgaris]
 gb|ESW13195.1| hypothetical protein PHAVU_008G175600g [Phaseolus vulgaris]
Length=479

 Score =   135 bits (341),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 77/152 (51%), Positives = 101/152 (66%), Gaps = 1/152 (1%)
 Frame = +2

Query  53   VQRPHAVCIPYPAQGHICAMLKLAKLLHHRGFHITYVLTQLNYTHIMKARNFLPLTQSPT  232
            + +PHAVC+P+PAQGHI  MLKLAKLLH  GFHIT+V T+ N+  ++K+R    L   P+
Sbjct  7    ISKPHAVCVPFPAQGHINPMLKLAKLLHSNGFHITFVNTECNHKRLLKSRGLDSLNGLPS  66

Query  233  FRFETIPDGLPSRENPDTALDVADLCFSTGKNCYAPFMELIQRLNSTAsdvppvscvvsd  412
            FRF+TIPDGLP  ++  T   V  LC ST   C   F  L+ +LN+    VP VSC+VSD
Sbjct  67   FRFQTIPDGLPEPDDEGTH-QVPSLCDSTRATCLPHFRNLLSKLNNDCPGVPAVSCIVSD  125

Query  413  tvMPFAVGATQELGVPVVLFWPLSAVASLMHI  508
             VM F + A+QELG+P VLFW  SA   + ++
Sbjct  126  GVMSFTLDASQELGIPNVLFWTSSACGFMCYV  157



>ref|XP_009145349.1| PREDICTED: UDP-glycosyltransferase 85A7 isoform X1 [Brassica 
rapa]
 ref|XP_009145350.1| PREDICTED: UDP-glycosyltransferase 85A7 isoform X1 [Brassica 
rapa]
Length=482

 Score =   135 bits (340),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 77/144 (53%), Positives = 104/144 (72%), Gaps = 2/144 (1%)
 Frame = +2

Query  56   QRPHAVCIPYPAQGHICAMLKLAKLLHHRGFHITYVLTQLNYTHIMKARNFLPLTQSPTF  235
            Q+PH VC+P+PAQGHI  MLK+AKLLH +GFH+T+V T  N+  ++++R    L   P+F
Sbjct  10   QKPHVVCVPHPAQGHINPMLKVAKLLHAKGFHVTFVNTVYNHKRLLRSRGPNALDGFPSF  69

Query  236  RFETIPDGLPSRENPDTALDVADLCFSTGKNCYAPFMELIQRLNSTAsdvppvscvvsdt  415
            RFE+IPDGLP  +  +T  D+  LC ST  NC +PF +L++++N T  DVPPVSC+VSD 
Sbjct  70   RFESIPDGLPETDG-NTTQDIPSLCVSTMNNCLSPFKDLLRKIN-TGDDVPPVSCIVSDA  127

Query  416  vMPFAVGATQELGVPVVLFWPLSA  487
            VM F + A +ELGVP V+FW  SA
Sbjct  128  VMSFTLDAAEELGVPDVVFWTASA  151



>emb|CDY67802.1| BnaC05g50340D [Brassica napus]
Length=479

 Score =   135 bits (340),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 78/151 (52%), Positives = 105/151 (70%), Gaps = 2/151 (1%)
 Frame = +2

Query  56   QRPHAVCIPYPAQGHICAMLKLAKLLHHRGFHITYVLTQLNYTHIMKARNFLPLTQSPTF  235
            Q+PH VC+PYPAQGHI  MLK+AKLLH+RGFH+T+V    N+  + ++R    L + PTF
Sbjct  10   QKPHVVCVPYPAQGHIDPMLKVAKLLHNRGFHVTFVNNVYNHNRLRRSRGPNALDRIPTF  69

Query  236  RFETIPDGLPSRENPDTALDVADLCFSTGKNCYAPFMELIQRLNSTAsdvppvscvvsdt  415
            RFE+IPDGL   +  D   D+  LC +T KNC AP  EL+QR+N+   DVPPVSC+V+D 
Sbjct  70   RFESIPDGLLETDG-DKMQDIPSLCEATMKNCLAPCKELLQRINARD-DVPPVSCIVADG  127

Query  416  vMPFAVGATQELGVPVVLFWPLSAVASLMHI  508
            +M F + A +E+GVP V+FW  SA   L ++
Sbjct  128  IMSFTLDAAEEIGVPEVIFWTTSACGFLSYL  158



>gb|AFJ53003.1| UDP-glycosyltransferase 1 [Linum usitatissimum]
Length=490

 Score =   135 bits (340),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 74/149 (50%), Positives = 102/149 (68%), Gaps = 0/149 (0%)
 Frame = +2

Query  62   PHAVCIPYPAQGHICAMLKLAKLLHHRGFHITYVLTQLNYTHIMKARNFLPLTQSPTFRF  241
            PHAVC+P+PAQGHI  ML +AK+L+  GFH+T+V T+ N+  ++K+     +T  P FRF
Sbjct  13   PHAVCVPFPAQGHINPMLHVAKILYSNGFHVTFVNTEYNHKRLLKSHGGDFVTLPPGFRF  72

Query  242  ETIPDGLPSRENPDTALDVADLCFSTGKNCYAPFMELIQRLNSTAsdvppvscvvsdtvM  421
            E+IPDGLP  EN D+  D+  LC S  KN  APF EL++RLN     +P VSC+VSD+ M
Sbjct  73   ESIPDGLPPSENIDSTQDLTSLCNSIAKNFLAPFRELVRRLNEDDVVLPRVSCIVSDSSM  132

Query  422  PFAVGATQELGVPVVLFWPLSAVASLMHI  508
             F +  ++ELG+P  LF   SA ASL+++
Sbjct  133  AFTLDVSKELGIPNALFSTPSACASLVYL  161



>dbj|BAJ88498.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=485

 Score =   135 bits (340),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 74/149 (50%), Positives = 98/149 (66%), Gaps = 0/149 (0%)
 Frame = +2

Query  59   RPHAVCIPYPAQGHICAMLKLAKLLHHRGFHITYVLTQLNYTHIMKARNFLPLTQSPTFR  238
            +PHAVC+PYPAQGHI  ML +AKLLH RGF +T+V T+ N+  ++++R    +   P FR
Sbjct  10   KPHAVCLPYPAQGHITPMLNVAKLLHARGFDVTFVNTEYNHARLVRSRGAAAVAGLPGFR  69

Query  239  FETIPDGLPSRENPDTALDVADLCFSTGKNCYAPFMELIQRLNSTAsdvppvscvvsdtv  418
            F TIPDGLP  E+ D   D+  LC ST + C  PF  L+ RLN  A+  PPV+CVVSD  
Sbjct  70   FATIPDGLPPSEDDDVTQDIPALCKSTTETCLGPFRNLLARLNDPATGHPPVTCVVSDVA  129

Query  419  MPFAVGATQELGVPVVLFWPLSAVASLMH  505
            M F++ A  ELG+P V  W  SA++ L +
Sbjct  130  MGFSMEAATELGLPYVQLWTASAISFLGY  158



>ref|XP_002513938.1| UDP-glucuronosyltransferase, putative [Ricinus communis]
 gb|EEF48521.1| UDP-glucuronosyltransferase, putative [Ricinus communis]
Length=482

 Score =   135 bits (340),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 78/152 (51%), Positives = 102/152 (67%), Gaps = 1/152 (1%)
 Frame = +2

Query  53   VQRPHAVCIPYPAQGHICAMLKLAKLLHHRGFHITYVLTQLNYTHIMKARNFLPLTQSPT  232
            +++ HAVCIPYPAQGHI  MLKLAK L+H+GFHIT+V ++ N+  ++K+R    L    +
Sbjct  7    LEKSHAVCIPYPAQGHINPMLKLAKFLYHKGFHITFVNSEYNHRRLLKSRGPDSLDGLSS  66

Query  233  FRFETIPDGLPSRENPDTALDVADLCFSTGKNCYAPFMELIQRLNSTAsdvppvscvvsd  412
            FRFETIPDGLP  +  D   D+  LC ST   C   F  ++ +LN T S VPPVSC++SD
Sbjct  67   FRFETIPDGLPPTDT-DATQDIPSLCVSTKNACLPHFKNVLSKLNDTPSSVPPVSCIISD  125

Query  413  tvMPFAVGATQELGVPVVLFWPLSAVASLMHI  508
             VM F + A QELG+P VLFW  SA   L ++
Sbjct  126  GVMSFTLDAAQELGIPEVLFWTTSACGFLAYL  157



>ref|XP_011031049.1| PREDICTED: 7-deoxyloganetin glucosyltransferase-like isoform 
X2 [Populus euphratica]
Length=491

 Score =   135 bits (340),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 77/152 (51%), Positives = 106/152 (70%), Gaps = 2/152 (1%)
 Frame = +2

Query  56   QRPHAVCIPYPAQGHICAMLKLAKLLHHRGFHITYVLTQLNYTHIMKARNFLPLTQSPTF  235
            ++PHAVC+PYP+QGH+  M+ LAKLLH RGFHIT+V T+ N+  ++++R    +   P F
Sbjct  7    RKPHAVCVPYPSQGHVTPMMHLAKLLHSRGFHITFVNTEFNHGRLIRSRGPDSVEGLPDF  66

Query  236  RFETIPDGLP-SRENPDTALDVADLCFSTGKNCYAPFMELIQRLNSTAsdvppvscvvsd  412
            RFETIPDGLP    + D   DV  LC ST KNC APF EL+ +LNS++ +VPPV+CV+SD
Sbjct  67   RFETIPDGLPLPPSDFDATQDVPSLCDSTRKNCMAPFKELLTKLNSSS-EVPPVTCVISD  125

Query  413  tvMPFAVGATQELGVPVVLFWPLSAVASLMHI  508
             VM F + A +E  +P V FW  SA + + ++
Sbjct  126  GVMSFGIKAAEEFNIPQVQFWTASACSFMGYL  157



>ref|XP_011031048.1| PREDICTED: 7-deoxyloganetin glucosyltransferase-like isoform 
X1 [Populus euphratica]
Length=492

 Score =   135 bits (340),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 77/152 (51%), Positives = 106/152 (70%), Gaps = 2/152 (1%)
 Frame = +2

Query  56   QRPHAVCIPYPAQGHICAMLKLAKLLHHRGFHITYVLTQLNYTHIMKARNFLPLTQSPTF  235
            ++PHAVC+PYP+QGH+  M+ LAKLLH RGFHIT+V T+ N+  ++++R    +   P F
Sbjct  7    RKPHAVCVPYPSQGHVTPMMHLAKLLHSRGFHITFVNTEFNHGRLIRSRGPDSVEGLPDF  66

Query  236  RFETIPDGLP-SRENPDTALDVADLCFSTGKNCYAPFMELIQRLNSTAsdvppvscvvsd  412
            RFETIPDGLP    + D   DV  LC ST KNC APF EL+ +LNS++ +VPPV+CV+SD
Sbjct  67   RFETIPDGLPLPPSDFDATQDVPSLCDSTRKNCMAPFKELLTKLNSSS-EVPPVTCVISD  125

Query  413  tvMPFAVGATQELGVPVVLFWPLSAVASLMHI  508
             VM F + A +E  +P V FW  SA + + ++
Sbjct  126  GVMSFGIKAAEEFNIPQVQFWTASACSFMGYL  157



>ref|XP_007226586.1| hypothetical protein PRUPE_ppa023851mg [Prunus persica]
 gb|EMJ27785.1| hypothetical protein PRUPE_ppa023851mg [Prunus persica]
Length=474

 Score =   135 bits (340),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 80/152 (53%), Positives = 103/152 (68%), Gaps = 2/152 (1%)
 Frame = +2

Query  53   VQRPHAVCIPYPAQGHICAMLKLAKLLHHRGFHITYVLTQLNYTHIMKARNFLPLTQSPT  232
            +++PHAVCIPYPAQGHI  MLKLAKLLH++GFHITYV ++ N   ++K+R    L   P+
Sbjct  7    IEKPHAVCIPYPAQGHINPMLKLAKLLHYKGFHITYVNSEFNLKRLLKSRGPNSLDGLPS  66

Query  233  FRFETIPDGLPSRENPDTALDVADLCFSTGKNCYAPFMELIQRLNSTAsdvppvscvvsd  412
            FRFETIPDGLP   + +   D+  LC ST K     F +L+ +LNS+  D PPVSC+VSD
Sbjct  67   FRFETIPDGLPPT-DANATQDIPSLCDSTRKRSLPYFRDLLSKLNSSP-DCPPVSCIVSD  124

Query  413  tvMPFAVGATQELGVPVVLFWPLSAVASLMHI  508
              M F + A QE G+P VLFW  SA   L ++
Sbjct  125  GAMGFTLDAAQEFGLPEVLFWTTSACGFLAYV  156



>ref|XP_009341756.1| PREDICTED: 7-deoxyloganetin glucosyltransferase-like [Pyrus x 
bretschneideri]
Length=485

 Score =   135 bits (340),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 80/151 (53%), Positives = 104/151 (69%), Gaps = 2/151 (1%)
 Frame = +2

Query  56   QRPHAVCIPYPAQGHICAMLKLAKLLHHRGFHITYVLTQLNYTHIMKARNFLPLTQSPTF  235
            ++PHAVCIP+PAQGHI  ML +AKLLH +GFHIT+V T+ N+  ++K+R    L   P+F
Sbjct  8    EKPHAVCIPFPAQGHINPMLNVAKLLHFKGFHITFVNTEFNHKRLLKSRGSNSLDGLPSF  67

Query  236  RFETIPDGLPSRENPDTALDVADLCFSTGKNCYAPFMELIQRLNSTAsdvppvscvvsdt  415
            +FETIPDGLP  +  +   D+  LC ST K C   F EL+ +LNS+  D PPVSC+VSD 
Sbjct  68   QFETIPDGLPPTK-ANVTQDIPSLCHSTKKTCLPHFRELLSKLNSSP-DSPPVSCIVSDG  125

Query  416  vMPFAVGATQELGVPVVLFWPLSAVASLMHI  508
            VM F + A QELG+P VLFW  SA   L ++
Sbjct  126  VMSFTLDAAQELGIPEVLFWTTSACGFLAYM  156



>ref|XP_007151399.1| hypothetical protein PHAVU_004G043300g [Phaseolus vulgaris]
 gb|ESW23393.1| hypothetical protein PHAVU_004G043300g [Phaseolus vulgaris]
Length=530

 Score =   135 bits (340),  Expect = 4e-34, Method: Composition-based stats.
 Identities = 71/155 (46%), Positives = 93/155 (60%), Gaps = 5/155 (3%)
 Frame = +2

Query  56   QRPHAVCIPYPAQGHICAMLKLAKLLHHRGFHITYVLTQLNYTHIMKARNFLPLTQSPTF  235
            ++PHAV IPYPAQGHI A+  LAKLLH RGFHIT+V T+ NY  ++ +R       SP F
Sbjct  7    RKPHAVLIPYPAQGHINALFGLAKLLHLRGFHITFVHTEYNYKRLLNSRGLKAFDGSPNF  66

Query  236  RFETIPDGLPSRENPDTAL-DVADLCFSTGKNCYAPFMELIQRLNSTAsdvppvscvvsd  412
             FETIPDGLP  +  D    D+  LC + G+N   PF EL+ RLN +A            
Sbjct  67   HFETIPDGLPLTDEADNVTQDIVSLCKTVGENFLLPFRELLARLNDSAIAGHIPPVTCLV  126

Query  413  t--vMPFAVGATQELGVPVVLFWPLSA--VASLMH  505
            +   + F   A QEL +P++LF P+SA  + S+MH
Sbjct  127  SDCSLTFTTKAAQELELPILLFSPISASTLLSIMH  161



>ref|XP_010521179.1| PREDICTED: UDP-glycosyltransferase 85A3-like [Tarenaya hassleriana]
Length=482

 Score =   135 bits (339),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 79/152 (52%), Positives = 104/152 (68%), Gaps = 2/152 (1%)
 Frame = +2

Query  56   QRPHAVCIPYPAQGHICAMLKLAKLLHHRGFHITYVLTQLNYTHIMKARNFLPLTQSPTF  235
            Q+PHAVC+PYPAQGHI  MLKLAKLLH RGFH+T+V T+ N+  ++++R    L   P+F
Sbjct  10   QKPHAVCVPYPAQGHINPMLKLAKLLHVRGFHVTFVNTEFNHRRLLRSRGPHALAGLPSF  69

Query  236  RFETIPDGLPSRENPDTALDVADLCFSTGKN-CYAPFMELIQRLNSTAsdvppvscvvsd  412
            RFETIPDGLP   + D   D+  LC S  +N   APF EL++R+N    ++P VSCVV+D
Sbjct  70   RFETIPDGLP-ETDVDATQDIPALCKSIMENRMLAPFRELLRRVNFAGKEIPAVSCVVAD  128

Query  413  tvMPFAVGATQELGVPVVLFWPLSAVASLMHI  508
              M F V A +ELGVPVVL    SA   ++++
Sbjct  129  GAMSFTVDAAEELGVPVVLLRTNSACVFMLYL  160



>ref|XP_007222804.1| hypothetical protein PRUPE_ppa005043mg [Prunus persica]
 gb|EMJ24003.1| hypothetical protein PRUPE_ppa005043mg [Prunus persica]
Length=480

 Score =   135 bits (339),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 81/152 (53%), Positives = 105/152 (69%), Gaps = 2/152 (1%)
 Frame = +2

Query  53   VQRPHAVCIPYPAQGHICAMLKLAKLLHHRGFHITYVLTQLNYTHIMKARNFLPLTQSPT  232
            +++PHAVCIP+PAQGHI  MLKLAKLLH++GFHIT+V T+ N+  ++K+R    L   P+
Sbjct  7    IEKPHAVCIPFPAQGHINPMLKLAKLLHYKGFHITFVNTEFNHKRLLKSRGPNSLDGFPS  66

Query  233  FRFETIPDGLPSRENPDTALDVADLCFSTGKNCYAPFMELIQRLNSTAsdvppvscvvsd  412
            FRFETIPDGLP   + +   D+  LC ST K     F +L+ +LNS+  D PPVSCVVSD
Sbjct  67   FRFETIPDGLPPT-DANATQDIPSLCDSTRKRGLPYFRDLLSKLNSSP-DCPPVSCVVSD  124

Query  413  tvMPFAVGATQELGVPVVLFWPLSAVASLMHI  508
              M F + A QELG+P VLFW  SA   L ++
Sbjct  125  GAMGFTLDAAQELGLPEVLFWTTSACGFLAYV  156



>ref|XP_002893222.1| UDP-glucoronosyl/UDP-glucosyl transferase family protein [Arabidopsis 
lyrata subsp. lyrata]
 gb|EFH69481.1| UDP-glucoronosyl/UDP-glucosyl transferase family protein [Arabidopsis 
lyrata subsp. lyrata]
Length=473

 Score =   135 bits (339),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 83/151 (55%), Positives = 104/151 (69%), Gaps = 2/151 (1%)
 Frame = +2

Query  56   QRPHAVCIPYPAQGHICAMLKLAKLLHHRGFHITYVLTQLNYTHIMKARNFLPLTQSPTF  235
            ++PH VC+P+PAQGHI  MLK+AKLL+ RGFH T+V T  N+  ++++R    L    +F
Sbjct  10   KKPHVVCVPFPAQGHINPMLKVAKLLYARGFHFTFVNTNYNHKRLIRSRGPNALDGLHSF  69

Query  236  RFETIPDGLPSRENPDTALDVADLCFSTGKNCYAPFMELIQRLNSTAsdvppvscvvsdt  415
            RFE+IPDGLP   N D   DV  LC ST KNC APF EL+ R+N T  DVPPVSC+VSD 
Sbjct  70   RFESIPDGLP-ETNKDVMQDVPHLCESTMKNCLAPFKELLWRIN-TREDVPPVSCIVSDG  127

Query  416  vMPFAVGATQELGVPVVLFWPLSAVASLMHI  508
            VM F + A +ELGVP VLFW  SA   L ++
Sbjct  128  VMSFTLDAAEELGVPDVLFWTPSACGFLAYL  158



>ref|XP_008219319.1| PREDICTED: UDP-glycosyltransferase 85A2-like [Prunus mume]
Length=490

 Score =   135 bits (339),  Expect = 5e-34, Method: Compositional matrix adjust.
 Identities = 82/152 (54%), Positives = 105/152 (69%), Gaps = 2/152 (1%)
 Frame = +2

Query  53   VQRPHAVCIPYPAQGHICAMLKLAKLLHHRGFHITYVLTQLNYTHIMKARNFLPLTQSPT  232
            +++PHAVCIP+PAQGHI  MLKLAKLLH++GFHIT+V T+ N+  ++K+R    L   P+
Sbjct  7    IEKPHAVCIPFPAQGHIDPMLKLAKLLHYKGFHITFVNTEFNHKRLLKSRGPNSLDGFPS  66

Query  233  FRFETIPDGLPSRENPDTALDVADLCFSTGKNCYAPFMELIQRLNSTAsdvppvscvvsd  412
            FRFETIPDGLP  +   T  D+  LC ST K+    F EL+ +LNS+  D PPVSCVVSD
Sbjct  67   FRFETIPDGLPPTDAIATQ-DIPSLCDSTRKHSLPYFRELLSKLNSSP-DCPPVSCVVSD  124

Query  413  tvMPFAVGATQELGVPVVLFWPLSAVASLMHI  508
              M F + A QE G+P VLFW  SA   L ++
Sbjct  125  GAMGFTLDAAQEFGLPEVLFWTTSACGFLAYV  156



>ref|XP_002323974.2| hypothetical protein POPTR_0017s07880g [Populus trichocarpa]
 gb|EEF04107.2| hypothetical protein POPTR_0017s07880g [Populus trichocarpa]
Length=482

 Score =   135 bits (339),  Expect = 5e-34, Method: Compositional matrix adjust.
 Identities = 74/149 (50%), Positives = 102/149 (68%), Gaps = 1/149 (1%)
 Frame = +2

Query  59   RPHAVCIPYPAQGHICAMLKLAKLLHHRGFHITYVLTQLNYTHIMKARNFLPLTQSPTFR  238
            + HAVC+PYPAQGHI  MLK+AKLLHH+GFHIT+V ++ N+  ++K+R    L   P F+
Sbjct  9    KAHAVCVPYPAQGHITPMLKVAKLLHHKGFHITFVNSEYNHRRLLKSRGRNSLDVLPDFQ  68

Query  239  FETIPDGLPSRENPDTALDVADLCFSTGKNCYAPFMELIQRLNSTAsdvppvscvvsdtv  418
            FETIPDGL  + + D   D + LC S  K C  PF  L+ +LNS+ + VPPV+C+V+D+ 
Sbjct  69   FETIPDGLGDQIDADVTQDTSFLCDSISKACLVPFRNLLAKLNSS-NVVPPVTCIVADSG  127

Query  419  MPFAVGATQELGVPVVLFWPLSAVASLMH  505
            M FA+   +EL +PVV FW  SA  +L +
Sbjct  128  MSFALDVKEELQIPVVTFWTSSACGTLAY  156



>ref|XP_010039907.1| PREDICTED: 7-deoxyloganetin glucosyltransferase-like [Eucalyptus 
grandis]
 gb|KCW45644.1| hypothetical protein EUGRSUZ_L00599 [Eucalyptus grandis]
Length=487

 Score =   135 bits (339),  Expect = 5e-34, Method: Compositional matrix adjust.
 Identities = 77/155 (50%), Positives = 101/155 (65%), Gaps = 3/155 (2%)
 Frame = +2

Query  53   VQRPHAVCIPYPAQGHICAMLKLAKLLHHRGFHITYVLTQLNYTHIMKARNFLPLTQSPT  232
            +Q+PHAVCIPYPAQGHI  ML LAKLLHHRGFH+T+V T+ N++ ++++R    L   P+
Sbjct  7    IQKPHAVCIPYPAQGHINPMLNLAKLLHHRGFHVTFVNTEYNHSRLLRSRGPSSLDGLPS  66

Query  233  FRFETIPDGL-PSRENPDTALDVADLCFSTGKNCYAPFMELIQRLNSTAsdvpp--vscv  403
            F+F TIPDGL PS    DT  D   LC ST K C   F +L+ RLN  ++      VSCV
Sbjct  67   FQFRTIPDGLPPSDAAADTTQDTLALCQSTSKFCLPYFRDLLHRLNEESATSGSPPVSCV  126

Query  404  vsdtvMPFAVGATQELGVPVVLFWPLSAVASLMHI  508
            VSD  M F + A + +GVP VL W  SA + + ++
Sbjct  127  VSDGAMTFTLDAAEAIGVPEVLLWTASACSFMGYV  161



>emb|CDY62991.1| BnaC07g48390D [Brassica napus]
Length=458

 Score =   134 bits (338),  Expect = 6e-34, Method: Compositional matrix adjust.
 Identities = 76/151 (50%), Positives = 104/151 (69%), Gaps = 2/151 (1%)
 Frame = +2

Query  56   QRPHAVCIPYPAQGHICAMLKLAKLLHHRGFHITYVLTQLNYTHIMKARNFLPLTQSPTF  235
            ++PH VC+PYPAQGHI  MLK+AKLL+ RGFH+T+V T  N+  ++++R    +   P F
Sbjct  10   EKPHVVCVPYPAQGHINPMLKVAKLLYARGFHVTFVNTIYNHNRLIRSRGPHAVKGLPFF  69

Query  236  RFETIPDGLPSRENPDTALDVADLCFSTGKNCYAPFMELIQRLNSTAsdvppvscvvsdt  415
            RFE+IPDGLP   + D   D+  LC ST KNC  PF EL+QR+N+   DVPPVSC+V+D 
Sbjct  70   RFESIPDGLPET-DVDVTQDITALCDSTMKNCLTPFKELLQRINA-GDDVPPVSCIVADG  127

Query  416  vMPFAVGATQELGVPVVLFWPLSAVASLMHI  508
             M F + A +ELG+P VLFW     A ++++
Sbjct  128  CMSFTLDAAEELGIPEVLFWTTGVCAFMVYL  158



>ref|XP_010030029.1| PREDICTED: 7-deoxyloganetin glucosyltransferase-like [Eucalyptus 
grandis]
Length=489

 Score =   134 bits (338),  Expect = 6e-34, Method: Compositional matrix adjust.
 Identities = 81/159 (51%), Positives = 102/159 (64%), Gaps = 12/159 (8%)
 Frame = +2

Query  56   QRPHAVCIPYPAQGHICAMLKLAKLLHHRGFHIT-----YVLTQLNYTHIMKARNFLPLT  220
             +PHAV IP+PAQGHI  ++KL   LHHRGFHIT     YV T+ N+   +K+R    L 
Sbjct  7    DKPHAVVIPFPAQGHINPIMKL---LHHRGFHITFVHTEYVHTEYNHKRFLKSRGLSSLE  63

Query  221  QSPTFRFETIPDGLP-SRENPDTALDVADLCFSTGKNCYAPFMELIQRLNSTAsdvp---  388
             SP FRFETIPDGLP S  + D    +  LC ST KNC APFM+L+ RLN  + D     
Sbjct  64   GSPGFRFETIPDGLPQSDSDEDVTQHIPPLCESTSKNCLAPFMDLLGRLNDKSVDDTEVP  123

Query  389  pvscvvsdtvMPFAVGATQELGVPVVLFWPLSAVASLMH  505
             VSCV++D  M FA+ A ++LGVP VLFW  SA  +L++
Sbjct  124  KVSCVIADGGMSFALDAAEKLGVPGVLFWTPSACGALVY  162



>gb|KDP41398.1| hypothetical protein JCGZ_15805 [Jatropha curcas]
Length=493

 Score =   134 bits (338),  Expect = 6e-34, Method: Compositional matrix adjust.
 Identities = 75/145 (52%), Positives = 96/145 (66%), Gaps = 4/145 (3%)
 Frame = +2

Query  65   HAVCIPYPAQGHICAMLKLAKLLHHRGFHITYVLTQLNYTHIMKARNFLPLTQSPTFRFE  244
            HAVCIP+PAQGHI  MLKLAKLLH +GFHIT+V T+ N+  ++K+R    +    TFRFE
Sbjct  12   HAVCIPFPAQGHINPMLKLAKLLHRKGFHITFVNTEYNHQRLLKSRGSNSIDCLSTFRFE  71

Query  245  TIPDGLPSRENPDTALDVADLCFSTGKNCYAPFMELIQRLNSTAsdvppv----scvvsd  412
            TIPDGLP  ++ D+  DV  LC ST KNC  PF +L+ +LN   S         +C+VSD
Sbjct  72   TIPDGLPPSDHADSTQDVPSLCDSTKKNCLPPFRDLLFKLNDNTSSSSSKVPPVTCIVSD  131

Query  413  tvMPFAVGATQELGVPVVLFWPLSA  487
             VM F + A +EL +P+VL W  SA
Sbjct  132  FVMSFTIEAAKELEIPIVLSWTASA  156



>ref|XP_008219317.1| PREDICTED: UDP-glycosyltransferase 85A2-like [Prunus mume]
Length=482

 Score =   134 bits (338),  Expect = 6e-34, Method: Compositional matrix adjust.
 Identities = 79/152 (52%), Positives = 105/152 (69%), Gaps = 2/152 (1%)
 Frame = +2

Query  53   VQRPHAVCIPYPAQGHICAMLKLAKLLHHRGFHITYVLTQLNYTHIMKARNFLPLTQSPT  232
            +++PHAVCIP+PAQGHI  MLKLAKLLH++GFHIT+V T+ N+  ++K+R    L   P+
Sbjct  7    IEKPHAVCIPFPAQGHINPMLKLAKLLHYKGFHITFVNTEFNHKRLLKSRGPNSLDGLPS  66

Query  233  FRFETIPDGLPSRENPDTALDVADLCFSTGKNCYAPFMELIQRLNSTAsdvppvscvvsd  412
            FRFETIPDGLP   + +   D+  LC ST K+    F +L+ +LNS+    PPVSC+VSD
Sbjct  67   FRFETIPDGLPPT-DANATQDIPSLCESTRKHSLPYFRDLLSKLNSST-GCPPVSCIVSD  124

Query  413  tvMPFAVGATQELGVPVVLFWPLSAVASLMHI  508
             VM F + A  ELG+P VLFW  SA   L ++
Sbjct  125  GVMSFTLDAAHELGIPEVLFWTTSACGFLAYV  156



>emb|CDP01079.1| unnamed protein product [Coffea canephora]
Length=481

 Score =   134 bits (338),  Expect = 6e-34, Method: Compositional matrix adjust.
 Identities = 75/145 (52%), Positives = 95/145 (66%), Gaps = 2/145 (1%)
 Frame = +2

Query  56   QRPHAVCIPYPAQGHICAMLKLAKLLHHRGFHITYVLTQLNYTHIMKARNFLPLTQSPTF  235
            ++PHAVCIP+PAQGHI  MLKLAKLLH +GFHIT+V T+ N+  ++K+R    L   P F
Sbjct  9    KKPHAVCIPFPAQGHIKPMLKLAKLLHQKGFHITFVNTEFNHRRLLKSRGPDALNGLPDF  68

Query  236  RFETIPDGLPSRENPDTALDVADLCFSTGKNCYAPFMELIQRLNSTAsdvpp-vscvvsd  412
            +F+ IPDGLP  +  D   D+  LC S  +NC  PF EL+  LN T+S     VSC+VSD
Sbjct  69   QFKAIPDGLPPSD-VDATQDILSLCESIDRNCLGPFRELLAELNDTSSSEVAPVSCIVSD  127

Query  413  tvMPFAVGATQELGVPVVLFWPLSA  487
                F + A QELG+P VL W  SA
Sbjct  128  GATTFTLAAAQELGIPEVLLWTSSA  152



>ref|XP_002300186.1| hypothetical protein POPTR_0001s31950g [Populus trichocarpa]
 gb|EEE84991.1| hypothetical protein POPTR_0001s31950g [Populus trichocarpa]
Length=483

 Score =   134 bits (338),  Expect = 7e-34, Method: Compositional matrix adjust.
 Identities = 73/148 (49%), Positives = 98/148 (66%), Gaps = 1/148 (1%)
 Frame = +2

Query  56   QRPHAVCIPYPAQGHICAMLKLAKLLHHRGFHITYVLTQLNYTHIMKARNFLPLTQSPTF  235
             +PHAVC+P+PAQGHI  MLKLAKLLH +GFH+T+V T+ N+  ++K+R    L   P F
Sbjct  8    DKPHAVCVPFPAQGHINPMLKLAKLLHFKGFHVTFVNTEYNHKRLLKSRGTNSLDGFPDF  67

Query  236  RFETIPDGLPSRENPDTALDVADLCFSTGKNCYAPFMELIQRLNSTAsdvppvscvvsdt  415
            +FETIPDGLPS +  D   DV  LC  T +   AP  +LI +LNS+   VP V+C+V+D 
Sbjct  68   QFETIPDGLPSSDIADATQDVPSLCKYTSQTALAPLCDLIAKLNSSG-AVPQVTCIVADA  126

Query  416  vMPFAVGATQELGVPVVLFWPLSAVASL  499
             M F++ A +E G+P  +FW  SA   L
Sbjct  127  CMSFSLDAAEEFGIPEAVFWTPSACGVL  154



>gb|AFJ52992.1| UDP-glycosyltransferase 1 [Linum usitatissimum]
Length=491

 Score =   134 bits (338),  Expect = 7e-34, Method: Compositional matrix adjust.
 Identities = 81/156 (52%), Positives = 102/156 (65%), Gaps = 7/156 (4%)
 Frame = +2

Query  50   EVQRPHAVCIPYPAQGHICAMLKLAKLLHHRGFHITYVLTQLNYTHIMKARNFLPLTQSP  229
            E  +PHAVCIPYPAQGH   MLKLAKLLHHRGFH+T+V T+ N+  + K++    ++  P
Sbjct  8    EKPKPHAVCIPYPAQGHKTPMLKLAKLLHHRGFHVTFVNTEYNHNRLRKSQ---AVSDLP  64

Query  230  TFRFETIPDGLPSRENPDTALDVADLCFSTGKNCYAPFMELIQRLNSTAsdvpp---vsc  400
            +FRF TIPDGLP  ++ D   D+  LC ST + C   F EL+ +LN  AS       VSC
Sbjct  65   SFRFATIPDGLPPTDS-DVTQDIPSLCESTRRTCLPHFKELLAKLNDVASFEDGVPPVSC  123

Query  401  vvsdtvMPFAVGATQELGVPVVLFWPLSAVASLMHI  508
            VVSD VM F + A +ELGVP VLFW  SA   L ++
Sbjct  124  VVSDGVMSFTLDAAEELGVPEVLFWTTSACGFLGYM  159



>ref|XP_007224069.1| hypothetical protein PRUPE_ppa015357mg [Prunus persica]
 gb|EMJ25268.1| hypothetical protein PRUPE_ppa015357mg [Prunus persica]
Length=482

 Score =   134 bits (338),  Expect = 7e-34, Method: Compositional matrix adjust.
 Identities = 79/152 (52%), Positives = 105/152 (69%), Gaps = 2/152 (1%)
 Frame = +2

Query  53   VQRPHAVCIPYPAQGHICAMLKLAKLLHHRGFHITYVLTQLNYTHIMKARNFLPLTQSPT  232
            +++PHAVCIP+PAQGHI  MLKLAKLLH++GFHIT+V T+ N+  ++K+R    L   P+
Sbjct  7    IEKPHAVCIPFPAQGHINPMLKLAKLLHYKGFHITFVNTEFNHKRLLKSRGPNSLDGLPS  66

Query  233  FRFETIPDGLPSRENPDTALDVADLCFSTGKNCYAPFMELIQRLNSTAsdvppvscvvsd  412
            FRFETIPDGLP   + +   D+  LC ST K+    F +L+ +LNS+    PPVSC+VSD
Sbjct  67   FRFETIPDGLP-LTDANATQDIPSLCESTRKHSLPYFRDLLSKLNSST-GCPPVSCIVSD  124

Query  413  tvMPFAVGATQELGVPVVLFWPLSAVASLMHI  508
             VM F + A  ELG+P VLFW  SA   L ++
Sbjct  125  GVMSFTLDAAHELGIPEVLFWTTSACGFLAYV  156



>ref|XP_006472583.1| PREDICTED: UDP-glycosyltransferase 85A2-like [Citrus sinensis]
Length=503

 Score =   134 bits (337),  Expect = 8e-34, Method: Compositional matrix adjust.
 Identities = 74/153 (48%), Positives = 101/153 (66%), Gaps = 3/153 (2%)
 Frame = +2

Query  56   QRPHAVCIPYPAQGHICAMLKLAKLLHHRGFHITYVLTQLNYTHIMKARNFLPLTQSPTF  235
            +RPHAVC+PYPAQGHI  M +LAKLLHH+GFHIT+V T+ N   ++K++    L   PTF
Sbjct  11   RRPHAVCVPYPAQGHINPMFQLAKLLHHKGFHITFVNTEFNQRRLLKSQGPDSLNAVPTF  70

Query  236  RFETIPDGLPSRENPDTALDVADLCFSTGKNCYAPFMELIQRLNSTAsdvpp--vscvvs  409
            RFETIPDGLP  +  D   D+  LC ST + C APF  L+  LN++A       V+C+VS
Sbjct  71   RFETIPDGLPPSD-ADATQDIPSLCDSTRRTCSAPFQALLTTLNNSALSNANPPVTCIVS  129

Query  410  dtvMPFAVGATQELGVPVVLFWPLSAVASLMHI  508
            D  M F + A+++L +P VLF+  SA   + ++
Sbjct  130  DWSMGFTLKASKQLNIPNVLFFTASACGFMGYV  162



>gb|KFK44329.1| hypothetical protein AALP_AA1G244100 [Arabis alpina]
Length=483

 Score =   134 bits (337),  Expect = 8e-34, Method: Compositional matrix adjust.
 Identities = 79/151 (52%), Positives = 104/151 (69%), Gaps = 2/151 (1%)
 Frame = +2

Query  56   QRPHAVCIPYPAQGHICAMLKLAKLLHHRGFHITYVLTQLNYTHIMKARNFLPLTQSPTF  235
            Q+PH VC+PYPAQGHI  MLK+AKLLH +GFH+T+V T  N+  ++++R    L   P+F
Sbjct  10   QKPHVVCVPYPAQGHINPMLKVAKLLHAKGFHVTFVNTIYNHNRLLRSRGPHALDGLPSF  69

Query  236  RFETIPDGLPSRENPDTALDVADLCFSTGKNCYAPFMELIQRLNSTAsdvppvscvvsdt  415
            RFE+IPDGLP   + D   D+  LC ST KNC  PF EL++R+N+   DVPPVSC+VSD 
Sbjct  70   RFESIPDGLPET-DVDATRDIPALCESTVKNCLTPFKELLRRINA-GDDVPPVSCIVSDG  127

Query  416  vMPFAVGATQELGVPVVLFWPLSAVASLMHI  508
             M F + A +ELG+P VLF   SA   L ++
Sbjct  128  CMTFTIDAAEELGIPEVLFRTTSACGFLAYL  158



>ref|XP_010498706.1| PREDICTED: UDP-glycosyltransferase 85A2-like [Camelina sativa]
Length=484

 Score =   134 bits (337),  Expect = 8e-34, Method: Compositional matrix adjust.
 Identities = 75/152 (49%), Positives = 106/152 (70%), Gaps = 2/152 (1%)
 Frame = +2

Query  53   VQRPHAVCIPYPAQGHICAMLKLAKLLHHRGFHITYVLTQLNYTHIMKARNFLPLTQSPT  232
            VQ+PH VC+PYPAQGHI  M+K+AKLL+ +GFH+T+V T  N+  ++++R    +    +
Sbjct  9    VQKPHVVCVPYPAQGHINPMMKMAKLLYAKGFHVTFVNTVYNHNRLLRSRGPKAVDGLAS  68

Query  233  FRFETIPDGLPSRENPDTALDVADLCFSTGKNCYAPFMELIQRLNSTAsdvppvscvvsd  412
            FRFE+IPDGLP   + D   D+  LC ST K+C APF EL++++N+   DVPPVSC++SD
Sbjct  69   FRFESIPDGLPET-DVDVTQDIPSLCESTAKHCLAPFKELLRQINAN-DDVPPVSCILSD  126

Query  413  tvMPFAVGATQELGVPVVLFWPLSAVASLMHI  508
              M F + A +ELG+P VLFW  SA   L ++
Sbjct  127  GCMSFTLDAAEELGIPEVLFWTTSACGFLAYL  158



>ref|XP_002454243.1| hypothetical protein SORBIDRAFT_04g027420 [Sorghum bicolor]
 gb|EES07219.1| hypothetical protein SORBIDRAFT_04g027420 [Sorghum bicolor]
Length=487

 Score =   134 bits (337),  Expect = 9e-34, Method: Compositional matrix adjust.
 Identities = 73/152 (48%), Positives = 98/152 (64%), Gaps = 2/152 (1%)
 Frame = +2

Query  56   QRPHAVCIPYPAQGHICAMLKLAKLLHHRGFHITYVLTQLNYTHIMKARNFLPLTQSPTF  235
            Q+PHAVC+PYPAQGHI  ML +AKLLH RGFH+T+V T+ N   +++ R    +   P F
Sbjct  9    QQPHAVCLPYPAQGHITPMLNVAKLLHARGFHVTFVNTEYNQARLVRTRGAAAVAGLPGF  68

Query  236  RFETIPDGLPSRENPDTALDVADLCFSTGKNCYAPFMELIQRLNSTAsdvpp--vscvvs  409
            RF TIPDGLP  ++ D   D+  LC ST + C  PF  L+  LN +A+      V+CVVS
Sbjct  69   RFATIPDGLPPSDDDDVTQDIPSLCKSTTETCLEPFRRLLADLNDSAATGCHPPVTCVVS  128

Query  410  dtvMPFAVGATQELGVPVVLFWPLSAVASLMH  505
            D VM F++ A +ELG+P V  W  SA++ L +
Sbjct  129  DVVMGFSIDAAKELGLPYVQLWTASAISFLGY  160



>gb|AID16086.1| flavonol-3-O-glucoside L-rhamnosyltransferase, partial [Morus 
alba]
Length=447

 Score =   134 bits (336),  Expect = 9e-34, Method: Compositional matrix adjust.
 Identities = 79/152 (52%), Positives = 106/152 (70%), Gaps = 2/152 (1%)
 Frame = +2

Query  53   VQRPHAVCIPYPAQGHICAMLKLAKLLHHRGFHITYVLTQLNYTHIMKARNFLPLTQSPT  232
            +++PHAVCIP+PAQGH+  MLKLAKLLH +GFHIT+V T+ N+  ++K+R    L   P+
Sbjct  7    LEKPHAVCIPFPAQGHVNPMLKLAKLLHSKGFHITFVNTEFNHKRLLKSRGAHALDGLPS  66

Query  233  FRFETIPDGLPSRENPDTALDVADLCFSTGKNCYAPFMELIQRLNSTAsdvppvscvvsd  412
            FRFE IPDGLP   + D    +  +C ST K+  APF +L+ +LNS+  +VPPVSCVVSD
Sbjct  67   FRFEAIPDGLPPT-DADATQSIPAICESTPKHSLAPFRDLLLKLNSSP-EVPPVSCVVSD  124

Query  413  tvMPFAVGATQELGVPVVLFWPLSAVASLMHI  508
              M F + A +ELG+P VLFW  SA   L ++
Sbjct  125  GAMSFTLDAAEELGIPEVLFWTTSACGFLGYL  156



>gb|KDO81005.1| hypothetical protein CISIN_1g046355mg, partial [Citrus sinensis]
Length=127

 Score =   127 bits (318),  Expect = 9e-34, Method: Compositional matrix adjust.
 Identities = 60/107 (56%), Positives = 77/107 (72%), Gaps = 1/107 (1%)
 Frame = +2

Query  56   QRPHAVCIPYPAQGHICAMLKLAKLLHHRGFHITYVLTQLNYTHIMKARNFLPLTQSPTF  235
            +RPHAVC+P+PAQGHI  M +LAKLLHH+GFHIT+V T+ N   ++K++    L   PTF
Sbjct  11   RRPHAVCVPHPAQGHINPMFQLAKLLHHKGFHITFVNTEFNQRRLLKSQGPDSLNAVPTF  70

Query  236  RFETIPDGLPSRENPDTALDVADLCFSTGKNCYAPFMELIQRLNSTA  376
            RFETIPDGLP   + D   D+  LC ST + C APF EL+ RLN++A
Sbjct  71   RFETIPDGLPP-SDADATQDIPSLCDSTRRTCSAPFQELLTRLNNSA  116



>ref|XP_010676190.1| PREDICTED: 7-deoxyloganetin glucosyltransferase-like [Beta vulgaris 
subsp. vulgaris]
Length=482

 Score =   134 bits (337),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 75/138 (54%), Positives = 94/138 (68%), Gaps = 1/138 (1%)
 Frame = +2

Query  56   QRPHAVCIPYPAQGHICAMLKLAKLLHHRGFHITYVLTQLNYTHIMKARNFLPLTQSPTF  235
            Q+PHAVCIPYPAQGHI  +LKLAKLLH +GFHIT+V T+ NY  ++++R    L   PTF
Sbjct  7    QKPHAVCIPYPAQGHINPLLKLAKLLHSQGFHITFVHTEYNYNRLLRSRGPDALAGLPTF  66

Query  236  RFETIPDGLPSRENPDTALDVADLCFSTGKNCYAPFMELIQRLNSTAsdvppvscvvsdt  415
            RFE I DG+P  E+ +   D+  LC ST      PF ELI RLN +  DVP VSC+V+D 
Sbjct  67   RFEAISDGMPCTEDANATQDIPSLCISTEYRSLGPFKELINRLNESG-DVPQVSCIVADA  125

Query  416  vMPFAVGATQELGVPVVL  469
             M F + A +ELG+P VL
Sbjct  126  AMYFTLDAAEELGIPEVL  143



>dbj|BAO51840.1| UDP-glycosyltransferase 85K12 [Humulus lupulus]
Length=484

 Score =   134 bits (337),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 72/153 (47%), Positives = 107/153 (70%), Gaps = 2/153 (1%)
 Frame = +2

Query  50   EVQRPHAVCIPYPAQGHICAMLKLAKLLHHRGFHITYVLTQLNYTHIMKARNFLPLTQSP  229
            E+ +PHAVC+P+PAQGH+  M++LAKLLH RGFHITYV T+ N+  ++++R    +   P
Sbjct  6    EMMKPHAVCVPFPAQGHVNPMMQLAKLLHSRGFHITYVNTEFNHRRLIRSRGPDSVKGLP  65

Query  230  TFRFETIPDGLPSRENPDTALDVADLCFSTGKNCYAPFMELIQRLNSTAsdvppvscvvs  409
             F+FETIPDGLP  +  D   +V  LC +T KNC  PF EL+ +L S + +VPPV+C+++
Sbjct  66   DFQFETIPDGLPPSDR-DATQEVPPLCDATRKNCLGPFKELLHKLRSCS-EVPPVTCIIT  123

Query  410  dtvMPFAVGATQELGVPVVLFWPLSAVASLMHI  508
            D +M F + A +E G+P V+FW  SA + + ++
Sbjct  124  DGIMTFGIKAAREFGIPEVVFWTASACSFMGYL  156



>ref|XP_006351765.1| PREDICTED: UDP-glycosyltransferase 85A5-like [Solanum tuberosum]
Length=499

 Score =   134 bits (337),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 75/150 (50%), Positives = 100/150 (67%), Gaps = 2/150 (1%)
 Frame = +2

Query  65   HAVCIPYPAQGHICAMLKLAKLLHHRGFHITYVLTQLNYTHIMKARNFLPLTQSPTFRFE  244
            H VC+PYPAQGHI  MLKLAKL+HH GF+IT+V T+ N+  ++++     L   P FRFE
Sbjct  26   HVVCVPYPAQGHISPMLKLAKLVHHNGFYITFVNTEFNHKRLLRSNGPQSLDGLPGFRFE  85

Query  245  TIPDGLPSRE-NPDTALDVADLCFSTGKNCYAPFMELIQRLNSTAsdvp-pvscvvsdtv  418
            TIPDGLPS + + D    V  LC ST KNC  PF  LI ++N+  + V  PV+C+VSD +
Sbjct  86   TIPDGLPSTDHDVDATQHVPSLCASTSKNCLVPFRNLINKINAEGNGVVPPVTCIVSDVI  145

Query  419  MPFAVGATQELGVPVVLFWPLSAVASLMHI  508
            M F + A +ELG+P VLFW  SA   + ++
Sbjct  146  MSFTLDAAEELGIPEVLFWTASACGFMCYL  175



>gb|AAV32498.1| UDP-glucuronosyltransferase [Arabidopsis thaliana]
Length=430

 Score =   133 bits (335),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 78/144 (54%), Positives = 101/144 (70%), Gaps = 2/144 (1%)
 Frame = +2

Query  56   QRPHAVCIPYPAQGHICAMLKLAKLLHHRGFHITYVLTQLNYTHIMKARNFLPLTQSPTF  235
            Q+PH VC+P+PAQGHI  MLK+AKLLH RGFH+T+V T  N+  ++++R    L   P+F
Sbjct  10   QKPHVVCVPHPAQGHINPMLKVAKLLHARGFHVTFVNTVYNHNRLLRSRGPYALDGLPSF  69

Query  236  RFETIPDGLPSRENPDTALDVADLCFSTGKNCYAPFMELIQRLNSTAsdvppvscvvsdt  415
            RFE+I DGLP  +  D   D+  LC ST KNC APF EL++R+N    DVPPVSC+VSD 
Sbjct  70   RFESIADGLPDTDG-DKTQDIPALCVSTMKNCLAPFKELLRRIND-VDDVPPVSCIVSDG  127

Query  416  vMPFAVGATQELGVPVVLFWPLSA  487
            VM F + A +EL +P V+FW  SA
Sbjct  128  VMSFTLDAAEELNLPEVIFWTNSA  151



>ref|XP_002893221.1| UDP-glycosyltransferase [Arabidopsis lyrata subsp. lyrata]
 gb|EFH69480.1| UDP-glycosyltransferase [Arabidopsis lyrata subsp. lyrata]
Length=469

 Score =   133 bits (335),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 77/151 (51%), Positives = 106/151 (70%), Gaps = 2/151 (1%)
 Frame = +2

Query  56   QRPHAVCIPYPAQGHICAMLKLAKLLHHRGFHITYVLTQLNYTHIMKARNFLPLTQSPTF  235
            Q+PH VC+PYPAQGHI  M+K+AKLL+ +GFH+T+V T  N+  ++++R    +   P+F
Sbjct  7    QKPHVVCVPYPAQGHINPMMKVAKLLYAKGFHVTFVNTVYNHNRLLRSRGSNAVDGLPSF  66

Query  236  RFETIPDGLPSRENPDTALDVADLCFSTGKNCYAPFMELIQRLNSTAsdvppvscvvsdt  415
            RFE+IPDGL S  + D   D+  LC ST K+C APF EL++++N+   DVPPVSC+VSD 
Sbjct  67   RFESIPDGL-SETDVDVTQDIPTLCESTMKHCLAPFKELLRQINA-GDDVPPVSCIVSDG  124

Query  416  vMPFAVGATQELGVPVVLFWPLSAVASLMHI  508
             M F + A +ELGVP VLFW  SA   L ++
Sbjct  125  CMSFTLDAAEELGVPEVLFWTTSACGFLAYL  155



>gb|AAF87258.1|AC068562_5 Strong similarity to UDP-glucose glucosyltransferase from Arabidopsis 
thaliana gb|AB016819 and contains a UDP-glucosyl transferase 
PF|00201 domain [Arabidopsis thaliana]
Length=450

 Score =   133 bits (335),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 78/144 (54%), Positives = 101/144 (70%), Gaps = 2/144 (1%)
 Frame = +2

Query  56   QRPHAVCIPYPAQGHICAMLKLAKLLHHRGFHITYVLTQLNYTHIMKARNFLPLTQSPTF  235
            Q+PH VC+P+PAQGHI  MLK+AKLLH RGFH+T+V T  N+  ++++R    L   P+F
Sbjct  10   QKPHVVCVPHPAQGHINPMLKVAKLLHARGFHVTFVNTVYNHNRLLRSRGPYALDGLPSF  69

Query  236  RFETIPDGLPSRENPDTALDVADLCFSTGKNCYAPFMELIQRLNSTAsdvppvscvvsdt  415
            RFE+I DGLP  +  D   D+  LC ST KNC APF EL++R+N    DVPPVSC+VSD 
Sbjct  70   RFESIADGLPDTDG-DKTQDIPALCVSTMKNCLAPFKELLRRIND-VDDVPPVSCIVSDG  127

Query  416  vMPFAVGATQELGVPVVLFWPLSA  487
            VM F + A +EL +P V+FW  SA
Sbjct  128  VMSFTLDAAEELNLPEVIFWTNSA  151



>ref|XP_004299648.1| PREDICTED: UDP-glycosyltransferase 85A1-like [Fragaria vesca 
subsp. vesca]
Length=488

 Score =   133 bits (335),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 79/154 (51%), Positives = 105/154 (68%), Gaps = 2/154 (1%)
 Frame = +2

Query  47   MEVQRPHAVCIPYPAQGHICAMLKLAKLLHHRGFHITYVLTQLNYTHIMKARNFLPLTQS  226
            +E  +PHAVCIPYPAQGHI  MLKLAKLLHH+GFH+T+V ++ N+  ++ +R    L   
Sbjct  8    VETNKPHAVCIPYPAQGHINPMLKLAKLLHHKGFHVTFVNSEYNHRRLLNSRGPNALDGL  67

Query  227  PTFRFETIPDGLPSRENPDTALDVADLCFSTGKNCYAPFMELIQRLNSTAsdvppvscvv  406
            P+F+F+TIPDGLP  +   T  D+  LC ST K C   F +L++ +NS   + PPVSCVV
Sbjct  68   PSFQFKTIPDGLPPTDTNATQ-DIPSLCESTRKYCLPHFRKLLEEVNSEE-NSPPVSCVV  125

Query  407  sdtvMPFAVGATQELGVPVVLFWPLSAVASLMHI  508
            SD VM F + A +ELGVP VLFW  SA   + ++
Sbjct  126  SDGVMSFTLDAAEELGVPEVLFWTTSACGFMAYV  159



>ref|XP_004237925.1| PREDICTED: 7-deoxyloganetin glucosyltransferase-like [Solanum 
lycopersicum]
Length=482

 Score =   133 bits (335),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 74/148 (50%), Positives = 101/148 (68%), Gaps = 2/148 (1%)
 Frame = +2

Query  50   EVQRPHAVCIPYPAQGHICAMLKLAKLLHHRGFHITYVLTQLNYTHIMKARNFLPLTQSP  229
            ++ +PHAVCIP+PAQGHI  MLKLAKLLH + FHIT+V T  N+  ++K+R    L + P
Sbjct  7    KLSKPHAVCIPFPAQGHINPMLKLAKLLHIQDFHITFVNTDFNHRRLLKSRGLNSLVRLP  66

Query  230  TFRFETIPDGLPSRENPDTALDVADLCFSTGKNCYAPFMELIQRLNSTAsdvppvscvvs  409
            +FRFE+IPDGLP   N D   DV  +C +  K+C APF +L+ RLN+ + ++P +SC+VS
Sbjct  67   SFRFESIPDGLPP-SNEDATQDVPSMCEACMKSCLAPFRDLVARLNNNS-NIPSISCIVS  124

Query  410  dtvMPFAVGATQELGVPVVLFWPLSAVA  493
            D  M F    ++ELGVP V FW  S  +
Sbjct  125  DAGMSFTQQVSEELGVPNVGFWTASVCS  152



>gb|EYU43443.1| hypothetical protein MIMGU_mgv1a018722mg [Erythranthe guttata]
Length=475

 Score =   133 bits (335),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 82/148 (55%), Positives = 99/148 (67%), Gaps = 5/148 (3%)
 Frame = +2

Query  59   RPHAVCIPYPAQGHICAMLKLAKLLHHRGFHITYVLTQLNYTHIMKARNFLPLTQSPTFR  238
            +PHAVCIP+PAQGHI  MLKLAKLLH+ GFHIT+V T+ N+  ++K+R    LT  P+FR
Sbjct  9    KPHAVCIPFPAQGHINPMLKLAKLLHNNGFHITFVNTEYNHHRLLKSRGPDSLTGLPSFR  68

Query  239  FETIPDGLP----SRENPDTALDVADLCFSTGKNCYAPFMELIQRLNSTAsdvp-pvscv  403
            FETIPDGLP       + D   D+  LC ST   C APF  L+ +LN TAS    PVSC+
Sbjct  69   FETIPDGLPPPSEDDADADATQDIPSLCESTTTTCLAPFRNLLAKLNDTASSEVPPVSCI  128

Query  404  vsdtvMPFAVGATQELGVPVVLFWPLSA  487
            VSD VM F   A +EL +P VLFW  SA
Sbjct  129  VSDGVMSFTADAAEELAIPEVLFWTTSA  156



>ref|XP_008219318.1| PREDICTED: UDP-glycosyltransferase 85A2-like [Prunus mume]
Length=480

 Score =   133 bits (335),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 78/152 (51%), Positives = 105/152 (69%), Gaps = 2/152 (1%)
 Frame = +2

Query  53   VQRPHAVCIPYPAQGHICAMLKLAKLLHHRGFHITYVLTQLNYTHIMKARNFLPLTQSPT  232
            +++PHAVCIP+PAQGHI  ML+LAKLLH++GFHIT+V T+ N+  ++K+R    L   P+
Sbjct  7    IEKPHAVCIPFPAQGHINPMLELAKLLHYKGFHITFVNTEFNHKRLLKSRGPNSLDGLPS  66

Query  233  FRFETIPDGLPSRENPDTALDVADLCFSTGKNCYAPFMELIQRLNSTAsdvppvscvvsd  412
            FRFETIPDGLP   + +   D+  LC ST K+    F +L+ +LNS+    PPVSC+VSD
Sbjct  67   FRFETIPDGLPPT-DANATQDIPSLCESTRKHSLPYFRDLLSKLNSST-GCPPVSCIVSD  124

Query  413  tvMPFAVGATQELGVPVVLFWPLSAVASLMHI  508
             VM F + A  ELG+P VLFW  SA   L ++
Sbjct  125  GVMSFTLDAAHELGIPEVLFWTTSACGFLAYV  156



>ref|XP_010320181.1| PREDICTED: 7-deoxyloganetin glucosyltransferase-like [Solanum 
lycopersicum]
Length=492

 Score =   133 bits (335),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 74/152 (49%), Positives = 102/152 (67%), Gaps = 1/152 (1%)
 Frame = +2

Query  53   VQRPHAVCIPYPAQGHICAMLKLAKLLHHRGFHITYVLTQLNYTHIMKARNFLPLTQSPT  232
            + +PHAVCI +PAQGHI  MLKLAKLLH RGFHIT+V T+ N+  ++K+R    L    +
Sbjct  9    LSKPHAVCIAFPAQGHINPMLKLAKLLHVRGFHITFVNTEFNHRRLLKSRGPNALDGLSS  68

Query  233  FRFETIPDGLPSRENPDTALDVADLCFSTGKNCYAPFMELIQRLNSTAsdvppvscvvsd  412
            FRFE+IPDGLP   N D   D++ LC +  K+C  PF +LI RLN+++ + P ++C+VSD
Sbjct  69   FRFESIPDGLPPPSNEDATQDISSLCEACKKSCLVPFRDLITRLNASS-NFPSITCIVSD  127

Query  413  tvMPFAVGATQELGVPVVLFWPLSAVASLMHI  508
              M F    ++EL +P V FW  SA A L ++
Sbjct  128  AGMSFTHQVSKELSIPNVGFWTSSAGALLAYL  159



>ref|XP_008219322.1| PREDICTED: UDP-glycosyltransferase 85A2-like [Prunus mume]
Length=483

 Score =   133 bits (335),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 76/151 (50%), Positives = 102/151 (68%), Gaps = 2/151 (1%)
 Frame = +2

Query  56   QRPHAVCIPYPAQGHICAMLKLAKLLHHRGFHITYVLTQLNYTHIMKARNFLPLTQSPTF  235
            ++PHAVCIP+PAQGHI  MLK+AKLLH +GFHIT+V T+ N+  ++K+R        P+F
Sbjct  8    EKPHAVCIPFPAQGHINPMLKVAKLLHCKGFHITFVNTEFNHKRLLKSRGPNSHDGLPSF  67

Query  236  RFETIPDGLPSRENPDTALDVADLCFSTGKNCYAPFMELIQRLNSTAsdvppvscvvsdt  415
            RFE IPDGLP   N     D+  LC+ST ++C   F EL+ +LNS+    PPVSC+VSD 
Sbjct  68   RFENIPDGLPPT-NASVTQDIPSLCYSTRRHCLPHFRELLSKLNSSP-ASPPVSCIVSDG  125

Query  416  vMPFAVGATQELGVPVVLFWPLSAVASLMHI  508
             M F + A +ELG+P VLFW  SA   + ++
Sbjct  126  AMSFTLDAAEELGIPEVLFWTTSACGFMSYV  156



>ref|XP_010060018.1| PREDICTED: 7-deoxyloganetin glucosyltransferase-like [Eucalyptus 
grandis]
Length=485

 Score =   133 bits (335),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 74/148 (50%), Positives = 98/148 (66%), Gaps = 3/148 (2%)
 Frame = +2

Query  56   QRPHAVCIPYPAQGHICAMLKLAKLLHHRGFHITYVLTQLNYTHIMKARNFLPLTQSPTF  235
            Q+PHAVCIP+PAQ HI AML LAKLLH RGFH+T+V T+ N+  ++++R    L   P+F
Sbjct  8    QKPHAVCIPFPAQSHINAMLNLAKLLHDRGFHVTFVNTEYNHNRLLRSRGPSSLDSLPSF  67

Query  236  RFETIPDGLPSRENPDTALDVADLCFSTGKNCYAPFMELIQRLNSTAsdvpp--vscvvs  409
            RF TIPDGLP  +  D   D+  LC ST + C   F +L++RL+  ++      VSCVVS
Sbjct  68   RFRTIPDGLPPSDG-DATQDIPALCQSTQERCLPYFQDLLKRLDEESATSGSPPVSCVVS  126

Query  410  dtvMPFAVGATQELGVPVVLFWPLSAVA  493
            D    F + A + +GVP VLFWP+SA A
Sbjct  127  DVSTTFTLDAAEAVGVPEVLFWPISACA  154



>ref|XP_004299646.1| PREDICTED: UDP-glycosyltransferase 85A2-like [Fragaria vesca 
subsp. vesca]
Length=486

 Score =   133 bits (335),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 75/151 (50%), Positives = 106/151 (70%), Gaps = 1/151 (1%)
 Frame = +2

Query  56   QRPHAVCIPYPAQGHICAMLKLAKLLHHRGFHITYVLTQLNYTHIMKARNFLPLTQSPTF  235
            ++PHAVCIP+PAQGHI  MLK+AKLLH++GF+IT+V T+  +  ++K+R    L   P+F
Sbjct  9    EKPHAVCIPFPAQGHINPMLKVAKLLHYKGFYITFVNTEFIHKRLLKSRGPNSLDGFPSF  68

Query  236  RFETIPDGLPSRENPDTALDVADLCFSTGKNCYAPFMELIQRLNSTAsdvppvscvvsdt  415
            RFETIPDGLP  +       +  LC ST KNC APF +L+ +LNS+  + PPV+C+V+D 
Sbjct  69   RFETIPDGLPPTDANVATQHMPSLCESTRKNCLAPFRDLLLKLNSSP-NSPPVTCIVADG  127

Query  416  vMPFAVGATQELGVPVVLFWPLSAVASLMHI  508
            +M F + A QELG+P V+FW  SA   + ++
Sbjct  128  IMNFTLDAAQELGLPEVIFWTTSACGFMGYL  158



>dbj|BAJ85429.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ85618.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=485

 Score =   133 bits (335),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 73/149 (49%), Positives = 99/149 (66%), Gaps = 0/149 (0%)
 Frame = +2

Query  59   RPHAVCIPYPAQGHICAMLKLAKLLHHRGFHITYVLTQLNYTHIMKARNFLPLTQSPTFR  238
            +PHAVC+PYPAQGHI  ML +AKLLH RGF +T+V T+ N+  ++++R    +   P FR
Sbjct  10   KPHAVCLPYPAQGHITPMLNVAKLLHARGFDVTFVNTEYNHARLVRSRGAAAVAGLPGFR  69

Query  239  FETIPDGLPSRENPDTALDVADLCFSTGKNCYAPFMELIQRLNSTAsdvppvscvvsdtv  418
            F TIPDGLP  ++ D   D+  LC ST + C  PF +L+ RLN   +  PPV+CVVSD V
Sbjct  70   FATIPDGLPPSDDDDVTQDIPALCKSTTETCLGPFRDLLARLNDPTTGHPPVTCVVSDVV  129

Query  419  MPFAVGATQELGVPVVLFWPLSAVASLMH  505
            M F++ A  ELG+P V  W  SA++ L +
Sbjct  130  MGFSMEAANELGLPYVHLWTASAISYLGY  158



>gb|KFK44332.1| hypothetical protein AALP_AA1G244400 [Arabis alpina]
Length=479

 Score =   133 bits (335),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 82/151 (54%), Positives = 104/151 (69%), Gaps = 2/151 (1%)
 Frame = +2

Query  56   QRPHAVCIPYPAQGHICAMLKLAKLLHHRGFHITYVLTQLNYTHIMKARNFLPLTQSPTF  235
            Q+PH VC+P+PAQGHI  MLK+AKLLH +GFH+T+V T  ++  ++++R    L    +F
Sbjct  10   QKPHVVCVPFPAQGHINPMLKVAKLLHAKGFHVTFVNTIYSHNRLLRSRGPNALDGLSSF  69

Query  236  RFETIPDGLPSRENPDTALDVADLCFSTGKNCYAPFMELIQRLNSTAsdvppvscvvsdt  415
            RFE+IPDGLP   + D   DV  LC ST KN  APF EL+ RLNS   DVPPVSC+VSD 
Sbjct  70   RFESIPDGLPET-SADAMQDVLALCESTMKNSLAPFKELLHRLNS-GDDVPPVSCIVSDG  127

Query  416  vMPFAVGATQELGVPVVLFWPLSAVASLMHI  508
            VM F + A +ELGVP VLFW  SA   L ++
Sbjct  128  VMSFTLDAAKELGVPEVLFWTTSACGFLAYL  158



>ref|XP_008455233.1| PREDICTED: UDP-glycosyltransferase 85A5-like [Cucumis melo]
Length=494

 Score =   133 bits (334),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 75/153 (49%), Positives = 100/153 (65%), Gaps = 1/153 (1%)
 Frame = +2

Query  50   EVQRPHAVCIPYPAQGHICAMLKLAKLLHHRGFHITYVLTQLNYTHIMKARNFLPLTQSP  229
            E Q+PHAV +PYP+QGHI  MLKLAKL HH+GFH+T+V T+ N+  ++++R    L   P
Sbjct  10   ENQQPHAVFVPYPSQGHISPMLKLAKLFHHKGFHVTFVNTEYNHRRLLRSRGPNSLDGLP  69

Query  230  TFRFETIPDGLPSRENPDTALDVADLCFSTGKNCYAPFMELIQRLNSTAsdvppvscvvs  409
             F+F  IPDGLP  +   T   V  LC+ST +NC AP   LI  +NS+ S VPPVSC++ 
Sbjct  70   DFQFRAIPDGLPPSDGNATQ-HVPSLCYSTSRNCLAPLCSLISEINSSGSTVPPVSCIIG  128

Query  410  dtvMPFAVGATQELGVPVVLFWPLSAVASLMHI  508
            D VM F V A Q+ G+P+  FW  SA   L ++
Sbjct  129  DGVMTFTVFAAQKFGIPIASFWTASACGCLGYM  161



>ref|XP_010647463.1| PREDICTED: 7-deoxyloganetin glucosyltransferase-like [Vitis vinifera]
Length=371

 Score =   132 bits (331),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 76/151 (50%), Positives = 107/151 (71%), Gaps = 2/151 (1%)
 Frame = +2

Query  56   QRPHAVCIPYPAQGHICAMLKLAKLLHHRGFHITYVLTQLNYTHIMKARNFLPLTQSPTF  235
            ++PHAVC+PYP+QGH+  +++LAKL+H RGFHIT+V T+ N+  ++++     +     F
Sbjct  7    RKPHAVCVPYPSQGHVTPLMQLAKLVHSRGFHITFVNTEFNHRRLIRSAGPDSVRGLVDF  66

Query  236  RFETIPDGLPSRENPDTALDVADLCFSTGKNCYAPFMELIQRLNSTAsdvppvscvvsdt  415
            RFE IPDGLP   + D   DV  LC ST KNC APF +L+ RLNS++ DVPPVSC++SD 
Sbjct  67   RFEAIPDGLPP-SDLDATQDVPALCDSTRKNCLAPFRDLLARLNSSS-DVPPVSCIISDG  124

Query  416  vMPFAVGATQELGVPVVLFWPLSAVASLMHI  508
            VM FA+ A +ELG+P V FW  SA + + ++
Sbjct  125  VMSFAIQAAEELGIPEVQFWTASACSFMGYL  155



>gb|KHN42553.1| UDP-glycosyltransferase 85A2 [Glycine soja]
Length=482

 Score =   133 bits (334),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 79/152 (52%), Positives = 102/152 (67%), Gaps = 3/152 (2%)
 Frame = +2

Query  53   VQRPHAVCIPYPAQGHICAMLKLAKLLHHRGFHITYVLTQLNYTHIMKARNFLPLTQSPT  232
            + +PHAVCIPYPAQGHI  MLKLAKLLH +GFHIT+V T+ N+  ++KAR    L    +
Sbjct  7    INKPHAVCIPYPAQGHINPMLKLAKLLHFKGFHITFVNTEYNHKRLLKARGPDSLNGLSS  66

Query  233  FRFETIPDGLPSRENPDTALDVADLCFSTGKNCYAPFMELIQRLNSTAsdvppvscvvsd  412
            FRFETIPDGLP   + D   D+  LC +T + C   F  L+ ++N +  D PPVSC+VSD
Sbjct  67   FRFETIPDGLP-ETDLDATQDIPSLCEATRRTCSPHFKNLLAKINDS--DAPPVSCIVSD  123

Query  413  tvMPFAVGATQELGVPVVLFWPLSAVASLMHI  508
             VM F + A +ELGVP VLFW  SA   + ++
Sbjct  124  GVMTFTLDAAEELGVPEVLFWTTSACGFMCYV  155



>ref|XP_003544800.1| PREDICTED: UDP-glycosyltransferase 85A2-like [Glycine max]
Length=482

 Score =   133 bits (334),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 79/152 (52%), Positives = 102/152 (67%), Gaps = 3/152 (2%)
 Frame = +2

Query  53   VQRPHAVCIPYPAQGHICAMLKLAKLLHHRGFHITYVLTQLNYTHIMKARNFLPLTQSPT  232
            + +PHAVCIPYPAQGHI  MLKLAKLLH +GFHIT+V T+ N+  ++KAR    L    +
Sbjct  7    INKPHAVCIPYPAQGHINPMLKLAKLLHFKGFHITFVNTEYNHKRLLKARGPDSLNGLSS  66

Query  233  FRFETIPDGLPSRENPDTALDVADLCFSTGKNCYAPFMELIQRLNSTAsdvppvscvvsd  412
            FRFETIPDGLP   + D   D+  LC +T + C   F  L+ ++N +  D PPVSC+VSD
Sbjct  67   FRFETIPDGLP-ETDLDATQDIPSLCEATRRTCSPHFKNLLAKINDS--DAPPVSCIVSD  123

Query  413  tvMPFAVGATQELGVPVVLFWPLSAVASLMHI  508
             VM F + A +ELGVP VLFW  SA   + ++
Sbjct  124  GVMTFTLDAAEELGVPEVLFWTTSACGFMCYV  155



>ref|XP_002532878.1| UDP-glucuronosyltransferase, putative [Ricinus communis]
 gb|EEF29507.1| UDP-glucuronosyltransferase, putative [Ricinus communis]
Length=404

 Score =   132 bits (332),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 77/152 (51%), Positives = 101/152 (66%), Gaps = 14/152 (9%)
 Frame = +2

Query  56   QRPHAVCIPYPAQGHICAMLKLAKLLHHRGFHITYVLTQLNYTHIMKARNFLPLTQSPTF  235
            ++PHAVC+PYP+QGH+  M++LAKLLH RGFHIT+V T+ N+            T  P F
Sbjct  7    RKPHAVCVPYPSQGHVTPMMQLAKLLHSRGFHITFVNTEFNH------------TIDPDF  54

Query  236  RFETIPDGLPSRENPDTALDVADLCFSTGKNCYAPFMELIQRLNSTAsdvp-pvscvvsd  412
            RFETIPDGLP +   D   DV  LC ST KNC APF EL+ +LNS++S    PVSC++SD
Sbjct  55   RFETIPDGLP-QSTFDATQDVPSLCDSTRKNCLAPFKELVSKLNSSSSTELPPVSCIISD  113

Query  413  tvMPFAVGATQELGVPVVLFWPLSAVASLMHI  508
             VM F + A +EL +P V FW  SA + + ++
Sbjct  114  GVMSFGIIAAEELSIPQVQFWTASACSFMAYL  145



>gb|EMT18349.1| Cytokinin-O-glucosyltransferase 2 [Aegilops tauschii]
Length=596

 Score =   134 bits (336),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 73/150 (49%), Positives = 99/150 (66%), Gaps = 0/150 (0%)
 Frame = +2

Query  56   QRPHAVCIPYPAQGHICAMLKLAKLLHHRGFHITYVLTQLNYTHIMKARNFLPLTQSPTF  235
            ++PHAVC+PYPAQGHI  ML +AKLLH RGF +T+V T+ N+  ++++R    +   P F
Sbjct  6    EKPHAVCLPYPAQGHITPMLNVAKLLHARGFDVTFVNTEYNHARLVRSRGLAAVAGLPGF  65

Query  236  RFETIPDGLPSRENPDTALDVADLCFSTGKNCYAPFMELIQRLNSTAsdvppvscvvsdt  415
            RF TIPDGLP  ++ D   D+  LC ST + C  PF  L+ RLN  A+  PPV+CVVSD 
Sbjct  66   RFATIPDGLPPSDDDDVTQDIPALCKSTTETCLGPFRSLLARLNDPAAGHPPVTCVVSDV  125

Query  416  vMPFAVGATQELGVPVVLFWPLSAVASLMH  505
            VM F++ A  ELG+  V  W  SA++ L +
Sbjct  126  VMGFSMEAANELGLTYVQLWTASAISYLGY  155



>ref|XP_008219315.1| PREDICTED: UDP-glycosyltransferase 85A2-like [Prunus mume]
Length=482

 Score =   132 bits (333),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 79/152 (52%), Positives = 104/152 (68%), Gaps = 2/152 (1%)
 Frame = +2

Query  53   VQRPHAVCIPYPAQGHICAMLKLAKLLHHRGFHITYVLTQLNYTHIMKARNFLPLTQSPT  232
            +++PHAVCIP+PAQGHI  +LKLAKLLH++GFHIT+V T+ N+  ++K+R    L   P+
Sbjct  7    IEKPHAVCIPFPAQGHINPLLKLAKLLHYKGFHITFVNTEFNHKRLLKSRGPNSLDGFPS  66

Query  233  FRFETIPDGLPSRENPDTALDVADLCFSTGKNCYAPFMELIQRLNSTAsdvppvscvvsd  412
            FRFETIPDGLP   + +   D+  LC ST K     F +L+ +LNS+  D PPVSCVVSD
Sbjct  67   FRFETIPDGLPPT-DANATQDIPSLCDSTRKRSLPYFRDLLSKLNSSP-DCPPVSCVVSD  124

Query  413  tvMPFAVGATQELGVPVVLFWPLSAVASLMHI  508
              M F + A QE G+P VLFW  SA   L ++
Sbjct  125  GAMGFTLDAAQEFGLPEVLFWTTSACGFLAYV  156



>gb|KCW66556.1| hypothetical protein EUGRSUZ_F00355 [Eucalyptus grandis]
Length=444

 Score =   132 bits (333),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 79/154 (51%), Positives = 102/154 (66%), Gaps = 3/154 (2%)
 Frame = +2

Query  53   VQRPHAVCIPYPAQGHICAMLKLAKLLHHRGFHITYVLTQLNYTHIMKARNFLPLTQSPT  232
             Q PHAVCIPYPAQGHI  ML LAKLLHHRGFH+T+V T+ N++ ++++R    L   P+
Sbjct  7    TQMPHAVCIPYPAQGHINPMLNLAKLLHHRGFHVTFVNTEYNHSRLLRSRGPSSLDGLPS  66

Query  233  FRFETIPDGLPSRENPDTALDVADLCFSTGKNCYAPFMELIQRLN--STAsdvppvscvv  406
            F+F  IPDGLP   + D   D+  LC ST K+C   F +L++RLN  S  S  PPVSCVV
Sbjct  67   FQFHAIPDGLPP-SDADATQDIPALCQSTQKSCSPYFRDLLERLNEESATSGSPPVSCVV  125

Query  407  sdtvMPFAVGATQELGVPVVLFWPLSAVASLMHI  508
            SD  M F + A + +GVP VLFW  SA   + ++
Sbjct  126  SDGAMSFTLDAAEAVGVPEVLFWTTSACGFMGYV  159



>gb|ACU19718.1| unknown [Glycine max]
Length=231

 Score =   129 bits (323),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 77/151 (51%), Positives = 102/151 (68%), Gaps = 3/151 (2%)
 Frame = +2

Query  56   QRPHAVCIPYPAQGHICAMLKLAKLLHHRGFHITYVLTQLNYTHIMKARNFLPLTQSPTF  235
             +PHAVCIP+PAQGHI  MLKLAKLLH +GFHIT+V T+ N+  ++KAR    L    +F
Sbjct  9    NKPHAVCIPHPAQGHINPMLKLAKLLHFKGFHITFVNTEYNHKRLLKARGPDSLNGLSSF  68

Query  236  RFETIPDGLPSRENPDTALDVADLCFSTGKNCYAPFMELIQRLNSTAsdvppvscvvsdt  415
            RFETIPDGLP  +  D   D+  LC +T + C   F  L+ ++N++  D PPVSC+VSD 
Sbjct  69   RFETIPDGLPETD-LDATQDIPSLCEATRRTCSPHFKNLLTKINNS--DAPPVSCIVSDG  125

Query  416  vMPFAVGATQELGVPVVLFWPLSAVASLMHI  508
            VM F + A +ELG+P VLFW  SA   + ++
Sbjct  126  VMSFTLDAAEELGLPEVLFWTTSACGFMCYV  156



>ref|XP_011003867.1| PREDICTED: 7-deoxyloganetin glucosyltransferase-like isoform 
X1 [Populus euphratica]
 ref|XP_011003868.1| PREDICTED: 7-deoxyloganetin glucosyltransferase-like isoform 
X2 [Populus euphratica]
Length=483

 Score =   132 bits (333),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 71/150 (47%), Positives = 99/150 (66%), Gaps = 1/150 (1%)
 Frame = +2

Query  56   QRPHAVCIPYPAQGHICAMLKLAKLLHHRGFHITYVLTQLNYTHIMKARNFLPLTQSPTF  235
             +PHAVC+P+PAQGHI  MLKLAKLLH +GFH+T+V T+ N+  ++K+R    L   P F
Sbjct  8    DKPHAVCVPFPAQGHINPMLKLAKLLHFKGFHVTFVNTEYNHKRLLKSRGTNSLDGFPDF  67

Query  236  RFETIPDGLPSRENPDTALDVADLCFSTGKNCYAPFMELIQRLNSTAsdvppvscvvsdt  415
            +FETIPDGLPS +  D   D+  LC  T +   AP  +L+ +LNS+   VP V+C+V+D 
Sbjct  68   QFETIPDGLPSSDIADATQDIPSLCKYTSQTALAPLCDLLAKLNSSG-VVPQVTCIVADA  126

Query  416  vMPFAVGATQELGVPVVLFWPLSAVASLMH  505
             M F++ A +E G+P  +FW  SA   L +
Sbjct  127  CMSFSLDAAEEFGIPEAVFWTPSACGVLGY  156



>gb|ABK95289.1| unknown [Populus trichocarpa]
Length=479

 Score =   132 bits (333),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 75/152 (49%), Positives = 104/152 (68%), Gaps = 2/152 (1%)
 Frame = +2

Query  56   QRPHAVCIPYPAQGHICAMLKLAKLLHHRGFHITYVLTQLNYTHIMKARNFLPLTQSPTF  235
            ++PHAVC+P+PAQGH+  M+ LAKLLH RGFHIT+V T+ N+  ++++R    +   P F
Sbjct  7    RKPHAVCVPFPAQGHVTPMMHLAKLLHSRGFHITFVNTEFNHRRLIRSRGPDSVEGLPDF  66

Query  236  RFETIPDGLP-SRENPDTALDVADLCFSTGKNCYAPFMELIQRLNSTAsdvppvscvvsd  412
            RFETIPDGLP    + D   DV  LC ST  NC APF EL+ +LNS++ +VPPV+CV+SD
Sbjct  67   RFETIPDGLPLPPSDFDATQDVPSLCDSTRTNCLAPFKELLTKLNSSS-EVPPVTCVISD  125

Query  413  tvMPFAVGATQELGVPVVLFWPLSAVASLMHI  508
              M F + A +E  +P V FW  SA + + ++
Sbjct  126  GAMSFGIKAAEEFSIPQVQFWTASACSFMGYL  157



>ref|XP_010035387.1| PREDICTED: 7-deoxyloganetin glucosyltransferase-like [Eucalyptus 
grandis]
 gb|KCW84253.1| hypothetical protein EUGRSUZ_B01109 [Eucalyptus grandis]
Length=488

 Score =   132 bits (333),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 80/156 (51%), Positives = 103/156 (66%), Gaps = 4/156 (3%)
 Frame = +2

Query  53   VQRPHAVCIPYPAQGHICAMLKLAKLLHHRGFHITYVLTQLNYTHIMKARNFLPLTQSPT  232
            +Q+PHAVCIPYPAQGHI  ML LAKLLHHRGFH+T+V T+ N++ ++++R    L   P+
Sbjct  7    IQKPHAVCIPYPAQGHINPMLNLAKLLHHRGFHVTFVNTEYNHSRLLRSRGPSSLDGLPS  66

Query  233  FRFETIPDGL-PSRENPDTALDVADLCFSTGKNCYAPFMELIQRLN---STAsdvppvsc  400
            F+F TIPDGL PS    D   D   LC ST K C   F +L+QRLN   +T S  PPVSC
Sbjct  67   FQFRTIPDGLPPSDAASDATQDTLALCQSTSKFCLPYFRDLLQRLNEESATTSGSPPVSC  126

Query  401  vvsdtvMPFAVGATQELGVPVVLFWPLSAVASLMHI  508
            VVSD  M F + A + + VP VL W  SA + + ++
Sbjct  127  VVSDGAMTFTLDAAEAINVPEVLLWTASACSFMGYV  162



>ref|XP_004953968.1| PREDICTED: UDP-glycosyltransferase 85A2-like [Setaria italica]
Length=486

 Score =   132 bits (333),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 73/149 (49%), Positives = 96/149 (64%), Gaps = 0/149 (0%)
 Frame = +2

Query  59   RPHAVCIPYPAQGHICAMLKLAKLLHHRGFHITYVLTQLNYTHIMKARNFLPLTQSPTFR  238
            +PHAVC+PYPAQGHI  ML +AKLLH RGF +T+V T+ N   +++ R    +   P FR
Sbjct  11   KPHAVCLPYPAQGHITPMLNVAKLLHARGFDVTFVNTEYNQARLVRTRGAAAVAGVPGFR  70

Query  239  FETIPDGLPSRENPDTALDVADLCFSTGKNCYAPFMELIQRLNSTAsdvppvscvvsdtv  418
            F TIPDGLP  E+ D   D+  LC ST + C  PF  L+  LN  A+  PPV+CVVSD V
Sbjct  71   FATIPDGLPPSEDDDVTQDIPSLCKSTTETCLGPFRRLLAALNDPATGHPPVTCVVSDVV  130

Query  419  MPFAVGATQELGVPVVLFWPLSAVASLMH  505
            M F++ A +ELG+P V  W  S ++ L +
Sbjct  131  MGFSIDAAKELGLPYVQLWTASTISFLGY  159



>ref|XP_008219313.1| PREDICTED: UDP-glycosyltransferase 85A2-like [Prunus mume]
Length=482

 Score =   132 bits (333),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 78/152 (51%), Positives = 105/152 (69%), Gaps = 2/152 (1%)
 Frame = +2

Query  53   VQRPHAVCIPYPAQGHICAMLKLAKLLHHRGFHITYVLTQLNYTHIMKARNFLPLTQSPT  232
            +++PHAVCIP+PAQGHI  MLKLAKLLH++GF+IT+V T+ N+  ++K+R    L   P+
Sbjct  7    IEKPHAVCIPFPAQGHINPMLKLAKLLHYKGFYITFVNTEFNHKRLLKSRGPNSLDGLPS  66

Query  233  FRFETIPDGLPSRENPDTALDVADLCFSTGKNCYAPFMELIQRLNSTAsdvppvscvvsd  412
            FRFETIPDGLP   + +   D+  LC ST K+    F +L+ +LNS+    PPVSC+VSD
Sbjct  67   FRFETIPDGLPPT-DANATQDIPSLCESTRKHSLPYFRDLLSKLNSST-GCPPVSCIVSD  124

Query  413  tvMPFAVGATQELGVPVVLFWPLSAVASLMHI  508
             VM F + A  ELG+P VLFW  SA   L ++
Sbjct  125  GVMSFTLDAAHELGIPEVLFWTTSACGLLAYV  156



>gb|KCW73112.1| hypothetical protein EUGRSUZ_E01563 [Eucalyptus grandis]
Length=230

 Score =   128 bits (322),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 79/154 (51%), Positives = 99/154 (64%), Gaps = 3/154 (2%)
 Frame = +2

Query  53   VQRPHAVCIPYPAQGHICAMLKLAKLLHHRGFHITYVLTQLNYTHIMKARNFLPLTQSPT  232
             Q+PH VCIP+PAQGHI  ML LAKLLHHRGFHIT+V T+ N+  ++++R    L   P+
Sbjct  7    TQKPHVVCIPFPAQGHIKPMLCLAKLLHHRGFHITFVNTEYNHKRLLRSRGPSALDGLPS  66

Query  233  FRFETIPDGLPSRENPDTALDVADLCFSTGKNCYAPFMELIQRLN--STAsdvppvscvv  406
            FRF TIPDGLP   N D   DV  LC S+   C   F +L+Q L+  S  S  P VSCVV
Sbjct  67   FRFRTIPDGLPP-SNADATQDVPTLCRSSRDLCLPYFRDLLQTLDEESATSGSPLVSCVV  125

Query  407  sdtvMPFAVGATQELGVPVVLFWPLSAVASLMHI  508
            SD VM F + A +  GVP+VLFW  SA   + ++
Sbjct  126  SDGVMSFTLDAAEAAGVPLVLFWTTSACGFMGYV  159



>dbj|BAO51833.1| UDP-glycosyltransferase 85K10 [Camellia sinensis]
Length=480

 Score =   132 bits (332),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 74/156 (47%), Positives = 109/156 (70%), Gaps = 4/156 (3%)
 Frame = +2

Query  47   MEVQRPHAVCIPYPAQGHICAMLKLAKLLHHRGFHITYVLTQLNYTHIMKAR--NFLPLT  220
            +E ++PH VC+PYP+QGH+  ++ LA+LL+ RGFH+T+V T+ N+  +++++  N   + 
Sbjct  5    LETRKPHVVCVPYPSQGHVTPLMLLAQLLYSRGFHVTFVNTEFNHRRLVRSKGPNSDSVK  64

Query  221  QSPTFRFETIPDGLPSRENPDTALDVADLCFSTGKNCYAPFMELIQRLNSTAsdvppvsc  400
              P FRFETIPDGLP  +  D   DV  LC S  KNC  PF++L+ RLNST+ +VP VSC
Sbjct  65   GLPGFRFETIPDGLPPSDR-DATQDVPALCDSVRKNCLVPFIDLLHRLNSTS-EVPRVSC  122

Query  401  vvsdtvMPFAVGATQELGVPVVLFWPLSAVASLMHI  508
            +VSD VM FA+ A +E+G+P V FW  SA + + ++
Sbjct  123  IVSDGVMSFAIEAAKEMGIPEVQFWTASACSFMGYL  158



>ref|XP_006388803.1| hypothetical protein POPTR_0098s003001g, partial [Populus trichocarpa]
 gb|ERP47717.1| hypothetical protein POPTR_0098s003001g, partial [Populus trichocarpa]
Length=173

 Score =   127 bits (318),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 78/148 (53%), Positives = 103/148 (70%), Gaps = 4/148 (3%)
 Frame = +2

Query  56   QRPHAVCIPYPAQGHICAMLKLAKLLHHRGFHITYVLTQLNYTHIMKARNFLPLTQSPTF  235
             +PHAVC+P P Q HI +MLKLAKLLHH+GFHIT+V T+ N+  ++K+R    L   P F
Sbjct  9    HKPHAVCLPSPYQSHIKSMLKLAKLLHHKGFHITFVNTEFNHKRLLKSRGPDSLKGLPDF  68

Query  236  RFETIPDGL-PSRENPDTALDVADLCFSTGKNCYAPFMELIQRLNSTAs-dvppvscvvs  409
            RFE++PDGL PS EN     D+  LC +  KN  APF +L+ +LN TAS DVPPV+C+VS
Sbjct  69   RFESVPDGLPPSDEN--ATQDLPGLCEAASKNLLAPFHDLLDKLNDTASPDVPPVTCIVS  126

Query  410  dtvMPFAVGATQELGVPVVLFWPLSAVA  493
            D  MP A+ A + LG+P+ LF  +SA +
Sbjct  127  DGFMPVAITAAEMLGIPIDLFITISACS  154



>ref|XP_010477495.1| PREDICTED: UDP-glycosyltransferase 85A2-like [Camelina sativa]
Length=484

 Score =   132 bits (332),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 75/151 (50%), Positives = 104/151 (69%), Gaps = 2/151 (1%)
 Frame = +2

Query  56   QRPHAVCIPYPAQGHICAMLKLAKLLHHRGFHITYVLTQLNYTHIMKARNFLPLTQSPTF  235
            Q+PH VC+PYPAQGHI  M+K+AKLL  +GFH+T+  T  N+  ++++R    +   P+F
Sbjct  10   QKPHVVCVPYPAQGHINPMMKMAKLLDAKGFHVTFCNTVYNHNRLLRSRGPNAVDGLPSF  69

Query  236  RFETIPDGLPSRENPDTALDVADLCFSTGKNCYAPFMELIQRLNSTAsdvppvscvvsdt  415
            RFE+IPDGLP   + D   D+  LC ST K+C APF EL++++N+   DVPPVSC++SD 
Sbjct  70   RFESIPDGLPET-DVDVTQDIPSLCESTSKHCLAPFKELLRQINAK-DDVPPVSCILSDG  127

Query  416  vMPFAVGATQELGVPVVLFWPLSAVASLMHI  508
             M F + A +ELGVP VLFW  SA   L ++
Sbjct  128  CMSFTLDAAEELGVPEVLFWTTSACGFLAYL  158



>ref|XP_010459988.1| PREDICTED: UDP-glycosyltransferase 85A2 [Camelina sativa]
Length=484

 Score =   132 bits (332),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 75/151 (50%), Positives = 104/151 (69%), Gaps = 2/151 (1%)
 Frame = +2

Query  56   QRPHAVCIPYPAQGHICAMLKLAKLLHHRGFHITYVLTQLNYTHIMKARNFLPLTQSPTF  235
            Q+PH VC+PYPAQGHI  M+K+AKLL+ +GFH+T+  T  N+  + ++R    +   P+F
Sbjct  10   QKPHVVCVPYPAQGHINPMMKMAKLLYAKGFHVTFCNTVYNHNRLRRSRGPNAVDGLPSF  69

Query  236  RFETIPDGLPSRENPDTALDVADLCFSTGKNCYAPFMELIQRLNSTAsdvppvscvvsdt  415
            RFE+IPDGLP   + D   D+  LC ST K+C APF EL++++N T  DVPPVSC++SD 
Sbjct  70   RFESIPDGLPET-DVDVTQDIPSLCESTAKHCLAPFKELLRQIN-TNDDVPPVSCILSDG  127

Query  416  vMPFAVGATQELGVPVVLFWPLSAVASLMHI  508
             M F + A +ELG+P VLFW  SA   L ++
Sbjct  128  CMSFTLDAAKELGIPEVLFWTTSACGFLAYL  158



>ref|XP_007141200.1| hypothetical protein PHAVU_008G175500g [Phaseolus vulgaris]
 gb|ESW13194.1| hypothetical protein PHAVU_008G175500g [Phaseolus vulgaris]
Length=484

 Score =   132 bits (332),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 79/152 (52%), Positives = 103/152 (68%), Gaps = 3/152 (2%)
 Frame = +2

Query  53   VQRPHAVCIPYPAQGHICAMLKLAKLLHHRGFHITYVLTQLNYTHIMKARNFLPLTQSPT  232
             ++PHAVCIPYPAQGHI  MLKLAKLLH +GFHIT+V ++ N   ++K+R    L    +
Sbjct  7    TKKPHAVCIPYPAQGHINPMLKLAKLLHFKGFHITFVNSEYNQKRLLKSRGSSSLHALSS  66

Query  233  FRFETIPDGLPSRENPDTALDVADLCFSTGKNCYAPFMELIQRLNSTAsdvppvscvvsd  412
            FRFETIPDGLP  +  D   D+  LC ST + C   F +L+ +LN++  D PPVSC+VSD
Sbjct  67   FRFETIPDGLPDSD-VDATQDIPSLCESTRRTCLPHFRKLLAKLNNS--DGPPVSCIVSD  123

Query  413  tvMPFAVGATQELGVPVVLFWPLSAVASLMHI  508
             VM F + A QELG+P VLFW  SA   + ++
Sbjct  124  GVMTFTLDAAQELGLPEVLFWTTSACGFMCYL  155



>ref|XP_010060022.1| PREDICTED: 7-deoxyloganetin glucosyltransferase-like isoform 
X2 [Eucalyptus grandis]
Length=500

 Score =   132 bits (332),  Expect = 5e-33, Method: Compositional matrix adjust.
 Identities = 77/154 (50%), Positives = 101/154 (66%), Gaps = 2/154 (1%)
 Frame = +2

Query  53   VQRPHAVCIPYPAQGHICAMLKLAKLLHHRGFHITYVLTQLNYTHIMKARNFLPLTQSPT  232
            +Q+PHAVCIPYPAQGHI  ML LAKLLHHRGFH+T+V T+ N++ ++ +R    L   P+
Sbjct  7    IQKPHAVCIPYPAQGHINPMLNLAKLLHHRGFHVTFVNTEYNHSRLLHSRGPSSLDGLPS  66

Query  233  FRFETIPDGLPSRENPDTALDVADLCFSTGKNCYAPFMELIQRLN--STAsdvppvscvv  406
            FRF TIP+GLP  +  D   D+  LC ST K C   F + ++RLN  ST    PPVSCVV
Sbjct  67   FRFRTIPNGLPPSDVADATQDIPALCQSTSKFCLPYFRDQLERLNEESTTLGSPPVSCVV  126

Query  407  sdtvMPFAVGATQELGVPVVLFWPLSAVASLMHI  508
            SD +M F + A + +GV  VLFW  S    + ++
Sbjct  127  SDGMMSFTLDAAKVIGVSEVLFWTTSVCGFMGYV  160



>emb|CDP21827.1| unnamed protein product [Coffea canephora]
Length=405

 Score =   131 bits (330),  Expect = 5e-33, Method: Compositional matrix adjust.
 Identities = 80/152 (53%), Positives = 102/152 (67%), Gaps = 2/152 (1%)
 Frame = +2

Query  56   QRPHAVCIPYPAQGHICAMLKLAKLLHHRGFHITYVLTQLNYTHIMKARNFLPLTQSPTF  235
            ++PHAVCIPYPAQGHI  MLKLAKLLHH+GFHIT+V T+ N+  ++K+R    L   P F
Sbjct  8    EKPHAVCIPYPAQGHINPMLKLAKLLHHKGFHITFVNTEFNHKRLLKSRGPDALNGLPDF  67

Query  236  RFETIPDGLPSRENPDTALDVADLCFSTGKNCYAPFMELIQRLNS-TAsdvppvscvvsd  412
            +F+ IPDGLP  +  D   DV  L  ST  +C  PF +L+  LN  ++S VPPVSC+VSD
Sbjct  68   QFKAIPDGLPPADV-DATQDVPSLSESTTTHCLGPFRDLLAELNDPSSSQVPPVSCIVSD  126

Query  413  tvMPFAVGATQELGVPVVLFWPLSAVASLMHI  508
              M F + A  ELGVP +LFW  SA   L ++
Sbjct  127  GAMSFTLEAAAELGVPEILFWTPSACGFLGYM  158



>ref|XP_004305878.1| PREDICTED: UDP-glycosyltransferase 85A2-like [Fragaria vesca 
subsp. vesca]
Length=481

 Score =   132 bits (331),  Expect = 5e-33, Method: Compositional matrix adjust.
 Identities = 79/153 (52%), Positives = 103/153 (67%), Gaps = 3/153 (2%)
 Frame = +2

Query  47   MEV-QRPHAVCIPYPAQGHICAMLKLAKLLHHRGFHITYVLTQLNYTHIMKARNFLPLTQ  223
            MEV ++PHAVCIP P Q HI AMLKLAKLLHHRGFHIT+V T+ N+   +K+     L  
Sbjct  4    MEVSKKPHAVCIPLPMQSHIKAMLKLAKLLHHRGFHITFVNTEFNHKRFLKSLGPNSLDG  63

Query  224  SPTFRFETIPDGLPSRENPDTALDVADLCFSTGKNCYAPFMELIQRLNSTAs-dvppvsc  400
               F F+TIPDGLPS +  DT  D+  LC S  KNC APF +L+ ++N +A+ + PPV+ 
Sbjct  64   LSDFHFKTIPDGLPSSDEDDTQ-DLILLCDSIRKNCLAPFCDLLNKINESATPNNPPVTS  122

Query  401  vvsdtvMPFAVGATQELGVPVVLFWPLSAVASL  499
            +VSD  M F + A +ELG+PV LF  ++A   L
Sbjct  123  IVSDGFMTFTITAAEELGIPVALFLSIAACGFL  155



>gb|KHN13067.1| UDP-glycosyltransferase 85A3 [Glycine soja]
Length=478

 Score =   132 bits (331),  Expect = 5e-33, Method: Compositional matrix adjust.
 Identities = 78/152 (51%), Positives = 101/152 (66%), Gaps = 1/152 (1%)
 Frame = +2

Query  53   VQRPHAVCIPYPAQGHICAMLKLAKLLHHRGFHITYVLTQLNYTHIMKARNFLPLTQSPT  232
            +++ HAVCIPYPAQGHI  MLKLAKLLH RGFHIT+V T+ N+  ++K+R    L   P+
Sbjct  1    MEKLHAVCIPYPAQGHINPMLKLAKLLHVRGFHITFVNTEYNHKRLLKSRGSDSLNSVPS  60

Query  233  FRFETIPDGLPSRENPDTALDVADLCFSTGKNCYAPFMELIQRLNSTAsdvppvscvvsd  412
            F+FETIPDGL    + D   DV  L  ST + C  PF  L+ +LNS ASD PPV+C+VSD
Sbjct  61   FQFETIPDGLSDNPDVDATQDVVSLSESTRRTCLTPFKNLLSKLNS-ASDTPPVTCIVSD  119

Query  413  tvMPFAVGATQELGVPVVLFWPLSAVASLMHI  508
              M F + A QELG+P V+    SA   + ++
Sbjct  120  GGMSFTLDAAQELGIPEVILSTASACGYMCYM  151



>ref|XP_009377931.1| PREDICTED: 7-deoxyloganetin glucosyltransferase-like [Pyrus x 
bretschneideri]
Length=487

 Score =   132 bits (331),  Expect = 6e-33, Method: Compositional matrix adjust.
 Identities = 73/150 (49%), Positives = 95/150 (63%), Gaps = 4/150 (3%)
 Frame = +2

Query  56   QRPHAVCIPYPAQGHICAMLKLAKLLHHRGFHITYVLTQLNYTHIMKARNFLPLTQSPTF  235
             +PHAVCIP P Q HI AMLKLAKLLH+RGFH+T+V T+ N+   +K+     +   P F
Sbjct  9    NKPHAVCIPLPLQSHIKAMLKLAKLLHYRGFHVTFVNTEFNHRRFLKSLGPNSVDDFPDF  68

Query  236  RFETIPDGLPSRENPDTALDVADLCFSTGKNCYAPFMELIQRLNSTAsdvpp----vscv  403
            RF+TIPDGLP  E   T  ++  LC S  KN  APF  L+ +LN  AS        V  +
Sbjct  69   RFQTIPDGLPDSEADATTQNIPSLCDSMRKNFLAPFRNLLLKLNEAASSNNSVGPPVISI  128

Query  404  vsdtvMPFAVGATQELGVPVVLFWPLSAVA  493
            VSD  MPFA+ A +ELG+P+ +F+ L+AV 
Sbjct  129  VSDGFMPFAITAAEELGLPIAVFFTLAAVG  158



>ref|XP_002323978.2| hypothetical protein POPTR_0017s07940g [Populus trichocarpa]
 gb|EEF04111.2| hypothetical protein POPTR_0017s07940g [Populus trichocarpa]
Length=482

 Score =   132 bits (331),  Expect = 6e-33, Method: Compositional matrix adjust.
 Identities = 74/149 (50%), Positives = 102/149 (68%), Gaps = 1/149 (1%)
 Frame = +2

Query  59   RPHAVCIPYPAQGHICAMLKLAKLLHHRGFHITYVLTQLNYTHIMKARNFLPLTQSPTFR  238
            + HAVC+PYPAQGHI  MLK+AKLLHH+GFHIT+V ++ N+  ++K+R    L   P F+
Sbjct  9    KAHAVCVPYPAQGHITPMLKVAKLLHHKGFHITFVNSEYNHRRLLKSRGRNSLDVLPDFQ  68

Query  239  FETIPDGLPSRENPDTALDVADLCFSTGKNCYAPFMELIQRLNSTAsdvppvscvvsdtv  418
            FETIPDGL  + + D   D + LC ST K C  PF +L+ +LNS+ + VPPV+C+V+D  
Sbjct  69   FETIPDGLGDQLDADVTQDTSFLCDSTSKACLDPFRQLLAKLNSS-NVVPPVTCIVADNG  127

Query  419  MPFAVGATQELGVPVVLFWPLSAVASLMH  505
            M FA+   +EL +PVV F   SA  +L +
Sbjct  128  MSFALDVKEELQIPVVTFLTSSACGTLAY  156



>ref|XP_008789349.1| PREDICTED: UDP-glycosyltransferase 85A2-like isoform X2 [Phoenix 
dactylifera]
Length=477

 Score =   132 bits (331),  Expect = 6e-33, Method: Compositional matrix adjust.
 Identities = 75/151 (50%), Positives = 96/151 (64%), Gaps = 1/151 (1%)
 Frame = +2

Query  56   QRPHAVCIPYPAQGHICAMLKLAKLLHHRGFHITYVLTQLNYTHIMKARNFLPLTQSPTF  235
            QRPHAV +PYPAQGH+  +LKLAKLLH RGF+IT+V T  N   ++++     L   P F
Sbjct  7    QRPHAVLVPYPAQGHVTPLLKLAKLLHSRGFYITFVNTHFNQNRLLRSGAISSLDSLPDF  66

Query  236  RFETIPDGLPSRENPDTALDVADLCFSTGKNCYAPFMELIQRLNSTAsdvppvscvvsdt  415
            RFE+I DGLP  +  D   DV  LC S  KNC APF +LI+ LN  +S  P VS +VSD 
Sbjct  67   RFESIRDGLPPTDK-DATQDVPSLCDSIPKNCIAPFRDLIKELNDPSSPTPTVSRIVSDG  125

Query  416  vMPFAVGATQELGVPVVLFWPLSAVASLMHI  508
            VM F +   +EL +P VLFW  SA   + ++
Sbjct  126  VMSFTLDVAKELQIPEVLFWTPSACGYMGYL  156



>ref|XP_008789350.1| PREDICTED: UDP-glycosyltransferase 85A2-like isoform X3 [Phoenix 
dactylifera]
Length=477

 Score =   132 bits (331),  Expect = 6e-33, Method: Compositional matrix adjust.
 Identities = 75/151 (50%), Positives = 96/151 (64%), Gaps = 1/151 (1%)
 Frame = +2

Query  56   QRPHAVCIPYPAQGHICAMLKLAKLLHHRGFHITYVLTQLNYTHIMKARNFLPLTQSPTF  235
            QRPHAV +PYPAQGH+  +LKLAKLLH RGF+IT+V T  N   ++++     L   P F
Sbjct  7    QRPHAVLVPYPAQGHVTPLLKLAKLLHSRGFYITFVNTHFNQNRLLRSGAISSLDSLPDF  66

Query  236  RFETIPDGLPSRENPDTALDVADLCFSTGKNCYAPFMELIQRLNSTAsdvppvscvvsdt  415
            RFE+I DGLP  +  D   DV  LC S  KNC APF +LI+ LN  +S  P VS +VSD 
Sbjct  67   RFESIRDGLPPTDK-DATQDVPSLCDSIPKNCIAPFRDLIKELNDPSSPTPTVSRIVSDG  125

Query  416  vMPFAVGATQELGVPVVLFWPLSAVASLMHI  508
            VM F +   +EL +P VLFW  SA   + ++
Sbjct  126  VMSFTLDVAKELQIPEVLFWTPSACGYMGYL  156



>gb|AFK34769.1| unknown [Lotus japonicus]
Length=484

 Score =   132 bits (331),  Expect = 6e-33, Method: Compositional matrix adjust.
 Identities = 78/152 (51%), Positives = 102/152 (67%), Gaps = 2/152 (1%)
 Frame = +2

Query  56   QRPHAVCIPYPAQGHICAMLKLAKLLHHR-GFHITYVLTQLNYTHIMKARNFLPLTQSPT  232
            ++PH VCIPYPAQGHI  MLKLAKLLH + GFH+T+V T+ N+  ++K+R    L   P+
Sbjct  9    KKPHVVCIPYPAQGHINPMLKLAKLLHFKGGFHVTFVNTEYNHKRLLKSRGPDSLNGLPS  68

Query  233  FRFETIPDGLPSRENPDTALDVADLCFSTGKNCYAPFMELIQRLNSTAsdvppvscvvsd  412
            FRFETIPDGLP   + D   D+  LC ST K C   F +L+ +LN  +SDVPPV+C+VSD
Sbjct  69   FRFETIPDGLP-ETDVDVTQDIPSLCISTRKTCLPHFKKLLSKLNDVSSDVPPVTCIVSD  127

Query  413  tvMPFAVGATQELGVPVVLFWPLSAVASLMHI  508
              M F + A  EL +P VLFW  SA   + ++
Sbjct  128  GCMSFTLDAAIELNIPEVLFWTTSACGFMGYV  159



>ref|XP_009413654.1| PREDICTED: 7-deoxyloganetin glucosyltransferase-like, partial 
[Musa acuminata subsp. malaccensis]
Length=250

 Score =   128 bits (321),  Expect = 6e-33, Method: Compositional matrix adjust.
 Identities = 76/149 (51%), Positives = 97/149 (65%), Gaps = 4/149 (3%)
 Frame = +2

Query  41   R*MEVQRPHAVCIPYPAQGHICAMLKLAKLLHHRGFHITYVLTQLNYTHIMKARNFLPLT  220
            R M  ++PHAVCIPYPAQGH+  M+ LAKLLH  GFHIT+V TQ N+  +++++      
Sbjct  2    RCMSTRKPHAVCIPYPAQGHVTPMMMLAKLLHSHGFHITFVNTQYNHRRLLRSKALSSAD  61

Query  221  QSPTFRFETIPDGLPSRENPDTALDVADLCFSTGKNCYAPFMELIQRLNSTAsdvppvsc  400
              P FRFETIPDGLP  +  D   D+  LC S   N   PF++L+++LN  +   PPVSC
Sbjct  62   VLPDFRFETIPDGLPPSDE-DATQDIPSLCESIQNNALPPFLDLLRQLNEGS---PPVSC  117

Query  401  vvsdtvMPFAVGATQELGVPVVLFWPLSA  487
            VVSD VM F V A  EL +P V+FW  SA
Sbjct  118  VVSDGVMSFTVDAATELSIPEVMFWTPSA  146



>ref|XP_007047908.1| UDP-glucosyl transferase 85A2 [Theobroma cacao]
 gb|EOX92065.1| UDP-glucosyl transferase 85A2 [Theobroma cacao]
Length=484

 Score =   132 bits (331),  Expect = 6e-33, Method: Compositional matrix adjust.
 Identities = 73/150 (49%), Positives = 103/150 (69%), Gaps = 2/150 (1%)
 Frame = +2

Query  59   RPHAVCIPYPAQGHICAMLKLAKLLHHRGFHITYVLTQLNYTHIMKARNFLPLTQSPTFR  238
            +PHAVC+PYP+QGH+  M+ LAKLLH +GFHIT+V T+ NY  +++ +    +   P FR
Sbjct  8    KPHAVCVPYPSQGHVTPMMHLAKLLHSKGFHITFVNTEFNYRRLVRFKGAEAVKGLPDFR  67

Query  239  FETIPDGLPSRENPDTALDVADLCFSTGKNCYAPFMELIQRLNSTAsdvppvscvvsdtv  418
            F++IPDGLP  +  D   D+  LC ST KNC APF+ELI +LNS++ +VPPVSC++SD V
Sbjct  68   FDSIPDGLPHSDR-DATQDIPALCDSTRKNCLAPFLELIAKLNSSS-EVPPVSCIISDGV  125

Query  419  MPFAVGATQELGVPVVLFWPLSAVASLMHI  508
            M F + A + LG+P   FW  S    + ++
Sbjct  126  MSFGIKAGEILGIPEFQFWTASVCGFMGYL  155



>gb|KCW66553.1| hypothetical protein EUGRSUZ_F00351 [Eucalyptus grandis]
Length=440

 Score =   131 bits (330),  Expect = 6e-33, Method: Compositional matrix adjust.
 Identities = 76/146 (52%), Positives = 97/146 (66%), Gaps = 3/146 (2%)
 Frame = +2

Query  53   VQRPHAVCIPYPAQGHICAMLKLAKLLHHRGFHITYVLTQLNYTHIMKARNFLPLTQSPT  232
             Q PHAVCIPYPAQGHI  ML LAKLLHHRGFH+T+V T+ N++ ++++R    L   P+
Sbjct  7    TQMPHAVCIPYPAQGHINPMLNLAKLLHHRGFHVTFVNTEYNHSRLLRSRGPSSLNGLPS  66

Query  233  FRFETIPDGLPSRENPDTALDVADLCFSTGKNCYAPFMELIQRLNSTAsdvpp--vscvv  406
            F+F TIPDGLP   + D   DV  LC ST K+C   F +L++RLN  ++      VSCVV
Sbjct  67   FQFRTIPDGLPP-SDADATQDVPALCQSTQKSCLPYFRDLLERLNEESARSGSPPVSCVV  125

Query  407  sdtvMPFAVGATQELGVPVVLFWPLS  484
            SD VM F + A + + VP VLFW  S
Sbjct  126  SDGVMSFTLDAAEAVSVPEVLFWTTS  151



>ref|XP_009350671.1| PREDICTED: 7-deoxyloganetin glucosyltransferase-like [Pyrus x 
bretschneideri]
Length=489

 Score =   132 bits (331),  Expect = 6e-33, Method: Compositional matrix adjust.
 Identities = 73/148 (49%), Positives = 93/148 (63%), Gaps = 4/148 (3%)
 Frame = +2

Query  56   QRPHAVCIPYPAQGHICAMLKLAKLLHHRGFHITYVLTQLNYTHIMKARNFLPLTQSPTF  235
             +PHAVCIP PAQ HI AMLK +KLLHHRGFHIT+V T+ N+   +K+     L   P F
Sbjct  9    NKPHAVCIPAPAQSHIKAMLKFSKLLHHRGFHITFVNTEFNHNRFLKSLGSNSLDGLPDF  68

Query  236  RFETIPDGLPSRENPDTALDVADLCFSTGKNCYAPFMELIQRLNSTAsdvppvs----cv  403
            RFETIPDGLP   N D   D +    +  KN   PF +L+ +LN  A  +  VS    C+
Sbjct  69   RFETIPDGLPPDSNQDATQDTSLASDAISKNLLPPFRDLLIKLNDAAISINNVSPPVTCI  128

Query  404  vsdtvMPFAVGATQELGVPVVLFWPLSA  487
             SD  MPF + A  E+G+P+VLF+P+SA
Sbjct  129  FSDGFMPFTITAADEIGLPLVLFFPISA  156



>gb|KCW66555.1| hypothetical protein EUGRSUZ_F00353, partial [Eucalyptus grandis]
Length=477

 Score =   131 bits (330),  Expect = 7e-33, Method: Compositional matrix adjust.
 Identities = 76/146 (52%), Positives = 97/146 (66%), Gaps = 3/146 (2%)
 Frame = +2

Query  53   VQRPHAVCIPYPAQGHICAMLKLAKLLHHRGFHITYVLTQLNYTHIMKARNFLPLTQSPT  232
             Q PHAVCIPYPAQGHI  ML LAKLLHHRGFH+T+V T+ N++ ++++R    L   P+
Sbjct  7    TQMPHAVCIPYPAQGHINPMLNLAKLLHHRGFHVTFVNTEYNHSRLLRSRGPSSLDGLPS  66

Query  233  FRFETIPDGLPSRENPDTALDVADLCFSTGKNCYAPFMELIQRLNSTAsdvpp--vscvv  406
            FRF TIPDGLP   + D   DV  LC ST K+C   F +L+++LN  ++      VSCVV
Sbjct  67   FRFRTIPDGLPP-SDADATQDVPALCQSTQKSCLPYFRDLLEKLNEESAMSGSPPVSCVV  125

Query  407  sdtvMPFAVGATQELGVPVVLFWPLS  484
            SD VM F + A + + VP VLFW  S
Sbjct  126  SDGVMSFTLDAAEAVSVPEVLFWTTS  151



>ref|XP_003546715.1| PREDICTED: UDP-glycosyltransferase 85A3 [Glycine max]
Length=478

 Score =   131 bits (330),  Expect = 7e-33, Method: Compositional matrix adjust.
 Identities = 78/152 (51%), Positives = 101/152 (66%), Gaps = 1/152 (1%)
 Frame = +2

Query  53   VQRPHAVCIPYPAQGHICAMLKLAKLLHHRGFHITYVLTQLNYTHIMKARNFLPLTQSPT  232
            +++ HAVCIPYPAQGHI  MLKLAKLLH RGFHIT+V T+ N+  ++K+R    L   P+
Sbjct  1    MEKLHAVCIPYPAQGHINPMLKLAKLLHVRGFHITFVNTEYNHKRLLKSRGSDSLNSVPS  60

Query  233  FRFETIPDGLPSRENPDTALDVADLCFSTGKNCYAPFMELIQRLNSTAsdvppvscvvsd  412
            F+FETIPDGL    + D   DV  L  ST + C  PF  L+ +LNS ASD PPV+C+VSD
Sbjct  61   FQFETIPDGLSDNPDVDATQDVVSLSESTRRTCLTPFKNLLSKLNS-ASDTPPVTCIVSD  119

Query  413  tvMPFAVGATQELGVPVVLFWPLSAVASLMHI  508
            + M F + A QELG+P V     SA   + ++
Sbjct  120  SGMSFTLDAAQELGIPDVFLSTASACGYMCYM  151



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 515555468376