BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c25597_g3_i3 len=1595 path=[4146:0-144 4291:145-229 4376:230-341
4488:342-625 4772:626-626 4773:627-672 4819:673-678 4825:679-832
4979:833-839 4986:840-881 5028:882-896 5043:897-940 5087:941-961
14370:962-1019 5166:1020-1075 5222:1076-1183 5330:1184-1223
5370:1224-1385 5532:1386-1594]

Length=1595
                                                                      Score     E

ref|XP_009793993.1|  PREDICTED: apyrase-like                            580   0.0      
ref|XP_009625429.1|  PREDICTED: apyrase-like                            575   0.0      
sp|P80595.2|APY_SOLTU  RecName: Full=Apyrase; AltName: Full=ATP-d...    566   0.0      Solanum tuberosum [potatoes]
ref|XP_006349910.1|  PREDICTED: apyrase 2 isoform X2                    561   0.0      
ref|XP_006349906.1|  PREDICTED: apyrase-like                            561   0.0      
ref|XP_006349909.1|  PREDICTED: apyrase 2 isoform X1                    561   0.0      
ref|XP_004252980.1|  PREDICTED: apyrase                                 552   0.0      
ref|NP_001275348.1|  apyrase precursor                                  550   0.0      
ref|XP_009615583.1|  PREDICTED: apyrase-like                            550   0.0      
gb|ADN83844.1|  putative apyrase AP5                                    548   0.0      
ref|XP_004247967.1|  PREDICTED: apyrase-like                            536   0.0      
ref|XP_006363161.1|  PREDICTED: apyrase-like isoform X1                 523   8e-179   
emb|CDP04088.1|  unnamed protein product                                518   1e-176   
ref|XP_004232617.1|  PREDICTED: apyrase-like isoform X1                 517   2e-176   
ref|XP_006360924.1|  PREDICTED: apyrase-like                            516   8e-176   
emb|CDP04087.1|  unnamed protein product                                488   4e-165   
ref|XP_011089773.1|  PREDICTED: apyrase 2-like                          487   3e-164   
emb|CDP04086.1|  unnamed protein product                                487   4e-164   
ref|XP_003548772.1|  PREDICTED: nucleoside-triphosphatase-like          484   3e-163   
gb|AAG32960.1|AF207688_1  apyrase GS52                                  483   1e-162   Glycine soja [wild soybean]
ref|XP_003548774.1|  PREDICTED: nucleoside-triphosphatase-like          473   8e-159   
ref|XP_007161810.1|  hypothetical protein PHAVU_001G100100g             468   4e-157   
ref|XP_004493131.1|  PREDICTED: apyrase 2-like isoform X1               467   1e-156   
dbj|BAK78981.1|  apyrase                                                467   1e-156   
ref|XP_006443349.1|  hypothetical protein CICLE_v10019963mg             468   1e-156   
gb|KDO45540.1|  hypothetical protein CISIN_1g048388mg                   467   2e-156   
gb|AAF00610.1|AF156781_1  apyrase                                       466   4e-156   Vigna unguiculata subsp. cylindrica [catjang]
dbj|BAK78982.1|  apyrase                                                466   5e-156   
gb|AAF00609.1|AF156780_1  nod factor binding lectin-nucleotide ph...    465   9e-156   Lotus japonicus
gb|AAO23007.1|  apyrase-like protein                                    465   1e-155   Medicago truncatula
gb|KHN46801.1|  Nucleoside-triphosphatase                               464   2e-155   
ref|XP_003624587.1|  Nod factor binding lectin-nucleotide phospho...    464   2e-155   
dbj|BAM84272.1|  apyrase                                                463   3e-155   
ref|XP_010316510.1|  PREDICTED: apyrase-like isoform X2                 460   4e-155   
ref|XP_010669578.1|  PREDICTED: apyrase 2                               463   4e-155   
ref|XP_004493134.1|  PREDICTED: nucleoside-triphosphatase-like is...    462   6e-155   
ref|XP_003624579.1|  Nucleoside-triphosphatase                          466   7e-155   
gb|AAD31285.1|AF139807_1  nod factor binding lectin-nucleotide ph...    462   1e-154   Vigna unguiculata subsp. cylindrica [catjang]
ref|XP_007161808.1|  hypothetical protein PHAVU_001G099900g             461   1e-154   
ref|XP_009770744.1|  PREDICTED: apyrase 2-like                          462   2e-154   
gb|ADD09804.1|  ectoapyrase 2                                           461   5e-154   Gossypium hirsutum [American cotton]
ref|XP_009622670.1|  PREDICTED: apyrase 2-like                          461   5e-154   
ref|XP_010246579.1|  PREDICTED: probable apyrase 1                      461   5e-154   
dbj|BAB85978.1|  PsAPY2                                                 460   7e-154   Pisum sativum [garden pea]
gb|AFK40353.1|  unknown                                                 460   9e-154   
gb|KHG24482.1|  Nucleoside-triphosphatase                               460   9e-154   
gb|ABK51386.1|  apyrase-like protein                                    460   1e-153   Nicotiana tabacum [American tobacco]
ref|XP_010999472.1|  PREDICTED: apyrase 2-like                          459   1e-153   
emb|CDP19074.1|  unnamed protein product                                460   1e-153   
ref|XP_004253046.1|  PREDICTED: probable apyrase 2                      459   2e-153   
dbj|BAD80836.1|  apyrase                                                458   2e-153   Vigna unguiculata subsp. unguiculata [black-eyed pea]
dbj|BAD80837.1|  apyrase                                                459   3e-153   Vigna unguiculata subsp. unguiculata [black-eyed pea]
ref|XP_002325398.1|  putative apyrase family protein                    458   4e-153   Populus trichocarpa [western balsam poplar]
ref|XP_006604215.1|  PREDICTED: apyrase 2-like                          458   7e-153   
ref|XP_007161770.1|  hypothetical protein PHAVU_001G096900g             456   3e-152   
gb|AAF00611.1|AF156782_1  nod factor binding lectin-nucleotide ph...    455   5e-152   Medicago sativa [alfalfa]
ref|XP_002525470.1|  adenosine diphosphatase, putative                  455   1e-151   Ricinus communis
gb|ABK94978.1|  unknown                                                 454   2e-151   Populus trichocarpa [western balsam poplar]
ref|XP_004493132.1|  PREDICTED: apyrase 2-like isoform X2               454   3e-151   
ref|XP_010524962.1|  PREDICTED: apyrase 2-like                          454   3e-151   
dbj|BAB87182.1|  apyrase                                                452   6e-151   Pisum sativum [garden pea]
ref|XP_010558706.1|  PREDICTED: apyrase 2                               451   2e-150   
ref|XP_003548776.1|  PREDICTED: apyrase 2                               451   2e-150   
ref|XP_011034426.1|  PREDICTED: apyrase 2-like                          456   3e-150   
ref|XP_008792533.1|  PREDICTED: probable apyrase 2 isoform X2           450   4e-150   
ref|XP_003624582.1|  Apyrase-like protein                               450   5e-150   
ref|XP_002319138.2|  hypothetical protein POPTR_0013s05040g             455   6e-150   Populus trichocarpa [western balsam poplar]
ref|XP_010650765.1|  PREDICTED: apyrase 2                               450   8e-150   
gb|ADD09803.1|  ectoapyrase 1                                           450   8e-150   Gossypium hirsutum [American cotton]
ref|XP_006598985.1|  PREDICTED: apyrase 2-like                          449   1e-149   
gb|AFK48943.1|  unknown                                                 449   2e-149   
ref|XP_010999471.1|  PREDICTED: apyrase 2-like                          447   1e-148   
ref|XP_002449357.1|  hypothetical protein SORBIDRAFT_05g008570          447   1e-148   Sorghum bicolor [broomcorn]
gb|AAG32959.1|  apyrase GS50                                            446   2e-148   Glycine soja [wild soybean]
dbj|BAD13527.1|  apyrase                                                446   2e-148   
dbj|BAM84271.1|  apyrase                                                446   2e-148   
ref|XP_010054281.1|  PREDICTED: apyrase 2                               446   2e-148   
dbj|BAB87198.1|  ATP diphosphohydrolase                                 446   4e-148   Pisum sativum [garden pea]
dbj|BAM84274.1|  apyrase                                                445   5e-148   
sp|P52914.1|NTPA_PEA  RecName: Full=Nucleoside-triphosphatase; Sh...    445   6e-148   Pisum sativum [garden pea]
dbj|BAB18890.1|  apyrase S-type                                         444   6e-148   Pisum sativum [garden pea]
ref|XP_010922866.1|  PREDICTED: probable apyrase 2                      444   9e-148   
gb|EYU41067.1|  hypothetical protein MIMGU_mgv1a004609mg                443   2e-147   
gb|EYU41066.1|  hypothetical protein MIMGU_mgv1a004609mg                445   4e-147   
gb|AAO23003.1|  apyrase-like protein                                    442   5e-147   Medicago truncatula
dbj|BAC45033.1|  apyrase                                                442   7e-147   Pisum sativum [garden pea]
gb|AAO23002.1|  apyrase-like protein                                    441   1e-146   Medicago truncatula
gb|EYU37260.1|  hypothetical protein MIMGU_mgv1a006675mg                441   1e-146   
ref|XP_007030232.1|  Apyrase 1                                          444   2e-146   
gb|KDP20285.1|  hypothetical protein JCGZ_06871                         441   3e-146   
dbj|BAA89275.1|  apyrase                                                440   4e-146   Pisum sativum [garden pea]
ref|XP_004511658.1|  PREDICTED: apyrase 2-like                          440   6e-146   
ref|XP_006843727.1|  hypothetical protein AMTR_s00007p00221730          440   7e-146   
ref|XP_004244791.1|  PREDICTED: apyrase 2-like                          440   9e-146   
ref|XP_011096861.1|  PREDICTED: LOW QUALITY PROTEIN: apyrase-like       438   1e-145   
gb|AAK15160.1|AF288132_1  putative apyrase                              439   2e-145   Medicago truncatula
ref|XP_002873882.1|  ATAPY2                                             439   2e-145   
dbj|BAD13518.1|  apyrase                                                438   3e-145   Pisum sativum [garden pea]
gb|AFK42133.1|  unknown                                                 437   9e-145   
ref|XP_003624584.1|  Nucleoside-triphosphatase                          437   9e-145   
ref|XP_010492830.1|  PREDICTED: apyrase 2-like                          437   1e-144   
ref|XP_006364259.1|  PREDICTED: probable apyrase 1-like                 437   2e-144   
ref|XP_010454056.1|  PREDICTED: apyrase 2-like                          436   2e-144   
gb|AES80802.2|  Nod factor-binding lectin-nucleotide phosphohydro...    436   2e-144   
ref|XP_010420574.1|  PREDICTED: apyrase 2                               436   3e-144   
gb|ACB38285.1|  apyrase                                                 434   8e-144   Trifolium repens [creeping white clover]
gb|ACB38286.1|  apyrase                                                 433   2e-143   Trifolium repens [creeping white clover]
gb|AAM98186.1|  unknown protein                                         434   2e-143   Arabidopsis thaliana [mouse-ear cress]
gb|AFI41206.1|  apyrase 2                                               434   2e-143   
sp|Q9SPM5.1|APY2_ARATH  RecName: Full=Apyrase 2; Short=AtAPY2; Al...    433   2e-143   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006342448.1|  PREDICTED: apyrase 2-like                          433   3e-143   
ref|XP_009416336.1|  PREDICTED: probable apyrase 1                      433   3e-143   
ref|XP_002448917.1|  hypothetical protein SORBIDRAFT_05g001550          433   4e-143   Sorghum bicolor [broomcorn]
emb|CDY54053.1|  BnaC09g54250D                                          433   4e-143   
ref|XP_006408225.1|  hypothetical protein EUTSA_v10020649mg             432   6e-143   
dbj|BAB40231.1|  S-type apyrase                                         430   7e-143   Pisum sativum [garden pea]
ref|XP_002325396.2|  putative apyrase family protein                    432   1e-142   Populus trichocarpa [western balsam poplar]
ref|XP_003518188.1|  PREDICTED: apyrase 1-like                          432   1e-142   
gb|AAF66599.1|AF141671_1  apyrase                                       432   1e-142   Arabidopsis thaliana [mouse-ear cress]
gb|KFK37843.1|  hypothetical protein AALP_AA3G036300                    431   3e-142   
ref|XP_006400376.1|  hypothetical protein EUTSA_v10013440mg             431   4e-142   
ref|XP_010463882.1|  PREDICTED: apyrase 1                               430   5e-142   
ref|XP_010922865.1|  PREDICTED: probable apyrase 2                      429   9e-142   
dbj|BAB87197.1|  ATP diphosphohydrolase                                 429   1e-141   Pisum sativum [garden pea]
ref|NP_197329.4|  apyrase 2                                             433   1e-141   Arabidopsis thaliana [mouse-ear cress]
gb|EPS65035.1|  apyrase-like protein                                    431   1e-141   
ref|XP_004147528.1|  PREDICTED: apyrase 2-like                          429   1e-141   
gb|AAG22044.1|AF305783_1  apyrase 2                                     428   1e-141   Pisum sativum [garden pea]
ref|NP_187058.1|  apyrase 1                                             429   2e-141   Arabidopsis thaliana [mouse-ear cress]
ref|XP_004172762.1|  PREDICTED: apyrase 2-like                          429   2e-141   
ref|XP_009618558.1|  PREDICTED: apyrase 1-like                          429   2e-141   
ref|XP_010485779.1|  PREDICTED: apyrase 1-like                          428   2e-141   
ref|XP_008240451.1|  PREDICTED: apyrase 2                               428   3e-141   
ref|XP_009406850.1|  PREDICTED: probable apyrase 2                      428   3e-141   
ref|XP_009757995.1|  PREDICTED: apyrase 1-like                          428   3e-141   
ref|XP_006297596.1|  hypothetical protein CARUB_v10013618mg             427   5e-141   
emb|CDY38503.1|  BnaA10g16550D                                          427   5e-141   
ref|XP_008793372.1|  PREDICTED: probable apyrase 1                      427   1e-140   
ref|XP_007202024.1|  hypothetical protein PRUPE_ppa005076mg             426   2e-140   
emb|CDY51237.1|  BnaA03g07010D                                          429   3e-140   
ref|XP_009366414.1|  PREDICTED: apyrase 2-like                          425   4e-140   
ref|XP_010938111.1|  PREDICTED: probable apyrase 1                      425   4e-140   
gb|KEH25611.1|  GDA1/CD39 nucleoside phosphatase family protein         426   4e-140   
ref|XP_009120988.1|  PREDICTED: apyrase 2                               425   5e-140   
ref|XP_004977419.1|  PREDICTED: probable apyrase 3-like                 424   7e-140   
ref|XP_010921280.1|  PREDICTED: probable apyrase 1                      424   8e-140   
gb|AAO23006.1|  apyrase-like protein                                    424   9e-140   Medicago truncatula
ref|XP_009132257.1|  PREDICTED: apyrase 2-like                          429   1e-139   
dbj|BAM84275.1|  apyrase                                                425   1e-139   
emb|CAN80801.1|  hypothetical protein VITISV_019811                     424   1e-139   Vitis vinifera
ref|XP_008670728.1|  PREDICTED: probable apyrase 3                      423   2e-139   
ref|XP_004984507.1|  PREDICTED: probable apyrase 1-like                 424   2e-139   
ref|XP_006651340.1|  PREDICTED: probable apyrase 1-like                 424   2e-139   
dbj|BAM84273.1|  apyrase                                                422   3e-139   
ref|XP_009125008.1|  PREDICTED: apyrase 1-like                          422   3e-139   
ref|XP_002448918.1|  hypothetical protein SORBIDRAFT_05g001560          423   3e-139   Sorghum bicolor [broomcorn]
ref|XP_008365001.1|  PREDICTED: apyrase 2-like                          422   3e-139   
ref|XP_002442736.1|  hypothetical protein SORBIDRAFT_08g001970          421   2e-138   Sorghum bicolor [broomcorn]
ref|XP_010518233.1|  PREDICTED: apyrase 1-like                          421   2e-138   
ref|XP_002461227.1|  hypothetical protein SORBIDRAFT_02g043200          421   2e-138   Sorghum bicolor [broomcorn]
ref|XP_009130420.1|  PREDICTED: apyrase 1                               421   2e-138   
ref|XP_009399920.1|  PREDICTED: probable apyrase 2 isoform X2           420   3e-138   
ref|XP_002884427.1|  ATAPY1                                             420   6e-138   
dbj|BAD13519.1|  apyrase                                                419   8e-138   Pisum sativum [garden pea]
gb|AES80807.2|  Nod factor-binding lectin-nucleotide phosphohydro...    419   9e-138   
sp|Q8H7L6.1|APY1_ORYSJ  RecName: Full=Probable apyrase 1; Short=O...    420   1e-137   Oryza sativa Japonica Group [Japonica rice]
emb|CDY29985.1|  BnaC01g40230D                                          428   2e-137   
dbj|BAD13517.1|  apyrase                                                417   2e-137   Pisum sativum [garden pea]
gb|EAZ26787.1|  hypothetical protein OsJ_10698                          419   3e-137   Oryza sativa Japonica Group [Japonica rice]
ref|XP_006658972.1|  PREDICTED: probable apyrase 2-like                 416   4e-137   
ref|XP_008782749.1|  PREDICTED: probable apyrase 2                      417   6e-137   
gb|EEC67580.1|  hypothetical protein OsI_34933                          416   6e-137   Oryza sativa Indica Group [Indian rice]
ref|XP_006664294.1|  PREDICTED: probable apyrase 3-like                 416   1e-136   
dbj|BAJ91877.1|  predicted protein                                      416   1e-136   
emb|CDY21139.1|  BnaA01g33700D                                          425   2e-136   
ref|XP_009399919.1|  PREDICTED: probable apyrase 2 isoform X1           416   2e-136   
ref|XP_009386978.1|  PREDICTED: probable apyrase 2                      415   3e-136   
ref|XP_008441968.1|  PREDICTED: apyrase 2-like                          415   4e-136   
ref|XP_008670667.1|  PREDICTED: probable apyrase 2                      414   5e-136   
gb|EEC75177.1|  hypothetical protein OsI_11404                          415   5e-136   Oryza sativa Indica Group [Indian rice]
gb|EMT14858.1|  Nucleoside-triphosphatase                               417   5e-136   
ref|XP_004291701.1|  PREDICTED: apyrase 2-like                          413   1e-135   
ref|XP_004958720.1|  PREDICTED: probable apyrase 2-like                 413   1e-135   
gb|EEE52675.1|  hypothetical protein OsJ_35057                          412   2e-135   Oryza sativa Japonica Group [Japonica rice]
ref|XP_008651023.1|  PREDICTED: putative apyrase family protein i...    412   7e-135   
gb|EEC82701.1|  hypothetical protein OsI_27366                          412   7e-135   Oryza sativa Indica Group [Indian rice]
ref|NP_001060663.1|  Os07g0682800                                       411   8e-135   Oryza sativa Japonica Group [Japonica rice]
gb|ACB38287.1|  apyrase                                                 411   9e-135   Lolium perenne [perennial ryegrass]
ref|XP_003624589.1|  Nucleoside-triphosphatase                          422   9e-135   
gb|EEC68772.1|  hypothetical protein OsI_37304                          410   1e-134   Oryza sativa Indica Group [Indian rice]
ref|NP_001066032.1|  Os12g0123500                                       410   1e-134   Oryza sativa Japonica Group [Japonica rice]
ref|XP_002465325.1|  hypothetical protein SORBIDRAFT_01g036510          411   2e-134   Sorghum bicolor [broomcorn]
gb|EMT30219.1|  Nucleoside-triphosphatase                               410   3e-134   
ref|XP_010088479.1|  hypothetical protein L484_013684                   415   4e-134   
ref|XP_008679360.1|  PREDICTED: probable apyrase 3 isoform X1           410   4e-134   
gb|EMS57965.1|  Nucleoside-triphosphatase                               408   1e-133   
dbj|BAJ85095.1|  predicted protein                                      408   2e-133   
ref|XP_003576205.1|  PREDICTED: LOW QUALITY PROTEIN: probable apy...    407   2e-133   
gb|EAY96392.1|  hypothetical protein OsI_18291                          407   5e-133   Oryza sativa Indica Group [Indian rice]
ref|XP_003624590.1|  Nucleoside-triphosphatase                          418   6e-133   
gb|ABA91264.2|  GDA1/CD39 family protein                                405   1e-132   Oryza sativa Japonica Group [Japonica rice]
dbj|BAD13524.1|  apyrase                                                405   1e-132   
ref|NP_001154717.1|  apyrase 2                                          409   8e-132   Arabidopsis thaliana [mouse-ear cress]
ref|NP_001067813.1|  Os11g0439600                                       403   1e-131   Oryza sativa Japonica Group [Japonica rice]
ref|XP_006664293.1|  PREDICTED: probable apyrase 3-like                 402   2e-131   
ref|XP_003562437.1|  PREDICTED: probable apyrase 2                      402   3e-131   
dbj|BAD13520.1|  apyrase                                                401   6e-131   
gb|EMS65821.1|  Apyrase                                                 400   6e-131   
ref|XP_008655272.1|  PREDICTED: probable apyrase 1 isoform X1           402   8e-131   
ref|XP_003557997.1|  PREDICTED: probable apyrase 1                      401   2e-130   
dbj|BAJ86398.1|  predicted protein                                      396   2e-129   
gb|EEC67579.1|  hypothetical protein OsI_34932                          398   6e-129   Oryza sativa Indica Group [Indian rice]
ref|XP_002449272.1|  hypothetical protein SORBIDRAFT_05g007000          396   6e-129   Sorghum bicolor [broomcorn]
ref|XP_008792532.1|  PREDICTED: probable apyrase 2 isoform X1           395   8e-129   
gb|KEH23514.1|  Nod factor-binding lectin-nucleotide phosphohydro...    395   9e-129   
ref|XP_002442734.1|  hypothetical protein SORBIDRAFT_08g001950          395   1e-128   Sorghum bicolor [broomcorn]
dbj|BAK78979.1|  apyrase                                                394   5e-128   
gb|EMT24071.1|  Apyrase                                                 391   4e-127   
dbj|BAK78980.1|  apyrase                                                391   5e-127   
ref|XP_004978978.1|  PREDICTED: probable apyrase 3-like                 391   6e-127   
dbj|BAK78977.1|  apyrase                                                391   6e-127   
ref|XP_003577116.1|  PREDICTED: probable apyrase 3                      390   1e-126   
dbj|BAD13526.1|  apyrase                                                386   4e-126   
ref|XP_004978980.1|  PREDICTED: probable apyrase 3-like isoform X2      389   5e-126   
gb|EEE51563.1|  hypothetical protein OsJ_32782                          390   9e-126   Oryza sativa Japonica Group [Japonica rice]
ref|XP_001753690.1|  predicted protein                                  387   4e-125   
emb|CDX70805.1|  BnaC03g08890D                                          410   2e-124   
gb|ABA91303.1|  GDA1/CD39 family protein, expressed                     383   4e-124   Oryza sativa Japonica Group [Japonica rice]
ref|XP_006290233.1|  hypothetical protein CARUB_v100030810mg            385   4e-124   
ref|XP_003570952.1|  PREDICTED: probable apyrase 3                      383   5e-124   
ref|XP_002979160.1|  hypothetical protein SELMODRAFT_233281             382   3e-123   
gb|AFW55891.1|  putative apyrase family protein                         382   4e-123   
ref|XP_002988529.1|  hypothetical protein SELMODRAFT_183978             380   1e-122   
gb|EMS59522.1|  Nucleoside-triphosphatase                               387   2e-122   
dbj|BAJ96614.1|  predicted protein                                      379   3e-122   
ref|XP_004978979.1|  PREDICTED: probable apyrase 3-like isoform X1      379   3e-122   
ref|XP_003605672.1|  Nucleoside-triphosphatase                          378   4e-122   
gb|KHN00658.1|  Nucleoside-triphosphatase                               375   5e-122   
gb|EMT13113.1|  Nucleoside-triphosphatase                               377   2e-121   
ref|XP_008679361.1|  PREDICTED: probable apyrase 3 isoform X2           376   2e-121   
gb|EMT18791.1|  Nucleoside-triphosphatase                               375   7e-121   
ref|NP_001065624.1|  Os11g0126400                                       378   1e-120   Oryza sativa Japonica Group [Japonica rice]
ref|NP_001167731.1|  putative apyrase family protein precursor          374   2e-120   Zea mays [maize]
tpg|DAA41781.1|  TPA: putative apyrase family protein                   373   2e-120   
dbj|BAJ99958.1|  predicted protein                                      367   1e-118   
ref|XP_001785876.1|  predicted protein                                  370   1e-118   
dbj|BAJ96497.1|  predicted protein                                      368   4e-118   
ref|XP_009399921.1|  PREDICTED: probable apyrase 2 isoform X3           364   1e-117   
dbj|BAD13525.1|  apyrase                                                364   2e-117   
ref|XP_006663415.1|  PREDICTED: probable apyrase 3-like                 363   2e-116   
ref|XP_001760185.1|  predicted protein                                  362   4e-116   
ref|XP_003579004.1|  PREDICTED: probable apyrase 3                      360   6e-115   
gb|AAQ10658.1|  apyrase 2                                               353   7e-115   Solanum tuberosum [potatoes]
emb|CDY42903.1|  BnaC05g47480D                                          356   1e-114   
gb|EMS51343.1|  Nucleoside-triphosphatase                               355   1e-113   
ref|XP_006443348.1|  hypothetical protein CICLE_v10019963mg             353   4e-113   
gb|AAX94982.1|  S-type apyrase                                          348   1e-111   Oryza sativa Japonica Group [Japonica rice]
ref|XP_008655289.1|  PREDICTED: probable apyrase 1 isoform X2           351   2e-111   
ref|NP_001067814.2|  Os11g0440200                                       348   2e-111   Oryza sativa Japonica Group [Japonica rice]
gb|EEE63379.1|  hypothetical protein OsJ_18191                          347   3e-111   Oryza sativa Japonica Group [Japonica rice]
gb|AAK15161.1|AF288133_1  putative apyrase                              328   2e-104   Medicago truncatula
gb|EMS49648.1|  Apyrase                                                 329   1e-103   
dbj|BAD13523.1|  apyrase                                                326   3e-103   
gb|ABA95699.2|  GDA1/CD39 family protein, expressed                     325   3e-102   Oryza sativa Japonica Group [Japonica rice]
gb|EMT26604.1|  Apyrase                                                 324   3e-101   
gb|EMS46853.1|  Apyrase                                                 320   2e-99    
dbj|BAK78978.1|  apyrase                                                315   1e-98    
gb|ABK95896.1|  unknown                                                 309   3e-97    Populus trichocarpa [western balsam poplar]
ref|XP_004493135.1|  PREDICTED: nucleoside-triphosphatase-like is...    305   1e-95    
gb|KDD73355.1|  GDA1/CD39 nucleoside phosphatase                        305   1e-93    
ref|XP_008353527.1|  PREDICTED: LOW QUALITY PROTEIN: apyrase 2-like     301   3e-93    
ref|XP_010257814.1|  PREDICTED: probable apyrase 1                      301   2e-92    
ref|XP_006387692.1|  hypothetical protein POPTR_0671s00200g             286   8e-89    
ref|XP_005648855.1|  apyrase                                            292   8e-89    
ref|XP_001417447.1|  predicted protein                                  290   3e-88    Ostreococcus lucimarinus CCE9901
gb|EAZ17260.1|  hypothetical protein OsJ_32781                          285   2e-87    Oryza sativa Japonica Group [Japonica rice]
gb|EMT11822.1|  Apyrase                                                 285   2e-87    
ref|XP_002507899.1|  predicted protein                                  285   7e-86    Micromonas commoda
ref|XP_003057698.1|  predicted protein                                  285   7e-86    
ref|XP_009783155.1|  PREDICTED: apyrase-like                            276   3e-84    
ref|XP_007151817.1|  hypothetical protein PHAVU_004G077500g             276   4e-84    
ref|XP_003078647.1|  apyrase (ISS)                                      280   8e-84    
emb|CEF97475.1|  Nucleoside phosphatase GDA1/CD39                       280   2e-83    
ref|XP_002946218.1|  hypothetical protein VOLCADRAFT_78871              276   7e-83    
ref|XP_001696196.1|  hypothetical protein CHLREDRAFT_167044             268   1e-79    
ref|XP_009788037.1|  PREDICTED: apyrase-like                            255   1e-75    
ref|XP_009768839.1|  PREDICTED: apyrase-like                            250   2e-75    
dbj|BAK08145.1|  predicted protein                                      246   2e-73    
gb|KHN08171.1|  Nucleoside-triphosphatase                               240   1e-71    
gb|EAY79780.1|  hypothetical protein OsI_34936                          239   3e-71    
ref|XP_011016574.1|  PREDICTED: apyrase 2-like                          240   4e-71    
gb|ACU22988.1|  unknown                                                 236   6e-70    
gb|AFK40109.1|  unknown                                                 234   6e-69    
gb|AFK41199.1|  unknown                                                 231   3e-68    
gb|KHN46804.1|  Nucleoside-triphosphatase                               230   1e-67    
ref|XP_001420472.1|  predicted protein                                  234   2e-67    
ref|XP_002509368.1|  predicted protein                                  232   5e-66    
ref|XP_004992897.1|  ectonucleoside triphosphate diphosphohydrola...    233   2e-65    
ref|XP_002319666.2|  hypothetical protein POPTR_0013s05060g             221   5e-64    
ref|XP_007509489.1|  predicted protein                                  225   1e-62    
ref|XP_007513901.1|  predicted protein                                  220   1e-60    
ref|XP_003061394.1|  predicted protein                                  213   2e-59    
ref|NP_001140212.1|  putative apyrase family protein                    207   5e-59    
ref|XP_002766352.1|  Apyrase precursor, putative                        212   7e-58    
gb|EMS56637.1|  Apyrase                                                 203   1e-57    
gb|EMT10219.1|  Apyrase                                                 194   3e-54    
ref|XP_008283692.1|  PREDICTED: ectonucleoside triphosphate dipho...    200   3e-54    
ref|XP_006638905.1|  PREDICTED: ectonucleoside triphosphate dipho...    200   5e-54    
ref|XP_005449784.1|  PREDICTED: ectonucleoside triphosphate dipho...    199   7e-54    
ref|XP_003440837.1|  PREDICTED: ectonucleoside triphosphate dipho...    199   9e-54    
ref|XP_006632434.1|  PREDICTED: ectonucleoside triphosphate dipho...    197   2e-53    
ref|XP_008396588.1|  PREDICTED: ectonucleoside triphosphate dipho...    197   5e-53    
emb|CDQ73589.1|  unnamed protein product                                197   5e-53    
ref|XP_005943072.1|  PREDICTED: ectonucleoside triphosphate dipho...    196   1e-52    
ref|XP_007230769.1|  PREDICTED: ectonucleoside triphosphate dipho...    194   3e-52    
emb|CBY36960.1|  unnamed protein product                                194   4e-52    
ref|XP_007230767.1|  PREDICTED: ectonucleoside triphosphate dipho...    194   6e-52    
ref|XP_004575351.1|  PREDICTED: ectonucleoside triphosphate dipho...    194   7e-52    
emb|CBY31835.1|  unnamed protein product                                194   7e-52    
ref|XP_005754307.1|  PREDICTED: ectonucleoside triphosphate dipho...    194   8e-52    
tpg|DAA45161.1|  TPA: putative apyrase family protein                   187   1e-51    
ref|XP_007436467.1|  PREDICTED: ectonucleoside triphosphate dipho...    193   1e-51    
ref|XP_005725024.1|  PREDICTED: ectonucleoside triphosphate dipho...    193   1e-51    
ref|XP_004527207.1|  PREDICTED: ectonucleoside triphosphate dipho...    194   1e-51    
gb|EXX78735.1|  Gda1p                                                   196   2e-51    
ref|XP_004527206.1|  PREDICTED: ectonucleoside triphosphate dipho...    193   2e-51    
emb|CDS07315.1|  hypothetical protein LRAMOSA01264                      194   2e-51    
ref|XP_003661448.1|  hypothetical protein MYCTH_2300848                 195   2e-51    
ref|XP_005754304.1|  PREDICTED: ectonucleoside triphosphate dipho...    192   2e-51    
gb|ESA19416.1|  hypothetical protein GLOINDRAFT_135661                  192   2e-51    
ref|XP_005917735.1|  PREDICTED: ectonucleoside triphosphate dipho...    192   2e-51    
ref|XP_006806928.1|  PREDICTED: ectonucleoside triphosphate dipho...    192   3e-51    
ref|XP_007904218.1|  PREDICTED: ectonucleoside triphosphate dipho...    191   5e-51    
ref|XP_004542169.1|  PREDICTED: ectonucleoside triphosphate dipho...    191   5e-51    
ref|XP_007904221.1|  PREDICTED: ectonucleoside triphosphate dipho...    191   5e-51    
gb|EPB82069.1|  hypothetical protein HMPREF1544_11197                   192   6e-51    
ref|XP_003971644.1|  PREDICTED: ectonucleoside triphosphate dipho...    191   7e-51    
ref|XP_002665866.3|  PREDICTED: ectonucleoside triphosphate dipho...    191   9e-51    
ref|XP_009291247.1|  PREDICTED: ectonucleoside triphosphate dipho...    191   1e-50    
ref|XP_010751317.1|  PREDICTED: ectonucleoside triphosphate dipho...    190   1e-50    
emb|CAQ15104.1|  novel protein similar to vertebrate ectonucleosi...    191   1e-50    
gb|KEY73292.1|  hypothetical protein S7711_01411                        192   1e-50    
ref|XP_008428722.1|  PREDICTED: ectonucleoside triphosphate dipho...    190   1e-50    
ref|XP_008428723.1|  PREDICTED: ectonucleoside triphosphate dipho...    190   1e-50    
ref|XP_006136956.1|  PREDICTED: ectonucleoside triphosphate dipho...    190   1e-50    
gb|KFA77821.1|  hypothetical protein S40288_00465                       192   1e-50    
ref|XP_005006597.1|  PREDICTED: ectonucleoside triphosphate dipho...    190   1e-50    
ref|XP_002795447.1|  guanosine-diphosphatase                            193   1e-50    
ref|XP_010730205.1|  PREDICTED: ectonucleoside triphosphate dipho...    189   2e-50    
ref|XP_007059006.1|  PREDICTED: ectonucleoside triphosphate dipho...    190   2e-50    
ref|XP_003490259.1|  PREDICTED: ectonucleoside triphosphate dipho...    190   2e-50    
ref|XP_003457515.1|  PREDICTED: ectonucleoside triphosphate dipho...    189   2e-50    
gb|KFA62138.1|  hypothetical protein S40285_01638                       192   2e-50    
ref|XP_004083373.1|  PREDICTED: ectonucleoside triphosphate dipho...    189   3e-50    
ref|XP_010894554.1|  PREDICTED: ectonucleoside triphosphate dipho...    189   3e-50    
ref|XP_003006260.1|  guanosine-diphosphatase                            191   4e-50    
ref|XP_009648620.1|  guanosine-diphosphatase                            191   4e-50    
ref|XP_011059725.1|  PREDICTED: ectonucleoside triphosphate dipho...    189   4e-50    
ref|XP_001382088.1|  PREDICTED: ectonucleoside triphosphate dipho...    189   4e-50    
ref|XP_001961483.1|  GF14909                                            189   5e-50    
ref|XP_004442009.1|  PREDICTED: ectonucleoside triphosphate dipho...    189   5e-50    
gb|EFZ12417.1|  hypothetical protein SINV_00549                         189   5e-50    
ref|NP_001065626.1|  Os11g0126800                                       182   5e-50    
ref|XP_011059707.1|  PREDICTED: ectonucleoside triphosphate dipho...    189   5e-50    
ref|NP_001166182.1|  ectonucleoside triphosphate diphosphohydrola...    189   5e-50    
ref|XP_011059715.1|  PREDICTED: ectonucleoside triphosphate dipho...    189   5e-50    
gb|EGI70159.1|  Ectonucleoside triphosphate diphosphohydrolase 5        189   6e-50    
ref|XP_006696900.1|  hypothetical protein CTHT_0066010                  191   6e-50    
ref|XP_003758179.1|  PREDICTED: ectonucleoside triphosphate dipho...    190   6e-50    
ref|XP_003707532.1|  PREDICTED: ectonucleoside triphosphate dipho...    189   7e-50    
ref|NP_001135181.1|  Ectonucleoside triphosphate diphosphohydrola...    188   7e-50    
ref|XP_003401829.1|  PREDICTED: ectonucleoside triphosphate dipho...    189   7e-50    
ref|XP_001269044.1|  nucleoside diphosphatase Gda1                      189   9e-50    
ref|XP_006624429.1|  PREDICTED: ectonucleoside triphosphate dipho...    188   9e-50    
ref|XP_004635708.1|  PREDICTED: ectonucleoside triphosphate dipho...    188   1e-49    
ref|XP_007573287.1|  PREDICTED: ectonucleoside triphosphate dipho...    187   1e-49    
ref|XP_002077961.1|  GD22791                                            188   1e-49    
ref|XP_009847356.1|  hypothetical protein NEUTE1DRAFT_58377             190   2e-49    
ref|XP_961489.1|  guanosine-diphosphatase                               189   2e-49    
ref|NP_477370.1|  NTPase, isoform A                                     187   2e-49    
ref|XP_005181833.1|  PREDICTED: ectonucleoside triphosphate dipho...    187   2e-49    
ref|NP_722860.1|  NTPase, isoform E                                     187   2e-49    
ref|XP_005181835.1|  PREDICTED: ectonucleoside triphosphate dipho...    187   2e-49    
ref|NP_001017862.1|  ectonucleoside triphosphate diphosphohydrola...    187   2e-49    
ref|XP_002037655.1|  GM18184                                            187   2e-49    
ref|XP_001968490.1|  GG24477                                            187   3e-49    
ref|XP_005334644.1|  PREDICTED: ectonucleoside triphosphate dipho...    187   3e-49    
ref|XP_010787411.1|  PREDICTED: ectonucleoside triphosphate dipho...    188   3e-49    
ref|XP_003695754.1|  PREDICTED: LOW QUALITY PROTEIN: ectonucleosi...    187   4e-49    
ref|XP_004061973.1|  PREDICTED: ectonucleoside triphosphate dipho...    187   4e-49    
ref|XP_004602087.1|  PREDICTED: ectonucleoside triphosphate dipho...    186   4e-49    
gb|EEQ90304.1|  guanosine-diphosphatase                                 189   4e-49    
ref|XP_003067005.1|  guanosine-diphosphatase, putative                  188   4e-49    
ref|XP_002021815.1|  GL26295                                            187   4e-49    
ref|XP_002620315.1|  guanosine-diphosphatase                            189   5e-49    
ref|XP_007537378.1|  PREDICTED: ectonucleoside triphosphate dipho...    186   5e-49    
ref|XP_004687182.1|  PREDICTED: ectonucleoside triphosphate dipho...    186   5e-49    
gb|EHB09565.1|  Ectonucleoside triphosphate diphosphohydrolase 6        187   5e-49    
ref|XP_002604544.1|  hypothetical protein BRAFLDRAFT_79389              184   6e-49    
ref|XP_008281408.1|  PREDICTED: ectonucleoside triphosphate dipho...    187   7e-49    
emb|CEI96568.1|  Putative Guanosine-diphosphatase                       185   9e-49    
ref|XP_004894992.1|  PREDICTED: LOW QUALITY PROTEIN: ectonucleosi...    186   9e-49    
ref|XP_002087752.1|  GE14979                                            186   1e-48    
gb|KFV80299.1|  Ectonucleoside triphosphate diphosphohydrolase 6        183   1e-48    
ref|XP_001239383.1|  hypothetical protein CIMG_09004                    187   1e-48    
gb|EZA56536.1|  Ectonucleoside triphosphate diphosphohydrolase          186   1e-48    
ref|XP_007244683.1|  PREDICTED: ectonucleoside triphosphate dipho...    184   2e-48    
ref|XP_001356152.2|  GA15897                                            185   2e-48    
ref|XP_003352136.1|  hypothetical protein SMAC_02571                    187   2e-48    
ref|XP_010207226.1|  PREDICTED: ectonucleoside triphosphate dipho...    184   2e-48    
ref|XP_002839610.1|  hypothetical protein                               187   2e-48    
gb|KFP34588.1|  Ectonucleoside triphosphate diphosphohydrolase 6        183   2e-48    
ref|XP_010732241.1|  PREDICTED: ectonucleoside triphosphate dipho...    186   2e-48    
gb|EQL01563.1|  guanosine diphosphatase                                 186   2e-48    
ref|XP_009671437.1|  PREDICTED: ectonucleoside triphosphate dipho...    184   2e-48    
ref|XP_010787034.1|  PREDICTED: ectonucleoside triphosphate dipho...    184   2e-48    
ref|XP_005813198.1|  PREDICTED: ectonucleoside triphosphate dipho...    184   2e-48    
ref|XP_007274043.1|  nucleoside diphosphatase gda1                      186   3e-48    
gb|KEZ39697.1|  putative guanosine-diphosphatase                        186   3e-48    
ref|XP_001541349.1|  guanosine-diphosphatase                            186   3e-48    
gb|EEH07893.1|  guanosine-diphosphatase                                 185   3e-48    
gb|EGC42925.1|  guanosine-diphosphatase                                 186   3e-48    
ref|XP_001948332.1|  PREDICTED: ectonucleoside triphosphate dipho...    184   3e-48    
gb|ADF28792.1|  RE08887p                                                184   3e-48    
ref|XP_003427269.1|  PREDICTED: ectonucleoside triphosphate dipho...    185   3e-48    
ref|NP_593447.1|  guanosine-diphosphatase Gda1                          186   4e-48    
ref|XP_003018916.1|  hypothetical protein TRV_07048                     186   4e-48    
ref|XP_007834195.1|  guanosine-diphosphatase                            186   4e-48    
ref|XP_008210010.1|  PREDICTED: ectonucleoside triphosphate dipho...    185   4e-48    
ref|XP_007151818.1|  hypothetical protein PHAVU_004G077600g             181   4e-48    
dbj|GAD95065.1|  nucleoside diphosphatase Gda1                          186   5e-48    
ref|XP_003234596.1|  nucleoside diphosphatase Gda1                      186   5e-48    
ref|XP_006163661.1|  PREDICTED: ectonucleoside triphosphate dipho...    184   5e-48    
ref|XP_001651207.1|  adenosine diphosphatase                            184   5e-48    
ref|XP_008210007.1|  PREDICTED: ectonucleoside triphosphate dipho...    184   6e-48    
emb|CEG70473.1|  Putative Guanosine-diphosphatase                       183   6e-48    
ref|XP_002128952.1|  PREDICTED: ectonucleoside triphosphate dipho...    184   6e-48    
ref|NP_001259972.1|  NTPase, isoform F                                  185   6e-48    
ref|XP_007892535.1|  PREDICTED: ectonucleoside triphosphate dipho...    182   7e-48    
ref|XP_001392563.1|  guanosine-diphosphatase                            185   7e-48    
ref|XP_005042839.1|  PREDICTED: ectonucleoside triphosphate dipho...    182   8e-48    
gb|EGD97667.1|  nucleoside diphosphatase Gda1                           185   8e-48    
dbj|GAA88430.1|  nucleoside diphosphatase Gda1                          184   8e-48    
ref|XP_010623914.1|  PREDICTED: ectonucleoside triphosphate dipho...    183   8e-48    
gb|EZF35933.1|  hypothetical protein H101_00565                         185   8e-48    
gb|AAC39883.1|  CD39L2                                                  184   8e-48    
ref|XP_008937957.1|  PREDICTED: ectonucleoside triphosphate dipho...    182   8e-48    
gb|ENH78776.1|  nucleoside diphosphatase gda1                           184   9e-48    
ref|XP_002380297.1|  nucleoside diphosphatase Gda1                      184   9e-48    
emb|CAL38442.1|  hypothetical protein                                   183   1e-47    
ref|XP_002848245.1|  guanosine-diphosphatase                            185   1e-47    
ref|XP_009810269.1|  PREDICTED: ectonucleoside triphosphate dipho...    182   1e-47    
ref|XP_005512093.1|  PREDICTED: ectonucleoside triphosphate dipho...    182   1e-47    
ref|XP_542683.3|  PREDICTED: ectonucleoside triphosphate diphosph...    182   1e-47    
ref|NP_001089154.1|  ectonucleoside triphosphate diphosphohydrola...    183   1e-47    
ref|XP_010329072.1|  PREDICTED: ectonucleoside triphosphate dipho...    182   1e-47    
ref|XP_007594492.1|  GDA1/CD39 family protein                           184   1e-47    
emb|CAN74890.1|  hypothetical protein VITISV_038853                     184   1e-47    
ref|XP_007232699.1|  PREDICTED: ectonucleoside triphosphate dipho...    183   1e-47    
ref|XP_514557.3|  PREDICTED: ectonucleoside triphosphate diphosph...    182   1e-47    
dbj|BAG64743.1|  unnamed protein product                                182   1e-47    
gb|AAH25980.1|  Ectonucleoside triphosphate diphosphohydrolase 6 ...    183   1e-47    
ref|XP_009509636.1|  PREDICTED: ectonucleoside triphosphate dipho...    182   1e-47    
gb|KFV53504.1|  Ectonucleoside triphosphate diphosphohydrolase 6        181   1e-47    
ref|NP_001107561.1|  ectonucleoside triphosphate diphosphohydrola...    182   1e-47    
ref|XP_002069396.1|  GK18683                                            182   1e-47    
ref|XP_008921118.1|  PREDICTED: ectonucleoside triphosphate dipho...    182   1e-47    
gb|AAP92131.1|  CD39L2 nucleotidase                                     183   1e-47    
gb|KFP37396.1|  Ectonucleoside triphosphate diphosphohydrolase 6        180   2e-47    
ref|NP_001238.2|  ectonucleoside triphosphate diphosphohydrolase ...    183   2e-47    
ref|XP_008968602.1|  PREDICTED: ectonucleoside triphosphate dipho...    183   2e-47    
gb|KFW97215.1|  Ectonucleoside triphosphate diphosphohydrolase 6        180   2e-47    
ref|XP_010896208.1|  PREDICTED: ectonucleoside triphosphate dipho...    182   2e-47    
ref|XP_001988221.1|  GH11050                                            182   2e-47    
dbj|BAE56862.1|  unnamed protein product                                184   2e-47    
ref|XP_003316901.1|  PREDICTED: ectonucleoside triphosphate dipho...    182   2e-47    
ref|XP_003175833.1|  guanosine-diphosphatase                            184   2e-47    
ref|XP_004474700.1|  PREDICTED: ectonucleoside triphosphate dipho...    182   2e-47    
ref|XP_010329067.1|  PREDICTED: ectonucleoside triphosphate dipho...    182   2e-47    
ref|XP_005688151.1|  PREDICTED: ectonucleoside triphosphate dipho...    182   2e-47    
ref|XP_010329071.1|  PREDICTED: ectonucleoside triphosphate dipho...    182   2e-47    
emb|CDP20479.1|  unnamed protein product                                178   2e-47    
ref|XP_004781285.1|  PREDICTED: ectonucleoside triphosphate dipho...    182   2e-47    
ref|XP_003453170.1|  PREDICTED: ectonucleoside triphosphate dipho...    183   2e-47    
ref|XP_009561914.1|  PREDICTED: ectonucleoside triphosphate dipho...    181   2e-47    
gb|KFW74636.1|  Ectonucleoside triphosphate diphosphohydrolase 6        180   2e-47    
gb|KFO78214.1|  Ectonucleoside triphosphate diphosphohydrolase 5        181   2e-47    
ref|XP_005604475.1|  PREDICTED: ectonucleoside triphosphate dipho...    182   2e-47    
ref|XP_005148960.1|  PREDICTED: ectonucleoside triphosphate dipho...    181   2e-47    
ref|XP_004082620.1|  PREDICTED: ectonucleoside triphosphate dipho...    184   2e-47    
ref|XP_009873142.1|  PREDICTED: ectonucleoside triphosphate dipho...    181   3e-47    
ref|XP_005260939.1|  PREDICTED: ectonucleoside triphosphate dipho...    182   3e-47    
ref|XP_004914735.1|  PREDICTED: ectonucleoside triphosphate dipho...    181   3e-47    
ref|XP_003278550.1|  PREDICTED: ectonucleoside triphosphate dipho...    182   3e-47    
gb|KFZ60607.1|  Ectonucleoside triphosphate diphosphohydrolase 6        179   3e-47    
sp|O75354.3|ENTP6_HUMAN  RecName: Full=Ectonucleoside triphosphat...    182   3e-47    
emb|CEI95978.1|  Putative Guanosine-diphosphatase                       181   3e-47    
ref|XP_005260935.1|  PREDICTED: ectonucleoside triphosphate dipho...    182   3e-47    
ref|XP_004474701.1|  PREDICTED: ectonucleoside triphosphate dipho...    181   3e-47    
ref|XP_008066805.1|  PREDICTED: ectonucleoside triphosphate dipho...    181   3e-47    



>ref|XP_009793993.1| PREDICTED: apyrase-like [Nicotiana sylvestris]
Length=453

 Score =   580 bits (1494),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 296/448 (66%), Positives = 358/448 (80%), Gaps = 6/448 (1%)
 Frame = +1

Query  55    HLVFISLAL-LLFPLACFSRSH----LRRVLLNHEAGNYAVIFDAGSTGSRVHVFHFDEN  219
             H VF  LA+ L+ PL+ FS  +    LRR LL+HE+ +YAVIFDAGSTGSRVHVF F+EN
Sbjct  7     HFVFTFLAIFLVLPLSFFSSVNAHKPLRRHLLSHESESYAVIFDAGSTGSRVHVFRFNEN  66

Query  220   LDLLPVGDGVEFFLKITPGLSSYADDPEAAAKSLEPLLLEAEGVVPTELQPDTPLELGAT  399
             L+LLP+G+ +EFF+   PGLSSYADDP+AAA SLEPLL  AEG VP ELQ +T LELGAT
Sbjct  67    LELLPIGNDIEFFMATNPGLSSYADDPKAAANSLEPLLEGAEGAVPKELQSETSLELGAT  126

Query  400   AGLRLLEGDASDKILQAVRDMFKNESNFKSKAEWVSILEGSQEGTYFWVAMNYLLGNLGK  579
             AGLR+L+GDA++KILQAVRD+ KNES F +K +WVSIL+G+QEG+Y WVA+NYLLGNLGK
Sbjct  127   AGLRMLKGDAAEKILQAVRDLVKNESTFHTKDQWVSILDGTQEGSYMWVAINYLLGNLGK  186

Query  580   GYQNTIATIDLGGGSVQVSYAVSGDTFANAPKPHNGEEPYVQEKYILGAQYYLYVHSYLN  759
              Y++T ATIDLGGGSVQ++YA+S + FANAP+  +GE PYVQEK+++   Y LYVHSYLN
Sbjct  187   NYKSTTATIDLGGGSVQMAYAISKEQFANAPQNEDGE-PYVQEKHLMSKDYDLYVHSYLN  245

Query  760   YGQLASRAEIFKASGNSTNPCVLEGYDGYYTYNDVSYKVTAPPNGSSLKNCRKLARKVVD  939
             YGQLA RAEIFKAS N +NPC LEGYDGYY+Y  V YKV APP+G+SLK CR L RK + 
Sbjct  246   YGQLAGRAEIFKASRNHSNPCALEGYDGYYSYGGVDYKVKAPPSGTSLKKCRALTRKALK  305

Query  940   FRAPCKYPNCTFNGVWSGGGGAGMENVDISSYFYDIAIDVGIIDEGKASKIVKPRSFLVA  1119
              RAPC Y NCTFNGVW+GGGGAG + V  SS+FYDI   VGI+D    S I KP  +L A
Sbjct  306   IRAPCNYKNCTFNGVWNGGGGAGTKTVHASSFFYDIGAQVGIVDSKFPSAIAKPIQYLNA  365

Query  1120  AKLACETKFEDVKSTFPNAVEKDYPYLCMDLVYQYTLLVDGLGLHPYKEITLMKKVEYKN  1299
             AK+AC+TK  DVKS FPN  E++ PYLC+DLVY+YTLLVDG  L+PYK+IT+M  V+YKN
Sbjct  366   AKVACKTKAADVKSVFPNTQERNIPYLCIDLVYEYTLLVDGFRLNPYKDITVMHDVKYKN  425

Query  1300  YMVEAAWPLGCAIDVISSSSANNLLSKY  1383
             Y+V AAWPLGCAID++SSSS    +S +
Sbjct  426   YLVGAAWPLGCAIDLVSSSSKKTRISSH  453



>ref|XP_009625429.1| PREDICTED: apyrase-like [Nicotiana tomentosiformis]
Length=453

 Score =   575 bits (1481),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 289/422 (68%), Positives = 347/422 (82%), Gaps = 1/422 (0%)
 Frame = +1

Query  118   LRRVLLNHEAGNYAVIFDAGSTGSRVHVFHFDENLDLLPVGDGVEFFLKITPGLSSYADD  297
             LRR LL+HE+ NYAVIFDAGSTGSRVHVF F+ENL+LLP+G+ +EFF+   PGLSSYADD
Sbjct  33    LRRHLLSHESENYAVIFDAGSTGSRVHVFRFNENLELLPIGNDIEFFMATKPGLSSYADD  92

Query  298   PEAAAKSLEPLLLEAEGVVPTELQPDTPLELGATAGLRLLEGDASDKILQAVRDMFKNES  477
             P+AAA SLEPLL+ AEG VP ELQ +TPLELGATAGLR+L+GDA++KILQAVRD+ KNES
Sbjct  93    PKAAANSLEPLLVGAEGAVPKELQSETPLELGATAGLRMLKGDAAEKILQAVRDLVKNES  152

Query  478   NFKSKAEWVSILEGSQEGTYFWVAMNYLLGNLGKGYQNTIATIDLGGGSVQVSYAVSGDT  657
              F +K +WVSIL+G+QEG+Y WVA+NYLLGNLGK Y++T ATIDLGGGSVQ++YA+S + 
Sbjct  153   TFHTKDQWVSILDGTQEGSYMWVAINYLLGNLGKNYKSTTATIDLGGGSVQMAYAISKEH  212

Query  658   FANAPKPHNGEEPYVQEKYILGAQYYLYVHSYLNYGQLASRAEIFKASGNSTNPCVLEGY  837
             FANAP+  +GE PYVQEK++L   YYLYVHSYLNYGQLA RAEIFKAS N +NPC LEGY
Sbjct  213   FANAPQNEDGE-PYVQEKHLLANDYYLYVHSYLNYGQLAGRAEIFKASRNYSNPCALEGY  271

Query  838   DGYYTYNDVSYKVTAPPNGSSLKNCRKLARKVVDFRAPCKYPNCTFNGVWSGGGGAGMEN  1017
             DGYY+Y  V+YKV AP +G+SLK CR L RK +   APC Y NCTFNGVW+GGGGAG + 
Sbjct  272   DGYYSYGGVNYKVKAPSSGTSLKKCRALTRKALKISAPCNYKNCTFNGVWNGGGGAGSKI  331

Query  1018  VDISSYFYDIAIDVGIIDEGKASKIVKPRSFLVAAKLACETKFEDVKSTFPNAVEKDYPY  1197
             V  SS+FYDI   VGI+D    S I KP  +L AAK+AC+TK  D+KS FPNA ++D PY
Sbjct  332   VHASSFFYDIGAQVGIVDSKFPSAIAKPIQYLNAAKVACKTKAADIKSVFPNAQDRDIPY  391

Query  1198  LCMDLVYQYTLLVDGLGLHPYKEITLMKKVEYKNYMVEAAWPLGCAIDVISSSSANNLLS  1377
             LC+DLVY YTLLVDGLGL+PYK+IT+M  V+YKNY+V AAWPLGCAID++SSS     +S
Sbjct  392   LCIDLVYDYTLLVDGLGLNPYKDITVMHDVKYKNYLVGAAWPLGCAIDLVSSSPKKTRIS  451

Query  1378  KY  1383
              +
Sbjct  452   SH  453



>sp|P80595.2|APY_SOLTU RecName: Full=Apyrase; AltName: Full=ATP-diphosphatase; AltName: 
Full=ATP-diphosphohydrolase; AltName: Full=Adenosine diphosphatase; 
Short=ADPase [Solanum tuberosum]
 gb|AAB02720.1| ATP-diphosphohydrolase [Solanum tuberosum]
Length=454

 Score =   566 bits (1459),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 274/441 (62%), Positives = 345/441 (78%), Gaps = 7/441 (2%)
 Frame = +1

Query  55    HLVFISLAL-LLFPLACFSRS-----HLRRVLLNHEAGNYAVIFDAGSTGSRVHVFHFDE  216
             H +FI LA+ L+ PL+  S++      LRR LL+HE+ +YAVIFDAGSTGSRVHVF FDE
Sbjct  7     HFIFIILAIFLVLPLSLLSKNVNAQIPLRRHLLSHESEHYAVIFDAGSTGSRVHVFRFDE  66

Query  217   NLDLLPVGDGVEFFLKITPGLSSYADDPEAAAKSLEPLLLEAEGVVPTELQPDTPLELGA  396
              L LLP+G+ +E+F+   PGLSSYA+DP+AAA SLEPLL  AEGVVP ELQ +TPLELGA
Sbjct  67    KLGLLPIGNNIEYFMATEPGLSSYAEDPKAAANSLEPLLDGAEGVVPQELQSETPLELGA  126

Query  397   TAGLRLLEGDASDKILQAVRDMFKNESNFKSKAEWVSILEGSQEGTYFWVAMNYLLGNLG  576
             TAGLR+L+GDA++KILQAVR++ KN+S F SK +WV+IL+G+QEG+Y W A+NYLLGNLG
Sbjct  127   TAGLRMLKGDAAEKILQAVRNLVKNQSTFHSKDQWVTILDGTQEGSYMWAAINYLLGNLG  186

Query  577   KGYQNTIATIDLGGGSVQVSYAVSGDTFANAPKPHNGEEPYVQEKYILGAQYYLYVHSYL  756
             K Y++T ATIDLGGGSVQ++YA+S + FA AP+  +GE PYVQ+K+++   Y LYVHSYL
Sbjct  187   KDYKSTTATIDLGGGSVQMAYAISNEQFAKAPQNEDGE-PYVQQKHLMSKDYNLYVHSYL  245

Query  757   NYGQLASRAEIFKASGNSTNPCVLEGYDGYYTYNDVSYKVTAPPNGSSLKNCRKLARKVV  936
             NYGQLA RAEIFKAS N +NPC LEG DGYY+Y  V YKV AP  GSS K CR+L R  +
Sbjct  246   NYGQLAGRAEIFKASRNESNPCALEGCDGYYSYGGVDYKVKAPKKGSSWKRCRRLTRHAL  305

Query  937   DFRAPCKYPNCTFNGVWSGGGGAGMENVDISSYFYDIAIDVGIIDEGKASKIVKPRSFLV  1116
                A C    CTFNGVW+GGGG G +N+  SS+FYDI   VGI+D    S + KP  +L 
Sbjct  306   KINAKCNIEECTFNGVWNGGGGDGQKNIHASSFFYDIGAQVGIVDTKFPSALAKPIQYLN  365

Query  1117  AAKLACETKFEDVKSTFPNAVEKDYPYLCMDLVYQYTLLVDGLGLHPYKEITLMKKVEYK  1296
             AAK+AC+T   D+KS FP   +++ PYLCMDL+Y+YTLLVDG GL+P+KEIT++  V+YK
Sbjct  366   AAKVACQTNVADIKSIFPKTQDRNIPYLCMDLIYEYTLLVDGFGLNPHKEITVIHDVQYK  425

Query  1297  NYMVEAAWPLGCAIDVISSSS  1359
             NY+V AAWPLGCAID++SS++
Sbjct  426   NYLVGAAWPLGCAIDLVSSTT  446



>ref|XP_006349910.1| PREDICTED: apyrase 2 isoform X2 [Solanum tuberosum]
Length=454

 Score =   561 bits (1445),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 284/441 (64%), Positives = 349/441 (79%), Gaps = 7/441 (2%)
 Frame = +1

Query  55    HLVFISLAL-LLFPLACFSRS-----HLRRVLLNHEAGNYAVIFDAGSTGSRVHVFHFDE  216
             H +F  LA+ L+ PL+  S++      LRR LL+HE+ +YAVIFDAGSTGSRVHVF FDE
Sbjct  7     HFIFTILAIFLVLPLSLLSKNVNAQIPLRRHLLSHESEHYAVIFDAGSTGSRVHVFRFDE  66

Query  217   NLDLLPVGDGVEFFLKITPGLSSYADDPEAAAKSLEPLLLEAEGVVPTELQPDTPLELGA  396
              L LLP+G+ +EFF++  PGLSSYA DP+AAA SLEPLL  AEGVVP ELQ +TPLELGA
Sbjct  67    KLGLLPIGNNIEFFMETNPGLSSYAKDPKAAANSLEPLLDGAEGVVPQELQYETPLELGA  126

Query  397   TAGLRLLEGDASDKILQAVRDMFKNESNFKSKAEWVSILEGSQEGTYFWVAMNYLLGNLG  576
             TAGLR+L+GDA++KILQAVRD+ KN+S F SK +WV+IL+G+QEG+Y WVAMNYLLGNLG
Sbjct  127   TAGLRMLKGDAAEKILQAVRDLVKNQSTFHSKDQWVTILDGTQEGSYMWVAMNYLLGNLG  186

Query  577   KGYQNTIATIDLGGGSVQVSYAVSGDTFANAPKPHNGEEPYVQEKYILGAQYYLYVHSYL  756
             K Y++T ATID+GGGS+Q++YA+S + FANAPK  +GE PYV +K+++   Y LYVHSYL
Sbjct  187   KDYKSTSATIDIGGGSIQMAYAISNEQFANAPKNVDGE-PYVLQKHLMSKDYNLYVHSYL  245

Query  757   NYGQLASRAEIFKASGNSTNPCVLEGYDGYYTYNDVSYKVTAPPNGSSLKNCRKLARKVV  936
             NYGQLA RAEIFKAS N +NPC LEGY+GYY+Y  V YKV AP  GSSLK CR L R+ +
Sbjct  246   NYGQLAGRAEIFKASRNESNPCALEGYEGYYSYGGVDYKVKAPKKGSSLKKCRNLTRQAL  305

Query  937   DFRAPCKYPNCTFNGVWSGGGGAGMENVDISSYFYDIAIDVGIIDEGKASKIVKPRSFLV  1116
               +A C   NCTFNGVW+GGGG G + +  SS+FY I   VGI+D    S + KP  +L 
Sbjct  306   RIKAQCNNKNCTFNGVWNGGGGDGQKTIHASSFFYYIGAQVGIVDTKFPSALAKPIQYLN  365

Query  1117  AAKLACETKFEDVKSTFPNAVEKDYPYLCMDLVYQYTLLVDGLGLHPYKEITLMKKVEYK  1296
             AAK+AC+TK  DVKS FP   +K+ PYLCMDLVYQYTLLVDG GL+PYK+ITLM KV+YK
Sbjct  366   AAKVACQTKATDVKSVFPQTQDKNIPYLCMDLVYQYTLLVDGFGLNPYKDITLMNKVQYK  425

Query  1297  NYMVEAAWPLGCAIDVISSSS  1359
             NY ++AAWPLGCAID++SS+S
Sbjct  426   NYQIKAAWPLGCAIDLVSSTS  446



>ref|XP_006349906.1| PREDICTED: apyrase-like [Solanum tuberosum]
Length=464

 Score =   561 bits (1446),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 283/441 (64%), Positives = 349/441 (79%), Gaps = 7/441 (2%)
 Frame = +1

Query  55    HLVFISLAL-LLFPLACFSRS-----HLRRVLLNHEAGNYAVIFDAGSTGSRVHVFHFDE  216
             H +F  LA+ L+ PL+  S++      LRR LL+HE+ +YAVIFDAGSTGSRVHVF FDE
Sbjct  17    HFIFTILAIFLVLPLSLLSKNVNAQIPLRRHLLSHESEHYAVIFDAGSTGSRVHVFRFDE  76

Query  217   NLDLLPVGDGVEFFLKITPGLSSYADDPEAAAKSLEPLLLEAEGVVPTELQPDTPLELGA  396
              L LLP+G+ +EFF++  PGLSSY  DP+AAA SLEPLL +AEGVVP ELQ +TPLELGA
Sbjct  77    KLGLLPIGNNIEFFMETNPGLSSYEKDPKAAANSLEPLLDKAEGVVPQELQYETPLELGA  136

Query  397   TAGLRLLEGDASDKILQAVRDMFKNESNFKSKAEWVSILEGSQEGTYFWVAMNYLLGNLG  576
             TAGLR+L+GDA++KILQAVRD+ KN+S F SK +WV+IL+G+QEG+Y WVAMNYLLGNLG
Sbjct  137   TAGLRMLKGDAAEKILQAVRDLVKNQSTFHSKDQWVTILDGTQEGSYMWVAMNYLLGNLG  196

Query  577   KGYQNTIATIDLGGGSVQVSYAVSGDTFANAPKPHNGEEPYVQEKYILGAQYYLYVHSYL  756
             K Y++T ATID+GGGS+Q++YA+S + FANAPK  +GE PYV +K+++   Y LYVHSYL
Sbjct  197   KDYKSTSATIDIGGGSIQMAYAISNEQFANAPKNVDGE-PYVLQKHLMSKDYNLYVHSYL  255

Query  757   NYGQLASRAEIFKASGNSTNPCVLEGYDGYYTYNDVSYKVTAPPNGSSLKNCRKLARKVV  936
             NYGQLA RAEIFKAS N +NPC LEGY+GYY+Y  V YKV AP  GSSLK CR L R+ +
Sbjct  256   NYGQLAGRAEIFKASRNESNPCALEGYEGYYSYGGVDYKVKAPKKGSSLKKCRNLTRQAL  315

Query  937   DFRAPCKYPNCTFNGVWSGGGGAGMENVDISSYFYDIAIDVGIIDEGKASKIVKPRSFLV  1116
               +A C   NCTFNGVW+GGGG G + +  SS+FY I   VGI+D    S + KP  +L 
Sbjct  316   RIKAQCNNKNCTFNGVWNGGGGDGQKTIHASSFFYYIGAQVGIVDTKFPSALAKPIQYLN  375

Query  1117  AAKLACETKFEDVKSTFPNAVEKDYPYLCMDLVYQYTLLVDGLGLHPYKEITLMKKVEYK  1296
             AAK+AC+TK  DVKS FP   +K+ PYLCMDLVYQYTLLVDG GL+PYK+ITLM KV+YK
Sbjct  376   AAKVACQTKATDVKSVFPQTQDKNIPYLCMDLVYQYTLLVDGFGLNPYKDITLMNKVQYK  435

Query  1297  NYMVEAAWPLGCAIDVISSSS  1359
             NY ++AAWPLGCAID++SS+S
Sbjct  436   NYQIKAAWPLGCAIDLVSSTS  456



>ref|XP_006349909.1| PREDICTED: apyrase 2 isoform X1 [Solanum tuberosum]
Length=477

 Score =   561 bits (1446),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 284/441 (64%), Positives = 349/441 (79%), Gaps = 7/441 (2%)
 Frame = +1

Query  55    HLVFISLAL-LLFPLACFSRS-----HLRRVLLNHEAGNYAVIFDAGSTGSRVHVFHFDE  216
             H +F  LA+ L+ PL+  S++      LRR LL+HE+ +YAVIFDAGSTGSRVHVF FDE
Sbjct  30    HFIFTILAIFLVLPLSLLSKNVNAQIPLRRHLLSHESEHYAVIFDAGSTGSRVHVFRFDE  89

Query  217   NLDLLPVGDGVEFFLKITPGLSSYADDPEAAAKSLEPLLLEAEGVVPTELQPDTPLELGA  396
              L LLP+G+ +EFF++  PGLSSYA DP+AAA SLEPLL  AEGVVP ELQ +TPLELGA
Sbjct  90    KLGLLPIGNNIEFFMETNPGLSSYAKDPKAAANSLEPLLDGAEGVVPQELQYETPLELGA  149

Query  397   TAGLRLLEGDASDKILQAVRDMFKNESNFKSKAEWVSILEGSQEGTYFWVAMNYLLGNLG  576
             TAGLR+L+GDA++KILQAVRD+ KN+S F SK +WV+IL+G+QEG+Y WVAMNYLLGNLG
Sbjct  150   TAGLRMLKGDAAEKILQAVRDLVKNQSTFHSKDQWVTILDGTQEGSYMWVAMNYLLGNLG  209

Query  577   KGYQNTIATIDLGGGSVQVSYAVSGDTFANAPKPHNGEEPYVQEKYILGAQYYLYVHSYL  756
             K Y++T ATID+GGGS+Q++YA+S + FANAPK  +GE PYV +K+++   Y LYVHSYL
Sbjct  210   KDYKSTSATIDIGGGSIQMAYAISNEQFANAPKNVDGE-PYVLQKHLMSKDYNLYVHSYL  268

Query  757   NYGQLASRAEIFKASGNSTNPCVLEGYDGYYTYNDVSYKVTAPPNGSSLKNCRKLARKVV  936
             NYGQLA RAEIFKAS N +NPC LEGY+GYY+Y  V YKV AP  GSSLK CR L R+ +
Sbjct  269   NYGQLAGRAEIFKASRNESNPCALEGYEGYYSYGGVDYKVKAPKKGSSLKKCRNLTRQAL  328

Query  937   DFRAPCKYPNCTFNGVWSGGGGAGMENVDISSYFYDIAIDVGIIDEGKASKIVKPRSFLV  1116
               +A C   NCTFNGVW+GGGG G + +  SS+FY I   VGI+D    S + KP  +L 
Sbjct  329   RIKAQCNNKNCTFNGVWNGGGGDGQKTIHASSFFYYIGAQVGIVDTKFPSALAKPIQYLN  388

Query  1117  AAKLACETKFEDVKSTFPNAVEKDYPYLCMDLVYQYTLLVDGLGLHPYKEITLMKKVEYK  1296
             AAK+AC+TK  DVKS FP   +K+ PYLCMDLVYQYTLLVDG GL+PYK+ITLM KV+YK
Sbjct  389   AAKVACQTKATDVKSVFPQTQDKNIPYLCMDLVYQYTLLVDGFGLNPYKDITLMNKVQYK  448

Query  1297  NYMVEAAWPLGCAIDVISSSS  1359
             NY ++AAWPLGCAID++SS+S
Sbjct  449   NYQIKAAWPLGCAIDLVSSTS  469



>ref|XP_004252980.1| PREDICTED: apyrase [Solanum lycopersicum]
Length=454

 Score =   552 bits (1422),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 275/447 (62%), Positives = 347/447 (78%), Gaps = 6/447 (1%)
 Frame = +1

Query  34    MKHTSHHHLVFISLALLLFPLACFSRS-----HLRRVLLNHEAGNYAVIFDAGSTGSRVH  198
             M   + H ++ I     + PL+  S++      LRR LL+HE+ +YAVIFDAGSTGSRVH
Sbjct  1     MLTKNSHFILSILTIFFVLPLSLLSKNVNGQIPLRRHLLSHESEHYAVIFDAGSTGSRVH  60

Query  199   VFHFDENLDLLPVGDGVEFFLKITPGLSSYADDPEAAAKSLEPLLLEAEGVVPTELQPDT  378
             VF FD+ L LLP+G+ +E+F+   PGLSSYA+DP+ AA SLEPLL  A+GVVP ELQ  T
Sbjct  61    VFRFDQKLGLLPIGNNIEYFMATEPGLSSYAEDPKTAANSLEPLLDGAKGVVPQELQSQT  120

Query  379   PLELGATAGLRLLEGDASDKILQAVRDMFKNESNFKSKAEWVSILEGSQEGTYFWVAMNY  558
             PLELGATAGLR+L+GDA++KILQAVR++ KN+S F SK +WV+IL+G+QEG+Y W A+NY
Sbjct  121   PLELGATAGLRMLKGDAAEKILQAVRNLVKNQSTFHSKDQWVTILDGTQEGSYMWAAINY  180

Query  559   LLGNLGKGYQNTIATIDLGGGSVQVSYAVSGDTFANAPKPHNGEEPYVQEKYILGAQYYL  738
             LLGNLGK Y++T ATIDLGGGSVQ++YA+S + FANAPK  +GE PYVQ+K+++   Y L
Sbjct  181   LLGNLGKDYKSTTATIDLGGGSVQMAYAISNEQFANAPKNEDGE-PYVQQKHLMSKDYNL  239

Query  739   YVHSYLNYGQLASRAEIFKASGNSTNPCVLEGYDGYYTYNDVSYKVTAPPNGSSLKNCRK  918
             YVHSYLNYGQLA RAEIFKAS N +NPC LEGYDGYY+Y  V YKV AP  GSSLK CR 
Sbjct  240   YVHSYLNYGQLAGRAEIFKASRNESNPCALEGYDGYYSYGGVDYKVKAPKKGSSLKKCRN  299

Query  919   LARKVVDFRAPCKYPNCTFNGVWSGGGGAGMENVDISSYFYDIAIDVGIIDEGKASKIVK  1098
             L R+ +  +A CK  NCTFNGVW+GGGG G +N+  SS+FYDI   VGI+D    S + K
Sbjct  300   LTRQALRIKAQCKNKNCTFNGVWNGGGGDGQKNIHASSFFYDIGAQVGIVDTKFPSALAK  359

Query  1099  PRSFLVAAKLACETKFEDVKSTFPNAVEKDYPYLCMDLVYQYTLLVDGLGLHPYKEITLM  1278
             P  +L AAK+AC+T   D+KS FP   +++ PYLCMDL+Y+YTLLVDG GL+P+KEIT++
Sbjct  360   PIQYLNAAKVACQTNVADIKSVFPKTQDRNIPYLCMDLIYEYTLLVDGFGLNPHKEITVI  419

Query  1279  KKVEYKNYMVEAAWPLGCAIDVISSSS  1359
               V+YKNY+V AAWPLGCAID++SS+S
Sbjct  420   HDVQYKNYLVGAAWPLGCAIDLVSSTS  446



>ref|NP_001275348.1| apyrase precursor [Solanum tuberosum]
 gb|ABV26545.1| apyrase 3 [Solanum tuberosum]
Length=454

 Score =   550 bits (1418),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 276/441 (63%), Positives = 345/441 (78%), Gaps = 7/441 (2%)
 Frame = +1

Query  55    HLVFISLAL-LLFPLACFSRS-----HLRRVLLNHEAGNYAVIFDAGSTGSRVHVFHFDE  216
             H VF  LA+ L+ PL+  S++      LRR LL+HE+ +YAVIFDAGSTGSRVHVF FDE
Sbjct  7     HFVFTILAIFLVLPLSLLSKNVDAQIPLRRHLLSHESEHYAVIFDAGSTGSRVHVFRFDE  66

Query  217   NLDLLPVGDGVEFFLKITPGLSSYADDPEAAAKSLEPLLLEAEGVVPTELQPDTPLELGA  396
              L LLP+G+ +E+F+   PGLSSYA+DP+AAA SLEPLL  AEGVVP ELQ +TPLELGA
Sbjct  67    KLGLLPIGNNIEYFMATEPGLSSYAEDPKAAANSLEPLLDGAEGVVPQELQSETPLELGA  126

Query  397   TAGLRLLEGDASDKILQAVRDMFKNESNFKSKAEWVSILEGSQEGTYFWVAMNYLLGNLG  576
             TAGLR+L+GDA++KILQAVR++ KN+S F SK +WV+IL+G+QEG+Y W A+NYLLGNLG
Sbjct  127   TAGLRMLKGDAAEKILQAVRNLVKNQSTFHSKDQWVTILDGTQEGSYMWAAINYLLGNLG  186

Query  577   KGYQNTIATIDLGGGSVQVSYAVSGDTFANAPKPHNGEEPYVQEKYILGAQYYLYVHSYL  756
             K Y++T ATIDLGGGSVQ++YA+S + FA AP   +GE PYVQ+K+++   Y LYVHSYL
Sbjct  187   KDYKSTTATIDLGGGSVQMAYAISNEQFAKAPNNEDGE-PYVQQKHLMSKDYNLYVHSYL  245

Query  757   NYGQLASRAEIFKASGNSTNPCVLEGYDGYYTYNDVSYKVTAPPNGSSLKNCRKLARKVV  936
             NYGQLA RAEIFKAS N +NPC LEGYDGYY+Y  V YKV AP  GSS K CR+L R  +
Sbjct  246   NYGQLAGRAEIFKASRNESNPCALEGYDGYYSYGGVDYKVKAPKKGSSWKRCRRLTRHAL  305

Query  937   DFRAPCKYPNCTFNGVWSGGGGAGMENVDISSYFYDIAIDVGIIDEGKASKIVKPRSFLV  1116
                A CK   CTFNGVW+GGGG G +N+  SS+FYDI   VGI+D    S + KP  +L 
Sbjct  306   KINAKCKIEECTFNGVWNGGGGDGQKNIHASSFFYDIGAQVGIVDTKFPSALAKPIQYLN  365

Query  1117  AAKLACETKFEDVKSTFPNAVEKDYPYLCMDLVYQYTLLVDGLGLHPYKEITLMKKVEYK  1296
             AAK+AC+T   D+KS FP   +++ PYLCMDL+Y+YTLLVDG GL+P+KEIT++  V+YK
Sbjct  366   AAKVACQTNVADIKSIFPKTQDRNIPYLCMDLIYEYTLLVDGFGLNPHKEITVIHDVQYK  425

Query  1297  NYMVEAAWPLGCAIDVISSSS  1359
             NY+V AAWPLGCAID++SS++
Sbjct  426   NYLVGAAWPLGCAIDLVSSTT  446



>ref|XP_009615583.1| PREDICTED: apyrase-like [Nicotiana tomentosiformis]
Length=447

 Score =   550 bits (1417),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 280/421 (67%), Positives = 347/421 (82%), Gaps = 2/421 (0%)
 Frame = +1

Query  100   CFSRSHLRRVLLNHEAGNYAVIFDAGSTGSRVHVFHFDENLDLLPVGDGVEFFLKITPGL  279
             C + S +RR+L +HE+ +YAVIFDAGSTGSRVHVF FD NLDLLP+G+ +E+FL I PGL
Sbjct  28    CSASSKVRRLLFSHESEHYAVIFDAGSTGSRVHVFRFDHNLDLLPIGNDIEYFLAINPGL  87

Query  280   SSYADDPEAAAKSLEPLLLEAEGVVPTELQPDTPLELGATAGLRLLEGDASDKILQAVRD  459
             SSYADDP AAA SL+PLL +AEGVVP +LQP+TPL+LGATAGLRLL+GDA+ KILQAVRD
Sbjct  88    SSYADDPNAAALSLKPLLDKAEGVVPKDLQPETPLKLGATAGLRLLKGDAAAKILQAVRD  147

Query  460   MFKNESNFKSKAEWVSILEGSQEGTYFWVAMNYLLGNLGKGYQNTIATIDLGGGSVQVSY  639
             +FKNE++   KAEWVS+L+G+QEG+YFWVA+NYLLGNLGK Y+ TIATIDLGGGSVQ++Y
Sbjct  148   LFKNETSLSYKAEWVSVLDGTQEGSYFWVALNYLLGNLGKKYERTIATIDLGGGSVQMTY  207

Query  640   AVSGDTFANAPKPHNGEEPYVQEKYILGAQYYLYVHSYLNYGQLASRAEIFKASGN-STN  816
             A+S ++ + APK  NG EPYV  K +LGA Y+LYVHSYLNYGQLA+R EIFKASGN S++
Sbjct  208   AISKESASKAPKVANG-EPYVLNKSLLGANYHLYVHSYLNYGQLAARKEIFKASGNSSSS  266

Query  817   PCVLEGYDGYYTYNDVSYKVTAPPNGSSLKNCRKLARKVVDFRAPCKYPNCTFNGVWSGG  996
             PC+L GY+GYYTYN V+YK ++P NGSSLK C+ L +K +  +APC +  CTF GVW+GG
Sbjct  267   PCILGGYNGYYTYNGVAYKASSPRNGSSLKKCKTLTKKALKIKAPCNHKKCTFGGVWNGG  326

Query  997   GGAGMENVDISSYFYDIAIDVGIIDEGKASKIVKPRSFLVAAKLACETKFEDVKSTFPNA  1176
             GG G +N+  SS+FYD A  VGIID  K S   KP  +L AAKLAC+T  +D+KS FPN 
Sbjct  327   GGDGYKNLYASSFFYDYAAMVGIIDPKKPSGRAKPIQYLNAAKLACKTSVKDIKSVFPNI  386

Query  1177  VEKDYPYLCMDLVYQYTLLVDGLGLHPYKEITLMKKVEYKNYMVEAAWPLGCAIDVISSS  1356
              E++ PY+CMDLVY+Y LLV+G GLHP +EIT++  V+Y+NY+V AAWPLGCAIDV+SSS
Sbjct  387   GERNVPYICMDLVYEYALLVNGFGLHPKQEITVVHDVKYRNYIVGAAWPLGCAIDVVSSS  446

Query  1357  S  1359
             S
Sbjct  447   S  447



>gb|ADN83844.1| putative apyrase AP5 [Solanum tuberosum]
Length=454

 Score =   548 bits (1412),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 275/441 (62%), Positives = 344/441 (78%), Gaps = 7/441 (2%)
 Frame = +1

Query  55    HLVFISLAL-LLFPLACFSRS-----HLRRVLLNHEAGNYAVIFDAGSTGSRVHVFHFDE  216
             H +F  LA+ L+ PL+  S++      LRR LL+HE+ +YAVIFDAGSTGSRVHVF FDE
Sbjct  7     HFIFTILAIFLVLPLSLLSKNVNAQIPLRRHLLSHESEHYAVIFDAGSTGSRVHVFRFDE  66

Query  217   NLDLLPVGDGVEFFLKITPGLSSYADDPEAAAKSLEPLLLEAEGVVPTELQPDTPLELGA  396
              L LLP+G+ +E+F+   PGLSSYA+DP+AAA SLEPLL  AEGVVP ELQ +TPLELGA
Sbjct  67    KLGLLPIGNNIEYFMATEPGLSSYAEDPKAAANSLEPLLDGAEGVVPQELQSETPLELGA  126

Query  397   TAGLRLLEGDASDKILQAVRDMFKNESNFKSKAEWVSILEGSQEGTYFWVAMNYLLGNLG  576
             TAGLR+L+GDA++KILQAVR++ KN+S F SK +WV+IL+G+QEG+Y W A+NYLLGNLG
Sbjct  127   TAGLRMLKGDAAEKILQAVRNLVKNQSTFHSKDQWVTILDGTQEGSYMWAAINYLLGNLG  186

Query  577   KGYQNTIATIDLGGGSVQVSYAVSGDTFANAPKPHNGEEPYVQEKYILGAQYYLYVHSYL  756
             K Y++T ATIDLGGGSVQ++YA+S + FA APK  +GE PYVQ+K+++   Y LYVHSYL
Sbjct  187   KDYKSTTATIDLGGGSVQMAYAISNEQFAQAPKNEDGE-PYVQQKHLMSKDYNLYVHSYL  245

Query  757   NYGQLASRAEIFKASGNSTNPCVLEGYDGYYTYNDVSYKVTAPPNGSSLKNCRKLARKVV  936
             NYGQL  RAEIFKAS N +NPC LEGYDGYY+Y  V YKV AP  GSS K CR L R  +
Sbjct  246   NYGQLVGRAEIFKASRNESNPCALEGYDGYYSYGGVDYKVKAPKKGSSWKRCRGLTRHAL  305

Query  937   DFRAPCKYPNCTFNGVWSGGGGAGMENVDISSYFYDIAIDVGIIDEGKASKIVKPRSFLV  1116
                A CK   CTFNGVW+GGGG G +N+  SS+FYDI   VGI+D    S + KP  +L 
Sbjct  306   KINAKCKIEECTFNGVWNGGGGDGQKNIHASSFFYDIGAQVGIVDTKFPSALAKPIQYLN  365

Query  1117  AAKLACETKFEDVKSTFPNAVEKDYPYLCMDLVYQYTLLVDGLGLHPYKEITLMKKVEYK  1296
             AAK+AC+T   D+KS FP   +++ PYLCMDL+Y+YTLLVDG GL+P+KEIT++  V+YK
Sbjct  366   AAKVACQTNVADIKSIFPKTQDRNIPYLCMDLIYEYTLLVDGFGLNPHKEITVIHDVQYK  425

Query  1297  NYMVEAAWPLGCAIDVISSSS  1359
             NY+V AAWPLGCAID++SS++
Sbjct  426   NYLVGAAWPLGCAIDLVSSTT  446



>ref|XP_004247967.1| PREDICTED: apyrase-like [Solanum lycopersicum]
Length=451

 Score =   536 bits (1380),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 263/444 (59%), Positives = 336/444 (76%), Gaps = 7/444 (2%)
 Frame = +1

Query  64    FISLALLLFPLACFSRS----HLRRVLLNHEAGNY-AVIFDAGSTGSRVHVFHFDENLDL  228
              I +  L+  L C   S    H+ R LL+++  +Y AVIFDAGS+GSRVHVF F +NLDL
Sbjct  7     LILMTCLVVLLICVKSSNGHFHIGRNLLSNQTDSYYAVIFDAGSSGSRVHVFRFSQNLDL  66

Query  229   LPVGD-GVEFFLKITPGLSSYADDPEAAAKSLEPLLLEAEGVVPTELQPDTPLELGATAG  405
             LP+G+ G+E F K+ PGLSSY +DP+AAAKSLEPLLL+AE VVP  L PDTP+ELGATAG
Sbjct  67    LPIGEYGLEVFDKVKPGLSSYENDPKAAAKSLEPLLLKAESVVPINLHPDTPVELGATAG  126

Query  406   LRLLEGDASDKILQAVRDMFKNESNFKSKAEWVSILEGSQEGTYFWVAMNYLLGNLGKGY  585
             LR+L+G+A+++I+Q+VR+M KNES F+ K E VSIL G+QEG+Y WV +NYLL  LGK Y
Sbjct  127   LRMLKGNAAERIMQSVRNMLKNESIFEYKDERVSILSGTQEGSYLWVGLNYLLKTLGKSY  186

Query  586   QNTIATIDLGGGSVQVSYAVSGDTFANAPKPHNGEEPYVQEKYILGAQYYLYVHSYLNYG  765
             QNT ATIDLGGGSVQ+++A+S +    APK  +GE  YV  K ++GA YYLYVHSYLNYG
Sbjct  187   QNTAATIDLGGGSVQMAFALSKENSEKAPKNLDGEN-YVLHKSLMGANYYLYVHSYLNYG  245

Query  766   QLASRAEIFKASGNSTNPCVLEGYDGYYTYNDVSYKVTAPPNGSSLKNCRKLARKVVDFR  945
              LASRAEI K S NST+PC+L+G DGYYT+  V+YK +  PNGSSL+ C+ +  K +   
Sbjct  246   LLASRAEILKVSRNSTSPCILKGTDGYYTFGGVAYKASPLPNGSSLRKCKAIVWKTLKLN  305

Query  946   APCKYPNCTFNGVWSGGGGAGMENVDISSYFYDIAIDVGIIDEGKASKIVKPRSFLVAAK  1125
             APCKY  CTFNGVW+GGG   ++N+ ISS+F+D+A +V I+D   +S   KP  +L AAK
Sbjct  306   APCKYHTCTFNGVWNGGGLDAIKNIYISSFFFDMASEVNIVDPKASSGKAKPIQYLNAAK  365

Query  1126  LACETKFEDVKSTFPNAVEKDYPYLCMDLVYQYTLLVDGLGLHPYKEITLMKKVEYKNYM  1305
             +AC+ K E+VK  FPN   KD PYLCMD++YQ++LLVDG GL+P++EITL+  + YKN  
Sbjct  366   IACKLKAEEVKYVFPNVDSKDLPYLCMDMIYQFSLLVDGFGLNPHREITLVHDINYKNNR  425

Query  1306  VEAAWPLGCAIDVISSSSANNLLS  1377
             VEAAWPLGCAIDV+SSSS    +S
Sbjct  426   VEAAWPLGCAIDVVSSSSLRTHIS  449



>ref|XP_006363161.1| PREDICTED: apyrase-like isoform X1 [Solanum tuberosum]
 ref|XP_006363162.1| PREDICTED: apyrase-like isoform X2 [Solanum tuberosum]
Length=451

 Score =   523 bits (1348),  Expect = 8e-179, Method: Compositional matrix adjust.
 Identities = 259/453 (57%), Positives = 348/453 (77%), Gaps = 11/453 (2%)
 Frame = +1

Query  22    KHNTMKHTSHHHLVFISLALLL-FPLACFSRSHLRRVLLNHEAGNYAVIFDAGSTGSRVH  198
             KHNT   T+ ++L  I L +L+  PL+  S+        ++ +  YAVIFDAGSTGSRVH
Sbjct  3     KHNT---TNIYNLFNIILLILVGLPLSSLSKHD------DNYSEKYAVIFDAGSTGSRVH  53

Query  199   VFHFDENLDLLPVGDGVEFFLKITPGLSSYADDPEAAAKSLEPLLLEAEGVVPTELQPDT  378
             VF F+ NLDLL +G+ +E FL I PGLSSYADDP+AAA SL+PLL +AE V+P  LQ  T
Sbjct  54    VFRFNSNLDLLNIGNDLELFLAIKPGLSSYADDPKAAANSLKPLLEKAEAVIPKNLQSQT  113

Query  379   PLELGATAGLRLLEGDASDKILQAVRDMFKNESNFKSKAEWVSILEGSQEGTYFWVAMNY  558
             P+++GATAGLRLL+GD+S+KILQAVRD+ KNE+    K EWVS+LEG+QEG+YFWVA+NY
Sbjct  114   PIKVGATAGLRLLKGDSSEKILQAVRDLLKNETTLSYKDEWVSVLEGTQEGSYFWVALNY  173

Query  559   LLGNLGKGYQNTIATIDLGGGSVQVSYAVSGDTFANAPKPHNGEEPYVQEKYILGAQYYL  738
             L GNLGK Y +TIATIDLGGGSVQ++YAVS ++  NAPK  NG+ PYVQ+K +LG  YYL
Sbjct  174   LYGNLGKNYPDTIATIDLGGGSVQIAYAVSKESALNAPKLPNGD-PYVQQKSLLGTNYYL  232

Query  739   YVHSYLNYGQLASRAEIFKASGNSTNPCVLEGYDGYYTYNDVSYKVTAPPNGSSLKNCRK  918
             YVHS+LNYG LA+RA+I KAS N T+PC++EG++GYYTYN V+YK  +   G +++ C+ 
Sbjct  233   YVHSFLNYGLLAARADILKASKNYTSPCIVEGHNGYYTYNGVAYKAASQKQGPNIRRCKA  292

Query  919   LARKVVDFRAPCKYPNCTFNGVWSGGGGAGMENVDISSYFYDIAIDVGIIDEGKASKIVK  1098
             + RK++   APC++ NC+F G+W+GGGGAG +N+ ISS+FYD A  VGI+D  + S I +
Sbjct  293   IIRKLLQLDAPCQHKNCSFAGIWNGGGGAGTKNLHISSFFYDYASTVGIVDPKEPSGITQ  352

Query  1099  PRSFLVAAKLACETKFEDVKSTFPNAVEKDYPYLCMDLVYQYTLLVDGLGLHPYKEITLM  1278
             P  +  AA LAC+TK +++K  FPN  +KD P++CMDL+Y+YTLLV G G+ P ++IT++
Sbjct  353   PIQYYKAATLACKTKKQNMKLVFPNIGDKDIPFICMDLLYEYTLLVHGFGIDPIRKITVV  412

Query  1279  KKVEYKNYMVEAAWPLGCAIDVISSSSANNLLS  1377
              +V YKN++VEAAWPLG AID +SS+++  L+S
Sbjct  413   HQVNYKNHLVEAAWPLGSAIDAVSSTTSEKLIS  445



>emb|CDP04088.1| unnamed protein product [Coffea canephora]
Length=464

 Score =   518 bits (1334),  Expect = 1e-176, Method: Compositional matrix adjust.
 Identities = 250/409 (61%), Positives = 322/409 (79%), Gaps = 0/409 (0%)
 Frame = +1

Query  127   VLLNHEAGNYAVIFDAGSTGSRVHVFHFDENLDLLPVGDGVEFFLKITPGLSSYADDPEA  306
             +L + E+  YAVIFDAGSTGSRVHVF FD N+DLL +G   EF+ K  PGLSSYADDP+A
Sbjct  47    ILRSEESEKYAVIFDAGSTGSRVHVFRFDPNMDLLRIGQDFEFYDKTNPGLSSYADDPQA  106

Query  307   AAKSLEPLLLEAEGVVPTELQPDTPLELGATAGLRLLEGDASDKILQAVRDMFKNESNFK  486
             AA SL+PLLLE + VVP EL+P TP++LGATAGLR+L+  ASD+ILQAVRD+FKNES+ +
Sbjct  107   AALSLKPLLLEGQAVVPEELRPQTPVKLGATAGLRMLKNGASDEILQAVRDLFKNESSLE  166

Query  487   SKAEWVSILEGSQEGTYFWVAMNYLLGNLGKGYQNTIATIDLGGGSVQVSYAVSGDTFAN  666
              KAEWVSILEGS+E +Y W+A+NYL G +GK Y +T+AT+DLGGGSV+++Y +S +T AN
Sbjct  167   YKAEWVSILEGSEEASYMWIAINYLSGRIGKPYPDTVATVDLGGGSVEMTYGISEETAAN  226

Query  667   APKPHNGEEPYVQEKYILGAQYYLYVHSYLNYGQLASRAEIFKASGNSTNPCVLEGYDGY  846
             APK  N  E YV EKYILG +Y+LY +SYL YGQLA+RAEIFK S NSTNPC+L+GY G+
Sbjct  227   APKCSNDGEAYVHEKYILGTKYHLYAYSYLYYGQLAARAEIFKVSRNSTNPCILDGYHGF  286

Query  847   YTYNDVSYKVTAPPNGSSLKNCRKLARKVVDFRAPCKYPNCTFNGVWSGGGGAGMENVDI  1026
             YTY   +Y+ ++PP+GSS K CR++  K +   APC++  CTFNG W GGGG G ENV +
Sbjct  287   YTYGGETYEASSPPSGSSFKKCRQVTLKALKLDAPCEHEKCTFNGTWGGGGGEGQENVYL  346

Query  1027  SSYFYDIAIDVGIIDEGKASKIVKPRSFLVAAKLACETKFEDVKSTFPNAVEKDYPYLCM  1206
             +S+F+DIAI+ GII     S   +P  F  AA+LAC TK+EDVK+ FPN  ++D PYLCM
Sbjct  347   ASFFFDIAIEAGIISPNVPSASARPIDFKRAARLACVTKYEDVKTVFPNVYDEDLPYLCM  406

Query  1207  DLVYQYTLLVDGLGLHPYKEITLMKKVEYKNYMVEAAWPLGCAIDVISS  1353
             DLVY+Y+LLVDG GL P+K++TL++++ Y+N ++ AAWPLG AID +SS
Sbjct  407   DLVYEYSLLVDGFGLDPFKKVTLVRQINYQNSLIGAAWPLGSAIDAVSS  455



>ref|XP_004232617.1| PREDICTED: apyrase-like isoform X1 [Solanum lycopersicum]
Length=449

 Score =   517 bits (1332),  Expect = 2e-176, Method: Compositional matrix adjust.
 Identities = 248/414 (60%), Positives = 327/414 (79%), Gaps = 1/414 (0%)
 Frame = +1

Query  136   NHEAGNYAVIFDAGSTGSRVHVFHFDENLDLLPVGDGVEFFLKITPGLSSYADDPEAAAK  315
             N  +  YAVIFDAGSTGSRVHVF F+ NLDL+ +G+ +E FL I PGLSSYADDP+AAA 
Sbjct  30    NDYSEKYAVIFDAGSTGSRVHVFRFNSNLDLINIGNDLELFLAIKPGLSSYADDPKAAAN  89

Query  316   SLEPLLLEAEGVVPTELQPDTPLELGATAGLRLLEGDASDKILQAVRDMFKNESNFKSKA  495
             SL+PLL +AE V+P  LQ  TP+++GATAGLRLL+GD+S+KILQAVRDM KNE+    K 
Sbjct  90    SLKPLLEKAEAVIPKNLQSQTPIKVGATAGLRLLKGDSSEKILQAVRDMLKNETTLSYKD  149

Query  496   EWVSILEGSQEGTYFWVAMNYLLGNLGKGYQNTIATIDLGGGSVQVSYAVSGDTFANAPK  675
             EWVS+LEG+ EG+YFWVA+NYL GNLGK Y +TIATIDLGGGSVQ++YAVS  +  NAPK
Sbjct  150   EWVSVLEGTLEGSYFWVALNYLYGNLGKNYPDTIATIDLGGGSVQIAYAVSKQSAINAPK  209

Query  676   PHNGEEPYVQEKYILGAQYYLYVHSYLNYGQLASRAEIFKASGNSTNPCVLEGYDGYYTY  855
               NG+  YVQ+K +LG  YYLYVHS+LNYG LA+RA+I KAS N T+PC++EG++GYYTY
Sbjct  210   LPNGDA-YVQQKALLGTNYYLYVHSFLNYGLLAARADILKASKNYTSPCIVEGHNGYYTY  268

Query  856   NDVSYKVTAPPNGSSLKNCRKLARKVVDFRAPCKYPNCTFNGVWSGGGGAGMENVDISSY  1035
             N VSYK  +   G +++ C+ + RK++   APC + NC+F G+W+GGGGAG +N+ ISS+
Sbjct  269   NGVSYKAASRKQGPNIRRCKAIIRKLLQIDAPCNHKNCSFAGIWNGGGGAGTKNLYISSF  328

Query  1036  FYDIAIDVGIIDEGKASKIVKPRSFLVAAKLACETKFEDVKSTFPNAVEKDYPYLCMDLV  1215
             FYD A  VGI+D  +A  I +P  +  AA LAC+TK +++KS FPN  +KD P++CMDL+
Sbjct  329   FYDYASTVGIVDPKEAYGITQPIQYYKAATLACKTKKQNMKSVFPNINDKDIPFICMDLL  388

Query  1216  YQYTLLVDGLGLHPYKEITLMKKVEYKNYMVEAAWPLGCAIDVISSSSANNLLS  1377
             Y+YTLLV+G G+ P ++IT++ +V YKN++VEAAWPLG AID +SS+++ N++S
Sbjct  389   YEYTLLVNGFGIDPIRKITVVHQVNYKNHLVEAAWPLGSAIDAVSSTTSENMIS  442



>ref|XP_006360924.1| PREDICTED: apyrase-like [Solanum tuberosum]
Length=454

 Score =   516 bits (1328),  Expect = 8e-176, Method: Compositional matrix adjust.
 Identities = 255/440 (58%), Positives = 335/440 (76%), Gaps = 3/440 (1%)
 Frame = +1

Query  34    MKHTSHHHLVFISLALLLFPLACFSRSHLRRVLLNHEAGNY-AVIFDAGSTGSRVHVFHF  210
             +K  S   L+   + LL+   +    SH+RR LL+++  +Y AVIFDAGS+GSRVHVF F
Sbjct  4     LKKNSSLVLMTCLVVLLICVKSSHEHSHIRRNLLSNQTDSYYAVIFDAGSSGSRVHVFRF  63

Query  211   DENLDLLPVGD-GVEFFLKITPGLSSYADDPEAAAKSLEPLLLEAEGVVPTELQPDTPLE  387
              +NLDLLP+G+ G+E F K+ PGLSSY +DP+AAAKSLEPLL++AE VVP  L  DTP+E
Sbjct  64    SQNLDLLPIGEYGLEVFDKVKPGLSSYENDPKAAAKSLEPLLIKAESVVPINLHTDTPVE  123

Query  388   LGATAGLRLLEGDASDKILQAVRDMFKNESNFKSKAEWVSILEGSQEGTYFWVAMNYLLG  567
             LGATAGLR+L+G+ +++I+Q+VR+M KNES F+ K  WVSIL G+QEG+YFWV +NYLL 
Sbjct  124   LGATAGLRMLKGNTAERIMQSVRNMLKNESIFEYKDGWVSILSGAQEGSYFWVGLNYLLR  183

Query  568   NLGKGYQNTIATIDLGGGSVQVSYAVSGDTFANAPKPHNGEEPYVQEKYILGAQYYLYVH  747
              LGK YQNT+ATIDLGGGSVQ+++A+S +    AP   +GE+ YV +K ++GA YYLYVH
Sbjct  184   TLGKSYQNTVATIDLGGGSVQMAFALSKENSEKAPINLDGEK-YVLQKSLMGANYYLYVH  242

Query  748   SYLNYGQLASRAEIFKASGNSTNPCVLEGYDGYYTYNDVSYKVTAPPNGSSLKNCRKLAR  927
             SYLNYG LASRAEI K S NST+PC+L+G  GYYTY  V+YK +  PNGSS++ C+ +  
Sbjct  243   SYLNYGLLASRAEILKVSRNSTSPCILKGTYGYYTYGGVAYKASPSPNGSSMRKCKAIVW  302

Query  928   KVVDFRAPCKYPNCTFNGVWSGGGGAGMENVDISSYFYDIAIDVGIIDEGKASKIVKPRS  1107
             + +   APCKY  CTFNGVW+GGG   ++N+ ISS+F+D+A +V I+D   +S   KP  
Sbjct  303   RTLKLNAPCKYHTCTFNGVWNGGGLDAIKNIYISSFFFDMASEVNIVDPKASSGKAKPIQ  362

Query  1108  FLVAAKLACETKFEDVKSTFPNAVEKDYPYLCMDLVYQYTLLVDGLGLHPYKEITLMKKV  1287
             +L AAK+AC+ K E+VK  FPN   KD PYLCMD++YQ++LLVDG GL+P++EITL+  +
Sbjct  363   YLNAAKIACKLKAEEVKYVFPNVDSKDLPYLCMDMIYQFSLLVDGFGLNPHREITLVHDI  422

Query  1288  EYKNYMVEAAWPLGCAIDVI  1347
              YKN  VEAAWPLGCAIDV+
Sbjct  423   NYKNNRVEAAWPLGCAIDVV  442



>emb|CDP04087.1| unnamed protein product [Coffea canephora]
Length=444

 Score =   488 bits (1256),  Expect = 4e-165, Method: Compositional matrix adjust.
 Identities = 249/442 (56%), Positives = 327/442 (74%), Gaps = 6/442 (1%)
 Frame = +1

Query  49    HHHLVFISLALLLFPLACFSRSHLRR----VLLNHEA-GNYAVIFDAGSTGSRVHVFHFD  213
              H + F+ ++ + F    +S S   +    VLL+++A G YAVI DAGSTGSR+HV HFD
Sbjct  4     QHLIAFVFVSCMPFLQTTYSLSLSGKLSNGVLLSNDASGKYAVIIDAGSTGSRLHVLHFD  63

Query  214   ENLDLLPVGDGVEFFLKITPGLSSYADDPEAAAKSLEPLLLEAEGVVPTELQPDTPLELG  393
              NLDL+ +G   EFF  I PGLSSYAD PEAAA+SL+PLL +AE +VP E + +TP+++G
Sbjct  64    RNLDLVQIGQDFEFFKAIKPGLSSYADGPEAAAQSLKPLLEKAEAIVPKEFRANTPVKVG  123

Query  394   ATAGLRLLEGDASDKILQAVRDMFKNESNFKSKAEWVSILEGSQEGTYFWVAMNYLLGNL  573
             ATAGLRLL+GD+S+KILQAVRD+ KNES+ K KAEWV+ILEGSQE  Y W A+NYLLG  
Sbjct  124   ATAGLRLLKGDSSEKILQAVRDLLKNESSLKYKAEWVTILEGSQEAAYIWAAINYLLGTA  183

Query  574   GKGYQNTIATIDLGGGSVQVSYAVSGDTFANAPKPHNGEEPYVQEKYILGAQYYLYVHSY  753
             GK Y  T+ TIDLGGGSVQ++YAVS +    A K  + +E Y+QEK +LG+ Y+LY +SY
Sbjct  184   GKKYSETVGTIDLGGGSVQMTYAVSKEVALKASK-LSKKETYIQEKNLLGSTYHLYAYSY  242

Query  754   LNYGQLASRAEIFKASGNSTNPCVLEGYDGYYTYNDVSYKVTAPPNGSSLKNCRKLARKV  933
             LNYG LA+RAEI K S NS++PC+L GY GYYTY DV+Y+ +A P G ++K CR    K 
Sbjct  243   LNYGLLAARAEILKVSRNSSHPCILYGYHGYYTYGDVAYRASAFPTGPNMKKCRAFVLKA  302

Query  934   VDFRAPCKYPNCTFNGVWSGGGGAGMENVDISSYFYDIAIDVGIIDEGKASKIVKPRSFL  1113
             +   APCK+  CTFNGVW+GGGG G +N+ ++S+FYD A  VG+I     S   +P  FL
Sbjct  303   LKINAPCKHKKCTFNGVWNGGGGDGQKNLYVASFFYDRASQVGVIKTNVPSATARPLHFL  362

Query  1114  VAAKLACETKFEDVKSTFPNAVEKDYPYLCMDLVYQYTLLVDGLGLHPYKEITLMKKVEY  1293
              AAK AC TK++D+KS FPN  E D P+ C+DLVY+Y+LLV+G GL+P+K+ITL+KK++Y
Sbjct  363   SAAKRACRTKYKDIKSVFPNINESDRPFTCLDLVYEYSLLVNGFGLNPFKKITLVKKIKY  422

Query  1294  KNYMVEAAWPLGCAIDVISSSS  1359
             K+ ++E AWPLG AID +SS +
Sbjct  423   KDSLLETAWPLGSAIDAVSSQN  444



>ref|XP_011089773.1| PREDICTED: apyrase 2-like [Sesamum indicum]
Length=466

 Score =   487 bits (1253),  Expect = 3e-164, Method: Compositional matrix adjust.
 Identities = 237/433 (55%), Positives = 310/433 (72%), Gaps = 1/433 (0%)
 Frame = +1

Query  58    LVFISLALLLFPLACFSRSHLRRVLLNHEAGNYAVIFDAGSTGSRVHVFHFDENLDLLPV  237
             L+ IS  L L P +  S S  R+   +  +  YAVIFDAGS+GSRVHVF F++ LDL+P+
Sbjct  32    LLLISFVLFLMPASSPSDSISRKFSPDFLSKRYAVIFDAGSSGSRVHVFCFNQQLDLVPM  91

Query  238   GDGVEFFLKITPGLSSYADDPEAAAKSLEPLLLEAEGVVPTELQPDTPLELGATAGLRLL  417
             G  +E FL+  PGLS YA DPEAAA SL  LL +A+  VP EL+ +TP+ +GATAGLR L
Sbjct  92    GQDLELFLQRKPGLSGYAKDPEAAANSLSDLLEKAQAAVPKELRYNTPVRVGATAGLRQL  151

Query  418   EGDASDKILQAVRDMFKNESNFKSKAEWVSILEGSQEGTYFWVAMNYLLGNLGKGYQNTI  597
             EGD SD+ILQAVRD  KN+S+ KS+A+WV++L+G+QEG Y WV +NYLLGNLGK Y +T+
Sbjct  152   EGDTSDRILQAVRDFLKNKSSLKSQADWVTVLDGNQEGAYQWVTINYLLGNLGKKYSSTV  211

Query  598   ATIDLGGGSVQVSYAVSGDTFANAPKPHNGEEPYVQEKYILGAQYYLYVHSYLNYGQLAS  777
               +DLGGGSVQ++YA+S    A AP   +GE+ YVQ+ Y+ G +Y+LYVHSYL+YG LA+
Sbjct  212   GVVDLGGGSVQMAYAISESDAAKAPMLSDGEDSYVQQMYLKGRKYHLYVHSYLHYGLLAA  271

Query  778   RAEIFKASGNSTNPCVLEGYDGYYTYNDVSYKVTAPPNGSSLKNCRKLARKVVDF-RAPC  954
             RAEI K      NPC+L GY+G Y Y    Y+ +A P+GSSL  CR++A K +    + C
Sbjct  272   RAEILKVDQEDDNPCILAGYNGSYKYGQAVYRASALPSGSSLSKCREVAIKALKINESSC  331

Query  955   KYPNCTFNGVWSGGGGAGMENVDISSYFYDIAIDVGIIDEGKASKIVKPRSFLVAAKLAC  1134
              +  CTF  VW+GGGG G +N+ ++S+F+D A + G ID   A   V P  F  AAK AC
Sbjct  332   THMKCTFGDVWNGGGGDGQKNLFVASFFFDRAAEAGFIDPNLAVAKVHPADFEDAAKRAC  391

Query  1135  ETKFEDVKSTFPNAVEKDYPYLCMDLVYQYTLLVDGLGLHPYKEITLMKKVEYKNYMVEA  1314
             +T  ED  S FP+   ++ PYLCMDLVYQ+TLLVDG GL P++EITL+KKV+Y+N +VEA
Sbjct  392   QTSLEDGSSAFPHVEPENLPYLCMDLVYQFTLLVDGFGLDPWQEITLVKKVKYQNSLVEA  451

Query  1315  AWPLGCAIDVISS  1353
             AWPLG AI+V+SS
Sbjct  452   AWPLGSAIEVVSS  464



>emb|CDP04086.1| unnamed protein product [Coffea canephora]
Length=476

 Score =   487 bits (1253),  Expect = 4e-164, Method: Compositional matrix adjust.
 Identities = 232/417 (56%), Positives = 308/417 (74%), Gaps = 0/417 (0%)
 Frame = +1

Query  103   FSRSHLRRVLLNHEAGNYAVIFDAGSTGSRVHVFHFDENLDLLPVGDGVEFFLKITPGLS  282
             FS +    ++L   +  Y VIFDAGSTGSRVHV+ FD +++LL +GD  E+F K TPGLS
Sbjct  41    FSLNGFLNLVLGEGSEQYVVIFDAGSTGSRVHVYRFDSDMNLLKIGDDFEYFEKTTPGLS  100

Query  283   SYADDPEAAAKSLEPLLLEAEGVVPTELQPDTPLELGATAGLRLLEGDASDKILQAVRDM  462
             SYADDP AAA+SL+ LL  AE +VP EL+ +TP+ +GATAGLR L GDA++ IL+AVRD+
Sbjct  101   SYADDPTAAAQSLKTLLENAEAIVPEELRANTPVLVGATAGLRQLNGDAAENILEAVRDL  160

Query  463   FKNESNFKSKAEWVSILEGSQEGTYFWVAMNYLLGNLGKGYQNTIATIDLGGGSVQVSYA  642
              KNES+FK KAEWV+IL+GSQE  Y W A+NYLLG++GK Y  T+ ++DLGGGSV+++YA
Sbjct  161   LKNESSFKYKAEWVTILDGSQEAAYAWAAINYLLGSIGKNYSETVGSVDLGGGSVEMTYA  220

Query  643   VSGDTFANAPKPHNGEEPYVQEKYILGAQYYLYVHSYLNYGQLASRAEIFKASGNSTNPC  822
             VS  T A A    N  EPY+ E   LG  YYLY +SYLNYG LA+RAEI K S NS+NPC
Sbjct  221   VSETTAAQASNISNNGEPYIHENNFLGTTYYLYAYSYLNYGLLAARAEILKLSRNSSNPC  280

Query  823   VLEGYDGYYTYNDVSYKVTAPPNGSSLKNCRKLARKVVDFRAPCKYPNCTFNGVWSGGGG  1002
             +L GYDGYYTY DV Y+ +A P G ++K C    +K ++  APC++ NCTFNGVW+GGGG
Sbjct  281   ILYGYDGYYTYEDVVYRASALPTGPNIKQCWGFVKKALNISAPCQHKNCTFNGVWNGGGG  340

Query  1003  AGMENVDISSYFYDIAIDVGIIDEGKASKIVKPRSFLVAAKLACETKFEDVKSTFPNAVE  1182
              G +N+ ++S+FYDI  +VGI +    S  V+P  +L  A  AC TK+ED++S FPN  E
Sbjct  341   DGQKNLYVASFFYDIGSEVGIFEPNAPSATVRPADYLSVANRACATKYEDIQSVFPNIYE  400

Query  1183  KDYPYLCMDLVYQYTLLVDGLGLHPYKEITLMKKVEYKNYMVEAAWPLGCAIDVISS  1353
              D P +CMDL+Y YTLLV+G G++P+K+IT+++ +EYK+ +V+A W LG AI+ +SS
Sbjct  401   ADKPVICMDLIYMYTLLVNGFGVNPFKKITVVQSIEYKDSLVDATWSLGSAINAVSS  457



>ref|XP_003548772.1| PREDICTED: nucleoside-triphosphatase-like [Glycine max]
 gb|KHN46800.1| Nucleoside-triphosphatase [Glycine soja]
Length=468

 Score =   484 bits (1246),  Expect = 3e-163, Method: Compositional matrix adjust.
 Identities = 227/412 (55%), Positives = 304/412 (74%), Gaps = 1/412 (0%)
 Frame = +1

Query  121   RRVLLNHEA-GNYAVIFDAGSTGSRVHVFHFDENLDLLPVGDGVEFFLKITPGLSSYADD  297
             R++    EA  +YAVIFDAGSTGSRVHVFHFD+NLDLL +G+ +EF+ K+TPGLS+YAD+
Sbjct  46    RKIFPKQEAITSYAVIFDAGSTGSRVHVFHFDQNLDLLRIGNELEFYDKVTPGLSAYADN  105

Query  298   PEAAAKSLEPLLLEAEGVVPTELQPDTPLELGATAGLRLLEGDASDKILQAVRDMFKNES  477
             P+ AA+SL PLL EAE VVP +L P TP++LGATAGLRLLEGDAS++ILQAVRD+ KN S
Sbjct  106   PQQAAESLIPLLEEAESVVPEDLYPTTPVKLGATAGLRLLEGDASERILQAVRDLLKNRS  165

Query  478   NFKSKAEWVSILEGSQEGTYFWVAMNYLLGNLGKGYQNTIATIDLGGGSVQVSYAVSGDT  657
                ++ + V+I++G+QEG+Y WV +NYLLG LGK +  T+  +DLGGGSVQ++YA+S +T
Sbjct  166   TLNTQPDAVAIIDGTQEGSYLWVTINYLLGKLGKRFSKTVGVVDLGGGSVQMAYAISRNT  225

Query  658   FANAPKPHNGEEPYVQEKYILGAQYYLYVHSYLNYGQLASRAEIFKASGNSTNPCVLEGY  837
               NAPKP +GEEPY+++  + G +Y LYVHSYL+YG+ ASRAEI K +  S NPC+L G+
Sbjct  226   AKNAPKPPDGEEPYIKKLVLKGKEYDLYVHSYLHYGREASRAEILKVTDGSANPCILAGF  285

Query  838   DGYYTYNDVSYKVTAPPNGSSLKNCRKLARKVVDFRAPCKYPNCTFNGVWSGGGGAGMEN  1017
             DG YTY+   YK  AP +GSS   CR++  + +     C + NCTF G+W GG G+G + 
Sbjct  286   DGTYTYSGADYKAFAPISGSSYDECREVVLQALKLNESCPHQNCTFGGIWDGGRGSGQKI  345

Query  1018  VDISSYFYDIAIDVGIIDEGKASKIVKPRSFLVAAKLACETKFEDVKSTFPNAVEKDYPY  1197
             +  +S FY +  ++GIID  K +  + P    + AK ACETK ED KST+PN  E   PY
Sbjct  346   LFGTSSFYYLPTEIGIIDLNKPNSKIHPVDLEIEAKRACETKLEDAKSTYPNLAEDRLPY  405

Query  1198  LCMDLVYQYTLLVDGLGLHPYKEITLMKKVEYKNYMVEAAWPLGCAIDVISS  1353
             +C+D+ YQY L  DG GL P++EIT+  ++EY++ +VEAAWPLG AI+ ISS
Sbjct  406   VCLDIAYQYALYTDGFGLDPWQEITVANEIEYQDALVEAAWPLGTAIEAISS  457



>gb|AAG32960.1|AF207688_1 apyrase GS52 [Glycine soja]
Length=468

 Score =   483 bits (1243),  Expect = 1e-162, Method: Compositional matrix adjust.
 Identities = 227/412 (55%), Positives = 303/412 (74%), Gaps = 1/412 (0%)
 Frame = +1

Query  121   RRVLLNHEA-GNYAVIFDAGSTGSRVHVFHFDENLDLLPVGDGVEFFLKITPGLSSYADD  297
             R++    EA  +YAVIFDAGSTGSRVHVFHFD+NLDLL +G+ +EF+ K+TPGLS+YAD+
Sbjct  46    RKIFPKQEAITSYAVIFDAGSTGSRVHVFHFDQNLDLLRIGNELEFYDKVTPGLSAYADN  105

Query  298   PEAAAKSLEPLLLEAEGVVPTELQPDTPLELGATAGLRLLEGDASDKILQAVRDMFKNES  477
             P+ AA+SL PLL EAE VVP +L P TP++LGATAGLRLLEGDAS++ILQAVRD+ KN S
Sbjct  106   PQQAAESLIPLLEEAESVVPEDLYPTTPVKLGATAGLRLLEGDASERILQAVRDLLKNRS  165

Query  478   NFKSKAEWVSILEGSQEGTYFWVAMNYLLGNLGKGYQNTIATIDLGGGSVQVSYAVSGDT  657
                ++ + V+I++G+QEG+Y WV +NYLLG LGK +  T+  +DLGGGSVQ++YA+S +T
Sbjct  166   TLNAQPDAVAIIDGTQEGSYLWVTINYLLGKLGKRFSKTVGVVDLGGGSVQMAYAISRNT  225

Query  658   FANAPKPHNGEEPYVQEKYILGAQYYLYVHSYLNYGQLASRAEIFKASGNSTNPCVLEGY  837
               NAPKP +GEEPY+++  + G +Y LYVHSYL+YG+ ASRAEI K +  S NPC+L GY
Sbjct  226   AKNAPKPPDGEEPYIKKLVLKGKEYDLYVHSYLHYGREASRAEILKVTDGSANPCILAGY  285

Query  838   DGYYTYNDVSYKVTAPPNGSSLKNCRKLARKVVDFRAPCKYPNCTFNGVWSGGGGAGMEN  1017
             DG YTY+   YK  AP +GSS   CR++  + +     C + NCTF G+W GG G+G + 
Sbjct  286   DGTYTYSGADYKAFAPISGSSYDECREVVLQALKLNESCPHQNCTFGGIWDGGRGSGQKI  345

Query  1018  VDISSYFYDIAIDVGIIDEGKASKIVKPRSFLVAAKLACETKFEDVKSTFPNAVEKDYPY  1197
             +  +S FY +  ++GIID  K +  + P    + AK ACETK ED KST+PN  E   PY
Sbjct  346   LFGTSSFYYLPTEIGIIDLNKPNSKIHPVDLEIEAKRACETKLEDAKSTYPNPAEDRLPY  405

Query  1198  LCMDLVYQYTLLVDGLGLHPYKEITLMKKVEYKNYMVEAAWPLGCAIDVISS  1353
             +C+D+ YQY L  DG  L P++EIT+  ++EY++ +VEAAWPLG AI+ ISS
Sbjct  406   VCLDIAYQYALYTDGFSLDPWQEITVANEIEYQDALVEAAWPLGTAIEAISS  457



>ref|XP_003548774.1| PREDICTED: nucleoside-triphosphatase-like [Glycine max]
Length=459

 Score =   473 bits (1216),  Expect = 8e-159, Method: Compositional matrix adjust.
 Identities = 240/449 (53%), Positives = 314/449 (70%), Gaps = 10/449 (2%)
 Frame = +1

Query  34    MKHTSHHHLVFISLALLLFPLACFSRSHLRRVLLNHEA---------GNYAVIFDAGSTG  186
             M   + + L F+++ L + P A  S  +L   LL H            +YAVIFD GSTG
Sbjct  1     MTKNNMNFLTFVTVLLFILP-ATSSSQYLGNNLLTHRKIFLKKDNIITSYAVIFDGGSTG  59

Query  187   SRVHVFHFDENLDLLPVGDGVEFFLKITPGLSSYADDPEAAAKSLEPLLLEAEGVVPTEL  366
             +RVHVFHFD+NLDLLP+GD +E   KITPGLS+Y DDPE AA+SL PLL EAE VVP +L
Sbjct  60    TRVHVFHFDQNLDLLPIGDSLELNKKITPGLSAYEDDPEQAAESLIPLLEEAESVVPEDL  119

Query  367   QPDTPLELGATAGLRLLEGDASDKILQAVRDMFKNESNFKSKAEWVSILEGSQEGTYFWV  546
             +P+TP+ LGATAGLRLL+G+AS++ILQAVRDM  N S    +++ V+IL+G+QE  Y WV
Sbjct  120   RPNTPVRLGATAGLRLLKGNASEQILQAVRDMLSNRSTLNLQSDAVTILDGNQEAAYMWV  179

Query  547   AMNYLLGNLGKGYQNTIATIDLGGGSVQVSYAVSGDTFANAPKPHNGEEPYVQEKYILGA  726
             A+NYLLGNLGK    T+   DLGGGSVQ++YAVS +T  NAP+P  GEE Y++   + G 
Sbjct  180   ALNYLLGNLGKVISKTVGVADLGGGSVQMAYAVSKNTAKNAPQPPEGEESYIKTLVLNGK  239

Query  727   QYYLYVHSYLNYGQLASRAEIFKASGNSTNPCVLEGYDGYYTYNDVSYKVTAPPNGSSLK  906
              Y LYVHSYL++G+ ASRAE+ K +G+S NPC+L GY+G YTY+ V YK  A  +GS+  
Sbjct  240   TYDLYVHSYLHFGKEASRAEMLKVTGDSANPCILAGYNGTYTYSGVKYKALASTSGSNFD  299

Query  907   NCRKLARKVVDFRAPCKYPNCTFNGVWSGGGGAGMENVDISSYFYDIAIDVGIIDEGKAS  1086
              CR++A K +    PC + NCTF G+W+GGGG+G + + +++ FY + I  GI D  K S
Sbjct  300   KCREVALKALKVNEPCPHQNCTFGGIWNGGGGSGQKVLYVTTSFYYLVIQAGIADASKTS  359

Query  1087  KIVKPRSFLVAAKLACETKFEDVKSTFPNAVEKDYPYLCMDLVYQYTLLVDGLGLHPYKE  1266
               V P  F  AAK AC+ KFED +ST+P  +E   PY+CMD+ YQYTLLVDG GL P+KE
Sbjct  360   SKVYPAEFKAAAKRACQVKFEDAQSTYPLMMEDALPYICMDITYQYTLLVDGFGLDPWKE  419

Query  1267  ITLMKKVEYKNYMVEAAWPLGCAIDVISS  1353
             I +  ++EY+  +VE AWPLG AI+ ISS
Sbjct  420   IIVANEIEYQGALVEGAWPLGSAIEAISS  448



>ref|XP_007161810.1| hypothetical protein PHAVU_001G100100g [Phaseolus vulgaris]
 gb|ESW33804.1| hypothetical protein PHAVU_001G100100g [Phaseolus vulgaris]
Length=454

 Score =   468 bits (1204),  Expect = 4e-157, Method: Compositional matrix adjust.
 Identities = 225/413 (54%), Positives = 295/413 (71%), Gaps = 2/413 (0%)
 Frame = +1

Query  121   RRVLLNHEAG--NYAVIFDAGSTGSRVHVFHFDENLDLLPVGDGVEFFLKITPGLSSYAD  294
             R++    E    +YA IFDAGSTGSRVHVFHFD+NLDLL +G+ +EF  ++TPGLSSYAD
Sbjct  31    RKIFPKQEEAITSYAAIFDAGSTGSRVHVFHFDQNLDLLYIGNNLEFHQRVTPGLSSYAD  90

Query  295   DPEAAAKSLEPLLLEAEGVVPTELQPDTPLELGATAGLRLLEGDASDKILQAVRDMFKNE  474
              PE AA+SL PLL  AE VVP +L   TPL+LGATAGLRLLEG+A++ IL AVRDMFKN 
Sbjct  91    KPEKAAQSLIPLLEAAENVVPQDLHFKTPLKLGATAGLRLLEGNAAENILNAVRDMFKNR  150

Query  475   SNFKSKAEWVSILEGSQEGTYFWVAMNYLLGNLGKGYQNTIATIDLGGGSVQVSYAVSGD  654
             S    +++ V+I++G+QEG+Y W+A+NYLLG LGK +  T+  +DLGGGSVQ++YAVS +
Sbjct  151   STLNVQSDAVAIIDGTQEGSYLWLAVNYLLGRLGKKFSKTVGVVDLGGGSVQMAYAVSRN  210

Query  655   TFANAPKPHNGEEPYVQEKYILGAQYYLYVHSYLNYGQLASRAEIFKASGNSTNPCVLEG  834
             T  NAP   +GE+PY+++ Y  G  Y LYVHSYL+YG  ASRAEI K S  S NPC+L G
Sbjct  211   TAKNAPLVPDGEDPYIKKLYAKGKNYDLYVHSYLHYGTEASRAEILKVSDGSANPCILAG  270

Query  835   YDGYYTYNDVSYKVTAPPNGSSLKNCRKLARKVVDFRAPCKYPNCTFNGVWSGGGGAGME  1014
             YDG YTY++V Y V  P +GSS   CR++  K +    PC   NCTF G+W GG G+G  
Sbjct  271   YDGNYTYSEVEYAVYPPSSGSSYDACREIVLKALKLNEPCSRHNCTFGGIWDGGRGSGQR  330

Query  1015  NVDISSYFYDIAIDVGIIDEGKASKIVKPRSFLVAAKLACETKFEDVKSTFPNAVEKDYP  1194
              +  +S FY + +DVG+ID    + +V+       AK AC   FE+ KS++P+  ++  P
Sbjct  331   TIYATSSFYYLPLDVGLIDAKAHNAVVRVVDLENLAKRACGKTFEEAKSSYPHLSKERVP  390

Query  1195  YLCMDLVYQYTLLVDGLGLHPYKEITLMKKVEYKNYMVEAAWPLGCAIDVISS  1353
             ++CMD+ YQYTLLVDG G+ P +EITL K++EYK+ +VE AWPLG AI+ ISS
Sbjct  391   FVCMDIAYQYTLLVDGFGIDPLQEITLAKEIEYKDAIVETAWPLGTAIEAISS  443



>ref|XP_004493131.1| PREDICTED: apyrase 2-like isoform X1 [Cicer arietinum]
Length=469

 Score =   467 bits (1202),  Expect = 1e-156, Method: Compositional matrix adjust.
 Identities = 234/440 (53%), Positives = 316/440 (72%), Gaps = 8/440 (2%)
 Frame = +1

Query  58    LVFISLALLLFPLACFSRSHLRRVLLNHE-------AGNYAVIFDAGSTGSRVHVFHFDE  216
             L+ I+  L + P +    S     L+N +          YAVIFDAGS+GSRVHVFHFD+
Sbjct  29    LLLITFVLYMMPSSSSYESAGDYALVNRKISPDKKSGSTYAVIFDAGSSGSRVHVFHFDQ  88

Query  217   NLDLLPVGDGVEFFLKITPGLSSYADDPEAAAKSLEPLLLEAEGVVPTELQPDTPLELGA  396
             NLDL+ +G  +E F +  PGLS+YA +P+ AA+SL  LL +AE VVP EL+  TP+ +GA
Sbjct  89    NLDLVHIGKDLELFEQTKPGLSAYAQNPQQAAESLVSLLEKAESVVPRELRSKTPVRVGA  148

Query  397   TAGLRLLEGDASDKILQAVRDMFKNESNFKSKAEWVSILEGSQEGTYFWVAMNYLLGNLG  576
             TAGLR LEGDASD+ILQAVRD+ K  S  +S+A+ V++L+G+QEG + WV +NYLLGNLG
Sbjct  149   TAGLRALEGDASDRILQAVRDLLKKRSTLRSEADAVTVLDGTQEGAFQWVTINYLLGNLG  208

Query  577   KGYQNTIATIDLGGGSVQVSYAVSGDTFANAPKPHNGEEPYVQEKYILGAQYYLYVHSYL  756
             K Y  T+  +DLGGGSVQ++YA+S    A APK  +GE+PYV+E ++ G +YYLYVHSYL
Sbjct  209   KDYSKTVGVVDLGGGSVQMAYAISESDAAMAPKVTDGEDPYVKEMFLRGRKYYLYVHSYL  268

Query  757   NYGQLASRAEIFKASGNSTNPCVLEGYDGYYTYNDVSYKVTAPPNGSSLKNCRKLARKVV  936
              YG LA+RAEI KASG++ NPC+L GYDG Y Y   S+K ++ P+G+SL  C+ +A K +
Sbjct  269   RYGLLAARAEILKASGDAENPCILSGYDGSYNYGGKSFKASSSPSGASLNECKSVALKAL  328

Query  937   DF-RAPCKYPNCTFNGVWSGGGGAGMENVDISSYFYDIAIDVGIIDEGKASKIVKPRSFL  1113
                 + C +  CTF G+W+GGGG G +N+ ++S+F+D A + G  +      IV+P  F 
Sbjct  329   KVNESTCTHMKCTFGGIWNGGGGDGQKNLFVASFFFDRAAEAGFANPNSPVAIVRPADFE  388

Query  1114  VAAKLACETKFEDVKSTFPNAVEKDYPYLCMDLVYQYTLLVDGLGLHPYKEITLMKKVEY  1293
              AAK AC+TK E+ KST+P   E + PYLCMDLVYQYTLLVDG G++P++EITL+KKV+Y
Sbjct  389   DAAKQACQTKLENAKSTYPRVEEGNLPYLCMDLVYQYTLLVDGFGIYPWQEITLVKKVKY  448

Query  1294  KNYMVEAAWPLGCAIDVISS  1353
             ++ +VEAAWPLG AI+ +SS
Sbjct  449   EDALVEAAWPLGSAIEAVSS  468



>dbj|BAK78981.1| apyrase [Mimosa pudica]
Length=470

 Score =   467 bits (1202),  Expect = 1e-156, Method: Compositional matrix adjust.
 Identities = 237/440 (54%), Positives = 314/440 (71%), Gaps = 8/440 (2%)
 Frame = +1

Query  58    LVFISLALLLFP-------LACFSRSHLRRVLLNHEAGNYAVIFDAGSTGSRVHVFHFDE  216
             L+ I+  L L P       +  ++ +H +   +N  + +YAVIFDAGS+GSRVHVFHFD+
Sbjct  30    LLLITFVLYLMPASYSNESVEDYALTHRKMAPINKLSNSYAVIFDAGSSGSRVHVFHFDQ  89

Query  217   NLDLLPVGDGVEFFLKITPGLSSYADDPEAAAKSLEPLLLEAEGVVPTELQPDTPLELGA  396
             NLDL+ +   +E FL+I PGLS+YA DP  AA+SL  LL +AE VVP EL+  TP+ +GA
Sbjct  90    NLDLVSIDGELELFLQIKPGLSAYAQDPRQAAESLVSLLDKAESVVPRELRSKTPVRVGA  149

Query  397   TAGLRLLEGDASDKILQAVRDMFKNESNFKSKAEWVSILEGSQEGTYFWVAMNYLLGNLG  576
             TAGLR LEGDASDKILQAVRD+ K+ S  K++A+ V++L+G+QEG Y WV +NYLLGNLG
Sbjct  150   TAGLRALEGDASDKILQAVRDLLKDRSLLKAEADAVTVLDGAQEGVYQWVTINYLLGNLG  209

Query  577   KGYQNTIATIDLGGGSVQVSYAVSGDTFANAPKPHNGEEPYVQEKYILGAQYYLYVHSYL  756
             K Y  T+  +DLGGGSVQ++YA+S      APK  +G +PYV+E ++ G +YY+YVHSYL
Sbjct  210   KDYSKTVGVVDLGGGSVQMAYAISETDADKAPKSLDGADPYVKEMFLRGRKYYVYVHSYL  269

Query  757   NYGQLASRAEIFKASGNSTNPCVLEGYDGYYTYNDVSYKVTAPPNGSSLKNCRKLARKVV  936
              YG LA+RAEI K SG+S NPC+L GYDG+Y Y   S+K +A P+G+SL  CR  A + +
Sbjct  270   RYGLLAARAEILKVSGDSENPCILAGYDGFYKYGGRSFKASAYPSGASLSECRSTALQAL  329

Query  937   DF-RAPCKYPNCTFNGVWSGGGGAGMENVDISSYFYDIAIDVGIIDEGKASKIVKPRSFL  1113
                 + C Y  CTF G+W+GGGG G EN+ ++S+F+D A + G +D    +  V+P +F 
Sbjct  330   RANESSCTYMKCTFGGIWNGGGGDGQENLFVASFFFDRAAEAGFVDSKLPTATVRPVNFK  389

Query  1114  VAAKLACETKFEDVKSTFPNAVEKDYPYLCMDLVYQYTLLVDGLGLHPYKEITLMKKVEY  1293
              AAK ACE   ED KST+ +  E + PYLCMDLVYQYTLLVDG GL P +EITL+K+V+Y
Sbjct  390   EAAKRACEKNIEDAKSTYKHVDEGNLPYLCMDLVYQYTLLVDGFGLDPQQEITLVKQVKY  449

Query  1294  KNYMVEAAWPLGCAIDVISS  1353
                +VEAAWPLG AI+ +SS
Sbjct  450   NGALVEAAWPLGSAIEAVSS  469



>ref|XP_006443349.1| hypothetical protein CICLE_v10019963mg [Citrus clementina]
 ref|XP_006479048.1| PREDICTED: apyrase 2-like [Citrus sinensis]
 gb|ESR56589.1| hypothetical protein CICLE_v10019963mg [Citrus clementina]
Length=477

 Score =   468 bits (1203),  Expect = 1e-156, Method: Compositional matrix adjust.
 Identities = 229/407 (56%), Positives = 304/407 (75%), Gaps = 0/407 (0%)
 Frame = +1

Query  151   NYAVIFDAGSTGSRVHVFHFDENLDLLPVGDGVEFFLKITPGLSSYADDPEAAAKSLEPL  330
             +YAVIFDAGS+GSRVHV+ FD+NLDL+P+G  +E F++  PGLS+YA DP+AAA SL  L
Sbjct  69    SYAVIFDAGSSGSRVHVYCFDQNLDLVPIGKDLELFVQTKPGLSAYASDPQAAANSLASL  128

Query  331   LLEAEGVVPTELQPDTPLELGATAGLRLLEGDASDKILQAVRDMFKNESNFKSKAEWVSI  510
             L +A+ VVP +L+P TP+++GATAGLR L  DASD+ILQAVRD+ K +S FKSK EWV++
Sbjct  129   LDKAQSVVPQDLRPKTPVKVGATAGLRQLGVDASDRILQAVRDLLKYKSAFKSKPEWVTV  188

Query  511   LEGSQEGTYFWVAMNYLLGNLGKGYQNTIATIDLGGGSVQVSYAVSGDTFANAPKPHNGE  690
             L+GSQEG+Y WV +NYLLGNLGK Y NT+  +DLGGGSVQ++YA+S    ANAP    GE
Sbjct  189   LDGSQEGSYQWVTINYLLGNLGKKYSNTVGVVDLGGGSVQMAYAISEKDAANAPTVPEGE  248

Query  691   EPYVQEKYILGAQYYLYVHSYLNYGQLASRAEIFKASGNSTNPCVLEGYDGYYTYNDVSY  870
             + YV E Y++G +YYLYVHSYL+YG LA+R EI K + +S NPC+L GYDG Y Y    Y
Sbjct  249   DQYVNEMYLMGTKYYLYVHSYLHYGLLAARTEILKVTKDSDNPCILAGYDGSYKYGGQEY  308

Query  871   KVTAPPNGSSLKNCRKLARKVVDFRAPCKYPNCTFNGVWSGGGGAGMENVDISSYFYDIA  1050
             K +A P+GS+++ C+ +A K +     C +  CTF GVW+GGGG G +N+ ++S+F+D A
Sbjct  309   KASASPSGSNIEECQSVAIKALKVNDTCTHMQCTFGGVWNGGGGDGQKNMFVASFFFDRA  368

Query  1051  IDVGIIDEGKASKIVKPRSFLVAAKLACETKFEDVKSTFPNAVEKDYPYLCMDLVYQYTL  1230
              + G ID+ +    V+P  F  AAK AC+TK ED KS +P   E + PY+CMDLVYQ+ L
Sbjct  369   AEAGFIDQNEPVAKVRPGDFESAAKRACQTKLEDAKSIYPRVDESNLPYICMDLVYQHAL  428

Query  1231  LVDGLGLHPYKEITLMKKVEYKNYMVEAAWPLGCAIDVISSSSANNL  1371
             LV G GL P++EITL+K+++Y+N +VEAAWPLG AI+ ISS   N +
Sbjct  429   LVVGFGLDPWQEITLVKQIKYQNSLVEAAWPLGSAIEAISSLGLNQV  475



>gb|KDO45540.1| hypothetical protein CISIN_1g048388mg [Citrus sinensis]
Length=477

 Score =   467 bits (1202),  Expect = 2e-156, Method: Compositional matrix adjust.
 Identities = 229/407 (56%), Positives = 304/407 (75%), Gaps = 0/407 (0%)
 Frame = +1

Query  151   NYAVIFDAGSTGSRVHVFHFDENLDLLPVGDGVEFFLKITPGLSSYADDPEAAAKSLEPL  330
             +YAVIFDAGS+GSRVHV+ FD+NLDL+P+G  +E F++  PGLS+YA DP+AAA SL  L
Sbjct  69    SYAVIFDAGSSGSRVHVYCFDQNLDLVPIGKDLELFVQTKPGLSAYASDPQAAANSLASL  128

Query  331   LLEAEGVVPTELQPDTPLELGATAGLRLLEGDASDKILQAVRDMFKNESNFKSKAEWVSI  510
             L +A+ VVP +L+P TP+++GATAGLR L  DASD+ILQAVRD+ K +S FKSK EWV++
Sbjct  129   LDKAQSVVPQDLRPKTPVKVGATAGLRQLGVDASDRILQAVRDLLKYKSAFKSKPEWVTV  188

Query  511   LEGSQEGTYFWVAMNYLLGNLGKGYQNTIATIDLGGGSVQVSYAVSGDTFANAPKPHNGE  690
             L+GSQEG+Y WV +NYLLGNLGK Y NT+  +DLGGGSVQ++YA+S    ANAP    GE
Sbjct  189   LDGSQEGSYQWVTINYLLGNLGKKYSNTVGVVDLGGGSVQMAYAISEKDAANAPTVPEGE  248

Query  691   EPYVQEKYILGAQYYLYVHSYLNYGQLASRAEIFKASGNSTNPCVLEGYDGYYTYNDVSY  870
             + YV E Y++G +YYLYVHSYL+YG LA+R EI K + +S NPC+L GYDG Y Y    Y
Sbjct  249   DQYVNEMYLMGTKYYLYVHSYLHYGLLAARTEILKVTKDSDNPCILAGYDGSYKYGGEEY  308

Query  871   KVTAPPNGSSLKNCRKLARKVVDFRAPCKYPNCTFNGVWSGGGGAGMENVDISSYFYDIA  1050
             K +A P+GS+++ C+ +A K +     C +  CTF GVW+GGGG G +N+ ++S+F+D A
Sbjct  309   KASASPSGSNIEECQSVAIKALKVNDTCTHMQCTFGGVWNGGGGDGQKNMFVASFFFDRA  368

Query  1051  IDVGIIDEGKASKIVKPRSFLVAAKLACETKFEDVKSTFPNAVEKDYPYLCMDLVYQYTL  1230
              + G ID+ +    V+P  F  AAK AC+TK ED KS +P   E + PY+CMDLVYQ+ L
Sbjct  369   AEAGFIDQNEPVAKVRPGDFESAAKRACQTKLEDAKSIYPRVDESNLPYICMDLVYQHAL  428

Query  1231  LVDGLGLHPYKEITLMKKVEYKNYMVEAAWPLGCAIDVISSSSANNL  1371
             LV G GL P++EITL+K+++Y+N +VEAAWPLG AI+ ISS   N +
Sbjct  429   LVVGFGLDPWQEITLVKQIKYQNSLVEAAWPLGSAIEAISSLGLNQV  475



>gb|AAF00610.1|AF156781_1 apyrase [Vigna unguiculata subsp. cylindrica]
Length=467

 Score =   466 bits (1199),  Expect = 4e-156, Method: Compositional matrix adjust.
 Identities = 227/401 (57%), Positives = 302/401 (75%), Gaps = 0/401 (0%)
 Frame = +1

Query  151   NYAVIFDAGSTGSRVHVFHFDENLDLLPVGDGVEFFLKITPGLSSYADDPEAAAKSLEPL  330
             +YAVIFDAGSTGSRVHV+ F++ LDLL +G  +E F+K  PGLS+YA++PE AA+SL PL
Sbjct  56    SYAVIFDAGSTGSRVHVYRFNQQLDLLRIGHDLELFVKTKPGLSAYAENPEEAAESLVPL  115

Query  331   LLEAEGVVPTELQPDTPLELGATAGLRLLEGDASDKILQAVRDMFKNESNFKSKAEWVSI  510
             L EAE V+P EL P TP+++GATAGLR LEGDAS++ILQAV DM K  S  K + + VS+
Sbjct  116   LEEAEAVIPQELHPRTPVKVGATAGLRQLEGDASNRILQAVSDMLKKRSTLKVEGDAVSV  175

Query  511   LEGSQEGTYFWVAMNYLLGNLGKGYQNTIATIDLGGGSVQVSYAVSGDTFANAPKPHNGE  690
             L G+QEG Y WV +NYLLGNLGK Y  T+A +DLGGGSVQ++YA+S +  A AP+  +G 
Sbjct  176   LSGNQEGAYQWVTINYLLGNLGKHYSKTVAVVDLGGGSVQMAYAISEEDAAKAPQVPDGV  235

Query  691   EPYVQEKYILGAQYYLYVHSYLNYGQLASRAEIFKASGNSTNPCVLEGYDGYYTYNDVSY  870
             E Y+ E ++ G +YYLYVHSYL YG LA+RAE+ K S +S NPC+L G+DGYYTY  V Y
Sbjct  236   ESYITEMFLRGKKYYLYVHSYLRYGLLAARAEVLKVSRDSENPCILSGFDGYYTYGGVQY  295

Query  871   KVTAPPNGSSLKNCRKLARKVVDFRAPCKYPNCTFNGVWSGGGGAGMENVDISSYFYDIA  1050
             K TAPP+GSS   C+ +  + +   A C Y +CTF G+W+GGGGAG  N  ++S+F+++A
Sbjct  296   KATAPPSGSSFSKCQNVVLEALHVNATCSYKDCTFGGIWNGGGGAGENNFFVASFFFEVA  355

Query  1051  IDVGIIDEGKASKIVKPRSFLVAAKLACETKFEDVKSTFPNAVEKDYPYLCMDLVYQYTL  1230
              + G +D   A+ IV+P  F  AAK+AC T+ +D+KS FP   + D PY+C+DLVYQYTL
Sbjct  356   DEAGFVDPNDANAIVRPVDFEDAAKVACSTELKDLKSVFPRVKDGDVPYICLDLVYQYTL  415

Query  1231  LVDGLGLHPYKEITLMKKVEYKNYMVEAAWPLGCAIDVISS  1353
             LVDG G+ P +EITL+++++Y++ +VEAAWPLG AI+ ISS
Sbjct  416   LVDGFGIDPQQEITLVRQIQYQDSLVEAAWPLGSAIEAISS  456



>dbj|BAK78982.1| apyrase [Mimosa pudica]
Length=470

 Score =   466 bits (1198),  Expect = 5e-156, Method: Compositional matrix adjust.
 Identities = 236/440 (54%), Positives = 314/440 (71%), Gaps = 8/440 (2%)
 Frame = +1

Query  58    LVFISLALLLFP-------LACFSRSHLRRVLLNHEAGNYAVIFDAGSTGSRVHVFHFDE  216
             L+ I+  L L P       +  ++ +H +   +N  + +YAVIFDAGS+GSRVHVFHFD+
Sbjct  30    LLLITFVLYLMPASYSNESVEDYALTHRKMAPINKLSNSYAVIFDAGSSGSRVHVFHFDQ  89

Query  217   NLDLLPVGDGVEFFLKITPGLSSYADDPEAAAKSLEPLLLEAEGVVPTELQPDTPLELGA  396
             NLDL+ +   +E FL+I PGLS+YA DP  AA+SL  LL +AE VVP EL+  TP+ +GA
Sbjct  90    NLDLVSIDGELELFLQIKPGLSAYAQDPRQAAESLVSLLDKAESVVPRELRSKTPVRVGA  149

Query  397   TAGLRLLEGDASDKILQAVRDMFKNESNFKSKAEWVSILEGSQEGTYFWVAMNYLLGNLG  576
             TAGLR LEGDASDKILQAVRD+ K+ S  K++A+ V++L+G+QEG Y WV +NYLLGNLG
Sbjct  150   TAGLRALEGDASDKILQAVRDLLKDRSLLKAEADAVTVLDGTQEGVYQWVTINYLLGNLG  209

Query  577   KGYQNTIATIDLGGGSVQVSYAVSGDTFANAPKPHNGEEPYVQEKYILGAQYYLYVHSYL  756
             K Y  T+  +DLGGGSVQ++YA+S      APK  +G +PYV+E ++ G +YY++VHSYL
Sbjct  210   KDYSKTVGVVDLGGGSVQMAYAISETDADKAPKSLDGADPYVKEMFLRGRKYYVHVHSYL  269

Query  757   NYGQLASRAEIFKASGNSTNPCVLEGYDGYYTYNDVSYKVTAPPNGSSLKNCRKLARKVV  936
              YG LA+RAEI K SG+S NPC+L GYDG+Y Y   S+K +A P+G+SL  CR  A + +
Sbjct  270   RYGLLAARAEILKVSGDSENPCILAGYDGFYKYGGKSFKASAYPSGASLSECRSTALQAL  329

Query  937   DF-RAPCKYPNCTFNGVWSGGGGAGMENVDISSYFYDIAIDVGIIDEGKASKIVKPRSFL  1113
                 + C Y  CTF G+W+GGGG G EN+ ++S+F+D A + G +D    +  V+P +F 
Sbjct  330   RANESSCTYMKCTFGGIWNGGGGDGQENLFVASFFFDRAAEAGFVDSKLPTATVRPVNFK  389

Query  1114  VAAKLACETKFEDVKSTFPNAVEKDYPYLCMDLVYQYTLLVDGLGLHPYKEITLMKKVEY  1293
              AAK ACE   ED KST+ +  E + PYLCMDLVYQYTLLVDG GL P +EITL+K+V+Y
Sbjct  390   EAAKRACEKNIEDAKSTYKHVDEGNLPYLCMDLVYQYTLLVDGFGLDPQQEITLVKQVKY  449

Query  1294  KNYMVEAAWPLGCAIDVISS  1353
                +VEAAWPLG AI+ +SS
Sbjct  450   NGALVEAAWPLGSAIEAVSS  469



>gb|AAF00609.1|AF156780_1 nod factor binding lectin-nucleotide phosphohydrolase [Lotus 
japonicus]
Length=456

 Score =   465 bits (1196),  Expect = 9e-156, Method: Compositional matrix adjust.
 Identities = 247/443 (56%), Positives = 322/443 (73%), Gaps = 14/443 (3%)
 Frame = +1

Query  64    FISLALLLFPL--ACFSRSHL-------RRVLL--NHE-AGNYAVIFDAGSTGSRVHVFH  207
              ISL   +F L  A  S  +L       R++LL  N E   +YAVIFDAGSTGSRVHV++
Sbjct  4     LISLMTFVFMLMPAISSSQYLGNNILMNRKILLPKNQEPVTSYAVIFDAGSTGSRVHVYN  63

Query  208   FDENLDLLPVGDGVEFFLKITPGLSSYADDPEAAAKSLEPLLLEAEGVVPTELQPDTPLE  387
             FD+NLDLLPV + +EF+  + PGLSSYA +PE AA+SL PLL EAE VVP   QP+TP++
Sbjct  64    FDQNLDLLPVENELEFYDSVKPGLSSYAANPEEAAESLIPLLKEAENVVPVSQQPNTPVK  123

Query  388   LGATAGLRLLEGDASDKILQAVRDMFKNESNFKSKAEWVSILEGSQEGTYFWVAMNYLLG  567
             LGATAGLRLLEG+A++ ILQAVRDM  N S    +++ VSIL+G+QEG+Y WV +NYLLG
Sbjct  124   LGATAGLRLLEGNAAENILQAVRDMLSNRSALNVQSDAVSILDGTQEGSYLWVTINYLLG  183

Query  568   NLGKGYQNTIATIDLGGGSVQVSYAVSGDTFANAPKPHNGEEPYVQEKYILGAQYYLYVH  747
              LGK +  T+  +DLGGGSVQ++YAVS +T  NAPK   GE+PY+++  + G +Y LYVH
Sbjct  184   KLGKRFTKTVGVVDLGGGSVQMTYAVSRNTAKNAPKVPEGEDPYIKKLVLQGKKYDLYVH  243

Query  748   SYLNYGQLASRAEIFKASGNSTNPCVLEGYDGYYTYNDVSYKVTAPPNGSSLKNCRKLAR  927
             SYL YG+ A RAEIFK +G S NPC+L G+DG YTY+   YKV+AP +GS+L  CRK+A 
Sbjct  244   SYLRYGREAFRAEIFKVAGGSANPCILAGFDGAYTYSGAEYKVSAPASGSNLNQCRKIAL  303

Query  928   KVVDFRAPCKYPNCTFNGVWSGGGGAGMENVDISSYFYDIAIDVGIIDEGKASKIVKPRS  1107
             K +   APC Y NCTF G+W+GGGG+G +N+ ++S FY ++ DVGI      +KI +P  
Sbjct  304   KALKVNAPCPYQNCTFGGIWNGGGGSGQKNLFLTSSFYYLSEDVGIFVNKPNAKI-RPVD  362

Query  1108  FLVAAKLACETKFEDVKSTFPNAVEKD-YPYLCMDLVYQYTLLVDGLGLHPYKEITLMKK  1284
                AAKLAC+T  ED KS +P+  EKD   Y+C+DLVY YTLLVDG GL P++E+T+  +
Sbjct  363   LKTAAKLACKTNLEDAKSKYPDLYEKDSVEYVCLDLVYVYTLLVDGFGLDPFQEVTVANE  422

Query  1285  VEYKNYMVEAAWPLGCAIDVISS  1353
             +EY++ +VEAAWPLG AI+ ISS
Sbjct  423   IEYQDALVEAAWPLGTAIEAISS  445



>gb|AAO23007.1| apyrase-like protein [Medicago truncatula]
 gb|AES80797.2| GDA1/CD39 nucleoside phosphatase family protein [Medicago truncatula]
Length=467

 Score =   465 bits (1196),  Expect = 1e-155, Method: Compositional matrix adjust.
 Identities = 236/441 (54%), Positives = 318/441 (72%), Gaps = 10/441 (2%)
 Frame = +1

Query  58    LVFISLALLLFPLACFSRSHLRRVLLNHE-------AGNYAVIFDAGSTGSRVHVFHFDE  216
             ++ I+  L + P +    S     LLN +        G+YAVIFDAGS+GSRVHVFHFD+
Sbjct  29    ILLITFVLYMMPSSSNYDSAGDYALLNRKLSPDKKSGGSYAVIFDAGSSGSRVHVFHFDQ  88

Query  217   NLDLLPVGDGVEFFLKITPGLSSYADDPEAAAKSLEPLLLEAEGVVPTELQPDTPLELGA  396
             NLDL+ +G  +E F ++ PGLS+YA  P+ AA+SL  LL +AEGVVP EL+  TP+ +GA
Sbjct  89    NLDLVHIGKDLELFEQLKPGLSAYAQKPQQAAESLVSLLEKAEGVVPRELRSKTPVRIGA  148

Query  397   TAGLRLLEGDASDKILQAVRDMFKNESNFKSKAEWVSILEGSQEGTYFWVAMNYLLGNLG  576
             TAGLR LEGDASDKIL+AVRD+ K+ S+FKS A+ V++L+G+QEG Y WV +NYLLGNLG
Sbjct  149   TAGLRALEGDASDKILRAVRDLLKHRSSFKSDADAVTVLDGTQEGAYQWVTINYLLGNLG  208

Query  577   KGYQNTIATIDLGGGSVQVSYAVSGDTFANAPKPHNGEEPYVQEKYILGAQYYLYVHSYL  756
             K Y  T+  +DLGGGSVQ++YA+S    A AP+  +GE+PYV+E ++ G +YYLYVHSYL
Sbjct  209   KDYSKTVGVVDLGGGSVQMAYAISESEAAMAPQVMDGEDPYVKEMFLRGRKYYLYVHSYL  268

Query  757   NYGQLASRAEIFKASGNSTNPCVLEGYDGYYTYNDVSYKVTAPPNGSSLKNCRKLARKVV  936
              YG LA+RAEI K +G++ NPC+L G DG Y Y   S+K  A  +G+SL  C+ +A K +
Sbjct  269   RYGLLAARAEILKVAGDAENPCILSGSDGTYKYGGKSFK--ASSSGASLNECKSVAHKAL  326

Query  937   DF-RAPCKYPNCTFNGVWSGGGGAGMENVDISSYFYDIAIDVGIIDEGKASKIVKPRSFL  1113
                 + C +  CTF G+W+GGGG G +N+ ++S+F+D A + G +D      IV+P  F 
Sbjct  327   KVNESTCTHMKCTFGGIWNGGGGDGQKNLFVASFFFDRAAEAGFVDPNSPVAIVRPADFE  386

Query  1114  VAAKLACETKFEDVKSTFPNAVEKDYPYLCMDLVYQYTLLVDGLGLHPYKEITLMKKVEY  1293
              AAK AC+TK E+ KST+P   E + PYLCMDLVYQYTLLVDG G++P++EITL+KKV+Y
Sbjct  387   DAAKQACQTKLENAKSTYPRVEEGNLPYLCMDLVYQYTLLVDGFGIYPWQEITLVKKVKY  446

Query  1294  KNYMVEAAWPLGCAIDVISSS  1356
              + +VEAAWPLG AI+ +SS+
Sbjct  447   DDALVEAAWPLGSAIEAVSST  467



>gb|KHN46801.1| Nucleoside-triphosphatase [Glycine soja]
Length=452

 Score =   464 bits (1193),  Expect = 2e-155, Method: Compositional matrix adjust.
 Identities = 238/441 (54%), Positives = 310/441 (70%), Gaps = 12/441 (3%)
 Frame = +1

Query  58    LVFISLALLLFPLACFSRSHLRRVLLNHEA---------GNYAVIFDAGSTGSRVHVFHF  210
             L F+++ L + P A  S  +L   LL H            +YAVIFD GSTG+RVHVFHF
Sbjct  4     LTFVTVLLFILP-ATSSSQYLGNNLLTHRKIFLKKDNIITSYAVIFDGGSTGTRVHVFHF  62

Query  211   DENLDLLPVGDGVEFFLKITPGLSSYADDPEAAAKSLEPLLLEAEGVVPTELQPDTPLEL  390
             D+NLDLLP+GD +E   KITPGLS+Y DDPE AA+SL PLL EAE VVP +L+P+TP+ L
Sbjct  63    DQNLDLLPIGDSLELNKKITPGLSAYEDDPEQAAESLIPLLEEAESVVPEDLRPNTPVRL  122

Query  391   GATAGLRLLEGDASDKILQAVRDMFKNESNFKSKAEWVSILEGSQEGTYFWVAMNYLLGN  570
             GATAGLRLL+G+AS++ILQAVRDM  N S    +++ V+IL+G+QE  Y WVA+NYLLGN
Sbjct  123   GATAGLRLLKGNASEQILQAVRDMLSNRSTLNLQSDAVTILDGNQEAAYMWVALNYLLGN  182

Query  571   LGKGYQNTIATIDLGGGSVQVSYAVSGDTFANAPKPHNGEEPYVQEKYILGAQYYLYVHS  750
             LGK    T+   DLGGGSVQ++YAVS +T  NAP+P  GEE Y++   + G  Y LYVHS
Sbjct  183   LGKVISKTVGVADLGGGSVQMAYAVSKNTAKNAPQPPEGEESYIKTLVLNGKTYDLYVHS  242

Query  751   YLNYGQLASRAEIFKASGNSTNPCVLEGYDGYYTYNDVSYKVTAPPNGSSLKNCRKLARK  930
             YL++G+ ASRAE+ K +G+S NPC+L GY+G YTY+ V YK  A  +GS+   CR++A K
Sbjct  243   YLHFGKEASRAEMLKVTGDSANPCILAGYNGTYTYSGVKYKALASTSGSNFDKCREVALK  302

Query  931   VVDFRAPCKYPNCTFNGVWSGGGGAGMENVDISSYFYDIAIDVGIIDEGKASKIVKPRSF  1110
              +    PC + NCTF G+W+GGGG+G + + +++ FY + I V   D  K S  V P  F
Sbjct  303   ALKVNEPCPHQNCTFGGIWNGGGGSGQKVLYVTTSFYYLVIQVA--DASKTSSKVYPAEF  360

Query  1111  LVAAKLACETKFEDVKSTFPNAVEKDYPYLCMDLVYQYTLLVDGLGLHPYKEITLMKKVE  1290
               AAK AC+ KFED +ST+P  +E   PY+CMD+ YQYTLLVDG GL P+KEI +  ++E
Sbjct  361   KAAAKRACQVKFEDAQSTYPLMMEDALPYICMDITYQYTLLVDGFGLDPWKEIIVANEIE  420

Query  1291  YKNYMVEAAWPLGCAIDVISS  1353
             Y+  +VE AWPLG AI+ ISS
Sbjct  421   YQGALVEGAWPLGSAIEAISS  441



>ref|XP_003624587.1| Nod factor binding lectin-nucleotide phosphohydrolase [Medicago 
truncatula]
 gb|AAO23005.1| apyrase-like protein [Medicago truncatula]
 gb|AES80805.1| Nod factor-binding lectin-nucleotide phosphohydrolase [Medicago 
truncatula]
Length=455

 Score =   464 bits (1194),  Expect = 2e-155, Method: Compositional matrix adjust.
 Identities = 220/412 (53%), Positives = 303/412 (74%), Gaps = 1/412 (0%)
 Frame = +1

Query  121   RRVLLNHEA-GNYAVIFDAGSTGSRVHVFHFDENLDLLPVGDGVEFFLKITPGLSSYADD  297
             R++    E   +YAVIFDAGSTG+RVHV+HFD+NLDLL +G+ +EF  KI PGLS+YAD+
Sbjct  33    RKIFQKQETLTSYAVIFDAGSTGTRVHVYHFDQNLDLLHIGNDIEFVDKIKPGLSAYADN  92

Query  298   PEAAAKSLEPLLLEAEGVVPTELQPDTPLELGATAGLRLLEGDASDKILQAVRDMFKNES  477
             PE AAKSL PLL EAE V+P ++ P TPL LGATAGLRLL GDA++KILQA R+MF N S
Sbjct  93    PEQAAKSLLPLLEEAEDVIPEDMHPKTPLRLGATAGLRLLNGDAAEKILQATRNMFSNRS  152

Query  478   NFKSKAEWVSILEGSQEGTYFWVAMNYLLGNLGKGYQNTIATIDLGGGSVQVSYAVSGDT  657
                 +++ VSI++G+QEG+Y WV +NY+LGNLGK +  T+  IDLGGGSVQ++YAVS  T
Sbjct  153   TLNVQSDAVSIIDGTQEGSYMWVTVNYILGNLGKSFTKTVGVIDLGGGSVQMTYAVSKKT  212

Query  658   FANAPKPHNGEEPYVQEKYILGAQYYLYVHSYLNYGQLASRAEIFKASGNSTNPCVLEGY  837
               NAPK  +GE+PY+++  + G QY LYVHSYL +G+ A+RA++  A+  S NPC+L G+
Sbjct  213   AKNAPKVADGEDPYIKKLVLKGKQYDLYVHSYLRFGKEATRAQVLNATNGSANPCILPGF  272

Query  838   DGYYTYNDVSYKVTAPPNGSSLKNCRKLARKVVDFRAPCKYPNCTFNGVWSGGGGAGMEN  1017
             +G +TY+ V YK  +P +GS+   C+++  KV+    PC Y +CTF+G+W+GGGG+G + 
Sbjct  273   NGTFTYSGVEYKAFSPSSGSNFNECKEIILKVLKVNDPCPYSSCTFSGIWNGGGGSGQKK  332

Query  1018  VDISSYFYDIAIDVGIIDEGKASKIVKPRSFLVAAKLACETKFEDVKSTFPNAVEKDYPY  1197
             + ++S F  +  DVG+++  K + I+ P  F + AK AC   FEDVKST+P   E   PY
Sbjct  333   LFVTSAFAYLTEDVGMVEPNKPNSILHPIDFEIEAKRACALNFEDVKSTYPRLTEAKRPY  392

Query  1198  LCMDLVYQYTLLVDGLGLHPYKEITLMKKVEYKNYMVEAAWPLGCAIDVISS  1353
             +CMDL+YQ+ LLV G GL P KEIT+ + ++Y+N +VEAAWPLG A++ IS+
Sbjct  393   VCMDLLYQHVLLVHGFGLSPRKEITVGEGIQYQNSVVEAAWPLGTAVEAIST  444



>dbj|BAM84272.1| apyrase [Medicago truncatula]
Length=455

 Score =   463 bits (1192),  Expect = 3e-155, Method: Compositional matrix adjust.
 Identities = 221/412 (54%), Positives = 303/412 (74%), Gaps = 1/412 (0%)
 Frame = +1

Query  121   RRVLLNHEA-GNYAVIFDAGSTGSRVHVFHFDENLDLLPVGDGVEFFLKITPGLSSYADD  297
             R++    E   +YAVIFDAGSTG+RVHV+HFD+NLDLL +G+ +EF  KI PGLS+YAD+
Sbjct  33    RKIFQKQETLTSYAVIFDAGSTGTRVHVYHFDQNLDLLHIGNDIEFVDKIKPGLSAYADN  92

Query  298   PEAAAKSLEPLLLEAEGVVPTELQPDTPLELGATAGLRLLEGDASDKILQAVRDMFKNES  477
             P+ AAKSL PLL EAE VVP +L P TPL LGATAGLRLL GDA++KILQA R+MF N S
Sbjct  93    PKQAAKSLIPLLEEAEDVVPEDLHPKTPLRLGATAGLRLLNGDAAEKILQATRNMFSNRS  152

Query  478   NFKSKAEWVSILEGSQEGTYFWVAMNYLLGNLGKGYQNTIATIDLGGGSVQVSYAVSGDT  657
                 +++ VSI++G+QEG+Y WV +NY+LGNLGK +  T+  IDLGGGSVQ++YAVS  T
Sbjct  153   TLNVQSDAVSIIDGTQEGSYMWVTVNYILGNLGKSFTKTVGVIDLGGGSVQMTYAVSKKT  212

Query  658   FANAPKPHNGEEPYVQEKYILGAQYYLYVHSYLNYGQLASRAEIFKASGNSTNPCVLEGY  837
               NAPK  +GE+PY+++  + G QY LYVHSYL +G+ A+RA++  A+  S NPC+L G+
Sbjct  213   AKNAPKVADGEDPYIKKLVLKGKQYDLYVHSYLRFGKEATRAQVLNATNGSANPCILPGF  272

Query  838   DGYYTYNDVSYKVTAPPNGSSLKNCRKLARKVVDFRAPCKYPNCTFNGVWSGGGGAGMEN  1017
             +G +TY+ V YK  +P +GS+   C+++  KV+    PC Y +CTF+G+W+GGGG+G + 
Sbjct  273   NGTFTYSGVEYKAFSPSSGSNFDECKEIILKVLKVNDPCPYSSCTFSGIWNGGGGSGQKK  332

Query  1018  VDISSYFYDIAIDVGIIDEGKASKIVKPRSFLVAAKLACETKFEDVKSTFPNAVEKDYPY  1197
             + ++S F  +  DVG+++  K + I+ P  F + AK AC   FEDVKST+P   E   PY
Sbjct  333   LFVTSAFAYLTEDVGMVEPNKPNSILHPIDFEIEAKRACALNFEDVKSTYPRLTEAKRPY  392

Query  1198  LCMDLVYQYTLLVDGLGLHPYKEITLMKKVEYKNYMVEAAWPLGCAIDVISS  1353
             +CMDL+YQ+ LLV G GL P KEIT+ + ++Y+N +VEAAWPLG A++ IS+
Sbjct  393   VCMDLLYQHVLLVHGFGLSPRKEITVGEGIQYQNSVVEAAWPLGTAVEAIST  444



>ref|XP_010316510.1| PREDICTED: apyrase-like isoform X2 [Solanum lycopersicum]
Length=383

 Score =   460 bits (1184),  Expect = 4e-155, Method: Compositional matrix adjust.
 Identities = 221/371 (60%), Positives = 294/371 (79%), Gaps = 1/371 (0%)
 Frame = +1

Query  265   ITPGLSSYADDPEAAAKSLEPLLLEAEGVVPTELQPDTPLELGATAGLRLLEGDASDKIL  444
             I PGLSSYADDP+AAA SL+PLL +AE V+P  LQ  TP+++GATAGLRLL+GD+S+KIL
Sbjct  7     IKPGLSSYADDPKAAANSLKPLLEKAEAVIPKNLQSQTPIKVGATAGLRLLKGDSSEKIL  66

Query  445   QAVRDMFKNESNFKSKAEWVSILEGSQEGTYFWVAMNYLLGNLGKGYQNTIATIDLGGGS  624
             QAVRDM KNE+    K EWVS+LEG+ EG+YFWVA+NYL GNLGK Y +TIATIDLGGGS
Sbjct  67    QAVRDMLKNETTLSYKDEWVSVLEGTLEGSYFWVALNYLYGNLGKNYPDTIATIDLGGGS  126

Query  625   VQVSYAVSGDTFANAPKPHNGEEPYVQEKYILGAQYYLYVHSYLNYGQLASRAEIFKASG  804
             VQ++YAVS  +  NAPK  NG+  YVQ+K +LG  YYLYVHS+LNYG LA+RA+I KAS 
Sbjct  127   VQIAYAVSKQSAINAPKLPNGDA-YVQQKALLGTNYYLYVHSFLNYGLLAARADILKASK  185

Query  805   NSTNPCVLEGYDGYYTYNDVSYKVTAPPNGSSLKNCRKLARKVVDFRAPCKYPNCTFNGV  984
             N T+PC++EG++GYYTYN VSYK  +   G +++ C+ + RK++   APC + NC+F G+
Sbjct  186   NYTSPCIVEGHNGYYTYNGVSYKAASRKQGPNIRRCKAIIRKLLQIDAPCNHKNCSFAGI  245

Query  985   WSGGGGAGMENVDISSYFYDIAIDVGIIDEGKASKIVKPRSFLVAAKLACETKFEDVKST  1164
             W+GGGGAG +N+ ISS+FYD A  VGI+D  +A  I +P  +  AA LAC+TK +++KS 
Sbjct  246   WNGGGGAGTKNLYISSFFYDYASTVGIVDPKEAYGITQPIQYYKAATLACKTKKQNMKSV  305

Query  1165  FPNAVEKDYPYLCMDLVYQYTLLVDGLGLHPYKEITLMKKVEYKNYMVEAAWPLGCAIDV  1344
             FPN  +KD P++CMDL+Y+YTLLV+G G+ P ++IT++ +V YKN++VEAAWPLG AID 
Sbjct  306   FPNINDKDIPFICMDLLYEYTLLVNGFGIDPIRKITVVHQVNYKNHLVEAAWPLGSAIDA  365

Query  1345  ISSSSANNLLS  1377
             +SS+++ N++S
Sbjct  366   VSSTTSENMIS  376



>ref|XP_010669578.1| PREDICTED: apyrase 2 [Beta vulgaris subsp. vulgaris]
Length=461

 Score =   463 bits (1192),  Expect = 4e-155, Method: Compositional matrix adjust.
 Identities = 228/432 (53%), Positives = 301/432 (70%), Gaps = 2/432 (0%)
 Frame = +1

Query  58    LVFISLALLLFPLACFSRSHLRRVLLNHEAGNYAVIFDAGSTGSRVHVFHFDENLDLLPV  237
             L+ IS  L++ P         R+  +  E   YAVIFDAGS+GSRVHVF FD+NLDL+P+
Sbjct  30    LLLISFVLIMMPRPTDEGYSPRK--MKTEYNRYAVIFDAGSSGSRVHVFCFDKNLDLVPI  87

Query  238   GDGVEFFLKITPGLSSYADDPEAAAKSLEPLLLEAEGVVPTELQPDTPLELGATAGLRLL  417
             G+ +E F +  PGLS+YA+DP+ AA SL  LL +AE VVP +L   TP+ +GATAGLR L
Sbjct  88    GNDLELFAQKKPGLSAYANDPQEAANSLLSLLKQAEDVVPRDLLGKTPVRVGATAGLRQL  147

Query  418   EGDASDKILQAVRDMFKNESNFKSKAEWVSILEGSQEGTYFWVAMNYLLGNLGKGYQNTI  597
              GDA ++ILQ+VRD+ K++S  KS    V++L+G+QEG + WV +NYLLGNLGK Y  T+
Sbjct  148   AGDAPERILQSVRDLLKDKSVLKSDPNGVTVLDGTQEGAFQWVTINYLLGNLGKKYPRTV  207

Query  598   ATIDLGGGSVQVSYAVSGDTFANAPKPHNGEEPYVQEKYILGAQYYLYVHSYLNYGQLAS  777
               +DLGGGSVQ++YAVS    A APK  NGEE YV+E Y+ G +YYLYVHSYL+YG LA+
Sbjct  208   GVVDLGGGSVQMAYAVSESDAAKAPKVSNGEEAYVREMYLKGRKYYLYVHSYLHYGLLAA  267

Query  778   RAEIFKASGNSTNPCVLEGYDGYYTYNDVSYKVTAPPNGSSLKNCRKLARKVVDFRAPCK  957
             RAEI KA G+S+NPC+L G+ G Y Y   SY+V+A P G+ + +CR      +     C 
Sbjct  268   RAEILKAVGDSSNPCILAGFHGTYKYGGASYEVSASPTGADVDSCRAFTSMALKVNETCT  327

Query  958   YPNCTFNGVWSGGGGAGMENVDISSYFYDIAIDVGIIDEGKASKIVKPRSFLVAAKLACE  1137
             +  C+F GVW+GG G G +N+ ++S+F+D A + G ID  K    V+P  F  AAKLAC 
Sbjct  328   HMQCSFGGVWNGGRGDGQKNLFVASFFFDRAAEAGFIDSEKPVVTVRPSDFEEAAKLACG  387

Query  1138  TKFEDVKSTFPNAVEKDYPYLCMDLVYQYTLLVDGLGLHPYKEITLMKKVEYKNYMVEAA  1317
             T  E+ KS + +    + PYLCMDL+YQYTLLV+G GL P +++TL+KKV Y N +VEAA
Sbjct  388   TTIEEGKSKYTHVESDNLPYLCMDLIYQYTLLVNGFGLAPSQKMTLVKKVPYGNSLVEAA  447

Query  1318  WPLGCAIDVISS  1353
             WPLG AIDV+SS
Sbjct  448   WPLGSAIDVMSS  459



>ref|XP_004493134.1| PREDICTED: nucleoside-triphosphatase-like isoform X1 [Cicer arietinum]
Length=456

 Score =   462 bits (1190),  Expect = 6e-155, Method: Compositional matrix adjust.
 Identities = 231/441 (52%), Positives = 311/441 (71%), Gaps = 9/441 (2%)
 Frame = +1

Query  58    LVFISLALLLFPLACFSRSHL-------RRVLLNHEA-GNYAVIFDAGSTGSRVHVFHFD  213
             +  I+  L L P    S  +L       R++    E   +YAVIFDAGSTGSRVHV+HFD
Sbjct  5     ITLITFLLFLIPSITSSSQYLGNNLLTNRKIFQKQETITSYAVIFDAGSTGSRVHVYHFD  64

Query  214   ENLDLLPVGDGVEFFLKITPGLSSYADDPEAAAKSLEPLLLEAEGVVPTELQPDTPLELG  393
             +NLDLL +G  VEF+ KI PGLS+Y D+PE AA SL PLL +A+ V+P ++ P TP+ LG
Sbjct  65    QNLDLLHIGKDVEFYNKIKPGLSAYGDNPEQAANSLIPLLEQAQNVIPEDVHPKTPVRLG  124

Query  394   ATAGLRLLEGDASDKILQAVRDMFKNESNFKSKAEWVSILEGSQEGTYFWVAMNYLLGNL  573
             ATAGLRLL+GDAS+KILQAVRDM  N S+F  + + VSI++G+QEG+Y WV +NY+LGNL
Sbjct  125   ATAGLRLLDGDASEKILQAVRDMLSNRSSFIVQPDAVSIIDGTQEGSYLWVTVNYVLGNL  184

Query  574   GKGYQNTIATIDLGGGSVQVSYAVSGDTFANAPKPHNGEEPYVQEKYILGAQYYLYVHSY  753
             GK Y  T+  +DLGGGS+Q++YAVS  T  NAPK  +G +PY+++  + G  Y LYVHSY
Sbjct  185   GKKYTKTVGVMDLGGGSLQMAYAVSKKTAQNAPKVADGNDPYIKKIVLKGKPYDLYVHSY  244

Query  754   LNYGQLASRAEIFKASGNSTNPCVLEGYDGYYTYNDVSYKVTAPPNGSSLKNCRKLARKV  933
             L++G+ ASRAEI K + +S NPC+L G+DG YTY+   YK TAP +G++   C+K+ RK 
Sbjct  245   LHFGREASRAEILKVTKHSANPCILAGFDGIYTYSGEEYKATAPASGANFNKCKKIIRKA  304

Query  934   VDFRAPCKYPNCTFNGVWSGGGGAGMENVDISSYFYDIAIDVGIIDEGKASKIVKPRSFL  1113
             +    PC Y NCTF G+W+GGGG+G +++  +S F+ +  DVG++D    +  ++P    
Sbjct  305   LKLNYPCPYQNCTFAGIWNGGGGSGQKHLFATSSFFYLPEDVGMVDSKTRNFKIRPLDLE  364

Query  1114  VAAKLACETKFEDVKSTFPNAV-EKDYPYLCMDLVYQYTLLVDGLGLHPYKEITLMKKVE  1290
             + AK AC   FED KST+P  V EK  PY CMDL+YQY LLVDG GL P +EIT  K++E
Sbjct  365   IEAKRACSLTFEDAKSTYPLLVEEKIVPYACMDLLYQYELLVDGFGLDPLQEITAGKEIE  424

Query  1291  YKNYMVEAAWPLGCAIDVISS  1353
             Y++ +VEA+WPLG A++ ISS
Sbjct  425   YQDAIVEASWPLGNAVEAISS  445



>ref|XP_003624579.1| Nucleoside-triphosphatase [Medicago truncatula]
Length=544

 Score =   466 bits (1198),  Expect = 7e-155, Method: Compositional matrix adjust.
 Identities = 235/441 (53%), Positives = 319/441 (72%), Gaps = 10/441 (2%)
 Frame = +1

Query  58    LVFISLALLLFPLACFSRSHLRRVLLNHE-------AGNYAVIFDAGSTGSRVHVFHFDE  216
             ++ I+  L + P +    S     LLN +        G+YAVIFDAGS+GSRVHVFHFD+
Sbjct  106   ILLITFVLYMMPSSSNYDSAGDYALLNRKLSPDKKSGGSYAVIFDAGSSGSRVHVFHFDQ  165

Query  217   NLDLLPVGDGVEFFLKITPGLSSYADDPEAAAKSLEPLLLEAEGVVPTELQPDTPLELGA  396
             NLDL+ +G  +E F ++ PGLS+YA  P+ AA+SL  LL +AEGVVP EL+  TP+ +GA
Sbjct  166   NLDLVHIGKDLELFEQLKPGLSAYAQKPQQAAESLVSLLEKAEGVVPRELRSKTPVRIGA  225

Query  397   TAGLRLLEGDASDKILQAVRDMFKNESNFKSKAEWVSILEGSQEGTYFWVAMNYLLGNLG  576
             TAGLR LEGDASDKIL+AVRD+ K+ S+FKS A+ V++L+G+QEG Y WV +NYLLGNLG
Sbjct  226   TAGLRALEGDASDKILRAVRDLLKHRSSFKSDADAVTVLDGTQEGAYQWVTINYLLGNLG  285

Query  577   KGYQNTIATIDLGGGSVQVSYAVSGDTFANAPKPHNGEEPYVQEKYILGAQYYLYVHSYL  756
             K Y  T+  +DLGGGSVQ++YA+S    A AP+  +GE+PYV+E ++ G +YYLYVHSYL
Sbjct  286   KDYSKTVGVVDLGGGSVQMAYAISESEAAMAPQVMDGEDPYVKEMFLRGRKYYLYVHSYL  345

Query  757   NYGQLASRAEIFKASGNSTNPCVLEGYDGYYTYNDVSYKVTAPPNGSSLKNCRKLARKVV  936
              YG LA+RAEI K +G++ NPC+L G DG Y Y   S+K ++  +G+SL  C+ +A K +
Sbjct  346   RYGLLAARAEILKVAGDAENPCILSGSDGTYKYGGKSFKASS--SGASLNECKSVAHKAL  403

Query  937   DF-RAPCKYPNCTFNGVWSGGGGAGMENVDISSYFYDIAIDVGIIDEGKASKIVKPRSFL  1113
                 + C +  CTF G+W+GGGG G +N+ ++S+F+D A + G +D      IV+P  F 
Sbjct  404   KVNESTCTHMKCTFGGIWNGGGGDGQKNLFVASFFFDRAAEAGFVDPNSPVAIVRPADFE  463

Query  1114  VAAKLACETKFEDVKSTFPNAVEKDYPYLCMDLVYQYTLLVDGLGLHPYKEITLMKKVEY  1293
              AAK AC+TK E+ KST+P   E + PYLCMDLVYQYTLLVDG G++P++EITL+KKV+Y
Sbjct  464   DAAKQACQTKLENAKSTYPRVEEGNLPYLCMDLVYQYTLLVDGFGIYPWQEITLVKKVKY  523

Query  1294  KNYMVEAAWPLGCAIDVISSS  1356
              + +VEAAWPLG AI+ +SS+
Sbjct  524   DDALVEAAWPLGSAIEAVSST  544



>gb|AAD31285.1|AF139807_1 nod factor binding lectin-nucleotide phosphohydrolase [Vigna 
unguiculata subsp. cylindrica]
Length=462

 Score =   462 bits (1189),  Expect = 1e-154, Method: Compositional matrix adjust.
 Identities = 223/419 (53%), Positives = 299/419 (71%), Gaps = 3/419 (1%)
 Frame = +1

Query  121   RRVLLNHEA-GNYAVIFDAGSTGSRVHVFHFDENLDLLPVGDGVEFFLKITPGLSSYADD  297
             R++L N E   +YAVIFDAGS+GSRVHVF+FD+NLDLL +G+ +EF  KI PGLSSYAD 
Sbjct  42    RKILPNQELLTSYAVIFDAGSSGSRVHVFNFDQNLDLLHIGNDLEFTKKIKPGLSSYADK  101

Query  298   PEAAAKSLEPLLLEAEGVVPTELQPDTPLELGATAGLRLLEGDASDKILQAVRDMFKNES  477
             PE AA+SL PLL EAE VVP EL P TPL+LGATAGLRLL+GDA++KILQAVR+MF+N S
Sbjct  102   PEKAAESLIPLLEEAEDVVPEELHPKTPLKLGATAGLRLLDGDAAEKILQAVREMFRNRS  161

Query  478   NFKSKAEWVSILEGSQEGTYFWVAMNYLLGNLGKGYQNTIATIDLGGGSVQVSYAVSGDT  657
             +   + + VS+++G+QEG+Y WV +NYLLG LGK +  T+  IDLGG SVQ++YAVS +T
Sbjct  162   SLSVQPDAVSVIDGTQEGSYLWVTVNYLLGKLGKKFTKTVGVIDLGGASVQMAYAVSRNT  221

Query  658   FANAPKPHNGEEPYVQEKYILGAQYYLYVHSYLNYGQLASRAEIFKASGNSTNPCVLEGY  837
               NAPKP  GE+PY+++  + G +Y LYVHSYL YG  A+R +IFK +  + +PC+L GY
Sbjct  222   AKNAPKPPQGEDPYMKKLVLKGKKYDLYVHSYLRYGNDAARVKIFKTTDGAASPCLLAGY  281

Query  838   DGYYTYNDVSYKVTAPPNGSSLKNCRKLARKVVDFRAPCKYPNCTFNGVWSGGGGAGMEN  1017
             +  Y Y+  SY +  P +G++   CR LA +++    PC + NCTF G+W GG G+G +N
Sbjct  282   EDIYRYSGESYNIYGPTSGANFNECRDLALQILRLNEPCSHENCTFGGIWDGGKGSGQKN  341

Query  1018  VDISSYFYDIAIDVGIIDEGKASKIVKPRSFLVAAKLACETKFEDVKSTFPNAVEKDYPY  1197
             + ++S FY  + +VG +    +    +P  F  AAK AC   FE+ KSTFPN  +   P+
Sbjct  342   LVVTSAFYYRSSEVGFVTPPNSKN--RPLDFETAAKQACSLTFEEAKSTFPNVEKDKLPF  399

Query  1198  LCMDLVYQYTLLVDGLGLHPYKEITLMKKVEYKNYMVEAAWPLGCAIDVISSSSANNLL  1374
             +C+D  YQYTLLVDG GL P +EIT+ + +EY++ +VE AWPLG AI+ ISS    N L
Sbjct  400   VCVDFTYQYTLLVDGFGLDPEQEITVAEGIEYQDAIVETAWPLGTAIEAISSLPKFNRL  458



>ref|XP_007161808.1| hypothetical protein PHAVU_001G099900g [Phaseolus vulgaris]
 gb|ESW33802.1| hypothetical protein PHAVU_001G099900g [Phaseolus vulgaris]
Length=454

 Score =   461 bits (1187),  Expect = 1e-154, Method: Compositional matrix adjust.
 Identities = 220/413 (53%), Positives = 290/413 (70%), Gaps = 2/413 (0%)
 Frame = +1

Query  121   RRVLLNHEAG--NYAVIFDAGSTGSRVHVFHFDENLDLLPVGDGVEFFLKITPGLSSYAD  294
             R++    E    +YA IFDAGSTGSRVHVFHFD+NLDLL +G+ +EF  K+ PGLSSYAD
Sbjct  31    RKIFPKQEEAITSYAAIFDAGSTGSRVHVFHFDQNLDLLHIGNNLEFQQKVAPGLSSYAD  90

Query  295   DPEAAAKSLEPLLLEAEGVVPTELQPDTPLELGATAGLRLLEGDASDKILQAVRDMFKNE  474
             +PE AA+SL PLL  AE VVP +L   TPL+LGATAGLRLLEG+A++ IL AVRDMFKN 
Sbjct  91    EPEKAAQSLIPLLEAAENVVPQDLHFKTPLKLGATAGLRLLEGNAAENILNAVRDMFKNR  150

Query  475   SNFKSKAEWVSILEGSQEGTYFWVAMNYLLGNLGKGYQNTIATIDLGGGSVQVSYAVSGD  654
             S    +++ V+I++G+QEG+Y WVA+NYLLG LGK +  T+  +DLGGGSVQ++YAVS +
Sbjct  151   STLNVQSDAVTIIDGTQEGSYLWVAVNYLLGRLGKRFSKTVGVVDLGGGSVQMAYAVSRN  210

Query  655   TFANAPKPHNGEEPYVQEKYILGAQYYLYVHSYLNYGQLASRAEIFKASGNSTNPCVLEG  834
             T  NAP   +GE+PY+ + Y+ G +Y LYVHSYL YG+ + R EI K +G S NPCVL G
Sbjct  211   TAKNAPLVPDGEDPYINKLYVKGKKYDLYVHSYLRYGRESFRTEILKVTGGSANPCVLAG  270

Query  835   YDGYYTYNDVSYKVTAPPNGSSLKNCRKLARKVVDFRAPCKYPNCTFNGVWSGGGGAGME  1014
             Y+G YTY+ V Y V  P +GS+   CR++  + +    PC +PNCTF G+W GG G+G  
Sbjct  271   YEGIYTYSGVEYAVYPPSSGSNYDACREIVLRAIKLNEPCSHPNCTFGGIWDGGKGSGQR  330

Query  1015  NVDISSYFYDIAIDVGIIDEGKASKIVKPRSFLVAAKLACETKFEDVKSTFPNAVEKDYP  1194
              +  +S FY +    G+ID    + I++       AK AC   +ED KS++P   E+  P
Sbjct  331   TLYATSSFYYLPEQAGLIDAEAPNAIIRVVDLENLAKQACGKTYEDAKSSYPRVAEERVP  390

Query  1195  YLCMDLVYQYTLLVDGLGLHPYKEITLMKKVEYKNYMVEAAWPLGCAIDVISS  1353
             ++CMDL YQY LLVDG GL P +EITL  ++EY++ +VE AWPLG AI+ ISS
Sbjct  391   FICMDLTYQYALLVDGFGLDPLQEITLANEIEYQDAVVETAWPLGTAIEAISS  443



>ref|XP_009770744.1| PREDICTED: apyrase 2-like [Nicotiana sylvestris]
Length=472

 Score =   462 bits (1188),  Expect = 2e-154, Method: Compositional matrix adjust.
 Identities = 243/436 (56%), Positives = 311/436 (71%), Gaps = 4/436 (1%)
 Frame = +1

Query  58    LVFISLALLLFPLACFSRSHL---RRVLLNHEAGNYAVIFDAGSTGSRVHVFHFDENLDL  228
             L  +SL L + P    S S     R+   N  +  YAVIFDAGS+GSRVHVF FDENLDL
Sbjct  35    LFLVSLVLYVMPTRSPSDSMESLNRKFSPNLGSMRYAVIFDAGSSGSRVHVFCFDENLDL  94

Query  229   LPVGDGVEFFLKITPGLSSYADDPEAAAKSLEPLLLEAEGVVPTELQPDTPLELGATAGL  408
             +P+G+ +E F++  PGLSSYA DPEAAA+SL  LL EAE VVP  L+ +TP+ +GATAGL
Sbjct  95    VPIGNELELFVQEKPGLSSYASDPEAAAESLLSLLKEAENVVPRNLRSNTPVRVGATAGL  154

Query  409   RLLEGDASDKILQAVRDMFKNESNFKSKAEWVSILEGSQEGTYFWVAMNYLLGNLGKGYQ  588
             R LEGDASD+ILQAVRD  K++S+FK+KA+ V++L+G+QEG Y WV +NYLLG LGK Y 
Sbjct  155   RQLEGDASDRILQAVRDFLKSKSSFKAKADAVTVLDGNQEGAYQWVTINYLLGKLGKKYS  214

Query  589   NTIATIDLGGGSVQVSYAVSGDTFANAPKPHNGEEPYVQEKYILGAQYYLYVHSYLNYGQ  768
             +T+  +DLGGGSVQ++YA+S      APK  +GE+ YVQE Y+ G +YYLY+HSYL+YG 
Sbjct  215   DTVGVVDLGGGSVQMAYAISESDAQKAPKVSDGEDTYVQEMYLKGTKYYLYIHSYLHYGL  274

Query  769   LASRAEIFKASGNSTNPCVLEGYDGYYTYNDVSYKVTAPPNGSSLKNCRKLARKVVDFRA  948
             LA+RAEI KA+  S NPC+L GY G Y Y    Y  +A   GSSL +C +++ K +    
Sbjct  275   LAARAEILKATDESGNPCILGGYHGSYKYGGAVYPASAMSQGSSLSSCMEVSLKALKVNE  334

Query  949   P-CKYPNCTFNGVWSGGGGAGMENVDISSYFYDIAIDVGIIDEGKASKIVKPRSFLVAAK  1125
             P C +  CTF GVW+GGGG G +N+ ++S+F+D A + G+I+   A   V+P  +  AAK
Sbjct  335   PTCTHMKCTFGGVWNGGGGDGQKNMFVASFFFDRAAEAGMINPSLAVAKVRPVDYESAAK  394

Query  1126  LACETKFEDVKSTFPNAVEKDYPYLCMDLVYQYTLLVDGLGLHPYKEITLMKKVEYKNYM  1305
              ACET  E  KS FP     + PY+CMDLVYQYTLLVDG GL P +EITL+KKV+YKN +
Sbjct  395   RACETGLEGAKSAFPRVDPDNLPYMCMDLVYQYTLLVDGFGLDPQQEITLVKKVQYKNSL  454

Query  1306  VEAAWPLGCAIDVISS  1353
             VEAAWPLG AI+V SS
Sbjct  455   VEAAWPLGSAIEVASS  470



>gb|ADD09804.1| ectoapyrase 2 [Gossypium hirsutum]
Length=469

 Score =   461 bits (1185),  Expect = 5e-154, Method: Compositional matrix adjust.
 Identities = 230/412 (56%), Positives = 304/412 (74%), Gaps = 1/412 (0%)
 Frame = +1

Query  121   RRVLLNHEAG-NYAVIFDAGSTGSRVHVFHFDENLDLLPVGDGVEFFLKITPGLSSYADD  297
             R+V  N     NYAVIFDAGS+GSRVHV+ FD+NLDL+P+G  +E F ++ PGLSSYA D
Sbjct  58    RKVGANSRGNRNYAVIFDAGSSGSRVHVYCFDQNLDLVPIGSELELFEQLKPGLSSYAKD  117

Query  298   PEAAAKSLEPLLLEAEGVVPTELQPDTPLELGATAGLRLLEGDASDKILQAVRDMFKNES  477
             P+AAAKSL  LL +AE VVP +L+  TP+ +GATAGLR LEGDA+D+ILQAVR++ K+ S
Sbjct  118   PQAAAKSLLSLLNKAESVVPLDLRSKTPVRVGATAGLRALEGDAADRILQAVRELLKDRS  177

Query  478   NFKSKAEWVSILEGSQEGTYFWVAMNYLLGNLGKGYQNTIATIDLGGGSVQVSYAVSGDT  657
               KS+A  V IL+G+QEG+Y WV +NYLLG LG  Y++T+  IDLGGGSVQ++YA+S + 
Sbjct  178   TLKSEANGVKILDGTQEGSYEWVTINYLLGKLGGTYKDTVGIIDLGGGSVQMAYAISKEA  237

Query  658   FANAPKPHNGEEPYVQEKYILGAQYYLYVHSYLNYGQLASRAEIFKASGNSTNPCVLEGY  837
              +NAP    G++ YV E Y+ G++YYLYVHSYL YG LA+RAEI KAS +S NPC+LEG+
Sbjct  238   ASNAPSVPAGQDNYVNEMYLKGSKYYLYVHSYLRYGLLAARAEILKASDDSGNPCILEGF  297

Query  838   DGYYTYNDVSYKVTAPPNGSSLKNCRKLARKVVDFRAPCKYPNCTFNGVWSGGGGAGMEN  1017
             DG Y Y    YK +AP +G+S++ CR++  K +     C +  CTF G+W+GGGG G +N
Sbjct  298   DGTYAYGGNQYKASAPSSGASMEECRRVTHKALKINDTCMHMKCTFGGIWNGGGGDGQKN  357

Query  1018  VDISSYFYDIAIDVGIIDEGKASKIVKPRSFLVAAKLACETKFEDVKSTFPNAVEKDYPY  1197
             + I+S+F+D A + G I        V+P SF  AAK AC TK+ D+K+T+P     +  Y
Sbjct  358   LFIASFFFDRAAEAGFIKAADPVATVQPHSFAEAAKRACGTKYTDIKATYPAVDVGNQAY  417

Query  1198  LCMDLVYQYTLLVDGLGLHPYKEITLMKKVEYKNYMVEAAWPLGCAIDVISS  1353
             LC+DLVYQYTLLVDG GL PY++ITL+KKV+++N  VEAAWPLG AI+ +SS
Sbjct  418   LCLDLVYQYTLLVDGFGLDPYQDITLVKKVKFRNSFVEAAWPLGSAIEAVSS  469



>ref|XP_009622670.1| PREDICTED: apyrase 2-like [Nicotiana tomentosiformis]
Length=472

 Score =   461 bits (1186),  Expect = 5e-154, Method: Compositional matrix adjust.
 Identities = 244/436 (56%), Positives = 309/436 (71%), Gaps = 4/436 (1%)
 Frame = +1

Query  58    LVFISLALLLFPLACFSRSHL---RRVLLNHEAGNYAVIFDAGSTGSRVHVFHFDENLDL  228
             L  +SL L + P    S S     R+   N  +  YAVIFDAGS+GSRVHVF FDENLDL
Sbjct  35    LFLVSLVLYVMPTRSPSDSMESLNRKFSPNLGSMRYAVIFDAGSSGSRVHVFCFDENLDL  94

Query  229   LPVGDGVEFFLKITPGLSSYADDPEAAAKSLEPLLLEAEGVVPTELQPDTPLELGATAGL  408
             +P+G+ +E F++  PGLSSYA DPEAAA+SL  LL EAE VVP  L+ +TP+ +GATAGL
Sbjct  95    VPIGNELELFVQKKPGLSSYASDPEAAAESLLSLLKEAENVVPRNLRSNTPVRVGATAGL  154

Query  409   RLLEGDASDKILQAVRDMFKNESNFKSKAEWVSILEGSQEGTYFWVAMNYLLGNLGKGYQ  588
             R LEGDASD+ILQAVRD  K++S+FK+KA+ V++L+G+QEG Y WV +NYLLG LGK Y 
Sbjct  155   RQLEGDASDRILQAVRDFLKSKSSFKAKADAVTVLDGNQEGAYQWVTINYLLGKLGKKYS  214

Query  589   NTIATIDLGGGSVQVSYAVSGDTFANAPKPHNGEEPYVQEKYILGAQYYLYVHSYLNYGQ  768
             +T+  +DLGGGSVQ++YA+S      APK  +GE+ YVQE Y+ G +YYLYVHSYL+YG 
Sbjct  215   DTVGVVDLGGGSVQMAYAISESDAQKAPKISDGEDSYVQEMYLKGTKYYLYVHSYLHYGL  274

Query  769   LASRAEIFKASGNSTNPCVLEGYDGYYTYNDVSYKVTAPPNGSSLKNCRKLARKVVDFRA  948
             LA+RAEI K +  S NPC+L GY G Y Y    Y  +A   GSSL +CR+++ K +    
Sbjct  275   LAARAEILKTTDESGNPCILGGYHGSYKYGGAVYPASAMSQGSSLSSCREVSLKALKVNE  334

Query  949   P-CKYPNCTFNGVWSGGGGAGMENVDISSYFYDIAIDVGIIDEGKASKIVKPRSFLVAAK  1125
             P C +  CTF GVW+GGGG G +N+ ++S+F+D A + G+I+   A   V P  +  AAK
Sbjct  335   PTCTHMKCTFGGVWNGGGGDGQKNMFVASFFFDRAAEAGMINPSLAVAKVHPVDYESAAK  394

Query  1126  LACETKFEDVKSTFPNAVEKDYPYLCMDLVYQYTLLVDGLGLHPYKEITLMKKVEYKNYM  1305
              ACET  E  KS FP     + PYLCMDLVYQYTLLVDG GL P +EITL+KKV+YK  +
Sbjct  395   RACETGLEGAKSAFPRVDPDNLPYLCMDLVYQYTLLVDGFGLDPQQEITLVKKVQYKKSL  454

Query  1306  VEAAWPLGCAIDVISS  1353
             VEAAWPLG AI+V SS
Sbjct  455   VEAAWPLGSAIEVASS  470



>ref|XP_010246579.1| PREDICTED: probable apyrase 1 [Nelumbo nucifera]
Length=469

 Score =   461 bits (1185),  Expect = 5e-154, Method: Compositional matrix adjust.
 Identities = 240/444 (54%), Positives = 311/444 (70%), Gaps = 10/444 (2%)
 Frame = +1

Query  58    LVFISLALLLFP------LACFSRSHLR---RVLLN-HEAGNYAVIFDAGSTGSRVHVFH  207
             L+ IS  L L P      L      H+R   R LL   E+ NYAVIFDAGS+GSRVHVF 
Sbjct  26    LLLISFVLFLTPRSPSDGLLSVESDHVRLERRGLLELRESRNYAVIFDAGSSGSRVHVFC  85

Query  208   FDENLDLLPVGDGVEFFLKITPGLSSYADDPEAAAKSLEPLLLEAEGVVPTELQPDTPLE  387
             FD+ L+LLP+G+ +E F++  PGLS+YA+ PE AA SL  LL +AE VVP EL+  TP+ 
Sbjct  86    FDKTLNLLPIGNVLELFVQTKPGLSAYANAPEKAADSLLSLLQQAENVVPKELRNKTPVR  145

Query  388   LGATAGLRLLEGDASDKILQAVRDMFKNESNFKSKAEWVSILEGSQEGTYFWVAMNYLLG  567
             +GATAGLR LEGD SD+ILQAVRD+  N+S+ KSK EWV++L G+QEG Y W  +NYLLG
Sbjct  146   VGATAGLRALEGDTSDRILQAVRDLLVNKSSLKSKPEWVTVLGGTQEGAYQWATINYLLG  205

Query  568   NLGKGYQNTIATIDLGGGSVQVSYAVSGDTFANAPKPHNGEEPYVQEKYILGAQYYLYVH  747
              +GK Y NT+  +DLGGGSVQ++YA+S      AP   NGE+ YV+E ++ G +YYLYVH
Sbjct  206   RVGKKYSNTVGIVDLGGGSVQMAYAISEKAAEKAPAVKNGEDSYVKELFLKGTKYYLYVH  265

Query  748   SYLNYGQLASRAEIFKASGNSTNPCVLEGYDGYYTYNDVSYKVTAPPNGSSLKNCRKLAR  927
             SYLNYG LASRAEI KA G+S NPC+L GY G Y Y    Y+V++  +GS++  CR  A 
Sbjct  266   SYLNYGLLASRAEILKAVGSSENPCILNGYHGSYIYGGHVYEVSSSASGSNINECRGAAF  325

Query  928   KVVDFRAPCKYPNCTFNGVWSGGGGAGMENVDISSYFYDIAIDVGIIDEGKASKIVKPRS  1107
             K +     C +  CTF GVW+GGGG G +N+ ++S+F+D A + G ID  K    V+P  
Sbjct  326   KALKVNESCTHMKCTFGGVWNGGGGVGQKNLFVASFFFDRAAEAGFIDSNKPVAKVRPVD  385

Query  1108  FLVAAKLACETKFEDVKSTFPNAVEKDYPYLCMDLVYQYTLLVDGLGLHPYKEITLMKKV  1287
             F  AAK ACETK  D +S +P   + + PYLCMDLVYQ+TLLVDG  L P++EITL+K+V
Sbjct  386   FEEAAKRACETKLADAESIYPLVEKDNLPYLCMDLVYQFTLLVDGFALDPWQEITLVKQV  445

Query  1288  EYKNYMVEAAWPLGCAIDVISSSS  1359
             +Y + ++EAAWPLG AI+V+SSS+
Sbjct  446   KYGDSLLEAAWPLGSAIEVVSSST  469



>dbj|BAB85978.1| PsAPY2 [Pisum sativum]
Length=467

 Score =   460 bits (1184),  Expect = 7e-154, Method: Compositional matrix adjust.
 Identities = 235/441 (53%), Positives = 317/441 (72%), Gaps = 10/441 (2%)
 Frame = +1

Query  58    LVFISLALLLFPLACFSRSHLRRVLLNHE-------AGNYAVIFDAGSTGSRVHVFHFDE  216
             L+ I+  L + P +    S     L+N +       +G+YAVIFDAGS+GSRVHVFHF+ 
Sbjct  29    LLLITFVLYMMPSSSNYESAGEYALVNRKVSPDKKSSGSYAVIFDAGSSGSRVHVFHFNH  88

Query  217   NLDLLPVGDGVEFFLKITPGLSSYADDPEAAAKSLEPLLLEAEGVVPTELQPDTPLELGA  396
             NLDL+ +G  +E F ++ PGLS+YA +P+ AA+SL  LL +AE VVP EL+  TP+ +GA
Sbjct  89    NLDLVHIGKDLELFEQLKPGLSAYAKNPKEAAESLISLLDKAESVVPRELRSKTPVRVGA  148

Query  397   TAGLRLLEGDASDKILQAVRDMFKNESNFKSKAEWVSILEGSQEGTYFWVAMNYLLGNLG  576
             TAGLR LEGDASDKILQAVRD+ K+ S  KS A+ V++L+G+QEG + WV +NYLLGNLG
Sbjct  149   TAGLRSLEGDASDKILQAVRDLLKHRSTLKSDADAVTVLDGNQEGAFQWVTINYLLGNLG  208

Query  577   KGYQNTIATIDLGGGSVQVSYAVSGDTFANAPKPHNGEEPYVQEKYILGAQYYLYVHSYL  756
             K Y  T+  +DLGGGSVQ++YA+S    A APK  +G++PYV+E ++ G +YYLYVHSYL
Sbjct  209   KDYSKTVGVVDLGGGSVQMAYAISESDAATAPKVKDGDDPYVKEMFLRGKKYYLYVHSYL  268

Query  757   NYGQLASRAEIFKASGNSTNPCVLEGYDGYYTYNDVSYKVTAPPNGSSLKNCRKLARKVV  936
              YG LA+RAEI KASG++ NPC+L GYDG Y Y    +K  A  +G+SL  C+  A K +
Sbjct  269   RYGLLAARAEILKASGDAENPCILSGYDGSYNYGGKKFK--ASSSGASLNECKSTALKAL  326

Query  937   DF-RAPCKYPNCTFNGVWSGGGGAGMENVDISSYFYDIAIDVGIIDEGKASKIVKPRSFL  1113
                 + C +  CTF G+W+GGGG G +N+ ++S+F+D A + G  D  K   IV P  F 
Sbjct  327   KVNESSCTHMKCTFGGIWNGGGGDGQKNLFVASFFFDRAAEAGFADPNKPVAIVHPMDFE  386

Query  1114  VAAKLACETKFEDVKSTFPNAVEKDYPYLCMDLVYQYTLLVDGLGLHPYKEITLMKKVEY  1293
              AAK AC+TKF++ KST+P   E + PYLCMDLVYQYTLLVDG G++P++EITL+KKV+Y
Sbjct  387   EAAKQACQTKFKNAKSTYPRVEEGNLPYLCMDLVYQYTLLVDGFGIYPWQEITLVKKVKY  446

Query  1294  KNYMVEAAWPLGCAIDVISSS  1356
             ++ +VEAAWPLG AI+ +S++
Sbjct  447   EDALVEAAWPLGSAIEAVSAT  467



>gb|AFK40353.1| unknown [Medicago truncatula]
Length=467

 Score =   460 bits (1183),  Expect = 9e-154, Method: Compositional matrix adjust.
 Identities = 235/439 (54%), Positives = 315/439 (72%), Gaps = 10/439 (2%)
 Frame = +1

Query  58    LVFISLALLLFPLACFSRSHLRRVLLNHE-------AGNYAVIFDAGSTGSRVHVFHFDE  216
             ++ I+  L + P +    S     LLN +        G+YAVIFDAGS+GSRVHVFHFD+
Sbjct  29    ILLITFVLYMMPSSSNYDSAGDYALLNRKLSPDKKSGGSYAVIFDAGSSGSRVHVFHFDQ  88

Query  217   NLDLLPVGDGVEFFLKITPGLSSYADDPEAAAKSLEPLLLEAEGVVPTELQPDTPLELGA  396
             NLDL+ +G  +E F ++ PGLS+YA  P+ AA+SL  LL +AEGVVP EL+  TP+ +GA
Sbjct  89    NLDLVHIGKDLELFEQLKPGLSAYAQKPQQAAESLVSLLEKAEGVVPRELRSKTPVRIGA  148

Query  397   TAGLRLLEGDASDKILQAVRDMFKNESNFKSKAEWVSILEGSQEGTYFWVAMNYLLGNLG  576
             TAGLR LEGDASDKIL+AVRD+ K+ S+FKS A+ V++L+G+QEG Y WV +NYLLGNLG
Sbjct  149   TAGLRALEGDASDKILRAVRDLLKHRSSFKSDADAVTVLDGTQEGAYQWVTINYLLGNLG  208

Query  577   KGYQNTIATIDLGGGSVQVSYAVSGDTFANAPKPHNGEEPYVQEKYILGAQYYLYVHSYL  756
             K Y  T+   DLGGGSVQ++YA+S    A AP+  +GE+PYV+E ++ G +YYLYVHSYL
Sbjct  209   KDYSKTVGVGDLGGGSVQMAYAISESEAAMAPQVMDGEDPYVKEMFLRGRKYYLYVHSYL  268

Query  757   NYGQLASRAEIFKASGNSTNPCVLEGYDGYYTYNDVSYKVTAPPNGSSLKNCRKLARKVV  936
              YG LA+RAEI K +G++ NPC+L G DG Y Y   S+K  A  +G+SL  C+ +A K +
Sbjct  269   RYGLLAARAEILKVAGDAENPCILSGSDGTYKYGGKSFK--ASSSGASLNECKSVAHKAL  326

Query  937   DF-RAPCKYPNCTFNGVWSGGGGAGMENVDISSYFYDIAIDVGIIDEGKASKIVKPRSFL  1113
                 + C +  CTF G+W+GGGG G +N+ ++S+F+D A + G +D      IV+P  F 
Sbjct  327   KVNESTCTHMKCTFGGIWNGGGGDGQKNLFVASFFFDRAAEAGFVDPNSPVAIVRPADFE  386

Query  1114  VAAKLACETKFEDVKSTFPNAVEKDYPYLCMDLVYQYTLLVDGLGLHPYKEITLMKKVEY  1293
              AAK AC+TK E+ KST+P   E + PYLCMDLVYQYTLLVDG G++P++EITL+KKV+Y
Sbjct  387   DAAKQACQTKLENAKSTYPRVEEGNLPYLCMDLVYQYTLLVDGFGIYPWQEITLVKKVKY  446

Query  1294  KNYMVEAAWPLGCAIDVIS  1350
              + +VEAAWPLG AI+ +S
Sbjct  447   DDALVEAAWPLGSAIEAVS  465



>gb|KHG24482.1| Nucleoside-triphosphatase [Gossypium arboreum]
Length=469

 Score =   460 bits (1183),  Expect = 9e-154, Method: Compositional matrix adjust.
 Identities = 237/463 (51%), Positives = 321/463 (69%), Gaps = 19/463 (4%)
 Frame = +1

Query  22    KHNTMKHTSHHH---LVFISLALLLFPLACFS---------------RSHLRRVLLNHEA  147
             +H+++    H +   L+ I++ +LL     F                  + R+V  N   
Sbjct  7     RHDSISDKIHRYRGVLLVIAIPILLVTFVLFVMPGKSSTDTAVMEEIEINSRKVGANSRG  66

Query  148   G-NYAVIFDAGSTGSRVHVFHFDENLDLLPVGDGVEFFLKITPGLSSYADDPEAAAKSLE  324
               NYAVIFDAGS+GSRVHV+ FD+NLDL+P+G  +E F ++ PGLSSYA DP+AAAKSL 
Sbjct  67    NRNYAVIFDAGSSGSRVHVYCFDQNLDLVPIGSELELFEQLKPGLSSYAKDPQAAAKSLL  126

Query  325   PLLLEAEGVVPTELQPDTPLELGATAGLRLLEGDASDKILQAVRDMFKNESNFKSKAEWV  504
              LL +AE VVP +L+  TP+ +GATAGLR LEGDA+D+ILQAVR++ K+ S  KS+A  V
Sbjct  127   SLLDKAESVVPLDLRSKTPVRVGATAGLRALEGDAADRILQAVRELLKDRSTLKSEANGV  186

Query  505   SILEGSQEGTYFWVAMNYLLGNLGKGYQNTIATIDLGGGSVQVSYAVSGDTFANAPKPHN  684
              IL+G+QEG+Y WV +NYLLG LG  Y++T+  IDLGGGSVQ++YA+S +  +NAP    
Sbjct  187   KILDGTQEGSYEWVTVNYLLGKLGGTYKDTVGIIDLGGGSVQMAYAISKEAASNAPSVPA  246

Query  685   GEEPYVQEKYILGAQYYLYVHSYLNYGQLASRAEIFKASGNSTNPCVLEGYDGYYTYNDV  864
             G++ YV E Y+ G++YYLYVHSYL YG LA+RAEI KAS +S NPC+LEG+DG Y Y   
Sbjct  247   GQDNYVNEMYLKGSKYYLYVHSYLCYGLLAARAEILKASDDSGNPCILEGFDGTYAYGGN  306

Query  865   SYKVTAPPNGSSLKNCRKLARKVVDFRAPCKYPNCTFNGVWSGGGGAGMENVDISSYFYD  1044
              YK +AP +G+S++ CR++  K +     C +  CTF G+W+GGGG G +N+ I+S+F+D
Sbjct  307   QYKASAPSSGASMEECRRVTHKALKINDTCMHMKCTFGGIWNGGGGDGQKNLFIASFFFD  366

Query  1045  IAIDVGIIDEGKASKIVKPRSFLVAAKLACETKFEDVKSTFPNAVEKDYPYLCMDLVYQY  1224
              A + G I        V+P SF  AAK AC TK+ D+K+T+P     +  YLC+DLVYQY
Sbjct  367   RAAEAGFIKAADPVATVQPHSFAEAAKRACGTKYTDIKATYPAVDVGNQAYLCLDLVYQY  426

Query  1225  TLLVDGLGLHPYKEITLMKKVEYKNYMVEAAWPLGCAIDVISS  1353
             TLLVDG GL PY++ITL+KKV+++N  VEAAWPLG AI+ +SS
Sbjct  427   TLLVDGFGLDPYQDITLVKKVKFRNSFVEAAWPLGSAIEAVSS  469



>gb|ABK51386.1| apyrase-like protein [Nicotiana tabacum]
Length=472

 Score =   460 bits (1184),  Expect = 1e-153, Method: Compositional matrix adjust.
 Identities = 242/436 (56%), Positives = 310/436 (71%), Gaps = 4/436 (1%)
 Frame = +1

Query  58    LVFISLALLLFPLACFSRSHL---RRVLLNHEAGNYAVIFDAGSTGSRVHVFHFDENLDL  228
             L  +SL L + P    S S     R+   N  +  YAVIFDAGS+GSRVHVF FDENLDL
Sbjct  35    LFLVSLVLYVMPTRSPSDSMESLNRKFSPNLGSMRYAVIFDAGSSGSRVHVFCFDENLDL  94

Query  229   LPVGDGVEFFLKITPGLSSYADDPEAAAKSLEPLLLEAEGVVPTELQPDTPLELGATAGL  408
             +P+G+ +E F++  PGLSSYA DPEAAA+SL  LL EAE VVP  L+ +TP+ +GATAGL
Sbjct  95    VPIGNELELFVQEKPGLSSYASDPEAAAESLLSLLKEAENVVPRNLRSNTPVRVGATAGL  154

Query  409   RLLEGDASDKILQAVRDMFKNESNFKSKAEWVSILEGSQEGTYFWVAMNYLLGNLGKGYQ  588
             R LEGDASD+ILQAVRD  K++S+FK+KA+ V++L+G+QEG Y WV +NYLLG LGK Y 
Sbjct  155   RQLEGDASDRILQAVRDFLKSKSSFKAKADAVTVLDGNQEGAYQWVTINYLLGKLGKKYS  214

Query  589   NTIATIDLGGGSVQVSYAVSGDTFANAPKPHNGEEPYVQEKYILGAQYYLYVHSYLNYGQ  768
             +T+  +DLGGGSVQ++YA+S      APK  +GE+ YVQE Y+ G +YYLY+HSYL+YG 
Sbjct  215   DTVGVVDLGGGSVQMAYAISESDAQKAPKVSDGEDTYVQEMYLKGTKYYLYIHSYLHYGL  274

Query  769   LASRAEIFKASGNSTNPCVLEGYDGYYTYNDVSYKVTAPPNGSSLKNCRKLARKVVDFRA  948
             LA+RAEI KA+  S NPC+L GY G Y Y    Y  +A   GSSL +C +++ K +    
Sbjct  275   LAARAEILKATDESGNPCILGGYHGSYKYGGAVYPASAMSQGSSLSSCMEVSLKALKVNE  334

Query  949   P-CKYPNCTFNGVWSGGGGAGMENVDISSYFYDIAIDVGIIDEGKASKIVKPRSFLVAAK  1125
             P C +  CTF GVW+GGGG G +N+ ++S+F+D A + G+++   A   V+P  +  AAK
Sbjct  335   PTCTHMKCTFGGVWNGGGGDGQKNMFVASFFFDRAAEAGMVNPSLAVAKVRPVDYESAAK  394

Query  1126  LACETKFEDVKSTFPNAVEKDYPYLCMDLVYQYTLLVDGLGLHPYKEITLMKKVEYKNYM  1305
              ACET  E  KS FP     + PY+CMDLVYQYTLLVDG GL P +EITL+KKV YKN +
Sbjct  395   RACETGLEGAKSAFPRVDPDNLPYMCMDLVYQYTLLVDGFGLDPQQEITLVKKVRYKNSL  454

Query  1306  VEAAWPLGCAIDVISS  1353
             VEAAWPLG AI+V SS
Sbjct  455   VEAAWPLGSAIEVASS  470



>ref|XP_010999472.1| PREDICTED: apyrase 2-like [Populus euphratica]
Length=457

 Score =   459 bits (1181),  Expect = 1e-153, Method: Compositional matrix adjust.
 Identities = 240/444 (54%), Positives = 313/444 (70%), Gaps = 9/444 (2%)
 Frame = +1

Query  64    FISLALLLFPLACFSRSHLRRVL------LNHEAGNYAVIFDAGSTGSRVHVFHFDENLD  225
             F+ +  +L P A +  ++ R VL      L+ ++ +YAV+FDAGSTGSRVHVF FD++ D
Sbjct  14    FLLMVFVLPPSAAYKITNPRIVLPVRSKGLDADSRSYAVVFDAGSTGSRVHVFCFDQDFD  73

Query  226   LLPVGDGVEF--FLKITPGLSSYADDPEAAAKSLEPLLLEAEGVVPTELQPDTPLELGAT  399
             LLPVG+G +F  F ++TPGLS+YA+DP+AAA SL PLL EAE VVP E  P TP+ LGAT
Sbjct  74    LLPVGNGTDFELFAQVTPGLSAYAEDPQAAADSLVPLLNEAESVVPEEFSPKTPVRLGAT  133

Query  400   AGLRLLEGDASDKILQAVRDMFKNESNFKSKAEWVSILEGSQEGTYFWVAMNYLLGNLGK  579
             AGLRLLEGD++++IL+AVRD+  + S  + +A+ VSIL GSQEG Y W+A+NY++GNLGK
Sbjct  134   AGLRLLEGDSAERILEAVRDLLSHGS-LEYEADDVSILTGSQEGYYMWIAINYIVGNLGK  192

Query  580   GYQNTIATIDLGGGSVQVSYAVSGDTFANAPKPHNGEEPYVQEKYILGAQYYLYVHSYLN  759
              Y  T A ID GGGSVQ++YA+S +    AP   +GE PYV++  + G QYY+YVHSYL+
Sbjct  193   PYSETAAVIDQGGGSVQMAYAISRENAEKAPIVADGEAPYVEKFLLRGTQYYVYVHSYLS  252

Query  760   YGQLASRAEIFKASGNSTNPCVLEGYDGYYTYNDVSYKVTAPPNGSSLKNCRKLARKVVD  939
             YG LASRAE+ K SGNS+N CV  GY+G Y Y    YK ++ P G+S K CRK+  K + 
Sbjct  253   YGLLASRAEMLKVSGNSSNECVTTGYNGVYKYGGKEYKASSSPTGTSFKKCRKVVLKALK  312

Query  940   FRAPCKYPNCTFNGVWSGGGGAGMENVDISSYFYDIAIDVGIIDEGKASKIVKPRSFLVA  1119
               APCKY NCTF GVW+GGGG G  N   SS+F+ ++   G +D    +       F  A
Sbjct  313   INAPCKYVNCTFGGVWNGGGGDGQNNFYASSFFFSMSQAAGFVDANAHTATASAADFKKA  372

Query  1120  AKLACETKFEDVKSTFPNAVEKDYPYLCMDLVYQYTLLVDGLGLHPYKEITLMKKVEYKN  1299
             AK AC T+FED  S FPNA EKD P+LCMD  Y+YTLLVDG GLHP K I++  ++ Y+N
Sbjct  373   AKRACGTRFEDASSRFPNAREKDLPFLCMDFTYEYTLLVDGYGLHPRKNISVAGQLTYEN  432

Query  1300  YMVEAAWPLGCAIDVISSSSANNL  1371
              ++EAAWPLG AI+ +S SSA+ L
Sbjct  433   SLMEAAWPLGSAIEAVSPSSASFL  456



>emb|CDP19074.1| unnamed protein product [Coffea canephora]
Length=477

 Score =   460 bits (1183),  Expect = 1e-153, Method: Compositional matrix adjust.
 Identities = 238/438 (54%), Positives = 311/438 (71%), Gaps = 6/438 (1%)
 Frame = +1

Query  58    LVFISLALLLFPLACFSRSHLRRVLL-----NHEAGNYAVIFDAGSTGSRVHVFHFDENL  222
             L+ +++ L L P    S S  R+        N  A +YAVIFDAGS+GSRVHVF FD +L
Sbjct  38    LLLVTIVLFLMPARSPSDSLPRKFSPMNANDNANARSYAVIFDAGSSGSRVHVFCFDSHL  97

Query  223   DLLPVGDGVEFFLKITPGLSSYADDPEAAAKSLEPLLLEAEGVVPTELQPDTPLELGATA  402
             DL+P+G  +E F +  PGLS++A+DPEAAA SL+ LL +AE VVP EL+  TP+ +GATA
Sbjct  98    DLVPIGKDLELFEQKKPGLSAFANDPEAAANSLQELLQKAEAVVPPELRQKTPVRVGATA  157

Query  403   GLRLLEGDASDKILQAVRDMFKNESNFKSKAEWVSILEGSQEGTYFWVAMNYLLGNLGKG  582
             GLR LEGDASD+ILQAVRD  KN+S+  SKA+WV++++G+QEG Y WV +NYL G LGK 
Sbjct  158   GLRQLEGDASDRILQAVRDFLKNKSSLTSKADWVTVIDGNQEGAYQWVTINYLSGKLGKK  217

Query  583   YQNTIATIDLGGGSVQVSYAVSGDTFANAPKPHNGEEPYVQEKYILGAQYYLYVHSYLNY  762
             Y  T+  +DLGGGSVQ++YA+S    A APK  +GE+ YVQE Y+ G +YYLYVHSYL+Y
Sbjct  218   YSRTVGVVDLGGGSVQMAYAISESDAAKAPKLPDGEDAYVQEMYLKGTKYYLYVHSYLHY  277

Query  763   GQLASRAEIFKASGNSTNPCVLEGYDGYYTYNDVSYKVTAPPNGSSLKNCRKLARKVVDF  942
             G LA+RAEI KA   S+NPC+L G+D  Y Y    Y  +A P+GS+   CR++A K +  
Sbjct  278   GLLAARAEILKAGVESSNPCILAGFDESYKYGGKEYPSSASPSGSNFNGCREVALKALKV  337

Query  943   R-APCKYPNCTFNGVWSGGGGAGMENVDISSYFYDIAIDVGIIDEGKASKIVKPRSFLVA  1119
               + C +  CTF GVW+GGGG G +N+ ++S+F+D A + G +D       V P  F  A
Sbjct  338   NDSACTHMKCTFGGVWNGGGGDGQKNLFVASFFFDRAAEAGFVDPHAHVAKVHPVDFEEA  397

Query  1120  AKLACETKFEDVKSTFPNAVEKDYPYLCMDLVYQYTLLVDGLGLHPYKEITLMKKVEYKN  1299
             AK AC+T+ ED +ST+      + PYLCMDLVYQ+TLLVDG GL P++EITL+KKVEYKN
Sbjct  398   AKRACQTRLEDARSTYSRVEPDNLPYLCMDLVYQFTLLVDGFGLDPWQEITLVKKVEYKN  457

Query  1300  YMVEAAWPLGCAIDVISS  1353
              +VEAAWPLG AI+V+SS
Sbjct  458   SLVEAAWPLGSAIEVVSS  475



>ref|XP_004253046.1| PREDICTED: probable apyrase 2 [Solanum lycopersicum]
Length=472

 Score =   459 bits (1181),  Expect = 2e-153, Method: Compositional matrix adjust.
 Identities = 242/438 (55%), Positives = 310/438 (71%), Gaps = 4/438 (1%)
 Frame = +1

Query  58    LVFISLALLLFPLACFSRSHL---RRVLLNHEAGNYAVIFDAGSTGSRVHVFHFDENLDL  228
             L  +SL L + P    S S     R+   N  +  YAVIFDAGS+GSRVHVF FDENLDL
Sbjct  35    LFLVSLVLYVMPTRYPSDSMESLNRKFSPNLGSMKYAVIFDAGSSGSRVHVFCFDENLDL  94

Query  229   LPVGDGVEFFLKITPGLSSYADDPEAAAKSLEPLLLEAEGVVPTELQPDTPLELGATAGL  408
             +P+G+ +E F++  PGLSS+A DP AAA SL PLL +AE VVP  L+ +TP+ +GATAGL
Sbjct  95    VPIGNELELFVQKKPGLSSFASDPVAAADSLLPLLKDAENVVPRNLRSNTPVRVGATAGL  154

Query  409   RLLEGDASDKILQAVRDMFKNESNFKSKAEWVSILEGSQEGTYFWVAMNYLLGNLGKGYQ  588
             R LEGDASD+ILQAVRD  K++S+FK+KA+ V++L+G+QEG Y WV++NYLLG LGK Y 
Sbjct  155   RQLEGDASDRILQAVRDFLKSKSSFKAKADAVTVLDGNQEGAYQWVSINYLLGKLGKKYS  214

Query  589   NTIATIDLGGGSVQVSYAVSGDTFANAPKPHNGEEPYVQEKYILGAQYYLYVHSYLNYGQ  768
             +T+  +DLGGGSVQ++YA+S      APK  +GE+ YVQE ++ G +YYLYVHSYL+YG 
Sbjct  215   DTVGVVDLGGGSVQMAYAISESDAQKAPKVSDGEDTYVQEMFLKGTKYYLYVHSYLHYGL  274

Query  769   LASRAEIFKASGNSTNPCVLEGYDGYYTYNDVSYKVTAPPNGSSLKNCRKLARKVVDFRA  948
             LA+RAEI K SG S +PC+L G+ G Y Y    Y  +A   GSS+  CR++A K +    
Sbjct  275   LAARAEILKVSGESGSPCILGGHHGTYKYGGAVYPASATSQGSSMSTCREVALKALKINE  334

Query  949   P-CKYPNCTFNGVWSGGGGAGMENVDISSYFYDIAIDVGIIDEGKASKIVKPRSFLVAAK  1125
             P C +  CTF GVW+GGGG G +N+ ++S+F+D A + GII+   A   V+P  +  AA 
Sbjct  335   PACTHMKCTFGGVWNGGGGDGQKNMFVASFFFDRAAEAGIINPSLAVAKVRPADYESAAN  394

Query  1126  LACETKFEDVKSTFPNAVEKDYPYLCMDLVYQYTLLVDGLGLHPYKEITLMKKVEYKNYM  1305
              AC T  E  KS FP     + PYLCMDLVYQYTLLVDG GL P++E+TL+KKVEYKN  
Sbjct  395   RACATGLEGAKSEFPRVEADNLPYLCMDLVYQYTLLVDGFGLEPHQEMTLVKKVEYKNSF  454

Query  1306  VEAAWPLGCAIDVISSSS  1359
             VEAAWPLG AI+V SS S
Sbjct  455   VEAAWPLGSAIEVASSLS  472



>dbj|BAD80836.1| apyrase [Vigna unguiculata subsp. unguiculata]
Length=455

 Score =   458 bits (1179),  Expect = 2e-153, Method: Compositional matrix adjust.
 Identities = 220/414 (53%), Positives = 291/414 (70%), Gaps = 0/414 (0%)
 Frame = +1

Query  112   SHLRRVLLNHEAGNYAVIFDAGSTGSRVHVFHFDENLDLLPVGDGVEFFLKITPGLSSYA  291
             +H +      E  +YAVIFDAGSTGSRVHVFHFD+NLDLL +G+ +EF+ K+TPGLS+YA
Sbjct  31    THRKIFPKQQELTSYAVIFDAGSTGSRVHVFHFDQNLDLLHIGNEIEFYDKVTPGLSAYA  90

Query  292   DDPEAAAKSLEPLLLEAEGVVPTELQPDTPLELGATAGLRLLEGDASDKILQAVRDMFKN  471
             D+PE AAKSL PLL EAE VVP EL P TP++LGATAGLRLL+GDAS++ILQAVRD+ KN
Sbjct  91    DNPENAAKSLVPLLEEAESVVPQELYPTTPVKLGATAGLRLLDGDASERILQAVRDLLKN  150

Query  472   ESNFKSKAEWVSILEGSQEGTYFWVAMNYLLGNLGKGYQNTIATIDLGGGSVQVSYAVSG  651
              S F  + + V+I++G+QEG+Y WV +NYLLGNLGK +  T+  +DLGGGSVQ++YAVS 
Sbjct  151   RSTFSVQPDAVAIIDGTQEGSYLWVTINYLLGNLGKKFSKTVGVVDLGGGSVQMAYAVSK  210

Query  652   DTFANAPKPHNGEEPYVQEKYILGAQYYLYVHSYLNYGQLASRAEIFKASGNSTNPCVLE  831
             +T  NAP+P   EEPY+++  + G +Y LYVHSYL+YG+ A RAE  K +  S NPC+L 
Sbjct  211   NTAKNAPQPQPEEEPYIKKLVLKGKKYDLYVHSYLHYGREAFRAEALKVTDGSANPCILS  270

Query  832   GYDGYYTYNDVSYKVTAPPNGSSLKNCRKLARKVVDFRAPCKYPNCTFNGVWSGGGGAGM  1011
             G+ G YTY+   YK  AP +GS+   CRK+  + +     C + NC+F G+W GG G+G 
Sbjct  271   GFYGTYTYSGEDYKAFAPISGSNYHECRKIVLQGLKVNQFCAHRNCSFGGIWDGGKGSGQ  330

Query  1012  ENVDISSYFYDIAIDVGIIDEGKASKIVKPRSFLVAAKLACETKFEDVKSTFPNAVEKDY  1191
               +  +S FY +A ++G+    K +  + P      AK ACE  FED  S +P       
Sbjct  331   NTLFGTSSFYYLASEIGMFGPNKPNSKIHPLDLKTEAKRACEKTFEDATSAYPLLSADRV  390

Query  1192  PYLCMDLVYQYTLLVDGLGLHPYKEITLMKKVEYKNYMVEAAWPLGCAIDVISS  1353
             PY+C+DL YQY LL DG GL P +EIT+  ++EY++ +VEAAWPLG AI+ ISS
Sbjct  391   PYVCLDLTYQYALLTDGFGLDPLQEITVANEIEYQDALVEAAWPLGTAIEAISS  444



>dbj|BAD80837.1| apyrase [Vigna unguiculata subsp. unguiculata]
Length=469

 Score =   459 bits (1181),  Expect = 3e-153, Method: Compositional matrix adjust.
 Identities = 231/441 (52%), Positives = 318/441 (72%), Gaps = 8/441 (2%)
 Frame = +1

Query  58    LVFISLALLLFPLACFSRSHLRRVLLNHE-------AGNYAVIFDAGSTGSRVHVFHFDE  216
             L+ I   L + P +  + S     L+N +        G+YAVIFDAGS+GSRVHVFHFD+
Sbjct  29    LLLIVFVLYVMPSSSSNESAGDFALVNRKMSPNKKSGGSYAVIFDAGSSGSRVHVFHFDQ  88

Query  217   NLDLLPVGDGVEFFLKITPGLSSYADDPEAAAKSLEPLLLEAEGVVPTELQPDTPLELGA  396
             NLDL+ +G  +E F+++ PGLSSYA DP+ AA+SL PLL +AE VVP EL+  T + +GA
Sbjct  89    NLDLVHIGKDLELFVQLKPGLSSYAQDPKKAAESLVPLLEKAESVVPRELRSKTIVRVGA  148

Query  397   TAGLRLLEGDASDKILQAVRDMFKNESNFKSKAEWVSILEGSQEGTYFWVAMNYLLGNLG  576
             TAGLR LEGDASD+ILQAVRD+ K++S+ +S+ + V++L+G+QEG Y WV +NYLLGNLG
Sbjct  149   TAGLRALEGDASDRILQAVRDLLKDKSSLRSEIDAVTVLDGTQEGAYQWVTINYLLGNLG  208

Query  577   KGYQNTIATIDLGGGSVQVSYAVSGDTFANAPKPHNGEEPYVQEKYILGAQYYLYVHSYL  756
             K Y  T+  +DLGGGSVQ++YA+S    A APK  +G +PYV+E ++ G +YY+YVHSYL
Sbjct  209   KDYSKTVGVVDLGGGSVQMAYAISETDAAMAPKVADGGDPYVREMFLRGRKYYVYVHSYL  268

Query  757   NYGQLASRAEIFKASGNSTNPCVLEGYDGYYTYNDVSYKVTAPPNGSSLKNCRKLARKVV  936
              YG LA+RAEI K S ++ NPC+L GYDG Y Y   S+K ++   G+++  C+ +A K +
Sbjct  269   RYGLLAARAEILKVSDDAENPCILSGYDGSYLYGGKSFKASSSSLGANINECKSVALKAL  328

Query  937   DF-RAPCKYPNCTFNGVWSGGGGAGMENVDISSYFYDIAIDVGIIDEGKASKIVKPRSFL  1113
                 + C +  CTF G+W+GGGG G +N+ ++S+F+D A + G  D      IV+P  F 
Sbjct  329   KVNESACTHMKCTFGGIWNGGGGDGQKNLFVASFFFDRAAEAGFADPKSPVAIVRPADFE  388

Query  1114  VAAKLACETKFEDVKSTFPNAVEKDYPYLCMDLVYQYTLLVDGLGLHPYKEITLMKKVEY  1293
              AAK AC+TK E+ KST+PN  E + PYLCMDLVYQYTLLVDG G++P++E+TL+KKV+Y
Sbjct  389   DAAKQACQTKLENAKSTYPNVDEGNLPYLCMDLVYQYTLLVDGFGIYPWQEVTLVKKVKY  448

Query  1294  KNYMVEAAWPLGCAIDVISSS  1356
              + +VEAAWPLG AI+ +SS+
Sbjct  449   DDALVEAAWPLGSAIEAVSST  469



>ref|XP_002325398.1| putative apyrase family protein [Populus trichocarpa]
 gb|ABK94907.1| unknown [Populus trichocarpa]
 gb|EEE99779.1| putative apyrase family protein [Populus trichocarpa]
Length=457

 Score =   458 bits (1178),  Expect = 4e-153, Method: Compositional matrix adjust.
 Identities = 240/444 (54%), Positives = 313/444 (70%), Gaps = 9/444 (2%)
 Frame = +1

Query  64    FISLALLLFPLACFSRSHLRRVL------LNHEAGNYAVIFDAGSTGSRVHVFHFDENLD  225
             F+ +  +L   A +  ++ R VL      L+ ++ +YAV+FDAGSTGSRVHVF FD+N D
Sbjct  14    FLLMVFVLPTSAAYKFTNPRIVLPVRSKGLDADSRSYAVVFDAGSTGSRVHVFCFDQNFD  73

Query  226   LLPVGDGV--EFFLKITPGLSSYADDPEAAAKSLEPLLLEAEGVVPTELQPDTPLELGAT  399
             LLPVG+    EFF ++ PGLS+YA DP+AAA SL PLL EAE VVP E  P TP++LGAT
Sbjct  74    LLPVGNDTDFEFFAQVRPGLSAYAKDPQAAANSLVPLLNEAESVVPEEFSPKTPVKLGAT  133

Query  400   AGLRLLEGDASDKILQAVRDMFKNESNFKSKAEWVSILEGSQEGTYFWVAMNYLLGNLGK  579
             AGLRLLEGD++++IL+AVRD+  + S  + +A+ VSIL GSQEG Y W+A+NY++GNLGK
Sbjct  134   AGLRLLEGDSAERILEAVRDLLSHGS-LEYEADDVSILSGSQEGYYMWIAINYMVGNLGK  192

Query  580   GYQNTIATIDLGGGSVQVSYAVSGDTFANAPKPHNGEEPYVQEKYILGAQYYLYVHSYLN  759
              Y  T A ID GGGSVQ++YA+S +    AP   +GE+PYV++  + GA+YY+YVHSYL+
Sbjct  193   PYSETAAVIDQGGGSVQMAYAISRENAEKAPTVADGEDPYVEKFLLRGAEYYVYVHSYLS  252

Query  760   YGQLASRAEIFKASGNSTNPCVLEGYDGYYTYNDVSYKVTAPPNGSSLKNCRKLARKVVD  939
             YG LASRAEI K S NS+N CV  GY+G Y Y    YK ++ P G+S K CR L  K + 
Sbjct  253   YGLLASRAEILKVSRNSSNECVATGYNGVYKYGGKEYKASSSPTGTSFKKCRTLVLKALK  312

Query  940   FRAPCKYPNCTFNGVWSGGGGAGMENVDISSYFYDIAIDVGIIDEGKASKIVKPRSFLVA  1119
               APC Y NCTF GVW+GGGG G  N   SS+F+ ++   G +D    +       F  A
Sbjct  313   VNAPCNYVNCTFGGVWNGGGGDGQNNFYASSFFFSMSQAAGFVDANAYTATASAADFKKA  372

Query  1120  AKLACETKFEDVKSTFPNAVEKDYPYLCMDLVYQYTLLVDGLGLHPYKEITLMKKVEYKN  1299
             AK ACET+FED  S FPNA+E+D P+LCMD  Y+YTLLVDG GLHP K+ ++ +KV+YKN
Sbjct  373   AKRACETRFEDASSRFPNALEEDLPFLCMDFTYEYTLLVDGFGLHPQKKFSVEEKVKYKN  432

Query  1300  YMVEAAWPLGCAIDVISSSSANNL  1371
              ++EAAWPLG AI+ +S SSA+ L
Sbjct  433   SLMEAAWPLGSAIEAVSPSSASFL  456



>ref|XP_006604215.1| PREDICTED: apyrase 2-like [Glycine max]
Length=469

 Score =   458 bits (1178),  Expect = 7e-153, Method: Compositional matrix adjust.
 Identities = 230/441 (52%), Positives = 320/441 (73%), Gaps = 8/441 (2%)
 Frame = +1

Query  58    LVFISLALLLFPLACFSRSHLRRVLLNHE-------AGNYAVIFDAGSTGSRVHVFHFDE  216
             L+ I+  L + P +  + S     L+N +       AG+YAVIFDAGS+GSRVHVFHFD 
Sbjct  29    LLLITFVLYVMPSSISNESVGGYALVNRKVSPVEKSAGSYAVIFDAGSSGSRVHVFHFDH  88

Query  217   NLDLLPVGDGVEFFLKITPGLSSYADDPEAAAKSLEPLLLEAEGVVPTELQPDTPLELGA  396
             NLDL+ +G  +E F++  PGLS++A +P+ AA+SL  LL EAE VVP EL+  TP+ +GA
Sbjct  89    NLDLVHIGKDLELFVQKKPGLSAFAKNPKQAAESLVSLLEEAESVVPRELRSKTPVRVGA  148

Query  397   TAGLRLLEGDASDKILQAVRDMFKNESNFKSKAEWVSILEGSQEGTYFWVAMNYLLGNLG  576
             TAGLR LEGDASD+ILQAVRD+ K+ S+ KS+++ V++L+G+QEG Y WV +NYLLGNLG
Sbjct  149   TAGLRALEGDASDRILQAVRDLLKDRSSLKSESDAVTVLDGTQEGAYQWVTINYLLGNLG  208

Query  577   KGYQNTIATIDLGGGSVQVSYAVSGDTFANAPKPHNGEEPYVQEKYILGAQYYLYVHSYL  756
             K +  T+  +DLGGGSVQ++YA+S    A APK  +G +PYV+E ++ G +YYLYVHSYL
Sbjct  209   KDHSKTVGVVDLGGGSVQMAYAISETDAAMAPKVADGGDPYVKEMFLRGRKYYLYVHSYL  268

Query  757   NYGQLASRAEIFKASGNSTNPCVLEGYDGYYTYNDVSYKVTAPPNGSSLKNCRKLARKVV  936
             +YG LA+RAEI KAS ++ NPC++ GYDG Y Y    +K ++  +G+SL  C+ +A + +
Sbjct  269   HYGLLAARAEILKASDDAENPCIISGYDGSYNYGGKLFKASSGSSGTSLNECKSVALRAL  328

Query  937   DF-RAPCKYPNCTFNGVWSGGGGAGMENVDISSYFYDIAIDVGIIDEGKASKIVKPRSFL  1113
                 + C +  CTF G+W+GGGG G +N+ ++S+F+D A++ G  D      IV+P  F 
Sbjct  329   KVNESTCTHMKCTFGGIWNGGGGDGQKNLFVASFFFDRAVEAGFADPNLPVAIVRPADFE  388

Query  1114  VAAKLACETKFEDVKSTFPNAVEKDYPYLCMDLVYQYTLLVDGLGLHPYKEITLMKKVEY  1293
              AAK AC+T+ E+ KSTFP   E + PYLCMDL+YQYTLLVDG G++P++EITL+KKV+Y
Sbjct  389   DAAKQACQTELENAKSTFPRVDEGNLPYLCMDLIYQYTLLVDGFGIYPWQEITLVKKVKY  448

Query  1294  KNYMVEAAWPLGCAIDVISSS  1356
              + +VEAAWPLG AI+ +SS+
Sbjct  449   DDALVEAAWPLGSAIEAVSST  469



>ref|XP_007161770.1| hypothetical protein PHAVU_001G096900g [Phaseolus vulgaris]
 gb|ESW33764.1| hypothetical protein PHAVU_001G096900g [Phaseolus vulgaris]
Length=469

 Score =   456 bits (1173),  Expect = 3e-152, Method: Compositional matrix adjust.
 Identities = 231/441 (52%), Positives = 320/441 (73%), Gaps = 8/441 (2%)
 Frame = +1

Query  58    LVFISLALLLFPLACFSRSHLRRVLLNHE-------AGNYAVIFDAGSTGSRVHVFHFDE  216
             L+ I   L + P +  + S     L+N +        G+YAVIFDAGS+GSRVHVFHFD+
Sbjct  29    LLLIVFVLYVMPSSSSNESAGDYALVNRKMSPNKKSGGSYAVIFDAGSSGSRVHVFHFDQ  88

Query  217   NLDLLPVGDGVEFFLKITPGLSSYADDPEAAAKSLEPLLLEAEGVVPTELQPDTPLELGA  396
             NLDL+ +G  +E F+++ PGLS+YA DP+ AA+SL PLL +AE VVP EL+  TP+ +GA
Sbjct  89    NLDLVHIGKDLELFVQLKPGLSAYAQDPKKAAESLVPLLEKAESVVPRELRSKTPVRVGA  148

Query  397   TAGLRLLEGDASDKILQAVRDMFKNESNFKSKAEWVSILEGSQEGTYFWVAMNYLLGNLG  576
             TAGLR LEGDASDKILQAVRD+ K++++ +S+ + V++L+G+QEG Y WV +NYLLGNLG
Sbjct  149   TAGLRALEGDASDKILQAVRDLLKDKTSLRSETDAVTVLDGTQEGAYQWVTINYLLGNLG  208

Query  577   KGYQNTIATIDLGGGSVQVSYAVSGDTFANAPKPHNGEEPYVQEKYILGAQYYLYVHSYL  756
             K Y  T+  +DLGGGSVQ++YA+S    A APK  +G +PYV+E ++ G +YYLYVHSYL
Sbjct  209   KDYSKTVGVVDLGGGSVQMAYAISETDAAMAPKVPDGGDPYVKEMFLRGRKYYLYVHSYL  268

Query  757   NYGQLASRAEIFKASGNSTNPCVLEGYDGYYTYNDVSYKVTAPPNGSSLKNCRKLARKVV  936
              YG LA+RAEI K S ++ NPC+L GYDG Y Y   ++K ++  +G+S+  C+ +A K +
Sbjct  269   RYGLLAARAEILKVSDDAENPCILSGYDGSYVYGGKTFKASSSSSGASINECKSVALKAL  328

Query  937   DF-RAPCKYPNCTFNGVWSGGGGAGMENVDISSYFYDIAIDVGIIDEGKASKIVKPRSFL  1113
                 + C +  CTF G+W+GGGG G +N+ ++S+F+D A + G  D      IV+P  F 
Sbjct  329   KVNESSCTHMKCTFGGIWNGGGGDGQKNLFVASFFFDRAAEAGFADPNSPVAIVRPADFE  388

Query  1114  VAAKLACETKFEDVKSTFPNAVEKDYPYLCMDLVYQYTLLVDGLGLHPYKEITLMKKVEY  1293
              AAK AC+TK E+ KST+P+  E + PYLCMDLVYQYTLLVDG G++P++E+TL+KKV+Y
Sbjct  389   DAAKRACQTKLENAKSTYPHVEEGNLPYLCMDLVYQYTLLVDGFGIYPWQEVTLVKKVKY  448

Query  1294  KNYMVEAAWPLGCAIDVISSS  1356
              + +VEAAWPLG AI+ +SS+
Sbjct  449   DDALVEAAWPLGSAIEAVSST  469



>gb|AAF00611.1|AF156782_1 nod factor binding lectin-nucleotide phosphohydrolase [Medicago 
sativa]
Length=455

 Score =   455 bits (1171),  Expect = 5e-152, Method: Compositional matrix adjust.
 Identities = 228/440 (52%), Positives = 313/440 (71%), Gaps = 8/440 (2%)
 Frame = +1

Query  58    LVFISLALLLFPLACFSRSHL-------RRVLLNHEA-GNYAVIFDAGSTGSRVHVFHFD  213
             +  I+  LLL   A  S  +L       R++    E   +YAVIFDAGSTG+RVHV+HFD
Sbjct  5     ITLIATFLLLLMPAITSSQYLGNNLLTNRKIFQKQETLTSYAVIFDAGSTGTRVHVYHFD  64

Query  214   ENLDLLPVGDGVEFFLKITPGLSSYADDPEAAAKSLEPLLLEAEGVVPTELQPDTPLELG  393
             +NLDLL +G+ +EF  KI PGLS+Y D+PE AAKSL PLL EAE VVP +L P TPL LG
Sbjct  65    QNLDLLHIGNDIEFVDKIKPGLSAYGDNPEQAAKSLIPLLEEAEDVVPEDLHPKTPLRLG  124

Query  394   ATAGLRLLEGDASDKILQAVRDMFKNESNFKSKAEWVSILEGSQEGTYFWVAMNYLLGNL  573
             ATAGLRLL GDA++KILQA R+MF N S    + + VSI++G+QEG+Y WV +NY+LGNL
Sbjct  125   ATAGLRLLNGDAAEKILQATRNMFSNRSTLNVQRDAVSIIDGTQEGSYMWVTVNYVLGNL  184

Query  574   GKGYQNTIATIDLGGGSVQVSYAVSGDTFANAPKPHNGEEPYVQEKYILGAQYYLYVHSY  753
             GK +  ++  IDLGGGSVQ++YAVS  T  NAPK  +GE+PY+++  + G QY LYVHSY
Sbjct  185   GKSFTKSVGVIDLGGGSVQMTYAVSKKTAKNAPKVADGEDPYIKKLVLKGKQYDLYVHSY  244

Query  754   LNYGQLASRAEIFKASGNSTNPCVLEGYDGYYTYNDVSYKVTAPPNGSSLKNCRKLARKV  933
             L +G+ A+RA++  A+  S NPC+L G++G +TY+ V YK  +P +GS+  +C+++  KV
Sbjct  245   LRFGKEATRAQVLNATNGSANPCILPGFNGTFTYSGVEYKAFSPSSGSNFDDCKEIILKV  304

Query  934   VDFRAPCKYPNCTFNGVWSGGGGAGMENVDISSYFYDIAIDVGIIDEGKASKIVKPRSFL  1113
             +    PC YP+CTF G+W+GGGG+G + + ++S F  +A DVG+++  K + I+ P  F 
Sbjct  305   LKVNDPCPYPSCTFGGIWNGGGGSGQKKLFVTSAFAYLAEDVGMVEPNKPNSILHPVDFE  364

Query  1114  VAAKLACETKFEDVKSTFPNAVEKDYPYLCMDLVYQYTLLVDGLGLHPYKEITLMKKVEY  1293
             + AK AC   FEDVKST+P   +   PY+CMDL+YQ+ LLV G GL P KEIT+ + ++Y
Sbjct  365   IEAKRACALNFEDVKSTYPRLTDAKRPYVCMDLLYQHVLLVHGFGLGPRKEITVGEGIQY  424

Query  1294  KNYMVEAAWPLGCAIDVISS  1353
             +N +VEAAWPLG A++ IS+
Sbjct  425   QNSVVEAAWPLGTAVEAISA  444



>ref|XP_002525470.1| adenosine diphosphatase, putative [Ricinus communis]
 gb|EEF36960.1| adenosine diphosphatase, putative [Ricinus communis]
Length=469

 Score =   455 bits (1170),  Expect = 1e-151, Method: Compositional matrix adjust.
 Identities = 240/461 (52%), Positives = 320/461 (69%), Gaps = 18/461 (4%)
 Frame = +1

Query  22    KHNTMKHTSHHH-----LVFISLALLLFPLACF-SRS----------HLRRVLLN-HEAG  150
             +H ++    H +     +V I + LLLF L    SRS            R+V  N  +A 
Sbjct  8     RHESLSDKIHRNRSILLVVSIPMVLLLFVLFVMPSRSPSAVVEEYDFRNRKVPPNLRDAK  67

Query  151   NYAVIFDAGSTGSRVHVFHFDENLDLLPVGDGVEFFLKITPGLSSYADDPEAAAKSLEPL  330
              YAVIFDAGS+GSRVHV+ FD N+DL+P+G  +E F++I PGLS+YA DP+AAA SL  L
Sbjct  68    MYAVIFDAGSSGSRVHVYCFDRNMDLVPIGKDLELFVQIKPGLSAYASDPQAAANSLLSL  127

Query  331   LLEAEGVVPTELQPDTPLELGATAGLRLLEGDASDKILQAVRDMFKNESNFKSKAEWVSI  510
             L +AE VVP E +  TP+ +GATAGLR L  DASD+IL AVRD+ ++ S  KS+A+ V++
Sbjct  128   LDKAESVVPKEQRSKTPVRVGATAGLRALGADASDRILDAVRDLLRDRSTLKSEADGVTV  187

Query  511   LEGSQEGTYFWVAMNYLLGNLGKGYQNTIATIDLGGGSVQVSYAVSGDTFANAPKPHNGE  690
             L+GSQEG+Y WV +NYLLG LGK Y +T+  +DLGGGSVQ++YA+S    A AP+  +GE
Sbjct  188   LDGSQEGSYEWVTINYLLGKLGKSYADTVGVVDLGGGSVQMAYAISKSDAAKAPRVLDGE  247

Query  691   EPYVQEKYILGAQYYLYVHSYLNYGQLASRAEIFKASGNSTNPCVLEGYDGYYTYNDVSY  870
             + YV+E  ++   YYLYVHSYL+YG LA+RAEI K S  S N CVL GYDG Y Y  + Y
Sbjct  248   DTYVKEMRLMATDYYLYVHSYLHYGLLAARAEILKVSEESDNACVLNGYDGAYKYGGLEY  307

Query  871   KVTAPPNGSSLKNCRKLARKVVDF-RAPCKYPNCTFNGVWSGGGGAGMENVDISSYFYDI  1047
             K +A P+G+SL+ CR LA K +    + C +  CTF G+W+GGGG G +N+ ++S+F+D 
Sbjct  308   KASASPSGASLEGCRSLALKALKVNESTCTHMKCTFGGIWNGGGGDGQKNLFVASFFFDR  367

Query  1048  AIDVGIIDEGKASKIVKPRSFLVAAKLACETKFEDVKSTFPNAVEKDYPYLCMDLVYQYT  1227
             A + G ID  +    V P  F  AAK ACETK E+ KST+P+  E + PYLCMDLVYQYT
Sbjct  368   AAEAGFIDPTQPVARVHPGDFEEAAKRACETKLENAKSTYPHVEEGNLPYLCMDLVYQYT  427

Query  1228  LLVDGLGLHPYKEITLMKKVEYKNYMVEAAWPLGCAIDVIS  1350
             LLVDG GL P++EITL+K+++Y++ +VEAAWPLG AI+ +S
Sbjct  428   LLVDGFGLEPWQEITLVKQIKYRDSLVEAAWPLGSAIEALS  468



>gb|ABK94978.1| unknown [Populus trichocarpa]
Length=467

 Score =   454 bits (1168),  Expect = 2e-151, Method: Compositional matrix adjust.
 Identities = 231/444 (52%), Positives = 318/444 (72%), Gaps = 12/444 (3%)
 Frame = +1

Query  58    LVFISLALLLFPLACF---SRSH------LRRVLLNH--EAGNYAVIFDAGSTGSRVHVF  204
             L+ IS+ +LL     F   SR        +R++  N   ++ +YAVIFDAGS+GSRVHV+
Sbjct  22    LLVISIPVLLIAFVLFVMPSREDYEYGGVIRKMSPNFGTDSRSYAVIFDAGSSGSRVHVY  81

Query  205   HFDENLDLLPVGDGVEFFLKITPGLSSYADDPEAAAKSLEPLLLEAEGVVPTELQPDTPL  384
              FD+NLDL+P+G  +E FL++ PGLS+YA++P  AA SL  LL +AE  VP EL+P TP+
Sbjct  82    CFDQNLDLVPIGKELELFLQLKPGLSAYANNPREAANSLVSLLHKAESSVPKELRPKTPV  141

Query  385   ELGATAGLRLLEGDASDKILQAVRDMFKNESNFKSKAEWVSILEGSQEGTYFWVAMNYLL  564
              +GATAGLR L  DASD+ILQAVRD+ ++ S  KS+A  V++L+GSQEG+Y WV +NYLL
Sbjct  142   RVGATAGLRALGMDASDRILQAVRDLLRDTSTLKSEANGVTVLDGSQEGSYQWVTINYLL  201

Query  565   GNLGKGYQNTIATIDLGGGSVQVSYAVSGDTFANAPKPHNGEEPYVQEKYILGAQYYLYV  744
             GNLGK Y NT+  +DLGGGSVQ++YA+S    A AP+  +GE+ YV+E +++G +YYLYV
Sbjct  202   GNLGKKYSNTVGVVDLGGGSVQMAYAISETDAAKAPRLSDGEDTYVKEMFLMGTKYYLYV  261

Query  745   HSYLNYGQLASRAEIFKASGNSTNPCVLEGYDGYYTYNDVSYKVTAPPNGSSLKNCRKLA  924
             HSYLNYG LA+RAE+   S +STNPC+L GYDG Y      +K +A P+GS+++ CR+LA
Sbjct  262   HSYLNYGLLAARAEMLDTSEDSTNPCILAGYDGVYKNGGKDHKASASPSGSNMEECRRLA  321

Query  925   RKVVDFR-APCKYPNCTFNGVWSGGGGAGMENVDISSYFYDIAIDVGIIDEGKASKIVKP  1101
                +  + + C +  CTF G+W+GGGG G +N+ ++S+F+D A   G +D    +  V+P
Sbjct  322   LNALKVKESTCTHMKCTFGGIWNGGGGDGQKNMFVASFFFDRAAQAGFVDSTVPAAKVQP  381

Query  1102  RSFLVAAKLACETKFEDVKSTFPNAVEKDYPYLCMDLVYQYTLLVDGLGLHPYKEITLMK  1281
               F  AAK ACETK E+ KS + +  + D PY+CMDLVYQYTLLVDG  L P++++TL+K
Sbjct  382   SDFENAAKRACETKLENAKSIYSSVDDNDLPYICMDLVYQYTLLVDGFALDPWQDMTLVK  441

Query  1282  KVEYKNYMVEAAWPLGCAIDVISS  1353
             KVEY+  +VEAAWPLG AI+ +SS
Sbjct  442   KVEYRTSLVEAAWPLGSAIEAVSS  465



>ref|XP_004493132.1| PREDICTED: apyrase 2-like isoform X2 [Cicer arietinum]
Length=469

 Score =   454 bits (1167),  Expect = 3e-151, Method: Compositional matrix adjust.
 Identities = 232/440 (53%), Positives = 310/440 (70%), Gaps = 8/440 (2%)
 Frame = +1

Query  58    LVFISLALLLFPLACFSRSHLRRVLLNHE-------AGNYAVIFDAGSTGSRVHVFHFDE  216
             L+ I+  L + P +    S     L+N +          YAVIFDAGS+GSRVHVFHFD+
Sbjct  29    LLLITFVLYMMPSSSSYESAGDYALVNRKISPDKKSGSTYAVIFDAGSSGSRVHVFHFDQ  88

Query  217   NLDLLPVGDGVEFFLKITPGLSSYADDPEAAAKSLEPLLLEAEGVVPTELQPDTPLELGA  396
             NLDL+ +G  +E F +  PGLS+YA +P+ AA+SL  LL +AE VVP EL+  TP+ +GA
Sbjct  89    NLDLVHIGKDLELFEQTKPGLSAYAQNPQQAAESLVSLLEKAESVVPRELRSKTPVRVGA  148

Query  397   TAGLRLLEGDASDKILQAVRDMFKNESNFKSKAEWVSILEGSQEGTYFWVAMNYLLGNLG  576
             TAGLR LEGDASD+ILQAVRD+ K  S  +S+A+ V++L+G+QEG + WV +NYLLGNLG
Sbjct  149   TAGLRALEGDASDRILQAVRDLLKKRSTLRSEADAVTVLDGTQEGAFQWVTINYLLGNLG  208

Query  577   KGYQNTIATIDLGGGSVQVSYAVSGDTFANAPKPHNGEEPYVQEKYILGAQYYLYVHSYL  756
             K Y  T+  +DLGGGSVQ++YA+S    A APK  +GE+PYV+E ++ G +YYLYVHSYL
Sbjct  209   KDYSKTVGVVDLGGGSVQMAYAISESDAAMAPKVTDGEDPYVKEMFLRGRKYYLYVHSYL  268

Query  757   NYGQLASRAEIFKASGNSTNPCVLEGYDGYYTYNDVSYKVTAPPNGSSLKNCRKLARKVV  936
              YG LA+RAEI KASG++ NPC+L GYDG Y Y   S+K ++ P+G+SL  C+ +A K +
Sbjct  269   RYGLLAARAEILKASGDAENPCILSGYDGSYNYGGKSFKASSSPSGASLNECKSVALKAL  328

Query  937   DF-RAPCKYPNCTFNGVWSGGGGAGMENVDISSYFYDIAIDVGIIDEGKASKIVKPRSFL  1113
                 + C +  CTF G+W+GGGG G +N+      Y I+   G  +      IV+P  F 
Sbjct  329   KVNESTCTHMKCTFGGIWNGGGGDGQKNLFHWHSNYIISSQAGFANPNSPVAIVRPADFE  388

Query  1114  VAAKLACETKFEDVKSTFPNAVEKDYPYLCMDLVYQYTLLVDGLGLHPYKEITLMKKVEY  1293
              AAK AC+TK E+ KST+P   E + PYLCMDLVYQYTLLVDG G++P++EITL+KKV+Y
Sbjct  389   DAAKQACQTKLENAKSTYPRVEEGNLPYLCMDLVYQYTLLVDGFGIYPWQEITLVKKVKY  448

Query  1294  KNYMVEAAWPLGCAIDVISS  1353
             ++ +VEAAWPLG AI+ +SS
Sbjct  449   EDALVEAAWPLGSAIEAVSS  468



>ref|XP_010524962.1| PREDICTED: apyrase 2-like [Tarenaya hassleriana]
Length=469

 Score =   454 bits (1167),  Expect = 3e-151, Method: Compositional matrix adjust.
 Identities = 228/402 (57%), Positives = 297/402 (74%), Gaps = 1/402 (0%)
 Frame = +1

Query  151   NYAVIFDAGSTGSRVHVFHFDENLDLLPVGDGVEFFLKITPGLSSYADDPEAAAKSLEPL  330
             NYAVIFDAGS+GSRVHV+ FD+NLDL+P+G+ +E FL++ PGLS+YA+DP+ AA SL  L
Sbjct  67    NYAVIFDAGSSGSRVHVYCFDQNLDLVPMGNELELFLQLKPGLSAYANDPQQAANSLMSL  126

Query  331   LLEAEGVVPTELQPDTPLELGATAGLRLLEGDASDKILQAVRDMFKNESNFKSKAEWVSI  510
             L +AE  VP EL+  TP+ +GATAGLR L  +AS+ ILQAVRD+ K  S  KS+A  V++
Sbjct  127   LDKAEASVPRELRRKTPVRVGATAGLRTLGHEASENILQAVRDLLKERSTLKSEANAVTV  186

Query  511   LEGSQEGTYFWVAMNYLLGNLGKGYQNTIATIDLGGGSVQVSYAVSGDTFANAPKPHNGE  690
             L+G+QEG+Y WV +NYLL NLGK Y NT+  +DLGGGSVQ++YA+S +  A APKP +GE
Sbjct  187   LDGTQEGSYQWVTINYLLRNLGKKYSNTVGVVDLGGGSVQMAYAISKEDAATAPKPLDGE  246

Query  691   EPYVQEKYILGAQYYLYVHSYLNYGQLASRAEIFKASGNSTNPCVLEGYDGYYTYNDVSY  870
             + YV+E Y+ G  YYLYVHSYL+YG LA+RAEI K S +S NPC+L GYDG Y Y   ++
Sbjct  247   DEYVREMYLKGETYYLYVHSYLHYGLLAARAEILKVSEDSNNPCILAGYDGTYKYGGQNH  306

Query  871   KVTAPPNGSSLKNCRKLARKVVDFR-APCKYPNCTFNGVWSGGGGAGMENVDISSYFYDI  1047
             K TA P+G+SL  CR++A   +    + C +  CTF G+W+GGGG G  N+ I+S+F+D 
Sbjct  307   KATASPSGASLDECRRVALNALKVNDSLCTHMRCTFGGIWNGGGGDGQRNLFIASFFFDR  366

Query  1048  AIDVGIIDEGKASKIVKPRSFLVAAKLACETKFEDVKSTFPNAVEKDYPYLCMDLVYQYT  1227
             A + G I+  +    V+P  F  AAK AC TK ED KS FP   E + PYLCMDLVYQYT
Sbjct  367   AYEAGFIEGNQPVAKVRPSDFEKAAKRACNTKMEDGKSKFPRVEEDNLPYLCMDLVYQYT  426

Query  1228  LLVDGLGLHPYKEITLMKKVEYKNYMVEAAWPLGCAIDVISS  1353
             LLVDG GL P ++ITL+K+V+Y ++ VEAAWPLG AI+ +SS
Sbjct  427   LLVDGFGLEPSQKITLVKQVKYGDFAVEAAWPLGSAIEAVSS  468



>dbj|BAB87182.1| apyrase [Pisum sativum]
Length=455

 Score =   452 bits (1163),  Expect = 6e-151, Method: Compositional matrix adjust.
 Identities = 222/437 (51%), Positives = 302/437 (69%), Gaps = 10/437 (2%)
 Frame = +1

Query  73    LALLLFPLACFSRSHL--------RRVLLNHEA-GNYAVIFDAGSTGSRVHVFHFDENLD  225
             +  LLF +   + S          RR+ L  E   +YAV+FDAGSTGSR+HV+HF++NLD
Sbjct  8     ITFLLFSMPAITSSQYLGNNLLTSRRIFLKQEEISSYAVVFDAGSTGSRIHVYHFNQNLD  67

Query  226   LLPVGDGVEFFLKITPGLSSYADDPEAAAKSLEPLLLEAEGVVPTELQPDTPLELGATAG  405
             L  +G GVE++ KITPGLSSYA++PE AAKSL PLL +AE  VP +LQP TP+ LGAT  
Sbjct  68    LPHIGKGVEYYNKITPGLSSYANNPEQAAKSLIPLLEQAEECVPDDLQPKTPVRLGATGV  127

Query  406   LRLLEGDASDKILQAVRDMFKNESNFKSKAEWVSILEGSQEGTYFWVAMNYLLGNLGKGY  585
             LRLL GDAS+KILQ+VRDM  N S F  + + VSI++G+QEG+Y WV +NY LG LGK Y
Sbjct  128   LRLLNGDASEKILQSVRDMLSNRSTFNVQPDAVSIIDGTQEGSYLWVTVNYALGKLGKKY  187

Query  586   QNTIATIDLGGGSVQVSYAVSGDTFANAPKPHNGEEPYVQEKYILGAQYYLYVHSYLNYG  765
               T+  IDLGGGSVQ++YAVS  T  NAPK  +G++PY+++  + G  Y LYVHSYL++G
Sbjct  188   TKTVGVIDLGGGSVQMAYAVSKKTAKNAPKVADGDDPYIKKVVLKGIPYDLYVHSYLHFG  247

Query  766   QLASRAEIFKASGNSTNPCVLEGYDGYYTYNDVSYKVTAPPNGSSLKNCRKLARKVVDFR  945
             + ASRAEI K +  S+NPC+L G++G YTY+   +K TA  +G++   C+   RK +   
Sbjct  248   REASRAEILKLTPRSSNPCLLAGFNGIYTYSREEFKATAYTSGANFNKCKNTIRKALKLN  307

Query  946   APCKYPNCTFNGVWSGGGGAGMENVDISSYFYDIAIDVGIIDEGKASKIVKPRSFLVAAK  1125
              PC Y NCTF G+W+ GGG G +N+  SS ++ +  D G++D    + I++P      AK
Sbjct  308   YPCPYQNCTFGGIWNSGGGNGQKNLFASSSYFYLPEDTGMVDASTPNFILRPVDIETKAK  367

Query  1126  LACETKFEDVKSTFPNAVEKDY-PYLCMDLVYQYTLLVDGLGLHPYKEITLMKKVEYKNY  1302
              +C   FED KST+P   +K+   Y+CMDL+YQY LLVDG GL P ++IT  K++EY++ 
Sbjct  368   ESCALNFEDAKSTYPFLDKKNVASYVCMDLIYQYVLLVDGFGLDPLQKITSGKEIEYQDA  427

Query  1303  MVEAAWPLGCAIDVISS  1353
             +VEAAWPLG A++ IS+
Sbjct  428   IVEAAWPLGNAVEAISA  444



>ref|XP_010558706.1| PREDICTED: apyrase 2 [Tarenaya hassleriana]
Length=469

 Score =   451 bits (1161),  Expect = 2e-150, Method: Compositional matrix adjust.
 Identities = 231/404 (57%), Positives = 297/404 (74%), Gaps = 5/404 (1%)
 Frame = +1

Query  151   NYAVIFDAGSTGSRVHVFHFDENLDLLPVGDGVEFFLKITPGLSSYADDPEAAAKSLEPL  330
             NYAVIFDAGS+GSRVHVF FD+NLDL+P+G  +E FL++ PGLS+Y  DP+ AA SL  L
Sbjct  67    NYAVIFDAGSSGSRVHVFCFDQNLDLVPMGIELELFLQLKPGLSAYPSDPQQAANSLVSL  126

Query  331   LLEAEGVVPTELQPDTPLELGATAGLRLLEGDASDKILQAVRDMFKNESNFKSKAEWVSI  510
             L +AE  VP EL+  TP+ +GATAGLR L  +AS+ ILQAVRD+ K  S  KS+A  V++
Sbjct  127   LDKAEATVPRELRRKTPVRVGATAGLRTLGHEASENILQAVRDLLKERSTLKSEANSVTV  186

Query  511   LEGSQEGTYFWVAMNYLLGNLGKGYQNTIATIDLGGGSVQVSYAVSGDTFANAPKPHNGE  690
             L+G+QEG+Y WV +NYLL NLGK Y NT+  +DLGGGSVQ++YA+S +  A APKP +GE
Sbjct  187   LDGTQEGSYQWVTINYLLRNLGKKYSNTVGVVDLGGGSVQMAYAISKEDAATAPKPLDGE  246

Query  691   EPYVQEKYILGAQYYLYVHSYLNYGQLASRAEIFKASGNSTNPCVLEGYDGYYTYNDVSY  870
             + YV+E Y+ G  YYLYVHSYL+YG LA+RAEI K S +S NPC+L GYDG Y Y   +Y
Sbjct  247   DEYVREMYLKGQTYYLYVHSYLHYGLLAARAEILKVSEDSNNPCILAGYDGTYKYGGENY  306

Query  871   KVTAPPNGSSLKNCRKL---ARKVVDFRAPCKYPNCTFNGVWSGGGGAGMENVDISSYFY  1041
             K TA P+G+SL  CR++   A KV D  + C +  CTF GVW+GGGG G  N+ ++S+F+
Sbjct  307   KATASPSGASLDECRRVTLNALKVND--SLCTHMRCTFGGVWNGGGGDGQRNLFVASFFF  364

Query  1042  DIAIDVGIIDEGKASKIVKPRSFLVAAKLACETKFEDVKSTFPNAVEKDYPYLCMDLVYQ  1221
             D A + G +D+ +    V+P  F  AA+ AC TK ED KS FP+  E + PYLCMDLVYQ
Sbjct  365   DRAAEAGFVDKNQPVAKVRPLDFEKAARRACNTKMEDGKSKFPHVEEDNLPYLCMDLVYQ  424

Query  1222  YTLLVDGLGLHPYKEITLMKKVEYKNYMVEAAWPLGCAIDVISS  1353
             YTLLVDGLG+   + ITL+KKV+Y ++ VEAAWPLG AI+ +SS
Sbjct  425   YTLLVDGLGMESSQTITLVKKVKYGDFAVEAAWPLGSAIEAVSS  468



>ref|XP_003548776.1| PREDICTED: apyrase 2 [Glycine max]
 gb|KHN46802.1| Nucleoside-triphosphatase [Glycine soja]
Length=463

 Score =   451 bits (1160),  Expect = 2e-150, Method: Compositional matrix adjust.
 Identities = 226/401 (56%), Positives = 293/401 (73%), Gaps = 1/401 (0%)
 Frame = +1

Query  151   NYAVIFDAGSTGSRVHVFHFDENLDLLPVGDGVEFFLKITPGLSSYADDPEAAAKSLEPL  330
             +YAVIFDAGSTGSRVHV+ F++ LDLL +G  +E F+K  PGLS+YA++P+ AA+SL PL
Sbjct  53    SYAVIFDAGSTGSRVHVYRFNQQLDLLRIGQDLELFVKTMPGLSAYAENPQDAAESLIPL  112

Query  331   LLEAEGVVPTELQPDTPLELGATAGLRLLEGDASDKILQAVRDMFKNESNFKSKAEWVSI  510
             L EAE  VP E  P TP++LGATAGLR LEGDASD+ILQAV DM KN S     A+ VS+
Sbjct  113   LEEAEAAVPQEFHPRTPVKLGATAGLRQLEGDASDRILQAVSDMLKNRSTLNVGADAVSV  172

Query  511   LEGSQEGTYFWVAMNYLLGNLGKGYQNTIATIDLGGGSVQVSYAVSGDTFANAPKPHNGE  690
             L G+QEG Y WV +NYLLGNLGK Y  T+A +DLGGGSVQ++YAVS    A AP+  +G 
Sbjct  173   LSGNQEGAYQWVTINYLLGNLGKHYSETVAVVDLGGGSVQMAYAVSETDAAKAPRAPDGV  232

Query  691   EPYVQEKYILGAQYYLYVHSYLNYGQLASRAEIFKASGNSTNPCVLEGYDGYYTYNDVSY  870
             E Y+ E ++ G +YYLYVHSYL YG LA+RAE  K   +S NPC+L G+DGYY Y  V Y
Sbjct  233   ESYITEMFLRGKKYYLYVHSYLRYGMLAARAEALKVR-DSENPCILAGFDGYYVYGGVQY  291

Query  871   KVTAPPNGSSLKNCRKLARKVVDFRAPCKYPNCTFNGVWSGGGGAGMENVDISSYFYDIA  1050
             K  APP+GSS   C+ +  + +   A C Y +CTF G+W+GGGGAG  N  I+S+F+++A
Sbjct  292   KAKAPPSGSSFSQCQNVVVEALHVNATCSYKDCTFGGIWNGGGGAGENNFFIASFFFEVA  351

Query  1051  IDVGIIDEGKASKIVKPRSFLVAAKLACETKFEDVKSTFPNAVEKDYPYLCMDLVYQYTL  1230
              + G +D    +  V+P  F  AAK+AC T+ +D+KS FP   + D PY+C+DLVY+YTL
Sbjct  352   DEAGFVDPNAPNAKVRPVDFENAAKVACNTELKDLKSIFPRVKDGDVPYICLDLVYEYTL  411

Query  1231  LVDGLGLHPYKEITLMKKVEYKNYMVEAAWPLGCAIDVISS  1353
             LVDG G+ P +EITL+++VEY++ +VEAAWPLG AI+ ISS
Sbjct  412   LVDGFGIDPQQEITLVRQVEYQDSLVEAAWPLGSAIEAISS  452



>ref|XP_011034426.1| PREDICTED: apyrase 2-like [Populus euphratica]
Length=596

 Score =   456 bits (1172),  Expect = 3e-150, Method: Compositional matrix adjust.
 Identities = 231/444 (52%), Positives = 319/444 (72%), Gaps = 12/444 (3%)
 Frame = +1

Query  58    LVFISLALLLFPLACF---SRSH------LRRVL--LNHEAGNYAVIFDAGSTGSRVHVF  204
             L+ IS+ +LL     F   SR        +R++   L  ++ +YAVIFDAGS+GSRVHV+
Sbjct  151   LLVISIPVLLIAFVLFVMPSREDYEYGGVIRKMSPNLGTDSRSYAVIFDAGSSGSRVHVY  210

Query  205   HFDENLDLLPVGDGVEFFLKITPGLSSYADDPEAAAKSLEPLLLEAEGVVPTELQPDTPL  384
              FD+NLDL+P+G  +E FL++ PGLS+YA++P  AA SL  LL +AE  VP EL+P TP+
Sbjct  211   CFDQNLDLVPIGKELELFLQLKPGLSAYANNPREAANSLVSLLHKAESSVPKELRPKTPV  270

Query  385   ELGATAGLRLLEGDASDKILQAVRDMFKNESNFKSKAEWVSILEGSQEGTYFWVAMNYLL  564
              +GATAGLR L  DASD+ILQAVRD+ ++ S  KS+A  V++L+GSQEG+Y WV +NYLL
Sbjct  271   RVGATAGLRALGMDASDRILQAVRDLLRDTSTLKSEANGVTVLDGSQEGSYQWVTINYLL  330

Query  565   GNLGKGYQNTIATIDLGGGSVQVSYAVSGDTFANAPKPHNGEEPYVQEKYILGAQYYLYV  744
             GNLGK Y NT+  +DLGGGSVQ++YA+S    A AP+  +GE+ YV+E +++G +YYLYV
Sbjct  331   GNLGKKYSNTVGVVDLGGGSVQMAYAISETDAAKAPRLSDGEDTYVKEMFLMGTKYYLYV  390

Query  745   HSYLNYGQLASRAEIFKASGNSTNPCVLEGYDGYYTYNDVSYKVTAPPNGSSLKNCRKLA  924
             HSYL+YG LA+RAE+  AS +STNPC+L GYDG Y Y    +K +A P+GS+++ CR+LA
Sbjct  391   HSYLHYGLLAARAEMLDASEDSTNPCILAGYDGVYEYGGKDHKASASPSGSNMEECRRLA  450

Query  925   RKVVDF-RAPCKYPNCTFNGVWSGGGGAGMENVDISSYFYDIAIDVGIIDEGKASKIVKP  1101
                +    + C +  CTF G+W+GGGG G +N+ ++S+F+D A   G +D    +  V+P
Sbjct  451   LNALKVNESTCTHMKCTFGGIWNGGGGDGQKNMFVASFFFDRAAQAGFVDSTVPAAKVQP  510

Query  1102  RSFLVAAKLACETKFEDVKSTFPNAVEKDYPYLCMDLVYQYTLLVDGLGLHPYKEITLMK  1281
               F  AAK ACET+ E+ KS + +  + D PY+CMDLVYQYTLLVDG  L P++E+TL+K
Sbjct  511   SDFENAAKRACETELENAKSIYSSVDDNDLPYICMDLVYQYTLLVDGFALDPWQEMTLVK  570

Query  1282  KVEYKNYMVEAAWPLGCAIDVISS  1353
             KV+Y+  +VEAAWPLG AI+ +SS
Sbjct  571   KVQYRTSLVEAAWPLGSAIEAVSS  594



>ref|XP_008792533.1| PREDICTED: probable apyrase 2 isoform X2 [Phoenix dactylifera]
 ref|XP_008792534.1| PREDICTED: probable apyrase 2 isoform X2 [Phoenix dactylifera]
Length=459

 Score =   450 bits (1158),  Expect = 4e-150, Method: Compositional matrix adjust.
 Identities = 236/445 (53%), Positives = 304/445 (68%), Gaps = 4/445 (1%)
 Frame = +1

Query  58    LVFISLALLLFPLACFSRSHLRRVL----LNHEAGNYAVIFDAGSTGSRVHVFHFDENLD  225
             +++ SL LLL P         R+      +  E  +YAVIFDAGSTGSRVHVF FDEN+D
Sbjct  6     VLYASLVLLLVPHVAGGIVLGRKAAGGGGVRGETESYAVIFDAGSTGSRVHVFRFDENMD  65

Query  226   LLPVGDGVEFFLKITPGLSSYADDPEAAAKSLEPLLLEAEGVVPTELQPDTPLELGATAG  405
             L+ +GD +E ++ + PGLSSYADDP+ AA SL PLL EAE VVP ELQP TP+ LGATAG
Sbjct  66    LVNIGDDIELYVAVKPGLSSYADDPQEAANSLIPLLEEAESVVPEELQPTTPVRLGATAG  125

Query  406   LRLLEGDASDKILQAVRDMFKNESNFKSKAEWVSILEGSQEGTYFWVAMNYLLGNLGKGY  585
             LR L  + S++ILQAVRD+ +  S+ + ++EWV++LEG QEG+Y WVAMNYLLGNLG  Y
Sbjct  126   LRNLGDEKSEEILQAVRDLLQTNSSLEYESEWVTVLEGYQEGSYLWVAMNYLLGNLGNKY  185

Query  586   QNTIATIDLGGGSVQVSYAVSGDTFANAPKPHNGEEPYVQEKYILGAQYYLYVHSYLNYG  765
              +T+  +DLGGGSVQ++YAVS +  ANAP   NG++PYV ++ +    YYLY +SYLN+G
Sbjct  186   SDTVGVVDLGGGSVQMAYAVSEEAAANAPNISNGDDPYVTKQLLNETNYYLYAYSYLNFG  245

Query  766   QLASRAEIFKASGNSTNPCVLEGYDGYYTYNDVSYKVTAPPNGSSLKNCRKLARKVVDFR  945
              LA+RAEI +A  +  + C+L GY G Y YN   Y  +A P+GSS   CR  A K +   
Sbjct  246   LLAARAEILEAVDDPYSYCMLGGYTGTYEYNGEVYNASASPSGSSYNKCRTDAIKTLKIN  305

Query  946   APCKYPNCTFNGVWSGGGGAGMENVDISSYFYDIAIDVGIIDEGKASKIVKPRSFLVAAK  1125
               C Y +C+F GVWSGGGG G +N+ ++S+FYD A  VG ID  + S +V P  F  AAK
Sbjct  306   ETCTYEDCSFGGVWSGGGGDGQKNIYVASFFYDRAAQVGFIDPEEPSALVTPSDFEEAAK  365

Query  1126  LACETKFEDVKSTFPNAVEKDYPYLCMDLVYQYTLLVDGLGLHPYKEITLMKKVEYKNYM  1305
              AC    E+   T+PN    D PY+CMDL Y+YTLLVDG GL P +EITL+ KV+Y +  
Sbjct  366   TACNLSLEEANVTYPNVAADDLPYICMDLAYEYTLLVDGFGLEPSQEITLVSKVKYGDSY  425

Query  1306  VEAAWPLGCAIDVISSSSANNLLSK  1380
             V AAWPLG AI+V+SS S  +L  K
Sbjct  426   VGAAWPLGSAIEVVSSQSTQSLAMK  450



>ref|XP_003624582.1| Apyrase-like protein [Medicago truncatula]
 gb|AES80800.1| Nod factor-binding lectin-nucleotide phosphohydrolase [Medicago 
truncatula]
Length=456

 Score =   450 bits (1157),  Expect = 5e-150, Method: Compositional matrix adjust.
 Identities = 228/413 (55%), Positives = 299/413 (72%), Gaps = 2/413 (0%)
 Frame = +1

Query  121   RRVLLNHEA-GNYAVIFDAGSTGSRVHVFHFDENLDLLPVGDGVEFFLKITPGLSSYADD  297
             R++    E   +YAV+FDAGSTGSR+HV+HFD+NLDLL +G  VEFF KITPGLSSYA+D
Sbjct  33    RKIFQKQETISSYAVVFDAGSTGSRIHVYHFDQNLDLLHIGKDVEFFNKITPGLSSYAND  92

Query  298   PEAAAKSLEPLLLEAEGVVPTELQPDTPLELGATAGLRLLEGDASDKILQAVRDMFKNES  477
             PE AAKSL PLL +AE VVP +L   TP+ LGATAGLRLL GDAS+KILQAVRDMF N S
Sbjct  93    PEQAAKSLIPLLQQAENVVPIDLHHKTPIRLGATAGLRLLNGDASEKILQAVRDMFSNRS  152

Query  478   NFKSKAEWVSILEGSQEGTYFWVAMNYLLGNLGKGYQNTIATIDLGGGSVQVSYAVSGDT  657
              F  + + VSI++G+QEG+Y WV +NY LGNLGK Y  T+  +DLGGGSVQ++YAVS  T
Sbjct  153   TFNVQPDAVSIIDGTQEGSYLWVTVNYALGNLGKKYTKTVGVMDLGGGSVQMAYAVSKKT  212

Query  658   FANAPKPHNGEEPYVQEKYILGAQYYLYVHSYLNYGQLASRAEIFKASGNSTNPCVLEGY  837
               NAPK  +G +PY+++  + G  Y LYVHSYL++G+ ASRAEI K + +S NPC+L G+
Sbjct  213   AKNAPKVADGVDPYIKKLVLKGKPYDLYVHSYLHFGREASRAEIMKVTRSSPNPCLLAGF  272

Query  838   DGYYTYNDVSYKVTAPPNGSSLKNCRKLARKVVDFRAPCKYPNCTFNGVWSGGGGAGMEN  1017
             DG YTY    +K  AP +G++   C+K+ RK +    PC Y NCTF G+W+GGGG G ++
Sbjct  273   DGTYTYAGEEFKAKAPASGANFNGCKKIIRKALKLNYPCPYQNCTFGGIWNGGGGNGQKH  332

Query  1018  VDISSYFYDIAIDVGIIDEGKASKIVKPRSFLVAAKLACETKFEDVKSTFPNAVEKDY-P  1194
             +  SS F+ +  DVG++D    +  ++P   +  AK AC   FED KST+P   +K+   
Sbjct  333   LFASSSFFYLPEDVGMVDPKTPNFKIRPVDLVSEAKKACALNFEDAKSTYPFLAKKNIAS  392

Query  1195  YLCMDLVYQYTLLVDGLGLHPYKEITLMKKVEYKNYMVEAAWPLGCAIDVISS  1353
             Y+CMDL+YQY LLVDG GL P +EIT  K++EY++ ++EAAWPLG A++ ISS
Sbjct  393   YVCMDLIYQYVLLVDGFGLDPLQEITSGKEIEYQDAVLEAAWPLGNAVEAISS  445



>ref|XP_002319138.2| hypothetical protein POPTR_0013s05040g [Populus trichocarpa]
 gb|EEE95061.2| hypothetical protein POPTR_0013s05040g [Populus trichocarpa]
Length=601

 Score =   455 bits (1170),  Expect = 6e-150, Method: Compositional matrix adjust.
 Identities = 236/469 (50%), Positives = 324/469 (69%), Gaps = 25/469 (5%)
 Frame = +1

Query  22    KHNTMKHTSHHH-------------LVFISLALLLFPLACF---SRSH------LRRVLL  135
             K +TMK     H             L+ IS+ +LL     F   SR        +R++  
Sbjct  131   KSSTMKRPGLRHESLSDKIKKCKGVLLVISIPVLLIAFVLFVMPSREDYEYGGVIRKMSP  190

Query  136   NH--EAGNYAVIFDAGSTGSRVHVFHFDENLDLLPVGDGVEFFLKITPGLSSYADDPEAA  309
             N   ++ +YAVIFDAGS+GSRVHV+ FD+NLDL+P+G  +E FL++ PGLS+YA++P  A
Sbjct  191   NFGTDSRSYAVIFDAGSSGSRVHVYCFDQNLDLVPIGKELELFLQLKPGLSAYANNPREA  250

Query  310   AKSLEPLLLEAEGVVPTELQPDTPLELGATAGLRLLEGDASDKILQAVRDMFKNESNFKS  489
             A SL  LL +AE  VP EL+P TP+ +GATAGLR L  DASD+ILQAVRD+ ++ S  KS
Sbjct  251   ANSLVSLLHKAESSVPKELRPKTPVRVGATAGLRALGMDASDRILQAVRDLLRDTSTLKS  310

Query  490   KAEWVSILEGSQEGTYFWVAMNYLLGNLGKGYQNTIATIDLGGGSVQVSYAVSGDTFANA  669
             +A  V++L+GSQEG+Y WV +NYLLGNLGK Y NT+  +DLGGGSVQ++YA+S    A A
Sbjct  311   EANGVTVLDGSQEGSYQWVTINYLLGNLGKKYSNTVGVVDLGGGSVQMAYAISETDAAKA  370

Query  670   PKPHNGEEPYVQEKYILGAQYYLYVHSYLNYGQLASRAEIFKASGNSTNPCVLEGYDGYY  849
             P+  +GE+ YV+E +++G +YYLYVHSYLNYG LA+RAE+   S +STNPC+L GYDG Y
Sbjct  371   PRLSDGEDTYVKEMFLMGTKYYLYVHSYLNYGLLAARAEMLDTSEDSTNPCILAGYDGVY  430

Query  850   TYNDVSYKVTAPPNGSSLKNCRKLARKVVDFR-APCKYPNCTFNGVWSGGGGAGMENVDI  1026
                   +K +A P+GS+++ CR+LA   +  + + C +  CTF G+W+GGGG G +N+ +
Sbjct  431   KNGGKDHKASASPSGSNMEECRRLALNALKVKESTCTHMKCTFGGIWNGGGGDGQKNMFV  490

Query  1027  SSYFYDIAIDVGIIDEGKASKIVKPRSFLVAAKLACETKFEDVKSTFPNAVEKDYPYLCM  1206
             +S+F+D A   G +D    +  V+P  F  AAK ACETK E+ KS + +  + D PY+CM
Sbjct  491   ASFFFDRAAQAGFVDSTVPAAKVQPSDFENAAKRACETKLENAKSIYSSVDDNDLPYICM  550

Query  1207  DLVYQYTLLVDGLGLHPYKEITLMKKVEYKNYMVEAAWPLGCAIDVISS  1353
             DLVYQYTLLVDG  L P++++TL+KKVEY+  +VEAAWPLG AI+ +SS
Sbjct  551   DLVYQYTLLVDGFALDPWQDMTLVKKVEYRTSLVEAAWPLGSAIEAVSS  599



>ref|XP_010650765.1| PREDICTED: apyrase 2 [Vitis vinifera]
 emb|CBI24778.3| unnamed protein product [Vitis vinifera]
Length=471

 Score =   450 bits (1158),  Expect = 8e-150, Method: Compositional matrix adjust.
 Identities = 229/441 (52%), Positives = 314/441 (71%), Gaps = 10/441 (2%)
 Frame = +1

Query  58    LVFISLALLLFPLACFSRSHL--------RRVLLNHEAGNYAVIFDAGSTGSRVHVFHFD  213
             L+ IS  L L P    SRS          R+   + ++  YAVIFDAGS+GSRVHVF FD
Sbjct  30    LLLISFVLFLMPTTTTSRSGAFQQYPLVHRKASPHSQSRTYAVIFDAGSSGSRVHVFCFD  89

Query  214   ENLDLLPVGDGVEFFLKITPGLSSYADDPEAAAKSLEPLLLEAEGVVPTELQPDTPLELG  393
              +L+L+ +G  +E FL+  PGLS+Y  +P+ AA+SL PLL +AE VVP +L+  TP+++G
Sbjct  90    SDLNLVHIGKDLELFLQRKPGLSAYPTEPQQAAESLLPLLDKAENVVPADLRRKTPVKVG  149

Query  394   ATAGLRLLEGDASDKILQAVRDMFKNESNFKSKAEWVSILEGSQEGTYFWVAMNYLLGNL  573
             ATAGLR L  DASD+ILQAV++  K++S  KSK EWV++L+GSQEG + WV +NYLLGNL
Sbjct  150   ATAGLRALGIDASDRILQAVKNFLKDKSTLKSKPEWVTVLDGSQEGAFQWVTINYLLGNL  209

Query  574   GKGYQNTIATIDLGGGSVQVSYAVSGDTFANAPKPHNGEEPYVQEKYILGAQYYLYVHSY  753
             G+ Y +T+  +DLGGGSVQ++YA+S      APK  +GE+ YV+E Y+ G +Y+LYVHSY
Sbjct  210   GRKYSHTVGVVDLGGGSVQMAYAISETAAEKAPKISDGEDTYVKEMYLKGTKYFLYVHSY  269

Query  754   LNYGQLASRAEIFKASGNSTNPCVLEGYDGYYTYNDVSYKVTAPPNGSSLKNCRKLARKV  933
             L+YG LA+RAEI K   +S NPC+L G+ G YTY  V+Y+ +A P+GSS++ CR++A + 
Sbjct  270   LHYGLLAARAEILKVE-SSENPCLLGGFHGTYTYGGVTYEASAHPSGSSMERCRRVAFRA  328

Query  934   VDF-RAPCKYPNCTFNGVWSGGGGAGMENVDISSYFYDIAIDVGIIDEGKASKIVKPRSF  1110
             +    + C +  CTF G+W+GGGG G +N+ ++S+F+D A + G +D  +    V+P  F
Sbjct  329   LKVNESTCTHMKCTFGGIWNGGGGDGQKNLFVASFFFDRAAEAGFVDRNQPVAKVQPMDF  388

Query  1111  LVAAKLACETKFEDVKSTFPNAVEKDYPYLCMDLVYQYTLLVDGLGLHPYKEITLMKKVE  1290
               AAK  CETK ED KS FP   E + PYLCMDLVYQ+TLL+DG GL P++EITL+K+V+
Sbjct  389   EDAAKRVCETKLEDAKSKFPLVEEANLPYLCMDLVYQFTLLIDGFGLDPWQEITLVKQVK  448

Query  1291  YKNYMVEAAWPLGCAIDVISS  1353
             Y + +VEAAWPLG AID +SS
Sbjct  449   YGDALVEAAWPLGSAIDAVSS  469



>gb|ADD09803.1| ectoapyrase 1 [Gossypium hirsutum]
Length=472

 Score =   450 bits (1158),  Expect = 8e-150, Method: Compositional matrix adjust.
 Identities = 224/412 (54%), Positives = 302/412 (73%), Gaps = 1/412 (0%)
 Frame = +1

Query  121   RRVLLNHEAG-NYAVIFDAGSTGSRVHVFHFDENLDLLPVGDGVEFFLKITPGLSSYADD  297
             RRV  N     NYAVIFDAGS+GSRVHV+ FD+ LDL+P+G  +E F ++ PGLS YA D
Sbjct  59    RRVGANSRGNRNYAVIFDAGSSGSRVHVYCFDQILDLVPIGSDLELFEQLKPGLSYYAKD  118

Query  298   PEAAAKSLEPLLLEAEGVVPTELQPDTPLELGATAGLRLLEGDASDKILQAVRDMFKNES  477
             P+AAA SL  LL +AE VVP +L+  TP+ +GATAGLR L G+ASDKILQ+VR++ K+ S
Sbjct  119   PQAAANSLTSLLDKAESVVPLDLRSKTPVRVGATAGLRALGGEASDKILQSVRELLKSRS  178

Query  478   NFKSKAEWVSILEGSQEGTYFWVAMNYLLGNLGKGYQNTIATIDLGGGSVQVSYAVSGDT  657
               KS+A  V IL+GSQEG+Y WV +NYLLGNLG+ YQ+T+  +DLGGGSVQ++YA+S + 
Sbjct  179   TLKSEANGVKILDGSQEGSYEWVTINYLLGNLGRTYQDTVGIVDLGGGSVQMAYAISENA  238

Query  658   FANAPKPHNGEEPYVQEKYILGAQYYLYVHSYLNYGQLASRAEIFKASGNSTNPCVLEGY  837
              + AP    G++ YV E Y+ G++YYLYVHSYL+YG LA+RAEI KA+ +S NPC+LEG+
Sbjct  239   ASRAPSVPAGQDNYVNEMYLKGSKYYLYVHSYLHYGLLAARAEILKATEDSGNPCILEGF  298

Query  838   DGYYTYNDVSYKVTAPPNGSSLKNCRKLARKVVDFRAPCKYPNCTFNGVWSGGGGAGMEN  1017
             DG Y Y    YK +AP +GSS++ CR++  K +     C +  CTF G+W+GGGG G +N
Sbjct  299   DGTYKYGGEEYKASAPSSGSSMEECRRVTLKALKVNDSCTHMKCTFGGIWNGGGGDGQKN  358

Query  1018  VDISSYFYDIAIDVGIIDEGKASKIVKPRSFLVAAKLACETKFEDVKSTFPNAVEKDYPY  1197
             + ++S+F+D A + G I        V+P SF  AAK AC+TK+ D K+ + +  E +  Y
Sbjct  359   LFVASFFFDRAAEAGFIKASDPVAKVQPHSFADAAKRACQTKYADAKAIYKDLGESNLAY  418

Query  1198  LCMDLVYQYTLLVDGLGLHPYKEITLMKKVEYKNYMVEAAWPLGCAIDVISS  1353
             +CMDLVYQYTLLVDG GL PY++++L+KKV+Y+N  VEAAWPLG AI+ +S+
Sbjct  419   ICMDLVYQYTLLVDGFGLDPYQDVSLVKKVKYRNSFVEAAWPLGSAIEAVSA  470



>ref|XP_006598985.1| PREDICTED: apyrase 2-like [Glycine max]
Length=469

 Score =   449 bits (1156),  Expect = 1e-149, Method: Compositional matrix adjust.
 Identities = 231/441 (52%), Positives = 318/441 (72%), Gaps = 8/441 (2%)
 Frame = +1

Query  58    LVFISLALLLFPLACFSRSHLRRVLLNHE-------AGNYAVIFDAGSTGSRVHVFHFDE  216
             L+ I+  L + P +  + S     L+N +        G+YAVIFDAGS+GSRVHVFHFD 
Sbjct  29    LLLITFVLYVMPSSTSNESVGDYALVNRKMSPEKKSVGSYAVIFDAGSSGSRVHVFHFDH  88

Query  217   NLDLLPVGDGVEFFLKITPGLSSYADDPEAAAKSLEPLLLEAEGVVPTELQPDTPLELGA  396
             NLDL+ +G  +E F++  PGLS++A +P+ AA+SL  LL EAE VVP EL+  TP+ +GA
Sbjct  89    NLDLVHIGKDLELFVQKKPGLSAFAKNPKQAAESLVSLLEEAESVVPRELRSKTPVRVGA  148

Query  397   TAGLRLLEGDASDKILQAVRDMFKNESNFKSKAEWVSILEGSQEGTYFWVAMNYLLGNLG  576
             TAGLR LEGDASD+ILQAVRD+ K+ S+ KS+++ V++L+G+QEG Y WV +NYLLGNLG
Sbjct  149   TAGLRALEGDASDRILQAVRDLLKDRSSLKSESDAVTVLDGTQEGAYQWVTINYLLGNLG  208

Query  577   KGYQNTIATIDLGGGSVQVSYAVSGDTFANAPKPHNGEEPYVQEKYILGAQYYLYVHSYL  756
             K Y  T+  +DLGGGSVQ++YA+S    A APK  +G +PY++E ++ G +YYLYVHSYL
Sbjct  209   KDYSKTVGVVDLGGGSVQMAYAISETDAAMAPKVVDGGDPYLKEMFLRGRKYYLYVHSYL  268

Query  757   NYGQLASRAEIFKASGNSTNPCVLEGYDGYYTYNDVSYKVTAPPNGSSLKNCRKLARKVV  936
             +YG LA+RAEI K S ++ NPCV+ GYDG Y Y   S+K ++  +G+SL  C+ +A + +
Sbjct  269   HYGLLAARAEILKISDDAENPCVISGYDGSYNYGGKSFKASSGSSGASLNECKSVALRAL  328

Query  937   DF-RAPCKYPNCTFNGVWSGGGGAGMENVDISSYFYDIAIDVGIIDEGKASKIVKPRSFL  1113
                 + C +  CTF G+W+GGGG G +N+ ++S+F+D A + G  D      IV+P  F 
Sbjct  329   KVNESTCTHMKCTFGGIWNGGGGDGQKNLFVASFFFDRAAEAGFADPNLPVAIVRPADFE  388

Query  1114  VAAKLACETKFEDVKSTFPNAVEKDYPYLCMDLVYQYTLLVDGLGLHPYKEITLMKKVEY  1293
              AAK AC+TK E+ KSTFP   E + PYLCMDL+YQYTLLVDG G++P++EITL+KKV+Y
Sbjct  389   DAAKQACQTKLENAKSTFPRVDEGNLPYLCMDLIYQYTLLVDGFGIYPWQEITLVKKVKY  448

Query  1294  KNYMVEAAWPLGCAIDVISSS  1356
              + +VEAAWPLG AI+ +SS+
Sbjct  449   DDALVEAAWPLGSAIEAVSSA  469



>gb|AFK48943.1| unknown [Medicago truncatula]
Length=456

 Score =   449 bits (1154),  Expect = 2e-149, Method: Compositional matrix adjust.
 Identities = 227/413 (55%), Positives = 299/413 (72%), Gaps = 2/413 (0%)
 Frame = +1

Query  121   RRVLLNHEA-GNYAVIFDAGSTGSRVHVFHFDENLDLLPVGDGVEFFLKITPGLSSYADD  297
             R++    E   +YAV+FDAGSTGSR+HV+HFD+NLDLL +G  VEFF KITPGLSSYA+D
Sbjct  33    RKIFQKQETISSYAVVFDAGSTGSRIHVYHFDQNLDLLHIGKDVEFFNKITPGLSSYAND  92

Query  298   PEAAAKSLEPLLLEAEGVVPTELQPDTPLELGATAGLRLLEGDASDKILQAVRDMFKNES  477
             PE AAKSL PLL +AE VVP +L   TP+ LGATAGLRLL GDAS+KILQAVRDMF N S
Sbjct  93    PEQAAKSLIPLLQQAENVVPIDLHHKTPIRLGATAGLRLLNGDASEKILQAVRDMFSNRS  152

Query  478   NFKSKAEWVSILEGSQEGTYFWVAMNYLLGNLGKGYQNTIATIDLGGGSVQVSYAVSGDT  657
              F  + + VSI++G+QEG+Y WV +NY LGN+GK Y  T+  +DLGGGSVQ++YAVS  T
Sbjct  153   TFNVQPDAVSIIDGTQEGSYLWVTVNYALGNVGKKYTKTVGVMDLGGGSVQMAYAVSKKT  212

Query  658   FANAPKPHNGEEPYVQEKYILGAQYYLYVHSYLNYGQLASRAEIFKASGNSTNPCVLEGY  837
               NAPK  +G +PY+++  + G  Y LYVHSYL++G+ ASRAEI K + +S NPC+L G+
Sbjct  213   AKNAPKVADGVDPYIKKLVLKGKPYDLYVHSYLHFGREASRAEIMKVTRSSPNPCLLAGF  272

Query  838   DGYYTYNDVSYKVTAPPNGSSLKNCRKLARKVVDFRAPCKYPNCTFNGVWSGGGGAGMEN  1017
             DG YTY    +K  AP +G++   C+K+ RK +    PC Y NCTF G+W+GGGG G ++
Sbjct  273   DGTYTYAGEEFKAKAPASGANFNGCKKIIRKALKLNYPCPYQNCTFGGIWNGGGGNGQKH  332

Query  1018  VDISSYFYDIAIDVGIIDEGKASKIVKPRSFLVAAKLACETKFEDVKSTFPNAVEKDY-P  1194
             +  SS F+ +  DVG++D    +  ++P   +  AK AC   FED KST+P   +K+   
Sbjct  333   LFASSSFFYLPEDVGMVDPKTPNFKIRPVDLVSEAKKACALNFEDAKSTYPFLAKKNIAS  392

Query  1195  YLCMDLVYQYTLLVDGLGLHPYKEITLMKKVEYKNYMVEAAWPLGCAIDVISS  1353
             Y+CMDL+YQY LLVDG GL P +EIT  K++EY++ ++EAAWPLG A++ ISS
Sbjct  393   YVCMDLIYQYVLLVDGFGLDPLQEITSGKEIEYQDAVLEAAWPLGNAVEAISS  445



>ref|XP_010999471.1| PREDICTED: apyrase 2-like [Populus euphratica]
Length=468

 Score =   447 bits (1150),  Expect = 1e-148, Method: Compositional matrix adjust.
 Identities = 233/460 (51%), Positives = 320/460 (70%), Gaps = 16/460 (3%)
 Frame = +1

Query  22    KHNTMKHTSHHH---LVFISLALLLFPLACF---SRSHL-------RRVLLN--HEAGNY  156
             +H ++   +H +   L+ IS+ +LL         SR          R++  N   ++ +Y
Sbjct  7     RHESLSDKAHKYRGVLLVISIPMLLIAFVLLVMPSREDYEYGGGGSRKMSPNLVRDSRSY  66

Query  157   AVIFDAGSTGSRVHVFHFDENLDLLPVGDGVEFFLKITPGLSSYADDPEAAAKSLEPLLL  336
             AVIFDAGS+GSRVHVF FD NLDL+P+G  +E F++++PGLS+YA++P+ AA SL  LL 
Sbjct  67    AVIFDAGSSGSRVHVFCFDRNLDLVPIGKELELFVQLSPGLSAYANNPQEAASSLASLLD  126

Query  337   EAEGVVPTELQPDTPLELGATAGLRLLEGDASDKILQAVRDMFKNESNFKSKAEWVSILE  516
             +AE  VP EL+P TP+ +GATAGLR L  DASD+ILQAVRD  + +S  KS+A  V++L+
Sbjct  127   KAESSVPKELRPKTPVRVGATAGLRALGMDASDRILQAVRDFLRAKSTLKSEASRVTVLD  186

Query  517   GSQEGTYFWVAMNYLLGNLGKGYQNTIATIDLGGGSVQVSYAVSGDTFANAPKPHNGEEP  696
             GSQEG+Y WV +NYLLGNLGK Y NT+  +DLGGGSVQ++YA+S    A AP+  +GE+ 
Sbjct  187   GSQEGSYQWVTINYLLGNLGKTYSNTVGVVDLGGGSVQMAYAISKMDAAKAPRISDGEDT  246

Query  697   YVQEKYILGAQYYLYVHSYLNYGQLASRAEIFKASGNSTNPCVLEGYDGYYTYNDVSYKV  876
             YV+E +++G +YYLYVHSYL+YG LA+RAEI  AS +S+NPC+L GYDG Y Y    +K 
Sbjct  247   YVKEMFLMGTKYYLYVHSYLHYGLLAARAEILDASEDSSNPCILGGYDGVYNYGGKDHKA  306

Query  877   TAPPNGSSLKNCRKLARKVVDF-RAPCKYPNCTFNGVWSGGGGAGMENVDISSYFYDIAI  1053
             +A P+GS+L  CR++A   +    + C    CTF GVW+GGGG G +N+ ++S+F+D A 
Sbjct  307   SASPSGSNLDECRRVALNALKVNESTCTSMKCTFGGVWNGGGGDGQKNMFVASFFFDRAA  366

Query  1054  DVGIIDEGKASKIVKPRSFLVAAKLACETKFEDVKSTFPNAVEKDYPYLCMDLVYQYTLL  1233
               G ID       V+P  F  AAK AC TK E+ KS + +  EKD PY+CMDLVYQYTLL
Sbjct  367   QAGFIDSSLPVVKVRPVDFEHAAKRACGTKLENAKSIYHSLDEKDLPYICMDLVYQYTLL  426

Query  1234  VDGLGLHPYKEITLMKKVEYKNYMVEAAWPLGCAIDVISS  1353
             VDG  + P +++ L+KKV+Y++ +VEAAWPLG AI+ +SS
Sbjct  427   VDGFAMDPLQDMMLVKKVQYRDSLVEAAWPLGSAIEAVSS  466



>ref|XP_002449357.1| hypothetical protein SORBIDRAFT_05g008570 [Sorghum bicolor]
 gb|EES08345.1| hypothetical protein SORBIDRAFT_05g008570 [Sorghum bicolor]
Length=461

 Score =   447 bits (1149),  Expect = 1e-148, Method: Compositional matrix adjust.
 Identities = 231/451 (51%), Positives = 308/451 (68%), Gaps = 15/451 (3%)
 Frame = +1

Query  58    LVFISLALLLFPLACFSRSHLRR----VLLNHEAGN---------YAVIFDAGSTGSRVH  198
             ++F+SL+  +  +     S L R    +  N  AGN         YAVIFD GSTGSRVH
Sbjct  12    VLFLSLSCQIITVVSGGASVLGRKAGSLATNEAAGNPAGKKGTAQYAVIFDGGSTGSRVH  71

Query  199   VFHFDENLDLLPVGDGVEFFLKITPGLSSYADDPEAAAKSLEPLLLEAEGVVPTELQPDT  378
             VF FD+ LDL+ +G+ ++FF ++ PGLS+YA +P+ AAKS+ PLL +A+ VVPT LQ  T
Sbjct  72    VFQFDKQLDLVKIGNEIQFFAQVKPGLSAYAGEPQEAAKSIAPLLEKAQSVVPTWLQHKT  131

Query  379   PLELGATAGLRLLEGDASDKILQAVRDMFKNESNFKSKAEWVSILEGSQEGTYFWVAMNY  558
             PL+LGATAGLRL+  + S++IL+AVRD+ +++S F+    W+++LEGSQEG+Y WVA+NY
Sbjct  132   PLKLGATAGLRLIGDEKSEEILEAVRDLVRSKSKFQYNPNWITVLEGSQEGSYLWVALNY  191

Query  559   LLGNLGKGYQNTIATIDLGGGSVQVSYAVSGDTFANAPKPHNGEEPYVQEKYILGAQYYL  738
             LLG LG  + +TI  +DLGGGSVQ++YA+S +  ANAP    G++PYV ++Y+ G QY L
Sbjct  192   LLGRLGGDFSDTIGVVDLGGGSVQMAYAISDEASANAPVVPQGQDPYVTKEYLKGKQYNL  251

Query  739   YVHSYLNYGQLASRAEIFKASGNSTNPCVLEGYDGYYTYNDVSYKVTAPPNGSSLKNCRK  918
             YVHSYL+YG LA+RAEI K +    +PC+L G+ G YTYN   Y+ TAPP G+S   CR 
Sbjct  252   YVHSYLHYGLLAARAEILKVNNGPFSPCILRGFSGTYTYNGEEYEATAPPEGASYHTCRD  311

Query  919   LARKVVDFRAPCKYPNCTFNGVWSGGGGAGMENVDISSYFYDIAIDVGIIDEGKASKIVK  1098
              A   ++  A C+  NCTFNGVW+GGGGAG  ++ ++SYFYD A  VGIID    +    
Sbjct  312   EAIAALNLGAHCETKNCTFNGVWNGGGGAGQADLYVASYFYDRASQVGIIDGDAPNGKST  371

Query  1099  PRSFLVAAKLACETKFEDVKSTFPNAVEKDYPYLCMDLVYQYTLLVDGLGLHPYKEITLM  1278
             P +F  AA   C    +D K+ +PNA   D  YLCMDLVY+YTLLVDG GL P KE TL+
Sbjct  372   PAAFADAALKVCSLSIDDAKAAYPNAW--DTEYLCMDLVYEYTLLVDGFGLEPSKEFTLV  429

Query  1279  KKVEYKNYMVEAAWPLGCAIDVISSSSANNL  1371
              KV+Y  Y V+AAWPLG AI+ +SS   N +
Sbjct  430   TKVKYGEYYVDAAWPLGDAIETLSSQKLNQI  460



>gb|AAG32959.1| apyrase GS50 [Glycine soja]
Length=463

 Score =   446 bits (1148),  Expect = 2e-148, Method: Compositional matrix adjust.
 Identities = 225/401 (56%), Positives = 292/401 (73%), Gaps = 1/401 (0%)
 Frame = +1

Query  151   NYAVIFDAGSTGSRVHVFHFDENLDLLPVGDGVEFFLKITPGLSSYADDPEAAAKSLEPL  330
             +YAVIFDAGSTGSRVHV+ F++ LDLL +G  +E F+K  PGLS+YA++P+ AA+SL PL
Sbjct  53    SYAVIFDAGSTGSRVHVYRFNQQLDLLRIGQDLELFVKTMPGLSAYAENPQDAAESLIPL  112

Query  331   LLEAEGVVPTELQPDTPLELGATAGLRLLEGDASDKILQAVRDMFKNESNFKSKAEWVSI  510
             L EAE  VP E  P TP++LGATAGLR LEGDASD+ILQAV DM KN S     A+ VS+
Sbjct  113   LEEAEAAVPQEFHPRTPVKLGATAGLRQLEGDASDRILQAVSDMLKNRSTLNVGADAVSV  172

Query  511   LEGSQEGTYFWVAMNYLLGNLGKGYQNTIATIDLGGGSVQVSYAVSGDTFANAPKPHNGE  690
             L G+QEG Y WV +NYLLGNLGK Y  T+A +DLGGGSVQ++YAVS    A AP+  +G 
Sbjct  173   LSGNQEGAYQWVTINYLLGNLGKHYSETVAVVDLGGGSVQMAYAVSETDAAKAPRAPDGV  232

Query  691   EPYVQEKYILGAQYYLYVHSYLNYGQLASRAEIFKASGNSTNPCVLEGYDGYYTYNDVSY  870
             E Y+ E ++ G +YYLYVHSYL YG LA+RAE  K   +S NPC+L G+DGYY Y  V Y
Sbjct  233   ESYITEMFLRGKKYYLYVHSYLRYGMLAARAEALKVR-HSENPCILAGFDGYYVYGGVQY  291

Query  871   KVTAPPNGSSLKNCRKLARKVVDFRAPCKYPNCTFNGVWSGGGGAGMENVDISSYFYDIA  1050
             K  APP+GSS   C+ +  + +   A C Y +CTF G+W+GGGGAG  N  I+S+F+++A
Sbjct  292   KAKAPPSGSSFSQCQNVVVEALHVNATCSYKDCTFGGIWNGGGGAGENNFFIASFFFEVA  351

Query  1051  IDVGIIDEGKASKIVKPRSFLVAAKLACETKFEDVKSTFPNAVEKDYPYLCMDLVYQYTL  1230
              + G +D    +  V+P  F  AAK+AC T+ +D+KS FP   + D PY+C+DLVY+YTL
Sbjct  352   DEAGFVDPNAPNAKVRPVDFENAAKVACNTELKDLKSIFPRVKDGDVPYICLDLVYEYTL  411

Query  1231  LVDGLGLHPYKEITLMKKVEYKNYMVEAAWPLGCAIDVISS  1353
             LVDG G+ P +EITL+++VEY++ +VEAA PLG AI+ ISS
Sbjct  412   LVDGFGIDPQQEITLVRQVEYQDSLVEAARPLGSAIEAISS  452



>dbj|BAD13527.1| apyrase [Glycine max]
Length=455

 Score =   446 bits (1147),  Expect = 2e-148, Method: Compositional matrix adjust.
 Identities = 231/443 (52%), Positives = 309/443 (70%), Gaps = 10/443 (2%)
 Frame = +1

Query  55    HLVFISLALLLFPLACFSRSHL--------RRVLLNH-EAGNYAVIFDAGSTGSRVHVFH  207
              L+   +  LLF +   + S          R++ L H E  +YAV+FDAGSTGSR+HV+H
Sbjct  2     ELLIKLITFLLFSMPAITSSQYLGNNLLTSRKIFLKHVEISSYAVVFDAGSTGSRIHVYH  61

Query  208   FDENLDLLPVGDGVEFFLKITPGLSSYADDPEAAAKSLEPLLLEAEGVVPTELQPDTPLE  387
             F++NLDLL +G GVE++ KITPGLSSYA++PE AAKSL PLL +AE VVP +LQP TP+ 
Sbjct  62    FNQNLDLLHIGKGVEYYNKITPGLSSYANNPEQAAKSLIPLLEQAEDVVPDDLQPKTPVR  121

Query  388   LGATAGLRLLEGDASDKILQAVRDMFKNESNFKSKAEWVSILEGSQEGTYFWVAMNYLLG  567
             LGATAGLRLL GDAS+KILQ+VRDM  N S F  + + VSI++G+QEG+Y WV +NY LG
Sbjct  122   LGATAGLRLLNGDASEKILQSVRDMLSNRSTFNVQPDAVSIIDGTQEGSYLWVTVNYALG  181

Query  568   NLGKGYQNTIATIDLGGGSVQVSYAVSGDTFANAPKPHNGEEPYVQEKYILGAQYYLYVH  747
             NLGK Y  T+  IDLGGGSVQ++YAVS  T  NAPK  +G++PY+++  + G  Y LYVH
Sbjct  182   NLGKKYTKTVGVIDLGGGSVQMAYAVSKKTAKNAPKVADGDDPYIKKVVLKGIPYDLYVH  241

Query  748   SYLNYGQLASRAEIFKASGNSTNPCVLEGYDGYYTYNDVSYKVTAPPNGSSLKNCRKLAR  927
             SYL++G+ ASRAEI K +  S NPC+L G++G YTY+   +K TA  +G++   C+   R
Sbjct  242   SYLHFGREASRAEILKLTPRSPNPCLLAGFNGIYTYSGEEFKATAYTSGANFNKCKNTIR  301

Query  928   KVVDFRAPCKYPNCTFNGVWSGGGGAGMENVDISSYFYDIAIDVGIIDEGKASKIVKPRS  1107
             K +    PC Y NCTF G+W+GGGG G +N   SS F+ +  D G++D    + I++P  
Sbjct  302   KALKLNYPCPYQNCTFGGIWNGGGGNGQKNPFASSSFFYLPEDTGMVDASTPNFILRPVD  361

Query  1108  FLVAAKLACETKFEDVKSTFPNAVEKDY-PYLCMDLVYQYTLLVDGLGLHPYKEITLMKK  1284
                 AK AC   FED KST+P   +K+   Y+CMDL+YQY LLVDG GL P ++IT  K+
Sbjct  362   IETKAKEACALNFEDAKSTYPFLDKKNVASYVCMDLIYQYVLLVDGFGLDPLQKITSGKE  421

Query  1285  VEYKNYMVEAAWPLGCAIDVISS  1353
             +EY++ +VEAAWPLG A++ IS+
Sbjct  422   IEYQDAIVEAAWPLGNAVEAISA  444



>dbj|BAM84271.1| apyrase [Medicago truncatula]
Length=456

 Score =   446 bits (1146),  Expect = 2e-148, Method: Compositional matrix adjust.
 Identities = 226/413 (55%), Positives = 298/413 (72%), Gaps = 2/413 (0%)
 Frame = +1

Query  121   RRVLLNHEA-GNYAVIFDAGSTGSRVHVFHFDENLDLLPVGDGVEFFLKITPGLSSYADD  297
             R++    E   +YAV+FDAGSTGSR+HV+HFD+NLDLL +G  VEFF KITPGLSSYA+D
Sbjct  33    RKIFQQQETISSYAVVFDAGSTGSRIHVYHFDQNLDLLHIGKDVEFFNKITPGLSSYAND  92

Query  298   PEAAAKSLEPLLLEAEGVVPTELQPDTPLELGATAGLRLLEGDASDKILQAVRDMFKNES  477
             PE AAKSL PLL +AE VVP +L   TP+ LGATAGLRLL GDAS+KILQAVRDMF N S
Sbjct  93    PEHAAKSLIPLLQQAENVVPIDLHHKTPIRLGATAGLRLLNGDASEKILQAVRDMFSNRS  152

Query  478   NFKSKAEWVSILEGSQEGTYFWVAMNYLLGNLGKGYQNTIATIDLGGGSVQVSYAVSGDT  657
              F  + + VSI++G+QEG+Y WV +NY LGNLGK Y  T+  +DLGGGSVQ++YAVS  T
Sbjct  153   TFNVQPDAVSIIDGTQEGSYLWVTVNYALGNLGKKYTKTVGVMDLGGGSVQMAYAVSKKT  212

Query  658   FANAPKPHNGEEPYVQEKYILGAQYYLYVHSYLNYGQLASRAEIFKASGNSTNPCVLEGY  837
               NAPK  +G +PY+++  + G  Y LYVHSYL++G+ ASRAEI K + +S N C+L G+
Sbjct  213   AKNAPKAADGVDPYIKKLVLKGKPYDLYVHSYLHFGREASRAEIMKVTRSSPNTCILAGF  272

Query  838   DGYYTYNDVSYKVTAPPNGSSLKNCRKLARKVVDFRAPCKYPNCTFNGVWSGGGGAGMEN  1017
             DG YTY  V +K  AP +G++   C+K+ RK +    PC Y NCTF G+W+GGGG G ++
Sbjct  273   DGTYTYAGVEFKAKAPASGANFNGCKKIIRKALKLNYPCPYQNCTFGGIWNGGGGNGQKH  332

Query  1018  VDISSYFYDIAIDVGIIDEGKASKIVKPRSFLVAAKLACETKFEDVKSTFPNAVEKDY-P  1194
             +  SS F+ +  DVG+++    +  ++P   +  AK AC   FED KST+P   +K+   
Sbjct  333   LFASSSFFYLPEDVGMVNPKTPNFKIRPVDLVSEAKKACALNFEDAKSTYPFLAKKNIAS  392

Query  1195  YLCMDLVYQYTLLVDGLGLHPYKEITLMKKVEYKNYMVEAAWPLGCAIDVISS  1353
             Y+CMDL+YQY LLVDG GL P +EIT  K++EY++ ++EAAW LG A++ ISS
Sbjct  393   YVCMDLIYQYVLLVDGFGLDPLQEITSGKEIEYQDAVLEAAWALGNAVEAISS  445



>ref|XP_010054281.1| PREDICTED: apyrase 2 [Eucalyptus grandis]
 gb|KCW89828.1| hypothetical protein EUGRSUZ_A02068 [Eucalyptus grandis]
Length=468

 Score =   446 bits (1147),  Expect = 2e-148, Method: Compositional matrix adjust.
 Identities = 235/441 (53%), Positives = 315/441 (71%), Gaps = 9/441 (2%)
 Frame = +1

Query  58    LVFISLALLLFP-------LACFSRSHLRRVLLNHEAGNYAVIFDAGSTGSRVHVFHFDE  216
             L+ I   L L P       +  F+ S+ RR     ++  YAVIFDAGS+GSRVHVF FD+
Sbjct  28    LLLIGFVLFLMPSGSPSGAIEDFALSN-RRGSPGSKSRTYAVIFDAGSSGSRVHVFCFDK  86

Query  217   NLDLLPVGDGVEFFLKITPGLSSYADDPEAAAKSLEPLLLEAEGVVPTELQPDTPLELGA  396
              LDL+P+G  +E F+K  PGLS++A +P  AA+SL  LL +AEG VP EL+ DTP+++GA
Sbjct  87    YLDLVPMGKELELFVKTDPGLSAFAKNPRQAAESLHSLLDKAEGAVPKELRGDTPVKVGA  146

Query  397   TAGLRLLEGDASDKILQAVRDMFKNESNFKSKAEWVSILEGSQEGTYFWVAMNYLLGNLG  576
             TAGLR LEGDA D+IL AVR++ K++S+ KS   WVS+L+G+QEG Y WV +NYLLG LG
Sbjct  147   TAGLRALEGDAPDRILDAVRELLKHKSSLKSDPRWVSVLDGTQEGAYQWVTINYLLGYLG  206

Query  577   KGYQNTIATIDLGGGSVQVSYAVSGDTFANAPKPHNGEEPYVQEKYILGAQYYLYVHSYL  756
             K Y NT+  +DLGGGSVQ++YA+S +  A AP+  NGE+ YV E ++ G +YYLYVHSYL
Sbjct  207   KEYSNTVGVVDLGGGSVQMAYAISEEDAAKAPRFSNGEDSYVNEMFLKGRRYYLYVHSYL  266

Query  757   NYGQLASRAEIFKASGNSTNPCVLEGYDGYYTYNDVSYKVTAPPNGSSLKNCRKLARKVV  936
             +YG LA+RAEI K SG+S NPC+LEGY+G Y Y   +Y+ +A  +GSS+  C+++A K +
Sbjct  267   HYGLLAARAEILKVSGDSGNPCILEGYEGSYKYGGATYQASASSSGSSINECKRIASKAL  326

Query  937   DF-RAPCKYPNCTFNGVWSGGGGAGMENVDISSYFYDIAIDVGIIDEGKASKIVKPRSFL  1113
                 + C +  CTF GVW+GGGG G +N+ ++S+FYD A + G +D  K    V    F 
Sbjct  327   KVNESTCTHMKCTFGGVWNGGGGDGQKNLFVASFFYDRAAEAGFVDPNKPVAKVSAAEFE  386

Query  1114  VAAKLACETKFEDVKSTFPNAVEKDYPYLCMDLVYQYTLLVDGLGLHPYKEITLMKKVEY  1293
              AAK AC+TK ED KS +P+  + + PYLCMDLVYQYTLLVDG  + P+++ITL+KKV+Y
Sbjct  387   EAAKRACQTKLEDAKSVYPHVGDANLPYLCMDLVYQYTLLVDGFAIDPWQKITLVKKVKY  446

Query  1294  KNYMVEAAWPLGCAIDVISSS  1356
             +N  VEAAWPLG AI+ +SSS
Sbjct  447   RNAFVEAAWPLGSAIEAVSSS  467



>dbj|BAB87198.1| ATP diphosphohydrolase [Pisum sativum]
Length=473

 Score =   446 bits (1146),  Expect = 4e-148, Method: Compositional matrix adjust.
 Identities = 225/455 (49%), Positives = 302/455 (66%), Gaps = 28/455 (6%)
 Frame = +1

Query  73    LALLLFPLACFSRSHL--------RRVLLNHEA-GNYAVIFDAGSTGSRVHVFHFDENLD  225
             +  LLF +   + S          RR+ L  E   +YAV+FDAGSTGSR+HV+HF++NLD
Sbjct  8     ITFLLFSMPAITSSQYLGNNLLTSRRIFLKQEEISSYAVVFDAGSTGSRIHVYHFNQNLD  67

Query  226   LLPVGDGVEFFLKITPGLSSYADDPEAAAKSLEPLLLEAEGVVPTELQPDTPLELGATAG  405
             LL +G GVE++ KITPGLSSYA++PE AAKSL PLL +AE  VP +LQP TP+ LGATA 
Sbjct  68    LLHIGKGVEYYNKITPGLSSYANNPEQAAKSLIPLLEQAEEFVPDDLQPKTPVRLGATAV  127

Query  406   LRLLEGDASDKILQAVRDMFKNESNFKSKAEWVSILEGSQEGTYFW--------------  543
             LRLL GDAS+KILQ+VRDM  N S F  + + VSI++G+QEG+Y W              
Sbjct  128   LRLLNGDASEKILQSVRDMLSNRSTFNVQPDAVSIIDGTQEGSYLWTYIYIHMMLLCLYT  187

Query  544   ----VAMNYLLGNLGKGYQNTIATIDLGGGSVQVSYAVSGDTFANAPKPHNGEEPYVQEK  711
                 V +NY LG LGK Y  T+  IDLGGGSVQ++YAVS  T  NAPK  +G++PY+++ 
Sbjct  188   LCSQVTVNYALGKLGKKYTKTVGVIDLGGGSVQMAYAVSKKTAKNAPKVADGDDPYIKKV  247

Query  712   YILGAQYYLYVHSYLNYGQLASRAEIFKASGNSTNPCVLEGYDGYYTYNDVSYKVTAPPN  891
              + G  Y LYVHSYL++G+ ASRAEI K +  S NPC+L G++G YTY+   +K TA  +
Sbjct  248   VLKGIPYDLYVHSYLHFGREASRAEILKLTRRSPNPCLLAGFNGIYTYSREEFKATAYTS  307

Query  892   GSSLKNCRKLARKVVDFRAPCKYPNCTFNGVWSGGGGAGMENVDISSYFYDIAIDVGIID  1071
             G++   C+   RK +    PC Y NCTF G+W  GGG G +N+  SS F+ +  D G++D
Sbjct  308   GANFNKCKNTIRKALKLNYPCPYQNCTFGGIWKSGGGNGQKNLFASSTFFYLPEDTGMVD  367

Query  1072  EGKASKIVKPRSFLVAAKLACETKFEDVKSTFPNAVEKDY-PYLCMDLVYQYTLLVDGLG  1248
                 + I++P      AK +C   FED KST+P   +K+   Y+CMDL+YQY LLVDG G
Sbjct  368   ASTPNFILRPVDIETKAKGSCALNFEDAKSTYPFLDKKNVASYVCMDLIYQYVLLVDGFG  427

Query  1249  LHPYKEITLMKKVEYKNYMVEAAWPLGCAIDVISS  1353
             L P ++IT  K++EY++ +VEAAWPLG A++ IS+
Sbjct  428   LDPLQKITSGKEIEYQDAIVEAAWPLGNAVEAISA  462



>dbj|BAM84274.1| apyrase [Medicago truncatula]
Length=467

 Score =   445 bits (1145),  Expect = 5e-148, Method: Compositional matrix adjust.
 Identities = 230/441 (52%), Positives = 311/441 (71%), Gaps = 10/441 (2%)
 Frame = +1

Query  58    LVFISLALLLFPLACFSRSHLRRVLLNHE-------AGNYAVIFDAGSTGSRVHVFHFDE  216
             ++ I+  L + P +    S     LLN +        G+YAVIFDAGS+GSRVHVFHFD+
Sbjct  29    ILLITFVLYMMPSSSNYDSAGDYALLNRKLSPDKKSGGSYAVIFDAGSSGSRVHVFHFDQ  88

Query  217   NLDLLPVGDGVEFFLKITPGLSSYADDPEAAAKSLEPLLLEAEGVVPTELQPDTPLELGA  396
             NLDL+ +G  +E F ++ PGLS+YA  P+ AA+SL  LL +AEGVVP EL+  TP+ +GA
Sbjct  89    NLDLVHIGKDLELFEQLKPGLSAYAQKPQQAAESLVSLLEKAEGVVPRELRSKTPVRIGA  148

Query  397   TAGLRLLEGDASDKILQAVRDMFKNESNFKSKAEWVSILEGSQEGTYFWVAMNYLLGNLG  576
             TAGLR LEGDASDKIL+AVRD+ K+ S+FKS A+ V++L+G+QEG Y WV +NYLLGNLG
Sbjct  149   TAGLRALEGDASDKILRAVRDLLKHRSSFKSDADAVTVLDGTQEGAYQWVTINYLLGNLG  208

Query  577   KGYQNTIATIDLGGGSVQVSYAVSGDTFANAPKPHNGEEPYVQEKYILGAQYYLYVHSYL  756
             K Y  T+  +DLGGGSVQ++YA+S    A AP+  +GE+PYV+E ++ G +YYLYVHSYL
Sbjct  209   KDYSKTVGVVDLGGGSVQMAYAISESEAAMAPQVTDGEDPYVKEMFLRGRKYYLYVHSYL  268

Query  757   NYGQLASRAEIFKASGNSTNPCVLEGYDGYYTYNDVSYKVTAPPNGSSLKNCRKLARKVV  936
              YG LA+RAEI K  G++ NPC        + Y   S+K  A  +G+SL  C+ +A K +
Sbjct  269   RYGLLAARAEILKVVGDAENPCSYLALMELHKYGGKSFK--ASSSGASLNECKSVAHKAL  326

Query  937   DF-RAPCKYPNCTFNGVWSGGGGAGMENVDISSYFYDIAIDVGIIDEGKASKIVKPRSFL  1113
                 + C +  CTF G+W+GGGG G +N+ ++S+F+D A + G +D      IV+P  F 
Sbjct  327   KVNESTCTHMKCTFGGIWNGGGGDGQKNLFVASFFFDRAAEAGFVDPNSPVAIVRPADFE  386

Query  1114  VAAKLACETKFEDVKSTFPNAVEKDYPYLCMDLVYQYTLLVDGLGLHPYKEITLMKKVEY  1293
              AAK AC+TK E+ KST+P   E + P LCMDLVYQYTLLVDG G++P++EITL+KKV+Y
Sbjct  387   DAAKQACQTKLENAKSTYPQVEEGNLPNLCMDLVYQYTLLVDGFGIYPWQEITLVKKVKY  446

Query  1294  KNYMVEAAWPLGCAIDVISSS  1356
              + +VEAAWPLG AI+ +SS+
Sbjct  447   DDALVEAAWPLGSAIEAVSST  467



>sp|P52914.1|NTPA_PEA RecName: Full=Nucleoside-triphosphatase; Short=NTPase; AltName: 
Full=Nucleoside triphosphate phosphohydrolase; Short=Apyrase 
[Pisum sativum]
 emb|CAA83655.1| nucleoside triphosphatase [Pisum sativum]
 dbj|BAA75506.1| apyrase [Pisum sativum]
 dbj|BAB18900.1| apyrase [Pisum sativum]
 dbj|BAB18894.1| apyrase H-type [Pisum sativum]
 dbj|BAB18896.1| apyrase [Pisum sativum]
Length=455

 Score =   445 bits (1144),  Expect = 6e-148, Method: Compositional matrix adjust.
 Identities = 230/443 (52%), Positives = 309/443 (70%), Gaps = 10/443 (2%)
 Frame = +1

Query  55    HLVFISLALLLFPLACFSRSHL--------RRVLLNHEA-GNYAVIFDAGSTGSRVHVFH  207
              L+   +  LLF +   + S          R++ L  E   +YAV+FDAGSTGSR+HV+H
Sbjct  2     ELLIKLITFLLFSMPAITSSQYLGNNLLTSRKIFLKQEEISSYAVVFDAGSTGSRIHVYH  61

Query  208   FDENLDLLPVGDGVEFFLKITPGLSSYADDPEAAAKSLEPLLLEAEGVVPTELQPDTPLE  387
             F++NLDLL +G GVE++ KITPGLSSYA++PE AAKSL PLL +AE VVP +LQP TP+ 
Sbjct  62    FNQNLDLLHIGKGVEYYNKITPGLSSYANNPEQAAKSLIPLLEQAEDVVPDDLQPKTPVR  121

Query  388   LGATAGLRLLEGDASDKILQAVRDMFKNESNFKSKAEWVSILEGSQEGTYFWVAMNYLLG  567
             LGATAGLRLL GDAS+KILQ+VRDM  N S F  + + VSI++G+QEG+Y WV +NY LG
Sbjct  122   LGATAGLRLLNGDASEKILQSVRDMLSNRSTFNVQPDAVSIIDGTQEGSYLWVTVNYALG  181

Query  568   NLGKGYQNTIATIDLGGGSVQVSYAVSGDTFANAPKPHNGEEPYVQEKYILGAQYYLYVH  747
             NLGK Y  T+  IDLGGGSVQ++YAVS  T  NAPK  +G++PY+++  + G  Y LYVH
Sbjct  182   NLGKKYTKTVGVIDLGGGSVQMAYAVSKKTAKNAPKVADGDDPYIKKVVLKGIPYDLYVH  241

Query  748   SYLNYGQLASRAEIFKASGNSTNPCVLEGYDGYYTYNDVSYKVTAPPNGSSLKNCRKLAR  927
             SYL++G+ ASRAEI K +  S NPC+L G++G YTY+   +K TA  +G++   C+   R
Sbjct  242   SYLHFGREASRAEILKLTPRSPNPCLLAGFNGIYTYSGEEFKATAYTSGANFNKCKNTIR  301

Query  928   KVVDFRAPCKYPNCTFNGVWSGGGGAGMENVDISSYFYDIAIDVGIIDEGKASKIVKPRS  1107
             K +    PC Y NCTF G+W+GGGG G +N+  SS F+ +  D G++D    + I++P  
Sbjct  302   KALKLNYPCPYQNCTFGGIWNGGGGNGQKNLFASSSFFYLPEDTGMVDASTPNFILRPVD  361

Query  1108  FLVAAKLACETKFEDVKSTFPNAVEKDY-PYLCMDLVYQYTLLVDGLGLHPYKEITLMKK  1284
                 AK AC   FED KST+P   +K+   Y+CMDL+YQY LLVDG GL P ++IT  K+
Sbjct  362   IETKAKEACALNFEDAKSTYPFLDKKNVASYVCMDLIYQYVLLVDGFGLDPLQKITSGKE  421

Query  1285  VEYKNYMVEAAWPLGCAIDVISS  1353
             +EY++ +VEAAWPLG A++ IS+
Sbjct  422   IEYQDAIVEAAWPLGNAVEAISA  444



>dbj|BAB18890.1| apyrase S-type [Pisum sativum]
 dbj|BAB18893.1| apyrase S-type [Pisum sativum]
 dbj|BAB18895.1| apyrase [Pisum sativum]
 dbj|BAB40230.1| S-type apyras [Pisum sativum]
 dbj|BAB85977.1| PsAPY1 [Pisum sativum]
Length=455

 Score =   444 bits (1143),  Expect = 6e-148, Method: Compositional matrix adjust.
 Identities = 229/437 (52%), Positives = 307/437 (70%), Gaps = 10/437 (2%)
 Frame = +1

Query  73    LALLLFPLACFSRSHL--------RRVLLNHEA-GNYAVIFDAGSTGSRVHVFHFDENLD  225
             +  LLF +   + S          R++ L  E   +YAV+FDAGSTGSR+HV+HF++NLD
Sbjct  8     ITFLLFSMPAITSSQYLGNNLLTSRKIFLKQEEISSYAVVFDAGSTGSRIHVYHFNQNLD  67

Query  226   LLPVGDGVEFFLKITPGLSSYADDPEAAAKSLEPLLLEAEGVVPTELQPDTPLELGATAG  405
             LL +G GVE++ KITPGLSSYA++PE AAKSL PLL +AE VVP +LQP TP+ LGATAG
Sbjct  68    LLHIGKGVEYYNKITPGLSSYANNPEQAAKSLIPLLEQAEDVVPDDLQPKTPVRLGATAG  127

Query  406   LRLLEGDASDKILQAVRDMFKNESNFKSKAEWVSILEGSQEGTYFWVAMNYLLGNLGKGY  585
             LRLL GDAS+KILQ+VRDM  N S F  + + VSI++G+QEG+Y WV +NY LGNLGK Y
Sbjct  128   LRLLNGDASEKILQSVRDMLSNRSTFNVQPDAVSIIDGTQEGSYLWVTVNYALGNLGKKY  187

Query  586   QNTIATIDLGGGSVQVSYAVSGDTFANAPKPHNGEEPYVQEKYILGAQYYLYVHSYLNYG  765
               T+  IDLGGGSVQ++YAVS  T  NAPK  +G++PY+++  + G  Y LYVHSYL++G
Sbjct  188   TKTVGVIDLGGGSVQMAYAVSKKTAKNAPKVADGDDPYIKKVVLKGIPYDLYVHSYLHFG  247

Query  766   QLASRAEIFKASGNSTNPCVLEGYDGYYTYNDVSYKVTAPPNGSSLKNCRKLARKVVDFR  945
             + ASRAEI K +  S NPC+L G++G YTY+   +K TA  +G++   C+   RK +   
Sbjct  248   REASRAEILKLTPRSPNPCLLAGFNGIYTYSGEEFKATAYTSGANFNKCKNTIRKALKLN  307

Query  946   APCKYPNCTFNGVWSGGGGAGMENVDISSYFYDIAIDVGIIDEGKASKIVKPRSFLVAAK  1125
              PC Y NCTF G+W+GGGG G +N+  SS F+ +  D G++D    + I++P      AK
Sbjct  308   YPCPYQNCTFGGIWNGGGGNGQKNLFASSSFFYLPEDTGMVDASTPNFILRPVDIETKAK  367

Query  1126  LACETKFEDVKSTFPNAVEKDY-PYLCMDLVYQYTLLVDGLGLHPYKEITLMKKVEYKNY  1302
              AC   FED KST+P   +K+   Y+CMDL+YQY LLVDG GL P ++IT  K++EY++ 
Sbjct  368   EACALNFEDAKSTYPFLDKKNVASYVCMDLIYQYVLLVDGFGLDPLQKITSGKEIEYQDA  427

Query  1303  MVEAAWPLGCAIDVISS  1353
             +VEAAWPLG A++ IS+
Sbjct  428   IVEAAWPLGNAVEAISA  444



>ref|XP_010922866.1| PREDICTED: probable apyrase 2 [Elaeis guineensis]
Length=459

 Score =   444 bits (1143),  Expect = 9e-148, Method: Compositional matrix adjust.
 Identities = 236/416 (57%), Positives = 296/416 (71%), Gaps = 0/416 (0%)
 Frame = +1

Query  133   LNHEAGNYAVIFDAGSTGSRVHVFHFDENLDLLPVGDGVEFFLKITPGLSSYADDPEAAA  312
             +  E  +YAVIFDAGSTGSRVHVF FDEN+DLL +GD +E F+++ PGLSSYADDP+ AA
Sbjct  35    VGREIESYAVIFDAGSTGSRVHVFRFDENMDLLYLGDDIELFVQVKPGLSSYADDPQKAA  94

Query  313   KSLEPLLLEAEGVVPTELQPDTPLELGATAGLRLLEGDASDKILQAVRDMFKNESNFKSK  492
              SL PLL EAEGVVP ELQP TP+ LGATAGLR L  + S++ILQAVRD+F+N S F+ K
Sbjct  95    NSLIPLLEEAEGVVPEELQPTTPVRLGATAGLRNLGEEKSEEILQAVRDLFQNNSLFEYK  154

Query  493   AEWVSILEGSQEGTYFWVAMNYLLGNLGKGYQNTIATIDLGGGSVQVSYAVSGDTFANAP  672
             +EW+++LEG QEG+Y WVAMNYLLGNLG  Y +T+  +DLGGGSVQ++YA+S    ANAP
Sbjct  155   SEWITVLEGYQEGSYLWVAMNYLLGNLGNRYSDTVGVVDLGGGSVQMAYALSEQAAANAP  214

Query  673   KPHNGEEPYVQEKYILGAQYYLYVHSYLNYGQLASRAEIFKASGNSTNPCVLEGYDGYYT  852
                 G +PYV ++ +    YYLY +SYLNYG LA+RA I +A+    N C+L GY G Y 
Sbjct  215   NVSIGGDPYVTKQLLNETNYYLYAYSYLNYGLLAARAGILEAADEPYNYCMLGGYTGSYE  274

Query  853   YNDVSYKVTAPPNGSSLKNCRKLARKVVDFRAPCKYPNCTFNGVWSGGGGAGMENVDISS  1032
             YN   Y  +A P+GSS   CR    KV+     C Y +CTF GVWSGGGG G +N+ ++S
Sbjct  275   YNGEVYNASASPSGSSYSKCRTETIKVLKINETCAYEDCTFGGVWSGGGGDGQKNLYVAS  334

Query  1033  YFYDIAIDVGIIDEGKASKIVKPRSFLVAAKLACETKFEDVKSTFPNAVEKDYPYLCMDL  1212
             +FYD A  VG ID  K + +V P  F  A K+AC+   E+   T+PN  E+D PY+CMDL
Sbjct  335   FFYDRAAQVGFIDSEKPNALVTPSDFEEATKMACKLSLEEANVTYPNVAEEDLPYICMDL  394

Query  1213  VYQYTLLVDGLGLHPYKEITLMKKVEYKNYMVEAAWPLGCAIDVISSSSANNLLSK  1380
             VY+YTLLVDG GL P +EI L+ KVEY +  V AAWPLG AI+V+SS S  +L  K
Sbjct  395   VYEYTLLVDGFGLEPSQEIILVTKVEYGDSYVGAAWPLGSAIEVVSSQSTQSLAMK  450



>gb|EYU41067.1| hypothetical protein MIMGU_mgv1a004609mg [Erythranthe guttata]
Length=462

 Score =   443 bits (1140),  Expect = 2e-147, Method: Compositional matrix adjust.
 Identities = 235/431 (55%), Positives = 304/431 (71%), Gaps = 0/431 (0%)
 Frame = +1

Query  58    LVFISLALLLFPLACFSRSHLRRVLLNHEAGNYAVIFDAGSTGSRVHVFHFDENLDLLPV  237
             L+ IS  L + P    S S  R+   N  +  YAVIFDAGS+GSRVHVF F++ L+L+P+
Sbjct  32    LMLISFVLFVMPTRPTSESISRKFSPNFISKRYAVIFDAGSSGSRVHVFCFNQQLELVPM  91

Query  238   GDGVEFFLKITPGLSSYADDPEAAAKSLEPLLLEAEGVVPTELQPDTPLELGATAGLRLL  417
             G  +E F++  PGLS YA DPEAAA SL  LL +AE  VP EL+ +TP+ +GATAGLR L
Sbjct  92    GKELELFIQRKPGLSGYAKDPEAAAHSLSDLLEKAEAAVPKELRQNTPVRVGATAGLRQL  151

Query  418   EGDASDKILQAVRDMFKNESNFKSKAEWVSILEGSQEGTYFWVAMNYLLGNLGKGYQNTI  597
             EGDASD+ILQAVRD  KN+S+FKSK++WV++L+G+QEG Y WV +NYLLGN+GK Y +T+
Sbjct  152   EGDASDRILQAVRDYLKNKSSFKSKSDWVTVLDGNQEGAYQWVTINYLLGNMGKEYSSTV  211

Query  598   ATIDLGGGSVQVSYAVSGDTFANAPKPHNGEEPYVQEKYILGAQYYLYVHSYLNYGQLAS  777
               +DLGGGSVQ++YA+S    ANAPK  +GEE YVQE ++ G +Y+LYVHSYL YG LA 
Sbjct  212   GVVDLGGGSVQMAYAISESDAANAPKISDGEESYVQEMFLKGRKYHLYVHSYLRYGLLAG  271

Query  778   RAEIFKASGNSTNPCVLEGYDGYYTYNDVSYKVTAPPNGSSLKNCRKLARKVVDFRAPCK  957
             RAEI K    S NPC+L GY+G Y Y    YK +A P+G+S   CR+ A K +     C 
Sbjct  272   RAEILKIDEESGNPCLLTGYNGSYKYGQTMYKASALPSGASYIKCRETAIKALRVNDSCT  331

Query  958   YPNCTFNGVWSGGGGAGMENVDISSYFYDIAIDVGIIDEGKASKIVKPRSFLVAAKLACE  1137
             +  CTF GVW+GGGG G +N+ ++S+F+D A + G +D       V P  F  AAK ACE
Sbjct  332   HMKCTFGGVWNGGGGDGQKNLFVASFFFDRAAEAGFVDPSLPVAKVHPADFEDAAKRACE  391

Query  1138  TKFEDVKSTFPNAVEKDYPYLCMDLVYQYTLLVDGLGLHPYKEITLMKKVEYKNYMVEAA  1317
             T+ ED KS +P     + PYLCMDL YQ+TLLVDG GL  ++ ITL+KKV+Y+N +VEAA
Sbjct  392   TRLEDGKSLYPRVEADNLPYLCMDLTYQFTLLVDGFGLDKWESITLVKKVQYQNSLVEAA  451

Query  1318  WPLGCAIDVIS  1350
             WPLG AI+ +S
Sbjct  452   WPLGSAIEAVS  462



>gb|EYU41066.1| hypothetical protein MIMGU_mgv1a004609mg [Erythranthe guttata]
Length=518

 Score =   445 bits (1144),  Expect = 4e-147, Method: Compositional matrix adjust.
 Identities = 235/431 (55%), Positives = 304/431 (71%), Gaps = 0/431 (0%)
 Frame = +1

Query  58    LVFISLALLLFPLACFSRSHLRRVLLNHEAGNYAVIFDAGSTGSRVHVFHFDENLDLLPV  237
             L+ IS  L + P    S S  R+   N  +  YAVIFDAGS+GSRVHVF F++ L+L+P+
Sbjct  88    LMLISFVLFVMPTRPTSESISRKFSPNFISKRYAVIFDAGSSGSRVHVFCFNQQLELVPM  147

Query  238   GDGVEFFLKITPGLSSYADDPEAAAKSLEPLLLEAEGVVPTELQPDTPLELGATAGLRLL  417
             G  +E F++  PGLS YA DPEAAA SL  LL +AE  VP EL+ +TP+ +GATAGLR L
Sbjct  148   GKELELFIQRKPGLSGYAKDPEAAAHSLSDLLEKAEAAVPKELRQNTPVRVGATAGLRQL  207

Query  418   EGDASDKILQAVRDMFKNESNFKSKAEWVSILEGSQEGTYFWVAMNYLLGNLGKGYQNTI  597
             EGDASD+ILQAVRD  KN+S+FKSK++WV++L+G+QEG Y WV +NYLLGN+GK Y +T+
Sbjct  208   EGDASDRILQAVRDYLKNKSSFKSKSDWVTVLDGNQEGAYQWVTINYLLGNMGKEYSSTV  267

Query  598   ATIDLGGGSVQVSYAVSGDTFANAPKPHNGEEPYVQEKYILGAQYYLYVHSYLNYGQLAS  777
               +DLGGGSVQ++YA+S    ANAPK  +GEE YVQE ++ G +Y+LYVHSYL YG LA 
Sbjct  268   GVVDLGGGSVQMAYAISESDAANAPKISDGEESYVQEMFLKGRKYHLYVHSYLRYGLLAG  327

Query  778   RAEIFKASGNSTNPCVLEGYDGYYTYNDVSYKVTAPPNGSSLKNCRKLARKVVDFRAPCK  957
             RAEI K    S NPC+L GY+G Y Y    YK +A P+G+S   CR+ A K +     C 
Sbjct  328   RAEILKIDEESGNPCLLTGYNGSYKYGQTMYKASALPSGASYIKCRETAIKALRVNDSCT  387

Query  958   YPNCTFNGVWSGGGGAGMENVDISSYFYDIAIDVGIIDEGKASKIVKPRSFLVAAKLACE  1137
             +  CTF GVW+GGGG G +N+ ++S+F+D A + G +D       V P  F  AAK ACE
Sbjct  388   HMKCTFGGVWNGGGGDGQKNLFVASFFFDRAAEAGFVDPSLPVAKVHPADFEDAAKRACE  447

Query  1138  TKFEDVKSTFPNAVEKDYPYLCMDLVYQYTLLVDGLGLHPYKEITLMKKVEYKNYMVEAA  1317
             T+ ED KS +P     + PYLCMDL YQ+TLLVDG GL  ++ ITL+KKV+Y+N +VEAA
Sbjct  448   TRLEDGKSLYPRVEADNLPYLCMDLTYQFTLLVDGFGLDKWESITLVKKVQYQNSLVEAA  507

Query  1318  WPLGCAIDVIS  1350
             WPLG AI+ +S
Sbjct  508   WPLGSAIEAVS  518



>gb|AAO23003.1| apyrase-like protein [Medicago truncatula]
Length=466

 Score =   442 bits (1138),  Expect = 5e-147, Method: Compositional matrix adjust.
 Identities = 224/441 (51%), Positives = 308/441 (70%), Gaps = 9/441 (2%)
 Frame = +1

Query  58    LVFISLALLLFPLACFSRSHLRRVLLNHEA--------GNYAVIFDAGSTGSRVHVFHFD  213
             +  I+  L + P   +S++    +LL +           +YAV+FDAGSTGSRVHV+HFD
Sbjct  15    MTLITFLLFIMPSISYSQNLGNNILLTNRKIFPKQETISSYAVVFDAGSTGSRVHVYHFD  74

Query  214   ENLDLLPVGDGVEFFLKITPGLSSYADDPEAAAKSLEPLLLEAEGVVPTELQPDTPLELG  393
             +NL+LL VG  VEF+ K TPGLS+YAD+PE AAKSL PLL +AE VVP + +  TP+ LG
Sbjct  75    QNLNLLHVGKDVEFYNKTTPGLSAYADNPEQAAKSLIPLLEQAESVVPEDQRSKTPVRLG  134

Query  394   ATAGLRLLEGDASDKILQAVRDMFKNESNFKSKAEWVSILEGSQEGTYFWVAMNYLLGNL  573
             ATAGLRLL GDAS+KILQ+VRD+  N S F  + + VSI++G+QEG+Y WV +NY LG L
Sbjct  135   ATAGLRLLNGDASEKILQSVRDLLSNRSTFNVQPDAVSIIDGTQEGSYLWVTVNYALGTL  194

Query  574   GKGYQNTIATIDLGGGSVQVSYAVSGDTFANAPKPHNGEEPYVQEKYILGAQYYLYVHSY  753
             GK +  T+  +DLGGGSVQ++YAVS +T  NAPK  +G++PY+++  + G +Y LYVHSY
Sbjct  195   GKKFTKTVGVMDLGGGSVQMAYAVSRNTAKNAPKVADGDDPYIKKLVLKGKKYDLYVHSY  254

Query  754   LNYGQLASRAEIFKASGNSTNPCVLEGYDGYYTYNDVSYKVTAPPNGSSLKNCRKLARKV  933
             L++G  ASRAEI K + NS NPC+L G+DG Y Y    +K  A  +G+S K C+K+  + 
Sbjct  255   LHFGTEASRAEILKVTHNSPNPCILAGFDGTYRYAGEEFKANALASGASFKKCKKIVHQA  314

Query  934   VDFRAPCKYPNCTFNGVWSGGGGAGMENVDISSYFYDIAIDVGIIDEGKASKIVKPRSFL  1113
             +    PC Y NCTF G+W+GGGG+G   +  +S+F+ +A +VG++D  K +  ++P  F 
Sbjct  315   LKLNYPCPYQNCTFGGIWNGGGGSGQRKLFAASFFFYLAAEVGMVDPNKPNFKIRPVDFE  374

Query  1114  VAAKLACETKFEDVKSTFPNAVEKDY-PYLCMDLVYQYTLLVDGLGLHPYKEITLMKKVE  1290
               AK AC   FED KS++P   +K+   Y+CMDL+YQY LLVDG GL P +EIT  K++E
Sbjct  375   SEAKKACALNFEDAKSSYPFLAKKNIASYVCMDLIYQYVLLVDGFGLDPLQEITAGKQIE  434

Query  1291  YKNYMVEAAWPLGCAIDVISS  1353
             Y++ +VEAAWPLG A++ ISS
Sbjct  435   YQDSLVEAAWPLGNAVEAISS  455



>dbj|BAC45033.1| apyrase [Pisum sativum]
 dbj|BAC66636.1| apyrase [Pisum sativum]
Length=455

 Score =   442 bits (1136),  Expect = 7e-147, Method: Compositional matrix adjust.
 Identities = 229/443 (52%), Positives = 308/443 (70%), Gaps = 10/443 (2%)
 Frame = +1

Query  55    HLVFISLALLLFPLACFSRSHL--------RRVLLNHEA-GNYAVIFDAGSTGSRVHVFH  207
              L+   +  LLF +   + S          R++ L  E   +YAV+FDAGSTGSR+HV+H
Sbjct  2     ELLIKLITFLLFSMPAITSSQYLGNNLLTSRKIFLKQEEISSYAVVFDAGSTGSRIHVYH  61

Query  208   FDENLDLLPVGDGVEFFLKITPGLSSYADDPEAAAKSLEPLLLEAEGVVPTELQPDTPLE  387
             F++NLDLL +G GVE++ KITPGLSSYA++PE AAKSL PLL +A  VVP +LQP TP+ 
Sbjct  62    FNQNLDLLHIGKGVEYYNKITPGLSSYANNPEQAAKSLIPLLEQAYDVVPDDLQPKTPVR  121

Query  388   LGATAGLRLLEGDASDKILQAVRDMFKNESNFKSKAEWVSILEGSQEGTYFWVAMNYLLG  567
             LGATAGLRLL GDAS+KILQ+VRDM  N S F  + + VSI++G+QEG+Y WV +NY LG
Sbjct  122   LGATAGLRLLNGDASEKILQSVRDMLSNRSTFNVQPDAVSIIDGTQEGSYLWVTVNYALG  181

Query  568   NLGKGYQNTIATIDLGGGSVQVSYAVSGDTFANAPKPHNGEEPYVQEKYILGAQYYLYVH  747
             NLGK Y  T+  IDLGGGSVQ++YAVS  T  NAPK  +G++PY+++  + G  Y LYVH
Sbjct  182   NLGKKYTKTVGVIDLGGGSVQMAYAVSKKTAKNAPKVADGDDPYIKKVVLKGIPYDLYVH  241

Query  748   SYLNYGQLASRAEIFKASGNSTNPCVLEGYDGYYTYNDVSYKVTAPPNGSSLKNCRKLAR  927
             SYL++G+ ASRAEI K +  S NPC+L G++G YTY+   +K TA  +G++   C+   R
Sbjct  242   SYLHFGREASRAEILKLTPRSPNPCLLAGFNGIYTYSGEEFKATAYTSGANFNKCKNTIR  301

Query  928   KVVDFRAPCKYPNCTFNGVWSGGGGAGMENVDISSYFYDIAIDVGIIDEGKASKIVKPRS  1107
             K +    PC Y NCTF G+W+GGGG G +N+  SS F+ +  D G++D    + I++P  
Sbjct  302   KALKLNYPCPYQNCTFGGIWNGGGGNGQKNLFASSSFFYLPEDTGMVDASTPNFILRPVD  361

Query  1108  FLVAAKLACETKFEDVKSTFPNAVEKDY-PYLCMDLVYQYTLLVDGLGLHPYKEITLMKK  1284
                 AK AC   FED KST+P   +K+   Y+CMDL+YQY LLVDG GL P ++IT  K+
Sbjct  362   IETKAKEACALNFEDAKSTYPFLDKKNVASYVCMDLIYQYVLLVDGFGLDPLQKITSGKE  421

Query  1285  VEYKNYMVEAAWPLGCAIDVISS  1353
             +EY++ +VEAAWPLG A++ IS+
Sbjct  422   IEYQDAIVEAAWPLGNAVEAISA  444



>gb|AAO23002.1| apyrase-like protein [Medicago truncatula]
Length=454

 Score =   441 bits (1135),  Expect = 1e-146, Method: Compositional matrix adjust.
 Identities = 226/413 (55%), Positives = 297/413 (72%), Gaps = 4/413 (1%)
 Frame = +1

Query  121   RRVLLNHEA-GNYAVIFDAGSTGSRVHVFHFDENLDLLPVGDGVEFFLKITPGLSSYADD  297
             R++    E   +YAV+FDAGSTGSR+HV+HFD+NLDLL +G  VEFF KITPGLSSYA+D
Sbjct  33    RKIFQKQETISSYAVVFDAGSTGSRIHVYHFDQNLDLLHIGKDVEFFNKITPGLSSYAND  92

Query  298   PEAAAKSLEPLLLEAEGVVPTELQPDTPLELGATAGLRLLEGDASDKILQAVRDMFKNES  477
             PE AAKSL PLL +AE VVP +L   TP+ LGATAGLRLL GDAS+KILQAVRDMF N S
Sbjct  93    PEQAAKSLIPLLQQAENVVPIDLHHKTPIRLGATAGLRLLNGDASEKILQAVRDMFSNRS  152

Query  478   NFKSKAEWVSILEGSQEGTYFWVAMNYLLGNLGKGYQNTIATIDLGGGSVQVSYAVSGDT  657
              F  + + VSI++G+QEG+Y WV +NY LGNLGK Y  T+  +DLGGGSVQ++YAVS  T
Sbjct  153   TFNVQPDAVSIIDGTQEGSYLWVTVNYALGNLGKKYTKTVGVMDLGGGSVQMAYAVSKKT  212

Query  658   FANAPKPHNGEEPYVQEKYILGAQYYLYVHSYLNYGQLASRAEIFKASGNSTNPCVLEGY  837
               NAPK  +G +PY+++  + G  Y LYVHSYL++G+ ASRAEI K + +S NPC+L G+
Sbjct  213   AKNAPKVADGVDPYIKKLVLKGKPYDLYVHSYLHFGREASRAEIMKVTRSSPNPCLLAGF  272

Query  838   DGYYTYNDVSYKVTAPPNGSSLKNCRKLARKVVDFRAPCKYPNCTFNGVWSGGGGAGMEN  1017
             DG YTY    +K  AP +G++   C+K+ RK +    PC Y NCTF G+W+GGGG G ++
Sbjct  273   DGTYTYAGEEFKAKAPASGANFNGCKKIIRKALKLNYPCPYQNCTFGGIWNGGGGNGQKH  332

Query  1018  VDISSYFYDIAIDVGIIDEGKASKIVKPRSFLVAAKLACETKFEDVKSTFPNAVEKDY-P  1194
             +  SS F+ +  DVG++D    +  ++P   +  AK AC   FED KST+P   +K+   
Sbjct  333   LFASSSFFYLPEDVGMVDPKTPNFKIRPVDLVSEAKKACALNFEDAKSTYPFLAKKNIAS  392

Query  1195  YLCMDLVYQYTLLVDGLGLHPYKEITLMKKVEYKNYMVEAAWPLGCAIDVISS  1353
             Y+CMDL+YQY LLVD  G  P +EIT  K++EY++ ++EAAWPLG A++ ISS
Sbjct  393   YVCMDLIYQYVLLVD--GFDPLQEITSGKEIEYQDAVLEAAWPLGNAVEAISS  443



>gb|EYU37260.1| hypothetical protein MIMGU_mgv1a006675mg [Erythranthe guttata]
Length=435

 Score =   441 bits (1133),  Expect = 1e-146, Method: Compositional matrix adjust.
 Identities = 215/405 (53%), Positives = 292/405 (72%), Gaps = 7/405 (2%)
 Frame = +1

Query  151   NYAVIFDAGSTGSRVHVFHFDENLDLLPVGDGVEFFLKITPGLSSYADDPEAAAKSLEPL  330
             NYAV+FDAGSTG+RVHV+ FD N+DLLPVG+  EFFL   PGLSSY +DPE  A+SL+PL
Sbjct  31    NYAVVFDAGSTGTRVHVYSFDRNMDLLPVGNDYEFFLSTKPGLSSYENDPEGGAQSLKPL  90

Query  331   LLEAEGVVPTELQPDTPLELGATAGLRLLEGDASDKILQAVRDMFKNESNFKSKAEWVSI  510
             L +A+ VVP +   +TP+ LGATAGLR L   A++ IL AVR++FKNES    KA+WVS 
Sbjct  91    LQKAQDVVPQQFLANTPVILGATAGLRQLPASATEAILDAVRNLFKNESKLSYKADWVST  150

Query  511   LEGSQEGTYFWVAMNYLLGNLGKGYQNTIATIDLGGGSVQVSYAVSGDTFANAPKPHNGE  690
             L+G+ EG Y WV +NYLLG LGK Y +T+  +DLGGGSVQ++YA+S  + ANAPK    E
Sbjct  151   LQGTDEGAYQWVTVNYLLGTLGKKYSSTVGVVDLGGGSVQMAYAISDKSAANAPK---DE  207

Query  691   EPYVQEKYILGAQYYLYVHSYLNYGQLASRAEIFKASGNSTNPCVLEGYDGYYTYNDVSY  870
             + YV +K ++G +Y LY HSY NYGQ A RA+    SG++ NPCV  GY G Y Y  V Y
Sbjct  208   DAYVMDKLVMGTKYNLYSHSYSNYGQKAGRAQSLNLSGDAGNPCVTNGYQGTYEYLGVVY  267

Query  871   KVTAPPNGSSLKNCRKLARKVVDFRAPCKYPNCTFNGVWSGGGGAGMENVDISSYFYDIA  1050
              V+AP +G+S++ CR L RK +   APC +  C+F+GVWSGGGG G++N+ ++SYFYD A
Sbjct  268   NVSAPLSGTSMRRCRALMRKTLRVDAPCNHTYCSFDGVWSGGGGLGLKNLYVASYFYDTA  327

Query  1051  IDVGIIDEGKASKIVKPRSFLVAAKLACETKFEDVKSTFPNAVEKDYPYLCMDLVYQYTL  1230
              + G+++    S  ++P  +  AAK AC    +++KS FP   E+D P+LC DL+Y+YT+
Sbjct  328   AETGLVEADAPSGKIRPIYYKNAAKKACSATVDNIKSIFPLLDERDVPFLCSDLIYEYTM  387

Query  1231  LVDGLGLHPYKEITLMKKVEYKNY----MVEAAWPLGCAIDVISS  1353
             LVDG G++  KEIT++K++EYK      ++EAAWPLGCA++++SS
Sbjct  388   LVDGFGVNQLKEITVVKQLEYKKDSSLPLLEAAWPLGCAVELVSS  432



>ref|XP_007030232.1| Apyrase 1 [Theobroma cacao]
 gb|EOY10734.1| Apyrase 1 [Theobroma cacao]
Length=557

 Score =   444 bits (1143),  Expect = 2e-146, Method: Compositional matrix adjust.
 Identities = 228/441 (52%), Positives = 309/441 (70%), Gaps = 9/441 (2%)
 Frame = +1

Query  58    LVFISLALLLFPLACFSRS--------HLRRVLLNHEAG-NYAVIFDAGSTGSRVHVFHF  210
             +V I+  L + P    S          ++R+V  N     NYAVIFDAGS+GSRVHVF F
Sbjct  117   IVLITFVLYVMPGKSASNEAVVQGVELNIRKVGANSRGNRNYAVIFDAGSSGSRVHVFCF  176

Query  211   DENLDLLPVGDGVEFFLKITPGLSSYADDPEAAAKSLEPLLLEAEGVVPTELQPDTPLEL  390
             D+NLDL+P+G  +E F +I PGLS YA DP+AAA SL  LL +AE VVP +L+  TP+ +
Sbjct  177   DQNLDLVPIGSELELFEQIKPGLSFYAKDPQAAANSLRTLLDKAESVVPLDLRSKTPVRV  236

Query  391   GATAGLRLLEGDASDKILQAVRDMFKNESNFKSKAEWVSILEGSQEGTYFWVAMNYLLGN  570
             GATAGLR LEGDASD+IL AV ++ K+ S  K +A  V IL+GSQEG Y WV +NYLLGN
Sbjct  237   GATAGLRALEGDASDRILHAVSELLKDRSTLKYEANGVRILDGSQEGAYEWVTINYLLGN  296

Query  571   LGKGYQNTIATIDLGGGSVQVSYAVSGDTFANAPKPHNGEEPYVQEKYILGAQYYLYVHS  750
             LG+ Y +T+  +DLGGGSVQ++YA+S +  A AP    GE+ +V E  ++G++Y+LYVHS
Sbjct  297   LGRTYADTVGIVDLGGGSVQMAYAISENAAAKAPSVPAGEDNFVNEMNLMGSKYHLYVHS  356

Query  751   YLNYGQLASRAEIFKASGNSTNPCVLEGYDGYYTYNDVSYKVTAPPNGSSLKNCRKLARK  930
             YL+YG LA+RAEI K S +S NPC+LEG+DG Y Y    +K +A  +G+S++ CR++  K
Sbjct  357   YLHYGLLAARAEILKVSEDSGNPCILEGFDGTYKYGGEEFKASASSSGTSMEECRRVTLK  416

Query  931   VVDFRAPCKYPNCTFNGVWSGGGGAGMENVDISSYFYDIAIDVGIIDEGKASKIVKPRSF  1110
              +     C +  CTF GVW+GGGG G +N+ ++S+F+D A + G I        V+P+ F
Sbjct  417   ALKINETCTHMKCTFGGVWNGGGGDGQKNLFVASFFFDRAAEAGFIKATDPVAKVQPQYF  476

Query  1111  LVAAKLACETKFEDVKSTFPNAVEKDYPYLCMDLVYQYTLLVDGLGLHPYKEITLMKKVE  1290
               AAK ACETK+ + K+T+ +  E +  Y+CMDLVYQYTLLVDG GL PY++ITL+K+V+
Sbjct  477   ADAAKRACETKYANAKATYEHVEESNLAYVCMDLVYQYTLLVDGFGLDPYQDITLVKQVK  536

Query  1291  YKNYMVEAAWPLGCAIDVISS  1353
             Y+N +VEAAWPLG AI+ +SS
Sbjct  537   YQNSLVEAAWPLGSAIEAVSS  557



>gb|KDP20285.1| hypothetical protein JCGZ_06871 [Jatropha curcas]
Length=470

 Score =   441 bits (1134),  Expect = 3e-146, Method: Compositional matrix adjust.
 Identities = 240/462 (52%), Positives = 320/462 (69%), Gaps = 19/462 (4%)
 Frame = +1

Query  22    KHNTMKHTSHHH---LVFISLALLLFPLACF---SRSHL-----------RRVLLN-HEA  147
             +H  +    H +   L+ IS+ LLL     F   SRS             R++  N  +A
Sbjct  7     RHEPLSEKIHRYRSVLLVISIPLLLIAFVLFFMPSRSPTAVLEEYEIISGRKMSPNLKDA  66

Query  148   GNYAVIFDAGSTGSRVHVFHFDENLDLLPVGDGVEFFLKITPGLSSYADDPEAAAKSLEP  327
               YAVIFDAGS+GSRVHV+ FD+  +L+P+G  +E FL+I PGLS+YA+DP AAA SL  
Sbjct  67    RRYAVIFDAGSSGSRVHVYCFDQYNNLVPIGRDLELFLQIKPGLSAYANDPLAAANSLLR  126

Query  328   LLLEAEGVVPTELQPDTPLELGATAGLRLLEGDASDKILQAVRDMFKNESNFKSKAEWVS  507
             LL +AE VVP EL+P+TP+ +GATAGLR LEGDASD+IL AVRD+ +++S  K++A+ VS
Sbjct  127   LLEQAERVVPKELRPNTPVRVGATAGLRALEGDASDRILDAVRDILRDKSTLKTEADGVS  186

Query  508   ILEGSQEGTYFWVAMNYLLGNLGKGYQNTIATIDLGGGSVQVSYAVSGDTFANAPKPHNG  687
             +L+GSQEG+Y WV +NYLLG LG  Y +T+  +DLGGGSVQ++YA+S    A AP+  +G
Sbjct  187   VLDGSQEGSYEWVTINYLLGKLGSSYSDTVGVVDLGGGSVQMAYAISKADAAKAPRVSDG  246

Query  688   EEPYVQEKYILGAQYYLYVHSYLNYGQLASRAEIFKASGNSTNPCVLEGYDGYYTYNDVS  867
             E+ Y++E +++G  YYLYVHSYL+YG LA+RAEI K S +S N C+L GYDG Y Y  + 
Sbjct  247   EDTYIKEMHLMGIDYYLYVHSYLHYGLLAARAEILKVSEDSENGCILAGYDGVYNYGGLD  306

Query  868   YKVTAPPNGSSLKNCRKLARKVVDF-RAPCKYPNCTFNGVWSGGGGAGMENVDISSYFYD  1044
             YK +A  +GSS + CR LA K +    + C +  CTF GVW+GGGG G  N+ ++S+F+D
Sbjct  307   YKASASSSGSSFEECRSLALKALKVNESTCIHMKCTFGGVWNGGGGDGQRNLFVASFFFD  366

Query  1045  IAIDVGIIDEGKASKIVKPRSFLVAAKLACETKFEDVKSTFPNAVEKDYPYLCMDLVYQY  1224
              A + G ID  +    V P  F  AAK ACETK ED KST+P   EK  PYLCMDLVYQY
Sbjct  367   RAAEAGFIDPAQPVAKVHPADFEEAAKRACETKLEDAKSTYPRVDEKLLPYLCMDLVYQY  426

Query  1225  TLLVDGLGLHPYKEITLMKKVEYKNYMVEAAWPLGCAIDVIS  1350
             TLLVDG  L  ++EITL+K+++Y++ +VEAAWPLG AI+ +S
Sbjct  427   TLLVDGFALEHWQEITLVKQIKYRDALVEAAWPLGSAIEALS  468



>dbj|BAA89275.1| apyrase [Pisum sativum]
Length=447

 Score =   440 bits (1131),  Expect = 4e-146, Method: Compositional matrix adjust.
 Identities = 228/435 (52%), Positives = 305/435 (70%), Gaps = 10/435 (2%)
 Frame = +1

Query  79    LLLFPLACFSRSHL--------RRVLLNHEA-GNYAVIFDAGSTGSRVHVFHFDENLDLL  231
              LLF +   + S          R++ L  E   +YAV+FDAGSTGS +HV+HF++NLDLL
Sbjct  2     FLLFSMPAITSSQYLGNNLLTSRKIFLKQEEISSYAVVFDAGSTGSCIHVYHFNQNLDLL  61

Query  232   PVGDGVEFFLKITPGLSSYADDPEAAAKSLEPLLLEAEGVVPTELQPDTPLELGATAGLR  411
              +G GVE++ KITPGLSSYA++PE AAKSL PLL +AE VVP +LQP TP+ LGATAGLR
Sbjct  62    HIGKGVEYYNKITPGLSSYANNPEQAAKSLIPLLEQAEDVVPDDLQPKTPVRLGATAGLR  121

Query  412   LLEGDASDKILQAVRDMFKNESNFKSKAEWVSILEGSQEGTYFWVAMNYLLGNLGKGYQN  591
             LL GDAS+KILQ+VRDM  N S F  + + VSI++G+QEG+Y WV +NY LGNLGK Y  
Sbjct  122   LLNGDASEKILQSVRDMLSNRSTFNVQPDAVSIIDGTQEGSYLWVTVNYALGNLGKKYTK  181

Query  592   TIATIDLGGGSVQVSYAVSGDTFANAPKPHNGEEPYVQEKYILGAQYYLYVHSYLNYGQL  771
             T+  IDLGGGSVQ++YAVS  T  NAPK  +G++PY+++  + G  Y LYVHSYL++G+ 
Sbjct  182   TVGVIDLGGGSVQMAYAVSKKTAKNAPKVADGDDPYIKKVVLKGIPYDLYVHSYLHFGRE  241

Query  772   ASRAEIFKASGNSTNPCVLEGYDGYYTYNDVSYKVTAPPNGSSLKNCRKLARKVVDFRAP  951
             ASRAEI K +  S NPC+L G++G YTY+   +K TA  +G++   C+   RK +    P
Sbjct  242   ASRAEILKLTPRSPNPCLLAGFNGIYTYSGEEFKATAYTSGANFNKCKNTIRKALKLNYP  301

Query  952   CKYPNCTFNGVWSGGGGAGMENVDISSYFYDIAIDVGIIDEGKASKIVKPRSFLVAAKLA  1131
             C Y NCTF G+W+GGGG G +N+  SS F+ +  D G++D    + I++P      AK A
Sbjct  302   CPYQNCTFGGIWNGGGGNGQKNLFASSSFFYLPEDTGMVDASTPNFILRPVDIETKAKEA  361

Query  1132  CETKFEDVKSTFPNAVEKDY-PYLCMDLVYQYTLLVDGLGLHPYKEITLMKKVEYKNYMV  1308
             C   FED KST+P   +K+   Y+CMDL+YQY LLVDG GL P ++IT  K++EY++ +V
Sbjct  362   CALNFEDAKSTYPFLDKKNVASYVCMDLIYQYVLLVDGFGLDPLQKITSGKEIEYQDAIV  421

Query  1309  EAAWPLGCAIDVISS  1353
             EAAWPLG A++ IS+
Sbjct  422   EAAWPLGNAVEAISA  436



>ref|XP_004511658.1| PREDICTED: apyrase 2-like [Cicer arietinum]
Length=476

 Score =   440 bits (1132),  Expect = 6e-146, Method: Compositional matrix adjust.
 Identities = 223/404 (55%), Positives = 296/404 (73%), Gaps = 1/404 (0%)
 Frame = +1

Query  145   AGNYAVIFDAGSTGSRVHVFHFDENLDLLPVGDGVEFFLKITPGLSSYADDPEAAAKSLE  324
             A ++AVIFDAGS+GSRVHVF FD NLDL+P+G  +E FL+I PGLS+YA DP+ AA+SL 
Sbjct  71    ADSFAVIFDAGSSGSRVHVFRFDRNLDLVPIGKDLEVFLQIKPGLSAYAQDPQQAAESLV  130

Query  325   PLLLEAEGVVPTELQPDTPLELGATAGLRLLEGDASDKILQAVRDMFKNESNFKSKAEWV  504
              LL +AE VVP E +  TP+ +GATAGLR LEGDASD+ILQAVRD+ K  S  KS+ + V
Sbjct  131   SLLDKAESVVPMEFRAMTPVRVGATAGLRALEGDASDRILQAVRDLLKQRSTLKSEPDAV  190

Query  505   SILEGSQEGTYFWVAMNYLLGNLGKGYQNTIATIDLGGGSVQVSYAVSGDTFANAPKPHN  684
             ++L+G+QEG + WV +NYLLG LGK Y +T+  +DLGGGSVQ++YA+S D+ A APK  +
Sbjct  191   AVLDGTQEGAFQWVTINYLLGKLGKDYSDTVGVVDLGGGSVQMAYAISEDSAAKAPKALD  250

Query  685   GEEPYVQEKYILGAQYYLYVHSYLNYGQLASRAEIFKASGNSTNPCVLEGYDGYYTYNDV  864
             GE+PYV+E ++ G +YYLYVHSYL YG LA+RAEI K S +S NPC+L GYDG Y Y   
Sbjct  251   GEDPYVKEMFLRGRKYYLYVHSYLRYGLLAARAEILKVSDDSGNPCILAGYDGSYNYGGK  310

Query  865   SYKVTAPPNGSSLKNCRKLARKVVDF-RAPCKYPNCTFNGVWSGGGGAGMENVDISSYFY  1041
             S+K ++  +GSSL  C+ +  K +    + C +  CTF G+W+GGGG G +N+ ++S+F+
Sbjct  311   SFKASSSSSGSSLNECKSITLKALKVNESTCTHMKCTFGGIWNGGGGDGQKNLFVASFFF  370

Query  1042  DIAIDVGIIDEGKASKIVKPRSFLVAAKLACETKFEDVKSTFPNAVEKDYPYLCMDLVYQ  1221
             D A + G  D       V+P  F   AK AC+TK ED KS +P+  E + PYLC+DLVYQ
Sbjct  371   DRAAEAGFADPKSPVVKVRPADFEDTAKRACQTKLEDAKSIYPHVEEGNLPYLCLDLVYQ  430

Query  1222  YTLLVDGLGLHPYKEITLMKKVEYKNYMVEAAWPLGCAIDVISS  1353
             YTLLV G GL P ++ITL+K+V+Y + +VEAAWPLG AI+ +SS
Sbjct  431   YTLLVVGFGLDPLQQITLVKQVKYHDSLVEAAWPLGSAIEAVSS  474



>ref|XP_006843727.1| hypothetical protein AMTR_s00007p00221730 [Amborella trichopoda]
 gb|ERN05402.1| hypothetical protein AMTR_s00007p00221730 [Amborella trichopoda]
Length=473

 Score =   440 bits (1131),  Expect = 7e-146, Method: Compositional matrix adjust.
 Identities = 222/446 (50%), Positives = 309/446 (69%), Gaps = 14/446 (3%)
 Frame = +1

Query  58    LVFISLALLLFPL-------------ACFSRSHLRRVLLNHEAGNYAVIFDAGSTGSRVH  198
             L+ IS  L L P              A  S+  +R++   H + +YAVIFDAGS+GSRVH
Sbjct  27    LLLISFVLFLMPRVPEEIDTFVEVQSAGVSKDSMRKMQNVHGSKSYAVIFDAGSSGSRVH  86

Query  199   VFHFDENLDLLPVGDGVEFFLKITPGLSSYADDPEAAAKSLEPLLLEAEGVVPTELQPDT  378
             V+ FD+NL+L+P+   +E F++  PGLS YA +PE AA SL+PLL++AE V+P  L+  T
Sbjct  87    VYCFDKNLELVPIEKELELFVQKKPGLSYYASNPEEAANSLKPLLVKAESVIPQALRKVT  146

Query  379   PLELGATAGLRLLEGDASDKILQAVRDMFKNESNFKSKAEWVSILEGSQEGTYFWVAMNY  558
             P+ +GATAGLR L GD+SD+ILQAVRD+  ++S+  SK +WV++L+G+QEG++ WV +N+
Sbjct  147   PVRVGATAGLRSLPGDSSDRILQAVRDLLADQSSLMSKPDWVTVLDGTQEGSFQWVTINH  206

Query  559   LLGNLGKGYQNTIATIDLGGGSVQVSYAVSGDTFANAPKPHNGEEPYVQEKYILGAQYYL  738
             LLGNLGK Y +T+  +DLGGGSVQ++YA+S      AP   +GE+ YV+E ++ G +YYL
Sbjct  207   LLGNLGKSYSHTVGIVDLGGGSVQMAYAISEKDAKKAPTIIDGEDTYVKELFLKGTKYYL  266

Query  739   YVHSYLNYGQLASRAEIFKASGNSTNPCVLEGYDGYYTYNDVSYKVTAPPNGSSLKNCRK  918
             YVHSYL+YG LA+RAEI K   +S +PC+L+G+ G Y Y D  +K +A P GS   +CR+
Sbjct  267   YVHSYLHYGLLAARAEILKVDRDSDSPCILKGFHGSYKYGDTQFKASALPTGSDFTSCRR  326

Query  919   LARKVVDFR-APCKYPNCTFNGVWSGGGGAGMENVDISSYFYDIAIDVGIIDEGKASKIV  1095
              A K +      C +  CTF G+W+GGGG G +N+ ++S+FYD A + G +D  +    V
Sbjct  327   AAVKALRVNDTTCTHMKCTFGGIWNGGGGDGQKNLFVASFFYDRAAEAGFVDPKQPVAKV  386

Query  1096  KPRSFLVAAKLACETKFEDVKSTFPNAVEKDYPYLCMDLVYQYTLLVDGLGLHPYKEITL  1275
             KP  F  AAK AC++  ++ K TF  A E + PYLCMDLVYQY LL+DG  L P++EITL
Sbjct  387   KPADFEDAAKRACQSSLDEAKKTFSRAEEGNLPYLCMDLVYQYALLIDGFALDPWQEITL  446

Query  1276  MKKVEYKNYMVEAAWPLGCAIDVISS  1353
             +K+VEYK + VEAAWPLG AI+V S+
Sbjct  447   VKQVEYKGFPVEAAWPLGSAIEVASA  472



>ref|XP_004244791.1| PREDICTED: apyrase 2-like [Solanum lycopersicum]
Length=480

 Score =   440 bits (1131),  Expect = 9e-146, Method: Compositional matrix adjust.
 Identities = 228/402 (57%), Positives = 299/402 (74%), Gaps = 1/402 (0%)
 Frame = +1

Query  151   NYAVIFDAGSTGSRVHVFHFDENLDLLPVGDGVEFFLKITPGLSSYADDPEAAAKSLEPL  330
             NYAVIFDAGS+GSRVHVF FD++LDL+P+G+ +E FL+  PGLS++A DP +AAKSL+ L
Sbjct  77    NYAVIFDAGSSGSRVHVFCFDQHLDLVPIGNDLELFLQKKPGLSAFASDPASAAKSLQSL  136

Query  331   LLEAEGVVPTELQPDTPLELGATAGLRLLEGDASDKILQAVRDMFKNESNFKSKAEWVSI  510
             L +AE VVP +L+ +TP+ +GATAGLR L G+ SDKILQAVRD  K++S+ KSK  WV++
Sbjct  137   LEKAEDVVPMDLRSNTPVRVGATAGLRQLGGNTSDKILQAVRDFLKSKSSLKSKGSWVTV  196

Query  511   LEGSQEGTYFWVAMNYLLGNLGKGYQNTIATIDLGGGSVQVSYAVSGDTFANAPKPHNGE  690
             L+GSQEG Y WV +NYLLGNLG+ Y +T+  +DLGGGSVQ++YA+S      APK   GE
Sbjct  197   LDGSQEGAYQWVTINYLLGNLGRKYSDTVGVVDLGGGSVQMAYAISELDAQKAPKLSVGE  256

Query  691   EPYVQEKYILGAQYYLYVHSYLNYGQLASRAEIFKASGNSTNPCVLEGYDGYYTYNDVSY  870
             + YVQE Y+ GA+YYLYVHSYL YG LA+RAEI K +  S +PC+L G+ G Y Y    Y
Sbjct  257   DTYVQEMYLKGAKYYLYVHSYLRYGLLAARAEILKVTKESGSPCILTGHHGSYKYGGKVY  316

Query  871   KVTAPPNGSSLKNCRKLARKVVDF-RAPCKYPNCTFNGVWSGGGGAGMENVDISSYFYDI  1047
               +A   GSS+ NCR +A K +    + C +  CTF GVW+GGGG G +N+ ++S+F+D 
Sbjct  317   PASAMSEGSSMTNCRLVALKALKVNESTCTHMKCTFGGVWNGGGGDGQKNMFVASFFFDR  376

Query  1048  AIDVGIIDEGKASKIVKPRSFLVAAKLACETKFEDVKSTFPNAVEKDYPYLCMDLVYQYT  1227
             A++VG +D   A   V+P  F  AA+ AC+T+ +D K+TFP+    + PYLCMDLVYQYT
Sbjct  377   AVEVGFVDPNVAVAKVRPIDFESAARRACDTRLDDAKATFPSVESDNLPYLCMDLVYQYT  436

Query  1228  LLVDGLGLHPYKEITLMKKVEYKNYMVEAAWPLGCAIDVISS  1353
             LLVDG GL   +E+TL+KKV+YKN +VEAAWPLG AI+V SS
Sbjct  437   LLVDGFGLDARQEMTLVKKVKYKNSLVEAAWPLGSAIEVASS  478



>ref|XP_011096861.1| PREDICTED: LOW QUALITY PROTEIN: apyrase-like [Sesamum indicum]
Length=436

 Score =   438 bits (1126),  Expect = 1e-145, Method: Compositional matrix adjust.
 Identities = 220/403 (55%), Positives = 287/403 (71%), Gaps = 7/403 (2%)
 Frame = +1

Query  151   NYAVIFDAGSTGSRVHVFHFDENLDLLPVGDGVEFFLKITPGLSSYADDPEAAAKSLEPL  330
             +YAV+FDAGSTGSRVHVF FD NL L P+    E FL I+PGLSSY  DPEAAA SL+PL
Sbjct  37    SYAVVFDAGSTGSRVHVFAFDPNLALTPIDQSYELFLSISPGLSSYEHDPEAAALSLKPL  96

Query  331   LLEAEGVVPTELQPDTPLELGATAGLRLLEGDASDKILQAVRDMFKNESNFKSKAEWVSI  510
             L  AE VVP EL+  TP+ LGATAGLRLL G+AS+ IL AVR + K ES    + +WVS+
Sbjct  97    LQNAEAVVPAELRAQTPVRLGATAGLRLLPGNASEDILDAVRKLLKTESRLYYRPDWVSV  156

Query  511   LEGSQEGTYFWVAMNYLLGNLGKGYQNTIATIDLGGGSVQVSYAVSGDTFANAPKPHNGE  690
             L G  EG Y WV +NYLLG+LGK Y +T+  +DLGGGSVQ++YA +           +GE
Sbjct  157   LRGIDEGGYQWVTINYLLGSLGKSYSSTVGVVDLGGGSVQMAYAXAAAPPV-----ADGE  211

Query  691   EPYVQEKYILGAQYYLYVHSYLNYGQLASRAEIFKASGNSTNPCVLEGYDGYYTYNDVSY  870
             +PYV EK  LG +Y+LY HSYLNYG  A+RA+  K SGN  NPC++ GY G Y Y++V Y
Sbjct  212   DPYVSEKVALGTKYHLYAHSYLNYGLKAARAQSLKLSGNKGNPCIINGYQGTYEYSNVVY  271

Query  871   KVTAPPNGSSLKNCRKLARKVVDFRAPCKYPNCTFNGVWSGGGGAGM--ENVDISSYFYD  1044
             KV+ P +G+S + CR L R+V+   APC + NC+FNGVW+GGGG G   +N+ ++S+FYD
Sbjct  272   KVSPPVSGTSRRRCRLLTREVLGLDAPCFHRNCSFNGVWNGGGGGGDGRKNLYVASFFYD  331

Query  1045  IAIDVGIIDEGKASKIVKPRSFLVAAKLACETKFEDVKSTFPNAVEKDYPYLCMDLVYQY  1224
              A + GII     +  V+P  +L AAK AC    +++ STFP   ++D P+LCMDLVY+Y
Sbjct  332   TAAETGIIAPNAPAATVRPIQYLKAAKQACAANVDNINSTFPLIDKRDVPFLCMDLVYEY  391

Query  1225  TLLVDGLGLHPYKEITLMKKVEYKNYMVEAAWPLGCAIDVISS  1353
              LLVDG G+ P +EIT++K+V+YK   +EAAWPLGCA++++SS
Sbjct  392   MLLVDGFGVDPLQEITVLKEVKYKGSSLEAAWPLGCAVELVSS  434



>gb|AAK15160.1|AF288132_1 putative apyrase [Medicago truncatula]
Length=466

 Score =   439 bits (1128),  Expect = 2e-145, Method: Compositional matrix adjust.
 Identities = 226/443 (51%), Positives = 308/443 (70%), Gaps = 9/443 (2%)
 Frame = +1

Query  52    HHLVFISLALLLFPLACFSRSHLRRVLLNHEA--------GNYAVIFDAGSTGSRVHVFH  207
             + +  I+  L + P   +S+     +LL +           +YAV+FDAGSTGSRVHV+H
Sbjct  13    NFMTLITFLLFIMPSISYSQYLGNNILLTNRKIFPKQEPISSYAVVFDAGSTGSRVHVYH  72

Query  208   FDENLDLLPVGDGVEFFLKITPGLSSYADDPEAAAKSLEPLLLEAEGVVPTELQPDTPLE  387
             FD+NL+LL VG  VEF+ K TPGLS+YAD+PE AAKSL PLL +AE VVP + +  TP+ 
Sbjct  73    FDQNLNLLHVGKDVEFYNKTTPGLSAYADNPEEAAKSLIPLLEQAESVVPEDQRSKTPIR  132

Query  388   LGATAGLRLLEGDASDKILQAVRDMFKNESNFKSKAEWVSILEGSQEGTYFWVAMNYLLG  567
             LGATAGLRLL GDAS+KILQ+VRD+F N S F  + + VSI++G+QEG Y WV +NY LG
Sbjct  133   LGATAGLRLLNGDASEKILQSVRDLFSNRSTFNVQPDAVSIIDGTQEGCYLWVTVNYALG  192

Query  568   NLGKGYQNTIATIDLGGGSVQVSYAVSGDTFANAPKPHNGEEPYVQEKYILGAQYYLYVH  747
             NLGK +  T+  +D+GGGSVQ++YAVS  T  NAPK  +GE+PY+++  + G  Y LYVH
Sbjct  193   NLGKKFTKTVGVMDVGGGSVQMAYAVSKYTAKNAPKVADGEDPYIKKLVLKGKPYDLYVH  252

Query  748   SYLNYGQLASRAEIFKASGNSTNPCVLEGYDGYYTYNDVSYKVTAPPNGSSLKNCRKLAR  927
             SYL++G+ ASRAEI K + +S NPC+L G+DG YTY    +K  AP +G++   C+K+ R
Sbjct  253   SYLHFGREASRAEIMKVTRSSPNPCLLAGFDGTYTYAGEEFKAKAPASGANFNGCKKIIR  312

Query  928   KVVDFRAPCKYPNCTFNGVWSGGGGAGMENVDISSYFYDIAIDVGIIDEGKASKIVKPRS  1107
             K +    PC Y NCTF G+W+GGGG G +++  SS F+ +  DVG++D    +  ++P  
Sbjct  313   KALKLNYPCPYQNCTFGGIWNGGGGNGQKHLFASSSFFYLPEDVGMVDPKTPNFKIRPVD  372

Query  1108  FLVAAKLACETKFEDVKSTFPNAVEKDY-PYLCMDLVYQYTLLVDGLGLHPYKEITLMKK  1284
              +  AK AC   FED KST+P   +K+   Y+CMDL+YQY LLVDG GL P +EIT  K+
Sbjct  373   LVSEAKKACALNFEDAKSTYPFLAKKNIASYVCMDLIYQYVLLVDGFGLDPLQEITSGKE  432

Query  1285  VEYKNYMVEAAWPLGCAIDVISS  1353
             +EY++ ++EAAWPLG A++ ISS
Sbjct  433   IEYQDAVLEAAWPLGNAVEAISS  455



>ref|XP_002873882.1| ATAPY2 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH50141.1| ATAPY2 [Arabidopsis lyrata subsp. lyrata]
Length=472

 Score =   439 bits (1128),  Expect = 2e-145, Method: Compositional matrix adjust.
 Identities = 220/404 (54%), Positives = 296/404 (73%), Gaps = 5/404 (1%)
 Frame = +1

Query  151   NYAVIFDAGSTGSRVHVFHFDENLDLLPVGDGVEFFLKITPGLSSYADDPEAAAKSLEPL  330
             NYAVIFDAGS+GSRVHV+ FD+NLDL+P+G+ +E FL++ PGLS+Y  DP  AA SL  L
Sbjct  70    NYAVIFDAGSSGSRVHVYCFDQNLDLIPLGNELELFLQLKPGLSAYPTDPRQAANSLVSL  129

Query  331   LLEAEGVVPTELQPDTPLELGATAGLRLLEGDASDKILQAVRDMFKNESNFKSKAEWVSI  510
             L +AE  VP EL+P TP+ +GATAGLR L  DAS+ ILQAVR++ ++ S  K++A  V++
Sbjct  130   LDKAEASVPRELRPKTPVRVGATAGLRTLGHDASENILQAVRELLRDRSMLKTEANAVTV  189

Query  511   LEGSQEGTYFWVAMNYLLGNLGKGYQNTIATIDLGGGSVQVSYAVSGDTFANAPKPHNGE  690
             L+G+QEG+Y WV +NYLL NLGK Y +T+  +DLGGGSVQ++YA+S +  A+APKP  GE
Sbjct  190   LDGTQEGSYQWVTINYLLRNLGKPYSDTVGVVDLGGGSVQMAYAISEEDAASAPKPLEGE  249

Query  691   EPYVQEKYILGAQYYLYVHSYLNYGQLASRAEIFKASGNSTNPCVLEGYDGYYTYNDVSY  870
             + YV+E Y+ G +Y+LYVHSYL+YG LA+RAEI K S +S NPC++ GYDG Y Y +  +
Sbjct  250   DSYVREMYLKGRKYFLYVHSYLHYGLLAARAEILKVSEDSENPCIVAGYDGMYKYGEKEF  309

Query  871   KVTAPPNGSSLKNCRKL---ARKVVDFRAPCKYPNCTFNGVWSGGGGAGMENVDISSYFY  1041
             K  A P+G+SL  CR++   A KV D    C +  CTF GVW+GG G G +N+ ++S+F+
Sbjct  310   KAPASPSGASLGECRRVTINALKVND--TLCTHMKCTFGGVWNGGRGGGQKNMFVASFFF  367

Query  1042  DIAIDVGIIDEGKASKIVKPRSFLVAAKLACETKFEDVKSTFPNAVEKDYPYLCMDLVYQ  1221
             D A + G +D  +    V+P  F  AAK AC  K E+ K+ FP   E++ PYLCMDL+YQ
Sbjct  368   DRAAEAGFVDPKQPVATVRPMDFEKAAKQACSMKLEEGKAKFPLVEEENLPYLCMDLIYQ  427

Query  1222  YTLLVDGLGLHPYKEITLMKKVEYKNYMVEAAWPLGCAIDVISS  1353
             YTLL+DG GL P + ITL+KKV+Y ++ VEAAWPLG AI+ +SS
Sbjct  428   YTLLIDGFGLEPSQTITLVKKVKYGDHAVEAAWPLGSAIEAVSS  471



>dbj|BAD13518.1| apyrase [Pisum sativum]
Length=455

 Score =   438 bits (1126),  Expect = 3e-145, Method: Compositional matrix adjust.
 Identities = 227/437 (52%), Positives = 306/437 (70%), Gaps = 10/437 (2%)
 Frame = +1

Query  73    LALLLFPLACFSRSHL--------RRVLLNHEA-GNYAVIFDAGSTGSRVHVFHFDENLD  225
             +  LLF +   + S          R++ L  E   +YAV+FDAGSTGSR+HV+HF++NLD
Sbjct  8     ITFLLFSMPAITSSQYLGNNLLTSRKIFLKQEEISSYAVVFDAGSTGSRIHVYHFNQNLD  67

Query  226   LLPVGDGVEFFLKITPGLSSYADDPEAAAKSLEPLLLEAEGVVPTELQPDTPLELGATAG  405
             LL +G GVE++ KITPGLSSYA++PE AAKSL PLL +AE VVP +LQP TP+ LGATAG
Sbjct  68    LLHIGKGVEYYNKITPGLSSYANNPEQAAKSLIPLLEQAEDVVPDDLQPKTPVRLGATAG  127

Query  406   LRLLEGDASDKILQAVRDMFKNESNFKSKAEWVSILEGSQEGTYFWVAMNYLLGNLGKGY  585
             LRLL GDAS+KILQ+VRDM  N S F  + + VSI++G+QEG+Y WV +NY LGNLG+  
Sbjct  128   LRLLNGDASEKILQSVRDMLSNRSTFNVQPDAVSIIDGTQEGSYLWVTVNYALGNLGERD  187

Query  586   QNTIATIDLGGGSVQVSYAVSGDTFANAPKPHNGEEPYVQEKYILGAQYYLYVHSYLNYG  765
               T+  IDLGGGSVQ++YAVS  T  NAPK  +G++PY+++  + G  Y LYVHSYL++G
Sbjct  188   TKTVGVIDLGGGSVQMAYAVSKKTAKNAPKVADGDDPYLKKVVLKGIPYDLYVHSYLHFG  247

Query  766   QLASRAEIFKASGNSTNPCVLEGYDGYYTYNDVSYKVTAPPNGSSLKNCRKLARKVVDFR  945
             + ASRAEIFK +    NPC+L G++G YTY+   +K TA  +G++   C+   RK +   
Sbjct  248   REASRAEIFKLTPRPPNPCLLGGFNGIYTYSGEEFKATAYTSGANFNKCKNTIRKALKLN  307

Query  946   APCKYPNCTFNGVWSGGGGAGMENVDISSYFYDIAIDVGIIDEGKASKIVKPRSFLVAAK  1125
              PC Y NCTF G+W+GGGG G +N+  SS F+ +  D G++D    + I++P      AK
Sbjct  308   YPCPYQNCTFGGIWNGGGGNGQKNLLASSSFFYLPEDTGMVDASTPNFILRPVDIETKAK  367

Query  1126  LACETKFEDVKSTFPNAVEKDY-PYLCMDLVYQYTLLVDGLGLHPYKEITLMKKVEYKNY  1302
              AC   FED KST+P   +K+   Y+CMDL+YQY LLVDG GL P ++IT  K++EY++ 
Sbjct  368   EACALNFEDAKSTYPFLDKKNVASYVCMDLIYQYVLLVDGFGLDPLQKITSGKEIEYQDA  427

Query  1303  MVEAAWPLGCAIDVISS  1353
             +VEAAWPLG A++ IS+
Sbjct  428   IVEAAWPLGNAVEAISA  444



>gb|AFK42133.1| unknown [Medicago truncatula]
Length=467

 Score =   437 bits (1124),  Expect = 9e-145, Method: Compositional matrix adjust.
 Identities = 227/444 (51%), Positives = 308/444 (69%), Gaps = 10/444 (2%)
 Frame = +1

Query  52    HHLVFISLALLLFPLACFSRSHLRRVLLNHEA--------GNYAVIFDAGSTGSRVHVFH  207
             + +  I+  L + P   +S+     +LL +           +YAV+FDAGSTGSRVHV+H
Sbjct  13    NFMTLITFLLFIMPSISYSQYLGNNILLTNRKIFPKQESISSYAVVFDAGSTGSRVHVYH  72

Query  208   FDENLDLLPVGDGVEFFLKITPGLSSYADDPEAAAKSLEPLLLEAEGVVPTELQPDTPLE  387
             FD+NL+LL VG  VEF+ K TPGLS+YAD+PE AAKSL PLL +AE VVP + +  TP+ 
Sbjct  73    FDQNLNLLHVGKDVEFYNKTTPGLSAYADNPEEAAKSLIPLLEQAESVVPEDQRSKTPIR  132

Query  388   LGATAGLRLLEGDASDKILQAVRDMFKNESNFKSKAEWVSILEGSQEGTYFWVAMNYLLG  567
             LGATAGLRLL GDAS+KILQ+VRD+F N S F  + + VSI++G+QEG+Y WV +NY LG
Sbjct  133   LGATAGLRLLNGDASEKILQSVRDLFSNRSTFNVQPDAVSIIDGTQEGSYLWVTVNYALG  192

Query  568   NLGKGYQNTIATIDLGGGSVQVSYAVSGDTFANAPKPHNGEEPYVQEKYILGAQYYLYVH  747
              LGK +  T+  +DLGGGSVQ++YAVS  T  NAPK  +GE+PY+++  + G +Y LYVH
Sbjct  193   KLGKKFTKTVGVMDLGGGSVQMAYAVSKYTAKNAPKVADGEDPYIKKLVLKGKKYDLYVH  252

Query  748   SYLNYGQLASRAEIFKASGNSTNPCVLEGYDGYYTYNDVSYKVTAPPNGSSLKNCRKLAR  927
             SYL++G+ ASRAEI K + NS NPC+L G+DG YTY    +K  AP +G++ K C+K+ R
Sbjct  253   SYLHFGREASRAEILKVTHNSPNPCILAGFDGTYTYAGEEFKANAPASGANFKKCKKIVR  312

Query  928   KVVDFRAPCKYPNCTFNGVWSGGGGAGMENVDISSYFYDIAIDVGIIDEGKA-SKIVKPR  1104
             + +    PC Y NCTF G+WSGGGG+G   +  +S F+ +A D+G++D     S  ++P 
Sbjct  313   EALKLNYPCPYQNCTFGGIWSGGGGSGQRILFAASSFFYLAEDIGLVDPNTPYSLTLRPV  372

Query  1105  SFLVAAKLACETKFEDVKSTFPNAVEKDY-PYLCMDLVYQYTLLVDGLGLHPYKEITLMK  1281
                  AK AC    E+ KST+P  V+ +   Y+CMDL+YQY LLVDG GL P +EIT  K
Sbjct  373   DLETEAKKACTLNLEEAKSTYPLLVDFNIVEYVCMDLIYQYVLLVDGFGLDPLQEITAGK  432

Query  1282  KVEYKNYMVEAAWPLGCAIDVISS  1353
             ++EY++ +VEAAWPLG A++ ISS
Sbjct  433   QIEYQDSLVEAAWPLGNAVEAISS  456



>ref|XP_003624584.1| Nucleoside-triphosphatase [Medicago truncatula]
 gb|AAO23004.1| apyrase-like protein [Medicago truncatula]
Length=467

 Score =   437 bits (1123),  Expect = 9e-145, Method: Compositional matrix adjust.
 Identities = 227/444 (51%), Positives = 308/444 (69%), Gaps = 10/444 (2%)
 Frame = +1

Query  52    HHLVFISLALLLFPLACFSRSHLRRVLLNHEA--------GNYAVIFDAGSTGSRVHVFH  207
             + +  I+  L + P   +S+     +LL +           +YAV+FDAGSTGSRVHV+H
Sbjct  13    NFMTLITFLLFIMPSISYSQYLGNNILLTNRKIFPKQEPISSYAVVFDAGSTGSRVHVYH  72

Query  208   FDENLDLLPVGDGVEFFLKITPGLSSYADDPEAAAKSLEPLLLEAEGVVPTELQPDTPLE  387
             FD+NL+LL VG  VEF+ K TPGLS+YAD+PE AAKSL PLL +AE VVP + +  TP+ 
Sbjct  73    FDQNLNLLHVGKDVEFYNKTTPGLSAYADNPEEAAKSLIPLLEQAESVVPEDQRSKTPIR  132

Query  388   LGATAGLRLLEGDASDKILQAVRDMFKNESNFKSKAEWVSILEGSQEGTYFWVAMNYLLG  567
             LGATAGLRLL GDAS+KILQ+VRD+F N S F  + + VSI++G+QEG+Y WV +NY LG
Sbjct  133   LGATAGLRLLNGDASEKILQSVRDLFSNRSTFNVQPDAVSIIDGTQEGSYLWVTVNYALG  192

Query  568   NLGKGYQNTIATIDLGGGSVQVSYAVSGDTFANAPKPHNGEEPYVQEKYILGAQYYLYVH  747
              LGK +  T+  +DLGGGSVQ++YAVS  T  NAPK  +GE+PY+++  + G +Y LYVH
Sbjct  193   KLGKKFTKTVGVMDLGGGSVQMAYAVSKYTAKNAPKVADGEDPYIKKLVLKGKKYDLYVH  252

Query  748   SYLNYGQLASRAEIFKASGNSTNPCVLEGYDGYYTYNDVSYKVTAPPNGSSLKNCRKLAR  927
             SYL++G+ ASRAEI K + NS NPC+L G+DG YTY    +K  AP +G++ K C+K+ R
Sbjct  253   SYLHFGREASRAEILKVTHNSPNPCILAGFDGTYTYAGEEFKANAPASGANFKKCKKIVR  312

Query  928   KVVDFRAPCKYPNCTFNGVWSGGGGAGMENVDISSYFYDIAIDVGIIDEGKA-SKIVKPR  1104
             + +    PC Y NCTF G+WSGGGG+G   +  +S F+ +A D+G++D     S  ++P 
Sbjct  313   EALKLNYPCPYQNCTFGGIWSGGGGSGQRILFAASSFFYLAEDIGLVDPNTPYSLTLRPV  372

Query  1105  SFLVAAKLACETKFEDVKSTFPNAVEKDY-PYLCMDLVYQYTLLVDGLGLHPYKEITLMK  1281
                  AK AC    E+ KST+P  V+ +   Y+CMDL+YQY LLVDG GL P +EIT  K
Sbjct  373   DLETEAKKACTLNLEEAKSTYPLLVDFNIVEYVCMDLIYQYVLLVDGFGLDPLQEITAGK  432

Query  1282  KVEYKNYMVEAAWPLGCAIDVISS  1353
             ++EY++ +VEAAWPLG A++ ISS
Sbjct  433   QIEYQDSLVEAAWPLGNAVEAISS  456



>ref|XP_010492830.1| PREDICTED: apyrase 2-like [Camelina sativa]
Length=473

 Score =   437 bits (1123),  Expect = 1e-144, Method: Compositional matrix adjust.
 Identities = 224/418 (54%), Positives = 299/418 (72%), Gaps = 12/418 (3%)
 Frame = +1

Query  130   LLNHEAG-------NYAVIFDAGSTGSRVHVFHFDENLDLLPVGDGVEFFLKITPGLSSY  288
             +LN + G       NYAVIFDAGS+GSRVHV+ FD+NLDL+P+G+ +E FL++ PGLS+Y
Sbjct  57    VLNRKGGPNSRGPKNYAVIFDAGSSGSRVHVYCFDQNLDLIPLGNELELFLQLKPGLSAY  116

Query  289   ADDPEAAAKSLEPLLLEAEGVVPTELQPDTPLELGATAGLRLLEGDASDKILQAVRDMFK  468
               DP  AA SL  LL +AE  VP EL+P TP+ +GATAGLR L  +AS+ ILQAVR++ +
Sbjct  117   PTDPRQAANSLVSLLDKAEASVPRELRPKTPVRVGATAGLRTLGHEASENILQAVRELLR  176

Query  469   NESNFKSKAEWVSILEGSQEGTYFWVAMNYLLGNLGKGYQNTIATIDLGGGSVQVSYAVS  648
             + S  K++A  V++L+G+QEG+Y WV +NYLL NLGK Y +T+  +DLGGGSVQ++YA+S
Sbjct  177   DRSMLKTEANAVTVLDGTQEGSYQWVTINYLLRNLGKPYSDTVGVVDLGGGSVQMAYAIS  236

Query  649   GDTFANAPKPHNGEEPYVQEKYILGAQYYLYVHSYLNYGQLASRAEIFKASGNSTNPCVL  828
              +  A+APKP  GE+ YV+E Y+ G +Y+LYVHSYL+YG LA+RAEI K S +S NPC++
Sbjct  237   EEDAASAPKPLEGEDSYVREMYLKGRKYFLYVHSYLHYGLLAARAEILKVSDDSENPCIV  296

Query  829   EGYDGYYTYNDVSYKVTAPPNGSSLKNCRKL---ARKVVDFRAPCKYPNCTFNGVWSGGG  999
              GYDG Y Y    +K TA P+G+SL  CR++   A KV D    C +  CTF GVW+GG 
Sbjct  297   TGYDGKYKYGGKEFKGTASPSGASLDECRRITINALKVND--TLCTHMKCTFGGVWNGGR  354

Query  1000  GAGMENVDISSYFYDIAIDVGIIDEGKASKIVKPRSFLVAAKLACETKFEDVKSTFPNAV  1179
             G G +N+ ++S+F+D A + G +D  +    V+P+ F  AAK AC    E+ KS FP   
Sbjct  355   GGGQKNMFVASFFFDRAAEAGFVDPKQPVATVRPKDFEKAAKKACSMNLEEGKSKFPLVE  414

Query  1180  EKDYPYLCMDLVYQYTLLVDGLGLHPYKEITLMKKVEYKNYMVEAAWPLGCAIDVISS  1353
             E + PYLCMDLVYQYTLL+DG GL P + ITL+KKV+Y  + VEAAWPLG AI+ +SS
Sbjct  415   EDNLPYLCMDLVYQYTLLIDGFGLEPSQTITLVKKVKYGEHAVEAAWPLGSAIEAVSS  472



>ref|XP_006364259.1| PREDICTED: probable apyrase 1-like [Solanum tuberosum]
Length=480

 Score =   437 bits (1123),  Expect = 2e-144, Method: Compositional matrix adjust.
 Identities = 225/402 (56%), Positives = 296/402 (74%), Gaps = 1/402 (0%)
 Frame = +1

Query  151   NYAVIFDAGSTGSRVHVFHFDENLDLLPVGDGVEFFLKITPGLSSYADDPEAAAKSLEPL  330
             NYAVIFDAGS+GSRVHVF FD++LDL+P+GD +E FL+  PGLS++A DP +AAKSL+ L
Sbjct  77    NYAVIFDAGSSGSRVHVFCFDQHLDLVPIGDDLELFLQKKPGLSAFASDPASAAKSLQSL  136

Query  331   LLEAEGVVPTELQPDTPLELGATAGLRLLEGDASDKILQAVRDMFKNESNFKSKAEWVSI  510
             L +AE VVP +L+ +TP+ +GATAGLR L G+ SDKILQAVRD  K++S+ KSK  WV++
Sbjct  137   LEKAEDVVPMDLRSNTPVRVGATAGLRQLGGNTSDKILQAVRDFLKSKSSLKSKGSWVTV  196

Query  511   LEGSQEGTYFWVAMNYLLGNLGKGYQNTIATIDLGGGSVQVSYAVSGDTFANAPKPHNGE  690
             L+GSQEG Y WV +NYLLGNLG+ + +T+  +DLGGGSVQ++YA++      APK   GE
Sbjct  197   LDGSQEGAYQWVTINYLLGNLGRKFSDTVGVVDLGGGSVQMAYAITESDAQKAPKLSGGE  256

Query  691   EPYVQEKYILGAQYYLYVHSYLNYGQLASRAEIFKASGNSTNPCVLEGYDGYYTYNDVSY  870
               YVQE Y+ G +YYLYVHSYL YG LA+RAEI K +  S +PC+L G+ G Y Y    Y
Sbjct  257   NTYVQEMYLKGVKYYLYVHSYLRYGLLAARAEILKVTKESGSPCILTGHHGSYKYGGKVY  316

Query  871   KVTAPPNGSSLKNCRKLARKVVDF-RAPCKYPNCTFNGVWSGGGGAGMENVDISSYFYDI  1047
               +    GSS+ NCR +A K +    + C +  CTF GVW+GGGG G +N+ ++S+F+D 
Sbjct  317   PASTMSEGSSMTNCRLVALKALKVNESTCTHMKCTFGGVWNGGGGDGQKNMFVASFFFDR  376

Query  1048  AIDVGIIDEGKASKIVKPRSFLVAAKLACETKFEDVKSTFPNAVEKDYPYLCMDLVYQYT  1227
             A++VG +D   A   V+P  F  AA+ AC+T+ +D K+TFP+    + PYLCMDLVYQYT
Sbjct  377   AVEVGFVDPNVAVAKVRPIDFESAARRACDTRLDDAKATFPSVEPDNLPYLCMDLVYQYT  436

Query  1228  LLVDGLGLHPYKEITLMKKVEYKNYMVEAAWPLGCAIDVISS  1353
             LLVDG GL   +E+TL+KKV+YKN +VEAAWPLG AI+V SS
Sbjct  437   LLVDGFGLDARQEMTLVKKVKYKNSLVEAAWPLGSAIEVTSS  478



>ref|XP_010454056.1| PREDICTED: apyrase 2-like [Camelina sativa]
Length=473

 Score =   436 bits (1122),  Expect = 2e-144, Method: Compositional matrix adjust.
 Identities = 224/418 (54%), Positives = 299/418 (72%), Gaps = 12/418 (3%)
 Frame = +1

Query  130   LLNHEAG-------NYAVIFDAGSTGSRVHVFHFDENLDLLPVGDGVEFFLKITPGLSSY  288
             +LN + G       NYAVIFDAGS+GSRVHV+ FD+NLDL+P+G+ +E FL++ PGLS+Y
Sbjct  57    VLNRKGGPNSRGPKNYAVIFDAGSSGSRVHVYCFDQNLDLIPLGNELELFLQLKPGLSAY  116

Query  289   ADDPEAAAKSLEPLLLEAEGVVPTELQPDTPLELGATAGLRLLEGDASDKILQAVRDMFK  468
               DP  AA SL  LL +AE  VP EL+P TP+ +GATAGLR L  +AS+ ILQAVR++ +
Sbjct  117   PTDPRQAANSLVSLLDKAEASVPRELRPKTPVRVGATAGLRTLGHEASENILQAVRELLR  176

Query  469   NESNFKSKAEWVSILEGSQEGTYFWVAMNYLLGNLGKGYQNTIATIDLGGGSVQVSYAVS  648
             + S  K++A  V++L+G+QEG+Y WV +NYLL NLGK Y +T+  +DLGGGSVQ++YA+S
Sbjct  177   DRSMLKTEANAVTVLDGTQEGSYQWVTINYLLRNLGKPYSDTVGVVDLGGGSVQMAYAIS  236

Query  649   GDTFANAPKPHNGEEPYVQEKYILGAQYYLYVHSYLNYGQLASRAEIFKASGNSTNPCVL  828
              +  A APKP  GE+ YV+E Y+ G +Y+LYVHSYL+YG LA+RAEI K S +S NPCV+
Sbjct  237   EEDAAKAPKPLEGEDSYVREMYLKGRKYFLYVHSYLHYGLLAARAEILKVSDDSDNPCVV  296

Query  829   EGYDGYYTYNDVSYKVTAPPNGSSLKNCRKL---ARKVVDFRAPCKYPNCTFNGVWSGGG  999
              GYDG Y Y    +K TA P+G+SL  CR++   + KV D    C +  CTF GVW+GG 
Sbjct  297   TGYDGKYKYGGKEFKGTASPSGASLDECRRITINSLKVND--TLCTHMKCTFGGVWNGGR  354

Query  1000  GAGMENVDISSYFYDIAIDVGIIDEGKASKIVKPRSFLVAAKLACETKFEDVKSTFPNAV  1179
             G G +N+ ++S+F+D A + G +D  +    V+P+ F  AAK AC    E+ KS FP   
Sbjct  355   GGGQKNMFVASFFFDRAAEAGFVDPKQPVATVRPKDFEKAAKKACSMNLEEGKSKFPLVE  414

Query  1180  EKDYPYLCMDLVYQYTLLVDGLGLHPYKEITLMKKVEYKNYMVEAAWPLGCAIDVISS  1353
             E++ PYLCMDLVYQYTLL+DG GL P + ITL+KKV+Y  + VEAAWPLG AI+ +SS
Sbjct  415   EENLPYLCMDLVYQYTLLIDGFGLEPSQTITLVKKVKYGEHAVEAAWPLGSAIEAVSS  472



>gb|AES80802.2| Nod factor-binding lectin-nucleotide phosphohydrolase [Medicago 
truncatula]
Length=478

 Score =   436 bits (1122),  Expect = 2e-144, Method: Compositional matrix adjust.
 Identities = 227/444 (51%), Positives = 308/444 (69%), Gaps = 10/444 (2%)
 Frame = +1

Query  52    HHLVFISLALLLFPLACFSRSHLRRVLLNHEA--------GNYAVIFDAGSTGSRVHVFH  207
             + +  I+  L + P   +S+     +LL +           +YAV+FDAGSTGSRVHV+H
Sbjct  24    NFMTLITFLLFIMPSISYSQYLGNNILLTNRKIFPKQEPISSYAVVFDAGSTGSRVHVYH  83

Query  208   FDENLDLLPVGDGVEFFLKITPGLSSYADDPEAAAKSLEPLLLEAEGVVPTELQPDTPLE  387
             FD+NL+LL VG  VEF+ K TPGLS+YAD+PE AAKSL PLL +AE VVP + +  TP+ 
Sbjct  84    FDQNLNLLHVGKDVEFYNKTTPGLSAYADNPEEAAKSLIPLLEQAESVVPEDQRSKTPIR  143

Query  388   LGATAGLRLLEGDASDKILQAVRDMFKNESNFKSKAEWVSILEGSQEGTYFWVAMNYLLG  567
             LGATAGLRLL GDAS+KILQ+VRD+F N S F  + + VSI++G+QEG+Y WV +NY LG
Sbjct  144   LGATAGLRLLNGDASEKILQSVRDLFSNRSTFNVQPDAVSIIDGTQEGSYLWVTVNYALG  203

Query  568   NLGKGYQNTIATIDLGGGSVQVSYAVSGDTFANAPKPHNGEEPYVQEKYILGAQYYLYVH  747
              LGK +  T+  +DLGGGSVQ++YAVS  T  NAPK  +GE+PY+++  + G +Y LYVH
Sbjct  204   KLGKKFTKTVGVMDLGGGSVQMAYAVSKYTAKNAPKVADGEDPYIKKLVLKGKKYDLYVH  263

Query  748   SYLNYGQLASRAEIFKASGNSTNPCVLEGYDGYYTYNDVSYKVTAPPNGSSLKNCRKLAR  927
             SYL++G+ ASRAEI K + NS NPC+L G+DG YTY    +K  AP +G++ K C+K+ R
Sbjct  264   SYLHFGREASRAEILKVTHNSPNPCILAGFDGTYTYAGEEFKANAPASGANFKKCKKIVR  323

Query  928   KVVDFRAPCKYPNCTFNGVWSGGGGAGMENVDISSYFYDIAIDVGIIDEGKA-SKIVKPR  1104
             + +    PC Y NCTF G+WSGGGG+G   +  +S F+ +A D+G++D     S  ++P 
Sbjct  324   EALKLNYPCPYQNCTFGGIWSGGGGSGQRILFAASSFFYLAEDIGLVDPNTPYSLTLRPV  383

Query  1105  SFLVAAKLACETKFEDVKSTFPNAVEKDY-PYLCMDLVYQYTLLVDGLGLHPYKEITLMK  1281
                  AK AC    E+ KST+P  V+ +   Y+CMDL+YQY LLVDG GL P +EIT  K
Sbjct  384   DLETEAKKACTLNLEEAKSTYPLLVDFNIVEYVCMDLIYQYVLLVDGFGLDPLQEITAGK  443

Query  1282  KVEYKNYMVEAAWPLGCAIDVISS  1353
             ++EY++ +VEAAWPLG A++ ISS
Sbjct  444   QIEYQDSLVEAAWPLGNAVEAISS  467



>ref|XP_010420574.1| PREDICTED: apyrase 2 [Camelina sativa]
Length=473

 Score =   436 bits (1121),  Expect = 3e-144, Method: Compositional matrix adjust.
 Identities = 223/418 (53%), Positives = 300/418 (72%), Gaps = 12/418 (3%)
 Frame = +1

Query  130   LLNHEAG-------NYAVIFDAGSTGSRVHVFHFDENLDLLPVGDGVEFFLKITPGLSSY  288
             +LN + G       NYAVIFDAGS+GSRVHV+ FD+NLDL+P+G+ +E FL++ PGLS+Y
Sbjct  57    VLNRKGGPNSRGPKNYAVIFDAGSSGSRVHVYCFDQNLDLIPLGNELELFLQLKPGLSAY  116

Query  289   ADDPEAAAKSLEPLLLEAEGVVPTELQPDTPLELGATAGLRLLEGDASDKILQAVRDMFK  468
               DP  AA SL  LL +AE  VP EL+P TP+ +GATAGLR L  +AS+ ILQAVR++ +
Sbjct  117   PTDPRQAANSLVSLLDKAEASVPRELRPKTPVRVGATAGLRTLGHEASENILQAVRELLR  176

Query  469   NESNFKSKAEWVSILEGSQEGTYFWVAMNYLLGNLGKGYQNTIATIDLGGGSVQVSYAVS  648
             + S  K++A  V++L+G+QEG+Y WV +NYLL NLGK Y +T+  +DLGGGSVQ++YA+S
Sbjct  177   DRSMLKTEANAVTVLDGTQEGSYQWVTINYLLRNLGKPYSDTVGVVDLGGGSVQMAYAIS  236

Query  649   GDTFANAPKPHNGEEPYVQEKYILGAQYYLYVHSYLNYGQLASRAEIFKASGNSTNPCVL  828
              +  A+APKP  GE+ YV+E Y+ G +Y+LYVHSYL+YG LA+RAEI K S +S NPC++
Sbjct  237   EEDAASAPKPLEGEDSYVREMYLKGRKYFLYVHSYLHYGLLAARAEILKVSDDSDNPCIV  296

Query  829   EGYDGYYTYNDVSYKVTAPPNGSSLKNCRKL---ARKVVDFRAPCKYPNCTFNGVWSGGG  999
              GYDG Y Y    +K TA P+G+SL  CR++   + KV D    C +  CTF GVW+GG 
Sbjct  297   TGYDGKYKYGGKEFKGTASPSGASLDECRRITINSLKVND--TLCTHMKCTFGGVWNGGR  354

Query  1000  GAGMENVDISSYFYDIAIDVGIIDEGKASKIVKPRSFLVAAKLACETKFEDVKSTFPNAV  1179
             G G +N+ ++S+F+D A + G +D  +    V+P+ F  AAK AC    E+ KS FP   
Sbjct  355   GGGQKNMFVASFFFDRAAEAGFVDPKQPVATVRPKDFEKAAKKACSMNLEEGKSKFPLVE  414

Query  1180  EKDYPYLCMDLVYQYTLLVDGLGLHPYKEITLMKKVEYKNYMVEAAWPLGCAIDVISS  1353
             E++ PYLCMDLVYQYTLL+DG GL P + ITL+KKV+Y  + VEAAWPLG AI+ +SS
Sbjct  415   EENLPYLCMDLVYQYTLLIDGFGLEPSQTITLVKKVKYGEHAVEAAWPLGSAIEAVSS  472



>gb|ACB38285.1| apyrase [Trifolium repens]
Length=460

 Score =   434 bits (1117),  Expect = 8e-144, Method: Compositional matrix adjust.
 Identities = 219/443 (49%), Positives = 299/443 (67%), Gaps = 4/443 (1%)
 Frame = +1

Query  37    KHTSHHHLVFISLALLLFPLACFSRSHL---RRVLLNHEA-GNYAVIFDAGSTGSRVHVF  204
             K  S   L+ +   LL    A  S  +L   R++    E   +YAVIFDAGSTGSRVHV+
Sbjct  7     KTKSMEFLINLITILLFLTPAISSTQYLGNNRKIFPKQETVTSYAVIFDAGSTGSRVHVY  66

Query  205   HFDENLDLLPVGDGVEFFLKITPGLSSYADDPEAAAKSLEPLLLEAEGVVPTELQPDTPL  384
             HFD+ LDLL +G+ VEF+ K TPGLS+YAD+P+ AA+SL PLL +AE VVP   QP TP+
Sbjct  67    HFDQYLDLLHIGNDVEFYNKTTPGLSAYADNPKQAAESLIPLLEQAENVVPVNQQPKTPV  126

Query  385   ELGATAGLRLLEGDASDKILQAVRDMFKNESNFKSKAEWVSILEGSQEGTYFWVAMNYLL  564
              LGATAGLRLL+G++S+ IL+AV  +  N + F  +++ V I++G++EG+Y WVA+NY+L
Sbjct  127   SLGATAGLRLLDGNSSELILEAVSKLLSNRNTFNVQSDAVGIIDGTKEGSYLWVAINYVL  186

Query  565   GNLGKGYQNTIATIDLGGGSVQVSYAVSGDTFANAPKPHNGEEPYVQEKYILGAQYYLYV  744
             G LG  +  T+A  DLGGGSVQ+ YA+S D    APK   GE+PY+++  + G +YYLYV
Sbjct  187   GKLGNKFSETVAVADLGGGSVQMVYAISRDQARKAPKVPQGEDPYIKKIVLKGNKYYLYV  246

Query  745   HSYLNYGQLASRAEIFKASGNSTNPCVLEGYDGYYTYNDVSYKVTAPPNGSSLKNCRKLA  924
             HSYL +G+ ASRA+I K +  S+NPC+L GYDG YTY+   YK  AP +GSSL  CR++ 
Sbjct  247   HSYLRFGKEASRAQILKVTNGSSNPCILAGYDGTYTYSGEEYKAYAPASGSSLDECREVI  306

Query  925   RKVVDFRAPCKYPNCTFNGVWSGGGGAGMENVDISSYFYDIAIDVGIIDEGKASKIVKPR  1104
             RK +     C Y +CTF+G+WSGGGG G + +  +S FY +  ++G+ D  K +  +   
Sbjct  307   RKALKVNHSCPYSSCTFDGIWSGGGGKGQKTLYATSSFYYVPQNIGLFDPNKPNSKIYIE  366

Query  1105  SFLVAAKLACETKFEDVKSTFPNAVEKDYPYLCMDLVYQYTLLVDGLGLHPYKEITLMKK  1284
                 AA+  C+ KF+D K+ FP   E   PY C+DL YQYTL VDG GL P + IT+  +
Sbjct  367   ELRAAAEQVCKIKFKDAKAKFPLLAESSLPYACLDLTYQYTLFVDGFGLDPLQRITVANE  426

Query  1285  VEYKNYMVEAAWPLGCAIDVISS  1353
             +EY+  +V+AAWPLG AI+ ISS
Sbjct  427   IEYQGAVVDAAWPLGNAIEAISS  449



>gb|ACB38286.1| apyrase [Trifolium repens]
Length=455

 Score =   433 bits (1114),  Expect = 2e-143, Method: Compositional matrix adjust.
 Identities = 219/412 (53%), Positives = 298/412 (72%), Gaps = 4/412 (1%)
 Frame = +1

Query  121   RRVLLNH-EAGNYAVIFDAGSTGSRVHVFHFDENLDLLPVGDGVEFFLKITPGLSSYADD  297
             R++ L      +YAV+FDAGSTGSRVHV+HFD+NLDLL +G  VEF+ KI PGLS+YAD+
Sbjct  32    RKIFLKQGTITSYAVVFDAGSTGSRVHVYHFDQNLDLLHIGKDVEFYNKIQPGLSAYADN  91

Query  298   PEAAAKSLEPLLLEAEGVVPTELQPDTPLELGATAGLRLLEGDASDKILQAVRDMFKNES  477
             PE AAKSL PLL +AE VVP +    TP+ LGATAGLRLL+GDAS++ILQAVRDM  N+S
Sbjct  92    PEQAAKSLIPLLEQAENVVPEDFHSKTPIRLGATAGLRLLDGDASERILQAVRDMLNNKS  151

Query  478   NFKSKAEWVSILEGSQEGTYFWVAMNYLLGNLGKGYQNTIATIDLGGGSVQVSYAVSGDT  657
              F  + + VSI++G+QEG+Y WV +NY+LGNLGK + NT+  IDLGGGSVQ++YAVS  T
Sbjct  152   TFNVQPDAVSIIDGTQEGSYLWVTINYVLGNLGKRFTNTVGVIDLGGGSVQMAYAVSKKT  211

Query  658   FANAPKPHNGEEPYVQEKYILGAQYYLYVHSYLNYGQLASRAEIFKASGNSTNPCVLEGY  837
               NAPK  +GE+PY+++  + G  Y LYVHSYL++G+ ASRAEI K +  S +PC+L G+
Sbjct  212   ARNAPKVTDGEDPYIKKIVLKGKPYDLYVHSYLHFGREASRAEILKVTHGSASPCILAGF  271

Query  838   DGYYTYNDVSYKVTAPPNGSSLKNCRKLARKVVDFRAPCKYPNCTFNGVWSGGGGAGMEN  1017
             DG YTY+   +K +AP +G++   C+K+ +K +    PC Y NCTF G+W+GGGG+G + 
Sbjct  272   DGIYTYSGEEFKASAPTSGANFDKCKKIIQKALKLDYPCPYQNCTFGGIWNGGGGSGQKK  331

Query  1018  VDISSYFYDIAIDVGIIDEGKASKIVKPRSFLVAAKLACETKFEDVKSTFPNAVEK--DY  1191
             +  +S F+ +  DVG++D  K++  ++P      AK+ C    EDVKS +P  +EK    
Sbjct  332   LFAASSFFYLPQDVGMVDPNKSNLKLRPVDLENKAKIVCTLNVEDVKSAYP-LLEKFNIV  390

Query  1192  PYLCMDLVYQYTLLVDGLGLHPYKEITLMKKVEYKNYMVEAAWPLGCAIDVI  1347
             PY CMDL+YQY LLVDG GL P +EIT  +K+EY+  +V+AAW LG A++ +
Sbjct  391   PYACMDLIYQYELLVDGFGLDPLQEITAGEKIEYQEALVDAAWALGNAVEAV  442



>gb|AAM98186.1| unknown protein [Arabidopsis thaliana]
Length=472

 Score =   434 bits (1115),  Expect = 2e-143, Method: Compositional matrix adjust.
 Identities = 221/404 (55%), Positives = 293/404 (73%), Gaps = 5/404 (1%)
 Frame = +1

Query  151   NYAVIFDAGSTGSRVHVFHFDENLDLLPVGDGVEFFLKITPGLSSYADDPEAAAKSLEPL  330
             NYAVIFDAGS+GSRVHV+ FD+NLDL+P+G+ +E FL++ PGLS+Y  DP  AA SL  L
Sbjct  70    NYAVIFDAGSSGSRVHVYCFDQNLDLIPLGNELELFLQLKPGLSAYPTDPRQAANSLVSL  129

Query  331   LLEAEGVVPTELQPDTPLELGATAGLRLLEGDASDKILQAVRDMFKNESNFKSKAEWVSI  510
             L +AE  VP EL+P T + +GATAGLR L  DAS+ ILQAVR++ ++ S  K++A  V++
Sbjct  130   LDKAEASVPRELRPKTHVRVGATAGLRTLGHDASENILQAVRELLRDRSMLKTEANAVTV  189

Query  511   LEGSQEGTYFWVAMNYLLGNLGKGYQNTIATIDLGGGSVQVSYAVSGDTFANAPKPHNGE  690
             L+G+QEG+Y WV +NYLL NLGK Y +T+  +DLGGGSVQ++YA+S +  A+APKP  GE
Sbjct  190   LDGTQEGSYQWVTINYLLRNLGKPYSDTVGVVDLGGGSVQMAYAISEEDAASAPKPLEGE  249

Query  691   EPYVQEKYILGAQYYLYVHSYLNYGQLASRAEIFKASGNSTNPCVLEGYDGYYTYNDVSY  870
             + YV+E Y+ G +Y+LYVHSYL+YG LA+RAEI K S +S NPC++ GYDG Y Y    +
Sbjct  250   DSYVREMYLKGQKYFLYVHSYLHYGLLAARAEILKVSEDSENPCIVAGYDGMYKYGGKEF  309

Query  871   KVTAPPNGSSLKNCRKL---ARKVVDFRAPCKYPNCTFNGVWSGGGGAGMENVDISSYFY  1041
             K  A  +G+SL  CR++   A KV D    C +  CTF GVW+GG G G +N+ ++S+F+
Sbjct  310   KAPASQSGASLDECRRITINALKVND--TLCTHMKCTFGGVWNGGRGGGQKNMFVASFFF  367

Query  1042  DIAIDVGIIDEGKASKIVKPRSFLVAAKLACETKFEDVKSTFPNAVEKDYPYLCMDLVYQ  1221
             D A + G +D  +    V+P  F  AAK AC  K E+ KSTFP   E++ PYLCMDLVYQ
Sbjct  368   DRAAEAGFVDPKQPVATVRPMDFEKAAKKACSMKLEEGKSTFPLVEEENLPYLCMDLVYQ  427

Query  1222  YTLLVDGLGLHPYKEITLMKKVEYKNYMVEAAWPLGCAIDVISS  1353
             YTLL+DG GL P + ITL+KKV+Y +  VEAAWPLG AI+ +SS
Sbjct  428   YTLLIDGFGLEPSQTITLVKKVKYGDQAVEAAWPLGSAIEAVSS  471



>gb|AFI41206.1| apyrase 2, partial [Arabidopsis thaliana]
Length=472

 Score =   434 bits (1115),  Expect = 2e-143, Method: Compositional matrix adjust.
 Identities = 221/404 (55%), Positives = 293/404 (73%), Gaps = 5/404 (1%)
 Frame = +1

Query  151   NYAVIFDAGSTGSRVHVFHFDENLDLLPVGDGVEFFLKITPGLSSYADDPEAAAKSLEPL  330
             NYAVIFDAGS+GSRVHV+ FD+NLDL+P+G+ +E FL++ PGLS+Y  DP  AA SL  L
Sbjct  70    NYAVIFDAGSSGSRVHVYCFDQNLDLIPLGNELELFLQLKPGLSAYPTDPRQAANSLVSL  129

Query  331   LLEAEGVVPTELQPDTPLELGATAGLRLLEGDASDKILQAVRDMFKNESNFKSKAEWVSI  510
             L +AE  VP EL+P T + +GATAGLR L  DAS+ ILQAVR++ ++ S  K++A  V++
Sbjct  130   LDKAEASVPRELRPKTHVRVGATAGLRTLGHDASENILQAVRELLRDRSMLKTEANAVTV  189

Query  511   LEGSQEGTYFWVAMNYLLGNLGKGYQNTIATIDLGGGSVQVSYAVSGDTFANAPKPHNGE  690
             L+G+QEG+Y WV +NYLL NLGK Y +T+  +DLGGGSVQ++YA+S +  A+APKP  GE
Sbjct  190   LDGTQEGSYQWVTINYLLRNLGKPYSDTVGVVDLGGGSVQMAYAISEEDAASAPKPLEGE  249

Query  691   EPYVQEKYILGAQYYLYVHSYLNYGQLASRAEIFKASGNSTNPCVLEGYDGYYTYNDVSY  870
             + YV+E Y+ G +Y+LYVHSYL+YG LA+RAEI K S +S NPC++ GYDG Y Y    +
Sbjct  250   DSYVREMYLKGRKYFLYVHSYLHYGLLAARAEILKVSEDSENPCIVAGYDGMYKYGGKEF  309

Query  871   KVTAPPNGSSLKNCRKL---ARKVVDFRAPCKYPNCTFNGVWSGGGGAGMENVDISSYFY  1041
             K  A  +G+SL  CR++   A KV D    C +  CTF GVW+GG G G +N+ ++S+F+
Sbjct  310   KAPASQSGASLDECRRITINALKVND--TLCTHMKCTFGGVWNGGRGGGQKNMFVASFFF  367

Query  1042  DIAIDVGIIDEGKASKIVKPRSFLVAAKLACETKFEDVKSTFPNAVEKDYPYLCMDLVYQ  1221
             D A + G +D  +    V+P  F  AAK AC  K E+ KSTFP   E++ PYLCMDLVYQ
Sbjct  368   DRAAEAGFVDPKQPVATVRPMDFEKAAKKACSMKLEEGKSTFPLVEEENLPYLCMDLVYQ  427

Query  1222  YTLLVDGLGLHPYKEITLMKKVEYKNYMVEAAWPLGCAIDVISS  1353
             YTLL+DG GL P + ITL+KKV+Y +  VEAAWPLG AI+ +SS
Sbjct  428   YTLLIDGFGLEPSQTITLVKKVKYGDQAVEAAWPLGSAIEAVSS  471



>sp|Q9SPM5.1|APY2_ARATH RecName: Full=Apyrase 2; Short=AtAPY2; AltName: Full=ATP-diphosphatase; 
AltName: Full=ATP-diphosphohydrolase; AltName: Full=Adenosine 
diphosphatase; Short=ADPase; AltName: Full=NTPDase; 
AltName: Full=Nucleoside triphosphate diphosphohydrolase 
2 [Arabidopsis thaliana]
 gb|AAF00612.1|AF156783_1 apyrase [Arabidopsis thaliana]
 dbj|BAB09486.1| apyrase [Arabidopsis thaliana]
 gb|AAM20717.1| apyrase [Arabidopsis thaliana]
 gb|AAN15648.1| apyrase [Arabidopsis thaliana]
Length=472

 Score =   433 bits (1114),  Expect = 2e-143, Method: Compositional matrix adjust.
 Identities = 221/404 (55%), Positives = 293/404 (73%), Gaps = 5/404 (1%)
 Frame = +1

Query  151   NYAVIFDAGSTGSRVHVFHFDENLDLLPVGDGVEFFLKITPGLSSYADDPEAAAKSLEPL  330
             NYAVIFDAGS+GSRVHV+ FD+NLDL+P+G+ +E FL++ PGLS+Y  DP  AA SL  L
Sbjct  70    NYAVIFDAGSSGSRVHVYCFDQNLDLIPLGNELELFLQLKPGLSAYPTDPRQAANSLVSL  129

Query  331   LLEAEGVVPTELQPDTPLELGATAGLRLLEGDASDKILQAVRDMFKNESNFKSKAEWVSI  510
             L +AE  VP EL+P T + +GATAGLR L  DAS+ ILQAVR++ ++ S  K++A  V++
Sbjct  130   LDKAEASVPRELRPKTHVRVGATAGLRTLGHDASENILQAVRELLRDRSMLKTEANAVTV  189

Query  511   LEGSQEGTYFWVAMNYLLGNLGKGYQNTIATIDLGGGSVQVSYAVSGDTFANAPKPHNGE  690
             L+G+QEG+Y WV +NYLL NLGK Y +T+  +DLGGGSVQ++YA+S +  A+APKP  GE
Sbjct  190   LDGTQEGSYQWVTINYLLRNLGKPYSDTVGVVDLGGGSVQMAYAISEEDAASAPKPLEGE  249

Query  691   EPYVQEKYILGAQYYLYVHSYLNYGQLASRAEIFKASGNSTNPCVLEGYDGYYTYNDVSY  870
             + YV+E Y+ G +Y+LYVHSYL+YG LA+RAEI K S +S NPC++ GYDG Y Y    +
Sbjct  250   DSYVREMYLKGRKYFLYVHSYLHYGLLAARAEILKVSEDSENPCIVAGYDGMYKYGGKEF  309

Query  871   KVTAPPNGSSLKNCRKL---ARKVVDFRAPCKYPNCTFNGVWSGGGGAGMENVDISSYFY  1041
             K  A  +G+SL  CR++   A KV D    C +  CTF GVW+GG G G +N+ ++S+F+
Sbjct  310   KAPASQSGASLDECRRITINALKVND--TLCTHMKCTFGGVWNGGRGGGQKNMFVASFFF  367

Query  1042  DIAIDVGIIDEGKASKIVKPRSFLVAAKLACETKFEDVKSTFPNAVEKDYPYLCMDLVYQ  1221
             D A + G +D  +    V+P  F  AAK AC  K E+ KSTFP   E++ PYLCMDLVYQ
Sbjct  368   DRAAEAGFVDPKQPVATVRPMDFEKAAKKACSMKLEEGKSTFPLVEEENLPYLCMDLVYQ  427

Query  1222  YTLLVDGLGLHPYKEITLMKKVEYKNYMVEAAWPLGCAIDVISS  1353
             YTLL+DG GL P + ITL+KKV+Y +  VEAAWPLG AI+ +SS
Sbjct  428   YTLLIDGFGLEPSQTITLVKKVKYGDQAVEAAWPLGSAIEAVSS  471



>ref|XP_006342448.1| PREDICTED: apyrase 2-like [Solanum tuberosum]
Length=472

 Score =   433 bits (1114),  Expect = 3e-143, Method: Compositional matrix adjust.
 Identities = 239/438 (55%), Positives = 305/438 (70%), Gaps = 4/438 (1%)
 Frame = +1

Query  58    LVFISLALLLFPLACFSRSHL---RRVLLNHEAGNYAVIFDAGSTGSRVHVFHFDENLDL  228
             L  +SL L + P    S S     R+   N  +  YAVIFDAGS+GSRVHVF FDENLDL
Sbjct  35    LFLVSLVLYVMPTRYPSDSMESLNRKFSPNLGSMKYAVIFDAGSSGSRVHVFCFDENLDL  94

Query  229   LPVGDGVEFFLKITPGLSSYADDPEAAAKSLEPLLLEAEGVVPTELQPDTPLELGATAGL  408
             +P+G+ +E F++  PGLSS+A DP AAA SL  LL +AE VVP  L+ +TP+ +GATAGL
Sbjct  95    VPIGNELELFVQKKPGLSSFASDPVAAADSLLLLLKDAENVVPRNLRSNTPVRVGATAGL  154

Query  409   RLLEGDASDKILQAVRDMFKNESNFKSKAEWVSILEGSQEGTYFWVAMNYLLGNLGKGYQ  588
             R LEGDASD+ILQAVRD  K++S+FK+  + V +L+G+QEG Y WV +NYLLG LGK Y 
Sbjct  155   RQLEGDASDRILQAVRDFLKSKSSFKATEDAVIVLDGNQEGAYQWVTINYLLGKLGKKYS  214

Query  589   NTIATIDLGGGSVQVSYAVSGDTFANAPKPHNGEEPYVQEKYILGAQYYLYVHSYLNYGQ  768
             +T+  +DLGGGSVQ++YA+S      APK  +GE+ YVQE Y+ G +Y+LYVHSYL+YG 
Sbjct  215   DTVGVVDLGGGSVQMAYAISESDAQKAPKVSDGEDTYVQEMYLKGTKYFLYVHSYLHYGL  274

Query  769   LASRAEIFKASGNSTNPCVLEGYDGYYTYNDVSYKVTAPPNGSSLKNCRKLARKVVDFRA  948
             LA+RAEI K SG S +PC+L G+ G Y Y    Y  ++   GSS+  CR++A K +    
Sbjct  275   LAARAEILKVSGESGSPCILGGHHGTYKYGGAVYPASSTSQGSSMSTCREVALKALKINE  334

Query  949   P-CKYPNCTFNGVWSGGGGAGMENVDISSYFYDIAIDVGIIDEGKASKIVKPRSFLVAAK  1125
             P C +  CTF GVW+GGGG G +N+ ++S+F+D A + GII+   A   V+P  +  AA 
Sbjct  335   PACTHMKCTFGGVWNGGGGDGQKNMFVASFFFDRAAEAGIINPSLAVAKVRPADYESAAN  394

Query  1126  LACETKFEDVKSTFPNAVEKDYPYLCMDLVYQYTLLVDGLGLHPYKEITLMKKVEYKNYM  1305
              AC T  E  KS FP+    + PYLCMDLVYQYTLLVDG GL P +EITL+KKVEYKN  
Sbjct  395   RACATGLEGAKSEFPHVETDNLPYLCMDLVYQYTLLVDGFGLQPQQEITLVKKVEYKNSF  454

Query  1306  VEAAWPLGCAIDVISSSS  1359
             VEAAWPLG AI+V SS S
Sbjct  455   VEAAWPLGSAIEVASSLS  472



>ref|XP_009416336.1| PREDICTED: probable apyrase 1 [Musa acuminata subsp. malaccensis]
Length=463

 Score =   433 bits (1113),  Expect = 3e-143, Method: Compositional matrix adjust.
 Identities = 224/438 (51%), Positives = 305/438 (70%), Gaps = 6/438 (1%)
 Frame = +1

Query  58    LVFISLALLLFPL--ACFSRSHLRRVLLNHEAGN--YAVIFDAGSTGSRVHVFHFDENLD  225
             L+ +S  L L P   A  S +  + +    EAG+  YAVIFDAGS+GSRVHVF FDENLD
Sbjct  27    LILVSFVLFLMPRSPAVISFASRKTMPGGSEAGSKSYAVIFDAGSSGSRVHVFCFDENLD  86

Query  226   LLPVGDGVEFFLKITPGLSSYADDPEAAAKSLEPLLLEAEGVVPTELQPDTPLELGATAG  405
             LLP+G  +E F++  PGLS YA DP+ AA+SL  LL +AE VVP +L+  TP+ +GATAG
Sbjct  87    LLPIGQELELFVQKKPGLSFYAKDPQQAAQSLVSLLEKAESVVPMKLRQQTPVRVGATAG  146

Query  406   LRLLEGDASDKILQAVRDMFKNESNFKSKAEWVSILEGSQEGTYFWVAMNYLLGNLGKGY  585
             LR L  + S+KILQAV+D+ +++S+ K K++WV++L+G+QEG + WV +NYLLG LGK Y
Sbjct  147   LRALGAETSEKILQAVKDLLQHKSSLKFKSDWVTVLDGTQEGAFQWVTINYLLGKLGKSY  206

Query  586   QNTIATIDLGGGSVQVSYAVSGDTFANAPKPHNGEEPYVQEKYILGAQYYLYVHSYLNYG  765
              NT+  +DLGGGSVQ++YA+S      APK  +GE+ YVQ+ ++ G +YYLYVHSYL YG
Sbjct  207   ANTVGVVDLGGGSVQMAYAISEKDAEQAPKVSDGEDSYVQKLFLKGTKYYLYVHSYLRYG  266

Query  766   QLASRAEIFKASGNSTNPCVLEGYDGYYTYNDVSYKVTAPPNGSSLKNCRKLARKVVDFR  945
              LA+RAEI K + + +N C+L GY G Y Y   +Y+ +A  +G+S   CR+ A K +   
Sbjct  267   LLAARAEILKVTKDDSN-CILSGYHGSYKYGGNAYRASAKQSGASFLKCREDAVKALRVD  325

Query  946   AP-CKYPNCTFNGVWSGGGGAGMENVDISSYFYDIAIDVGIIDEGKASKIVKPRSFLVAA  1122
              P C +  CTF G+W+GGGG G +N+ ++S+F+D A + G +D  K   +VKP  F  AA
Sbjct  326   EPACTHMKCTFGGIWNGGGGDGQKNLFVASFFFDRAAEAGFVDREKPIAVVKPSHFEKAA  385

Query  1123  KLACETKFEDVKSTFPNAVEKDYPYLCMDLVYQYTLLVDGLGLHPYKEITLMKKVEYKNY  1302
             K AC+   ED K+ +P   E + PYLCMDLVYQYTLLVDG  + P  +ITL+K+V+Y + 
Sbjct  386   KHACQLSIEDAKAAYPRVQEDNLPYLCMDLVYQYTLLVDGFAIDPDHDITLVKQVKYGDA  445

Query  1303  MVEAAWPLGCAIDVISSS  1356
              VEAAWPLG AI+V SS+
Sbjct  446   FVEAAWPLGSAIEVASSA  463



>ref|XP_002448917.1| hypothetical protein SORBIDRAFT_05g001550 [Sorghum bicolor]
 gb|EES07905.1| hypothetical protein SORBIDRAFT_05g001550 [Sorghum bicolor]
Length=469

 Score =   433 bits (1113),  Expect = 4e-143, Method: Compositional matrix adjust.
 Identities = 215/402 (53%), Positives = 281/402 (70%), Gaps = 2/402 (0%)
 Frame = +1

Query  145   AGNYAVIFDAGSTGSRVHVFHFDENLDLLPVGDGVEFFLKITPGLSSYADDPEAAAKSLE  324
             AG YAVIFDAGSTGSRVHVF FD+ L L+ +GD +EFF K+ PGLSSYA  P+ AA SL 
Sbjct  62    AGRYAVIFDAGSTGSRVHVFKFDKKLHLVQIGDDIEFFAKVKPGLSSYAGRPQEAASSLL  121

Query  325   PLLLEAEGVVPTELQPDTPLELGATAGLRLLEGDASDKILQAVRDMFKNESNFKSKAEWV  504
             PLL +A+ +VP  LQ +TPL+LGATAGLRL+  + +++IL+AVRD+   +S F+   +++
Sbjct  122   PLLEQADKIVPRRLQKNTPLKLGATAGLRLIGDEKAEEILEAVRDLVHIKSKFQYNPKYI  181

Query  505   SILEGSQEGTYFWVAMNYLLGNLGKGYQNTIATIDLGGGSVQVSYAVSGDTFANAPKPHN  684
             S+LEGSQEG+Y WVA+NYLLG LG  Y  T+  ID+GGGSVQ++YA+S D  ANAP   +
Sbjct  182   SVLEGSQEGSYLWVALNYLLGKLGGDYSKTVGVIDMGGGSVQMAYAISTDAAANAPAVPD  241

Query  685   GEEPYVQEKYILGAQYYLYVHSYLNYGQLASRAEIFKASGNSTNPCVLEGYDGYYTYNDV  864
             G++PY+ ++Y+ G  Y LYVHSYL YG LA+R EI KA     + C+L G+ G YTYN  
Sbjct  242   GKDPYITKEYLKGKDYNLYVHSYLYYGALAARVEILKAKNGPFSHCILRGFSGKYTYNGK  301

Query  865   SYKVTAPPNGSSLKNCRKLARKVVDFRAPCKYPNCTFNGVWSGGGGAGMENVDISSYFYD  1044
              Y  TA P G+    CR+   K +   APC+  NCTFNGVW+GGGGAG +N+ ++S+F+D
Sbjct  302   EYDATASPEGAVYDKCREEIIKALKLNAPCESKNCTFNGVWNGGGGAGQDNLYVASFFFD  361

Query  1045  IAIDVGIIDEGKASKIVKPRSFLVAAKLACETKFEDVKSTFPNAVEKDYPYLCMDLVYQY  1224
              A   G ID    S    P +F  AA   C    ++ K  +PN +  D PY+CMDL+YQY
Sbjct  362   KATQFGFIDSKAPSAKSTPEAFKGAADKVCSLSAQEAKVMYPNVL--DVPYICMDLIYQY  419

Query  1225  TLLVDGLGLHPYKEITLMKKVEYKNYMVEAAWPLGCAIDVIS  1350
             TLLVDG GL P KEITL+ +V+Y  Y +EAAWPLG AI+ I+
Sbjct  420   TLLVDGFGLAPTKEITLVARVKYGEYYIEAAWPLGTAIEAIA  461



>emb|CDY54053.1| BnaC09g54250D [Brassica napus]
Length=472

 Score =   433 bits (1113),  Expect = 4e-143, Method: Compositional matrix adjust.
 Identities = 228/443 (51%), Positives = 307/443 (69%), Gaps = 13/443 (3%)
 Frame = +1

Query  58    LVFISLALLLFPLACFSRSHLRR-VLLNHEAG-------NYAVIFDAGSTGSRVHVFHFD  213
             +V I+L  LL P    + + +    +LN + G       NYAV+FDAGS+GSRVHV+ FD
Sbjct  31    VVLIALVFLLMPGRSTTDAVVEEYTVLNRKGGPNSRPPKNYAVVFDAGSSGSRVHVYCFD  90

Query  214   ENLDLLPVGDGVEFFLKITPGLSSYADDPEAAAKSLEPLLLEAEGVVPTELQPDTPLELG  393
             +NLDLLP+G+ +E FL++ PGLS+Y  DP  AA SL  LL +AE  VP EL+P TP+ +G
Sbjct  91    KNLDLLPLGNELELFLQLKPGLSAYPTDPRQAANSLVSLLDKAESSVPRELRPKTPVRVG  150

Query  394   ATAGLRLLEGDASDKILQAVRDMFKNESNFKSKAEWVSILEGSQEGTYFWVAMNYLLGNL  573
             ATAGLR L  +AS+ ILQAV+++ ++ S  K++A  V++L+G+QEG+Y WV +NYLL NL
Sbjct  151   ATAGLRTLGHEASENILQAVKELLRDRSMLKTEANAVTVLDGTQEGSYQWVTINYLLRNL  210

Query  574   GKGYQNTIATIDLGGGSVQVSYAVSGDTFANAPKPHNGEEPYVQEKYILGAQYYLYVHSY  753
             GK Y +T+  +DLGGGSVQ++YA+S +  A+APKP  GE+ YV+E Y+ G +Y+LYVHSY
Sbjct  211   GKPYSDTVGVVDLGGGSVQMAYAISEEDAASAPKPLEGEDAYVREMYLKGRKYFLYVHSY  270

Query  754   LNYGQLASRAEIFKASGNSTNPCVLEGYDGYYTYNDVSYKVTAPPNGSSLKNCRKL---A  924
             L+YG LA+RAEI K S +S+NPC++ G+DG Y Y     K  A  +G+SL  CR+L   A
Sbjct  271   LHYGLLAARAEILKVSEDSSNPCIVTGHDGTYKYGGEELKAAALQSGASLDECRRLTINA  330

Query  925   RKVVDFRAPCKYPNCTFNGVWSGGGGAGMENVDISSYFYDIAIDVGIIDEGKASKIVKPR  1104
              KV D    C +  CTF GVW+GG G G +N+ ++S+F+D A + G +D  +    V+P 
Sbjct  331   LKVND--TLCTHMKCTFGGVWNGGRGGGQKNMFVASFFFDRAAEAGFVDPKQPVATVRPI  388

Query  1105  SFLVAAKLACETKFEDVKSTFPNAVEKDYPYLCMDLVYQYTLLVDGLGLHPYKEITLMKK  1284
              F  AAK AC  K E  KS FP   E + PYLCMDLVYQ+TLLVDG GL P + ITL+KK
Sbjct  389   DFEKAAKKACSMKMEAGKSKFPRVEEDNLPYLCMDLVYQHTLLVDGFGLKPTQTITLVKK  448

Query  1285  VEYKNYMVEAAWPLGCAIDVISS  1353
             V+Y  + VEAAWPLG AI+ +SS
Sbjct  449   VKYGEHAVEAAWPLGSAIEAVSS  471



>ref|XP_006408225.1| hypothetical protein EUTSA_v10020649mg [Eutrema salsugineum]
 gb|ESQ49678.1| hypothetical protein EUTSA_v10020649mg [Eutrema salsugineum]
Length=472

 Score =   432 bits (1112),  Expect = 6e-143, Method: Compositional matrix adjust.
 Identities = 230/463 (50%), Positives = 313/463 (68%), Gaps = 19/463 (4%)
 Frame = +1

Query  22    KHNTMKHTSHHH---LVFISL-------ALLLFPLACFSRSHLRRVLLNHEAG-------  150
             +H ++    H H   L+ IS+        LLL P    S S +    L + AG       
Sbjct  9     RHESLADKIHRHRGVLLLISIPIVLITLVLLLMPGTSTSVSVIEEYTLKNRAGGSNSRGP  68

Query  151   -NYAVIFDAGSTGSRVHVFHFDENLDLLPVGDGVEFFLKITPGLSSYADDPEAAAKSLEP  327
              NYAVIFDAGS+GSRVHV+ FD+NLDL+P+G+ +E F+++ PGLS+Y +DP  +A SL  
Sbjct  69    KNYAVIFDAGSSGSRVHVYCFDQNLDLVPLGNELELFIQLKPGLSAYPNDPRQSANSLVS  128

Query  328   LLLEAEGVVPTELQPDTPLELGATAGLRLLEGDASDKILQAVRDMFKNESNFKSKAEWVS  507
             LL +AE  VP EL+P+TP+ +GATAGLR L   AS+ ILQAVR++ K+ S  K++A  V+
Sbjct  129   LLDKAEASVPRELRPNTPVRVGATAGLRALGHKASENILQAVRELLKDRSRLKTEANAVT  188

Query  508   ILEGSQEGTYFWVAMNYLLGNLGKGYQNTIATIDLGGGSVQVSYAVSGDTFANAPKPHNG  687
             +L+G+QEG+Y WV +NYLL  LGK Y +T+  +DLGGGSVQ++YA+S +  A APKP  G
Sbjct  189   VLDGTQEGSYQWVTINYLLRTLGKPYSDTVGVVDLGGGSVQMAYAISEEDAATAPKPLEG  248

Query  688   EEPYVQEKYILGAQYYLYVHSYLNYGQLASRAEIFKASGNSTNPCVLEGYDGYYTYNDVS  867
             E+ YV+E Y+ G +Y+LYVHSYL+YG LA+RAEI K S  S NPC++ GYDG Y Y   +
Sbjct  249   EDSYVREMYLKGRKYFLYVHSYLHYGLLAARAEILKVSEGSNNPCIVTGYDGTYKYGGKA  308

Query  868   YKVTAPPNGSSLKNCRKLARKVVDFR-APCKYPNCTFNGVWSGGGGAGMENVDISSYFYD  1044
             ++  A P+G+SL  CR++A   +    + C +  CTF GVW+GGGG G +N+ ++S+F+D
Sbjct  309   FRAAASPSGASLDECRRVALNALKVNDSLCTHMKCTFGGVWNGGGGGGQKNMFVASFFFD  368

Query  1045  IAIDVGIIDEGKASKIVKPRSFLVAAKLACETKFEDVKSTFPNAVEKDYPYLCMDLVYQY  1224
              A + G +D  +   IV P  F  AA  AC  K  + K+ FP   E + PYLC+DLVYQY
Sbjct  369   RAAEAGFVDPTQPVAIVHPVDFEKAANQACNMKMGEGKTKFPRVEEDNLPYLCLDLVYQY  428

Query  1225  TLLVDGLGLHPYKEITLMKKVEYKNYMVEAAWPLGCAIDVISS  1353
             TLLVDG GL P + ITL+KKV+Y +Y VEAAWPLG AI+ +SS
Sbjct  429   TLLVDGFGLKPSQTITLVKKVKYGDYAVEAAWPLGSAIEAVSS  471



>dbj|BAB40231.1| S-type apyrase, partial [Pisum sativum]
Length=407

 Score =   430 bits (1105),  Expect = 7e-143, Method: Compositional matrix adjust.
 Identities = 218/396 (55%), Positives = 289/396 (73%), Gaps = 1/396 (0%)
 Frame = +1

Query  169   DAGSTGSRVHVFHFDENLDLLPVGDGVEFFLKITPGLSSYADDPEAAAKSLEPLLLEAEG  348
             DAGSTGSR+HV+HF++NLDLL +G GVE++ KITPGLSSYA++PE AAKSL PLL +AE 
Sbjct  1     DAGSTGSRIHVYHFNQNLDLLHIGKGVEYYNKITPGLSSYANNPEQAAKSLIPLLEQAED  60

Query  349   VVPTELQPDTPLELGATAGLRLLEGDASDKILQAVRDMFKNESNFKSKAEWVSILEGSQE  528
             VVP +LQP TP+ LGATAGLRLL GDAS+KILQ+VRDM  N S F  + + VSI++G+QE
Sbjct  61    VVPDDLQPKTPVRLGATAGLRLLNGDASEKILQSVRDMLSNRSTFNVQPDAVSIIDGTQE  120

Query  529   GTYFWVAMNYLLGNLGKGYQNTIATIDLGGGSVQVSYAVSGDTFANAPKPHNGEEPYVQE  708
             G+Y WV +NY LGNLGK Y  T+  IDLGGGSVQ++YAVS  T  NAPK  +G++PY+++
Sbjct  121   GSYLWVTVNYALGNLGKKYTKTVGVIDLGGGSVQMAYAVSKKTAKNAPKVADGDDPYIKK  180

Query  709   KYILGAQYYLYVHSYLNYGQLASRAEIFKASGNSTNPCVLEGYDGYYTYNDVSYKVTAPP  888
               + G  Y LYVHSYL++G+ ASRAEI K +  S NPC+L G++G YTY+   +K TA  
Sbjct  181   VVLKGIPYDLYVHSYLHFGREASRAEILKLTPRSPNPCLLAGFNGIYTYSGEEFKATAYT  240

Query  889   NGSSLKNCRKLARKVVDFRAPCKYPNCTFNGVWSGGGGAGMENVDISSYFYDIAIDVGII  1068
             +G++   C+   RK +    PC Y NCTF G+W+GGGG G +N+  SS F+ +  D G++
Sbjct  241   SGANFNKCKNTIRKALKLNYPCPYQNCTFGGIWNGGGGNGQKNLFASSSFFYLPEDTGMV  300

Query  1069  DEGKASKIVKPRSFLVAAKLACETKFEDVKSTFPNAVEKDY-PYLCMDLVYQYTLLVDGL  1245
             D    + I++P      AK AC   FED KST+P   +K+   Y+CMDL+YQY LLVDG 
Sbjct  301   DASTPNFILRPVDIETKAKEACALNFEDAKSTYPFLDKKNVASYVCMDLIYQYVLLVDGF  360

Query  1246  GLHPYKEITLMKKVEYKNYMVEAAWPLGCAIDVISS  1353
             GL P ++IT  K++EY++ +VEAAWPLG A++ IS+
Sbjct  361   GLDPLQKITSGKEIEYQDAIVEAAWPLGNAVEAISA  396



>ref|XP_002325396.2| putative apyrase family protein [Populus trichocarpa]
 gb|EEE99777.2| putative apyrase family protein [Populus trichocarpa]
Length=474

 Score =   432 bits (1110),  Expect = 1e-142, Method: Compositional matrix adjust.
 Identities = 220/414 (53%), Positives = 298/414 (72%), Gaps = 7/414 (2%)
 Frame = +1

Query  133   LNHEAGNYAVIFDAGSTGSRVHVFHFDENLDLLPVGDGVEFFLKITPGLSSYADDPEAAA  312
             L  ++ +YAVIFDAGS+GSRVHVF FD NLDL+P+G  +E F+++ PGLS+YA++P+ AA
Sbjct  59    LVRDSRSYAVIFDAGSSGSRVHVFCFDRNLDLVPIGKELELFVQLKPGLSAYANNPQEAA  118

Query  313   KSLEPLLLEAEGVVPTELQPDTPLELGATAGLRLLEGDASDKILQA------VRDMFKNE  474
             KSL  LL +AE  VP EL+P TP+ +GATAGLR L  +ASD+ILQA      VRD  + +
Sbjct  119   KSLASLLDKAESSVPKELRPKTPVRVGATAGLRALGMEASDRILQAASPYLIVRDFLRAK  178

Query  475   SNFKSKAEWVSILEGSQEGTYFWVAMNYLLGNLGKGYQNTIATIDLGGGSVQVSYAVSGD  654
             S  KS+A  V++L+GSQEG+Y WV +NYLLGNLGK Y NT+  +DLGGGSVQ++YA+S  
Sbjct  179   STLKSEANGVTVLDGSQEGSYQWVTINYLLGNLGKKYSNTVGVVDLGGGSVQMAYAISEM  238

Query  655   TFANAPKPHNGEEPYVQEKYILGAQYYLYVHSYLNYGQLASRAEIFKASGNSTNPCVLEG  834
               A AP+  +GE+ YV+E +++G +YYLYVHSYL+YG LA+RAEI  AS  S+NPC+L G
Sbjct  239   DAAKAPRISDGEDTYVKEMFLMGTKYYLYVHSYLHYGLLAARAEILDASEESSNPCILGG  298

Query  835   YDGYYTYNDVSYKVTAPPNGSSLKNCRKLARKVVDF-RAPCKYPNCTFNGVWSGGGGAGM  1011
             YDG Y Y    +K +A P+GS+L  CR++A   +    + C    CTF GVW+GGGG G 
Sbjct  299   YDGVYNYGGKDHKASASPSGSNLDECRRVALNALKVNESTCTNMKCTFGGVWNGGGGDGQ  358

Query  1012  ENVDISSYFYDIAIDVGIIDEGKASKIVKPRSFLVAAKLACETKFEDVKSTFPNAVEKDY  1191
             +N+ ++S+F+D A   G +D       V+P  F  AAK AC TK E+ KS + +  E D 
Sbjct  359   KNMFVASFFFDRAAQAGFVDSTLPVVKVRPVDFEHAAKRACGTKLENAKSIYHSLDENDL  418

Query  1192  PYLCMDLVYQYTLLVDGLGLHPYKEITLMKKVEYKNYMVEAAWPLGCAIDVISS  1353
             PY+CMDLVYQYTLLV+G  + P +++ L+KKV+Y++ +VEAAWPLG AI+ +SS
Sbjct  419   PYICMDLVYQYTLLVEGFAMDPLQDMMLVKKVQYRDSLVEAAWPLGSAIEAVSS  472



>ref|XP_003518188.1| PREDICTED: apyrase 1-like [Glycine max]
Length=472

 Score =   432 bits (1110),  Expect = 1e-142, Method: Compositional matrix adjust.
 Identities = 216/412 (52%), Positives = 295/412 (72%), Gaps = 1/412 (0%)
 Frame = +1

Query  124   RVLLNHEAGNYAVIFDAGSTGSRVHVFHFDENLDLLPVGDGVEFFLKITPGLSSYADDPE  303
             R + N  + ++AVIFDAGS+GSRVHVF FD NLDL+ +G  +E F++I PGLS+YA +P 
Sbjct  61    RKVGNERSTSFAVIFDAGSSGSRVHVFRFDRNLDLVHIGKDLELFVQIKPGLSAYAQNPR  120

Query  304   AAAKSLEPLLLEAEGVVPTELQPDTPLELGATAGLRLLEGDASDKILQAVRDMFKNESNF  483
              AA+SL  LL +AE VVP E +P TP+ +GATAGLR LEGDAS +ILQAVRD+ K  S  
Sbjct  121   QAAESLISLLDKAESVVPREFRPKTPVRVGATAGLRALEGDASGRILQAVRDLLKQRSTL  180

Query  484   KSKAEWVSILEGSQEGTYFWVAMNYLLGNLGKGYQNTIATIDLGGGSVQVSYAVSGDTFA  663
             KS+ + V++L+G+QEG + WV +NYLLG LGK +  T+  +DLGGGSVQ++YA+S    A
Sbjct  181   KSEPDAVTVLDGTQEGAFQWVTINYLLGKLGKDFSETVGVVDLGGGSVQMAYAISETDAA  240

Query  664   NAPKPHNGEEPYVQEKYILGAQYYLYVHSYLNYGQLASRAEIFKASGNSTNPCVLEGYDG  843
              APK   GE+PYV+E ++ G +YYLYVHSYL YG LA+RA+I + S +S NPC+L G++G
Sbjct  241   KAPKLSVGEDPYVKEMFLRGRKYYLYVHSYLGYGLLAARAKILEVSDDSGNPCILNGFNG  300

Query  844   YYTYNDVSYKVTAPPNGSSLKNCRKLARKVVDF-RAPCKYPNCTFNGVWSGGGGAGMENV  1020
              Y Y   S K ++ P+G+SL  C+ +A + +    + C +  CTF G+W+GGGG G +N+
Sbjct  301   SYIYGGKSVKASSAPSGASLNECKNIAFQALKVNESKCTHMKCTFGGIWNGGGGDGQKNL  360

Query  1021  DISSYFYDIAIDVGIIDEGKASKIVKPRSFLVAAKLACETKFEDVKSTFPNAVEKDYPYL  1200
              ++S+F+D A + G  +       V+P  F  AAK AC+TK ED KST+    E + PYL
Sbjct  361   FVASFFFDRAAEAGFANPNLPVVKVRPVDFEAAAKQACKTKLEDAKSTYQRVEEGNLPYL  420

Query  1201  CMDLVYQYTLLVDGLGLHPYKEITLMKKVEYKNYMVEAAWPLGCAIDVISSS  1356
             CMDL+YQYTLLV G GL P+++ITL+KKV+Y +  VEAAWPLG AI+ +SS+
Sbjct  421   CMDLLYQYTLLVVGFGLDPWQQITLVKKVKYHDAFVEAAWPLGSAIEAVSST  472



>gb|AAF66599.1|AF141671_1 apyrase [Arabidopsis thaliana]
Length=472

 Score =   432 bits (1110),  Expect = 1e-142, Method: Compositional matrix adjust.
 Identities = 220/404 (54%), Positives = 292/404 (72%), Gaps = 5/404 (1%)
 Frame = +1

Query  151   NYAVIFDAGSTGSRVHVFHFDENLDLLPVGDGVEFFLKITPGLSSYADDPEAAAKSLEPL  330
             NYAVIFDAGS+GSRVHV+ FD+NLDL+P+G+ +E FL++ PGLS+Y  DP  AA SL  L
Sbjct  70    NYAVIFDAGSSGSRVHVYCFDQNLDLIPLGNELELFLQLKPGLSAYPTDPRQAANSLVSL  129

Query  331   LLEAEGVVPTELQPDTPLELGATAGLRLLEGDASDKILQAVRDMFKNESNFKSKAEWVSI  510
             L +AE  VP EL+P T + +G TAGLR L  DAS+ ILQAVR++ ++ S  K++A  V++
Sbjct  130   LDKAEASVPRELRPKTHVRVGVTAGLRTLGHDASENILQAVRELLRDRSMLKTEANAVTV  189

Query  511   LEGSQEGTYFWVAMNYLLGNLGKGYQNTIATIDLGGGSVQVSYAVSGDTFANAPKPHNGE  690
             L+G+QEG+Y WV +NYLL NLGK Y +T+  +DLGGGSVQ++YA+S +  A+APKP  GE
Sbjct  190   LDGTQEGSYQWVTINYLLRNLGKPYSDTVGVVDLGGGSVQMAYAISEEDAASAPKPLEGE  249

Query  691   EPYVQEKYILGAQYYLYVHSYLNYGQLASRAEIFKASGNSTNPCVLEGYDGYYTYNDVSY  870
             + YV+E Y+ G +Y+LYVHSYL+YG LA+RAEI K S +S NPC++ GYDG Y Y    +
Sbjct  250   DSYVREMYLKGRKYFLYVHSYLHYGLLAARAEILKVSEDSENPCIVAGYDGTYKYGGKEF  309

Query  871   KVTAPPNGSSLKNCRKL---ARKVVDFRAPCKYPNCTFNGVWSGGGGAGMENVDISSYFY  1041
             K  A  +G+SL  CR++   A KV D    C +  CTF GVW+GG G G +N+ ++S+F+
Sbjct  310   KAPASQSGASLDECRRITINALKVND--TLCTHMKCTFGGVWNGGRGGGQKNMFVASFFF  367

Query  1042  DIAIDVGIIDEGKASKIVKPRSFLVAAKLACETKFEDVKSTFPNAVEKDYPYLCMDLVYQ  1221
             D A + G +D  +    V+P  F  AAK AC  K E+ KSTFP   E++ PYLCMDLVYQ
Sbjct  368   DRAAEAGFVDPKQPVATVRPMDFEKAAKKACSMKLEEGKSTFPLVEEENLPYLCMDLVYQ  427

Query  1222  YTLLVDGLGLHPYKEITLMKKVEYKNYMVEAAWPLGCAIDVISS  1353
             YTLL+DG GL P + ITL+KKV+Y +  VEAAWPLG AI+ +SS
Sbjct  428   YTLLIDGFGLEPSQTITLVKKVKYGDQAVEAAWPLGSAIEAVSS  471



>gb|KFK37843.1| hypothetical protein AALP_AA3G036300 [Arabis alpina]
Length=468

 Score =   431 bits (1107),  Expect = 3e-142, Method: Compositional matrix adjust.
 Identities = 231/459 (50%), Positives = 308/459 (67%), Gaps = 15/459 (3%)
 Frame = +1

Query  22    KHNTMKHTSHHH---LVFISL-------ALLLFPLACFSRSHLRRVLLNHEAG----NYA  159
             +H ++    H H   L+ IS+        LLL P    S S +   L N E      NYA
Sbjct  9     RHESLSDKIHRHRGLLLVISIPIVLIALVLLLMPGTSTSVSVVEYTLKNRENSRGPKNYA  68

Query  160   VIFDAGSTGSRVHVFHFDENLDLLPVGDGVEFFLKITPGLSSYADDPEAAAKSLEPLLLE  339
             VIFDAGS+GSRVHV+ FD+NLDL+P+G+ +E FL++ PGLS+Y +DP  +A SL  LL +
Sbjct  69    VIFDAGSSGSRVHVYCFDQNLDLVPLGNELELFLQLKPGLSAYPNDPRQSANSLVSLLDK  128

Query  340   AEGVVPTELQPDTPLELGATAGLRLLEGDASDKILQAVRDMFKNESNFKSKAEWVSILEG  519
             AE  VP EL+  TP+ +GATAGLR L    S+ ILQAVR++ K+ S  +++   V +L+G
Sbjct  129   AESSVPRELRTKTPVRVGATAGLRALGHKTSENILQAVRELLKDRSRLRTEENAVIVLDG  188

Query  520   SQEGTYFWVAMNYLLGNLGKGYQNTIATIDLGGGSVQVSYAVSGDTFANAPKPHNGEEPY  699
             +QEG+Y WV +NYLL  LGK Y  T+  +DLGGGSVQ++YA+S +  A APKP  GE+ Y
Sbjct  189   TQEGSYQWVTINYLLKTLGKPYSETVGVVDLGGGSVQMAYAISEEEAATAPKPSEGEDSY  248

Query  700   VQEKYILGAQYYLYVHSYLNYGQLASRAEIFKASGNSTNPCVLEGYDGYYTYNDVSYKVT  879
             V+E Y+ G +Y+LYVHSYL+YG LA+RAEI + S  S NPCV+ GYDG Y Y   ++K T
Sbjct  249   VKEMYLKGRKYFLYVHSYLHYGLLAARAEILQVSDVSNNPCVVSGYDGTYKYGGKAFKAT  308

Query  880   APPNGSSLKNCRKLARKVVDF-RAPCKYPNCTFNGVWSGGGGAGMENVDISSYFYDIAID  1056
             A P+G+SL  CR++A   +    + C +  CTF GVW+GGGG G +N+ ++S+F+D A +
Sbjct  309   ASPSGASLDECRRVAINALKVNNSVCTHMKCTFGGVWNGGGGGGQKNMFVASFFFDRAAE  368

Query  1057  VGIIDEGKASKIVKPRSFLVAAKLACETKFEDVKSTFPNAVEKDYPYLCMDLVYQYTLLV  1236
              G +D  +    VKP  F  AA  AC  K E+ KS FP   E + PYLC+DLVYQYTLLV
Sbjct  369   AGFVDPEQPVATVKPLDFEKAANKACSMKLEEGKSKFPRVEEDNLPYLCLDLVYQYTLLV  428

Query  1237  DGLGLHPYKEITLMKKVEYKNYMVEAAWPLGCAIDVISS  1353
             DG GL P + ITL+KKV+Y +Y VEAAWPLG AI+ +SS
Sbjct  429   DGFGLKPSQTITLVKKVKYGDYAVEAAWPLGSAIEAVSS  467



>ref|XP_006400376.1| hypothetical protein EUTSA_v10013440mg [Eutrema salsugineum]
 gb|ESQ41829.1| hypothetical protein EUTSA_v10013440mg [Eutrema salsugineum]
Length=472

 Score =   431 bits (1107),  Expect = 4e-142, Method: Compositional matrix adjust.
 Identities = 219/404 (54%), Positives = 292/404 (72%), Gaps = 5/404 (1%)
 Frame = +1

Query  151   NYAVIFDAGSTGSRVHVFHFDENLDLLPVGDGVEFFLKITPGLSSYADDPEAAAKSLEPL  330
             NYAVIFDAGS+GSRVHV+ FD+NLDLLP+G+ +E FL++ PGLS+Y  DP  AA SL  L
Sbjct  70    NYAVIFDAGSSGSRVHVYCFDQNLDLLPLGNELELFLQLKPGLSAYPTDPRQAANSLVSL  129

Query  331   LLEAEGVVPTELQPDTPLELGATAGLRLLEGDASDKILQAVRDMFKNESNFKSKAEWVSI  510
             L +AE  VP EL+P T + +GATAGLR L  +AS+ ILQAVR++ ++ S  K++A  V++
Sbjct  130   LDKAEASVPRELRPKTHVRVGATAGLRTLGHEASENILQAVRELLRDRSMLKTEANAVTV  189

Query  511   LEGSQEGTYFWVAMNYLLGNLGKGYQNTIATIDLGGGSVQVSYAVSGDTFANAPKPHNGE  690
             L+G+QEG+Y WV +NYLL NLGK Y +T+  +DLGGGSVQ++YA+S +  A+APKP  GE
Sbjct  190   LDGTQEGSYQWVTINYLLRNLGKPYSDTVGVVDLGGGSVQMAYAISEEDAASAPKPSEGE  249

Query  691   EPYVQEKYILGAQYYLYVHSYLNYGQLASRAEIFKASGNSTNPCVLEGYDGYYTYNDVSY  870
             + YV+E Y+ G +Y+LYVHSYL+YG LA+RAEI K S +S NPC++ GYDG Y Y    +
Sbjct  250   DTYVREMYLKGRKYFLYVHSYLHYGLLAARAEILKVSDDSNNPCIVTGYDGTYKYGGEGF  309

Query  871   KVTAPPNGSSLKNCRKL---ARKVVDFRAPCKYPNCTFNGVWSGGGGAGMENVDISSYFY  1041
             K     +G S+  CR+L   A KV D    C +  CTF GVW+GG G G +N+ ++S+F+
Sbjct  310   KAAGSQSGGSVDECRRLTLNALKVND--TLCTHMKCTFGGVWNGGRGGGQKNMFVASFFF  367

Query  1042  DIAIDVGIIDEGKASKIVKPRSFLVAAKLACETKFEDVKSTFPNAVEKDYPYLCMDLVYQ  1221
             D A + G +D  +    V+P  F  AAK AC  K E+ KS FP   E++ PYLCMDLVYQ
Sbjct  368   DRAAEAGFVDPKQPVATVRPIEFEKAAKKACSMKLEEGKSKFPRVEEENLPYLCMDLVYQ  427

Query  1222  YTLLVDGLGLHPYKEITLMKKVEYKNYMVEAAWPLGCAIDVISS  1353
             YTLL+DG GL P ++ITL+KKV+Y ++ VEAAWPLG AI+ +SS
Sbjct  428   YTLLIDGFGLVPSQKITLVKKVKYGDHAVEAAWPLGSAIEAVSS  471



>ref|XP_010463882.1| PREDICTED: apyrase 1 [Camelina sativa]
Length=471

 Score =   430 bits (1105),  Expect = 5e-142, Method: Compositional matrix adjust.
 Identities = 229/462 (50%), Positives = 313/462 (68%), Gaps = 18/462 (4%)
 Frame = +1

Query  22    KHNTMKHTSHHH---LVFISL-------ALLLFPLACFSRSHLRRVLLNHEAG-------  150
             +H ++    H H   L+ IS+        LLL P +  S S +   + +HE G       
Sbjct  9     RHESLADKIHRHRGLLLVISIPIVLIALVLLLMPGSSTSVSVIEYTMKSHEGGSNSRGPK  68

Query  151   NYAVIFDAGSTGSRVHVFHFDENLDLLPVGDGVEFFLKITPGLSSYADDPEAAAKSLEPL  330
             NYAVIFDAGS+GSRVHV+ FD+NLDL+P+ + +E FL++ PGLS+Y +DP  +A SL  L
Sbjct  69    NYAVIFDAGSSGSRVHVYCFDQNLDLVPLENELELFLQLKPGLSAYPNDPRQSANSLVSL  128

Query  331   LLEAEGVVPTELQPDTPLELGATAGLRLLEGDASDKILQAVRDMFKNESNFKSKAEWVSI  510
             L +AE  VP EL+P TP+ +GATAGLR L   AS+ ILQAVR++ K+ S  K++A  V++
Sbjct  129   LDKAEASVPRELRPKTPVRVGATAGLRALGHKASENILQAVRELLKDRSRLKTEANAVTV  188

Query  511   LEGSQEGTYFWVAMNYLLGNLGKGYQNTIATIDLGGGSVQVSYAVSGDTFANAPKPHNGE  690
             L+G+QEG+Y WV +NYLL  LGK Y +T+  +DLGGGSVQ++YA+S +  A APKP  GE
Sbjct  189   LDGTQEGSYQWVTINYLLRTLGKPYSDTVGVVDLGGGSVQMAYAISEEDAATAPKPLEGE  248

Query  691   EPYVQEKYILGAQYYLYVHSYLNYGQLASRAEIFKASGNSTNPCVLEGYDGYYTYNDVSY  870
             + YV+E Y+ G +Y+LYVHSYL+YG LA+RAEI K S +S NPC++ GY G Y Y   ++
Sbjct  249   DSYVREMYLKGRKYFLYVHSYLHYGLLAARAEILKVSEDSNNPCIVTGYTGTYKYGGKAF  308

Query  871   KVTAPPNGSSLKNCRKLARKVVDFR-APCKYPNCTFNGVWSGGGGAGMENVDISSYFYDI  1047
             K TA  +G+SL  CR++A   +    + C +  CTF GVW+GGGG G + + ++S+F+D 
Sbjct  309   KATASSSGTSLDECRRVAINALKVNDSLCTHMKCTFGGVWNGGGGGGQKKMFVASFFFDR  368

Query  1048  AIDVGIIDEGKASKIVKPRSFLVAAKLACETKFEDVKSTFPNAVEKDYPYLCMDLVYQYT  1227
             A + G +D  +    V+P  F  AA  AC  + E+ KS FP   E + PYLC+DLVYQYT
Sbjct  369   AAEAGFVDPKQPVAEVRPLDFEKAANKACNMRMEEGKSKFPRVEEDNLPYLCLDLVYQYT  428

Query  1228  LLVDGLGLHPYKEITLMKKVEYKNYMVEAAWPLGCAIDVISS  1353
             LLVDG GL P + ITL+KKV+Y +Y VEAAWPLG AI+ +SS
Sbjct  429   LLVDGFGLKPSQTITLVKKVKYGDYAVEAAWPLGSAIEAVSS  470



>ref|XP_010922865.1| PREDICTED: probable apyrase 2 [Elaeis guineensis]
Length=458

 Score =   429 bits (1103),  Expect = 9e-142, Method: Compositional matrix adjust.
 Identities = 226/406 (56%), Positives = 289/406 (71%), Gaps = 0/406 (0%)
 Frame = +1

Query  142   EAGNYAVIFDAGSTGSRVHVFHFDENLDLLPVGDGVEFFLKITPGLSSYADDPEAAAKSL  321
             E   YAVIFDAGSTGSRVHVF FD+N+DL+ +GD +E F+ + PGLSSY DDP+ AA SL
Sbjct  38    ETETYAVIFDAGSTGSRVHVFRFDQNMDLVNIGDDIELFVAVKPGLSSYDDDPQEAANSL  97

Query  322   EPLLLEAEGVVPTELQPDTPLELGATAGLRLLEGDASDKILQAVRDMFKNESNFKSKAEW  501
              PLL EAEGV+P ELQP TP+ LGATAGLR+L  + S+KIL+AVRD+F+  S+ + K+EW
Sbjct  98    IPLLEEAEGVIPEELQPTTPIRLGATAGLRILGEEKSEKILKAVRDLFQTNSSLEYKSEW  157

Query  502   VSILEGSQEGTYFWVAMNYLLGNLGKGYQNTIATIDLGGGSVQVSYAVSGDTFANAPKPH  681
             V++LEG QEG+Y WVAMNYLLGNLG  Y +T+  +DLGGGSVQ++YA+S +  ANAP   
Sbjct  158   VTVLEGYQEGSYLWVAMNYLLGNLGNKYSDTVGVVDLGGGSVQMAYALSKEAAANAPNIS  217

Query  682   NGEEPYVQEKYILGAQYYLYVHSYLNYGQLASRAEIFKASGNSTNPCVLEGYDGYYTYND  861
              G  PYV ++ +    YYLY +SYL+YG  A+RAEI +A     + CVL GY G Y Y+ 
Sbjct  218   IGNNPYVTKQLLNETNYYLYAYSYLHYGLFAARAEILEAVDGPYSYCVLGGYAGSYKYSG  277

Query  862   VSYKVTAPPNGSSLKNCRKLARKVVDFRAPCKYPNCTFNGVWSGGGGAGMENVDISSYFY  1041
               Y  +A P+GSS   CR  A K +     C Y +CTF GVWSGGGG G +N+ ++S FY
Sbjct  278   KVYNASASPSGSSYSKCRVEAIKALKINEICTYQDCTFGGVWSGGGGDGQKNLYVASSFY  337

Query  1042  DIAIDVGIIDEGKASKIVKPRSFLVAAKLACETKFEDVKSTFPNAVEKDYPYLCMDLVYQ  1221
               A +VG ID    + +V+P  F  AAK+AC++  E+   T+PN  E + PY+CMDLVY+
Sbjct  338   YTAAEVGFIDSETPNALVRPSDFKKAAKIACKSSLEEANVTYPNVTEDNLPYICMDLVYE  397

Query  1222  YTLLVDGLGLHPYKEITLMKKVEYKNYMVEAAWPLGCAIDVISSSS  1359
             YTLLVDG GL P +EITL+ KVEY +  V AAWPLG AI+V+SS S
Sbjct  398   YTLLVDGFGLKPTQEITLVTKVEYGDSYVNAAWPLGSAIEVVSSQS  443



>dbj|BAB87197.1| ATP diphosphohydrolase [Pisum sativum]
Length=455

 Score =   429 bits (1102),  Expect = 1e-141, Method: Compositional matrix adjust.
 Identities = 224/437 (51%), Positives = 302/437 (69%), Gaps = 10/437 (2%)
 Frame = +1

Query  73    LALLLFPLACFSRSHL--------RRVLLN-HEAGNYAVIFDAGSTGSRVHVFHFDENLD  225
             +  LLF +   + S          R++ L   E  +YAV+FDAGSTGSR+HV+HF++NLD
Sbjct  8     ITFLLFSMPAITSSQYLGNNLLTSRKIFLKLEEISSYAVVFDAGSTGSRIHVYHFNQNLD  67

Query  226   LLPVGDGVEFFLKITPGLSSYADDPEAAAKSLEPLLLEAEGVVPTELQPDTPLELGATAG  405
             LL +G GVE++ KITPGLSSYA++PE AAKSL PLL +AE VV   LQP TP+ LGATA 
Sbjct  68    LLHIGKGVEYYNKITPGLSSYANNPEQAAKSLIPLLEQAEDVVSPNLQPKTPVRLGATAV  127

Query  406   LRLLEGDASDKILQAVRDMFKNESNFKSKAEWVSILEGSQEGTYFWVAMNYLLGNLGKGY  585
             LRLL GDAS+KILQ+VR +  N S F  + E VSI++G+QEG+Y WV +NY LGNLGK Y
Sbjct  128   LRLLNGDASEKILQSVRGLLSNRSTFNVQPEAVSIIDGTQEGSYLWVTVNYALGNLGKKY  187

Query  586   QNTIATIDLGGGSVQVSYAVSGDTFANAPKPHNGEEPYVQEKYILGAQYYLYVHSYLNYG  765
               T+  IDLGGGSVQ++YAVS  T  NAPK  +G++PY+++  + G  Y LYVHSYL++G
Sbjct  188   TKTVGVIDLGGGSVQMAYAVSKKTAKNAPKVADGDDPYIKKGVLKGIPYDLYVHSYLHFG  247

Query  766   QLASRAEIFKASGNSTNPCVLEGYDGYYTYNDVSYKVTAPPNGSSLKNCRKLARKVVDFR  945
             + ASRAEI K +  S+NPC+L G++G YTY+   +K TA  +G++   C+   RK +   
Sbjct  248   REASRAEILKLTPRSSNPCLLAGFNGIYTYSGEEFKATAYTSGANFNKCKNTIRKALKLN  307

Query  946   APCKYPNCTFNGVWSGGGGAGMENVDISSYFYDIAIDVGIIDEGKASKIVKPRSFLVAAK  1125
              PC Y NCTF G+W+GGGG G +N+  SS F+ +  D G++D    + I++P      AK
Sbjct  308   YPCPYQNCTFGGIWNGGGGNGQKNLFASSSFFYLPEDTGMVDASTPNFILRPVDIETKAK  367

Query  1126  LACETKFEDVKSTFPNAVEKDY-PYLCMDLVYQYTLLVDGLGLHPYKEITLMKKVEYKNY  1302
               C   FED KST+P   +K+   Y+CMDL+YQY LLVDG GL P ++IT  K++EY++ 
Sbjct  368   GTCALNFEDAKSTYPFLDKKNVASYVCMDLIYQYVLLVDGFGLDPLQKITSGKEIEYQDA  427

Query  1303  MVEAAWPLGCAIDVISS  1353
             +VEAA PLG A++ IS+
Sbjct  428   IVEAALPLGNAVEAISA  444



>ref|NP_197329.4| apyrase 2 [Arabidopsis thaliana]
 gb|AED92532.1| apyrase 2 [Arabidopsis thaliana]
Length=578

 Score =   433 bits (1113),  Expect = 1e-141, Method: Compositional matrix adjust.
 Identities = 221/404 (55%), Positives = 293/404 (73%), Gaps = 5/404 (1%)
 Frame = +1

Query  151   NYAVIFDAGSTGSRVHVFHFDENLDLLPVGDGVEFFLKITPGLSSYADDPEAAAKSLEPL  330
             NYAVIFDAGS+GSRVHV+ FD+NLDL+P+G+ +E FL++ PGLS+Y  DP  AA SL  L
Sbjct  176   NYAVIFDAGSSGSRVHVYCFDQNLDLIPLGNELELFLQLKPGLSAYPTDPRQAANSLVSL  235

Query  331   LLEAEGVVPTELQPDTPLELGATAGLRLLEGDASDKILQAVRDMFKNESNFKSKAEWVSI  510
             L +AE  VP EL+P T + +GATAGLR L  DAS+ ILQAVR++ ++ S  K++A  V++
Sbjct  236   LDKAEASVPRELRPKTHVRVGATAGLRTLGHDASENILQAVRELLRDRSMLKTEANAVTV  295

Query  511   LEGSQEGTYFWVAMNYLLGNLGKGYQNTIATIDLGGGSVQVSYAVSGDTFANAPKPHNGE  690
             L+G+QEG+Y WV +NYLL NLGK Y +T+  +DLGGGSVQ++YA+S +  A+APKP  GE
Sbjct  296   LDGTQEGSYQWVTINYLLRNLGKPYSDTVGVVDLGGGSVQMAYAISEEDAASAPKPLEGE  355

Query  691   EPYVQEKYILGAQYYLYVHSYLNYGQLASRAEIFKASGNSTNPCVLEGYDGYYTYNDVSY  870
             + YV+E Y+ G +Y+LYVHSYL+YG LA+RAEI K S +S NPC++ GYDG Y Y    +
Sbjct  356   DSYVREMYLKGRKYFLYVHSYLHYGLLAARAEILKVSEDSENPCIVAGYDGMYKYGGKEF  415

Query  871   KVTAPPNGSSLKNCRKL---ARKVVDFRAPCKYPNCTFNGVWSGGGGAGMENVDISSYFY  1041
             K  A  +G+SL  CR++   A KV D    C +  CTF GVW+GG G G +N+ ++S+F+
Sbjct  416   KAPASQSGASLDECRRITINALKVND--TLCTHMKCTFGGVWNGGRGGGQKNMFVASFFF  473

Query  1042  DIAIDVGIIDEGKASKIVKPRSFLVAAKLACETKFEDVKSTFPNAVEKDYPYLCMDLVYQ  1221
             D A + G +D  +    V+P  F  AAK AC  K E+ KSTFP   E++ PYLCMDLVYQ
Sbjct  474   DRAAEAGFVDPKQPVATVRPMDFEKAAKKACSMKLEEGKSTFPLVEEENLPYLCMDLVYQ  533

Query  1222  YTLLVDGLGLHPYKEITLMKKVEYKNYMVEAAWPLGCAIDVISS  1353
             YTLL+DG GL P + ITL+KKV+Y +  VEAAWPLG AI+ +SS
Sbjct  534   YTLLIDGFGLEPSQTITLVKKVKYGDQAVEAAWPLGSAIEAVSS  577



>gb|EPS65035.1| apyrase-like protein, partial [Genlisea aurea]
Length=536

 Score =   431 bits (1109),  Expect = 1e-141, Method: Compositional matrix adjust.
 Identities = 236/481 (49%), Positives = 298/481 (62%), Gaps = 50/481 (10%)
 Frame = +1

Query  58    LVFISLALLLFPLACFSRSHLRRVLLNHEAGNYAVIFDAGSTGSRVHVFHFDENLDLLPV  237
              + IS  L L P A  S    RR+     +  YAV+FDAGS+GSRVHVF F+  LDL+P+
Sbjct  57    FLLISTVLYLMPAALHSELS-RRLSPEFGSRKYAVVFDAGSSGSRVHVFSFNRKLDLVPM  115

Query  238   GDGVEFFLKIT------------------------------------------------P  273
             G  +E F++++                                                P
Sbjct  116   GQDLELFVQVSLMASSALFLYFTSPFDNEGNGLCPFCRLECRIVFPPFYIFRCFVLQRKP  175

Query  274   GLSSYADDPEAAAKSLEPLLLEAEGVVPTELQPDTPLELGATAGLRLLEGDASDKILQAV  453
             GLS YA DPEAAA SL  LL +AE VVP ELQ  TP+++GATAGLR LEGD SD+IL  V
Sbjct  176   GLSGYAKDPEAAANSLSELLEQAEAVVPLELQSMTPVKVGATAGLRQLEGDTSDRILHEV  235

Query  454   RDMFKNESNFKSKAEWVSILEGSQEGTYFWVAMNYLLGNLGKGYQNTIATIDLGGGSVQV  633
             R   K +S  KS+AEWV++L+G+QEG Y WV +NYLLGNLGK Y  ++  +DLGGGSVQ+
Sbjct  236   RQFLKTKSKLKSQAEWVTVLDGNQEGAYQWVTINYLLGNLGKKYSESVGVVDLGGGSVQM  295

Query  634   SYAVSGDTFANAPKPHNGEEPYVQEKYILGAQYYLYVHSYLNYGQLASRAEIFKASGNST  813
             +YA+S    A APK     E YVQ   + G  Y LYVHSYL+YG LA+RAEI K S  S 
Sbjct  296   AYAISDSDAAKAPKLSGEGESYVQRMILKGTTYNLYVHSYLHYGLLAARAEILKTSEESG  355

Query  814   NPCVLEGYDGYYTYNDVSYKVTAPPNGSSLKNCRKLARKVVDFRAP-CKYPNCTFNGVWS  990
             NPC+L GYDG Y Y    YK  A P+GSSL  CR+ A K +    P C +  CTF GVW+
Sbjct  356   NPCILAGYDGSYKYGQAVYKAAALPSGSSLLKCREAAIKALKINEPACTHMKCTFGGVWN  415

Query  991   GGGGAGMENVDISSYFYDIAIDVGIIDEGKASKIVKPRSFLVAAKLACETKFEDVKSTFP  1170
             GGGG G +N+ ++S+F+D A + G++D   A   V+P  F  AAK AC+T+ ED  S +P
Sbjct  416   GGGGDGQKNLFVASFFFDRAAEAGLVDPSAAVAKVRPSDFEDAAKRACQTRIEDGNSAYP  475

Query  1171  NAVEKDYPYLCMDLVYQYTLLVDGLGLHPYKEITLMKKVEYKNYMVEAAWPLGCAIDVIS  1350
                  + PYLCMDLVYQ TLLVDG GL P++EITL+KKV+Y+N+ VEAAWPLG AI+ +S
Sbjct  476   QVEADNLPYLCMDLVYQLTLLVDGFGLDPWQEITLVKKVKYQNHFVEAAWPLGSAIEAVS  535

Query  1351  S  1353
             S
Sbjct  536   S  536



>ref|XP_004147528.1| PREDICTED: apyrase 2-like [Cucumis sativus]
Length=466

 Score =   429 bits (1102),  Expect = 1e-141, Method: Compositional matrix adjust.
 Identities = 219/401 (55%), Positives = 294/401 (73%), Gaps = 5/401 (1%)
 Frame = +1

Query  154   YAVIFDAGSTGSRVHVFHFDENLDLLPVGDGVEFFLKITPGLSSYADDPEAAAKSLEPLL  333
             +AVIFDAGS+GSRVHVF FD NLDLLPVG  +E FL++ PGLS+YAD P+ AA SL  LL
Sbjct  68    FAVIFDAGSSGSRVHVFCFDHNLDLLPVGKDIELFLQLKPGLSAYADSPKDAAASLISLL  127

Query  334   LEAEGVVPTELQPDTPLELGATAGLRLLEGDASDKILQAVRDMFKNESNFKSKAEWVSIL  513
              +A+ VVP  L+P TP+ +GATAGLR L+GDASD+ILQAVRD+ +++S  + + + VS++
Sbjct  128   DKAQDVVPKGLRPMTPVRVGATAGLRALKGDASDRILQAVRDLMRDKSELRLEGDAVSVI  187

Query  514   EGSQEGTYFWVAMNYLLGNLGKGYQNTIATIDLGGGSVQVSYAVSGDTFANAPKPHNGEE  693
             +G+QEG+Y WV +NYLLGNLGK Y +T+  +DLGGGSVQ++YA+S +   +A +    E 
Sbjct  188   DGTQEGSYLWVTLNYLLGNLGKKYSDTVGVVDLGGGSVQMAYAISEN---DAARLSEAEG  244

Query  694   PYVQEKYILGAQYYLYVHSYLNYGQLASRAEIFKASGNSTNPCVLEGYDGYYTYNDVSYK  873
              YV++ Y+ GA YYLYVHSYL+YG LA+RAE+   S +S+N C+L GY+G Y Y    YK
Sbjct  245   AYVKKMYLKGATYYLYVHSYLHYGLLAARAEVLSVSEDSSNDCILSGYEGEYHYGGKDYK  304

Query  874   VTAPPNGSSLKNCRKLARKVVDF-RAPCKYPNCTFNGVWSGGGGAGMENVDISSYFYDIA  1050
              +A  +GS+L  CR    K +    + C +  CTF GVW+GGGG G +N+ ++S+F+D A
Sbjct  305   ASASSSGSNLNGCRSTVLKALKVNESTCTHMKCTFGGVWNGGGGDGQKNLFVASFFFDRA  364

Query  1051  IDVGIIDEGKASKIVKPRSFLVAAKLACETKFEDVKSTFPNAVEKDYPYLCMDLVYQYTL  1230
              + G  D  +   IV+P  F  AAK AC+ K ED  ST+P+  + + PYLCMDLVYQYTL
Sbjct  365   AEAGFADPNEPVAIVRPADFNDAAKQACQIKVEDA-STYPHVEKDNLPYLCMDLVYQYTL  423

Query  1231  LVDGLGLHPYKEITLMKKVEYKNYMVEAAWPLGCAIDVISS  1353
             LVDG GL P++EITL+KKV+Y+N +VEAAWPLG AI+ +SS
Sbjct  424   LVDGFGLDPWQEITLVKKVKYQNSLVEAAWPLGSAIEAVSS  464



>gb|AAG22044.1|AF305783_1 apyrase 2 [Pisum sativum]
Length=447

 Score =   428 bits (1100),  Expect = 1e-141, Method: Compositional matrix adjust.
 Identities = 223/402 (55%), Positives = 292/402 (73%), Gaps = 1/402 (0%)
 Frame = +1

Query  151   NYAVIFDAGSTGSRVHVFHFDENLDLLPVGDGVEFFLKITPGLSSYADDPEAAAKSLEPL  330
             ++AVIFDAGS+GSRVHVF FD NLDL+ +G+ +E FL+I PGLS+YA DP  AA+SL  L
Sbjct  44    SFAVIFDAGSSGSRVHVFRFDRNLDLVHIGNDLEVFLQIKPGLSAYAQDPRQAAESLISL  103

Query  331   LLEAEGVVPTELQPDTPLELGATAGLRLLEGDASDKILQAVRDMFKNESNFKSKAEWVSI  510
             L +AE VVP E +P TP+ +GATAGLR LEGDASD+ILQAVRD+ K  S  KS+   V++
Sbjct  104   LDKAESVVPMEYRPMTPVRVGATAGLRALEGDASDRILQAVRDLLKQRSTLKSEPGAVAV  163

Query  511   LEGSQEGTYFWVAMNYLLGNLGKGYQNTIATIDLGGGSVQVSYAVSGDTFANAPKPHNGE  690
             L+G+QEG + WV +NYLLG LG+ Y +T+  +DLGGGSVQ++YA+S  +   APK  +GE
Sbjct  164   LDGTQEGAFQWVTINYLLGKLGRDYSDTVGVVDLGGGSVQMAYAISETSATKAPKVPDGE  223

Query  691   EPYVQEKYILGAQYYLYVHSYLNYGQLASRAEIFKASGNSTNPCVLEGYDGYYTYNDVSY  870
             +PYV+E ++ G +YYLYVHSYL YG LA+RAEI K S +S NPC+L GYDG Y Y   S+
Sbjct  224   DPYVKEMFLRGRKYYLYVHSYLRYGLLAARAEILKISDDSGNPCILAGYDGSYNYGGKSF  283

Query  871   KVTAPPNGSSLKNCRKLARKVVDF-RAPCKYPNCTFNGVWSGGGGAGMENVDISSYFYDI  1047
             K ++ P+GSSL  C+ +A K +    + C +  CTF G+W+GGGG G +N+   S+F+  
Sbjct  284   KASSSPSGSSLNECKGIALKTLKVNESICTHMKCTFGGIWNGGGGDGQKNLFARSFFFYR  343

Query  1048  AIDVGIIDEGKASKIVKPRSFLVAAKLACETKFEDVKSTFPNAVEKDYPYLCMDLVYQYT  1227
             A + G  D       V+P  F  AAKLAC+ K ED KST+PN  E + PYLCMDLVYQYT
Sbjct  344   AAEAGFADPKSPVAKVRPVDFEKAAKLACQPKLEDAKSTYPNVEEGNLPYLCMDLVYQYT  403

Query  1228  LLVDGLGLHPYKEITLMKKVEYKNYMVEAAWPLGCAIDVISS  1353
             LLV G GL   ++ITL+K+V+Y + +VEAAWPLG AI+ +SS
Sbjct  404   LLVFGFGLDQMQQITLVKQVKYHDSLVEAAWPLGSAIEAVSS  445



>ref|NP_187058.1| apyrase 1 [Arabidopsis thaliana]
 sp|Q9SQG2.1|APY1_ARATH RecName: Full=Apyrase 1; Short=AtAPY1; AltName: Full=ATP-diphosphatase; 
AltName: Full=ATP-diphosphohydrolase; AltName: Full=Adenosine 
diphosphatase; Short=ADPase; AltName: Full=NTPDase; 
AltName: Full=Nucleoside triphosphate diphosphohydrolase 
1 [Arabidopsis thaliana]
 gb|AAF00071.1|AF093604_1 apyrase [Arabidopsis thaliana]
 gb|AAF26805.1|AC016829_29 apyrase (Atapy1) [Arabidopsis thaliana]
 gb|ABJ17092.1| At3g04080 [Arabidopsis thaliana]
 gb|AEE74035.1| apyrase 1 [Arabidopsis thaliana]
 gb|AFI41199.1| apyrase 1, partial [Arabidopsis thaliana]
Length=471

 Score =   429 bits (1102),  Expect = 2e-141, Method: Compositional matrix adjust.
 Identities = 229/462 (50%), Positives = 309/462 (67%), Gaps = 18/462 (4%)
 Frame = +1

Query  22    KHNTMKHTSHHH---LVFISL-------ALLLFPLACFSRSHLRRVLLNHEAG-------  150
             +H ++    H H   L+ IS+        LLL P    S S +   + NHE G       
Sbjct  9     RHESLADKVHRHRGLLLVISIPIVLIALVLLLMPGTSTSVSVIEYTMKNHEGGSNSRGPK  68

Query  151   NYAVIFDAGSTGSRVHVFHFDENLDLLPVGDGVEFFLKITPGLSSYADDPEAAAKSLEPL  330
             NYAVIFDAGS+GSRVHV+ FD+NLDL+P+ + +E FL++ PGLS+Y +DP  +A SL  L
Sbjct  69    NYAVIFDAGSSGSRVHVYCFDQNLDLVPLENELELFLQLKPGLSAYPNDPRQSANSLVTL  128

Query  331   LLEAEGVVPTELQPDTPLELGATAGLRLLEGDASDKILQAVRDMFKNESNFKSKAEWVSI  510
             L +AE  VP EL+P TP+ +GATAGLR L   AS+ ILQAVR++ K  S  K++A  V++
Sbjct  129   LDKAEASVPRELRPKTPVRVGATAGLRALGHQASENILQAVRELLKGRSRLKTEANAVTV  188

Query  511   LEGSQEGTYFWVAMNYLLGNLGKGYQNTIATIDLGGGSVQVSYAVSGDTFANAPKPHNGE  690
             L+G+QEG+Y WV +NYLL  LGK Y +T+  +DLGGGSVQ++YA+  +  A APKP  GE
Sbjct  189   LDGTQEGSYQWVTINYLLRTLGKPYSDTVGVVDLGGGSVQMAYAIPEEDAATAPKPVEGE  248

Query  691   EPYVQEKYILGAQYYLYVHSYLNYGQLASRAEIFKASGNSTNPCVLEGYDGYYTYNDVSY  870
             + YV+E Y+ G +Y+LYVHSYL+YG LA+RAEI K S +S NPC+  GY G Y Y   ++
Sbjct  249   DSYVREMYLKGRKYFLYVHSYLHYGLLAARAEILKVSEDSNNPCIATGYAGTYKYGGKAF  308

Query  871   KVTAPPNGSSLKNCRKLARKVVDF-RAPCKYPNCTFNGVWSGGGGAGMENVDISSYFYDI  1047
             K  A P+G+SL  CR++A   +    + C +  CTF GVW+GGGG G + + ++S+F+D 
Sbjct  309   KAAASPSGASLDECRRVAINALKVNNSLCTHMKCTFGGVWNGGGGGGQKKMFVASFFFDR  368

Query  1048  AIDVGIIDEGKASKIVKPRSFLVAAKLACETKFEDVKSTFPNAVEKDYPYLCMDLVYQYT  1227
             A + G +D  +    V+P  F  AA  AC  + E+ KS FP   E + PYLC+DLVYQYT
Sbjct  369   AAEAGFVDPNQPVAEVRPLDFEKAANKACNMRMEEGKSKFPRVEEDNLPYLCLDLVYQYT  428

Query  1228  LLVDGLGLHPYKEITLMKKVEYKNYMVEAAWPLGCAIDVISS  1353
             LLVDG GL P + ITL+KKV+Y +Y VEAAWPLG AI+ +SS
Sbjct  429   LLVDGFGLKPSQTITLVKKVKYGDYAVEAAWPLGSAIEAVSS  470



>ref|XP_004172762.1| PREDICTED: apyrase 2-like [Cucumis sativus]
 gb|KGN53950.1| hypothetical protein Csa_4G192220 [Cucumis sativus]
Length=466

 Score =   429 bits (1102),  Expect = 2e-141, Method: Compositional matrix adjust.
 Identities = 219/401 (55%), Positives = 294/401 (73%), Gaps = 5/401 (1%)
 Frame = +1

Query  154   YAVIFDAGSTGSRVHVFHFDENLDLLPVGDGVEFFLKITPGLSSYADDPEAAAKSLEPLL  333
             +AVIFDAGS+GSRVHVF FD NLDLLPVG  +E FL++ PGLS+YAD P+ AA SL  LL
Sbjct  68    FAVIFDAGSSGSRVHVFCFDHNLDLLPVGKDIELFLQLKPGLSAYADSPKDAAASLISLL  127

Query  334   LEAEGVVPTELQPDTPLELGATAGLRLLEGDASDKILQAVRDMFKNESNFKSKAEWVSIL  513
              +A+ VVP  L+P TP+ +GATAGLR L+GDASD+ILQAVRD+ +++S  + + + VS++
Sbjct  128   DKAQDVVPKGLRPMTPVRVGATAGLRALKGDASDRILQAVRDLLRDKSELRLEGDAVSVI  187

Query  514   EGSQEGTYFWVAMNYLLGNLGKGYQNTIATIDLGGGSVQVSYAVSGDTFANAPKPHNGEE  693
             +G+QEG+Y WV +NYLLGNLGK Y +T+  +DLGGGSVQ++YA+S +   +A +    E 
Sbjct  188   DGTQEGSYLWVTLNYLLGNLGKKYSDTVGVVDLGGGSVQMAYAISEN---DAARLSEAEG  244

Query  694   PYVQEKYILGAQYYLYVHSYLNYGQLASRAEIFKASGNSTNPCVLEGYDGYYTYNDVSYK  873
              YV++ Y+ GA YYLYVHSYL+YG LA+RAE+   S +S+N C+L GY+G Y Y    YK
Sbjct  245   AYVKKMYLKGATYYLYVHSYLHYGLLAARAEVLSVSEDSSNDCILSGYEGEYHYGGKDYK  304

Query  874   VTAPPNGSSLKNCRKLARKVVDF-RAPCKYPNCTFNGVWSGGGGAGMENVDISSYFYDIA  1050
              +A  +GS+L  CR    K +    + C +  CTF GVW+GGGG G +N+ ++S+F+D A
Sbjct  305   ASASSSGSNLNGCRSTVLKALKVNESTCTHMKCTFGGVWNGGGGDGQKNLFVASFFFDRA  364

Query  1051  IDVGIIDEGKASKIVKPRSFLVAAKLACETKFEDVKSTFPNAVEKDYPYLCMDLVYQYTL  1230
              + G  D  +   IV+P  F  AAK AC+ K ED  ST+P+  + + PYLCMDLVYQYTL
Sbjct  365   AEAGFADPNEPVAIVRPADFNDAAKQACQIKVEDA-STYPHVEKDNLPYLCMDLVYQYTL  423

Query  1231  LVDGLGLHPYKEITLMKKVEYKNYMVEAAWPLGCAIDVISS  1353
             LVDG GL P++EITL+KKV+Y+N +VEAAWPLG AI+ +SS
Sbjct  424   LVDGFGLDPWQEITLVKKVKYQNSLVEAAWPLGSAIEAVSS  464



>ref|XP_009618558.1| PREDICTED: apyrase 1-like [Nicotiana tomentosiformis]
Length=477

 Score =   429 bits (1102),  Expect = 2e-141, Method: Compositional matrix adjust.
 Identities = 236/437 (54%), Positives = 313/437 (72%), Gaps = 5/437 (1%)
 Frame = +1

Query  58    LVFISLALLLFPLACFSRSH----LRRVLLNHEAGNYAVIFDAGSTGSRVHVFHFDENLD  225
             ++ I   L + P + +S S      R+      + NYAVIFDAGS+GSRVHVF FD +LD
Sbjct  39    VLLICFVLFIMPTSEYSESMGGSVNRKFSPKFGSRNYAVIFDAGSSGSRVHVFCFDHHLD  98

Query  226   LLPVGDGVEFFLKITPGLSSYADDPEAAAKSLEPLLLEAEGVVPTELQPDTPLELGATAG  405
             L+P+G+ +E F++  PGLS+YA DP AAAKSL+ LL +AE V+P +L+ +TP+ +GATAG
Sbjct  99    LVPIGNDLELFVQKKPGLSAYASDPAAAAKSLQSLLEKAEDVLPVDLRSNTPVRVGATAG  158

Query  406   LRLLEGDASDKILQAVRDMFKNESNFKSKAEWVSILEGSQEGTYFWVAMNYLLGNLGKGY  585
             LR L G+ASDKILQAVRD  K++S+ KSKA WV++L+G+QEG Y WV +NYLLGNLGK Y
Sbjct  159   LRQLGGNASDKILQAVRDFLKSKSSLKSKASWVTVLDGNQEGAYQWVTINYLLGNLGKKY  218

Query  586   QNTIATIDLGGGSVQVSYAVSGDTFANAPKPHNGEEPYVQEKYILGAQYYLYVHSYLNYG  765
              +T+  +DLGGGSVQ++YA+S      APK   GE+ YVQE Y+ GA+YYLYVHSYL+YG
Sbjct  219   SDTVGVVDLGGGSVQMAYAISEADAQKAPKLSGGEDTYVQEMYLKGAKYYLYVHSYLHYG  278

Query  766   QLASRAEIFKASGNSTNPCVLEGYDGYYTYNDVSYKVTAPPNGSSLKNCRKLARKVVDF-  942
              LA+RAEI K +  S +PC+L G+ G Y Y   +Y  +A   GSSL NCR +A K +   
Sbjct  279   LLAARAEILKVTKESGSPCILTGHHGSYKYGGKTYTASAMSQGSSLTNCRMVALKALKVN  338

Query  943   RAPCKYPNCTFNGVWSGGGGAGMENVDISSYFYDIAIDVGIIDEGKASKIVKPRSFLVAA  1122
              + C +  CTF GVW+GGGG G +N+ ++S+F+D A +VG +D   A   V+P  F  AA
Sbjct  339   ESACTHMKCTFGGVWNGGGGDGQKNMFVASFFFDRAAEVGFVDPNAAVAKVRPTDFESAA  398

Query  1123  KLACETKFEDVKSTFPNAVEKDYPYLCMDLVYQYTLLVDGLGLHPYKEITLMKKVEYKNY  1302
             + AC+T+ +D K+TFP     + P+LCMDLVYQYTLLVDG GL   +E+TL+KKV+YKN 
Sbjct  399   RRACDTRIDDAKATFPRVDPDNLPFLCMDLVYQYTLLVDGFGLDARQEMTLVKKVKYKNS  458

Query  1303  MVEAAWPLGCAIDVISS  1353
             +VEAAWPLG AI+V SS
Sbjct  459   LVEAAWPLGSAIEVASS  475



>ref|XP_010485779.1| PREDICTED: apyrase 1-like [Camelina sativa]
Length=471

 Score =   428 bits (1101),  Expect = 2e-141, Method: Compositional matrix adjust.
 Identities = 229/462 (50%), Positives = 313/462 (68%), Gaps = 18/462 (4%)
 Frame = +1

Query  22    KHNTMKHTSHHH---LVFISL-------ALLLFPLACFSRSHLRRVLLNHEAG-------  150
             +H ++    H H   L+ IS+        LLL P +  S S +   + +HE G       
Sbjct  9     RHESLADKIHRHRGVLLVISIPIVLIALVLLLMPGSSTSVSVIEYTMKSHEGGSNSRGPK  68

Query  151   NYAVIFDAGSTGSRVHVFHFDENLDLLPVGDGVEFFLKITPGLSSYADDPEAAAKSLEPL  330
             NYAVIFDAGS+GSRVHV+ FD+NLDL+P+ + +E FL++ PGLS+Y +DP  +A SL  L
Sbjct  69    NYAVIFDAGSSGSRVHVYCFDQNLDLVPLENELELFLQLKPGLSAYPNDPRQSANSLVSL  128

Query  331   LLEAEGVVPTELQPDTPLELGATAGLRLLEGDASDKILQAVRDMFKNESNFKSKAEWVSI  510
             L +AE  VP EL+P TP+ +GATAGLR L   AS+ ILQAVR++ K+ S  K++A  V++
Sbjct  129   LDKAEASVPRELRPKTPVRVGATAGLRALGHKASENILQAVRELLKDRSRLKTEANAVTV  188

Query  511   LEGSQEGTYFWVAMNYLLGNLGKGYQNTIATIDLGGGSVQVSYAVSGDTFANAPKPHNGE  690
             L+G+QEG+Y WV +NYLL  LGK Y +T+  +DLGGGSVQ++YA+S +  A+APKP  GE
Sbjct  189   LDGTQEGSYQWVTINYLLRTLGKPYSDTVGVVDLGGGSVQMAYAISEEDAASAPKPLEGE  248

Query  691   EPYVQEKYILGAQYYLYVHSYLNYGQLASRAEIFKASGNSTNPCVLEGYDGYYTYNDVSY  870
             + YV+E Y+ G +Y+LYVHSYL+YG LA+RAEI K S  S NPC++ GY G Y Y    +
Sbjct  249   DSYVREMYLKGRKYFLYVHSYLHYGLLAARAEILKVSEGSNNPCIVTGYTGTYKYGGKGF  308

Query  871   KVTAPPNGSSLKNCRKLARKVVDFR-APCKYPNCTFNGVWSGGGGAGMENVDISSYFYDI  1047
             K TA  +G+SL  CR++A   +    + C +  CTF GVW+GGGG G + + ++S+F+D 
Sbjct  309   KATASSSGASLDECRRVAINALKVNDSLCTHMKCTFGGVWNGGGGGGQKKMFVASFFFDR  368

Query  1048  AIDVGIIDEGKASKIVKPRSFLVAAKLACETKFEDVKSTFPNAVEKDYPYLCMDLVYQYT  1227
             A + G +D  +    V+P  F  AA  AC  + E+ KS FP+  E + PYLC+DLVYQYT
Sbjct  369   AAEAGFVDPKQPVAEVRPLDFEKAANKACNMRMEEGKSKFPHVEEDNLPYLCLDLVYQYT  428

Query  1228  LLVDGLGLHPYKEITLMKKVEYKNYMVEAAWPLGCAIDVISS  1353
             LLVDG GL P + ITL+KKV+Y +Y VEAAWPLG AI+ +SS
Sbjct  429   LLVDGFGLKPSQTITLVKKVKYGDYAVEAAWPLGSAIEAVSS  470



>ref|XP_008240451.1| PREDICTED: apyrase 2 [Prunus mume]
Length=477

 Score =   428 bits (1101),  Expect = 3e-141, Method: Compositional matrix adjust.
 Identities = 218/402 (54%), Positives = 298/402 (74%), Gaps = 1/402 (0%)
 Frame = +1

Query  151   NYAVIFDAGSTGSRVHVFHFDENLDLLPVGDGVEFFLKITPGLSSYADDPEAAAKSLEPL  330
             +YAVIFDAGS+GSRVHVF FD NL LLP+G  +E F+++TPGLS++A DP +AA+SL  L
Sbjct  75    SYAVIFDAGSSGSRVHVFCFDHNLQLLPIGKDLELFIQVTPGLSAFAKDPRSAAESLTEL  134

Query  331   LLEAEGVVPTELQPDTPLELGATAGLRLLEGDASDKILQAVRDMFKNESNFKSKAEWVSI  510
             L +AE  VP +L+  TP+ +GATAGLR LEGDASD+ILQAVR++ K  S+  SK + V++
Sbjct  135   LDKAESAVPKDLRSFTPVRVGATAGLRALEGDASDRILQAVRNLLKERSSLNSKPDSVTV  194

Query  511   LEGSQEGTYFWVAMNYLLGNLGKGYQNTIATIDLGGGSVQVSYAVSGDTFANAPKPHNGE  690
             ++G+QEG++ WV +NYLLGN+GK Y +T+  +DLGGGSVQ++YA+S    A AP+  +G+
Sbjct  195   IDGTQEGSFQWVTINYLLGNVGKKYSDTVGVVDLGGGSVQMAYAISEADAAKAPRLSDGD  254

Query  691   EPYVQEKYILGAQYYLYVHSYLNYGQLASRAEIFKASGNSTNPCVLEGYDGYYTYNDVSY  870
             + YV+E  + G +Y LYVHSYL+YG LA+RAEI K S +S NPC+L GYDG Y Y    Y
Sbjct  255   DSYVREMTLKGTKYNLYVHSYLHYGLLAARAEILKVSDDSGNPCILAGYDGSYKYGGQIY  314

Query  871   KVTAPPNGSSLKNCRKLARKVVDF-RAPCKYPNCTFNGVWSGGGGAGMENVDISSYFYDI  1047
             K +A  +GSS++ C ++A K +    A C +  CTF GVW+GGGG G  N+ ++S+F+D 
Sbjct  315   KASASSSGSSVEGCMRVAMKALKVNEATCTHMKCTFGGVWNGGGGDGQRNLFVASFFFDR  374

Query  1048  AIDVGIIDEGKASKIVKPRSFLVAAKLACETKFEDVKSTFPNAVEKDYPYLCMDLVYQYT  1227
             A + G ++  +    V+P +F  AAK ACETK ED KS + +  E + P+LCMDLVYQ+T
Sbjct  375   AAEAGFVNRNEPVAKVRPGNFEEAAKRACETKLEDAKSAYQDVKEDNLPFLCMDLVYQFT  434

Query  1228  LLVDGLGLHPYKEITLMKKVEYKNYMVEAAWPLGCAIDVISS  1353
             LLV+G GL P++EITL+KKV+Y N +VEAAWPLG AI+ +SS
Sbjct  435   LLVNGFGLDPWQEITLVKKVKYNNALVEAAWPLGSAIEAVSS  476



>ref|XP_009406850.1| PREDICTED: probable apyrase 2 [Musa acuminata subsp. malaccensis]
Length=463

 Score =   428 bits (1100),  Expect = 3e-141, Method: Compositional matrix adjust.
 Identities = 225/437 (51%), Positives = 303/437 (69%), Gaps = 6/437 (1%)
 Frame = +1

Query  58    LVFISLALLLFPLACFSRSHLRRVLL----NHEAGNYAVIFDAGSTGSRVHVFHFDENLD  225
             L+ IS  L L P +  + S   R  +       + +YAVIFDAGS+GSRVHV+ FDENLD
Sbjct  27    LLLISFVLFLMPRSPATISIAGRKAMPGGGEPRSKSYAVIFDAGSSGSRVHVYCFDENLD  86

Query  226   LLPVGDGVEFFLKITPGLSSYADDPEAAAKSLEPLLLEAEGVVPTELQPDTPLELGATAG  405
             LL +G  +E F++  PGLS YA+DP+ AA SL PLL +AE VVP EL+  TP+ +GATAG
Sbjct  87    LLHIGMELELFIQKKPGLSFYANDPQEAANSLVPLLEKAESVVPVELRQKTPVRVGATAG  146

Query  406   LRLLEGDASDKILQAVRDMFKNESNFKSKAEWVSILEGSQEGTYFWVAMNYLLGNLGKGY  585
             LR L  + S+KILQAVRD+ + +S+ K   +WV++L+G+QEG + WV +NYLLG LGK Y
Sbjct  147   LRALGAETSEKILQAVRDLLQRKSSLKFNPDWVTVLDGTQEGAFQWVTINYLLGKLGKSY  206

Query  586   QNTIATIDLGGGSVQVSYAVSGDTFANAPKPHNGEEPYVQEKYILGAQYYLYVHSYLNYG  765
               T+  +DLGGGSVQ++YA+S    ANAPK  +G++ YVQE ++ G +YYLYVHSYL+YG
Sbjct  207   AKTVGVVDLGGGSVQMAYAISEKDAANAPKVSDGQDSYVQELFLKGTRYYLYVHSYLHYG  266

Query  766   QLASRAEIFKASGNSTNPCVLEGYDGYYTYNDVSYKVTAPPNGSSLKNCRKLARKVVDFR  945
              LA+RAEI K + + +N C+L GYDG Y Y   +YK +A P+G+S   CR  A K +   
Sbjct  267   LLAARAEILKITEDRSN-CILGGYDGSYKYGGKAYKASASPSGASFSKCRDDAIKALKVD  325

Query  946   AP-CKYPNCTFNGVWSGGGGAGMENVDISSYFYDIAIDVGIIDEGKASKIVKPRSFLVAA  1122
              P C +  CTF G+W+GGGG G +++ ++S+F+D A + G +D  K +  VKP  F  AA
Sbjct  326   EPACTHMKCTFGGIWNGGGGDGQKHLFVASFFFDRAAEAGFVDSEKPTAKVKPAYFKKAA  385

Query  1123  KLACETKFEDVKSTFPNAVEKDYPYLCMDLVYQYTLLVDGLGLHPYKEITLMKKVEYKNY  1302
             K AC+   ED K+ +P   + + PYLCMDLVYQYTLLVDG  + P  +ITL+KKV+Y + 
Sbjct  386   KQACQLSVEDAKTKYPLVQDDNLPYLCMDLVYQYTLLVDGFDVDPDHDITLVKKVKYADA  445

Query  1303  MVEAAWPLGCAIDVISS  1353
             +VEAAWPLG AI+V SS
Sbjct  446   VVEAAWPLGSAIEVASS  462



>ref|XP_009757995.1| PREDICTED: apyrase 1-like [Nicotiana sylvestris]
Length=477

 Score =   428 bits (1101),  Expect = 3e-141, Method: Compositional matrix adjust.
 Identities = 236/437 (54%), Positives = 313/437 (72%), Gaps = 5/437 (1%)
 Frame = +1

Query  58    LVFISLALLLFPLACFSRSH----LRRVLLNHEAGNYAVIFDAGSTGSRVHVFHFDENLD  225
             ++ I   L + P + +S S      R+      + NYAVIFDAGS+GSRVHVF FD +LD
Sbjct  39    VLLICFVLFIMPTSEYSESMGGSVNRKFSPKFGSRNYAVIFDAGSSGSRVHVFCFDHHLD  98

Query  226   LLPVGDGVEFFLKITPGLSSYADDPEAAAKSLEPLLLEAEGVVPTELQPDTPLELGATAG  405
             L+P+G+ +E F++  PGLS+YA DP AAAKSL+ LL +AE VVP +L+ + P+ +GATAG
Sbjct  99    LVPIGNDLELFVQKKPGLSAYASDPAAAAKSLQSLLEKAEDVVPVDLRSNAPVRVGATAG  158

Query  406   LRLLEGDASDKILQAVRDMFKNESNFKSKAEWVSILEGSQEGTYFWVAMNYLLGNLGKGY  585
             LR L G+ASDKILQAVRD  K++S+ KSKA WV++L+G+QEG Y WV +NYLLGNLGK Y
Sbjct  159   LRQLGGNASDKILQAVRDFLKSKSSLKSKASWVTVLDGNQEGAYQWVTINYLLGNLGKKY  218

Query  586   QNTIATIDLGGGSVQVSYAVSGDTFANAPKPHNGEEPYVQEKYILGAQYYLYVHSYLNYG  765
              +T+  +DLGGGSVQ++YA+S      APK   GE+ YVQE Y+ GA+YYLYVHSYL+YG
Sbjct  219   SDTVGVVDLGGGSVQMAYAISEADAQKAPKLSGGEDTYVQEMYLKGAKYYLYVHSYLHYG  278

Query  766   QLASRAEIFKASGNSTNPCVLEGYDGYYTYNDVSYKVTAPPNGSSLKNCRKLARKVVDF-  942
              LA+RAEI K +  S +PC+L G+ G Y Y   +Y  +A   GSSL NCR +A K +   
Sbjct  279   LLAARAEILKVTKESGSPCILTGHHGSYKYGGKTYTASAMSQGSSLTNCRMVALKALKVN  338

Query  943   RAPCKYPNCTFNGVWSGGGGAGMENVDISSYFYDIAIDVGIIDEGKASKIVKPRSFLVAA  1122
              + C +  CTF GVW+GGGG G +N+ ++S+F+D A +VG +D   A   V+P  F  AA
Sbjct  339   ESACTHMKCTFGGVWNGGGGDGQKNMFVASFFFDRAAEVGFVDPNAAVAKVRPIDFESAA  398

Query  1123  KLACETKFEDVKSTFPNAVEKDYPYLCMDLVYQYTLLVDGLGLHPYKEITLMKKVEYKNY  1302
             + AC+T+ +D K+TFP     ++P+LCMDLVYQYTLLVDG GL   +E+TL+KKV+YKN 
Sbjct  399   RRACDTRIDDAKATFPRVDPDNWPFLCMDLVYQYTLLVDGFGLDARQEMTLVKKVKYKNS  458

Query  1303  MVEAAWPLGCAIDVISS  1353
             +VEAAWPLG AI+V SS
Sbjct  459   LVEAAWPLGSAIEVASS  475



>ref|XP_006297596.1| hypothetical protein CARUB_v10013618mg [Capsella rubella]
 gb|EOA30494.1| hypothetical protein CARUB_v10013618mg [Capsella rubella]
Length=471

 Score =   427 bits (1099),  Expect = 5e-141, Method: Compositional matrix adjust.
 Identities = 229/462 (50%), Positives = 312/462 (68%), Gaps = 18/462 (4%)
 Frame = +1

Query  22    KHNTMKHTSHHH---LVFISL-------ALLLFPLACFSRSHLRRVLLNHEAG-------  150
             +H ++    H H   L+ IS+        LLL P    S S +   + NHE G       
Sbjct  9     RHESLADKIHRHRGLLLVISIPIVLIALVLLLMPGTSTSVSVIEYTMKNHEGGSTSRGPR  68

Query  151   NYAVIFDAGSTGSRVHVFHFDENLDLLPVGDGVEFFLKITPGLSSYADDPEAAAKSLEPL  330
             NYAVIFDAGS+GSRVHV+ FD+NLDL+P+ + +E FL++ PGLS+Y +DP  +A SL  L
Sbjct  69    NYAVIFDAGSSGSRVHVYCFDQNLDLVPLENELELFLQLKPGLSAYPNDPRQSANSLVSL  128

Query  331   LLEAEGVVPTELQPDTPLELGATAGLRLLEGDASDKILQAVRDMFKNESNFKSKAEWVSI  510
             L +AE  VP EL+P TP+ +GATAGLR L   AS+ ILQAVR++ K+ S  K++A  V++
Sbjct  129   LDKAEASVPRELRPKTPVRVGATAGLRALGHKASENILQAVRELLKDRSRLKTEANAVTV  188

Query  511   LEGSQEGTYFWVAMNYLLGNLGKGYQNTIATIDLGGGSVQVSYAVSGDTFANAPKPHNGE  690
             L+G+QEG+Y WV +NYLL  LGK Y +T+  +DLGGGSVQ++YA+  +  A APKP  GE
Sbjct  189   LDGTQEGSYQWVTINYLLRTLGKPYSDTVGVVDLGGGSVQMAYAIPEEDAATAPKPLEGE  248

Query  691   EPYVQEKYILGAQYYLYVHSYLNYGQLASRAEIFKASGNSTNPCVLEGYDGYYTYNDVSY  870
             + YV+E Y+ G +Y+LYVHSYL+YG LA+RAEI K S +S NPC++ GY G Y Y   ++
Sbjct  249   DSYVREMYLKGRKYFLYVHSYLHYGLLAARAEILKVSEDSNNPCMVTGYAGNYKYGGKAF  308

Query  871   KVTAPPNGSSLKNCRKLARKVVDFR-APCKYPNCTFNGVWSGGGGAGMENVDISSYFYDI  1047
             K TA  +G+SL  CR++A   +    + C +  CTF GVW+GGGG G + + ++S+F+D 
Sbjct  309   KATASSSGASLDECRRVAINALKVNDSLCTHMKCTFGGVWNGGGGGGQKKMFVASFFFDR  368

Query  1048  AIDVGIIDEGKASKIVKPRSFLVAAKLACETKFEDVKSTFPNAVEKDYPYLCMDLVYQYT  1227
             A + G +D  +    V+P  F  AA  AC  + E+ KS FP+  E + PYLC+DLVYQYT
Sbjct  369   AAEAGFVDPKQPVAEVRPLDFEKAANKACSMRMEEGKSKFPHVEEDNLPYLCLDLVYQYT  428

Query  1228  LLVDGLGLHPYKEITLMKKVEYKNYMVEAAWPLGCAIDVISS  1353
             LLVDG GL P + ITL+KKV+Y +Y VEAAWPLG AI+ +SS
Sbjct  429   LLVDGFGLKPSQTITLVKKVKYGDYAVEAAWPLGSAIEAVSS  470



>emb|CDY38503.1| BnaA10g16550D [Brassica napus]
Length=472

 Score =   427 bits (1099),  Expect = 5e-141, Method: Compositional matrix adjust.
 Identities = 221/419 (53%), Positives = 295/419 (70%), Gaps = 12/419 (3%)
 Frame = +1

Query  127   VLLNHEAG-------NYAVIFDAGSTGSRVHVFHFDENLDLLPVGDGVEFFLKITPGLSS  285
              +LN + G       NYAV+FDAGS+GSRVHV+ FD+NLDL+P+G+ +E FL++ PGLS+
Sbjct  55    TVLNRKGGPNSRPPKNYAVVFDAGSSGSRVHVYCFDKNLDLIPLGNELELFLQLKPGLSA  114

Query  286   YADDPEAAAKSLEPLLLEAEGVVPTELQPDTPLELGATAGLRLLEGDASDKILQAVRDMF  465
             Y  DP  AA SL  LL +AE  VP EL+P TP+ +GATAGLR L  +AS+ ILQAV+++ 
Sbjct  115   YPTDPRQAANSLVSLLDKAESSVPRELRPKTPVRVGATAGLRTLGHEASENILQAVKELL  174

Query  466   KNESNFKSKAEWVSILEGSQEGTYFWVAMNYLLGNLGKGYQNTIATIDLGGGSVQVSYAV  645
             ++ S  K++A  V++L+G+QEG+Y WV +NYLL NLGK Y +T+  +DLGGGSVQ++YA+
Sbjct  175   RDRSMLKTEANAVTVLDGTQEGSYQWVTINYLLRNLGKPYSDTVGVVDLGGGSVQMAYAI  234

Query  646   SGDTFANAPKPHNGEEPYVQEKYILGAQYYLYVHSYLNYGQLASRAEIFKASGNSTNPCV  825
             S +  A+APKP  GE+ YV+E Y+ G +Y+LYVHSYL+YG LA+RAEI K S +S NPC+
Sbjct  235   SEEDAASAPKPLEGEDAYVREMYLKGRKYFLYVHSYLHYGLLAARAEILKVSEDSNNPCI  294

Query  826   LEGYDGYYTYNDVSYKVTAPPNGSSLKNCRKL---ARKVVDFRAPCKYPNCTFNGVWSGG  996
             + GYDG Y Y     K  A  +G+SL  CR+    A KV D    C +  CTF GVW+GG
Sbjct  295   VTGYDGTYKYGGEELKAAALQSGASLDECRRFTINALKVND--TLCTHMKCTFGGVWNGG  352

Query  997   GGAGMENVDISSYFYDIAIDVGIIDEGKASKIVKPRSFLVAAKLACETKFEDVKSTFPNA  1176
              G G +N+ ++S+F+D A + G +D  +    V+P  F  AAK AC  K E+ KS FP  
Sbjct  353   RGGGQKNMFVASFFFDRAAEAGFVDPKQPVATVRPIDFEKAAKKACSMKMEEGKSKFPRV  412

Query  1177  VEKDYPYLCMDLVYQYTLLVDGLGLHPYKEITLMKKVEYKNYMVEAAWPLGCAIDVISS  1353
              E + PYLC+DLVYQYTLLVDG GL P + ITL+KKV+Y  + VEAAWPLG AI+ +SS
Sbjct  413   EEDNLPYLCVDLVYQYTLLVDGFGLKPTQTITLVKKVKYGEHAVEAAWPLGSAIEAVSS  471



>ref|XP_008793372.1| PREDICTED: probable apyrase 1 [Phoenix dactylifera]
Length=477

 Score =   427 bits (1098),  Expect = 1e-140, Method: Compositional matrix adjust.
 Identities = 222/404 (55%), Positives = 291/404 (72%), Gaps = 4/404 (1%)
 Frame = +1

Query  151   NYAVIFDAGSTGSRVHVFHFDENLDLLPVGDGVEFFLKITPGLSSYADDPEAAAKSLEPL  330
             +YAVIFDAGS+GSRVHV+ FDENLDLL +G  +E F +I  GLSSYA DP+ AA SL PL
Sbjct  76    SYAVIFDAGSSGSRVHVYCFDENLDLLHIGKEIELFRRIGTGLSSYAKDPQEAANSLIPL  135

Query  331   LLEAEGVVPTELQPDTPLELGATAGLRLLEGDASDKILQAVRDMFKNESNFKSKAEWVSI  510
             L EAE VVP EL+  TP+ +GATAGLR L  + S+KILQAVRD+ K++S+ K + +WVS+
Sbjct  136   LEEAESVVPVELRWKTPVRVGATAGLRALGAETSEKILQAVRDLLKDKSSLKFQPDWVSV  195

Query  511   LEGSQEGTYFWVAMNYLLGNLGKGYQNTIATIDLGGGSVQVSYAVSGDTFANAPKPHNGE  690
             L+GSQEG + WV +NYLLG+LGK Y +T+  +DLGGGSVQ++YA+S    A APK  +GE
Sbjct  196   LDGSQEGAFQWVTINYLLGHLGKTYSDTVGVVDLGGGSVQMAYAISEKDAAEAPKVTDGE  255

Query  691   EPYVQEKYILGAQYYLYVHSYLNYGQLASRAEIFKASGNSTNPCVLEGYDGYYTYNDVSY  870
             + YV++ ++ G +YYLYVHSY++YG LA+RAEI  A  N +N C+L GY G Y Y D  +
Sbjct  256   DSYVKQLFLKGTKYYLYVHSYMHYGLLAARAEILTAGDNYSN-CILNGYRGTYKYGDEVH  314

Query  871   KVTAPPNGSSLKNCRKLARKV--VDFRAPCKYPNCTFNGVWSGGGGAGMENVDISSYFYD  1044
             K  A P+G+SL  CR  A K   VD R  C +  CTF GVW+GGGG G  N+ ++S+F+D
Sbjct  315   KAIAAPSGASLSKCRNEAVKALKVDGRV-CTHMKCTFGGVWNGGGGDGQRNLFVASFFFD  373

Query  1045  IAIDVGIIDEGKASKIVKPRSFLVAAKLACETKFEDVKSTFPNAVEKDYPYLCMDLVYQY  1224
              A + G +D       V+P  F  AAK AC+   +D ++T+ +   ++ P+LCMDLVYQY
Sbjct  374   RAAEAGFVDPKVPVAKVRPSDFEEAAKRACKLNVDDARTTYSHVSVENLPFLCMDLVYQY  433

Query  1225  TLLVDGLGLHPYKEITLMKKVEYKNYMVEAAWPLGCAIDVISSS  1356
             TLLVDG  L P++EITL+KKV+Y N  VEAAWPLG AI+V SS+
Sbjct  434   TLLVDGFALDPHQEITLVKKVQYGNAFVEAAWPLGSAIEVASSA  477



>ref|XP_007202024.1| hypothetical protein PRUPE_ppa005076mg [Prunus persica]
 gb|EMJ03223.1| hypothetical protein PRUPE_ppa005076mg [Prunus persica]
Length=478

 Score =   426 bits (1096),  Expect = 2e-140, Method: Compositional matrix adjust.
 Identities = 225/440 (51%), Positives = 308/440 (70%), Gaps = 8/440 (2%)
 Frame = +1

Query  58    LVFISLALLLFPLACFSRSHLRRVLL---NHEA----GNYAVIFDAGSTGSRVHVFHFDE  216
             L+ +++ L + P        L   +    NH       +YAVIFDAGS+GSRVHVF FD 
Sbjct  38    LLLLTMVLYVMPGGGGGGGELSTTVTTNRNHRKLPPKTSYAVIFDAGSSGSRVHVFCFDH  97

Query  217   NLDLLPVGDGVEFFLKITPGLSSYADDPEAAAKSLEPLLLEAEGVVPTELQPDTPLELGA  396
             NL LLP+G  +E FL + PGLS YA DP +AA+SL  LL +AE  VP +L+  TP+ +GA
Sbjct  98    NLQLLPIGKDLELFLHVEPGLSFYAKDPRSAAESLTGLLDKAESAVPKDLRSFTPVRVGA  157

Query  397   TAGLRLLEGDASDKILQAVRDMFKNESNFKSKAEWVSILEGSQEGTYFWVAMNYLLGNLG  576
             TAGLR LEGDASD+ILQAVRD+ K  S+  SK + V++++G+QEG++ WV +NYLLGN+G
Sbjct  158   TAGLRALEGDASDRILQAVRDLLKERSSLSSKPDSVTVIDGTQEGSFQWVTINYLLGNVG  217

Query  577   KGYQNTIATIDLGGGSVQVSYAVSGDTFANAPKPHNGEEPYVQEKYILGAQYYLYVHSYL  756
             K Y +T+  +DLGGGSVQ++YA+S    A AP+  +G++ YV+E  + G +Y LYVHSYL
Sbjct  218   KKYSDTVGVVDLGGGSVQMAYAISEADAAKAPRLSDGDDSYVREMTLKGTKYNLYVHSYL  277

Query  757   NYGQLASRAEIFKASGNSTNPCVLEGYDGYYTYNDVSYKVTAPPNGSSLKNCRKLARKVV  936
             +YG LA+RAEI K S +S NPC+L GY+G Y Y    YK +A  +GSS++ C ++A K +
Sbjct  278   HYGLLAARAEILKVSDDSGNPCILAGYNGSYKYGGQIYKASASSSGSSVEGCMRVAMKAL  337

Query  937   DF-RAPCKYPNCTFNGVWSGGGGAGMENVDISSYFYDIAIDVGIIDEGKASKIVKPRSFL  1113
                 A C +  CTF GVW+GGGG G  N+ ++S+F+D A + G ++  +    V+P +F 
Sbjct  338   KVNEATCTHMKCTFGGVWNGGGGDGQRNLFVASFFFDRAAEAGFVNPNEPVAKVRPGNFE  397

Query  1114  VAAKLACETKFEDVKSTFPNAVEKDYPYLCMDLVYQYTLLVDGLGLHPYKEITLMKKVEY  1293
              AAK ACETK ED KS +P+  + + P+LCMDLVYQ+TLLV+G GL P++EITL+KKV+Y
Sbjct  398   EAAKRACETKLEDAKSAYPDVKQDNLPFLCMDLVYQFTLLVNGFGLDPWQEITLVKKVKY  457

Query  1294  KNYMVEAAWPLGCAIDVISS  1353
              N +VEAAWPLG AI+ +SS
Sbjct  458   NNALVEAAWPLGSAIEAVSS  477



>emb|CDY51237.1| BnaA03g07010D [Brassica napus]
Length=580

 Score =   429 bits (1104),  Expect = 3e-140, Method: Compositional matrix adjust.
 Identities = 223/419 (53%), Positives = 293/419 (70%), Gaps = 12/419 (3%)
 Frame = +1

Query  127   VLLNHEAG-------NYAVIFDAGSTGSRVHVFHFDENLDLLPVGDGVEFFLKITPGLSS  285
              +LN + G       NYAVIFDAGS+GSRVHV+ FD NLDLLP+G+ +E F+++ PGLS+
Sbjct  163   TVLNRKGGPNSRPPKNYAVIFDAGSSGSRVHVYCFDRNLDLLPLGNELELFVQLKPGLSA  222

Query  286   YADDPEAAAKSLEPLLLEAEGVVPTELQPDTPLELGATAGLRLLEGDASDKILQAVRDMF  465
             Y  DP  AA SL  LL +AE  VP EL+P TP+ +GATAGLR L  +AS+ ILQAV+++ 
Sbjct  223   YPTDPRQAANSLVSLLDKAEASVPRELRPKTPVRVGATAGLRTLGHEASENILQAVKELL  282

Query  466   KNESNFKSKAEWVSILEGSQEGTYFWVAMNYLLGNLGKGYQNTIATIDLGGGSVQVSYAV  645
             ++ S  K++A  V++L+G+QEG Y WV +NYLL NLGK Y +T+  +DLGGGSVQ++YA+
Sbjct  283   RDRSMLKTEANAVTVLDGTQEGAYQWVTINYLLRNLGKPYSDTVGVVDLGGGSVQMAYAI  342

Query  646   SGDTFANAPKPHNGEEPYVQEKYILGAQYYLYVHSYLNYGQLASRAEIFKASGNSTNPCV  825
             S +  A APKP  GE+ YV+E Y+ G +Y+LYVHSYL+YG LA+RAEI K S +S NPC+
Sbjct  343   SEEDAATAPKPLEGEDSYVREMYLKGRKYFLYVHSYLHYGLLAARAEILKVSEDSNNPCI  402

Query  826   LEGYDGYYTYNDVSYKVTAPPNGSSLKNCRKL---ARKVVDFRAPCKYPNCTFNGVWSGG  996
             + GYDG Y Y    +K  A  +G+SL  CR+L   A KV D    C +  CTF GVW+GG
Sbjct  403   VAGYDGTYKYGGDGFKAAAVQSGASLNECRRLTVNALKVND--TLCTHMKCTFGGVWNGG  460

Query  997   GGAGMENVDISSYFYDIAIDVGIIDEGKASKIVKPRSFLVAAKLACETKFEDVKSTFPNA  1176
              G G +N+ ++S+F+D A + G +D  +    V+P  F  AAK AC  K E+ KS FP  
Sbjct  461   RGGGQKNMFVASFFFDRAAEAGFVDPKQPVATVRPMDFEKAAKKACSMKIEEGKSKFPRV  520

Query  1177  VEKDYPYLCMDLVYQYTLLVDGLGLHPYKEITLMKKVEYKNYMVEAAWPLGCAIDVISS  1353
              E + PYLCMDLVYQYTLLVDG GL   + ITL+KKV+Y  + VEAAWPLG AI+ +SS
Sbjct  521   EEDNLPYLCMDLVYQYTLLVDGFGLEASQTITLVKKVKYGEHAVEAAWPLGSAIEAVSS  579



>ref|XP_009366414.1| PREDICTED: apyrase 2-like [Pyrus x bretschneideri]
Length=468

 Score =   425 bits (1093),  Expect = 4e-140, Method: Compositional matrix adjust.
 Identities = 233/433 (54%), Positives = 311/433 (72%), Gaps = 3/433 (1%)
 Frame = +1

Query  58    LVFISLALLLFPLACFSRSHLRRVLLNHEAGNYAVIFDAGSTGSRVHVFHFDENLDLLPV  237
             L+ +++ L + P      + L R L +    ++AVIFDAGS+GSRVHVF FD NL LLP+
Sbjct  37    LLLLTMVLYVMPPGGNLSNQLPRKLPSK--ASFAVIFDAGSSGSRVHVFCFDHNLQLLPI  94

Query  238   GDGVEFFLKITPGLSSYADDPEAAAKSLEPLLLEAEGVVPTELQPDTPLELGATAGLRLL  417
             G  +E FL++ PGLS+YA DP +AA+SL  LL +AE  VP EL+  TP+ +GATAGLR L
Sbjct  95    GKDLELFLQVKPGLSAYAKDPRSAAESLTSLLDKAESAVPKELRSFTPVRVGATAGLRAL  154

Query  418   EGDASDKILQAVRDMFKNESNFKSKAEWVSILEGSQEGTYFWVAMNYLLGNLGKGYQNTI  597
             +GDASD+ILQAVRD+ K  S+  S+ + V++++G+QEG++ WV +NYLLGNLGK Y +T+
Sbjct  155   KGDASDRILQAVRDLLKQRSSLSSRPDAVTVIDGTQEGSFQWVTINYLLGNLGKKYSDTV  214

Query  598   ATIDLGGGSVQVSYAVSGDTFANAPKPHNGEEPYVQEKYILGAQYYLYVHSYLNYGQLAS  777
               +DLGGGSVQ++YA+S    A APK  +GE+ YV+E  + GA+Y LYVHSYL+YG LA+
Sbjct  215   GVVDLGGGSVQMAYAISEADAAKAPKLSDGEDVYVREMNLKGAKYNLYVHSYLHYGLLAA  274

Query  778   RAEIFKASGNSTNPCVLEGYDGYYTYNDVSYKVTAPPNGSSLKNCRKLARKVVDF-RAPC  954
             RAEI K S +S NPC+L GY G YTY   SYK +A  +GSS++ CR +  K +    A C
Sbjct  275   RAEILKVSEDSANPCILAGYYGSYTYGGQSYKASASSSGSSVEECRGVVTKALKVNEATC  334

Query  955   KYPNCTFNGVWSGGGGAGMENVDISSYFYDIAIDVGIIDEGKASKIVKPRSFLVAAKLAC  1134
              +  CTF GVW+GGGG G  N+ ++S+F+D A + G ++  +    V P +F  AAK AC
Sbjct  335   SHMKCTFGGVWNGGGGDGQRNLFVASFFFDRAAEAGFVNPDEPVAKVHPGNFEEAAKRAC  394

Query  1135  ETKFEDVKSTFPNAVEKDYPYLCMDLVYQYTLLVDGLGLHPYKEITLMKKVEYKNYMVEA  1314
             ETK ED KST+P   E + P+LCMDLVYQ TLLVDG GL P++EITL+KKVEY+N +VEA
Sbjct  395   ETKLEDAKSTYPQVEEGNLPFLCMDLVYQSTLLVDGFGLDPWQEITLVKKVEYQNSLVEA  454

Query  1315  AWPLGCAIDVISS  1353
             AWPLG AI+ +SS
Sbjct  455   AWPLGSAIEAVSS  467



>ref|XP_010938111.1| PREDICTED: probable apyrase 1 [Elaeis guineensis]
Length=470

 Score =   425 bits (1093),  Expect = 4e-140, Method: Compositional matrix adjust.
 Identities = 217/402 (54%), Positives = 289/402 (72%), Gaps = 2/402 (0%)
 Frame = +1

Query  151   NYAVIFDAGSTGSRVHVFHFDENLDLLPVGDGVEFFLKITPGLSSYADDPEAAAKSLEPL  330
             +YAVIFDAGS+GSRVHV+ FDE LDLL +G  +E F +  PGLSS+A DPE AA SL PL
Sbjct  69    SYAVIFDAGSSGSRVHVYCFDEKLDLLHIGKEIELFRQKKPGLSSFAKDPEEAANSLIPL  128

Query  331   LLEAEGVVPTELQPDTPLELGATAGLRLLEGDASDKILQAVRDMFKNESNFKSKAEWVSI  510
             L EAE VVP EL+  TP+ +GATAGLR L  + S+KILQAVRD+ K++S+ + +++WVS+
Sbjct  129   LEEAESVVPAELRWKTPVRVGATAGLRALGAETSEKILQAVRDLLKDKSSLRFQSDWVSV  188

Query  511   LEGSQEGTYFWVAMNYLLGNLGKGYQNTIATIDLGGGSVQVSYAVSGDTFANAPKPHNGE  690
             L+GSQEG + WV +NYLLGNLGK Y +T+  +DLGGGSVQ++YA+S    A APK  +GE
Sbjct  189   LDGSQEGAFQWVTINYLLGNLGKTYSDTVGVVDLGGGSVQMAYAISEKDAAEAPKVTDGE  248

Query  691   EPYVQEKYILGAQYYLYVHSYLNYGQLASRAEIFKASGNSTNPCVLEGYDGYYTYNDVSY  870
             + YV+  ++ G +YYLYVHSYL+YG LA+RAEI  A   ++N C+L GY G Y Y D  +
Sbjct  249   DSYVKHLFLKGTKYYLYVHSYLHYGLLAARAEILMAGEGNSN-CILNGYRGTYKYGDDVH  307

Query  871   KVTAPPNGSSLKNCRKLARKVVDFRAP-CKYPNCTFNGVWSGGGGAGMENVDISSYFYDI  1047
             K  + P+G+SL  CR  A K +    P C +  CTF G+W+GGGG G +N+ ++S+F+D 
Sbjct  308   KAISAPSGASLSKCRSDAVKALKVDEPVCTHIKCTFGGIWNGGGGDGQKNLFVASFFFDR  367

Query  1048  AIDVGIIDEGKASKIVKPRSFLVAAKLACETKFEDVKSTFPNAVEKDYPYLCMDLVYQYT  1227
             A + G +D       V+P  F  AAK AC    +D ++T+P+   ++ P+LCMDLVYQYT
Sbjct  368   AAEAGFVDPKVPVAKVRPSEFEEAAKRACRLNIDDARTTYPHVSVENLPFLCMDLVYQYT  427

Query  1228  LLVDGLGLHPYKEITLMKKVEYKNYMVEAAWPLGCAIDVISS  1353
             LLVDG  L P++EITL+KKV+Y +  VEAAWPLG AI+V SS
Sbjct  428   LLVDGFALDPHQEITLVKKVQYGDAFVEAAWPLGSAIEVASS  469



>gb|KEH25611.1| GDA1/CD39 nucleoside phosphatase family protein [Medicago truncatula]
Length=483

 Score =   426 bits (1094),  Expect = 4e-140, Method: Compositional matrix adjust.
 Identities = 218/402 (54%), Positives = 293/402 (73%), Gaps = 1/402 (0%)
 Frame = +1

Query  151   NYAVIFDAGSTGSRVHVFHFDENLDLLPVGDGVEFFLKITPGLSSYADDPEAAAKSLEPL  330
             ++AV+FDAGS+GSRVHVF FD NL+L+ +G+ +E FL+I PGLS+YA DP+ AAKSL  L
Sbjct  80    SFAVVFDAGSSGSRVHVFRFDRNLELVKIGNDLEVFLQIKPGLSAYARDPQQAAKSLVSL  139

Query  331   LLEAEGVVPTELQPDTPLELGATAGLRLLEGDASDKILQAVRDMFKNESNFKSKAEWVSI  510
             L +AE VVP E +  TP+ +GATAGLR LEGDASD+ILQAVR++ K  S  KS+   V++
Sbjct  140   LDKAESVVPMEFRSMTPVRVGATAGLRALEGDASDRILQAVRELLKQRSTLKSEPNAVAV  199

Query  511   LEGSQEGTYFWVAMNYLLGNLGKGYQNTIATIDLGGGSVQVSYAVSGDTFANAPKPHNGE  690
             L+G+QEG + WV +NYLLG LG+ Y +T+  +DLGGGSVQ++YA+S  + A APK  +G 
Sbjct  200   LDGTQEGAFQWVTINYLLGKLGRDYSDTVGVVDLGGGSVQMAYAISETSAAEAPKVPDGG  259

Query  691   EPYVQEKYILGAQYYLYVHSYLNYGQLASRAEIFKASGNSTNPCVLEGYDGYYTYNDVSY  870
             EPYV+E ++ G +YYLYVHSYL +G LA+RAEI KAS +  NPC+L GYDG Y Y   S+
Sbjct  260   EPYVKEMFLRGRKYYLYVHSYLRFGLLAARAEILKASDDFGNPCILAGYDGSYKYGGKSF  319

Query  871   KVTAPPNGSSLKNCRKLARKVVDF-RAPCKYPNCTFNGVWSGGGGAGMENVDISSYFYDI  1047
               ++ P+GSSL  C+ +A   +    + C +  CTF G+W+GGGG G +N+ ++S+F+D 
Sbjct  320   NASSSPSGSSLNECKSIALNALTVNESTCAHMKCTFGGIWNGGGGDGQKNLFVASFFFDR  379

Query  1048  AIDVGIIDEGKASKIVKPRSFLVAAKLACETKFEDVKSTFPNAVEKDYPYLCMDLVYQYT  1227
             A   G  +       V+P  F  AAK AC+TK ED KST+P   + + PYLCMDLVYQYT
Sbjct  380   AAQAGFANPKSPVAKVRPVDFKNAAKQACQTKLEDAKSTYPLVDDGNLPYLCMDLVYQYT  439

Query  1228  LLVDGLGLHPYKEITLMKKVEYKNYMVEAAWPLGCAIDVISS  1353
             LLVDG GL P ++ITL+K+V+Y + +VEAAWPLG AI+ +SS
Sbjct  440   LLVDGFGLDPLQDITLVKQVKYHDSLVEAAWPLGSAIEAVSS  481



>ref|XP_009120988.1| PREDICTED: apyrase 2 [Brassica rapa]
Length=472

 Score =   425 bits (1093),  Expect = 5e-140, Method: Compositional matrix adjust.
 Identities = 220/419 (53%), Positives = 295/419 (70%), Gaps = 12/419 (3%)
 Frame = +1

Query  127   VLLNHEAG-------NYAVIFDAGSTGSRVHVFHFDENLDLLPVGDGVEFFLKITPGLSS  285
              +LN + G       NYAV+FDAGS+GSRVHV+ FD+NLDL+P+G+ +E FL++ PGLS+
Sbjct  55    TVLNRKGGPNSRPPKNYAVVFDAGSSGSRVHVYCFDKNLDLVPLGNELELFLQLKPGLSA  114

Query  286   YADDPEAAAKSLEPLLLEAEGVVPTELQPDTPLELGATAGLRLLEGDASDKILQAVRDMF  465
             Y  DP  AA SL  LL +AE  VP EL+P TP+ +GATAGLR L  +AS+ ILQAV+++ 
Sbjct  115   YPTDPRQAANSLVSLLDKAESSVPRELRPKTPVRVGATAGLRTLGHEASENILQAVKELL  174

Query  466   KNESNFKSKAEWVSILEGSQEGTYFWVAMNYLLGNLGKGYQNTIATIDLGGGSVQVSYAV  645
             ++ S  K++A  V++L+G+QEG+Y WV +NYLL NLGK Y +T+  +DLGGGSVQ++YA+
Sbjct  175   RDRSMLKTEANAVTVLDGTQEGSYQWVTINYLLRNLGKPYSDTVGVVDLGGGSVQMAYAI  234

Query  646   SGDTFANAPKPHNGEEPYVQEKYILGAQYYLYVHSYLNYGQLASRAEIFKASGNSTNPCV  825
             S +  A+APKP  GE+ YV+E Y+ G +Y+LYVHSYL+YG LA+RAEI K S +S +PC+
Sbjct  235   SEEDAASAPKPLEGEDAYVREMYLKGRKYFLYVHSYLHYGLLAARAEILKVSEDSNSPCI  294

Query  826   LEGYDGYYTYNDVSYKVTAPPNGSSLKNCRKL---ARKVVDFRAPCKYPNCTFNGVWSGG  996
             + GYDG Y Y     K  A  +G+SL  CR+    A KV D    C +  CTF GVW+GG
Sbjct  295   VTGYDGTYKYGGEELKAAALQSGASLDECRRFTINALKVND--TLCTHMKCTFGGVWNGG  352

Query  997   GGAGMENVDISSYFYDIAIDVGIIDEGKASKIVKPRSFLVAAKLACETKFEDVKSTFPNA  1176
              G G +N+ ++S+F+D A + G +D  +    V+P  F  AAK AC  K E+ KS FP  
Sbjct  353   RGGGQKNMFVASFFFDRAAEAGFVDPKQPVATVRPIDFEKAAKKACSMKMEEGKSKFPRV  412

Query  1177  VEKDYPYLCMDLVYQYTLLVDGLGLHPYKEITLMKKVEYKNYMVEAAWPLGCAIDVISS  1353
              E + PYLC+DLVYQYTLLVDG GL P + ITL+KKV+Y  + VEAAWPLG AI+ +SS
Sbjct  413   EEDNLPYLCVDLVYQYTLLVDGFGLKPTQTITLVKKVKYGEHAVEAAWPLGSAIEAVSS  471



>ref|XP_004977419.1| PREDICTED: probable apyrase 3-like [Setaria italica]
Length=459

 Score =   424 bits (1090),  Expect = 7e-140, Method: Compositional matrix adjust.
 Identities = 214/400 (54%), Positives = 282/400 (71%), Gaps = 2/400 (1%)
 Frame = +1

Query  151   NYAVIFDAGSTGSRVHVFHFDENLDLLPVGDGVEFFLKITPGLSSYADDPEAAAKSLEPL  330
              +AVIFDAGSTGSRVHVF FD  LDL+P+GD +EFF KI PGLSSYA  P+ AA S+ PL
Sbjct  53    RFAVIFDAGSTGSRVHVFKFDSKLDLVPIGDDIEFFAKIKPGLSSYAGRPQEAASSILPL  112

Query  331   LLEAEGVVPTELQPDTPLELGATAGLRLLEGDASDKILQAVRDMFKNESNFKSKAEWVSI  510
             L +A+ +VPT LQ  TPL+LGATAGLRL+    +++IL+AV+D+   +S F+   +W+++
Sbjct  113   LEQAKKIVPTSLQKYTPLKLGATAGLRLIGDKKAEEILEAVQDLVHTKSKFQYNPKWITV  172

Query  511   LEGSQEGTYFWVAMNYLLGNLGKGYQNTIATIDLGGGSVQVSYAVSGDTFANAPKPHNGE  690
             LEG+QEG+Y WVA+NYLLG LG  Y  T+  IDLGGGSVQ++YA+S +  ANAP   +G+
Sbjct  173   LEGTQEGSYLWVALNYLLGKLGGDYSKTVGVIDLGGGSVQMAYAISTNAAANAPAVPDGK  232

Query  691   EPYVQEKYILGAQYYLYVHSYLNYGQLASRAEIFKASGNSTNPCVLEGYDGYYTYNDVSY  870
             +PY+ ++Y+ G  Y LYVHSYL YG  ASR EI KA     + CVL G+ G YTYN   Y
Sbjct  233   DPYITKEYLKGKDYNLYVHSYLYYGTFASRVEILKAKNGPFSRCVLRGFSGNYTYNGKEY  292

Query  871   KVTAPPNGSSLKNCRKLARKVVDFRAPCKYPNCTFNGVWSGGGGAGMENVDISSYFYDIA  1050
               TA P G+    CR+   K ++  APC+  NC+FNGVW+GGGGAG +N+ ++S+F+D A
Sbjct  293   DATASPEGAVYDKCREEIIKALNLSAPCETKNCSFNGVWNGGGGAGQDNLYVASFFFDKA  352

Query  1051  IDVGIIDEGKASKIVKPRSFLVAAKLACETKFEDVKSTFPNAVEKDYPYLCMDLVYQYTL  1230
                G I+    S    P +F VAA+  C    ++VK+ +PNA   D PY CMDL+YQYTL
Sbjct  353   TQYGFIESEAPSAKSTPAAFKVAAEKVCSLSVKEVKAAYPNAF--DLPYACMDLLYQYTL  410

Query  1231  LVDGLGLHPYKEITLMKKVEYKNYMVEAAWPLGCAIDVIS  1350
             LVDG GL P KEITL+ +V+Y  Y +EAAWPLG AI+ ++
Sbjct  411   LVDGFGLDPTKEITLINRVKYGEYYIEAAWPLGTAIEAVA  450



>ref|XP_010921280.1| PREDICTED: probable apyrase 1 [Elaeis guineensis]
Length=473

 Score =   424 bits (1091),  Expect = 8e-140, Method: Compositional matrix adjust.
 Identities = 215/403 (53%), Positives = 292/403 (72%), Gaps = 2/403 (0%)
 Frame = +1

Query  151   NYAVIFDAGSTGSRVHVFHFDENLDLLPVGDGVEFFLKITPGLSSYADDPEAAAKSLEPL  330
             +YAVIFDAGS+GSRVHV+ FDENLDLL +G  +E F++  PGLS++A DP+ AA SL PL
Sbjct  72    SYAVIFDAGSSGSRVHVYCFDENLDLLHIGVEIELFIQKKPGLSAFAKDPQEAANSLIPL  131

Query  331   LLEAEGVVPTELQPDTPLELGATAGLRLLEGDASDKILQAVRDMFKNESNFKSKAEWVSI  510
             L +AE VVP EL+  TP+ +GATAGLR L  + S+KILQAVRD+  ++S+ K + +WVS+
Sbjct  132   LAKAESVVPAELREKTPIRVGATAGLRALGAETSEKILQAVRDLLNSKSSLKFQPDWVSV  191

Query  511   LEGSQEGTYFWVAMNYLLGNLGKGYQNTIATIDLGGGSVQVSYAVSGDTFANAPKPHNGE  690
             L+G+QEG + WV +NYLLG LGK + +T+  +DLGGGSVQ++YA+S +  A APK  +GE
Sbjct  192   LDGTQEGAFQWVTINYLLGKLGKTHSDTVGVVDLGGGSVQMAYAISEEDAAKAPKVADGE  251

Query  691   EPYVQEKYILGAQYYLYVHSYLNYGQLASRAEIFKASGNSTNPCVLEGYDGYYTYNDVSY  870
             + YV++ ++ G +YYLYVHSYL+YG LA+RAEI KA G+ +  C+L GY+G Y Y D  Y
Sbjct  252   DTYVKQLFLKGTKYYLYVHSYLHYGLLAARAEILKAGGDYST-CILNGYNGKYKYGDDVY  310

Query  871   KVTAPPNGSSLKNCRKLARKVVDFRAP-CKYPNCTFNGVWSGGGGAGMENVDISSYFYDI  1047
             K +A P+G+SL  CR  A K +    P C +  CTF G+W+GGGG G +N+ ++S+F+D 
Sbjct  311   KASAAPSGASLSKCRSDAVKALKVDEPVCTHMKCTFGGIWNGGGGDGQKNLFVASFFFDR  370

Query  1048  AIDVGIIDEGKASKIVKPRSFLVAAKLACETKFEDVKSTFPNAVEKDYPYLCMDLVYQYT  1227
             A + G ID       V+P  F  AAK AC+   +D K T+     ++ P+LCMDLVYQYT
Sbjct  371   AAEAGFIDPKVPVAKVRPSDFEKAAKRACKLNVDDAKVTYSRVSVENLPFLCMDLVYQYT  430

Query  1228  LLVDGLGLHPYKEITLMKKVEYKNYMVEAAWPLGCAIDVISSS  1356
             LLVDG  L P++EITL+K+V+Y +  VEAAWPLG AI+V SS+
Sbjct  431   LLVDGFALDPHQEITLVKQVQYGDAFVEAAWPLGSAIEVASSA  473



>gb|AAO23006.1| apyrase-like protein [Medicago truncatula]
 gb|AES80808.2| Nod factor-binding lectin-nucleotide phosphohydrolase [Medicago 
truncatula]
Length=455

 Score =   424 bits (1089),  Expect = 9e-140, Method: Compositional matrix adjust.
 Identities = 214/437 (49%), Positives = 299/437 (68%), Gaps = 7/437 (2%)
 Frame = +1

Query  64    FISLALLLFPLACFSRSHLRRVLLNHEA-------GNYAVIFDAGSTGSRVHVFHFDENL  222
              I+  L L P    S+     +L N +         +YAV+FDAGSTGSRVHV+HFD+NL
Sbjct  7     LITFLLFLMPTISSSQYLGNNILTNRKIFPKQETLTSYAVVFDAGSTGSRVHVYHFDQNL  66

Query  223   DLLPVGDGVEFFLKITPGLSSYADDPEAAAKSLEPLLLEAEGVVPTELQPDTPLELGATA  402
             DLL +G+ VEF+ K TPGLS+YAD+P+ AA+SL PLL +AE VVP  LQP TP++LGATA
Sbjct  67    DLLHIGNDVEFYNKTTPGLSAYADNPKEAAESLIPLLEQAERVVPVNLQPKTPVKLGATA  126

Query  403   GLRLLEGDASDKILQAVRDMFKNESNFKSKAEWVSILEGSQEGTYFWVAMNYLLGNLGKG  582
             GLRLL+G++S+ IL+AV  + K  S F  +++ V I++G+QEG+Y WV +NY+LGNLGK 
Sbjct  127   GLRLLDGNSSELILEAVSSLLKKRSTFNVQSDAVGIIDGTQEGSYLWVTINYVLGNLGKD  186

Query  583   YQNTIATIDLGGGSVQVSYAVSGDTFANAPKPHNGEEPYVQEKYILGAQYYLYVHSYLNY  762
             +  T+A  DLGGGSVQ+ YAVS +    AP+   GE+PY+++  + G +YYLYVHSYL +
Sbjct  187   FSETVAVADLGGGSVQMVYAVSREQAKKAPQVPQGEDPYIKKIVLKGKKYYLYVHSYLRF  246

Query  763   GQLASRAEIFKASGNSTNPCVLEGYDGYYTYNDVSYKVTAPPNGSSLKNCRKLARKVVDF  942
             G+ ASRAEI K +  S NPC+L GY G YTY+   YK  +P +GS+   C+++  K +  
Sbjct  247   GKEASRAEILKVTNGSPNPCILAGYHGTYTYSGEEYKAFSPASGSNFDECKEIILKALKV  306

Query  943   RAPCKYPNCTFNGVWSGGGGAGMENVDISSYFYDIAIDVGIIDEGKASKIVKPRSFLVAA  1122
               PC Y  C+F G+W+GGGG+G + + ++S FY +   V I D  K +  ++       A
Sbjct  307   NDPCPYGKCSFGGIWNGGGGSGQKTLYVTSSFYYVPTGVNIADPNKPNSKIRIEDLKTGA  366

Query  1123  KLACETKFEDVKSTFPNAVEKDYPYLCMDLVYQYTLLVDGLGLHPYKEITLMKKVEYKNY  1302
             +  C+TK++D K+T+P   E   PY C+DL+YQYTL VDG GL P +EIT+  ++EY++ 
Sbjct  367   EQVCKTKYKDAKATYPLIYEDSLPYACLDLIYQYTLFVDGFGLDPLQEITVANQIEYQDA  426

Query  1303  MVEAAWPLGCAIDVISS  1353
             +V+AAWPLG AI+ ISS
Sbjct  427   LVDAAWPLGNAIEAISS  443



>ref|XP_009132257.1| PREDICTED: apyrase 2-like [Brassica rapa]
Length=597

 Score =   429 bits (1102),  Expect = 1e-139, Method: Compositional matrix adjust.
 Identities = 222/419 (53%), Positives = 292/419 (70%), Gaps = 12/419 (3%)
 Frame = +1

Query  127   VLLNHEAG-------NYAVIFDAGSTGSRVHVFHFDENLDLLPVGDGVEFFLKITPGLSS  285
              +LN + G       NYAVIFDAGS+GSRVHV+ FD NLDLLP+G+ +E F+++ PGLS+
Sbjct  180   TVLNRKGGPNSRPPKNYAVIFDAGSSGSRVHVYCFDRNLDLLPLGNELELFVQLKPGLSA  239

Query  286   YADDPEAAAKSLEPLLLEAEGVVPTELQPDTPLELGATAGLRLLEGDASDKILQAVRDMF  465
             Y  DP  AA SL  LL +AE  VP EL+P TP+ +GATAGLR L  +AS+ ILQAV+++ 
Sbjct  240   YPTDPRQAANSLVSLLDKAEASVPRELRPKTPVRVGATAGLRTLGHEASENILQAVKELL  299

Query  466   KNESNFKSKAEWVSILEGSQEGTYFWVAMNYLLGNLGKGYQNTIATIDLGGGSVQVSYAV  645
             ++ S  K++A  V++L+G+QEG Y WV +NYLL NLGK Y +T+  +DLGGGSVQ++YA+
Sbjct  300   RDRSMLKTEANAVTVLDGTQEGAYQWVTINYLLRNLGKPYSDTVGVVDLGGGSVQMAYAI  359

Query  646   SGDTFANAPKPHNGEEPYVQEKYILGAQYYLYVHSYLNYGQLASRAEIFKASGNSTNPCV  825
             S +  A APKP  GE+ YV+E Y+ G +Y+LYVHSYL+YG LA+RAEI K S +S NPC+
Sbjct  360   SEEDAATAPKPLEGEDSYVREMYLKGRKYFLYVHSYLHYGLLAARAEILKVSEDSNNPCI  419

Query  826   LEGYDGYYTYNDVSYKVTAPPNGSSLKNCRKL---ARKVVDFRAPCKYPNCTFNGVWSGG  996
             + GYDG Y Y    +K  A  +G+SL  CR+L   A KV D    C +  CTF GVW+GG
Sbjct  420   VAGYDGTYKYGGDGFKAAAVQSGASLNECRRLTVNALKVND--TLCTHMKCTFGGVWNGG  477

Query  997   GGAGMENVDISSYFYDIAIDVGIIDEGKASKIVKPRSFLVAAKLACETKFEDVKSTFPNA  1176
              G G +N+ ++S+F+D A + G +D  +    V+P  F  AAK AC  K E+ KS FP  
Sbjct  478   RGGGQKNMFVASFFFDRAAEAGFVDPKQPVATVRPMDFEKAAKKACSMKIEEGKSKFPRV  537

Query  1177  VEKDYPYLCMDLVYQYTLLVDGLGLHPYKEITLMKKVEYKNYMVEAAWPLGCAIDVISS  1353
              E + PYLCMDLVYQYTLLVDG GL   +  TL+KKV+Y  + VEAAWPLG AI+ +SS
Sbjct  538   EEDNLPYLCMDLVYQYTLLVDGFGLEASQTTTLVKKVKYGEHAVEAAWPLGSAIEAVSS  596



>dbj|BAM84275.1| apyrase, partial [Medicago truncatula]
Length=500

 Score =   425 bits (1092),  Expect = 1e-139, Method: Compositional matrix adjust.
 Identities = 219/402 (54%), Positives = 291/402 (72%), Gaps = 1/402 (0%)
 Frame = +1

Query  151   NYAVIFDAGSTGSRVHVFHFDENLDLLPVGDGVEFFLKITPGLSSYADDPEAAAKSLEPL  330
             ++AV+FDAGS+GSRVHVF FD NL+L+ +G+ +E FL+I PGLS+YA DP+ AAKSL  L
Sbjct  97    SFAVVFDAGSSGSRVHVFRFDRNLELVKIGNDLEVFLQIKPGLSAYARDPQQAAKSLVSL  156

Query  331   LLEAEGVVPTELQPDTPLELGATAGLRLLEGDASDKILQAVRDMFKNESNFKSKAEWVSI  510
             L +AE VVP E +  TP+ +GATAGLR LEGDASD+ILQAVR++ K  S  KS+   V++
Sbjct  157   LDKAESVVPMEFRSMTPVRVGATAGLRALEGDASDRILQAVRELLKQRSTLKSEPNAVAV  216

Query  511   LEGSQEGTYFWVAMNYLLGNLGKGYQNTIATIDLGGGSVQVSYAVSGDTFANAPKPHNGE  690
             L+G+QEG + WV +NYLLG LG+ Y  T+  +DLGGGSVQ++YA+S  + A A K  NG 
Sbjct  217   LDGTQEGAFQWVTINYLLGKLGRDYSETVGVVDLGGGSVQMAYAISETSAAEASKIPNGG  276

Query  691   EPYVQEKYILGAQYYLYVHSYLNYGQLASRAEIFKASGNSTNPCVLEGYDGYYTYNDVSY  870
             EPYV+E ++ G +YYLYVHSYL YG LA+RAEI KAS +  NPC+L GYDG Y Y   S+
Sbjct  277   EPYVKEMFLRGRKYYLYVHSYLRYGLLAARAEILKASDDFGNPCILAGYDGSYKYGGKSF  336

Query  871   KVTAPPNGSSLKNCRKLARKVVDF-RAPCKYPNCTFNGVWSGGGGAGMENVDISSYFYDI  1047
               ++ P+GSSL  C+ +A   +    + C +  CTF G+W+GGGG G +N+ ++S+F+D 
Sbjct  337   NASSSPSGSSLNECKSMALNALTVNESTCTHMKCTFGGIWNGGGGDGQKNLFVASFFFDR  396

Query  1048  AIDVGIIDEGKASKIVKPRSFLVAAKLACETKFEDVKSTFPNAVEKDYPYLCMDLVYQYT  1227
             A   G  +       V+P  F  AAK AC+TK ED KST+P   + + PYLCMDLVYQYT
Sbjct  397   AAQAGFANPKSPVAKVRPVDFKSAAKQACQTKLEDAKSTYPLVDDGNLPYLCMDLVYQYT  456

Query  1228  LLVDGLGLHPYKEITLMKKVEYKNYMVEAAWPLGCAIDVISS  1353
             LLVDG GL P ++ITL+K+V+Y + +VEAAWPLG AI+ +SS
Sbjct  457   LLVDGFGLDPLQDITLVKQVKYHDSLVEAAWPLGSAIEAVSS  498



>emb|CAN80801.1| hypothetical protein VITISV_019811 [Vitis vinifera]
Length=465

 Score =   424 bits (1089),  Expect = 1e-139, Method: Compositional matrix adjust.
 Identities = 225/446 (50%), Positives = 304/446 (68%), Gaps = 26/446 (6%)
 Frame = +1

Query  58    LVFISLALLLFPLACFSRSHL--------RRVLLNHEAGNYAVIFDAGSTGSRVHVFHFD  213
             L+ IS  L L P    SRS          R+   + ++  YAVIFDAGS+GSRVHVF FD
Sbjct  30    LLLISFVLFLMPTTTTSRSGAFQQYPLVHRKASPHSQSRTYAVIFDAGSSGSRVHVFCFD  89

Query  214   ENLDLLPVGDGVEFFLKITPGLSSYADDPEAAAKSLEPLLLEAEGVVPTELQPDTPLELG  393
              +L+L+ +G  +E FL+  PGLS+Y   P+ AA+SL PLL +AE VVP +L+  TP+++G
Sbjct  90    SDLNLVHIGKDLELFLQRKPGLSAYPTXPQQAAESLLPLLDKAENVVPADLRRKTPVKVG  149

Query  394   ATAGLRLLEGDASDKILQA-----VRDMFKNESNFKSKAEWVSILEGSQEGTYFWVAMNY  558
             ATAGLR L  DASD+ILQA     V++  K++S  KSK EWV++L+GSQEG + WV +NY
Sbjct  150   ATAGLRALGIDASDRILQALSVPKVKNFLKDKSTLKSKPEWVTVLDGSQEGAFQWVTINY  209

Query  559   LLGNLGKGYQNTIATIDLGGGSVQVSYAVSGDTFANAPKPHNGEEPYVQEKYILGAQYYL  738
             LLGNLG+ Y +T+  +DLGGGSVQ++YA+S      APK  +GE+ YV+E Y+ G +Y+L
Sbjct  210   LLGNLGRKYSHTVGVVDLGGGSVQMAYAISETAAEKAPKISDGEDTYVKEMYLKGTKYFL  269

Query  739   YVHSYLNYGQLASRAEIFKASGNSTNPCVLEGYDGYYTYNDVSYKVTAPPNGSSLKNCRK  918
             YVHSYL+YG LA+RAEI K   +S NPC+L G+ G YTY  V+Y+ +A P+GSS++ CR+
Sbjct  270   YVHSYLHYGLLAARAEILKVE-SSENPCLLGGFHGTYTYGGVTYEASAHPSGSSMERCRR  328

Query  919   LARKVVDF-RAPCKYPNCTFNGVWSGGGGAGMENVDISSYFYDIAIDVGIIDEGKASKIV  1095
             +A + +    + C +  CTF G+W+GGGG G +N           +  G +D  +    V
Sbjct  329   VAFRALKVNESTCTHMKCTFGGIWNGGGGDGQKN-----------LFAGFVDRNQPVAKV  377

Query  1096  KPRSFLVAAKLACETKFEDVKSTFPNAVEKDYPYLCMDLVYQYTLLVDGLGLHPYKEITL  1275
             +P  F  AAK  CETK ED KS FP   E + PYLCMDLVYQ+TLL+DG GL P++EITL
Sbjct  378   QPMDFEDAAKRVCETKLEDAKSKFPLVEEANLPYLCMDLVYQFTLLIDGFGLDPWQEITL  437

Query  1276  MKKVEYKNYMVEAAWPLGCAIDVISS  1353
             +K+V+Y + +VEAAWPLG AID +SS
Sbjct  438   VKQVKYGDALVEAAWPLGSAIDAVSS  463



>ref|XP_008670728.1| PREDICTED: probable apyrase 3 [Zea mays]
 tpg|DAA41935.1| TPA: putative apyrase family protein [Zea mays]
Length=462

 Score =   423 bits (1088),  Expect = 2e-139, Method: Compositional matrix adjust.
 Identities = 224/456 (49%), Positives = 300/456 (66%), Gaps = 23/456 (5%)
 Frame = +1

Query  67    ISLALLLFPLACFSRSHLRRVLLNHEAG---------------------NYAVIFDAGST  183
             I++ +L   L+C S       +L  +AG                      YAVIFD GST
Sbjct  8     IAVLVLFLSLSCQSTVSAGAAVLGRKAGGSSPATTHEGTNPAGTGTGTAQYAVIFDGGST  67

Query  184   GSRVHVFHFDENLDLLPVGDGVEFFLKITPGLSSYADDPEAAAKSLEPLLLEAEGVVPTE  363
             GSRVHVF FD+ LDL+ +GD ++FF ++ PGLS YA +P+ AA+S+ PLL +A+G VP  
Sbjct  68    GSRVHVFKFDKQLDLVKIGDDIQFFAQVKPGLSEYAGEPQEAARSIAPLLEKAQGAVPAS  127

Query  364   LQPDTPLELGATAGLRLLEGDASDKILQAVRDMFKNESNFKSKAEWVSILEGSQEGTYFW  543
             LQ  TPL+LGATAGLRL+  + S++IL+A+RD+ K++S F+    W+++LEGSQEG+Y W
Sbjct  128   LQSTTPLKLGATAGLRLIGDEKSEEILEAIRDLVKSKSEFEYNPNWITVLEGSQEGSYLW  187

Query  544   VAMNYLLGNLGKGYQNTIATIDLGGGSVQVSYAVSGDTFANAPKPHNGEEPYVQEKYILG  723
             VA+NYLLG LG  Y +T+  +DLGGGSVQ++YA+S D  ANAP    G++PYV ++++ G
Sbjct  188   VALNYLLGKLGGDYSDTVGVVDLGGGSVQMAYAISDDASANAPAVPEGQDPYVTKEHLKG  247

Query  724   AQYYLYVHSYLNYGQLASRAEIFKASGNSTNPCVLEGYDGYYTYNDVSYKVTAPPNGSSL  903
               Y LYVHSYL+YG LA+RAEI KA+    +PC+L G+ G YTYN   Y+  A P G+S 
Sbjct  248   KHYNLYVHSYLHYGLLAARAEILKANNGPFSPCILRGFSGTYTYNGEEYEAAAAPEGASY  307

Query  904   KNCRKLARKVVDFRAPCKYPNCTFNGVWSGGGGAGMENVDISSYFYDIAIDVGIIDEGKA  1083
             + CR  A   ++  A C+  NCTFNGVW+GGGGAG  ++ ++SYFYD A  VGII     
Sbjct  308   EKCRDGAVAALNLGARCEAKNCTFNGVWNGGGGAGQADLYVASYFYDRASQVGIIGGDAP  367

Query  1084  SKIVKPRSFLVAAKLACETKFEDVKSTFPNAVEKDYPYLCMDLVYQYTLLVDGLGLHPYK  1263
             +    P +F  AA   C     D ++ FP+A   D  YLCMDLVY+YTLLVDG GL P K
Sbjct  368   NGRSTPAAFADAALKVCSLSVADAEAAFPDAW--DAEYLCMDLVYEYTLLVDGFGLEPTK  425

Query  1264  EITLMKKVEYKNYMVEAAWPLGCAIDVISSSSANNL  1371
             E TL+ KV+Y  Y V+AAWPLG AI+ +SS   N +
Sbjct  426   EFTLVTKVKYGEYYVDAAWPLGDAIETLSSQKLNQI  461



>ref|XP_004984507.1| PREDICTED: probable apyrase 1-like [Setaria italica]
Length=480

 Score =   424 bits (1089),  Expect = 2e-139, Method: Compositional matrix adjust.
 Identities = 214/404 (53%), Positives = 295/404 (73%), Gaps = 2/404 (0%)
 Frame = +1

Query  151   NYAVIFDAGSTGSRVHVFHFDENLDLLPVGDGVEFFLKITPGLSSYADDPEAAAKSLEPL  330
              YAVIFDAGS+GSRVHV+ FDENLDL+P+G  +E F +  PGLS++A+DP+ AA+SL  L
Sbjct  77    KYAVIFDAGSSGSRVHVYCFDENLDLVPIGKEIELFKQKKPGLSAHANDPQEAAESLISL  136

Query  331   LLEAEGVVPTELQPDTPLELGATAGLRLLEGDASDKILQAVRDMFKNESNFKSKAEWVSI  510
             L EAE VVP EL+  TP+ +GATAGLR L  + S++ILQAVR++ +++S+FKS+ +WV++
Sbjct  137   LEEAEKVVPVELRKQTPVRVGATAGLRALGTERSEEILQAVRELLRDKSSFKSQPDWVTV  196

Query  511   LEGSQEGTYFWVAMNYLLGNLGKGYQNTIATIDLGGGSVQVSYAVSGDTFANAPKPHNGE  690
             L+GSQEG + WV +NYLLG LGK Y +T+  +DLGGGSVQ++YA+S      AP   + E
Sbjct  197   LDGSQEGAFQWVTINYLLGKLGKPYSDTVGVVDLGGGSVQMAYAISEKDAVKAPDVSDDE  256

Query  691   EPYVQEKYILGAQYYLYVHSYLNYGQLASRAEIFKA-SGNSTNPCVLEGYDGYYTYNDVS  867
             + YV++  + G  YYLYVHSYL+YG LA+RAEIFKA  GN  + C+LEG+ G Y+Y D +
Sbjct  257   DSYVKKLLLKGTTYYLYVHSYLHYGLLAARAEIFKAGEGNDHSDCMLEGHHGKYSYGDNT  316

Query  868   YKVTAPPNGSSLKNCRKLARKVVDFRAP-CKYPNCTFNGVWSGGGGAGMENVDISSYFYD  1044
             ++ +  P+G+S   CR LA + +    P C +  CTF GVW+GGGG G +N+ ++S+F+D
Sbjct  317   FEASGSPSGASYSKCRALAVRALKVDEPACTHMKCTFGGVWNGGGGDGQKNLFVASFFFD  376

Query  1045  IAIDVGIIDEGKASKIVKPRSFLVAAKLACETKFEDVKSTFPNAVEKDYPYLCMDLVYQY  1224
              A + G +D   A+  VKP  F  AA+  C+   +D  +T+P+  E++ PYLC+DLVYQY
Sbjct  377   RAAEAGFVDPKAATAEVKPSDFEEAARRVCKLNVKDAHATYPDVSEENIPYLCIDLVYQY  436

Query  1225  TLLVDGLGLHPYKEITLMKKVEYKNYMVEAAWPLGCAIDVISSS  1356
             TLLVDG G+ PY++ITL+KKV Y +  VEAAWPLG AI+V SSS
Sbjct  437   TLLVDGFGVDPYQDITLVKKVSYGDSYVEAAWPLGSAIEVASSS  480



>ref|XP_006651340.1| PREDICTED: probable apyrase 1-like [Oryza brachyantha]
Length=488

 Score =   424 bits (1090),  Expect = 2e-139, Method: Compositional matrix adjust.
 Identities = 220/404 (54%), Positives = 293/404 (73%), Gaps = 2/404 (0%)
 Frame = +1

Query  151   NYAVIFDAGSTGSRVHVFHFDENLDLLPVGDGVEFFLKITPGLSSYADDPEAAAKSLEPL  330
              YAVIFDAGS+GSRVHV+ FD NLDLLP+G  +E F +  PGLS+YA+DP+ AAKSL  L
Sbjct  85    KYAVIFDAGSSGSRVHVYCFDGNLDLLPIGKEIELFKQKKPGLSAYANDPQEAAKSLVSL  144

Query  331   LLEAEGVVPTELQPDTPLELGATAGLRLLEGDASDKILQAVRDMFKNESNFKSKAEWVSI  510
             L EAE VVP EL+  TP+ +GATAGLR L  + S++ILQAVRD+ +++S+F+S+ EWV++
Sbjct  145   LEEAEKVVPVELREQTPVRVGATAGLRTLGTEKSEEILQAVRDLLQDKSSFRSQPEWVTV  204

Query  511   LEGSQEGTYFWVAMNYLLGNLGKGYQNTIATIDLGGGSVQVSYAVSGDTFANAPKPHNGE  690
             L+GSQEG + WV +NYLLG LG+ Y  T+  +DLGGGSVQ++YA+S    A APK   GE
Sbjct  205   LDGSQEGAFQWVTINYLLGKLGEPYSQTVGVVDLGGGSVQMAYAISEKDAAKAPKVSEGE  264

Query  691   EPYVQEKYILGAQYYLYVHSYLNYGQLASRAEIFKA-SGNSTNPCVLEGYDGYYTYNDVS  867
             + YV++  + GA YYLY+HSYL+YG LA+RAEI KA  GN  N C+LEG+ G Y Y D  
Sbjct  265   DSYVKKLLLKGATYYLYIHSYLHYGLLAARAEILKAGEGNDYNNCILEGHRGNYKYGDDI  324

Query  868   YKVTAPPNGSSLKNCRKLARKVVDFRAP-CKYPNCTFNGVWSGGGGAGMENVDISSYFYD  1044
              +V+   +G+S   CR +A + ++   P C +  CTF GVW+GGGG G +N+ ++S+F+D
Sbjct  325   VEVSGSSSGASYSKCRAVAVRALNVDEPACTHMKCTFGGVWNGGGGDGQKNLFVASFFFD  384

Query  1045  IAIDVGIIDEGKASKIVKPRSFLVAAKLACETKFEDVKSTFPNAVEKDYPYLCMDLVYQY  1224
              A + G ++   A   VKP  F  AA+  C+   +D ++T+P+  E++ PYLCMDLVYQY
Sbjct  385   RAAEAGFVNPKAADAKVKPSDFEEAARRVCKLNVKDAQATYPDVSEENIPYLCMDLVYQY  444

Query  1225  TLLVDGLGLHPYKEITLMKKVEYKNYMVEAAWPLGCAIDVISSS  1356
             TLLVDG GL PY++ITL+KKV Y N  VEAAWPLG AI+V SSS
Sbjct  445   TLLVDGFGLDPYQDITLVKKVPYSNSFVEAAWPLGSAIEVASSS  488



>dbj|BAM84273.1| apyrase [Medicago truncatula]
Length=455

 Score =   422 bits (1086),  Expect = 3e-139, Method: Compositional matrix adjust.
 Identities = 214/435 (49%), Positives = 298/435 (69%), Gaps = 9/435 (2%)
 Frame = +1

Query  76    ALLLFPLACFSRSHL--------RRVLLNHEA-GNYAVIFDAGSTGSRVHVFHFDENLDL  228
               LLF +   S S          R++    E   +YAV+FDAGSTGSRVHV+HFD+NLDL
Sbjct  9     TFLLFLMPTISSSQYLGNNILTNRKIFPKQETLTSYAVVFDAGSTGSRVHVYHFDQNLDL  68

Query  229   LPVGDGVEFFLKITPGLSSYADDPEAAAKSLEPLLLEAEGVVPTELQPDTPLELGATAGL  408
             L +G+ VEF+ K TPGLS+YAD+P+ AA+SL PLL +AE VVP  LQP TP++LGATAGL
Sbjct  69    LHIGNDVEFYNKTTPGLSAYADNPKEAAESLIPLLEQAERVVPVNLQPKTPVKLGATAGL  128

Query  409   RLLEGDASDKILQAVRDMFKNESNFKSKAEWVSILEGSQEGTYFWVAMNYLLGNLGKGYQ  588
             RLL+G++S+ IL+AV  + K  S F  +++ V I++G+QEG+Y WV +NY+LGNLGK + 
Sbjct  129   RLLDGNSSELILEAVSSLLKKRSTFNVQSDAVGIIDGTQEGSYLWVTINYVLGNLGKDFS  188

Query  589   NTIATIDLGGGSVQVSYAVSGDTFANAPKPHNGEEPYVQEKYILGAQYYLYVHSYLNYGQ  768
              T+A  DLGGGSVQ+ YAVS +    AP+   GE+PY+++  + G +YYLYVHSYL +G+
Sbjct  189   ETVAVADLGGGSVQMVYAVSREQAKKAPQVPQGEDPYIKKIVLKGKKYYLYVHSYLRFGK  248

Query  769   LASRAEIFKASGNSTNPCVLEGYDGYYTYNDVSYKVTAPPNGSSLKNCRKLARKVVDFRA  948
              ASRAEI K +  S NPC+L GY G YTY+   YK  +P +GS+   C+++  K +    
Sbjct  249   EASRAEILKVTNGSPNPCILAGYHGTYTYSGEEYKAFSPASGSNFDECKEIILKALKVND  308

Query  949   PCKYPNCTFNGVWSGGGGAGMENVDISSYFYDIAIDVGIIDEGKASKIVKPRSFLVAAKL  1128
             PC Y  CTF G+W+GGGG+G + + ++S FY +   V I D  K +  ++       A+ 
Sbjct  309   PCPYGKCTFGGIWNGGGGSGQKTLYVTSSFYYVPTGVNIADPNKPNSKIRIEDLKTGAEQ  368

Query  1129  ACETKFEDVKSTFPNAVEKDYPYLCMDLVYQYTLLVDGLGLHPYKEITLMKKVEYKNYMV  1308
              C+TK++D K+T+P   E   PY C+DL+YQYTL VDG GL P ++IT+  ++EY++ +V
Sbjct  369   VCKTKYKDAKATYPLIYEDSLPYACLDLIYQYTLFVDGFGLDPLQDITVANQIEYQDAVV  428

Query  1309  EAAWPLGCAIDVISS  1353
             +AAWPLG AI+ ISS
Sbjct  429   DAAWPLGNAIEAISS  443



>ref|XP_009125008.1| PREDICTED: apyrase 1-like [Brassica rapa]
Length=462

 Score =   422 bits (1086),  Expect = 3e-139, Method: Compositional matrix adjust.
 Identities = 220/437 (50%), Positives = 298/437 (68%), Gaps = 11/437 (3%)
 Frame = +1

Query  58    LVFISLALLLFPLACFSRSHLRRVLLNHEAG----NYAVIFDAGSTGSRVHVFHFDENLD  225
             +V I+L +LL P             LN   G     YAVIFDAGS+GSRVHV+ FD+NLD
Sbjct  31    IVLITLVILLMP------GTTSEYALNGGGGADSKKYAVIFDAGSSGSRVHVYCFDKNLD  84

Query  226   LLPVGDGVEFFLKITPGLSSYADDPEAAAKSLEPLLLEAEGVVPTELQPDTPLELGATAG  405
             L+P+ + +E FL++ PGLS+Y +DP  +A SL  LL +AE  VP EL+P T + +GATAG
Sbjct  85    LVPLENELELFLQLKPGLSAYPNDPRQSANSLVTLLDKAEDSVPNELRPKTHVRVGATAG  144

Query  406   LRLLEGDASDKILQAVRDMFKNESNFKSKAEWVSILEGSQEGTYFWVAMNYLLGNLGKGY  585
             LR L  +AS+ ILQAVR++ K+ S  K++A  V++L+G+QEG+Y WV +NYLL  LGK Y
Sbjct  145   LRALGHEASENILQAVRELLKDRSRLKTEANAVTVLDGTQEGSYQWVTINYLLKTLGKPY  204

Query  586   QNTIATIDLGGGSVQVSYAVSGDTFANAPKPHNGEEPYVQEKYILGAQYYLYVHSYLNYG  765
               T+  +DLGGGSVQ++YA+S    A APKP  GE+ YV+E Y+ G +Y+LYVHSYL+YG
Sbjct  205   SETVGVVDLGGGSVQMAYAISEKDAATAPKPLQGEDSYVREMYLKGRKYFLYVHSYLHYG  264

Query  766   QLASRAEIFKASGNSTNPCVLEGYDGYYTYNDVSYKVTAPPNGSSLKNCRKLARKVVD-F  942
              LA+RAEI K S  S NPC++ GYDG Y Y   ++K  A P+G+S+  C+++A K +   
Sbjct  265   LLAARAEILKVSEGSNNPCIVTGYDGTYKYGGTAFKAAASPSGASVDECKRVALKALKVI  324

Query  943   RAPCKYPNCTFNGVWSGGGGAGMENVDISSYFYDIAIDVGIIDEGKASKIVKPRSFLVAA  1122
              + C +  CTF GVW+GGGG G +N+ ++S+F+D A + G +D  +    V+P  F  AA
Sbjct  325   DSVCTHMKCTFGGVWNGGGGGGQKNMFVASFFFDRAAEAGFVDPSQPVATVRPADFEKAA  384

Query  1123  KLACETKFEDVKSTFPNAVEKDYPYLCMDLVYQYTLLVDGLGLHPYKEITLMKKVEYKNY  1302
               AC  K  + K+ FP   E + PYLC+DLVYQYTLLVDG GL P + ITL+KKV+Y  +
Sbjct  385   SQACNMKMGEGKTKFPRVEEDNLPYLCLDLVYQYTLLVDGFGLKPSQTITLVKKVKYGEH  444

Query  1303  MVEAAWPLGCAIDVISS  1353
              VEAAWPLG AI+ +SS
Sbjct  445   AVEAAWPLGSAIEAVSS  461



>ref|XP_002448918.1| hypothetical protein SORBIDRAFT_05g001560 [Sorghum bicolor]
 gb|EES07906.1| hypothetical protein SORBIDRAFT_05g001560 [Sorghum bicolor]
Length=468

 Score =   423 bits (1087),  Expect = 3e-139, Method: Compositional matrix adjust.
 Identities = 208/395 (53%), Positives = 277/395 (70%), Gaps = 1/395 (0%)
 Frame = +1

Query  148   GNYAVIFDAGSTGSRVHVFHFDENLDLLPVGD-GVEFFLKITPGLSSYADDPEAAAKSLE  324
             G YAVIF+AGSTG+RVHVF FD  L+LL +GD G+E F K+ PGLSSYA  P+ AA S+ 
Sbjct  55    GRYAVIFNAGSTGTRVHVFRFDRKLELLEIGDEGIEVFAKVKPGLSSYAGHPQEAANSIL  114

Query  325   PLLLEAEGVVPTELQPDTPLELGATAGLRLLEGDASDKILQAVRDMFKNESNFKSKAEWV  504
             PLL +A+ VVP +L   TPL LGATAGLRL+  + SD+IL+AVR++   ++ F++K EW+
Sbjct  115   PLLDKAKSVVPKQLMKRTPLRLGATAGLRLIGEEQSDQILEAVRNLVHTKTKFQTKPEWI  174

Query  505   SILEGSQEGTYFWVAMNYLLGNLGKGYQNTIATIDLGGGSVQVSYAVSGDTFANAPKPHN  684
             +++EGSQEG+Y WVA+NYLL  LG  Y  T+A +D+GGGSVQ++YA+S +T ANAP   +
Sbjct  175   NVIEGSQEGSYLWVALNYLLDKLGGDYSQTVAVVDMGGGSVQIAYAISANTAANAPVAPH  234

Query  685   GEEPYVQEKYILGAQYYLYVHSYLNYGQLASRAEIFKASGNSTNPCVLEGYDGYYTYNDV  864
             GE+PYV  +Y+ G  Y +Y HSYL+YG  ASRAEI KA     + C+L G+ G YTYN+ 
Sbjct  235   GEDPYVIREYLKGKDYNIYAHSYLHYGAFASRAEILKAKNGPFSSCMLRGFIGQYTYNEE  294

Query  865   SYKVTAPPNGSSLKNCRKLARKVVDFRAPCKYPNCTFNGVWSGGGGAGMENVDISSYFYD  1044
              Y  TA P G+    CR+   K ++  APC+  NCTFNG+W+GGGGAG +N+ ++S FY 
Sbjct  295   QYDATAAPEGAVYYKCREEIGKALNLNAPCETKNCTFNGIWNGGGGAGQDNLYVASSFYY  354

Query  1045  IAIDVGIIDEGKASKIVKPRSFLVAAKLACETKFEDVKSTFPNAVEKDYPYLCMDLVYQY  1224
             +A +VGIID    S    P +F  +A+  C+   E+ K  +PN  + D PYLCMDL YQY
Sbjct  355   VASEVGIIDGNAPSGETTPGAFRASAERVCQMSVEEAKIEYPNVNDVDVPYLCMDLAYQY  414

Query  1225  TLLVDGLGLHPYKEITLMKKVEYKNYMVEAAWPLG  1329
             TLLVDG G+   KEIT++ KV++  Y VEA WPL 
Sbjct  415   TLLVDGFGVEATKEITVVDKVKHGEYYVEAVWPLA  449



>ref|XP_008365001.1| PREDICTED: apyrase 2-like [Malus domestica]
Length=468

 Score =   422 bits (1086),  Expect = 3e-139, Method: Compositional matrix adjust.
 Identities = 229/433 (53%), Positives = 311/433 (72%), Gaps = 3/433 (1%)
 Frame = +1

Query  58    LVFISLALLLFPLACFSRSHLRRVLLNHEAGNYAVIFDAGSTGSRVHVFHFDENLDLLPV  237
             L+ +++ L + P     R+ L R L +  +  YAVIFDAGS+GSR+HVF FD NL LLP+
Sbjct  37    LLLLTMVLYVMPPGGNLRNQLPRKLPSKTS--YAVIFDAGSSGSRIHVFCFDHNLQLLPI  94

Query  238   GDGVEFFLKITPGLSSYADDPEAAAKSLEPLLLEAEGVVPTELQPDTPLELGATAGLRLL  417
             G  +E FL++ PGLS+YA DP +AA+SL  LL +AE  VP EL+  TP+ +GATAGLR L
Sbjct  95    GKDLELFLQVKPGLSAYAKDPRSAAESLTGLLDKAESAVPKELRSFTPVRVGATAGLRAL  154

Query  418   EGDASDKILQAVRDMFKNESNFKSKAEWVSILEGSQEGTYFWVAMNYLLGNLGKGYQNTI  597
             EGDASD+ILQAVRD+ K  S+  S+ + V++++G+QEG++ WV +NYLLGNLGK Y +T+
Sbjct  155   EGDASDRILQAVRDLLKQRSSLSSRPDAVTVIDGTQEGSFQWVTINYLLGNLGKKYSDTV  214

Query  598   ATIDLGGGSVQVSYAVSGDTFANAPKPHNGEEPYVQEKYILGAQYYLYVHSYLNYGQLAS  777
               +DLGGGSVQ++YA+S    A APK  +GE+ YV++  + G +Y LYVHSYL+YG LA+
Sbjct  215   GVVDLGGGSVQMAYAISEADAAKAPKLSDGEDVYVRQMNLKGVKYNLYVHSYLHYGLLAA  274

Query  778   RAEIFKASGNSTNPCVLEGYDGYYTYNDVSYKVTAPPNGSSLKNCRKLARKVVDF-RAPC  954
             RAEI K S +S NPC+L GY G Y Y   SYK +A  +GSS++ CR++  K +    A C
Sbjct  275   RAEILKVSEDSGNPCILAGYYGSYAYGGQSYKASASSSGSSVEECRRVVTKALKVNEATC  334

Query  955   KYPNCTFNGVWSGGGGAGMENVDISSYFYDIAIDVGIIDEGKASKIVKPRSFLVAAKLAC  1134
              +  CTF GVW+GGGG G  N+ ++S+F+D A + G ++  +    V P +F  AAK AC
Sbjct  335   SHMKCTFGGVWNGGGGDGQRNLFVASFFFDRAAEAGFVNPNEPIAKVHPGNFEEAAKRAC  394

Query  1135  ETKFEDVKSTFPNAVEKDYPYLCMDLVYQYTLLVDGLGLHPYKEITLMKKVEYKNYMVEA  1314
             ETK ED KST+P   E + P+LCMDLVYQ +LLVDG GL P+++ITL+KKV+Y+N +VEA
Sbjct  395   ETKLEDAKSTYPRVEEGNLPFLCMDLVYQSSLLVDGFGLDPWQDITLVKKVKYQNSLVEA  454

Query  1315  AWPLGCAIDVISS  1353
             AWPLG AI+ +SS
Sbjct  455   AWPLGSAIEAVSS  467



>ref|XP_002442736.1| hypothetical protein SORBIDRAFT_08g001970 [Sorghum bicolor]
 gb|EES16574.1| hypothetical protein SORBIDRAFT_08g001970 [Sorghum bicolor]
Length=468

 Score =   421 bits (1082),  Expect = 2e-138, Method: Compositional matrix adjust.
 Identities = 198/401 (49%), Positives = 277/401 (69%), Gaps = 0/401 (0%)
 Frame = +1

Query  148   GNYAVIFDAGSTGSRVHVFHFDENLDLLPVGDGVEFFLKITPGLSSYADDPEAAAKSLEP  327
             G YAVIFDAGSTG+R+HVF FD  +DL+ +G G+EFF K+ PGLSSYA+ P+ AA S+ P
Sbjct  60    GRYAVIFDAGSTGTRMHVFRFDNKMDLVGIGHGIEFFAKVKPGLSSYAERPQEAANSILP  119

Query  328   LLLEAEGVVPTELQPDTPLELGATAGLRLLEGDASDKILQAVRDMFKNESNFKSKAEWVS  507
             L+ +A+ +VP++L   TPL+LGATAGLRL+  + +DKILQAVRD+  ++S F+   +W++
Sbjct  120   LVKKAKSIVPSQLTERTPLKLGATAGLRLIGDEQADKILQAVRDLVHSKSQFQYNPDWIN  179

Query  508   ILEGSQEGTYFWVAMNYLLGNLGKGYQNTIATIDLGGGSVQVSYAVSGDTFANAPKPHNG  687
             ++EG QEG+Y WVA+NYLL  LG  Y  T+  +D+GGGS+Q++YA+S +  A APK  +G
Sbjct  180   VIEGYQEGSYLWVALNYLLDKLGGDYSQTVGVVDMGGGSMQMAYAISANDAAKAPKVPDG  239

Query  688   EEPYVQEKYILGAQYYLYVHSYLNYGQLASRAEIFKASGNSTNPCVLEGYDGYYTYNDVS  867
             ++ YV ++Y+ G  Y +Y HSYL+YG LA+R +I  A     + C+L G+ G YTYN   
Sbjct  240   KDRYVTKEYLKGKDYNIYAHSYLHYGALAARVKILNAKNGQFSLCMLRGFRGNYTYNGQQ  299

Query  868   YKVTAPPNGSSLKNCRKLARKVVDFRAPCKYPNCTFNGVWSGGGGAGMENVDISSYFYDI  1047
             Y  TA P G+  + CR+   K ++  APC   +CTF+GVW+GG GAG +N+ +SS F+ +
Sbjct  300   YDATASPQGAVYEKCREEIAKALNMNAPCNTKSCTFDGVWNGGRGAGQDNLYLSSSFHYV  359

Query  1048  AIDVGIIDEGKASKIVKPRSFLVAAKLACETKFEDVKSTFPNAVEKDYPYLCMDLVYQYT  1227
             A  VGIID    S    P +F V AK  C+   ++VK  +P   +   PYLC+DL Y YT
Sbjct  360   ATRVGIIDGKLPSARSTPSAFRVVAKRVCQMSVKEVKVAYPMVEDISVPYLCLDLTYLYT  419

Query  1228  LLVDGLGLHPYKEITLMKKVEYKNYMVEAAWPLGCAIDVIS  1350
             +LVDG GL   K+ITL+ KV++  Y VEAAWPLG AI+ +S
Sbjct  420   VLVDGFGLKSIKKITLVSKVKHGEYYVEAAWPLGTAIEALS  460



>ref|XP_010518233.1| PREDICTED: apyrase 1-like [Camelina sativa]
Length=468

 Score =   421 bits (1082),  Expect = 2e-138, Method: Compositional matrix adjust.
 Identities = 223/459 (49%), Positives = 310/459 (68%), Gaps = 15/459 (3%)
 Frame = +1

Query  22    KHNTMKHTSHHH---LVFISLALLLFPLACF----SRSHLRRVLLNHEAG-------NYA  159
             +H ++    H H   L+ IS+ ++L  L       S + +   + +HE G       NYA
Sbjct  9     RHESLADKIHRHRGLLLVISIPIVLIALVLLLMPGSSTSVSVTMKSHEGGSNSRGPKNYA  68

Query  160   VIFDAGSTGSRVHVFHFDENLDLLPVGDGVEFFLKITPGLSSYADDPEAAAKSLEPLLLE  339
             VIFDAGS+GSRVHV+ FD+NLDL+P+ + +E FL++ PGLS+Y +DP  +A SL  LL +
Sbjct  69    VIFDAGSSGSRVHVYCFDQNLDLVPLENELELFLQLKPGLSAYPNDPRQSANSLVSLLDK  128

Query  340   AEGVVPTELQPDTPLELGATAGLRLLEGDASDKILQAVRDMFKNESNFKSKAEWVSILEG  519
             AE  VP EL+P TP+ +GATAGLR L   AS+ ILQAVR++ K+ S  K++A  V++L+G
Sbjct  129   AEASVPRELRPKTPVRVGATAGLRALGHKASENILQAVRELLKDRSRLKTEANAVTVLDG  188

Query  520   SQEGTYFWVAMNYLLGNLGKGYQNTIATIDLGGGSVQVSYAVSGDTFANAPKPHNGEEPY  699
             +QEG+Y WV +NYLL  LGK Y +T+  +DLGGGSVQ++YA+S +  A APKP  GE+ Y
Sbjct  189   TQEGSYQWVTINYLLRTLGKPYSDTVGVVDLGGGSVQMAYAISEEDAATAPKPLEGEDSY  248

Query  700   VQEKYILGAQYYLYVHSYLNYGQLASRAEIFKASGNSTNPCVLEGYDGYYTYNDVSYKVT  879
             V+E Y+ G +Y+LYVHSYL+YG LA+RAEI K S +S NPC++ G+ G Y Y   ++K  
Sbjct  249   VREMYLKGRKYFLYVHSYLHYGLLAARAEILKVSEDSNNPCIVTGHSGTYKYGGNAFKAI  308

Query  880   APPNGSSLKNCRKLARKVVDFR-APCKYPNCTFNGVWSGGGGAGMENVDISSYFYDIAID  1056
                +G+SL  CR++A   +    + C +  CTF GVW+GGGG G + + ++S+F+D A +
Sbjct  309   GSSSGASLDECRRVAINALKVNDSLCTHMKCTFGGVWNGGGGGGQKKIFVASFFFDRAAE  368

Query  1057  VGIIDEGKASKIVKPRSFLVAAKLACETKFEDVKSTFPNAVEKDYPYLCMDLVYQYTLLV  1236
              G +D  +    V+P  F  AA  AC  + E+ KS FP   E + PYLC+DLVYQYTLLV
Sbjct  369   AGFVDPKQPVAEVRPLDFEKAANKACNMRMEEGKSKFPRVEEDNLPYLCLDLVYQYTLLV  428

Query  1237  DGLGLHPYKEITLMKKVEYKNYMVEAAWPLGCAIDVISS  1353
             DG GL P + ITL+KKV+Y +Y VEAAWPLG AI+ +SS
Sbjct  429   DGFGLKPSQTITLVKKVKYGDYAVEAAWPLGSAIEAVSS  467



>ref|XP_002461227.1| hypothetical protein SORBIDRAFT_02g043200 [Sorghum bicolor]
 gb|EER97748.1| hypothetical protein SORBIDRAFT_02g043200 [Sorghum bicolor]
Length=467

 Score =   421 bits (1081),  Expect = 2e-138, Method: Compositional matrix adjust.
 Identities = 212/405 (52%), Positives = 290/405 (72%), Gaps = 1/405 (0%)
 Frame = +1

Query  145   AGNYAVIFDAGSTGSRVHVFHFDENLDLLPVGDGVEFFLKITPGLSSYADDPEAAAKSLE  324
             A  YAVIFDAGS+GSRVHVF FD NLDL+ +G  +E F++  PGLS+Y +DP  AA+SL 
Sbjct  63    ADKYAVIFDAGSSGSRVHVFRFDSNLDLVHIGSEIELFVQKKPGLSAYGNDPREAAESLV  122

Query  325   PLLLEAEGVVPTELQPDTPLELGATAGLRLLEGDASDKILQAVRDMFKNESNFKSKAEWV  504
              LL EA+ VVP EL+  TP+ +GATAGLR L    S+ ILQAVRD+ + +S+FK+K +WV
Sbjct  123   SLLDEAKRVVPVELRDQTPVRVGATAGLRNLGAQKSEAILQAVRDLLREKSSFKNKEDWV  182

Query  505   SILEGSQEGTYFWVAMNYLLGNLGKGYQNTIATIDLGGGSVQVSYAVSGDTFANAPKPHN  684
             ++L+G+QEG Y WV +NYLLGNLGK Y +T+  +DLGGGSVQ++YA++      APKP +
Sbjct  183   TVLDGTQEGAYEWVTINYLLGNLGKTYADTVGVVDLGGGSVQMAYAIAEKDAEKAPKPSD  242

Query  685   GEEPYVQEKYILGAQYYLYVHSYLNYGQLASRAEIFKA-SGNSTNPCVLEGYDGYYTYND  861
             GE+ YV++ ++ G  YYLYVHSYL+YG LA+RAE+ KA +GN  + C+LEG+ G Y Y D
Sbjct  243   GEDAYVKKLFLKGTTYYLYVHSYLHYGLLAARAEVLKAGNGNGYSNCMLEGFQGQYKYGD  302

Query  862   VSYKVTAPPNGSSLKNCRKLARKVVDFRAPCKYPNCTFNGVWSGGGGAGMENVDISSYFY  1041
              S++ +A P+G+S   C+  A K +     C +  C+F G+W+GGGGAG +N+ ++S+F+
Sbjct  303   DSFEASASPSGASYSKCKDDAVKALKVDEACTHMKCSFGGIWNGGGGAGQKNLFVASFFF  362

Query  1042  DIAIDVGIIDEGKASKIVKPRSFLVAAKLACETKFEDVKSTFPNAVEKDYPYLCMDLVYQ  1221
             D A + G ++   A   VKP  F  AA+ AC    ++ ++TFP   + + PY+CMDLVYQ
Sbjct  363   DRAAEAGFVNANAAVAKVKPSDFRQAAERACSLSVKNAEATFPGVPKDNIPYICMDLVYQ  422

Query  1222  YTLLVDGLGLHPYKEITLMKKVEYKNYMVEAAWPLGCAIDVISSS  1356
             YTLLVDG G+ P  E+TL+KKV Y +  VEAAWPLG AI+V SSS
Sbjct  423   YTLLVDGFGVDPNHEMTLVKKVPYSDAYVEAAWPLGSAIEVASSS  467



>ref|XP_009130420.1| PREDICTED: apyrase 1 [Brassica rapa]
 emb|CDY50882.1| BnaA05g37430D [Brassica napus]
Length=468

 Score =   421 bits (1081),  Expect = 2e-138, Method: Compositional matrix adjust.
 Identities = 227/461 (49%), Positives = 306/461 (66%), Gaps = 19/461 (4%)
 Frame = +1

Query  22    KHNTMKHTSHHH----------LVFISLALLLFPLACFSRSHLRRVLLNHEAG------N  153
             +H ++    H H          +V I+L +LL P A  S S +    L    G       
Sbjct  9     RHESLSDKIHRHRSVLLLISIPVVLITLVILLMPGA--STSVIEEYALKSSEGGGSNSRK  66

Query  154   YAVIFDAGSTGSRVHVFHFDENLDLLPVGDGVEFFLKITPGLSSYADDPEAAAKSLEPLL  333
             YAVIFDAGS+GSRVHV+ FDENLDL+P+ + +E FL++ PGLS+Y +DP  +A SL  LL
Sbjct  67    YAVIFDAGSSGSRVHVYCFDENLDLVPLENELELFLQLKPGLSAYPNDPRQSANSLVSLL  126

Query  334   LEAEGVVPTELQPDTPLELGATAGLRLLEGDASDKILQAVRDMFKNESNFKSKAEWVSIL  513
              +AE  VP EL+P TP+ +GATAGLR L   AS+ IL+AVR++ K+ S  K++A  V++L
Sbjct  127   DKAEASVPHELRPKTPVRVGATAGLRALGHKASENILEAVRELLKDRSRLKTEANAVTVL  186

Query  514   EGSQEGTYFWVAMNYLLGNLGKGYQNTIATIDLGGGSVQVSYAVSGDTFANAPKPHNGEE  693
             +G+QEG+Y WV +NYLL  LGK Y  T+  +DLGGGSVQ++YA+S +  A APKP  GE+
Sbjct  187   DGTQEGSYQWVTINYLLKTLGKPYSETVGVVDLGGGSVQMAYAISEEDAATAPKPLQGED  246

Query  694   PYVQEKYILGAQYYLYVHSYLNYGQLASRAEIFKASGNSTNPCVLEGYDGYYTYNDVSYK  873
              YV+E Y+ G +Y+LYVHSYL+YG LA+RAEI K S  S NPC++ GYDG Y Y   ++K
Sbjct  247   SYVREMYLKGRKYFLYVHSYLHYGLLAARAEILKVSEGSNNPCIVTGYDGTYKYGGKAFK  306

Query  874   VTAPPNGSSLKNCRKLARKVVDFR-APCKYPNCTFNGVWSGGGGAGMENVDISSYFYDIA  1050
               A  +G+SL  CR++A   +    + C +  CTF GVW+GGGG G +N+ ++S+F+D A
Sbjct  307   AAASSSGASLDECRRVALNALKVNDSVCTHMKCTFGGVWNGGGGGGQKNMFVASFFFDRA  366

Query  1051  IDVGIIDEGKASKIVKPRSFLVAAKLACETKFEDVKSTFPNAVEKDYPYLCMDLVYQYTL  1230
              + G +D  +    V+P  F  AA  AC  K  + KS FP   E + PYLC+DLVYQYTL
Sbjct  367   AEAGFVDPTQPVATVRPADFEKAASQACNMKMGEGKSKFPRVEEDNIPYLCLDLVYQYTL  426

Query  1231  LVDGLGLHPYKEITLMKKVEYKNYMVEAAWPLGCAIDVISS  1353
             LVDG GL P + ITL+KKV+Y  + VEAAWPLG AI+ +SS
Sbjct  427   LVDGFGLKPSQTITLVKKVKYGEHAVEAAWPLGSAIEAVSS  467



>ref|XP_009399920.1| PREDICTED: probable apyrase 2 isoform X2 [Musa acuminata subsp. 
malaccensis]
Length=470

 Score =   420 bits (1080),  Expect = 3e-138, Method: Compositional matrix adjust.
 Identities = 216/403 (54%), Positives = 287/403 (71%), Gaps = 4/403 (1%)
 Frame = +1

Query  151   NYAVIFDAGSTGSRVHVFHFDENLDLLPVGDGVEFFLKITPGLSSYADDPEAAAKSLEPL  330
             +YAVIFDAGS+GSRVHV+ FD NLDLL +G  +E F + TPGLS YA +P+ AA SL PL
Sbjct  69    SYAVIFDAGSSGSRVHVYCFDVNLDLLSIGKEIELFEQRTPGLSFYAKNPQEAANSLLPL  128

Query  331   LLEAEGVVPTELQPDTPLELGATAGLRLLEGDASDKILQAVRDMFKNESNFKSKAEWVSI  510
             L +AE V+P EL+  TP+ +GATAGLR L    +++ILQAVRD+ + +S+ K +++WV++
Sbjct  129   LEKAESVIPAELRRTTPVRVGATAGLRALGAVTAEQILQAVRDLLRQKSSLKFQSDWVTV  188

Query  511   LEGSQEGTYFWVAMNYLLGNLGKGYQNTIATIDLGGGSVQVSYAVSGDTFANAPKPHNGE  690
             L+G+QEG + WV +NYLLG LGK Y +T+  +DLGGGSVQ++YA+S +  ANAPK  N E
Sbjct  189   LDGTQEGAFQWVTINYLLGKLGKSYWDTVGVVDLGGGSVQMAYAISENDAANAPKISNEE  248

Query  691   EPYVQEKYILGAQYYLYVHSYLNYGQLASRAEIFKAS-GNSTNPCVLEGYDGYYTYNDVS  867
               YVQ+ ++ G  Y+LYVHSYL+YG LA RAEI KA+ GNS   C+L+GY+G Y Y +  
Sbjct  249   HSYVQQLFLKGTSYHLYVHSYLHYGLLAVRAEILKAADGNSK--CILDGYNGSYKYGEKE  306

Query  868   YKVTAPPNGSSLKNCRKLARKVVDFRAP-CKYPNCTFNGVWSGGGGAGMENVDISSYFYD  1044
             YK  A P+G+S   CR    K +    P C +  CTF GVW+GGGG G  N+ ++S+F+D
Sbjct  307   YKAVASPSGASYSKCRSDTIKALKVDEPTCTHMKCTFGGVWNGGGGDGQRNLFVASFFFD  366

Query  1045  IAIDVGIIDEGKASKIVKPRSFLVAAKLACETKFEDVKSTFPNAVEKDYPYLCMDLVYQY  1224
              A++ G +D       VKP  F V AK AC+   E  K+T+P   + + PYLCMDLVYQ+
Sbjct  367   RAVEAGFVDHKVPVAKVKPAEFKVVAKHACKLNVEKAKATYPRVQDNNLPYLCMDLVYQF  426

Query  1225  TLLVDGLGLHPYKEITLMKKVEYKNYMVEAAWPLGCAIDVISS  1353
             TLLVDG GL PY+EITL+KKV+Y +  VEAAWPLG AI+V S+
Sbjct  427   TLLVDGFGLDPYQEITLVKKVKYGDAFVEAAWPLGSAIEVAST  469



>ref|XP_002884427.1| ATAPY1 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH60686.1| ATAPY1 [Arabidopsis lyrata subsp. lyrata]
Length=471

 Score =   420 bits (1079),  Expect = 6e-138, Method: Compositional matrix adjust.
 Identities = 227/462 (49%), Positives = 310/462 (67%), Gaps = 18/462 (4%)
 Frame = +1

Query  22    KHNTMKHTSHHH---LVFISL-------ALLLFPLACFSRSHLRRVLLNHEAG-------  150
             +H ++    H H   L+ IS+        LLL P    S S +   +  HE G       
Sbjct  9     RHESLADKVHRHRGLLLVISIPIVLIALVLLLMPGTSTSVSVIEYTMKKHEGGSNSRGPK  68

Query  151   NYAVIFDAGSTGSRVHVFHFDENLDLLPVGDGVEFFLKITPGLSSYADDPEAAAKSLEPL  330
             NYAVIFDAGS+GSRVHV+ FD+NLDL+P+ + +E FL++ PGLS+Y +DP  +A SL  L
Sbjct  69    NYAVIFDAGSSGSRVHVYCFDQNLDLVPLENELELFLQLKPGLSAYPNDPRQSANSLVSL  128

Query  331   LLEAEGVVPTELQPDTPLELGATAGLRLLEGDASDKILQAVRDMFKNESNFKSKAEWVSI  510
             L +AE  VP EL+P TP+ +GATAGLR L   AS+ ILQAVR++ K+ S  K++A  V++
Sbjct  129   LDKAEASVPRELRPKTPVRVGATAGLRALGHQASENILQAVRELLKDRSRLKTEANAVTV  188

Query  511   LEGSQEGTYFWVAMNYLLGNLGKGYQNTIATIDLGGGSVQVSYAVSGDTFANAPKPHNGE  690
             L+G+QEG+Y WV +NYLL  LGK Y +T+  +DLGGGSVQ++YA+  +  A APKP  GE
Sbjct  189   LDGAQEGSYQWVTINYLLRTLGKPYSDTVGVVDLGGGSVQMAYAIPEEDAATAPKPLEGE  248

Query  691   EPYVQEKYILGAQYYLYVHSYLNYGQLASRAEIFKASGNSTNPCVLEGYDGYYTYNDVSY  870
             + YV+E Y+ G +Y+LYVHSYL+YG LA+RAEI K S +S NPC++ G+ G Y Y   ++
Sbjct  249   DSYVKEMYLKGRKYFLYVHSYLHYGLLAARAEILKVSEDSNNPCIVTGFAGTYKYGGKAF  308

Query  871   KVTAPPNGSSLKNCRKLARKVVDFR-APCKYPNCTFNGVWSGGGGAGMENVDISSYFYDI  1047
             K  A P+G+SL  CR++A   +    + C +  CTF GVW+GGGG G + + ++S+F+D 
Sbjct  309   KAAAAPSGASLDECRRVAINALKVNDSLCTHMKCTFGGVWNGGGGGGQKKMFVASFFFDR  368

Query  1048  AIDVGIIDEGKASKIVKPRSFLVAAKLACETKFEDVKSTFPNAVEKDYPYLCMDLVYQYT  1227
             A + G +D  +    V+P  F  AA  AC  + E+ KS FP   E + PYLC+DLVYQYT
Sbjct  369   AAEAGFVDPKQPVAEVRPLDFEKAANKACNMRMEEGKSKFPRVEEDNLPYLCLDLVYQYT  428

Query  1228  LLVDGLGLHPYKEITLMKKVEYKNYMVEAAWPLGCAIDVISS  1353
             LLVDG GL P + ITL+KKV+Y +Y VEAAWPLG AI+ +SS
Sbjct  429   LLVDGFGLKPSQTITLVKKVKYGDYAVEAAWPLGSAIEAVSS  470



>dbj|BAD13519.1| apyrase [Pisum sativum]
Length=455

 Score =   419 bits (1076),  Expect = 8e-138, Method: Compositional matrix adjust.
 Identities = 227/437 (52%), Positives = 304/437 (70%), Gaps = 10/437 (2%)
 Frame = +1

Query  73    LALLLFPLACFSRSHL--------RRVLLNHEA-GNYAVIFDAGSTGSRVHVFHFDENLD  225
             +  LLF +   + S          R++ L  E   +YAV+FDAGSTGSR+HV+HF++NLD
Sbjct  8     ITFLLFSMPAITSSQYLGNNLLTSRKIFLKQEEISSYAVVFDAGSTGSRIHVYHFNQNLD  67

Query  226   LLPVGDGVEFFLKITPGLSSYADDPEAAAKSLEPLLLEAEGVVPTELQPDTPLELGATAG  405
             LL +G GVE++ KITPGLSSYA++PE AAKSL PLL +AE VVP +LQP TP+ LGA AG
Sbjct  68    LLHIGKGVEYYNKITPGLSSYANNPEQAAKSLIPLLEQAEDVVPDDLQPKTPVRLGALAG  127

Query  406   LRLLEGDASDKILQAVRDMFKNESNFKSKAEWVSILEGSQEGTYFWVAMNYLLGNLGKGY  585
             LRLL GDAS+KILQ+VRDM  N S F  + + VSI++G+QEG+Y WV +NY LGNLGK Y
Sbjct  128   LRLLNGDASEKILQSVRDMLSNRSTFNVQPDAVSIIDGTQEGSYLWVTVNYALGNLGKKY  187

Query  586   QNTIATIDLGGGSVQVSYAVSGDTFANAPKPHNGEEPYVQEKYILGAQYYLYVHSYLNYG  765
               T+  IDLGGGSVQ++YAVS  T  NAPK  +G++PY+++  + G  Y LYVHSYL++G
Sbjct  188   TKTVGVIDLGGGSVQMAYAVSKKTAKNAPKVADGDDPYIKKVVLKGIPYDLYVHSYLHFG  247

Query  766   QLASRAEIFKASGNSTNPCVLEGYDGYYTYNDVSYKVTAPPNGSSLKNCRKLARKVVDFR  945
             + ASRAEI K +  S NPC+L G++G YTY+   +K TA   G++   C+   RK +   
Sbjct  248   REASRAEILKLTPRSPNPCLLAGFNGIYTYSGREFKATAYTFGATFNKCKNTIRKALKLN  307

Query  946   APCKYPNCTFNGVWSGGGGAGMENVDISSYFYDIAIDVGIIDEGKASKIVKPRSFLVAAK  1125
              PC Y NCTF G+W+GGGG G + +  SS F+ +  D G++D    + I++P      AK
Sbjct  308   YPCPYQNCTFGGIWNGGGGNGQKTLVASSSFFYLPEDAGMVDASTPNFILRPVDIETKAK  367

Query  1126  LACETKFEDVKSTFPNAVEKDY-PYLCMDLVYQYTLLVDGLGLHPYKEITLMKKVEYKNY  1302
              AC   FED KST+P   +K+   Y+CMDL+YQY LLVDG GL P ++IT  K++EY++ 
Sbjct  368   EACALNFEDAKSTYPFLDKKNVASYVCMDLIYQYVLLVDGFGLDPLQKITSGKEIEYQDA  427

Query  1303  MVEAAWPLGCAIDVISS  1353
             +VEAAWPLG A++ IS+
Sbjct  428   IVEAAWPLGNAVEAISA  444



>gb|AES80807.2| Nod factor-binding lectin-nucleotide phosphohydrolase [Medicago 
truncatula]
Length=457

 Score =   419 bits (1076),  Expect = 9e-138, Method: Compositional matrix adjust.
 Identities = 214/439 (49%), Positives = 299/439 (68%), Gaps = 9/439 (2%)
 Frame = +1

Query  64    FISLALLLFPLACFSRSHLRRVLLNHEA-------GNYAVIFDAGSTGSRVHVFHFDENL  222
              I+  L L P    S+     +L N +         +YAV+FDAGSTGSRVHV+HFD+NL
Sbjct  7     LITFLLFLMPTISSSQYLGNNILTNRKIFPKQETLTSYAVVFDAGSTGSRVHVYHFDQNL  66

Query  223   DLLPVGDGVEFFLKITPGLSSYADDPEAAAKSLEPLLLEAEGVVPTELQPDTPLELGATA  402
             DLL +G+ VEF+ K TPGLS+YAD+P+ AA+SL PLL +AE VVP  LQP TP++LGATA
Sbjct  67    DLLHIGNDVEFYNKTTPGLSAYADNPKEAAESLIPLLEQAERVVPVNLQPKTPVKLGATA  126

Query  403   GLRLLEGDASDKILQAV--RDMFKNESNFKSKAEWVSILEGSQEGTYFWVAMNYLLGNLG  576
             GLRLL+G++S+ IL+AV    + K  S F  +++ V I++G+QEG+Y WV +NY+LGNLG
Sbjct  127   GLRLLDGNSSELILEAVIVSSLLKKRSTFNVQSDAVGIIDGTQEGSYLWVTINYVLGNLG  186

Query  577   KGYQNTIATIDLGGGSVQVSYAVSGDTFANAPKPHNGEEPYVQEKYILGAQYYLYVHSYL  756
             K +  T+A  DLGGGSVQ+ YAVS +    AP+   GE+PY+++  + G +YYLYVHSYL
Sbjct  187   KDFSETVAVADLGGGSVQMVYAVSREQAKKAPQVPQGEDPYIKKIVLKGKKYYLYVHSYL  246

Query  757   NYGQLASRAEIFKASGNSTNPCVLEGYDGYYTYNDVSYKVTAPPNGSSLKNCRKLARKVV  936
              +G+ ASRAEI K +  S NPC+L GY G YTY+   YK  +P +GS+   C+++  K +
Sbjct  247   RFGKEASRAEILKVTNGSPNPCILAGYHGTYTYSGEEYKAFSPASGSNFDECKEIILKAL  306

Query  937   DFRAPCKYPNCTFNGVWSGGGGAGMENVDISSYFYDIAIDVGIIDEGKASKIVKPRSFLV  1116
                 PC Y  C+F G+W+GGGG+G + + ++S FY +   V I D  K +  ++      
Sbjct  307   KVNDPCPYGKCSFGGIWNGGGGSGQKTLYVTSSFYYVPTGVNIADPNKPNSKIRIEDLKT  366

Query  1117  AAKLACETKFEDVKSTFPNAVEKDYPYLCMDLVYQYTLLVDGLGLHPYKEITLMKKVEYK  1296
              A+  C+TK++D K+T+P   E   PY C+DL+YQYTL VDG GL P +EIT+  ++EY+
Sbjct  367   GAEQVCKTKYKDAKATYPLIYEDSLPYACLDLIYQYTLFVDGFGLDPLQEITVANQIEYQ  426

Query  1297  NYMVEAAWPLGCAIDVISS  1353
             + +V+AAWPLG AI+ ISS
Sbjct  427   DALVDAAWPLGNAIEAISS  445



>sp|Q8H7L6.1|APY1_ORYSJ RecName: Full=Probable apyrase 1; Short=OsAPY1; AltName: Full=ATP-diphosphatase; 
AltName: Full=ATP-diphosphohydrolase; AltName: 
Full=Adenosine diphosphatase; Short=ADPase [Oryza sativa 
Japonica Group]
 gb|AAN65004.1| Putative apyrase [Oryza sativa Japonica Group]
 gb|ABF95735.1| Nucleoside-triphosphatase, putative, expressed [Oryza sativa 
Japonica Group]
Length=489

 Score =   420 bits (1079),  Expect = 1e-137, Method: Compositional matrix adjust.
 Identities = 216/404 (53%), Positives = 287/404 (71%), Gaps = 2/404 (0%)
 Frame = +1

Query  151   NYAVIFDAGSTGSRVHVFHFDENLDLLPVGDGVEFFLKITPGLSSYADDPEAAAKSLEPL  330
              YAVIFDAGS+GSRVHV+ FD NLDLLP+G  +E F +  PGLS+YA DP+ AAKSL  L
Sbjct  86    RYAVIFDAGSSGSRVHVYCFDGNLDLLPIGKEIELFKQKKPGLSAYAMDPQEAAKSLVSL  145

Query  331   LLEAEGVVPTELQPDTPLELGATAGLRLLEGDASDKILQAVRDMFKNESNFKSKAEWVSI  510
             L EAE V+P EL+  TP+ +GATAGLR L  + S++ILQAVRD+ +++S+F+S+ EWV++
Sbjct  146   LEEAEKVIPVELREQTPVRVGATAGLRALGTEKSEEILQAVRDLLQDKSSFRSQPEWVTV  205

Query  511   LEGSQEGTYFWVAMNYLLGNLGKGYQNTIATIDLGGGSVQVSYAVSGDTFANAPKPHNGE  690
             L+GSQEG + WV +NYLLGNLGK Y +T+  +DLGGGSVQ++YA+S      AP    GE
Sbjct  206   LDGSQEGAFQWVTINYLLGNLGKPYSHTVGVVDLGGGSVQMAYAISEKDAGKAPPVAEGE  265

Query  691   EPYVQEKYILGAQYYLYVHSYLNYGQLASRAEIFKA-SGNSTNPCVLEGYDGYYTYNDVS  867
             + YV+E  + G  YYLYVHSYL YG LA+RAEI KA  GN    C+LEG+ G Y Y D  
Sbjct  266   DSYVKELLLKGTTYYLYVHSYLRYGLLAARAEILKAGEGNDYRNCMLEGHHGQYRYGDDI  325

Query  868   YKVTAPPNGSSLKNCRKLARKVVDFRAP-CKYPNCTFNGVWSGGGGAGMENVDISSYFYD  1044
             ++ +   +G+S   CR +A + +    P C +  CTF GVW+GGGG G +N+ ++S+F+D
Sbjct  326   FEASGLSSGASYSKCRAVAVRALKVDEPACTHMKCTFGGVWNGGGGDGQKNLFVASFFFD  385

Query  1045  IAIDVGIIDEGKASKIVKPRSFLVAAKLACETKFEDVKSTFPNAVEKDYPYLCMDLVYQY  1224
              A + G ++       VKP  F  AA+  C+   +D ++T+P+  E++ PYLCMDLVYQY
Sbjct  386   RAAEAGFVNPKAPFAKVKPSDFEEAARRVCKLNVKDAQATYPDVSEENVPYLCMDLVYQY  445

Query  1225  TLLVDGLGLHPYKEITLMKKVEYKNYMVEAAWPLGCAIDVISSS  1356
             TLLVDG G+ PY++ITL+KKV Y N  VEAAWPLG AI+V SSS
Sbjct  446   TLLVDGFGVDPYQDITLVKKVPYSNSFVEAAWPLGSAIEVASSS  489



>emb|CDY29985.1| BnaC01g40230D [Brassica napus]
Length=757

 Score =   428 bits (1100),  Expect = 2e-137, Method: Compositional matrix adjust.
 Identities = 222/458 (48%), Positives = 307/458 (67%), Gaps = 20/458 (4%)
 Frame = +1

Query  22    KHNTMKHTSHHH----------LVFISLALLLFPLACFSRSHLRRVLLN---HEAGNYAV  162
             +H+++      H          +V I+L +LL P             LN    ++  YAV
Sbjct  305   RHDSLSEKIRRHRGLLLVISIPIVLIALVILLMP------GTTSEYALNGGGSDSKKYAV  358

Query  163   IFDAGSTGSRVHVFHFDENLDLLPVGDGVEFFLKITPGLSSYADDPEAAAKSLEPLLLEA  342
             IFDAGS+GSRVHV+ FD+NLDL+P+ + +E FL++ PGLS+Y +DP  +A SL  LL +A
Sbjct  359   IFDAGSSGSRVHVYCFDKNLDLVPLENELELFLQLKPGLSAYPNDPRQSANSLVTLLDKA  418

Query  343   EGVVPTELQPDTPLELGATAGLRLLEGDASDKILQAVRDMFKNESNFKSKAEWVSILEGS  522
             E  VP+EL+P TP+ +GATAGLR L  +AS+ ILQAVR++ K+ S  K++A  V++L+G+
Sbjct  419   EDSVPSELRPKTPVRVGATAGLRALGHEASENILQAVRELLKDRSRLKTEANAVTVLDGT  478

Query  523   QEGTYFWVAMNYLLGNLGKGYQNTIATIDLGGGSVQVSYAVSGDTFANAPKPHNGEEPYV  702
             QEG+Y WV +NYLL  LGK Y  T+  +DLGGGSVQ++YA+S    A APKP  GE+ YV
Sbjct  479   QEGSYQWVTINYLLKTLGKPYSETVGVVDLGGGSVQMAYAISEKDAATAPKPLQGEDSYV  538

Query  703   QEKYILGAQYYLYVHSYLNYGQLASRAEIFKASGNSTNPCVLEGYDGYYTYNDVSYKVTA  882
             +E Y+ G +Y+LYVHSYL+YG LA+RAEI K S  S NPC++ GYDG Y Y   ++K  A
Sbjct  539   REMYLKGRKYFLYVHSYLHYGLLAARAEILKVSEGSNNPCIVTGYDGTYKYGGTAFKAAA  598

Query  883   PPNGSSLKNCRKLARKVVDFR-APCKYPNCTFNGVWSGGGGAGMENVDISSYFYDIAIDV  1059
              P+G+S+  C+++A K +    + C +  CTF GVW+GGGG G +N+ ++S+F+D A + 
Sbjct  599   SPSGASVDECKRVALKALKVNDSVCTHMKCTFGGVWNGGGGGGQKNMFVASFFFDRAAEA  658

Query  1060  GIIDEGKASKIVKPRSFLVAAKLACETKFEDVKSTFPNAVEKDYPYLCMDLVYQYTLLVD  1239
             G +D  +    V+P  F  AA  AC  K  + K+ FP   E + PYLC+DLVYQYTLLVD
Sbjct  659   GFVDPSQPVATVRPADFEKAASQACNMKMGEGKTKFPRVEEDNLPYLCLDLVYQYTLLVD  718

Query  1240  GLGLHPYKEITLMKKVEYKNYMVEAAWPLGCAIDVISS  1353
             G GL P + ITL+KKV+Y  + VEAAWPLG AI+ +SS
Sbjct  719   GFGLKPSQTITLVKKVKYGEHAVEAAWPLGSAIEAVSS  756



>dbj|BAD13517.1| apyrase [Pisum sativum]
Length=455

 Score =   417 bits (1073),  Expect = 2e-137, Method: Compositional matrix adjust.
 Identities = 218/437 (50%), Positives = 295/437 (68%), Gaps = 10/437 (2%)
 Frame = +1

Query  73    LALLLFPLACFSRSHL--------RRVLLNHEA-GNYAVIFDAGSTGSRVHVFHFDENLD  225
             +  LLF +   + S          R++ L  E   +YAV+FDAGSTGSR+HV+HF++NLD
Sbjct  8     ITFLLFSMPAITSSQYLGNNLLTSRKIFLKQEEISSYAVVFDAGSTGSRIHVYHFNQNLD  67

Query  226   LLPVGDGVEFFLKITPGLSSYADDPEAAAKSLEPLLLEAEGVVPTELQPDTPLELGATAG  405
             LL +G GVE++ KITPGLSSYA++PE AAKSL PLL + E VVP +LQP TP+ LGA AG
Sbjct  68    LLHIGKGVEYYNKITPGLSSYANNPEQAAKSLIPLLEQGEDVVPDDLQPITPVRLGAPAG  127

Query  406   LRLLEGDASDKILQAVRDMFKNESNFKSKAEWVSILEGSQEGTYFWVAMNYLLGNLGKGY  585
             LRLL GDA +KILQ+VRDM  N S F  +    SI++G+ +G+Y WV +NY LGNLGK  
Sbjct  128   LRLLNGDAFEKILQSVRDMLSNRSTFNVQPHXASIIDGTHDGSYLWVTVNYALGNLGKRS  187

Query  586   QNTIATIDLGGGSVQVSYAVSGDTFANAPKPHNGEEPYVQEKYILGAQYYLYVHSYLNYG  765
                +  IDLGGGSVQ++YAVS  T  NAPK  +G++PY+++  + G  Y LYVHSYL+ G
Sbjct  188   TKPVGVIDLGGGSVQMAYAVSKKTAKNAPKVADGDDPYIKKVVLKGIPYDLYVHSYLHLG  247

Query  766   QLASRAEIFKASGNSTNPCVLEGYDGYYTYNDVSYKVTAPPNGSSLKNCRKLARKVVDFR  945
             + A RAEI K +  S NPC+L G++G YTY+   +K TA  +G++   C+   RK +   
Sbjct  248   REAFRAEILKLTPRSPNPCLLAGFNGIYTYSGEEFKETAYTSGANFNKCKNTIRKALKLN  307

Query  946   APCKYPNCTFNGVWSGGGGAGMENVDISSYFYDIAIDVGIIDEGKASKIVKPRSFLVAAK  1125
              PC Y NCTF G+W+GGGG   +N+   S F+ +  D G++D    + I++P      AK
Sbjct  308   YPCPYQNCTFGGIWNGGGGNEQKNLFACSSFFYLPEDTGMVDASTPNFILRPVDIETKAK  367

Query  1126  LACETKFEDVKSTFPNAVEKDY-PYLCMDLVYQYTLLVDGLGLHPYKEITLMKKVEYKNY  1302
              AC   FED KST+P   +K+   Y+CMDL+YQY LLVDG GL P ++IT  K++EY++ 
Sbjct  368   EACALNFEDAKSTYPFLDKKNVASYVCMDLIYQYVLLVDGFGLDPLQKITSGKEIEYQDA  427

Query  1303  MVEAAWPLGCAIDVISS  1353
             +VEAAWPLG A++ IS+
Sbjct  428   IVEAAWPLGNAVEAISA  444



>gb|EAZ26787.1| hypothetical protein OsJ_10698 [Oryza sativa Japonica Group]
Length=505

 Score =   419 bits (1077),  Expect = 3e-137, Method: Compositional matrix adjust.
 Identities = 216/404 (53%), Positives = 287/404 (71%), Gaps = 2/404 (0%)
 Frame = +1

Query  151   NYAVIFDAGSTGSRVHVFHFDENLDLLPVGDGVEFFLKITPGLSSYADDPEAAAKSLEPL  330
              YAVIFDAGS+GSRVHV+ FD NLDLLP+G  +E F +  PGLS+YA DP+ AAKSL  L
Sbjct  102   RYAVIFDAGSSGSRVHVYCFDGNLDLLPIGKEIELFKQKKPGLSAYAMDPQEAAKSLVSL  161

Query  331   LLEAEGVVPTELQPDTPLELGATAGLRLLEGDASDKILQAVRDMFKNESNFKSKAEWVSI  510
             L EAE V+P EL+  TP+ +GATAGLR L  + S++ILQAVRD+ +++S+F+S+ EWV++
Sbjct  162   LEEAEKVIPVELREQTPVRVGATAGLRALGTEKSEEILQAVRDLLQDKSSFRSQPEWVTV  221

Query  511   LEGSQEGTYFWVAMNYLLGNLGKGYQNTIATIDLGGGSVQVSYAVSGDTFANAPKPHNGE  690
             L+GSQEG + WV +NYLLGNLGK Y +T+  +DLGGGSVQ++YA+S      AP    GE
Sbjct  222   LDGSQEGAFQWVTINYLLGNLGKPYSHTVGVVDLGGGSVQMAYAISEKDAGKAPPVAEGE  281

Query  691   EPYVQEKYILGAQYYLYVHSYLNYGQLASRAEIFKA-SGNSTNPCVLEGYDGYYTYNDVS  867
             + YV+E  + G  YYLYVHSYL YG LA+RAEI KA  GN    C+LEG+ G Y Y D  
Sbjct  282   DSYVKELLLKGTTYYLYVHSYLRYGLLAARAEILKAGEGNDYRNCMLEGHHGQYRYGDDI  341

Query  868   YKVTAPPNGSSLKNCRKLARKVVDFRAP-CKYPNCTFNGVWSGGGGAGMENVDISSYFYD  1044
             ++ +   +G+S   CR +A + +    P C +  CTF GVW+GGGG G +N+ ++S+F+D
Sbjct  342   FEASGLSSGASYSKCRAVAVRALKVDEPACTHMKCTFGGVWNGGGGDGQKNLFVASFFFD  401

Query  1045  IAIDVGIIDEGKASKIVKPRSFLVAAKLACETKFEDVKSTFPNAVEKDYPYLCMDLVYQY  1224
              A + G ++       VKP  F  AA+  C+   +D ++T+P+  E++ PYLCMDLVYQY
Sbjct  402   RAAEAGFVNPKAPFAKVKPSDFEEAARRVCKLNVKDAQATYPDVSEENVPYLCMDLVYQY  461

Query  1225  TLLVDGLGLHPYKEITLMKKVEYKNYMVEAAWPLGCAIDVISSS  1356
             TLLVDG G+ PY++ITL+KKV Y N  VEAAWPLG AI+V SSS
Sbjct  462   TLLVDGFGVDPYQDITLVKKVPYSNSFVEAAWPLGSAIEVASSS  505



>ref|XP_006658972.1| PREDICTED: probable apyrase 2-like [Oryza brachyantha]
Length=423

 Score =   416 bits (1069),  Expect = 4e-137, Method: Compositional matrix adjust.
 Identities = 208/402 (52%), Positives = 287/402 (71%), Gaps = 1/402 (0%)
 Frame = +1

Query  151   NYAVIFDAGSTGSRVHVFHFDENLDLLPVGDGVEFFLKITPGLSSYADDPEAAAKSLEPL  330
              YAVIFDAGS+GSRVHVF FD  LDLL +GD +E F++  PGLS+YA DP+ AA+SL PL
Sbjct  22    RYAVIFDAGSSGSRVHVFRFDGKLDLLHIGDDIELFVQKKPGLSAYAKDPQEAAESLVPL  81

Query  331   LLEAEGVVPTELQPDTPLELGATAGLRLLEGDASDKILQAVRDMFKNESNFKSKAEWVSI  510
             L +A+ VVP EL+  TP+ +GATAGLR L  + S++ILQAVRD+ + +S+FK++ +WV++
Sbjct  82    LEDAKRVVPAELRDKTPVRVGATAGLRALGAEKSEQILQAVRDLLREKSSFKTQPDWVTV  141

Query  511   LEGSQEGTYFWVAMNYLLGNLGKGYQNTIATIDLGGGSVQVSYAVSGDTFANAPKPHNGE  690
             L+G+QEG Y WV +NYLLG LGK Y +T+  +DLGGGSVQ++YA++      APKP  GE
Sbjct  142   LDGTQEGAYEWVTINYLLGKLGKTYADTVGVVDLGGGSVQMAYAIAEKDAGKAPKPSEGE  201

Query  691   EPYVQEKYILGAQYYLYVHSYLNYGQLASRAEIFKA-SGNSTNPCVLEGYDGYYTYNDVS  867
             + YV++ ++ GA YYLYVHSYL+YG LA+RAEI KA +G   + C L+G+ G Y Y D  
Sbjct  202   DTYVKKLFLKGATYYLYVHSYLHYGLLAARAEILKAGNGKGYSYCTLKGHQGQYKYGDGK  261

Query  868   YKVTAPPNGSSLKNCRKLARKVVDFRAPCKYPNCTFNGVWSGGGGAGMENVDISSYFYDI  1047
             ++  A P+G+S   C+    K +     C +  C+F G+W+GGGGAG +N+ ++S+F+D 
Sbjct  262   FEALASPSGASFSKCKADVVKALKVDQACTHMKCSFGGIWNGGGGAGQKNLFVASFFFDR  321

Query  1048  AIDVGIIDEGKASKIVKPRSFLVAAKLACETKFEDVKSTFPNAVEKDYPYLCMDLVYQYT  1227
             A + G ++   A   VKP  F  AAK AC+   +D ++ +P   + + PY+CMDLVYQYT
Sbjct  322   AAEAGFVNPKAAVAKVKPSDFEKAAKRACKLNLKDAEAAYPGVQKDNIPYICMDLVYQYT  381

Query  1228  LLVDGLGLHPYKEITLMKKVEYKNYMVEAAWPLGCAIDVISS  1353
             LLVDG G+  ++E+TL+KKV Y N  VEAAWPLG AI+V SS
Sbjct  382   LLVDGFGVGSHQEMTLVKKVPYSNAFVEAAWPLGSAIEVASS  423



>ref|XP_008782749.1| PREDICTED: probable apyrase 2 [Phoenix dactylifera]
Length=472

 Score =   417 bits (1072),  Expect = 6e-137, Method: Compositional matrix adjust.
 Identities = 218/403 (54%), Positives = 291/403 (72%), Gaps = 4/403 (1%)
 Frame = +1

Query  151   NYAVIFDAGSTGSRVHVFHFDENLDLLPVGDGVEFFLKITPGLSSYADDPEAAAKSLEPL  330
             +YAVIFDAGS+GSRVHV+ FDE LDLL +G+ +E F++I PGLS++A DP+ AA SL PL
Sbjct  71    SYAVIFDAGSSGSRVHVYCFDEKLDLLHIGEEIELFIQIKPGLSAFAKDPQEAANSLIPL  130

Query  331   LLEAEGVVPTELQPDTPLELGATAGLRLLEGDASDKILQAVRDMFKNESNFKSKAEWVSI  510
             L +AE VVP +L+  TP+ +GATAGLR L  + S+KILQAVRD+ K +S+ K + +WVS+
Sbjct  131   LDKAESVVPADLREKTPVRVGATAGLRALGAETSEKILQAVRDLLKGKSSLKFQDDWVSV  190

Query  511   LEGSQEGTYFWVAMNYLLGNLGKGYQNTIATIDLGGGSVQVSYAVSGDTFANAPKPHNGE  690
             L+G+QEG + WV +NYLLGNLGK Y +T+  +DLGGGSVQ++YA+S +  A APK  +GE
Sbjct  191   LDGAQEGAFQWVTINYLLGNLGKTYSDTVGVVDLGGGSVQMAYAISEEDAAKAPKVTDGE  250

Query  691   EPYVQEKYILGAQYYLYVHSYLNYGQLASRAEIFKASGNSTNPCVLEGYDGYYTYNDVSY  870
             + YV++ ++ G +YYLYVHSYL+YG LA RAEI KA G+  + C+L GY G Y Y D  Y
Sbjct  251   DTYVKQLFLKGTKYYLYVHSYLHYGLLAGRAEILKA-GDDYSTCILNGYRGKYKYGDEVY  309

Query  871   KVTAPPNGSSLKNCRKLARKV--VDFRAPCKYPNCTFNGVWSGGGGAGMENVDISSYFYD  1044
             K  A  +G+SL  CR  A K   VD R  C +  CTF GVW+GGGGAG +N+ ++S+F+D
Sbjct  310   KALAAHSGASLSKCRSDAIKALKVDGRV-CTHMKCTFGGVWNGGGGAGQKNLFVASFFFD  368

Query  1045  IAIDVGIIDEGKASKIVKPRSFLVAAKLACETKFEDVKSTFPNAVEKDYPYLCMDLVYQY  1224
              A + G ID       V+P  F  AAK AC+   +D K+T+ +   ++ P+LCMDLVYQY
Sbjct  369   RAAEAGFIDPKVPVAKVRPSDFEEAAKRACKLNVDDAKTTYSHVSVENLPFLCMDLVYQY  428

Query  1225  TLLVDGLGLHPYKEITLMKKVEYKNYMVEAAWPLGCAIDVISS  1353
             TLLVDG  L P++EITL+K+V Y +  VEAAWPLG AI+  S+
Sbjct  429   TLLVDGFALDPHQEITLVKQVPYGDAFVEAAWPLGSAIEAASA  471



>gb|EEC67580.1| hypothetical protein OsI_34933 [Oryza sativa Indica Group]
Length=457

 Score =   416 bits (1070),  Expect = 6e-137, Method: Compositional matrix adjust.
 Identities = 207/401 (52%), Positives = 275/401 (69%), Gaps = 2/401 (0%)
 Frame = +1

Query  148   GNYAVIFDAGSTGSRVHVFHFDENLDLLPVGDGVEFFLKITPGLSSYADDPEAAAKSLEP  327
             G YAVI DAGSTG+RVHVF FD+ +DLL +GD +E F K+ PGLSSYA  P+ AAKS+ P
Sbjct  51    GRYAVILDAGSTGTRVHVFRFDKKIDLLKIGDDIEVFAKVDPGLSSYAGRPQEAAKSIMP  110

Query  328   LLLEAEGVVPTELQPDTPLELGATAGLRLLEGDASDKILQAVRDMFKNESNFKSKAEWVS  507
             LL  A   VPT L   TPLELGATAGLRL+  D +++IL+AVRD+   ++ F+    W++
Sbjct  111   LLDRANHAVPTWLMNKTPLELGATAGLRLIGDDKANQILEAVRDVVHTKTKFQYNPNWIN  170

Query  508   ILEGSQEGTYFWVAMNYLLGNLGKGYQNTIATIDLGGGSVQVSYAVSGDTFANAPKPHNG  687
             +L GSQEG+Y WVA+NYLL  LG  Y  T+  IDLGGGSVQ++YA+S  T ANAP+  +G
Sbjct  171   VLSGSQEGSYMWVALNYLLDRLGGDYSKTVGVIDLGGGSVQMAYAISTGTAANAPEVLDG  230

Query  688   EEPYVQEKYILGAQYYLYVHSYLNYGQLASRAEIFKASGNSTNPCVLEGYDGYYTYNDVS  867
             ++PY+ ++Y+ G  Y +YVHSYL+YG  ASR EI K    + + C+L G+ G Y YN   
Sbjct  231   QDPYITKEYLKGRDYNVYVHSYLHYGARASRVEILKRKNGTFSNCMLRGFSGKYIYNGEQ  290

Query  868   YKVTAPPNGSSLKNCRKLARKVVDFRAPCKYPNCTFNGVWSGGGGAGMENVDISSYFYDI  1047
             Y  TA P G+    CR    K ++  APC+  NC+FNGVW+GGGGAG + + +++ FY +
Sbjct  291   YDATAAPQGADYHKCRDDVVKALNLDAPCETNNCSFNGVWNGGGGAGQDELYVATSFYYM  350

Query  1048  AIDVGIIDEGKASKIVKPRSFLVAAKLACETKFEDVKSTFPNAVEKDYPYLCMDLVYQYT  1227
             A D+G ID    S    P ++ VAA+  C    E+ K+ +P A   D+ YLCMDLVYQYT
Sbjct  351   ASDIGFIDSEAPSAKSTPAAYKVAAEKVCSLSVEEAKAAYPRAC--DHAYLCMDLVYQYT  408

Query  1228  LLVDGLGLHPYKEITLMKKVEYKNYMVEAAWPLGCAIDVIS  1350
             LLVDG GL   KE+TL++KV++  Y +EAAWPLG AI+ +S
Sbjct  409   LLVDGFGLEATKEMTLVEKVKHGEYYIEAAWPLGTAIEAVS  449



>ref|XP_006664294.1| PREDICTED: probable apyrase 3-like [Oryza brachyantha]
Length=455

 Score =   416 bits (1068),  Expect = 1e-136, Method: Compositional matrix adjust.
 Identities = 204/401 (51%), Positives = 281/401 (70%), Gaps = 2/401 (0%)
 Frame = +1

Query  148   GNYAVIFDAGSTGSRVHVFHFDENLDLLPVGDGVEFFLKITPGLSSYADDPEAAAKSLEP  327
             G YAVI DAGSTG+RVHVF FD+ +DLL +GD +E F K+ PGLSSYA  P+ AAKS+ P
Sbjct  49    GRYAVILDAGSTGTRVHVFRFDKKMDLLKIGDDIEVFAKVNPGLSSYAGRPQEAAKSILP  108

Query  328   LLLEAEGVVPTELQPDTPLELGATAGLRLLEGDASDKILQAVRDMFKNESNFKSKAEWVS  507
             LL +A   VP  L   TPLELGATAGLRL+  + +++IL+AVRD+  ++S F+    W++
Sbjct  109   LLDKANHAVPAGLMNKTPLELGATAGLRLIGDEKANQILEAVRDVVHSKSKFQYDPNWIN  168

Query  508   ILEGSQEGTYFWVAMNYLLGNLGKGYQNTIATIDLGGGSVQVSYAVSGDTFANAPKPHNG  687
             +L GSQEG+Y WVA+NYLL  LG  Y  T+  IDLGGGSVQ++YA+S  T ANAP+  +G
Sbjct  169   VLTGSQEGSYMWVALNYLLDRLGGDYSETVGVIDLGGGSVQMAYAISSSTAANAPRVPHG  228

Query  688   EEPYVQEKYILGAQYYLYVHSYLNYGQLASRAEIFKASGNSTNPCVLEGYDGYYTYNDVS  867
             ++PYV ++Y+ G  Y +YVHSYL+YG  A+R E+ K      + C+L G++G YTYN   
Sbjct  229   QDPYVTKEYLKGRDYNVYVHSYLHYGARAARVEVLKRKNGPFSNCMLRGFNGKYTYNGEE  288

Query  868   YKVTAPPNGSSLKNCRKLARKVVDFRAPCKYPNCTFNGVWSGGGGAGMENVDISSYFYDI  1047
             Y   A P G+    CR+   K ++ +APC+  +CTFNGVW+GGGGAG + + ++S FY +
Sbjct  289   YDAMAAPQGADYHKCRQDVVKALNLKAPCQTNSCTFNGVWNGGGGAGQDELYVASSFYFM  348

Query  1048  AIDVGIIDEGKASKIVKPRSFLVAAKLACETKFEDVKSTFPNAVEKDYPYLCMDLVYQYT  1227
             A D+  ID    S    P ++  AA+  C+   ++ K+ +P+A  +D+ YLCMDLVYQYT
Sbjct  349   ASDIRFIDNNAPSAKSTPAAYKDAAEKVCKLSVQEAKAVYPSA--RDHAYLCMDLVYQYT  406

Query  1228  LLVDGLGLHPYKEITLMKKVEYKNYMVEAAWPLGCAIDVIS  1350
             LLVDG GL P K+ITL++KV+++ Y +EAAWPLG AI+ +S
Sbjct  407   LLVDGFGLAPTKKITLVEKVKHEEYYIEAAWPLGTAIEAVS  447



>dbj|BAJ91877.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ88546.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=457

 Score =   416 bits (1068),  Expect = 1e-136, Method: Compositional matrix adjust.
 Identities = 211/412 (51%), Positives = 279/412 (68%), Gaps = 0/412 (0%)
 Frame = +1

Query  133   LNHEAGNYAVIFDAGSTGSRVHVFHFDENLDLLPVGDGVEFFLKITPGLSSYADDPEAAA  312
             L    G YAVIFDAGSTG+RVHVF FD+ ++L+ VGD +E F K+ PGLSSYA  P+ AA
Sbjct  44    LKAAPGKYAVIFDAGSTGTRVHVFRFDKKMELVDVGDDIEVFAKVEPGLSSYAGRPQEAA  103

Query  313   KSLEPLLLEAEGVVPTELQPDTPLELGATAGLRLLEGDASDKILQAVRDMFKNESNFKSK  492
             KS+ PLL +A+  VP  L   TP++LGATAGLRL+  D +++IL+AVRD   +++ F+  
Sbjct  104   KSITPLLEKAKSAVPRWLMKKTPVKLGATAGLRLIGDDKAEQILEAVRDAVHSKTKFQYN  163

Query  493   AEWVSILEGSQEGTYFWVAMNYLLGNLGKGYQNTIATIDLGGGSVQVSYAVSGDTFANAP  672
               W+++L+GSQEG+Y WVA+NYLLG LG  Y  T+A IDLGGGSVQ++YA+S +  A AP
Sbjct  164   PSWINVLKGSQEGSYLWVALNYLLGKLGGDYSKTVAVIDLGGGSVQMAYAISANAAAAAP  223

Query  673   KPHNGEEPYVQEKYILGAQYYLYVHSYLNYGQLASRAEIFKASGNSTNPCVLEGYDGYYT  852
                  E+PYV ++Y+ G  Y +YVHSYL+YG  ASR EIFKA     + CVL GYDG YT
Sbjct  224   TVPQREDPYVTKEYLKGKDYNVYVHSYLHYGAQASRVEIFKAKNGPVSYCVLRGYDGKYT  283

Query  853   YNDVSYKVTAPPNGSSLKNCRKLARKVVDFRAPCKYPNCTFNGVWSGGGGAGMENVDISS  1032
             YN   Y   A P G++ + CR+   + +   APC   NCTFNG W+GGGG G   + ++S
Sbjct  284   YNGEQYDAIAAPQGAAYEKCREDVTRALRISAPCAAKNCTFNGAWNGGGGPGQAELYVTS  343

Query  1033  YFYDIAIDVGIIDEGKASKIVKPRSFLVAAKLACETKFEDVKSTFPNAVEKDYPYLCMDL  1212
              FY +A DVG+ID   +S    P +F  AA+  C   F + K+ +P     D PY+CMDL
Sbjct  344   SFYYMAADVGLIDSEASSGKTTPAAFRAAAEEICPMSFLEAKAAYPKVRSVDAPYICMDL  403

Query  1213  VYQYTLLVDGLGLHPYKEITLMKKVEYKNYMVEAAWPLGCAIDVISSSSANN  1368
             VYQY+LLVDG GL P KEIT+ +KV++  Y +EAAWPLG AI+ +S +   N
Sbjct  404   VYQYSLLVDGFGLEPTKEITVAQKVKHGEYFIEAAWPLGEAIEAVSPTKRLN  455



>emb|CDY21139.1| BnaA01g33700D [Brassica napus]
Length=751

 Score =   425 bits (1093),  Expect = 2e-136, Method: Compositional matrix adjust.
 Identities = 220/436 (50%), Positives = 299/436 (69%), Gaps = 10/436 (2%)
 Frame = +1

Query  58    LVFISLALLLFPLACFSRSHLRRVLLN---HEAGNYAVIFDAGSTGSRVHVFHFDENLDL  228
             +V I+L +LL P             LN     +  YAVIFDAGS+GSRVHV+ FD+NLDL
Sbjct  321   IVLITLVILLMP------GTTSEYALNGGGSGSKKYAVIFDAGSSGSRVHVYCFDKNLDL  374

Query  229   LPVGDGVEFFLKITPGLSSYADDPEAAAKSLEPLLLEAEGVVPTELQPDTPLELGATAGL  408
             +P+ + +E FL++ PGLS+Y +DP  +A SL  LL +AE  VP EL+P TP+ +GATAGL
Sbjct  375   VPLENELELFLQLKPGLSAYPNDPRQSANSLVTLLDKAEDSVPNELRPKTPVRVGATAGL  434

Query  409   RLLEGDASDKILQAVRDMFKNESNFKSKAEWVSILEGSQEGTYFWVAMNYLLGNLGKGYQ  588
             R L  +AS+ ILQAVR++ K+ S  K++A  V++L+G+QEG+Y WV +NYLL  LGK Y 
Sbjct  435   RALGHEASENILQAVRELLKDRSRLKTEANAVTVLDGTQEGSYQWVTINYLLKTLGKPYS  494

Query  589   NTIATIDLGGGSVQVSYAVSGDTFANAPKPHNGEEPYVQEKYILGAQYYLYVHSYLNYGQ  768
              T+  +DLGGGSVQ++YA+S    A APKP  GE+ YV+E Y+ G +Y+LYVHSYL+YG 
Sbjct  495   ETVGVVDLGGGSVQMAYAISEKDAATAPKPLQGEDSYVREMYLKGRKYFLYVHSYLHYGL  554

Query  769   LASRAEIFKASGNSTNPCVLEGYDGYYTYNDVSYKVTAPPNGSSLKNCRKLARKVVDFR-  945
             LA+RAEI K S  S NPC++ GYDG Y Y   ++K  A P+G+S+  C+++A K +    
Sbjct  555   LAARAEILKVSEGSNNPCIVTGYDGTYKYGGTAFKAAASPSGASVDECKRVALKALKVND  614

Query  946   APCKYPNCTFNGVWSGGGGAGMENVDISSYFYDIAIDVGIIDEGKASKIVKPRSFLVAAK  1125
             + C +  CTF GVW+GGGG G +N+ ++S+F+D A + G +D  +    V+P  F  AA 
Sbjct  615   SVCTHMKCTFGGVWNGGGGGGQKNMFVASFFFDRAAEAGFVDPSQPVATVRPADFEKAAN  674

Query  1126  LACETKFEDVKSTFPNAVEKDYPYLCMDLVYQYTLLVDGLGLHPYKEITLMKKVEYKNYM  1305
              AC  K  + K+ FP   E + PYLC+DLVYQYTLLVDG GL P + ITL+KKV+Y  + 
Sbjct  675   QACNMKMGEGKTKFPRVEEDNLPYLCLDLVYQYTLLVDGFGLKPSQTITLVKKVKYGEHA  734

Query  1306  VEAAWPLGCAIDVISS  1353
             VEAAWPLG AI+ +SS
Sbjct  735   VEAAWPLGSAIEAVSS  750



>ref|XP_009399919.1| PREDICTED: probable apyrase 2 isoform X1 [Musa acuminata subsp. 
malaccensis]
Length=472

 Score =   416 bits (1068),  Expect = 2e-136, Method: Compositional matrix adjust.
 Identities = 216/405 (53%), Positives = 287/405 (71%), Gaps = 6/405 (1%)
 Frame = +1

Query  151   NYAVIFDAGSTGSRVHVFHFDENLDLLPVGDGVEFFLKITPGLSSYADDPEAAAKSLEPL  330
             +YAVIFDAGS+GSRVHV+ FD NLDLL +G  +E F + TPGLS YA +P+ AA SL PL
Sbjct  69    SYAVIFDAGSSGSRVHVYCFDVNLDLLSIGKEIELFEQRTPGLSFYAKNPQEAANSLLPL  128

Query  331   LLEAEGVVPTELQPDTPLELGATAGLRLLEGDASDKILQAVR--DMFKNESNFKSKAEWV  504
             L +AE V+P EL+  TP+ +GATAGLR L    +++ILQAVR  D+ + +S+ K +++WV
Sbjct  129   LEKAESVIPAELRRTTPVRVGATAGLRALGAVTAEQILQAVRFLDLLRQKSSLKFQSDWV  188

Query  505   SILEGSQEGTYFWVAMNYLLGNLGKGYQNTIATIDLGGGSVQVSYAVSGDTFANAPKPHN  684
             ++L+G+QEG + WV +NYLLG LGK Y +T+  +DLGGGSVQ++YA+S +  ANAPK  N
Sbjct  189   TVLDGTQEGAFQWVTINYLLGKLGKSYWDTVGVVDLGGGSVQMAYAISENDAANAPKISN  248

Query  685   GEEPYVQEKYILGAQYYLYVHSYLNYGQLASRAEIFKAS-GNSTNPCVLEGYDGYYTYND  861
              E  YVQ+ ++ G  Y+LYVHSYL+YG LA RAEI KA+ GNS   C+L+GY+G Y Y +
Sbjct  249   EEHSYVQQLFLKGTSYHLYVHSYLHYGLLAVRAEILKAADGNSK--CILDGYNGSYKYGE  306

Query  862   VSYKVTAPPNGSSLKNCRKLARKVVDFRAP-CKYPNCTFNGVWSGGGGAGMENVDISSYF  1038
               YK  A P+G+S   CR    K +    P C +  CTF GVW+GGGG G  N+ ++S+F
Sbjct  307   KEYKAVASPSGASYSKCRSDTIKALKVDEPTCTHMKCTFGGVWNGGGGDGQRNLFVASFF  366

Query  1039  YDIAIDVGIIDEGKASKIVKPRSFLVAAKLACETKFEDVKSTFPNAVEKDYPYLCMDLVY  1218
             +D A++ G +D       VKP  F V AK AC+   E  K+T+P   + + PYLCMDLVY
Sbjct  367   FDRAVEAGFVDHKVPVAKVKPAEFKVVAKHACKLNVEKAKATYPRVQDNNLPYLCMDLVY  426

Query  1219  QYTLLVDGLGLHPYKEITLMKKVEYKNYMVEAAWPLGCAIDVISS  1353
             Q+TLLVDG GL PY+EITL+KKV+Y +  VEAAWPLG AI+V S+
Sbjct  427   QFTLLVDGFGLDPYQEITLVKKVKYGDAFVEAAWPLGSAIEVAST  471



>ref|XP_009386978.1| PREDICTED: probable apyrase 2 [Musa acuminata subsp. malaccensis]
Length=450

 Score =   415 bits (1066),  Expect = 3e-136, Method: Compositional matrix adjust.
 Identities = 215/410 (52%), Positives = 291/410 (71%), Gaps = 2/410 (0%)
 Frame = +1

Query  142   EAGNYAVIFDAGSTGSRVHVFHFDENLDLLPVGDGVEFFLKITPGLSSYADDPEAAAKSL  321
             E+  YAVIFDAGSTGSRVHV+ FD+ L+L+ +G  +E F+K+ PGLS+YADDP+AAA SL
Sbjct  37    ESRRYAVIFDAGSTGSRVHVYCFDDGLELVHIGSDIELFVKVKPGLSAYADDPQAAANSL  96

Query  322   EPLLLEAEGVVPTELQPDTPLELGATAGLRLLEGDASDKILQAVRDMFKNESNFKSKAEW  501
              PLL +A GV+P EL+  TP+ +GATAGLR L  D S++ILQAVRD+ + +S+ +   +W
Sbjct  97    LPLLEKAVGVIPEELRNKTPIRVGATAGLRSLGTDKSNQILQAVRDLLREKSSLELVDDW  156

Query  502   VSILEGSQEGTYFWVAMNYLLGNLGKGYQNTIATIDLGGGSVQVSYAVSGDTFANAPKPH  681
             V++L G QEG+Y WVA+NYLLG+LG  Y  +I  +DLGGGSVQ++YA+S    ANAP   
Sbjct  157   VTVLSGYQEGSYLWVAINYLLGHLGNKYSESIGVVDLGGGSVQMAYAISEKAAANAPNVP  216

Query  682   NGEEPYVQEKYILGAQYYLYVHSYLNYGQLASRAEIFKASGNSTNPCVLEGYDGYYTYND  861
             +GEE YV+E ++ GA+YYLYVHSYLNYG LA+RA+I K +  S + C+L GY+G Y Y+ 
Sbjct  217   SGEETYVKELFLQGAKYYLYVHSYLNYGLLAARAQILKVATKSYSYCILGGYNGVYDYDG  276

Query  862   VSYKVTAPPNGSSLKNCRKLARKVVDFRAPCKYPNCTFNGVWSGGGGAGMENVDISSYFY  1041
               Y  ++ P+GSS   CR    K +    PCKY +CTF GVW+GGGGAG + +  +SYF+
Sbjct  277   ELYNASSSPSGSSFTKCRNEVIKALKIDEPCKYSSCTFGGVWNGGGGAGQKTLYGASYFF  336

Query  1042  DIAIDVGIIDEGKASKIVKPRSFLVAAKLACETKFEDVKSTFPNAVEKDYPYLCMDLVYQ  1221
             D   DVG +D    S + KP  F+ AAK AC+     V++ +PN  + D PY+CMDL+YQ
Sbjct  337   DRPSDVGFVDPAATSALAKPSDFMEAAKHACKVTMNTVETKYPNVRKNDLPYVCMDLIYQ  396

Query  1222  YTLLVDGLGLHPYKEITLMKKVEY--KNYMVEAAWPLGCAIDVISSSSAN  1365
             YTLLV+G GL P + ITL+++V Y   ++  EAAWPLG AI+ ++S   N
Sbjct  397   YTLLVNGFGLKPRQNITLVRQVRYGDSDFFGEAAWPLGSAIEAVTSEKIN  446



>ref|XP_008441968.1| PREDICTED: apyrase 2-like [Cucumis melo]
Length=466

 Score =   415 bits (1066),  Expect = 4e-136, Method: Compositional matrix adjust.
 Identities = 217/402 (54%), Positives = 293/402 (73%), Gaps = 5/402 (1%)
 Frame = +1

Query  151   NYAVIFDAGSTGSRVHVFHFDENLDLLPVGDGVEFFLKITPGLSSYADDPEAAAKSLEPL  330
             ++AVIFDAGS+GSRVHVF FD NLDLLPVG  +E F ++ PGLS+YAD P+ AA SL  L
Sbjct  67    SFAVIFDAGSSGSRVHVFCFDHNLDLLPVGKDIELFEQLKPGLSAYADSPKDAAASLISL  126

Query  331   LLEAEGVVPTELQPDTPLELGATAGLRLLEGDASDKILQAVRDMFKNESNFKSKAEWVSI  510
             L +A+ VVP  L+P TP+ +GATAGLR L+GDASD+ILQAVRD+ +++S  + + + VS+
Sbjct  127   LDKAQDVVPKGLRPMTPVRVGATAGLRALKGDASDRILQAVRDLLRDKSELRLEGDAVSV  186

Query  511   LEGSQEGTYFWVAMNYLLGNLGKGYQNTIATIDLGGGSVQVSYAVSGDTFANAPKPHNGE  690
             ++G+QEG+Y WV +NYLLGNLGK Y +T+  +DLGGGSVQ++YA+S     +A +  + E
Sbjct  187   IDGTQEGSYLWVTLNYLLGNLGKKYSDTVGVVDLGGGSVQMAYAISE---KDAARLSDAE  243

Query  691   EPYVQEKYILGAQYYLYVHSYLNYGQLASRAEIFKASGNSTNPCVLEGYDGYYTYNDVSY  870
               Y+++ Y+ GA YYLYVHSYL+YG LA+RAE+   S +S+N C+L GY+G Y Y    Y
Sbjct  244   GAYIKKMYLKGATYYLYVHSYLHYGLLAARAEVLSVSEDSSNDCILSGYEGAYHYGGKDY  303

Query  871   KVTAPPNGSSLKNCRKLARKVVDF-RAPCKYPNCTFNGVWSGGGGAGMENVDISSYFYDI  1047
             K +A  +GSSL  CR    K +    + C +  CTF GVW+GGGG G +N+ ++S+F+D 
Sbjct  304   KASASSSGSSLNGCRSTVLKALKVNESTCTHMKCTFGGVWNGGGGDGQKNLFVASFFFDR  363

Query  1048  AIDVGIIDEGKASKIVKPRSFLVAAKLACETKFEDVKSTFPNAVEKDYPYLCMDLVYQYT  1227
             A + G  D  +    V+P  F  AAK AC+ K ED  ST+P+  + + PYLCMDLVYQYT
Sbjct  364   AAEAGFADPNEPVAKVRPADFSDAAKQACQIKLEDA-STYPHVEKDNLPYLCMDLVYQYT  422

Query  1228  LLVDGLGLHPYKEITLMKKVEYKNYMVEAAWPLGCAIDVISS  1353
             LLVDG GL P++EITL+KKV+Y+N +VEAAWPLG AI+ +SS
Sbjct  423   LLVDGFGLDPWQEITLVKKVKYQNSLVEAAWPLGSAIEAVSS  464



>ref|XP_008670667.1| PREDICTED: probable apyrase 2 [Zea mays]
 tpg|DAA41782.1| TPA: putative apyrase family protein [Zea mays]
Length=466

 Score =   414 bits (1065),  Expect = 5e-136, Method: Compositional matrix adjust.
 Identities = 209/404 (52%), Positives = 287/404 (71%), Gaps = 1/404 (0%)
 Frame = +1

Query  145   AGNYAVIFDAGSTGSRVHVFHFDENLDLLPVGDGVEFFLKITPGLSSYADDPEAAAKSLE  324
             A  YAVIFDAGS+GSRVHVF FD NLDL+ +G  +E F++I PGLS YA+DP  AA+SL 
Sbjct  63    ADKYAVIFDAGSSGSRVHVFRFDANLDLVHIGSEIELFVQIKPGLSHYANDPREAAESLV  122

Query  325   PLLLEAEGVVPTELQPDTPLELGATAGLRLLEGDASDKILQAVRDMFKNESNFKSKAEWV  504
              LL +A+ VVP EL+  TP+ +GATAGLR L    S+ ILQAVRD+ + +S+FK++ +WV
Sbjct  123   SLLDDAKRVVPAELRDQTPVRVGATAGLRNLGAQKSEAILQAVRDILREKSSFKNQPDWV  182

Query  505   SILEGSQEGTYFWVAMNYLLGNLGKGYQNTIATIDLGGGSVQVSYAVSGDTFANAPKPHN  684
             ++L+G+QEG Y WV +NYLLGNLGK Y +T+  +DLGGGSVQ++YA++      APKP  
Sbjct  183   TVLDGTQEGAYEWVTINYLLGNLGKTYADTVGVVDLGGGSVQMAYAIAEKDAEKAPKPSE  242

Query  685   GEEPYVQEKYILGAQYYLYVHSYLNYGQLASRAEIFKA-SGNSTNPCVLEGYDGYYTYND  861
             GE+ YV++ ++ G  YYLYVHSYL+YG LA+RAE+ KA +GN  + C+LEG+ G Y Y D
Sbjct  243   GEDAYVKKLFLKGTTYYLYVHSYLHYGLLAARAEVLKAGNGNGYSNCMLEGFQGKYKYGD  302

Query  862   VSYKVTAPPNGSSLKNCRKLARKVVDFRAPCKYPNCTFNGVWSGGGGAGMENVDISSYFY  1041
              S++ + PP+G+S   C+  A K +     C +  C+F G+W+GGGGAG +N+ ++S+F+
Sbjct  303   DSFEASGPPSGASYSKCKDDAVKALKVDEACTHMKCSFGGIWNGGGGAGQKNLFVASFFF  362

Query  1042  DIAIDVGIIDEGKASKIVKPRSFLVAAKLACETKFEDVKSTFPNAVEKDYPYLCMDLVYQ  1221
             D A + G ++       VKP  F  AA+ AC    ++ ++TFP   +   PY+CMDLVYQ
Sbjct  363   DRAAEAGFVNANAPVAKVKPSDFRQAAERACSLSVKNAEATFPGVQKDSIPYICMDLVYQ  422

Query  1222  YTLLVDGLGLHPYKEITLMKKVEYKNYMVEAAWPLGCAIDVISS  1353
             YTLLV+G G+ P  E+TL+KKV Y +  VEAAWPLG AI+V SS
Sbjct  423   YTLLVEGFGVDPDHEMTLVKKVPYSDAYVEAAWPLGSAIEVASS  466



>gb|EEC75177.1| hypothetical protein OsI_11404 [Oryza sativa Indica Group]
Length=489

 Score =   415 bits (1067),  Expect = 5e-136, Method: Compositional matrix adjust.
 Identities = 216/404 (53%), Positives = 285/404 (71%), Gaps = 2/404 (0%)
 Frame = +1

Query  151   NYAVIFDAGSTGSRVHVFHFDENLDLLPVGDGVEFFLKITPGLSSYADDPEAAAKSLEPL  330
              YAVIFDAGS+GSRVHV+ FD NLDLLP+G  +E F +  PGLS+YA DP+ AAKSL  L
Sbjct  86    RYAVIFDAGSSGSRVHVYCFDGNLDLLPIGKEIELFKQKKPGLSAYAMDPQEAAKSLVSL  145

Query  331   LLEAEGVVPTELQPDTPLELGATAGLRLLEGDASDKILQAVRDMFKNESNFKSKAEWVSI  510
             L EAE VVP EL+  TP+ +GATAGLR L  + S++ILQAVRD+ +++S+F+S+ EWV++
Sbjct  146   LEEAEKVVPVELREQTPVRVGATAGLRALGTEKSEEILQAVRDLLQDKSSFRSQPEWVTV  205

Query  511   LEGSQEGTYFWVAMNYLLGNLGKGYQNTIATIDLGGGSVQVSYAVSGDTFANAPKPHNGE  690
             L+GSQEG + WV +NYLLGNLGK Y +T+  +DLGGGSVQ++YA+S      AP    GE
Sbjct  206   LDGSQEGAFQWVTINYLLGNLGKPYSHTVGVVDLGGGSVQMAYAISEKDAGKAPPVAEGE  265

Query  691   EPYVQEKYILGAQYYLYVHSYLNYGQLASRAEIFKA-SGNSTNPCVLEGYDGYYTYNDVS  867
             + YV+E  + G  YYLYVHSYL YG LA+RAEI KA  GN    C+LE   G Y Y D  
Sbjct  266   DSYVKELLLKGTTYYLYVHSYLRYGLLAARAEILKAGEGNDYRNCMLEDIMGQYRYGDDI  325

Query  868   YKVTAPPNGSSLKNCRKLARKVVDFRAP-CKYPNCTFNGVWSGGGGAGMENVDISSYFYD  1044
             ++ +   +G+S   CR +A + +    P C +  CTF GVW+GGGG G +N+ ++S+F+D
Sbjct  326   FEASGLSSGASYSKCRAVAVRALKVDEPACTHMKCTFGGVWNGGGGDGQKNLFVASFFFD  385

Query  1045  IAIDVGIIDEGKASKIVKPRSFLVAAKLACETKFEDVKSTFPNAVEKDYPYLCMDLVYQY  1224
              A + G ++       VKP  F  AA+  C+   +D ++T+P+  E++ PYLCMDLVYQY
Sbjct  386   RAAEAGFVNPKAPFAKVKPSDFEEAARRVCKLNVKDAQATYPDVSEENVPYLCMDLVYQY  445

Query  1225  TLLVDGLGLHPYKEITLMKKVEYKNYMVEAAWPLGCAIDVISSS  1356
             TLLVDG G+ PY++ITL+KKV Y N  VEAAWPLG AI+V SSS
Sbjct  446   TLLVDGFGVDPYQDITLVKKVPYSNSFVEAAWPLGSAIEVASSS  489



>gb|EMT14858.1| Nucleoside-triphosphatase [Aegilops tauschii]
Length=526

 Score =   417 bits (1071),  Expect = 5e-136, Method: Compositional matrix adjust.
 Identities = 208/423 (49%), Positives = 280/423 (66%), Gaps = 21/423 (5%)
 Frame = +1

Query  148   GNYAVIFDAGSTGSRVHVFHFDENLDLLPVGDGVEFFLKITPGLSSYADDPEAAAKSLEP  327
             G YAVIFDAGSTG+RVHVF FD+ +DL+ +GD +E + K+ PGLSSYA  P+ AAKS+ P
Sbjct  44    GKYAVIFDAGSTGTRVHVFQFDKKMDLVEIGDDIEVYAKVEPGLSSYAGRPQEAAKSIIP  103

Query  328   LLLEAEGVVPTELQPDTPLELGATAGLRLLEGDASDKILQAVRDMFKNESNFKSKAEWVS  507
             LL +A+  VP  L   TP++LGATAGLRL+  D +++IL+AVRD+  ++S F+    W++
Sbjct  104   LLDKAKSTVPRWLMGKTPVKLGATAGLRLIGDDKAEQILEAVRDVIHSKSKFQYNPSWIN  163

Query  508   ILEGSQEGTYFW---------------------VAMNYLLGNLGKGYQNTIATIDLGGGS  624
             ++EGSQEG+Y W                     VA+NYLLG LG  Y  T+  IDLGGGS
Sbjct  164   VIEGSQEGSYIWVYATTATVVAAANSTTDLVADVALNYLLGKLGGDYVKTVGVIDLGGGS  223

Query  625   VQVSYAVSGDTFANAPKPHNGEEPYVQEKYILGAQYYLYVHSYLNYGQLASRAEIFKASG  804
             VQ++YA+S    A AP   +G+EPYV ++Y+ G  Y +Y +SYL+YG LASR EIFKAS 
Sbjct  224   VQMTYAISSAAAAAAPVVSDGKEPYVTKEYLKGRDYNVYAYSYLHYGALASRVEIFKASN  283

Query  805   NSTNPCVLEGYDGYYTYNDVSYKVTAPPNGSSLKNCRKLARKVVDFRAPCKYPNCTFNGV  984
                N C+L G++G YTYN   Y   APP G++   CR+   K +   APC+  NCTFN V
Sbjct  284   GPFNYCMLRGFNGKYTYNGEQYDAIAPPQGAAYDKCREDITKALKLNAPCETKNCTFNSV  343

Query  985   WSGGGGAGMENVDISSYFYDIAIDVGIIDEGKASKIVKPRSFLVAAKLACETKFEDVKST  1164
             WSGGGGAG+ ++ I++ FY  A  VG+ID   +S    P ++  AA+  C   F++ K  
Sbjct  344   WSGGGGAGLSDLYITTSFYYTASQVGLIDSEASSAKTTPAAWRAAAEKICPLSFKEAKDA  403

Query  1165  FPNAVEKDYPYLCMDLVYQYTLLVDGLGLHPYKEITLMKKVEYKNYMVEAAWPLGCAIDV  1344
             +P     D PY+CMDL+YQY+LLVDG GL P KEIT+ +KV+Y  Y +EAAWPLG AI+ 
Sbjct  404   YPRVRAIDTPYICMDLIYQYSLLVDGFGLEPTKEITVAEKVKYGEYFIEAAWPLGEAIEG  463

Query  1345  ISS  1353
             + +
Sbjct  464   VQN  466



>ref|XP_004291701.1| PREDICTED: apyrase 2-like [Fragaria vesca subsp. vesca]
Length=456

 Score =   413 bits (1061),  Expect = 1e-135, Method: Compositional matrix adjust.
 Identities = 221/410 (54%), Positives = 297/410 (72%), Gaps = 3/410 (1%)
 Frame = +1

Query  127   VLLNHEAGNYAVIFDAGSTGSRVHVFHFDENLDLLPVGDGVEFFLKITPGLSSYADDPEA  306
             + ++    +YAVIFDAGS+GSRVHVF FD NL+LLP+G  +E FL+  PGLSSYA +P +
Sbjct  47    IQIHSSKTSYAVIFDAGSSGSRVHVFCFDHNLNLLPIGKDLELFLQTKPGLSSYASNPRS  106

Query  307   AAKSLEPLLLEAEGVVPTELQPDTPLELGATAGLRLLEGDASDKILQAVRDMFKNESNFK  486
             AA SL  LL +AE  VP +L+P TP+ +GATAGLR L  DAS++ILQAVRD+ K  S+  
Sbjct  107   AALSLSDLLHKAEAAVPKDLRPFTPVRVGATAGLRALGVDASNRILQAVRDLLKQSSSLS  166

Query  487   SKAEWVSILEGSQEGTYFWVAMNYLLGNLGKGYQNTIATIDLGGGSVQVSYAVSGDTFAN  666
             S+ + V++++G+QEG++ WV +NYLLGNLGK Y +T+  +DLGGGSVQ++YA+S    A 
Sbjct  167   SQPDAVTVIDGTQEGSFQWVTINYLLGNLGKEYSDTVGVVDLGGGSVQMAYAISEADAAK  226

Query  667   APKPHNGEEPYVQEKYILGAQYYLYVHSYLNYGQLASRAEIFKASGNSTNPCVLEGYDGY  846
             APK  +GE+ YV++  + G  Y LYVHSYL+YG LA+RAEI K S +S NPC+LEGY+G 
Sbjct  227   APKLSDGEDIYVRKMSLKGTNYNLYVHSYLHYGLLAARAEILKVSEDSGNPCILEGYNGS  286

Query  847   YTYNDVSYKVTAPPNGSSLKNCRKLARKVVDFRA-PCKYPNCTFNGVWSGGGGAGMENVD  1023
             Y Y   S+K  A  +GSS+  CR++A K +      C +  CTF GVW+GGGG G  N+ 
Sbjct  287   YNYGGESFK--ASSSGSSIDGCRRVATKALKVNEDTCTHMKCTFGGVWNGGGGDGQRNLF  344

Query  1024  ISSYFYDIAIDVGIIDEGKASKIVKPRSFLVAAKLACETKFEDVKSTFPNAVEKDYPYLC  1203
             ++S+F+D A + G ++  +    V P  F  AAK AC+TK ED KST+P+  + + PYLC
Sbjct  345   VASFFFDRAAEAGFVNAKEPVAKVHPGDFEEAAKRACQTKLEDAKSTYPHVDKDNLPYLC  404

Query  1204  MDLVYQYTLLVDGLGLHPYKEITLMKKVEYKNYMVEAAWPLGCAIDVISS  1353
             MDLVYQYTLLVDG G+ P++EITL+KKV+Y N +VEAAWPLG AI+ +SS
Sbjct  405   MDLVYQYTLLVDGFGIDPWQEITLVKKVKYNNALVEAAWPLGSAIEAVSS  454



>ref|XP_004958720.1| PREDICTED: probable apyrase 2-like [Setaria italica]
Length=470

 Score =   413 bits (1062),  Expect = 1e-135, Method: Compositional matrix adjust.
 Identities = 210/402 (52%), Positives = 288/402 (72%), Gaps = 1/402 (0%)
 Frame = +1

Query  151   NYAVIFDAGSTGSRVHVFHFDENLDLLPVGDGVEFFLKITPGLSSYADDPEAAAKSLEPL  330
              YAVIFDAGS+GSRVHVF FD NLDL+ +G  +E F++  PGLS+YA DP  AA+SL  L
Sbjct  69    KYAVIFDAGSSGSRVHVFCFDANLDLVNIGSEIELFVQKKPGLSAYASDPREAAESLVSL  128

Query  331   LLEAEGVVPTELQPDTPLELGATAGLRLLEGDASDKILQAVRDMFKNESNFKSKAEWVSI  510
             L EA+ VVP EL+  TP+ +GATAGLR L  + S++ILQAVRD+ + +S+FK++A+WV++
Sbjct  129   LDEAKRVVPAELRDQTPVRVGATAGLRNLGAEKSEEILQAVRDLLREKSSFKNQADWVTV  188

Query  511   LEGSQEGTYFWVAMNYLLGNLGKGYQNTIATIDLGGGSVQVSYAVSGDTFANAPKPHNGE  690
             L+GSQEG Y WV +NYLLGNLGK Y +T+  +DLGGGSVQ++YA++       PKP +GE
Sbjct  189   LDGSQEGAYEWVTINYLLGNLGKTYADTVGVVDLGGGSVQMAYAIAEKDAEKVPKPSDGE  248

Query  691   EPYVQEKYILGAQYYLYVHSYLNYGQLASRAEIFKA-SGNSTNPCVLEGYDGYYTYNDVS  867
             + YV++ Y+ G  Y LYVHSYL+YG LA+RAE+ KA +GN  + C+LEGY G Y Y   +
Sbjct  249   DTYVKKLYLKGTTYNLYVHSYLHYGLLAARAEVLKAGNGNGYSNCMLEGYQGQYKYGSET  308

Query  868   YKVTAPPNGSSLKNCRKLARKVVDFRAPCKYPNCTFNGVWSGGGGAGMENVDISSYFYDI  1047
             ++ +A P+G+S   C+  A K +     C +  C+F G+W+GGGGAG +N+ ++S+F+D 
Sbjct  309   FEASASPSGASYSKCKDDAVKALKVDEACTHMKCSFGGIWNGGGGAGQKNLFVASFFFDR  368

Query  1048  AIDVGIIDEGKASKIVKPRSFLVAAKLACETKFEDVKSTFPNAVEKDYPYLCMDLVYQYT  1227
             A +VG ++   A   VKP  F  AAK AC+   +D ++ +P   + + PY+C+DLVYQYT
Sbjct  369   AAEVGFVNPKAAVAKVKPSDFEQAAKRACKLSVKDAEAAYPGVQKDNLPYICLDLVYQYT  428

Query  1228  LLVDGLGLHPYKEITLMKKVEYKNYMVEAAWPLGCAIDVISS  1353
             LLVDG G+ P  E+TL+KKV Y    VEAAWPLG AI+V SS
Sbjct  429   LLVDGFGVDPNHEMTLVKKVPYNGAYVEAAWPLGSAIEVASS  470



>gb|EEE52675.1| hypothetical protein OsJ_35057 [Oryza sativa Japonica Group]
Length=457

 Score =   412 bits (1060),  Expect = 2e-135, Method: Compositional matrix adjust.
 Identities = 206/401 (51%), Positives = 274/401 (68%), Gaps = 2/401 (0%)
 Frame = +1

Query  148   GNYAVIFDAGSTGSRVHVFHFDENLDLLPVGDGVEFFLKITPGLSSYADDPEAAAKSLEP  327
             G YAVI DAGSTG+RVHVF FD+ +DLL +GD +E F K+ PGLSSYA  P+ AAKS+ P
Sbjct  51    GRYAVILDAGSTGTRVHVFRFDKKIDLLKIGDDIEVFAKVDPGLSSYAGRPQEAAKSIMP  110

Query  328   LLLEAEGVVPTELQPDTPLELGATAGLRLLEGDASDKILQAVRDMFKNESNFKSKAEWVS  507
             LL  A   VPT L   TPLELGATAGLRL+  D +++IL+AVRD+   ++ F+    W++
Sbjct  111   LLDRANHAVPTWLMNKTPLELGATAGLRLIGDDKANQILEAVRDVVHTKTKFQYNPNWIN  170

Query  508   ILEGSQEGTYFWVAMNYLLGNLGKGYQNTIATIDLGGGSVQVSYAVSGDTFANAPKPHNG  687
             +L GSQEG+Y WVA+NYLL  LG  Y  T+  IDLGGGSVQ++YA+S  T ANAP+  +G
Sbjct  171   VLSGSQEGSYMWVALNYLLDRLGGDYSKTVGVIDLGGGSVQMAYAISTGTAANAPEVLDG  230

Query  688   EEPYVQEKYILGAQYYLYVHSYLNYGQLASRAEIFKASGNSTNPCVLEGYDGYYTYNDVS  867
             ++PY+ ++Y+    Y +YVHSYL+YG  ASR EI K    + + C+L G+ G Y YN   
Sbjct  231   QDPYIIKEYLKERDYNVYVHSYLHYGARASRVEILKRKNGTFSNCMLRGFSGKYIYNGEQ  290

Query  868   YKVTAPPNGSSLKNCRKLARKVVDFRAPCKYPNCTFNGVWSGGGGAGMENVDISSYFYDI  1047
             Y  TA P G+    CR    K ++  APC+  NC+FNGVW+GGGGAG + + +++ FY +
Sbjct  291   YDATAAPQGADYHKCRDDVVKALNLDAPCETNNCSFNGVWNGGGGAGQDELYVATSFYYM  350

Query  1048  AIDVGIIDEGKASKIVKPRSFLVAAKLACETKFEDVKSTFPNAVEKDYPYLCMDLVYQYT  1227
             A D+G ID    S    P ++ VAA+  C    E+ K+ +P A   D+ YLCMDLVYQYT
Sbjct  351   ASDIGFIDSEAPSAKSTPAAYKVAAEKVCSLSVEEAKAAYPRAC--DHAYLCMDLVYQYT  408

Query  1228  LLVDGLGLHPYKEITLMKKVEYKNYMVEAAWPLGCAIDVIS  1350
             LLVDG GL   KE+TL++KV++  Y +EAAWPLG AI+ +S
Sbjct  409   LLVDGFGLEATKEMTLVEKVKHGEYYIEAAWPLGTAIEAVS  449



>ref|XP_008651023.1| PREDICTED: putative apyrase family protein isoform X1 [Zea mays]
 tpg|DAA64157.1| TPA: putative apyrase family protein [Zea mays]
Length=467

 Score =   412 bits (1058),  Expect = 7e-135, Method: Compositional matrix adjust.
 Identities = 210/405 (52%), Positives = 287/405 (71%), Gaps = 1/405 (0%)
 Frame = +1

Query  145   AGNYAVIFDAGSTGSRVHVFHFDENLDLLPVGDGVEFFLKITPGLSSYADDPEAAAKSLE  324
             A  YAVIFDAGS+GSRVHVF FD NLDL+ +G  +E F++I PGLS YA+DP  AA+SL 
Sbjct  63    ADRYAVIFDAGSSGSRVHVFRFDANLDLVRIGSEIELFVQIKPGLSHYANDPREAAESLV  122

Query  325   PLLLEAEGVVPTELQPDTPLELGATAGLRLLEGDASDKILQAVRDMFKNESNFKSKAEWV  504
              LL +A+ VVP EL+  TP+ +GATAGLR L    S+ ILQAVRD+ + +S+FK++ +WV
Sbjct  123   SLLDDAKRVVPAELRDQTPVRVGATAGLRNLGAQKSEAILQAVRDLLREKSSFKNQPDWV  182

Query  505   SILEGSQEGTYFWVAMNYLLGNLGKGYQNTIATIDLGGGSVQVSYAVSGDTFANAPKPHN  684
             ++L+G+QEG Y WV +NYLLGNLGK Y +T+  +DLGGGSVQ++YA++      APKP +
Sbjct  183   TVLDGTQEGAYEWVTINYLLGNLGKTYADTVGVVDLGGGSVQMAYAIAEKDAEKAPKPSD  242

Query  685   GEEPYVQEKYILGAQYYLYVHSYLNYGQLASRAEIFKA-SGNSTNPCVLEGYDGYYTYND  861
             GE+ YV++ ++ G  YYLYVHSYL+YG LA+RAE+ KA +GN  + C+LEG+ G Y Y D
Sbjct  243   GEDAYVKKLFLKGTTYYLYVHSYLHYGLLAARAEVLKAGNGNGYSNCMLEGFQGQYKYGD  302

Query  862   VSYKVTAPPNGSSLKNCRKLARKVVDFRAPCKYPNCTFNGVWSGGGGAGMENVDISSYFY  1041
              S++ +A P+G+S   C+  A K +     C +  C+F G+W+GGGGAG  N+ ++S+F+
Sbjct  303   NSFEASASPSGASYSKCKDDAVKALKVDEACTHMKCSFGGIWNGGGGAGQNNLFVASFFF  362

Query  1042  DIAIDVGIIDEGKASKIVKPRSFLVAAKLACETKFEDVKSTFPNAVEKDYPYLCMDLVYQ  1221
             D A + G ++       VKP  F  AA+ AC    ++ ++TFP   + + PY+CMDLVYQ
Sbjct  363   DRAAEAGFVNANAPVAKVKPSDFRQAAERACSLSVKNAEATFPGVQKDNIPYICMDLVYQ  422

Query  1222  YTLLVDGLGLHPYKEITLMKKVEYKNYMVEAAWPLGCAIDVISSS  1356
             YTLLV G G+ P  E+TL+KKV Y    VEAAWPLG AI+V SSS
Sbjct  423   YTLLVHGFGVDPDHEMTLVKKVPYSGAYVEAAWPLGSAIEVASSS  467



>gb|EEC82701.1| hypothetical protein OsI_27366 [Oryza sativa Indica Group]
Length=467

 Score =   412 bits (1058),  Expect = 7e-135, Method: Compositional matrix adjust.
 Identities = 207/404 (51%), Positives = 286/404 (71%), Gaps = 1/404 (0%)
 Frame = +1

Query  142   EAGNYAVIFDAGSTGSRVHVFHFDENLDLLPVGDGVEFFLKITPGLSSYADDPEAAAKSL  321
             +A  YAVIFDAGS+GSRVHVF FD NLDLL +GD +E F++  PGLS+YA +P+ AAKSL
Sbjct  64    DANKYAVIFDAGSSGSRVHVFRFDANLDLLHIGDQIELFVQKKPGLSAYAKNPQEAAKSL  123

Query  322   EPLLLEAEGVVPTELQPDTPLELGATAGLRLLEGDASDKILQAVRDMFKNESNFKSKAEW  501
               LL +A+ VVP EL+  TP+ +GATAGLR L  + S++ILQAVRD+ + +S+FK++ +W
Sbjct  124   VSLLEDAKRVVPAELRGQTPVRVGATAGLRALGAEKSEEILQAVRDLLREKSSFKTQPDW  183

Query  502   VSILEGSQEGTYFWVAMNYLLGNLGKGYQNTIATIDLGGGSVQVSYAVSGDTFANAPKPH  681
             V++L+G QEG Y WV +NYLLG LGK Y +T+  +DLGGGSVQ++YA++      APKP 
Sbjct  184   VTVLDGPQEGAYEWVTINYLLGKLGKTYADTVGVVDLGGGSVQMAYAIAEKDAVKAPKPS  243

Query  682   NGEEPYVQEKYILGAQYYLYVHSYLNYGQLASRAEIFKA-SGNSTNPCVLEGYDGYYTYN  858
              GE+ YV++ ++ G  YYLYVHSYL+YG LA+RAEI KA +G   + C LEG+ G Y Y 
Sbjct  244   EGEDSYVKKLFLKGTTYYLYVHSYLHYGLLAARAEILKAGNGKGYSYCTLEGHQGQYKYG  303

Query  859   DVSYKVTAPPNGSSLKNCRKLARKVVDFRAPCKYPNCTFNGVWSGGGGAGMENVDISSYF  1038
             +  ++ +A P+G+S   CR    K +     C +  C+F G+W+GGGGAG +N+ ++S+F
Sbjct  304   NGKFEASASPSGASYSKCRDDVVKALKVDQACTHMKCSFGGIWNGGGGAGQKNLFVASFF  363

Query  1039  YDIAIDVGIIDEGKASKIVKPRSFLVAAKLACETKFEDVKSTFPNAVEKDYPYLCMDLVY  1218
             +D A + G ++       VKP  F  AAK AC+   +D ++ +P   + + PY+CMDLVY
Sbjct  364   FDRAAEAGFVNPKAPVAKVKPSDFEKAAKRACKLNLKDAEAAYPGVQKDNIPYICMDLVY  423

Query  1219  QYTLLVDGLGLHPYKEITLMKKVEYKNYMVEAAWPLGCAIDVIS  1350
             QYTLLVDG G+  ++E+TL+KKV Y N  VEAAWPLG AI+V S
Sbjct  424   QYTLLVDGFGVGSHQEMTLVKKVPYSNAFVEAAWPLGSAIEVAS  467



>ref|NP_001060663.1| Os07g0682800 [Oryza sativa Japonica Group]
 sp|Q6Z4P2.1|APY2_ORYSJ RecName: Full=Probable apyrase 2; Short=OsAPY2; AltName: Full=ATP-diphosphatase; 
AltName: Full=ATP-diphosphohydrolase; AltName: 
Full=Adenosine diphosphatase; Short=ADPase [Oryza sativa 
Japonica Group]
 dbj|BAC83798.1| putative nucleoside-triphosphatase [Oryza sativa Japonica Group]
 dbj|BAF22577.1| Os07g0682800 [Oryza sativa Japonica Group]
 gb|EAZ41118.1| hypothetical protein OsJ_25612 [Oryza sativa Japonica Group]
Length=467

 Score =   411 bits (1057),  Expect = 8e-135, Method: Compositional matrix adjust.
 Identities = 207/404 (51%), Positives = 286/404 (71%), Gaps = 1/404 (0%)
 Frame = +1

Query  142   EAGNYAVIFDAGSTGSRVHVFHFDENLDLLPVGDGVEFFLKITPGLSSYADDPEAAAKSL  321
             +A  YAVIFDAGS+GSRVHVF FD NLDLL +GD +E F++  PGLS YA++P+ AAKSL
Sbjct  64    DANKYAVIFDAGSSGSRVHVFRFDANLDLLHIGDQIELFVQKKPGLSEYANNPQEAAKSL  123

Query  322   EPLLLEAEGVVPTELQPDTPLELGATAGLRLLEGDASDKILQAVRDMFKNESNFKSKAEW  501
               LL +A+ VVP EL+  TP+ +GATAGLR L  + S++ILQAVRD+ + +S+FK++ +W
Sbjct  124   VSLLEDAKRVVPVELRGQTPVRVGATAGLRALGAEKSEEILQAVRDLLREKSSFKTQPDW  183

Query  502   VSILEGSQEGTYFWVAMNYLLGNLGKGYQNTIATIDLGGGSVQVSYAVSGDTFANAPKPH  681
             V++L+G QEG Y WV +NYLLG LGK Y +T+  +DLGGGSVQ++YA++      APKP 
Sbjct  184   VTVLDGPQEGAYEWVTINYLLGKLGKTYADTVGVVDLGGGSVQMAYAIAEKDAVKAPKPS  243

Query  682   NGEEPYVQEKYILGAQYYLYVHSYLNYGQLASRAEIFKA-SGNSTNPCVLEGYDGYYTYN  858
              GE+ YV++ ++ G  YYLYVHSYL+YG LA+RAEI KA +G   + C LEG+ G Y Y 
Sbjct  244   EGEDSYVKKLFLKGTTYYLYVHSYLHYGLLAARAEILKAGNGKGYSYCTLEGHQGQYKYG  303

Query  859   DVSYKVTAPPNGSSLKNCRKLARKVVDFRAPCKYPNCTFNGVWSGGGGAGMENVDISSYF  1038
             +  ++ +A P+G+S   CR    K +     C +  C+F G+W+GGGGAG +N+ ++S+F
Sbjct  304   NGKFEASASPSGASYSKCRDDVVKALKVDQACTHMKCSFGGIWNGGGGAGQKNLFVASFF  363

Query  1039  YDIAIDVGIIDEGKASKIVKPRSFLVAAKLACETKFEDVKSTFPNAVEKDYPYLCMDLVY  1218
             +D A + G ++       VKP  F  AAK AC+   +D ++ +P   + + PY+CMDLVY
Sbjct  364   FDRAAEAGFVNPKAPVAKVKPSDFEKAAKRACKLNLKDAEAAYPGVQKDNIPYICMDLVY  423

Query  1219  QYTLLVDGLGLHPYKEITLMKKVEYKNYMVEAAWPLGCAIDVIS  1350
             QYTLLVDG G+  ++E+TL+KKV Y N  VEAAWPLG AI+V S
Sbjct  424   QYTLLVDGFGVGSHQEMTLVKKVPYSNAFVEAAWPLGSAIEVAS  467



>gb|ACB38287.1| apyrase [Lolium perenne]
Length=454

 Score =   411 bits (1056),  Expect = 9e-135, Method: Compositional matrix adjust.
 Identities = 206/403 (51%), Positives = 281/403 (70%), Gaps = 0/403 (0%)
 Frame = +1

Query  148   GNYAVIFDAGSTGSRVHVFHFDENLDLLPVGDGVEFFLKITPGLSSYADDPEAAAKSLEP  327
             G YAVIFDAGSTG+RVHVFHFD+ ++L+ +GD +E F K+ PGLS+YA  P+ AA S+ P
Sbjct  46    GKYAVIFDAGSTGTRVHVFHFDKRMELVEIGDDIEVFAKVQPGLSAYAGRPQEAATSIVP  105

Query  328   LLLEAEGVVPTELQPDTPLELGATAGLRLLEGDASDKILQAVRDMFKNESNFKSKAEWVS  507
             LL  A+ +VP  L   TPL+LGATAGLR++  + +++IL+AVRD+   +SNF+    W++
Sbjct  106   LLETAKTIVPRWLMRRTPLKLGATAGLRIIGEEQAEQILEAVRDVVHTKSNFQYNPSWIN  165

Query  508   ILEGSQEGTYFWVAMNYLLGNLGKGYQNTIATIDLGGGSVQVSYAVSGDTFANAPKPHNG  687
             +LEGSQEG+Y WVA+NYLL  LG  Y  T+  IDLGG SVQ++YA+S DT A+AP   +G
Sbjct  166   VLEGSQEGSYLWVALNYLLDKLGGDYAKTVGVIDLGGASVQMAYAISPDTAASAPVKPDG  225

Query  688   EEPYVQEKYILGAQYYLYVHSYLNYGQLASRAEIFKASGNSTNPCVLEGYDGYYTYNDVS  867
             ++PYV ++Y+ G  Y +Y HSYL+YG  ASR EIFKA   S + C+L G+ G YTYN   
Sbjct  226   KDPYVTKEYLKGRDYNVYAHSYLHYGSDASRVEIFKAKNGSFSNCMLRGFIGNYTYNGDQ  285

Query  868   YKVTAPPNGSSLKNCRKLARKVVDFRAPCKYPNCTFNGVWSGGGGAGMENVDISSYFYDI  1047
             Y  TA P G++ + CR+   K ++  APC+  NCTFNG W+GGGGAG  ++ + S FY +
Sbjct  286   YDATASPQGAAYERCREDVTKALNLSAPCETRNCTFNGAWNGGGGAGQADLYVMSSFYYM  345

Query  1048  AIDVGIIDEGKASKIVKPRSFLVAAKLACETKFEDVKSTFPNAVEKDYPYLCMDLVYQYT  1227
             A  VG+ID    S    P +F  AA+  C   FE+ K+ +P     + PY+CMDLVYQYT
Sbjct  346   ASQVGLIDGDATSGKTTPAAFRAAAEEICPLSFEESKAAYPRVRASNAPYVCMDLVYQYT  405

Query  1228  LLVDGLGLHPYKEITLMKKVEYKNYMVEAAWPLGCAIDVISSS  1356
             LLVDG GL P KE+T+++KV++  Y +EA WPLG AI+ +S +
Sbjct  406   LLVDGFGLEPTKEVTVVQKVKHGEYFIEAKWPLGEAIEAVSDT  448



>ref|XP_003624589.1| Nucleoside-triphosphatase [Medicago truncatula]
Length=808

 Score =   422 bits (1086),  Expect = 9e-135, Method: Compositional matrix adjust.
 Identities = 214/437 (49%), Positives = 299/437 (68%), Gaps = 7/437 (2%)
 Frame = +1

Query  64    FISLALLLFPLACFSRSHLRRVLLNHEA-------GNYAVIFDAGSTGSRVHVFHFDENL  222
              I+  L L P    S+     +L N +         +YAV+FDAGSTGSRVHV+HFD+NL
Sbjct  7     LITFLLFLMPTISSSQYLGNNILTNRKIFPKQETLTSYAVVFDAGSTGSRVHVYHFDQNL  66

Query  223   DLLPVGDGVEFFLKITPGLSSYADDPEAAAKSLEPLLLEAEGVVPTELQPDTPLELGATA  402
             DLL +G+ VEF+ K TPGLS+YAD+P+ AA+SL PLL +AE VVP  LQP TP++LGATA
Sbjct  67    DLLHIGNDVEFYNKTTPGLSAYADNPKEAAESLIPLLEQAERVVPVNLQPKTPVKLGATA  126

Query  403   GLRLLEGDASDKILQAVRDMFKNESNFKSKAEWVSILEGSQEGTYFWVAMNYLLGNLGKG  582
             GLRLL+G++S+ IL+AV  + K  S F  +++ V I++G+QEG+Y WV +NY+LGNLGK 
Sbjct  127   GLRLLDGNSSELILEAVSSLLKKRSTFNVQSDAVGIIDGTQEGSYLWVTINYVLGNLGKD  186

Query  583   YQNTIATIDLGGGSVQVSYAVSGDTFANAPKPHNGEEPYVQEKYILGAQYYLYVHSYLNY  762
             +  T+A  DLGGGSVQ+ YAVS +    AP+   GE+PY+++  + G +YYLYVHSYL +
Sbjct  187   FSETVAVADLGGGSVQMVYAVSREQAKKAPQVPQGEDPYIKKIVLKGKKYYLYVHSYLRF  246

Query  763   GQLASRAEIFKASGNSTNPCVLEGYDGYYTYNDVSYKVTAPPNGSSLKNCRKLARKVVDF  942
             G+ ASRAEI K +  S NPC+L GY G YTY+   YK  +P +GS+   C+++  K +  
Sbjct  247   GKEASRAEILKVTNGSPNPCILAGYHGTYTYSGEEYKAFSPASGSNFDECKEIILKALKV  306

Query  943   RAPCKYPNCTFNGVWSGGGGAGMENVDISSYFYDIAIDVGIIDEGKASKIVKPRSFLVAA  1122
               PC Y  C+F G+W+GGGG+G + + ++S FY +   V I D  K +  ++       A
Sbjct  307   NDPCPYGKCSFGGIWNGGGGSGQKTLYVTSSFYYVPTGVNIADPNKPNSKIRIEDLKTGA  366

Query  1123  KLACETKFEDVKSTFPNAVEKDYPYLCMDLVYQYTLLVDGLGLHPYKEITLMKKVEYKNY  1302
             +  C+TK++D K+T+P   E   PY C+DL+YQYTL VDG GL P +EIT+  ++EY++ 
Sbjct  367   EQVCKTKYKDAKATYPLIYEDSLPYACLDLIYQYTLFVDGFGLDPLQEITVANQIEYQDA  426

Query  1303  MVEAAWPLGCAIDVISS  1353
             +V+AAWPLG AI+ ISS
Sbjct  427   LVDAAWPLGNAIEAISS  443


 Score =   213 bits (542),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 116/289 (40%), Positives = 176/289 (61%), Gaps = 21/289 (7%)
 Frame = +1

Query  544   VAMNYLLGNLGKGYQN-------------------TIATIDLGGGSVQVSYAVSGDTFAN  666
             V +NY+LGNLG   ++                   ++A  D+GGG + +  AVS +    
Sbjct  519   VTINYVLGNLGNTQKDFSEAMSVLENVVVELGNTLSVALGDIGGG-ITID-AVSREQAKK  576

Query  667   APKPHNGEEPYVQEKYILGAQYYLYVHSYLNYGQLASRAEIFKASGNSTNPCVLEGYDGY  846
             AP+   GE+PY+++  + G +YYLYVHSYL +G+ ASRAEI K +  S NPC+L GY G 
Sbjct  577   APQVPQGEDPYIKKIVLKGKKYYLYVHSYLRFGKEASRAEILKVTNGSPNPCILAGYHGT  636

Query  847   YTYNDVSYKVTAPPNGSSLKNCRKLARKVVDFRAPCKYPNCTFNGVWSGGGGAGMENVDI  1026
             YTY+   YK  +P +G +   C+++  K +    PC Y  C+F G+W+GGGG+G + + +
Sbjct  637   YTYSGEEYKAFSPASGPNFDECKEIILKALKVNDPCPYGKCSFGGIWNGGGGSGQKTLYV  696

Query  1027  SSYFYDIAIDVGIIDEGKASKIVKPRSFLVAAKLACETKFEDVKSTFPNAVEKDYPYLCM  1206
             +S FY +   V I D  K +  ++       A+  C+TK++D K+T+P   E   PY C+
Sbjct  697   TSSFYYVPTGVNIADPNKPNSKIRIEDLKTGAEQVCKTKYKDAKATYPLIYEDSLPYACL  756

Query  1207  DLVYQYTLLVDGLGLHPYKEITLMKKVEYKNYMVEAAWPLGCAIDVISS  1353
             DL+YQYTL VDG GL P ++IT+  ++EY++ +V+AAWPLG AI+ +SS
Sbjct  757   DLIYQYTLFVDGFGLDPLQDITVANQIEYQDALVDAAWPLGNAIEAVSS  805



>gb|EEC68772.1| hypothetical protein OsI_37304 [Oryza sativa Indica Group]
Length=451

 Score =   410 bits (1055),  Expect = 1e-134, Method: Compositional matrix adjust.
 Identities = 204/401 (51%), Positives = 276/401 (69%), Gaps = 2/401 (0%)
 Frame = +1

Query  148   GNYAVIFDAGSTGSRVHVFHFDENLDLLPVGDGVEFFLKITPGLSSYADDPEAAAKSLEP  327
             G YAVI DAGSTG+RVHVF FD  LDLL VGD +E F K+ PGLSSYA  P+ AA S+ P
Sbjct  43    GRYAVILDAGSTGTRVHVFRFDNKLDLLKVGDNIELFAKVDPGLSSYAGRPQDAANSILP  102

Query  328   LLLEAEGVVPTELQPDTPLELGATAGLRLLEGDASDKILQAVRDMFKNESNFKSKAEWVS  507
             LL +A  VVP  L   TPL+LGATAGLRL+  + +++IL+AVRD+   +S ++    W++
Sbjct  103   LLDKANTVVPARLMNKTPLKLGATAGLRLIGDEKANQILEAVRDVVHTKSKYQYNPNWIN  162

Query  508   ILEGSQEGTYFWVAMNYLLGNLGKGYQNTIATIDLGGGSVQVSYAVSGDTFANAPKPHNG  687
             +LEGSQEG+Y WVA+NYLL  LG  Y  T+  +DLGGGSVQ++YA+S +T A APK   G
Sbjct  163   VLEGSQEGSYIWVALNYLLDKLGGDYSKTVGVVDLGGGSVQMAYAISSNTAATAPKVPEG  222

Query  688   EEPYVQEKYILGAQYYLYVHSYLNYGQLASRAEIFKASGNSTNPCVLEGYDGYYTYNDVS  867
             ++PYV ++Y+ G  Y +YVHSYL+YG  ASRA I +      + C+L G+ G +TYN   
Sbjct  223   KDPYVVKEYLKGKDYNIYVHSYLHYGGFASRAHILERKDGPFSNCMLRGFSGNFTYNGKQ  282

Query  868   YKVTAPPNGSSLKNCRKLARKVVDFRAPCKYPNCTFNGVWSGGGGAGMENVDISSYFYDI  1047
             Y  TA P+G+    CR+   K++   APC+  NC+FNGVW+GGGGAG +++ ++S FY I
Sbjct  283   YDATAAPHGADYHKCREEVVKLLKVNAPCETKNCSFNGVWNGGGGAGQDDLYVASAFYYI  342

Query  1048  AIDVGIIDEGKASKIVKPRSFLVAAKLACETKFEDVKSTFPNAVEKDYPYLCMDLVYQYT  1227
             A  VG I+    S    P +F   A+  C+   ++ K  +PN   +D+ YLCMDL+Y+Y+
Sbjct  343   ASHVGFINSDAPSAKSTPATFKAVAEKVCKLSVKEAKVEYPNV--RDHAYLCMDLIYEYS  400

Query  1228  LLVDGLGLHPYKEITLMKKVEYKNYMVEAAWPLGCAIDVIS  1350
             LLVDG GLHP KEITL+ KV++  Y ++AAWPLG AI+ +S
Sbjct  401   LLVDGFGLHPSKEITLVDKVKHGEYYIDAAWPLGTAIEAVS  441



>ref|NP_001066032.1| Os12g0123500 [Oryza sativa Japonica Group]
 sp|Q2QYE1.2|APY3_ORYSJ RecName: Full=Probable apyrase 3; Short=OsAPY3; AltName: Full=ATP-diphosphatase; 
AltName: Full=ATP-diphosphohydrolase; AltName: 
Full=Adenosine diphosphatase; Short=ADPase; Flags: Precursor 
[Oryza sativa Japonica Group]
 gb|ABA95698.2| GDA1/CD39 family protein, expressed [Oryza sativa Japonica Group]
 dbj|BAF29051.1| Os12g0123500 [Oryza sativa Japonica Group]
 gb|EEE52674.1| hypothetical protein OsJ_35056 [Oryza sativa Japonica Group]
Length=451

 Score =   410 bits (1055),  Expect = 1e-134, Method: Compositional matrix adjust.
 Identities = 204/401 (51%), Positives = 275/401 (69%), Gaps = 2/401 (0%)
 Frame = +1

Query  148   GNYAVIFDAGSTGSRVHVFHFDENLDLLPVGDGVEFFLKITPGLSSYADDPEAAAKSLEP  327
             G YAVI DAGSTG+RVHVF FD  LDLL VGD +E F K+ PGLSSYA  P+ AA S+ P
Sbjct  43    GRYAVILDAGSTGTRVHVFRFDNKLDLLKVGDNIELFAKVDPGLSSYAGRPQDAANSILP  102

Query  328   LLLEAEGVVPTELQPDTPLELGATAGLRLLEGDASDKILQAVRDMFKNESNFKSKAEWVS  507
             LL +A  VVP  L   TPL+LGATAGLRL+  + +++IL+AVRD+   +S ++    W++
Sbjct  103   LLDKANTVVPARLMNKTPLKLGATAGLRLIGDEKANQILEAVRDVVHTKSKYQYNPNWIN  162

Query  508   ILEGSQEGTYFWVAMNYLLGNLGKGYQNTIATIDLGGGSVQVSYAVSGDTFANAPKPHNG  687
             +LEGSQEG+Y WVA+NYLL  LG  Y  T+  +DLGGGSVQ++YA+S +T A APK   G
Sbjct  163   VLEGSQEGSYIWVALNYLLDKLGGDYSKTVGVVDLGGGSVQMAYAISSNTAATAPKVPEG  222

Query  688   EEPYVQEKYILGAQYYLYVHSYLNYGQLASRAEIFKASGNSTNPCVLEGYDGYYTYNDVS  867
             ++PYV ++Y+ G  Y +YVHSYL+YG  ASRA I +      + C+L G+ G +TYN   
Sbjct  223   KDPYVVKEYLKGKDYNIYVHSYLHYGGFASRAHILERKDGPFSNCMLRGFSGNFTYNGKQ  282

Query  868   YKVTAPPNGSSLKNCRKLARKVVDFRAPCKYPNCTFNGVWSGGGGAGMENVDISSYFYDI  1047
             Y  TA P G+    CR+   K++   APC+  NC+FNGVW+GGGGAG +++ ++S FY I
Sbjct  283   YDATAAPQGADYHKCREEVVKLLKVNAPCETKNCSFNGVWNGGGGAGQDDLYVASAFYYI  342

Query  1048  AIDVGIIDEGKASKIVKPRSFLVAAKLACETKFEDVKSTFPNAVEKDYPYLCMDLVYQYT  1227
             A  VG I+    S    P +F   A+  C+   ++ K  +PN   +D+ YLCMDL+Y+Y+
Sbjct  343   ASHVGFINSDAPSAKSTPATFKAVAEKVCKLSVKEAKVEYPNV--RDHAYLCMDLIYEYS  400

Query  1228  LLVDGLGLHPYKEITLMKKVEYKNYMVEAAWPLGCAIDVIS  1350
             LLVDG GLHP KEITL+ KV++  Y ++AAWPLG AI+ +S
Sbjct  401   LLVDGFGLHPSKEITLVDKVKHGEYYIDAAWPLGTAIEAVS  441



>ref|XP_002465325.1| hypothetical protein SORBIDRAFT_01g036510 [Sorghum bicolor]
 gb|EER92323.1| hypothetical protein SORBIDRAFT_01g036510 [Sorghum bicolor]
Length=479

 Score =   411 bits (1057),  Expect = 2e-134, Method: Compositional matrix adjust.
 Identities = 224/445 (50%), Positives = 304/445 (68%), Gaps = 13/445 (3%)
 Frame = +1

Query  58    LVFISLALLLFPLACFSRSHL-------RR---VLLNHEAGNYAVIFDAGSTGSRVHVFH  207
             ++ IS  LLL P A  S S         RR     +      YAVIFDAGS+GSRVHV+ 
Sbjct  36    VLLISFVLLLMPRAPASASGGGLLAVGGRRWGPRAVEDGLNKYAVIFDAGSSGSRVHVYC  95

Query  208   FDENLDLLPVGDGVEFFLKITPGLSSYADDPEAAAKSLEPLLLEAEGVVPTELQPDTPLE  387
             FDENLDL+P+G  +E F +  PGLS+ A  P+ AA+SL  LL EAE VVP EL+  TP+ 
Sbjct  96    FDENLDLVPIGKEIELFKQKKPGLSA-AKGPQEAAESLISLLEEAEKVVPAELRGQTPVR  154

Query  388   LGATAGLRLLEGDASDKILQAVRDMFKNESNFKSKAEWVSILEGSQEGTYFWVAMNYLLG  567
             +GATAGLR L  + S++ILQAVR++ +++S+FKS+  WVS+L+GSQEG + WV +NYLLG
Sbjct  155   VGATAGLRALGTERSEEILQAVRELLRDKSSFKSQPNWVSVLDGSQEGAFQWVTINYLLG  214

Query  568   NLGKGYQNTIATIDLGGGSVQVSYAVSGDTFANAPKPHNGEEPYVQEKYILGAQYYLYVH  747
              LGK Y NT+  +DLGGGSVQ++YA+S    A AP+  +GE+ YV+E  + G  YYLYVH
Sbjct  215   KLGKPYSNTVGVVDLGGGSVQMAYAISEKDAAKAPEVADGEDSYVKELLLKGTTYYLYVH  274

Query  748   SYLNYGQLASRAEIFKA-SGNSTNPCVLEGYDGYYTYNDVSYKVTAPPNGSSLKNCRKLA  924
             SYL+YG LA+RAEI KA  G+  + C+LEG+ G Y Y   +++ +  P+G+S   CR LA
Sbjct  275   SYLHYGLLAARAEILKAGEGSDYSDCMLEGHLGKYNYGGNTFEASGSPSGASYSKCRALA  334

Query  925   RKVVDFRAP-CKYPNCTFNGVWSGGGGAGMENVDISSYFYDIAIDVGIIDEGKASKIVKP  1101
              + +    P C +  CTF GVW+GGGG G +N+ ++S+F+D A + G ++   A   VKP
Sbjct  335   VRALKVDEPACTHMKCTFGGVWNGGGGDGQKNLFVASFFFDRAAEAGFVNPKAAVAKVKP  394

Query  1102  RSFLVAAKLACETKFEDVKSTFPNAVEKDYPYLCMDLVYQYTLLVDGLGLHPYKEITLMK  1281
               F   A+  C+   +D ++T+P+  E++ PYLC+DLVYQYTLLVDG G+ PY++ITL+K
Sbjct  395   SDFEETARRVCKLNLKDAQATYPDVSEENIPYLCIDLVYQYTLLVDGFGVDPYQDITLVK  454

Query  1282  KVEYKNYMVEAAWPLGCAIDVISSS  1356
             KV Y +  VEAAWPLG AI+V SSS
Sbjct  455   KVPYGDSYVEAAWPLGSAIEVASSS  479



>gb|EMT30219.1| Nucleoside-triphosphatase [Aegilops tauschii]
Length=463

 Score =   410 bits (1053),  Expect = 3e-134, Method: Compositional matrix adjust.
 Identities = 208/414 (50%), Positives = 282/414 (68%), Gaps = 2/414 (0%)
 Frame = +1

Query  133   LNHEAGNYAVIFDAGSTGSRVHVFHFDENLDLLPVGDG--VEFFLKITPGLSSYADDPEA  306
             L    G YAVIFDAGSTG+RVHVF FD+ ++L+ +GDG  +E F K+ PGLS+YA  P+ 
Sbjct  48    LKAAPGKYAVIFDAGSTGTRVHVFRFDKKMELIDIGDGDDIEVFAKVEPGLSAYAGRPQE  107

Query  307   AAKSLEPLLLEAEGVVPTELQPDTPLELGATAGLRLLEGDASDKILQAVRDMFKNESNFK  486
             AAKS+ PLL +A+  VP  L   TP++LGATAGLRL+  + +++IL+AVRD   ++S F+
Sbjct  108   AAKSIVPLLEKAKSTVPRWLMKKTPVKLGATAGLRLIGDEKAEQILEAVRDAVHSQSKFQ  167

Query  487   SKAEWVSILEGSQEGTYFWVAMNYLLGNLGKGYQNTIATIDLGGGSVQVSYAVSGDTFAN  666
                 W+++L+GSQEG+Y WVA+NYLLGNLG  Y  T+  IDLGGGSVQ++YA+S D  A 
Sbjct  168   YNPSWINVLKGSQEGSYLWVALNYLLGNLGGDYSKTVGVIDLGGGSVQMAYAISADAAAA  227

Query  667   APKPHNGEEPYVQEKYILGAQYYLYVHSYLNYGQLASRAEIFKASGNSTNPCVLEGYDGY  846
             AP    G++PYV ++Y+ G  Y +YVHSYL+YG +ASR EIFKA     + C+L GY+G 
Sbjct  228   APGVPQGDDPYVTKEYLKGRDYNVYVHSYLHYGAMASRVEIFKAKNGPVSYCMLRGYNGK  287

Query  847   YTYNDVSYKVTAPPNGSSLKNCRKLARKVVDFRAPCKYPNCTFNGVWSGGGGAGMENVDI  1026
             YTYN   Y   APP G++   CR+   + +   APC+  NCTFNG W+GGGG G  ++ +
Sbjct  288   YTYNGEQYDAIAPPQGAAYDKCREDVTRALKISAPCQAKNCTFNGAWNGGGGPGQADLYV  347

Query  1027  SSYFYDIAIDVGIIDEGKASKIVKPRSFLVAAKLACETKFEDVKSTFPNAVEKDYPYLCM  1206
             +S FY +A DVG+ID    S    P +F  AA+  C   F + K+ +P     D PY+CM
Sbjct  348   TSSFYYMASDVGLIDSEATSGKTTPAAFRAAAEKICPMGFVEAKAAYPKVRSADAPYICM  407

Query  1207  DLVYQYTLLVDGLGLHPYKEITLMKKVEYKNYMVEAAWPLGCAIDVISSSSANN  1368
             DL+YQY+LLVDG GL P KEIT+ +KV++  Y +EAAW LG AI+ +S +   N
Sbjct  408   DLIYQYSLLVDGFGLEPTKEITVAQKVKHGEYFIEAAWALGEAIEAVSPTKRLN  461



>ref|XP_010088479.1| hypothetical protein L484_013684 [Morus notabilis]
 gb|EXB36249.1| hypothetical protein L484_013684 [Morus notabilis]
Length=625

 Score =   415 bits (1067),  Expect = 4e-134, Method: Compositional matrix adjust.
 Identities = 221/402 (55%), Positives = 295/402 (73%), Gaps = 0/402 (0%)
 Frame = +1

Query  151   NYAVIFDAGSTGSRVHVFHFDENLDLLPVGDGVEFFLKITPGLSSYADDPEAAAKSLEPL  330
             +YAVIFDAGS+GSRVHVF FD NLDL+P+GD +E F +I PGLS+YA DP+AAA+SL  L
Sbjct  224   SYAVIFDAGSSGSRVHVFSFDRNLDLVPIGDDLELFEQIKPGLSAYASDPKAAAESLIGL  283

Query  331   LLEAEGVVPTELQPDTPLELGATAGLRLLEGDASDKILQAVRDMFKNESNFKSKAEWVSI  510
             L +A  VVP  L+  TP+ +GATAGLR L GD S++ILQAVRD+ K+ S FK +++ VS+
Sbjct  284   LDKAVNVVPKNLRASTPVRVGATAGLRSLPGDTSERILQAVRDLLKDRSTFKLESDAVSV  343

Query  511   LEGSQEGTYFWVAMNYLLGNLGKGYQNTIATIDLGGGSVQVSYAVSGDTFANAPKPHNGE  690
             ++G+QEG+Y WV +N+LLGNLG+ Y +T+  +DLGGGSVQ++YA+S    A APKP +GE
Sbjct  344   IDGTQEGSYQWVTINFLLGNLGQKYGSTVGVVDLGGGSVQMAYAISEAAAAKAPKPTDGE  403

Query  691   EPYVQEKYILGAQYYLYVHSYLNYGQLASRAEIFKASGNSTNPCVLEGYDGYYTYNDVSY  870
             E YV+E ++ G +Y+LYVHSYL YG LA RAE+ K +G S NPC+L GYDG +TY   +Y
Sbjct  404   ETYVKEMFLKGKKYFLYVHSYLRYGLLAGRAELLKVTGESGNPCILSGYDGSFTYGGNTY  463

Query  871   KVTAPPNGSSLKNCRKLARKVVDFRAPCKYPNCTFNGVWSGGGGAGMENVDISSYFYDIA  1050
             K +A  +GSS+  CR +A K +  +  C +  CTF GVW+GGGG G  N+ ++S+F+D A
Sbjct  464   KASASSSGSSVDGCRMVADKALKIKDTCTHMKCTFGGVWNGGGGDGQRNLFVASFFFDRA  523

Query  1051  IDVGIIDEGKASKIVKPRSFLVAAKLACETKFEDVKSTFPNAVEKDYPYLCMDLVYQYTL  1230
              + G ++  +    V P  F  AAK AC+T   + KS +P   E + PYLCMDLVYQY L
Sbjct  524   AEAGFVNPKEPVAKVHPADFEDAAKRACQTTHNEAKSIYPRVEESNLPYLCMDLVYQYKL  583

Query  1231  LVDGLGLHPYKEITLMKKVEYKNYMVEAAWPLGCAIDVISSS  1356
             LVDG GL P++EI L+K+VEY N +VEAAWPLG AI+ +SS+
Sbjct  584   LVDGFGLDPWQEIKLVKQVEYHNNLVEAAWPLGSAIEAVSSA  625



>ref|XP_008679360.1| PREDICTED: probable apyrase 3 isoform X1 [Zea mays]
 gb|AFW64668.1| putative apyrase family protein [Zea mays]
Length=471

 Score =   410 bits (1053),  Expect = 4e-134, Method: Compositional matrix adjust.
 Identities = 212/404 (52%), Positives = 284/404 (70%), Gaps = 1/404 (0%)
 Frame = +1

Query  148   GNYAVIFDAGSTGSRVHVFHFDENLDLLPVGD-GVEFFLKITPGLSSYADDPEAAAKSLE  324
             G YAVIFDAGSTG+RVHVF FD  L+LL +GD G+E F K+ PGLSSYA  P+ AA S+ 
Sbjct  61    GRYAVIFDAGSTGTRVHVFRFDRKLELLEIGDDGIEVFAKVKPGLSSYAGHPQEAANSML  120

Query  325   PLLLEAEGVVPTELQPDTPLELGATAGLRLLEGDASDKILQAVRDMFKNESNFKSKAEWV  504
             PLL +A+  VP +L   TPL LGATAGLRL+  + S++IL+AVR++   +S F+ K EW+
Sbjct  121   PLLDKAKSAVPKQLTKRTPLRLGATAGLRLIGEEQSEQILEAVRNLIHTKSKFQYKPEWI  180

Query  505   SILEGSQEGTYFWVAMNYLLGNLGKGYQNTIATIDLGGGSVQVSYAVSGDTFANAPKPHN  684
             +++EGSQEG+Y WVA+NYLL  LG  Y  T+A +D+GGGSVQ++YAVS +  A+AP P +
Sbjct  181   NVIEGSQEGSYLWVALNYLLDKLGGDYSQTVAVLDMGGGSVQMAYAVSANAAASAPAPTH  240

Query  685   GEEPYVQEKYILGAQYYLYVHSYLNYGQLASRAEIFKASGNSTNPCVLEGYDGYYTYNDV  864
             GE+PYV  +Y+ G  Y +Y HSYL+YG  ASRAEI KA     + C+L G+ G YTYN+ 
Sbjct  241   GEDPYVTREYLKGKDYNIYTHSYLHYGAFASRAEILKAKDGPFSSCMLRGFIGQYTYNEE  300

Query  865   SYKVTAPPNGSSLKNCRKLARKVVDFRAPCKYPNCTFNGVWSGGGGAGMENVDISSYFYD  1044
              Y  TA P G+    CR+   + ++  APC+  NCTFNG+W+GGGGAG  ++ ++S FY 
Sbjct  301   QYDATAAPEGAVYGKCREEIGRALNLNAPCEMKNCTFNGIWNGGGGAGQGSIYVASSFYF  360

Query  1045  IAIDVGIIDEGKASKIVKPRSFLVAAKLACETKFEDVKSTFPNAVEKDYPYLCMDLVYQY  1224
             +A +VGI+D    S    P +F  +A+ AC+   E+ K  +PN  + D PYLCMDL YQY
Sbjct  361   VASEVGIVDGNAPSGNTTPGAFGASAEKACQMSVEEAKIEYPNVNDVDVPYLCMDLAYQY  420

Query  1225  TLLVDGLGLHPYKEITLMKKVEYKNYMVEAAWPLGCAIDVISSS  1356
             TLLVDG G+   KEIT++ KV++  Y VEAAWPLG AI+ +SS+
Sbjct  421   TLLVDGFGVERTKEITVVDKVKHGEYYVEAAWPLGSAIEAVSST  464



>gb|EMS57965.1| Nucleoside-triphosphatase [Triticum urartu]
Length=462

 Score =   408 bits (1049),  Expect = 1e-133, Method: Compositional matrix adjust.
 Identities = 207/409 (51%), Positives = 280/409 (68%), Gaps = 2/409 (0%)
 Frame = +1

Query  148   GNYAVIFDAGSTGSRVHVFHFDENLDLLPVGDG--VEFFLKITPGLSSYADDPEAAAKSL  321
             G YAVIFDAGSTG+RVHVF FD+ ++L+ +GDG  +E F K+ PGLS+YA  P+ AAKS+
Sbjct  52    GKYAVIFDAGSTGTRVHVFRFDKKMELIDIGDGDDIEVFAKVEPGLSAYAGRPQEAAKSI  111

Query  322   EPLLLEAEGVVPTELQPDTPLELGATAGLRLLEGDASDKILQAVRDMFKNESNFKSKAEW  501
              PLL +A+  VP  L   TP++LGATAGLRL+  + +++IL+AVRD   ++S F+    W
Sbjct  112   VPLLEKAKSTVPRWLMKKTPVKLGATAGLRLIGDEKAEQILEAVRDAVHSKSKFQYNPSW  171

Query  502   VSILEGSQEGTYFWVAMNYLLGNLGKGYQNTIATIDLGGGSVQVSYAVSGDTFANAPKPH  681
             +++L GSQEG+Y WVA+NYLLGNLG  Y  T+  IDLGGGSVQ++YA+S D  A AP   
Sbjct  172   INVLTGSQEGSYLWVALNYLLGNLGGDYSKTVGVIDLGGGSVQMAYAISADAAAAAPVVP  231

Query  682   NGEEPYVQEKYILGAQYYLYVHSYLNYGQLASRAEIFKASGNSTNPCVLEGYDGYYTYND  861
              G++PYV ++Y+ G  Y +YVHSYL+YG +ASR EIFKA     + C+L GY+G YTYN 
Sbjct  232   QGDDPYVTKEYLKGRDYNVYVHSYLHYGAMASRVEIFKAKNGPVSYCMLRGYNGKYTYNG  291

Query  862   VSYKVTAPPNGSSLKNCRKLARKVVDFRAPCKYPNCTFNGVWSGGGGAGMENVDISSYFY  1041
               Y   APP G++   CR+   K +   APC+  NCTFNG W+GGGG G  ++ ++S FY
Sbjct  292   EQYDAVAPPQGAAYDKCREDVTKALKISAPCQAKNCTFNGAWNGGGGPGQADLYVTSSFY  351

Query  1042  DIAIDVGIIDEGKASKIVKPRSFLVAAKLACETKFEDVKSTFPNAVEKDYPYLCMDLVYQ  1221
              +A DVG+ID    S    P +F  AA+  C   F + K+ +P     D P++CMDL+YQ
Sbjct  352   YMAADVGLIDSEATSGKTTPAAFRAAAEKICPMGFVEAKAAYPKVRSVDAPFICMDLIYQ  411

Query  1222  YTLLVDGLGLHPYKEITLMKKVEYKNYMVEAAWPLGCAIDVISSSSANN  1368
             Y+LLVDG GL P KEIT+ +KV++  Y +EAAW LG AI+ +S +   N
Sbjct  412   YSLLVDGFGLEPTKEITVAQKVKHGEYFIEAAWALGEAIEAVSPTKRLN  460



>dbj|BAJ85095.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=472

 Score =   408 bits (1049),  Expect = 2e-133, Method: Compositional matrix adjust.
 Identities = 207/403 (51%), Positives = 284/403 (70%), Gaps = 1/403 (0%)
 Frame = +1

Query  151   NYAVIFDAGSTGSRVHVFHFDENLDLLPVGDGVEFFLKITPGLSSYADDPEAAAKSLEPL  330
              YAVIFDAGS+GSRVHVF FD NLDL+ +G  +E F++  PGLS++A+DP  AA+SL  L
Sbjct  70    KYAVIFDAGSSGSRVHVFCFDGNLDLVHIGTDIELFVQKKPGLSAFANDPREAAQSLVSL  129

Query  331   LLEAEGVVPTELQPDTPLELGATAGLRLLEGDASDKILQAVRDMFKNESNFKSKAEWVSI  510
             + +A+ VVP EL+  TP+ +GATAGLR L    S++ILQAVRD+ + +S+FK++ +WV++
Sbjct  130   IEKAKEVVPAELRDQTPVRVGATAGLRALGAGKSEEILQAVRDLLREKSSFKNQPDWVTV  189

Query  511   LEGSQEGTYFWVAMNYLLGNLGKGYQNTIATIDLGGGSVQVSYAVSGDTFANAPKPHNGE  690
             L+G+QEG Y WV +NYLLG LGK Y +T+  +DLGGGSVQ++YA+       APKP +GE
Sbjct  190   LDGTQEGAYEWVTINYLLGKLGKTYADTVGVVDLGGGSVQMAYAIPEKDAEKAPKPADGE  249

Query  691   EPYVQEKYILGAQYYLYVHSYLNYGQLASRAEIFKA-SGNSTNPCVLEGYDGYYTYNDVS  867
             E Y+++ ++ G  Y+LYVHSYL YG LA+RAEI KA + N  + CVL G+ G Y Y    
Sbjct  250   ESYMKKLFLKGTTYHLYVHSYLRYGLLAARAEILKAGNANGYSNCVLAGHQGQYKYGGNI  309

Query  868   YKVTAPPNGSSLKNCRKLARKVVDFRAPCKYPNCTFNGVWSGGGGAGMENVDISSYFYDI  1047
             ++ +A P+GSS   CR    K +     C +  C+F G+W+GGGGAG +N+ ++S+F+D 
Sbjct  310   FEASAAPSGSSFSECRADVVKALKVDEACTHMKCSFGGIWNGGGGAGQKNLFVASFFFDR  369

Query  1048  AIDVGIIDEGKASKIVKPRSFLVAAKLACETKFEDVKSTFPNAVEKDYPYLCMDLVYQYT  1227
             A + G I+   A   VKP  F  AAK AC+    D +S++P   + + PY+CMDLVYQYT
Sbjct  370   AAEAGFINSNAAVAKVKPSDFEEAAKRACKLNVNDAQSSYPAVQKDNVPYICMDLVYQYT  429

Query  1228  LLVDGLGLHPYKEITLMKKVEYKNYMVEAAWPLGCAIDVISSS  1356
             LLVDG G+ P +E+TL+KKV Y +  VEAAWPLG AI+V SSS
Sbjct  430   LLVDGFGVDPQQEMTLVKKVPYSDAFVEAAWPLGSAIEVASSS  472



>ref|XP_003576205.1| PREDICTED: LOW QUALITY PROTEIN: probable apyrase 3 [Brachypodium 
distachyon]
Length=446

 Score =   407 bits (1046),  Expect = 2e-133, Method: Compositional matrix adjust.
 Identities = 196/401 (49%), Positives = 269/401 (67%), Gaps = 6/401 (1%)
 Frame = +1

Query  148   GNYAVIFDAGSTGSRVHVFHFDENLDLLPVGDGVEFFLKITPGLSSYADDPEAAAKSLEP  327
             G YAVIFDAGSTG+RVHVF FD  ++L+ +GD ++ F K+ PGLSSYA  PE AA S+ P
Sbjct  44    GKYAVIFDAGSTGTRVHVFRFDTKMELVEIGDDIKVFAKVEPGLSSYAGRPEEAADSILP  103

Query  328   LLLEAEGVVPTELQPDTPLELGATAGLRLLEGDASDKILQAVRDMFKNESNFKSKAEWVS  507
             LL +A+ VVP  L   T ++LGATAGLRL   + +++IL+A +D+   +S F+    W++
Sbjct  104   LLQKAKSVVPRWLMRRTAVKLGATAGLRLTGDEKAEQILEAAKDVIHTKSKFQYDPSWIN  163

Query  508   ILEGSQEGTYFWVAMNYLLGNLGKGYQNTIATIDLGGGSVQVSYAVSGDTFANAPKPHNG  687
             +LEGSQEG+Y WVA+N+LL  LG  Y  T+  IDLGGGSVQ++Y +S D  A AP   +G
Sbjct  164   VLEGSQEGSYLWVALNHLLDKLGGDYGKTVGVIDLGGGSVQMAYDISEDAAATAPVVPDG  223

Query  688   EEPYVQEKYILGAQYYLYVHSYLNYGQLASRAEIFKASGNSTNPCVLEGYDGYYTYNDVS  867
             ++PY  ++Y  G  Y +Y HSYL+YG +ASRAEIFKA    T+ C+L G+ G Y+YN V 
Sbjct  224   KDPYXTKEYFKGRDYNIYAHSYLHYGAMASRAEIFKAKNGPTSYCMLRGFVGEYSYNGVQ  283

Query  868   YKVTAPPNGSSLKNCRKLARKVVDFRAPCKYPNCTFNGVWSGGGGAGMENVDISSYFYDI  1047
             +  TA P G++   CR+   K +   APC++ NCTFNG W+G       ++ ++S FY +
Sbjct  284   FDATASPQGAAYGKCREDVTKALKLGAPCEHKNCTFNGAWNG------XDLYVTSTFYYV  337

Query  1048  AIDVGIIDEGKASKIVKPRSFLVAAKLACETKFEDVKSTFPNAVEKDYPYLCMDLVYQYT  1227
             A +VG+ID    S    P +F  AA+  C   FE+ K+ +      D PY+CMDLVYQY+
Sbjct  338   ASEVGLIDSEATSGKTTPAAFGSAAEKICAMSFEETKAAYTRVRASDAPYICMDLVYQYS  397

Query  1228  LLVDGLGLHPYKEITLMKKVEYKNYMVEAAWPLGCAIDVIS  1350
             LLVDG GL P KEIT+ +KV++  Y +EAAWPLG AI+ +S
Sbjct  398   LLVDGFGLEPMKEITVAQKVKHGEYFLEAAWPLGEAIEAVS  438



>gb|EAY96392.1| hypothetical protein OsI_18291 [Oryza sativa Indica Group]
Length=475

 Score =   407 bits (1046),  Expect = 5e-133, Method: Compositional matrix adjust.
 Identities = 210/410 (51%), Positives = 280/410 (68%), Gaps = 4/410 (1%)
 Frame = +1

Query  145   AGN--YAVIFDAGSTGSRVHVFHFDENLDLLPVGDGVEFFLKITPGLSSYADDPEAAAKS  318
             AGN  YAVIFDAGSTGSRVHVF FD+ +DL+ +GD +E F K+ PGLSSYA  P+ AA S
Sbjct  66    AGNDKYAVIFDAGSTGSRVHVFRFDKQMDLVKIGDDMELFAKVKPGLSSYAGKPQEAANS  125

Query  319   LEPLLLEAEGVVPTELQPDTPLELGATAGLRLLEGDASDKILQAVRDMFKNESNFKSKAE  498
             + PLL +A+GVVP +LQ  TPL+LGATAGLRL+  + S++IL+AVRD+  ++SNF+ K E
Sbjct  126   IAPLLEKAKGVVPKQLQKRTPLKLGATAGLRLIGDEKSEQILEAVRDLVHSKSNFQYKPE  185

Query  499   WVSILEGSQEGTYFWVAMNYLLGNLGKGYQNTIATIDLGGGSVQVSYAVSGDTFANAPKP  678
             W+S+L GSQEG+  WVA+NYLLG LG  Y  T+  IDLGGGSVQ++YA+S D   NAP  
Sbjct  186   WISVLGGSQEGSNLWVALNYLLGKLGGDYSKTVGVIDLGGGSVQMAYAISSDAAENAPPV  245

Query  679   HNGEEPYVQEKYILGAQYYLYVHSYLNYGQLASRAEIFKASGNSTNPCVLEGYDGYYTYN  858
               G++PYV ++Y+ G  Y LYVHSYL+YG  ASR EI K      + C+L G++G Y YN
Sbjct  246   PVGKDPYVTKEYLKGKDYNLYVHSYLHYGLQASRVEILKTKNGQFSSCMLRGFNGTYKYN  305

Query  859   DVSYKVTAPPNGSSLKNCRKLARKVVDFRAPCKYPNCTFNGVWSGGGGAGMENVDISSYF  1038
                Y   A P G+    C + A   +   APC+  NC+FNGVW+GGGGAGM ++ ++SYF
Sbjct  306   GEEYDAAASPEGADHGKCGEEAAAALGLDAPCESRNCSFNGVWNGGGGAGMADLYVASYF  365

Query  1039  YDIAIDVGIIDEGKASKIVKPRSFLVAAKLACETKFEDVKSTFPNAVEKDYPYLCMDLVY  1218
             YD A+  G + +   S +  P +F  AA  AC     +  + +P A   D  ++CMDL Y
Sbjct  366   YDRAVHGGFVVDDAPSAVTTPAAFAEAASKACSLSSGEAAAAYPEAF--DVQFICMDLTY  423

Query  1219  QYTLLVDGLGLHPYKEITLMKKVEYKNYMVEAAWPLGCAIDVISSSSANN  1368
             QYTLL  G GL P +E+TL+K+V+Y +  VE+AWPLG AI+ +SS  ++ 
Sbjct  424   QYTLLTKGFGLKPTREMTLVKQVKYGDCYVESAWPLGTAIEALSSQKSHQ  473



>ref|XP_003624590.1| Nucleoside-triphosphatase [Medicago truncatula]
Length=810

 Score =   418 bits (1074),  Expect = 6e-133, Method: Compositional matrix adjust.
 Identities = 214/439 (49%), Positives = 299/439 (68%), Gaps = 9/439 (2%)
 Frame = +1

Query  64    FISLALLLFPLACFSRSHLRRVLLNHEA-------GNYAVIFDAGSTGSRVHVFHFDENL  222
              I+  L L P    S+     +L N +         +YAV+FDAGSTGSRVHV+HFD+NL
Sbjct  7     LITFLLFLMPTISSSQYLGNNILTNRKIFPKQETLTSYAVVFDAGSTGSRVHVYHFDQNL  66

Query  223   DLLPVGDGVEFFLKITPGLSSYADDPEAAAKSLEPLLLEAEGVVPTELQPDTPLELGATA  402
             DLL +G+ VEF+ K TPGLS+YAD+P+ AA+SL PLL +AE VVP  LQP TP++LGATA
Sbjct  67    DLLHIGNDVEFYNKTTPGLSAYADNPKEAAESLIPLLEQAERVVPVNLQPKTPVKLGATA  126

Query  403   GLRLLEGDASDKILQAV--RDMFKNESNFKSKAEWVSILEGSQEGTYFWVAMNYLLGNLG  576
             GLRLL+G++S+ IL+AV    + K  S F  +++ V I++G+QEG+Y WV +NY+LGNLG
Sbjct  127   GLRLLDGNSSELILEAVIVSSLLKKRSTFNVQSDAVGIIDGTQEGSYLWVTINYVLGNLG  186

Query  577   KGYQNTIATIDLGGGSVQVSYAVSGDTFANAPKPHNGEEPYVQEKYILGAQYYLYVHSYL  756
             K +  T+A  DLGGGSVQ+ YAVS +    AP+   GE+PY+++  + G +YYLYVHSYL
Sbjct  187   KDFSETVAVADLGGGSVQMVYAVSREQAKKAPQVPQGEDPYIKKIVLKGKKYYLYVHSYL  246

Query  757   NYGQLASRAEIFKASGNSTNPCVLEGYDGYYTYNDVSYKVTAPPNGSSLKNCRKLARKVV  936
              +G+ ASRAEI K +  S NPC+L GY G YTY+   YK  +P +GS+   C+++  K +
Sbjct  247   RFGKEASRAEILKVTNGSPNPCILAGYHGTYTYSGEEYKAFSPASGSNFDECKEIILKAL  306

Query  937   DFRAPCKYPNCTFNGVWSGGGGAGMENVDISSYFYDIAIDVGIIDEGKASKIVKPRSFLV  1116
                 PC Y  C+F G+W+GGGG+G + + ++S FY +   V I D  K +  ++      
Sbjct  307   KVNDPCPYGKCSFGGIWNGGGGSGQKTLYVTSSFYYVPTGVNIADPNKPNSKIRIEDLKT  366

Query  1117  AAKLACETKFEDVKSTFPNAVEKDYPYLCMDLVYQYTLLVDGLGLHPYKEITLMKKVEYK  1296
              A+  C+TK++D K+T+P   E   PY C+DL+YQYTL VDG GL P +EIT+  ++EY+
Sbjct  367   GAEQVCKTKYKDAKATYPLIYEDSLPYACLDLIYQYTLFVDGFGLDPLQEITVANQIEYQ  426

Query  1297  NYMVEAAWPLGCAIDVISS  1353
             + +V+AAWPLG AI+ ISS
Sbjct  427   DALVDAAWPLGNAIEAISS  445


 Score =   213 bits (542),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 116/289 (40%), Positives = 176/289 (61%), Gaps = 21/289 (7%)
 Frame = +1

Query  544   VAMNYLLGNLGKGYQN-------------------TIATIDLGGGSVQVSYAVSGDTFAN  666
             V +NY+LGNLG   ++                   ++A  D+GGG + +  AVS +    
Sbjct  521   VTINYVLGNLGNTQKDFSEAMSVLENVVVELGNTLSVALGDIGGG-ITID-AVSREQAKK  578

Query  667   APKPHNGEEPYVQEKYILGAQYYLYVHSYLNYGQLASRAEIFKASGNSTNPCVLEGYDGY  846
             AP+   GE+PY+++  + G +YYLYVHSYL +G+ ASRAEI K +  S NPC+L GY G 
Sbjct  579   APQVPQGEDPYIKKIVLKGKKYYLYVHSYLRFGKEASRAEILKVTNGSPNPCILAGYHGT  638

Query  847   YTYNDVSYKVTAPPNGSSLKNCRKLARKVVDFRAPCKYPNCTFNGVWSGGGGAGMENVDI  1026
             YTY+   YK  +P +G +   C+++  K +    PC Y  C+F G+W+GGGG+G + + +
Sbjct  639   YTYSGEEYKAFSPASGPNFDECKEIILKALKVNDPCPYGKCSFGGIWNGGGGSGQKTLYV  698

Query  1027  SSYFYDIAIDVGIIDEGKASKIVKPRSFLVAAKLACETKFEDVKSTFPNAVEKDYPYLCM  1206
             +S FY +   V I D  K +  ++       A+  C+TK++D K+T+P   E   PY C+
Sbjct  699   TSSFYYVPTGVNIADPNKPNSKIRIEDLKTGAEQVCKTKYKDAKATYPLIYEDSLPYACL  758

Query  1207  DLVYQYTLLVDGLGLHPYKEITLMKKVEYKNYMVEAAWPLGCAIDVISS  1353
             DL+YQYTL VDG GL P ++IT+  ++EY++ +V+AAWPLG AI+ +SS
Sbjct  759   DLIYQYTLFVDGFGLDPLQDITVANQIEYQDALVDAAWPLGNAIEAVSS  807



>gb|ABA91264.2| GDA1/CD39 family protein [Oryza sativa Japonica Group]
Length=465

 Score =   405 bits (1042),  Expect = 1e-132, Method: Compositional matrix adjust.
 Identities = 206/409 (50%), Positives = 274/409 (67%), Gaps = 10/409 (2%)
 Frame = +1

Query  148   GNYAVIFDAGSTGSRVHVFHFDENLDLLPVGDGVEFFLKITPGLSSYADDPEAAAKSLEP  327
             G YAVI DAGSTG+RVHVF FD+ +DLL +GD +E F K+ PGLSSYA  P+ AAKS+ P
Sbjct  51    GRYAVILDAGSTGTRVHVFRFDKKIDLLKIGDDIEVFAKVDPGLSSYAGRPQEAAKSIMP  110

Query  328   LLLEAEGVVPTELQPDTPLELGATAGLRLLEGDASDKILQAVRDMFKNESNFKSKAEWVS  507
             LL  A   VPT L   TPLELGATAGLRL+  D +++IL+AVRD+   ++ F+    W++
Sbjct  111   LLDRANHAVPTWLMNKTPLELGATAGLRLIGDDKANQILEAVRDVVHTKTKFQYNPNWIN  170

Query  508   ILEGSQEGTYFWVAMNYLLGNLGKGYQNTIATIDLGGGSVQVSYAVSGDTFANAPKPHNG  687
             +L GSQEG+Y WVA+NYLL  LG  Y  T+  IDLGGGSVQ++YA+S  T ANAP+  +G
Sbjct  171   VLSGSQEGSYMWVALNYLLDRLGGDYSKTVGVIDLGGGSVQMAYAISTGTAANAPEVLDG  230

Query  688   EEPYVQEKYILGAQYYLYVHSYLNYGQLASRAEIFKASGNSTNPCVLEGYDGYYTYNDVS  867
             ++PY+ ++Y+    Y +YVHSYL+YG  ASR EI K    + + C+L G+ G Y YN   
Sbjct  231   QDPYIIKEYLKERDYNVYVHSYLHYGARASRVEILKRKNGTFSNCMLRGFSGKYIYNGEQ  290

Query  868   YKVTAPPNGSSLKNCRKLARKVVDFRAPCKYPNCTFNGVWSGGGGAGMENVDISSYFYDI  1047
             Y  TA P G+    CR    K ++  APC+  NC+FNGVW+GGGGAG + + +++ FY +
Sbjct  291   YDATAAPQGADYHKCRDDVVKALNLDAPCETNNCSFNGVWNGGGGAGQDELYVATSFYYM  350

Query  1048  AID--------VGIIDEGKASKIVKPRSFLVAAKLACETKFEDVKSTFPNAVEKDYPYLC  1203
             A D        +G ID    S    P ++ VAA+  C    E+ K+ +P A   D+ YLC
Sbjct  351   ASDHEQGRLQQIGFIDSEAPSAKSTPAAYKVAAEKVCSLSVEEAKAAYPRAC--DHAYLC  408

Query  1204  MDLVYQYTLLVDGLGLHPYKEITLMKKVEYKNYMVEAAWPLGCAIDVIS  1350
             MDLVYQYTLLVDG GL   KE+TL++KV++  Y +EAAWPLG AI+ +S
Sbjct  409   MDLVYQYTLLVDGFGLEATKEMTLVEKVKHGEYYIEAAWPLGTAIEAVS  457



>dbj|BAD13524.1| apyrase [Vicia faba]
Length=440

 Score =   405 bits (1040),  Expect = 1e-132, Method: Compositional matrix adjust.
 Identities = 216/443 (49%), Positives = 292/443 (66%), Gaps = 25/443 (6%)
 Frame = +1

Query  55    HLVFISLALLLFPLACFSRSHL--------RRVLLNHEA-GNYAVIFDAGSTGSRVHVFH  207
              L+   +  LLF +   + S          R++ L  E   +YAV+FDAGSTGSR+HV+H
Sbjct  2     ELLIKLITFLLFSMPAITSSQYLGNNLLTSRKIFLKQEEISSYAVVFDAGSTGSRIHVYH  61

Query  208   FDENLDLLPVGDGVEFFLKITPGLSSYADDPEAAAKSLEPLLLEAEGVVPTELQPDTPLE  387
             F++NLDLL +G GVE++ KITPGLSSYA++PE AAKSL PLL +AE VVP +LQP TP+ 
Sbjct  62    FNQNLDLLHIGKGVEYYNKITPGLSSYANNPEQAAKSLIPLLEQAEDVVPDDLQPKTPVR  121

Query  388   LGATAGLRLLEGDASDKILQAVRDMFKNESNFKSKAEWVSILEGSQEGTYFWVAMNYLLG  567
             LG               ILQ+VRDM  N S F  + + VSI++G+QEG+Y WV +NY LG
Sbjct  122   LG---------------ILQSVRDMLSNRSTFNVQPDAVSIIDGTQEGSYLWVTVNYALG  166

Query  568   NLGKGYQNTIATIDLGGGSVQVSYAVSGDTFANAPKPHNGEEPYVQEKYILGAQYYLYVH  747
             NLGK Y  T+  IDLGGGSVQ++YAVS  T  NAPK  +G++PY+++  + G  Y LYVH
Sbjct  167   NLGKKYTKTVGVIDLGGGSVQMAYAVSKKTAKNAPKVADGDDPYIKKVVLKGIPYDLYVH  226

Query  748   SYLNYGQLASRAEIFKASGNSTNPCVLEGYDGYYTYNDVSYKVTAPPNGSSLKNCRKLAR  927
             SYL++G+ ASRAEI K +  S NPC+L G++G YTY+    K TA  + +    C+   R
Sbjct  227   SYLHFGREASRAEILKLTPRSPNPCLLAGFNGIYTYSGEEVKATAYTSWAQFNKCKNTIR  286

Query  928   KVVDFRAPCKYPNCTFNGVWSGGGGAGMENVDISSYFYDIAIDVGIIDEGKASKIVKPRS  1107
             K +    PC Y NCTF G+W+GGGG G +N+  SS F+ +  D G++D    + I++P  
Sbjct  287   KALKLNYPCPYQNCTFGGIWNGGGGNGQKNLFASSSFFYLPEDTGMVDASTPNFILRPVD  346

Query  1108  FLVAAKLACETKFEDVKSTFPNAVEKDY-PYLCMDLVYQYTLLVDGLGLHPYKEITLMKK  1284
                 AK AC   FED KST+P   +K+   Y+CMDL+YQY LLVDG GL P ++IT  K+
Sbjct  347   IETKAKEACALNFEDAKSTYPFLDKKNVASYVCMDLIYQYVLLVDGFGLDPLQKITSGKE  406

Query  1285  VEYKNYMVEAAWPLGCAIDVISS  1353
             +EY++ +VEAAWPLG A++ IS+
Sbjct  407   IEYQDAIVEAAWPLGNAVEAISA  429



>ref|NP_001154717.1| apyrase 2 [Arabidopsis thaliana]
 gb|AED92533.1| apyrase 2 [Arabidopsis thaliana]
Length=630

 Score =   409 bits (1052),  Expect = 8e-132, Method: Compositional matrix adjust.
 Identities = 221/456 (48%), Positives = 293/456 (64%), Gaps = 57/456 (13%)
 Frame = +1

Query  151   NYAVIFDAGSTGSRVHVFHFDENLDLLPVGDGVEFFLK----------------------  264
             NYAVIFDAGS+GSRVHV+ FD+NLDL+P+G+ +E FL+                      
Sbjct  176   NYAVIFDAGSSGSRVHVYCFDQNLDLIPLGNELELFLQSLVKKLASPNGSNRANMTLFDH  235

Query  265   ------------------------------ITPGLSSYADDPEAAAKSLEPLLLEAEGVV  354
                                           + PGLS+Y  DP  AA SL  LL +AE  V
Sbjct  236   GNISCPEVKLNRINGKLRTLLSMYIIDLCSLKPGLSAYPTDPRQAANSLVSLLDKAEASV  295

Query  355   PTELQPDTPLELGATAGLRLLEGDASDKILQAVRDMFKNESNFKSKAEWVSILEGSQEGT  534
             P EL+P T + +GATAGLR L  DAS+ ILQAVR++ ++ S  K++A  V++L+G+QEG+
Sbjct  296   PRELRPKTHVRVGATAGLRTLGHDASENILQAVRELLRDRSMLKTEANAVTVLDGTQEGS  355

Query  535   YFWVAMNYLLGNLGKGYQNTIATIDLGGGSVQVSYAVSGDTFANAPKPHNGEEPYVQEKY  714
             Y WV +NYLL NLGK Y +T+  +DLGGGSVQ++YA+S +  A+APKP  GE+ YV+E Y
Sbjct  356   YQWVTINYLLRNLGKPYSDTVGVVDLGGGSVQMAYAISEEDAASAPKPLEGEDSYVREMY  415

Query  715   ILGAQYYLYVHSYLNYGQLASRAEIFKASGNSTNPCVLEGYDGYYTYNDVSYKVTAPPNG  894
             + G +Y+LYVHSYL+YG LA+RAEI K S +S NPC++ GYDG Y Y    +K  A  +G
Sbjct  416   LKGRKYFLYVHSYLHYGLLAARAEILKVSEDSENPCIVAGYDGMYKYGGKEFKAPASQSG  475

Query  895   SSLKNCRKL---ARKVVDFRAPCKYPNCTFNGVWSGGGGAGMENVDISSYFYDIAIDVGI  1065
             +SL  CR++   A KV D    C +  CTF GVW+GG G G +N+ ++S+F+D A + G 
Sbjct  476   ASLDECRRITINALKVND--TLCTHMKCTFGGVWNGGRGGGQKNMFVASFFFDRAAEAGF  533

Query  1066  IDEGKASKIVKPRSFLVAAKLACETKFEDVKSTFPNAVEKDYPYLCMDLVYQYTLLVDGL  1245
             +D  +    V+P  F  AAK AC  K E+ KSTFP   E++ PYLCMDLVYQYTLL+DG 
Sbjct  534   VDPKQPVATVRPMDFEKAAKKACSMKLEEGKSTFPLVEEENLPYLCMDLVYQYTLLIDGF  593

Query  1246  GLHPYKEITLMKKVEYKNYMVEAAWPLGCAIDVISS  1353
             GL P + ITL+KKV+Y +  VEAAWPLG AI+ +SS
Sbjct  594   GLEPSQTITLVKKVKYGDQAVEAAWPLGSAIEAVSS  629



>ref|NP_001067813.1| Os11g0439600 [Oryza sativa Japonica Group]
 gb|AAX94975.1| apyrase [Oryza sativa Japonica Group]
 gb|ABA93335.1| GDA1/CD39 family protein, expressed [Oryza sativa Japonica Group]
 dbj|BAF28176.1| Os11g0439600 [Oryza sativa Japonica Group]
 dbj|BAG96402.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG91697.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG96675.1| unnamed protein product [Oryza sativa Japonica Group]
Length=475

 Score =   403 bits (1036),  Expect = 1e-131, Method: Compositional matrix adjust.
 Identities = 208/410 (51%), Positives = 279/410 (68%), Gaps = 4/410 (1%)
 Frame = +1

Query  145   AGN--YAVIFDAGSTGSRVHVFHFDENLDLLPVGDGVEFFLKITPGLSSYADDPEAAAKS  318
             AGN  YAVIFDAGSTGSRVHVF FD+ +DL+ +GD +E F K+ PGLSSYA  P+ AA S
Sbjct  66    AGNDKYAVIFDAGSTGSRVHVFRFDKQMDLVKIGDDMELFAKVKPGLSSYAGKPQEAANS  125

Query  319   LEPLLLEAEGVVPTELQPDTPLELGATAGLRLLEGDASDKILQAVRDMFKNESNFKSKAE  498
             + PLL +A+GVVP +LQ  TPL+LGATAGLRL+  + S++IL+AVRD+  ++SNF+ K E
Sbjct  126   IAPLLEKAKGVVPKQLQKRTPLKLGATAGLRLIGDEKSEQILEAVRDLVHSKSNFQYKPE  185

Query  499   WVSILEGSQEGTYFWVAMNYLLGNLGKGYQNTIATIDLGGGSVQVSYAVSGDTFANAPKP  678
             W+S+L GSQEG+  WVA+NYLLG LG  Y  T+  IDLGGGSVQ++YA+S D   N+P  
Sbjct  186   WISVLGGSQEGSNLWVALNYLLGKLGGDYSKTVGVIDLGGGSVQMAYAISSDAAENSPPV  245

Query  679   HNGEEPYVQEKYILGAQYYLYVHSYLNYGQLASRAEIFKASGNSTNPCVLEGYDGYYTYN  858
               G++PYV ++Y+ G  Y LYVHSYL+YG  ASR EI K      + C+L  ++G Y YN
Sbjct  246   PVGKDPYVTKEYLKGKDYNLYVHSYLHYGLQASRVEILKTKNGQFSSCMLREFNGTYKYN  305

Query  859   DVSYKVTAPPNGSSLKNCRKLARKVVDFRAPCKYPNCTFNGVWSGGGGAGMENVDISSYF  1038
                Y   A P G+    C + A   +   APC+  NC+FNGVW+GGGGAGM ++ ++SYF
Sbjct  306   GEEYDAAASPEGADHGKCGEEAAAALGLDAPCESRNCSFNGVWNGGGGAGMADLYVASYF  365

Query  1039  YDIAIDVGIIDEGKASKIVKPRSFLVAAKLACETKFEDVKSTFPNAVEKDYPYLCMDLVY  1218
             YD A+  G + +   S +  P +F  AA  AC     +  + +P A   D  ++CMDL Y
Sbjct  366   YDRAVHGGFVVDDAPSAVTTPAAFAEAASKACSLSSGEAAAAYPEAF--DVQFICMDLTY  423

Query  1219  QYTLLVDGLGLHPYKEITLMKKVEYKNYMVEAAWPLGCAIDVISSSSANN  1368
             QYTLL  G GL P +E+TL+K+V+Y +  VE+AWPLG AI+ +SS  ++ 
Sbjct  424   QYTLLTKGFGLKPTREMTLVKQVKYGDCYVESAWPLGTAIEALSSQKSHQ  473



>ref|XP_006664293.1| PREDICTED: probable apyrase 3-like [Oryza brachyantha]
Length=445

 Score =   402 bits (1033),  Expect = 2e-131, Method: Compositional matrix adjust.
 Identities = 200/404 (50%), Positives = 275/404 (68%), Gaps = 3/404 (1%)
 Frame = +1

Query  142   EAGNYAVIFDAGSTGSRVHVFHFD-ENLDLLPVGDGVEFFLKITPGLSSYADDPEAAAKS  318
             +AG Y VI DAGSTG+R+HVF FD + LDLL +GD +E F K+ PGLSSYA  P+ AAKS
Sbjct  43    KAGRYVVILDAGSTGTRLHVFRFDVKRLDLLDIGDHIEVFAKVDPGLSSYAGRPQEAAKS  102

Query  319   LEPLLLEAEGVVPTELQPDTPLELGATAGLRLLEGDASDKILQAVRDMFKNESNFKSKAE  498
             + PLL +A   VP  L   TPL LGATAGLRL+  + +++IL+AVRD+  ++S ++    
Sbjct  103   ILPLLHDANKAVPAPLINKTPLRLGATAGLRLVGDEKANQILEAVRDVVHSKSKYQYNPN  162

Query  499   WVSILEGSQEGTYFWVAMNYLLGNLGKGYQNTIATIDLGGGSVQVSYAVSGDTFANAPKP  678
             W+++L GSQEG+Y WVA+NYLL  LG+ Y  T+  IDLGG SVQ++YA+S  T ANAPK 
Sbjct  163   WINVLTGSQEGSYMWVALNYLLDRLGRDYSKTVGVIDLGGASVQMAYAISSSTAANAPKV  222

Query  679   HNGEEPYVQEKYILGAQYYLYVHSYLNYGQLASRAEIFKASGNSTNPCVLEGYDGYYTYN  858
              +G++PY+ ++Y+ G  Y +YVHSYL YG LA+R EI K      + C+L G++G +TYN
Sbjct  223   PHGKDPYITKEYLNGKDYNIYVHSYLRYGGLAARVEILKRKTGQYSNCMLHGFNGNFTYN  282

Query  859   DVSYKVTAPPNGSSLKNCRKLARKVVDFRAPCKYPNCTFNGVWSGGGGAGMENVDISSYF  1038
                Y  TA P G+   NCR      ++  APCK  NCTFNGVW+GGGG G +++ ++S F
Sbjct  283   GKQYDATAAPQGADYHNCRDDVVNTLNLDAPCKTKNCTFNGVWNGGGGKGQDDLYVASGF  342

Query  1039  YDIAIDVGIIDEGKASKIVKPRSFLVAAKLACETKFEDVKSTFPNAVEKDYPYLCMDLVY  1218
             Y +A ++G ID    S    P +F   A+  C    ++ K+ +P A  +D+ YLCMDL+Y
Sbjct  343   YYLASNLGFIDNDAPSAKSTPTAFKDGAEKVCRMSIQEAKAAYPKA--RDHAYLCMDLIY  400

Query  1219  QYTLLVDGLGLHPYKEITLMKKVEYKNYMVEAAWPLGCAIDVIS  1350
             QY+LLVDG GL   K+ITL+ KV++  Y ++AAWPLG AI+ +S
Sbjct  401   QYSLLVDGYGLDSNKKITLVAKVKHGEYYIDAAWPLGTAIEAVS  444



>ref|XP_003562437.1| PREDICTED: probable apyrase 2 [Brachypodium distachyon]
Length=465

 Score =   402 bits (1033),  Expect = 3e-131, Method: Compositional matrix adjust.
 Identities = 209/433 (48%), Positives = 291/433 (67%), Gaps = 2/433 (0%)
 Frame = +1

Query  58    LVFISLALLLFPLACFSRSHLRRVLLNHEAGNYAVIFDAGSTGSRVHVFHFDENLDLLPV  237
             +  +SL LLL P +  +   L          +YAVIFDAGS+GSRVHVF FD NLDL+ +
Sbjct  34    IALVSLVLLLMPRSPAAHGRLGGGSAGGAR-SYAVIFDAGSSGSRVHVFCFDANLDLVHI  92

Query  238   GDGVEFFLKITPGLSSYADDPEAAAKSLEPLLLEAEGVVPTELQPDTPLELGATAGLRLL  417
             G  +E F++  PGLS+YA DP  AA+SL  L+  A+ VVP EL+  TP+ +GATAGLR L
Sbjct  93    GTEIELFVQKKPGLSAYASDPREAAESLVSLIDAAKQVVPAELRDQTPVRVGATAGLRAL  152

Query  418   EGDASDKILQAVRDMFKNESNFKSKAEWVSILEGSQEGTYFWVAMNYLLGNLGKGYQNTI  597
               + S++IL AVRD+ + +S+FK++ +WV++L+G QEG Y WV +NYLLG LGK Y +T+
Sbjct  153   GAEKSEQILDAVRDLLREKSSFKNQPDWVTVLDGYQEGAYEWVTINYLLGKLGKTYADTV  212

Query  598   ATIDLGGGSVQVSYAVSGDTFANAPKPHNGEEPYVQEKYILGAQYYLYVHSYLNYGQLAS  777
               +DLGGGSVQ++YA+       APKP +GEE YV++ ++ G  Y+LYVHSYL YG LA+
Sbjct  213   GVVDLGGGSVQMAYAIPEKDAEKAPKPTDGEESYVKKLFLKGTTYHLYVHSYLRYGLLAA  272

Query  778   RAEIFKAS-GNSTNPCVLEGYDGYYTYNDVSYKVTAPPNGSSLKNCRKLARKVVDFRAPC  954
             RAEI KA   N  + C+L G+ G Y Y   +++ +A P+G+S   CR    K +     C
Sbjct  273   RAEILKAGIANGYSDCILGGHQGQYKYGGNTFEASAAPSGASYSKCRDDVVKALKVDEAC  332

Query  955   KYPNCTFNGVWSGGGGAGMENVDISSYFYDIAIDVGIIDEGKASKIVKPRSFLVAAKLAC  1134
              +  C+F G+W+GGGG G +N+ ++S+F+D A + G I+   A   VKP  F  AAK AC
Sbjct  333   THMKCSFGGIWNGGGGDGQKNLFVASFFFDRAAEAGFINPKAAVAKVKPSDFEEAAKRAC  392

Query  1135  ETKFEDVKSTFPNAVEKDYPYLCMDLVYQYTLLVDGLGLHPYKEITLMKKVEYKNYMVEA  1314
             +    D +S++P   + + P++CMDLVYQY+LLVDG G+ P +E+TL+KKV Y +  VEA
Sbjct  393   KLNVNDAQSSYPGVQQDNVPFICMDLVYQYSLLVDGFGVDPQQEMTLVKKVPYSDAFVEA  452

Query  1315  AWPLGCAIDVISS  1353
             AWPLG AI+V SS
Sbjct  453   AWPLGSAIEVASS  465



>dbj|BAD13520.1| apyrase [Vicia faba]
Length=455

 Score =   401 bits (1030),  Expect = 6e-131, Method: Compositional matrix adjust.
 Identities = 219/437 (50%), Positives = 296/437 (68%), Gaps = 10/437 (2%)
 Frame = +1

Query  73    LALLLFPLACFSRSHL--------RRVLLNHEA-GNYAVIFDAGSTGSRVHVFHFDENLD  225
             +  LLF +   + S          R++ L  E   +YAV+FDAGSTGSR+HV+HF++NLD
Sbjct  8     ITFLLFSMPAITSSQYLGNNLLTSRKIFLKQEEISSYAVVFDAGSTGSRIHVYHFNQNLD  67

Query  226   LLPVGDGVEFFLKITPGLSSYADDPEAAAKSLEPLLLEAEGVVPTELQPDTPLELGATAG  405
             LL +G GVE++ KITPG SSYA++PE AAKSL PLL +AE VVP +LQP TP+ LGA  G
Sbjct  68    LLHIGKGVEYYNKITPGFSSYANNPEQAAKSLIPLLEQAEDVVPDDLQPKTPVRLGALPG  127

Query  406   LRLLEGDASDKILQAVRDMFKNESNFKSKAEWVSILEGSQEGTYFWVAMNYLLGNLGKGY  585
             L LL GDAS+KILQ+VRDM  N S F    + VSI++G+QEG+Y WV +NY LGNLGK Y
Sbjct  128   LGLLNGDASEKILQSVRDMLSNRSTFTVPPDAVSIIDGTQEGSYLWVTVNYALGNLGKKY  187

Query  586   QNTIATIDLGGGSVQVSYAVSGDTFANAPKPHNGEEPYVQEKYILGAQYYLYVHSYLNYG  765
               T+  IDLGGGSVQ++YAVS  T   APK  +G++P +++  + G  Y LYVHSYL++ 
Sbjct  188   TKTVGVIDLGGGSVQMAYAVSKKTAKTAPKVADGDDPSIKKVALKGIPYDLYVHSYLHFA  247

Query  766   QLASRAEIFKASGNSTNPCVLEGYDGYYTYNDVSYKVTAPPNGSSLKNCRKLARKVVDFR  945
             + ASRAE  K +  S  P +L G++G YTY+   +K TA  +G++   C+   RK +   
Sbjct  248   REASRAETLKLTPRSPTPFLLAGFNGIYTYSGEEFKATAYTSGANFNKCKNTIRKALKLN  307

Query  946   APCKYPNCTFNGVWSGGGGAGMENVDISSYFYDIAIDVGIIDEGKASKIVKPRSFLVAAK  1125
              PC Y NCTF G+W+GGGG G +N+  SS F+ +  D G++D    + I++P      AK
Sbjct  308   YPCPYQNCTFGGIWNGGGGNGQKNLFASSSFFYLPEDAGMVDASTPNFILRPVDIETKAK  367

Query  1126  LACETKFEDVKSTFPNAVEKDY-PYLCMDLVYQYTLLVDGLGLHPYKEITLMKKVEYKNY  1302
              AC   FED KST+P   +K+   Y+CMDL+YQY LLVDG GL P ++IT  K++EY++ 
Sbjct  368   EACALNFEDAKSTYPFLDKKNVASYVCMDLIYQYVLLVDGFGLDPLQKITSGKEIEYQDA  427

Query  1303  MVEAAWPLGCAIDVISS  1353
             +VEAAWPLG A++ IS+
Sbjct  428   IVEAAWPLGNAVEAISA  444



>gb|EMS65821.1| Apyrase [Triticum urartu]
Length=436

 Score =   400 bits (1028),  Expect = 6e-131, Method: Compositional matrix adjust.
 Identities = 199/401 (50%), Positives = 266/401 (66%), Gaps = 2/401 (0%)
 Frame = +1

Query  148   GNYAVIFDAGSTGSRVHVFHFDENLDLLPVGDGVEFFLKITPGLSSYADDPEAAAKSLEP  327
             G YAVI DAGSTG+R+HVF FD+ +DL+ +GD +E F K+ PGLSSY+  P+ A +S+ P
Sbjct  33    GKYAVILDAGSTGTRMHVFRFDKRMDLVKIGDDIEVFAKVNPGLSSYSGRPKEATESILP  92

Query  328   LLLEAEGVVPTELQPDTPLELGATAGLRLLEGDASDKILQAVRDMFKNESNFKSKAEWVS  507
             LL +A  VVP  L   TP++LGATAGLRL+    + +IL AVR      + F+   +W++
Sbjct  93    LLQKANSVVPQRLMKTTPVKLGATAGLRLIGDKQAKQILDAVRGAVHTNTKFQYNPKWIN  152

Query  508   ILEGSQEGTYFWVAMNYLLGNLGKGYQNTIATIDLGGGSVQVSYAVSGDTFANAPKPHNG  687
             +LEGSQEG+Y WVA+NYLL NLG  Y  T+  IDLGGGSVQ++YA+S  T   AP   +G
Sbjct  153   VLEGSQEGSYLWVALNYLLDNLGGDYSKTVGVIDLGGGSVQMAYAISPATVVAAPGVPHG  212

Query  688   EEPYVQEKYILGAQYYLYVHSYLNYGQLASRAEIFKASGNSTNPCVLEGYDGYYTYNDVS  867
             ++PYV ++Y+ G  Y +YVHSYL YG LASR EIFKA     + C+L G+ G YTYN   
Sbjct  213   KDPYVTKEYLKGRDYNIYVHSYLRYGALASRVEIFKAKEGPFSYCMLRGFSGKYTYNGEE  272

Query  868   YKVTAPPNGSSLKNCRKLARKVVDFRAPCKYPNCTFNGVWSGGGGAGMENVDISSYFYDI  1047
             Y  TA   G+    CR    K +   APC+   CTF+GVW+GGGG G  N+ ++S FY +
Sbjct  273   YNATASTGGAQYGKCRGDVMKALKLDAPCQAKKCTFDGVWNGGGGPGQANLYVASSFYYM  332

Query  1048  AIDVGIIDEGKASKIVKPRSFLVAAKLACETKFEDVKSTFPNAVEKDYPYLCMDLVYQYT  1227
             A  VG+ID    S    P +F   A+  C    ++VK+ +P    +D PY+CMDLVYQY+
Sbjct  333   ASQVGLIDSDAPSGTSTPMAFRAVAQKICRMSLKEVKAKYPKV--RDIPYICMDLVYQYS  390

Query  1228  LLVDGLGLHPYKEITLMKKVEYKNYMVEAAWPLGCAIDVIS  1350
             LLVDG GL P K ITL++KV++  Y +EAAWPLG AI+ ++
Sbjct  391   LLVDGFGLEPTKNITLVEKVKHGEYFIEAAWPLGEAIEAVA  431



>ref|XP_008655272.1| PREDICTED: probable apyrase 1 isoform X1 [Zea mays]
 ref|XP_008655278.1| PREDICTED: probable apyrase 1 isoform X1 [Zea mays]
 ref|XP_008655286.1| PREDICTED: probable apyrase 1 isoform X1 [Zea mays]
 tpg|DAA45163.1| TPA: putative apyrase family protein [Zea mays]
Length=478

 Score =   402 bits (1032),  Expect = 8e-131, Method: Compositional matrix adjust.
 Identities = 222/445 (50%), Positives = 299/445 (67%), Gaps = 14/445 (3%)
 Frame = +1

Query  58    LVFISLALLLFPLACFSRSHL-------RR---VLLNHEAGNYAVIFDAGSTGSRVHVFH  207
             ++ IS  LLL P A  S S         RR     +      YAVIFDAGS+GSRVHV+ 
Sbjct  36    VLLISFVLLLMPRAPASASGGVLLAVGGRRWGPRAVEDGLNKYAVIFDAGSSGSRVHVYC  95

Query  208   FDENLDLLPVGDGVEFFLKITPGLSSYADDPEAAAKSLEPLLLEAEGVVPTELQPDTPLE  387
             FDENLDL+P+G  +E F +  PGLS+ A  P+ AA+SL  LL EAE VVP EL+  TP+ 
Sbjct  96    FDENLDLVPIGKEIELFKQKKPGLSA-AKGPQEAAESLISLLEEAEKVVPAELREQTPVR  154

Query  388   LGATAGLRLLEGDASDKILQAVRDMFKNESNFKSKAEWVSILEGSQEGTYFWVAMNYLLG  567
             +GATAGLR L    S++ILQAVR++  ++S+FKS+  WV++L+GSQEG + WV +NYLLG
Sbjct  155   VGATAGLRALGTQRSEEILQAVRELL-HDSSFKSQPNWVTVLDGSQEGAFQWVTINYLLG  213

Query  568   NLGKGYQNTIATIDLGGGSVQVSYAVSGDTFANAPKPHNGEEPYVQEKYILGAQYYLYVH  747
              LGK Y NT+  +DLGGGSVQ++YA+S    A AP   +GE+ YV+E  + G  YYLYVH
Sbjct  214   KLGKPYSNTVGVVDLGGGSVQMAYAISEKDAAKAPLVADGEDSYVKELLLKGTTYYLYVH  273

Query  748   SYLNYGQLASRAEIFKA-SGNSTNPCVLEGYDGYYTYNDVSYKVTAPPNGSSLKNCRKLA  924
             SYL+YG LA+R EI KA  G+  + C+LEG+ G Y Y   +++ +  P+G+S   CR LA
Sbjct  274   SYLHYGLLAARGEILKAGEGSDYSDCMLEGHLGKYNYGGNTFEASGSPSGASYSKCRALA  333

Query  925   RKVVDFRAP-CKYPNCTFNGVWSGGGGAGMENVDISSYFYDIAIDVGIIDEGKASKIVKP  1101
              + +    P C +  CTF GVW+GGGG G +N+ ++S+F+D A + G +D   A   VKP
Sbjct  334   VRALKVDEPACTHMKCTFGGVWNGGGGDGQKNLFVASFFFDRAAEAGFVDPKAAVAKVKP  393

Query  1102  RSFLVAAKLACETKFEDVKSTFPNAVEKDYPYLCMDLVYQYTLLVDGLGLHPYKEITLMK  1281
               F   A+  C+   +D  +T+P+  E++ PYLC+DLVYQYTLLVDG G+ PY++ITL+K
Sbjct  394   SDFEETARRVCKLNLKDAHATYPDVSEENIPYLCIDLVYQYTLLVDGFGVDPYQDITLVK  453

Query  1282  KVEYKNYMVEAAWPLGCAIDVISSS  1356
             KV Y +  VEAAWPLG AI++ SSS
Sbjct  454   KVPYGDSYVEAAWPLGSAIEIASSS  478



>ref|XP_003557997.1| PREDICTED: probable apyrase 1 [Brachypodium distachyon]
Length=484

 Score =   401 bits (1030),  Expect = 2e-130, Method: Compositional matrix adjust.
 Identities = 211/406 (52%), Positives = 289/406 (71%), Gaps = 3/406 (1%)
 Frame = +1

Query  145   AGNYAVIFDAGSTGSRVHVFHFDENLDLLPVGDGVEFFLKITPGLSSYADDPEAAAKSLE  324
             +  YAVIFDAGS+GSRVHV+ FD NLDL+P+G+ +E F +   GLS+YA DP+ AA+SL 
Sbjct  80    SNRYAVIFDAGSSGSRVHVYCFDANLDLVPIGNEIELFKQQKLGLSAYAKDPQEAAESLV  139

Query  325   PLLLEAEGVVPTELQPDTPLELGATAGLRLLEGDASDKILQAVRDMFKNESNFKSKAEWV  504
              LL EAE VVP EL+  TP+ +GATAGLR L  + SD+ILQAVRD+ +++S+FKS+ +WV
Sbjct  140   SLLEEAEKVVPVELREQTPVRVGATAGLRALGTERSDEILQAVRDLLRDKSSFKSQPDWV  199

Query  505   SILEGSQEGTYFWVAMNYLLGNLGKGYQNTIATIDLGGGSVQVSYAVSGDTFANAPKPHN  684
             ++L+GSQEG + WV +NYLL  LGK Y +T+  +DLGGGSVQ++YA+S    A AP+  +
Sbjct  200   TVLDGSQEGAFQWVTINYLLEKLGKPYSHTVGVVDLGGGSVQMAYAISEKDAAKAPEVSD  259

Query  685   GEEPYVQEKYILGAQYYLYVHSYLNYGQLASRAEIFKA-SGNSTNPCVLEGYDGYYTYND  861
             GE+ YV++  + G  YYLYVHSYL+YG LA+RAEI KA   N  + C+L+GY G Y Y D
Sbjct  260   GEDSYVKKLVLKGTTYYLYVHSYLHYGLLAARAEILKAGESNDYSNCMLDGYHGKYKYGD  319

Query  862   VSYKVTAPPNGSSLKNCRKLARKVVDFRAP-CKYPNCTFNGVWSGGGGAGMENVDISSYF  1038
              +++ +   + S  K CR +A   +    P C +  CTF GVW+GGGG G +N+ ++S+F
Sbjct  320   DTFEASGSSSASYSK-CRAIAVSALKVDEPACTHMKCTFGGVWNGGGGDGQKNLFVASFF  378

Query  1039  YDIAIDVGIIDEGKASKIVKPRSFLVAAKLACETKFEDVKSTFPNAVEKDYPYLCMDLVY  1218
             +D A + G ++   A   VKP  F  AA+  C+   ++ ++T+P+  E + PYLCMDLVY
Sbjct  379   FDRAAEAGFVNPKAAVPKVKPSDFEEAARRVCKLNVKEARATYPDVSEDNIPYLCMDLVY  438

Query  1219  QYTLLVDGLGLHPYKEITLMKKVEYKNYMVEAAWPLGCAIDVISSS  1356
             Q+TLLVDG G+ PY++ITL+KKV Y N  VEAAWPLG AI+V SSS
Sbjct  439   QHTLLVDGFGVDPYQDITLVKKVPYGNSFVEAAWPLGSAIEVASSS  484



>dbj|BAJ86398.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ96465.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=437

 Score =   396 bits (1018),  Expect = 2e-129, Method: Compositional matrix adjust.
 Identities = 208/432 (48%), Positives = 278/432 (64%), Gaps = 2/432 (0%)
 Frame = +1

Query  55    HLVFISLALLLFPLACFSRSHLRRVLLNHEAGNYAVIFDAGSTGSRVHVFHFDENLDLLP  234
             H+V   +AL L  LA      L R      AG YAVI DAGSTG+R+HVF FD+ +DL+ 
Sbjct  3     HVVEGIVALFLILLAASVEIALARAATGPPAGKYAVILDAGSTGTRMHVFRFDKQMDLVK  62

Query  235   VGDGVEFFLKITPGLSSYADDPEAAAKSLEPLLLEAEGVVPTELQPDTPLELGATAGLRL  414
             +GD +E F K+ PGLSSYA  P+ A KS+ PLL EA   VP  L   TP++LGATAGLRL
Sbjct  63    IGDDIEVFAKVNPGLSSYAGRPKEATKSILPLLQEANTAVPQRLMKTTPVKLGATAGLRL  122

Query  415   LEGDASDKILQAVRDMFKNESNFKSKAEWVSILEGSQEGTYFWVAMNYLLGNLGKGYQNT  594
             +    +++IL AVR     ++ F+   +W+++LEGSQEG+Y WVA+NYLL  LG  Y  T
Sbjct  123   IGDKQAEQILDAVRGAVHTKTKFQYNPKWINVLEGSQEGSYLWVALNYLLDKLGGDYSKT  182

Query  595   IATIDLGGGSVQVSYAVSGDTFANAPKPHNGEEPYVQEKYILGAQYYLYVHSYLNYGQLA  774
             +  IDLGGGSVQ++YA+S    A AP+  +G++PYV ++Y+ G  Y +YVHSYL YG LA
Sbjct  183   VGVIDLGGGSVQMAYAISPAAAAAAPQVPHGKDPYVTKEYLKGRDYNVYVHSYLRYGALA  242

Query  775   SRAEIFKASGNSTNPCVLEGYDGYYTYNDVSYKVTAPPNGSSLKNCRKLARKVVDFRAPC  954
             SR EIFKA     + C+L G+ G YTYN   Y  TA   G+    CR    K +   APC
Sbjct  243   SRVEIFKAKEGPFSYCMLRGFSGKYTYNGEEYNATASTGGAQYGKCRGDVVKALKLDAPC  302

Query  955   KYPNCTFNGVWSGGGGAGMENVDISSYFYDIAIDVGIIDEGKASKIVKPRSFLVAAKLAC  1134
             +   C FNGVW+GGGG G  N+ ++S FY +A  VG+ID    S    P +F   A+  C
Sbjct  303   QAKKCAFNGVWNGGGGPGQANLYVASSFYYMASQVGLIDSDAPSGTSTPAAFKAIAQKVC  362

Query  1135  ETKFEDVKSTFPNAVEKDYPYLCMDLVYQYTLLVDGLGLHPYKEITLMKKVEYKNYMVEA  1314
                 ++VK+ +P    +D PY+CMDLVYQY+LL+DG GL   K+ITL++KV++  Y +EA
Sbjct  363   RMSMKEVKAKYPKV--RDIPYVCMDLVYQYSLLIDGFGLESTKKITLVEKVKHGEYFIEA  420

Query  1315  AWPLGCAIDVIS  1350
             AWPLG AI+ ++
Sbjct  421   AWPLGEAIEAVA  432



>gb|EEC67579.1| hypothetical protein OsI_34932 [Oryza sativa Indica Group]
Length=519

 Score =   398 bits (1023),  Expect = 6e-129, Method: Compositional matrix adjust.
 Identities = 202/407 (50%), Positives = 274/407 (67%), Gaps = 2/407 (0%)
 Frame = +1

Query  148   GNYAVIFDAGSTGSRVHVFHFDENLDLLPVGDGVEFFLKITPGLSSYADDPEAAAKSLEP  327
             G YAVI DAGSTG+RVHVF FD  +DLL +GD +E F K+ PGLSSYA  P  AA S++P
Sbjct  54    GKYAVILDAGSTGTRVHVFRFDRKMDLLKIGDDIEVFAKVDPGLSSYAGRPREAANSIQP  113

Query  328   LLLEAEGVVPTELQPDTPLELGATAGLRLLEGDASDKILQAVRDMFKNESNFKSKAEWVS  507
             LL +A  VVP  L   TPL+LGATAGLRL+  + +++IL+AVRD+   +S F+    W++
Sbjct  114   LLDKAIHVVPNWLMKKTPLKLGATAGLRLIGDEKANQILEAVRDVVHTKSKFQYNPNWIN  173

Query  508   ILEGSQEGTYFWVAMNYLLGNLGKGYQNTIATIDLGGGSVQVSYAVSGDTFANAPKPHNG  687
             +L GSQEG+Y WVA+NYLL  LG+ Y  T+  IDLGGGSVQ++YAVS    ANAP+  NG
Sbjct  174   VLTGSQEGSYMWVALNYLLDRLGEDYSKTVGVIDLGGGSVQMAYAVSSSIAANAPEVSNG  233

Query  688   EEPYVQEKYILGAQYYLYVHSYLNYGQLASRAEIFKASGNSTNPCVLEGYDGYYTYNDVS  867
             ++PY+ ++Y+ G  Y +YVHSYL+YG  ASR EI K      + C+L G+ G +TYN   
Sbjct  234   QDPYITKEYLKGRDYNIYVHSYLHYGAQASRVEILKRKNGPFSNCMLRGFKGKFTYNGEQ  293

Query  868   YKVTAPPNGSSLKNCRKLARKVVDFRAPCKYPNCTFNGVWSGGGGAGMENVDISSYFYDI  1047
             Y+  A P G+    CR+   K ++  +PC+  NC+FNGVW+GGGG G + + ++S FY I
Sbjct  294   YEAMAAPQGADYHKCRQDVVKALNLDSPCETKNCSFNGVWNGGGGVGQDEIYVTSSFYYI  353

Query  1048  AIDVGIIDEGKASKIVKPRSFLVAAKLACETKFEDVKSTFPNAVEKDYPYLCMDLVYQYT  1227
             A  +G ID    S    P ++  A++  C    E+ K+ +P  + +D+ YLCMDL+YQYT
Sbjct  354   ASGIGFIDSEAPSAKSTPAAYKAASEKVCILSIEEAKAAYP--IARDHAYLCMDLIYQYT  411

Query  1228  LLVDGLGLHPYKEITLMKKVEYKNYMVEAAWPLGCAIDVISSSSANN  1368
             LLVDG GL   KEITL++KV++  Y +EAAWPLG AI+     +A N
Sbjct  412   LLVDGFGLEATKEITLVEKVKHGEYYIEAAWPLGTAIEARRPQAAAN  458


 Score = 61.2 bits (147),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 31/71 (44%), Positives = 46/71 (65%), Gaps = 0/71 (0%)
 Frame = +1

Query  274  GLSSYADDPEAAAKSLEPLLLEAEGVVPTELQPDTPLELGATAGLRLLEGDASDKILQAV  453
            G +  A  P+AAA S+ PLL +A  VVP  L   TPL+LGAT G RL+  + +++IL+AV
Sbjct  445  GTAIEARRPQAAANSILPLLDKANTVVPARLMNKTPLKLGATTGPRLIGDEKANQILEAV  504

Query  454  RDMFKNESNFK  486
            RD+   +  ++
Sbjct  505  RDVVHTKRKYQ  515



>ref|XP_002449272.1| hypothetical protein SORBIDRAFT_05g007000 [Sorghum bicolor]
 gb|EES08260.1| hypothetical protein SORBIDRAFT_05g007000 [Sorghum bicolor]
Length=460

 Score =   396 bits (1018),  Expect = 6e-129, Method: Compositional matrix adjust.
 Identities = 212/401 (53%), Positives = 276/401 (69%), Gaps = 0/401 (0%)
 Frame = +1

Query  148   GNYAVIFDAGSTGSRVHVFHFDENLDLLPVGDGVEFFLKITPGLSSYADDPEAAAKSLEP  327
             G YAVIFDAGSTGSRV+VF FD  +DLL +GD +EFF K+ PGLSSYA  P+ AAKS+ P
Sbjct  54    GRYAVIFDAGSTGSRVYVFRFDRQMDLLRIGDEIEFFAKVKPGLSSYAGQPQEAAKSILP  113

Query  328   LLLEAEGVVPTELQPDTPLELGATAGLRLLEGDASDKILQAVRDMFKNESNFKSKAEWVS  507
             LL +A+ +VP+ L   TPL+LGATAGLRL+    +D+IL AVRD+   +S F+ K+  ++
Sbjct  114   LLDKAKRIVPSWLMKRTPLKLGATAGLRLIGNQQADQILDAVRDLVHKKSKFQCKSNCIN  173

Query  508   ILEGSQEGTYFWVAMNYLLGNLGKGYQNTIATIDLGGGSVQVSYAVSGDTFANAPKPHNG  687
             +LEGSQEG+Y WVA+NYLL  LG  Y  T+  ID+GGGSVQ++YAVS  + A AP   +G
Sbjct  174   VLEGSQEGSYLWVALNYLLDKLGGDYSQTVGVIDMGGGSVQMAYAVSSYSAARAPAVPDG  233

Query  688   EEPYVQEKYILGAQYYLYVHSYLNYGQLASRAEIFKASGNSTNPCVLEGYDGYYTYNDVS  867
             E+PY+ ++Y  G +Y +YVHSYL+YG  ASRAEI K+     + C+L G+ G YTYN   
Sbjct  234   EDPYITKEYFKGKEYNVYVHSYLHYGSFASRAEILKSKNGPFSFCMLRGFSGKYTYNGQQ  293

Query  868   YKVTAPPNGSSLKNCRKLARKVVDFRAPCKYPNCTFNGVWSGGGGAGMENVDISSYFYDI  1047
             Y   A P G+  + CR+   K ++ +APCK  NCTF GVW+GGGGAG  N+ ++S FY +
Sbjct  294   YDAIARPEGALYEKCREEITKALNLKAPCKTKNCTFGGVWNGGGGAGQNNIYVASGFYYL  353

Query  1048  AIDVGIIDEGKASKIVKPRSFLVAAKLACETKFEDVKSTFPNAVEKDYPYLCMDLVYQYT  1227
             A  VG ID    S    P +F  AAK AC+   +  K  +PN  + D PYLCMDL Y YT
Sbjct  354   ASHVGFIDSKAPSAKAAPAAFRAAAKKACQLDVKKAKVAYPNISDSDVPYLCMDLTYTYT  413

Query  1228  LLVDGLGLHPYKEITLMKKVEYKNYMVEAAWPLGCAIDVIS  1350
             LLVDG GL P K+IT + KV++  Y +EAAWPLG AI+ +S
Sbjct  414   LLVDGFGLQPMKKITFVSKVKHGEYYMEAAWPLGTAIEAVS  454



>ref|XP_008792532.1| PREDICTED: probable apyrase 2 isoform X1 [Phoenix dactylifera]
Length=428

 Score =   395 bits (1014),  Expect = 8e-129, Method: Compositional matrix adjust.
 Identities = 221/445 (50%), Positives = 280/445 (63%), Gaps = 35/445 (8%)
 Frame = +1

Query  58    LVFISLALLLFPLACFSRSHLRRVL----LNHEAGNYAVIFDAGSTGSRVHVFHFDENLD  225
             +++ SL LLL P         R+      +  E  +YAVIFDAGSTGSRVHVF FDEN+D
Sbjct  6     VLYASLVLLLVPHVAGGIVLGRKAAGGGGVRGETESYAVIFDAGSTGSRVHVFRFDENMD  65

Query  226   LLPVGDGVEFFLKITPGLSSYADDPEAAAKSLEPLLLEAEGVVPTELQPDTPLELGATAG  405
             L+ +GD +E ++ + PGLSSYADDP+ AA SL PLL EAE VVP ELQP TP+ LGATAG
Sbjct  66    LVNIGDDIELYVAVKPGLSSYADDPQEAANSLIPLLEEAESVVPEELQPTTPVRLGATAG  125

Query  406   LRLLEGDASDKILQAVRDMFKNESNFKSKAEWVSILEGSQEGTYFWVAMNYLLGNLGKGY  585
             LR L  + S++ILQAV                               AMNYLLGNLG  Y
Sbjct  126   LRNLGDEKSEEILQAV-------------------------------AMNYLLGNLGNKY  154

Query  586   QNTIATIDLGGGSVQVSYAVSGDTFANAPKPHNGEEPYVQEKYILGAQYYLYVHSYLNYG  765
              +T+  +DLGGGSVQ++YAVS +  ANAP   NG++PYV ++ +    YYLY +SYLN+G
Sbjct  155   SDTVGVVDLGGGSVQMAYAVSEEAAANAPNISNGDDPYVTKQLLNETNYYLYAYSYLNFG  214

Query  766   QLASRAEIFKASGNSTNPCVLEGYDGYYTYNDVSYKVTAPPNGSSLKNCRKLARKVVDFR  945
              LA+RAEI +A  +  + C+L GY G Y YN   Y  +A P+GSS   CR  A K +   
Sbjct  215   LLAARAEILEAVDDPYSYCMLGGYTGTYEYNGEVYNASASPSGSSYNKCRTDAIKTLKIN  274

Query  946   APCKYPNCTFNGVWSGGGGAGMENVDISSYFYDIAIDVGIIDEGKASKIVKPRSFLVAAK  1125
               C Y +C+F GVWSGGGG G +N+ ++S+FYD A  VG ID  + S +V P  F  AAK
Sbjct  275   ETCTYEDCSFGGVWSGGGGDGQKNIYVASFFYDRAAQVGFIDPEEPSALVTPSDFEEAAK  334

Query  1126  LACETKFEDVKSTFPNAVEKDYPYLCMDLVYQYTLLVDGLGLHPYKEITLMKKVEYKNYM  1305
              AC    E+   T+PN    D PY+CMDL Y+YTLLVDG GL P +EITL+ KV+Y +  
Sbjct  335   TACNLSLEEANVTYPNVAADDLPYICMDLAYEYTLLVDGFGLEPSQEITLVSKVKYGDSY  394

Query  1306  VEAAWPLGCAIDVISSSSANNLLSK  1380
             V AAWPLG AI+V+SS S  +L  K
Sbjct  395   VGAAWPLGSAIEVVSSQSTQSLAMK  419



>gb|KEH23514.1| Nod factor-binding lectin-nucleotide phosphohydrolase [Medicago 
truncatula]
Length=439

 Score =   395 bits (1014),  Expect = 9e-129, Method: Compositional matrix adjust.
 Identities = 207/409 (51%), Positives = 280/409 (68%), Gaps = 10/409 (2%)
 Frame = +1

Query  52    HHLVFISLALLLFPLACFSRSHLRRVLLNHEA--------GNYAVIFDAGSTGSRVHVFH  207
             + +  I+  L + P   +S+     +LL +           +YAV+FDAGSTGSRVHV+H
Sbjct  24    NFMTLITFLLFIMPSISYSQYLGNNILLTNRKIFPKQEPISSYAVVFDAGSTGSRVHVYH  83

Query  208   FDENLDLLPVGDGVEFFLKITPGLSSYADDPEAAAKSLEPLLLEAEGVVPTELQPDTPLE  387
             FD+NL+LL VG  VEF+ K TPGLS+YAD+PE AAKSL PLL +AE VVP + +  TP+ 
Sbjct  84    FDQNLNLLHVGKDVEFYNKTTPGLSAYADNPEEAAKSLIPLLEQAESVVPEDQRSKTPIR  143

Query  388   LGATAGLRLLEGDASDKILQAVRDMFKNESNFKSKAEWVSILEGSQEGTYFWVAMNYLLG  567
             LGATAGLRLL GDAS+KILQ+VRD+F N S F  + + VSI++G+QEG+Y WV +NY LG
Sbjct  144   LGATAGLRLLNGDASEKILQSVRDLFSNRSTFNVQPDAVSIIDGTQEGSYLWVTVNYALG  203

Query  568   NLGKGYQNTIATIDLGGGSVQVSYAVSGDTFANAPKPHNGEEPYVQEKYILGAQYYLYVH  747
              LGK +  T+  +DLGGGSVQ++YAVS  T  NAPK  +GE+PY+++  + G +Y LYVH
Sbjct  204   KLGKKFTKTVGVMDLGGGSVQMAYAVSKYTAKNAPKVADGEDPYIKKLVLKGKKYDLYVH  263

Query  748   SYLNYGQLASRAEIFKASGNSTNPCVLEGYDGYYTYNDVSYKVTAPPNGSSLKNCRKLAR  927
             SYL++G+ ASRAEI K + NS NPC+L G+DG YTY    +K  AP +G++ K C+K+ R
Sbjct  264   SYLHFGREASRAEILKVTHNSPNPCILAGFDGTYTYAGEEFKANAPASGANFKKCKKIVR  323

Query  928   KVVDFRAPCKYPNCTFNGVWSGGGGAGMENVDISSYFYDIAIDVGIIDEGKA-SKIVKPR  1104
             + +    PC Y NCTF G+WSGGGG+G   +  +S F+ +A D+G++D     S  ++P 
Sbjct  324   EALKLNYPCPYQNCTFGGIWSGGGGSGQRILFAASSFFYLAEDIGLVDPNTPYSLTLRPV  383

Query  1105  SFLVAAKLACETKFEDVKSTFPNAVEKDY-PYLCMDLVYQYTLLVDGLG  1248
                  AK AC    E+ KST+P  V+ +   Y+CMDL+YQY LLVDG G
Sbjct  384   DLETEAKKACTLNLEEAKSTYPLLVDFNIVEYVCMDLIYQYVLLVDGFG  432



>ref|XP_002442734.1| hypothetical protein SORBIDRAFT_08g001950 [Sorghum bicolor]
 gb|EES16572.1| hypothetical protein SORBIDRAFT_08g001950 [Sorghum bicolor]
Length=442

 Score =   395 bits (1014),  Expect = 1e-128, Method: Compositional matrix adjust.
 Identities = 203/407 (50%), Positives = 268/407 (66%), Gaps = 21/407 (5%)
 Frame = +1

Query  148   GNYAVIFDAGSTGSRVHVFHFDENLDLLPVGDGVEFFLKITPGLSSYADDPEAAAKSLEP  327
             G YAVIFDAGSTGSRVHVF FD+ LDL+P+GD +EFF KI PGLSS+A  P+ AA S+ P
Sbjct  55    GRYAVIFDAGSTGSRVHVFKFDKKLDLVPIGDDIEFFTKIKPGLSSFAGKPQEAANSILP  114

Query  328   LLLEAEGVVPTELQPDTPLELGATAGLRLLEGDASDKILQAVRDMFKNESNFKSKAEWVS  507
             LL +A+ +VP  LQ DTPL+LGATAGLRL+  + +++IL+AVRD+   +S F+   +W++
Sbjct  115   LLEQAKEIVPLRLQKDTPLKLGATAGLRLIGDEKAEEILEAVRDLVHTKSKFQYNPKWIT  174

Query  508   ILEGSQEGTYFWVAMNYLLGNLGKGYQNTIATIDLGGGSVQVSYAVSGDTFANAPKPHNG  687
             +LEG+QEG+Y WVA+NYLLG LG  Y  T+  IDLG                  P   +G
Sbjct  175   VLEGTQEGSYLWVALNYLLGKLGGDYSKTVGVIDLGA----------------VP---DG  215

Query  688   EEPYVQEKYILGAQYYLYVHSYLNYGQLASRAEIFKASGNSTNPCVLEGYDGYYTYNDVS  867
             ++PY+ ++Y+ G  Y LYVHSYL YG  A R EI KA     + CVL G+ G Y+YN   
Sbjct  216   KDPYITKEYLKGKYYNLYVHSYLYYGLSAVRVEILKAKNGPFSHCVLRGFSGTYSYNGKD  275

Query  868   YKVTAPPNGSSLKNCRKLARKVVDFRAPCKYPNCTFNGVWSGGGGAGMENVDISSYFYDI  1047
             Y  TA P G+    CR+   K ++  APC   NCTFNGVW+GGGGAG +N+ ++S+F+D 
Sbjct  276   YDATASPEGAVYDKCREEIIKALNQSAPCNAKNCTFNGVWNGGGGAGQDNLYVASFFFDK  335

Query  1048  AIDVGIIDEGKASKIVKPRSFLVAAKLACETKFEDVKSTFPNAVEKDYPYLCMDLVYQYT  1227
             A  VG ID    S    P +F  AA+  C    ++ K+ +P+    D PY+CMDL+YQYT
Sbjct  336   ASQVGFIDSEAPSVKSTPSAFKAAAEKVCLLSADEAKAGYPDLY--DVPYICMDLIYQYT  393

Query  1228  LLVDGLGLHPYKEITLMKKVEYKNYMVEAAWPLGCAIDVISSSSANN  1368
             LLVDG GL P KEITL+ +V+Y  + VEAAWPLG AI+ ++    N 
Sbjct  394   LLVDGFGLAPTKEITLVSRVKYGEFDVEAAWPLGTAIEAVAPKKMNQ  440



>dbj|BAK78979.1| apyrase [Mimosa pudica]
Length=468

 Score =   394 bits (1012),  Expect = 5e-128, Method: Compositional matrix adjust.
 Identities = 196/404 (49%), Positives = 281/404 (70%), Gaps = 1/404 (0%)
 Frame = +1

Query  154   YAVIFDAGSTGSRVHVFHFDENLDLLPVGDGVEFFLKITPGLSSYADDPEAAAKSLEPLL  333
             YAVI D+GSTG+R+HVF F+++  +  + D  E+  K+TPGLSSYA +PE AA+S+  LL
Sbjct  57    YAVILDSGSTGTRLHVFSFNQSTQIQYIDDDFEYLYKVTPGLSSYASNPEGAAESVMALL  116

Query  334   LEAEGVVPTELQPDTPLELGATAGLRLLEGDASDKILQAVRDMFKNESNFKSKAE-WVSI  510
              +AE VVP E Q  TP+ LGATAGLR L  + S+ IL+A+R++ K+ ++F  +++  ++I
Sbjct  117   EKAEAVVPEEYQASTPVRLGATAGLRALSSNTSELILEAIREVVKSNTSFALESDDAIAI  176

Query  511   LEGSQEGTYFWVAMNYLLGNLGKGYQNTIATIDLGGGSVQVSYAVSGDTFANAPKPHNGE  690
             L G+QEG Y WV +NYLL NLG+ Y  TI   DLGGGSVQ++YA+S D  +NAP      
Sbjct  177   LSGNQEGYYLWVTVNYLLNNLGEEYPKTIGVADLGGGSVQMAYAISDDVASNAPDYAPNG  236

Query  691   EPYVQEKYILGAQYYLYVHSYLNYGQLASRAEIFKASGNSTNPCVLEGYDGYYTYNDVSY  870
             + YV +  +  + Y++YVHSYLN G  +SRA I K +G+S NPC+L G++G Y Y+DV Y
Sbjct  237   DAYVTKISLSNSTYHIYVHSYLNPGTESSRAAILKLTGDSDNPCILTGFNGTYNYSDVEY  296

Query  871   KVTAPPNGSSLKNCRKLARKVVDFRAPCKYPNCTFNGVWSGGGGAGMENVDISSYFYDIA  1050
             K ++P NGSS   CR    K+ DF A C + NCTF GVW+GGGGAG   + +++ FY +A
Sbjct  297   KASSPANGSSYDECRSTVLKLFDFNATCAHKNCTFAGVWNGGGGAGQSELYLATSFYYLA  356

Query  1051  IDVGIIDEGKASKIVKPRSFLVAAKLACETKFEDVKSTFPNAVEKDYPYLCMDLVYQYTL  1230
              D GI+++      V+P  + + A+LAC+T +E+ K+ F N  E   PY+CMDLVYQYTL
Sbjct  357   ADAGIVNKNAMIGKVRPIDYKIMAELACKTTYEEAKTVFSNMDEVWLPYICMDLVYQYTL  416

Query  1231  LVDGLGLHPYKEITLMKKVEYKNYMVEAAWPLGCAIDVISSSSA  1362
             LVD  GL P++ +T++KK+EY++  ++A+W LG AI+ +SS S+
Sbjct  417   LVDAFGLDPWEVVTVVKKIEYEDSQLDASWALGSAIESVSSLSS  460



>gb|EMT24071.1| Apyrase [Aegilops tauschii]
Length=458

 Score =   391 bits (1005),  Expect = 4e-127, Method: Compositional matrix adjust.
 Identities = 206/401 (51%), Positives = 268/401 (67%), Gaps = 2/401 (0%)
 Frame = +1

Query  148   GNYAVIFDAGSTGSRVHVFHFDENLDLLPVGDGVEFFLKITPGLSSYADDPEAAAKSLEP  327
             G YAVIFDAGSTG+RVHVF FD  +DLL +GD +E F K++PGLSS++  P+ AAKS+ P
Sbjct  46    GKYAVIFDAGSTGTRVHVFKFDNKMDLLEIGDDIEVFAKVSPGLSSFSGRPKEAAKSMIP  105

Query  328   LLLEAEGVVPTELQPDTPLELGATAGLRLLEGDASDKILQAVRDMFKNESNFKSKAEWVS  507
             LL +A  VVP      TPL+LGATAGLRL+    S++ILQAVRD+   +S F+   +W++
Sbjct  106   LLDKANSVVPWWQMNRTPLKLGATAGLRLIGDKPSEQILQAVRDIVHTKSKFQYNPKWIN  165

Query  508   ILEGSQEGTYFWVAMNYLLGNLGKGYQNTIATIDLGGGSVQVSYAVSGDTFANAPKPHNG  687
             +LEGSQEG+Y WVA+NYLL  LG  Y  T+  IDLGGGSVQ++YAVS +T ANAP   +G
Sbjct  166   VLEGSQEGSYMWVALNYLLDRLGGDYSKTVGVIDLGGGSVQMAYAVSPNTAANAPATPDG  225

Query  688   EEPYVQEKYILGAQYYLYVHSYLNYGQLASRAEIFKASGNSTNPCVLEGYDGYYTYNDVS  867
             ++PY+ ++Y+ G  Y +YVHSYL YG LA+R EI KA     + C+L G  G YTYN   
Sbjct  226   KDPYITKEYLKGNDYNVYVHSYLYYGNLAARVEILKAKSGPFSSCMLRGSTGNYTYNGEV  285

Query  868   YKVTAPPNGSSLKNCRKLARKVVDFRAPCKYPNCTFNGVWSGGGGAGMENVDISSYFYDI  1047
             Y   A P G+    CRK   K +   APC   NC F GVW GGGGAG   +  +S+FY  
Sbjct  286   YDAAASPEGAVYTKCRKEVAKALKLDAPCASKNCPFGGVWGGGGGAGQATLYAASFFYGK  345

Query  1048  AIDVGIIDEGKASKIVKPRSFLVAAKLACETKFEDVKSTFPNAVEKDYPYLCMDLVYQYT  1227
             A  VG + +   S    P +F  AAK  C    E+ K+ +P    ++ PY+CMDLVYQYT
Sbjct  346   ATQVGWVKKDAPSAKSSPGAFRAAAKKICPLSLEEAKAAYPGV--RETPYICMDLVYQYT  403

Query  1228  LLVDGLGLHPYKEITLMKKVEYKNYMVEAAWPLGCAIDVIS  1350
             LLV G GL P +EITL++KV++  Y +EAAWPLG AI+ ++
Sbjct  404   LLVYGFGLAPAREITLVEKVKHGEYFMEAAWPLGEAIEAVA  444



>dbj|BAK78980.1| apyrase [Mimosa pudica]
Length=468

 Score =   391 bits (1005),  Expect = 5e-127, Method: Compositional matrix adjust.
 Identities = 194/404 (48%), Positives = 278/404 (69%), Gaps = 1/404 (0%)
 Frame = +1

Query  154   YAVIFDAGSTGSRVHVFHFDENLDLLPVGDGVEFFLKITPGLSSYADDPEAAAKSLEPLL  333
             YAVI D+GSTG+R+HVF F+++  +  + D  E+  K+TPGLSSYA +PE AA+S+  LL
Sbjct  57    YAVILDSGSTGTRLHVFSFNQSTQIQYIDDDFEYLYKVTPGLSSYASNPEGAAESVMALL  116

Query  334   LEAEGVVPTELQPDTPLELGATAGLRLLEGDASDKILQAVRDMFKNESNFKSKAE-WVSI  510
              +AE VVP E Q  TP+ LGATAGLR L  + S+ IL+A+R++ K+ ++F  +++  ++I
Sbjct  117   EKAEAVVPEEYQASTPVRLGATAGLRALSSNTSELILEAIREVVKSNTSFALESDDAIAI  176

Query  511   LEGSQEGTYFWVAMNYLLGNLGKGYQNTIATIDLGGGSVQVSYAVSGDTFANAPKPHNGE  690
             L G+QEG Y WV +NYLL NLG+ Y  TI   DLGGGSV+++YA+S D  +NAP      
Sbjct  177   LSGNQEGYYLWVTVNYLLNNLGEEYPKTIGVADLGGGSVRMAYAISDDVASNAPDYAPNG  236

Query  691   EPYVQEKYILGAQYYLYVHSYLNYGQLASRAEIFKASGNSTNPCVLEGYDGYYTYNDVSY  870
             + YV +  +  + Y++YVHSYLN+G+ +SRA I   +G+S NPCVL G++G Y Y+DV Y
Sbjct  237   DAYVTKVSLSNSTYHIYVHSYLNFGKESSRAAILNLTGDSDNPCVLTGFNGTYNYSDVEY  296

Query  871   KVTAPPNGSSLKNCRKLARKVVDFRAPCKYPNCTFNGVWSGGGGAGMENVDISSYFYDIA  1050
             K ++P NGSS   CR    K+ DF A C + NCTF G+W+GGGGAG   + +++ FY +A
Sbjct  297   KASSPANGSSYDECRSTILKLFDFNATCTHDNCTFAGIWNGGGGAGQSELYLATSFYYLA  356

Query  1051  IDVGIIDEGKASKIVKPRSFLVAAKLACETKFEDVKSTFPNAVEKDYPYLCMDLVYQYTL  1230
             ID G +DE      V+   + + A+LAC+T +E+ K+ FPN  E    Y CMDLVYQYTL
Sbjct  357   IDAGFVDENAMIAKVRLIDYKITAELACKTTYEEAKTVFPNMDEDVLAYTCMDLVYQYTL  416

Query  1231  LVDGLGLHPYKEITLMKKVEYKNYMVEAAWPLGCAIDVISSSSA  1362
             LVD  GL P++ +T++ K+EY+   ++A+W LG AI+ +SS S+
Sbjct  417   LVDAFGLDPWEVVTVVDKIEYEGSQLDASWALGSAIESVSSLSS  460



>ref|XP_004978978.1| PREDICTED: probable apyrase 3-like [Setaria italica]
Length=462

 Score =   391 bits (1005),  Expect = 6e-127, Method: Compositional matrix adjust.
 Identities = 210/401 (52%), Positives = 273/401 (68%), Gaps = 0/401 (0%)
 Frame = +1

Query  148   GNYAVIFDAGSTGSRVHVFHFDENLDLLPVGDGVEFFLKITPGLSSYADDPEAAAKSLEP  327
             G YAVIFDAGSTGSRV+VF FD  +DL  +GD +EFF K+ PGLSSYA  P+ AA S+ P
Sbjct  55    GRYAVIFDAGSTGSRVYVFRFDRQMDLARIGDDIEFFAKVKPGLSSYAGQPKEAANSILP  114

Query  328   LLLEAEGVVPTELQPDTPLELGATAGLRLLEGDASDKILQAVRDMFKNESNFKSKAEWVS  507
             LL +A+ VVP+ L   TPL+LGATAGLRL+    +++IL AVRD+   +S F+ KA W++
Sbjct  115   LLDKAKSVVPSRLTKTTPLKLGATAGLRLIGNQKAEQILDAVRDLVHKKSKFQYKANWIN  174

Query  508   ILEGSQEGTYFWVAMNYLLGNLGKGYQNTIATIDLGGGSVQVSYAVSGDTFANAPKPHNG  687
             +LEG+QEG+Y WVA+NYLL  LG  Y  T+  ID+GGGSVQ++YA+S    A AP   NG
Sbjct  175   VLEGTQEGSYLWVALNYLLDKLGGDYSQTVGVIDMGGGSVQMAYAISATAAARAPAAANG  234

Query  688   EEPYVQEKYILGAQYYLYVHSYLNYGQLASRAEIFKASGNSTNPCVLEGYDGYYTYNDVS  867
             E+PY+ ++Y  G  Y +YVHSYL YG  A+RAEI K+     + C+L G+ G YTY+   
Sbjct  235   EDPYITKEYFKGKDYNVYVHSYLRYGAFAARAEILKSKNGPFSSCMLRGFSGNYTYHGKE  294

Query  868   YKVTAPPNGSSLKNCRKLARKVVDFRAPCKYPNCTFNGVWSGGGGAGMENVDISSYFYDI  1047
             Y  TA P G+  +NCR+   K +   APC   NCTFNGVW+GGGGAG  N+  S+ FY +
Sbjct  295   YDATARPEGAVYENCREEITKALKLNAPCHTKNCTFNGVWNGGGGAGQNNIYASTGFYYL  354

Query  1048  AIDVGIIDEGKASKIVKPRSFLVAAKLACETKFEDVKSTFPNAVEKDYPYLCMDLVYQYT  1227
             A  VG ID    S    P +F+ AAK AC+   +  K  +PN  + D PYLCMDL Y+YT
Sbjct  355   ASHVGFIDSKAPSAKAAPAAFMAAAKKACQLDVKKAKVAYPNVDDMDVPYLCMDLSYKYT  414

Query  1228  LLVDGLGLHPYKEITLMKKVEYKNYMVEAAWPLGCAIDVIS  1350
             LLVDG GL P K+IT + KV++  Y +EAAWPLG AI+ ++
Sbjct  415   LLVDGFGLQPMKKITFVDKVKHGEYYIEAAWPLGTAIEAVT  455



>dbj|BAK78977.1| apyrase [Mimosa pudica]
Length=468

 Score =   391 bits (1005),  Expect = 6e-127, Method: Compositional matrix adjust.
 Identities = 194/404 (48%), Positives = 277/404 (69%), Gaps = 1/404 (0%)
 Frame = +1

Query  154   YAVIFDAGSTGSRVHVFHFDENLDLLPVGDGVEFFLKITPGLSSYADDPEAAAKSLEPLL  333
             YAVI D+GSTG+R+HVF F+++  +  + D  E+  K+TPGLSSYA +PE AA+S+  LL
Sbjct  57    YAVILDSGSTGTRLHVFSFNQSTQIQYIDDDFEYLYKVTPGLSSYASNPEGAAESVMALL  116

Query  334   LEAEGVVPTELQPDTPLELGATAGLRLLEGDASDKILQAVRDMFKNESNFKSKAE-WVSI  510
              +AE VVP E Q  TP+ LGATAGLR L  + S+ IL+A+R++ K+ ++F  +++  ++I
Sbjct  117   EKAEAVVPEEYQASTPVRLGATAGLRALSSNTSELILEAIREVVKSNTSFALESDDAIAI  176

Query  511   LEGSQEGTYFWVAMNYLLGNLGKGYQNTIATIDLGGGSVQVSYAVSGDTFANAPKPHNGE  690
             L G+QEG Y WV +NYLL NLG+ Y  TI   DLGGGSVQ++YA+S D  +NAP      
Sbjct  177   LSGNQEGYYLWVTVNYLLNNLGEEYPKTIGVADLGGGSVQMAYAISDDVASNAPDYAPNG  236

Query  691   EPYVQEKYILGAQYYLYVHSYLNYGQLASRAEIFKASGNSTNPCVLEGYDGYYTYNDVSY  870
             + YV +  +  + Y++YVHSYLN+G+ +SRA I   +G+S NPCVL G++G Y Y+DV Y
Sbjct  237   DAYVTKVSLSNSTYHIYVHSYLNFGKESSRAAILNLTGDSDNPCVLTGFNGTYNYSDVEY  296

Query  871   KVTAPPNGSSLKNCRKLARKVVDFRAPCKYPNCTFNGVWSGGGGAGMENVDISSYFYDIA  1050
             K ++P NGSS   CR    K+ D  A C + NCTF G+W+GGGGAG   + +++ FY +A
Sbjct  297   KASSPANGSSYDECRSTILKLFDLNATCAHDNCTFAGIWNGGGGAGQSELYLATSFYYLA  356

Query  1051  IDVGIIDEGKASKIVKPRSFLVAAKLACETKFEDVKSTFPNAVEKDYPYLCMDLVYQYTL  1230
             ID G +DE      V+   + + A+LAC+T +E+ K+ FPN  E    Y CMDLVYQYTL
Sbjct  357   IDAGFVDENATIAKVRLIDYKITAELACKTTYEEAKTVFPNMDEDVLAYTCMDLVYQYTL  416

Query  1231  LVDGLGLHPYKEITLMKKVEYKNYMVEAAWPLGCAIDVISSSSA  1362
             LVD  GL P++ +T++ K+EY+   ++A+W LG AI+ +SS S+
Sbjct  417   LVDAFGLDPWEVVTVVDKIEYEGSQLDASWALGSAIESVSSLSS  460



>ref|XP_003577116.1| PREDICTED: probable apyrase 3 [Brachypodium distachyon]
Length=463

 Score =   390 bits (1002),  Expect = 1e-126, Method: Compositional matrix adjust.
 Identities = 208/400 (52%), Positives = 273/400 (68%), Gaps = 2/400 (1%)
 Frame = +1

Query  151   NYAVIFDAGSTGSRVHVFHFDENLDLLPVGDGVEFFLKITPGLSSYADDPEAAAKSLEPL  330
              YAVIFDAGSTG+RVHVF FD  +DLL +GD VE F K++PGLSSYA  P+ AAK+L PL
Sbjct  57    KYAVIFDAGSTGTRVHVFKFDRKMDLLKIGDDVEVFAKVSPGLSSYAGRPQEAAKTLLPL  116

Query  331   LLEAEGVVPTELQPDTPLELGATAGLRLLEGDASDKILQAVRDMFKNESNFKSKAEWVSI  510
             L  A+  VP      TP++LGATAGLRL+  + S++IL+AVRD+    S F+   +W+++
Sbjct  117   LDRAKSAVPWWQMSLTPVKLGATAGLRLIGDEQSEQILEAVRDVIWRRSIFQYNPKWINV  176

Query  511   LEGSQEGTYFWVAMNYLLGNLGKGYQNTIATIDLGGGSVQVSYAVSGDTFANAPKPHNGE  690
             LEGSQEG+Y WVA+NYLL  LG  Y NT+  IDLGGGSVQ++YAVS +  ANAP   +G+
Sbjct  177   LEGSQEGSYIWVALNYLLDRLGGDYSNTVGVIDLGGGSVQMAYAVSANAAANAPAVPDGK  236

Query  691   EPYVQEKYILGAQYYLYVHSYLNYGQLASRAEIFKASGNSTNPCVLEGYDGYYTYNDVSY  870
             +PY+ ++Y+ G  Y +YVHSYL YG LA+R EI KAS    + C+L G  G YTYN   Y
Sbjct  237   DPYITKEYLKGKDYSVYVHSYLYYGNLAARVEILKASPRPFSDCMLLGSTGNYTYNGEDY  296

Query  871   KVTAPPNGSSLKNCRKLARKVVDFRAPCKYPNCTFNGVWSGGGGAGMENVDISSYFYDIA  1050
                A P G+S   CRK AR+ +   APCK  NCTFNGVW+GGGGAG + +  +S+FY  A
Sbjct  297   PAVAAPWGASYGKCRKEARRALRLDAPCKAKNCTFNGVWNGGGGAGQKEIYAASFFYGKA  356

Query  1051  IDVGIIDEGKASKIVKPRSFLVAAKLACETKFEDVKSTFPNAVEKDYPYLCMDLVYQYTL  1230
               VG +D+   S    P  F  AAK  C    E+ ++ FP   E +  ++CMDLVYQYTL
Sbjct  357   TQVGWVDKAAPSAKSSPAEFRAAAKEICPLSLEEARAAFPGVRETE--FICMDLVYQYTL  414

Query  1231  LVDGLGLHPYKEITLMKKVEYKNYMVEAAWPLGCAIDVIS  1350
             L DG GL   ++ITL++KV++  + +EAAWPLG AI+ ++
Sbjct  415   LKDGFGLRRRRQITLVEKVKHGEFFIEAAWPLGEAIEAVA  454



>dbj|BAD13526.1| apyrase [Glycine max]
Length=388

 Score =   386 bits (992),  Expect = 4e-126, Method: Compositional matrix adjust.
 Identities = 201/392 (51%), Positives = 270/392 (69%), Gaps = 16/392 (4%)
 Frame = +1

Query  181   TGSRVHVFHFDENLDLLPVGDGVEFFLKITPGLSSYADDPEAAAKSLEPLLLEAEGVVPT  360
             TGSR+HV+HF++NLDLL +G GVE++ KITPGLSSYA++PE AAKSL PLL +AE VVP 
Sbjct  1     TGSRIHVYHFNQNLDLLHIGKGVEYYNKITPGLSSYANNPEQAAKSLIPLLEQAEDVVPD  60

Query  361   ELQPDTPLELGATAGLRLLEGDASDKILQAVRDMFKNESNFKSKAEWVSILEGSQEGTYF  540
             +LQP TP+ LG               ILQ+VRDM  N S F  + + VSI++G+QEG+Y 
Sbjct  61    DLQPKTPVRLG---------------ILQSVRDMLSNRSTFNVQPDAVSIIDGTQEGSYL  105

Query  541   WVAMNYLLGNLGKGYQNTIATIDLGGGSVQVSYAVSGDTFANAPKPHNGEEPYVQEKYIL  720
             WV +NY LGNLGK Y  T+  IDLGGGSVQ++YAVS  T  NAPK  +G++PY+++  + 
Sbjct  106   WVTVNYALGNLGKKYTKTVGVIDLGGGSVQMAYAVSKKTAKNAPKVADGDDPYIKKVVLK  165

Query  721   GAQYYLYVHSYLNYGQLASRAEIFKASGNSTNPCVLEGYDGYYTYNDVSYKVTAPPNGSS  900
             G  Y LYVHSYL++G+ ASRAEI K +  S NPC+L G++G YTY+   +K TA  +G++
Sbjct  166   GIPYDLYVHSYLHFGREASRAEILKLTPRSPNPCLLAGFNGIYTYSGEEFKATAYTSGAN  225

Query  901   LKNCRKLARKVVDFRAPCKYPNCTFNGVWSGGGGAGMENVDISSYFYDIAIDVGIIDEGK  1080
                C+   RK +    PC Y NCTF G+W+GGGG G +N+  SS F+ +  D G++D   
Sbjct  226   FNKCKNTIRKALKLNYPCPYQNCTFGGIWNGGGGNGQKNLFASSSFFYLPEDTGMVDAST  285

Query  1081  ASKIVKPRSFLVAAKLACETKFEDVKSTFPNAVEKDY-PYLCMDLVYQYTLLVDGLGLHP  1257
              + I++P      AK AC   FED KST+P   +K+   Y+CMDL+YQY LLVDG GL P
Sbjct  286   PNFILRPVDIETKAKEACALNFEDAKSTYPFLDKKNVASYVCMDLIYQYVLLVDGFGLDP  345

Query  1258  YKEITLMKKVEYKNYMVEAAWPLGCAIDVISS  1353
              ++IT  K++EY+  +VEAAWPLG A++ IS+
Sbjct  346   LQKITSGKEIEYQEAIVEAAWPLGNAVEAISA  377



>ref|XP_004978980.1| PREDICTED: probable apyrase 3-like isoform X2 [Setaria italica]
Length=460

 Score =   389 bits (998),  Expect = 5e-126, Method: Compositional matrix adjust.
 Identities = 208/409 (51%), Positives = 277/409 (68%), Gaps = 2/409 (0%)
 Frame = +1

Query  148   GNYAVIFDAGSTGSRVHVFHFDENLDLLPVGDGVEFFLKITPGLSSYADDPEAAAKSLEP  327
             G YAVIFDAGSTGSR+HVF FD  +DLL +GD ++ F K+ PGLSSYA  P+ AA S+ P
Sbjct  52    GRYAVIFDAGSTGSRLHVFRFDRQMDLLGIGDDIQVFAKVKPGLSSYAGRPQDAANSILP  111

Query  328   LLLEAEGVVPTELQPDTPLELGATAGLRLLEGDASDKILQAVRDMFKNESNFKSKAEWVS  507
             LL +A+ VVP+ L   T L+LGATAGLRL+  + S++IL+AVRD+   +S F+    W++
Sbjct  112   LLEKAKSVVPSRLMKTTTLKLGATAGLRLIGEEKSEEILEAVRDLVHTKSKFQYNPNWIN  171

Query  508   ILEGSQEGTYFWVAMNYLLGNLGKGYQNTIATIDLGGGSVQVSYAVSGDTFANAPKPHNG  687
             +LEGSQEG Y WVA+NYLL  LG  Y  T+  +DLGGGSVQ++YA+S    A+AP   +G
Sbjct  172   VLEGSQEGHYLWVALNYLLDKLGGDYSQTVGIVDLGGGSVQMAYAISAYAAASAPAVPDG  231

Query  688   EEPYVQEKYILGAQYYLYVHSYLNYGQLASRAEIFKASGNSTNPCVLEGYDGYYTYNDVS  867
             E+PYV ++Y+ G  Y +YVHSYL++G  A+RAEI KA     + C L G+ G Y+YN   
Sbjct  232   EDPYVTKEYLKGKDYSVYVHSYLSFGAFAARAEILKAKNGPFSSCTLRGFSGTYSYNGKK  291

Query  868   YKVTAPPNGSSLKNCRKLARKVVDFRAPCKYPNCTFNGVWSGGGGAGMENVDISSYFYDI  1047
             Y  TA P G++ + CR+   K ++  APCK  NCTF GVW+GGGGAG  N+ ++S F+ +
Sbjct  292   YDATASPKGANYEKCREEITKALNLNAPCKTKNCTFGGVWNGGGGAGQNNLYVTSSFHYL  351

Query  1048  AIDVGIIDEGKASKIVKPRSFLVAAKLACETKFEDVKSTFPNAVEKDYPYLCMDLVYQYT  1227
             A  VG ID    S    P +F +AA+ AC    + VK  FP   + + PYLC+DL YQYT
Sbjct  352   ASRVGFIDSEAPSAKATPAAFRIAARKACRLGVKKVKVAFPKIEDSNVPYLCLDLTYQYT  411

Query  1228  LLVDGLGLHPYKEITLMKKVEYKNYMVEAAWPLGCAIDVIS--SSSANN  1368
             LLVDG GL P K+IT + KV++  Y +EAAWPLG AI+ +S    + NN
Sbjct  412   LLVDGFGLPPTKKITFVSKVKHGEYFIEAAWPLGTAIEALSPKKQTGNN  460



>gb|EEE51563.1| hypothetical protein OsJ_32782 [Oryza sativa Japonica Group]
Length=527

 Score =   390 bits (1002),  Expect = 9e-126, Method: Compositional matrix adjust.
 Identities = 203/415 (49%), Positives = 275/415 (66%), Gaps = 8/415 (2%)
 Frame = +1

Query  148   GNYAVIFDAGSTGSRVHVFHFDENLDLLPVGDGVEFFLKITPGLSSYADDPEAAAKSLEP  327
             G YAVI DAGSTG+RVHVF FD  +DLL +GD +E F K+ PGLSSYA  P  AA S++P
Sbjct  54    GKYAVILDAGSTGTRVHVFRFDRMMDLLKIGDDIEVFAKVVPGLSSYAGRPREAANSIQP  113

Query  328   LLLEAEGVVPTELQPDTPLELGATAGLRLLEGDASDKILQAVRDMFKNESNFKSKAEWVS  507
             LL +A  VVP  L   TPL+LGATAGL L+  + +++IL+AVRD+   +S F+    W++
Sbjct  114   LLDKAIHVVPNWLMKKTPLKLGATAGLILIGDEKANQILEAVRDVVHTKSKFQYNPNWIN  173

Query  508   ILEGSQEGTYFWVAMNYLLGNLGKGYQNTIATIDLGGGSVQVSYAVSGDTFANAPKPHNG  687
             +L GSQEG+Y WVA+NYLL  LG+ Y  T+  IDLGGGSVQ++YAVS    ANAP+  NG
Sbjct  174   VLTGSQEGSYMWVALNYLLDRLGEDYSKTVGVIDLGGGSVQMAYAVSSSIAANAPEVPNG  233

Query  688   EEPYVQEKYILGAQYYLYVHSYLNYGQLASRAEIFKASGNSTNPCVLEGYDGYYTYNDVS  867
             ++PY+ E+Y+ G  Y +YVHSYL+YG  ASR EI K      + C+L G+ G +TYN   
Sbjct  234   QDPYITEEYLKGRDYNIYVHSYLHYGAQASRVEILKRKNGPFSNCMLRGFKGKFTYNGEQ  293

Query  868   YKVTAPPNGSSLKNCRKLARKVVDFRAPCKYPNCTFNGVWSGGGGAGMENVDISSYFYDI  1047
             Y+  A P G+    CR+   K ++  +PC+  NC+FNGVW+GGGG G + + ++S FY I
Sbjct  294   YEAMAAPQGADYHKCRQDVVKALNLDSPCETKNCSFNGVWNGGGGVGQDEIYVTSSFYYI  353

Query  1048  AIDVGIIDEGKASKIVKPRSFLVAAKLACETKFEDVKSTFPNAVEKDYPYLCMDLVYQYT  1227
             A  +G ID    S    P ++  A++  C    E+ K+ +P  + +D+ YLCMDL+YQYT
Sbjct  354   ASGIGFIDSEAPSAKSTPAAYKAASEKVCILSIEEAKAAYP--IARDHAYLCMDLIYQYT  411

Query  1228  LLVDGLGLHPYKEITLMKKVEYKNYMVEAAWPLGCAID------VISSSSANNLL  1374
             LLVDG GL   KEITL++KV++    +EAAWPLG AI+      +I    AN +L
Sbjct  412   LLVDGFGLEATKEITLVEKVKHGESYIEAAWPLGTAIEATTGPRLIGDEKANQIL  466



>ref|XP_001753690.1| predicted protein [Physcomitrella patens]
 gb|EDQ81442.1| predicted protein [Physcomitrella patens]
Length=471

 Score =   387 bits (993),  Expect = 4e-125, Method: Compositional matrix adjust.
 Identities = 212/443 (48%), Positives = 290/443 (65%), Gaps = 14/443 (3%)
 Frame = +1

Query  58    LVFISLALLLFP-------LACFSRSH---LRRVLLNHEAGNYAVIFDAGSTGSRVHVFH  207
             L  IS+ L+L P       +A F  S       V L+ E   YAV+FDAGS+GSRVHVF 
Sbjct  27    LALISVVLVLMPRIVDPHSIAAFDSSFELPSNNVRLS-EQKRYAVVFDAGSSGSRVHVFS  85

Query  208   FDENLDLLPVGDGVEFFLKITPGLSSYADDPEAAAKSLEPLLLEAEGVVPTELQPDTPLE  387
             FD++L L+ VGDG E F ++ PGLSSYA +P+  A SL+PLL +A  VVPTE +  TP+ 
Sbjct  86    FDKDLQLVKVGDGFEVFDQLKPGLSSYALNPKKGAASLQPLLDKALEVVPTEQRSTTPVL  145

Query  388   LGATAGLRLLEGDASDKILQAVRDMFKNESNFKSKAEWVSILEGSQEGTYFWVAMNYLLG  567
             LGATAGLRLL GD S  +L+ V D+   ES+FK K EWVSI++G+QEG+Y WV +NYLL 
Sbjct  146   LGATAGLRLLPGDQSSNLLKEV-DVLLRESSFKFKPEWVSIIDGTQEGSYQWVTVNYLLK  204

Query  568   NLGKGYQNTIATIDLGGGSVQVSYAVSGDTFANAPKPHNGEEPYVQEKYILGAQYYLYVH  747
              LGK +  T+  +DLGGGSVQ+ YA+S + FA APK  +G++ YV++  ++GA Y LYVH
Sbjct  205   RLGKSFDETVGIVDLGGGSVQMGYAISDEDFAKAPKARDGQQSYVRKMSLMGASYNLYVH  264

Query  748   SYLNYGQLASRAEIFKASGNSTN-PCVLEGYDGYYTYNDVSYKVTAPPNGSSLKNCRKLA  924
             SYLNYG LASRAEI K   ++ +  C+ +G+ G YTY    Y+ +A  +G   + C+KL 
Sbjct  265   SYLNYGLLASRAEILKLLDDTESCSCLPKGFQGTYTYGSQEYRASASVDGGEYEKCKKLV  324

Query  925   RKVVDFRAPCKYPNCTFNGVWSGGGGAGMENVDISSYFYDIAIDVGII-DEGKASKIVKP  1101
              K +     C+   CTF GVW GGGG GM+++ ++S+F+D A++ GI+ D   A  ++ P
Sbjct  325   IKALKADQTCESLQCTFAGVWGGGGGVGMKSLFVASFFFDRALESGIVTDPDAAEAVITP  384

Query  1102  RSFLVAAKLACETKFEDVKSTFPNAVEKDYPYLCMDLVYQYTLLVDGLGLHPYKEITLMK  1281
               F  AAK  C    +++  ++P   E    +LCMDL YQYTL+V G  + P  +ITL+K
Sbjct  385   ADFEAAAKKICRLSLDELAQSYPKVQEDTRKFLCMDLTYQYTLIVTGFQVKPDTKITLVK  444

Query  1282  KVEYKNYMVEAAWPLGCAIDVIS  1350
             KV+Y    VE AWPLG AI+++S
Sbjct  445   KVKYSGSYVETAWPLGSAIELVS  467



>emb|CDX70805.1| BnaC03g08890D [Brassica napus]
Length=1541

 Score =   410 bits (1053),  Expect = 2e-124, Method: Compositional matrix adjust.
 Identities = 223/471 (47%), Positives = 295/471 (63%), Gaps = 65/471 (14%)
 Frame = +1

Query  130   LLNHEAG-------NYAVIFDAGSTGSRVHVFHFDENLDLLPVGDGVEFFLK--------  264
             +LN + G       NYAVIFDAGS+GSRVHV+ FD NLDLLP+G+ +E F++        
Sbjct  1072  VLNRKGGPNSRPPKNYAVIFDAGSSGSRVHVYCFDRNLDLLPLGNELELFVQRMFLIDAC  1131

Query  265   ---------------------------------------------ITPGLSSYADDPEAA  309
                                                          + PGLS+Y  DP  A
Sbjct  1132  ISCDVSLIQFVMVIRGTFVLFKLTYISLDVSLIQFLMVNSWYICVLKPGLSAYPTDPRQA  1191

Query  310   AKSLEPLLLEAEGVVPTELQPDTPLELGATAGLRLLEGDASDKILQAVRDMFKNESNFKS  489
             A SL  LL +AE  VP EL+P TP+ +GATAGLR L  +AS+ ILQAV+++ ++ S  K+
Sbjct  1192  ANSLVSLLDKAEASVPRELRPKTPVRVGATAGLRTLGHEASENILQAVKELLRDRSMLKT  1251

Query  490   KAEWVSILEGSQEGTYFWVAMNYLLGNLGKGYQNTIATIDLGGGSVQVSYAVSGDTFANA  669
             +A  V++L+G+QEG Y WV +NYLL NLGK Y +T+  +DLGGGSVQ++YA+S +  A A
Sbjct  1252  EANAVTVLDGTQEGAYQWVTINYLLRNLGKPYSDTVGVVDLGGGSVQMAYAISEEDAATA  1311

Query  670   PKPHNGEEPYVQEKYILGAQYYLYVHSYLNYGQLASRAEIFKASGNSTNPCVLEGYDGYY  849
             PKP  GE+ YV+E Y+ G +Y+LYVHSYL+YG LA+RAEI K S +S NPC++ GYDG Y
Sbjct  1312  PKPLEGEDSYVREMYLKGRKYFLYVHSYLHYGLLAARAEILKVSEDSNNPCIVAGYDGTY  1371

Query  850   TYNDVSYKVTAPPNGSSLKNCRKL---ARKVVDFRAPCKYPNCTFNGVWSGGGGAGMENV  1020
              Y    +K  A  +G+SL  CR+L   A KV D    C +  CTF GVW+GG G G +N+
Sbjct  1372  KYGGDGFKAAAVQSGASLNECRRLTVNALKVND--TLCTHMKCTFGGVWNGGRGGGQKNM  1429

Query  1021  DISSYFYDIAIDVGIIDEGKASKIVKPRSFLVAAKLACETKFEDVKSTFPNAVEKDYPYL  1200
              ++S+F+D A + G +D  +    V+P  F  AAK AC  K ++ KS FP   E ++PYL
Sbjct  1430  FVASFFFDRAAEAGFVDPKQPVATVRPIDFEKAAKKACSMKMDEGKSKFPRVEEDNFPYL  1489

Query  1201  CMDLVYQYTLLVDGLGLHPYKEITLMKKVEYKNYMVEAAWPLGCAIDVISS  1353
             CMDLVYQYTLLVDG GL P + ITL+KKV+Y  + VEAAWPLG AI+ +SS
Sbjct  1490  CMDLVYQYTLLVDGFGLEPSQTITLVKKVKYGEHAVEAAWPLGSAIEAVSS  1540



>gb|ABA91303.1| GDA1/CD39 family protein, expressed [Oryza sativa Japonica Group]
Length=429

 Score =   383 bits (983),  Expect = 4e-124, Method: Compositional matrix adjust.
 Identities = 200/401 (50%), Positives = 263/401 (66%), Gaps = 24/401 (6%)
 Frame = +1

Query  148   GNYAVIFDAGSTGSRVHVFHFDENLDLLPVGDGVEFFLKITPGLSSYADDPEAAAKSLEP  327
             G YAVI DAGSTG+RVHVF FD  LDLL VGD +E F K+ PGLSSYA  P+ AA S+ P
Sbjct  43    GRYAVILDAGSTGTRVHVFRFDNKLDLLKVGDDIELFAKVDPGLSSYAGRPQDAANSILP  102

Query  328   LLLEAEGVVPTELQPDTPLELGATAGLRLLEGDASDKILQAVRDMFKNESNFKSKAEWVS  507
             LL +A  VVPT L   TPL+LGATAGLRL+  + +++IL+A                   
Sbjct  103   LLDKANTVVPTRLMNKTPLKLGATAGLRLIGDEKANQILEA-------------------  143

Query  508   ILEGSQEGTYFWVAMNYLLGNLGKGYQNTIATIDLGGGSVQVSYAVSGDTFANAPKPHNG  687
                GSQEG+Y WVA+NYLL  LG  Y  T+  +DLGGGSVQ++YA+  +T ANAPK   G
Sbjct  144   ---GSQEGSYMWVALNYLLDKLGGDYFKTVGVVDLGGGSVQMAYAMLSNTAANAPKVPEG  200

Query  688   EEPYVQEKYILGAQYYLYVHSYLNYGQLASRAEIFKASGNSTNPCVLEGYDGYYTYNDVS  867
             ++PYV ++Y+ G  Y +YVHSYL+YG  ASR +I +      + C+L G+ G YTYND  
Sbjct  201   KDPYVVKEYLKGKDYNIYVHSYLHYGGFASRVQILERKDGPFSNCMLRGFSGNYTYNDKQ  260

Query  868   YKVTAPPNGSSLKNCRKLARKVVDFRAPCKYPNCTFNGVWSGGGGAGMENVDISSYFYDI  1047
             Y  T  P G+    CR+   K++   APC+  NC+FNGVW+GGGGAG +++ ++S FY I
Sbjct  261   YDATTAPQGADYHKCREEVVKLLKVNAPCETKNCSFNGVWNGGGGAGQDDLYVASAFYYI  320

Query  1048  AIDVGIIDEGKASKIVKPRSFLVAAKLACETKFEDVKSTFPNAVEKDYPYLCMDLVYQYT  1227
             A  VG ID    S    P +F   A+ AC+   ++ K  +PN   +D+ YLCMDL+Y+Y+
Sbjct  321   ASHVGFIDSDAPSAKSTPATFKAVAEKACKLSVKEAKVEYPNV--RDHAYLCMDLIYEYS  378

Query  1228  LLVDGLGLHPYKEITLMKKVEYKNYMVEAAWPLGCAIDVIS  1350
             LLVDG GLHP KEITL+ KV++  Y ++AAWPLG AI+ +S
Sbjct  379   LLVDGFGLHPSKEITLVDKVKHGEYYIDAAWPLGTAIEAVS  419



>ref|XP_006290233.1| hypothetical protein CARUB_v100030810mg, partial [Capsella rubella]
 gb|EOA23131.1| hypothetical protein CARUB_v100030810mg, partial [Capsella rubella]
Length=502

 Score =   385 bits (989),  Expect = 4e-124, Method: Compositional matrix adjust.
 Identities = 197/368 (54%), Positives = 264/368 (72%), Gaps = 5/368 (1%)
 Frame = +1

Query  151   NYAVIFDAGSTGSRVHVFHFDENLDLLPVGDGVEFFLKITPGLSSYADDPEAAAKSLEPL  330
             NYAVIFDAGS+GSRVHV+ FD NLDL+P+G+ +E FL++ PGLS+Y  DP  AA SL  L
Sbjct  137   NYAVIFDAGSSGSRVHVYCFDHNLDLIPLGNELELFLQLKPGLSAYPTDPRQAANSLVSL  196

Query  331   LLEAEGVVPTELQPDTPLELGATAGLRLLEGDASDKILQAVRDMFKNESNFKSKAEWVSI  510
             L +AE  VP EL+P TP+ +GATAGLR L  +AS+ IL+AVR++ ++ S  K++A  V++
Sbjct  197   LDKAEASVPRELRPKTPVRVGATAGLRTLGHEASENILEAVRELLRDRSMLKTEANAVTV  256

Query  511   LEGSQEGTYFWVAMNYLLGNLGKGYQNTIATIDLGGGSVQVSYAVSGDTFANAPKPHNGE  690
             L+G+QEG+Y WV +NYLL NLGK Y +T+  +DLGGGSVQ++YA+S +  A+APKP +GE
Sbjct  257   LDGTQEGSYQWVTINYLLRNLGKPYSDTVGVVDLGGGSVQMAYAISEEDAASAPKPLDGE  316

Query  691   EPYVQEKYILGAQYYLYVHSYLNYGQLASRAEIFKASGNSTNPCVLEGYDGYYTYNDVSY  870
             + YV+E Y+ G +Y+LYVHSYL+YG LA+RAEI K S +S N C++ GYDG Y Y    +
Sbjct  317   DSYVREMYLKGRKYFLYVHSYLHYGLLAARAEILKVSEDSDNSCIVTGYDGMYKYGGKEF  376

Query  871   KVTAPPNGSSLKNCRKL---ARKVVDFRAPCKYPNCTFNGVWSGGGGAGMENVDISSYFY  1041
             K TA P+G+SL  CR++   A KV D    C +  CTF GVW+GG G G +N+ ++S+F+
Sbjct  377   KGTASPSGASLDECRRITINALKVND--TLCTHMKCTFGGVWNGGRGGGQKNMFVASFFF  434

Query  1042  DIAIDVGIIDEGKASKIVKPRSFLVAAKLACETKFEDVKSTFPNAVEKDYPYLCMDLVYQ  1221
             D A + G +D  +    V+P  F  AAK AC    E+ KS FP   E + PYLCMDLVYQ
Sbjct  435   DRAAEAGFVDPKQPVATVRPMDFEKAAKKACSMNLEEGKSKFPLVEEDNLPYLCMDLVYQ  494

Query  1222  YTLLVDGL  1245
             YTLL+DG 
Sbjct  495   YTLLIDGF  502



>ref|XP_003570952.1| PREDICTED: probable apyrase 3 [Brachypodium distachyon]
Length=454

 Score =   383 bits (984),  Expect = 5e-124, Method: Compositional matrix adjust.
 Identities = 201/401 (50%), Positives = 274/401 (68%), Gaps = 0/401 (0%)
 Frame = +1

Query  148   GNYAVIFDAGSTGSRVHVFHFDENLDLLPVGDGVEFFLKITPGLSSYADDPEAAAKSLEP  327
             G YAVIFDAGSTG+RVHVF FD  ++L+ +G  +E F K+ PGLSSYA  P+ AA S+ P
Sbjct  46    GKYAVIFDAGSTGTRVHVFRFDTEMELVEIGHDIEVFAKVEPGLSSYAGRPQEAADSILP  105

Query  328   LLLEAEGVVPTELQPDTPLELGATAGLRLLEGDASDKILQAVRDMFKNESNFKSKAEWVS  507
             LL +A+ VVP  L   T ++LGATAGLRL+  + +++IL+AVR +   +S F+    W++
Sbjct  106   LLQKAKSVVPRWLMRRTAVKLGATAGLRLIGDEKAEQILEAVRGVIHTKSKFQYDPSWIN  165

Query  508   ILEGSQEGTYFWVAMNYLLGNLGKGYQNTIATIDLGGGSVQVSYAVSGDTFANAPKPHNG  687
             +LEGSQEG+Y WVA+NYLL  LG  Y  T+  IDLGGGSVQ++YA+S D  A AP   +G
Sbjct  166   VLEGSQEGSYLWVALNYLLDKLGGDYGKTVGVIDLGGGSVQMAYAISEDAAAAAPVVPDG  225

Query  688   EEPYVQEKYILGAQYYLYVHSYLNYGQLASRAEIFKASGNSTNPCVLEGYDGYYTYNDVS  867
             ++PYV ++Y+ G  Y +Y HSYL+YG +ASRAEIFKA     + C+L G+ G Y+YN   
Sbjct  226   KDPYVTKEYLKGRDYNIYAHSYLHYGAMASRAEIFKAKNGPVSYCMLRGFVGEYSYNGEQ  285

Query  868   YKVTAPPNGSSLKNCRKLARKVVDFRAPCKYPNCTFNGVWSGGGGAGMENVDISSYFYDI  1047
             +  TA   G++   CR+   K +   A C++ NCTFNG W+GGGGAG  ++ ++S FY +
Sbjct  286   FDATASLQGAAYDKCREDVTKALKLGAACEHKNCTFNGAWNGGGGAGQTDLYVTSTFYYV  345

Query  1048  AIDVGIIDEGKASKIVKPRSFLVAAKLACETKFEDVKSTFPNAVEKDYPYLCMDLVYQYT  1227
             A +VG+ID   AS    P +F  AA+  C   FE+ K+ +      D PY+CMDLVYQY+
Sbjct  346   ASEVGLIDGEAASGKTTPAAFGAAAEKICAMSFEETKAAYTRVRASDAPYICMDLVYQYS  405

Query  1228  LLVDGLGLHPYKEITLMKKVEYKNYMVEAAWPLGCAIDVIS  1350
             LLVDG GL P KEIT+ +KV++  Y +EAAWPLG AI+ +S
Sbjct  406   LLVDGFGLEPAKEITVAQKVKHGEYFLEAAWPLGEAIEAVS  446



>ref|XP_002979160.1| hypothetical protein SELMODRAFT_233281 [Selaginella moellendorffii]
 gb|EFJ19568.1| hypothetical protein SELMODRAFT_233281 [Selaginella moellendorffii]
Length=471

 Score =   382 bits (980),  Expect = 3e-123, Method: Compositional matrix adjust.
 Identities = 217/470 (46%), Positives = 295/470 (63%), Gaps = 28/470 (6%)
 Frame = +1

Query  34    MKHTSHHH----------LVFISLALLLFPLACFSRSHLRRVLL------NHEA----GN  153
             M+H S             LV I L L+L  +    RS L    +      + EA     +
Sbjct  4     MRHESSQEKFAKYRGVLLLVSIPLGLILAVMLLMPRSTLENGAVSITDPFDREAFGSQSS  63

Query  154   YAVIFDAGSTGSRVHVFHFDENLDLLPVGDGVEFFLKITPGLSSYADDPEAAAKSLEPLL  333
             +AVIFDAGS+GSRVHVF F  +L+LL + +G+E F ++ PGLS YA DP AAA SL+PLL
Sbjct  64    FAVIFDAGSSGSRVHVFRFSSDLELLAMDNGLELFRQLKPGLSYYASDPRAAANSLKPLL  123

Query  334   LEAEGVVPTELQPDTPLELGATAGLRLLEGDASDKILQAVRDMFKNESNFKSKAEWVSIL  513
               A  VVP  LQ  TP+ LGATAGLR L G  +++IL+ VRD+  N S+FK    WVSIL
Sbjct  124   DAALKVVPENLQGKTPVRLGATAGLRTLPGGKANEILEEVRDLLSN-SSFKFDPSWVSIL  182

Query  514   EGSQEGTYFWVAMNYLLGNLGKGYQNTIATIDLGGGSVQVSYAVSGDTFANAPKPHNGEE  693
             +G+ EG++ WV +NYLLG LGK    T+  +DLGGGSVQ++YA++ +  A APK   GE+
Sbjct  183   DGADEGSFQWVTINYLLGRLGKDLSETVGIVDLGGGSVQMAYAIAEEDAAKAPKAAAGED  242

Query  694   PYVQEKYILGAQYYLYVHSYLNYGQLASRAEIFK-ASGNSTNPCVLEGYDGYYTYNDVSY  870
              YV+   +LG  YYLYVHSYL+YG LA+RAE+ +    N  NPCV  G+ G Y Y   ++
Sbjct  243   AYVKTLTLLGKTYYLYVHSYLHYGLLAARAEVLRLVKTNDENPCVTSGFKGQYVYGSETF  302

Query  871   KVTAPPNGSSLKNCRKLARKVVDFRAPCKYPNCTFNGVWSGGGGAGMENVDISSYFYDIA  1050
                    G+    C  L    ++    C Y  CTF G+WSGGGGAG + + ++S+F+D A
Sbjct  303   DAVG---GADFDRCSDLIVSALEINHTCNYLKCTFKGIWSGGGGAGQKKLFVASFFFDRA  359

Query  1051  IDVGIIDEGKASK-IVKPRSFLVAAKLACETKFEDVKSTFPNAVEKDYPYLCMDLVYQYT  1227
              ++GII + + S+ +V+P  F  AA+  C T +ED+   FP   E   PY+CMD++YQY 
Sbjct  360   SEIGIIKDPQVSEAVVEPSQFRDAARSICSTSYEDMPKKFPGVPELALPYICMDVLYQYD  419

Query  1228  LLVDGLGLHPYKEITLMKKVEYKNYMVEAAWPLGCAIDVIS--SSSANNL  1371
             LLV G G+   ++ITL+K+V+YK Y VEAAWPLG AI+V+S  SSS ++L
Sbjct  420   LLVKGFGIPANEKITLVKRVQYKGYEVEAAWPLGSAIEVVSGHSSSTHSL  469



>gb|AFW55891.1| putative apyrase family protein [Zea mays]
Length=498

 Score =   382 bits (982),  Expect = 4e-123, Method: Compositional matrix adjust.
 Identities = 200/408 (49%), Positives = 277/408 (68%), Gaps = 7/408 (2%)
 Frame = +1

Query  148   GNYAVIFDAGSTGSRVHVFHFDENLDLLPVGDGVEFFLKITPGLSSYADDPEAAAKSLEP  327
             G YAVIFDAGSTG+R+HVF FD ++DL+ +G G+EFF K+ PGLSSYA +P+ AA S+ P
Sbjct  78    GRYAVIFDAGSTGTRMHVFRFDNHMDLVGIGHGIEFFAKVKPGLSSYAGEPQEAANSILP  137

Query  328   LLLEAEGVVPTELQPDTPLELGATAGLRLLEGDASDKILQAVRDMF--KNESNFKSKAEW  501
             LL +A+ VVP+EL   TPL+LGATAGLRL+  + +DKIL+AVRD+   K+++ F+   +W
Sbjct  138   LLKKAKRVVPSELIEKTPLKLGATAGLRLIGDEQADKILEAVRDLVHTKSKTQFQYNPDW  197

Query  502   VSILEGSQEGTYFWVAMNYLLGNLGKG-YQNTIATIDLGGGSVQVSYAVSGDTFANAPKP  678
             ++++EG QEG+Y WVA+NYLL  LG G Y  T+  +D+GGGS+Q++YA+S    A APK 
Sbjct  198   INVIEGYQEGSYLWVALNYLLDKLGVGDYSQTVGVVDMGGGSLQMAYAISAKDAAKAPKA  257

Query  679   HNGEEPYVQEKYILGAQYYLYVHSYLNYGQLASRAEIFKASG-NSTNPCVLEGYDGYYTY  855
              + ++ YV  +Y+ G  Y +Y HSYL+YG  A+R +I  A      + C+L G+ G YTY
Sbjct  258   PDADDRYVTREYLKGKDYNIYAHSYLHYGAFAARVKILDAKKYGQFSSCMLRGFKGNYTY  317

Query  856   NDVSYKVTAPPNGSSLKNCRKLARKVVDFRAPCKYPNC---TFNGVWSGGGGAGMENVDI  1026
             N   +  TA P G+    CR+   K ++  APC    C   TFNGVWSGGGG G++ + +
Sbjct  318   NGQQHDATASPEGAVYGKCREEVAKALNLSAPCVISCCGCCTFNGVWSGGGGPGLDTLYL  377

Query  1027  SSYFYDIAIDVGIIDEGKASKIVKPRSFLVAAKLACETKFEDVKSTFPNAVEKDYPYLCM  1206
             +S F+ +A  VG+ID    S    P +F VAAK AC+   E+ K+ +P   +   PYLCM
Sbjct  378   ASSFHFLAAQVGMIDGKLPSAKSTPSAFRVAAKKACQMSVEEAKAAYPGVQDIHVPYLCM  437

Query  1207  DLVYQYTLLVDGLGLHPYKEITLMKKVEYKNYMVEAAWPLGCAIDVIS  1350
             DL YQYTLLVDG GL   K++TL+ KV++  Y V+AAWPLG AI+ +S
Sbjct  438   DLTYQYTLLVDGFGLKSIKKVTLVSKVKHGEYYVQAAWPLGTAIEALS  485



>ref|XP_002988529.1| hypothetical protein SELMODRAFT_183978 [Selaginella moellendorffii]
 gb|EFJ10325.1| hypothetical protein SELMODRAFT_183978 [Selaginella moellendorffii]
Length=471

 Score =   380 bits (976),  Expect = 1e-122, Method: Compositional matrix adjust.
 Identities = 217/470 (46%), Positives = 294/470 (63%), Gaps = 28/470 (6%)
 Frame = +1

Query  34    MKHTSHHH----------LVFISLALLLFPLACFSRSHLRRVLL------NHEA----GN  153
             M+H S             LV I L L+L  +    RS L    +      + EA     +
Sbjct  4     MRHESSQEKFAKYRGVLLLVSIPLGLILAVMLLMPRSTLENGAVSITDPFDREAFGSQSS  63

Query  154   YAVIFDAGSTGSRVHVFHFDENLDLLPVGDGVEFFLKITPGLSSYADDPEAAAKSLEPLL  333
             +AVIFDAGS+GSRVHVF F  +L+LL + +G+E F ++ PGLS YA DP AAA SL+PLL
Sbjct  64    FAVIFDAGSSGSRVHVFRFSSDLELLAMDNGLELFRQLKPGLSYYASDPRAAANSLKPLL  123

Query  334   LEAEGVVPTELQPDTPLELGATAGLRLLEGDASDKILQAVRDMFKNESNFKSKAEWVSIL  513
               A  VVP  LQ  TP+ LGATAGLR L G  +++IL+ VRD+  N S+FK    WVSIL
Sbjct  124   DAALKVVPENLQGKTPVRLGATAGLRTLPGGKANEILEEVRDLLTN-SSFKFDPSWVSIL  182

Query  514   EGSQEGTYFWVAMNYLLGNLGKGYQNTIATIDLGGGSVQVSYAVSGDTFANAPKPHNGEE  693
             +G+ EG++ WV +NYLLG LGK    T+  +DLGGGSVQ++YA++ +  A APK   GE+
Sbjct  183   DGADEGSFQWVTVNYLLGRLGKDLSETVGIVDLGGGSVQMAYAITEEDAAKAPKAAAGED  242

Query  694   PYVQEKYILGAQYYLYVHSYLNYGQLASRAEIFK-ASGNSTNPCVLEGYDGYYTYNDVSY  870
              YV+   +LG  YYLYVHSYL+YG LA+RAE+ +    N  NPCV  G+ G Y Y   ++
Sbjct  243   AYVKTLTLLGKTYYLYVHSYLHYGLLAARAEVLRLVKTNDENPCVTSGFKGQYVYGSETF  302

Query  871   KVTAPPNGSSLKNCRKLARKVVDFRAPCKYPNCTFNGVWSGGGGAGMENVDISSYFYDIA  1050
                    G+    C  L    ++    C Y  CTF G+WSGGGGAG + + ++S+F+D A
Sbjct  303   DAVG---GADFDRCSDLIVSALEINHTCNYLKCTFKGIWSGGGGAGQKKLFVASFFFDRA  359

Query  1051  IDVGIIDEGKASK-IVKPRSFLVAAKLACETKFEDVKSTFPNAVEKDYPYLCMDLVYQYT  1227
              ++GII + + S+ +V+P  F  AA   C T +ED+   FP   E   PY+CMD++YQY 
Sbjct  360   SEIGIIKDPQVSEAVVEPSQFRDAATSICSTSYEDMPKKFPGVPELALPYICMDVLYQYD  419

Query  1228  LLVDGLGLHPYKEITLMKKVEYKNYMVEAAWPLGCAIDVIS--SSSANNL  1371
             LLV G G+   ++ITL+K+V+YK Y VEAAWPLG AI+V+S  SSS ++L
Sbjct  420   LLVKGFGIPANEKITLVKRVQYKGYEVEAAWPLGSAIEVVSGHSSSTHSL  469



>gb|EMS59522.1| Nucleoside-triphosphatase [Triticum urartu]
Length=716

 Score =   387 bits (995),  Expect = 2e-122, Method: Compositional matrix adjust.
 Identities = 197/392 (50%), Positives = 274/392 (70%), Gaps = 1/392 (0%)
 Frame = +1

Query  181   TGSRVHVFHFDENLDLLPVGDGVEFFLKITPGLSSYADDPEAAAKSLEPLLLEAEGVVPT  360
             +GSRVHVF FD NLDL+ +G  +E F++  PGLS+YA DP  AA+SL  L+ +A+ VVP 
Sbjct  99    SGSRVHVFCFDGNLDLVHIGTDIELFVQKKPGLSAYAQDPREAAQSLVSLIEKAKEVVPA  158

Query  361   ELQPDTPLELGATAGLRLLEGDASDKILQAVRDMFKNESNFKSKAEWVSILEGSQEGTYF  540
             EL+  TP+ +GATAGLR L    S++ILQAVRD+ + +S+FK++ +WV++L+G+QEG Y 
Sbjct  159   ELRDQTPVRVGATAGLRALGAGKSEEILQAVRDLLREKSSFKNQPDWVTVLDGTQEGAYE  218

Query  541   WVAMNYLLGNLGKGYQNTIATIDLGGGSVQVSYAVSGDTFANAPKPHNGEEPYVQEKYIL  720
             WV +NYLLGNLGK Y +T+  +DLGGGSVQ++YA+       APKP +GEE YV++ ++ 
Sbjct  219   WVTINYLLGNLGKTYADTVGVVDLGGGSVQMAYAIPEKDAEKAPKPADGEESYVKKLFLK  278

Query  721   GAQYYLYVHSYLNYGQLASRAEIFKA-SGNSTNPCVLEGYDGYYTYNDVSYKVTAPPNGS  897
             G  Y+LYVHSYL YG LA+RAEI KA + N  + CVL G+ G Y Y   +++ +A P+GS
Sbjct  279   GTMYHLYVHSYLRYGLLAARAEILKAGNANGYSNCVLAGHQGQYKYGGNTFEASAAPSGS  338

Query  898   SLKNCRKLARKVVDFRAPCKYPNCTFNGVWSGGGGAGMENVDISSYFYDIAIDVGIIDEG  1077
             S   CR    K +     C +  C+F G+W+GGGGAG +N+ ++S+F+D A + G I+  
Sbjct  339   SFSECRADVVKALKVDEACTHMKCSFGGIWNGGGGAGQKNLFVASFFFDRAAEAGFINSN  398

Query  1078  KASKIVKPRSFLVAAKLACETKFEDVKSTFPNAVEKDYPYLCMDLVYQYTLLVDGLGLHP  1257
              A   VK   F  AAK AC+    D +S++P   + + PY+CMDLVYQYTLLVDG G+ P
Sbjct  399   AAVAKVKSSDFEEAAKRACKLNVNDAQSSYPGVQKDNVPYICMDLVYQYTLLVDGFGVDP  458

Query  1258  YKEITLMKKVEYKNYMVEAAWPLGCAIDVISS  1353
              +E+TL+KKV Y +  VEAAWPLG AI+ ++S
Sbjct  459   QQEMTLVKKVPYSDAFVEAAWPLGSAIEYVAS  490



>dbj|BAJ96614.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=464

 Score =   379 bits (973),  Expect = 3e-122, Method: Compositional matrix adjust.
 Identities = 201/401 (50%), Positives = 269/401 (67%), Gaps = 2/401 (0%)
 Frame = +1

Query  148   GNYAVIFDAGSTGSRVHVFHFDENLDLLPVGDGVEFFLKITPGLSSYADDPEAAAKSLEP  327
             G YAVIFDAGSTG+RVHVF FD  +DLL +GD +E F K++PGLSSY+  P  AAKS+ P
Sbjct  52    GKYAVIFDAGSTGTRVHVFKFDNRMDLLQIGDQIEVFAKVSPGLSSYSGRPLEAAKSMIP  111

Query  328   LLLEAEGVVPTELQPDTPLELGATAGLRLLEGDASDKILQAVRDMFKNESNFKSKAEWVS  507
             LL +A+ +VP      TPL+LGATAGLRL+    S++IL+AVRD+   ++ F+   +W++
Sbjct  112   LLDKAKSIVPWWQMNRTPLKLGATAGLRLIGDKQSEQILEAVRDIVHTKTKFQYNPKWIN  171

Query  508   ILEGSQEGTYFWVAMNYLLGNLGKGYQNTIATIDLGGGSVQVSYAVSGDTFANAPKPHNG  687
             +LEGSQEG+Y WVA+NYLL  LG  Y  T+  IDLGGGSVQ++YAVS +  ANAP   +G
Sbjct  172   VLEGSQEGSYMWVALNYLLDRLGGDYSKTVGVIDLGGGSVQMAYAVSPNAAANAPAAPHG  231

Query  688   EEPYVQEKYILGAQYYLYVHSYLNYGQLASRAEIFKASGNSTNPCVLEGYDGYYTYNDVS  867
              +PY+ ++Y+ G  Y +YVHSYL YG +A+R EI KA     + C+L G  G YTYN  +
Sbjct  232   MDPYITKEYLKGKDYNVYVHSYLYYGSMAARVEILKAKSGPFSSCMLRGSTGNYTYNGEA  291

Query  868   YKVTAPPNGSSLKNCRKLARKVVDFRAPCKYPNCTFNGVWSGGGGAGMENVDISSYFYDI  1047
             Y  +A P G+  + CRK   + +   APC+  NCTF GVW GGGGAG   +  +S FY +
Sbjct  292   YDASASPEGAVYRKCRKEVARALKIDAPCEAKNCTFGGVWGGGGGAGQATLYAASSFYAM  351

Query  1048  AIDVGIIDEGKASKIVKPRSFLVAAKLACETKFEDVKSTFPNAVEKDYPYLCMDLVYQYT  1227
             A  VG + +G  S    P +F  AAK  C    E+ K+ +P    +D PY+CMDLVYQYT
Sbjct  352   ASQVGWVKKGTPSARSSPAAFRAAAKKMCPLSLEEAKAAYPGV--RDTPYVCMDLVYQYT  409

Query  1228  LLVDGLGLHPYKEITLMKKVEYKNYMVEAAWPLGCAIDVIS  1350
             LL  G GL   +EITL++KV++  Y +EA WPLG AI+ ++
Sbjct  410   LLAYGFGLARSREITLVEKVKHGEYFMEAKWPLGEAIEAVA  450



>ref|XP_004978979.1| PREDICTED: probable apyrase 3-like isoform X1 [Setaria italica]
Length=472

 Score =   379 bits (974),  Expect = 3e-122, Method: Compositional matrix adjust.
 Identities = 207/421 (49%), Positives = 278/421 (66%), Gaps = 14/421 (3%)
 Frame = +1

Query  148   GNYAVIFDAGSTGSRVHVFHFDENLDLLPVGDGVEFF------------LKITPGLSSYA  291
             G YAVIFDAGSTGSR+HVF FD  +DLL +GD ++ F            +++ PGLSSYA
Sbjct  52    GRYAVIFDAGSTGSRLHVFRFDRQMDLLGIGDDIQVFAKVLIPYYLFLRIQVKPGLSSYA  111

Query  292   DDPEAAAKSLEPLLLEAEGVVPTELQPDTPLELGATAGLRLLEGDASDKILQAVRDMFKN  471
               P+ AA S+ PLL +A+ VVP+ L   T L+LGATAGLRL+  + S++IL+AVRD+   
Sbjct  112   GRPQDAANSILPLLEKAKSVVPSRLMKTTTLKLGATAGLRLIGEEKSEEILEAVRDLVHT  171

Query  472   ESNFKSKAEWVSILEGSQEGTYFWVAMNYLLGNLGKGYQNTIATIDLGGGSVQVSYAVSG  651
             +S F+    W+++LEGSQEG Y WVA+NYLL  LG  Y  T+  +DLGGGSVQ++YA+S 
Sbjct  172   KSKFQYNPNWINVLEGSQEGHYLWVALNYLLDKLGGDYSQTVGIVDLGGGSVQMAYAISA  231

Query  652   DTFANAPKPHNGEEPYVQEKYILGAQYYLYVHSYLNYGQLASRAEIFKASGNSTNPCVLE  831
                A+AP   +GE+PYV ++Y+ G  Y +YVHSYL++G  A+RAEI KA     + C L 
Sbjct  232   YAAASAPAVPDGEDPYVTKEYLKGKDYSVYVHSYLSFGAFAARAEILKAKNGPFSSCTLR  291

Query  832   GYDGYYTYNDVSYKVTAPPNGSSLKNCRKLARKVVDFRAPCKYPNCTFNGVWSGGGGAGM  1011
             G+ G Y+YN   Y  TA P G++ + CR+   K ++  APCK  NCTF GVW+GGGGAG 
Sbjct  292   GFSGTYSYNGKKYDATASPKGANYEKCREEITKALNLNAPCKTKNCTFGGVWNGGGGAGQ  351

Query  1012  ENVDISSYFYDIAIDVGIIDEGKASKIVKPRSFLVAAKLACETKFEDVKSTFPNAVEKDY  1191
              N+ ++S F+ +A  VG ID    S    P +F +AA+ AC    + VK  FP   + + 
Sbjct  352   NNLYVTSSFHYLASRVGFIDSEAPSAKATPAAFRIAARKACRLGVKKVKVAFPKIEDSNV  411

Query  1192  PYLCMDLVYQYTLLVDGLGLHPYKEITLMKKVEYKNYMVEAAWPLGCAIDVIS--SSSAN  1365
             PYLC+DL YQYTLLVDG GL P K+IT + KV++  Y +EAAWPLG AI+ +S    + N
Sbjct  412   PYLCLDLTYQYTLLVDGFGLPPTKKITFVSKVKHGEYFIEAAWPLGTAIEALSPKKQTGN  471

Query  1366  N  1368
             N
Sbjct  472   N  472



>ref|XP_003605672.1| Nucleoside-triphosphatase [Medicago truncatula]
 gb|AES87869.1| Nod factor-binding lectin-nucleotide phosphohydrolase [Medicago 
truncatula]
Length=433

 Score =   378 bits (970),  Expect = 4e-122, Method: Compositional matrix adjust.
 Identities = 201/443 (45%), Positives = 282/443 (64%), Gaps = 42/443 (9%)
 Frame = +1

Query  52    HHLVFISLALLLFPLACFSRSHLRRVLLNHEA--------GNYAVIFDAGSTGSRVHVFH  207
             + +  I+  L + P   +S++    +LL +           +YAV+FDAGSTGSRVHV+H
Sbjct  13    NFMTLITFLLFIMPSISYSQNLGNNILLTNRKIFPKQETISSYAVVFDAGSTGSRVHVYH  72

Query  208   FDENLDLLPVGDGVEFFLKITPGLSSYADDPEAAAKSLEPLLLEAEGVVPTELQPDTPLE  387
             FD+NL+LL VG  VEF+ K TPGLS+YAD+PE AAKSL PLL +AE VVP + +  TP+ 
Sbjct  73    FDQNLNLLHVGKDVEFYNKTTPGLSAYADNPEQAAKSLIPLLEQAESVVPEDQRSKTPVR  132

Query  388   LGATAGLRLLEGDASDKILQAVRDMFKNESNFKSKAEWVSILEGSQEGTYFWVAMNYLLG  567
             LG                   VRD+  N S F  + + VSI++G+QEG+Y WV +NY LG
Sbjct  133   LG-------------------VRDLLSNRSTFNVQPDAVSIIDGTQEGSYLWVTVNYALG  173

Query  568   NLGKGYQNTIATIDLGGGSVQVSYAVSGDTFANAPKPHNGEEPYVQEKYILGAQYYLYVH  747
              LGK +  T+  +DLGGGSVQ++YAVS +T  NAPK  +G++PY++              
Sbjct  174   TLGKKFTKTVGVMDLGGGSVQMAYAVSRNTAKNAPKVADGDDPYIK--------------  219

Query  748   SYLNYGQLASRAEIFKASGNSTNPCVLEGYDGYYTYNDVSYKVTAPPNGSSLKNCRKLAR  927
             +YL++G  ASRAEI K + NS NPC+L G+DG Y Y    +K  A  +G+S K C+K+  
Sbjct  220   NYLHFGTEASRAEILKVTHNSPNPCILAGFDGTYRYAGEEFKANALASGASFKKCKKIVH  279

Query  928   KVVDFRAPCKYPNCTFNGVWSGGGGAGMENVDISSYFYDIAIDVGIIDEGKASKIVKPRS  1107
             + +    PC Y NCTF G+W+GGGG+G   +  +S+F+ +A +VG++D  K +  ++P  
Sbjct  280   QALKLNYPCPYQNCTFGGIWNGGGGSGQRKLFAASFFFYLAAEVGMVDPNKPNFKIRPVD  339

Query  1108  FLVAAKLACETKFEDVKSTFPNAVEKDY-PYLCMDLVYQYTLLVDGLGLHPYKEITLMKK  1284
             F   AK AC   FED KS++P   +K+   Y+CMDL+YQY LLVDG GL P +EIT  K+
Sbjct  340   FESEAKKACALNFEDAKSSYPFLAKKNIASYVCMDLIYQYVLLVDGFGLDPLQEITAGKQ  399

Query  1285  VEYKNYMVEAAWPLGCAIDVISS  1353
             +EY++ +VEAAWPLG A++ ISS
Sbjct  400   IEYQDSLVEAAWPLGNAVEAISS  422



>gb|KHN00658.1| Nucleoside-triphosphatase [Glycine soja]
Length=382

 Score =   375 bits (964),  Expect = 5e-122, Method: Compositional matrix adjust.
 Identities = 190/365 (52%), Positives = 259/365 (71%), Gaps = 1/365 (0%)
 Frame = +1

Query  265   ITPGLSSYADDPEAAAKSLEPLLLEAEGVVPTELQPDTPLELGATAGLRLLEGDASDKIL  444
             I PGLS+YA +P  AA+SL  LL +AE VVP E +P TP+ +GATAGLR LEGDAS +IL
Sbjct  18    IKPGLSAYAQNPRQAAESLISLLDKAESVVPREFRPKTPVRVGATAGLRALEGDASGRIL  77

Query  445   QAVRDMFKNESNFKSKAEWVSILEGSQEGTYFWVAMNYLLGNLGKGYQNTIATIDLGGGS  624
             QAVRD+ K  S  KS+ + V++L+G+QEG + WV +NYLLG LGK +  T+  +DLGGGS
Sbjct  78    QAVRDLLKQRSTLKSEPDAVTVLDGTQEGAFQWVTINYLLGKLGKDFSETVGVVDLGGGS  137

Query  625   VQVSYAVSGDTFANAPKPHNGEEPYVQEKYILGAQYYLYVHSYLNYGQLASRAEIFKASG  804
             VQ++YA+S    A APK   GE+PYV+E ++ G +YYLYVHSYL YG LA+RA+I + S 
Sbjct  138   VQMAYAISETDAAKAPKLSVGEDPYVKEMFLRGRKYYLYVHSYLGYGLLAARAKILEVSD  197

Query  805   NSTNPCVLEGYDGYYTYNDVSYKVTAPPNGSSLKNCRKLARKVVDF-RAPCKYPNCTFNG  981
             +S NPC+L G++G Y Y   S K ++ P+G+SL  C+ +A + +    + C +  CTF G
Sbjct  198   DSGNPCILNGFNGSYIYGGKSVKASSAPSGASLNECKNIAFQALKVNESKCTHMKCTFGG  257

Query  982   VWSGGGGAGMENVDISSYFYDIAIDVGIIDEGKASKIVKPRSFLVAAKLACETKFEDVKS  1161
             +W+GGGG G +N+ ++S+F+D A + G  +       V+P  F  AAK AC+TK ED KS
Sbjct  258   IWNGGGGDGQKNLFVASFFFDRAAEAGFANPNLPVVKVRPVDFEAAAKQACKTKLEDAKS  317

Query  1162  TFPNAVEKDYPYLCMDLVYQYTLLVDGLGLHPYKEITLMKKVEYKNYMVEAAWPLGCAID  1341
             T+    E + PYLCMDL+YQYTLLV G GL P+++ITL+KKV+Y +  VEAAWPLG AI+
Sbjct  318   TYQRVEEGNLPYLCMDLLYQYTLLVVGFGLDPWQQITLVKKVKYHDAFVEAAWPLGSAIE  377

Query  1342  VISSS  1356
              +SS+
Sbjct  378   AVSST  382



>gb|EMT13113.1| Nucleoside-triphosphatase [Aegilops tauschii]
Length=480

 Score =   377 bits (969),  Expect = 2e-121, Method: Compositional matrix adjust.
 Identities = 199/410 (49%), Positives = 274/410 (67%), Gaps = 18/410 (4%)
 Frame = +1

Query  181   TGSRVHVFHFDENLDLLPVGDGVEFFLKITPGLSSYADDPEAAAKSLEPLLLEAEGVVPT  360
             +GSRVHVF FD NLDL+ +G  +E F++  PGLS+YA DP  AA+SL  L+ +A+ VVP 
Sbjct  71    SGSRVHVFCFDGNLDLVHIGTDIELFVQKKPGLSAYAQDPREAAQSLVSLIEKAKEVVPA  130

Query  361   ELQPDTPLELGATAGLRLLEGDASDKILQAVRDMFKNESNFKSKAEWVSILEGSQEGTYF  540
             EL+  TP+ +GATAGLR L    S++ILQAVRD+ + +S+FK++ +WV++L+G+QE  Y 
Sbjct  131   ELRDQTPVRVGATAGLRALGAGKSEEILQAVRDLLREKSSFKNQPDWVTVLDGTQEEDYM  190

Query  541   -----------------WVAMNYLLGNLGKGYQNTIATIDLGGGSVQVSYAVSGDTFANA  669
                               V +NYLLGNLGK Y +T+  +DLGGGSVQ++YA+       A
Sbjct  191   PFSLSYELIFGGLLVSDKVTINYLLGNLGKTYADTVGVVDLGGGSVQMAYAIPEKDAEKA  250

Query  670   PKPHNGEEPYVQEKYILGAQYYLYVHSYLNYGQLASRAEIFKA-SGNSTNPCVLEGYDGY  846
             PKP +GEE YV++ ++ G  Y+LYVHSYL YG LA+RAEI KA + N  + CVL G+ G 
Sbjct  251   PKPADGEESYVKKLFLKGTTYHLYVHSYLRYGLLAARAEILKAGNANGYSNCVLAGHQGQ  310

Query  847   YTYNDVSYKVTAPPNGSSLKNCRKLARKVVDFRAPCKYPNCTFNGVWSGGGGAGMENVDI  1026
             Y Y   +++ +A P+GSS   CR    K +     C +  C+F G+W+GGGGAG +N+ +
Sbjct  311   YKYGGNTFEASAAPSGSSFSECRADVVKALKVDEACTHMKCSFGGIWNGGGGAGQKNLFV  370

Query  1027  SSYFYDIAIDVGIIDEGKASKIVKPRSFLVAAKLACETKFEDVKSTFPNAVEKDYPYLCM  1206
             +S+F+D A + G I+   A   VKP  F  AAK AC+    D +S++P   + + PY+CM
Sbjct  371   ASFFFDRAAEAGFINSNAAVAKVKPSDFEEAAKRACKLNVNDAQSSYPGVQKDNVPYICM  430

Query  1207  DLVYQYTLLVDGLGLHPYKEITLMKKVEYKNYMVEAAWPLGCAIDVISSS  1356
             DLVYQYTLLVDG G+ P +E+TL+KKV Y +  VEAAWPLG AI+V SSS
Sbjct  431   DLVYQYTLLVDGFGVDPQQEMTLVKKVPYSDAFVEAAWPLGSAIEVASSS  480



>ref|XP_008679361.1| PREDICTED: probable apyrase 3 isoform X2 [Zea mays]
Length=452

 Score =   376 bits (966),  Expect = 2e-121, Method: Compositional matrix adjust.
 Identities = 201/404 (50%), Positives = 268/404 (66%), Gaps = 20/404 (5%)
 Frame = +1

Query  148   GNYAVIFDAGSTGSRVHVFHFDENLDLLPVGD-GVEFFLKITPGLSSYADDPEAAAKSLE  324
             G YAVIFDAGSTG+RVHVF FD  L+LL +GD G+E F K+ PGLSSYA  P+ AA S+ 
Sbjct  61    GRYAVIFDAGSTGTRVHVFRFDRKLELLEIGDDGIEVFAKVKPGLSSYAGHPQEAANSML  120

Query  325   PLLLEAEGVVPTELQPDTPLELGATAGLRLLEGDASDKILQAVRDMFKNESNFKSKAEWV  504
             PLL +A+  VP +L   TPL LG                   VR++   +S F+ K EW+
Sbjct  121   PLLDKAKSAVPKQLTKRTPLRLG-------------------VRNLIHTKSKFQYKPEWI  161

Query  505   SILEGSQEGTYFWVAMNYLLGNLGKGYQNTIATIDLGGGSVQVSYAVSGDTFANAPKPHN  684
             +++EGSQEG+Y WVA+NYLL  LG  Y  T+A +D+GGGSVQ++YAVS +  A+AP P +
Sbjct  162   NVIEGSQEGSYLWVALNYLLDKLGGDYSQTVAVLDMGGGSVQMAYAVSANAAASAPAPTH  221

Query  685   GEEPYVQEKYILGAQYYLYVHSYLNYGQLASRAEIFKASGNSTNPCVLEGYDGYYTYNDV  864
             GE+PYV  +Y+ G  Y +Y HSYL+YG  ASRAEI KA     + C+L G+ G YTYN+ 
Sbjct  222   GEDPYVTREYLKGKDYNIYTHSYLHYGAFASRAEILKAKDGPFSSCMLRGFIGQYTYNEE  281

Query  865   SYKVTAPPNGSSLKNCRKLARKVVDFRAPCKYPNCTFNGVWSGGGGAGMENVDISSYFYD  1044
              Y  TA P G+    CR+   + ++  APC+  NCTFNG+W+GGGGAG  ++ ++S FY 
Sbjct  282   QYDATAAPEGAVYGKCREEIGRALNLNAPCEMKNCTFNGIWNGGGGAGQGSIYVASSFYF  341

Query  1045  IAIDVGIIDEGKASKIVKPRSFLVAAKLACETKFEDVKSTFPNAVEKDYPYLCMDLVYQY  1224
             +A +VGI+D    S    P +F  +A+ AC+   E+ K  +PN  + D PYLCMDL YQY
Sbjct  342   VASEVGIVDGNAPSGNTTPGAFGASAEKACQMSVEEAKIEYPNVNDVDVPYLCMDLAYQY  401

Query  1225  TLLVDGLGLHPYKEITLMKKVEYKNYMVEAAWPLGCAIDVISSS  1356
             TLLVDG G+   KEIT++ KV++  Y VEAAWPLG AI+ +SS+
Sbjct  402   TLLVDGFGVERTKEITVVDKVKHGEYYVEAAWPLGSAIEAVSST  445



>gb|EMT18791.1| Nucleoside-triphosphatase [Aegilops tauschii]
Length=439

 Score =   375 bits (962),  Expect = 7e-121, Method: Compositional matrix adjust.
 Identities = 201/421 (48%), Positives = 276/421 (66%), Gaps = 38/421 (9%)
 Frame = +1

Query  151   NYAVIFDAGSTGSRVHVFHFDENLDLLPVGDGVEFFLKITPGLSSYADDPEAAAKSLEPL  330
              YAVIFDAGS+GSRVHV+ FDE+LDL+P+G+ +E F +  PGLSSYA DP+ AA+SL  L
Sbjct  38    RYAVIFDAGSSGSRVHVYCFDESLDLVPIGNAIELFKQKKPGLSSYAKDPQEAAESLVSL  97

Query  331   LLEAEGVVPTELQPDTPLELGATAGLRLLEGDASDKILQAVRDMFKNESNFKSKAEWVSI  510
             L EAE VVP EL+  TP+ +G                   VRD+ +++S+FKS+ +WVS+
Sbjct  98    LEEAEKVVPVELREQTPVRVG-------------------VRDLLRDKSSFKSQPDWVSV  138

Query  511   LEGSQEGTYFWVAMNYLLGNLGKGYQNTIATIDLGGGSVQVSYAVSGDTFANAPKPHNGE  690
             L+GSQEG + WV +NYLL  LGK Y +T+  +DLGGGSVQ++YA+S    A AP+  +GE
Sbjct  139   LDGSQEGAFAWVTINYLLEKLGKPYSHTVGVVDLGGGSVQMAYAISEKDAAKAPQVSDGE  198

Query  691   EPYVQEKYILGAQYYLYVHS-----------------YLNYGQLASRAEIFKASGNST-N  816
             + YV++  + G  YYLYVH                  YL+YG LA+RAEI KA  NS  +
Sbjct  199   DSYVKKLVLKGTTYYLYVHRVATNPAICPILKDVKAFYLHYGLLAARAEILKAGENSDYS  258

Query  817   PCVLEGYDGYYTYNDVSYKVTAPPNGSSLKNCRKLARKVVDFRAP-CKYPNCTFNGVWSG  993
              C+L+GY G Y Y D +++ +   +G++   CR +A + +    P C +  CTF GVW+G
Sbjct  259   NCMLDGYHGKYQYGDDTFEASGSSSGATYSKCRAVAVRALKVDEPACTHMKCTFGGVWNG  318

Query  994   GGGAGMENVDISSYFYDIAIDVGIIDEGKASKIVKPRSFLVAAKLACETKFEDVKSTFPN  1173
             GGG G +N+ ++S+FYD A   G ++   A   VKP  F  AA+  C+   ++  +T+P+
Sbjct  319   GGGDGQKNLFVASFFYDRAAQAGFVNPKAAVAKVKPSDFEEAARRVCKLNVKEAHATYPD  378

Query  1174  AVEKDYPYLCMDLVYQYTLLVDGLGLHPYKEITLMKKVEYKNYMVEAAWPLGCAIDVISS  1353
               E+D P+LCMDLVYQ+TLLVDG G+ PY++ITL+KKV Y N  VEAAWPLG AI+V SS
Sbjct  379   VSEEDIPFLCMDLVYQHTLLVDGFGVDPYQDITLVKKVRYGNSFVEAAWPLGSAIEVASS  438

Query  1354  S  1356
             S
Sbjct  439   S  439



>ref|NP_001065624.1| Os11g0126400 [Oryza sativa Japonica Group]
 gb|ABA91311.1| GDA1/CD39 family protein [Oryza sativa Japonica Group]
 dbj|BAF27469.1| Os11g0126400 [Oryza sativa Japonica Group]
Length=548

 Score =   378 bits (970),  Expect = 1e-120, Method: Compositional matrix adjust.
 Identities = 203/436 (47%), Positives = 275/436 (63%), Gaps = 29/436 (7%)
 Frame = +1

Query  148   GNYAVIFDAGSTGSRVHVFHFDENLDLLPVGDGVEFFLK---------------------  264
             G YAVI DAGSTG+RVHVF FD  +DLL +GD +E F K                     
Sbjct  54    GKYAVILDAGSTGTRVHVFRFDRMMDLLKIGDDIEVFAKNKTLINKYRILIGYYFVVKIN  113

Query  265   ITPGLSSYADDPEAAAKSLEPLLLEAEGVVPTELQPDTPLELGATAGLRLLEGDASDKIL  444
             + PGLSSYA  P  AA S++PLL +A  VVP  L   TPL+LGATAGL L+  + +++IL
Sbjct  114   VVPGLSSYAGRPREAANSIQPLLDKAIHVVPNWLMKKTPLKLGATAGLILIGDEKANQIL  173

Query  445   QAVRDMFKNESNFKSKAEWVSILEGSQEGTYFWVAMNYLLGNLGKGYQNTIATIDLGGGS  624
             +AVRD+   +S F+    W+++L GSQEG+Y WVA+NYLL  LG+ Y  T+  IDLGGGS
Sbjct  174   EAVRDVVHTKSKFQYNPNWINVLTGSQEGSYMWVALNYLLDRLGEDYSKTVGVIDLGGGS  233

Query  625   VQVSYAVSGDTFANAPKPHNGEEPYVQEKYILGAQYYLYVHSYLNYGQLASRAEIFKASG  804
             VQ++YAVS    ANAP+  NG++PY+ E+Y+ G  Y +YVHSYL+YG  ASR EI K   
Sbjct  234   VQMAYAVSSSIAANAPEVPNGQDPYITEEYLKGRDYNIYVHSYLHYGAQASRVEILKRKN  293

Query  805   NSTNPCVLEGYDGYYTYNDVSYKVTAPPNGSSLKNCRKLARKVVDFRAPCKYPNCTFNGV  984
                + C+L G+ G +TYN   Y+  A P G+    CR+   K ++  +PC+  NC+FNGV
Sbjct  294   GPFSNCMLRGFKGKFTYNGEQYEAMAAPQGADYHKCRQDVVKALNLDSPCETKNCSFNGV  353

Query  985   WSGGGGAGMENVDISSYFYDIAIDVGIIDEGKASKIVKPRSFLVAAKLACETKFEDVKST  1164
             W+GGGG G + + ++S FY IA  +G ID    S    P ++  A++  C    E+ K+ 
Sbjct  354   WNGGGGVGQDEIYVTSSFYYIASGIGFIDSEAPSAKSTPAAYKAASEKVCILSIEEAKAA  413

Query  1165  FPNAVEKDYPYLCMDLVYQYTLLVDGLGLHPYKEITLMKKVEYKNYMVEAAWPLGCAID-  1341
             +P  + +D+ YLCMDL+YQYTLLVDG GL   KEITL++KV++    +EAAWPLG AI+ 
Sbjct  414   YP--IARDHAYLCMDLIYQYTLLVDGFGLEATKEITLVEKVKHGESYIEAAWPLGTAIEA  471

Query  1342  -----VISSSSANNLL  1374
                  +I    AN +L
Sbjct  472   TTGPRLIGDEKANQIL  487



>ref|NP_001167731.1| putative apyrase family protein precursor [Zea mays]
 gb|ACN25910.1| unknown [Zea mays]
 gb|AFW60555.1| putative apyrase family protein [Zea mays]
Length=464

 Score =   374 bits (961),  Expect = 2e-120, Method: Compositional matrix adjust.
 Identities = 207/404 (51%), Positives = 268/404 (66%), Gaps = 1/404 (0%)
 Frame = +1

Query  148   GNYAVIFDAGSTGSRVHVFHFDENLDLLPVGDGVEFFLKITPGLSSYADDPEAAAKSLEP  327
             G YAVIFDAGSTGSRV++F F   +DLL +GD +EFF K+ PGLSSYA  P+ AAKS+ P
Sbjct  56    GRYAVIFDAGSTGSRVYIFRFGRQMDLLRIGDEIEFFAKLKPGLSSYAGRPQEAAKSILP  115

Query  328   LLLEAEGVVPTELQPDTPLELGATAGLRLLEGDASDKILQAVRDMFKNESNFKSKAEWVS  507
             LL +A+ +VP+ L   TP++LGATAGLRL+    +D+IL AVRD+   +S F+ K  W++
Sbjct  116   LLEKAKSIVPSWLMKRTPVKLGATAGLRLIGNQQADQILDAVRDLVHKKSKFQYKPNWIN  175

Query  508   ILEGSQEGTYFWVAMNYLLGNLGKGYQNTIATIDLGGGSVQVSYAVSGDTFANAPKPHNG  687
             +LEGSQE +Y WVA+NYLL  LG  Y  T+  IDLGGGSVQ++YAVS +  A AP   +G
Sbjct  176   VLEGSQEASYLWVALNYLLDKLGGEYSQTVGVIDLGGGSVQMAYAVSANAAARAPAVPDG  235

Query  688   EEPYVQEKYILGAQYYLYVHSYLNYGQLASRAEIFKASGNSTNPCVLEGYDGYYTYNDVS  867
             E+PY+ ++Y  G QY +YVHSYL YG  ASRAEI  +     + C+L G+ G YTYN   
Sbjct  236   EDPYITKEYFKGKQYNVYVHSYLRYGSFASRAEILMSKNGPFSSCMLRGFSGKYTYNGQQ  295

Query  868   YKVTAPPNGSSLKNCRKLARKVVDFRAPCKYP-NCTFNGVWSGGGGAGMENVDISSYFYD  1044
             +  TA P G+    CR    K ++ +APCK   NCTF GVW GGGGAG  ++ ++S FY 
Sbjct  296   FDATARPEGALYDKCRGEIAKAMNLKAPCKTAKNCTFCGVWKGGGGAGQNDIYVASGFYY  355

Query  1045  IAIDVGIIDEGKASKIVKPRSFLVAAKLACETKFEDVKSTFPNAVEKDYPYLCMDLVYQY  1224
             +A  VG ID    S    P +F  AAK AC+      K  +P+    D PYLCMDL Y Y
Sbjct  356   LASHVGFIDSKAPSAKAPPAAFRAAAKKACKFDVNRAKVAYPDVSNSDVPYLCMDLTYTY  415

Query  1225  TLLVDGLGLHPYKEITLMKKVEYKNYMVEAAWPLGCAIDVISSS  1356
             TLLVDG GL P K+IT + KV++  Y +EA WPLG AI+ +S +
Sbjct  416   TLLVDGFGLQPMKKITFVSKVKHGEYYIEATWPLGTAIEAVSPT  459



>tpg|DAA41781.1| TPA: putative apyrase family protein [Zea mays]
Length=441

 Score =   373 bits (958),  Expect = 2e-120, Method: Compositional matrix adjust.
 Identities = 187/370 (51%), Positives = 260/370 (70%), Gaps = 1/370 (0%)
 Frame = +1

Query  145   AGNYAVIFDAGSTGSRVHVFHFDENLDLLPVGDGVEFFLKITPGLSSYADDPEAAAKSLE  324
             A  YAVIFDAGS+GSRVHVF FD NLDL+ +G  +E F++I PGLS YA+DP  AA+SL 
Sbjct  63    ADKYAVIFDAGSSGSRVHVFRFDANLDLVHIGSEIELFVQIKPGLSHYANDPREAAESLV  122

Query  325   PLLLEAEGVVPTELQPDTPLELGATAGLRLLEGDASDKILQAVRDMFKNESNFKSKAEWV  504
              LL +A+ VVP EL+  TP+ +GATAGLR L    S+ ILQAVRD+ + +S+FK++ +WV
Sbjct  123   SLLDDAKRVVPAELRDQTPVRVGATAGLRNLGAQKSEAILQAVRDILREKSSFKNQPDWV  182

Query  505   SILEGSQEGTYFWVAMNYLLGNLGKGYQNTIATIDLGGGSVQVSYAVSGDTFANAPKPHN  684
             ++L+G+QEG Y WV +NYLLGNLGK Y +T+  +DLGGGSVQ++YA++      APKP  
Sbjct  183   TVLDGTQEGAYEWVTINYLLGNLGKTYADTVGVVDLGGGSVQMAYAIAEKDAEKAPKPSE  242

Query  685   GEEPYVQEKYILGAQYYLYVHSYLNYGQLASRAEIFKA-SGNSTNPCVLEGYDGYYTYND  861
             GE+ YV++ ++ G  YYLYVHSYL+YG LA+RAE+ KA +GN  + C+LEG+ G Y Y D
Sbjct  243   GEDAYVKKLFLKGTTYYLYVHSYLHYGLLAARAEVLKAGNGNGYSNCMLEGFQGKYKYGD  302

Query  862   VSYKVTAPPNGSSLKNCRKLARKVVDFRAPCKYPNCTFNGVWSGGGGAGMENVDISSYFY  1041
              S++ + PP+G+S   C+  A K +     C +  C+F G+W+GGGGAG +N+ ++S+F+
Sbjct  303   DSFEASGPPSGASYSKCKDDAVKALKVDEACTHMKCSFGGIWNGGGGAGQKNLFVASFFF  362

Query  1042  DIAIDVGIIDEGKASKIVKPRSFLVAAKLACETKFEDVKSTFPNAVEKDYPYLCMDLVYQ  1221
             D A + G ++       VKP  F  AA+ AC    ++ ++TFP   +   PY+CMDLVYQ
Sbjct  363   DRAAEAGFVNANAPVAKVKPSDFRQAAERACSLSVKNAEATFPGVQKDSIPYICMDLVYQ  422

Query  1222  YTLLVDGLGL  1251
             YTLLV+G   
Sbjct  423   YTLLVEGFAF  432



>dbj|BAJ99958.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=370

 Score =   367 bits (941),  Expect = 1e-118, Method: Compositional matrix adjust.
 Identities = 189/364 (52%), Positives = 260/364 (71%), Gaps = 2/364 (1%)
 Frame = +1

Query  271   PGLSSYADDPEAAAKSLEPLLLEAEGVVPTELQPDTPLELGATAGLRLLEGDASDKILQA  450
             PGLSSYA DP+ AA+SL  LL EAE VVP EL+  TP+ +GATAGLR L  + S++ILQA
Sbjct  7     PGLSSYAKDPQEAAESLVSLLEEAEKVVPVELREQTPVRVGATAGLRALGAERSEEILQA  66

Query  451   VRDMFKNESNFKSKAEWVSILEGSQEGTYFWVAMNYLLGNLGKGYQNTIATIDLGGGSVQ  630
             VRD+ +++S+FKS+ +WVS+L+GSQEG + WV +NYLL  LGK Y +T+  +DLGGGSVQ
Sbjct  67    VRDLLRDKSSFKSQPDWVSVLDGSQEGAFAWVTINYLLEKLGKPYSHTVGVVDLGGGSVQ  126

Query  631   VSYAVSGDTFANAPKPHNGEEPYVQEKYILGAQYYLYVHSYLNYGQLASRAEIFKASGNS  810
             ++YA+S    A AP+  +GE+ YV++  + G  YYLYVHSYL+YG LA+RAEI KAS  S
Sbjct  127   MAYAISEKDAAKAPQVSDGEDSYVKKLVLKGTTYYLYVHSYLHYGLLAARAEILKASERS  186

Query  811   T-NPCVLEGYDGYYTYNDVSYKVTAPPNGSSLKNCRKLARKVVDFRAP-CKYPNCTFNGV  984
               + C+L+GY G Y Y D +++ +   +G++   CR +A + +    P C +  CTF GV
Sbjct  187   DYSNCMLDGYHGKYQYGDDTFEASGSSSGATYSKCRAVAVRALKVDEPACTHMKCTFGGV  246

Query  985   WSGGGGAGMENVDISSYFYDIAIDVGIIDEGKASKIVKPRSFLVAAKLACETKFEDVKST  1164
             W+GGGG G +N+ ++S+FYD A + G ++   A   VKP  F  AA+  C+   ++  +T
Sbjct  247   WNGGGGDGQKNLFVASFFYDRAAEAGFVNPKAAVAKVKPSDFEEAARRVCKLNVKEAHAT  306

Query  1165  FPNAVEKDYPYLCMDLVYQYTLLVDGLGLHPYKEITLMKKVEYKNYMVEAAWPLGCAIDV  1344
             +P+  E+D P+LCMDLVYQ+TLLVDG G+ PY++ITL+KKV Y N  VEAAWPLG AI+V
Sbjct  307   YPDVSEEDIPFLCMDLVYQHTLLVDGFGVDPYQDITLVKKVPYGNSFVEAAWPLGSAIEV  366

Query  1345  ISSS  1356
              SSS
Sbjct  367   ASSS  370



>ref|XP_001785876.1| predicted protein [Physcomitrella patens]
 gb|EDQ49304.1| predicted protein [Physcomitrella patens]
Length=471

 Score =   370 bits (949),  Expect = 1e-118, Method: Compositional matrix adjust.
 Identities = 200/407 (49%), Positives = 265/407 (65%), Gaps = 3/407 (1%)
 Frame = +1

Query  142   EAGNYAVIFDAGSTGSRVHVFHFDENLDLLPVGDGVEFFLKITPGLSSYADDPEAAAKSL  321
             E   YAVIFDAGS+GSRVHVF FD+NL L+ VGD  E F ++  GLSSYA  P+  A SL
Sbjct  64    EQKRYAVIFDAGSSGSRVHVFSFDKNLQLVKVGDEFEVFKQLPHGLSSYALSPKEGAASL  123

Query  322   EPLLLEAEGVVPTELQPDTPLELGATAGLRLLEGDASDKILQAVRDMFKNESNFKSKAEW  501
             +PLL  A  VVP E    TP+ LGATAGLRLL GD +  +L+ V D    ES+FK K EW
Sbjct  124   QPLLDIALKVVPAEQYRTTPVLLGATAGLRLLPGDQATNLLKEV-DTLLMESSFKFKPEW  182

Query  502   VSILEGSQEGTYFWVAMNYLLGNLGKGYQNTIATIDLGGGSVQVSYAVSGDTFANAPKPH  681
             VSI++G+QEG+Y WV +NYLL  LG+ +  T+  +DLGGGSVQ++YA+S + F +APKP 
Sbjct  183   VSIIDGTQEGSYQWVTVNYLLKRLGQSFDQTVGIVDLGGGSVQMAYAISDNDFLSAPKPR  242

Query  682   NGEEPYVQEKYILGAQYYLYVHSYLNYGQLASRAEIFKASGNSTN-PCVLEGYDGYYTYN  858
             +GE+ YV+   +LG  Y LYVHSYL+YG LA+RAE+ K    S + PC+ +G++G Y Y 
Sbjct  243   SGEQAYVRRMSLLGTSYNLYVHSYLSYGLLAARAEVLKLVDESKSCPCLAKGFEGSYIYA  302

Query  859   DVSYKVTAPPNGSSLKNCRKLARKVVDFRAPCKYPNCTFNGVWSGGGGAGMENVDISSYF  1038
                YK +A  +G   K CR L    +     C    CTF G WSGGGGAGM+++ ++S+F
Sbjct  303   GQEYKASASADGGDYKKCRTLVVNALKVDQTCDSLKCTFGGTWSGGGGAGMKSLFVASFF  362

Query  1039  YDIAIDVGII-DEGKASKIVKPRSFLVAAKLACETKFEDVKSTFPNAVEKDYPYLCMDLV  1215
             +D A++ GI+ D   A  +V P  F  AAK  C    +++   +P   E    +LCMDL 
Sbjct  363   FDRALEAGIVTDPDAAEAVVMPSDFEAAAKKICVLSIDELAEEYPKLKEDTRKFLCMDLT  422

Query  1216  YQYTLLVDGLGLHPYKEITLMKKVEYKNYMVEAAWPLGCAIDVISSS  1356
             YQY+LLV G  + P  +ITL+KKV Y    VE AWPLG AI+++S +
Sbjct  423   YQYSLLVSGFQVQPDTKITLVKKVRYSGSFVETAWPLGSAIELVSQN  469



>dbj|BAJ96497.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ97240.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=448

 Score =   368 bits (944),  Expect = 4e-118, Method: Compositional matrix adjust.
 Identities = 199/403 (49%), Positives = 268/403 (67%), Gaps = 3/403 (1%)
 Frame = +1

Query  148   GNYAVIFDAGSTGSRVHVFHFDENLDLLPVGDGVEFFLKITPGLSSYADDPEAAAKSLEP  327
             G YAVI DAGSTG+RVHVF FD+ ++L+ VGD +E F  + PGLSSYA  P+ AA S+ P
Sbjct  43    GKYAVIMDAGSTGTRVHVFRFDKKMELVDVGDDIEVFATVNPGLSSYAGRPQEAANSIVP  102

Query  328   LLLEAEGVVPTELQPDTPLELGATAGLRLLEGDASDKILQAVRDMFKNESNFKSKAEWVS  507
             LL +A   VP  L   TP++LGATAGLRL+  + +++IL+AVR +   +S F+    W++
Sbjct  103   LLEKANSAVPRSLMKRTPVKLGATAGLRLIGDEQAEQILEAVRGVVHTKSKFQYNPSWIN  162

Query  508   ILEGSQEGTYFWVAMNYLLGNLGKGYQNTIATIDLGGGSVQVSYAVSGDTFANAPKPHNG  687
             +LEGSQEG+Y WVA+NYLL  LG  Y  T+  IDLGGGSVQ++YA+S D  A AP     
Sbjct  163   VLEGSQEGSYLWVALNYLLDKLGGEYTKTVGVIDLGGGSVQMAYAISADAAATAPVV---  219

Query  688   EEPYVQEKYILGAQYYLYVHSYLNYGQLASRAEIFKASGNSTNPCVLEGYDGYYTYNDVS  867
             ++PYV ++Y+ G  Y +Y HSYL+YG +A+R EIFKA     + C+L G+ G YTYN   
Sbjct  220   KDPYVTKEYLKGRDYNVYAHSYLHYGAMAARGEIFKAKNGPISYCMLRGFIGKYTYNGDK  279

Query  868   YKVTAPPNGSSLKNCRKLARKVVDFRAPCKYPNCTFNGVWSGGGGAGMENVDISSYFYDI  1047
             Y   A P G++   CR+   K +   APC+  NCTFNG W+GGGGAG  ++  +S FY +
Sbjct  280   YDAIASPTGAAYDKCREDVIKALKLSAPCEAKNCTFNGAWNGGGGAGQADLYAASSFYYM  339

Query  1048  AIDVGIIDEGKASKIVKPRSFLVAAKLACETKFEDVKSTFPNAVEKDYPYLCMDLVYQYT  1227
             A  VG+ID    S    P ++  AA+  C    E+ K+ +P A   D PYLCMDLVYQY+
Sbjct  340   ASRVGLIDSDSTSGKTTPAAYRAAAEKICRLSLEEAKALYPRARATDVPYLCMDLVYQYS  399

Query  1228  LLVDGLGLHPYKEITLMKKVEYKNYMVEAAWPLGCAIDVISSS  1356
             LLV G GL P K IT+++KV++  Y +EAAWPLG AI+ +S +
Sbjct  400   LLVYGFGLEPTKVITVVEKVKHGEYFIEAAWPLGEAIEAVSPT  442



>ref|XP_009399921.1| PREDICTED: probable apyrase 2 isoform X3 [Musa acuminata subsp. 
malaccensis]
Length=379

 Score =   364 bits (935),  Expect = 1e-117, Method: Compositional matrix adjust.
 Identities = 191/370 (52%), Positives = 258/370 (70%), Gaps = 6/370 (2%)
 Frame = +1

Query  256   FLKITPGLSSYADDPEAAAKSLEPLLLEAEGVVPTELQPDTPLELGATAGLRLLEGDASD  435
              ++ TPGLS YA +P+ AA SL PLL +AE V+P EL+  TP+ +GATAGLR L    ++
Sbjct  11    LVQRTPGLSFYAKNPQEAANSLLPLLEKAESVIPAELRRTTPVRVGATAGLRALGAVTAE  70

Query  436   KILQAVR--DMFKNESNFKSKAEWVSILEGSQEGTYFWVAMNYLLGNLGKGYQNTIATID  609
             +ILQAVR  D+ + +S+ K +++WV++L+G+QEG + WV +NYLLG LGK Y +T+  +D
Sbjct  71    QILQAVRFLDLLRQKSSLKFQSDWVTVLDGTQEGAFQWVTINYLLGKLGKSYWDTVGVVD  130

Query  610   LGGGSVQVSYAVSGDTFANAPKPHNGEEPYVQEKYILGAQYYLYVHSYLNYGQLASRAEI  789
             LGGGSVQ++YA+S +  ANAPK  N E  YVQ+ ++ G  Y+LYVHSYL+YG LA RAEI
Sbjct  131   LGGGSVQMAYAISENDAANAPKISNEEHSYVQQLFLKGTSYHLYVHSYLHYGLLAVRAEI  190

Query  790   FKAS-GNSTNPCVLEGYDGYYTYNDVSYKVTAPPNGSSLKNCRKLARKVVDFRAP-CKYP  963
              KA+ GNS   C+L+GY+G Y Y +  YK  A P+G+S   CR    K +    P C + 
Sbjct  191   LKAADGNSK--CILDGYNGSYKYGEKEYKAVASPSGASYSKCRSDTIKALKVDEPTCTHM  248

Query  964   NCTFNGVWSGGGGAGMENVDISSYFYDIAIDVGIIDEGKASKIVKPRSFLVAAKLACETK  1143
              CTF GVW+GGGG G  N+ ++S+F+D A++ G +D       VKP  F V AK AC+  
Sbjct  249   KCTFGGVWNGGGGDGQRNLFVASFFFDRAVEAGFVDHKVPVAKVKPAEFKVVAKHACKLN  308

Query  1144  FEDVKSTFPNAVEKDYPYLCMDLVYQYTLLVDGLGLHPYKEITLMKKVEYKNYMVEAAWP  1323
              E  K+T+P   + + PYLCMDLVYQ+TLLVDG GL PY+EITL+KKV+Y +  VEAAWP
Sbjct  309   VEKAKATYPRVQDNNLPYLCMDLVYQFTLLVDGFGLDPYQEITLVKKVKYGDAFVEAAWP  368

Query  1324  LGCAIDVISS  1353
             LG AI+V S+
Sbjct  369   LGSAIEVAST  378



>dbj|BAD13525.1| apyrase [Glycine max]
Length=389

 Score =   364 bits (935),  Expect = 2e-117, Method: Compositional matrix adjust.
 Identities = 193/393 (49%), Positives = 263/393 (67%), Gaps = 16/393 (4%)
 Frame = +1

Query  178   STGSRVHVFHFDENLDLLPVGDGVEFFLKITPGLSSYADDPEAAAKSLEPLLLEAEGVVP  357
             STGSR+HV+HF++NL LL +G GVE++ KITPGLSSYA++PE AAKSL PLL +AE VVP
Sbjct  1     STGSRIHVYHFNQNLRLLHIGKGVEYYNKITPGLSSYANNPEQAAKSLIPLLEQAEDVVP  60

Query  358   TELQPDTPLELGATAGLRLLEGDASDKILQAVRDMFKNESNFKSKAEWVSILEGSQEGTY  537
              +LQP TP+ LG               ILQ+ RDM  N S F  + + VSI++G+QEG+Y
Sbjct  61    DDLQPKTPVRLG---------------ILQSGRDMLSNRSTFNVQPDAVSIIDGTQEGSY  105

Query  538   FWVAMNYLLGNLGKGYQNTIATIDLGGGSVQVSYAVSGDTFANAPKPHNGEEPYVQEKYI  717
              WV +NY  GNLGK Y  T+  IDLG GSVQ++ AVS  T  NAPK  +G++PY+++  +
Sbjct  106   LWVTVNYAWGNLGKKYTETVGVIDLGVGSVQMADAVSKKTAKNAPKVADGDDPYIKKVVL  165

Query  718   LGAQYYLYVHSYLNYGQLASRAEIFKASGNSTNPCVLEGYDGYYTYNDVSYKVTAPPNGS  897
              G  Y  YV  +L++G+ ASRAEI K +  S NPC+L G +G YTY+   +K TA  +G+
Sbjct  166   KGIPYDRYVQQFLHFGREASRAEILKLTPRSPNPCLLAGLNGIYTYSGEEFKATAYTSGA  225

Query  898   SLKNCRKLARKVVDFRAPCKYPNCTFNGVWSGGGGAGMENVDISSYFYDIAIDVGIIDEG  1077
             +   C+   RK +    PC Y NCTF G+W+GGGG G +N+  SS F+ +  D G++D  
Sbjct  226   NFNKCKNTIRKALKLNYPCPYQNCTFGGIWNGGGGNGQKNLFASSSFFYLPEDTGMVDAS  285

Query  1078  KASKIVKPRSFLVAAKLACETKFEDVKSTFPNAVEKDY-PYLCMDLVYQYTLLVDGLGLH  1254
               + I++P      AK AC   FED KST+P   +K+   Y+CMDL+YQY LLVDG GL 
Sbjct  286   TPNFILRPVDIETKAKKACALNFEDAKSTYPFLDKKNVASYVCMDLIYQYVLLVDGFGLD  345

Query  1255  PYKEITLMKKVEYKNYMVEAAWPLGCAIDVISS  1353
             P ++IT  K++EY++ +VEAAWPLG A++ IS+
Sbjct  346   PLQKITSGKEIEYQDAIVEAAWPLGNAVEAISA  378



>ref|XP_006663415.1| PREDICTED: probable apyrase 3-like [Oryza brachyantha]
Length=440

 Score =   363 bits (932),  Expect = 2e-116, Method: Compositional matrix adjust.
 Identities = 200/406 (49%), Positives = 258/406 (64%), Gaps = 28/406 (7%)
 Frame = +1

Query  151   NYAVIFDAGSTGSRVHVFHFDENLDLLPVGDGVEFFLKITPGLSSYADDPEAAAKSLEPL  330
              YAVIFDAGSTGSRVHVF FDE +DL+ +GD +E F K+ PGLSSYA  PE AA S+ PL
Sbjct  61    KYAVIFDAGSTGSRVHVFRFDEQMDLVKIGDEIELFAKVKPGLSSYAGKPEEAANSIAPL  120

Query  331   LLEAEGVVPTELQPDTPLELGATAGLRLLEGDASDKILQAVRDMFKNESNFKSKAEWVSI  510
             L +AE VVP  LQ  TPL+LGATAGLRL+  + +++ILQAVRD+  ++S F  K EW+S+
Sbjct  121   LEKAESVVPKRLQKRTPLKLGATAGLRLIGDEKAEEILQAVRDLVHSKSKFHYKPEWISV  180

Query  511   LEGSQEGTYFWVAMNYLLGNLGKGYQNTIATIDLGGGSVQVSYAVSGDTFANAPKPHNGE  690
             L GSQEG+  WVA+NYLLG LG  Y  T+  IDLGGGSVQ++YA+S D  ANAP    G+
Sbjct  181   LGGSQEGSNLWVALNYLLGRLGGDYSKTVGVIDLGGGSVQMAYAISADAAANAPPVPVGK  240

Query  691   EPYVQEKYILGAQYYLYVHSYLNYGQLASRAEIFKASGNSTNPCVLEGYDGYYTYNDVSY  870
             +PYV ++Y+ G  Y LYVHSYL YG  ASR EI K      + C+L G++G Y YN   Y
Sbjct  241   DPYVTKEYLRGKDYNLYVHSYLLYGLQASRVEILKIKNGPFSYCMLRGFNGTYKYNGEEY  300

Query  871   KVTAPPNGSSLKNCRKLARKVVDFRAPCKYPNCTFNGVWSGGGGAGMENVDISSYFYDIA  1050
                A P G+    C                          G   A    + ++SYFYD A
Sbjct  301   AAAASPEGADYGKC--------------------------GEEAAAALGLYVASYFYDRA  334

Query  1051  IDVGIIDEGKASKIVKPRSFLVAAKLACETKFEDVKSTFPNAVEKDYPYLCMDLVYQYTL  1230
               VGI+ EG  S +V P ++  AA+ AC     +  + +P A   D  +LCMDL YQYTL
Sbjct  335   EHVGIVAEGAPSAVVTPAAYAEAAEKACSLSSGEAAAAYPTAF--DVQFLCMDLTYQYTL  392

Query  1231  LVDGLGLHPYKEITLMKKVEYKNYMVEAAWPLGCAIDVISSSSANN  1368
             LV G GL P +E+TL+K+V+Y +Y VE+AWPLG AI+ +SS +++ 
Sbjct  393   LVKGFGLQPTREMTLVKQVKYGDYYVESAWPLGTAIEALSSQTSHQ  438



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 4460266560568