BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c25597_g3_i1 len=1629 path=[10933:0-173 4291:174-258 13563:259-370
4488:371-654 13824:655-655 4773:656-701 11318:702-707 4825:708-861
12254:862-910 5028:911-925 5043:926-969 9988:970-990 14370:991-1048
10119:1049-1104 5222:1105-1212 10198:1213-1252 5370:1253-1414
13000:1415-1628]

Length=1629
                                                                      Score     E

ref|XP_009625429.1|  PREDICTED: apyrase-like                            584   0.0      
ref|XP_009793993.1|  PREDICTED: apyrase-like                            580   0.0      
sp|P80595.2|APY_SOLTU  RecName: Full=Apyrase; AltName: Full=ATP-d...    567   0.0      Solanum tuberosum [potatoes]
ref|XP_006349906.1|  PREDICTED: apyrase-like                            559   0.0      
ref|XP_006349910.1|  PREDICTED: apyrase 2 isoform X2                    559   0.0      
ref|XP_006349909.1|  PREDICTED: apyrase 2 isoform X1                    560   0.0      
ref|XP_004252980.1|  PREDICTED: apyrase                                 557   0.0      
ref|XP_009615583.1|  PREDICTED: apyrase-like                            555   0.0      
ref|NP_001275348.1|  apyrase precursor                                  553   0.0      
gb|ADN83844.1|  putative apyrase AP5                                    550   0.0      
ref|XP_004247967.1|  PREDICTED: apyrase-like                            544   0.0      
emb|CDP04088.1|  unnamed protein product                                525   3e-179   
ref|XP_006360924.1|  PREDICTED: apyrase-like                            525   3e-179   
ref|XP_004232617.1|  PREDICTED: apyrase-like isoform X1                 523   1e-178   
ref|XP_006363161.1|  PREDICTED: apyrase-like isoform X1                 522   4e-178   
emb|CDP04086.1|  unnamed protein product                                496   2e-167   
emb|CDP04087.1|  unnamed protein product                                492   2e-166   
ref|XP_003548772.1|  PREDICTED: nucleoside-triphosphatase-like          485   2e-163   
gb|AAG32960.1|AF207688_1  apyrase GS52                                  485   3e-163   Glycine soja [wild soybean]
ref|XP_011089773.1|  PREDICTED: apyrase 2-like                          483   8e-163   
ref|XP_006443349.1|  hypothetical protein CICLE_v10019963mg             480   3e-161   
gb|KDO45540.1|  hypothetical protein CISIN_1g048388mg                   479   5e-161   
gb|AAF00610.1|AF156781_1  apyrase                                       472   2e-158   Vigna unguiculata subsp. cylindrica [catjang]
ref|XP_004493131.1|  PREDICTED: apyrase 2-like isoform X1               471   4e-158   
ref|XP_007161810.1|  hypothetical protein PHAVU_001G100100g             470   1e-157   
ref|XP_010316510.1|  PREDICTED: apyrase-like isoform X2                 466   3e-157   
gb|AAF00609.1|AF156780_1  nod factor binding lectin-nucleotide ph...    469   3e-157   Lotus japonicus
ref|XP_010669578.1|  PREDICTED: apyrase 2                               468   6e-157   
ref|XP_010246579.1|  PREDICTED: probable apyrase 1                      468   2e-156   
ref|XP_002325398.1|  putative apyrase family protein                    465   7e-156   Populus trichocarpa [western balsam poplar]
gb|ADD09804.1|  ectoapyrase 2                                           466   8e-156   Gossypium hirsutum [American cotton]
ref|XP_003548774.1|  PREDICTED: nucleoside-triphosphatase-like          465   9e-156   
gb|AAO23007.1|  apyrase-like protein                                    465   1e-155   Medicago truncatula
gb|KHG24482.1|  Nucleoside-triphosphatase                               464   3e-155   
dbj|BAK78981.1|  apyrase                                                464   3e-155   
ref|XP_007161808.1|  hypothetical protein PHAVU_001G099900g             463   6e-155   
ref|XP_003624579.1|  Nucleoside-triphosphatase                          466   7e-155   
ref|XP_003624587.1|  Nod factor binding lectin-nucleotide phospho...    462   9e-155   
ref|XP_009770744.1|  PREDICTED: apyrase 2-like                          463   1e-154   
ref|XP_004493134.1|  PREDICTED: nucleoside-triphosphatase-like is...    462   1e-154   
dbj|BAK78982.1|  apyrase                                                462   2e-154   
dbj|BAM84272.1|  apyrase                                                461   2e-154   
ref|XP_009622670.1|  PREDICTED: apyrase 2-like                          462   2e-154   
gb|ABK51386.1|  apyrase-like protein                                    462   3e-154   Nicotiana tabacum [American tobacco]
emb|CDP19074.1|  unnamed protein product                                462   3e-154   
dbj|BAD80837.1|  apyrase                                                461   4e-154   Vigna unguiculata subsp. unguiculata [black-eyed pea]
ref|XP_004253046.1|  PREDICTED: probable apyrase 2                      461   6e-154   
ref|XP_010999472.1|  PREDICTED: apyrase 2-like                          460   8e-154   
gb|AFK40353.1|  unknown                                                 460   1e-153   
ref|XP_003548776.1|  PREDICTED: apyrase 2                               460   1e-153   
dbj|BAB85978.1|  PsAPY2                                                 460   1e-153   Pisum sativum [garden pea]
ref|XP_008792533.1|  PREDICTED: probable apyrase 2 isoform X2           459   3e-153   
dbj|BAD80836.1|  apyrase                                                459   3e-153   Vigna unguiculata subsp. unguiculata [black-eyed pea]
gb|KHN46801.1|  Nucleoside-triphosphatase                               458   4e-153   
gb|AAD31285.1|AF139807_1  nod factor binding lectin-nucleotide ph...    457   1e-152   Vigna unguiculata subsp. cylindrica [catjang]
ref|XP_004493132.1|  PREDICTED: apyrase 2-like isoform X2               457   1e-152   
ref|XP_006604215.1|  PREDICTED: apyrase 2-like                          457   1e-152   
gb|ABK94978.1|  unknown                                                 457   1e-152   Populus trichocarpa [western balsam poplar]
ref|XP_003624582.1|  Apyrase-like protein                               456   2e-152   
ref|XP_007161770.1|  hypothetical protein PHAVU_001G096900g             457   2e-152   
dbj|BAB87182.1|  apyrase                                                456   5e-152   Pisum sativum [garden pea]
gb|AFK48943.1|  unknown                                                 455   7e-152   
ref|XP_002449357.1|  hypothetical protein SORBIDRAFT_05g008570          455   7e-152   Sorghum bicolor [broomcorn]
ref|XP_010524962.1|  PREDICTED: apyrase 2-like                          456   8e-152   
gb|AAG32959.1|  apyrase GS50                                            455   1e-151   Glycine soja [wild soybean]
ref|XP_011034426.1|  PREDICTED: apyrase 2-like                          459   1e-151   
ref|XP_010922866.1|  PREDICTED: probable apyrase 2                      454   3e-151   
ref|XP_002319138.2|  hypothetical protein POPTR_0013s05040g             459   4e-151   Populus trichocarpa [western balsam poplar]
gb|ADD09803.1|  ectoapyrase 1                                           454   4e-151   Gossypium hirsutum [American cotton]
ref|XP_010558706.1|  PREDICTED: apyrase 2                               453   9e-151   
dbj|BAM84271.1|  apyrase                                                452   1e-150   
ref|XP_002525470.1|  adenosine diphosphatase, putative                  452   1e-150   Ricinus communis
ref|XP_010999471.1|  PREDICTED: apyrase 2-like                          451   3e-150   
ref|XP_006598985.1|  PREDICTED: apyrase 2-like                          451   3e-150   
ref|XP_010054281.1|  PREDICTED: apyrase 2                               451   7e-150   
ref|XP_011096861.1|  PREDICTED: LOW QUALITY PROTEIN: apyrase-like       449   1e-149   
gb|EYU37260.1|  hypothetical protein MIMGU_mgv1a006675mg                448   2e-149   
dbj|BAD13527.1|  apyrase                                                449   3e-149   
dbj|BAB87198.1|  ATP diphosphohydrolase                                 449   3e-149   Pisum sativum [garden pea]
gb|AAF00611.1|AF156782_1  nod factor binding lectin-nucleotide ph...    448   4e-149   Medicago sativa [alfalfa]
gb|AAO23002.1|  apyrase-like protein                                    447   5e-149   Medicago truncatula
sp|P52914.1|NTPA_PEA  RecName: Full=Nucleoside-triphosphatase; Sh...    447   8e-149   Pisum sativum [garden pea]
dbj|BAB18890.1|  apyrase S-type                                         447   1e-148   Pisum sativum [garden pea]
ref|XP_010650765.1|  PREDICTED: apyrase 2                               447   1e-148   
dbj|BAM84274.1|  apyrase                                                447   1e-148   
ref|XP_006843727.1|  hypothetical protein AMTR_s00007p00221730          447   2e-148   
gb|AAO23003.1|  apyrase-like protein                                    444   1e-147   Medicago truncatula
dbj|BAC45033.1|  apyrase                                                444   1e-147   Pisum sativum [garden pea]
dbj|BAA89275.1|  apyrase                                                444   2e-147   Pisum sativum [garden pea]
ref|XP_007030232.1|  Apyrase 1                                          447   2e-147   
ref|XP_004244791.1|  PREDICTED: apyrase 2-like                          443   7e-147   
ref|XP_004511658.1|  PREDICTED: apyrase 2-like                          441   3e-146   
ref|XP_002873882.1|  ATAPY2                                             441   3e-146   
ref|XP_010922865.1|  PREDICTED: probable apyrase 2                      440   4e-146   
gb|AAK15160.1|AF288132_1  putative apyrase                              441   5e-146   Medicago truncatula
ref|XP_002448917.1|  hypothetical protein SORBIDRAFT_05g001550          441   5e-146   Sorghum bicolor [broomcorn]
gb|KDP20285.1|  hypothetical protein JCGZ_06871                         440   8e-146   
dbj|BAD13518.1|  apyrase                                                439   1e-145   Pisum sativum [garden pea]
ref|XP_006364259.1|  PREDICTED: probable apyrase 1-like                 440   2e-145   
ref|XP_010492830.1|  PREDICTED: apyrase 2-like                          439   2e-145   
ref|XP_010454056.1|  PREDICTED: apyrase 2-like                          439   4e-145   
ref|XP_010420574.1|  PREDICTED: apyrase 2                               438   4e-145   
gb|AFK42133.1|  unknown                                                 437   7e-145   
ref|XP_002325396.2|  putative apyrase family protein                    437   1e-144   Populus trichocarpa [western balsam poplar]
gb|EYU41067.1|  hypothetical protein MIMGU_mgv1a004609mg                437   1e-144   
ref|XP_003624584.1|  Nucleoside-triphosphatase                          437   2e-144   
gb|AES80802.2|  Nod factor-binding lectin-nucleotide phosphohydro...    437   2e-144   
gb|EYU41066.1|  hypothetical protein MIMGU_mgv1a004609mg                438   2e-144   
gb|ACB38285.1|  apyrase                                                 436   3e-144   Trifolium repens [creeping white clover]
gb|AAM98186.1|  unknown protein                                         436   3e-144   Arabidopsis thaliana [mouse-ear cress]
gb|AFI41206.1|  apyrase 2                                               436   3e-144   
sp|Q9SPM5.1|APY2_ARATH  RecName: Full=Apyrase 2; Short=AtAPY2; Al...    436   4e-144   Arabidopsis thaliana [mouse-ear cress]
dbj|BAB40231.1|  S-type apyrase                                         433   5e-144   Pisum sativum [garden pea]
gb|ACB38286.1|  apyrase                                                 435   5e-144   Trifolium repens [creeping white clover]
ref|XP_009416336.1|  PREDICTED: probable apyrase 1                      435   7e-144   
gb|KFK37843.1|  hypothetical protein AALP_AA3G036300                    435   8e-144   
ref|XP_006342448.1|  PREDICTED: apyrase 2-like                          435   9e-144   
ref|XP_009406850.1|  PREDICTED: probable apyrase 2                      434   1e-143   
ref|XP_004977419.1|  PREDICTED: probable apyrase 3-like                 434   2e-143   
gb|AAF66599.1|AF141671_1  apyrase                                       434   2e-143   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006408225.1|  hypothetical protein EUTSA_v10020649mg             434   2e-143   
ref|XP_006400376.1|  hypothetical protein EUTSA_v10013440mg             433   4e-143   
ref|XP_008670728.1|  PREDICTED: probable apyrase 3                      432   6e-143   
ref|XP_004984507.1|  PREDICTED: probable apyrase 1-like                 433   7e-143   
ref|NP_197329.4|  apyrase 2                                             436   1e-142   Arabidopsis thaliana [mouse-ear cress]
dbj|BAB87197.1|  ATP diphosphohydrolase                                 432   1e-142   Pisum sativum [garden pea]
ref|XP_008240451.1|  PREDICTED: apyrase 2                               432   2e-142   
gb|AAG22044.1|AF305783_1  apyrase 2                                     431   2e-142   Pisum sativum [garden pea]
emb|CDY54053.1|  BnaC09g54250D                                          431   3e-142   
ref|XP_009618558.1|  PREDICTED: apyrase 1-like                          431   3e-142   
ref|XP_009757995.1|  PREDICTED: apyrase 1-like                          431   4e-142   
ref|XP_003518188.1|  PREDICTED: apyrase 1-like                          431   5e-142   
gb|AAO23006.1|  apyrase-like protein                                    430   5e-142   Medicago truncatula
ref|XP_006651340.1|  PREDICTED: probable apyrase 1-like                 431   6e-142   
ref|XP_010463882.1|  PREDICTED: apyrase 1                               430   6e-142   
ref|XP_010921280.1|  PREDICTED: probable apyrase 1                      430   7e-142   
ref|XP_002448918.1|  hypothetical protein SORBIDRAFT_05g001560          429   1e-141   Sorghum bicolor [broomcorn]
ref|XP_010938111.1|  PREDICTED: probable apyrase 1                      430   1e-141   
emb|CDY38503.1|  BnaA10g16550D                                          429   1e-141   
ref|XP_004172762.1|  PREDICTED: apyrase 2-like                          429   1e-141   
dbj|BAM84273.1|  apyrase                                                429   1e-141   
ref|XP_004147528.1|  PREDICTED: apyrase 2-like                          429   1e-141   
ref|XP_007202024.1|  hypothetical protein PRUPE_ppa005076mg             429   2e-141   
ref|XP_010485779.1|  PREDICTED: apyrase 1-like                          429   3e-141   
ref|XP_008793372.1|  PREDICTED: probable apyrase 1                      429   3e-141   
emb|CDY51237.1|  BnaA03g07010D                                          432   6e-141   
ref|XP_009120988.1|  PREDICTED: apyrase 2                               428   6e-141   
gb|KEH25611.1|  GDA1/CD39 nucleoside phosphatase family protein         427   9e-141   
dbj|BAM84275.1|  apyrase                                                428   1e-140   
ref|XP_009366414.1|  PREDICTED: apyrase 2-like                          427   1e-140   
sp|Q8H7L6.1|APY1_ORYSJ  RecName: Full=Probable apyrase 1; Short=O...    427   2e-140   Oryza sativa Japonica Group [Japonica rice]
gb|EPS65035.1|  apyrase-like protein                                    429   2e-140   
ref|XP_009132257.1|  PREDICTED: apyrase 2-like                          431   2e-140   
ref|XP_002442736.1|  hypothetical protein SORBIDRAFT_08g001970          426   2e-140   Sorghum bicolor [broomcorn]
ref|XP_002461227.1|  hypothetical protein SORBIDRAFT_02g043200          426   3e-140   Sorghum bicolor [broomcorn]
ref|XP_006297596.1|  hypothetical protein CARUB_v10013618mg             426   3e-140   
ref|XP_010518233.1|  PREDICTED: apyrase 1-like                          426   4e-140   
gb|EAZ26787.1|  hypothetical protein OsJ_10698                          427   5e-140   Oryza sativa Japonica Group [Japonica rice]
ref|NP_187058.1|  apyrase 1                                             425   5e-140   Arabidopsis thaliana [mouse-ear cress]
gb|AES80807.2|  Nod factor-binding lectin-nucleotide phosphohydro...    425   5e-140   
dbj|BAJ91877.1|  predicted protein                                      424   8e-140   
ref|XP_009399920.1|  PREDICTED: probable apyrase 2 isoform X2           424   1e-139   
gb|EEC67580.1|  hypothetical protein OsI_34933                          424   1e-139   Oryza sativa Indica Group [Indian rice]
ref|XP_009125008.1|  PREDICTED: apyrase 1-like                          424   2e-139   
gb|EMT14858.1|  Nucleoside-triphosphatase                               426   2e-139   
ref|XP_006658972.1|  PREDICTED: probable apyrase 2-like                 421   4e-139   
gb|EEC75177.1|  hypothetical protein OsI_11404                          423   8e-139   Oryza sativa Indica Group [Indian rice]
ref|XP_008365001.1|  PREDICTED: apyrase 2-like                          421   2e-138   
dbj|BAD13517.1|  apyrase                                                421   2e-138   Pisum sativum [garden pea]
ref|XP_006664294.1|  PREDICTED: probable apyrase 3-like                 420   3e-138   
dbj|BAD13519.1|  apyrase                                                419   5e-138   Pisum sativum [garden pea]
ref|XP_008782749.1|  PREDICTED: probable apyrase 2                      420   5e-138   
gb|ACB38287.1|  apyrase                                                 419   7e-138   Lolium perenne [perennial ryegrass]
ref|XP_004291701.1|  PREDICTED: apyrase 2-like                          419   7e-138   
gb|EEE52675.1|  hypothetical protein OsJ_35057                          419   8e-138   Oryza sativa Japonica Group [Japonica rice]
ref|XP_002884427.1|  ATAPY1                                             420   8e-138   
gb|EMT30219.1|  Nucleoside-triphosphatase                               419   1e-137   
ref|XP_009399919.1|  PREDICTED: probable apyrase 2 isoform X1           419   1e-137   
emb|CAN80801.1|  hypothetical protein VITISV_019811                     419   2e-137   Vitis vinifera
ref|XP_004958720.1|  PREDICTED: probable apyrase 2-like                 419   2e-137   
emb|CDY29985.1|  BnaC01g40230D                                          428   2e-137   
gb|EEC68772.1|  hypothetical protein OsI_37304                          417   3e-137   Oryza sativa Indica Group [Indian rice]
ref|NP_001066032.1|  Os12g0123500                                       417   5e-137   Oryza sativa Japonica Group [Japonica rice]
gb|EMS57965.1|  Nucleoside-triphosphatase                               417   6e-137   
ref|XP_008670667.1|  PREDICTED: probable apyrase 2                      417   6e-137   
ref|XP_003576205.1|  PREDICTED: LOW QUALITY PROTEIN: probable apy...    416   7e-137   
ref|XP_003624589.1|  Nucleoside-triphosphatase                          428   7e-137   
ref|XP_008679360.1|  PREDICTED: probable apyrase 3 isoform X1           417   9e-137   
emb|CDY21139.1|  BnaA01g33700D                                          426   9e-137   
ref|NP_001060663.1|  Os07g0682800                                       417   1e-136   Oryza sativa Japonica Group [Japonica rice]
ref|XP_009386978.1|  PREDICTED: probable apyrase 2                      416   1e-136   
ref|XP_009130420.1|  PREDICTED: apyrase 1                               416   1e-136   
ref|XP_002465325.1|  hypothetical protein SORBIDRAFT_01g036510          417   2e-136   Sorghum bicolor [broomcorn]
gb|EEC82701.1|  hypothetical protein OsI_27366                          415   4e-136   Oryza sativa Indica Group [Indian rice]
ref|XP_008441968.1|  PREDICTED: apyrase 2-like                          415   4e-136   
ref|XP_008651023.1|  PREDICTED: putative apyrase family protein i...    414   1e-135   
ref|XP_010088479.1|  hypothetical protein L484_013684                   419   1e-135   
dbj|BAJ85095.1|  predicted protein                                      413   2e-135   
ref|XP_003624590.1|  Nucleoside-triphosphatase                          423   5e-135   
gb|ABA91264.2|  GDA1/CD39 family protein                                412   5e-135   Oryza sativa Japonica Group [Japonica rice]
gb|EAY96392.1|  hypothetical protein OsI_18291                          409   1e-133   Oryza sativa Indica Group [Indian rice]
ref|XP_008655272.1|  PREDICTED: probable apyrase 1 isoform X1           409   2e-133   
dbj|BAD13524.1|  apyrase                                                407   2e-133   
gb|EMS65821.1|  Apyrase                                                 407   3e-133   
ref|NP_001154717.1|  apyrase 2                                          413   4e-133   Arabidopsis thaliana [mouse-ear cress]
ref|XP_003557997.1|  PREDICTED: probable apyrase 1                      408   4e-133   
ref|XP_002442734.1|  hypothetical protein SORBIDRAFT_08g001950          406   6e-133   Sorghum bicolor [broomcorn]
ref|XP_006664293.1|  PREDICTED: probable apyrase 3-like                 405   1e-132   
ref|XP_003562437.1|  PREDICTED: probable apyrase 2                      406   1e-132   
ref|XP_008792532.1|  PREDICTED: probable apyrase 2 isoform X1           404   4e-132   
ref|NP_001067813.1|  Os11g0439600                                       405   5e-132   Oryza sativa Japonica Group [Japonica rice]
gb|EEC67579.1|  hypothetical protein OsI_34932                          406   7e-132   Oryza sativa Indica Group [Indian rice]
ref|XP_002449272.1|  hypothetical protein SORBIDRAFT_05g007000          404   9e-132   Sorghum bicolor [broomcorn]
dbj|BAD13520.1|  apyrase                                                403   1e-131   
gb|EMT24071.1|  Apyrase                                                 401   8e-131   
ref|XP_004978978.1|  PREDICTED: probable apyrase 3-like                 398   2e-129   
dbj|BAK78979.1|  apyrase                                                398   3e-129   
ref|XP_003577116.1|  PREDICTED: probable apyrase 3                      397   4e-129   
ref|XP_004978980.1|  PREDICTED: probable apyrase 3-like isoform X2      396   8e-129   
gb|KEH23514.1|  Nod factor-binding lectin-nucleotide phosphohydro...    395   8e-129   
gb|EEE51563.1|  hypothetical protein OsJ_32782                          399   9e-129   Oryza sativa Japonica Group [Japonica rice]
dbj|BAJ86398.1|  predicted protein                                      395   1e-128   
dbj|BAD13526.1|  apyrase                                                390   2e-127   
ref|XP_003570952.1|  PREDICTED: probable apyrase 3                      391   5e-127   
gb|ABA91303.1|  GDA1/CD39 family protein, expressed                     389   1e-126   Oryza sativa Japonica Group [Japonica rice]
dbj|BAK78980.1|  apyrase                                                390   2e-126   
dbj|BAK78977.1|  apyrase                                                390   2e-126   
ref|XP_004978979.1|  PREDICTED: probable apyrase 3-like isoform X1      387   4e-125   
gb|AFW55891.1|  putative apyrase family protein                         387   6e-125   
ref|XP_006290233.1|  hypothetical protein CARUB_v100030810mg            387   7e-125   
ref|XP_008679361.1|  PREDICTED: probable apyrase 3 isoform X2           384   3e-124   
ref|XP_002979160.1|  hypothetical protein SELMODRAFT_233281             384   4e-124   
gb|EMS59522.1|  Nucleoside-triphosphatase                               392   9e-124   
ref|XP_001753690.1|  predicted protein                                  384   1e-123   
emb|CDX70805.1|  BnaC03g08890D                                          408   1e-123   
ref|NP_001065624.1|  Os11g0126400                                       386   1e-123   Oryza sativa Japonica Group [Japonica rice]
ref|XP_002988529.1|  hypothetical protein SELMODRAFT_183978             383   2e-123   
gb|EMT18791.1|  Nucleoside-triphosphatase                               382   2e-123   
dbj|BAJ96614.1|  predicted protein                                      381   5e-123   
ref|NP_001167731.1|  putative apyrase family protein precursor          381   6e-123   Zea mays [maize]
ref|XP_003605672.1|  Nucleoside-triphosphatase                          380   8e-123   
gb|EMT13113.1|  Nucleoside-triphosphatase                               381   1e-122   
gb|KHN00658.1|  Nucleoside-triphosphatase                               376   4e-122   
tpg|DAA41781.1|  TPA: putative apyrase family protein                   376   3e-121   
dbj|BAJ96497.1|  predicted protein                                      374   2e-120   
dbj|BAJ99958.1|  predicted protein                                      371   2e-120   
dbj|BAD13525.1|  apyrase                                                367   1e-118   
ref|XP_009399921.1|  PREDICTED: probable apyrase 2 isoform X3           367   1e-118   
ref|XP_001785876.1|  predicted protein                                  369   5e-118   
ref|XP_006443348.1|  hypothetical protein CICLE_v10019963mg             364   2e-117   
ref|XP_001760185.1|  predicted protein                                  364   6e-117   
ref|XP_003579004.1|  PREDICTED: probable apyrase 3                      365   9e-117   
ref|XP_006663415.1|  PREDICTED: probable apyrase 3-like                 362   8e-116   
gb|EMS51343.1|  Nucleoside-triphosphatase                               360   9e-116   
emb|CDY42903.1|  BnaC05g47480D                                          359   1e-115   
ref|XP_008655289.1|  PREDICTED: probable apyrase 1 isoform X2           358   4e-114   
gb|AAQ10658.1|  apyrase 2                                               348   7e-113   Solanum tuberosum [potatoes]
gb|AAX94982.1|  S-type apyrase                                          351   2e-112   Oryza sativa Japonica Group [Japonica rice]
ref|NP_001067814.2|  Os11g0440200                                       350   4e-112   Oryza sativa Japonica Group [Japonica rice]
gb|EEE63379.1|  hypothetical protein OsJ_18191                          349   6e-112   Oryza sativa Japonica Group [Japonica rice]
gb|EMS49648.1|  Apyrase                                                 340   8e-108   
gb|AAK15161.1|AF288133_1  putative apyrase                              329   2e-104   Medicago truncatula
dbj|BAD13523.1|  apyrase                                                329   3e-104   
gb|ABA95699.2|  GDA1/CD39 family protein, expressed                     330   3e-104   Oryza sativa Japonica Group [Japonica rice]
gb|EMT26604.1|  Apyrase                                                 329   3e-103   
gb|EMS46853.1|  Apyrase                                                 328   2e-102   
dbj|BAK78978.1|  apyrase                                                316   9e-99    
ref|XP_004493135.1|  PREDICTED: nucleoside-triphosphatase-like is...    309   4e-97    
gb|ABK95896.1|  unknown                                                 308   7e-97    Populus trichocarpa [western balsam poplar]
ref|XP_010257814.1|  PREDICTED: probable apyrase 1                      311   4e-96    
ref|XP_008353527.1|  PREDICTED: LOW QUALITY PROTEIN: apyrase 2-like     305   2e-94    
gb|KDD73355.1|  GDA1/CD39 nucleoside phosphatase                        305   1e-93    
gb|EMT11822.1|  Apyrase                                                 294   1e-90    
ref|XP_005648855.1|  apyrase                                            294   3e-89    
gb|EAZ17260.1|  hypothetical protein OsJ_32781                          288   1e-88    Oryza sativa Japonica Group [Japonica rice]
ref|XP_001417447.1|  predicted protein                                  291   2e-88    Ostreococcus lucimarinus CCE9901
ref|XP_009783155.1|  PREDICTED: apyrase-like                            284   5e-87    
ref|XP_002507899.1|  predicted protein                                  287   1e-86    Micromonas commoda
ref|XP_003057698.1|  predicted protein                                  287   2e-86    
ref|XP_007151817.1|  hypothetical protein PHAVU_004G077500g             282   3e-86    
ref|XP_006387692.1|  hypothetical protein POPTR_0671s00200g             276   5e-85    
ref|XP_003078647.1|  apyrase (ISS)                                      282   2e-84    
emb|CEF97475.1|  Nucleoside phosphatase GDA1/CD39                       283   2e-84    
ref|XP_002946218.1|  hypothetical protein VOLCADRAFT_78871              274   8e-82    
ref|XP_001696196.1|  hypothetical protein CHLREDRAFT_167044             270   2e-80    
ref|XP_009768839.1|  PREDICTED: apyrase-like                            254   6e-77    
dbj|BAK08145.1|  predicted protein                                      249   4e-74    
ref|XP_009788037.1|  PREDICTED: apyrase-like                            247   1e-72    
ref|XP_011016574.1|  PREDICTED: apyrase 2-like                          243   4e-72    
gb|ACU22988.1|  unknown                                                 241   7e-72    
gb|KHN08171.1|  Nucleoside-triphosphatase                               240   2e-71    
gb|EAY79780.1|  hypothetical protein OsI_34936                          237   4e-70    
gb|AFK41199.1|  unknown                                                 236   6e-70    
gb|KHN46804.1|  Nucleoside-triphosphatase                               231   4e-68    
gb|AFK40109.1|  unknown                                                 232   4e-68    
ref|XP_002509368.1|  predicted protein                                  236   3e-67    
ref|XP_001420472.1|  predicted protein                                  234   3e-67    
ref|XP_004992897.1|  ectonucleoside triphosphate diphosphohydrola...    229   4e-64    
ref|XP_007509489.1|  predicted protein                                  223   7e-62    
ref|XP_003061394.1|  predicted protein                                  218   5e-61    
ref|XP_002319666.2|  hypothetical protein POPTR_0013s05060g             212   2e-60    
ref|XP_007513901.1|  predicted protein                                  218   8e-60    
ref|NP_001140212.1|  putative apyrase family protein                    209   9e-60    
gb|EMS56637.1|  Apyrase                                                 203   2e-57    
ref|XP_002766352.1|  Apyrase precursor, putative                        207   7e-56    
gb|EMT10219.1|  Apyrase                                                 194   4e-54    
ref|XP_003661448.1|  hypothetical protein MYCTH_2300848                 202   8e-54    
tpg|DAA45161.1|  TPA: putative apyrase family protein                   192   2e-53    
ref|XP_006632434.1|  PREDICTED: ectonucleoside triphosphate dipho...    196   1e-52    
gb|EPB82069.1|  hypothetical protein HMPREF1544_11197                   197   1e-52    
ref|NP_001065626.1|  Os11g0126800                                       189   1e-52    
ref|XP_005943072.1|  PREDICTED: ectonucleoside triphosphate dipho...    196   1e-52    
ref|XP_005449784.1|  PREDICTED: ectonucleoside triphosphate dipho...    195   3e-52    
ref|XP_006696900.1|  hypothetical protein CTHT_0066010                  197   3e-52    
ref|XP_003440837.1|  PREDICTED: ectonucleoside triphosphate dipho...    195   4e-52    
ref|XP_006638905.1|  PREDICTED: ectonucleoside triphosphate dipho...    194   5e-52    
ref|XP_009648620.1|  guanosine-diphosphatase                            197   5e-52    
ref|XP_005006597.1|  PREDICTED: ectonucleoside triphosphate dipho...    194   5e-52    
ref|XP_003006260.1|  guanosine-diphosphatase                            197   5e-52    
ref|XP_003490259.1|  PREDICTED: ectonucleoside triphosphate dipho...    195   5e-52    
emb|CBY36960.1|  unnamed protein product                                194   6e-52    
emb|CDQ73589.1|  unnamed protein product                                194   6e-52    
ref|XP_002795447.1|  guanosine-diphosphatase                            196   8e-52    
ref|XP_008283692.1|  PREDICTED: ectonucleoside triphosphate dipho...    194   8e-52    
ref|XP_003971644.1|  PREDICTED: ectonucleoside triphosphate dipho...    194   9e-52    
ref|XP_005754307.1|  PREDICTED: ectonucleoside triphosphate dipho...    194   1e-51    
ref|XP_004575351.1|  PREDICTED: ectonucleoside triphosphate dipho...    194   1e-51    
emb|CBY31835.1|  unnamed protein product                                193   1e-51    
emb|CDS07315.1|  hypothetical protein LRAMOSA01264                      194   1e-51    
ref|XP_003401829.1|  PREDICTED: ectonucleoside triphosphate dipho...    194   1e-51    
ref|NP_001166182.1|  ectonucleoside triphosphate diphosphohydrola...    193   2e-51    
ref|XP_003707532.1|  PREDICTED: ectonucleoside triphosphate dipho...    194   2e-51    
ref|XP_005754304.1|  PREDICTED: ectonucleoside triphosphate dipho...    192   3e-51    
ref|XP_001269044.1|  nucleoside diphosphatase Gda1                      194   3e-51    
ref|XP_006136956.1|  PREDICTED: ectonucleoside triphosphate dipho...    192   3e-51    
ref|XP_004635708.1|  PREDICTED: ectonucleoside triphosphate dipho...    192   3e-51    
gb|EXX78735.1|  Gda1p                                                   195   4e-51    
ref|XP_002665866.3|  PREDICTED: ectonucleoside triphosphate dipho...    192   4e-51    
ref|XP_007436467.1|  PREDICTED: ectonucleoside triphosphate dipho...    192   4e-51    
ref|XP_008428723.1|  PREDICTED: ectonucleoside triphosphate dipho...    191   5e-51    
ref|XP_008428722.1|  PREDICTED: ectonucleoside triphosphate dipho...    191   6e-51    
gb|KEY73292.1|  hypothetical protein S7711_01411                        194   6e-51    
gb|KFA77821.1|  hypothetical protein S40288_00465                       193   7e-51    
ref|XP_006806928.1|  PREDICTED: ectonucleoside triphosphate dipho...    191   7e-51    
ref|XP_003695754.1|  PREDICTED: LOW QUALITY PROTEIN: ectonucleosi...    192   9e-51    
ref|XP_004442009.1|  PREDICTED: ectonucleoside triphosphate dipho...    191   1e-50    
gb|KFA62138.1|  hypothetical protein S40285_01638                       193   1e-50    
ref|XP_008396588.1|  PREDICTED: ectonucleoside triphosphate dipho...    190   1e-50    
ref|XP_004527206.1|  PREDICTED: ectonucleoside triphosphate dipho...    191   1e-50    
ref|XP_005725024.1|  PREDICTED: ectonucleoside triphosphate dipho...    190   1e-50    
ref|XP_004527207.1|  PREDICTED: ectonucleoside triphosphate dipho...    191   2e-50    
ref|XP_001239383.1|  hypothetical protein CIMG_09004                    192   2e-50    
ref|XP_003067005.1|  guanosine-diphosphatase, putative                  192   2e-50    
ref|XP_003457515.1|  PREDICTED: ectonucleoside triphosphate dipho...    190   2e-50    
ref|XP_006624429.1|  PREDICTED: ectonucleoside triphosphate dipho...    190   2e-50    
ref|XP_004602087.1|  PREDICTED: ectonucleoside triphosphate dipho...    190   2e-50    
ref|XP_007230769.1|  PREDICTED: ectonucleoside triphosphate dipho...    189   3e-50    
gb|EFZ12417.1|  hypothetical protein SINV_00549                         190   4e-50    
ref|XP_005917735.1|  PREDICTED: ectonucleoside triphosphate dipho...    189   4e-50    
gb|ESA19416.1|  hypothetical protein GLOINDRAFT_135661                  188   5e-50    
ref|XP_007834195.1|  guanosine-diphosphatase                            192   5e-50    
ref|XP_007230767.1|  PREDICTED: ectonucleoside triphosphate dipho...    189   6e-50    
ref|XP_004542169.1|  PREDICTED: ectonucleoside triphosphate dipho...    188   7e-50    
ref|XP_010751317.1|  PREDICTED: ectonucleoside triphosphate dipho...    188   7e-50    
emb|CAQ15104.1|  novel protein similar to vertebrate ectonucleosi...    188   8e-50    
ref|XP_009291247.1|  PREDICTED: ectonucleoside triphosphate dipho...    188   8e-50    
gb|EQL01563.1|  guanosine diphosphatase                                 191   8e-50    
ref|XP_001392563.1|  guanosine-diphosphatase                            191   1e-49    
ref|XP_003758179.1|  PREDICTED: ectonucleoside triphosphate dipho...    190   1e-49    
ref|XP_003018916.1|  hypothetical protein TRV_07048                     191   1e-49    
ref|XP_009847356.1|  hypothetical protein NEUTE1DRAFT_58377             191   1e-49    
ref|XP_004061973.1|  PREDICTED: ectonucleoside triphosphate dipho...    189   1e-49    
ref|XP_961489.1|  guanosine-diphosphatase                               190   1e-49    
ref|XP_003234596.1|  nucleoside diphosphatase Gda1                      190   1e-49    
ref|XP_011059725.1|  PREDICTED: ectonucleoside triphosphate dipho...    187   1e-49    
ref|XP_007904218.1|  PREDICTED: ectonucleoside triphosphate dipho...    187   1e-49    
ref|XP_004083373.1|  PREDICTED: ectonucleoside triphosphate dipho...    187   1e-49    
dbj|GAA88430.1|  nucleoside diphosphatase Gda1                          189   1e-49    
ref|XP_011059715.1|  PREDICTED: ectonucleoside triphosphate dipho...    188   2e-49    
gb|KEZ39697.1|  putative guanosine-diphosphatase                        190   2e-49    
ref|XP_011059707.1|  PREDICTED: ectonucleoside triphosphate dipho...    188   2e-49    
ref|XP_001382088.1|  PREDICTED: ectonucleoside triphosphate dipho...    188   2e-49    
ref|XP_006218346.1|  PREDICTED: ectonucleoside triphosphate dipho...    188   2e-49    
ref|XP_007904221.1|  PREDICTED: ectonucleoside triphosphate dipho...    187   2e-49    
ref|XP_005181833.1|  PREDICTED: ectonucleoside triphosphate dipho...    188   2e-49    
gb|EZF35933.1|  hypothetical protein H101_00565                         189   2e-49    
gb|EGI70159.1|  Ectonucleoside triphosphate diphosphohydrolase 5        188   2e-49    
ref|XP_004894992.1|  PREDICTED: LOW QUALITY PROTEIN: ectonucleosi...    188   2e-49    
gb|EHB09565.1|  Ectonucleoside triphosphate diphosphohydrolase 6        188   2e-49    
ref|XP_005688151.1|  PREDICTED: ectonucleoside triphosphate dipho...    187   2e-49    
gb|KFV80299.1|  Ectonucleoside triphosphate diphosphohydrolase 6        186   2e-49    
ref|XP_010971248.1|  PREDICTED: ectonucleoside triphosphate dipho...    187   2e-49    
ref|XP_005181835.1|  PREDICTED: ectonucleoside triphosphate dipho...    187   3e-49    
gb|EGD97667.1|  nucleoside diphosphatase Gda1                           189   3e-49    
ref|NP_001135181.1|  Ectonucleoside triphosphate diphosphohydrola...    187   3e-49    
ref|XP_007274043.1|  nucleoside diphosphatase gda1                      188   3e-49    
ref|XP_010623914.1|  PREDICTED: ectonucleoside triphosphate dipho...    187   3e-49    
ref|XP_002380297.1|  nucleoside diphosphatase Gda1                      188   4e-49    
ref|XP_010894554.1|  PREDICTED: ectonucleoside triphosphate dipho...    187   4e-49    
ref|XP_005334644.1|  PREDICTED: ectonucleoside triphosphate dipho...    187   4e-49    
ref|XP_006964657.1|  guanosine diphosphatase                            189   4e-49    
emb|CAG01512.1|  unnamed protein product                                185   4e-49    
gb|KEQ73787.1|  nucleoside phosphatase GDA1/CD39                        188   4e-49    
ref|XP_004687182.1|  PREDICTED: ectonucleoside triphosphate dipho...    187   5e-49    
gb|EZA56536.1|  Ectonucleoside triphosphate diphosphohydrolase          187   5e-49    
dbj|GAD95065.1|  nucleoside diphosphatase Gda1                          189   5e-49    
ref|XP_010991045.1|  PREDICTED: LOW QUALITY PROTEIN: ectonucleosi...    186   6e-49    
ref|XP_007594492.1|  GDA1/CD39 family protein                           187   6e-49    
gb|KEQ94361.1|  hypothetical protein AUEXF2481DRAFT_66397               187   6e-49    
ref|XP_010730205.1|  PREDICTED: ectonucleoside triphosphate dipho...    186   6e-49    
gb|ENH78776.1|  nucleoside diphosphatase gda1                           188   8e-49    
ref|XP_002839610.1|  hypothetical protein                               188   8e-49    
gb|ERS96521.1|  hypothetical protein HMPREF1624_06725                   188   8e-49    
ref|XP_003352136.1|  hypothetical protein SMAC_02571                    188   9e-49    
dbj|BAE56862.1|  unnamed protein product                                188   9e-49    
ref|XP_009671437.1|  PREDICTED: ectonucleoside triphosphate dipho...    186   1e-48    
ref|NP_001017862.1|  ectonucleoside triphosphate diphosphohydrola...    185   1e-48    
ref|XP_003175833.1|  guanosine-diphosphatase                            187   1e-48    
ref|XP_002848245.1|  guanosine-diphosphatase                            187   1e-48    
ref|XP_002620315.1|  guanosine-diphosphatase                            187   1e-48    
ref|XP_005813198.1|  PREDICTED: ectonucleoside triphosphate dipho...    185   1e-48    
ref|XP_004014357.1|  PREDICTED: ectonucleoside triphosphate dipho...    185   1e-48    
ref|XP_752583.1|  nucleoside diphosphatase Gda1                         186   1e-48    
gb|EEQ90304.1|  guanosine-diphosphatase                                 187   2e-48    
gb|EEH21153.2|  hypothetical protein PABG_03384                         187   2e-48    
ref|XP_010787411.1|  PREDICTED: ectonucleoside triphosphate dipho...    186   2e-48    
gb|EFQ28041.1|  GDA1/CD39 family protein                                187   2e-48    
ref|XP_008592838.1|  PREDICTED: LOW QUALITY PROTEIN: ectonucleosi...    187   2e-48    
gb|KIH89134.1|  guanosine-diphosphatase                                 186   2e-48    
ref|XP_002604544.1|  hypothetical protein BRAFLDRAFT_79389              182   2e-48    
emb|CEI96568.1|  Putative Guanosine-diphosphatase                       184   2e-48    
ref|XP_010757652.1|  hypothetical protein PADG_01951                    187   2e-48    
emb|CEJ02871.1|  hypothetical protein RMCBS344292_16865                 185   2e-48    
ref|XP_001264544.1|  nucleoside diphosphatase Gda1                      186   3e-48    
emb|CEG64211.1|  hypothetical protein RMATCC62417_01229                 185   3e-48    
ref|XP_003278550.1|  PREDICTED: ectonucleoside triphosphate dipho...    185   3e-48    
emb|CEI91098.1|  hypothetical protein RMCBS344292_05400                 185   3e-48    
sp|E1C1L6.1|ENTP5_CHICK  RecName: Full=Ectonucleoside triphosphat...    184   3e-48    
ref|XP_001961483.1|  GF14909                                            184   3e-48    
ref|XP_007537378.1|  PREDICTED: ectonucleoside triphosphate dipho...    184   3e-48    
gb|KFH46943.1|  guanosine-diphosphatase-like protein                    186   3e-48    
gb|KFP37396.1|  Ectonucleoside triphosphate diphosphohydrolase 6        182   3e-48    
emb|CAD27295.1|  probable guanosine-diphosphatase                       186   4e-48    
gb|KFP34588.1|  Ectonucleoside triphosphate diphosphohydrolase 6        182   4e-48    
ref|XP_011117410.1|  hypothetical protein AOL_s00004g459                186   4e-48    
ref|XP_007799553.1|  putative guanosine-diphosphatase protein           186   4e-48    
gb|KEQ60913.1|  nucleoside phosphatase GDA1/CD39                        185   4e-48    
ref|XP_003010434.1|  hypothetical protein ARB_03135                     186   4e-48    
ref|XP_010732241.1|  PREDICTED: ectonucleoside triphosphate dipho...    185   4e-48    
ref|XP_005512093.1|  PREDICTED: ectonucleoside triphosphate dipho...    184   4e-48    
ref|XP_008281408.1|  PREDICTED: ectonucleoside triphosphate dipho...    185   4e-48    
ref|XP_003361606.1|  PREDICTED: ectonucleoside triphosphate dipho...    184   4e-48    
ref|XP_007244683.1|  PREDICTED: ectonucleoside triphosphate dipho...    183   5e-48    
emb|CAL38442.1|  hypothetical protein                                   184   5e-48    
ref|XP_010329072.1|  PREDICTED: ectonucleoside triphosphate dipho...    184   5e-48    
ref|XP_009216459.1|  guanosine-diphosphatase                            186   5e-48    
gb|AAC39883.1|  CD39L2                                                  184   5e-48    
ref|XP_002195514.1|  PREDICTED: ectonucleoside triphosphate dipho...    183   5e-48    
ref|XP_007573287.1|  PREDICTED: ectonucleoside triphosphate dipho...    183   6e-48    
ref|XP_006041773.1|  PREDICTED: ectonucleoside triphosphate dipho...    184   6e-48    
ref|XP_006163661.1|  PREDICTED: ectonucleoside triphosphate dipho...    184   6e-48    
ref|XP_005533065.1|  PREDICTED: ectonucleoside triphosphate dipho...    183   6e-48    
gb|AAH25980.1|  Ectonucleoside triphosphate diphosphohydrolase 6 ...    184   7e-48    
ref|NP_001238.2|  ectonucleoside triphosphate diphosphohydrolase ...    184   7e-48    
ref|XP_658686.1|  hypothetical protein AN1082.2                         184   7e-48    
ref|XP_514557.3|  PREDICTED: ectonucleoside triphosphate diphosph...    183   7e-48    
ref|XP_010329071.1|  PREDICTED: ectonucleoside triphosphate dipho...    184   7e-48    
ref|NP_593447.1|  guanosine-diphosphatase Gda1                          185   7e-48    
dbj|BAG64743.1|  unnamed protein product                                184   7e-48    
gb|AAP92131.1|  CD39L2 nucleotidase                                     184   7e-48    
ref|XP_010329067.1|  PREDICTED: ectonucleoside triphosphate dipho...    184   7e-48    
ref|XP_007059006.1|  PREDICTED: ectonucleoside triphosphate dipho...    183   7e-48    
ref|XP_004398470.1|  PREDICTED: ectonucleoside triphosphate dipho...    183   7e-48    
ref|XP_002077961.1|  GD22791                                            183   7e-48    
ref|XP_005042839.1|  PREDICTED: ectonucleoside triphosphate dipho...    183   7e-48    
emb|CDH48978.1|  nucleoside diphosphatase gda1                          184   8e-48    
ref|XP_008709708.1|  PREDICTED: ectonucleoside triphosphate dipho...    183   8e-48    
ref|XP_008968602.1|  PREDICTED: ectonucleoside triphosphate dipho...    184   8e-48    
ref|NP_001107561.1|  ectonucleoside triphosphate diphosphohydrola...    183   9e-48    
ref|XP_003316901.1|  PREDICTED: ectonucleoside triphosphate dipho...    184   9e-48    
ref|XP_007892535.1|  PREDICTED: ectonucleoside triphosphate dipho...    182   1e-47    
ref|XP_002128952.1|  PREDICTED: ectonucleoside triphosphate dipho...    183   1e-47    
ref|XP_006672955.1|  guanosine-diphosphatase                            186   1e-47    
ref|XP_385319.1|  hypothetical protein FG05143.1                        185   1e-47    
ref|XP_010207226.1|  PREDICTED: ectonucleoside triphosphate dipho...    182   1e-47    
gb|KFW97215.1|  Ectonucleoside triphosphate diphosphohydrolase 6        181   1e-47    
ref|XP_009257933.1|  hypothetical protein FPSE_06540                    184   1e-47    
ref|NP_722860.1|  NTPase, isoform E                                     183   1e-47    
ref|XP_001948332.1|  PREDICTED: ectonucleoside triphosphate dipho...    182   1e-47    
ref|XP_003427269.1|  PREDICTED: ectonucleoside triphosphate dipho...    184   1e-47    
ref|XP_009094384.1|  PREDICTED: ectonucleoside triphosphate dipho...    182   1e-47    
gb|EYE95469.1|  guanosine-diphosphatase                                 184   1e-47    
ref|XP_004941838.1|  PREDICTED: ectonucleoside triphosphate dipho...    184   1e-47    
ref|XP_006860820.1|  PREDICTED: ectonucleoside triphosphate dipho...    182   1e-47    
ref|XP_005901018.1|  PREDICTED: ectonucleoside triphosphate dipho...    182   1e-47    
ref|XP_001968490.1|  GG24477                                            183   1e-47    
ref|XP_010126038.1|  PREDICTED: ectonucleoside triphosphate dipho...    182   1e-47    
ref|XP_008595959.1|  Guanosine diphosphatase                            185   1e-47    
ref|XP_001541349.1|  guanosine-diphosphatase                            185   1e-47    
gb|EFX05558.1|  nucleoside diphosphatase gda1                           184   1e-47    



>ref|XP_009625429.1| PREDICTED: apyrase-like [Nicotiana tomentosiformis]
Length=453

 Score =   584 bits (1506),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 292/422 (69%), Positives = 352/422 (83%), Gaps = 1/422 (0%)
 Frame = +3

Query  147   LRRVLLSHETGNYAVIFDAGSTGSRVHVFHFDENLDLLPIGDGVEFFLKTTPGLSSYAND  326
             LRR LLSHE+ NYAVIFDAGSTGSRVHVF F+ENL+LLPIG+ +EFF+ T PGLSSYA+D
Sbjct  33    LRRHLLSHESENYAVIFDAGSTGSRVHVFRFNENLELLPIGNDIEFFMATKPGLSSYADD  92

Query  327   PEAAAKSLEPLLLEAEGVVPTELQPDTPLELGATAGLRLLEGDASDKILQAVRDMFKNES  506
             P+AAA SLEPLL+ AEG VP ELQ +TPLELGATAGLR+L+GDA++KILQAVRD+ KNES
Sbjct  93    PKAAANSLEPLLVGAEGAVPKELQSETPLELGATAGLRMLKGDAAEKILQAVRDLVKNES  152

Query  507   NFKSKAEWVSILEGSQEGTYFWVAMNYLLGNLGKGYQNTIATIDLGGGSVQVSYAVSGDT  686
              F +K +WVSIL+G+QEG+Y WVA+NYLLGNLGK Y++T ATIDLGGGSVQ++YA+S + 
Sbjct  153   TFHTKDQWVSILDGTQEGSYMWVAINYLLGNLGKNYKSTTATIDLGGGSVQMAYAISKEH  212

Query  687   FANAPTPDNGEEPYVQEKYILGAQYYLYVHSYLNYGQLASRAEIFKASGNSTNPCVLEGY  866
             FANAP  ++GE PYVQEK++L   YYLYVHSYLNYGQLA RAEIFKAS N +NPC LEGY
Sbjct  213   FANAPQNEDGE-PYVQEKHLLANDYYLYVHSYLNYGQLAGRAEIFKASRNYSNPCALEGY  271

Query  867   DGYYTYNDVSYKVTAPPNGSSLKNCRKLARKVVDFRAPCKYQNCTFNGVWSGGGGAGMEN  1046
             DGYY+Y  V+YKV AP +G+SLK CR L RK +   APC Y+NCTFNGVW+GGGGAG + 
Sbjct  272   DGYYSYGGVNYKVKAPSSGTSLKKCRALTRKALKISAPCNYKNCTFNGVWNGGGGAGSKI  331

Query  1047  VYISSFFYDIATDVGIIDQEKASKIVKPRSFLVAAKLACETKFEDVKSTFPNAVEKDYPY  1226
             V+ SSFFYDI   VGI+D +  S I KP  +L AAK+AC+TK  D+KS FPNA ++D PY
Sbjct  332   VHASSFFYDIGAQVGIVDSKFPSAIAKPIQYLNAAKVACKTKAADIKSVFPNAQDRDIPY  391

Query  1227  LCMDLVYEYTLLVDGLGLHPYKEITLMKKVEYKNYMVEAAWPLGCAIDVISSSSANNLLS  1406
             LC+DLVY+YTLLVDGLGL+PYK+IT+M  V+YKNY+V AAWPLGCAID++SSS     +S
Sbjct  392   LCIDLVYDYTLLVDGLGLNPYKDITVMHDVKYKNYLVGAAWPLGCAIDLVSSSPKKTRIS  451

Query  1407  KY  1412
              +
Sbjct  452   SH  453



>ref|XP_009793993.1| PREDICTED: apyrase-like [Nicotiana sylvestris]
Length=453

 Score =   580 bits (1494),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 290/422 (69%), Positives = 348/422 (82%), Gaps = 1/422 (0%)
 Frame = +3

Query  147   LRRVLLSHETGNYAVIFDAGSTGSRVHVFHFDENLDLLPIGDGVEFFLKTTPGLSSYAND  326
             LRR LLSHE+ +YAVIFDAGSTGSRVHVF F+ENL+LLPIG+ +EFF+ T PGLSSYA+D
Sbjct  33    LRRHLLSHESESYAVIFDAGSTGSRVHVFRFNENLELLPIGNDIEFFMATNPGLSSYADD  92

Query  327   PEAAAKSLEPLLLEAEGVVPTELQPDTPLELGATAGLRLLEGDASDKILQAVRDMFKNES  506
             P+AAA SLEPLL  AEG VP ELQ +T LELGATAGLR+L+GDA++KILQAVRD+ KNES
Sbjct  93    PKAAANSLEPLLEGAEGAVPKELQSETSLELGATAGLRMLKGDAAEKILQAVRDLVKNES  152

Query  507   NFKSKAEWVSILEGSQEGTYFWVAMNYLLGNLGKGYQNTIATIDLGGGSVQVSYAVSGDT  686
              F +K +WVSIL+G+QEG+Y WVA+NYLLGNLGK Y++T ATIDLGGGSVQ++YA+S + 
Sbjct  153   TFHTKDQWVSILDGTQEGSYMWVAINYLLGNLGKNYKSTTATIDLGGGSVQMAYAISKEQ  212

Query  687   FANAPTPDNGEEPYVQEKYILGAQYYLYVHSYLNYGQLASRAEIFKASGNSTNPCVLEGY  866
             FANAP  ++GE PYVQEK+++   Y LYVHSYLNYGQLA RAEIFKAS N +NPC LEGY
Sbjct  213   FANAPQNEDGE-PYVQEKHLMSKDYDLYVHSYLNYGQLAGRAEIFKASRNHSNPCALEGY  271

Query  867   DGYYTYNDVSYKVTAPPNGSSLKNCRKLARKVVDFRAPCKYQNCTFNGVWSGGGGAGMEN  1046
             DGYY+Y  V YKV APP+G+SLK CR L RK +  RAPC Y+NCTFNGVW+GGGGAG + 
Sbjct  272   DGYYSYGGVDYKVKAPPSGTSLKKCRALTRKALKIRAPCNYKNCTFNGVWNGGGGAGTKT  331

Query  1047  VYISSFFYDIATDVGIIDQEKASKIVKPRSFLVAAKLACETKFEDVKSTFPNAVEKDYPY  1226
             V+ SSFFYDI   VGI+D +  S I KP  +L AAK+AC+TK  DVKS FPN  E++ PY
Sbjct  332   VHASSFFYDIGAQVGIVDSKFPSAIAKPIQYLNAAKVACKTKAADVKSVFPNTQERNIPY  391

Query  1227  LCMDLVYEYTLLVDGLGLHPYKEITLMKKVEYKNYMVEAAWPLGCAIDVISSSSANNLLS  1406
             LC+DLVYEYTLLVDG  L+PYK+IT+M  V+YKNY+V AAWPLGCAID++SSSS    +S
Sbjct  392   LCIDLVYEYTLLVDGFRLNPYKDITVMHDVKYKNYLVGAAWPLGCAIDLVSSSSKKTRIS  451

Query  1407  KY  1412
              +
Sbjct  452   SH  453



>sp|P80595.2|APY_SOLTU RecName: Full=Apyrase; AltName: Full=ATP-diphosphatase; AltName: 
Full=ATP-diphosphohydrolase; AltName: Full=Adenosine diphosphatase; 
Short=ADPase [Solanum tuberosum]
 gb|AAB02720.1| ATP-diphosphohydrolase [Solanum tuberosum]
Length=454

 Score =   567 bits (1461),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 270/414 (65%), Positives = 333/414 (80%), Gaps = 1/414 (0%)
 Frame = +3

Query  147   LRRVLLSHETGNYAVIFDAGSTGSRVHVFHFDENLDLLPIGDGVEFFLKTTPGLSSYAND  326
             LRR LLSHE+ +YAVIFDAGSTGSRVHVF FDE L LLPIG+ +E+F+ T PGLSSYA D
Sbjct  34    LRRHLLSHESEHYAVIFDAGSTGSRVHVFRFDEKLGLLPIGNNIEYFMATEPGLSSYAED  93

Query  327   PEAAAKSLEPLLLEAEGVVPTELQPDTPLELGATAGLRLLEGDASDKILQAVRDMFKNES  506
             P+AAA SLEPLL  AEGVVP ELQ +TPLELGATAGLR+L+GDA++KILQAVR++ KN+S
Sbjct  94    PKAAANSLEPLLDGAEGVVPQELQSETPLELGATAGLRMLKGDAAEKILQAVRNLVKNQS  153

Query  507   NFKSKAEWVSILEGSQEGTYFWVAMNYLLGNLGKGYQNTIATIDLGGGSVQVSYAVSGDT  686
              F SK +WV+IL+G+QEG+Y W A+NYLLGNLGK Y++T ATIDLGGGSVQ++YA+S + 
Sbjct  154   TFHSKDQWVTILDGTQEGSYMWAAINYLLGNLGKDYKSTTATIDLGGGSVQMAYAISNEQ  213

Query  687   FANAPTPDNGEEPYVQEKYILGAQYYLYVHSYLNYGQLASRAEIFKASGNSTNPCVLEGY  866
             FA AP  ++GE PYVQ+K+++   Y LYVHSYLNYGQLA RAEIFKAS N +NPC LEG 
Sbjct  214   FAKAPQNEDGE-PYVQQKHLMSKDYNLYVHSYLNYGQLAGRAEIFKASRNESNPCALEGC  272

Query  867   DGYYTYNDVSYKVTAPPNGSSLKNCRKLARKVVDFRAPCKYQNCTFNGVWSGGGGAGMEN  1046
             DGYY+Y  V YKV AP  GSS K CR+L R  +   A C  + CTFNGVW+GGGG G +N
Sbjct  273   DGYYSYGGVDYKVKAPKKGSSWKRCRRLTRHALKINAKCNIEECTFNGVWNGGGGDGQKN  332

Query  1047  VYISSFFYDIATDVGIIDQEKASKIVKPRSFLVAAKLACETKFEDVKSTFPNAVEKDYPY  1226
             ++ SSFFYDI   VGI+D +  S + KP  +L AAK+AC+T   D+KS FP   +++ PY
Sbjct  333   IHASSFFYDIGAQVGIVDTKFPSALAKPIQYLNAAKVACQTNVADIKSIFPKTQDRNIPY  392

Query  1227  LCMDLVYEYTLLVDGLGLHPYKEITLMKKVEYKNYMVEAAWPLGCAIDVISSSS  1388
             LCMDL+YEYTLLVDG GL+P+KEIT++  V+YKNY+V AAWPLGCAID++SS++
Sbjct  393   LCMDLIYEYTLLVDGFGLNPHKEITVIHDVQYKNYLVGAAWPLGCAIDLVSSTT  446



>ref|XP_006349906.1| PREDICTED: apyrase-like [Solanum tuberosum]
Length=464

 Score =   559 bits (1441),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 277/414 (67%), Positives = 338/414 (82%), Gaps = 1/414 (0%)
 Frame = +3

Query  147   LRRVLLSHETGNYAVIFDAGSTGSRVHVFHFDENLDLLPIGDGVEFFLKTTPGLSSYAND  326
             LRR LLSHE+ +YAVIFDAGSTGSRVHVF FDE L LLPIG+ +EFF++T PGLSSY  D
Sbjct  44    LRRHLLSHESEHYAVIFDAGSTGSRVHVFRFDEKLGLLPIGNNIEFFMETNPGLSSYEKD  103

Query  327   PEAAAKSLEPLLLEAEGVVPTELQPDTPLELGATAGLRLLEGDASDKILQAVRDMFKNES  506
             P+AAA SLEPLL +AEGVVP ELQ +TPLELGATAGLR+L+GDA++KILQAVRD+ KN+S
Sbjct  104   PKAAANSLEPLLDKAEGVVPQELQYETPLELGATAGLRMLKGDAAEKILQAVRDLVKNQS  163

Query  507   NFKSKAEWVSILEGSQEGTYFWVAMNYLLGNLGKGYQNTIATIDLGGGSVQVSYAVSGDT  686
              F SK +WV+IL+G+QEG+Y WVAMNYLLGNLGK Y++T ATID+GGGS+Q++YA+S + 
Sbjct  164   TFHSKDQWVTILDGTQEGSYMWVAMNYLLGNLGKDYKSTSATIDIGGGSIQMAYAISNEQ  223

Query  687   FANAPTPDNGEEPYVQEKYILGAQYYLYVHSYLNYGQLASRAEIFKASGNSTNPCVLEGY  866
             FANAP   +GE PYV +K+++   Y LYVHSYLNYGQLA RAEIFKAS N +NPC LEGY
Sbjct  224   FANAPKNVDGE-PYVLQKHLMSKDYNLYVHSYLNYGQLAGRAEIFKASRNESNPCALEGY  282

Query  867   DGYYTYNDVSYKVTAPPNGSSLKNCRKLARKVVDFRAPCKYQNCTFNGVWSGGGGAGMEN  1046
             +GYY+Y  V YKV AP  GSSLK CR L R+ +  +A C  +NCTFNGVW+GGGG G + 
Sbjct  283   EGYYSYGGVDYKVKAPKKGSSLKKCRNLTRQALRIKAQCNNKNCTFNGVWNGGGGDGQKT  342

Query  1047  VYISSFFYDIATDVGIIDQEKASKIVKPRSFLVAAKLACETKFEDVKSTFPNAVEKDYPY  1226
             ++ SSFFY I   VGI+D +  S + KP  +L AAK+AC+TK  DVKS FP   +K+ PY
Sbjct  343   IHASSFFYYIGAQVGIVDTKFPSALAKPIQYLNAAKVACQTKATDVKSVFPQTQDKNIPY  402

Query  1227  LCMDLVYEYTLLVDGLGLHPYKEITLMKKVEYKNYMVEAAWPLGCAIDVISSSS  1388
             LCMDLVY+YTLLVDG GL+PYK+ITLM KV+YKNY ++AAWPLGCAID++SS+S
Sbjct  403   LCMDLVYQYTLLVDGFGLNPYKDITLMNKVQYKNYQIKAAWPLGCAIDLVSSTS  456



>ref|XP_006349910.1| PREDICTED: apyrase 2 isoform X2 [Solanum tuberosum]
Length=454

 Score =   559 bits (1440),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 278/414 (67%), Positives = 338/414 (82%), Gaps = 1/414 (0%)
 Frame = +3

Query  147   LRRVLLSHETGNYAVIFDAGSTGSRVHVFHFDENLDLLPIGDGVEFFLKTTPGLSSYAND  326
             LRR LLSHE+ +YAVIFDAGSTGSRVHVF FDE L LLPIG+ +EFF++T PGLSSYA D
Sbjct  34    LRRHLLSHESEHYAVIFDAGSTGSRVHVFRFDEKLGLLPIGNNIEFFMETNPGLSSYAKD  93

Query  327   PEAAAKSLEPLLLEAEGVVPTELQPDTPLELGATAGLRLLEGDASDKILQAVRDMFKNES  506
             P+AAA SLEPLL  AEGVVP ELQ +TPLELGATAGLR+L+GDA++KILQAVRD+ KN+S
Sbjct  94    PKAAANSLEPLLDGAEGVVPQELQYETPLELGATAGLRMLKGDAAEKILQAVRDLVKNQS  153

Query  507   NFKSKAEWVSILEGSQEGTYFWVAMNYLLGNLGKGYQNTIATIDLGGGSVQVSYAVSGDT  686
              F SK +WV+IL+G+QEG+Y WVAMNYLLGNLGK Y++T ATID+GGGS+Q++YA+S + 
Sbjct  154   TFHSKDQWVTILDGTQEGSYMWVAMNYLLGNLGKDYKSTSATIDIGGGSIQMAYAISNEQ  213

Query  687   FANAPTPDNGEEPYVQEKYILGAQYYLYVHSYLNYGQLASRAEIFKASGNSTNPCVLEGY  866
             FANAP   +GE PYV +K+++   Y LYVHSYLNYGQLA RAEIFKAS N +NPC LEGY
Sbjct  214   FANAPKNVDGE-PYVLQKHLMSKDYNLYVHSYLNYGQLAGRAEIFKASRNESNPCALEGY  272

Query  867   DGYYTYNDVSYKVTAPPNGSSLKNCRKLARKVVDFRAPCKYQNCTFNGVWSGGGGAGMEN  1046
             +GYY+Y  V YKV AP  GSSLK CR L R+ +  +A C  +NCTFNGVW+GGGG G + 
Sbjct  273   EGYYSYGGVDYKVKAPKKGSSLKKCRNLTRQALRIKAQCNNKNCTFNGVWNGGGGDGQKT  332

Query  1047  VYISSFFYDIATDVGIIDQEKASKIVKPRSFLVAAKLACETKFEDVKSTFPNAVEKDYPY  1226
             ++ SSFFY I   VGI+D +  S + KP  +L AAK+AC+TK  DVKS FP   +K+ PY
Sbjct  333   IHASSFFYYIGAQVGIVDTKFPSALAKPIQYLNAAKVACQTKATDVKSVFPQTQDKNIPY  392

Query  1227  LCMDLVYEYTLLVDGLGLHPYKEITLMKKVEYKNYMVEAAWPLGCAIDVISSSS  1388
             LCMDLVY+YTLLVDG GL+PYK+ITLM KV+YKNY ++AAWPLGCAID++SS+S
Sbjct  393   LCMDLVYQYTLLVDGFGLNPYKDITLMNKVQYKNYQIKAAWPLGCAIDLVSSTS  446



>ref|XP_006349909.1| PREDICTED: apyrase 2 isoform X1 [Solanum tuberosum]
Length=477

 Score =   560 bits (1442),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 278/414 (67%), Positives = 338/414 (82%), Gaps = 1/414 (0%)
 Frame = +3

Query  147   LRRVLLSHETGNYAVIFDAGSTGSRVHVFHFDENLDLLPIGDGVEFFLKTTPGLSSYAND  326
             LRR LLSHE+ +YAVIFDAGSTGSRVHVF FDE L LLPIG+ +EFF++T PGLSSYA D
Sbjct  57    LRRHLLSHESEHYAVIFDAGSTGSRVHVFRFDEKLGLLPIGNNIEFFMETNPGLSSYAKD  116

Query  327   PEAAAKSLEPLLLEAEGVVPTELQPDTPLELGATAGLRLLEGDASDKILQAVRDMFKNES  506
             P+AAA SLEPLL  AEGVVP ELQ +TPLELGATAGLR+L+GDA++KILQAVRD+ KN+S
Sbjct  117   PKAAANSLEPLLDGAEGVVPQELQYETPLELGATAGLRMLKGDAAEKILQAVRDLVKNQS  176

Query  507   NFKSKAEWVSILEGSQEGTYFWVAMNYLLGNLGKGYQNTIATIDLGGGSVQVSYAVSGDT  686
              F SK +WV+IL+G+QEG+Y WVAMNYLLGNLGK Y++T ATID+GGGS+Q++YA+S + 
Sbjct  177   TFHSKDQWVTILDGTQEGSYMWVAMNYLLGNLGKDYKSTSATIDIGGGSIQMAYAISNEQ  236

Query  687   FANAPTPDNGEEPYVQEKYILGAQYYLYVHSYLNYGQLASRAEIFKASGNSTNPCVLEGY  866
             FANAP   +GE PYV +K+++   Y LYVHSYLNYGQLA RAEIFKAS N +NPC LEGY
Sbjct  237   FANAPKNVDGE-PYVLQKHLMSKDYNLYVHSYLNYGQLAGRAEIFKASRNESNPCALEGY  295

Query  867   DGYYTYNDVSYKVTAPPNGSSLKNCRKLARKVVDFRAPCKYQNCTFNGVWSGGGGAGMEN  1046
             +GYY+Y  V YKV AP  GSSLK CR L R+ +  +A C  +NCTFNGVW+GGGG G + 
Sbjct  296   EGYYSYGGVDYKVKAPKKGSSLKKCRNLTRQALRIKAQCNNKNCTFNGVWNGGGGDGQKT  355

Query  1047  VYISSFFYDIATDVGIIDQEKASKIVKPRSFLVAAKLACETKFEDVKSTFPNAVEKDYPY  1226
             ++ SSFFY I   VGI+D +  S + KP  +L AAK+AC+TK  DVKS FP   +K+ PY
Sbjct  356   IHASSFFYYIGAQVGIVDTKFPSALAKPIQYLNAAKVACQTKATDVKSVFPQTQDKNIPY  415

Query  1227  LCMDLVYEYTLLVDGLGLHPYKEITLMKKVEYKNYMVEAAWPLGCAIDVISSSS  1388
             LCMDLVY+YTLLVDG GL+PYK+ITLM KV+YKNY ++AAWPLGCAID++SS+S
Sbjct  416   LCMDLVYQYTLLVDGFGLNPYKDITLMNKVQYKNYQIKAAWPLGCAIDLVSSTS  469



>ref|XP_004252980.1| PREDICTED: apyrase [Solanum lycopersicum]
Length=454

 Score =   557 bits (1435),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 273/414 (66%), Positives = 337/414 (81%), Gaps = 1/414 (0%)
 Frame = +3

Query  147   LRRVLLSHETGNYAVIFDAGSTGSRVHVFHFDENLDLLPIGDGVEFFLKTTPGLSSYAND  326
             LRR LLSHE+ +YAVIFDAGSTGSRVHVF FD+ L LLPIG+ +E+F+ T PGLSSYA D
Sbjct  34    LRRHLLSHESEHYAVIFDAGSTGSRVHVFRFDQKLGLLPIGNNIEYFMATEPGLSSYAED  93

Query  327   PEAAAKSLEPLLLEAEGVVPTELQPDTPLELGATAGLRLLEGDASDKILQAVRDMFKNES  506
             P+ AA SLEPLL  A+GVVP ELQ  TPLELGATAGLR+L+GDA++KILQAVR++ KN+S
Sbjct  94    PKTAANSLEPLLDGAKGVVPQELQSQTPLELGATAGLRMLKGDAAEKILQAVRNLVKNQS  153

Query  507   NFKSKAEWVSILEGSQEGTYFWVAMNYLLGNLGKGYQNTIATIDLGGGSVQVSYAVSGDT  686
              F SK +WV+IL+G+QEG+Y W A+NYLLGNLGK Y++T ATIDLGGGSVQ++YA+S + 
Sbjct  154   TFHSKDQWVTILDGTQEGSYMWAAINYLLGNLGKDYKSTTATIDLGGGSVQMAYAISNEQ  213

Query  687   FANAPTPDNGEEPYVQEKYILGAQYYLYVHSYLNYGQLASRAEIFKASGNSTNPCVLEGY  866
             FANAP  ++GE PYVQ+K+++   Y LYVHSYLNYGQLA RAEIFKAS N +NPC LEGY
Sbjct  214   FANAPKNEDGE-PYVQQKHLMSKDYNLYVHSYLNYGQLAGRAEIFKASRNESNPCALEGY  272

Query  867   DGYYTYNDVSYKVTAPPNGSSLKNCRKLARKVVDFRAPCKYQNCTFNGVWSGGGGAGMEN  1046
             DGYY+Y  V YKV AP  GSSLK CR L R+ +  +A CK +NCTFNGVW+GGGG G +N
Sbjct  273   DGYYSYGGVDYKVKAPKKGSSLKKCRNLTRQALRIKAQCKNKNCTFNGVWNGGGGDGQKN  332

Query  1047  VYISSFFYDIATDVGIIDQEKASKIVKPRSFLVAAKLACETKFEDVKSTFPNAVEKDYPY  1226
             ++ SSFFYDI   VGI+D +  S + KP  +L AAK+AC+T   D+KS FP   +++ PY
Sbjct  333   IHASSFFYDIGAQVGIVDTKFPSALAKPIQYLNAAKVACQTNVADIKSVFPKTQDRNIPY  392

Query  1227  LCMDLVYEYTLLVDGLGLHPYKEITLMKKVEYKNYMVEAAWPLGCAIDVISSSS  1388
             LCMDL+YEYTLLVDG GL+P+KEIT++  V+YKNY+V AAWPLGCAID++SS+S
Sbjct  393   LCMDLIYEYTLLVDGFGLNPHKEITVIHDVQYKNYLVGAAWPLGCAIDLVSSTS  446



>ref|XP_009615583.1| PREDICTED: apyrase-like [Nicotiana tomentosiformis]
Length=447

 Score =   555 bits (1429),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 281/421 (67%), Positives = 347/421 (82%), Gaps = 2/421 (0%)
 Frame = +3

Query  129   CFSRPHLRRVLLSHETGNYAVIFDAGSTGSRVHVFHFDENLDLLPIGDGVEFFLKTTPGL  308
             C +   +RR+L SHE+ +YAVIFDAGSTGSRVHVF FD NLDLLPIG+ +E+FL   PGL
Sbjct  28    CSASSKVRRLLFSHESEHYAVIFDAGSTGSRVHVFRFDHNLDLLPIGNDIEYFLAINPGL  87

Query  309   SSYANDPEAAAKSLEPLLLEAEGVVPTELQPDTPLELGATAGLRLLEGDASDKILQAVRD  488
             SSYA+DP AAA SL+PLL +AEGVVP +LQP+TPL+LGATAGLRLL+GDA+ KILQAVRD
Sbjct  88    SSYADDPNAAALSLKPLLDKAEGVVPKDLQPETPLKLGATAGLRLLKGDAAAKILQAVRD  147

Query  489   MFKNESNFKSKAEWVSILEGSQEGTYFWVAMNYLLGNLGKGYQNTIATIDLGGGSVQVSY  668
             +FKNE++   KAEWVS+L+G+QEG+YFWVA+NYLLGNLGK Y+ TIATIDLGGGSVQ++Y
Sbjct  148   LFKNETSLSYKAEWVSVLDGTQEGSYFWVALNYLLGNLGKKYERTIATIDLGGGSVQMTY  207

Query  669   AVSGDTFANAPTPDNGEEPYVQEKYILGAQYYLYVHSYLNYGQLASRAEIFKASGN-STN  845
             A+S ++ + AP   NG EPYV  K +LGA Y+LYVHSYLNYGQLA+R EIFKASGN S++
Sbjct  208   AISKESASKAPKVANG-EPYVLNKSLLGANYHLYVHSYLNYGQLAARKEIFKASGNSSSS  266

Query  846   PCVLEGYDGYYTYNDVSYKVTAPPNGSSLKNCRKLARKVVDFRAPCKYQNCTFNGVWSGG  1025
             PC+L GY+GYYTYN V+YK ++P NGSSLK C+ L +K +  +APC ++ CTF GVW+GG
Sbjct  267   PCILGGYNGYYTYNGVAYKASSPRNGSSLKKCKTLTKKALKIKAPCNHKKCTFGGVWNGG  326

Query  1026  GGAGMENVYISSFFYDIATDVGIIDQEKASKIVKPRSFLVAAKLACETKFEDVKSTFPNA  1205
             GG G +N+Y SSFFYD A  VGIID +K S   KP  +L AAKLAC+T  +D+KS FPN 
Sbjct  327   GGDGYKNLYASSFFYDYAAMVGIIDPKKPSGRAKPIQYLNAAKLACKTSVKDIKSVFPNI  386

Query  1206  VEKDYPYLCMDLVYEYTLLVDGLGLHPYKEITLMKKVEYKNYMVEAAWPLGCAIDVISSS  1385
              E++ PY+CMDLVYEY LLV+G GLHP +EIT++  V+Y+NY+V AAWPLGCAIDV+SSS
Sbjct  387   GERNVPYICMDLVYEYALLVNGFGLHPKQEITVVHDVKYRNYIVGAAWPLGCAIDVVSSS  446

Query  1386  S  1388
             S
Sbjct  447   S  447



>ref|NP_001275348.1| apyrase precursor [Solanum tuberosum]
 gb|ABV26545.1| apyrase 3 [Solanum tuberosum]
Length=454

 Score =   553 bits (1426),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 272/414 (66%), Positives = 335/414 (81%), Gaps = 1/414 (0%)
 Frame = +3

Query  147   LRRVLLSHETGNYAVIFDAGSTGSRVHVFHFDENLDLLPIGDGVEFFLKTTPGLSSYAND  326
             LRR LLSHE+ +YAVIFDAGSTGSRVHVF FDE L LLPIG+ +E+F+ T PGLSSYA D
Sbjct  34    LRRHLLSHESEHYAVIFDAGSTGSRVHVFRFDEKLGLLPIGNNIEYFMATEPGLSSYAED  93

Query  327   PEAAAKSLEPLLLEAEGVVPTELQPDTPLELGATAGLRLLEGDASDKILQAVRDMFKNES  506
             P+AAA SLEPLL  AEGVVP ELQ +TPLELGATAGLR+L+GDA++KILQAVR++ KN+S
Sbjct  94    PKAAANSLEPLLDGAEGVVPQELQSETPLELGATAGLRMLKGDAAEKILQAVRNLVKNQS  153

Query  507   NFKSKAEWVSILEGSQEGTYFWVAMNYLLGNLGKGYQNTIATIDLGGGSVQVSYAVSGDT  686
              F SK +WV+IL+G+QEG+Y W A+NYLLGNLGK Y++T ATIDLGGGSVQ++YA+S + 
Sbjct  154   TFHSKDQWVTILDGTQEGSYMWAAINYLLGNLGKDYKSTTATIDLGGGSVQMAYAISNEQ  213

Query  687   FANAPTPDNGEEPYVQEKYILGAQYYLYVHSYLNYGQLASRAEIFKASGNSTNPCVLEGY  866
             FA AP  ++GE PYVQ+K+++   Y LYVHSYLNYGQLA RAEIFKAS N +NPC LEGY
Sbjct  214   FAKAPNNEDGE-PYVQQKHLMSKDYNLYVHSYLNYGQLAGRAEIFKASRNESNPCALEGY  272

Query  867   DGYYTYNDVSYKVTAPPNGSSLKNCRKLARKVVDFRAPCKYQNCTFNGVWSGGGGAGMEN  1046
             DGYY+Y  V YKV AP  GSS K CR+L R  +   A CK + CTFNGVW+GGGG G +N
Sbjct  273   DGYYSYGGVDYKVKAPKKGSSWKRCRRLTRHALKINAKCKIEECTFNGVWNGGGGDGQKN  332

Query  1047  VYISSFFYDIATDVGIIDQEKASKIVKPRSFLVAAKLACETKFEDVKSTFPNAVEKDYPY  1226
             ++ SSFFYDI   VGI+D +  S + KP  +L AAK+AC+T   D+KS FP   +++ PY
Sbjct  333   IHASSFFYDIGAQVGIVDTKFPSALAKPIQYLNAAKVACQTNVADIKSIFPKTQDRNIPY  392

Query  1227  LCMDLVYEYTLLVDGLGLHPYKEITLMKKVEYKNYMVEAAWPLGCAIDVISSSS  1388
             LCMDL+YEYTLLVDG GL+P+KEIT++  V+YKNY+V AAWPLGCAID++SS++
Sbjct  393   LCMDLIYEYTLLVDGFGLNPHKEITVIHDVQYKNYLVGAAWPLGCAIDLVSSTT  446



>gb|ADN83844.1| putative apyrase AP5 [Solanum tuberosum]
Length=454

 Score =   550 bits (1416),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 271/414 (65%), Positives = 333/414 (80%), Gaps = 1/414 (0%)
 Frame = +3

Query  147   LRRVLLSHETGNYAVIFDAGSTGSRVHVFHFDENLDLLPIGDGVEFFLKTTPGLSSYAND  326
             LRR LLSHE+ +YAVIFDAGSTGSRVHVF FDE L LLPIG+ +E+F+ T PGLSSYA D
Sbjct  34    LRRHLLSHESEHYAVIFDAGSTGSRVHVFRFDEKLGLLPIGNNIEYFMATEPGLSSYAED  93

Query  327   PEAAAKSLEPLLLEAEGVVPTELQPDTPLELGATAGLRLLEGDASDKILQAVRDMFKNES  506
             P+AAA SLEPLL  AEGVVP ELQ +TPLELGATAGLR+L+GDA++KILQAVR++ KN+S
Sbjct  94    PKAAANSLEPLLDGAEGVVPQELQSETPLELGATAGLRMLKGDAAEKILQAVRNLVKNQS  153

Query  507   NFKSKAEWVSILEGSQEGTYFWVAMNYLLGNLGKGYQNTIATIDLGGGSVQVSYAVSGDT  686
              F SK +WV+IL+G+QEG+Y W A+NYLLGNLGK Y++T ATIDLGGGSVQ++YA+S + 
Sbjct  154   TFHSKDQWVTILDGTQEGSYMWAAINYLLGNLGKDYKSTTATIDLGGGSVQMAYAISNEQ  213

Query  687   FANAPTPDNGEEPYVQEKYILGAQYYLYVHSYLNYGQLASRAEIFKASGNSTNPCVLEGY  866
             FA AP  ++GE PYVQ+K+++   Y LYVHSYLNYGQL  RAEIFKAS N +NPC LEGY
Sbjct  214   FAQAPKNEDGE-PYVQQKHLMSKDYNLYVHSYLNYGQLVGRAEIFKASRNESNPCALEGY  272

Query  867   DGYYTYNDVSYKVTAPPNGSSLKNCRKLARKVVDFRAPCKYQNCTFNGVWSGGGGAGMEN  1046
             DGYY+Y  V YKV AP  GSS K CR L R  +   A CK + CTFNGVW+GGGG G +N
Sbjct  273   DGYYSYGGVDYKVKAPKKGSSWKRCRGLTRHALKINAKCKIEECTFNGVWNGGGGDGQKN  332

Query  1047  VYISSFFYDIATDVGIIDQEKASKIVKPRSFLVAAKLACETKFEDVKSTFPNAVEKDYPY  1226
             ++ SSFFYDI   VGI+D +  S + KP  +L AAK+AC+T   D+KS FP   +++ PY
Sbjct  333   IHASSFFYDIGAQVGIVDTKFPSALAKPIQYLNAAKVACQTNVADIKSIFPKTQDRNIPY  392

Query  1227  LCMDLVYEYTLLVDGLGLHPYKEITLMKKVEYKNYMVEAAWPLGCAIDVISSSS  1388
             LCMDL+YEYTLLVDG GL+P+KEIT++  V+YKNY+V AAWPLGCAID++SS++
Sbjct  393   LCMDLIYEYTLLVDGFGLNPHKEITVIHDVQYKNYLVGAAWPLGCAIDLVSSTT  446



>ref|XP_004247967.1| PREDICTED: apyrase-like [Solanum lycopersicum]
Length=451

 Score =   544 bits (1402),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 262/423 (62%), Positives = 331/423 (78%), Gaps = 3/423 (1%)
 Frame = +3

Query  144   HLRRVLLSHETGNY-AVIFDAGSTGSRVHVFHFDENLDLLPIGD-GVEFFLKTTPGLSSY  317
             H+ R LLS++T +Y AVIFDAGS+GSRVHVF F +NLDLLPIG+ G+E F K  PGLSSY
Sbjct  28    HIGRNLLSNQTDSYYAVIFDAGSSGSRVHVFRFSQNLDLLPIGEYGLEVFDKVKPGLSSY  87

Query  318   ANDPEAAAKSLEPLLLEAEGVVPTELQPDTPLELGATAGLRLLEGDASDKILQAVRDMFK  497
              NDP+AAAKSLEPLLL+AE VVP  L PDTP+ELGATAGLR+L+G+A+++I+Q+VR+M K
Sbjct  88    ENDPKAAAKSLEPLLLKAESVVPINLHPDTPVELGATAGLRMLKGNAAERIMQSVRNMLK  147

Query  498   NESNFKSKAEWVSILEGSQEGTYFWVAMNYLLGNLGKGYQNTIATIDLGGGSVQVSYAVS  677
             NES F+ K E VSIL G+QEG+Y WV +NYLL  LGK YQNT ATIDLGGGSVQ+++A+S
Sbjct  148   NESIFEYKDERVSILSGTQEGSYLWVGLNYLLKTLGKSYQNTAATIDLGGGSVQMAFALS  207

Query  678   GDTFANAPTPDNGEEPYVQEKYILGAQYYLYVHSYLNYGQLASRAEIFKASGNSTNPCVL  857
              +    AP   +GE  YV  K ++GA YYLYVHSYLNYG LASRAEI K S NST+PC+L
Sbjct  208   KENSEKAPKNLDGEN-YVLHKSLMGANYYLYVHSYLNYGLLASRAEILKVSRNSTSPCIL  266

Query  858   EGYDGYYTYNDVSYKVTAPPNGSSLKNCRKLARKVVDFRAPCKYQNCTFNGVWSGGGGAG  1037
             +G DGYYT+  V+YK +  PNGSSL+ C+ +  K +   APCKY  CTFNGVW+GGG   
Sbjct  267   KGTDGYYTFGGVAYKASPLPNGSSLRKCKAIVWKTLKLNAPCKYHTCTFNGVWNGGGLDA  326

Query  1038  MENVYISSFFYDIATDVGIIDQEKASKIVKPRSFLVAAKLACETKFEDVKSTFPNAVEKD  1217
             ++N+YISSFF+D+A++V I+D + +S   KP  +L AAK+AC+ K E+VK  FPN   KD
Sbjct  327   IKNIYISSFFFDMASEVNIVDPKASSGKAKPIQYLNAAKIACKLKAEEVKYVFPNVDSKD  386

Query  1218  YPYLCMDLVYEYTLLVDGLGLHPYKEITLMKKVEYKNYMVEAAWPLGCAIDVISSSSANN  1397
              PYLCMD++Y+++LLVDG GL+P++EITL+  + YKN  VEAAWPLGCAIDV+SSSS   
Sbjct  387   LPYLCMDMIYQFSLLVDGFGLNPHREITLVHDINYKNNRVEAAWPLGCAIDVVSSSSLRT  446

Query  1398  LLS  1406
              +S
Sbjct  447   HIS  449



>emb|CDP04088.1| unnamed protein product [Coffea canephora]
Length=464

 Score =   525 bits (1353),  Expect = 3e-179, Method: Compositional matrix adjust.
 Identities = 254/412 (62%), Positives = 324/412 (79%), Gaps = 0/412 (0%)
 Frame = +3

Query  147   LRRVLLSHETGNYAVIFDAGSTGSRVHVFHFDENLDLLPIGDGVEFFLKTTPGLSSYAND  326
             L  +L S E+  YAVIFDAGSTGSRVHVF FD N+DLL IG   EF+ KT PGLSSYA+D
Sbjct  44    LDGILRSEESEKYAVIFDAGSTGSRVHVFRFDPNMDLLRIGQDFEFYDKTNPGLSSYADD  103

Query  327   PEAAAKSLEPLLLEAEGVVPTELQPDTPLELGATAGLRLLEGDASDKILQAVRDMFKNES  506
             P+AAA SL+PLLLE + VVP EL+P TP++LGATAGLR+L+  ASD+ILQAVRD+FKNES
Sbjct  104   PQAAALSLKPLLLEGQAVVPEELRPQTPVKLGATAGLRMLKNGASDEILQAVRDLFKNES  163

Query  507   NFKSKAEWVSILEGSQEGTYFWVAMNYLLGNLGKGYQNTIATIDLGGGSVQVSYAVSGDT  686
             + + KAEWVSILEGS+E +Y W+A+NYL G +GK Y +T+AT+DLGGGSV+++Y +S +T
Sbjct  164   SLEYKAEWVSILEGSEEASYMWIAINYLSGRIGKPYPDTVATVDLGGGSVEMTYGISEET  223

Query  687   FANAPTPDNGEEPYVQEKYILGAQYYLYVHSYLNYGQLASRAEIFKASGNSTNPCVLEGY  866
              ANAP   N  E YV EKYILG +Y+LY +SYL YGQLA+RAEIFK S NSTNPC+L+GY
Sbjct  224   AANAPKCSNDGEAYVHEKYILGTKYHLYAYSYLYYGQLAARAEIFKVSRNSTNPCILDGY  283

Query  867   DGYYTYNDVSYKVTAPPNGSSLKNCRKLARKVVDFRAPCKYQNCTFNGVWSGGGGAGMEN  1046
              G+YTY   +Y+ ++PP+GSS K CR++  K +   APC+++ CTFNG W GGGG G EN
Sbjct  284   HGFYTYGGETYEASSPPSGSSFKKCRQVTLKALKLDAPCEHEKCTFNGTWGGGGGEGQEN  343

Query  1047  VYISSFFYDIATDVGIIDQEKASKIVKPRSFLVAAKLACETKFEDVKSTFPNAVEKDYPY  1226
             VY++SFF+DIA + GII     S   +P  F  AA+LAC TK+EDVK+ FPN  ++D PY
Sbjct  344   VYLASFFFDIAIEAGIISPNVPSASARPIDFKRAARLACVTKYEDVKTVFPNVYDEDLPY  403

Query  1227  LCMDLVYEYTLLVDGLGLHPYKEITLMKKVEYKNYMVEAAWPLGCAIDVISS  1382
             LCMDLVYEY+LLVDG GL P+K++TL++++ Y+N ++ AAWPLG AID +SS
Sbjct  404   LCMDLVYEYSLLVDGFGLDPFKKVTLVRQINYQNSLIGAAWPLGSAIDAVSS  455



>ref|XP_006360924.1| PREDICTED: apyrase-like [Solanum tuberosum]
Length=454

 Score =   525 bits (1352),  Expect = 3e-179, Method: Compositional matrix adjust.
 Identities = 254/413 (62%), Positives = 327/413 (79%), Gaps = 3/413 (1%)
 Frame = +3

Query  144   HLRRVLLSHETGNY-AVIFDAGSTGSRVHVFHFDENLDLLPIGD-GVEFFLKTTPGLSSY  317
             H+RR LLS++T +Y AVIFDAGS+GSRVHVF F +NLDLLPIG+ G+E F K  PGLSSY
Sbjct  31    HIRRNLLSNQTDSYYAVIFDAGSSGSRVHVFRFSQNLDLLPIGEYGLEVFDKVKPGLSSY  90

Query  318   ANDPEAAAKSLEPLLLEAEGVVPTELQPDTPLELGATAGLRLLEGDASDKILQAVRDMFK  497
              NDP+AAAKSLEPLL++AE VVP  L  DTP+ELGATAGLR+L+G+ +++I+Q+VR+M K
Sbjct  91    ENDPKAAAKSLEPLLIKAESVVPINLHTDTPVELGATAGLRMLKGNTAERIMQSVRNMLK  150

Query  498   NESNFKSKAEWVSILEGSQEGTYFWVAMNYLLGNLGKGYQNTIATIDLGGGSVQVSYAVS  677
             NES F+ K  WVSIL G+QEG+YFWV +NYLL  LGK YQNT+ATIDLGGGSVQ+++A+S
Sbjct  151   NESIFEYKDGWVSILSGAQEGSYFWVGLNYLLRTLGKSYQNTVATIDLGGGSVQMAFALS  210

Query  678   GDTFANAPTPDNGEEPYVQEKYILGAQYYLYVHSYLNYGQLASRAEIFKASGNSTNPCVL  857
              +    AP   +GE+ YV +K ++GA YYLYVHSYLNYG LASRAEI K S NST+PC+L
Sbjct  211   KENSEKAPINLDGEK-YVLQKSLMGANYYLYVHSYLNYGLLASRAEILKVSRNSTSPCIL  269

Query  858   EGYDGYYTYNDVSYKVTAPPNGSSLKNCRKLARKVVDFRAPCKYQNCTFNGVWSGGGGAG  1037
             +G  GYYTY  V+YK +  PNGSS++ C+ +  + +   APCKY  CTFNGVW+GGG   
Sbjct  270   KGTYGYYTYGGVAYKASPSPNGSSMRKCKAIVWRTLKLNAPCKYHTCTFNGVWNGGGLDA  329

Query  1038  MENVYISSFFYDIATDVGIIDQEKASKIVKPRSFLVAAKLACETKFEDVKSTFPNAVEKD  1217
             ++N+YISSFF+D+A++V I+D + +S   KP  +L AAK+AC+ K E+VK  FPN   KD
Sbjct  330   IKNIYISSFFFDMASEVNIVDPKASSGKAKPIQYLNAAKIACKLKAEEVKYVFPNVDSKD  389

Query  1218  YPYLCMDLVYEYTLLVDGLGLHPYKEITLMKKVEYKNYMVEAAWPLGCAIDVI  1376
              PYLCMD++Y+++LLVDG GL+P++EITL+  + YKN  VEAAWPLGCAIDV+
Sbjct  390   LPYLCMDMIYQFSLLVDGFGLNPHREITLVHDINYKNNRVEAAWPLGCAIDVV  442



>ref|XP_004232617.1| PREDICTED: apyrase-like isoform X1 [Solanum lycopersicum]
Length=449

 Score =   523 bits (1347),  Expect = 1e-178, Method: Compositional matrix adjust.
 Identities = 248/408 (61%), Positives = 327/408 (80%), Gaps = 1/408 (0%)
 Frame = +3

Query  183   YAVIFDAGSTGSRVHVFHFDENLDLLPIGDGVEFFLKTTPGLSSYANDPEAAAKSLEPLL  362
             YAVIFDAGSTGSRVHVF F+ NLDL+ IG+ +E FL   PGLSSYA+DP+AAA SL+PLL
Sbjct  36    YAVIFDAGSTGSRVHVFRFNSNLDLINIGNDLELFLAIKPGLSSYADDPKAAANSLKPLL  95

Query  363   LEAEGVVPTELQPDTPLELGATAGLRLLEGDASDKILQAVRDMFKNESNFKSKAEWVSIL  542
              +AE V+P  LQ  TP+++GATAGLRLL+GD+S+KILQAVRDM KNE+    K EWVS+L
Sbjct  96    EKAEAVIPKNLQSQTPIKVGATAGLRLLKGDSSEKILQAVRDMLKNETTLSYKDEWVSVL  155

Query  543   EGSQEGTYFWVAMNYLLGNLGKGYQNTIATIDLGGGSVQVSYAVSGDTFANAPTPDNGEE  722
             EG+ EG+YFWVA+NYL GNLGK Y +TIATIDLGGGSVQ++YAVS  +  NAP   NG+ 
Sbjct  156   EGTLEGSYFWVALNYLYGNLGKNYPDTIATIDLGGGSVQIAYAVSKQSAINAPKLPNGDA  215

Query  723   PYVQEKYILGAQYYLYVHSYLNYGQLASRAEIFKASGNSTNPCVLEGYDGYYTYNDVSYK  902
              YVQ+K +LG  YYLYVHS+LNYG LA+RA+I KAS N T+PC++EG++GYYTYN VSYK
Sbjct  216   -YVQQKALLGTNYYLYVHSFLNYGLLAARADILKASKNYTSPCIVEGHNGYYTYNGVSYK  274

Query  903   VTAPPNGSSLKNCRKLARKVVDFRAPCKYQNCTFNGVWSGGGGAGMENVYISSFFYDIAT  1082
               +   G +++ C+ + RK++   APC ++NC+F G+W+GGGGAG +N+YISSFFYD A+
Sbjct  275   AASRKQGPNIRRCKAIIRKLLQIDAPCNHKNCSFAGIWNGGGGAGTKNLYISSFFYDYAS  334

Query  1083  DVGIIDQEKASKIVKPRSFLVAAKLACETKFEDVKSTFPNAVEKDYPYLCMDLVYEYTLL  1262
              VGI+D ++A  I +P  +  AA LAC+TK +++KS FPN  +KD P++CMDL+YEYTLL
Sbjct  335   TVGIVDPKEAYGITQPIQYYKAATLACKTKKQNMKSVFPNINDKDIPFICMDLLYEYTLL  394

Query  1263  VDGLGLHPYKEITLMKKVEYKNYMVEAAWPLGCAIDVISSSSANNLLS  1406
             V+G G+ P ++IT++ +V YKN++VEAAWPLG AID +SS+++ N++S
Sbjct  395   VNGFGIDPIRKITVVHQVNYKNHLVEAAWPLGSAIDAVSSTTSENMIS  442



>ref|XP_006363161.1| PREDICTED: apyrase-like isoform X1 [Solanum tuberosum]
 ref|XP_006363162.1| PREDICTED: apyrase-like isoform X2 [Solanum tuberosum]
Length=451

 Score =   522 bits (1344),  Expect = 4e-178, Method: Compositional matrix adjust.
 Identities = 247/408 (61%), Positives = 328/408 (80%), Gaps = 1/408 (0%)
 Frame = +3

Query  183   YAVIFDAGSTGSRVHVFHFDENLDLLPIGDGVEFFLKTTPGLSSYANDPEAAAKSLEPLL  362
             YAVIFDAGSTGSRVHVF F+ NLDLL IG+ +E FL   PGLSSYA+DP+AAA SL+PLL
Sbjct  39    YAVIFDAGSTGSRVHVFRFNSNLDLLNIGNDLELFLAIKPGLSSYADDPKAAANSLKPLL  98

Query  363   LEAEGVVPTELQPDTPLELGATAGLRLLEGDASDKILQAVRDMFKNESNFKSKAEWVSIL  542
              +AE V+P  LQ  TP+++GATAGLRLL+GD+S+KILQAVRD+ KNE+    K EWVS+L
Sbjct  99    EKAEAVIPKNLQSQTPIKVGATAGLRLLKGDSSEKILQAVRDLLKNETTLSYKDEWVSVL  158

Query  543   EGSQEGTYFWVAMNYLLGNLGKGYQNTIATIDLGGGSVQVSYAVSGDTFANAPTPDNGEE  722
             EG+QEG+YFWVA+NYL GNLGK Y +TIATIDLGGGSVQ++YAVS ++  NAP   NG+ 
Sbjct  159   EGTQEGSYFWVALNYLYGNLGKNYPDTIATIDLGGGSVQIAYAVSKESALNAPKLPNGD-  217

Query  723   PYVQEKYILGAQYYLYVHSYLNYGQLASRAEIFKASGNSTNPCVLEGYDGYYTYNDVSYK  902
             PYVQ+K +LG  YYLYVHS+LNYG LA+RA+I KAS N T+PC++EG++GYYTYN V+YK
Sbjct  218   PYVQQKSLLGTNYYLYVHSFLNYGLLAARADILKASKNYTSPCIVEGHNGYYTYNGVAYK  277

Query  903   VTAPPNGSSLKNCRKLARKVVDFRAPCKYQNCTFNGVWSGGGGAGMENVYISSFFYDIAT  1082
               +   G +++ C+ + RK++   APC+++NC+F G+W+GGGGAG +N++ISSFFYD A+
Sbjct  278   AASQKQGPNIRRCKAIIRKLLQLDAPCQHKNCSFAGIWNGGGGAGTKNLHISSFFYDYAS  337

Query  1083  DVGIIDQEKASKIVKPRSFLVAAKLACETKFEDVKSTFPNAVEKDYPYLCMDLVYEYTLL  1262
              VGI+D ++ S I +P  +  AA LAC+TK +++K  FPN  +KD P++CMDL+YEYTLL
Sbjct  338   TVGIVDPKEPSGITQPIQYYKAATLACKTKKQNMKLVFPNIGDKDIPFICMDLLYEYTLL  397

Query  1263  VDGLGLHPYKEITLMKKVEYKNYMVEAAWPLGCAIDVISSSSANNLLS  1406
             V G G+ P ++IT++ +V YKN++VEAAWPLG AID +SS+++  L+S
Sbjct  398   VHGFGIDPIRKITVVHQVNYKNHLVEAAWPLGSAIDAVSSTTSEKLIS  445



>emb|CDP04086.1| unnamed protein product [Coffea canephora]
Length=476

 Score =   496 bits (1276),  Expect = 2e-167, Method: Compositional matrix adjust.
 Identities = 235/417 (56%), Positives = 311/417 (75%), Gaps = 0/417 (0%)
 Frame = +3

Query  132   FSRPHLRRVLLSHETGNYAVIFDAGSTGSRVHVFHFDENLDLLPIGDGVEFFLKTTPGLS  311
             FS      ++L   +  Y VIFDAGSTGSRVHV+ FD +++LL IGD  E+F KTTPGLS
Sbjct  41    FSLNGFLNLVLGEGSEQYVVIFDAGSTGSRVHVYRFDSDMNLLKIGDDFEYFEKTTPGLS  100

Query  312   SYANDPEAAAKSLEPLLLEAEGVVPTELQPDTPLELGATAGLRLLEGDASDKILQAVRDM  491
             SYA+DP AAA+SL+ LL  AE +VP EL+ +TP+ +GATAGLR L GDA++ IL+AVRD+
Sbjct  101   SYADDPTAAAQSLKTLLENAEAIVPEELRANTPVLVGATAGLRQLNGDAAENILEAVRDL  160

Query  492   FKNESNFKSKAEWVSILEGSQEGTYFWVAMNYLLGNLGKGYQNTIATIDLGGGSVQVSYA  671
              KNES+FK KAEWV+IL+GSQE  Y W A+NYLLG++GK Y  T+ ++DLGGGSV+++YA
Sbjct  161   LKNESSFKYKAEWVTILDGSQEAAYAWAAINYLLGSIGKNYSETVGSVDLGGGSVEMTYA  220

Query  672   VSGDTFANAPTPDNGEEPYVQEKYILGAQYYLYVHSYLNYGQLASRAEIFKASGNSTNPC  851
             VS  T A A    N  EPY+ E   LG  YYLY +SYLNYG LA+RAEI K S NS+NPC
Sbjct  221   VSETTAAQASNISNNGEPYIHENNFLGTTYYLYAYSYLNYGLLAARAEILKLSRNSSNPC  280

Query  852   VLEGYDGYYTYNDVSYKVTAPPNGSSLKNCRKLARKVVDFRAPCKYQNCTFNGVWSGGGG  1031
             +L GYDGYYTY DV Y+ +A P G ++K C    +K ++  APC+++NCTFNGVW+GGGG
Sbjct  281   ILYGYDGYYTYEDVVYRASALPTGPNIKQCWGFVKKALNISAPCQHKNCTFNGVWNGGGG  340

Query  1032  AGMENVYISSFFYDIATDVGIIDQEKASKIVKPRSFLVAAKLACETKFEDVKSTFPNAVE  1211
              G +N+Y++SFFYDI ++VGI +    S  V+P  +L  A  AC TK+ED++S FPN  E
Sbjct  341   DGQKNLYVASFFYDIGSEVGIFEPNAPSATVRPADYLSVANRACATKYEDIQSVFPNIYE  400

Query  1212  KDYPYLCMDLVYEYTLLVDGLGLHPYKEITLMKKVEYKNYMVEAAWPLGCAIDVISS  1382
              D P +CMDL+Y YTLLV+G G++P+K+IT+++ +EYK+ +V+A W LG AI+ +SS
Sbjct  401   ADKPVICMDLIYMYTLLVNGFGVNPFKKITVVQSIEYKDSLVDATWSLGSAINAVSS  457



>emb|CDP04087.1| unnamed protein product [Coffea canephora]
Length=444

 Score =   492 bits (1267),  Expect = 2e-166, Method: Compositional matrix adjust.
 Identities = 245/412 (59%), Positives = 317/412 (77%), Gaps = 2/412 (0%)
 Frame = +3

Query  156   VLLSHE-TGNYAVIFDAGSTGSRVHVFHFDENLDLLPIGDGVEFFLKTTPGLSSYANDPE  332
             VLLS++ +G YAVI DAGSTGSR+HV HFD NLDL+ IG   EFF    PGLSSYA+ PE
Sbjct  34    VLLSNDASGKYAVIIDAGSTGSRLHVLHFDRNLDLVQIGQDFEFFKAIKPGLSSYADGPE  93

Query  333   AAAKSLEPLLLEAEGVVPTELQPDTPLELGATAGLRLLEGDASDKILQAVRDMFKNESNF  512
             AAA+SL+PLL +AE +VP E + +TP+++GATAGLRLL+GD+S+KILQAVRD+ KNES+ 
Sbjct  94    AAAQSLKPLLEKAEAIVPKEFRANTPVKVGATAGLRLLKGDSSEKILQAVRDLLKNESSL  153

Query  513   KSKAEWVSILEGSQEGTYFWVAMNYLLGNLGKGYQNTIATIDLGGGSVQVSYAVSGDTFA  692
             K KAEWV+ILEGSQE  Y W A+NYLLG  GK Y  T+ TIDLGGGSVQ++YAVS +   
Sbjct  154   KYKAEWVTILEGSQEAAYIWAAINYLLGTAGKKYSETVGTIDLGGGSVQMTYAVSKEVAL  213

Query  693   NAPTPDNGEEPYVQEKYILGAQYYLYVHSYLNYGQLASRAEIFKASGNSTNPCVLEGYDG  872
              A +  + +E Y+QEK +LG+ Y+LY +SYLNYG LA+RAEI K S NS++PC+L GY G
Sbjct  214   KA-SKLSKKETYIQEKNLLGSTYHLYAYSYLNYGLLAARAEILKVSRNSSHPCILYGYHG  272

Query  873   YYTYNDVSYKVTAPPNGSSLKNCRKLARKVVDFRAPCKYQNCTFNGVWSGGGGAGMENVY  1052
             YYTY DV+Y+ +A P G ++K CR    K +   APCK++ CTFNGVW+GGGG G +N+Y
Sbjct  273   YYTYGDVAYRASAFPTGPNMKKCRAFVLKALKINAPCKHKKCTFNGVWNGGGGDGQKNLY  332

Query  1053  ISSFFYDIATDVGIIDQEKASKIVKPRSFLVAAKLACETKFEDVKSTFPNAVEKDYPYLC  1232
             ++SFFYD A+ VG+I     S   +P  FL AAK AC TK++D+KS FPN  E D P+ C
Sbjct  333   VASFFYDRASQVGVIKTNVPSATARPLHFLSAAKRACRTKYKDIKSVFPNINESDRPFTC  392

Query  1233  MDLVYEYTLLVDGLGLHPYKEITLMKKVEYKNYMVEAAWPLGCAIDVISSSS  1388
             +DLVYEY+LLV+G GL+P+K+ITL+KK++YK+ ++E AWPLG AID +SS +
Sbjct  393   LDLVYEYSLLVNGFGLNPFKKITLVKKIKYKDSLLETAWPLGSAIDAVSSQN  444



>ref|XP_003548772.1| PREDICTED: nucleoside-triphosphatase-like [Glycine max]
 gb|KHN46800.1| Nucleoside-triphosphatase [Glycine soja]
Length=468

 Score =   485 bits (1249),  Expect = 2e-163, Method: Compositional matrix adjust.
 Identities = 228/421 (54%), Positives = 306/421 (73%), Gaps = 8/421 (2%)
 Frame = +3

Query  144   HLRRVLLSHE--------TGNYAVIFDAGSTGSRVHVFHFDENLDLLPIGDGVEFFLKTT  299
             H   +LL+H           +YAVIFDAGSTGSRVHVFHFD+NLDLL IG+ +EF+ K T
Sbjct  37    HDGNILLTHRKIFPKQEAITSYAVIFDAGSTGSRVHVFHFDQNLDLLRIGNELEFYDKVT  96

Query  300   PGLSSYANDPEAAAKSLEPLLLEAEGVVPTELQPDTPLELGATAGLRLLEGDASDKILQA  479
             PGLS+YA++P+ AA+SL PLL EAE VVP +L P TP++LGATAGLRLLEGDAS++ILQA
Sbjct  97    PGLSAYADNPQQAAESLIPLLEEAESVVPEDLYPTTPVKLGATAGLRLLEGDASERILQA  156

Query  480   VRDMFKNESNFKSKAEWVSILEGSQEGTYFWVAMNYLLGNLGKGYQNTIATIDLGGGSVQ  659
             VRD+ KN S   ++ + V+I++G+QEG+Y WV +NYLLG LGK +  T+  +DLGGGSVQ
Sbjct  157   VRDLLKNRSTLNTQPDAVAIIDGTQEGSYLWVTINYLLGKLGKRFSKTVGVVDLGGGSVQ  216

Query  660   VSYAVSGDTFANAPTPDNGEEPYVQEKYILGAQYYLYVHSYLNYGQLASRAEIFKASGNS  839
             ++YA+S +T  NAP P +GEEPY+++  + G +Y LYVHSYL+YG+ ASRAEI K +  S
Sbjct  217   MAYAISRNTAKNAPKPPDGEEPYIKKLVLKGKEYDLYVHSYLHYGREASRAEILKVTDGS  276

Query  840   TNPCVLEGYDGYYTYNDVSYKVTAPPNGSSLKNCRKLARKVVDFRAPCKYQNCTFNGVWS  1019
              NPC+L G+DG YTY+   YK  AP +GSS   CR++  + +     C +QNCTF G+W 
Sbjct  277   ANPCILAGFDGTYTYSGADYKAFAPISGSSYDECREVVLQALKLNESCPHQNCTFGGIWD  336

Query  1020  GGGGAGMENVYISSFFYDIATDVGIIDQEKASKIVKPRSFLVAAKLACETKFEDVKSTFP  1199
             GG G+G + ++ +S FY + T++GIID  K +  + P    + AK ACETK ED KST+P
Sbjct  337   GGRGSGQKILFGTSSFYYLPTEIGIIDLNKPNSKIHPVDLEIEAKRACETKLEDAKSTYP  396

Query  1200  NAVEKDYPYLCMDLVYEYTLLVDGLGLHPYKEITLMKKVEYKNYMVEAAWPLGCAIDVIS  1379
             N  E   PY+C+D+ Y+Y L  DG GL P++EIT+  ++EY++ +VEAAWPLG AI+ IS
Sbjct  397   NLAEDRLPYVCLDIAYQYALYTDGFGLDPWQEITVANEIEYQDALVEAAWPLGTAIEAIS  456

Query  1380  S  1382
             S
Sbjct  457   S  457



>gb|AAG32960.1|AF207688_1 apyrase GS52 [Glycine soja]
Length=468

 Score =   485 bits (1248),  Expect = 3e-163, Method: Compositional matrix adjust.
 Identities = 228/421 (54%), Positives = 305/421 (72%), Gaps = 8/421 (2%)
 Frame = +3

Query  144   HLRRVLLSHE--------TGNYAVIFDAGSTGSRVHVFHFDENLDLLPIGDGVEFFLKTT  299
             H   +LL+H           +YAVIFDAGSTGSRVHVFHFD+NLDLL IG+ +EF+ K T
Sbjct  37    HDGNILLTHRKIFPKQEAITSYAVIFDAGSTGSRVHVFHFDQNLDLLRIGNELEFYDKVT  96

Query  300   PGLSSYANDPEAAAKSLEPLLLEAEGVVPTELQPDTPLELGATAGLRLLEGDASDKILQA  479
             PGLS+YA++P+ AA+SL PLL EAE VVP +L P TP++LGATAGLRLLEGDAS++ILQA
Sbjct  97    PGLSAYADNPQQAAESLIPLLEEAESVVPEDLYPTTPVKLGATAGLRLLEGDASERILQA  156

Query  480   VRDMFKNESNFKSKAEWVSILEGSQEGTYFWVAMNYLLGNLGKGYQNTIATIDLGGGSVQ  659
             VRD+ KN S   ++ + V+I++G+QEG+Y WV +NYLLG LGK +  T+  +DLGGGSVQ
Sbjct  157   VRDLLKNRSTLNAQPDAVAIIDGTQEGSYLWVTINYLLGKLGKRFSKTVGVVDLGGGSVQ  216

Query  660   VSYAVSGDTFANAPTPDNGEEPYVQEKYILGAQYYLYVHSYLNYGQLASRAEIFKASGNS  839
             ++YA+S +T  NAP P +GEEPY+++  + G +Y LYVHSYL+YG+ ASRAEI K +  S
Sbjct  217   MAYAISRNTAKNAPKPPDGEEPYIKKLVLKGKEYDLYVHSYLHYGREASRAEILKVTDGS  276

Query  840   TNPCVLEGYDGYYTYNDVSYKVTAPPNGSSLKNCRKLARKVVDFRAPCKYQNCTFNGVWS  1019
              NPC+L GYDG YTY+   YK  AP +GSS   CR++  + +     C +QNCTF G+W 
Sbjct  277   ANPCILAGYDGTYTYSGADYKAFAPISGSSYDECREVVLQALKLNESCPHQNCTFGGIWD  336

Query  1020  GGGGAGMENVYISSFFYDIATDVGIIDQEKASKIVKPRSFLVAAKLACETKFEDVKSTFP  1199
             GG G+G + ++ +S FY + T++GIID  K +  + P    + AK ACETK ED KST+P
Sbjct  337   GGRGSGQKILFGTSSFYYLPTEIGIIDLNKPNSKIHPVDLEIEAKRACETKLEDAKSTYP  396

Query  1200  NAVEKDYPYLCMDLVYEYTLLVDGLGLHPYKEITLMKKVEYKNYMVEAAWPLGCAIDVIS  1379
             N  E   PY+C+D+ Y+Y L  DG  L P++EIT+  ++EY++ +VEAAWPLG AI+ IS
Sbjct  397   NPAEDRLPYVCLDIAYQYALYTDGFSLDPWQEITVANEIEYQDALVEAAWPLGTAIEAIS  456

Query  1380  S  1382
             S
Sbjct  457   S  457



>ref|XP_011089773.1| PREDICTED: apyrase 2-like [Sesamum indicum]
Length=466

 Score =   483 bits (1244),  Expect = 8e-163, Method: Compositional matrix adjust.
 Identities = 228/404 (56%), Positives = 298/404 (74%), Gaps = 1/404 (0%)
 Frame = +3

Query  174   TGNYAVIFDAGSTGSRVHVFHFDENLDLLPIGDGVEFFLKTTPGLSSYANDPEAAAKSLE  353
             +  YAVIFDAGS+GSRVHVF F++ LDL+P+G  +E FL+  PGLS YA DPEAAA SL 
Sbjct  61    SKRYAVIFDAGSSGSRVHVFCFNQQLDLVPMGQDLELFLQRKPGLSGYAKDPEAAANSLS  120

Query  354   PLLLEAEGVVPTELQPDTPLELGATAGLRLLEGDASDKILQAVRDMFKNESNFKSKAEWV  533
              LL +A+  VP EL+ +TP+ +GATAGLR LEGD SD+ILQAVRD  KN+S+ KS+A+WV
Sbjct  121   DLLEKAQAAVPKELRYNTPVRVGATAGLRQLEGDTSDRILQAVRDFLKNKSSLKSQADWV  180

Query  534   SILEGSQEGTYFWVAMNYLLGNLGKGYQNTIATIDLGGGSVQVSYAVSGDTFANAPTPDN  713
             ++L+G+QEG Y WV +NYLLGNLGK Y +T+  +DLGGGSVQ++YA+S    A AP   +
Sbjct  181   TVLDGNQEGAYQWVTINYLLGNLGKKYSSTVGVVDLGGGSVQMAYAISESDAAKAPMLSD  240

Query  714   GEEPYVQEKYILGAQYYLYVHSYLNYGQLASRAEIFKASGNSTNPCVLEGYDGYYTYNDV  893
             GE+ YVQ+ Y+ G +Y+LYVHSYL+YG LA+RAEI K      NPC+L GY+G Y Y   
Sbjct  241   GEDSYVQQMYLKGRKYHLYVHSYLHYGLLAARAEILKVDQEDDNPCILAGYNGSYKYGQA  300

Query  894   SYKVTAPPNGSSLKNCRKLARKVVDF-RAPCKYQNCTFNGVWSGGGGAGMENVYISSFFY  1070
              Y+ +A P+GSSL  CR++A K +    + C +  CTF  VW+GGGG G +N++++SFF+
Sbjct  301   VYRASALPSGSSLSKCREVAIKALKINESSCTHMKCTFGDVWNGGGGDGQKNLFVASFFF  360

Query  1071  DIATDVGIIDQEKASKIVKPRSFLVAAKLACETKFEDVKSTFPNAVEKDYPYLCMDLVYE  1250
             D A + G ID   A   V P  F  AAK AC+T  ED  S FP+   ++ PYLCMDLVY+
Sbjct  361   DRAAEAGFIDPNLAVAKVHPADFEDAAKRACQTSLEDGSSAFPHVEPENLPYLCMDLVYQ  420

Query  1251  YTLLVDGLGLHPYKEITLMKKVEYKNYMVEAAWPLGCAIDVISS  1382
             +TLLVDG GL P++EITL+KKV+Y+N +VEAAWPLG AI+V+SS
Sbjct  421   FTLLVDGFGLDPWQEITLVKKVKYQNSLVEAAWPLGSAIEVVSS  464



>ref|XP_006443349.1| hypothetical protein CICLE_v10019963mg [Citrus clementina]
 ref|XP_006479048.1| PREDICTED: apyrase 2-like [Citrus sinensis]
 gb|ESR56589.1| hypothetical protein CICLE_v10019963mg [Citrus clementina]
Length=477

 Score =   480 bits (1235),  Expect = 3e-161, Method: Compositional matrix adjust.
 Identities = 233/409 (57%), Positives = 309/409 (76%), Gaps = 0/409 (0%)
 Frame = +3

Query  174   TGNYAVIFDAGSTGSRVHVFHFDENLDLLPIGDGVEFFLKTTPGLSSYANDPEAAAKSLE  353
             + +YAVIFDAGS+GSRVHV+ FD+NLDL+PIG  +E F++T PGLS+YA+DP+AAA SL 
Sbjct  67    SKSYAVIFDAGSSGSRVHVYCFDQNLDLVPIGKDLELFVQTKPGLSAYASDPQAAANSLA  126

Query  354   PLLLEAEGVVPTELQPDTPLELGATAGLRLLEGDASDKILQAVRDMFKNESNFKSKAEWV  533
              LL +A+ VVP +L+P TP+++GATAGLR L  DASD+ILQAVRD+ K +S FKSK EWV
Sbjct  127   SLLDKAQSVVPQDLRPKTPVKVGATAGLRQLGVDASDRILQAVRDLLKYKSAFKSKPEWV  186

Query  534   SILEGSQEGTYFWVAMNYLLGNLGKGYQNTIATIDLGGGSVQVSYAVSGDTFANAPTPDN  713
             ++L+GSQEG+Y WV +NYLLGNLGK Y NT+  +DLGGGSVQ++YA+S    ANAPT   
Sbjct  187   TVLDGSQEGSYQWVTINYLLGNLGKKYSNTVGVVDLGGGSVQMAYAISEKDAANAPTVPE  246

Query  714   GEEPYVQEKYILGAQYYLYVHSYLNYGQLASRAEIFKASGNSTNPCVLEGYDGYYTYNDV  893
             GE+ YV E Y++G +YYLYVHSYL+YG LA+R EI K + +S NPC+L GYDG Y Y   
Sbjct  247   GEDQYVNEMYLMGTKYYLYVHSYLHYGLLAARTEILKVTKDSDNPCILAGYDGSYKYGGQ  306

Query  894   SYKVTAPPNGSSLKNCRKLARKVVDFRAPCKYQNCTFNGVWSGGGGAGMENVYISSFFYD  1073
              YK +A P+GS+++ C+ +A K +     C +  CTF GVW+GGGG G +N++++SFF+D
Sbjct  307   EYKASASPSGSNIEECQSVAIKALKVNDTCTHMQCTFGGVWNGGGGDGQKNMFVASFFFD  366

Query  1074  IATDVGIIDQEKASKIVKPRSFLVAAKLACETKFEDVKSTFPNAVEKDYPYLCMDLVYEY  1253
              A + G IDQ +    V+P  F  AAK AC+TK ED KS +P   E + PY+CMDLVY++
Sbjct  367   RAAEAGFIDQNEPVAKVRPGDFESAAKRACQTKLEDAKSIYPRVDESNLPYICMDLVYQH  426

Query  1254  TLLVDGLGLHPYKEITLMKKVEYKNYMVEAAWPLGCAIDVISSSSANNL  1400
              LLV G GL P++EITL+K+++Y+N +VEAAWPLG AI+ ISS   N +
Sbjct  427   ALLVVGFGLDPWQEITLVKQIKYQNSLVEAAWPLGSAIEAISSLGLNQV  475



>gb|KDO45540.1| hypothetical protein CISIN_1g048388mg [Citrus sinensis]
Length=477

 Score =   479 bits (1233),  Expect = 5e-161, Method: Compositional matrix adjust.
 Identities = 233/409 (57%), Positives = 309/409 (76%), Gaps = 0/409 (0%)
 Frame = +3

Query  174   TGNYAVIFDAGSTGSRVHVFHFDENLDLLPIGDGVEFFLKTTPGLSSYANDPEAAAKSLE  353
             + +YAVIFDAGS+GSRVHV+ FD+NLDL+PIG  +E F++T PGLS+YA+DP+AAA SL 
Sbjct  67    SKSYAVIFDAGSSGSRVHVYCFDQNLDLVPIGKDLELFVQTKPGLSAYASDPQAAANSLA  126

Query  354   PLLLEAEGVVPTELQPDTPLELGATAGLRLLEGDASDKILQAVRDMFKNESNFKSKAEWV  533
              LL +A+ VVP +L+P TP+++GATAGLR L  DASD+ILQAVRD+ K +S FKSK EWV
Sbjct  127   SLLDKAQSVVPQDLRPKTPVKVGATAGLRQLGVDASDRILQAVRDLLKYKSAFKSKPEWV  186

Query  534   SILEGSQEGTYFWVAMNYLLGNLGKGYQNTIATIDLGGGSVQVSYAVSGDTFANAPTPDN  713
             ++L+GSQEG+Y WV +NYLLGNLGK Y NT+  +DLGGGSVQ++YA+S    ANAPT   
Sbjct  187   TVLDGSQEGSYQWVTINYLLGNLGKKYSNTVGVVDLGGGSVQMAYAISEKDAANAPTVPE  246

Query  714   GEEPYVQEKYILGAQYYLYVHSYLNYGQLASRAEIFKASGNSTNPCVLEGYDGYYTYNDV  893
             GE+ YV E Y++G +YYLYVHSYL+YG LA+R EI K + +S NPC+L GYDG Y Y   
Sbjct  247   GEDQYVNEMYLMGTKYYLYVHSYLHYGLLAARTEILKVTKDSDNPCILAGYDGSYKYGGE  306

Query  894   SYKVTAPPNGSSLKNCRKLARKVVDFRAPCKYQNCTFNGVWSGGGGAGMENVYISSFFYD  1073
              YK +A P+GS+++ C+ +A K +     C +  CTF GVW+GGGG G +N++++SFF+D
Sbjct  307   EYKASASPSGSNIEECQSVAIKALKVNDTCTHMQCTFGGVWNGGGGDGQKNMFVASFFFD  366

Query  1074  IATDVGIIDQEKASKIVKPRSFLVAAKLACETKFEDVKSTFPNAVEKDYPYLCMDLVYEY  1253
              A + G IDQ +    V+P  F  AAK AC+TK ED KS +P   E + PY+CMDLVY++
Sbjct  367   RAAEAGFIDQNEPVAKVRPGDFESAAKRACQTKLEDAKSIYPRVDESNLPYICMDLVYQH  426

Query  1254  TLLVDGLGLHPYKEITLMKKVEYKNYMVEAAWPLGCAIDVISSSSANNL  1400
              LLV G GL P++EITL+K+++Y+N +VEAAWPLG AI+ ISS   N +
Sbjct  427   ALLVVGFGLDPWQEITLVKQIKYQNSLVEAAWPLGSAIEAISSLGLNQV  475



>gb|AAF00610.1|AF156781_1 apyrase [Vigna unguiculata subsp. cylindrica]
Length=467

 Score =   472 bits (1215),  Expect = 2e-158, Method: Compositional matrix adjust.
 Identities = 229/401 (57%), Positives = 303/401 (76%), Gaps = 0/401 (0%)
 Frame = +3

Query  180   NYAVIFDAGSTGSRVHVFHFDENLDLLPIGDGVEFFLKTTPGLSSYANDPEAAAKSLEPL  359
             +YAVIFDAGSTGSRVHV+ F++ LDLL IG  +E F+KT PGLS+YA +PE AA+SL PL
Sbjct  56    SYAVIFDAGSTGSRVHVYRFNQQLDLLRIGHDLELFVKTKPGLSAYAENPEEAAESLVPL  115

Query  360   LLEAEGVVPTELQPDTPLELGATAGLRLLEGDASDKILQAVRDMFKNESNFKSKAEWVSI  539
             L EAE V+P EL P TP+++GATAGLR LEGDAS++ILQAV DM K  S  K + + VS+
Sbjct  116   LEEAEAVIPQELHPRTPVKVGATAGLRQLEGDASNRILQAVSDMLKKRSTLKVEGDAVSV  175

Query  540   LEGSQEGTYFWVAMNYLLGNLGKGYQNTIATIDLGGGSVQVSYAVSGDTFANAPTPDNGE  719
             L G+QEG Y WV +NYLLGNLGK Y  T+A +DLGGGSVQ++YA+S +  A AP   +G 
Sbjct  176   LSGNQEGAYQWVTINYLLGNLGKHYSKTVAVVDLGGGSVQMAYAISEEDAAKAPQVPDGV  235

Query  720   EPYVQEKYILGAQYYLYVHSYLNYGQLASRAEIFKASGNSTNPCVLEGYDGYYTYNDVSY  899
             E Y+ E ++ G +YYLYVHSYL YG LA+RAE+ K S +S NPC+L G+DGYYTY  V Y
Sbjct  236   ESYITEMFLRGKKYYLYVHSYLRYGLLAARAEVLKVSRDSENPCILSGFDGYYTYGGVQY  295

Query  900   KVTAPPNGSSLKNCRKLARKVVDFRAPCKYQNCTFNGVWSGGGGAGMENVYISSFFYDIA  1079
             K TAPP+GSS   C+ +  + +   A C Y++CTF G+W+GGGGAG  N +++SFF+++A
Sbjct  296   KATAPPSGSSFSKCQNVVLEALHVNATCSYKDCTFGGIWNGGGGAGENNFFVASFFFEVA  355

Query  1080  TDVGIIDQEKASKIVKPRSFLVAAKLACETKFEDVKSTFPNAVEKDYPYLCMDLVYEYTL  1259
              + G +D   A+ IV+P  F  AAK+AC T+ +D+KS FP   + D PY+C+DLVY+YTL
Sbjct  356   DEAGFVDPNDANAIVRPVDFEDAAKVACSTELKDLKSVFPRVKDGDVPYICLDLVYQYTL  415

Query  1260  LVDGLGLHPYKEITLMKKVEYKNYMVEAAWPLGCAIDVISS  1382
             LVDG G+ P +EITL+++++Y++ +VEAAWPLG AI+ ISS
Sbjct  416   LVDGFGIDPQQEITLVRQIQYQDSLVEAAWPLGSAIEAISS  456



>ref|XP_004493131.1| PREDICTED: apyrase 2-like isoform X1 [Cicer arietinum]
Length=469

 Score =   471 bits (1213),  Expect = 4e-158, Method: Compositional matrix adjust.
 Identities = 230/413 (56%), Positives = 311/413 (75%), Gaps = 2/413 (0%)
 Frame = +3

Query  150   RRVLLSHETGN-YAVIFDAGSTGSRVHVFHFDENLDLLPIGDGVEFFLKTTPGLSSYAND  326
             R++    ++G+ YAVIFDAGS+GSRVHVFHFD+NLDL+ IG  +E F +T PGLS+YA +
Sbjct  56    RKISPDKKSGSTYAVIFDAGSSGSRVHVFHFDQNLDLVHIGKDLELFEQTKPGLSAYAQN  115

Query  327   PEAAAKSLEPLLLEAEGVVPTELQPDTPLELGATAGLRLLEGDASDKILQAVRDMFKNES  506
             P+ AA+SL  LL +AE VVP EL+  TP+ +GATAGLR LEGDASD+ILQAVRD+ K  S
Sbjct  116   PQQAAESLVSLLEKAESVVPRELRSKTPVRVGATAGLRALEGDASDRILQAVRDLLKKRS  175

Query  507   NFKSKAEWVSILEGSQEGTYFWVAMNYLLGNLGKGYQNTIATIDLGGGSVQVSYAVSGDT  686
               +S+A+ V++L+G+QEG + WV +NYLLGNLGK Y  T+  +DLGGGSVQ++YA+S   
Sbjct  176   TLRSEADAVTVLDGTQEGAFQWVTINYLLGNLGKDYSKTVGVVDLGGGSVQMAYAISESD  235

Query  687   FANAPTPDNGEEPYVQEKYILGAQYYLYVHSYLNYGQLASRAEIFKASGNSTNPCVLEGY  866
              A AP   +GE+PYV+E ++ G +YYLYVHSYL YG LA+RAEI KASG++ NPC+L GY
Sbjct  236   AAMAPKVTDGEDPYVKEMFLRGRKYYLYVHSYLRYGLLAARAEILKASGDAENPCILSGY  295

Query  867   DGYYTYNDVSYKVTAPPNGSSLKNCRKLARKVVDF-RAPCKYQNCTFNGVWSGGGGAGME  1043
             DG Y Y   S+K ++ P+G+SL  C+ +A K +    + C +  CTF G+W+GGGG G +
Sbjct  296   DGSYNYGGKSFKASSSPSGASLNECKSVALKALKVNESTCTHMKCTFGGIWNGGGGDGQK  355

Query  1044  NVYISSFFYDIATDVGIIDQEKASKIVKPRSFLVAAKLACETKFEDVKSTFPNAVEKDYP  1223
             N++++SFF+D A + G  +      IV+P  F  AAK AC+TK E+ KST+P   E + P
Sbjct  356   NLFVASFFFDRAAEAGFANPNSPVAIVRPADFEDAAKQACQTKLENAKSTYPRVEEGNLP  415

Query  1224  YLCMDLVYEYTLLVDGLGLHPYKEITLMKKVEYKNYMVEAAWPLGCAIDVISS  1382
             YLCMDLVY+YTLLVDG G++P++EITL+KKV+Y++ +VEAAWPLG AI+ +SS
Sbjct  416   YLCMDLVYQYTLLVDGFGIYPWQEITLVKKVKYEDALVEAAWPLGSAIEAVSS  468



>ref|XP_007161810.1| hypothetical protein PHAVU_001G100100g [Phaseolus vulgaris]
 gb|ESW33804.1| hypothetical protein PHAVU_001G100100g [Phaseolus vulgaris]
Length=454

 Score =   470 bits (1209),  Expect = 1e-157, Method: Compositional matrix adjust.
 Identities = 225/413 (54%), Positives = 295/413 (71%), Gaps = 2/413 (0%)
 Frame = +3

Query  150   RRVLLSHETG--NYAVIFDAGSTGSRVHVFHFDENLDLLPIGDGVEFFLKTTPGLSSYAN  323
             R++    E    +YA IFDAGSTGSRVHVFHFD+NLDLL IG+ +EF  + TPGLSSYA+
Sbjct  31    RKIFPKQEEAITSYAAIFDAGSTGSRVHVFHFDQNLDLLYIGNNLEFHQRVTPGLSSYAD  90

Query  324   DPEAAAKSLEPLLLEAEGVVPTELQPDTPLELGATAGLRLLEGDASDKILQAVRDMFKNE  503
              PE AA+SL PLL  AE VVP +L   TPL+LGATAGLRLLEG+A++ IL AVRDMFKN 
Sbjct  91    KPEKAAQSLIPLLEAAENVVPQDLHFKTPLKLGATAGLRLLEGNAAENILNAVRDMFKNR  150

Query  504   SNFKSKAEWVSILEGSQEGTYFWVAMNYLLGNLGKGYQNTIATIDLGGGSVQVSYAVSGD  683
             S    +++ V+I++G+QEG+Y W+A+NYLLG LGK +  T+  +DLGGGSVQ++YAVS +
Sbjct  151   STLNVQSDAVAIIDGTQEGSYLWLAVNYLLGRLGKKFSKTVGVVDLGGGSVQMAYAVSRN  210

Query  684   TFANAPTPDNGEEPYVQEKYILGAQYYLYVHSYLNYGQLASRAEIFKASGNSTNPCVLEG  863
             T  NAP   +GE+PY+++ Y  G  Y LYVHSYL+YG  ASRAEI K S  S NPC+L G
Sbjct  211   TAKNAPLVPDGEDPYIKKLYAKGKNYDLYVHSYLHYGTEASRAEILKVSDGSANPCILAG  270

Query  864   YDGYYTYNDVSYKVTAPPNGSSLKNCRKLARKVVDFRAPCKYQNCTFNGVWSGGGGAGME  1043
             YDG YTY++V Y V  P +GSS   CR++  K +    PC   NCTF G+W GG G+G  
Sbjct  271   YDGNYTYSEVEYAVYPPSSGSSYDACREIVLKALKLNEPCSRHNCTFGGIWDGGRGSGQR  330

Query  1044  NVYISSFFYDIATDVGIIDQEKASKIVKPRSFLVAAKLACETKFEDVKSTFPNAVEKDYP  1223
              +Y +S FY +  DVG+ID +  + +V+       AK AC   FE+ KS++P+  ++  P
Sbjct  331   TIYATSSFYYLPLDVGLIDAKAHNAVVRVVDLENLAKRACGKTFEEAKSSYPHLSKERVP  390

Query  1224  YLCMDLVYEYTLLVDGLGLHPYKEITLMKKVEYKNYMVEAAWPLGCAIDVISS  1382
             ++CMD+ Y+YTLLVDG G+ P +EITL K++EYK+ +VE AWPLG AI+ ISS
Sbjct  391   FVCMDIAYQYTLLVDGFGIDPLQEITLAKEIEYKDAIVETAWPLGTAIEAISS  443



>ref|XP_010316510.1| PREDICTED: apyrase-like isoform X2 [Solanum lycopersicum]
Length=383

 Score =   466 bits (1199),  Expect = 3e-157, Method: Compositional matrix adjust.
 Identities = 221/369 (60%), Positives = 296/369 (80%), Gaps = 1/369 (0%)
 Frame = +3

Query  300   PGLSSYANDPEAAAKSLEPLLLEAEGVVPTELQPDTPLELGATAGLRLLEGDASDKILQA  479
             PGLSSYA+DP+AAA SL+PLL +AE V+P  LQ  TP+++GATAGLRLL+GD+S+KILQA
Sbjct  9     PGLSSYADDPKAAANSLKPLLEKAEAVIPKNLQSQTPIKVGATAGLRLLKGDSSEKILQA  68

Query  480   VRDMFKNESNFKSKAEWVSILEGSQEGTYFWVAMNYLLGNLGKGYQNTIATIDLGGGSVQ  659
             VRDM KNE+    K EWVS+LEG+ EG+YFWVA+NYL GNLGK Y +TIATIDLGGGSVQ
Sbjct  69    VRDMLKNETTLSYKDEWVSVLEGTLEGSYFWVALNYLYGNLGKNYPDTIATIDLGGGSVQ  128

Query  660   VSYAVSGDTFANAPTPDNGEEPYVQEKYILGAQYYLYVHSYLNYGQLASRAEIFKASGNS  839
             ++YAVS  +  NAP   NG+  YVQ+K +LG  YYLYVHS+LNYG LA+RA+I KAS N 
Sbjct  129   IAYAVSKQSAINAPKLPNGDA-YVQQKALLGTNYYLYVHSFLNYGLLAARADILKASKNY  187

Query  840   TNPCVLEGYDGYYTYNDVSYKVTAPPNGSSLKNCRKLARKVVDFRAPCKYQNCTFNGVWS  1019
             T+PC++EG++GYYTYN VSYK  +   G +++ C+ + RK++   APC ++NC+F G+W+
Sbjct  188   TSPCIVEGHNGYYTYNGVSYKAASRKQGPNIRRCKAIIRKLLQIDAPCNHKNCSFAGIWN  247

Query  1020  GGGGAGMENVYISSFFYDIATDVGIIDQEKASKIVKPRSFLVAAKLACETKFEDVKSTFP  1199
             GGGGAG +N+YISSFFYD A+ VGI+D ++A  I +P  +  AA LAC+TK +++KS FP
Sbjct  248   GGGGAGTKNLYISSFFYDYASTVGIVDPKEAYGITQPIQYYKAATLACKTKKQNMKSVFP  307

Query  1200  NAVEKDYPYLCMDLVYEYTLLVDGLGLHPYKEITLMKKVEYKNYMVEAAWPLGCAIDVIS  1379
             N  +KD P++CMDL+YEYTLLV+G G+ P ++IT++ +V YKN++VEAAWPLG AID +S
Sbjct  308   NINDKDIPFICMDLLYEYTLLVNGFGIDPIRKITVVHQVNYKNHLVEAAWPLGSAIDAVS  367

Query  1380  SSSANNLLS  1406
             S+++ N++S
Sbjct  368   STTSENMIS  376



>gb|AAF00609.1|AF156780_1 nod factor binding lectin-nucleotide phosphohydrolase [Lotus 
japonicus]
Length=456

 Score =   469 bits (1206),  Expect = 3e-157, Method: Compositional matrix adjust.
 Identities = 236/415 (57%), Positives = 311/415 (75%), Gaps = 5/415 (1%)
 Frame = +3

Query  150   RRVLL---SHETGNYAVIFDAGSTGSRVHVFHFDENLDLLPIGDGVEFFLKTTPGLSSYA  320
             R++LL        +YAVIFDAGSTGSRVHV++FD+NLDLLP+ + +EF+    PGLSSYA
Sbjct  32    RKILLPKNQEPVTSYAVIFDAGSTGSRVHVYNFDQNLDLLPVENELEFYDSVKPGLSSYA  91

Query  321   NDPEAAAKSLEPLLLEAEGVVPTELQPDTPLELGATAGLRLLEGDASDKILQAVRDMFKN  500
              +PE AA+SL PLL EAE VVP   QP+TP++LGATAGLRLLEG+A++ ILQAVRDM  N
Sbjct  92    ANPEEAAESLIPLLKEAENVVPVSQQPNTPVKLGATAGLRLLEGNAAENILQAVRDMLSN  151

Query  501   ESNFKSKAEWVSILEGSQEGTYFWVAMNYLLGNLGKGYQNTIATIDLGGGSVQVSYAVSG  680
              S    +++ VSIL+G+QEG+Y WV +NYLLG LGK +  T+  +DLGGGSVQ++YAVS 
Sbjct  152   RSALNVQSDAVSILDGTQEGSYLWVTINYLLGKLGKRFTKTVGVVDLGGGSVQMTYAVSR  211

Query  681   DTFANAPTPDNGEEPYVQEKYILGAQYYLYVHSYLNYGQLASRAEIFKASGNSTNPCVLE  860
             +T  NAP    GE+PY+++  + G +Y LYVHSYL YG+ A RAEIFK +G S NPC+L 
Sbjct  212   NTAKNAPKVPEGEDPYIKKLVLQGKKYDLYVHSYLRYGREAFRAEIFKVAGGSANPCILA  271

Query  861   GYDGYYTYNDVSYKVTAPPNGSSLKNCRKLARKVVDFRAPCKYQNCTFNGVWSGGGGAGM  1040
             G+DG YTY+   YKV+AP +GS+L  CRK+A K +   APC YQNCTF G+W+GGGG+G 
Sbjct  272   GFDGAYTYSGAEYKVSAPASGSNLNQCRKIALKALKVNAPCPYQNCTFGGIWNGGGGSGQ  331

Query  1041  ENVYISSFFYDIATDVGIIDQEKASKIVKPRSFLVAAKLACETKFEDVKSTFPNAVEKD-  1217
             +N++++S FY ++ DVGI   +  +KI +P     AAKLAC+T  ED KS +P+  EKD 
Sbjct  332   KNLFLTSSFYYLSEDVGIFVNKPNAKI-RPVDLKTAAKLACKTNLEDAKSKYPDLYEKDS  390

Query  1218  YPYLCMDLVYEYTLLVDGLGLHPYKEITLMKKVEYKNYMVEAAWPLGCAIDVISS  1382
               Y+C+DLVY YTLLVDG GL P++E+T+  ++EY++ +VEAAWPLG AI+ ISS
Sbjct  391   VEYVCLDLVYVYTLLVDGFGLDPFQEVTVANEIEYQDALVEAAWPLGTAIEAISS  445



>ref|XP_010669578.1| PREDICTED: apyrase 2 [Beta vulgaris subsp. vulgaris]
Length=461

 Score =   468 bits (1205),  Expect = 6e-157, Method: Compositional matrix adjust.
 Identities = 224/407 (55%), Positives = 292/407 (72%), Gaps = 0/407 (0%)
 Frame = +3

Query  162   LSHETGNYAVIFDAGSTGSRVHVFHFDENLDLLPIGDGVEFFLKTTPGLSSYANDPEAAA  341
             +  E   YAVIFDAGS+GSRVHVF FD+NLDL+PIG+ +E F +  PGLS+YANDP+ AA
Sbjct  53    MKTEYNRYAVIFDAGSSGSRVHVFCFDKNLDLVPIGNDLELFAQKKPGLSAYANDPQEAA  112

Query  342   KSLEPLLLEAEGVVPTELQPDTPLELGATAGLRLLEGDASDKILQAVRDMFKNESNFKSK  521
              SL  LL +AE VVP +L   TP+ +GATAGLR L GDA ++ILQ+VRD+ K++S  KS 
Sbjct  113   NSLLSLLKQAEDVVPRDLLGKTPVRVGATAGLRQLAGDAPERILQSVRDLLKDKSVLKSD  172

Query  522   AEWVSILEGSQEGTYFWVAMNYLLGNLGKGYQNTIATIDLGGGSVQVSYAVSGDTFANAP  701
                V++L+G+QEG + WV +NYLLGNLGK Y  T+  +DLGGGSVQ++YAVS    A AP
Sbjct  173   PNGVTVLDGTQEGAFQWVTINYLLGNLGKKYPRTVGVVDLGGGSVQMAYAVSESDAAKAP  232

Query  702   TPDNGEEPYVQEKYILGAQYYLYVHSYLNYGQLASRAEIFKASGNSTNPCVLEGYDGYYT  881
                NGEE YV+E Y+ G +YYLYVHSYL+YG LA+RAEI KA G+S+NPC+L G+ G Y 
Sbjct  233   KVSNGEEAYVREMYLKGRKYYLYVHSYLHYGLLAARAEILKAVGDSSNPCILAGFHGTYK  292

Query  882   YNDVSYKVTAPPNGSSLKNCRKLARKVVDFRAPCKYQNCTFNGVWSGGGGAGMENVYISS  1061
             Y   SY+V+A P G+ + +CR      +     C +  C+F GVW+GG G G +N++++S
Sbjct  293   YGGASYEVSASPTGADVDSCRAFTSMALKVNETCTHMQCSFGGVWNGGRGDGQKNLFVAS  352

Query  1062  FFYDIATDVGIIDQEKASKIVKPRSFLVAAKLACETKFEDVKSTFPNAVEKDYPYLCMDL  1241
             FF+D A + G ID EK    V+P  F  AAKLAC T  E+ KS + +    + PYLCMDL
Sbjct  353   FFFDRAAEAGFIDSEKPVVTVRPSDFEEAAKLACGTTIEEGKSKYTHVESDNLPYLCMDL  412

Query  1242  VYEYTLLVDGLGLHPYKEITLMKKVEYKNYMVEAAWPLGCAIDVISS  1382
             +Y+YTLLV+G GL P +++TL+KKV Y N +VEAAWPLG AIDV+SS
Sbjct  413   IYQYTLLVNGFGLAPSQKMTLVKKVPYGNSLVEAAWPLGSAIDVMSS  459



>ref|XP_010246579.1| PREDICTED: probable apyrase 1 [Nelumbo nucifera]
Length=469

 Score =   468 bits (1203),  Expect = 2e-156, Method: Compositional matrix adjust.
 Identities = 235/414 (57%), Positives = 303/414 (73%), Gaps = 1/414 (0%)
 Frame = +3

Query  150   RRVLLS-HETGNYAVIFDAGSTGSRVHVFHFDENLDLLPIGDGVEFFLKTTPGLSSYAND  326
             RR LL   E+ NYAVIFDAGS+GSRVHVF FD+ L+LLPIG+ +E F++T PGLS+YAN 
Sbjct  56    RRGLLELRESRNYAVIFDAGSSGSRVHVFCFDKTLNLLPIGNVLELFVQTKPGLSAYANA  115

Query  327   PEAAAKSLEPLLLEAEGVVPTELQPDTPLELGATAGLRLLEGDASDKILQAVRDMFKNES  506
             PE AA SL  LL +AE VVP EL+  TP+ +GATAGLR LEGD SD+ILQAVRD+  N+S
Sbjct  116   PEKAADSLLSLLQQAENVVPKELRNKTPVRVGATAGLRALEGDTSDRILQAVRDLLVNKS  175

Query  507   NFKSKAEWVSILEGSQEGTYFWVAMNYLLGNLGKGYQNTIATIDLGGGSVQVSYAVSGDT  686
             + KSK EWV++L G+QEG Y W  +NYLLG +GK Y NT+  +DLGGGSVQ++YA+S   
Sbjct  176   SLKSKPEWVTVLGGTQEGAYQWATINYLLGRVGKKYSNTVGIVDLGGGSVQMAYAISEKA  235

Query  687   FANAPTPDNGEEPYVQEKYILGAQYYLYVHSYLNYGQLASRAEIFKASGNSTNPCVLEGY  866
                AP   NGE+ YV+E ++ G +YYLYVHSYLNYG LASRAEI KA G+S NPC+L GY
Sbjct  236   AEKAPAVKNGEDSYVKELFLKGTKYYLYVHSYLNYGLLASRAEILKAVGSSENPCILNGY  295

Query  867   DGYYTYNDVSYKVTAPPNGSSLKNCRKLARKVVDFRAPCKYQNCTFNGVWSGGGGAGMEN  1046
              G Y Y    Y+V++  +GS++  CR  A K +     C +  CTF GVW+GGGG G +N
Sbjct  296   HGSYIYGGHVYEVSSSASGSNINECRGAAFKALKVNESCTHMKCTFGGVWNGGGGVGQKN  355

Query  1047  VYISSFFYDIATDVGIIDQEKASKIVKPRSFLVAAKLACETKFEDVKSTFPNAVEKDYPY  1226
             ++++SFF+D A + G ID  K    V+P  F  AAK ACETK  D +S +P   + + PY
Sbjct  356   LFVASFFFDRAAEAGFIDSNKPVAKVRPVDFEEAAKRACETKLADAESIYPLVEKDNLPY  415

Query  1227  LCMDLVYEYTLLVDGLGLHPYKEITLMKKVEYKNYMVEAAWPLGCAIDVISSSS  1388
             LCMDLVY++TLLVDG  L P++EITL+K+V+Y + ++EAAWPLG AI+V+SSS+
Sbjct  416   LCMDLVYQFTLLVDGFALDPWQEITLVKQVKYGDSLLEAAWPLGSAIEVVSSST  469



>ref|XP_002325398.1| putative apyrase family protein [Populus trichocarpa]
 gb|ABK94907.1| unknown [Populus trichocarpa]
 gb|EEE99779.1| putative apyrase family protein [Populus trichocarpa]
Length=457

 Score =   465 bits (1197),  Expect = 7e-156, Method: Compositional matrix adjust.
 Identities = 240/429 (56%), Positives = 306/429 (71%), Gaps = 7/429 (2%)
 Frame = +3

Query  132   FSRPHL----RRVLLSHETGNYAVIFDAGSTGSRVHVFHFDENLDLLPIGDGV--EFFLK  293
             F+ P +    R   L  ++ +YAV+FDAGSTGSRVHVF FD+N DLLP+G+    EFF +
Sbjct  29    FTNPRIVLPVRSKGLDADSRSYAVVFDAGSTGSRVHVFCFDQNFDLLPVGNDTDFEFFAQ  88

Query  294   TTPGLSSYANDPEAAAKSLEPLLLEAEGVVPTELQPDTPLELGATAGLRLLEGDASDKIL  473
               PGLS+YA DP+AAA SL PLL EAE VVP E  P TP++LGATAGLRLLEGD++++IL
Sbjct  89    VRPGLSAYAKDPQAAANSLVPLLNEAESVVPEEFSPKTPVKLGATAGLRLLEGDSAERIL  148

Query  474   QAVRDMFKNESNFKSKAEWVSILEGSQEGTYFWVAMNYLLGNLGKGYQNTIATIDLGGGS  653
             +AVRD+  + S  + +A+ VSIL GSQEG Y W+A+NY++GNLGK Y  T A ID GGGS
Sbjct  149   EAVRDLLSHGS-LEYEADDVSILSGSQEGYYMWIAINYMVGNLGKPYSETAAVIDQGGGS  207

Query  654   VQVSYAVSGDTFANAPTPDNGEEPYVQEKYILGAQYYLYVHSYLNYGQLASRAEIFKASG  833
             VQ++YA+S +    APT  +GE+PYV++  + GA+YY+YVHSYL+YG LASRAEI K S 
Sbjct  208   VQMAYAISRENAEKAPTVADGEDPYVEKFLLRGAEYYVYVHSYLSYGLLASRAEILKVSR  267

Query  834   NSTNPCVLEGYDGYYTYNDVSYKVTAPPNGSSLKNCRKLARKVVDFRAPCKYQNCTFNGV  1013
             NS+N CV  GY+G Y Y    YK ++ P G+S K CR L  K +   APC Y NCTF GV
Sbjct  268   NSSNECVATGYNGVYKYGGKEYKASSSPTGTSFKKCRTLVLKALKVNAPCNYVNCTFGGV  327

Query  1014  WSGGGGAGMENVYISSFFYDIATDVGIIDQEKASKIVKPRSFLVAAKLACETKFEDVKST  1193
             W+GGGG G  N Y SSFF+ ++   G +D    +       F  AAK ACET+FED  S 
Sbjct  328   WNGGGGDGQNNFYASSFFFSMSQAAGFVDANAYTATASAADFKKAAKRACETRFEDASSR  387

Query  1194  FPNAVEKDYPYLCMDLVYEYTLLVDGLGLHPYKEITLMKKVEYKNYMVEAAWPLGCAIDV  1373
             FPNA+E+D P+LCMD  YEYTLLVDG GLHP K+ ++ +KV+YKN ++EAAWPLG AI+ 
Sbjct  388   FPNALEEDLPFLCMDFTYEYTLLVDGFGLHPQKKFSVEEKVKYKNSLMEAAWPLGSAIEA  447

Query  1374  ISSSSANNL  1400
             +S SSA+ L
Sbjct  448   VSPSSASFL  456



>gb|ADD09804.1| ectoapyrase 2 [Gossypium hirsutum]
Length=469

 Score =   466 bits (1198),  Expect = 8e-156, Method: Compositional matrix adjust.
 Identities = 228/401 (57%), Positives = 301/401 (75%), Gaps = 0/401 (0%)
 Frame = +3

Query  180   NYAVIFDAGSTGSRVHVFHFDENLDLLPIGDGVEFFLKTTPGLSSYANDPEAAAKSLEPL  359
             NYAVIFDAGS+GSRVHV+ FD+NLDL+PIG  +E F +  PGLSSYA DP+AAAKSL  L
Sbjct  69    NYAVIFDAGSSGSRVHVYCFDQNLDLVPIGSELELFEQLKPGLSSYAKDPQAAAKSLLSL  128

Query  360   LLEAEGVVPTELQPDTPLELGATAGLRLLEGDASDKILQAVRDMFKNESNFKSKAEWVSI  539
             L +AE VVP +L+  TP+ +GATAGLR LEGDA+D+ILQAVR++ K+ S  KS+A  V I
Sbjct  129   LNKAESVVPLDLRSKTPVRVGATAGLRALEGDAADRILQAVRELLKDRSTLKSEANGVKI  188

Query  540   LEGSQEGTYFWVAMNYLLGNLGKGYQNTIATIDLGGGSVQVSYAVSGDTFANAPTPDNGE  719
             L+G+QEG+Y WV +NYLLG LG  Y++T+  IDLGGGSVQ++YA+S +  +NAP+   G+
Sbjct  189   LDGTQEGSYEWVTINYLLGKLGGTYKDTVGIIDLGGGSVQMAYAISKEAASNAPSVPAGQ  248

Query  720   EPYVQEKYILGAQYYLYVHSYLNYGQLASRAEIFKASGNSTNPCVLEGYDGYYTYNDVSY  899
             + YV E Y+ G++YYLYVHSYL YG LA+RAEI KAS +S NPC+LEG+DG Y Y    Y
Sbjct  249   DNYVNEMYLKGSKYYLYVHSYLRYGLLAARAEILKASDDSGNPCILEGFDGTYAYGGNQY  308

Query  900   KVTAPPNGSSLKNCRKLARKVVDFRAPCKYQNCTFNGVWSGGGGAGMENVYISSFFYDIA  1079
             K +AP +G+S++ CR++  K +     C +  CTF G+W+GGGG G +N++I+SFF+D A
Sbjct  309   KASAPSSGASMEECRRVTHKALKINDTCMHMKCTFGGIWNGGGGDGQKNLFIASFFFDRA  368

Query  1080  TDVGIIDQEKASKIVKPRSFLVAAKLACETKFEDVKSTFPNAVEKDYPYLCMDLVYEYTL  1259
              + G I        V+P SF  AAK AC TK+ D+K+T+P     +  YLC+DLVY+YTL
Sbjct  369   AEAGFIKAADPVATVQPHSFAEAAKRACGTKYTDIKATYPAVDVGNQAYLCLDLVYQYTL  428

Query  1260  LVDGLGLHPYKEITLMKKVEYKNYMVEAAWPLGCAIDVISS  1382
             LVDG GL PY++ITL+KKV+++N  VEAAWPLG AI+ +SS
Sbjct  429   LVDGFGLDPYQDITLVKKVKFRNSFVEAAWPLGSAIEAVSS  469



>ref|XP_003548774.1| PREDICTED: nucleoside-triphosphatase-like [Glycine max]
Length=459

 Score =   465 bits (1197),  Expect = 9e-156, Method: Compositional matrix adjust.
 Identities = 230/413 (56%), Positives = 300/413 (73%), Gaps = 2/413 (0%)
 Frame = +3

Query  150   RRVLLSHET--GNYAVIFDAGSTGSRVHVFHFDENLDLLPIGDGVEFFLKTTPGLSSYAN  323
             R++ L  +    +YAVIFD GSTG+RVHVFHFD+NLDLLPIGD +E   K TPGLS+Y +
Sbjct  36    RKIFLKKDNIITSYAVIFDGGSTGTRVHVFHFDQNLDLLPIGDSLELNKKITPGLSAYED  95

Query  324   DPEAAAKSLEPLLLEAEGVVPTELQPDTPLELGATAGLRLLEGDASDKILQAVRDMFKNE  503
             DPE AA+SL PLL EAE VVP +L+P+TP+ LGATAGLRLL+G+AS++ILQAVRDM  N 
Sbjct  96    DPEQAAESLIPLLEEAESVVPEDLRPNTPVRLGATAGLRLLKGNASEQILQAVRDMLSNR  155

Query  504   SNFKSKAEWVSILEGSQEGTYFWVAMNYLLGNLGKGYQNTIATIDLGGGSVQVSYAVSGD  683
             S    +++ V+IL+G+QE  Y WVA+NYLLGNLGK    T+   DLGGGSVQ++YAVS +
Sbjct  156   STLNLQSDAVTILDGNQEAAYMWVALNYLLGNLGKVISKTVGVADLGGGSVQMAYAVSKN  215

Query  684   TFANAPTPDNGEEPYVQEKYILGAQYYLYVHSYLNYGQLASRAEIFKASGNSTNPCVLEG  863
             T  NAP P  GEE Y++   + G  Y LYVHSYL++G+ ASRAE+ K +G+S NPC+L G
Sbjct  216   TAKNAPQPPEGEESYIKTLVLNGKTYDLYVHSYLHFGKEASRAEMLKVTGDSANPCILAG  275

Query  864   YDGYYTYNDVSYKVTAPPNGSSLKNCRKLARKVVDFRAPCKYQNCTFNGVWSGGGGAGME  1043
             Y+G YTY+ V YK  A  +GS+   CR++A K +    PC +QNCTF G+W+GGGG+G +
Sbjct  276   YNGTYTYSGVKYKALASTSGSNFDKCREVALKALKVNEPCPHQNCTFGGIWNGGGGSGQK  335

Query  1044  NVYISSFFYDIATDVGIIDQEKASKIVKPRSFLVAAKLACETKFEDVKSTFPNAVEKDYP  1223
              +Y+++ FY +    GI D  K S  V P  F  AAK AC+ KFED +ST+P  +E   P
Sbjct  336   VLYVTTSFYYLVIQAGIADASKTSSKVYPAEFKAAAKRACQVKFEDAQSTYPLMMEDALP  395

Query  1224  YLCMDLVYEYTLLVDGLGLHPYKEITLMKKVEYKNYMVEAAWPLGCAIDVISS  1382
             Y+CMD+ Y+YTLLVDG GL P+KEI +  ++EY+  +VE AWPLG AI+ ISS
Sbjct  396   YICMDITYQYTLLVDGFGLDPWKEIIVANEIEYQGALVEGAWPLGSAIEAISS  448



>gb|AAO23007.1| apyrase-like protein [Medicago truncatula]
 gb|AES80797.2| GDA1/CD39 nucleoside phosphatase family protein [Medicago truncatula]
Length=467

 Score =   465 bits (1197),  Expect = 1e-155, Method: Compositional matrix adjust.
 Identities = 229/404 (57%), Positives = 305/404 (75%), Gaps = 3/404 (1%)
 Frame = +3

Query  177   GNYAVIFDAGSTGSRVHVFHFDENLDLLPIGDGVEFFLKTTPGLSSYANDPEAAAKSLEP  356
             G+YAVIFDAGS+GSRVHVFHFD+NLDL+ IG  +E F +  PGLS+YA  P+ AA+SL  
Sbjct  66    GSYAVIFDAGSSGSRVHVFHFDQNLDLVHIGKDLELFEQLKPGLSAYAQKPQQAAESLVS  125

Query  357   LLLEAEGVVPTELQPDTPLELGATAGLRLLEGDASDKILQAVRDMFKNESNFKSKAEWVS  536
             LL +AEGVVP EL+  TP+ +GATAGLR LEGDASDKIL+AVRD+ K+ S+FKS A+ V+
Sbjct  126   LLEKAEGVVPRELRSKTPVRIGATAGLRALEGDASDKILRAVRDLLKHRSSFKSDADAVT  185

Query  537   ILEGSQEGTYFWVAMNYLLGNLGKGYQNTIATIDLGGGSVQVSYAVSGDTFANAPTPDNG  716
             +L+G+QEG Y WV +NYLLGNLGK Y  T+  +DLGGGSVQ++YA+S    A AP   +G
Sbjct  186   VLDGTQEGAYQWVTINYLLGNLGKDYSKTVGVVDLGGGSVQMAYAISESEAAMAPQVMDG  245

Query  717   EEPYVQEKYILGAQYYLYVHSYLNYGQLASRAEIFKASGNSTNPCVLEGYDGYYTYNDVS  896
             E+PYV+E ++ G +YYLYVHSYL YG LA+RAEI K +G++ NPC+L G DG Y Y   S
Sbjct  246   EDPYVKEMFLRGRKYYLYVHSYLRYGLLAARAEILKVAGDAENPCILSGSDGTYKYGGKS  305

Query  897   YKVTAPPNGSSLKNCRKLARKVVDF-RAPCKYQNCTFNGVWSGGGGAGMENVYISSFFYD  1073
             +K ++  +G+SL  C+ +A K +    + C +  CTF G+W+GGGG G +N++++SFF+D
Sbjct  306   FKASS--SGASLNECKSVAHKALKVNESTCTHMKCTFGGIWNGGGGDGQKNLFVASFFFD  363

Query  1074  IATDVGIIDQEKASKIVKPRSFLVAAKLACETKFEDVKSTFPNAVEKDYPYLCMDLVYEY  1253
              A + G +D      IV+P  F  AAK AC+TK E+ KST+P   E + PYLCMDLVY+Y
Sbjct  364   RAAEAGFVDPNSPVAIVRPADFEDAAKQACQTKLENAKSTYPRVEEGNLPYLCMDLVYQY  423

Query  1254  TLLVDGLGLHPYKEITLMKKVEYKNYMVEAAWPLGCAIDVISSS  1385
             TLLVDG G++P++EITL+KKV+Y + +VEAAWPLG AI+ +SS+
Sbjct  424   TLLVDGFGIYPWQEITLVKKVKYDDALVEAAWPLGSAIEAVSST  467



>gb|KHG24482.1| Nucleoside-triphosphatase [Gossypium arboreum]
Length=469

 Score =   464 bits (1195),  Expect = 3e-155, Method: Compositional matrix adjust.
 Identities = 228/401 (57%), Positives = 301/401 (75%), Gaps = 0/401 (0%)
 Frame = +3

Query  180   NYAVIFDAGSTGSRVHVFHFDENLDLLPIGDGVEFFLKTTPGLSSYANDPEAAAKSLEPL  359
             NYAVIFDAGS+GSRVHV+ FD+NLDL+PIG  +E F +  PGLSSYA DP+AAAKSL  L
Sbjct  69    NYAVIFDAGSSGSRVHVYCFDQNLDLVPIGSELELFEQLKPGLSSYAKDPQAAAKSLLSL  128

Query  360   LLEAEGVVPTELQPDTPLELGATAGLRLLEGDASDKILQAVRDMFKNESNFKSKAEWVSI  539
             L +AE VVP +L+  TP+ +GATAGLR LEGDA+D+ILQAVR++ K+ S  KS+A  V I
Sbjct  129   LDKAESVVPLDLRSKTPVRVGATAGLRALEGDAADRILQAVRELLKDRSTLKSEANGVKI  188

Query  540   LEGSQEGTYFWVAMNYLLGNLGKGYQNTIATIDLGGGSVQVSYAVSGDTFANAPTPDNGE  719
             L+G+QEG+Y WV +NYLLG LG  Y++T+  IDLGGGSVQ++YA+S +  +NAP+   G+
Sbjct  189   LDGTQEGSYEWVTVNYLLGKLGGTYKDTVGIIDLGGGSVQMAYAISKEAASNAPSVPAGQ  248

Query  720   EPYVQEKYILGAQYYLYVHSYLNYGQLASRAEIFKASGNSTNPCVLEGYDGYYTYNDVSY  899
             + YV E Y+ G++YYLYVHSYL YG LA+RAEI KAS +S NPC+LEG+DG Y Y    Y
Sbjct  249   DNYVNEMYLKGSKYYLYVHSYLCYGLLAARAEILKASDDSGNPCILEGFDGTYAYGGNQY  308

Query  900   KVTAPPNGSSLKNCRKLARKVVDFRAPCKYQNCTFNGVWSGGGGAGMENVYISSFFYDIA  1079
             K +AP +G+S++ CR++  K +     C +  CTF G+W+GGGG G +N++I+SFF+D A
Sbjct  309   KASAPSSGASMEECRRVTHKALKINDTCMHMKCTFGGIWNGGGGDGQKNLFIASFFFDRA  368

Query  1080  TDVGIIDQEKASKIVKPRSFLVAAKLACETKFEDVKSTFPNAVEKDYPYLCMDLVYEYTL  1259
              + G I        V+P SF  AAK AC TK+ D+K+T+P     +  YLC+DLVY+YTL
Sbjct  369   AEAGFIKAADPVATVQPHSFAEAAKRACGTKYTDIKATYPAVDVGNQAYLCLDLVYQYTL  428

Query  1260  LVDGLGLHPYKEITLMKKVEYKNYMVEAAWPLGCAIDVISS  1382
             LVDG GL PY++ITL+KKV+++N  VEAAWPLG AI+ +SS
Sbjct  429   LVDGFGLDPYQDITLVKKVKFRNSFVEAAWPLGSAIEAVSS  469



>dbj|BAK78981.1| apyrase [Mimosa pudica]
Length=470

 Score =   464 bits (1194),  Expect = 3e-155, Method: Compositional matrix adjust.
 Identities = 230/418 (55%), Positives = 305/418 (73%), Gaps = 1/418 (0%)
 Frame = +3

Query  132   FSRPHLRRVLLSHETGNYAVIFDAGSTGSRVHVFHFDENLDLLPIGDGVEFFLKTTPGLS  311
             ++  H +   ++  + +YAVIFDAGS+GSRVHVFHFD+NLDL+ I   +E FL+  PGLS
Sbjct  52    YALTHRKMAPINKLSNSYAVIFDAGSSGSRVHVFHFDQNLDLVSIDGELELFLQIKPGLS  111

Query  312   SYANDPEAAAKSLEPLLLEAEGVVPTELQPDTPLELGATAGLRLLEGDASDKILQAVRDM  491
             +YA DP  AA+SL  LL +AE VVP EL+  TP+ +GATAGLR LEGDASDKILQAVRD+
Sbjct  112   AYAQDPRQAAESLVSLLDKAESVVPRELRSKTPVRVGATAGLRALEGDASDKILQAVRDL  171

Query  492   FKNESNFKSKAEWVSILEGSQEGTYFWVAMNYLLGNLGKGYQNTIATIDLGGGSVQVSYA  671
              K+ S  K++A+ V++L+G+QEG Y WV +NYLLGNLGK Y  T+  +DLGGGSVQ++YA
Sbjct  172   LKDRSLLKAEADAVTVLDGAQEGVYQWVTINYLLGNLGKDYSKTVGVVDLGGGSVQMAYA  231

Query  672   VSGDTFANAPTPDNGEEPYVQEKYILGAQYYLYVHSYLNYGQLASRAEIFKASGNSTNPC  851
             +S      AP   +G +PYV+E ++ G +YY+YVHSYL YG LA+RAEI K SG+S NPC
Sbjct  232   ISETDADKAPKSLDGADPYVKEMFLRGRKYYVYVHSYLRYGLLAARAEILKVSGDSENPC  291

Query  852   VLEGYDGYYTYNDVSYKVTAPPNGSSLKNCRKLARKVVDF-RAPCKYQNCTFNGVWSGGG  1028
             +L GYDG+Y Y   S+K +A P+G+SL  CR  A + +    + C Y  CTF G+W+GGG
Sbjct  292   ILAGYDGFYKYGGRSFKASAYPSGASLSECRSTALQALRANESSCTYMKCTFGGIWNGGG  351

Query  1029  GAGMENVYISSFFYDIATDVGIIDQEKASKIVKPRSFLVAAKLACETKFEDVKSTFPNAV  1208
             G G EN++++SFF+D A + G +D +  +  V+P +F  AAK ACE   ED KST+ +  
Sbjct  352   GDGQENLFVASFFFDRAAEAGFVDSKLPTATVRPVNFKEAAKRACEKNIEDAKSTYKHVD  411

Query  1209  EKDYPYLCMDLVYEYTLLVDGLGLHPYKEITLMKKVEYKNYMVEAAWPLGCAIDVISS  1382
             E + PYLCMDLVY+YTLLVDG GL P +EITL+K+V+Y   +VEAAWPLG AI+ +SS
Sbjct  412   EGNLPYLCMDLVYQYTLLVDGFGLDPQQEITLVKQVKYNGALVEAAWPLGSAIEAVSS  469



>ref|XP_007161808.1| hypothetical protein PHAVU_001G099900g [Phaseolus vulgaris]
 gb|ESW33802.1| hypothetical protein PHAVU_001G099900g [Phaseolus vulgaris]
Length=454

 Score =   463 bits (1191),  Expect = 6e-155, Method: Compositional matrix adjust.
 Identities = 220/413 (53%), Positives = 290/413 (70%), Gaps = 2/413 (0%)
 Frame = +3

Query  150   RRVLLSHETG--NYAVIFDAGSTGSRVHVFHFDENLDLLPIGDGVEFFLKTTPGLSSYAN  323
             R++    E    +YA IFDAGSTGSRVHVFHFD+NLDLL IG+ +EF  K  PGLSSYA+
Sbjct  31    RKIFPKQEEAITSYAAIFDAGSTGSRVHVFHFDQNLDLLHIGNNLEFQQKVAPGLSSYAD  90

Query  324   DPEAAAKSLEPLLLEAEGVVPTELQPDTPLELGATAGLRLLEGDASDKILQAVRDMFKNE  503
             +PE AA+SL PLL  AE VVP +L   TPL+LGATAGLRLLEG+A++ IL AVRDMFKN 
Sbjct  91    EPEKAAQSLIPLLEAAENVVPQDLHFKTPLKLGATAGLRLLEGNAAENILNAVRDMFKNR  150

Query  504   SNFKSKAEWVSILEGSQEGTYFWVAMNYLLGNLGKGYQNTIATIDLGGGSVQVSYAVSGD  683
             S    +++ V+I++G+QEG+Y WVA+NYLLG LGK +  T+  +DLGGGSVQ++YAVS +
Sbjct  151   STLNVQSDAVTIIDGTQEGSYLWVAVNYLLGRLGKRFSKTVGVVDLGGGSVQMAYAVSRN  210

Query  684   TFANAPTPDNGEEPYVQEKYILGAQYYLYVHSYLNYGQLASRAEIFKASGNSTNPCVLEG  863
             T  NAP   +GE+PY+ + Y+ G +Y LYVHSYL YG+ + R EI K +G S NPCVL G
Sbjct  211   TAKNAPLVPDGEDPYINKLYVKGKKYDLYVHSYLRYGRESFRTEILKVTGGSANPCVLAG  270

Query  864   YDGYYTYNDVSYKVTAPPNGSSLKNCRKLARKVVDFRAPCKYQNCTFNGVWSGGGGAGME  1043
             Y+G YTY+ V Y V  P +GS+   CR++  + +    PC + NCTF G+W GG G+G  
Sbjct  271   YEGIYTYSGVEYAVYPPSSGSNYDACREIVLRAIKLNEPCSHPNCTFGGIWDGGKGSGQR  330

Query  1044  NVYISSFFYDIATDVGIIDQEKASKIVKPRSFLVAAKLACETKFEDVKSTFPNAVEKDYP  1223
              +Y +S FY +    G+ID E  + I++       AK AC   +ED KS++P   E+  P
Sbjct  331   TLYATSSFYYLPEQAGLIDAEAPNAIIRVVDLENLAKQACGKTYEDAKSSYPRVAEERVP  390

Query  1224  YLCMDLVYEYTLLVDGLGLHPYKEITLMKKVEYKNYMVEAAWPLGCAIDVISS  1382
             ++CMDL Y+Y LLVDG GL P +EITL  ++EY++ +VE AWPLG AI+ ISS
Sbjct  391   FICMDLTYQYALLVDGFGLDPLQEITLANEIEYQDAVVETAWPLGTAIEAISS  443



>ref|XP_003624579.1| Nucleoside-triphosphatase [Medicago truncatula]
Length=544

 Score =   466 bits (1199),  Expect = 7e-155, Method: Compositional matrix adjust.
 Identities = 229/404 (57%), Positives = 305/404 (75%), Gaps = 3/404 (1%)
 Frame = +3

Query  177   GNYAVIFDAGSTGSRVHVFHFDENLDLLPIGDGVEFFLKTTPGLSSYANDPEAAAKSLEP  356
             G+YAVIFDAGS+GSRVHVFHFD+NLDL+ IG  +E F +  PGLS+YA  P+ AA+SL  
Sbjct  143   GSYAVIFDAGSSGSRVHVFHFDQNLDLVHIGKDLELFEQLKPGLSAYAQKPQQAAESLVS  202

Query  357   LLLEAEGVVPTELQPDTPLELGATAGLRLLEGDASDKILQAVRDMFKNESNFKSKAEWVS  536
             LL +AEGVVP EL+  TP+ +GATAGLR LEGDASDKIL+AVRD+ K+ S+FKS A+ V+
Sbjct  203   LLEKAEGVVPRELRSKTPVRIGATAGLRALEGDASDKILRAVRDLLKHRSSFKSDADAVT  262

Query  537   ILEGSQEGTYFWVAMNYLLGNLGKGYQNTIATIDLGGGSVQVSYAVSGDTFANAPTPDNG  716
             +L+G+QEG Y WV +NYLLGNLGK Y  T+  +DLGGGSVQ++YA+S    A AP   +G
Sbjct  263   VLDGTQEGAYQWVTINYLLGNLGKDYSKTVGVVDLGGGSVQMAYAISESEAAMAPQVMDG  322

Query  717   EEPYVQEKYILGAQYYLYVHSYLNYGQLASRAEIFKASGNSTNPCVLEGYDGYYTYNDVS  896
             E+PYV+E ++ G +YYLYVHSYL YG LA+RAEI K +G++ NPC+L G DG Y Y   S
Sbjct  323   EDPYVKEMFLRGRKYYLYVHSYLRYGLLAARAEILKVAGDAENPCILSGSDGTYKYGGKS  382

Query  897   YKVTAPPNGSSLKNCRKLARKVVDF-RAPCKYQNCTFNGVWSGGGGAGMENVYISSFFYD  1073
             +K ++  +G+SL  C+ +A K +    + C +  CTF G+W+GGGG G +N++++SFF+D
Sbjct  383   FKASS--SGASLNECKSVAHKALKVNESTCTHMKCTFGGIWNGGGGDGQKNLFVASFFFD  440

Query  1074  IATDVGIIDQEKASKIVKPRSFLVAAKLACETKFEDVKSTFPNAVEKDYPYLCMDLVYEY  1253
              A + G +D      IV+P  F  AAK AC+TK E+ KST+P   E + PYLCMDLVY+Y
Sbjct  441   RAAEAGFVDPNSPVAIVRPADFEDAAKQACQTKLENAKSTYPRVEEGNLPYLCMDLVYQY  500

Query  1254  TLLVDGLGLHPYKEITLMKKVEYKNYMVEAAWPLGCAIDVISSS  1385
             TLLVDG G++P++EITL+KKV+Y + +VEAAWPLG AI+ +SS+
Sbjct  501   TLLVDGFGIYPWQEITLVKKVKYDDALVEAAWPLGSAIEAVSST  544



>ref|XP_003624587.1| Nod factor binding lectin-nucleotide phosphohydrolase [Medicago 
truncatula]
 gb|AAO23005.1| apyrase-like protein [Medicago truncatula]
 gb|AES80805.1| Nod factor-binding lectin-nucleotide phosphohydrolase [Medicago 
truncatula]
Length=455

 Score =   462 bits (1190),  Expect = 9e-155, Method: Compositional matrix adjust.
 Identities = 218/412 (53%), Positives = 303/412 (74%), Gaps = 1/412 (0%)
 Frame = +3

Query  150   RRVLLSHET-GNYAVIFDAGSTGSRVHVFHFDENLDLLPIGDGVEFFLKTTPGLSSYAND  326
             R++    ET  +YAVIFDAGSTG+RVHV+HFD+NLDLL IG+ +EF  K  PGLS+YA++
Sbjct  33    RKIFQKQETLTSYAVIFDAGSTGTRVHVYHFDQNLDLLHIGNDIEFVDKIKPGLSAYADN  92

Query  327   PEAAAKSLEPLLLEAEGVVPTELQPDTPLELGATAGLRLLEGDASDKILQAVRDMFKNES  506
             PE AAKSL PLL EAE V+P ++ P TPL LGATAGLRLL GDA++KILQA R+MF N S
Sbjct  93    PEQAAKSLLPLLEEAEDVIPEDMHPKTPLRLGATAGLRLLNGDAAEKILQATRNMFSNRS  152

Query  507   NFKSKAEWVSILEGSQEGTYFWVAMNYLLGNLGKGYQNTIATIDLGGGSVQVSYAVSGDT  686
                 +++ VSI++G+QEG+Y WV +NY+LGNLGK +  T+  IDLGGGSVQ++YAVS  T
Sbjct  153   TLNVQSDAVSIIDGTQEGSYMWVTVNYILGNLGKSFTKTVGVIDLGGGSVQMTYAVSKKT  212

Query  687   FANAPTPDNGEEPYVQEKYILGAQYYLYVHSYLNYGQLASRAEIFKASGNSTNPCVLEGY  866
               NAP   +GE+PY+++  + G QY LYVHSYL +G+ A+RA++  A+  S NPC+L G+
Sbjct  213   AKNAPKVADGEDPYIKKLVLKGKQYDLYVHSYLRFGKEATRAQVLNATNGSANPCILPGF  272

Query  867   DGYYTYNDVSYKVTAPPNGSSLKNCRKLARKVVDFRAPCKYQNCTFNGVWSGGGGAGMEN  1046
             +G +TY+ V YK  +P +GS+   C+++  KV+    PC Y +CTF+G+W+GGGG+G + 
Sbjct  273   NGTFTYSGVEYKAFSPSSGSNFNECKEIILKVLKVNDPCPYSSCTFSGIWNGGGGSGQKK  332

Query  1047  VYISSFFYDIATDVGIIDQEKASKIVKPRSFLVAAKLACETKFEDVKSTFPNAVEKDYPY  1226
             ++++S F  +  DVG+++  K + I+ P  F + AK AC   FEDVKST+P   E   PY
Sbjct  333   LFVTSAFAYLTEDVGMVEPNKPNSILHPIDFEIEAKRACALNFEDVKSTYPRLTEAKRPY  392

Query  1227  LCMDLVYEYTLLVDGLGLHPYKEITLMKKVEYKNYMVEAAWPLGCAIDVISS  1382
             +CMDL+Y++ LLV G GL P KEIT+ + ++Y+N +VEAAWPLG A++ IS+
Sbjct  393   VCMDLLYQHVLLVHGFGLSPRKEITVGEGIQYQNSVVEAAWPLGTAVEAIST  444



>ref|XP_009770744.1| PREDICTED: apyrase 2-like [Nicotiana sylvestris]
Length=472

 Score =   463 bits (1191),  Expect = 1e-154, Method: Compositional matrix adjust.
 Identities = 234/402 (58%), Positives = 299/402 (74%), Gaps = 1/402 (0%)
 Frame = +3

Query  180   NYAVIFDAGSTGSRVHVFHFDENLDLLPIGDGVEFFLKTTPGLSSYANDPEAAAKSLEPL  359
              YAVIFDAGS+GSRVHVF FDENLDL+PIG+ +E F++  PGLSSYA+DPEAAA+SL  L
Sbjct  69    RYAVIFDAGSSGSRVHVFCFDENLDLVPIGNELELFVQEKPGLSSYASDPEAAAESLLSL  128

Query  360   LLEAEGVVPTELQPDTPLELGATAGLRLLEGDASDKILQAVRDMFKNESNFKSKAEWVSI  539
             L EAE VVP  L+ +TP+ +GATAGLR LEGDASD+ILQAVRD  K++S+FK+KA+ V++
Sbjct  129   LKEAENVVPRNLRSNTPVRVGATAGLRQLEGDASDRILQAVRDFLKSKSSFKAKADAVTV  188

Query  540   LEGSQEGTYFWVAMNYLLGNLGKGYQNTIATIDLGGGSVQVSYAVSGDTFANAPTPDNGE  719
             L+G+QEG Y WV +NYLLG LGK Y +T+  +DLGGGSVQ++YA+S      AP   +GE
Sbjct  189   LDGNQEGAYQWVTINYLLGKLGKKYSDTVGVVDLGGGSVQMAYAISESDAQKAPKVSDGE  248

Query  720   EPYVQEKYILGAQYYLYVHSYLNYGQLASRAEIFKASGNSTNPCVLEGYDGYYTYNDVSY  899
             + YVQE Y+ G +YYLY+HSYL+YG LA+RAEI KA+  S NPC+L GY G Y Y    Y
Sbjct  249   DTYVQEMYLKGTKYYLYIHSYLHYGLLAARAEILKATDESGNPCILGGYHGSYKYGGAVY  308

Query  900   KVTAPPNGSSLKNCRKLARKVVDFRAP-CKYQNCTFNGVWSGGGGAGMENVYISSFFYDI  1076
               +A   GSSL +C +++ K +    P C +  CTF GVW+GGGG G +N++++SFF+D 
Sbjct  309   PASAMSQGSSLSSCMEVSLKALKVNEPTCTHMKCTFGGVWNGGGGDGQKNMFVASFFFDR  368

Query  1077  ATDVGIIDQEKASKIVKPRSFLVAAKLACETKFEDVKSTFPNAVEKDYPYLCMDLVYEYT  1256
             A + G+I+   A   V+P  +  AAK ACET  E  KS FP     + PY+CMDLVY+YT
Sbjct  369   AAEAGMINPSLAVAKVRPVDYESAAKRACETGLEGAKSAFPRVDPDNLPYMCMDLVYQYT  428

Query  1257  LLVDGLGLHPYKEITLMKKVEYKNYMVEAAWPLGCAIDVISS  1382
             LLVDG GL P +EITL+KKV+YKN +VEAAWPLG AI+V SS
Sbjct  429   LLVDGFGLDPQQEITLVKKVQYKNSLVEAAWPLGSAIEVASS  470



>ref|XP_004493134.1| PREDICTED: nucleoside-triphosphatase-like isoform X1 [Cicer arietinum]
Length=456

 Score =   462 bits (1189),  Expect = 1e-154, Method: Compositional matrix adjust.
 Identities = 224/413 (54%), Positives = 304/413 (74%), Gaps = 2/413 (0%)
 Frame = +3

Query  150   RRVLLSHET-GNYAVIFDAGSTGSRVHVFHFDENLDLLPIGDGVEFFLKTTPGLSSYAND  326
             R++    ET  +YAVIFDAGSTGSRVHV+HFD+NLDLL IG  VEF+ K  PGLS+Y ++
Sbjct  33    RKIFQKQETITSYAVIFDAGSTGSRVHVYHFDQNLDLLHIGKDVEFYNKIKPGLSAYGDN  92

Query  327   PEAAAKSLEPLLLEAEGVVPTELQPDTPLELGATAGLRLLEGDASDKILQAVRDMFKNES  506
             PE AA SL PLL +A+ V+P ++ P TP+ LGATAGLRLL+GDAS+KILQAVRDM  N S
Sbjct  93    PEQAANSLIPLLEQAQNVIPEDVHPKTPVRLGATAGLRLLDGDASEKILQAVRDMLSNRS  152

Query  507   NFKSKAEWVSILEGSQEGTYFWVAMNYLLGNLGKGYQNTIATIDLGGGSVQVSYAVSGDT  686
             +F  + + VSI++G+QEG+Y WV +NY+LGNLGK Y  T+  +DLGGGS+Q++YAVS  T
Sbjct  153   SFIVQPDAVSIIDGTQEGSYLWVTVNYVLGNLGKKYTKTVGVMDLGGGSLQMAYAVSKKT  212

Query  687   FANAPTPDNGEEPYVQEKYILGAQYYLYVHSYLNYGQLASRAEIFKASGNSTNPCVLEGY  866
               NAP   +G +PY+++  + G  Y LYVHSYL++G+ ASRAEI K + +S NPC+L G+
Sbjct  213   AQNAPKVADGNDPYIKKIVLKGKPYDLYVHSYLHFGREASRAEILKVTKHSANPCILAGF  272

Query  867   DGYYTYNDVSYKVTAPPNGSSLKNCRKLARKVVDFRAPCKYQNCTFNGVWSGGGGAGMEN  1046
             DG YTY+   YK TAP +G++   C+K+ RK +    PC YQNCTF G+W+GGGG+G ++
Sbjct  273   DGIYTYSGEEYKATAPASGANFNKCKKIIRKALKLNYPCPYQNCTFAGIWNGGGGSGQKH  332

Query  1047  VYISSFFYDIATDVGIIDQEKASKIVKPRSFLVAAKLACETKFEDVKSTFPNAV-EKDYP  1223
             ++ +S F+ +  DVG++D +  +  ++P    + AK AC   FED KST+P  V EK  P
Sbjct  333   LFATSSFFYLPEDVGMVDSKTRNFKIRPLDLEIEAKRACSLTFEDAKSTYPLLVEEKIVP  392

Query  1224  YLCMDLVYEYTLLVDGLGLHPYKEITLMKKVEYKNYMVEAAWPLGCAIDVISS  1382
             Y CMDL+Y+Y LLVDG GL P +EIT  K++EY++ +VEA+WPLG A++ ISS
Sbjct  393   YACMDLLYQYELLVDGFGLDPLQEITAGKEIEYQDAIVEASWPLGNAVEAISS  445



>dbj|BAK78982.1| apyrase [Mimosa pudica]
Length=470

 Score =   462 bits (1190),  Expect = 2e-154, Method: Compositional matrix adjust.
 Identities = 229/418 (55%), Positives = 305/418 (73%), Gaps = 1/418 (0%)
 Frame = +3

Query  132   FSRPHLRRVLLSHETGNYAVIFDAGSTGSRVHVFHFDENLDLLPIGDGVEFFLKTTPGLS  311
             ++  H +   ++  + +YAVIFDAGS+GSRVHVFHFD+NLDL+ I   +E FL+  PGLS
Sbjct  52    YALTHRKMAPINKLSNSYAVIFDAGSSGSRVHVFHFDQNLDLVSIDGELELFLQIKPGLS  111

Query  312   SYANDPEAAAKSLEPLLLEAEGVVPTELQPDTPLELGATAGLRLLEGDASDKILQAVRDM  491
             +YA DP  AA+SL  LL +AE VVP EL+  TP+ +GATAGLR LEGDASDKILQAVRD+
Sbjct  112   AYAQDPRQAAESLVSLLDKAESVVPRELRSKTPVRVGATAGLRALEGDASDKILQAVRDL  171

Query  492   FKNESNFKSKAEWVSILEGSQEGTYFWVAMNYLLGNLGKGYQNTIATIDLGGGSVQVSYA  671
              K+ S  K++A+ V++L+G+QEG Y WV +NYLLGNLGK Y  T+  +DLGGGSVQ++YA
Sbjct  172   LKDRSLLKAEADAVTVLDGTQEGVYQWVTINYLLGNLGKDYSKTVGVVDLGGGSVQMAYA  231

Query  672   VSGDTFANAPTPDNGEEPYVQEKYILGAQYYLYVHSYLNYGQLASRAEIFKASGNSTNPC  851
             +S      AP   +G +PYV+E ++ G +YY++VHSYL YG LA+RAEI K SG+S NPC
Sbjct  232   ISETDADKAPKSLDGADPYVKEMFLRGRKYYVHVHSYLRYGLLAARAEILKVSGDSENPC  291

Query  852   VLEGYDGYYTYNDVSYKVTAPPNGSSLKNCRKLARKVVDF-RAPCKYQNCTFNGVWSGGG  1028
             +L GYDG+Y Y   S+K +A P+G+SL  CR  A + +    + C Y  CTF G+W+GGG
Sbjct  292   ILAGYDGFYKYGGKSFKASAYPSGASLSECRSTALQALRANESSCTYMKCTFGGIWNGGG  351

Query  1029  GAGMENVYISSFFYDIATDVGIIDQEKASKIVKPRSFLVAAKLACETKFEDVKSTFPNAV  1208
             G G EN++++SFF+D A + G +D +  +  V+P +F  AAK ACE   ED KST+ +  
Sbjct  352   GDGQENLFVASFFFDRAAEAGFVDSKLPTATVRPVNFKEAAKRACEKNIEDAKSTYKHVD  411

Query  1209  EKDYPYLCMDLVYEYTLLVDGLGLHPYKEITLMKKVEYKNYMVEAAWPLGCAIDVISS  1382
             E + PYLCMDLVY+YTLLVDG GL P +EITL+K+V+Y   +VEAAWPLG AI+ +SS
Sbjct  412   EGNLPYLCMDLVYQYTLLVDGFGLDPQQEITLVKQVKYNGALVEAAWPLGSAIEAVSS  469



>dbj|BAM84272.1| apyrase [Medicago truncatula]
Length=455

 Score =   461 bits (1187),  Expect = 2e-154, Method: Compositional matrix adjust.
 Identities = 219/412 (53%), Positives = 303/412 (74%), Gaps = 1/412 (0%)
 Frame = +3

Query  150   RRVLLSHET-GNYAVIFDAGSTGSRVHVFHFDENLDLLPIGDGVEFFLKTTPGLSSYAND  326
             R++    ET  +YAVIFDAGSTG+RVHV+HFD+NLDLL IG+ +EF  K  PGLS+YA++
Sbjct  33    RKIFQKQETLTSYAVIFDAGSTGTRVHVYHFDQNLDLLHIGNDIEFVDKIKPGLSAYADN  92

Query  327   PEAAAKSLEPLLLEAEGVVPTELQPDTPLELGATAGLRLLEGDASDKILQAVRDMFKNES  506
             P+ AAKSL PLL EAE VVP +L P TPL LGATAGLRLL GDA++KILQA R+MF N S
Sbjct  93    PKQAAKSLIPLLEEAEDVVPEDLHPKTPLRLGATAGLRLLNGDAAEKILQATRNMFSNRS  152

Query  507   NFKSKAEWVSILEGSQEGTYFWVAMNYLLGNLGKGYQNTIATIDLGGGSVQVSYAVSGDT  686
                 +++ VSI++G+QEG+Y WV +NY+LGNLGK +  T+  IDLGGGSVQ++YAVS  T
Sbjct  153   TLNVQSDAVSIIDGTQEGSYMWVTVNYILGNLGKSFTKTVGVIDLGGGSVQMTYAVSKKT  212

Query  687   FANAPTPDNGEEPYVQEKYILGAQYYLYVHSYLNYGQLASRAEIFKASGNSTNPCVLEGY  866
               NAP   +GE+PY+++  + G QY LYVHSYL +G+ A+RA++  A+  S NPC+L G+
Sbjct  213   AKNAPKVADGEDPYIKKLVLKGKQYDLYVHSYLRFGKEATRAQVLNATNGSANPCILPGF  272

Query  867   DGYYTYNDVSYKVTAPPNGSSLKNCRKLARKVVDFRAPCKYQNCTFNGVWSGGGGAGMEN  1046
             +G +TY+ V YK  +P +GS+   C+++  KV+    PC Y +CTF+G+W+GGGG+G + 
Sbjct  273   NGTFTYSGVEYKAFSPSSGSNFDECKEIILKVLKVNDPCPYSSCTFSGIWNGGGGSGQKK  332

Query  1047  VYISSFFYDIATDVGIIDQEKASKIVKPRSFLVAAKLACETKFEDVKSTFPNAVEKDYPY  1226
             ++++S F  +  DVG+++  K + I+ P  F + AK AC   FEDVKST+P   E   PY
Sbjct  333   LFVTSAFAYLTEDVGMVEPNKPNSILHPIDFEIEAKRACALNFEDVKSTYPRLTEAKRPY  392

Query  1227  LCMDLVYEYTLLVDGLGLHPYKEITLMKKVEYKNYMVEAAWPLGCAIDVISS  1382
             +CMDL+Y++ LLV G GL P KEIT+ + ++Y+N +VEAAWPLG A++ IS+
Sbjct  393   VCMDLLYQHVLLVHGFGLSPRKEITVGEGIQYQNSVVEAAWPLGTAVEAIST  444



>ref|XP_009622670.1| PREDICTED: apyrase 2-like [Nicotiana tomentosiformis]
Length=472

 Score =   462 bits (1189),  Expect = 2e-154, Method: Compositional matrix adjust.
 Identities = 235/402 (58%), Positives = 297/402 (74%), Gaps = 1/402 (0%)
 Frame = +3

Query  180   NYAVIFDAGSTGSRVHVFHFDENLDLLPIGDGVEFFLKTTPGLSSYANDPEAAAKSLEPL  359
              YAVIFDAGS+GSRVHVF FDENLDL+PIG+ +E F++  PGLSSYA+DPEAAA+SL  L
Sbjct  69    RYAVIFDAGSSGSRVHVFCFDENLDLVPIGNELELFVQKKPGLSSYASDPEAAAESLLSL  128

Query  360   LLEAEGVVPTELQPDTPLELGATAGLRLLEGDASDKILQAVRDMFKNESNFKSKAEWVSI  539
             L EAE VVP  L+ +TP+ +GATAGLR LEGDASD+ILQAVRD  K++S+FK+KA+ V++
Sbjct  129   LKEAENVVPRNLRSNTPVRVGATAGLRQLEGDASDRILQAVRDFLKSKSSFKAKADAVTV  188

Query  540   LEGSQEGTYFWVAMNYLLGNLGKGYQNTIATIDLGGGSVQVSYAVSGDTFANAPTPDNGE  719
             L+G+QEG Y WV +NYLLG LGK Y +T+  +DLGGGSVQ++YA+S      AP   +GE
Sbjct  189   LDGNQEGAYQWVTINYLLGKLGKKYSDTVGVVDLGGGSVQMAYAISESDAQKAPKISDGE  248

Query  720   EPYVQEKYILGAQYYLYVHSYLNYGQLASRAEIFKASGNSTNPCVLEGYDGYYTYNDVSY  899
             + YVQE Y+ G +YYLYVHSYL+YG LA+RAEI K +  S NPC+L GY G Y Y    Y
Sbjct  249   DSYVQEMYLKGTKYYLYVHSYLHYGLLAARAEILKTTDESGNPCILGGYHGSYKYGGAVY  308

Query  900   KVTAPPNGSSLKNCRKLARKVVDFRAP-CKYQNCTFNGVWSGGGGAGMENVYISSFFYDI  1076
               +A   GSSL +CR+++ K +    P C +  CTF GVW+GGGG G +N++++SFF+D 
Sbjct  309   PASAMSQGSSLSSCREVSLKALKVNEPTCTHMKCTFGGVWNGGGGDGQKNMFVASFFFDR  368

Query  1077  ATDVGIIDQEKASKIVKPRSFLVAAKLACETKFEDVKSTFPNAVEKDYPYLCMDLVYEYT  1256
             A + G+I+   A   V P  +  AAK ACET  E  KS FP     + PYLCMDLVY+YT
Sbjct  369   AAEAGMINPSLAVAKVHPVDYESAAKRACETGLEGAKSAFPRVDPDNLPYLCMDLVYQYT  428

Query  1257  LLVDGLGLHPYKEITLMKKVEYKNYMVEAAWPLGCAIDVISS  1382
             LLVDG GL P +EITL+KKV+YK  +VEAAWPLG AI+V SS
Sbjct  429   LLVDGFGLDPQQEITLVKKVQYKKSLVEAAWPLGSAIEVASS  470



>gb|ABK51386.1| apyrase-like protein [Nicotiana tabacum]
Length=472

 Score =   462 bits (1188),  Expect = 3e-154, Method: Compositional matrix adjust.
 Identities = 233/402 (58%), Positives = 298/402 (74%), Gaps = 1/402 (0%)
 Frame = +3

Query  180   NYAVIFDAGSTGSRVHVFHFDENLDLLPIGDGVEFFLKTTPGLSSYANDPEAAAKSLEPL  359
              YAVIFDAGS+GSRVHVF FDENLDL+PIG+ +E F++  PGLSSYA+DPEAAA+SL  L
Sbjct  69    RYAVIFDAGSSGSRVHVFCFDENLDLVPIGNELELFVQEKPGLSSYASDPEAAAESLLSL  128

Query  360   LLEAEGVVPTELQPDTPLELGATAGLRLLEGDASDKILQAVRDMFKNESNFKSKAEWVSI  539
             L EAE VVP  L+ +TP+ +GATAGLR LEGDASD+ILQAVRD  K++S+FK+KA+ V++
Sbjct  129   LKEAENVVPRNLRSNTPVRVGATAGLRQLEGDASDRILQAVRDFLKSKSSFKAKADAVTV  188

Query  540   LEGSQEGTYFWVAMNYLLGNLGKGYQNTIATIDLGGGSVQVSYAVSGDTFANAPTPDNGE  719
             L+G+QEG Y WV +NYLLG LGK Y +T+  +DLGGGSVQ++YA+S      AP   +GE
Sbjct  189   LDGNQEGAYQWVTINYLLGKLGKKYSDTVGVVDLGGGSVQMAYAISESDAQKAPKVSDGE  248

Query  720   EPYVQEKYILGAQYYLYVHSYLNYGQLASRAEIFKASGNSTNPCVLEGYDGYYTYNDVSY  899
             + YVQE Y+ G +YYLY+HSYL+YG LA+RAEI KA+  S NPC+L GY G Y Y    Y
Sbjct  249   DTYVQEMYLKGTKYYLYIHSYLHYGLLAARAEILKATDESGNPCILGGYHGSYKYGGAVY  308

Query  900   KVTAPPNGSSLKNCRKLARKVVDFRAP-CKYQNCTFNGVWSGGGGAGMENVYISSFFYDI  1076
               +A   GSSL +C +++ K +    P C +  CTF GVW+GGGG G +N++++SFF+D 
Sbjct  309   PASAMSQGSSLSSCMEVSLKALKVNEPTCTHMKCTFGGVWNGGGGDGQKNMFVASFFFDR  368

Query  1077  ATDVGIIDQEKASKIVKPRSFLVAAKLACETKFEDVKSTFPNAVEKDYPYLCMDLVYEYT  1256
             A + G+++   A   V+P  +  AAK ACET  E  KS FP     + PY+CMDLVY+YT
Sbjct  369   AAEAGMVNPSLAVAKVRPVDYESAAKRACETGLEGAKSAFPRVDPDNLPYMCMDLVYQYT  428

Query  1257  LLVDGLGLHPYKEITLMKKVEYKNYMVEAAWPLGCAIDVISS  1382
             LLVDG GL P +EITL+KKV YKN +VEAAWPLG AI+V SS
Sbjct  429   LLVDGFGLDPQQEITLVKKVRYKNSLVEAAWPLGSAIEVASS  470



>emb|CDP19074.1| unnamed protein product [Coffea canephora]
Length=477

 Score =   462 bits (1188),  Expect = 3e-154, Method: Compositional matrix adjust.
 Identities = 230/402 (57%), Positives = 297/402 (74%), Gaps = 1/402 (0%)
 Frame = +3

Query  180   NYAVIFDAGSTGSRVHVFHFDENLDLLPIGDGVEFFLKTTPGLSSYANDPEAAAKSLEPL  359
             +YAVIFDAGS+GSRVHVF FD +LDL+PIG  +E F +  PGLS++ANDPEAAA SL+ L
Sbjct  74    SYAVIFDAGSSGSRVHVFCFDSHLDLVPIGKDLELFEQKKPGLSAFANDPEAAANSLQEL  133

Query  360   LLEAEGVVPTELQPDTPLELGATAGLRLLEGDASDKILQAVRDMFKNESNFKSKAEWVSI  539
             L +AE VVP EL+  TP+ +GATAGLR LEGDASD+ILQAVRD  KN+S+  SKA+WV++
Sbjct  134   LQKAEAVVPPELRQKTPVRVGATAGLRQLEGDASDRILQAVRDFLKNKSSLTSKADWVTV  193

Query  540   LEGSQEGTYFWVAMNYLLGNLGKGYQNTIATIDLGGGSVQVSYAVSGDTFANAPTPDNGE  719
             ++G+QEG Y WV +NYL G LGK Y  T+  +DLGGGSVQ++YA+S    A AP   +GE
Sbjct  194   IDGNQEGAYQWVTINYLSGKLGKKYSRTVGVVDLGGGSVQMAYAISESDAAKAPKLPDGE  253

Query  720   EPYVQEKYILGAQYYLYVHSYLNYGQLASRAEIFKASGNSTNPCVLEGYDGYYTYNDVSY  899
             + YVQE Y+ G +YYLYVHSYL+YG LA+RAEI KA   S+NPC+L G+D  Y Y    Y
Sbjct  254   DAYVQEMYLKGTKYYLYVHSYLHYGLLAARAEILKAGVESSNPCILAGFDESYKYGGKEY  313

Query  900   KVTAPPNGSSLKNCRKLARKVVDFR-APCKYQNCTFNGVWSGGGGAGMENVYISSFFYDI  1076
               +A P+GS+   CR++A K +    + C +  CTF GVW+GGGG G +N++++SFF+D 
Sbjct  314   PSSASPSGSNFNGCREVALKALKVNDSACTHMKCTFGGVWNGGGGDGQKNLFVASFFFDR  373

Query  1077  ATDVGIIDQEKASKIVKPRSFLVAAKLACETKFEDVKSTFPNAVEKDYPYLCMDLVYEYT  1256
             A + G +D       V P  F  AAK AC+T+ ED +ST+      + PYLCMDLVY++T
Sbjct  374   AAEAGFVDPHAHVAKVHPVDFEEAAKRACQTRLEDARSTYSRVEPDNLPYLCMDLVYQFT  433

Query  1257  LLVDGLGLHPYKEITLMKKVEYKNYMVEAAWPLGCAIDVISS  1382
             LLVDG GL P++EITL+KKVEYKN +VEAAWPLG AI+V+SS
Sbjct  434   LLVDGFGLDPWQEITLVKKVEYKNSLVEAAWPLGSAIEVVSS  475



>dbj|BAD80837.1| apyrase [Vigna unguiculata subsp. unguiculata]
Length=469

 Score =   461 bits (1187),  Expect = 4e-154, Method: Compositional matrix adjust.
 Identities = 224/404 (55%), Positives = 305/404 (75%), Gaps = 1/404 (0%)
 Frame = +3

Query  177   GNYAVIFDAGSTGSRVHVFHFDENLDLLPIGDGVEFFLKTTPGLSSYANDPEAAAKSLEP  356
             G+YAVIFDAGS+GSRVHVFHFD+NLDL+ IG  +E F++  PGLSSYA DP+ AA+SL P
Sbjct  66    GSYAVIFDAGSSGSRVHVFHFDQNLDLVHIGKDLELFVQLKPGLSSYAQDPKKAAESLVP  125

Query  357   LLLEAEGVVPTELQPDTPLELGATAGLRLLEGDASDKILQAVRDMFKNESNFKSKAEWVS  536
             LL +AE VVP EL+  T + +GATAGLR LEGDASD+ILQAVRD+ K++S+ +S+ + V+
Sbjct  126   LLEKAESVVPRELRSKTIVRVGATAGLRALEGDASDRILQAVRDLLKDKSSLRSEIDAVT  185

Query  537   ILEGSQEGTYFWVAMNYLLGNLGKGYQNTIATIDLGGGSVQVSYAVSGDTFANAPTPDNG  716
             +L+G+QEG Y WV +NYLLGNLGK Y  T+  +DLGGGSVQ++YA+S    A AP   +G
Sbjct  186   VLDGTQEGAYQWVTINYLLGNLGKDYSKTVGVVDLGGGSVQMAYAISETDAAMAPKVADG  245

Query  717   EEPYVQEKYILGAQYYLYVHSYLNYGQLASRAEIFKASGNSTNPCVLEGYDGYYTYNDVS  896
              +PYV+E ++ G +YY+YVHSYL YG LA+RAEI K S ++ NPC+L GYDG Y Y   S
Sbjct  246   GDPYVREMFLRGRKYYVYVHSYLRYGLLAARAEILKVSDDAENPCILSGYDGSYLYGGKS  305

Query  897   YKVTAPPNGSSLKNCRKLARKVVDF-RAPCKYQNCTFNGVWSGGGGAGMENVYISSFFYD  1073
             +K ++   G+++  C+ +A K +    + C +  CTF G+W+GGGG G +N++++SFF+D
Sbjct  306   FKASSSSLGANINECKSVALKALKVNESACTHMKCTFGGIWNGGGGDGQKNLFVASFFFD  365

Query  1074  IATDVGIIDQEKASKIVKPRSFLVAAKLACETKFEDVKSTFPNAVEKDYPYLCMDLVYEY  1253
              A + G  D +    IV+P  F  AAK AC+TK E+ KST+PN  E + PYLCMDLVY+Y
Sbjct  366   RAAEAGFADPKSPVAIVRPADFEDAAKQACQTKLENAKSTYPNVDEGNLPYLCMDLVYQY  425

Query  1254  TLLVDGLGLHPYKEITLMKKVEYKNYMVEAAWPLGCAIDVISSS  1385
             TLLVDG G++P++E+TL+KKV+Y + +VEAAWPLG AI+ +SS+
Sbjct  426   TLLVDGFGIYPWQEVTLVKKVKYDDALVEAAWPLGSAIEAVSST  469



>ref|XP_004253046.1| PREDICTED: probable apyrase 2 [Solanum lycopersicum]
Length=472

 Score =   461 bits (1186),  Expect = 6e-154, Method: Compositional matrix adjust.
 Identities = 233/404 (58%), Positives = 298/404 (74%), Gaps = 1/404 (0%)
 Frame = +3

Query  180   NYAVIFDAGSTGSRVHVFHFDENLDLLPIGDGVEFFLKTTPGLSSYANDPEAAAKSLEPL  359
              YAVIFDAGS+GSRVHVF FDENLDL+PIG+ +E F++  PGLSS+A+DP AAA SL PL
Sbjct  69    KYAVIFDAGSSGSRVHVFCFDENLDLVPIGNELELFVQKKPGLSSFASDPVAAADSLLPL  128

Query  360   LLEAEGVVPTELQPDTPLELGATAGLRLLEGDASDKILQAVRDMFKNESNFKSKAEWVSI  539
             L +AE VVP  L+ +TP+ +GATAGLR LEGDASD+ILQAVRD  K++S+FK+KA+ V++
Sbjct  129   LKDAENVVPRNLRSNTPVRVGATAGLRQLEGDASDRILQAVRDFLKSKSSFKAKADAVTV  188

Query  540   LEGSQEGTYFWVAMNYLLGNLGKGYQNTIATIDLGGGSVQVSYAVSGDTFANAPTPDNGE  719
             L+G+QEG Y WV++NYLLG LGK Y +T+  +DLGGGSVQ++YA+S      AP   +GE
Sbjct  189   LDGNQEGAYQWVSINYLLGKLGKKYSDTVGVVDLGGGSVQMAYAISESDAQKAPKVSDGE  248

Query  720   EPYVQEKYILGAQYYLYVHSYLNYGQLASRAEIFKASGNSTNPCVLEGYDGYYTYNDVSY  899
             + YVQE ++ G +YYLYVHSYL+YG LA+RAEI K SG S +PC+L G+ G Y Y    Y
Sbjct  249   DTYVQEMFLKGTKYYLYVHSYLHYGLLAARAEILKVSGESGSPCILGGHHGTYKYGGAVY  308

Query  900   KVTAPPNGSSLKNCRKLARKVVDFRAP-CKYQNCTFNGVWSGGGGAGMENVYISSFFYDI  1076
               +A   GSS+  CR++A K +    P C +  CTF GVW+GGGG G +N++++SFF+D 
Sbjct  309   PASATSQGSSMSTCREVALKALKINEPACTHMKCTFGGVWNGGGGDGQKNMFVASFFFDR  368

Query  1077  ATDVGIIDQEKASKIVKPRSFLVAAKLACETKFEDVKSTFPNAVEKDYPYLCMDLVYEYT  1256
             A + GII+   A   V+P  +  AA  AC T  E  KS FP     + PYLCMDLVY+YT
Sbjct  369   AAEAGIINPSLAVAKVRPADYESAANRACATGLEGAKSEFPRVEADNLPYLCMDLVYQYT  428

Query  1257  LLVDGLGLHPYKEITLMKKVEYKNYMVEAAWPLGCAIDVISSSS  1388
             LLVDG GL P++E+TL+KKVEYKN  VEAAWPLG AI+V SS S
Sbjct  429   LLVDGFGLEPHQEMTLVKKVEYKNSFVEAAWPLGSAIEVASSLS  472



>ref|XP_010999472.1| PREDICTED: apyrase 2-like [Populus euphratica]
Length=457

 Score =   460 bits (1184),  Expect = 8e-154, Method: Compositional matrix adjust.
 Identities = 236/420 (56%), Positives = 300/420 (71%), Gaps = 3/420 (1%)
 Frame = +3

Query  147   LRRVLLSHETGNYAVIFDAGSTGSRVHVFHFDENLDLLPIGDGVEF--FLKTTPGLSSYA  320
             +R   L  ++ +YAV+FDAGSTGSRVHVF FD++ DLLP+G+G +F  F + TPGLS+YA
Sbjct  38    VRSKGLDADSRSYAVVFDAGSTGSRVHVFCFDQDFDLLPVGNGTDFELFAQVTPGLSAYA  97

Query  321   NDPEAAAKSLEPLLLEAEGVVPTELQPDTPLELGATAGLRLLEGDASDKILQAVRDMFKN  500
              DP+AAA SL PLL EAE VVP E  P TP+ LGATAGLRLLEGD++++IL+AVRD+  +
Sbjct  98    EDPQAAADSLVPLLNEAESVVPEEFSPKTPVRLGATAGLRLLEGDSAERILEAVRDLLSH  157

Query  501   ESNFKSKAEWVSILEGSQEGTYFWVAMNYLLGNLGKGYQNTIATIDLGGGSVQVSYAVSG  680
              S  + +A+ VSIL GSQEG Y W+A+NY++GNLGK Y  T A ID GGGSVQ++YA+S 
Sbjct  158   GS-LEYEADDVSILTGSQEGYYMWIAINYIVGNLGKPYSETAAVIDQGGGSVQMAYAISR  216

Query  681   DTFANAPTPDNGEEPYVQEKYILGAQYYLYVHSYLNYGQLASRAEIFKASGNSTNPCVLE  860
             +    AP   +GE PYV++  + G QYY+YVHSYL+YG LASRAE+ K SGNS+N CV  
Sbjct  217   ENAEKAPIVADGEAPYVEKFLLRGTQYYVYVHSYLSYGLLASRAEMLKVSGNSSNECVTT  276

Query  861   GYDGYYTYNDVSYKVTAPPNGSSLKNCRKLARKVVDFRAPCKYQNCTFNGVWSGGGGAGM  1040
             GY+G Y Y    YK ++ P G+S K CRK+  K +   APCKY NCTF GVW+GGGG G 
Sbjct  277   GYNGVYKYGGKEYKASSSPTGTSFKKCRKVVLKALKINAPCKYVNCTFGGVWNGGGGDGQ  336

Query  1041  ENVYISSFFYDIATDVGIIDQEKASKIVKPRSFLVAAKLACETKFEDVKSTFPNAVEKDY  1220
              N Y SSFF+ ++   G +D    +       F  AAK AC T+FED  S FPNA EKD 
Sbjct  337   NNFYASSFFFSMSQAAGFVDANAHTATASAADFKKAAKRACGTRFEDASSRFPNAREKDL  396

Query  1221  PYLCMDLVYEYTLLVDGLGLHPYKEITLMKKVEYKNYMVEAAWPLGCAIDVISSSSANNL  1400
             P+LCMD  YEYTLLVDG GLHP K I++  ++ Y+N ++EAAWPLG AI+ +S SSA+ L
Sbjct  397   PFLCMDFTYEYTLLVDGYGLHPRKNISVAGQLTYENSLMEAAWPLGSAIEAVSPSSASFL  456



>gb|AFK40353.1| unknown [Medicago truncatula]
Length=467

 Score =   460 bits (1184),  Expect = 1e-153, Method: Compositional matrix adjust.
 Identities = 228/402 (57%), Positives = 302/402 (75%), Gaps = 3/402 (1%)
 Frame = +3

Query  177   GNYAVIFDAGSTGSRVHVFHFDENLDLLPIGDGVEFFLKTTPGLSSYANDPEAAAKSLEP  356
             G+YAVIFDAGS+GSRVHVFHFD+NLDL+ IG  +E F +  PGLS+YA  P+ AA+SL  
Sbjct  66    GSYAVIFDAGSSGSRVHVFHFDQNLDLVHIGKDLELFEQLKPGLSAYAQKPQQAAESLVS  125

Query  357   LLLEAEGVVPTELQPDTPLELGATAGLRLLEGDASDKILQAVRDMFKNESNFKSKAEWVS  536
             LL +AEGVVP EL+  TP+ +GATAGLR LEGDASDKIL+AVRD+ K+ S+FKS A+ V+
Sbjct  126   LLEKAEGVVPRELRSKTPVRIGATAGLRALEGDASDKILRAVRDLLKHRSSFKSDADAVT  185

Query  537   ILEGSQEGTYFWVAMNYLLGNLGKGYQNTIATIDLGGGSVQVSYAVSGDTFANAPTPDNG  716
             +L+G+QEG Y WV +NYLLGNLGK Y  T+   DLGGGSVQ++YA+S    A AP   +G
Sbjct  186   VLDGTQEGAYQWVTINYLLGNLGKDYSKTVGVGDLGGGSVQMAYAISESEAAMAPQVMDG  245

Query  717   EEPYVQEKYILGAQYYLYVHSYLNYGQLASRAEIFKASGNSTNPCVLEGYDGYYTYNDVS  896
             E+PYV+E ++ G +YYLYVHSYL YG LA+RAEI K +G++ NPC+L G DG Y Y   S
Sbjct  246   EDPYVKEMFLRGRKYYLYVHSYLRYGLLAARAEILKVAGDAENPCILSGSDGTYKYGGKS  305

Query  897   YKVTAPPNGSSLKNCRKLARKVVDF-RAPCKYQNCTFNGVWSGGGGAGMENVYISSFFYD  1073
             +K ++  +G+SL  C+ +A K +    + C +  CTF G+W+GGGG G +N++++SFF+D
Sbjct  306   FKASS--SGASLNECKSVAHKALKVNESTCTHMKCTFGGIWNGGGGDGQKNLFVASFFFD  363

Query  1074  IATDVGIIDQEKASKIVKPRSFLVAAKLACETKFEDVKSTFPNAVEKDYPYLCMDLVYEY  1253
              A + G +D      IV+P  F  AAK AC+TK E+ KST+P   E + PYLCMDLVY+Y
Sbjct  364   RAAEAGFVDPNSPVAIVRPADFEDAAKQACQTKLENAKSTYPRVEEGNLPYLCMDLVYQY  423

Query  1254  TLLVDGLGLHPYKEITLMKKVEYKNYMVEAAWPLGCAIDVIS  1379
             TLLVDG G++P++EITL+KKV+Y + +VEAAWPLG AI+ +S
Sbjct  424   TLLVDGFGIYPWQEITLVKKVKYDDALVEAAWPLGSAIEAVS  465



>ref|XP_003548776.1| PREDICTED: apyrase 2 [Glycine max]
 gb|KHN46802.1| Nucleoside-triphosphatase [Glycine soja]
Length=463

 Score =   460 bits (1183),  Expect = 1e-153, Method: Compositional matrix adjust.
 Identities = 230/401 (57%), Positives = 294/401 (73%), Gaps = 1/401 (0%)
 Frame = +3

Query  180   NYAVIFDAGSTGSRVHVFHFDENLDLLPIGDGVEFFLKTTPGLSSYANDPEAAAKSLEPL  359
             +YAVIFDAGSTGSRVHV+ F++ LDLL IG  +E F+KT PGLS+YA +P+ AA+SL PL
Sbjct  53    SYAVIFDAGSTGSRVHVYRFNQQLDLLRIGQDLELFVKTMPGLSAYAENPQDAAESLIPL  112

Query  360   LLEAEGVVPTELQPDTPLELGATAGLRLLEGDASDKILQAVRDMFKNESNFKSKAEWVSI  539
             L EAE  VP E  P TP++LGATAGLR LEGDASD+ILQAV DM KN S     A+ VS+
Sbjct  113   LEEAEAAVPQEFHPRTPVKLGATAGLRQLEGDASDRILQAVSDMLKNRSTLNVGADAVSV  172

Query  540   LEGSQEGTYFWVAMNYLLGNLGKGYQNTIATIDLGGGSVQVSYAVSGDTFANAPTPDNGE  719
             L G+QEG Y WV +NYLLGNLGK Y  T+A +DLGGGSVQ++YAVS    A AP   +G 
Sbjct  173   LSGNQEGAYQWVTINYLLGNLGKHYSETVAVVDLGGGSVQMAYAVSETDAAKAPRAPDGV  232

Query  720   EPYVQEKYILGAQYYLYVHSYLNYGQLASRAEIFKASGNSTNPCVLEGYDGYYTYNDVSY  899
             E Y+ E ++ G +YYLYVHSYL YG LA+RAE  K   +S NPC+L G+DGYY Y  V Y
Sbjct  233   ESYITEMFLRGKKYYLYVHSYLRYGMLAARAEALKVR-DSENPCILAGFDGYYVYGGVQY  291

Query  900   KVTAPPNGSSLKNCRKLARKVVDFRAPCKYQNCTFNGVWSGGGGAGMENVYISSFFYDIA  1079
             K  APP+GSS   C+ +  + +   A C Y++CTF G+W+GGGGAG  N +I+SFF+++A
Sbjct  292   KAKAPPSGSSFSQCQNVVVEALHVNATCSYKDCTFGGIWNGGGGAGENNFFIASFFFEVA  351

Query  1080  TDVGIIDQEKASKIVKPRSFLVAAKLACETKFEDVKSTFPNAVEKDYPYLCMDLVYEYTL  1259
              + G +D    +  V+P  F  AAK+AC T+ +D+KS FP   + D PY+C+DLVYEYTL
Sbjct  352   DEAGFVDPNAPNAKVRPVDFENAAKVACNTELKDLKSIFPRVKDGDVPYICLDLVYEYTL  411

Query  1260  LVDGLGLHPYKEITLMKKVEYKNYMVEAAWPLGCAIDVISS  1382
             LVDG G+ P +EITL+++VEY++ +VEAAWPLG AI+ ISS
Sbjct  412   LVDGFGIDPQQEITLVRQVEYQDSLVEAAWPLGSAIEAISS  452



>dbj|BAB85978.1| PsAPY2 [Pisum sativum]
Length=467

 Score =   460 bits (1183),  Expect = 1e-153, Method: Compositional matrix adjust.
 Identities = 227/405 (56%), Positives = 304/405 (75%), Gaps = 3/405 (1%)
 Frame = +3

Query  174   TGNYAVIFDAGSTGSRVHVFHFDENLDLLPIGDGVEFFLKTTPGLSSYANDPEAAAKSLE  353
             +G+YAVIFDAGS+GSRVHVFHF+ NLDL+ IG  +E F +  PGLS+YA +P+ AA+SL 
Sbjct  65    SGSYAVIFDAGSSGSRVHVFHFNHNLDLVHIGKDLELFEQLKPGLSAYAKNPKEAAESLI  124

Query  354   PLLLEAEGVVPTELQPDTPLELGATAGLRLLEGDASDKILQAVRDMFKNESNFKSKAEWV  533
              LL +AE VVP EL+  TP+ +GATAGLR LEGDASDKILQAVRD+ K+ S  KS A+ V
Sbjct  125   SLLDKAESVVPRELRSKTPVRVGATAGLRSLEGDASDKILQAVRDLLKHRSTLKSDADAV  184

Query  534   SILEGSQEGTYFWVAMNYLLGNLGKGYQNTIATIDLGGGSVQVSYAVSGDTFANAPTPDN  713
             ++L+G+QEG + WV +NYLLGNLGK Y  T+  +DLGGGSVQ++YA+S    A AP   +
Sbjct  185   TVLDGNQEGAFQWVTINYLLGNLGKDYSKTVGVVDLGGGSVQMAYAISESDAATAPKVKD  244

Query  714   GEEPYVQEKYILGAQYYLYVHSYLNYGQLASRAEIFKASGNSTNPCVLEGYDGYYTYNDV  893
             G++PYV+E ++ G +YYLYVHSYL YG LA+RAEI KASG++ NPC+L GYDG Y Y   
Sbjct  245   GDDPYVKEMFLRGKKYYLYVHSYLRYGLLAARAEILKASGDAENPCILSGYDGSYNYGGK  304

Query  894   SYKVTAPPNGSSLKNCRKLARKVVDF-RAPCKYQNCTFNGVWSGGGGAGMENVYISSFFY  1070
              +K ++  +G+SL  C+  A K +    + C +  CTF G+W+GGGG G +N++++SFF+
Sbjct  305   KFKASS--SGASLNECKSTALKALKVNESSCTHMKCTFGGIWNGGGGDGQKNLFVASFFF  362

Query  1071  DIATDVGIIDQEKASKIVKPRSFLVAAKLACETKFEDVKSTFPNAVEKDYPYLCMDLVYE  1250
             D A + G  D  K   IV P  F  AAK AC+TKF++ KST+P   E + PYLCMDLVY+
Sbjct  363   DRAAEAGFADPNKPVAIVHPMDFEEAAKQACQTKFKNAKSTYPRVEEGNLPYLCMDLVYQ  422

Query  1251  YTLLVDGLGLHPYKEITLMKKVEYKNYMVEAAWPLGCAIDVISSS  1385
             YTLLVDG G++P++EITL+KKV+Y++ +VEAAWPLG AI+ +S++
Sbjct  423   YTLLVDGFGIYPWQEITLVKKVKYEDALVEAAWPLGSAIEAVSAT  467



>ref|XP_008792533.1| PREDICTED: probable apyrase 2 isoform X2 [Phoenix dactylifera]
 ref|XP_008792534.1| PREDICTED: probable apyrase 2 isoform X2 [Phoenix dactylifera]
Length=459

 Score =   459 bits (1180),  Expect = 3e-153, Method: Compositional matrix adjust.
 Identities = 234/413 (57%), Positives = 295/413 (71%), Gaps = 0/413 (0%)
 Frame = +3

Query  171   ETGNYAVIFDAGSTGSRVHVFHFDENLDLLPIGDGVEFFLKTTPGLSSYANDPEAAAKSL  350
             ET +YAVIFDAGSTGSRVHVF FDEN+DL+ IGD +E ++   PGLSSYA+DP+ AA SL
Sbjct  38    ETESYAVIFDAGSTGSRVHVFRFDENMDLVNIGDDIELYVAVKPGLSSYADDPQEAANSL  97

Query  351   EPLLLEAEGVVPTELQPDTPLELGATAGLRLLEGDASDKILQAVRDMFKNESNFKSKAEW  530
              PLL EAE VVP ELQP TP+ LGATAGLR L  + S++ILQAVRD+ +  S+ + ++EW
Sbjct  98    IPLLEEAESVVPEELQPTTPVRLGATAGLRNLGDEKSEEILQAVRDLLQTNSSLEYESEW  157

Query  531   VSILEGSQEGTYFWVAMNYLLGNLGKGYQNTIATIDLGGGSVQVSYAVSGDTFANAPTPD  710
             V++LEG QEG+Y WVAMNYLLGNLG  Y +T+  +DLGGGSVQ++YAVS +  ANAP   
Sbjct  158   VTVLEGYQEGSYLWVAMNYLLGNLGNKYSDTVGVVDLGGGSVQMAYAVSEEAAANAPNIS  217

Query  711   NGEEPYVQEKYILGAQYYLYVHSYLNYGQLASRAEIFKASGNSTNPCVLEGYDGYYTYND  890
             NG++PYV ++ +    YYLY +SYLN+G LA+RAEI +A  +  + C+L GY G Y YN 
Sbjct  218   NGDDPYVTKQLLNETNYYLYAYSYLNFGLLAARAEILEAVDDPYSYCMLGGYTGTYEYNG  277

Query  891   VSYKVTAPPNGSSLKNCRKLARKVVDFRAPCKYQNCTFNGVWSGGGGAGMENVYISSFFY  1070
               Y  +A P+GSS   CR  A K +     C Y++C+F GVWSGGGG G +N+Y++SFFY
Sbjct  278   EVYNASASPSGSSYNKCRTDAIKTLKINETCTYEDCSFGGVWSGGGGDGQKNIYVASFFY  337

Query  1071  DIATDVGIIDQEKASKIVKPRSFLVAAKLACETKFEDVKSTFPNAVEKDYPYLCMDLVYE  1250
             D A  VG ID E+ S +V P  F  AAK AC    E+   T+PN    D PY+CMDL YE
Sbjct  338   DRAAQVGFIDPEEPSALVTPSDFEEAAKTACNLSLEEANVTYPNVAADDLPYICMDLAYE  397

Query  1251  YTLLVDGLGLHPYKEITLMKKVEYKNYMVEAAWPLGCAIDVISSSSANNLLSK  1409
             YTLLVDG GL P +EITL+ KV+Y +  V AAWPLG AI+V+SS S  +L  K
Sbjct  398   YTLLVDGFGLEPSQEITLVSKVKYGDSYVGAAWPLGSAIEVVSSQSTQSLAMK  450



>dbj|BAD80836.1| apyrase [Vigna unguiculata subsp. unguiculata]
Length=455

 Score =   459 bits (1180),  Expect = 3e-153, Method: Compositional matrix adjust.
 Identities = 219/413 (53%), Positives = 291/413 (70%), Gaps = 0/413 (0%)
 Frame = +3

Query  144   HLRRVLLSHETGNYAVIFDAGSTGSRVHVFHFDENLDLLPIGDGVEFFLKTTPGLSSYAN  323
             H +      E  +YAVIFDAGSTGSRVHVFHFD+NLDLL IG+ +EF+ K TPGLS+YA+
Sbjct  32    HRKIFPKQQELTSYAVIFDAGSTGSRVHVFHFDQNLDLLHIGNEIEFYDKVTPGLSAYAD  91

Query  324   DPEAAAKSLEPLLLEAEGVVPTELQPDTPLELGATAGLRLLEGDASDKILQAVRDMFKNE  503
             +PE AAKSL PLL EAE VVP EL P TP++LGATAGLRLL+GDAS++ILQAVRD+ KN 
Sbjct  92    NPENAAKSLVPLLEEAESVVPQELYPTTPVKLGATAGLRLLDGDASERILQAVRDLLKNR  151

Query  504   SNFKSKAEWVSILEGSQEGTYFWVAMNYLLGNLGKGYQNTIATIDLGGGSVQVSYAVSGD  683
             S F  + + V+I++G+QEG+Y WV +NYLLGNLGK +  T+  +DLGGGSVQ++YAVS +
Sbjct  152   STFSVQPDAVAIIDGTQEGSYLWVTINYLLGNLGKKFSKTVGVVDLGGGSVQMAYAVSKN  211

Query  684   TFANAPTPDNGEEPYVQEKYILGAQYYLYVHSYLNYGQLASRAEIFKASGNSTNPCVLEG  863
             T  NAP P   EEPY+++  + G +Y LYVHSYL+YG+ A RAE  K +  S NPC+L G
Sbjct  212   TAKNAPQPQPEEEPYIKKLVLKGKKYDLYVHSYLHYGREAFRAEALKVTDGSANPCILSG  271

Query  864   YDGYYTYNDVSYKVTAPPNGSSLKNCRKLARKVVDFRAPCKYQNCTFNGVWSGGGGAGME  1043
             + G YTY+   YK  AP +GS+   CRK+  + +     C ++NC+F G+W GG G+G  
Sbjct  272   FYGTYTYSGEDYKAFAPISGSNYHECRKIVLQGLKVNQFCAHRNCSFGGIWDGGKGSGQN  331

Query  1044  NVYISSFFYDIATDVGIIDQEKASKIVKPRSFLVAAKLACETKFEDVKSTFPNAVEKDYP  1223
              ++ +S FY +A+++G+    K +  + P      AK ACE  FED  S +P       P
Sbjct  332   TLFGTSSFYYLASEIGMFGPNKPNSKIHPLDLKTEAKRACEKTFEDATSAYPLLSADRVP  391

Query  1224  YLCMDLVYEYTLLVDGLGLHPYKEITLMKKVEYKNYMVEAAWPLGCAIDVISS  1382
             Y+C+DL Y+Y LL DG GL P +EIT+  ++EY++ +VEAAWPLG AI+ ISS
Sbjct  392   YVCLDLTYQYALLTDGFGLDPLQEITVANEIEYQDALVEAAWPLGTAIEAISS  444



>gb|KHN46801.1| Nucleoside-triphosphatase [Glycine soja]
Length=452

 Score =   458 bits (1179),  Expect = 4e-153, Method: Compositional matrix adjust.
 Identities = 229/413 (55%), Positives = 299/413 (72%), Gaps = 4/413 (1%)
 Frame = +3

Query  150   RRVLLSHET--GNYAVIFDAGSTGSRVHVFHFDENLDLLPIGDGVEFFLKTTPGLSSYAN  323
             R++ L  +    +YAVIFD GSTG+RVHVFHFD+NLDLLPIGD +E   K TPGLS+Y +
Sbjct  31    RKIFLKKDNIITSYAVIFDGGSTGTRVHVFHFDQNLDLLPIGDSLELNKKITPGLSAYED  90

Query  324   DPEAAAKSLEPLLLEAEGVVPTELQPDTPLELGATAGLRLLEGDASDKILQAVRDMFKNE  503
             DPE AA+SL PLL EAE VVP +L+P+TP+ LGATAGLRLL+G+AS++ILQAVRDM  N 
Sbjct  91    DPEQAAESLIPLLEEAESVVPEDLRPNTPVRLGATAGLRLLKGNASEQILQAVRDMLSNR  150

Query  504   SNFKSKAEWVSILEGSQEGTYFWVAMNYLLGNLGKGYQNTIATIDLGGGSVQVSYAVSGD  683
             S    +++ V+IL+G+QE  Y WVA+NYLLGNLGK    T+   DLGGGSVQ++YAVS +
Sbjct  151   STLNLQSDAVTILDGNQEAAYMWVALNYLLGNLGKVISKTVGVADLGGGSVQMAYAVSKN  210

Query  684   TFANAPTPDNGEEPYVQEKYILGAQYYLYVHSYLNYGQLASRAEIFKASGNSTNPCVLEG  863
             T  NAP P  GEE Y++   + G  Y LYVHSYL++G+ ASRAE+ K +G+S NPC+L G
Sbjct  211   TAKNAPQPPEGEESYIKTLVLNGKTYDLYVHSYLHFGKEASRAEMLKVTGDSANPCILAG  270

Query  864   YDGYYTYNDVSYKVTAPPNGSSLKNCRKLARKVVDFRAPCKYQNCTFNGVWSGGGGAGME  1043
             Y+G YTY+ V YK  A  +GS+   CR++A K +    PC +QNCTF G+W+GGGG+G +
Sbjct  271   YNGTYTYSGVKYKALASTSGSNFDKCREVALKALKVNEPCPHQNCTFGGIWNGGGGSGQK  330

Query  1044  NVYISSFFYDIATDVGIIDQEKASKIVKPRSFLVAAKLACETKFEDVKSTFPNAVEKDYP  1223
              +Y+++ FY +   V   D  K S  V P  F  AAK AC+ KFED +ST+P  +E   P
Sbjct  331   VLYVTTSFYYLVIQVA--DASKTSSKVYPAEFKAAAKRACQVKFEDAQSTYPLMMEDALP  388

Query  1224  YLCMDLVYEYTLLVDGLGLHPYKEITLMKKVEYKNYMVEAAWPLGCAIDVISS  1382
             Y+CMD+ Y+YTLLVDG GL P+KEI +  ++EY+  +VE AWPLG AI+ ISS
Sbjct  389   YICMDITYQYTLLVDGFGLDPWKEIIVANEIEYQGALVEGAWPLGSAIEAISS  441



>gb|AAD31285.1|AF139807_1 nod factor binding lectin-nucleotide phosphohydrolase [Vigna 
unguiculata subsp. cylindrica]
Length=462

 Score =   457 bits (1177),  Expect = 1e-152, Method: Compositional matrix adjust.
 Identities = 219/419 (52%), Positives = 299/419 (71%), Gaps = 3/419 (1%)
 Frame = +3

Query  150   RRVLLSHET-GNYAVIFDAGSTGSRVHVFHFDENLDLLPIGDGVEFFLKTTPGLSSYAND  326
             R++L + E   +YAVIFDAGS+GSRVHVF+FD+NLDLL IG+ +EF  K  PGLSSYA+ 
Sbjct  42    RKILPNQELLTSYAVIFDAGSSGSRVHVFNFDQNLDLLHIGNDLEFTKKIKPGLSSYADK  101

Query  327   PEAAAKSLEPLLLEAEGVVPTELQPDTPLELGATAGLRLLEGDASDKILQAVRDMFKNES  506
             PE AA+SL PLL EAE VVP EL P TPL+LGATAGLRLL+GDA++KILQAVR+MF+N S
Sbjct  102   PEKAAESLIPLLEEAEDVVPEELHPKTPLKLGATAGLRLLDGDAAEKILQAVREMFRNRS  161

Query  507   NFKSKAEWVSILEGSQEGTYFWVAMNYLLGNLGKGYQNTIATIDLGGGSVQVSYAVSGDT  686
             +   + + VS+++G+QEG+Y WV +NYLLG LGK +  T+  IDLGG SVQ++YAVS +T
Sbjct  162   SLSVQPDAVSVIDGTQEGSYLWVTVNYLLGKLGKKFTKTVGVIDLGGASVQMAYAVSRNT  221

Query  687   FANAPTPDNGEEPYVQEKYILGAQYYLYVHSYLNYGQLASRAEIFKASGNSTNPCVLEGY  866
               NAP P  GE+PY+++  + G +Y LYVHSYL YG  A+R +IFK +  + +PC+L GY
Sbjct  222   AKNAPKPPQGEDPYMKKLVLKGKKYDLYVHSYLRYGNDAARVKIFKTTDGAASPCLLAGY  281

Query  867   DGYYTYNDVSYKVTAPPNGSSLKNCRKLARKVVDFRAPCKYQNCTFNGVWSGGGGAGMEN  1046
             +  Y Y+  SY +  P +G++   CR LA +++    PC ++NCTF G+W GG G+G +N
Sbjct  282   EDIYRYSGESYNIYGPTSGANFNECRDLALQILRLNEPCSHENCTFGGIWDGGKGSGQKN  341

Query  1047  VYISSFFYDIATDVGIIDQEKASKIVKPRSFLVAAKLACETKFEDVKSTFPNAVEKDYPY  1226
             + ++S FY  +++VG +    +    +P  F  AAK AC   FE+ KSTFPN  +   P+
Sbjct  342   LVVTSAFYYRSSEVGFVTPPNSKN--RPLDFETAAKQACSLTFEEAKSTFPNVEKDKLPF  399

Query  1227  LCMDLVYEYTLLVDGLGLHPYKEITLMKKVEYKNYMVEAAWPLGCAIDVISSSSANNLL  1403
             +C+D  Y+YTLLVDG GL P +EIT+ + +EY++ +VE AWPLG AI+ ISS    N L
Sbjct  400   VCVDFTYQYTLLVDGFGLDPEQEITVAEGIEYQDAIVETAWPLGTAIEAISSLPKFNRL  458



>ref|XP_004493132.1| PREDICTED: apyrase 2-like isoform X2 [Cicer arietinum]
Length=469

 Score =   457 bits (1177),  Expect = 1e-152, Method: Compositional matrix adjust.
 Identities = 227/413 (55%), Positives = 306/413 (74%), Gaps = 2/413 (0%)
 Frame = +3

Query  150   RRVLLSHETGN-YAVIFDAGSTGSRVHVFHFDENLDLLPIGDGVEFFLKTTPGLSSYAND  326
             R++    ++G+ YAVIFDAGS+GSRVHVFHFD+NLDL+ IG  +E F +T PGLS+YA +
Sbjct  56    RKISPDKKSGSTYAVIFDAGSSGSRVHVFHFDQNLDLVHIGKDLELFEQTKPGLSAYAQN  115

Query  327   PEAAAKSLEPLLLEAEGVVPTELQPDTPLELGATAGLRLLEGDASDKILQAVRDMFKNES  506
             P+ AA+SL  LL +AE VVP EL+  TP+ +GATAGLR LEGDASD+ILQAVRD+ K  S
Sbjct  116   PQQAAESLVSLLEKAESVVPRELRSKTPVRVGATAGLRALEGDASDRILQAVRDLLKKRS  175

Query  507   NFKSKAEWVSILEGSQEGTYFWVAMNYLLGNLGKGYQNTIATIDLGGGSVQVSYAVSGDT  686
               +S+A+ V++L+G+QEG + WV +NYLLGNLGK Y  T+  +DLGGGSVQ++YA+S   
Sbjct  176   TLRSEADAVTVLDGTQEGAFQWVTINYLLGNLGKDYSKTVGVVDLGGGSVQMAYAISESD  235

Query  687   FANAPTPDNGEEPYVQEKYILGAQYYLYVHSYLNYGQLASRAEIFKASGNSTNPCVLEGY  866
              A AP   +GE+PYV+E ++ G +YYLYVHSYL YG LA+RAEI KASG++ NPC+L GY
Sbjct  236   AAMAPKVTDGEDPYVKEMFLRGRKYYLYVHSYLRYGLLAARAEILKASGDAENPCILSGY  295

Query  867   DGYYTYNDVSYKVTAPPNGSSLKNCRKLARKVVDF-RAPCKYQNCTFNGVWSGGGGAGME  1043
             DG Y Y   S+K ++ P+G+SL  C+ +A K +    + C +  CTF G+W+GGGG G +
Sbjct  296   DGSYNYGGKSFKASSSPSGASLNECKSVALKALKVNESTCTHMKCTFGGIWNGGGGDGQK  355

Query  1044  NVYISSFFYDIATDVGIIDQEKASKIVKPRSFLVAAKLACETKFEDVKSTFPNAVEKDYP  1223
             N++     Y I++  G  +      IV+P  F  AAK AC+TK E+ KST+P   E + P
Sbjct  356   NLFHWHSNYIISSQAGFANPNSPVAIVRPADFEDAAKQACQTKLENAKSTYPRVEEGNLP  415

Query  1224  YLCMDLVYEYTLLVDGLGLHPYKEITLMKKVEYKNYMVEAAWPLGCAIDVISS  1382
             YLCMDLVY+YTLLVDG G++P++EITL+KKV+Y++ +VEAAWPLG AI+ +SS
Sbjct  416   YLCMDLVYQYTLLVDGFGIYPWQEITLVKKVKYEDALVEAAWPLGSAIEAVSS  468



>ref|XP_006604215.1| PREDICTED: apyrase 2-like [Glycine max]
Length=469

 Score =   457 bits (1177),  Expect = 1e-152, Method: Compositional matrix adjust.
 Identities = 222/404 (55%), Positives = 304/404 (75%), Gaps = 1/404 (0%)
 Frame = +3

Query  177   GNYAVIFDAGSTGSRVHVFHFDENLDLLPIGDGVEFFLKTTPGLSSYANDPEAAAKSLEP  356
             G+YAVIFDAGS+GSRVHVFHFD NLDL+ IG  +E F++  PGLS++A +P+ AA+SL  
Sbjct  66    GSYAVIFDAGSSGSRVHVFHFDHNLDLVHIGKDLELFVQKKPGLSAFAKNPKQAAESLVS  125

Query  357   LLLEAEGVVPTELQPDTPLELGATAGLRLLEGDASDKILQAVRDMFKNESNFKSKAEWVS  536
             LL EAE VVP EL+  TP+ +GATAGLR LEGDASD+ILQAVRD+ K+ S+ KS+++ V+
Sbjct  126   LLEEAESVVPRELRSKTPVRVGATAGLRALEGDASDRILQAVRDLLKDRSSLKSESDAVT  185

Query  537   ILEGSQEGTYFWVAMNYLLGNLGKGYQNTIATIDLGGGSVQVSYAVSGDTFANAPTPDNG  716
             +L+G+QEG Y WV +NYLLGNLGK +  T+  +DLGGGSVQ++YA+S    A AP   +G
Sbjct  186   VLDGTQEGAYQWVTINYLLGNLGKDHSKTVGVVDLGGGSVQMAYAISETDAAMAPKVADG  245

Query  717   EEPYVQEKYILGAQYYLYVHSYLNYGQLASRAEIFKASGNSTNPCVLEGYDGYYTYNDVS  896
              +PYV+E ++ G +YYLYVHSYL+YG LA+RAEI KAS ++ NPC++ GYDG Y Y    
Sbjct  246   GDPYVKEMFLRGRKYYLYVHSYLHYGLLAARAEILKASDDAENPCIISGYDGSYNYGGKL  305

Query  897   YKVTAPPNGSSLKNCRKLARKVVDF-RAPCKYQNCTFNGVWSGGGGAGMENVYISSFFYD  1073
             +K ++  +G+SL  C+ +A + +    + C +  CTF G+W+GGGG G +N++++SFF+D
Sbjct  306   FKASSGSSGTSLNECKSVALRALKVNESTCTHMKCTFGGIWNGGGGDGQKNLFVASFFFD  365

Query  1074  IATDVGIIDQEKASKIVKPRSFLVAAKLACETKFEDVKSTFPNAVEKDYPYLCMDLVYEY  1253
              A + G  D      IV+P  F  AAK AC+T+ E+ KSTFP   E + PYLCMDL+Y+Y
Sbjct  366   RAVEAGFADPNLPVAIVRPADFEDAAKQACQTELENAKSTFPRVDEGNLPYLCMDLIYQY  425

Query  1254  TLLVDGLGLHPYKEITLMKKVEYKNYMVEAAWPLGCAIDVISSS  1385
             TLLVDG G++P++EITL+KKV+Y + +VEAAWPLG AI+ +SS+
Sbjct  426   TLLVDGFGIYPWQEITLVKKVKYDDALVEAAWPLGSAIEAVSST  469



>gb|ABK94978.1| unknown [Populus trichocarpa]
Length=467

 Score =   457 bits (1176),  Expect = 1e-152, Method: Compositional matrix adjust.
 Identities = 223/405 (55%), Positives = 301/405 (74%), Gaps = 1/405 (0%)
 Frame = +3

Query  171   ETGNYAVIFDAGSTGSRVHVFHFDENLDLLPIGDGVEFFLKTTPGLSSYANDPEAAAKSL  350
             ++ +YAVIFDAGS+GSRVHV+ FD+NLDL+PIG  +E FL+  PGLS+YAN+P  AA SL
Sbjct  61    DSRSYAVIFDAGSSGSRVHVYCFDQNLDLVPIGKELELFLQLKPGLSAYANNPREAANSL  120

Query  351   EPLLLEAEGVVPTELQPDTPLELGATAGLRLLEGDASDKILQAVRDMFKNESNFKSKAEW  530
               LL +AE  VP EL+P TP+ +GATAGLR L  DASD+ILQAVRD+ ++ S  KS+A  
Sbjct  121   VSLLHKAESSVPKELRPKTPVRVGATAGLRALGMDASDRILQAVRDLLRDTSTLKSEANG  180

Query  531   VSILEGSQEGTYFWVAMNYLLGNLGKGYQNTIATIDLGGGSVQVSYAVSGDTFANAPTPD  710
             V++L+GSQEG+Y WV +NYLLGNLGK Y NT+  +DLGGGSVQ++YA+S    A AP   
Sbjct  181   VTVLDGSQEGSYQWVTINYLLGNLGKKYSNTVGVVDLGGGSVQMAYAISETDAAKAPRLS  240

Query  711   NGEEPYVQEKYILGAQYYLYVHSYLNYGQLASRAEIFKASGNSTNPCVLEGYDGYYTYND  890
             +GE+ YV+E +++G +YYLYVHSYLNYG LA+RAE+   S +STNPC+L GYDG Y    
Sbjct  241   DGEDTYVKEMFLMGTKYYLYVHSYLNYGLLAARAEMLDTSEDSTNPCILAGYDGVYKNGG  300

Query  891   VSYKVTAPPNGSSLKNCRKLARKVVDFR-APCKYQNCTFNGVWSGGGGAGMENVYISSFF  1067
               +K +A P+GS+++ CR+LA   +  + + C +  CTF G+W+GGGG G +N++++SFF
Sbjct  301   KDHKASASPSGSNMEECRRLALNALKVKESTCTHMKCTFGGIWNGGGGDGQKNMFVASFF  360

Query  1068  YDIATDVGIIDQEKASKIVKPRSFLVAAKLACETKFEDVKSTFPNAVEKDYPYLCMDLVY  1247
             +D A   G +D    +  V+P  F  AAK ACETK E+ KS + +  + D PY+CMDLVY
Sbjct  361   FDRAAQAGFVDSTVPAAKVQPSDFENAAKRACETKLENAKSIYSSVDDNDLPYICMDLVY  420

Query  1248  EYTLLVDGLGLHPYKEITLMKKVEYKNYMVEAAWPLGCAIDVISS  1382
             +YTLLVDG  L P++++TL+KKVEY+  +VEAAWPLG AI+ +SS
Sbjct  421   QYTLLVDGFALDPWQDMTLVKKVEYRTSLVEAAWPLGSAIEAVSS  465



>ref|XP_003624582.1| Apyrase-like protein [Medicago truncatula]
 gb|AES80800.1| Nod factor-binding lectin-nucleotide phosphohydrolase [Medicago 
truncatula]
Length=456

 Score =   456 bits (1174),  Expect = 2e-152, Method: Compositional matrix adjust.
 Identities = 229/413 (55%), Positives = 301/413 (73%), Gaps = 2/413 (0%)
 Frame = +3

Query  150   RRVLLSHET-GNYAVIFDAGSTGSRVHVFHFDENLDLLPIGDGVEFFLKTTPGLSSYAND  326
             R++    ET  +YAV+FDAGSTGSR+HV+HFD+NLDLL IG  VEFF K TPGLSSYAND
Sbjct  33    RKIFQKQETISSYAVVFDAGSTGSRIHVYHFDQNLDLLHIGKDVEFFNKITPGLSSYAND  92

Query  327   PEAAAKSLEPLLLEAEGVVPTELQPDTPLELGATAGLRLLEGDASDKILQAVRDMFKNES  506
             PE AAKSL PLL +AE VVP +L   TP+ LGATAGLRLL GDAS+KILQAVRDMF N S
Sbjct  93    PEQAAKSLIPLLQQAENVVPIDLHHKTPIRLGATAGLRLLNGDASEKILQAVRDMFSNRS  152

Query  507   NFKSKAEWVSILEGSQEGTYFWVAMNYLLGNLGKGYQNTIATIDLGGGSVQVSYAVSGDT  686
              F  + + VSI++G+QEG+Y WV +NY LGNLGK Y  T+  +DLGGGSVQ++YAVS  T
Sbjct  153   TFNVQPDAVSIIDGTQEGSYLWVTVNYALGNLGKKYTKTVGVMDLGGGSVQMAYAVSKKT  212

Query  687   FANAPTPDNGEEPYVQEKYILGAQYYLYVHSYLNYGQLASRAEIFKASGNSTNPCVLEGY  866
               NAP   +G +PY+++  + G  Y LYVHSYL++G+ ASRAEI K + +S NPC+L G+
Sbjct  213   AKNAPKVADGVDPYIKKLVLKGKPYDLYVHSYLHFGREASRAEIMKVTRSSPNPCLLAGF  272

Query  867   DGYYTYNDVSYKVTAPPNGSSLKNCRKLARKVVDFRAPCKYQNCTFNGVWSGGGGAGMEN  1046
             DG YTY    +K  AP +G++   C+K+ RK +    PC YQNCTF G+W+GGGG G ++
Sbjct  273   DGTYTYAGEEFKAKAPASGANFNGCKKIIRKALKLNYPCPYQNCTFGGIWNGGGGNGQKH  332

Query  1047  VYISSFFYDIATDVGIIDQEKASKIVKPRSFLVAAKLACETKFEDVKSTFPNAVEKDYP-  1223
             ++ SS F+ +  DVG++D +  +  ++P   +  AK AC   FED KST+P   +K+   
Sbjct  333   LFASSSFFYLPEDVGMVDPKTPNFKIRPVDLVSEAKKACALNFEDAKSTYPFLAKKNIAS  392

Query  1224  YLCMDLVYEYTLLVDGLGLHPYKEITLMKKVEYKNYMVEAAWPLGCAIDVISS  1382
             Y+CMDL+Y+Y LLVDG GL P +EIT  K++EY++ ++EAAWPLG A++ ISS
Sbjct  393   YVCMDLIYQYVLLVDGFGLDPLQEITSGKEIEYQDAVLEAAWPLGNAVEAISS  445



>ref|XP_007161770.1| hypothetical protein PHAVU_001G096900g [Phaseolus vulgaris]
 gb|ESW33764.1| hypothetical protein PHAVU_001G096900g [Phaseolus vulgaris]
Length=469

 Score =   457 bits (1175),  Expect = 2e-152, Method: Compositional matrix adjust.
 Identities = 224/404 (55%), Positives = 306/404 (76%), Gaps = 1/404 (0%)
 Frame = +3

Query  177   GNYAVIFDAGSTGSRVHVFHFDENLDLLPIGDGVEFFLKTTPGLSSYANDPEAAAKSLEP  356
             G+YAVIFDAGS+GSRVHVFHFD+NLDL+ IG  +E F++  PGLS+YA DP+ AA+SL P
Sbjct  66    GSYAVIFDAGSSGSRVHVFHFDQNLDLVHIGKDLELFVQLKPGLSAYAQDPKKAAESLVP  125

Query  357   LLLEAEGVVPTELQPDTPLELGATAGLRLLEGDASDKILQAVRDMFKNESNFKSKAEWVS  536
             LL +AE VVP EL+  TP+ +GATAGLR LEGDASDKILQAVRD+ K++++ +S+ + V+
Sbjct  126   LLEKAESVVPRELRSKTPVRVGATAGLRALEGDASDKILQAVRDLLKDKTSLRSETDAVT  185

Query  537   ILEGSQEGTYFWVAMNYLLGNLGKGYQNTIATIDLGGGSVQVSYAVSGDTFANAPTPDNG  716
             +L+G+QEG Y WV +NYLLGNLGK Y  T+  +DLGGGSVQ++YA+S    A AP   +G
Sbjct  186   VLDGTQEGAYQWVTINYLLGNLGKDYSKTVGVVDLGGGSVQMAYAISETDAAMAPKVPDG  245

Query  717   EEPYVQEKYILGAQYYLYVHSYLNYGQLASRAEIFKASGNSTNPCVLEGYDGYYTYNDVS  896
              +PYV+E ++ G +YYLYVHSYL YG LA+RAEI K S ++ NPC+L GYDG Y Y   +
Sbjct  246   GDPYVKEMFLRGRKYYLYVHSYLRYGLLAARAEILKVSDDAENPCILSGYDGSYVYGGKT  305

Query  897   YKVTAPPNGSSLKNCRKLARKVVDF-RAPCKYQNCTFNGVWSGGGGAGMENVYISSFFYD  1073
             +K ++  +G+S+  C+ +A K +    + C +  CTF G+W+GGGG G +N++++SFF+D
Sbjct  306   FKASSSSSGASINECKSVALKALKVNESSCTHMKCTFGGIWNGGGGDGQKNLFVASFFFD  365

Query  1074  IATDVGIIDQEKASKIVKPRSFLVAAKLACETKFEDVKSTFPNAVEKDYPYLCMDLVYEY  1253
              A + G  D      IV+P  F  AAK AC+TK E+ KST+P+  E + PYLCMDLVY+Y
Sbjct  366   RAAEAGFADPNSPVAIVRPADFEDAAKRACQTKLENAKSTYPHVEEGNLPYLCMDLVYQY  425

Query  1254  TLLVDGLGLHPYKEITLMKKVEYKNYMVEAAWPLGCAIDVISSS  1385
             TLLVDG G++P++E+TL+KKV+Y + +VEAAWPLG AI+ +SS+
Sbjct  426   TLLVDGFGIYPWQEVTLVKKVKYDDALVEAAWPLGSAIEAVSST  469



>dbj|BAB87182.1| apyrase [Pisum sativum]
Length=455

 Score =   456 bits (1172),  Expect = 5e-152, Method: Compositional matrix adjust.
 Identities = 218/413 (53%), Positives = 295/413 (71%), Gaps = 2/413 (0%)
 Frame = +3

Query  150   RRVLLSHE-TGNYAVIFDAGSTGSRVHVFHFDENLDLLPIGDGVEFFLKTTPGLSSYAND  326
             RR+ L  E   +YAV+FDAGSTGSR+HV+HF++NLDL  IG GVE++ K TPGLSSYAN+
Sbjct  32    RRIFLKQEEISSYAVVFDAGSTGSRIHVYHFNQNLDLPHIGKGVEYYNKITPGLSSYANN  91

Query  327   PEAAAKSLEPLLLEAEGVVPTELQPDTPLELGATAGLRLLEGDASDKILQAVRDMFKNES  506
             PE AAKSL PLL +AE  VP +LQP TP+ LGAT  LRLL GDAS+KILQ+VRDM  N S
Sbjct  92    PEQAAKSLIPLLEQAEECVPDDLQPKTPVRLGATGVLRLLNGDASEKILQSVRDMLSNRS  151

Query  507   NFKSKAEWVSILEGSQEGTYFWVAMNYLLGNLGKGYQNTIATIDLGGGSVQVSYAVSGDT  686
              F  + + VSI++G+QEG+Y WV +NY LG LGK Y  T+  IDLGGGSVQ++YAVS  T
Sbjct  152   TFNVQPDAVSIIDGTQEGSYLWVTVNYALGKLGKKYTKTVGVIDLGGGSVQMAYAVSKKT  211

Query  687   FANAPTPDNGEEPYVQEKYILGAQYYLYVHSYLNYGQLASRAEIFKASGNSTNPCVLEGY  866
               NAP   +G++PY+++  + G  Y LYVHSYL++G+ ASRAEI K +  S+NPC+L G+
Sbjct  212   AKNAPKVADGDDPYIKKVVLKGIPYDLYVHSYLHFGREASRAEILKLTPRSSNPCLLAGF  271

Query  867   DGYYTYNDVSYKVTAPPNGSSLKNCRKLARKVVDFRAPCKYQNCTFNGVWSGGGGAGMEN  1046
             +G YTY+   +K TA  +G++   C+   RK +    PC YQNCTF G+W+ GGG G +N
Sbjct  272   NGIYTYSREEFKATAYTSGANFNKCKNTIRKALKLNYPCPYQNCTFGGIWNSGGGNGQKN  331

Query  1047  VYISSFFYDIATDVGIIDQEKASKIVKPRSFLVAAKLACETKFEDVKSTFPNAVEKDYP-  1223
             ++ SS ++ +  D G++D    + I++P      AK +C   FED KST+P   +K+   
Sbjct  332   LFASSSYFYLPEDTGMVDASTPNFILRPVDIETKAKESCALNFEDAKSTYPFLDKKNVAS  391

Query  1224  YLCMDLVYEYTLLVDGLGLHPYKEITLMKKVEYKNYMVEAAWPLGCAIDVISS  1382
             Y+CMDL+Y+Y LLVDG GL P ++IT  K++EY++ +VEAAWPLG A++ IS+
Sbjct  392   YVCMDLIYQYVLLVDGFGLDPLQKITSGKEIEYQDAIVEAAWPLGNAVEAISA  444



>gb|AFK48943.1| unknown [Medicago truncatula]
Length=456

 Score =   455 bits (1171),  Expect = 7e-152, Method: Compositional matrix adjust.
 Identities = 228/413 (55%), Positives = 301/413 (73%), Gaps = 2/413 (0%)
 Frame = +3

Query  150   RRVLLSHET-GNYAVIFDAGSTGSRVHVFHFDENLDLLPIGDGVEFFLKTTPGLSSYAND  326
             R++    ET  +YAV+FDAGSTGSR+HV+HFD+NLDLL IG  VEFF K TPGLSSYAND
Sbjct  33    RKIFQKQETISSYAVVFDAGSTGSRIHVYHFDQNLDLLHIGKDVEFFNKITPGLSSYAND  92

Query  327   PEAAAKSLEPLLLEAEGVVPTELQPDTPLELGATAGLRLLEGDASDKILQAVRDMFKNES  506
             PE AAKSL PLL +AE VVP +L   TP+ LGATAGLRLL GDAS+KILQAVRDMF N S
Sbjct  93    PEQAAKSLIPLLQQAENVVPIDLHHKTPIRLGATAGLRLLNGDASEKILQAVRDMFSNRS  152

Query  507   NFKSKAEWVSILEGSQEGTYFWVAMNYLLGNLGKGYQNTIATIDLGGGSVQVSYAVSGDT  686
              F  + + VSI++G+QEG+Y WV +NY LGN+GK Y  T+  +DLGGGSVQ++YAVS  T
Sbjct  153   TFNVQPDAVSIIDGTQEGSYLWVTVNYALGNVGKKYTKTVGVMDLGGGSVQMAYAVSKKT  212

Query  687   FANAPTPDNGEEPYVQEKYILGAQYYLYVHSYLNYGQLASRAEIFKASGNSTNPCVLEGY  866
               NAP   +G +PY+++  + G  Y LYVHSYL++G+ ASRAEI K + +S NPC+L G+
Sbjct  213   AKNAPKVADGVDPYIKKLVLKGKPYDLYVHSYLHFGREASRAEIMKVTRSSPNPCLLAGF  272

Query  867   DGYYTYNDVSYKVTAPPNGSSLKNCRKLARKVVDFRAPCKYQNCTFNGVWSGGGGAGMEN  1046
             DG YTY    +K  AP +G++   C+K+ RK +    PC YQNCTF G+W+GGGG G ++
Sbjct  273   DGTYTYAGEEFKAKAPASGANFNGCKKIIRKALKLNYPCPYQNCTFGGIWNGGGGNGQKH  332

Query  1047  VYISSFFYDIATDVGIIDQEKASKIVKPRSFLVAAKLACETKFEDVKSTFPNAVEKDYP-  1223
             ++ SS F+ +  DVG++D +  +  ++P   +  AK AC   FED KST+P   +K+   
Sbjct  333   LFASSSFFYLPEDVGMVDPKTPNFKIRPVDLVSEAKKACALNFEDAKSTYPFLAKKNIAS  392

Query  1224  YLCMDLVYEYTLLVDGLGLHPYKEITLMKKVEYKNYMVEAAWPLGCAIDVISS  1382
             Y+CMDL+Y+Y LLVDG GL P +EIT  K++EY++ ++EAAWPLG A++ ISS
Sbjct  393   YVCMDLIYQYVLLVDGFGLDPLQEITSGKEIEYQDAVLEAAWPLGNAVEAISS  445



>ref|XP_002449357.1| hypothetical protein SORBIDRAFT_05g008570 [Sorghum bicolor]
 gb|EES08345.1| hypothetical protein SORBIDRAFT_05g008570 [Sorghum bicolor]
Length=461

 Score =   455 bits (1171),  Expect = 7e-152, Method: Compositional matrix adjust.
 Identities = 224/409 (55%), Positives = 295/409 (72%), Gaps = 2/409 (0%)
 Frame = +3

Query  174   TGNYAVIFDAGSTGSRVHVFHFDENLDLLPIGDGVEFFLKTTPGLSSYANDPEAAAKSLE  353
             T  YAVIFD GSTGSRVHVF FD+ LDL+ IG+ ++FF +  PGLS+YA +P+ AAKS+ 
Sbjct  54    TAQYAVIFDGGSTGSRVHVFQFDKQLDLVKIGNEIQFFAQVKPGLSAYAGEPQEAAKSIA  113

Query  354   PLLLEAEGVVPTELQPDTPLELGATAGLRLLEGDASDKILQAVRDMFKNESNFKSKAEWV  533
             PLL +A+ VVPT LQ  TPL+LGATAGLRL+  + S++IL+AVRD+ +++S F+    W+
Sbjct  114   PLLEKAQSVVPTWLQHKTPLKLGATAGLRLIGDEKSEEILEAVRDLVRSKSKFQYNPNWI  173

Query  534   SILEGSQEGTYFWVAMNYLLGNLGKGYQNTIATIDLGGGSVQVSYAVSGDTFANAPTPDN  713
             ++LEGSQEG+Y WVA+NYLLG LG  + +TI  +DLGGGSVQ++YA+S +  ANAP    
Sbjct  174   TVLEGSQEGSYLWVALNYLLGRLGGDFSDTIGVVDLGGGSVQMAYAISDEASANAPVVPQ  233

Query  714   GEEPYVQEKYILGAQYYLYVHSYLNYGQLASRAEIFKASGNSTNPCVLEGYDGYYTYNDV  893
             G++PYV ++Y+ G QY LYVHSYL+YG LA+RAEI K +    +PC+L G+ G YTYN  
Sbjct  234   GQDPYVTKEYLKGKQYNLYVHSYLHYGLLAARAEILKVNNGPFSPCILRGFSGTYTYNGE  293

Query  894   SYKVTAPPNGSSLKNCRKLARKVVDFRAPCKYQNCTFNGVWSGGGGAGMENVYISSFFYD  1073
              Y+ TAPP G+S   CR  A   ++  A C+ +NCTFNGVW+GGGGAG  ++Y++S+FYD
Sbjct  294   EYEATAPPEGASYHTCRDEAIAALNLGAHCETKNCTFNGVWNGGGGAGQADLYVASYFYD  353

Query  1074  IATDVGIIDQEKASKIVKPRSFLVAAKLACETKFEDVKSTFPNAVEKDYPYLCMDLVYEY  1253
              A+ VGIID +  +    P +F  AA   C    +D K+ +PNA   D  YLCMDLVYEY
Sbjct  354   RASQVGIIDGDAPNGKSTPAAFADAALKVCSLSIDDAKAAYPNAW--DTEYLCMDLVYEY  411

Query  1254  TLLVDGLGLHPYKEITLMKKVEYKNYMVEAAWPLGCAIDVISSSSANNL  1400
             TLLVDG GL P KE TL+ KV+Y  Y V+AAWPLG AI+ +SS   N +
Sbjct  412   TLLVDGFGLEPSKEFTLVTKVKYGEYYVDAAWPLGDAIETLSSQKLNQI  460



>ref|XP_010524962.1| PREDICTED: apyrase 2-like [Tarenaya hassleriana]
Length=469

 Score =   456 bits (1172),  Expect = 8e-152, Method: Compositional matrix adjust.
 Identities = 228/402 (57%), Positives = 296/402 (74%), Gaps = 1/402 (0%)
 Frame = +3

Query  180   NYAVIFDAGSTGSRVHVFHFDENLDLLPIGDGVEFFLKTTPGLSSYANDPEAAAKSLEPL  359
             NYAVIFDAGS+GSRVHV+ FD+NLDL+P+G+ +E FL+  PGLS+YANDP+ AA SL  L
Sbjct  67    NYAVIFDAGSSGSRVHVYCFDQNLDLVPMGNELELFLQLKPGLSAYANDPQQAANSLMSL  126

Query  360   LLEAEGVVPTELQPDTPLELGATAGLRLLEGDASDKILQAVRDMFKNESNFKSKAEWVSI  539
             L +AE  VP EL+  TP+ +GATAGLR L  +AS+ ILQAVRD+ K  S  KS+A  V++
Sbjct  127   LDKAEASVPRELRRKTPVRVGATAGLRTLGHEASENILQAVRDLLKERSTLKSEANAVTV  186

Query  540   LEGSQEGTYFWVAMNYLLGNLGKGYQNTIATIDLGGGSVQVSYAVSGDTFANAPTPDNGE  719
             L+G+QEG+Y WV +NYLL NLGK Y NT+  +DLGGGSVQ++YA+S +  A AP P +GE
Sbjct  187   LDGTQEGSYQWVTINYLLRNLGKKYSNTVGVVDLGGGSVQMAYAISKEDAATAPKPLDGE  246

Query  720   EPYVQEKYILGAQYYLYVHSYLNYGQLASRAEIFKASGNSTNPCVLEGYDGYYTYNDVSY  899
             + YV+E Y+ G  YYLYVHSYL+YG LA+RAEI K S +S NPC+L GYDG Y Y   ++
Sbjct  247   DEYVREMYLKGETYYLYVHSYLHYGLLAARAEILKVSEDSNNPCILAGYDGTYKYGGQNH  306

Query  900   KVTAPPNGSSLKNCRKLARKVVDFR-APCKYQNCTFNGVWSGGGGAGMENVYISSFFYDI  1076
             K TA P+G+SL  CR++A   +    + C +  CTF G+W+GGGG G  N++I+SFF+D 
Sbjct  307   KATASPSGASLDECRRVALNALKVNDSLCTHMRCTFGGIWNGGGGDGQRNLFIASFFFDR  366

Query  1077  ATDVGIIDQEKASKIVKPRSFLVAAKLACETKFEDVKSTFPNAVEKDYPYLCMDLVYEYT  1256
             A + G I+  +    V+P  F  AAK AC TK ED KS FP   E + PYLCMDLVY+YT
Sbjct  367   AYEAGFIEGNQPVAKVRPSDFEKAAKRACNTKMEDGKSKFPRVEEDNLPYLCMDLVYQYT  426

Query  1257  LLVDGLGLHPYKEITLMKKVEYKNYMVEAAWPLGCAIDVISS  1382
             LLVDG GL P ++ITL+K+V+Y ++ VEAAWPLG AI+ +SS
Sbjct  427   LLVDGFGLEPSQKITLVKQVKYGDFAVEAAWPLGSAIEAVSS  468



>gb|AAG32959.1| apyrase GS50 [Glycine soja]
Length=463

 Score =   455 bits (1170),  Expect = 1e-151, Method: Compositional matrix adjust.
 Identities = 229/401 (57%), Positives = 293/401 (73%), Gaps = 1/401 (0%)
 Frame = +3

Query  180   NYAVIFDAGSTGSRVHVFHFDENLDLLPIGDGVEFFLKTTPGLSSYANDPEAAAKSLEPL  359
             +YAVIFDAGSTGSRVHV+ F++ LDLL IG  +E F+KT PGLS+YA +P+ AA+SL PL
Sbjct  53    SYAVIFDAGSTGSRVHVYRFNQQLDLLRIGQDLELFVKTMPGLSAYAENPQDAAESLIPL  112

Query  360   LLEAEGVVPTELQPDTPLELGATAGLRLLEGDASDKILQAVRDMFKNESNFKSKAEWVSI  539
             L EAE  VP E  P TP++LGATAGLR LEGDASD+ILQAV DM KN S     A+ VS+
Sbjct  113   LEEAEAAVPQEFHPRTPVKLGATAGLRQLEGDASDRILQAVSDMLKNRSTLNVGADAVSV  172

Query  540   LEGSQEGTYFWVAMNYLLGNLGKGYQNTIATIDLGGGSVQVSYAVSGDTFANAPTPDNGE  719
             L G+QEG Y WV +NYLLGNLGK Y  T+A +DLGGGSVQ++YAVS    A AP   +G 
Sbjct  173   LSGNQEGAYQWVTINYLLGNLGKHYSETVAVVDLGGGSVQMAYAVSETDAAKAPRAPDGV  232

Query  720   EPYVQEKYILGAQYYLYVHSYLNYGQLASRAEIFKASGNSTNPCVLEGYDGYYTYNDVSY  899
             E Y+ E ++ G +YYLYVHSYL YG LA+RAE  K   +S NPC+L G+DGYY Y  V Y
Sbjct  233   ESYITEMFLRGKKYYLYVHSYLRYGMLAARAEALKVR-HSENPCILAGFDGYYVYGGVQY  291

Query  900   KVTAPPNGSSLKNCRKLARKVVDFRAPCKYQNCTFNGVWSGGGGAGMENVYISSFFYDIA  1079
             K  APP+GSS   C+ +  + +   A C Y++CTF G+W+GGGGAG  N +I+SFF+++A
Sbjct  292   KAKAPPSGSSFSQCQNVVVEALHVNATCSYKDCTFGGIWNGGGGAGENNFFIASFFFEVA  351

Query  1080  TDVGIIDQEKASKIVKPRSFLVAAKLACETKFEDVKSTFPNAVEKDYPYLCMDLVYEYTL  1259
              + G +D    +  V+P  F  AAK+AC T+ +D+KS FP   + D PY+C+DLVYEYTL
Sbjct  352   DEAGFVDPNAPNAKVRPVDFENAAKVACNTELKDLKSIFPRVKDGDVPYICLDLVYEYTL  411

Query  1260  LVDGLGLHPYKEITLMKKVEYKNYMVEAAWPLGCAIDVISS  1382
             LVDG G+ P +EITL+++VEY++ +VEAA PLG AI+ ISS
Sbjct  412   LVDGFGIDPQQEITLVRQVEYQDSLVEAARPLGSAIEAISS  452



>ref|XP_011034426.1| PREDICTED: apyrase 2-like [Populus euphratica]
Length=596

 Score =   459 bits (1182),  Expect = 1e-151, Method: Compositional matrix adjust.
 Identities = 224/408 (55%), Positives = 303/408 (74%), Gaps = 1/408 (0%)
 Frame = +3

Query  162   LSHETGNYAVIFDAGSTGSRVHVFHFDENLDLLPIGDGVEFFLKTTPGLSSYANDPEAAA  341
             L  ++ +YAVIFDAGS+GSRVHV+ FD+NLDL+PIG  +E FL+  PGLS+YAN+P  AA
Sbjct  187   LGTDSRSYAVIFDAGSSGSRVHVYCFDQNLDLVPIGKELELFLQLKPGLSAYANNPREAA  246

Query  342   KSLEPLLLEAEGVVPTELQPDTPLELGATAGLRLLEGDASDKILQAVRDMFKNESNFKSK  521
              SL  LL +AE  VP EL+P TP+ +GATAGLR L  DASD+ILQAVRD+ ++ S  KS+
Sbjct  247   NSLVSLLHKAESSVPKELRPKTPVRVGATAGLRALGMDASDRILQAVRDLLRDTSTLKSE  306

Query  522   AEWVSILEGSQEGTYFWVAMNYLLGNLGKGYQNTIATIDLGGGSVQVSYAVSGDTFANAP  701
             A  V++L+GSQEG+Y WV +NYLLGNLGK Y NT+  +DLGGGSVQ++YA+S    A AP
Sbjct  307   ANGVTVLDGSQEGSYQWVTINYLLGNLGKKYSNTVGVVDLGGGSVQMAYAISETDAAKAP  366

Query  702   TPDNGEEPYVQEKYILGAQYYLYVHSYLNYGQLASRAEIFKASGNSTNPCVLEGYDGYYT  881
                +GE+ YV+E +++G +YYLYVHSYL+YG LA+RAE+  AS +STNPC+L GYDG Y 
Sbjct  367   RLSDGEDTYVKEMFLMGTKYYLYVHSYLHYGLLAARAEMLDASEDSTNPCILAGYDGVYE  426

Query  882   YNDVSYKVTAPPNGSSLKNCRKLARKVVDF-RAPCKYQNCTFNGVWSGGGGAGMENVYIS  1058
             Y    +K +A P+GS+++ CR+LA   +    + C +  CTF G+W+GGGG G +N++++
Sbjct  427   YGGKDHKASASPSGSNMEECRRLALNALKVNESTCTHMKCTFGGIWNGGGGDGQKNMFVA  486

Query  1059  SFFYDIATDVGIIDQEKASKIVKPRSFLVAAKLACETKFEDVKSTFPNAVEKDYPYLCMD  1238
             SFF+D A   G +D    +  V+P  F  AAK ACET+ E+ KS + +  + D PY+CMD
Sbjct  487   SFFFDRAAQAGFVDSTVPAAKVQPSDFENAAKRACETELENAKSIYSSVDDNDLPYICMD  546

Query  1239  LVYEYTLLVDGLGLHPYKEITLMKKVEYKNYMVEAAWPLGCAIDVISS  1382
             LVY+YTLLVDG  L P++E+TL+KKV+Y+  +VEAAWPLG AI+ +SS
Sbjct  547   LVYQYTLLVDGFALDPWQEMTLVKKVQYRTSLVEAAWPLGSAIEAVSS  594



>ref|XP_010922866.1| PREDICTED: probable apyrase 2 [Elaeis guineensis]
Length=459

 Score =   454 bits (1167),  Expect = 3e-151, Method: Compositional matrix adjust.
 Identities = 239/416 (57%), Positives = 298/416 (72%), Gaps = 0/416 (0%)
 Frame = +3

Query  162   LSHETGNYAVIFDAGSTGSRVHVFHFDENLDLLPIGDGVEFFLKTTPGLSSYANDPEAAA  341
             +  E  +YAVIFDAGSTGSRVHVF FDEN+DLL +GD +E F++  PGLSSYA+DP+ AA
Sbjct  35    VGREIESYAVIFDAGSTGSRVHVFRFDENMDLLYLGDDIELFVQVKPGLSSYADDPQKAA  94

Query  342   KSLEPLLLEAEGVVPTELQPDTPLELGATAGLRLLEGDASDKILQAVRDMFKNESNFKSK  521
              SL PLL EAEGVVP ELQP TP+ LGATAGLR L  + S++ILQAVRD+F+N S F+ K
Sbjct  95    NSLIPLLEEAEGVVPEELQPTTPVRLGATAGLRNLGEEKSEEILQAVRDLFQNNSLFEYK  154

Query  522   AEWVSILEGSQEGTYFWVAMNYLLGNLGKGYQNTIATIDLGGGSVQVSYAVSGDTFANAP  701
             +EW+++LEG QEG+Y WVAMNYLLGNLG  Y +T+  +DLGGGSVQ++YA+S    ANAP
Sbjct  155   SEWITVLEGYQEGSYLWVAMNYLLGNLGNRYSDTVGVVDLGGGSVQMAYALSEQAAANAP  214

Query  702   TPDNGEEPYVQEKYILGAQYYLYVHSYLNYGQLASRAEIFKASGNSTNPCVLEGYDGYYT  881
                 G +PYV ++ +    YYLY +SYLNYG LA+RA I +A+    N C+L GY G Y 
Sbjct  215   NVSIGGDPYVTKQLLNETNYYLYAYSYLNYGLLAARAGILEAADEPYNYCMLGGYTGSYE  274

Query  882   YNDVSYKVTAPPNGSSLKNCRKLARKVVDFRAPCKYQNCTFNGVWSGGGGAGMENVYISS  1061
             YN   Y  +A P+GSS   CR    KV+     C Y++CTF GVWSGGGG G +N+Y++S
Sbjct  275   YNGEVYNASASPSGSSYSKCRTETIKVLKINETCAYEDCTFGGVWSGGGGDGQKNLYVAS  334

Query  1062  FFYDIATDVGIIDQEKASKIVKPRSFLVAAKLACETKFEDVKSTFPNAVEKDYPYLCMDL  1241
             FFYD A  VG ID EK + +V P  F  A K+AC+   E+   T+PN  E+D PY+CMDL
Sbjct  335   FFYDRAAQVGFIDSEKPNALVTPSDFEEATKMACKLSLEEANVTYPNVAEEDLPYICMDL  394

Query  1242  VYEYTLLVDGLGLHPYKEITLMKKVEYKNYMVEAAWPLGCAIDVISSSSANNLLSK  1409
             VYEYTLLVDG GL P +EI L+ KVEY +  V AAWPLG AI+V+SS S  +L  K
Sbjct  395   VYEYTLLVDGFGLEPSQEIILVTKVEYGDSYVGAAWPLGSAIEVVSSQSTQSLAMK  450



>ref|XP_002319138.2| hypothetical protein POPTR_0013s05040g [Populus trichocarpa]
 gb|EEE95061.2| hypothetical protein POPTR_0013s05040g [Populus trichocarpa]
Length=601

 Score =   459 bits (1180),  Expect = 4e-151, Method: Compositional matrix adjust.
 Identities = 223/405 (55%), Positives = 301/405 (74%), Gaps = 1/405 (0%)
 Frame = +3

Query  171   ETGNYAVIFDAGSTGSRVHVFHFDENLDLLPIGDGVEFFLKTTPGLSSYANDPEAAAKSL  350
             ++ +YAVIFDAGS+GSRVHV+ FD+NLDL+PIG  +E FL+  PGLS+YAN+P  AA SL
Sbjct  195   DSRSYAVIFDAGSSGSRVHVYCFDQNLDLVPIGKELELFLQLKPGLSAYANNPREAANSL  254

Query  351   EPLLLEAEGVVPTELQPDTPLELGATAGLRLLEGDASDKILQAVRDMFKNESNFKSKAEW  530
               LL +AE  VP EL+P TP+ +GATAGLR L  DASD+ILQAVRD+ ++ S  KS+A  
Sbjct  255   VSLLHKAESSVPKELRPKTPVRVGATAGLRALGMDASDRILQAVRDLLRDTSTLKSEANG  314

Query  531   VSILEGSQEGTYFWVAMNYLLGNLGKGYQNTIATIDLGGGSVQVSYAVSGDTFANAPTPD  710
             V++L+GSQEG+Y WV +NYLLGNLGK Y NT+  +DLGGGSVQ++YA+S    A AP   
Sbjct  315   VTVLDGSQEGSYQWVTINYLLGNLGKKYSNTVGVVDLGGGSVQMAYAISETDAAKAPRLS  374

Query  711   NGEEPYVQEKYILGAQYYLYVHSYLNYGQLASRAEIFKASGNSTNPCVLEGYDGYYTYND  890
             +GE+ YV+E +++G +YYLYVHSYLNYG LA+RAE+   S +STNPC+L GYDG Y    
Sbjct  375   DGEDTYVKEMFLMGTKYYLYVHSYLNYGLLAARAEMLDTSEDSTNPCILAGYDGVYKNGG  434

Query  891   VSYKVTAPPNGSSLKNCRKLARKVVDFR-APCKYQNCTFNGVWSGGGGAGMENVYISSFF  1067
               +K +A P+GS+++ CR+LA   +  + + C +  CTF G+W+GGGG G +N++++SFF
Sbjct  435   KDHKASASPSGSNMEECRRLALNALKVKESTCTHMKCTFGGIWNGGGGDGQKNMFVASFF  494

Query  1068  YDIATDVGIIDQEKASKIVKPRSFLVAAKLACETKFEDVKSTFPNAVEKDYPYLCMDLVY  1247
             +D A   G +D    +  V+P  F  AAK ACETK E+ KS + +  + D PY+CMDLVY
Sbjct  495   FDRAAQAGFVDSTVPAAKVQPSDFENAAKRACETKLENAKSIYSSVDDNDLPYICMDLVY  554

Query  1248  EYTLLVDGLGLHPYKEITLMKKVEYKNYMVEAAWPLGCAIDVISS  1382
             +YTLLVDG  L P++++TL+KKVEY+  +VEAAWPLG AI+ +SS
Sbjct  555   QYTLLVDGFALDPWQDMTLVKKVEYRTSLVEAAWPLGSAIEAVSS  599



>gb|ADD09803.1| ectoapyrase 1 [Gossypium hirsutum]
Length=472

 Score =   454 bits (1167),  Expect = 4e-151, Method: Compositional matrix adjust.
 Identities = 221/401 (55%), Positives = 299/401 (75%), Gaps = 0/401 (0%)
 Frame = +3

Query  180   NYAVIFDAGSTGSRVHVFHFDENLDLLPIGDGVEFFLKTTPGLSSYANDPEAAAKSLEPL  359
             NYAVIFDAGS+GSRVHV+ FD+ LDL+PIG  +E F +  PGLS YA DP+AAA SL  L
Sbjct  70    NYAVIFDAGSSGSRVHVYCFDQILDLVPIGSDLELFEQLKPGLSYYAKDPQAAANSLTSL  129

Query  360   LLEAEGVVPTELQPDTPLELGATAGLRLLEGDASDKILQAVRDMFKNESNFKSKAEWVSI  539
             L +AE VVP +L+  TP+ +GATAGLR L G+ASDKILQ+VR++ K+ S  KS+A  V I
Sbjct  130   LDKAESVVPLDLRSKTPVRVGATAGLRALGGEASDKILQSVRELLKSRSTLKSEANGVKI  189

Query  540   LEGSQEGTYFWVAMNYLLGNLGKGYQNTIATIDLGGGSVQVSYAVSGDTFANAPTPDNGE  719
             L+GSQEG+Y WV +NYLLGNLG+ YQ+T+  +DLGGGSVQ++YA+S +  + AP+   G+
Sbjct  190   LDGSQEGSYEWVTINYLLGNLGRTYQDTVGIVDLGGGSVQMAYAISENAASRAPSVPAGQ  249

Query  720   EPYVQEKYILGAQYYLYVHSYLNYGQLASRAEIFKASGNSTNPCVLEGYDGYYTYNDVSY  899
             + YV E Y+ G++YYLYVHSYL+YG LA+RAEI KA+ +S NPC+LEG+DG Y Y    Y
Sbjct  250   DNYVNEMYLKGSKYYLYVHSYLHYGLLAARAEILKATEDSGNPCILEGFDGTYKYGGEEY  309

Query  900   KVTAPPNGSSLKNCRKLARKVVDFRAPCKYQNCTFNGVWSGGGGAGMENVYISSFFYDIA  1079
             K +AP +GSS++ CR++  K +     C +  CTF G+W+GGGG G +N++++SFF+D A
Sbjct  310   KASAPSSGSSMEECRRVTLKALKVNDSCTHMKCTFGGIWNGGGGDGQKNLFVASFFFDRA  369

Query  1080  TDVGIIDQEKASKIVKPRSFLVAAKLACETKFEDVKSTFPNAVEKDYPYLCMDLVYEYTL  1259
              + G I        V+P SF  AAK AC+TK+ D K+ + +  E +  Y+CMDLVY+YTL
Sbjct  370   AEAGFIKASDPVAKVQPHSFADAAKRACQTKYADAKAIYKDLGESNLAYICMDLVYQYTL  429

Query  1260  LVDGLGLHPYKEITLMKKVEYKNYMVEAAWPLGCAIDVISS  1382
             LVDG GL PY++++L+KKV+Y+N  VEAAWPLG AI+ +S+
Sbjct  430   LVDGFGLDPYQDVSLVKKVKYRNSFVEAAWPLGSAIEAVSA  470



>ref|XP_010558706.1| PREDICTED: apyrase 2 [Tarenaya hassleriana]
Length=469

 Score =   453 bits (1165),  Expect = 9e-151, Method: Compositional matrix adjust.
 Identities = 230/404 (57%), Positives = 297/404 (74%), Gaps = 5/404 (1%)
 Frame = +3

Query  180   NYAVIFDAGSTGSRVHVFHFDENLDLLPIGDGVEFFLKTTPGLSSYANDPEAAAKSLEPL  359
             NYAVIFDAGS+GSRVHVF FD+NLDL+P+G  +E FL+  PGLS+Y +DP+ AA SL  L
Sbjct  67    NYAVIFDAGSSGSRVHVFCFDQNLDLVPMGIELELFLQLKPGLSAYPSDPQQAANSLVSL  126

Query  360   LLEAEGVVPTELQPDTPLELGATAGLRLLEGDASDKILQAVRDMFKNESNFKSKAEWVSI  539
             L +AE  VP EL+  TP+ +GATAGLR L  +AS+ ILQAVRD+ K  S  KS+A  V++
Sbjct  127   LDKAEATVPRELRRKTPVRVGATAGLRTLGHEASENILQAVRDLLKERSTLKSEANSVTV  186

Query  540   LEGSQEGTYFWVAMNYLLGNLGKGYQNTIATIDLGGGSVQVSYAVSGDTFANAPTPDNGE  719
             L+G+QEG+Y WV +NYLL NLGK Y NT+  +DLGGGSVQ++YA+S +  A AP P +GE
Sbjct  187   LDGTQEGSYQWVTINYLLRNLGKKYSNTVGVVDLGGGSVQMAYAISKEDAATAPKPLDGE  246

Query  720   EPYVQEKYILGAQYYLYVHSYLNYGQLASRAEIFKASGNSTNPCVLEGYDGYYTYNDVSY  899
             + YV+E Y+ G  YYLYVHSYL+YG LA+RAEI K S +S NPC+L GYDG Y Y   +Y
Sbjct  247   DEYVREMYLKGQTYYLYVHSYLHYGLLAARAEILKVSEDSNNPCILAGYDGTYKYGGENY  306

Query  900   KVTAPPNGSSLKNCRKL---ARKVVDFRAPCKYQNCTFNGVWSGGGGAGMENVYISSFFY  1070
             K TA P+G+SL  CR++   A KV D  + C +  CTF GVW+GGGG G  N++++SFF+
Sbjct  307   KATASPSGASLDECRRVTLNALKVND--SLCTHMRCTFGGVWNGGGGDGQRNLFVASFFF  364

Query  1071  DIATDVGIIDQEKASKIVKPRSFLVAAKLACETKFEDVKSTFPNAVEKDYPYLCMDLVYE  1250
             D A + G +D+ +    V+P  F  AA+ AC TK ED KS FP+  E + PYLCMDLVY+
Sbjct  365   DRAAEAGFVDKNQPVAKVRPLDFEKAARRACNTKMEDGKSKFPHVEEDNLPYLCMDLVYQ  424

Query  1251  YTLLVDGLGLHPYKEITLMKKVEYKNYMVEAAWPLGCAIDVISS  1382
             YTLLVDGLG+   + ITL+KKV+Y ++ VEAAWPLG AI+ +SS
Sbjct  425   YTLLVDGLGMESSQTITLVKKVKYGDFAVEAAWPLGSAIEAVSS  468



>dbj|BAM84271.1| apyrase [Medicago truncatula]
Length=456

 Score =   452 bits (1163),  Expect = 1e-150, Method: Compositional matrix adjust.
 Identities = 227/413 (55%), Positives = 300/413 (73%), Gaps = 2/413 (0%)
 Frame = +3

Query  150   RRVLLSHET-GNYAVIFDAGSTGSRVHVFHFDENLDLLPIGDGVEFFLKTTPGLSSYAND  326
             R++    ET  +YAV+FDAGSTGSR+HV+HFD+NLDLL IG  VEFF K TPGLSSYAND
Sbjct  33    RKIFQQQETISSYAVVFDAGSTGSRIHVYHFDQNLDLLHIGKDVEFFNKITPGLSSYAND  92

Query  327   PEAAAKSLEPLLLEAEGVVPTELQPDTPLELGATAGLRLLEGDASDKILQAVRDMFKNES  506
             PE AAKSL PLL +AE VVP +L   TP+ LGATAGLRLL GDAS+KILQAVRDMF N S
Sbjct  93    PEHAAKSLIPLLQQAENVVPIDLHHKTPIRLGATAGLRLLNGDASEKILQAVRDMFSNRS  152

Query  507   NFKSKAEWVSILEGSQEGTYFWVAMNYLLGNLGKGYQNTIATIDLGGGSVQVSYAVSGDT  686
              F  + + VSI++G+QEG+Y WV +NY LGNLGK Y  T+  +DLGGGSVQ++YAVS  T
Sbjct  153   TFNVQPDAVSIIDGTQEGSYLWVTVNYALGNLGKKYTKTVGVMDLGGGSVQMAYAVSKKT  212

Query  687   FANAPTPDNGEEPYVQEKYILGAQYYLYVHSYLNYGQLASRAEIFKASGNSTNPCVLEGY  866
               NAP   +G +PY+++  + G  Y LYVHSYL++G+ ASRAEI K + +S N C+L G+
Sbjct  213   AKNAPKAADGVDPYIKKLVLKGKPYDLYVHSYLHFGREASRAEIMKVTRSSPNTCILAGF  272

Query  867   DGYYTYNDVSYKVTAPPNGSSLKNCRKLARKVVDFRAPCKYQNCTFNGVWSGGGGAGMEN  1046
             DG YTY  V +K  AP +G++   C+K+ RK +    PC YQNCTF G+W+GGGG G ++
Sbjct  273   DGTYTYAGVEFKAKAPASGANFNGCKKIIRKALKLNYPCPYQNCTFGGIWNGGGGNGQKH  332

Query  1047  VYISSFFYDIATDVGIIDQEKASKIVKPRSFLVAAKLACETKFEDVKSTFPNAVEKDYP-  1223
             ++ SS F+ +  DVG+++ +  +  ++P   +  AK AC   FED KST+P   +K+   
Sbjct  333   LFASSSFFYLPEDVGMVNPKTPNFKIRPVDLVSEAKKACALNFEDAKSTYPFLAKKNIAS  392

Query  1224  YLCMDLVYEYTLLVDGLGLHPYKEITLMKKVEYKNYMVEAAWPLGCAIDVISS  1382
             Y+CMDL+Y+Y LLVDG GL P +EIT  K++EY++ ++EAAW LG A++ ISS
Sbjct  393   YVCMDLIYQYVLLVDGFGLDPLQEITSGKEIEYQDAVLEAAWALGNAVEAISS  445



>ref|XP_002525470.1| adenosine diphosphatase, putative [Ricinus communis]
 gb|EEF36960.1| adenosine diphosphatase, putative [Ricinus communis]
Length=469

 Score =   452 bits (1164),  Expect = 1e-150, Method: Compositional matrix adjust.
 Identities = 227/414 (55%), Positives = 301/414 (73%), Gaps = 7/414 (2%)
 Frame = +3

Query  141   PHLRRVLLSHETGNYAVIFDAGSTGSRVHVFHFDENLDLLPIGDGVEFFLKTTPGLSSYA  320
             P+LR      +   YAVIFDAGS+GSRVHV+ FD N+DL+PIG  +E F++  PGLS+YA
Sbjct  61    PNLR------DAKMYAVIFDAGSSGSRVHVYCFDRNMDLVPIGKDLELFVQIKPGLSAYA  114

Query  321   NDPEAAAKSLEPLLLEAEGVVPTELQPDTPLELGATAGLRLLEGDASDKILQAVRDMFKN  500
             +DP+AAA SL  LL +AE VVP E +  TP+ +GATAGLR L  DASD+IL AVRD+ ++
Sbjct  115   SDPQAAANSLLSLLDKAESVVPKEQRSKTPVRVGATAGLRALGADASDRILDAVRDLLRD  174

Query  501   ESNFKSKAEWVSILEGSQEGTYFWVAMNYLLGNLGKGYQNTIATIDLGGGSVQVSYAVSG  680
              S  KS+A+ V++L+GSQEG+Y WV +NYLLG LGK Y +T+  +DLGGGSVQ++YA+S 
Sbjct  175   RSTLKSEADGVTVLDGSQEGSYEWVTINYLLGKLGKSYADTVGVVDLGGGSVQMAYAISK  234

Query  681   DTFANAPTPDNGEEPYVQEKYILGAQYYLYVHSYLNYGQLASRAEIFKASGNSTNPCVLE  860
                A AP   +GE+ YV+E  ++   YYLYVHSYL+YG LA+RAEI K S  S N CVL 
Sbjct  235   SDAAKAPRVLDGEDTYVKEMRLMATDYYLYVHSYLHYGLLAARAEILKVSEESDNACVLN  294

Query  861   GYDGYYTYNDVSYKVTAPPNGSSLKNCRKLARKVVDF-RAPCKYQNCTFNGVWSGGGGAG  1037
             GYDG Y Y  + YK +A P+G+SL+ CR LA K +    + C +  CTF G+W+GGGG G
Sbjct  295   GYDGAYKYGGLEYKASASPSGASLEGCRSLALKALKVNESTCTHMKCTFGGIWNGGGGDG  354

Query  1038  MENVYISSFFYDIATDVGIIDQEKASKIVKPRSFLVAAKLACETKFEDVKSTFPNAVEKD  1217
              +N++++SFF+D A + G ID  +    V P  F  AAK ACETK E+ KST+P+  E +
Sbjct  355   QKNLFVASFFFDRAAEAGFIDPTQPVARVHPGDFEEAAKRACETKLENAKSTYPHVEEGN  414

Query  1218  YPYLCMDLVYEYTLLVDGLGLHPYKEITLMKKVEYKNYMVEAAWPLGCAIDVIS  1379
              PYLCMDLVY+YTLLVDG GL P++EITL+K+++Y++ +VEAAWPLG AI+ +S
Sbjct  415   LPYLCMDLVYQYTLLVDGFGLEPWQEITLVKQIKYRDSLVEAAWPLGSAIEALS  468



>ref|XP_010999471.1| PREDICTED: apyrase 2-like [Populus euphratica]
Length=468

 Score =   451 bits (1161),  Expect = 3e-150, Method: Compositional matrix adjust.
 Identities = 225/408 (55%), Positives = 299/408 (73%), Gaps = 1/408 (0%)
 Frame = +3

Query  162   LSHETGNYAVIFDAGSTGSRVHVFHFDENLDLLPIGDGVEFFLKTTPGLSSYANDPEAAA  341
             L  ++ +YAVIFDAGS+GSRVHVF FD NLDL+PIG  +E F++ +PGLS+YAN+P+ AA
Sbjct  59    LVRDSRSYAVIFDAGSSGSRVHVFCFDRNLDLVPIGKELELFVQLSPGLSAYANNPQEAA  118

Query  342   KSLEPLLLEAEGVVPTELQPDTPLELGATAGLRLLEGDASDKILQAVRDMFKNESNFKSK  521
              SL  LL +AE  VP EL+P TP+ +GATAGLR L  DASD+ILQAVRD  + +S  KS+
Sbjct  119   SSLASLLDKAESSVPKELRPKTPVRVGATAGLRALGMDASDRILQAVRDFLRAKSTLKSE  178

Query  522   AEWVSILEGSQEGTYFWVAMNYLLGNLGKGYQNTIATIDLGGGSVQVSYAVSGDTFANAP  701
             A  V++L+GSQEG+Y WV +NYLLGNLGK Y NT+  +DLGGGSVQ++YA+S    A AP
Sbjct  179   ASRVTVLDGSQEGSYQWVTINYLLGNLGKTYSNTVGVVDLGGGSVQMAYAISKMDAAKAP  238

Query  702   TPDNGEEPYVQEKYILGAQYYLYVHSYLNYGQLASRAEIFKASGNSTNPCVLEGYDGYYT  881
                +GE+ YV+E +++G +YYLYVHSYL+YG LA+RAEI  AS +S+NPC+L GYDG Y 
Sbjct  239   RISDGEDTYVKEMFLMGTKYYLYVHSYLHYGLLAARAEILDASEDSSNPCILGGYDGVYN  298

Query  882   YNDVSYKVTAPPNGSSLKNCRKLARKVVDF-RAPCKYQNCTFNGVWSGGGGAGMENVYIS  1058
             Y    +K +A P+GS+L  CR++A   +    + C    CTF GVW+GGGG G +N++++
Sbjct  299   YGGKDHKASASPSGSNLDECRRVALNALKVNESTCTSMKCTFGGVWNGGGGDGQKNMFVA  358

Query  1059  SFFYDIATDVGIIDQEKASKIVKPRSFLVAAKLACETKFEDVKSTFPNAVEKDYPYLCMD  1238
             SFF+D A   G ID       V+P  F  AAK AC TK E+ KS + +  EKD PY+CMD
Sbjct  359   SFFFDRAAQAGFIDSSLPVVKVRPVDFEHAAKRACGTKLENAKSIYHSLDEKDLPYICMD  418

Query  1239  LVYEYTLLVDGLGLHPYKEITLMKKVEYKNYMVEAAWPLGCAIDVISS  1382
             LVY+YTLLVDG  + P +++ L+KKV+Y++ +VEAAWPLG AI+ +SS
Sbjct  419   LVYQYTLLVDGFAMDPLQDMMLVKKVQYRDSLVEAAWPLGSAIEAVSS  466



>ref|XP_006598985.1| PREDICTED: apyrase 2-like [Glycine max]
Length=469

 Score =   451 bits (1161),  Expect = 3e-150, Method: Compositional matrix adjust.
 Identities = 224/405 (55%), Positives = 304/405 (75%), Gaps = 1/405 (0%)
 Frame = +3

Query  174   TGNYAVIFDAGSTGSRVHVFHFDENLDLLPIGDGVEFFLKTTPGLSSYANDPEAAAKSLE  353
              G+YAVIFDAGS+GSRVHVFHFD NLDL+ IG  +E F++  PGLS++A +P+ AA+SL 
Sbjct  65    VGSYAVIFDAGSSGSRVHVFHFDHNLDLVHIGKDLELFVQKKPGLSAFAKNPKQAAESLV  124

Query  354   PLLLEAEGVVPTELQPDTPLELGATAGLRLLEGDASDKILQAVRDMFKNESNFKSKAEWV  533
              LL EAE VVP EL+  TP+ +GATAGLR LEGDASD+ILQAVRD+ K+ S+ KS+++ V
Sbjct  125   SLLEEAESVVPRELRSKTPVRVGATAGLRALEGDASDRILQAVRDLLKDRSSLKSESDAV  184

Query  534   SILEGSQEGTYFWVAMNYLLGNLGKGYQNTIATIDLGGGSVQVSYAVSGDTFANAPTPDN  713
             ++L+G+QEG Y WV +NYLLGNLGK Y  T+  +DLGGGSVQ++YA+S    A AP   +
Sbjct  185   TVLDGTQEGAYQWVTINYLLGNLGKDYSKTVGVVDLGGGSVQMAYAISETDAAMAPKVVD  244

Query  714   GEEPYVQEKYILGAQYYLYVHSYLNYGQLASRAEIFKASGNSTNPCVLEGYDGYYTYNDV  893
             G +PY++E ++ G +YYLYVHSYL+YG LA+RAEI K S ++ NPCV+ GYDG Y Y   
Sbjct  245   GGDPYLKEMFLRGRKYYLYVHSYLHYGLLAARAEILKISDDAENPCVISGYDGSYNYGGK  304

Query  894   SYKVTAPPNGSSLKNCRKLARKVVDF-RAPCKYQNCTFNGVWSGGGGAGMENVYISSFFY  1070
             S+K ++  +G+SL  C+ +A + +    + C +  CTF G+W+GGGG G +N++++SFF+
Sbjct  305   SFKASSGSSGASLNECKSVALRALKVNESTCTHMKCTFGGIWNGGGGDGQKNLFVASFFF  364

Query  1071  DIATDVGIIDQEKASKIVKPRSFLVAAKLACETKFEDVKSTFPNAVEKDYPYLCMDLVYE  1250
             D A + G  D      IV+P  F  AAK AC+TK E+ KSTFP   E + PYLCMDL+Y+
Sbjct  365   DRAAEAGFADPNLPVAIVRPADFEDAAKQACQTKLENAKSTFPRVDEGNLPYLCMDLIYQ  424

Query  1251  YTLLVDGLGLHPYKEITLMKKVEYKNYMVEAAWPLGCAIDVISSS  1385
             YTLLVDG G++P++EITL+KKV+Y + +VEAAWPLG AI+ +SS+
Sbjct  425   YTLLVDGFGIYPWQEITLVKKVKYDDALVEAAWPLGSAIEAVSSA  469



>ref|XP_010054281.1| PREDICTED: apyrase 2 [Eucalyptus grandis]
 gb|KCW89828.1| hypothetical protein EUGRSUZ_A02068 [Eucalyptus grandis]
Length=468

 Score =   451 bits (1159),  Expect = 7e-150, Method: Compositional matrix adjust.
 Identities = 229/413 (55%), Positives = 305/413 (74%), Gaps = 1/413 (0%)
 Frame = +3

Query  150   RRVLLSHETGNYAVIFDAGSTGSRVHVFHFDENLDLLPIGDGVEFFLKTTPGLSSYANDP  329
             RR     ++  YAVIFDAGS+GSRVHVF FD+ LDL+P+G  +E F+KT PGLS++A +P
Sbjct  55    RRGSPGSKSRTYAVIFDAGSSGSRVHVFCFDKYLDLVPMGKELELFVKTDPGLSAFAKNP  114

Query  330   EAAAKSLEPLLLEAEGVVPTELQPDTPLELGATAGLRLLEGDASDKILQAVRDMFKNESN  509
               AA+SL  LL +AEG VP EL+ DTP+++GATAGLR LEGDA D+IL AVR++ K++S+
Sbjct  115   RQAAESLHSLLDKAEGAVPKELRGDTPVKVGATAGLRALEGDAPDRILDAVRELLKHKSS  174

Query  510   FKSKAEWVSILEGSQEGTYFWVAMNYLLGNLGKGYQNTIATIDLGGGSVQVSYAVSGDTF  689
              KS   WVS+L+G+QEG Y WV +NYLLG LGK Y NT+  +DLGGGSVQ++YA+S +  
Sbjct  175   LKSDPRWVSVLDGTQEGAYQWVTINYLLGYLGKEYSNTVGVVDLGGGSVQMAYAISEEDA  234

Query  690   ANAPTPDNGEEPYVQEKYILGAQYYLYVHSYLNYGQLASRAEIFKASGNSTNPCVLEGYD  869
             A AP   NGE+ YV E ++ G +YYLYVHSYL+YG LA+RAEI K SG+S NPC+LEGY+
Sbjct  235   AKAPRFSNGEDSYVNEMFLKGRRYYLYVHSYLHYGLLAARAEILKVSGDSGNPCILEGYE  294

Query  870   GYYTYNDVSYKVTAPPNGSSLKNCRKLARKVVDF-RAPCKYQNCTFNGVWSGGGGAGMEN  1046
             G Y Y   +Y+ +A  +GSS+  C+++A K +    + C +  CTF GVW+GGGG G +N
Sbjct  295   GSYKYGGATYQASASSSGSSINECKRIASKALKVNESTCTHMKCTFGGVWNGGGGDGQKN  354

Query  1047  VYISSFFYDIATDVGIIDQEKASKIVKPRSFLVAAKLACETKFEDVKSTFPNAVEKDYPY  1226
             ++++SFFYD A + G +D  K    V    F  AAK AC+TK ED KS +P+  + + PY
Sbjct  355   LFVASFFYDRAAEAGFVDPNKPVAKVSAAEFEEAAKRACQTKLEDAKSVYPHVGDANLPY  414

Query  1227  LCMDLVYEYTLLVDGLGLHPYKEITLMKKVEYKNYMVEAAWPLGCAIDVISSS  1385
             LCMDLVY+YTLLVDG  + P+++ITL+KKV+Y+N  VEAAWPLG AI+ +SSS
Sbjct  415   LCMDLVYQYTLLVDGFAIDPWQKITLVKKVKYRNAFVEAAWPLGSAIEAVSSS  467



>ref|XP_011096861.1| PREDICTED: LOW QUALITY PROTEIN: apyrase-like [Sesamum indicum]
Length=436

 Score =   449 bits (1154),  Expect = 1e-149, Method: Compositional matrix adjust.
 Identities = 225/408 (55%), Positives = 291/408 (71%), Gaps = 7/408 (2%)
 Frame = +3

Query  165   SHETGNYAVIFDAGSTGSRVHVFHFDENLDLLPIGDGVEFFLKTTPGLSSYANDPEAAAK  344
             S  T +YAV+FDAGSTGSRVHVF FD NL L PI    E FL  +PGLSSY +DPEAAA 
Sbjct  32    STATQSYAVVFDAGSTGSRVHVFAFDPNLALTPIDQSYELFLSISPGLSSYEHDPEAAAL  91

Query  345   SLEPLLLEAEGVVPTELQPDTPLELGATAGLRLLEGDASDKILQAVRDMFKNESNFKSKA  524
             SL+PLL  AE VVP EL+  TP+ LGATAGLRLL G+AS+ IL AVR + K ES    + 
Sbjct  92    SLKPLLQNAEAVVPAELRAQTPVRLGATAGLRLLPGNASEDILDAVRKLLKTESRLYYRP  151

Query  525   EWVSILEGSQEGTYFWVAMNYLLGNLGKGYQNTIATIDLGGGSVQVSYAVSGDTFANAPT  704
             +WVS+L G  EG Y WV +NYLLG+LGK Y +T+  +DLGGGSVQ++YA +         
Sbjct  152   DWVSVLRGIDEGGYQWVTINYLLGSLGKSYSSTVGVVDLGGGSVQMAYAXAAAPPVA---  208

Query  705   PDNGEEPYVQEKYILGAQYYLYVHSYLNYGQLASRAEIFKASGNSTNPCVLEGYDGYYTY  884
               +GE+PYV EK  LG +Y+LY HSYLNYG  A+RA+  K SGN  NPC++ GY G Y Y
Sbjct  209   --DGEDPYVSEKVALGTKYHLYAHSYLNYGLKAARAQSLKLSGNKGNPCIINGYQGTYEY  266

Query  885   NDVSYKVTAPPNGSSLKNCRKLARKVVDFRAPCKYQNCTFNGVWSGGGGAGM--ENVYIS  1058
             ++V YKV+ P +G+S + CR L R+V+   APC ++NC+FNGVW+GGGG G   +N+Y++
Sbjct  267   SNVVYKVSPPVSGTSRRRCRLLTREVLGLDAPCFHRNCSFNGVWNGGGGGGDGRKNLYVA  326

Query  1059  SFFYDIATDVGIIDQEKASKIVKPRSFLVAAKLACETKFEDVKSTFPNAVEKDYPYLCMD  1238
             SFFYD A + GII     +  V+P  +L AAK AC    +++ STFP   ++D P+LCMD
Sbjct  327   SFFYDTAAETGIIAPNAPAATVRPIQYLKAAKQACAANVDNINSTFPLIDKRDVPFLCMD  386

Query  1239  LVYEYTLLVDGLGLHPYKEITLMKKVEYKNYMVEAAWPLGCAIDVISS  1382
             LVYEY LLVDG G+ P +EIT++K+V+YK   +EAAWPLGCA++++SS
Sbjct  387   LVYEYMLLVDGFGVDPLQEITVLKEVKYKGSSLEAAWPLGCAVELVSS  434



>gb|EYU37260.1| hypothetical protein MIMGU_mgv1a006675mg [Erythranthe guttata]
Length=435

 Score =   448 bits (1153),  Expect = 2e-149, Method: Compositional matrix adjust.
 Identities = 217/414 (52%), Positives = 296/414 (71%), Gaps = 7/414 (2%)
 Frame = +3

Query  153   RVLLSHETGNYAVIFDAGSTGSRVHVFHFDENLDLLPIGDGVEFFLKTTPGLSSYANDPE  332
              V+      NYAV+FDAGSTG+RVHV+ FD N+DLLP+G+  EFFL T PGLSSY NDPE
Sbjct  22    EVIKIENINNYAVVFDAGSTGTRVHVYSFDRNMDLLPVGNDYEFFLSTKPGLSSYENDPE  81

Query  333   AAAKSLEPLLLEAEGVVPTELQPDTPLELGATAGLRLLEGDASDKILQAVRDMFKNESNF  512
               A+SL+PLL +A+ VVP +   +TP+ LGATAGLR L   A++ IL AVR++FKNES  
Sbjct  82    GGAQSLKPLLQKAQDVVPQQFLANTPVILGATAGLRQLPASATEAILDAVRNLFKNESKL  141

Query  513   KSKAEWVSILEGSQEGTYFWVAMNYLLGNLGKGYQNTIATIDLGGGSVQVSYAVSGDTFA  692
               KA+WVS L+G+ EG Y WV +NYLLG LGK Y +T+  +DLGGGSVQ++YA+S  + A
Sbjct  142   SYKADWVSTLQGTDEGAYQWVTVNYLLGTLGKKYSSTVGVVDLGGGSVQMAYAISDKSAA  201

Query  693   NAPTPDNGEEPYVQEKYILGAQYYLYVHSYLNYGQLASRAEIFKASGNSTNPCVLEGYDG  872
             NAP     E+ YV +K ++G +Y LY HSY NYGQ A RA+    SG++ NPCV  GY G
Sbjct  202   NAP---KDEDAYVMDKLVMGTKYNLYSHSYSNYGQKAGRAQSLNLSGDAGNPCVTNGYQG  258

Query  873   YYTYNDVSYKVTAPPNGSSLKNCRKLARKVVDFRAPCKYQNCTFNGVWSGGGGAGMENVY  1052
              Y Y  V Y V+AP +G+S++ CR L RK +   APC +  C+F+GVWSGGGG G++N+Y
Sbjct  259   TYEYLGVVYNVSAPLSGTSMRRCRALMRKTLRVDAPCNHTYCSFDGVWSGGGGLGLKNLY  318

Query  1053  ISSFFYDIATDVGIIDQEKASKIVKPRSFLVAAKLACETKFEDVKSTFPNAVEKDYPYLC  1232
             ++S+FYD A + G+++ +  S  ++P  +  AAK AC    +++KS FP   E+D P+LC
Sbjct  319   VASYFYDTAAETGLVEADAPSGKIRPIYYKNAAKKACSATVDNIKSIFPLLDERDVPFLC  378

Query  1233  MDLVYEYTLLVDGLGLHPYKEITLMKKVEYKNY----MVEAAWPLGCAIDVISS  1382
              DL+YEYT+LVDG G++  KEIT++K++EYK      ++EAAWPLGCA++++SS
Sbjct  379   SDLIYEYTMLVDGFGVNQLKEITVVKQLEYKKDSSLPLLEAAWPLGCAVELVSS  432



>dbj|BAD13527.1| apyrase [Glycine max]
Length=455

 Score =   449 bits (1154),  Expect = 3e-149, Method: Compositional matrix adjust.
 Identities = 226/413 (55%), Positives = 300/413 (73%), Gaps = 2/413 (0%)
 Frame = +3

Query  150   RRVLLSH-ETGNYAVIFDAGSTGSRVHVFHFDENLDLLPIGDGVEFFLKTTPGLSSYAND  326
             R++ L H E  +YAV+FDAGSTGSR+HV+HF++NLDLL IG GVE++ K TPGLSSYAN+
Sbjct  32    RKIFLKHVEISSYAVVFDAGSTGSRIHVYHFNQNLDLLHIGKGVEYYNKITPGLSSYANN  91

Query  327   PEAAAKSLEPLLLEAEGVVPTELQPDTPLELGATAGLRLLEGDASDKILQAVRDMFKNES  506
             PE AAKSL PLL +AE VVP +LQP TP+ LGATAGLRLL GDAS+KILQ+VRDM  N S
Sbjct  92    PEQAAKSLIPLLEQAEDVVPDDLQPKTPVRLGATAGLRLLNGDASEKILQSVRDMLSNRS  151

Query  507   NFKSKAEWVSILEGSQEGTYFWVAMNYLLGNLGKGYQNTIATIDLGGGSVQVSYAVSGDT  686
              F  + + VSI++G+QEG+Y WV +NY LGNLGK Y  T+  IDLGGGSVQ++YAVS  T
Sbjct  152   TFNVQPDAVSIIDGTQEGSYLWVTVNYALGNLGKKYTKTVGVIDLGGGSVQMAYAVSKKT  211

Query  687   FANAPTPDNGEEPYVQEKYILGAQYYLYVHSYLNYGQLASRAEIFKASGNSTNPCVLEGY  866
               NAP   +G++PY+++  + G  Y LYVHSYL++G+ ASRAEI K +  S NPC+L G+
Sbjct  212   AKNAPKVADGDDPYIKKVVLKGIPYDLYVHSYLHFGREASRAEILKLTPRSPNPCLLAGF  271

Query  867   DGYYTYNDVSYKVTAPPNGSSLKNCRKLARKVVDFRAPCKYQNCTFNGVWSGGGGAGMEN  1046
             +G YTY+   +K TA  +G++   C+   RK +    PC YQNCTF G+W+GGGG G +N
Sbjct  272   NGIYTYSGEEFKATAYTSGANFNKCKNTIRKALKLNYPCPYQNCTFGGIWNGGGGNGQKN  331

Query  1047  VYISSFFYDIATDVGIIDQEKASKIVKPRSFLVAAKLACETKFEDVKSTFPNAVEKDYP-  1223
              + SS F+ +  D G++D    + I++P      AK AC   FED KST+P   +K+   
Sbjct  332   PFASSSFFYLPEDTGMVDASTPNFILRPVDIETKAKEACALNFEDAKSTYPFLDKKNVAS  391

Query  1224  YLCMDLVYEYTLLVDGLGLHPYKEITLMKKVEYKNYMVEAAWPLGCAIDVISS  1382
             Y+CMDL+Y+Y LLVDG GL P ++IT  K++EY++ +VEAAWPLG A++ IS+
Sbjct  392   YVCMDLIYQYVLLVDGFGLDPLQKITSGKEIEYQDAIVEAAWPLGNAVEAISA  444



>dbj|BAB87198.1| ATP diphosphohydrolase [Pisum sativum]
Length=473

 Score =   449 bits (1155),  Expect = 3e-149, Method: Compositional matrix adjust.
 Identities = 221/431 (51%), Positives = 295/431 (68%), Gaps = 20/431 (5%)
 Frame = +3

Query  150   RRVLLSHE-TGNYAVIFDAGSTGSRVHVFHFDENLDLLPIGDGVEFFLKTTPGLSSYAND  326
             RR+ L  E   +YAV+FDAGSTGSR+HV+HF++NLDLL IG GVE++ K TPGLSSYAN+
Sbjct  32    RRIFLKQEEISSYAVVFDAGSTGSRIHVYHFNQNLDLLHIGKGVEYYNKITPGLSSYANN  91

Query  327   PEAAAKSLEPLLLEAEGVVPTELQPDTPLELGATAGLRLLEGDASDKILQAVRDMFKNES  506
             PE AAKSL PLL +AE  VP +LQP TP+ LGATA LRLL GDAS+KILQ+VRDM  N S
Sbjct  92    PEQAAKSLIPLLEQAEEFVPDDLQPKTPVRLGATAVLRLLNGDASEKILQSVRDMLSNRS  151

Query  507   NFKSKAEWVSILEGSQEGTYFW------------------VAMNYLLGNLGKGYQNTIAT  632
              F  + + VSI++G+QEG+Y W                  V +NY LG LGK Y  T+  
Sbjct  152   TFNVQPDAVSIIDGTQEGSYLWTYIYIHMMLLCLYTLCSQVTVNYALGKLGKKYTKTVGV  211

Query  633   IDLGGGSVQVSYAVSGDTFANAPTPDNGEEPYVQEKYILGAQYYLYVHSYLNYGQLASRA  812
             IDLGGGSVQ++YAVS  T  NAP   +G++PY+++  + G  Y LYVHSYL++G+ ASRA
Sbjct  212   IDLGGGSVQMAYAVSKKTAKNAPKVADGDDPYIKKVVLKGIPYDLYVHSYLHFGREASRA  271

Query  813   EIFKASGNSTNPCVLEGYDGYYTYNDVSYKVTAPPNGSSLKNCRKLARKVVDFRAPCKYQ  992
             EI K +  S NPC+L G++G YTY+   +K TA  +G++   C+   RK +    PC YQ
Sbjct  272   EILKLTRRSPNPCLLAGFNGIYTYSREEFKATAYTSGANFNKCKNTIRKALKLNYPCPYQ  331

Query  993   NCTFNGVWSGGGGAGMENVYISSFFYDIATDVGIIDQEKASKIVKPRSFLVAAKLACETK  1172
             NCTF G+W  GGG G +N++ SS F+ +  D G++D    + I++P      AK +C   
Sbjct  332   NCTFGGIWKSGGGNGQKNLFASSTFFYLPEDTGMVDASTPNFILRPVDIETKAKGSCALN  391

Query  1173  FEDVKSTFPNAVEKDYP-YLCMDLVYEYTLLVDGLGLHPYKEITLMKKVEYKNYMVEAAW  1349
             FED KST+P   +K+   Y+CMDL+Y+Y LLVDG GL P ++IT  K++EY++ +VEAAW
Sbjct  392   FEDAKSTYPFLDKKNVASYVCMDLIYQYVLLVDGFGLDPLQKITSGKEIEYQDAIVEAAW  451

Query  1350  PLGCAIDVISS  1382
             PLG A++ IS+
Sbjct  452   PLGNAVEAISA  462



>gb|AAF00611.1|AF156782_1 nod factor binding lectin-nucleotide phosphohydrolase [Medicago 
sativa]
Length=455

 Score =   448 bits (1153),  Expect = 4e-149, Method: Compositional matrix adjust.
 Identities = 218/412 (53%), Positives = 302/412 (73%), Gaps = 1/412 (0%)
 Frame = +3

Query  150   RRVLLSHET-GNYAVIFDAGSTGSRVHVFHFDENLDLLPIGDGVEFFLKTTPGLSSYAND  326
             R++    ET  +YAVIFDAGSTG+RVHV+HFD+NLDLL IG+ +EF  K  PGLS+Y ++
Sbjct  33    RKIFQKQETLTSYAVIFDAGSTGTRVHVYHFDQNLDLLHIGNDIEFVDKIKPGLSAYGDN  92

Query  327   PEAAAKSLEPLLLEAEGVVPTELQPDTPLELGATAGLRLLEGDASDKILQAVRDMFKNES  506
             PE AAKSL PLL EAE VVP +L P TPL LGATAGLRLL GDA++KILQA R+MF N S
Sbjct  93    PEQAAKSLIPLLEEAEDVVPEDLHPKTPLRLGATAGLRLLNGDAAEKILQATRNMFSNRS  152

Query  507   NFKSKAEWVSILEGSQEGTYFWVAMNYLLGNLGKGYQNTIATIDLGGGSVQVSYAVSGDT  686
                 + + VSI++G+QEG+Y WV +NY+LGNLGK +  ++  IDLGGGSVQ++YAVS  T
Sbjct  153   TLNVQRDAVSIIDGTQEGSYMWVTVNYVLGNLGKSFTKSVGVIDLGGGSVQMTYAVSKKT  212

Query  687   FANAPTPDNGEEPYVQEKYILGAQYYLYVHSYLNYGQLASRAEIFKASGNSTNPCVLEGY  866
               NAP   +GE+PY+++  + G QY LYVHSYL +G+ A+RA++  A+  S NPC+L G+
Sbjct  213   AKNAPKVADGEDPYIKKLVLKGKQYDLYVHSYLRFGKEATRAQVLNATNGSANPCILPGF  272

Query  867   DGYYTYNDVSYKVTAPPNGSSLKNCRKLARKVVDFRAPCKYQNCTFNGVWSGGGGAGMEN  1046
             +G +TY+ V YK  +P +GS+  +C+++  KV+    PC Y +CTF G+W+GGGG+G + 
Sbjct  273   NGTFTYSGVEYKAFSPSSGSNFDDCKEIILKVLKVNDPCPYPSCTFGGIWNGGGGSGQKK  332

Query  1047  VYISSFFYDIATDVGIIDQEKASKIVKPRSFLVAAKLACETKFEDVKSTFPNAVEKDYPY  1226
             ++++S F  +A DVG+++  K + I+ P  F + AK AC   FEDVKST+P   +   PY
Sbjct  333   LFVTSAFAYLAEDVGMVEPNKPNSILHPVDFEIEAKRACALNFEDVKSTYPRLTDAKRPY  392

Query  1227  LCMDLVYEYTLLVDGLGLHPYKEITLMKKVEYKNYMVEAAWPLGCAIDVISS  1382
             +CMDL+Y++ LLV G GL P KEIT+ + ++Y+N +VEAAWPLG A++ IS+
Sbjct  393   VCMDLLYQHVLLVHGFGLGPRKEITVGEGIQYQNSVVEAAWPLGTAVEAISA  444



>gb|AAO23002.1| apyrase-like protein [Medicago truncatula]
Length=454

 Score =   447 bits (1151),  Expect = 5e-149, Method: Compositional matrix adjust.
 Identities = 227/413 (55%), Positives = 299/413 (72%), Gaps = 4/413 (1%)
 Frame = +3

Query  150   RRVLLSHET-GNYAVIFDAGSTGSRVHVFHFDENLDLLPIGDGVEFFLKTTPGLSSYAND  326
             R++    ET  +YAV+FDAGSTGSR+HV+HFD+NLDLL IG  VEFF K TPGLSSYAND
Sbjct  33    RKIFQKQETISSYAVVFDAGSTGSRIHVYHFDQNLDLLHIGKDVEFFNKITPGLSSYAND  92

Query  327   PEAAAKSLEPLLLEAEGVVPTELQPDTPLELGATAGLRLLEGDASDKILQAVRDMFKNES  506
             PE AAKSL PLL +AE VVP +L   TP+ LGATAGLRLL GDAS+KILQAVRDMF N S
Sbjct  93    PEQAAKSLIPLLQQAENVVPIDLHHKTPIRLGATAGLRLLNGDASEKILQAVRDMFSNRS  152

Query  507   NFKSKAEWVSILEGSQEGTYFWVAMNYLLGNLGKGYQNTIATIDLGGGSVQVSYAVSGDT  686
              F  + + VSI++G+QEG+Y WV +NY LGNLGK Y  T+  +DLGGGSVQ++YAVS  T
Sbjct  153   TFNVQPDAVSIIDGTQEGSYLWVTVNYALGNLGKKYTKTVGVMDLGGGSVQMAYAVSKKT  212

Query  687   FANAPTPDNGEEPYVQEKYILGAQYYLYVHSYLNYGQLASRAEIFKASGNSTNPCVLEGY  866
               NAP   +G +PY+++  + G  Y LYVHSYL++G+ ASRAEI K + +S NPC+L G+
Sbjct  213   AKNAPKVADGVDPYIKKLVLKGKPYDLYVHSYLHFGREASRAEIMKVTRSSPNPCLLAGF  272

Query  867   DGYYTYNDVSYKVTAPPNGSSLKNCRKLARKVVDFRAPCKYQNCTFNGVWSGGGGAGMEN  1046
             DG YTY    +K  AP +G++   C+K+ RK +    PC YQNCTF G+W+GGGG G ++
Sbjct  273   DGTYTYAGEEFKAKAPASGANFNGCKKIIRKALKLNYPCPYQNCTFGGIWNGGGGNGQKH  332

Query  1047  VYISSFFYDIATDVGIIDQEKASKIVKPRSFLVAAKLACETKFEDVKSTFPNAVEKDYP-  1223
             ++ SS F+ +  DVG++D +  +  ++P   +  AK AC   FED KST+P   +K+   
Sbjct  333   LFASSSFFYLPEDVGMVDPKTPNFKIRPVDLVSEAKKACALNFEDAKSTYPFLAKKNIAS  392

Query  1224  YLCMDLVYEYTLLVDGLGLHPYKEITLMKKVEYKNYMVEAAWPLGCAIDVISS  1382
             Y+CMDL+Y+Y LLVD  G  P +EIT  K++EY++ ++EAAWPLG A++ ISS
Sbjct  393   YVCMDLIYQYVLLVD--GFDPLQEITSGKEIEYQDAVLEAAWPLGNAVEAISS  443



>sp|P52914.1|NTPA_PEA RecName: Full=Nucleoside-triphosphatase; Short=NTPase; AltName: 
Full=Nucleoside triphosphate phosphohydrolase; Short=Apyrase 
[Pisum sativum]
 emb|CAA83655.1| nucleoside triphosphatase [Pisum sativum]
 dbj|BAA75506.1| apyrase [Pisum sativum]
 dbj|BAB18900.1| apyrase [Pisum sativum]
 dbj|BAB18894.1| apyrase H-type [Pisum sativum]
 dbj|BAB18896.1| apyrase [Pisum sativum]
Length=455

 Score =   447 bits (1150),  Expect = 8e-149, Method: Compositional matrix adjust.
 Identities = 225/413 (54%), Positives = 300/413 (73%), Gaps = 2/413 (0%)
 Frame = +3

Query  150   RRVLLSHE-TGNYAVIFDAGSTGSRVHVFHFDENLDLLPIGDGVEFFLKTTPGLSSYAND  326
             R++ L  E   +YAV+FDAGSTGSR+HV+HF++NLDLL IG GVE++ K TPGLSSYAN+
Sbjct  32    RKIFLKQEEISSYAVVFDAGSTGSRIHVYHFNQNLDLLHIGKGVEYYNKITPGLSSYANN  91

Query  327   PEAAAKSLEPLLLEAEGVVPTELQPDTPLELGATAGLRLLEGDASDKILQAVRDMFKNES  506
             PE AAKSL PLL +AE VVP +LQP TP+ LGATAGLRLL GDAS+KILQ+VRDM  N S
Sbjct  92    PEQAAKSLIPLLEQAEDVVPDDLQPKTPVRLGATAGLRLLNGDASEKILQSVRDMLSNRS  151

Query  507   NFKSKAEWVSILEGSQEGTYFWVAMNYLLGNLGKGYQNTIATIDLGGGSVQVSYAVSGDT  686
              F  + + VSI++G+QEG+Y WV +NY LGNLGK Y  T+  IDLGGGSVQ++YAVS  T
Sbjct  152   TFNVQPDAVSIIDGTQEGSYLWVTVNYALGNLGKKYTKTVGVIDLGGGSVQMAYAVSKKT  211

Query  687   FANAPTPDNGEEPYVQEKYILGAQYYLYVHSYLNYGQLASRAEIFKASGNSTNPCVLEGY  866
               NAP   +G++PY+++  + G  Y LYVHSYL++G+ ASRAEI K +  S NPC+L G+
Sbjct  212   AKNAPKVADGDDPYIKKVVLKGIPYDLYVHSYLHFGREASRAEILKLTPRSPNPCLLAGF  271

Query  867   DGYYTYNDVSYKVTAPPNGSSLKNCRKLARKVVDFRAPCKYQNCTFNGVWSGGGGAGMEN  1046
             +G YTY+   +K TA  +G++   C+   RK +    PC YQNCTF G+W+GGGG G +N
Sbjct  272   NGIYTYSGEEFKATAYTSGANFNKCKNTIRKALKLNYPCPYQNCTFGGIWNGGGGNGQKN  331

Query  1047  VYISSFFYDIATDVGIIDQEKASKIVKPRSFLVAAKLACETKFEDVKSTFPNAVEKDYP-  1223
             ++ SS F+ +  D G++D    + I++P      AK AC   FED KST+P   +K+   
Sbjct  332   LFASSSFFYLPEDTGMVDASTPNFILRPVDIETKAKEACALNFEDAKSTYPFLDKKNVAS  391

Query  1224  YLCMDLVYEYTLLVDGLGLHPYKEITLMKKVEYKNYMVEAAWPLGCAIDVISS  1382
             Y+CMDL+Y+Y LLVDG GL P ++IT  K++EY++ +VEAAWPLG A++ IS+
Sbjct  392   YVCMDLIYQYVLLVDGFGLDPLQKITSGKEIEYQDAIVEAAWPLGNAVEAISA  444



>dbj|BAB18890.1| apyrase S-type [Pisum sativum]
 dbj|BAB18893.1| apyrase S-type [Pisum sativum]
 dbj|BAB18895.1| apyrase [Pisum sativum]
 dbj|BAB40230.1| S-type apyras [Pisum sativum]
 dbj|BAB85977.1| PsAPY1 [Pisum sativum]
Length=455

 Score =   447 bits (1150),  Expect = 1e-148, Method: Compositional matrix adjust.
 Identities = 225/413 (54%), Positives = 300/413 (73%), Gaps = 2/413 (0%)
 Frame = +3

Query  150   RRVLLSHE-TGNYAVIFDAGSTGSRVHVFHFDENLDLLPIGDGVEFFLKTTPGLSSYAND  326
             R++ L  E   +YAV+FDAGSTGSR+HV+HF++NLDLL IG GVE++ K TPGLSSYAN+
Sbjct  32    RKIFLKQEEISSYAVVFDAGSTGSRIHVYHFNQNLDLLHIGKGVEYYNKITPGLSSYANN  91

Query  327   PEAAAKSLEPLLLEAEGVVPTELQPDTPLELGATAGLRLLEGDASDKILQAVRDMFKNES  506
             PE AAKSL PLL +AE VVP +LQP TP+ LGATAGLRLL GDAS+KILQ+VRDM  N S
Sbjct  92    PEQAAKSLIPLLEQAEDVVPDDLQPKTPVRLGATAGLRLLNGDASEKILQSVRDMLSNRS  151

Query  507   NFKSKAEWVSILEGSQEGTYFWVAMNYLLGNLGKGYQNTIATIDLGGGSVQVSYAVSGDT  686
              F  + + VSI++G+QEG+Y WV +NY LGNLGK Y  T+  IDLGGGSVQ++YAVS  T
Sbjct  152   TFNVQPDAVSIIDGTQEGSYLWVTVNYALGNLGKKYTKTVGVIDLGGGSVQMAYAVSKKT  211

Query  687   FANAPTPDNGEEPYVQEKYILGAQYYLYVHSYLNYGQLASRAEIFKASGNSTNPCVLEGY  866
               NAP   +G++PY+++  + G  Y LYVHSYL++G+ ASRAEI K +  S NPC+L G+
Sbjct  212   AKNAPKVADGDDPYIKKVVLKGIPYDLYVHSYLHFGREASRAEILKLTPRSPNPCLLAGF  271

Query  867   DGYYTYNDVSYKVTAPPNGSSLKNCRKLARKVVDFRAPCKYQNCTFNGVWSGGGGAGMEN  1046
             +G YTY+   +K TA  +G++   C+   RK +    PC YQNCTF G+W+GGGG G +N
Sbjct  272   NGIYTYSGEEFKATAYTSGANFNKCKNTIRKALKLNYPCPYQNCTFGGIWNGGGGNGQKN  331

Query  1047  VYISSFFYDIATDVGIIDQEKASKIVKPRSFLVAAKLACETKFEDVKSTFPNAVEKDYP-  1223
             ++ SS F+ +  D G++D    + I++P      AK AC   FED KST+P   +K+   
Sbjct  332   LFASSSFFYLPEDTGMVDASTPNFILRPVDIETKAKEACALNFEDAKSTYPFLDKKNVAS  391

Query  1224  YLCMDLVYEYTLLVDGLGLHPYKEITLMKKVEYKNYMVEAAWPLGCAIDVISS  1382
             Y+CMDL+Y+Y LLVDG GL P ++IT  K++EY++ +VEAAWPLG A++ IS+
Sbjct  392   YVCMDLIYQYVLLVDGFGLDPLQKITSGKEIEYQDAIVEAAWPLGNAVEAISA  444



>ref|XP_010650765.1| PREDICTED: apyrase 2 [Vitis vinifera]
 emb|CBI24778.3| unnamed protein product [Vitis vinifera]
Length=471

 Score =   447 bits (1151),  Expect = 1e-148, Method: Compositional matrix adjust.
 Identities = 220/412 (53%), Positives = 304/412 (74%), Gaps = 2/412 (0%)
 Frame = +3

Query  150   RRVLLSHETGNYAVIFDAGSTGSRVHVFHFDENLDLLPIGDGVEFFLKTTPGLSSYANDP  329
             R+     ++  YAVIFDAGS+GSRVHVF FD +L+L+ IG  +E FL+  PGLS+Y  +P
Sbjct  59    RKASPHSQSRTYAVIFDAGSSGSRVHVFCFDSDLNLVHIGKDLELFLQRKPGLSAYPTEP  118

Query  330   EAAAKSLEPLLLEAEGVVPTELQPDTPLELGATAGLRLLEGDASDKILQAVRDMFKNESN  509
             + AA+SL PLL +AE VVP +L+  TP+++GATAGLR L  DASD+ILQAV++  K++S 
Sbjct  119   QQAAESLLPLLDKAENVVPADLRRKTPVKVGATAGLRALGIDASDRILQAVKNFLKDKST  178

Query  510   FKSKAEWVSILEGSQEGTYFWVAMNYLLGNLGKGYQNTIATIDLGGGSVQVSYAVSGDTF  689
              KSK EWV++L+GSQEG + WV +NYLLGNLG+ Y +T+  +DLGGGSVQ++YA+S    
Sbjct  179   LKSKPEWVTVLDGSQEGAFQWVTINYLLGNLGRKYSHTVGVVDLGGGSVQMAYAISETAA  238

Query  690   ANAPTPDNGEEPYVQEKYILGAQYYLYVHSYLNYGQLASRAEIFKASGNSTNPCVLEGYD  869
               AP   +GE+ YV+E Y+ G +Y+LYVHSYL+YG LA+RAEI K   +S NPC+L G+ 
Sbjct  239   EKAPKISDGEDTYVKEMYLKGTKYFLYVHSYLHYGLLAARAEILKVE-SSENPCLLGGFH  297

Query  870   GYYTYNDVSYKVTAPPNGSSLKNCRKLARKVVDF-RAPCKYQNCTFNGVWSGGGGAGMEN  1046
             G YTY  V+Y+ +A P+GSS++ CR++A + +    + C +  CTF G+W+GGGG G +N
Sbjct  298   GTYTYGGVTYEASAHPSGSSMERCRRVAFRALKVNESTCTHMKCTFGGIWNGGGGDGQKN  357

Query  1047  VYISSFFYDIATDVGIIDQEKASKIVKPRSFLVAAKLACETKFEDVKSTFPNAVEKDYPY  1226
             ++++SFF+D A + G +D+ +    V+P  F  AAK  CETK ED KS FP   E + PY
Sbjct  358   LFVASFFFDRAAEAGFVDRNQPVAKVQPMDFEDAAKRVCETKLEDAKSKFPLVEEANLPY  417

Query  1227  LCMDLVYEYTLLVDGLGLHPYKEITLMKKVEYKNYMVEAAWPLGCAIDVISS  1382
             LCMDLVY++TLL+DG GL P++EITL+K+V+Y + +VEAAWPLG AID +SS
Sbjct  418   LCMDLVYQFTLLIDGFGLDPWQEITLVKQVKYGDALVEAAWPLGSAIDAVSS  469



>dbj|BAM84274.1| apyrase [Medicago truncatula]
Length=467

 Score =   447 bits (1150),  Expect = 1e-148, Method: Compositional matrix adjust.
 Identities = 223/404 (55%), Positives = 298/404 (74%), Gaps = 3/404 (1%)
 Frame = +3

Query  177   GNYAVIFDAGSTGSRVHVFHFDENLDLLPIGDGVEFFLKTTPGLSSYANDPEAAAKSLEP  356
             G+YAVIFDAGS+GSRVHVFHFD+NLDL+ IG  +E F +  PGLS+YA  P+ AA+SL  
Sbjct  66    GSYAVIFDAGSSGSRVHVFHFDQNLDLVHIGKDLELFEQLKPGLSAYAQKPQQAAESLVS  125

Query  357   LLLEAEGVVPTELQPDTPLELGATAGLRLLEGDASDKILQAVRDMFKNESNFKSKAEWVS  536
             LL +AEGVVP EL+  TP+ +GATAGLR LEGDASDKIL+AVRD+ K+ S+FKS A+ V+
Sbjct  126   LLEKAEGVVPRELRSKTPVRIGATAGLRALEGDASDKILRAVRDLLKHRSSFKSDADAVT  185

Query  537   ILEGSQEGTYFWVAMNYLLGNLGKGYQNTIATIDLGGGSVQVSYAVSGDTFANAPTPDNG  716
             +L+G+QEG Y WV +NYLLGNLGK Y  T+  +DLGGGSVQ++YA+S    A AP   +G
Sbjct  186   VLDGTQEGAYQWVTINYLLGNLGKDYSKTVGVVDLGGGSVQMAYAISESEAAMAPQVTDG  245

Query  717   EEPYVQEKYILGAQYYLYVHSYLNYGQLASRAEIFKASGNSTNPCVLEGYDGYYTYNDVS  896
             E+PYV+E ++ G +YYLYVHSYL YG LA+RAEI K  G++ NPC        + Y   S
Sbjct  246   EDPYVKEMFLRGRKYYLYVHSYLRYGLLAARAEILKVVGDAENPCSYLALMELHKYGGKS  305

Query  897   YKVTAPPNGSSLKNCRKLARKVVDF-RAPCKYQNCTFNGVWSGGGGAGMENVYISSFFYD  1073
             +K ++  +G+SL  C+ +A K +    + C +  CTF G+W+GGGG G +N++++SFF+D
Sbjct  306   FKASS--SGASLNECKSVAHKALKVNESTCTHMKCTFGGIWNGGGGDGQKNLFVASFFFD  363

Query  1074  IATDVGIIDQEKASKIVKPRSFLVAAKLACETKFEDVKSTFPNAVEKDYPYLCMDLVYEY  1253
              A + G +D      IV+P  F  AAK AC+TK E+ KST+P   E + P LCMDLVY+Y
Sbjct  364   RAAEAGFVDPNSPVAIVRPADFEDAAKQACQTKLENAKSTYPQVEEGNLPNLCMDLVYQY  423

Query  1254  TLLVDGLGLHPYKEITLMKKVEYKNYMVEAAWPLGCAIDVISSS  1385
             TLLVDG G++P++EITL+KKV+Y + +VEAAWPLG AI+ +SS+
Sbjct  424   TLLVDGFGIYPWQEITLVKKVKYDDALVEAAWPLGSAIEAVSST  467



>ref|XP_006843727.1| hypothetical protein AMTR_s00007p00221730 [Amborella trichopoda]
 gb|ERN05402.1| hypothetical protein AMTR_s00007p00221730 [Amborella trichopoda]
Length=473

 Score =   447 bits (1149),  Expect = 2e-148, Method: Compositional matrix adjust.
 Identities = 217/417 (52%), Positives = 305/417 (73%), Gaps = 1/417 (0%)
 Frame = +3

Query  135   SRPHLRRVLLSHETGNYAVIFDAGSTGSRVHVFHFDENLDLLPIGDGVEFFLKTTPGLSS  314
             S+  +R++   H + +YAVIFDAGS+GSRVHV+ FD+NL+L+PI   +E F++  PGLS 
Sbjct  56    SKDSMRKMQNVHGSKSYAVIFDAGSSGSRVHVYCFDKNLELVPIEKELELFVQKKPGLSY  115

Query  315   YANDPEAAAKSLEPLLLEAEGVVPTELQPDTPLELGATAGLRLLEGDASDKILQAVRDMF  494
             YA++PE AA SL+PLL++AE V+P  L+  TP+ +GATAGLR L GD+SD+ILQAVRD+ 
Sbjct  116   YASNPEEAANSLKPLLVKAESVIPQALRKVTPVRVGATAGLRSLPGDSSDRILQAVRDLL  175

Query  495   KNESNFKSKAEWVSILEGSQEGTYFWVAMNYLLGNLGKGYQNTIATIDLGGGSVQVSYAV  674
              ++S+  SK +WV++L+G+QEG++ WV +N+LLGNLGK Y +T+  +DLGGGSVQ++YA+
Sbjct  176   ADQSSLMSKPDWVTVLDGTQEGSFQWVTINHLLGNLGKSYSHTVGIVDLGGGSVQMAYAI  235

Query  675   SGDTFANAPTPDNGEEPYVQEKYILGAQYYLYVHSYLNYGQLASRAEIFKASGNSTNPCV  854
             S      APT  +GE+ YV+E ++ G +YYLYVHSYL+YG LA+RAEI K   +S +PC+
Sbjct  236   SEKDAKKAPTIIDGEDTYVKELFLKGTKYYLYVHSYLHYGLLAARAEILKVDRDSDSPCI  295

Query  855   LEGYDGYYTYNDVSYKVTAPPNGSSLKNCRKLARKVVDFR-APCKYQNCTFNGVWSGGGG  1031
             L+G+ G Y Y D  +K +A P GS   +CR+ A K +      C +  CTF G+W+GGGG
Sbjct  296   LKGFHGSYKYGDTQFKASALPTGSDFTSCRRAAVKALRVNDTTCTHMKCTFGGIWNGGGG  355

Query  1032  AGMENVYISSFFYDIATDVGIIDQEKASKIVKPRSFLVAAKLACETKFEDVKSTFPNAVE  1211
              G +N++++SFFYD A + G +D ++    VKP  F  AAK AC++  ++ K TF  A E
Sbjct  356   DGQKNLFVASFFYDRAAEAGFVDPKQPVAKVKPADFEDAAKRACQSSLDEAKKTFSRAEE  415

Query  1212  KDYPYLCMDLVYEYTLLVDGLGLHPYKEITLMKKVEYKNYMVEAAWPLGCAIDVISS  1382
              + PYLCMDLVY+Y LL+DG  L P++EITL+K+VEYK + VEAAWPLG AI+V S+
Sbjct  416   GNLPYLCMDLVYQYALLIDGFALDPWQEITLVKQVEYKGFPVEAAWPLGSAIEVASA  472



>gb|AAO23003.1| apyrase-like protein [Medicago truncatula]
Length=466

 Score =   444 bits (1143),  Expect = 1e-147, Method: Compositional matrix adjust.
 Identities = 220/413 (53%), Positives = 301/413 (73%), Gaps = 2/413 (0%)
 Frame = +3

Query  150   RRVLLSHET-GNYAVIFDAGSTGSRVHVFHFDENLDLLPIGDGVEFFLKTTPGLSSYAND  326
             R++    ET  +YAV+FDAGSTGSRVHV+HFD+NL+LL +G  VEF+ KTTPGLS+YA++
Sbjct  43    RKIFPKQETISSYAVVFDAGSTGSRVHVYHFDQNLNLLHVGKDVEFYNKTTPGLSAYADN  102

Query  327   PEAAAKSLEPLLLEAEGVVPTELQPDTPLELGATAGLRLLEGDASDKILQAVRDMFKNES  506
             PE AAKSL PLL +AE VVP + +  TP+ LGATAGLRLL GDAS+KILQ+VRD+  N S
Sbjct  103   PEQAAKSLIPLLEQAESVVPEDQRSKTPVRLGATAGLRLLNGDASEKILQSVRDLLSNRS  162

Query  507   NFKSKAEWVSILEGSQEGTYFWVAMNYLLGNLGKGYQNTIATIDLGGGSVQVSYAVSGDT  686
              F  + + VSI++G+QEG+Y WV +NY LG LGK +  T+  +DLGGGSVQ++YAVS +T
Sbjct  163   TFNVQPDAVSIIDGTQEGSYLWVTVNYALGTLGKKFTKTVGVMDLGGGSVQMAYAVSRNT  222

Query  687   FANAPTPDNGEEPYVQEKYILGAQYYLYVHSYLNYGQLASRAEIFKASGNSTNPCVLEGY  866
               NAP   +G++PY+++  + G +Y LYVHSYL++G  ASRAEI K + NS NPC+L G+
Sbjct  223   AKNAPKVADGDDPYIKKLVLKGKKYDLYVHSYLHFGTEASRAEILKVTHNSPNPCILAGF  282

Query  867   DGYYTYNDVSYKVTAPPNGSSLKNCRKLARKVVDFRAPCKYQNCTFNGVWSGGGGAGMEN  1046
             DG Y Y    +K  A  +G+S K C+K+  + +    PC YQNCTF G+W+GGGG+G   
Sbjct  283   DGTYRYAGEEFKANALASGASFKKCKKIVHQALKLNYPCPYQNCTFGGIWNGGGGSGQRK  342

Query  1047  VYISSFFYDIATDVGIIDQEKASKIVKPRSFLVAAKLACETKFEDVKSTFPNAVEKDYP-  1223
             ++ +SFF+ +A +VG++D  K +  ++P  F   AK AC   FED KS++P   +K+   
Sbjct  343   LFAASFFFYLAAEVGMVDPNKPNFKIRPVDFESEAKKACALNFEDAKSSYPFLAKKNIAS  402

Query  1224  YLCMDLVYEYTLLVDGLGLHPYKEITLMKKVEYKNYMVEAAWPLGCAIDVISS  1382
             Y+CMDL+Y+Y LLVDG GL P +EIT  K++EY++ +VEAAWPLG A++ ISS
Sbjct  403   YVCMDLIYQYVLLVDGFGLDPLQEITAGKQIEYQDSLVEAAWPLGNAVEAISS  455



>dbj|BAC45033.1| apyrase [Pisum sativum]
 dbj|BAC66636.1| apyrase [Pisum sativum]
Length=455

 Score =   444 bits (1142),  Expect = 1e-147, Method: Compositional matrix adjust.
 Identities = 224/413 (54%), Positives = 299/413 (72%), Gaps = 2/413 (0%)
 Frame = +3

Query  150   RRVLLSHE-TGNYAVIFDAGSTGSRVHVFHFDENLDLLPIGDGVEFFLKTTPGLSSYAND  326
             R++ L  E   +YAV+FDAGSTGSR+HV+HF++NLDLL IG GVE++ K TPGLSSYAN+
Sbjct  32    RKIFLKQEEISSYAVVFDAGSTGSRIHVYHFNQNLDLLHIGKGVEYYNKITPGLSSYANN  91

Query  327   PEAAAKSLEPLLLEAEGVVPTELQPDTPLELGATAGLRLLEGDASDKILQAVRDMFKNES  506
             PE AAKSL PLL +A  VVP +LQP TP+ LGATAGLRLL GDAS+KILQ+VRDM  N S
Sbjct  92    PEQAAKSLIPLLEQAYDVVPDDLQPKTPVRLGATAGLRLLNGDASEKILQSVRDMLSNRS  151

Query  507   NFKSKAEWVSILEGSQEGTYFWVAMNYLLGNLGKGYQNTIATIDLGGGSVQVSYAVSGDT  686
              F  + + VSI++G+QEG+Y WV +NY LGNLGK Y  T+  IDLGGGSVQ++YAVS  T
Sbjct  152   TFNVQPDAVSIIDGTQEGSYLWVTVNYALGNLGKKYTKTVGVIDLGGGSVQMAYAVSKKT  211

Query  687   FANAPTPDNGEEPYVQEKYILGAQYYLYVHSYLNYGQLASRAEIFKASGNSTNPCVLEGY  866
               NAP   +G++PY+++  + G  Y LYVHSYL++G+ ASRAEI K +  S NPC+L G+
Sbjct  212   AKNAPKVADGDDPYIKKVVLKGIPYDLYVHSYLHFGREASRAEILKLTPRSPNPCLLAGF  271

Query  867   DGYYTYNDVSYKVTAPPNGSSLKNCRKLARKVVDFRAPCKYQNCTFNGVWSGGGGAGMEN  1046
             +G YTY+   +K TA  +G++   C+   RK +    PC YQNCTF G+W+GGGG G +N
Sbjct  272   NGIYTYSGEEFKATAYTSGANFNKCKNTIRKALKLNYPCPYQNCTFGGIWNGGGGNGQKN  331

Query  1047  VYISSFFYDIATDVGIIDQEKASKIVKPRSFLVAAKLACETKFEDVKSTFPNAVEKDYP-  1223
             ++ SS F+ +  D G++D    + I++P      AK AC   FED KST+P   +K+   
Sbjct  332   LFASSSFFYLPEDTGMVDASTPNFILRPVDIETKAKEACALNFEDAKSTYPFLDKKNVAS  391

Query  1224  YLCMDLVYEYTLLVDGLGLHPYKEITLMKKVEYKNYMVEAAWPLGCAIDVISS  1382
             Y+CMDL+Y+Y LLVDG GL P ++IT  K++EY++ +VEAAWPLG A++ IS+
Sbjct  392   YVCMDLIYQYVLLVDGFGLDPLQKITSGKEIEYQDAIVEAAWPLGNAVEAISA  444



>dbj|BAA89275.1| apyrase [Pisum sativum]
Length=447

 Score =   444 bits (1141),  Expect = 2e-147, Method: Compositional matrix adjust.
 Identities = 224/413 (54%), Positives = 299/413 (72%), Gaps = 2/413 (0%)
 Frame = +3

Query  150   RRVLLSHE-TGNYAVIFDAGSTGSRVHVFHFDENLDLLPIGDGVEFFLKTTPGLSSYAND  326
             R++ L  E   +YAV+FDAGSTGS +HV+HF++NLDLL IG GVE++ K TPGLSSYAN+
Sbjct  24    RKIFLKQEEISSYAVVFDAGSTGSCIHVYHFNQNLDLLHIGKGVEYYNKITPGLSSYANN  83

Query  327   PEAAAKSLEPLLLEAEGVVPTELQPDTPLELGATAGLRLLEGDASDKILQAVRDMFKNES  506
             PE AAKSL PLL +AE VVP +LQP TP+ LGATAGLRLL GDAS+KILQ+VRDM  N S
Sbjct  84    PEQAAKSLIPLLEQAEDVVPDDLQPKTPVRLGATAGLRLLNGDASEKILQSVRDMLSNRS  143

Query  507   NFKSKAEWVSILEGSQEGTYFWVAMNYLLGNLGKGYQNTIATIDLGGGSVQVSYAVSGDT  686
              F  + + VSI++G+QEG+Y WV +NY LGNLGK Y  T+  IDLGGGSVQ++YAVS  T
Sbjct  144   TFNVQPDAVSIIDGTQEGSYLWVTVNYALGNLGKKYTKTVGVIDLGGGSVQMAYAVSKKT  203

Query  687   FANAPTPDNGEEPYVQEKYILGAQYYLYVHSYLNYGQLASRAEIFKASGNSTNPCVLEGY  866
               NAP   +G++PY+++  + G  Y LYVHSYL++G+ ASRAEI K +  S NPC+L G+
Sbjct  204   AKNAPKVADGDDPYIKKVVLKGIPYDLYVHSYLHFGREASRAEILKLTPRSPNPCLLAGF  263

Query  867   DGYYTYNDVSYKVTAPPNGSSLKNCRKLARKVVDFRAPCKYQNCTFNGVWSGGGGAGMEN  1046
             +G YTY+   +K TA  +G++   C+   RK +    PC YQNCTF G+W+GGGG G +N
Sbjct  264   NGIYTYSGEEFKATAYTSGANFNKCKNTIRKALKLNYPCPYQNCTFGGIWNGGGGNGQKN  323

Query  1047  VYISSFFYDIATDVGIIDQEKASKIVKPRSFLVAAKLACETKFEDVKSTFPNAVEKDYP-  1223
             ++ SS F+ +  D G++D    + I++P      AK AC   FED KST+P   +K+   
Sbjct  324   LFASSSFFYLPEDTGMVDASTPNFILRPVDIETKAKEACALNFEDAKSTYPFLDKKNVAS  383

Query  1224  YLCMDLVYEYTLLVDGLGLHPYKEITLMKKVEYKNYMVEAAWPLGCAIDVISS  1382
             Y+CMDL+Y+Y LLVDG GL P ++IT  K++EY++ +VEAAWPLG A++ IS+
Sbjct  384   YVCMDLIYQYVLLVDGFGLDPLQKITSGKEIEYQDAIVEAAWPLGNAVEAISA  436



>ref|XP_007030232.1| Apyrase 1 [Theobroma cacao]
 gb|EOY10734.1| Apyrase 1 [Theobroma cacao]
Length=557

 Score =   447 bits (1150),  Expect = 2e-147, Method: Compositional matrix adjust.
 Identities = 220/401 (55%), Positives = 296/401 (74%), Gaps = 0/401 (0%)
 Frame = +3

Query  180   NYAVIFDAGSTGSRVHVFHFDENLDLLPIGDGVEFFLKTTPGLSSYANDPEAAAKSLEPL  359
             NYAVIFDAGS+GSRVHVF FD+NLDL+PIG  +E F +  PGLS YA DP+AAA SL  L
Sbjct  157   NYAVIFDAGSSGSRVHVFCFDQNLDLVPIGSELELFEQIKPGLSFYAKDPQAAANSLRTL  216

Query  360   LLEAEGVVPTELQPDTPLELGATAGLRLLEGDASDKILQAVRDMFKNESNFKSKAEWVSI  539
             L +AE VVP +L+  TP+ +GATAGLR LEGDASD+IL AV ++ K+ S  K +A  V I
Sbjct  217   LDKAESVVPLDLRSKTPVRVGATAGLRALEGDASDRILHAVSELLKDRSTLKYEANGVRI  276

Query  540   LEGSQEGTYFWVAMNYLLGNLGKGYQNTIATIDLGGGSVQVSYAVSGDTFANAPTPDNGE  719
             L+GSQEG Y WV +NYLLGNLG+ Y +T+  +DLGGGSVQ++YA+S +  A AP+   GE
Sbjct  277   LDGSQEGAYEWVTINYLLGNLGRTYADTVGIVDLGGGSVQMAYAISENAAAKAPSVPAGE  336

Query  720   EPYVQEKYILGAQYYLYVHSYLNYGQLASRAEIFKASGNSTNPCVLEGYDGYYTYNDVSY  899
             + +V E  ++G++Y+LYVHSYL+YG LA+RAEI K S +S NPC+LEG+DG Y Y    +
Sbjct  337   DNFVNEMNLMGSKYHLYVHSYLHYGLLAARAEILKVSEDSGNPCILEGFDGTYKYGGEEF  396

Query  900   KVTAPPNGSSLKNCRKLARKVVDFRAPCKYQNCTFNGVWSGGGGAGMENVYISSFFYDIA  1079
             K +A  +G+S++ CR++  K +     C +  CTF GVW+GGGG G +N++++SFF+D A
Sbjct  397   KASASSSGTSMEECRRVTLKALKINETCTHMKCTFGGVWNGGGGDGQKNLFVASFFFDRA  456

Query  1080  TDVGIIDQEKASKIVKPRSFLVAAKLACETKFEDVKSTFPNAVEKDYPYLCMDLVYEYTL  1259
              + G I        V+P+ F  AAK ACETK+ + K+T+ +  E +  Y+CMDLVY+YTL
Sbjct  457   AEAGFIKATDPVAKVQPQYFADAAKRACETKYANAKATYEHVEESNLAYVCMDLVYQYTL  516

Query  1260  LVDGLGLHPYKEITLMKKVEYKNYMVEAAWPLGCAIDVISS  1382
             LVDG GL PY++ITL+K+V+Y+N +VEAAWPLG AI+ +SS
Sbjct  517   LVDGFGLDPYQDITLVKQVKYQNSLVEAAWPLGSAIEAVSS  557



>ref|XP_004244791.1| PREDICTED: apyrase 2-like [Solanum lycopersicum]
Length=480

 Score =   443 bits (1140),  Expect = 7e-147, Method: Compositional matrix adjust.
 Identities = 228/402 (57%), Positives = 299/402 (74%), Gaps = 1/402 (0%)
 Frame = +3

Query  180   NYAVIFDAGSTGSRVHVFHFDENLDLLPIGDGVEFFLKTTPGLSSYANDPEAAAKSLEPL  359
             NYAVIFDAGS+GSRVHVF FD++LDL+PIG+ +E FL+  PGLS++A+DP +AAKSL+ L
Sbjct  77    NYAVIFDAGSSGSRVHVFCFDQHLDLVPIGNDLELFLQKKPGLSAFASDPASAAKSLQSL  136

Query  360   LLEAEGVVPTELQPDTPLELGATAGLRLLEGDASDKILQAVRDMFKNESNFKSKAEWVSI  539
             L +AE VVP +L+ +TP+ +GATAGLR L G+ SDKILQAVRD  K++S+ KSK  WV++
Sbjct  137   LEKAEDVVPMDLRSNTPVRVGATAGLRQLGGNTSDKILQAVRDFLKSKSSLKSKGSWVTV  196

Query  540   LEGSQEGTYFWVAMNYLLGNLGKGYQNTIATIDLGGGSVQVSYAVSGDTFANAPTPDNGE  719
             L+GSQEG Y WV +NYLLGNLG+ Y +T+  +DLGGGSVQ++YA+S      AP    GE
Sbjct  197   LDGSQEGAYQWVTINYLLGNLGRKYSDTVGVVDLGGGSVQMAYAISELDAQKAPKLSVGE  256

Query  720   EPYVQEKYILGAQYYLYVHSYLNYGQLASRAEIFKASGNSTNPCVLEGYDGYYTYNDVSY  899
             + YVQE Y+ GA+YYLYVHSYL YG LA+RAEI K +  S +PC+L G+ G Y Y    Y
Sbjct  257   DTYVQEMYLKGAKYYLYVHSYLRYGLLAARAEILKVTKESGSPCILTGHHGSYKYGGKVY  316

Query  900   KVTAPPNGSSLKNCRKLARKVVDF-RAPCKYQNCTFNGVWSGGGGAGMENVYISSFFYDI  1076
               +A   GSS+ NCR +A K +    + C +  CTF GVW+GGGG G +N++++SFF+D 
Sbjct  317   PASAMSEGSSMTNCRLVALKALKVNESTCTHMKCTFGGVWNGGGGDGQKNMFVASFFFDR  376

Query  1077  ATDVGIIDQEKASKIVKPRSFLVAAKLACETKFEDVKSTFPNAVEKDYPYLCMDLVYEYT  1256
             A +VG +D   A   V+P  F  AA+ AC+T+ +D K+TFP+    + PYLCMDLVY+YT
Sbjct  377   AVEVGFVDPNVAVAKVRPIDFESAARRACDTRLDDAKATFPSVESDNLPYLCMDLVYQYT  436

Query  1257  LLVDGLGLHPYKEITLMKKVEYKNYMVEAAWPLGCAIDVISS  1382
             LLVDG GL   +E+TL+KKV+YKN +VEAAWPLG AI+V SS
Sbjct  437   LLVDGFGLDARQEMTLVKKVKYKNSLVEAAWPLGSAIEVASS  478



>ref|XP_004511658.1| PREDICTED: apyrase 2-like [Cicer arietinum]
Length=476

 Score =   441 bits (1135),  Expect = 3e-146, Method: Compositional matrix adjust.
 Identities = 221/402 (55%), Positives = 295/402 (73%), Gaps = 1/402 (0%)
 Frame = +3

Query  180   NYAVIFDAGSTGSRVHVFHFDENLDLLPIGDGVEFFLKTTPGLSSYANDPEAAAKSLEPL  359
             ++AVIFDAGS+GSRVHVF FD NLDL+PIG  +E FL+  PGLS+YA DP+ AA+SL  L
Sbjct  73    SFAVIFDAGSSGSRVHVFRFDRNLDLVPIGKDLEVFLQIKPGLSAYAQDPQQAAESLVSL  132

Query  360   LLEAEGVVPTELQPDTPLELGATAGLRLLEGDASDKILQAVRDMFKNESNFKSKAEWVSI  539
             L +AE VVP E +  TP+ +GATAGLR LEGDASD+ILQAVRD+ K  S  KS+ + V++
Sbjct  133   LDKAESVVPMEFRAMTPVRVGATAGLRALEGDASDRILQAVRDLLKQRSTLKSEPDAVAV  192

Query  540   LEGSQEGTYFWVAMNYLLGNLGKGYQNTIATIDLGGGSVQVSYAVSGDTFANAPTPDNGE  719
             L+G+QEG + WV +NYLLG LGK Y +T+  +DLGGGSVQ++YA+S D+ A AP   +GE
Sbjct  193   LDGTQEGAFQWVTINYLLGKLGKDYSDTVGVVDLGGGSVQMAYAISEDSAAKAPKALDGE  252

Query  720   EPYVQEKYILGAQYYLYVHSYLNYGQLASRAEIFKASGNSTNPCVLEGYDGYYTYNDVSY  899
             +PYV+E ++ G +YYLYVHSYL YG LA+RAEI K S +S NPC+L GYDG Y Y   S+
Sbjct  253   DPYVKEMFLRGRKYYLYVHSYLRYGLLAARAEILKVSDDSGNPCILAGYDGSYNYGGKSF  312

Query  900   KVTAPPNGSSLKNCRKLARKVVDF-RAPCKYQNCTFNGVWSGGGGAGMENVYISSFFYDI  1076
             K ++  +GSSL  C+ +  K +    + C +  CTF G+W+GGGG G +N++++SFF+D 
Sbjct  313   KASSSSSGSSLNECKSITLKALKVNESTCTHMKCTFGGIWNGGGGDGQKNLFVASFFFDR  372

Query  1077  ATDVGIIDQEKASKIVKPRSFLVAAKLACETKFEDVKSTFPNAVEKDYPYLCMDLVYEYT  1256
             A + G  D +     V+P  F   AK AC+TK ED KS +P+  E + PYLC+DLVY+YT
Sbjct  373   AAEAGFADPKSPVVKVRPADFEDTAKRACQTKLEDAKSIYPHVEEGNLPYLCLDLVYQYT  432

Query  1257  LLVDGLGLHPYKEITLMKKVEYKNYMVEAAWPLGCAIDVISS  1382
             LLV G GL P ++ITL+K+V+Y + +VEAAWPLG AI+ +SS
Sbjct  433   LLVVGFGLDPLQQITLVKQVKYHDSLVEAAWPLGSAIEAVSS  474



>ref|XP_002873882.1| ATAPY2 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH50141.1| ATAPY2 [Arabidopsis lyrata subsp. lyrata]
Length=472

 Score =   441 bits (1135),  Expect = 3e-146, Method: Compositional matrix adjust.
 Identities = 219/404 (54%), Positives = 296/404 (73%), Gaps = 5/404 (1%)
 Frame = +3

Query  180   NYAVIFDAGSTGSRVHVFHFDENLDLLPIGDGVEFFLKTTPGLSSYANDPEAAAKSLEPL  359
             NYAVIFDAGS+GSRVHV+ FD+NLDL+P+G+ +E FL+  PGLS+Y  DP  AA SL  L
Sbjct  70    NYAVIFDAGSSGSRVHVYCFDQNLDLIPLGNELELFLQLKPGLSAYPTDPRQAANSLVSL  129

Query  360   LLEAEGVVPTELQPDTPLELGATAGLRLLEGDASDKILQAVRDMFKNESNFKSKAEWVSI  539
             L +AE  VP EL+P TP+ +GATAGLR L  DAS+ ILQAVR++ ++ S  K++A  V++
Sbjct  130   LDKAEASVPRELRPKTPVRVGATAGLRTLGHDASENILQAVRELLRDRSMLKTEANAVTV  189

Query  540   LEGSQEGTYFWVAMNYLLGNLGKGYQNTIATIDLGGGSVQVSYAVSGDTFANAPTPDNGE  719
             L+G+QEG+Y WV +NYLL NLGK Y +T+  +DLGGGSVQ++YA+S +  A+AP P  GE
Sbjct  190   LDGTQEGSYQWVTINYLLRNLGKPYSDTVGVVDLGGGSVQMAYAISEEDAASAPKPLEGE  249

Query  720   EPYVQEKYILGAQYYLYVHSYLNYGQLASRAEIFKASGNSTNPCVLEGYDGYYTYNDVSY  899
             + YV+E Y+ G +Y+LYVHSYL+YG LA+RAEI K S +S NPC++ GYDG Y Y +  +
Sbjct  250   DSYVREMYLKGRKYFLYVHSYLHYGLLAARAEILKVSEDSENPCIVAGYDGMYKYGEKEF  309

Query  900   KVTAPPNGSSLKNCRKL---ARKVVDFRAPCKYQNCTFNGVWSGGGGAGMENVYISSFFY  1070
             K  A P+G+SL  CR++   A KV D    C +  CTF GVW+GG G G +N++++SFF+
Sbjct  310   KAPASPSGASLGECRRVTINALKVND--TLCTHMKCTFGGVWNGGRGGGQKNMFVASFFF  367

Query  1071  DIATDVGIIDQEKASKIVKPRSFLVAAKLACETKFEDVKSTFPNAVEKDYPYLCMDLVYE  1250
             D A + G +D ++    V+P  F  AAK AC  K E+ K+ FP   E++ PYLCMDL+Y+
Sbjct  368   DRAAEAGFVDPKQPVATVRPMDFEKAAKQACSMKLEEGKAKFPLVEEENLPYLCMDLIYQ  427

Query  1251  YTLLVDGLGLHPYKEITLMKKVEYKNYMVEAAWPLGCAIDVISS  1382
             YTLL+DG GL P + ITL+KKV+Y ++ VEAAWPLG AI+ +SS
Sbjct  428   YTLLIDGFGLEPSQTITLVKKVKYGDHAVEAAWPLGSAIEAVSS  471



>ref|XP_010922865.1| PREDICTED: probable apyrase 2 [Elaeis guineensis]
Length=458

 Score =   440 bits (1132),  Expect = 4e-146, Method: Compositional matrix adjust.
 Identities = 231/406 (57%), Positives = 292/406 (72%), Gaps = 0/406 (0%)
 Frame = +3

Query  171   ETGNYAVIFDAGSTGSRVHVFHFDENLDLLPIGDGVEFFLKTTPGLSSYANDPEAAAKSL  350
             ET  YAVIFDAGSTGSRVHVF FD+N+DL+ IGD +E F+   PGLSSY +DP+ AA SL
Sbjct  38    ETETYAVIFDAGSTGSRVHVFRFDQNMDLVNIGDDIELFVAVKPGLSSYDDDPQEAANSL  97

Query  351   EPLLLEAEGVVPTELQPDTPLELGATAGLRLLEGDASDKILQAVRDMFKNESNFKSKAEW  530
              PLL EAEGV+P ELQP TP+ LGATAGLR+L  + S+KIL+AVRD+F+  S+ + K+EW
Sbjct  98    IPLLEEAEGVIPEELQPTTPIRLGATAGLRILGEEKSEKILKAVRDLFQTNSSLEYKSEW  157

Query  531   VSILEGSQEGTYFWVAMNYLLGNLGKGYQNTIATIDLGGGSVQVSYAVSGDTFANAPTPD  710
             V++LEG QEG+Y WVAMNYLLGNLG  Y +T+  +DLGGGSVQ++YA+S +  ANAP   
Sbjct  158   VTVLEGYQEGSYLWVAMNYLLGNLGNKYSDTVGVVDLGGGSVQMAYALSKEAAANAPNIS  217

Query  711   NGEEPYVQEKYILGAQYYLYVHSYLNYGQLASRAEIFKASGNSTNPCVLEGYDGYYTYND  890
              G  PYV ++ +    YYLY +SYL+YG  A+RAEI +A     + CVL GY G Y Y+ 
Sbjct  218   IGNNPYVTKQLLNETNYYLYAYSYLHYGLFAARAEILEAVDGPYSYCVLGGYAGSYKYSG  277

Query  891   VSYKVTAPPNGSSLKNCRKLARKVVDFRAPCKYQNCTFNGVWSGGGGAGMENVYISSFFY  1070
               Y  +A P+GSS   CR  A K +     C YQ+CTF GVWSGGGG G +N+Y++S FY
Sbjct  278   KVYNASASPSGSSYSKCRVEAIKALKINEICTYQDCTFGGVWSGGGGDGQKNLYVASSFY  337

Query  1071  DIATDVGIIDQEKASKIVKPRSFLVAAKLACETKFEDVKSTFPNAVEKDYPYLCMDLVYE  1250
               A +VG ID E  + +V+P  F  AAK+AC++  E+   T+PN  E + PY+CMDLVYE
Sbjct  338   YTAAEVGFIDSETPNALVRPSDFKKAAKIACKSSLEEANVTYPNVTEDNLPYICMDLVYE  397

Query  1251  YTLLVDGLGLHPYKEITLMKKVEYKNYMVEAAWPLGCAIDVISSSS  1388
             YTLLVDG GL P +EITL+ KVEY +  V AAWPLG AI+V+SS S
Sbjct  398   YTLLVDGFGLKPTQEITLVTKVEYGDSYVNAAWPLGSAIEVVSSQS  443



>gb|AAK15160.1|AF288132_1 putative apyrase [Medicago truncatula]
Length=466

 Score =   441 bits (1133),  Expect = 5e-146, Method: Compositional matrix adjust.
 Identities = 220/413 (53%), Positives = 301/413 (73%), Gaps = 2/413 (0%)
 Frame = +3

Query  150   RRVLLSHE-TGNYAVIFDAGSTGSRVHVFHFDENLDLLPIGDGVEFFLKTTPGLSSYAND  326
             R++    E   +YAV+FDAGSTGSRVHV+HFD+NL+LL +G  VEF+ KTTPGLS+YA++
Sbjct  43    RKIFPKQEPISSYAVVFDAGSTGSRVHVYHFDQNLNLLHVGKDVEFYNKTTPGLSAYADN  102

Query  327   PEAAAKSLEPLLLEAEGVVPTELQPDTPLELGATAGLRLLEGDASDKILQAVRDMFKNES  506
             PE AAKSL PLL +AE VVP + +  TP+ LGATAGLRLL GDAS+KILQ+VRD+F N S
Sbjct  103   PEEAAKSLIPLLEQAESVVPEDQRSKTPIRLGATAGLRLLNGDASEKILQSVRDLFSNRS  162

Query  507   NFKSKAEWVSILEGSQEGTYFWVAMNYLLGNLGKGYQNTIATIDLGGGSVQVSYAVSGDT  686
              F  + + VSI++G+QEG Y WV +NY LGNLGK +  T+  +D+GGGSVQ++YAVS  T
Sbjct  163   TFNVQPDAVSIIDGTQEGCYLWVTVNYALGNLGKKFTKTVGVMDVGGGSVQMAYAVSKYT  222

Query  687   FANAPTPDNGEEPYVQEKYILGAQYYLYVHSYLNYGQLASRAEIFKASGNSTNPCVLEGY  866
               NAP   +GE+PY+++  + G  Y LYVHSYL++G+ ASRAEI K + +S NPC+L G+
Sbjct  223   AKNAPKVADGEDPYIKKLVLKGKPYDLYVHSYLHFGREASRAEIMKVTRSSPNPCLLAGF  282

Query  867   DGYYTYNDVSYKVTAPPNGSSLKNCRKLARKVVDFRAPCKYQNCTFNGVWSGGGGAGMEN  1046
             DG YTY    +K  AP +G++   C+K+ RK +    PC YQNCTF G+W+GGGG G ++
Sbjct  283   DGTYTYAGEEFKAKAPASGANFNGCKKIIRKALKLNYPCPYQNCTFGGIWNGGGGNGQKH  342

Query  1047  VYISSFFYDIATDVGIIDQEKASKIVKPRSFLVAAKLACETKFEDVKSTFPNAVEKDYP-  1223
             ++ SS F+ +  DVG++D +  +  ++P   +  AK AC   FED KST+P   +K+   
Sbjct  343   LFASSSFFYLPEDVGMVDPKTPNFKIRPVDLVSEAKKACALNFEDAKSTYPFLAKKNIAS  402

Query  1224  YLCMDLVYEYTLLVDGLGLHPYKEITLMKKVEYKNYMVEAAWPLGCAIDVISS  1382
             Y+CMDL+Y+Y LLVDG GL P +EIT  K++EY++ ++EAAWPLG A++ ISS
Sbjct  403   YVCMDLIYQYVLLVDGFGLDPLQEITSGKEIEYQDAVLEAAWPLGNAVEAISS  455



>ref|XP_002448917.1| hypothetical protein SORBIDRAFT_05g001550 [Sorghum bicolor]
 gb|EES07905.1| hypothetical protein SORBIDRAFT_05g001550 [Sorghum bicolor]
Length=469

 Score =   441 bits (1133),  Expect = 5e-146, Method: Compositional matrix adjust.
 Identities = 217/402 (54%), Positives = 283/402 (70%), Gaps = 2/402 (0%)
 Frame = +3

Query  174   TGNYAVIFDAGSTGSRVHVFHFDENLDLLPIGDGVEFFLKTTPGLSSYANDPEAAAKSLE  353
              G YAVIFDAGSTGSRVHVF FD+ L L+ IGD +EFF K  PGLSSYA  P+ AA SL 
Sbjct  62    AGRYAVIFDAGSTGSRVHVFKFDKKLHLVQIGDDIEFFAKVKPGLSSYAGRPQEAASSLL  121

Query  354   PLLLEAEGVVPTELQPDTPLELGATAGLRLLEGDASDKILQAVRDMFKNESNFKSKAEWV  533
             PLL +A+ +VP  LQ +TPL+LGATAGLRL+  + +++IL+AVRD+   +S F+   +++
Sbjct  122   PLLEQADKIVPRRLQKNTPLKLGATAGLRLIGDEKAEEILEAVRDLVHIKSKFQYNPKYI  181

Query  534   SILEGSQEGTYFWVAMNYLLGNLGKGYQNTIATIDLGGGSVQVSYAVSGDTFANAPTPDN  713
             S+LEGSQEG+Y WVA+NYLLG LG  Y  T+  ID+GGGSVQ++YA+S D  ANAP   +
Sbjct  182   SVLEGSQEGSYLWVALNYLLGKLGGDYSKTVGVIDMGGGSVQMAYAISTDAAANAPAVPD  241

Query  714   GEEPYVQEKYILGAQYYLYVHSYLNYGQLASRAEIFKASGNSTNPCVLEGYDGYYTYNDV  893
             G++PY+ ++Y+ G  Y LYVHSYL YG LA+R EI KA     + C+L G+ G YTYN  
Sbjct  242   GKDPYITKEYLKGKDYNLYVHSYLYYGALAARVEILKAKNGPFSHCILRGFSGKYTYNGK  301

Query  894   SYKVTAPPNGSSLKNCRKLARKVVDFRAPCKYQNCTFNGVWSGGGGAGMENVYISSFFYD  1073
              Y  TA P G+    CR+   K +   APC+ +NCTFNGVW+GGGGAG +N+Y++SFF+D
Sbjct  302   EYDATASPEGAVYDKCREEIIKALKLNAPCESKNCTFNGVWNGGGGAGQDNLYVASFFFD  361

Query  1074  IATDVGIIDQEKASKIVKPRSFLVAAKLACETKFEDVKSTFPNAVEKDYPYLCMDLVYEY  1253
              AT  G ID +  S    P +F  AA   C    ++ K  +PN +  D PY+CMDL+Y+Y
Sbjct  362   KATQFGFIDSKAPSAKSTPEAFKGAADKVCSLSAQEAKVMYPNVL--DVPYICMDLIYQY  419

Query  1254  TLLVDGLGLHPYKEITLMKKVEYKNYMVEAAWPLGCAIDVIS  1379
             TLLVDG GL P KEITL+ +V+Y  Y +EAAWPLG AI+ I+
Sbjct  420   TLLVDGFGLAPTKEITLVARVKYGEYYIEAAWPLGTAIEAIA  461



>gb|KDP20285.1| hypothetical protein JCGZ_06871 [Jatropha curcas]
Length=470

 Score =   440 bits (1132),  Expect = 8e-146, Method: Compositional matrix adjust.
 Identities = 226/401 (56%), Positives = 296/401 (74%), Gaps = 1/401 (0%)
 Frame = +3

Query  180   NYAVIFDAGSTGSRVHVFHFDENLDLLPIGDGVEFFLKTTPGLSSYANDPEAAAKSLEPL  359
              YAVIFDAGS+GSRVHV+ FD+  +L+PIG  +E FL+  PGLS+YANDP AAA SL  L
Sbjct  68    RYAVIFDAGSSGSRVHVYCFDQYNNLVPIGRDLELFLQIKPGLSAYANDPLAAANSLLRL  127

Query  360   LLEAEGVVPTELQPDTPLELGATAGLRLLEGDASDKILQAVRDMFKNESNFKSKAEWVSI  539
             L +AE VVP EL+P+TP+ +GATAGLR LEGDASD+IL AVRD+ +++S  K++A+ VS+
Sbjct  128   LEQAERVVPKELRPNTPVRVGATAGLRALEGDASDRILDAVRDILRDKSTLKTEADGVSV  187

Query  540   LEGSQEGTYFWVAMNYLLGNLGKGYQNTIATIDLGGGSVQVSYAVSGDTFANAPTPDNGE  719
             L+GSQEG+Y WV +NYLLG LG  Y +T+  +DLGGGSVQ++YA+S    A AP   +GE
Sbjct  188   LDGSQEGSYEWVTINYLLGKLGSSYSDTVGVVDLGGGSVQMAYAISKADAAKAPRVSDGE  247

Query  720   EPYVQEKYILGAQYYLYVHSYLNYGQLASRAEIFKASGNSTNPCVLEGYDGYYTYNDVSY  899
             + Y++E +++G  YYLYVHSYL+YG LA+RAEI K S +S N C+L GYDG Y Y  + Y
Sbjct  248   DTYIKEMHLMGIDYYLYVHSYLHYGLLAARAEILKVSEDSENGCILAGYDGVYNYGGLDY  307

Query  900   KVTAPPNGSSLKNCRKLARKVVDF-RAPCKYQNCTFNGVWSGGGGAGMENVYISSFFYDI  1076
             K +A  +GSS + CR LA K +    + C +  CTF GVW+GGGG G  N++++SFF+D 
Sbjct  308   KASASSSGSSFEECRSLALKALKVNESTCIHMKCTFGGVWNGGGGDGQRNLFVASFFFDR  367

Query  1077  ATDVGIIDQEKASKIVKPRSFLVAAKLACETKFEDVKSTFPNAVEKDYPYLCMDLVYEYT  1256
             A + G ID  +    V P  F  AAK ACETK ED KST+P   EK  PYLCMDLVY+YT
Sbjct  368   AAEAGFIDPAQPVAKVHPADFEEAAKRACETKLEDAKSTYPRVDEKLLPYLCMDLVYQYT  427

Query  1257  LLVDGLGLHPYKEITLMKKVEYKNYMVEAAWPLGCAIDVIS  1379
             LLVDG  L  ++EITL+K+++Y++ +VEAAWPLG AI+ +S
Sbjct  428   LLVDGFALEHWQEITLVKQIKYRDALVEAAWPLGSAIEALS  468



>dbj|BAD13518.1| apyrase [Pisum sativum]
Length=455

 Score =   439 bits (1129),  Expect = 1e-145, Method: Compositional matrix adjust.
 Identities = 223/413 (54%), Positives = 298/413 (72%), Gaps = 2/413 (0%)
 Frame = +3

Query  150   RRVLLSHE-TGNYAVIFDAGSTGSRVHVFHFDENLDLLPIGDGVEFFLKTTPGLSSYAND  326
             R++ L  E   +YAV+FDAGSTGSR+HV+HF++NLDLL IG GVE++ K TPGLSSYAN+
Sbjct  32    RKIFLKQEEISSYAVVFDAGSTGSRIHVYHFNQNLDLLHIGKGVEYYNKITPGLSSYANN  91

Query  327   PEAAAKSLEPLLLEAEGVVPTELQPDTPLELGATAGLRLLEGDASDKILQAVRDMFKNES  506
             PE AAKSL PLL +AE VVP +LQP TP+ LGATAGLRLL GDAS+KILQ+VRDM  N S
Sbjct  92    PEQAAKSLIPLLEQAEDVVPDDLQPKTPVRLGATAGLRLLNGDASEKILQSVRDMLSNRS  151

Query  507   NFKSKAEWVSILEGSQEGTYFWVAMNYLLGNLGKGYQNTIATIDLGGGSVQVSYAVSGDT  686
              F  + + VSI++G+QEG+Y WV +NY LGNLG+    T+  IDLGGGSVQ++YAVS  T
Sbjct  152   TFNVQPDAVSIIDGTQEGSYLWVTVNYALGNLGERDTKTVGVIDLGGGSVQMAYAVSKKT  211

Query  687   FANAPTPDNGEEPYVQEKYILGAQYYLYVHSYLNYGQLASRAEIFKASGNSTNPCVLEGY  866
               NAP   +G++PY+++  + G  Y LYVHSYL++G+ ASRAEIFK +    NPC+L G+
Sbjct  212   AKNAPKVADGDDPYLKKVVLKGIPYDLYVHSYLHFGREASRAEIFKLTPRPPNPCLLGGF  271

Query  867   DGYYTYNDVSYKVTAPPNGSSLKNCRKLARKVVDFRAPCKYQNCTFNGVWSGGGGAGMEN  1046
             +G YTY+   +K TA  +G++   C+   RK +    PC YQNCTF G+W+GGGG G +N
Sbjct  272   NGIYTYSGEEFKATAYTSGANFNKCKNTIRKALKLNYPCPYQNCTFGGIWNGGGGNGQKN  331

Query  1047  VYISSFFYDIATDVGIIDQEKASKIVKPRSFLVAAKLACETKFEDVKSTFPNAVEKDYP-  1223
             +  SS F+ +  D G++D    + I++P      AK AC   FED KST+P   +K+   
Sbjct  332   LLASSSFFYLPEDTGMVDASTPNFILRPVDIETKAKEACALNFEDAKSTYPFLDKKNVAS  391

Query  1224  YLCMDLVYEYTLLVDGLGLHPYKEITLMKKVEYKNYMVEAAWPLGCAIDVISS  1382
             Y+CMDL+Y+Y LLVDG GL P ++IT  K++EY++ +VEAAWPLG A++ IS+
Sbjct  392   YVCMDLIYQYVLLVDGFGLDPLQKITSGKEIEYQDAIVEAAWPLGNAVEAISA  444



>ref|XP_006364259.1| PREDICTED: probable apyrase 1-like [Solanum tuberosum]
Length=480

 Score =   440 bits (1131),  Expect = 2e-145, Method: Compositional matrix adjust.
 Identities = 225/402 (56%), Positives = 296/402 (74%), Gaps = 1/402 (0%)
 Frame = +3

Query  180   NYAVIFDAGSTGSRVHVFHFDENLDLLPIGDGVEFFLKTTPGLSSYANDPEAAAKSLEPL  359
             NYAVIFDAGS+GSRVHVF FD++LDL+PIGD +E FL+  PGLS++A+DP +AAKSL+ L
Sbjct  77    NYAVIFDAGSSGSRVHVFCFDQHLDLVPIGDDLELFLQKKPGLSAFASDPASAAKSLQSL  136

Query  360   LLEAEGVVPTELQPDTPLELGATAGLRLLEGDASDKILQAVRDMFKNESNFKSKAEWVSI  539
             L +AE VVP +L+ +TP+ +GATAGLR L G+ SDKILQAVRD  K++S+ KSK  WV++
Sbjct  137   LEKAEDVVPMDLRSNTPVRVGATAGLRQLGGNTSDKILQAVRDFLKSKSSLKSKGSWVTV  196

Query  540   LEGSQEGTYFWVAMNYLLGNLGKGYQNTIATIDLGGGSVQVSYAVSGDTFANAPTPDNGE  719
             L+GSQEG Y WV +NYLLGNLG+ + +T+  +DLGGGSVQ++YA++      AP    GE
Sbjct  197   LDGSQEGAYQWVTINYLLGNLGRKFSDTVGVVDLGGGSVQMAYAITESDAQKAPKLSGGE  256

Query  720   EPYVQEKYILGAQYYLYVHSYLNYGQLASRAEIFKASGNSTNPCVLEGYDGYYTYNDVSY  899
               YVQE Y+ G +YYLYVHSYL YG LA+RAEI K +  S +PC+L G+ G Y Y    Y
Sbjct  257   NTYVQEMYLKGVKYYLYVHSYLRYGLLAARAEILKVTKESGSPCILTGHHGSYKYGGKVY  316

Query  900   KVTAPPNGSSLKNCRKLARKVVDF-RAPCKYQNCTFNGVWSGGGGAGMENVYISSFFYDI  1076
               +    GSS+ NCR +A K +    + C +  CTF GVW+GGGG G +N++++SFF+D 
Sbjct  317   PASTMSEGSSMTNCRLVALKALKVNESTCTHMKCTFGGVWNGGGGDGQKNMFVASFFFDR  376

Query  1077  ATDVGIIDQEKASKIVKPRSFLVAAKLACETKFEDVKSTFPNAVEKDYPYLCMDLVYEYT  1256
             A +VG +D   A   V+P  F  AA+ AC+T+ +D K+TFP+    + PYLCMDLVY+YT
Sbjct  377   AVEVGFVDPNVAVAKVRPIDFESAARRACDTRLDDAKATFPSVEPDNLPYLCMDLVYQYT  436

Query  1257  LLVDGLGLHPYKEITLMKKVEYKNYMVEAAWPLGCAIDVISS  1382
             LLVDG GL   +E+TL+KKV+YKN +VEAAWPLG AI+V SS
Sbjct  437   LLVDGFGLDARQEMTLVKKVKYKNSLVEAAWPLGSAIEVTSS  478



>ref|XP_010492830.1| PREDICTED: apyrase 2-like [Camelina sativa]
Length=473

 Score =   439 bits (1130),  Expect = 2e-145, Method: Compositional matrix adjust.
 Identities = 220/404 (54%), Positives = 294/404 (73%), Gaps = 5/404 (1%)
 Frame = +3

Query  180   NYAVIFDAGSTGSRVHVFHFDENLDLLPIGDGVEFFLKTTPGLSSYANDPEAAAKSLEPL  359
             NYAVIFDAGS+GSRVHV+ FD+NLDL+P+G+ +E FL+  PGLS+Y  DP  AA SL  L
Sbjct  71    NYAVIFDAGSSGSRVHVYCFDQNLDLIPLGNELELFLQLKPGLSAYPTDPRQAANSLVSL  130

Query  360   LLEAEGVVPTELQPDTPLELGATAGLRLLEGDASDKILQAVRDMFKNESNFKSKAEWVSI  539
             L +AE  VP EL+P TP+ +GATAGLR L  +AS+ ILQAVR++ ++ S  K++A  V++
Sbjct  131   LDKAEASVPRELRPKTPVRVGATAGLRTLGHEASENILQAVRELLRDRSMLKTEANAVTV  190

Query  540   LEGSQEGTYFWVAMNYLLGNLGKGYQNTIATIDLGGGSVQVSYAVSGDTFANAPTPDNGE  719
             L+G+QEG+Y WV +NYLL NLGK Y +T+  +DLGGGSVQ++YA+S +  A+AP P  GE
Sbjct  191   LDGTQEGSYQWVTINYLLRNLGKPYSDTVGVVDLGGGSVQMAYAISEEDAASAPKPLEGE  250

Query  720   EPYVQEKYILGAQYYLYVHSYLNYGQLASRAEIFKASGNSTNPCVLEGYDGYYTYNDVSY  899
             + YV+E Y+ G +Y+LYVHSYL+YG LA+RAEI K S +S NPC++ GYDG Y Y    +
Sbjct  251   DSYVREMYLKGRKYFLYVHSYLHYGLLAARAEILKVSDDSENPCIVTGYDGKYKYGGKEF  310

Query  900   KVTAPPNGSSLKNCRKL---ARKVVDFRAPCKYQNCTFNGVWSGGGGAGMENVYISSFFY  1070
             K TA P+G+SL  CR++   A KV D    C +  CTF GVW+GG G G +N++++SFF+
Sbjct  311   KGTASPSGASLDECRRITINALKVND--TLCTHMKCTFGGVWNGGRGGGQKNMFVASFFF  368

Query  1071  DIATDVGIIDQEKASKIVKPRSFLVAAKLACETKFEDVKSTFPNAVEKDYPYLCMDLVYE  1250
             D A + G +D ++    V+P+ F  AAK AC    E+ KS FP   E + PYLCMDLVY+
Sbjct  369   DRAAEAGFVDPKQPVATVRPKDFEKAAKKACSMNLEEGKSKFPLVEEDNLPYLCMDLVYQ  428

Query  1251  YTLLVDGLGLHPYKEITLMKKVEYKNYMVEAAWPLGCAIDVISS  1382
             YTLL+DG GL P + ITL+KKV+Y  + VEAAWPLG AI+ +SS
Sbjct  429   YTLLIDGFGLEPSQTITLVKKVKYGEHAVEAAWPLGSAIEAVSS  472



>ref|XP_010454056.1| PREDICTED: apyrase 2-like [Camelina sativa]
Length=473

 Score =   439 bits (1128),  Expect = 4e-145, Method: Compositional matrix adjust.
 Identities = 220/404 (54%), Positives = 294/404 (73%), Gaps = 5/404 (1%)
 Frame = +3

Query  180   NYAVIFDAGSTGSRVHVFHFDENLDLLPIGDGVEFFLKTTPGLSSYANDPEAAAKSLEPL  359
             NYAVIFDAGS+GSRVHV+ FD+NLDL+P+G+ +E FL+  PGLS+Y  DP  AA SL  L
Sbjct  71    NYAVIFDAGSSGSRVHVYCFDQNLDLIPLGNELELFLQLKPGLSAYPTDPRQAANSLVSL  130

Query  360   LLEAEGVVPTELQPDTPLELGATAGLRLLEGDASDKILQAVRDMFKNESNFKSKAEWVSI  539
             L +AE  VP EL+P TP+ +GATAGLR L  +AS+ ILQAVR++ ++ S  K++A  V++
Sbjct  131   LDKAEASVPRELRPKTPVRVGATAGLRTLGHEASENILQAVRELLRDRSMLKTEANAVTV  190

Query  540   LEGSQEGTYFWVAMNYLLGNLGKGYQNTIATIDLGGGSVQVSYAVSGDTFANAPTPDNGE  719
             L+G+QEG+Y WV +NYLL NLGK Y +T+  +DLGGGSVQ++YA+S +  A AP P  GE
Sbjct  191   LDGTQEGSYQWVTINYLLRNLGKPYSDTVGVVDLGGGSVQMAYAISEEDAAKAPKPLEGE  250

Query  720   EPYVQEKYILGAQYYLYVHSYLNYGQLASRAEIFKASGNSTNPCVLEGYDGYYTYNDVSY  899
             + YV+E Y+ G +Y+LYVHSYL+YG LA+RAEI K S +S NPCV+ GYDG Y Y    +
Sbjct  251   DSYVREMYLKGRKYFLYVHSYLHYGLLAARAEILKVSDDSDNPCVVTGYDGKYKYGGKEF  310

Query  900   KVTAPPNGSSLKNCRKL---ARKVVDFRAPCKYQNCTFNGVWSGGGGAGMENVYISSFFY  1070
             K TA P+G+SL  CR++   + KV D    C +  CTF GVW+GG G G +N++++SFF+
Sbjct  311   KGTASPSGASLDECRRITINSLKVND--TLCTHMKCTFGGVWNGGRGGGQKNMFVASFFF  368

Query  1071  DIATDVGIIDQEKASKIVKPRSFLVAAKLACETKFEDVKSTFPNAVEKDYPYLCMDLVYE  1250
             D A + G +D ++    V+P+ F  AAK AC    E+ KS FP   E++ PYLCMDLVY+
Sbjct  369   DRAAEAGFVDPKQPVATVRPKDFEKAAKKACSMNLEEGKSKFPLVEEENLPYLCMDLVYQ  428

Query  1251  YTLLVDGLGLHPYKEITLMKKVEYKNYMVEAAWPLGCAIDVISS  1382
             YTLL+DG GL P + ITL+KKV+Y  + VEAAWPLG AI+ +SS
Sbjct  429   YTLLIDGFGLEPSQTITLVKKVKYGEHAVEAAWPLGSAIEAVSS  472



>ref|XP_010420574.1| PREDICTED: apyrase 2 [Camelina sativa]
Length=473

 Score =   438 bits (1127),  Expect = 4e-145, Method: Compositional matrix adjust.
 Identities = 219/404 (54%), Positives = 295/404 (73%), Gaps = 5/404 (1%)
 Frame = +3

Query  180   NYAVIFDAGSTGSRVHVFHFDENLDLLPIGDGVEFFLKTTPGLSSYANDPEAAAKSLEPL  359
             NYAVIFDAGS+GSRVHV+ FD+NLDL+P+G+ +E FL+  PGLS+Y  DP  AA SL  L
Sbjct  71    NYAVIFDAGSSGSRVHVYCFDQNLDLIPLGNELELFLQLKPGLSAYPTDPRQAANSLVSL  130

Query  360   LLEAEGVVPTELQPDTPLELGATAGLRLLEGDASDKILQAVRDMFKNESNFKSKAEWVSI  539
             L +AE  VP EL+P TP+ +GATAGLR L  +AS+ ILQAVR++ ++ S  K++A  V++
Sbjct  131   LDKAEASVPRELRPKTPVRVGATAGLRTLGHEASENILQAVRELLRDRSMLKTEANAVTV  190

Query  540   LEGSQEGTYFWVAMNYLLGNLGKGYQNTIATIDLGGGSVQVSYAVSGDTFANAPTPDNGE  719
             L+G+QEG+Y WV +NYLL NLGK Y +T+  +DLGGGSVQ++YA+S +  A+AP P  GE
Sbjct  191   LDGTQEGSYQWVTINYLLRNLGKPYSDTVGVVDLGGGSVQMAYAISEEDAASAPKPLEGE  250

Query  720   EPYVQEKYILGAQYYLYVHSYLNYGQLASRAEIFKASGNSTNPCVLEGYDGYYTYNDVSY  899
             + YV+E Y+ G +Y+LYVHSYL+YG LA+RAEI K S +S NPC++ GYDG Y Y    +
Sbjct  251   DSYVREMYLKGRKYFLYVHSYLHYGLLAARAEILKVSDDSDNPCIVTGYDGKYKYGGKEF  310

Query  900   KVTAPPNGSSLKNCRKL---ARKVVDFRAPCKYQNCTFNGVWSGGGGAGMENVYISSFFY  1070
             K TA P+G+SL  CR++   + KV D    C +  CTF GVW+GG G G +N++++SFF+
Sbjct  311   KGTASPSGASLDECRRITINSLKVND--TLCTHMKCTFGGVWNGGRGGGQKNMFVASFFF  368

Query  1071  DIATDVGIIDQEKASKIVKPRSFLVAAKLACETKFEDVKSTFPNAVEKDYPYLCMDLVYE  1250
             D A + G +D ++    V+P+ F  AAK AC    E+ KS FP   E++ PYLCMDLVY+
Sbjct  369   DRAAEAGFVDPKQPVATVRPKDFEKAAKKACSMNLEEGKSKFPLVEEENLPYLCMDLVYQ  428

Query  1251  YTLLVDGLGLHPYKEITLMKKVEYKNYMVEAAWPLGCAIDVISS  1382
             YTLL+DG GL P + ITL+KKV+Y  + VEAAWPLG AI+ +SS
Sbjct  429   YTLLIDGFGLEPSQTITLVKKVKYGEHAVEAAWPLGSAIEAVSS  472



>gb|AFK42133.1| unknown [Medicago truncatula]
Length=467

 Score =   437 bits (1125),  Expect = 7e-145, Method: Compositional matrix adjust.
 Identities = 221/414 (53%), Positives = 301/414 (73%), Gaps = 3/414 (1%)
 Frame = +3

Query  150   RRVLLSHET-GNYAVIFDAGSTGSRVHVFHFDENLDLLPIGDGVEFFLKTTPGLSSYAND  326
             R++    E+  +YAV+FDAGSTGSRVHV+HFD+NL+LL +G  VEF+ KTTPGLS+YA++
Sbjct  43    RKIFPKQESISSYAVVFDAGSTGSRVHVYHFDQNLNLLHVGKDVEFYNKTTPGLSAYADN  102

Query  327   PEAAAKSLEPLLLEAEGVVPTELQPDTPLELGATAGLRLLEGDASDKILQAVRDMFKNES  506
             PE AAKSL PLL +AE VVP + +  TP+ LGATAGLRLL GDAS+KILQ+VRD+F N S
Sbjct  103   PEEAAKSLIPLLEQAESVVPEDQRSKTPIRLGATAGLRLLNGDASEKILQSVRDLFSNRS  162

Query  507   NFKSKAEWVSILEGSQEGTYFWVAMNYLLGNLGKGYQNTIATIDLGGGSVQVSYAVSGDT  686
              F  + + VSI++G+QEG+Y WV +NY LG LGK +  T+  +DLGGGSVQ++YAVS  T
Sbjct  163   TFNVQPDAVSIIDGTQEGSYLWVTVNYALGKLGKKFTKTVGVMDLGGGSVQMAYAVSKYT  222

Query  687   FANAPTPDNGEEPYVQEKYILGAQYYLYVHSYLNYGQLASRAEIFKASGNSTNPCVLEGY  866
               NAP   +GE+PY+++  + G +Y LYVHSYL++G+ ASRAEI K + NS NPC+L G+
Sbjct  223   AKNAPKVADGEDPYIKKLVLKGKKYDLYVHSYLHFGREASRAEILKVTHNSPNPCILAGF  282

Query  867   DGYYTYNDVSYKVTAPPNGSSLKNCRKLARKVVDFRAPCKYQNCTFNGVWSGGGGAGMEN  1046
             DG YTY    +K  AP +G++ K C+K+ R+ +    PC YQNCTF G+WSGGGG+G   
Sbjct  283   DGTYTYAGEEFKANAPASGANFKKCKKIVREALKLNYPCPYQNCTFGGIWSGGGGSGQRI  342

Query  1047  VYISSFFYDIATDVGIIDQEKA-SKIVKPRSFLVAAKLACETKFEDVKSTFPNAVEKDY-  1220
             ++ +S F+ +A D+G++D     S  ++P      AK AC    E+ KST+P  V+ +  
Sbjct  343   LFAASSFFYLAEDIGLVDPNTPYSLTLRPVDLETEAKKACTLNLEEAKSTYPLLVDFNIV  402

Query  1221  PYLCMDLVYEYTLLVDGLGLHPYKEITLMKKVEYKNYMVEAAWPLGCAIDVISS  1382
              Y+CMDL+Y+Y LLVDG GL P +EIT  K++EY++ +VEAAWPLG A++ ISS
Sbjct  403   EYVCMDLIYQYVLLVDGFGLDPLQEITAGKQIEYQDSLVEAAWPLGNAVEAISS  456



>ref|XP_002325396.2| putative apyrase family protein [Populus trichocarpa]
 gb|EEE99777.2| putative apyrase family protein [Populus trichocarpa]
Length=474

 Score =   437 bits (1125),  Expect = 1e-144, Method: Compositional matrix adjust.
 Identities = 222/414 (54%), Positives = 297/414 (72%), Gaps = 7/414 (2%)
 Frame = +3

Query  162   LSHETGNYAVIFDAGSTGSRVHVFHFDENLDLLPIGDGVEFFLKTTPGLSSYANDPEAAA  341
             L  ++ +YAVIFDAGS+GSRVHVF FD NLDL+PIG  +E F++  PGLS+YAN+P+ AA
Sbjct  59    LVRDSRSYAVIFDAGSSGSRVHVFCFDRNLDLVPIGKELELFVQLKPGLSAYANNPQEAA  118

Query  342   KSLEPLLLEAEGVVPTELQPDTPLELGATAGLRLLEGDASDKILQA------VRDMFKNE  503
             KSL  LL +AE  VP EL+P TP+ +GATAGLR L  +ASD+ILQA      VRD  + +
Sbjct  119   KSLASLLDKAESSVPKELRPKTPVRVGATAGLRALGMEASDRILQAASPYLIVRDFLRAK  178

Query  504   SNFKSKAEWVSILEGSQEGTYFWVAMNYLLGNLGKGYQNTIATIDLGGGSVQVSYAVSGD  683
             S  KS+A  V++L+GSQEG+Y WV +NYLLGNLGK Y NT+  +DLGGGSVQ++YA+S  
Sbjct  179   STLKSEANGVTVLDGSQEGSYQWVTINYLLGNLGKKYSNTVGVVDLGGGSVQMAYAISEM  238

Query  684   TFANAPTPDNGEEPYVQEKYILGAQYYLYVHSYLNYGQLASRAEIFKASGNSTNPCVLEG  863
               A AP   +GE+ YV+E +++G +YYLYVHSYL+YG LA+RAEI  AS  S+NPC+L G
Sbjct  239   DAAKAPRISDGEDTYVKEMFLMGTKYYLYVHSYLHYGLLAARAEILDASEESSNPCILGG  298

Query  864   YDGYYTYNDVSYKVTAPPNGSSLKNCRKLARKVVDF-RAPCKYQNCTFNGVWSGGGGAGM  1040
             YDG Y Y    +K +A P+GS+L  CR++A   +    + C    CTF GVW+GGGG G 
Sbjct  299   YDGVYNYGGKDHKASASPSGSNLDECRRVALNALKVNESTCTNMKCTFGGVWNGGGGDGQ  358

Query  1041  ENVYISSFFYDIATDVGIIDQEKASKIVKPRSFLVAAKLACETKFEDVKSTFPNAVEKDY  1220
             +N++++SFF+D A   G +D       V+P  F  AAK AC TK E+ KS + +  E D 
Sbjct  359   KNMFVASFFFDRAAQAGFVDSTLPVVKVRPVDFEHAAKRACGTKLENAKSIYHSLDENDL  418

Query  1221  PYLCMDLVYEYTLLVDGLGLHPYKEITLMKKVEYKNYMVEAAWPLGCAIDVISS  1382
             PY+CMDLVY+YTLLV+G  + P +++ L+KKV+Y++ +VEAAWPLG AI+ +SS
Sbjct  419   PYICMDLVYQYTLLVEGFAMDPLQDMMLVKKVQYRDSLVEAAWPLGSAIEAVSS  472



>gb|EYU41067.1| hypothetical protein MIMGU_mgv1a004609mg [Erythranthe guttata]
Length=462

 Score =   437 bits (1123),  Expect = 1e-144, Method: Compositional matrix adjust.
 Identities = 225/402 (56%), Positives = 292/402 (73%), Gaps = 0/402 (0%)
 Frame = +3

Query  174   TGNYAVIFDAGSTGSRVHVFHFDENLDLLPIGDGVEFFLKTTPGLSSYANDPEAAAKSLE  353
             +  YAVIFDAGS+GSRVHVF F++ L+L+P+G  +E F++  PGLS YA DPEAAA SL 
Sbjct  61    SKRYAVIFDAGSSGSRVHVFCFNQQLELVPMGKELELFIQRKPGLSGYAKDPEAAAHSLS  120

Query  354   PLLLEAEGVVPTELQPDTPLELGATAGLRLLEGDASDKILQAVRDMFKNESNFKSKAEWV  533
              LL +AE  VP EL+ +TP+ +GATAGLR LEGDASD+ILQAVRD  KN+S+FKSK++WV
Sbjct  121   DLLEKAEAAVPKELRQNTPVRVGATAGLRQLEGDASDRILQAVRDYLKNKSSFKSKSDWV  180

Query  534   SILEGSQEGTYFWVAMNYLLGNLGKGYQNTIATIDLGGGSVQVSYAVSGDTFANAPTPDN  713
             ++L+G+QEG Y WV +NYLLGN+GK Y +T+  +DLGGGSVQ++YA+S    ANAP   +
Sbjct  181   TVLDGNQEGAYQWVTINYLLGNMGKEYSSTVGVVDLGGGSVQMAYAISESDAANAPKISD  240

Query  714   GEEPYVQEKYILGAQYYLYVHSYLNYGQLASRAEIFKASGNSTNPCVLEGYDGYYTYNDV  893
             GEE YVQE ++ G +Y+LYVHSYL YG LA RAEI K    S NPC+L GY+G Y Y   
Sbjct  241   GEESYVQEMFLKGRKYHLYVHSYLRYGLLAGRAEILKIDEESGNPCLLTGYNGSYKYGQT  300

Query  894   SYKVTAPPNGSSLKNCRKLARKVVDFRAPCKYQNCTFNGVWSGGGGAGMENVYISSFFYD  1073
              YK +A P+G+S   CR+ A K +     C +  CTF GVW+GGGG G +N++++SFF+D
Sbjct  301   MYKASALPSGASYIKCRETAIKALRVNDSCTHMKCTFGGVWNGGGGDGQKNLFVASFFFD  360

Query  1074  IATDVGIIDQEKASKIVKPRSFLVAAKLACETKFEDVKSTFPNAVEKDYPYLCMDLVYEY  1253
              A + G +D       V P  F  AAK ACET+ ED KS +P     + PYLCMDL Y++
Sbjct  361   RAAEAGFVDPSLPVAKVHPADFEDAAKRACETRLEDGKSLYPRVEADNLPYLCMDLTYQF  420

Query  1254  TLLVDGLGLHPYKEITLMKKVEYKNYMVEAAWPLGCAIDVIS  1379
             TLLVDG GL  ++ ITL+KKV+Y+N +VEAAWPLG AI+ +S
Sbjct  421   TLLVDGFGLDKWESITLVKKVQYQNSLVEAAWPLGSAIEAVS  462



>ref|XP_003624584.1| Nucleoside-triphosphatase [Medicago truncatula]
 gb|AAO23004.1| apyrase-like protein [Medicago truncatula]
Length=467

 Score =   437 bits (1123),  Expect = 2e-144, Method: Compositional matrix adjust.
 Identities = 221/414 (53%), Positives = 300/414 (72%), Gaps = 3/414 (1%)
 Frame = +3

Query  150   RRVLLSHE-TGNYAVIFDAGSTGSRVHVFHFDENLDLLPIGDGVEFFLKTTPGLSSYAND  326
             R++    E   +YAV+FDAGSTGSRVHV+HFD+NL+LL +G  VEF+ KTTPGLS+YA++
Sbjct  43    RKIFPKQEPISSYAVVFDAGSTGSRVHVYHFDQNLNLLHVGKDVEFYNKTTPGLSAYADN  102

Query  327   PEAAAKSLEPLLLEAEGVVPTELQPDTPLELGATAGLRLLEGDASDKILQAVRDMFKNES  506
             PE AAKSL PLL +AE VVP + +  TP+ LGATAGLRLL GDAS+KILQ+VRD+F N S
Sbjct  103   PEEAAKSLIPLLEQAESVVPEDQRSKTPIRLGATAGLRLLNGDASEKILQSVRDLFSNRS  162

Query  507   NFKSKAEWVSILEGSQEGTYFWVAMNYLLGNLGKGYQNTIATIDLGGGSVQVSYAVSGDT  686
              F  + + VSI++G+QEG+Y WV +NY LG LGK +  T+  +DLGGGSVQ++YAVS  T
Sbjct  163   TFNVQPDAVSIIDGTQEGSYLWVTVNYALGKLGKKFTKTVGVMDLGGGSVQMAYAVSKYT  222

Query  687   FANAPTPDNGEEPYVQEKYILGAQYYLYVHSYLNYGQLASRAEIFKASGNSTNPCVLEGY  866
               NAP   +GE+PY+++  + G +Y LYVHSYL++G+ ASRAEI K + NS NPC+L G+
Sbjct  223   AKNAPKVADGEDPYIKKLVLKGKKYDLYVHSYLHFGREASRAEILKVTHNSPNPCILAGF  282

Query  867   DGYYTYNDVSYKVTAPPNGSSLKNCRKLARKVVDFRAPCKYQNCTFNGVWSGGGGAGMEN  1046
             DG YTY    +K  AP +G++ K C+K+ R+ +    PC YQNCTF G+WSGGGG+G   
Sbjct  283   DGTYTYAGEEFKANAPASGANFKKCKKIVREALKLNYPCPYQNCTFGGIWSGGGGSGQRI  342

Query  1047  VYISSFFYDIATDVGIIDQEKA-SKIVKPRSFLVAAKLACETKFEDVKSTFPNAVEKDY-  1220
             ++ +S F+ +A D+G++D     S  ++P      AK AC    E+ KST+P  V+ +  
Sbjct  343   LFAASSFFYLAEDIGLVDPNTPYSLTLRPVDLETEAKKACTLNLEEAKSTYPLLVDFNIV  402

Query  1221  PYLCMDLVYEYTLLVDGLGLHPYKEITLMKKVEYKNYMVEAAWPLGCAIDVISS  1382
              Y+CMDL+Y+Y LLVDG GL P +EIT  K++EY++ +VEAAWPLG A++ ISS
Sbjct  403   EYVCMDLIYQYVLLVDGFGLDPLQEITAGKQIEYQDSLVEAAWPLGNAVEAISS  456



>gb|AES80802.2| Nod factor-binding lectin-nucleotide phosphohydrolase [Medicago 
truncatula]
Length=478

 Score =   437 bits (1124),  Expect = 2e-144, Method: Compositional matrix adjust.
 Identities = 221/414 (53%), Positives = 300/414 (72%), Gaps = 3/414 (1%)
 Frame = +3

Query  150   RRVLLSHE-TGNYAVIFDAGSTGSRVHVFHFDENLDLLPIGDGVEFFLKTTPGLSSYAND  326
             R++    E   +YAV+FDAGSTGSRVHV+HFD+NL+LL +G  VEF+ KTTPGLS+YA++
Sbjct  54    RKIFPKQEPISSYAVVFDAGSTGSRVHVYHFDQNLNLLHVGKDVEFYNKTTPGLSAYADN  113

Query  327   PEAAAKSLEPLLLEAEGVVPTELQPDTPLELGATAGLRLLEGDASDKILQAVRDMFKNES  506
             PE AAKSL PLL +AE VVP + +  TP+ LGATAGLRLL GDAS+KILQ+VRD+F N S
Sbjct  114   PEEAAKSLIPLLEQAESVVPEDQRSKTPIRLGATAGLRLLNGDASEKILQSVRDLFSNRS  173

Query  507   NFKSKAEWVSILEGSQEGTYFWVAMNYLLGNLGKGYQNTIATIDLGGGSVQVSYAVSGDT  686
              F  + + VSI++G+QEG+Y WV +NY LG LGK +  T+  +DLGGGSVQ++YAVS  T
Sbjct  174   TFNVQPDAVSIIDGTQEGSYLWVTVNYALGKLGKKFTKTVGVMDLGGGSVQMAYAVSKYT  233

Query  687   FANAPTPDNGEEPYVQEKYILGAQYYLYVHSYLNYGQLASRAEIFKASGNSTNPCVLEGY  866
               NAP   +GE+PY+++  + G +Y LYVHSYL++G+ ASRAEI K + NS NPC+L G+
Sbjct  234   AKNAPKVADGEDPYIKKLVLKGKKYDLYVHSYLHFGREASRAEILKVTHNSPNPCILAGF  293

Query  867   DGYYTYNDVSYKVTAPPNGSSLKNCRKLARKVVDFRAPCKYQNCTFNGVWSGGGGAGMEN  1046
             DG YTY    +K  AP +G++ K C+K+ R+ +    PC YQNCTF G+WSGGGG+G   
Sbjct  294   DGTYTYAGEEFKANAPASGANFKKCKKIVREALKLNYPCPYQNCTFGGIWSGGGGSGQRI  353

Query  1047  VYISSFFYDIATDVGIIDQEKA-SKIVKPRSFLVAAKLACETKFEDVKSTFPNAVEKDY-  1220
             ++ +S F+ +A D+G++D     S  ++P      AK AC    E+ KST+P  V+ +  
Sbjct  354   LFAASSFFYLAEDIGLVDPNTPYSLTLRPVDLETEAKKACTLNLEEAKSTYPLLVDFNIV  413

Query  1221  PYLCMDLVYEYTLLVDGLGLHPYKEITLMKKVEYKNYMVEAAWPLGCAIDVISS  1382
              Y+CMDL+Y+Y LLVDG GL P +EIT  K++EY++ +VEAAWPLG A++ ISS
Sbjct  414   EYVCMDLIYQYVLLVDGFGLDPLQEITAGKQIEYQDSLVEAAWPLGNAVEAISS  467



>gb|EYU41066.1| hypothetical protein MIMGU_mgv1a004609mg [Erythranthe guttata]
Length=518

 Score =   438 bits (1127),  Expect = 2e-144, Method: Compositional matrix adjust.
 Identities = 225/402 (56%), Positives = 292/402 (73%), Gaps = 0/402 (0%)
 Frame = +3

Query  174   TGNYAVIFDAGSTGSRVHVFHFDENLDLLPIGDGVEFFLKTTPGLSSYANDPEAAAKSLE  353
             +  YAVIFDAGS+GSRVHVF F++ L+L+P+G  +E F++  PGLS YA DPEAAA SL 
Sbjct  117   SKRYAVIFDAGSSGSRVHVFCFNQQLELVPMGKELELFIQRKPGLSGYAKDPEAAAHSLS  176

Query  354   PLLLEAEGVVPTELQPDTPLELGATAGLRLLEGDASDKILQAVRDMFKNESNFKSKAEWV  533
              LL +AE  VP EL+ +TP+ +GATAGLR LEGDASD+ILQAVRD  KN+S+FKSK++WV
Sbjct  177   DLLEKAEAAVPKELRQNTPVRVGATAGLRQLEGDASDRILQAVRDYLKNKSSFKSKSDWV  236

Query  534   SILEGSQEGTYFWVAMNYLLGNLGKGYQNTIATIDLGGGSVQVSYAVSGDTFANAPTPDN  713
             ++L+G+QEG Y WV +NYLLGN+GK Y +T+  +DLGGGSVQ++YA+S    ANAP   +
Sbjct  237   TVLDGNQEGAYQWVTINYLLGNMGKEYSSTVGVVDLGGGSVQMAYAISESDAANAPKISD  296

Query  714   GEEPYVQEKYILGAQYYLYVHSYLNYGQLASRAEIFKASGNSTNPCVLEGYDGYYTYNDV  893
             GEE YVQE ++ G +Y+LYVHSYL YG LA RAEI K    S NPC+L GY+G Y Y   
Sbjct  297   GEESYVQEMFLKGRKYHLYVHSYLRYGLLAGRAEILKIDEESGNPCLLTGYNGSYKYGQT  356

Query  894   SYKVTAPPNGSSLKNCRKLARKVVDFRAPCKYQNCTFNGVWSGGGGAGMENVYISSFFYD  1073
              YK +A P+G+S   CR+ A K +     C +  CTF GVW+GGGG G +N++++SFF+D
Sbjct  357   MYKASALPSGASYIKCRETAIKALRVNDSCTHMKCTFGGVWNGGGGDGQKNLFVASFFFD  416

Query  1074  IATDVGIIDQEKASKIVKPRSFLVAAKLACETKFEDVKSTFPNAVEKDYPYLCMDLVYEY  1253
              A + G +D       V P  F  AAK ACET+ ED KS +P     + PYLCMDL Y++
Sbjct  417   RAAEAGFVDPSLPVAKVHPADFEDAAKRACETRLEDGKSLYPRVEADNLPYLCMDLTYQF  476

Query  1254  TLLVDGLGLHPYKEITLMKKVEYKNYMVEAAWPLGCAIDVIS  1379
             TLLVDG GL  ++ ITL+KKV+Y+N +VEAAWPLG AI+ +S
Sbjct  477   TLLVDGFGLDKWESITLVKKVQYQNSLVEAAWPLGSAIEAVS  518



>gb|ACB38285.1| apyrase [Trifolium repens]
Length=460

 Score =   436 bits (1121),  Expect = 3e-144, Method: Compositional matrix adjust.
 Identities = 212/412 (51%), Positives = 290/412 (70%), Gaps = 1/412 (0%)
 Frame = +3

Query  150   RRVLLSHET-GNYAVIFDAGSTGSRVHVFHFDENLDLLPIGDGVEFFLKTTPGLSSYAND  326
             R++    ET  +YAVIFDAGSTGSRVHV+HFD+ LDLL IG+ VEF+ KTTPGLS+YA++
Sbjct  38    RKIFPKQETVTSYAVIFDAGSTGSRVHVYHFDQYLDLLHIGNDVEFYNKTTPGLSAYADN  97

Query  327   PEAAAKSLEPLLLEAEGVVPTELQPDTPLELGATAGLRLLEGDASDKILQAVRDMFKNES  506
             P+ AA+SL PLL +AE VVP   QP TP+ LGATAGLRLL+G++S+ IL+AV  +  N +
Sbjct  98    PKQAAESLIPLLEQAENVVPVNQQPKTPVSLGATAGLRLLDGNSSELILEAVSKLLSNRN  157

Query  507   NFKSKAEWVSILEGSQEGTYFWVAMNYLLGNLGKGYQNTIATIDLGGGSVQVSYAVSGDT  686
              F  +++ V I++G++EG+Y WVA+NY+LG LG  +  T+A  DLGGGSVQ+ YA+S D 
Sbjct  158   TFNVQSDAVGIIDGTKEGSYLWVAINYVLGKLGNKFSETVAVADLGGGSVQMVYAISRDQ  217

Query  687   FANAPTPDNGEEPYVQEKYILGAQYYLYVHSYLNYGQLASRAEIFKASGNSTNPCVLEGY  866
                AP    GE+PY+++  + G +YYLYVHSYL +G+ ASRA+I K +  S+NPC+L GY
Sbjct  218   ARKAPKVPQGEDPYIKKIVLKGNKYYLYVHSYLRFGKEASRAQILKVTNGSSNPCILAGY  277

Query  867   DGYYTYNDVSYKVTAPPNGSSLKNCRKLARKVVDFRAPCKYQNCTFNGVWSGGGGAGMEN  1046
             DG YTY+   YK  AP +GSSL  CR++ RK +     C Y +CTF+G+WSGGGG G + 
Sbjct  278   DGTYTYSGEEYKAYAPASGSSLDECREVIRKALKVNHSCPYSSCTFDGIWSGGGGKGQKT  337

Query  1047  VYISSFFYDIATDVGIIDQEKASKIVKPRSFLVAAKLACETKFEDVKSTFPNAVEKDYPY  1226
             +Y +S FY +  ++G+ D  K +  +       AA+  C+ KF+D K+ FP   E   PY
Sbjct  338   LYATSSFYYVPQNIGLFDPNKPNSKIYIEELRAAAEQVCKIKFKDAKAKFPLLAESSLPY  397

Query  1227  LCMDLVYEYTLLVDGLGLHPYKEITLMKKVEYKNYMVEAAWPLGCAIDVISS  1382
              C+DL Y+YTL VDG GL P + IT+  ++EY+  +V+AAWPLG AI+ ISS
Sbjct  398   ACLDLTYQYTLFVDGFGLDPLQRITVANEIEYQGAVVDAAWPLGNAIEAISS  449



>gb|AAM98186.1| unknown protein [Arabidopsis thaliana]
Length=472

 Score =   436 bits (1121),  Expect = 3e-144, Method: Compositional matrix adjust.
 Identities = 220/404 (54%), Positives = 293/404 (73%), Gaps = 5/404 (1%)
 Frame = +3

Query  180   NYAVIFDAGSTGSRVHVFHFDENLDLLPIGDGVEFFLKTTPGLSSYANDPEAAAKSLEPL  359
             NYAVIFDAGS+GSRVHV+ FD+NLDL+P+G+ +E FL+  PGLS+Y  DP  AA SL  L
Sbjct  70    NYAVIFDAGSSGSRVHVYCFDQNLDLIPLGNELELFLQLKPGLSAYPTDPRQAANSLVSL  129

Query  360   LLEAEGVVPTELQPDTPLELGATAGLRLLEGDASDKILQAVRDMFKNESNFKSKAEWVSI  539
             L +AE  VP EL+P T + +GATAGLR L  DAS+ ILQAVR++ ++ S  K++A  V++
Sbjct  130   LDKAEASVPRELRPKTHVRVGATAGLRTLGHDASENILQAVRELLRDRSMLKTEANAVTV  189

Query  540   LEGSQEGTYFWVAMNYLLGNLGKGYQNTIATIDLGGGSVQVSYAVSGDTFANAPTPDNGE  719
             L+G+QEG+Y WV +NYLL NLGK Y +T+  +DLGGGSVQ++YA+S +  A+AP P  GE
Sbjct  190   LDGTQEGSYQWVTINYLLRNLGKPYSDTVGVVDLGGGSVQMAYAISEEDAASAPKPLEGE  249

Query  720   EPYVQEKYILGAQYYLYVHSYLNYGQLASRAEIFKASGNSTNPCVLEGYDGYYTYNDVSY  899
             + YV+E Y+ G +Y+LYVHSYL+YG LA+RAEI K S +S NPC++ GYDG Y Y    +
Sbjct  250   DSYVREMYLKGQKYFLYVHSYLHYGLLAARAEILKVSEDSENPCIVAGYDGMYKYGGKEF  309

Query  900   KVTAPPNGSSLKNCRKL---ARKVVDFRAPCKYQNCTFNGVWSGGGGAGMENVYISSFFY  1070
             K  A  +G+SL  CR++   A KV D    C +  CTF GVW+GG G G +N++++SFF+
Sbjct  310   KAPASQSGASLDECRRITINALKVND--TLCTHMKCTFGGVWNGGRGGGQKNMFVASFFF  367

Query  1071  DIATDVGIIDQEKASKIVKPRSFLVAAKLACETKFEDVKSTFPNAVEKDYPYLCMDLVYE  1250
             D A + G +D ++    V+P  F  AAK AC  K E+ KSTFP   E++ PYLCMDLVY+
Sbjct  368   DRAAEAGFVDPKQPVATVRPMDFEKAAKKACSMKLEEGKSTFPLVEEENLPYLCMDLVYQ  427

Query  1251  YTLLVDGLGLHPYKEITLMKKVEYKNYMVEAAWPLGCAIDVISS  1382
             YTLL+DG GL P + ITL+KKV+Y +  VEAAWPLG AI+ +SS
Sbjct  428   YTLLIDGFGLEPSQTITLVKKVKYGDQAVEAAWPLGSAIEAVSS  471



>gb|AFI41206.1| apyrase 2, partial [Arabidopsis thaliana]
Length=472

 Score =   436 bits (1121),  Expect = 3e-144, Method: Compositional matrix adjust.
 Identities = 220/404 (54%), Positives = 293/404 (73%), Gaps = 5/404 (1%)
 Frame = +3

Query  180   NYAVIFDAGSTGSRVHVFHFDENLDLLPIGDGVEFFLKTTPGLSSYANDPEAAAKSLEPL  359
             NYAVIFDAGS+GSRVHV+ FD+NLDL+P+G+ +E FL+  PGLS+Y  DP  AA SL  L
Sbjct  70    NYAVIFDAGSSGSRVHVYCFDQNLDLIPLGNELELFLQLKPGLSAYPTDPRQAANSLVSL  129

Query  360   LLEAEGVVPTELQPDTPLELGATAGLRLLEGDASDKILQAVRDMFKNESNFKSKAEWVSI  539
             L +AE  VP EL+P T + +GATAGLR L  DAS+ ILQAVR++ ++ S  K++A  V++
Sbjct  130   LDKAEASVPRELRPKTHVRVGATAGLRTLGHDASENILQAVRELLRDRSMLKTEANAVTV  189

Query  540   LEGSQEGTYFWVAMNYLLGNLGKGYQNTIATIDLGGGSVQVSYAVSGDTFANAPTPDNGE  719
             L+G+QEG+Y WV +NYLL NLGK Y +T+  +DLGGGSVQ++YA+S +  A+AP P  GE
Sbjct  190   LDGTQEGSYQWVTINYLLRNLGKPYSDTVGVVDLGGGSVQMAYAISEEDAASAPKPLEGE  249

Query  720   EPYVQEKYILGAQYYLYVHSYLNYGQLASRAEIFKASGNSTNPCVLEGYDGYYTYNDVSY  899
             + YV+E Y+ G +Y+LYVHSYL+YG LA+RAEI K S +S NPC++ GYDG Y Y    +
Sbjct  250   DSYVREMYLKGRKYFLYVHSYLHYGLLAARAEILKVSEDSENPCIVAGYDGMYKYGGKEF  309

Query  900   KVTAPPNGSSLKNCRKL---ARKVVDFRAPCKYQNCTFNGVWSGGGGAGMENVYISSFFY  1070
             K  A  +G+SL  CR++   A KV D    C +  CTF GVW+GG G G +N++++SFF+
Sbjct  310   KAPASQSGASLDECRRITINALKVND--TLCTHMKCTFGGVWNGGRGGGQKNMFVASFFF  367

Query  1071  DIATDVGIIDQEKASKIVKPRSFLVAAKLACETKFEDVKSTFPNAVEKDYPYLCMDLVYE  1250
             D A + G +D ++    V+P  F  AAK AC  K E+ KSTFP   E++ PYLCMDLVY+
Sbjct  368   DRAAEAGFVDPKQPVATVRPMDFEKAAKKACSMKLEEGKSTFPLVEEENLPYLCMDLVYQ  427

Query  1251  YTLLVDGLGLHPYKEITLMKKVEYKNYMVEAAWPLGCAIDVISS  1382
             YTLL+DG GL P + ITL+KKV+Y +  VEAAWPLG AI+ +SS
Sbjct  428   YTLLIDGFGLEPSQTITLVKKVKYGDQAVEAAWPLGSAIEAVSS  471



>sp|Q9SPM5.1|APY2_ARATH RecName: Full=Apyrase 2; Short=AtAPY2; AltName: Full=ATP-diphosphatase; 
AltName: Full=ATP-diphosphohydrolase; AltName: Full=Adenosine 
diphosphatase; Short=ADPase; AltName: Full=NTPDase; 
AltName: Full=Nucleoside triphosphate diphosphohydrolase 
2 [Arabidopsis thaliana]
 gb|AAF00612.1|AF156783_1 apyrase [Arabidopsis thaliana]
 dbj|BAB09486.1| apyrase [Arabidopsis thaliana]
 gb|AAM20717.1| apyrase [Arabidopsis thaliana]
 gb|AAN15648.1| apyrase [Arabidopsis thaliana]
Length=472

 Score =   436 bits (1121),  Expect = 4e-144, Method: Compositional matrix adjust.
 Identities = 220/404 (54%), Positives = 293/404 (73%), Gaps = 5/404 (1%)
 Frame = +3

Query  180   NYAVIFDAGSTGSRVHVFHFDENLDLLPIGDGVEFFLKTTPGLSSYANDPEAAAKSLEPL  359
             NYAVIFDAGS+GSRVHV+ FD+NLDL+P+G+ +E FL+  PGLS+Y  DP  AA SL  L
Sbjct  70    NYAVIFDAGSSGSRVHVYCFDQNLDLIPLGNELELFLQLKPGLSAYPTDPRQAANSLVSL  129

Query  360   LLEAEGVVPTELQPDTPLELGATAGLRLLEGDASDKILQAVRDMFKNESNFKSKAEWVSI  539
             L +AE  VP EL+P T + +GATAGLR L  DAS+ ILQAVR++ ++ S  K++A  V++
Sbjct  130   LDKAEASVPRELRPKTHVRVGATAGLRTLGHDASENILQAVRELLRDRSMLKTEANAVTV  189

Query  540   LEGSQEGTYFWVAMNYLLGNLGKGYQNTIATIDLGGGSVQVSYAVSGDTFANAPTPDNGE  719
             L+G+QEG+Y WV +NYLL NLGK Y +T+  +DLGGGSVQ++YA+S +  A+AP P  GE
Sbjct  190   LDGTQEGSYQWVTINYLLRNLGKPYSDTVGVVDLGGGSVQMAYAISEEDAASAPKPLEGE  249

Query  720   EPYVQEKYILGAQYYLYVHSYLNYGQLASRAEIFKASGNSTNPCVLEGYDGYYTYNDVSY  899
             + YV+E Y+ G +Y+LYVHSYL+YG LA+RAEI K S +S NPC++ GYDG Y Y    +
Sbjct  250   DSYVREMYLKGRKYFLYVHSYLHYGLLAARAEILKVSEDSENPCIVAGYDGMYKYGGKEF  309

Query  900   KVTAPPNGSSLKNCRKL---ARKVVDFRAPCKYQNCTFNGVWSGGGGAGMENVYISSFFY  1070
             K  A  +G+SL  CR++   A KV D    C +  CTF GVW+GG G G +N++++SFF+
Sbjct  310   KAPASQSGASLDECRRITINALKVND--TLCTHMKCTFGGVWNGGRGGGQKNMFVASFFF  367

Query  1071  DIATDVGIIDQEKASKIVKPRSFLVAAKLACETKFEDVKSTFPNAVEKDYPYLCMDLVYE  1250
             D A + G +D ++    V+P  F  AAK AC  K E+ KSTFP   E++ PYLCMDLVY+
Sbjct  368   DRAAEAGFVDPKQPVATVRPMDFEKAAKKACSMKLEEGKSTFPLVEEENLPYLCMDLVYQ  427

Query  1251  YTLLVDGLGLHPYKEITLMKKVEYKNYMVEAAWPLGCAIDVISS  1382
             YTLL+DG GL P + ITL+KKV+Y +  VEAAWPLG AI+ +SS
Sbjct  428   YTLLIDGFGLEPSQTITLVKKVKYGDQAVEAAWPLGSAIEAVSS  471



>dbj|BAB40231.1| S-type apyrase, partial [Pisum sativum]
Length=407

 Score =   433 bits (1114),  Expect = 5e-144, Method: Compositional matrix adjust.
 Identities = 218/396 (55%), Positives = 289/396 (73%), Gaps = 1/396 (0%)
 Frame = +3

Query  198   DAGSTGSRVHVFHFDENLDLLPIGDGVEFFLKTTPGLSSYANDPEAAAKSLEPLLLEAEG  377
             DAGSTGSR+HV+HF++NLDLL IG GVE++ K TPGLSSYAN+PE AAKSL PLL +AE 
Sbjct  1     DAGSTGSRIHVYHFNQNLDLLHIGKGVEYYNKITPGLSSYANNPEQAAKSLIPLLEQAED  60

Query  378   VVPTELQPDTPLELGATAGLRLLEGDASDKILQAVRDMFKNESNFKSKAEWVSILEGSQE  557
             VVP +LQP TP+ LGATAGLRLL GDAS+KILQ+VRDM  N S F  + + VSI++G+QE
Sbjct  61    VVPDDLQPKTPVRLGATAGLRLLNGDASEKILQSVRDMLSNRSTFNVQPDAVSIIDGTQE  120

Query  558   GTYFWVAMNYLLGNLGKGYQNTIATIDLGGGSVQVSYAVSGDTFANAPTPDNGEEPYVQE  737
             G+Y WV +NY LGNLGK Y  T+  IDLGGGSVQ++YAVS  T  NAP   +G++PY+++
Sbjct  121   GSYLWVTVNYALGNLGKKYTKTVGVIDLGGGSVQMAYAVSKKTAKNAPKVADGDDPYIKK  180

Query  738   KYILGAQYYLYVHSYLNYGQLASRAEIFKASGNSTNPCVLEGYDGYYTYNDVSYKVTAPP  917
               + G  Y LYVHSYL++G+ ASRAEI K +  S NPC+L G++G YTY+   +K TA  
Sbjct  181   VVLKGIPYDLYVHSYLHFGREASRAEILKLTPRSPNPCLLAGFNGIYTYSGEEFKATAYT  240

Query  918   NGSSLKNCRKLARKVVDFRAPCKYQNCTFNGVWSGGGGAGMENVYISSFFYDIATDVGII  1097
             +G++   C+   RK +    PC YQNCTF G+W+GGGG G +N++ SS F+ +  D G++
Sbjct  241   SGANFNKCKNTIRKALKLNYPCPYQNCTFGGIWNGGGGNGQKNLFASSSFFYLPEDTGMV  300

Query  1098  DQEKASKIVKPRSFLVAAKLACETKFEDVKSTFPNAVEKDYP-YLCMDLVYEYTLLVDGL  1274
             D    + I++P      AK AC   FED KST+P   +K+   Y+CMDL+Y+Y LLVDG 
Sbjct  301   DASTPNFILRPVDIETKAKEACALNFEDAKSTYPFLDKKNVASYVCMDLIYQYVLLVDGF  360

Query  1275  GLHPYKEITLMKKVEYKNYMVEAAWPLGCAIDVISS  1382
             GL P ++IT  K++EY++ +VEAAWPLG A++ IS+
Sbjct  361   GLDPLQKITSGKEIEYQDAIVEAAWPLGNAVEAISA  396



>gb|ACB38286.1| apyrase [Trifolium repens]
Length=455

 Score =   435 bits (1118),  Expect = 5e-144, Method: Compositional matrix adjust.
 Identities = 218/412 (53%), Positives = 299/412 (73%), Gaps = 4/412 (1%)
 Frame = +3

Query  150   RRVLLSHET-GNYAVIFDAGSTGSRVHVFHFDENLDLLPIGDGVEFFLKTTPGLSSYAND  326
             R++ L   T  +YAV+FDAGSTGSRVHV+HFD+NLDLL IG  VEF+ K  PGLS+YA++
Sbjct  32    RKIFLKQGTITSYAVVFDAGSTGSRVHVYHFDQNLDLLHIGKDVEFYNKIQPGLSAYADN  91

Query  327   PEAAAKSLEPLLLEAEGVVPTELQPDTPLELGATAGLRLLEGDASDKILQAVRDMFKNES  506
             PE AAKSL PLL +AE VVP +    TP+ LGATAGLRLL+GDAS++ILQAVRDM  N+S
Sbjct  92    PEQAAKSLIPLLEQAENVVPEDFHSKTPIRLGATAGLRLLDGDASERILQAVRDMLNNKS  151

Query  507   NFKSKAEWVSILEGSQEGTYFWVAMNYLLGNLGKGYQNTIATIDLGGGSVQVSYAVSGDT  686
              F  + + VSI++G+QEG+Y WV +NY+LGNLGK + NT+  IDLGGGSVQ++YAVS  T
Sbjct  152   TFNVQPDAVSIIDGTQEGSYLWVTINYVLGNLGKRFTNTVGVIDLGGGSVQMAYAVSKKT  211

Query  687   FANAPTPDNGEEPYVQEKYILGAQYYLYVHSYLNYGQLASRAEIFKASGNSTNPCVLEGY  866
               NAP   +GE+PY+++  + G  Y LYVHSYL++G+ ASRAEI K +  S +PC+L G+
Sbjct  212   ARNAPKVTDGEDPYIKKIVLKGKPYDLYVHSYLHFGREASRAEILKVTHGSASPCILAGF  271

Query  867   DGYYTYNDVSYKVTAPPNGSSLKNCRKLARKVVDFRAPCKYQNCTFNGVWSGGGGAGMEN  1046
             DG YTY+   +K +AP +G++   C+K+ +K +    PC YQNCTF G+W+GGGG+G + 
Sbjct  272   DGIYTYSGEEFKASAPTSGANFDKCKKIIQKALKLDYPCPYQNCTFGGIWNGGGGSGQKK  331

Query  1047  VYISSFFYDIATDVGIIDQEKASKIVKPRSFLVAAKLACETKFEDVKSTFPNAVEK--DY  1220
             ++ +S F+ +  DVG++D  K++  ++P      AK+ C    EDVKS +P  +EK    
Sbjct  332   LFAASSFFYLPQDVGMVDPNKSNLKLRPVDLENKAKIVCTLNVEDVKSAYP-LLEKFNIV  390

Query  1221  PYLCMDLVYEYTLLVDGLGLHPYKEITLMKKVEYKNYMVEAAWPLGCAIDVI  1376
             PY CMDL+Y+Y LLVDG GL P +EIT  +K+EY+  +V+AAW LG A++ +
Sbjct  391   PYACMDLIYQYELLVDGFGLDPLQEITAGEKIEYQEALVDAAWALGNAVEAV  442



>ref|XP_009416336.1| PREDICTED: probable apyrase 1 [Musa acuminata subsp. malaccensis]
Length=463

 Score =   435 bits (1118),  Expect = 7e-144, Method: Compositional matrix adjust.
 Identities = 215/405 (53%), Positives = 293/405 (72%), Gaps = 2/405 (0%)
 Frame = +3

Query  174   TGNYAVIFDAGSTGSRVHVFHFDENLDLLPIGDGVEFFLKTTPGLSSYANDPEAAAKSLE  353
             + +YAVIFDAGS+GSRVHVF FDENLDLLPIG  +E F++  PGLS YA DP+ AA+SL 
Sbjct  60    SKSYAVIFDAGSSGSRVHVFCFDENLDLLPIGQELELFVQKKPGLSFYAKDPQQAAQSLV  119

Query  354   PLLLEAEGVVPTELQPDTPLELGATAGLRLLEGDASDKILQAVRDMFKNESNFKSKAEWV  533
              LL +AE VVP +L+  TP+ +GATAGLR L  + S+KILQAV+D+ +++S+ K K++WV
Sbjct  120   SLLEKAESVVPMKLRQQTPVRVGATAGLRALGAETSEKILQAVKDLLQHKSSLKFKSDWV  179

Query  534   SILEGSQEGTYFWVAMNYLLGNLGKGYQNTIATIDLGGGSVQVSYAVSGDTFANAPTPDN  713
             ++L+G+QEG + WV +NYLLG LGK Y NT+  +DLGGGSVQ++YA+S      AP   +
Sbjct  180   TVLDGTQEGAFQWVTINYLLGKLGKSYANTVGVVDLGGGSVQMAYAISEKDAEQAPKVSD  239

Query  714   GEEPYVQEKYILGAQYYLYVHSYLNYGQLASRAEIFKASGNSTNPCVLEGYDGYYTYNDV  893
             GE+ YVQ+ ++ G +YYLYVHSYL YG LA+RAEI K + + +N C+L GY G Y Y   
Sbjct  240   GEDSYVQKLFLKGTKYYLYVHSYLRYGLLAARAEILKVTKDDSN-CILSGYHGSYKYGGN  298

Query  894   SYKVTAPPNGSSLKNCRKLARKVVDFRAP-CKYQNCTFNGVWSGGGGAGMENVYISSFFY  1070
             +Y+ +A  +G+S   CR+ A K +    P C +  CTF G+W+GGGG G +N++++SFF+
Sbjct  299   AYRASAKQSGASFLKCREDAVKALRVDEPACTHMKCTFGGIWNGGGGDGQKNLFVASFFF  358

Query  1071  DIATDVGIIDQEKASKIVKPRSFLVAAKLACETKFEDVKSTFPNAVEKDYPYLCMDLVYE  1250
             D A + G +D+EK   +VKP  F  AAK AC+   ED K+ +P   E + PYLCMDLVY+
Sbjct  359   DRAAEAGFVDREKPIAVVKPSHFEKAAKHACQLSIEDAKAAYPRVQEDNLPYLCMDLVYQ  418

Query  1251  YTLLVDGLGLHPYKEITLMKKVEYKNYMVEAAWPLGCAIDVISSS  1385
             YTLLVDG  + P  +ITL+K+V+Y +  VEAAWPLG AI+V SS+
Sbjct  419   YTLLVDGFAIDPDHDITLVKQVKYGDAFVEAAWPLGSAIEVASSA  463



>gb|KFK37843.1| hypothetical protein AALP_AA3G036300 [Arabis alpina]
Length=468

 Score =   435 bits (1118),  Expect = 8e-144, Method: Compositional matrix adjust.
 Identities = 217/402 (54%), Positives = 287/402 (71%), Gaps = 1/402 (0%)
 Frame = +3

Query  180   NYAVIFDAGSTGSRVHVFHFDENLDLLPIGDGVEFFLKTTPGLSSYANDPEAAAKSLEPL  359
             NYAVIFDAGS+GSRVHV+ FD+NLDL+P+G+ +E FL+  PGLS+Y NDP  +A SL  L
Sbjct  66    NYAVIFDAGSSGSRVHVYCFDQNLDLVPLGNELELFLQLKPGLSAYPNDPRQSANSLVSL  125

Query  360   LLEAEGVVPTELQPDTPLELGATAGLRLLEGDASDKILQAVRDMFKNESNFKSKAEWVSI  539
             L +AE  VP EL+  TP+ +GATAGLR L    S+ ILQAVR++ K+ S  +++   V +
Sbjct  126   LDKAESSVPRELRTKTPVRVGATAGLRALGHKTSENILQAVRELLKDRSRLRTEENAVIV  185

Query  540   LEGSQEGTYFWVAMNYLLGNLGKGYQNTIATIDLGGGSVQVSYAVSGDTFANAPTPDNGE  719
             L+G+QEG+Y WV +NYLL  LGK Y  T+  +DLGGGSVQ++YA+S +  A AP P  GE
Sbjct  186   LDGTQEGSYQWVTINYLLKTLGKPYSETVGVVDLGGGSVQMAYAISEEEAATAPKPSEGE  245

Query  720   EPYVQEKYILGAQYYLYVHSYLNYGQLASRAEIFKASGNSTNPCVLEGYDGYYTYNDVSY  899
             + YV+E Y+ G +Y+LYVHSYL+YG LA+RAEI + S  S NPCV+ GYDG Y Y   ++
Sbjct  246   DSYVKEMYLKGRKYFLYVHSYLHYGLLAARAEILQVSDVSNNPCVVSGYDGTYKYGGKAF  305

Query  900   KVTAPPNGSSLKNCRKLARKVVDF-RAPCKYQNCTFNGVWSGGGGAGMENVYISSFFYDI  1076
             K TA P+G+SL  CR++A   +    + C +  CTF GVW+GGGG G +N++++SFF+D 
Sbjct  306   KATASPSGASLDECRRVAINALKVNNSVCTHMKCTFGGVWNGGGGGGQKNMFVASFFFDR  365

Query  1077  ATDVGIIDQEKASKIVKPRSFLVAAKLACETKFEDVKSTFPNAVEKDYPYLCMDLVYEYT  1256
             A + G +D E+    VKP  F  AA  AC  K E+ KS FP   E + PYLC+DLVY+YT
Sbjct  366   AAEAGFVDPEQPVATVKPLDFEKAANKACSMKLEEGKSKFPRVEEDNLPYLCLDLVYQYT  425

Query  1257  LLVDGLGLHPYKEITLMKKVEYKNYMVEAAWPLGCAIDVISS  1382
             LLVDG GL P + ITL+KKV+Y +Y VEAAWPLG AI+ +SS
Sbjct  426   LLVDGFGLKPSQTITLVKKVKYGDYAVEAAWPLGSAIEAVSS  467



>ref|XP_006342448.1| PREDICTED: apyrase 2-like [Solanum tuberosum]
Length=472

 Score =   435 bits (1119),  Expect = 9e-144, Method: Compositional matrix adjust.
 Identities = 230/404 (57%), Positives = 293/404 (73%), Gaps = 1/404 (0%)
 Frame = +3

Query  180   NYAVIFDAGSTGSRVHVFHFDENLDLLPIGDGVEFFLKTTPGLSSYANDPEAAAKSLEPL  359
              YAVIFDAGS+GSRVHVF FDENLDL+PIG+ +E F++  PGLSS+A+DP AAA SL  L
Sbjct  69    KYAVIFDAGSSGSRVHVFCFDENLDLVPIGNELELFVQKKPGLSSFASDPVAAADSLLLL  128

Query  360   LLEAEGVVPTELQPDTPLELGATAGLRLLEGDASDKILQAVRDMFKNESNFKSKAEWVSI  539
             L +AE VVP  L+ +TP+ +GATAGLR LEGDASD+ILQAVRD  K++S+FK+  + V +
Sbjct  129   LKDAENVVPRNLRSNTPVRVGATAGLRQLEGDASDRILQAVRDFLKSKSSFKATEDAVIV  188

Query  540   LEGSQEGTYFWVAMNYLLGNLGKGYQNTIATIDLGGGSVQVSYAVSGDTFANAPTPDNGE  719
             L+G+QEG Y WV +NYLLG LGK Y +T+  +DLGGGSVQ++YA+S      AP   +GE
Sbjct  189   LDGNQEGAYQWVTINYLLGKLGKKYSDTVGVVDLGGGSVQMAYAISESDAQKAPKVSDGE  248

Query  720   EPYVQEKYILGAQYYLYVHSYLNYGQLASRAEIFKASGNSTNPCVLEGYDGYYTYNDVSY  899
             + YVQE Y+ G +Y+LYVHSYL+YG LA+RAEI K SG S +PC+L G+ G Y Y    Y
Sbjct  249   DTYVQEMYLKGTKYFLYVHSYLHYGLLAARAEILKVSGESGSPCILGGHHGTYKYGGAVY  308

Query  900   KVTAPPNGSSLKNCRKLARKVVDFRAP-CKYQNCTFNGVWSGGGGAGMENVYISSFFYDI  1076
               ++   GSS+  CR++A K +    P C +  CTF GVW+GGGG G +N++++SFF+D 
Sbjct  309   PASSTSQGSSMSTCREVALKALKINEPACTHMKCTFGGVWNGGGGDGQKNMFVASFFFDR  368

Query  1077  ATDVGIIDQEKASKIVKPRSFLVAAKLACETKFEDVKSTFPNAVEKDYPYLCMDLVYEYT  1256
             A + GII+   A   V+P  +  AA  AC T  E  KS FP+    + PYLCMDLVY+YT
Sbjct  369   AAEAGIINPSLAVAKVRPADYESAANRACATGLEGAKSEFPHVETDNLPYLCMDLVYQYT  428

Query  1257  LLVDGLGLHPYKEITLMKKVEYKNYMVEAAWPLGCAIDVISSSS  1388
             LLVDG GL P +EITL+KKVEYKN  VEAAWPLG AI+V SS S
Sbjct  429   LLVDGFGLQPQQEITLVKKVEYKNSFVEAAWPLGSAIEVASSLS  472



>ref|XP_009406850.1| PREDICTED: probable apyrase 2 [Musa acuminata subsp. malaccensis]
Length=463

 Score =   434 bits (1117),  Expect = 1e-143, Method: Compositional matrix adjust.
 Identities = 219/405 (54%), Positives = 292/405 (72%), Gaps = 2/405 (0%)
 Frame = +3

Query  171   ETGNYAVIFDAGSTGSRVHVFHFDENLDLLPIGDGVEFFLKTTPGLSSYANDPEAAAKSL  350
              + +YAVIFDAGS+GSRVHV+ FDENLDLL IG  +E F++  PGLS YANDP+ AA SL
Sbjct  59    RSKSYAVIFDAGSSGSRVHVYCFDENLDLLHIGMELELFIQKKPGLSFYANDPQEAANSL  118

Query  351   EPLLLEAEGVVPTELQPDTPLELGATAGLRLLEGDASDKILQAVRDMFKNESNFKSKAEW  530
              PLL +AE VVP EL+  TP+ +GATAGLR L  + S+KILQAVRD+ + +S+ K   +W
Sbjct  119   VPLLEKAESVVPVELRQKTPVRVGATAGLRALGAETSEKILQAVRDLLQRKSSLKFNPDW  178

Query  531   VSILEGSQEGTYFWVAMNYLLGNLGKGYQNTIATIDLGGGSVQVSYAVSGDTFANAPTPD  710
             V++L+G+QEG + WV +NYLLG LGK Y  T+  +DLGGGSVQ++YA+S    ANAP   
Sbjct  179   VTVLDGTQEGAFQWVTINYLLGKLGKSYAKTVGVVDLGGGSVQMAYAISEKDAANAPKVS  238

Query  711   NGEEPYVQEKYILGAQYYLYVHSYLNYGQLASRAEIFKASGNSTNPCVLEGYDGYYTYND  890
             +G++ YVQE ++ G +YYLYVHSYL+YG LA+RAEI K + + +N C+L GYDG Y Y  
Sbjct  239   DGQDSYVQELFLKGTRYYLYVHSYLHYGLLAARAEILKITEDRSN-CILGGYDGSYKYGG  297

Query  891   VSYKVTAPPNGSSLKNCRKLARKVVDFRAP-CKYQNCTFNGVWSGGGGAGMENVYISSFF  1067
              +YK +A P+G+S   CR  A K +    P C +  CTF G+W+GGGG G ++++++SFF
Sbjct  298   KAYKASASPSGASFSKCRDDAIKALKVDEPACTHMKCTFGGIWNGGGGDGQKHLFVASFF  357

Query  1068  YDIATDVGIIDQEKASKIVKPRSFLVAAKLACETKFEDVKSTFPNAVEKDYPYLCMDLVY  1247
             +D A + G +D EK +  VKP  F  AAK AC+   ED K+ +P   + + PYLCMDLVY
Sbjct  358   FDRAAEAGFVDSEKPTAKVKPAYFKKAAKQACQLSVEDAKTKYPLVQDDNLPYLCMDLVY  417

Query  1248  EYTLLVDGLGLHPYKEITLMKKVEYKNYMVEAAWPLGCAIDVISS  1382
             +YTLLVDG  + P  +ITL+KKV+Y + +VEAAWPLG AI+V SS
Sbjct  418   QYTLLVDGFDVDPDHDITLVKKVKYADAVVEAAWPLGSAIEVASS  462



>ref|XP_004977419.1| PREDICTED: probable apyrase 3-like [Setaria italica]
Length=459

 Score =   434 bits (1115),  Expect = 2e-143, Method: Compositional matrix adjust.
 Identities = 217/400 (54%), Positives = 285/400 (71%), Gaps = 2/400 (1%)
 Frame = +3

Query  180   NYAVIFDAGSTGSRVHVFHFDENLDLLPIGDGVEFFLKTTPGLSSYANDPEAAAKSLEPL  359
              +AVIFDAGSTGSRVHVF FD  LDL+PIGD +EFF K  PGLSSYA  P+ AA S+ PL
Sbjct  53    RFAVIFDAGSTGSRVHVFKFDSKLDLVPIGDDIEFFAKIKPGLSSYAGRPQEAASSILPL  112

Query  360   LLEAEGVVPTELQPDTPLELGATAGLRLLEGDASDKILQAVRDMFKNESNFKSKAEWVSI  539
             L +A+ +VPT LQ  TPL+LGATAGLRL+    +++IL+AV+D+   +S F+   +W+++
Sbjct  113   LEQAKKIVPTSLQKYTPLKLGATAGLRLIGDKKAEEILEAVQDLVHTKSKFQYNPKWITV  172

Query  540   LEGSQEGTYFWVAMNYLLGNLGKGYQNTIATIDLGGGSVQVSYAVSGDTFANAPTPDNGE  719
             LEG+QEG+Y WVA+NYLLG LG  Y  T+  IDLGGGSVQ++YA+S +  ANAP   +G+
Sbjct  173   LEGTQEGSYLWVALNYLLGKLGGDYSKTVGVIDLGGGSVQMAYAISTNAAANAPAVPDGK  232

Query  720   EPYVQEKYILGAQYYLYVHSYLNYGQLASRAEIFKASGNSTNPCVLEGYDGYYTYNDVSY  899
             +PY+ ++Y+ G  Y LYVHSYL YG  ASR EI KA     + CVL G+ G YTYN   Y
Sbjct  233   DPYITKEYLKGKDYNLYVHSYLYYGTFASRVEILKAKNGPFSRCVLRGFSGNYTYNGKEY  292

Query  900   KVTAPPNGSSLKNCRKLARKVVDFRAPCKYQNCTFNGVWSGGGGAGMENVYISSFFYDIA  1079
               TA P G+    CR+   K ++  APC+ +NC+FNGVW+GGGGAG +N+Y++SFF+D A
Sbjct  293   DATASPEGAVYDKCREEIIKALNLSAPCETKNCSFNGVWNGGGGAGQDNLYVASFFFDKA  352

Query  1080  TDVGIIDQEKASKIVKPRSFLVAAKLACETKFEDVKSTFPNAVEKDYPYLCMDLVYEYTL  1259
             T  G I+ E  S    P +F VAA+  C    ++VK+ +PNA   D PY CMDL+Y+YTL
Sbjct  353   TQYGFIESEAPSAKSTPAAFKVAAEKVCSLSVKEVKAAYPNAF--DLPYACMDLLYQYTL  410

Query  1260  LVDGLGLHPYKEITLMKKVEYKNYMVEAAWPLGCAIDVIS  1379
             LVDG GL P KEITL+ +V+Y  Y +EAAWPLG AI+ ++
Sbjct  411   LVDGFGLDPTKEITLINRVKYGEYYIEAAWPLGTAIEAVA  450



>gb|AAF66599.1|AF141671_1 apyrase [Arabidopsis thaliana]
Length=472

 Score =   434 bits (1116),  Expect = 2e-143, Method: Compositional matrix adjust.
 Identities = 219/404 (54%), Positives = 292/404 (72%), Gaps = 5/404 (1%)
 Frame = +3

Query  180   NYAVIFDAGSTGSRVHVFHFDENLDLLPIGDGVEFFLKTTPGLSSYANDPEAAAKSLEPL  359
             NYAVIFDAGS+GSRVHV+ FD+NLDL+P+G+ +E FL+  PGLS+Y  DP  AA SL  L
Sbjct  70    NYAVIFDAGSSGSRVHVYCFDQNLDLIPLGNELELFLQLKPGLSAYPTDPRQAANSLVSL  129

Query  360   LLEAEGVVPTELQPDTPLELGATAGLRLLEGDASDKILQAVRDMFKNESNFKSKAEWVSI  539
             L +AE  VP EL+P T + +G TAGLR L  DAS+ ILQAVR++ ++ S  K++A  V++
Sbjct  130   LDKAEASVPRELRPKTHVRVGVTAGLRTLGHDASENILQAVRELLRDRSMLKTEANAVTV  189

Query  540   LEGSQEGTYFWVAMNYLLGNLGKGYQNTIATIDLGGGSVQVSYAVSGDTFANAPTPDNGE  719
             L+G+QEG+Y WV +NYLL NLGK Y +T+  +DLGGGSVQ++YA+S +  A+AP P  GE
Sbjct  190   LDGTQEGSYQWVTINYLLRNLGKPYSDTVGVVDLGGGSVQMAYAISEEDAASAPKPLEGE  249

Query  720   EPYVQEKYILGAQYYLYVHSYLNYGQLASRAEIFKASGNSTNPCVLEGYDGYYTYNDVSY  899
             + YV+E Y+ G +Y+LYVHSYL+YG LA+RAEI K S +S NPC++ GYDG Y Y    +
Sbjct  250   DSYVREMYLKGRKYFLYVHSYLHYGLLAARAEILKVSEDSENPCIVAGYDGTYKYGGKEF  309

Query  900   KVTAPPNGSSLKNCRKL---ARKVVDFRAPCKYQNCTFNGVWSGGGGAGMENVYISSFFY  1070
             K  A  +G+SL  CR++   A KV D    C +  CTF GVW+GG G G +N++++SFF+
Sbjct  310   KAPASQSGASLDECRRITINALKVND--TLCTHMKCTFGGVWNGGRGGGQKNMFVASFFF  367

Query  1071  DIATDVGIIDQEKASKIVKPRSFLVAAKLACETKFEDVKSTFPNAVEKDYPYLCMDLVYE  1250
             D A + G +D ++    V+P  F  AAK AC  K E+ KSTFP   E++ PYLCMDLVY+
Sbjct  368   DRAAEAGFVDPKQPVATVRPMDFEKAAKKACSMKLEEGKSTFPLVEEENLPYLCMDLVYQ  427

Query  1251  YTLLVDGLGLHPYKEITLMKKVEYKNYMVEAAWPLGCAIDVISS  1382
             YTLL+DG GL P + ITL+KKV+Y +  VEAAWPLG AI+ +SS
Sbjct  428   YTLLIDGFGLEPSQTITLVKKVKYGDQAVEAAWPLGSAIEAVSS  471



>ref|XP_006408225.1| hypothetical protein EUTSA_v10020649mg [Eutrema salsugineum]
 gb|ESQ49678.1| hypothetical protein EUTSA_v10020649mg [Eutrema salsugineum]
Length=472

 Score =   434 bits (1116),  Expect = 2e-143, Method: Compositional matrix adjust.
 Identities = 215/402 (53%), Positives = 290/402 (72%), Gaps = 1/402 (0%)
 Frame = +3

Query  180   NYAVIFDAGSTGSRVHVFHFDENLDLLPIGDGVEFFLKTTPGLSSYANDPEAAAKSLEPL  359
             NYAVIFDAGS+GSRVHV+ FD+NLDL+P+G+ +E F++  PGLS+Y NDP  +A SL  L
Sbjct  70    NYAVIFDAGSSGSRVHVYCFDQNLDLVPLGNELELFIQLKPGLSAYPNDPRQSANSLVSL  129

Query  360   LLEAEGVVPTELQPDTPLELGATAGLRLLEGDASDKILQAVRDMFKNESNFKSKAEWVSI  539
             L +AE  VP EL+P+TP+ +GATAGLR L   AS+ ILQAVR++ K+ S  K++A  V++
Sbjct  130   LDKAEASVPRELRPNTPVRVGATAGLRALGHKASENILQAVRELLKDRSRLKTEANAVTV  189

Query  540   LEGSQEGTYFWVAMNYLLGNLGKGYQNTIATIDLGGGSVQVSYAVSGDTFANAPTPDNGE  719
             L+G+QEG+Y WV +NYLL  LGK Y +T+  +DLGGGSVQ++YA+S +  A AP P  GE
Sbjct  190   LDGTQEGSYQWVTINYLLRTLGKPYSDTVGVVDLGGGSVQMAYAISEEDAATAPKPLEGE  249

Query  720   EPYVQEKYILGAQYYLYVHSYLNYGQLASRAEIFKASGNSTNPCVLEGYDGYYTYNDVSY  899
             + YV+E Y+ G +Y+LYVHSYL+YG LA+RAEI K S  S NPC++ GYDG Y Y   ++
Sbjct  250   DSYVREMYLKGRKYFLYVHSYLHYGLLAARAEILKVSEGSNNPCIVTGYDGTYKYGGKAF  309

Query  900   KVTAPPNGSSLKNCRKLARKVVDFR-APCKYQNCTFNGVWSGGGGAGMENVYISSFFYDI  1076
             +  A P+G+SL  CR++A   +    + C +  CTF GVW+GGGG G +N++++SFF+D 
Sbjct  310   RAAASPSGASLDECRRVALNALKVNDSLCTHMKCTFGGVWNGGGGGGQKNMFVASFFFDR  369

Query  1077  ATDVGIIDQEKASKIVKPRSFLVAAKLACETKFEDVKSTFPNAVEKDYPYLCMDLVYEYT  1256
             A + G +D  +   IV P  F  AA  AC  K  + K+ FP   E + PYLC+DLVY+YT
Sbjct  370   AAEAGFVDPTQPVAIVHPVDFEKAANQACNMKMGEGKTKFPRVEEDNLPYLCLDLVYQYT  429

Query  1257  LLVDGLGLHPYKEITLMKKVEYKNYMVEAAWPLGCAIDVISS  1382
             LLVDG GL P + ITL+KKV+Y +Y VEAAWPLG AI+ +SS
Sbjct  430   LLVDGFGLKPSQTITLVKKVKYGDYAVEAAWPLGSAIEAVSS  471



>ref|XP_006400376.1| hypothetical protein EUTSA_v10013440mg [Eutrema salsugineum]
 gb|ESQ41829.1| hypothetical protein EUTSA_v10013440mg [Eutrema salsugineum]
Length=472

 Score =   433 bits (1114),  Expect = 4e-143, Method: Compositional matrix adjust.
 Identities = 218/404 (54%), Positives = 292/404 (72%), Gaps = 5/404 (1%)
 Frame = +3

Query  180   NYAVIFDAGSTGSRVHVFHFDENLDLLPIGDGVEFFLKTTPGLSSYANDPEAAAKSLEPL  359
             NYAVIFDAGS+GSRVHV+ FD+NLDLLP+G+ +E FL+  PGLS+Y  DP  AA SL  L
Sbjct  70    NYAVIFDAGSSGSRVHVYCFDQNLDLLPLGNELELFLQLKPGLSAYPTDPRQAANSLVSL  129

Query  360   LLEAEGVVPTELQPDTPLELGATAGLRLLEGDASDKILQAVRDMFKNESNFKSKAEWVSI  539
             L +AE  VP EL+P T + +GATAGLR L  +AS+ ILQAVR++ ++ S  K++A  V++
Sbjct  130   LDKAEASVPRELRPKTHVRVGATAGLRTLGHEASENILQAVRELLRDRSMLKTEANAVTV  189

Query  540   LEGSQEGTYFWVAMNYLLGNLGKGYQNTIATIDLGGGSVQVSYAVSGDTFANAPTPDNGE  719
             L+G+QEG+Y WV +NYLL NLGK Y +T+  +DLGGGSVQ++YA+S +  A+AP P  GE
Sbjct  190   LDGTQEGSYQWVTINYLLRNLGKPYSDTVGVVDLGGGSVQMAYAISEEDAASAPKPSEGE  249

Query  720   EPYVQEKYILGAQYYLYVHSYLNYGQLASRAEIFKASGNSTNPCVLEGYDGYYTYNDVSY  899
             + YV+E Y+ G +Y+LYVHSYL+YG LA+RAEI K S +S NPC++ GYDG Y Y    +
Sbjct  250   DTYVREMYLKGRKYFLYVHSYLHYGLLAARAEILKVSDDSNNPCIVTGYDGTYKYGGEGF  309

Query  900   KVTAPPNGSSLKNCRKL---ARKVVDFRAPCKYQNCTFNGVWSGGGGAGMENVYISSFFY  1070
             K     +G S+  CR+L   A KV D    C +  CTF GVW+GG G G +N++++SFF+
Sbjct  310   KAAGSQSGGSVDECRRLTLNALKVND--TLCTHMKCTFGGVWNGGRGGGQKNMFVASFFF  367

Query  1071  DIATDVGIIDQEKASKIVKPRSFLVAAKLACETKFEDVKSTFPNAVEKDYPYLCMDLVYE  1250
             D A + G +D ++    V+P  F  AAK AC  K E+ KS FP   E++ PYLCMDLVY+
Sbjct  368   DRAAEAGFVDPKQPVATVRPIEFEKAAKKACSMKLEEGKSKFPRVEEENLPYLCMDLVYQ  427

Query  1251  YTLLVDGLGLHPYKEITLMKKVEYKNYMVEAAWPLGCAIDVISS  1382
             YTLL+DG GL P ++ITL+KKV+Y ++ VEAAWPLG AI+ +SS
Sbjct  428   YTLLIDGFGLVPSQKITLVKKVKYGDHAVEAAWPLGSAIEAVSS  471



>ref|XP_008670728.1| PREDICTED: probable apyrase 3 [Zea mays]
 tpg|DAA41935.1| TPA: putative apyrase family protein [Zea mays]
Length=462

 Score =   432 bits (1112),  Expect = 6e-143, Method: Compositional matrix adjust.
 Identities = 219/409 (54%), Positives = 290/409 (71%), Gaps = 2/409 (0%)
 Frame = +3

Query  174   TGNYAVIFDAGSTGSRVHVFHFDENLDLLPIGDGVEFFLKTTPGLSSYANDPEAAAKSLE  353
             T  YAVIFD GSTGSRVHVF FD+ LDL+ IGD ++FF +  PGLS YA +P+ AA+S+ 
Sbjct  55    TAQYAVIFDGGSTGSRVHVFKFDKQLDLVKIGDDIQFFAQVKPGLSEYAGEPQEAARSIA  114

Query  354   PLLLEAEGVVPTELQPDTPLELGATAGLRLLEGDASDKILQAVRDMFKNESNFKSKAEWV  533
             PLL +A+G VP  LQ  TPL+LGATAGLRL+  + S++IL+A+RD+ K++S F+    W+
Sbjct  115   PLLEKAQGAVPASLQSTTPLKLGATAGLRLIGDEKSEEILEAIRDLVKSKSEFEYNPNWI  174

Query  534   SILEGSQEGTYFWVAMNYLLGNLGKGYQNTIATIDLGGGSVQVSYAVSGDTFANAPTPDN  713
             ++LEGSQEG+Y WVA+NYLLG LG  Y +T+  +DLGGGSVQ++YA+S D  ANAP    
Sbjct  175   TVLEGSQEGSYLWVALNYLLGKLGGDYSDTVGVVDLGGGSVQMAYAISDDASANAPAVPE  234

Query  714   GEEPYVQEKYILGAQYYLYVHSYLNYGQLASRAEIFKASGNSTNPCVLEGYDGYYTYNDV  893
             G++PYV ++++ G  Y LYVHSYL+YG LA+RAEI KA+    +PC+L G+ G YTYN  
Sbjct  235   GQDPYVTKEHLKGKHYNLYVHSYLHYGLLAARAEILKANNGPFSPCILRGFSGTYTYNGE  294

Query  894   SYKVTAPPNGSSLKNCRKLARKVVDFRAPCKYQNCTFNGVWSGGGGAGMENVYISSFFYD  1073
              Y+  A P G+S + CR  A   ++  A C+ +NCTFNGVW+GGGGAG  ++Y++S+FYD
Sbjct  295   EYEAAAAPEGASYEKCRDGAVAALNLGARCEAKNCTFNGVWNGGGGAGQADLYVASYFYD  354

Query  1074  IATDVGIIDQEKASKIVKPRSFLVAAKLACETKFEDVKSTFPNAVEKDYPYLCMDLVYEY  1253
              A+ VGII  +  +    P +F  AA   C     D ++ FP+A   D  YLCMDLVYEY
Sbjct  355   RASQVGIIGGDAPNGRSTPAAFADAALKVCSLSVADAEAAFPDAW--DAEYLCMDLVYEY  412

Query  1254  TLLVDGLGLHPYKEITLMKKVEYKNYMVEAAWPLGCAIDVISSSSANNL  1400
             TLLVDG GL P KE TL+ KV+Y  Y V+AAWPLG AI+ +SS   N +
Sbjct  413   TLLVDGFGLEPTKEFTLVTKVKYGEYYVDAAWPLGDAIETLSSQKLNQI  461



>ref|XP_004984507.1| PREDICTED: probable apyrase 1-like [Setaria italica]
Length=480

 Score =   433 bits (1113),  Expect = 7e-143, Method: Compositional matrix adjust.
 Identities = 216/404 (53%), Positives = 297/404 (74%), Gaps = 2/404 (0%)
 Frame = +3

Query  180   NYAVIFDAGSTGSRVHVFHFDENLDLLPIGDGVEFFLKTTPGLSSYANDPEAAAKSLEPL  359
              YAVIFDAGS+GSRVHV+ FDENLDL+PIG  +E F +  PGLS++ANDP+ AA+SL  L
Sbjct  77    KYAVIFDAGSSGSRVHVYCFDENLDLVPIGKEIELFKQKKPGLSAHANDPQEAAESLISL  136

Query  360   LLEAEGVVPTELQPDTPLELGATAGLRLLEGDASDKILQAVRDMFKNESNFKSKAEWVSI  539
             L EAE VVP EL+  TP+ +GATAGLR L  + S++ILQAVR++ +++S+FKS+ +WV++
Sbjct  137   LEEAEKVVPVELRKQTPVRVGATAGLRALGTERSEEILQAVRELLRDKSSFKSQPDWVTV  196

Query  540   LEGSQEGTYFWVAMNYLLGNLGKGYQNTIATIDLGGGSVQVSYAVSGDTFANAPTPDNGE  719
             L+GSQEG + WV +NYLLG LGK Y +T+  +DLGGGSVQ++YA+S      AP   + E
Sbjct  197   LDGSQEGAFQWVTINYLLGKLGKPYSDTVGVVDLGGGSVQMAYAISEKDAVKAPDVSDDE  256

Query  720   EPYVQEKYILGAQYYLYVHSYLNYGQLASRAEIFKA-SGNSTNPCVLEGYDGYYTYNDVS  896
             + YV++  + G  YYLYVHSYL+YG LA+RAEIFKA  GN  + C+LEG+ G Y+Y D +
Sbjct  257   DSYVKKLLLKGTTYYLYVHSYLHYGLLAARAEIFKAGEGNDHSDCMLEGHHGKYSYGDNT  316

Query  897   YKVTAPPNGSSLKNCRKLARKVVDFRAP-CKYQNCTFNGVWSGGGGAGMENVYISSFFYD  1073
             ++ +  P+G+S   CR LA + +    P C +  CTF GVW+GGGG G +N++++SFF+D
Sbjct  317   FEASGSPSGASYSKCRALAVRALKVDEPACTHMKCTFGGVWNGGGGDGQKNLFVASFFFD  376

Query  1074  IATDVGIIDQEKASKIVKPRSFLVAAKLACETKFEDVKSTFPNAVEKDYPYLCMDLVYEY  1253
              A + G +D + A+  VKP  F  AA+  C+   +D  +T+P+  E++ PYLC+DLVY+Y
Sbjct  377   RAAEAGFVDPKAATAEVKPSDFEEAARRVCKLNVKDAHATYPDVSEENIPYLCIDLVYQY  436

Query  1254  TLLVDGLGLHPYKEITLMKKVEYKNYMVEAAWPLGCAIDVISSS  1385
             TLLVDG G+ PY++ITL+KKV Y +  VEAAWPLG AI+V SSS
Sbjct  437   TLLVDGFGVDPYQDITLVKKVSYGDSYVEAAWPLGSAIEVASSS  480



>ref|NP_197329.4| apyrase 2 [Arabidopsis thaliana]
 gb|AED92532.1| apyrase 2 [Arabidopsis thaliana]
Length=578

 Score =   436 bits (1121),  Expect = 1e-142, Method: Compositional matrix adjust.
 Identities = 220/404 (54%), Positives = 293/404 (73%), Gaps = 5/404 (1%)
 Frame = +3

Query  180   NYAVIFDAGSTGSRVHVFHFDENLDLLPIGDGVEFFLKTTPGLSSYANDPEAAAKSLEPL  359
             NYAVIFDAGS+GSRVHV+ FD+NLDL+P+G+ +E FL+  PGLS+Y  DP  AA SL  L
Sbjct  176   NYAVIFDAGSSGSRVHVYCFDQNLDLIPLGNELELFLQLKPGLSAYPTDPRQAANSLVSL  235

Query  360   LLEAEGVVPTELQPDTPLELGATAGLRLLEGDASDKILQAVRDMFKNESNFKSKAEWVSI  539
             L +AE  VP EL+P T + +GATAGLR L  DAS+ ILQAVR++ ++ S  K++A  V++
Sbjct  236   LDKAEASVPRELRPKTHVRVGATAGLRTLGHDASENILQAVRELLRDRSMLKTEANAVTV  295

Query  540   LEGSQEGTYFWVAMNYLLGNLGKGYQNTIATIDLGGGSVQVSYAVSGDTFANAPTPDNGE  719
             L+G+QEG+Y WV +NYLL NLGK Y +T+  +DLGGGSVQ++YA+S +  A+AP P  GE
Sbjct  296   LDGTQEGSYQWVTINYLLRNLGKPYSDTVGVVDLGGGSVQMAYAISEEDAASAPKPLEGE  355

Query  720   EPYVQEKYILGAQYYLYVHSYLNYGQLASRAEIFKASGNSTNPCVLEGYDGYYTYNDVSY  899
             + YV+E Y+ G +Y+LYVHSYL+YG LA+RAEI K S +S NPC++ GYDG Y Y    +
Sbjct  356   DSYVREMYLKGRKYFLYVHSYLHYGLLAARAEILKVSEDSENPCIVAGYDGMYKYGGKEF  415

Query  900   KVTAPPNGSSLKNCRKL---ARKVVDFRAPCKYQNCTFNGVWSGGGGAGMENVYISSFFY  1070
             K  A  +G+SL  CR++   A KV D    C +  CTF GVW+GG G G +N++++SFF+
Sbjct  416   KAPASQSGASLDECRRITINALKVND--TLCTHMKCTFGGVWNGGRGGGQKNMFVASFFF  473

Query  1071  DIATDVGIIDQEKASKIVKPRSFLVAAKLACETKFEDVKSTFPNAVEKDYPYLCMDLVYE  1250
             D A + G +D ++    V+P  F  AAK AC  K E+ KSTFP   E++ PYLCMDLVY+
Sbjct  474   DRAAEAGFVDPKQPVATVRPMDFEKAAKKACSMKLEEGKSTFPLVEEENLPYLCMDLVYQ  533

Query  1251  YTLLVDGLGLHPYKEITLMKKVEYKNYMVEAAWPLGCAIDVISS  1382
             YTLL+DG GL P + ITL+KKV+Y +  VEAAWPLG AI+ +SS
Sbjct  534   YTLLIDGFGLEPSQTITLVKKVKYGDQAVEAAWPLGSAIEAVSS  577



>dbj|BAB87197.1| ATP diphosphohydrolase [Pisum sativum]
Length=455

 Score =   432 bits (1110),  Expect = 1e-142, Method: Compositional matrix adjust.
 Identities = 220/413 (53%), Positives = 295/413 (71%), Gaps = 2/413 (0%)
 Frame = +3

Query  150   RRVLLS-HETGNYAVIFDAGSTGSRVHVFHFDENLDLLPIGDGVEFFLKTTPGLSSYAND  326
             R++ L   E  +YAV+FDAGSTGSR+HV+HF++NLDLL IG GVE++ K TPGLSSYAN+
Sbjct  32    RKIFLKLEEISSYAVVFDAGSTGSRIHVYHFNQNLDLLHIGKGVEYYNKITPGLSSYANN  91

Query  327   PEAAAKSLEPLLLEAEGVVPTELQPDTPLELGATAGLRLLEGDASDKILQAVRDMFKNES  506
             PE AAKSL PLL +AE VV   LQP TP+ LGATA LRLL GDAS+KILQ+VR +  N S
Sbjct  92    PEQAAKSLIPLLEQAEDVVSPNLQPKTPVRLGATAVLRLLNGDASEKILQSVRGLLSNRS  151

Query  507   NFKSKAEWVSILEGSQEGTYFWVAMNYLLGNLGKGYQNTIATIDLGGGSVQVSYAVSGDT  686
              F  + E VSI++G+QEG+Y WV +NY LGNLGK Y  T+  IDLGGGSVQ++YAVS  T
Sbjct  152   TFNVQPEAVSIIDGTQEGSYLWVTVNYALGNLGKKYTKTVGVIDLGGGSVQMAYAVSKKT  211

Query  687   FANAPTPDNGEEPYVQEKYILGAQYYLYVHSYLNYGQLASRAEIFKASGNSTNPCVLEGY  866
               NAP   +G++PY+++  + G  Y LYVHSYL++G+ ASRAEI K +  S+NPC+L G+
Sbjct  212   AKNAPKVADGDDPYIKKGVLKGIPYDLYVHSYLHFGREASRAEILKLTPRSSNPCLLAGF  271

Query  867   DGYYTYNDVSYKVTAPPNGSSLKNCRKLARKVVDFRAPCKYQNCTFNGVWSGGGGAGMEN  1046
             +G YTY+   +K TA  +G++   C+   RK +    PC YQNCTF G+W+GGGG G +N
Sbjct  272   NGIYTYSGEEFKATAYTSGANFNKCKNTIRKALKLNYPCPYQNCTFGGIWNGGGGNGQKN  331

Query  1047  VYISSFFYDIATDVGIIDQEKASKIVKPRSFLVAAKLACETKFEDVKSTFPNAVEKDYP-  1223
             ++ SS F+ +  D G++D    + I++P      AK  C   FED KST+P   +K+   
Sbjct  332   LFASSSFFYLPEDTGMVDASTPNFILRPVDIETKAKGTCALNFEDAKSTYPFLDKKNVAS  391

Query  1224  YLCMDLVYEYTLLVDGLGLHPYKEITLMKKVEYKNYMVEAAWPLGCAIDVISS  1382
             Y+CMDL+Y+Y LLVDG GL P ++IT  K++EY++ +VEAA PLG A++ IS+
Sbjct  392   YVCMDLIYQYVLLVDGFGLDPLQKITSGKEIEYQDAIVEAALPLGNAVEAISA  444



>ref|XP_008240451.1| PREDICTED: apyrase 2 [Prunus mume]
Length=477

 Score =   432 bits (1110),  Expect = 2e-142, Method: Compositional matrix adjust.
 Identities = 219/402 (54%), Positives = 298/402 (74%), Gaps = 1/402 (0%)
 Frame = +3

Query  180   NYAVIFDAGSTGSRVHVFHFDENLDLLPIGDGVEFFLKTTPGLSSYANDPEAAAKSLEPL  359
             +YAVIFDAGS+GSRVHVF FD NL LLPIG  +E F++ TPGLS++A DP +AA+SL  L
Sbjct  75    SYAVIFDAGSSGSRVHVFCFDHNLQLLPIGKDLELFIQVTPGLSAFAKDPRSAAESLTEL  134

Query  360   LLEAEGVVPTELQPDTPLELGATAGLRLLEGDASDKILQAVRDMFKNESNFKSKAEWVSI  539
             L +AE  VP +L+  TP+ +GATAGLR LEGDASD+ILQAVR++ K  S+  SK + V++
Sbjct  135   LDKAESAVPKDLRSFTPVRVGATAGLRALEGDASDRILQAVRNLLKERSSLNSKPDSVTV  194

Query  540   LEGSQEGTYFWVAMNYLLGNLGKGYQNTIATIDLGGGSVQVSYAVSGDTFANAPTPDNGE  719
             ++G+QEG++ WV +NYLLGN+GK Y +T+  +DLGGGSVQ++YA+S    A AP   +G+
Sbjct  195   IDGTQEGSFQWVTINYLLGNVGKKYSDTVGVVDLGGGSVQMAYAISEADAAKAPRLSDGD  254

Query  720   EPYVQEKYILGAQYYLYVHSYLNYGQLASRAEIFKASGNSTNPCVLEGYDGYYTYNDVSY  899
             + YV+E  + G +Y LYVHSYL+YG LA+RAEI K S +S NPC+L GYDG Y Y    Y
Sbjct  255   DSYVREMTLKGTKYNLYVHSYLHYGLLAARAEILKVSDDSGNPCILAGYDGSYKYGGQIY  314

Query  900   KVTAPPNGSSLKNCRKLARKVVDF-RAPCKYQNCTFNGVWSGGGGAGMENVYISSFFYDI  1076
             K +A  +GSS++ C ++A K +    A C +  CTF GVW+GGGG G  N++++SFF+D 
Sbjct  315   KASASSSGSSVEGCMRVAMKALKVNEATCTHMKCTFGGVWNGGGGDGQRNLFVASFFFDR  374

Query  1077  ATDVGIIDQEKASKIVKPRSFLVAAKLACETKFEDVKSTFPNAVEKDYPYLCMDLVYEYT  1256
             A + G +++ +    V+P +F  AAK ACETK ED KS + +  E + P+LCMDLVY++T
Sbjct  375   AAEAGFVNRNEPVAKVRPGNFEEAAKRACETKLEDAKSAYQDVKEDNLPFLCMDLVYQFT  434

Query  1257  LLVDGLGLHPYKEITLMKKVEYKNYMVEAAWPLGCAIDVISS  1382
             LLV+G GL P++EITL+KKV+Y N +VEAAWPLG AI+ +SS
Sbjct  435   LLVNGFGLDPWQEITLVKKVKYNNALVEAAWPLGSAIEAVSS  476



>gb|AAG22044.1|AF305783_1 apyrase 2 [Pisum sativum]
Length=447

 Score =   431 bits (1107),  Expect = 2e-142, Method: Compositional matrix adjust.
 Identities = 222/404 (55%), Positives = 293/404 (73%), Gaps = 1/404 (0%)
 Frame = +3

Query  174   TGNYAVIFDAGSTGSRVHVFHFDENLDLLPIGDGVEFFLKTTPGLSSYANDPEAAAKSLE  353
             + ++AVIFDAGS+GSRVHVF FD NLDL+ IG+ +E FL+  PGLS+YA DP  AA+SL 
Sbjct  42    SDSFAVIFDAGSSGSRVHVFRFDRNLDLVHIGNDLEVFLQIKPGLSAYAQDPRQAAESLI  101

Query  354   PLLLEAEGVVPTELQPDTPLELGATAGLRLLEGDASDKILQAVRDMFKNESNFKSKAEWV  533
              LL +AE VVP E +P TP+ +GATAGLR LEGDASD+ILQAVRD+ K  S  KS+   V
Sbjct  102   SLLDKAESVVPMEYRPMTPVRVGATAGLRALEGDASDRILQAVRDLLKQRSTLKSEPGAV  161

Query  534   SILEGSQEGTYFWVAMNYLLGNLGKGYQNTIATIDLGGGSVQVSYAVSGDTFANAPTPDN  713
             ++L+G+QEG + WV +NYLLG LG+ Y +T+  +DLGGGSVQ++YA+S  +   AP   +
Sbjct  162   AVLDGTQEGAFQWVTINYLLGKLGRDYSDTVGVVDLGGGSVQMAYAISETSATKAPKVPD  221

Query  714   GEEPYVQEKYILGAQYYLYVHSYLNYGQLASRAEIFKASGNSTNPCVLEGYDGYYTYNDV  893
             GE+PYV+E ++ G +YYLYVHSYL YG LA+RAEI K S +S NPC+L GYDG Y Y   
Sbjct  222   GEDPYVKEMFLRGRKYYLYVHSYLRYGLLAARAEILKISDDSGNPCILAGYDGSYNYGGK  281

Query  894   SYKVTAPPNGSSLKNCRKLARKVVDF-RAPCKYQNCTFNGVWSGGGGAGMENVYISSFFY  1070
             S+K ++ P+GSSL  C+ +A K +    + C +  CTF G+W+GGGG G +N++  SFF+
Sbjct  282   SFKASSSPSGSSLNECKGIALKTLKVNESICTHMKCTFGGIWNGGGGDGQKNLFARSFFF  341

Query  1071  DIATDVGIIDQEKASKIVKPRSFLVAAKLACETKFEDVKSTFPNAVEKDYPYLCMDLVYE  1250
               A + G  D +     V+P  F  AAKLAC+ K ED KST+PN  E + PYLCMDLVY+
Sbjct  342   YRAAEAGFADPKSPVAKVRPVDFEKAAKLACQPKLEDAKSTYPNVEEGNLPYLCMDLVYQ  401

Query  1251  YTLLVDGLGLHPYKEITLMKKVEYKNYMVEAAWPLGCAIDVISS  1382
             YTLLV G GL   ++ITL+K+V+Y + +VEAAWPLG AI+ +SS
Sbjct  402   YTLLVFGFGLDQMQQITLVKQVKYHDSLVEAAWPLGSAIEAVSS  445



>emb|CDY54053.1| BnaC09g54250D [Brassica napus]
Length=472

 Score =   431 bits (1108),  Expect = 3e-142, Method: Compositional matrix adjust.
 Identities = 219/409 (54%), Positives = 292/409 (71%), Gaps = 5/409 (1%)
 Frame = +3

Query  165   SHETGNYAVIFDAGSTGSRVHVFHFDENLDLLPIGDGVEFFLKTTPGLSSYANDPEAAAK  344
             S    NYAV+FDAGS+GSRVHV+ FD+NLDLLP+G+ +E FL+  PGLS+Y  DP  AA 
Sbjct  65    SRPPKNYAVVFDAGSSGSRVHVYCFDKNLDLLPLGNELELFLQLKPGLSAYPTDPRQAAN  124

Query  345   SLEPLLLEAEGVVPTELQPDTPLELGATAGLRLLEGDASDKILQAVRDMFKNESNFKSKA  524
             SL  LL +AE  VP EL+P TP+ +GATAGLR L  +AS+ ILQAV+++ ++ S  K++A
Sbjct  125   SLVSLLDKAESSVPRELRPKTPVRVGATAGLRTLGHEASENILQAVKELLRDRSMLKTEA  184

Query  525   EWVSILEGSQEGTYFWVAMNYLLGNLGKGYQNTIATIDLGGGSVQVSYAVSGDTFANAPT  704
               V++L+G+QEG+Y WV +NYLL NLGK Y +T+  +DLGGGSVQ++YA+S +  A+AP 
Sbjct  185   NAVTVLDGTQEGSYQWVTINYLLRNLGKPYSDTVGVVDLGGGSVQMAYAISEEDAASAPK  244

Query  705   PDNGEEPYVQEKYILGAQYYLYVHSYLNYGQLASRAEIFKASGNSTNPCVLEGYDGYYTY  884
             P  GE+ YV+E Y+ G +Y+LYVHSYL+YG LA+RAEI K S +S+NPC++ G+DG Y Y
Sbjct  245   PLEGEDAYVREMYLKGRKYFLYVHSYLHYGLLAARAEILKVSEDSSNPCIVTGHDGTYKY  304

Query  885   NDVSYKVTAPPNGSSLKNCRKL---ARKVVDFRAPCKYQNCTFNGVWSGGGGAGMENVYI  1055
                  K  A  +G+SL  CR+L   A KV D    C +  CTF GVW+GG G G +N+++
Sbjct  305   GGEELKAAALQSGASLDECRRLTINALKVND--TLCTHMKCTFGGVWNGGRGGGQKNMFV  362

Query  1056  SSFFYDIATDVGIIDQEKASKIVKPRSFLVAAKLACETKFEDVKSTFPNAVEKDYPYLCM  1235
             +SFF+D A + G +D ++    V+P  F  AAK AC  K E  KS FP   E + PYLCM
Sbjct  363   ASFFFDRAAEAGFVDPKQPVATVRPIDFEKAAKKACSMKMEAGKSKFPRVEEDNLPYLCM  422

Query  1236  DLVYEYTLLVDGLGLHPYKEITLMKKVEYKNYMVEAAWPLGCAIDVISS  1382
             DLVY++TLLVDG GL P + ITL+KKV+Y  + VEAAWPLG AI+ +SS
Sbjct  423   DLVYQHTLLVDGFGLKPTQTITLVKKVKYGEHAVEAAWPLGSAIEAVSS  471



>ref|XP_009618558.1| PREDICTED: apyrase 1-like [Nicotiana tomentosiformis]
Length=477

 Score =   431 bits (1108),  Expect = 3e-142, Method: Compositional matrix adjust.
 Identities = 230/402 (57%), Positives = 301/402 (75%), Gaps = 1/402 (0%)
 Frame = +3

Query  180   NYAVIFDAGSTGSRVHVFHFDENLDLLPIGDGVEFFLKTTPGLSSYANDPEAAAKSLEPL  359
             NYAVIFDAGS+GSRVHVF FD +LDL+PIG+ +E F++  PGLS+YA+DP AAAKSL+ L
Sbjct  74    NYAVIFDAGSSGSRVHVFCFDHHLDLVPIGNDLELFVQKKPGLSAYASDPAAAAKSLQSL  133

Query  360   LLEAEGVVPTELQPDTPLELGATAGLRLLEGDASDKILQAVRDMFKNESNFKSKAEWVSI  539
             L +AE V+P +L+ +TP+ +GATAGLR L G+ASDKILQAVRD  K++S+ KSKA WV++
Sbjct  134   LEKAEDVLPVDLRSNTPVRVGATAGLRQLGGNASDKILQAVRDFLKSKSSLKSKASWVTV  193

Query  540   LEGSQEGTYFWVAMNYLLGNLGKGYQNTIATIDLGGGSVQVSYAVSGDTFANAPTPDNGE  719
             L+G+QEG Y WV +NYLLGNLGK Y +T+  +DLGGGSVQ++YA+S      AP    GE
Sbjct  194   LDGNQEGAYQWVTINYLLGNLGKKYSDTVGVVDLGGGSVQMAYAISEADAQKAPKLSGGE  253

Query  720   EPYVQEKYILGAQYYLYVHSYLNYGQLASRAEIFKASGNSTNPCVLEGYDGYYTYNDVSY  899
             + YVQE Y+ GA+YYLYVHSYL+YG LA+RAEI K +  S +PC+L G+ G Y Y   +Y
Sbjct  254   DTYVQEMYLKGAKYYLYVHSYLHYGLLAARAEILKVTKESGSPCILTGHHGSYKYGGKTY  313

Query  900   KVTAPPNGSSLKNCRKLARKVVDF-RAPCKYQNCTFNGVWSGGGGAGMENVYISSFFYDI  1076
               +A   GSSL NCR +A K +    + C +  CTF GVW+GGGG G +N++++SFF+D 
Sbjct  314   TASAMSQGSSLTNCRMVALKALKVNESACTHMKCTFGGVWNGGGGDGQKNMFVASFFFDR  373

Query  1077  ATDVGIIDQEKASKIVKPRSFLVAAKLACETKFEDVKSTFPNAVEKDYPYLCMDLVYEYT  1256
             A +VG +D   A   V+P  F  AA+ AC+T+ +D K+TFP     + P+LCMDLVY+YT
Sbjct  374   AAEVGFVDPNAAVAKVRPTDFESAARRACDTRIDDAKATFPRVDPDNLPFLCMDLVYQYT  433

Query  1257  LLVDGLGLHPYKEITLMKKVEYKNYMVEAAWPLGCAIDVISS  1382
             LLVDG GL   +E+TL+KKV+YKN +VEAAWPLG AI+V SS
Sbjct  434   LLVDGFGLDARQEMTLVKKVKYKNSLVEAAWPLGSAIEVASS  475



>ref|XP_009757995.1| PREDICTED: apyrase 1-like [Nicotiana sylvestris]
Length=477

 Score =   431 bits (1108),  Expect = 4e-142, Method: Compositional matrix adjust.
 Identities = 230/402 (57%), Positives = 301/402 (75%), Gaps = 1/402 (0%)
 Frame = +3

Query  180   NYAVIFDAGSTGSRVHVFHFDENLDLLPIGDGVEFFLKTTPGLSSYANDPEAAAKSLEPL  359
             NYAVIFDAGS+GSRVHVF FD +LDL+PIG+ +E F++  PGLS+YA+DP AAAKSL+ L
Sbjct  74    NYAVIFDAGSSGSRVHVFCFDHHLDLVPIGNDLELFVQKKPGLSAYASDPAAAAKSLQSL  133

Query  360   LLEAEGVVPTELQPDTPLELGATAGLRLLEGDASDKILQAVRDMFKNESNFKSKAEWVSI  539
             L +AE VVP +L+ + P+ +GATAGLR L G+ASDKILQAVRD  K++S+ KSKA WV++
Sbjct  134   LEKAEDVVPVDLRSNAPVRVGATAGLRQLGGNASDKILQAVRDFLKSKSSLKSKASWVTV  193

Query  540   LEGSQEGTYFWVAMNYLLGNLGKGYQNTIATIDLGGGSVQVSYAVSGDTFANAPTPDNGE  719
             L+G+QEG Y WV +NYLLGNLGK Y +T+  +DLGGGSVQ++YA+S      AP    GE
Sbjct  194   LDGNQEGAYQWVTINYLLGNLGKKYSDTVGVVDLGGGSVQMAYAISEADAQKAPKLSGGE  253

Query  720   EPYVQEKYILGAQYYLYVHSYLNYGQLASRAEIFKASGNSTNPCVLEGYDGYYTYNDVSY  899
             + YVQE Y+ GA+YYLYVHSYL+YG LA+RAEI K +  S +PC+L G+ G Y Y   +Y
Sbjct  254   DTYVQEMYLKGAKYYLYVHSYLHYGLLAARAEILKVTKESGSPCILTGHHGSYKYGGKTY  313

Query  900   KVTAPPNGSSLKNCRKLARKVVDF-RAPCKYQNCTFNGVWSGGGGAGMENVYISSFFYDI  1076
               +A   GSSL NCR +A K +    + C +  CTF GVW+GGGG G +N++++SFF+D 
Sbjct  314   TASAMSQGSSLTNCRMVALKALKVNESACTHMKCTFGGVWNGGGGDGQKNMFVASFFFDR  373

Query  1077  ATDVGIIDQEKASKIVKPRSFLVAAKLACETKFEDVKSTFPNAVEKDYPYLCMDLVYEYT  1256
             A +VG +D   A   V+P  F  AA+ AC+T+ +D K+TFP     ++P+LCMDLVY+YT
Sbjct  374   AAEVGFVDPNAAVAKVRPIDFESAARRACDTRIDDAKATFPRVDPDNWPFLCMDLVYQYT  433

Query  1257  LLVDGLGLHPYKEITLMKKVEYKNYMVEAAWPLGCAIDVISS  1382
             LLVDG GL   +E+TL+KKV+YKN +VEAAWPLG AI+V SS
Sbjct  434   LLVDGFGLDARQEMTLVKKVKYKNSLVEAAWPLGSAIEVASS  475



>ref|XP_003518188.1| PREDICTED: apyrase 1-like [Glycine max]
Length=472

 Score =   431 bits (1107),  Expect = 5e-142, Method: Compositional matrix adjust.
 Identities = 214/412 (52%), Positives = 294/412 (71%), Gaps = 1/412 (0%)
 Frame = +3

Query  153   RVLLSHETGNYAVIFDAGSTGSRVHVFHFDENLDLLPIGDGVEFFLKTTPGLSSYANDPE  332
             R + +  + ++AVIFDAGS+GSRVHVF FD NLDL+ IG  +E F++  PGLS+YA +P 
Sbjct  61    RKVGNERSTSFAVIFDAGSSGSRVHVFRFDRNLDLVHIGKDLELFVQIKPGLSAYAQNPR  120

Query  333   AAAKSLEPLLLEAEGVVPTELQPDTPLELGATAGLRLLEGDASDKILQAVRDMFKNESNF  512
              AA+SL  LL +AE VVP E +P TP+ +GATAGLR LEGDAS +ILQAVRD+ K  S  
Sbjct  121   QAAESLISLLDKAESVVPREFRPKTPVRVGATAGLRALEGDASGRILQAVRDLLKQRSTL  180

Query  513   KSKAEWVSILEGSQEGTYFWVAMNYLLGNLGKGYQNTIATIDLGGGSVQVSYAVSGDTFA  692
             KS+ + V++L+G+QEG + WV +NYLLG LGK +  T+  +DLGGGSVQ++YA+S    A
Sbjct  181   KSEPDAVTVLDGTQEGAFQWVTINYLLGKLGKDFSETVGVVDLGGGSVQMAYAISETDAA  240

Query  693   NAPTPDNGEEPYVQEKYILGAQYYLYVHSYLNYGQLASRAEIFKASGNSTNPCVLEGYDG  872
              AP    GE+PYV+E ++ G +YYLYVHSYL YG LA+RA+I + S +S NPC+L G++G
Sbjct  241   KAPKLSVGEDPYVKEMFLRGRKYYLYVHSYLGYGLLAARAKILEVSDDSGNPCILNGFNG  300

Query  873   YYTYNDVSYKVTAPPNGSSLKNCRKLARKVVDF-RAPCKYQNCTFNGVWSGGGGAGMENV  1049
              Y Y   S K ++ P+G+SL  C+ +A + +    + C +  CTF G+W+GGGG G +N+
Sbjct  301   SYIYGGKSVKASSAPSGASLNECKNIAFQALKVNESKCTHMKCTFGGIWNGGGGDGQKNL  360

Query  1050  YISSFFYDIATDVGIIDQEKASKIVKPRSFLVAAKLACETKFEDVKSTFPNAVEKDYPYL  1229
             +++SFF+D A + G  +       V+P  F  AAK AC+TK ED KST+    E + PYL
Sbjct  361   FVASFFFDRAAEAGFANPNLPVVKVRPVDFEAAAKQACKTKLEDAKSTYQRVEEGNLPYL  420

Query  1230  CMDLVYEYTLLVDGLGLHPYKEITLMKKVEYKNYMVEAAWPLGCAIDVISSS  1385
             CMDL+Y+YTLLV G GL P+++ITL+KKV+Y +  VEAAWPLG AI+ +SS+
Sbjct  421   CMDLLYQYTLLVVGFGLDPWQQITLVKKVKYHDAFVEAAWPLGSAIEAVSST  472



>gb|AAO23006.1| apyrase-like protein [Medicago truncatula]
 gb|AES80808.2| Nod factor-binding lectin-nucleotide phosphohydrolase [Medicago 
truncatula]
Length=455

 Score =   430 bits (1105),  Expect = 5e-142, Method: Compositional matrix adjust.
 Identities = 212/412 (51%), Positives = 295/412 (72%), Gaps = 1/412 (0%)
 Frame = +3

Query  150   RRVLLSHET-GNYAVIFDAGSTGSRVHVFHFDENLDLLPIGDGVEFFLKTTPGLSSYAND  326
             R++    ET  +YAV+FDAGSTGSRVHV+HFD+NLDLL IG+ VEF+ KTTPGLS+YA++
Sbjct  32    RKIFPKQETLTSYAVVFDAGSTGSRVHVYHFDQNLDLLHIGNDVEFYNKTTPGLSAYADN  91

Query  327   PEAAAKSLEPLLLEAEGVVPTELQPDTPLELGATAGLRLLEGDASDKILQAVRDMFKNES  506
             P+ AA+SL PLL +AE VVP  LQP TP++LGATAGLRLL+G++S+ IL+AV  + K  S
Sbjct  92    PKEAAESLIPLLEQAERVVPVNLQPKTPVKLGATAGLRLLDGNSSELILEAVSSLLKKRS  151

Query  507   NFKSKAEWVSILEGSQEGTYFWVAMNYLLGNLGKGYQNTIATIDLGGGSVQVSYAVSGDT  686
              F  +++ V I++G+QEG+Y WV +NY+LGNLGK +  T+A  DLGGGSVQ+ YAVS + 
Sbjct  152   TFNVQSDAVGIIDGTQEGSYLWVTINYVLGNLGKDFSETVAVADLGGGSVQMVYAVSREQ  211

Query  687   FANAPTPDNGEEPYVQEKYILGAQYYLYVHSYLNYGQLASRAEIFKASGNSTNPCVLEGY  866
                AP    GE+PY+++  + G +YYLYVHSYL +G+ ASRAEI K +  S NPC+L GY
Sbjct  212   AKKAPQVPQGEDPYIKKIVLKGKKYYLYVHSYLRFGKEASRAEILKVTNGSPNPCILAGY  271

Query  867   DGYYTYNDVSYKVTAPPNGSSLKNCRKLARKVVDFRAPCKYQNCTFNGVWSGGGGAGMEN  1046
              G YTY+   YK  +P +GS+   C+++  K +    PC Y  C+F G+W+GGGG+G + 
Sbjct  272   HGTYTYSGEEYKAFSPASGSNFDECKEIILKALKVNDPCPYGKCSFGGIWNGGGGSGQKT  331

Query  1047  VYISSFFYDIATDVGIIDQEKASKIVKPRSFLVAAKLACETKFEDVKSTFPNAVEKDYPY  1226
             +Y++S FY + T V I D  K +  ++       A+  C+TK++D K+T+P   E   PY
Sbjct  332   LYVTSSFYYVPTGVNIADPNKPNSKIRIEDLKTGAEQVCKTKYKDAKATYPLIYEDSLPY  391

Query  1227  LCMDLVYEYTLLVDGLGLHPYKEITLMKKVEYKNYMVEAAWPLGCAIDVISS  1382
              C+DL+Y+YTL VDG GL P +EIT+  ++EY++ +V+AAWPLG AI+ ISS
Sbjct  392   ACLDLIYQYTLFVDGFGLDPLQEITVANQIEYQDALVDAAWPLGNAIEAISS  443



>ref|XP_006651340.1| PREDICTED: probable apyrase 1-like [Oryza brachyantha]
Length=488

 Score =   431 bits (1108),  Expect = 6e-142, Method: Compositional matrix adjust.
 Identities = 221/404 (55%), Positives = 294/404 (73%), Gaps = 2/404 (0%)
 Frame = +3

Query  180   NYAVIFDAGSTGSRVHVFHFDENLDLLPIGDGVEFFLKTTPGLSSYANDPEAAAKSLEPL  359
              YAVIFDAGS+GSRVHV+ FD NLDLLPIG  +E F +  PGLS+YANDP+ AAKSL  L
Sbjct  85    KYAVIFDAGSSGSRVHVYCFDGNLDLLPIGKEIELFKQKKPGLSAYANDPQEAAKSLVSL  144

Query  360   LLEAEGVVPTELQPDTPLELGATAGLRLLEGDASDKILQAVRDMFKNESNFKSKAEWVSI  539
             L EAE VVP EL+  TP+ +GATAGLR L  + S++ILQAVRD+ +++S+F+S+ EWV++
Sbjct  145   LEEAEKVVPVELREQTPVRVGATAGLRTLGTEKSEEILQAVRDLLQDKSSFRSQPEWVTV  204

Query  540   LEGSQEGTYFWVAMNYLLGNLGKGYQNTIATIDLGGGSVQVSYAVSGDTFANAPTPDNGE  719
             L+GSQEG + WV +NYLLG LG+ Y  T+  +DLGGGSVQ++YA+S    A AP    GE
Sbjct  205   LDGSQEGAFQWVTINYLLGKLGEPYSQTVGVVDLGGGSVQMAYAISEKDAAKAPKVSEGE  264

Query  720   EPYVQEKYILGAQYYLYVHSYLNYGQLASRAEIFKA-SGNSTNPCVLEGYDGYYTYNDVS  896
             + YV++  + GA YYLY+HSYL+YG LA+RAEI KA  GN  N C+LEG+ G Y Y D  
Sbjct  265   DSYVKKLLLKGATYYLYIHSYLHYGLLAARAEILKAGEGNDYNNCILEGHRGNYKYGDDI  324

Query  897   YKVTAPPNGSSLKNCRKLARKVVDFRAP-CKYQNCTFNGVWSGGGGAGMENVYISSFFYD  1073
              +V+   +G+S   CR +A + ++   P C +  CTF GVW+GGGG G +N++++SFF+D
Sbjct  325   VEVSGSSSGASYSKCRAVAVRALNVDEPACTHMKCTFGGVWNGGGGDGQKNLFVASFFFD  384

Query  1074  IATDVGIIDQEKASKIVKPRSFLVAAKLACETKFEDVKSTFPNAVEKDYPYLCMDLVYEY  1253
              A + G ++ + A   VKP  F  AA+  C+   +D ++T+P+  E++ PYLCMDLVY+Y
Sbjct  385   RAAEAGFVNPKAADAKVKPSDFEEAARRVCKLNVKDAQATYPDVSEENIPYLCMDLVYQY  444

Query  1254  TLLVDGLGLHPYKEITLMKKVEYKNYMVEAAWPLGCAIDVISSS  1385
             TLLVDG GL PY++ITL+KKV Y N  VEAAWPLG AI+V SSS
Sbjct  445   TLLVDGFGLDPYQDITLVKKVPYSNSFVEAAWPLGSAIEVASSS  488



>ref|XP_010463882.1| PREDICTED: apyrase 1 [Camelina sativa]
Length=471

 Score =   430 bits (1106),  Expect = 6e-142, Method: Compositional matrix adjust.
 Identities = 218/417 (52%), Positives = 294/417 (71%), Gaps = 8/417 (2%)
 Frame = +3

Query  156   VLLSHETG-------NYAVIFDAGSTGSRVHVFHFDENLDLLPIGDGVEFFLKTTPGLSS  314
              + SHE G       NYAVIFDAGS+GSRVHV+ FD+NLDL+P+ + +E FL+  PGLS+
Sbjct  54    TMKSHEGGSNSRGPKNYAVIFDAGSSGSRVHVYCFDQNLDLVPLENELELFLQLKPGLSA  113

Query  315   YANDPEAAAKSLEPLLLEAEGVVPTELQPDTPLELGATAGLRLLEGDASDKILQAVRDMF  494
             Y NDP  +A SL  LL +AE  VP EL+P TP+ +GATAGLR L   AS+ ILQAVR++ 
Sbjct  114   YPNDPRQSANSLVSLLDKAEASVPRELRPKTPVRVGATAGLRALGHKASENILQAVRELL  173

Query  495   KNESNFKSKAEWVSILEGSQEGTYFWVAMNYLLGNLGKGYQNTIATIDLGGGSVQVSYAV  674
             K+ S  K++A  V++L+G+QEG+Y WV +NYLL  LGK Y +T+  +DLGGGSVQ++YA+
Sbjct  174   KDRSRLKTEANAVTVLDGTQEGSYQWVTINYLLRTLGKPYSDTVGVVDLGGGSVQMAYAI  233

Query  675   SGDTFANAPTPDNGEEPYVQEKYILGAQYYLYVHSYLNYGQLASRAEIFKASGNSTNPCV  854
             S +  A AP P  GE+ YV+E Y+ G +Y+LYVHSYL+YG LA+RAEI K S +S NPC+
Sbjct  234   SEEDAATAPKPLEGEDSYVREMYLKGRKYFLYVHSYLHYGLLAARAEILKVSEDSNNPCI  293

Query  855   LEGYDGYYTYNDVSYKVTAPPNGSSLKNCRKLARKVVDFR-APCKYQNCTFNGVWSGGGG  1031
             + GY G Y Y   ++K TA  +G+SL  CR++A   +    + C +  CTF GVW+GGGG
Sbjct  294   VTGYTGTYKYGGKAFKATASSSGTSLDECRRVAINALKVNDSLCTHMKCTFGGVWNGGGG  353

Query  1032  AGMENVYISSFFYDIATDVGIIDQEKASKIVKPRSFLVAAKLACETKFEDVKSTFPNAVE  1211
              G + ++++SFF+D A + G +D ++    V+P  F  AA  AC  + E+ KS FP   E
Sbjct  354   GGQKKMFVASFFFDRAAEAGFVDPKQPVAEVRPLDFEKAANKACNMRMEEGKSKFPRVEE  413

Query  1212  KDYPYLCMDLVYEYTLLVDGLGLHPYKEITLMKKVEYKNYMVEAAWPLGCAIDVISS  1382
              + PYLC+DLVY+YTLLVDG GL P + ITL+KKV+Y +Y VEAAWPLG AI+ +SS
Sbjct  414   DNLPYLCLDLVYQYTLLVDGFGLKPSQTITLVKKVKYGDYAVEAAWPLGSAIEAVSS  470



>ref|XP_010921280.1| PREDICTED: probable apyrase 1 [Elaeis guineensis]
Length=473

 Score =   430 bits (1106),  Expect = 7e-142, Method: Compositional matrix adjust.
 Identities = 215/405 (53%), Positives = 294/405 (73%), Gaps = 2/405 (0%)
 Frame = +3

Query  174   TGNYAVIFDAGSTGSRVHVFHFDENLDLLPIGDGVEFFLKTTPGLSSYANDPEAAAKSLE  353
             + +YAVIFDAGS+GSRVHV+ FDENLDLL IG  +E F++  PGLS++A DP+ AA SL 
Sbjct  70    SKSYAVIFDAGSSGSRVHVYCFDENLDLLHIGVEIELFIQKKPGLSAFAKDPQEAANSLI  129

Query  354   PLLLEAEGVVPTELQPDTPLELGATAGLRLLEGDASDKILQAVRDMFKNESNFKSKAEWV  533
             PLL +AE VVP EL+  TP+ +GATAGLR L  + S+KILQAVRD+  ++S+ K + +WV
Sbjct  130   PLLAKAESVVPAELREKTPIRVGATAGLRALGAETSEKILQAVRDLLNSKSSLKFQPDWV  189

Query  534   SILEGSQEGTYFWVAMNYLLGNLGKGYQNTIATIDLGGGSVQVSYAVSGDTFANAPTPDN  713
             S+L+G+QEG + WV +NYLLG LGK + +T+  +DLGGGSVQ++YA+S +  A AP   +
Sbjct  190   SVLDGTQEGAFQWVTINYLLGKLGKTHSDTVGVVDLGGGSVQMAYAISEEDAAKAPKVAD  249

Query  714   GEEPYVQEKYILGAQYYLYVHSYLNYGQLASRAEIFKASGNSTNPCVLEGYDGYYTYNDV  893
             GE+ YV++ ++ G +YYLYVHSYL+YG LA+RAEI KA G+ +  C+L GY+G Y Y D 
Sbjct  250   GEDTYVKQLFLKGTKYYLYVHSYLHYGLLAARAEILKAGGDYST-CILNGYNGKYKYGDD  308

Query  894   SYKVTAPPNGSSLKNCRKLARKVVDFRAP-CKYQNCTFNGVWSGGGGAGMENVYISSFFY  1070
              YK +A P+G+SL  CR  A K +    P C +  CTF G+W+GGGG G +N++++SFF+
Sbjct  309   VYKASAAPSGASLSKCRSDAVKALKVDEPVCTHMKCTFGGIWNGGGGDGQKNLFVASFFF  368

Query  1071  DIATDVGIIDQEKASKIVKPRSFLVAAKLACETKFEDVKSTFPNAVEKDYPYLCMDLVYE  1250
             D A + G ID +     V+P  F  AAK AC+   +D K T+     ++ P+LCMDLVY+
Sbjct  369   DRAAEAGFIDPKVPVAKVRPSDFEKAAKRACKLNVDDAKVTYSRVSVENLPFLCMDLVYQ  428

Query  1251  YTLLVDGLGLHPYKEITLMKKVEYKNYMVEAAWPLGCAIDVISSS  1385
             YTLLVDG  L P++EITL+K+V+Y +  VEAAWPLG AI+V SS+
Sbjct  429   YTLLVDGFALDPHQEITLVKQVQYGDAFVEAAWPLGSAIEVASSA  473



>ref|XP_002448918.1| hypothetical protein SORBIDRAFT_05g001560 [Sorghum bicolor]
 gb|EES07906.1| hypothetical protein SORBIDRAFT_05g001560 [Sorghum bicolor]
Length=468

 Score =   429 bits (1104),  Expect = 1e-141, Method: Compositional matrix adjust.
 Identities = 209/395 (53%), Positives = 279/395 (71%), Gaps = 1/395 (0%)
 Frame = +3

Query  177   GNYAVIFDAGSTGSRVHVFHFDENLDLLPIGD-GVEFFLKTTPGLSSYANDPEAAAKSLE  353
             G YAVIF+AGSTG+RVHVF FD  L+LL IGD G+E F K  PGLSSYA  P+ AA S+ 
Sbjct  55    GRYAVIFNAGSTGTRVHVFRFDRKLELLEIGDEGIEVFAKVKPGLSSYAGHPQEAANSIL  114

Query  354   PLLLEAEGVVPTELQPDTPLELGATAGLRLLEGDASDKILQAVRDMFKNESNFKSKAEWV  533
             PLL +A+ VVP +L   TPL LGATAGLRL+  + SD+IL+AVR++   ++ F++K EW+
Sbjct  115   PLLDKAKSVVPKQLMKRTPLRLGATAGLRLIGEEQSDQILEAVRNLVHTKTKFQTKPEWI  174

Query  534   SILEGSQEGTYFWVAMNYLLGNLGKGYQNTIATIDLGGGSVQVSYAVSGDTFANAPTPDN  713
             +++EGSQEG+Y WVA+NYLL  LG  Y  T+A +D+GGGSVQ++YA+S +T ANAP   +
Sbjct  175   NVIEGSQEGSYLWVALNYLLDKLGGDYSQTVAVVDMGGGSVQIAYAISANTAANAPVAPH  234

Query  714   GEEPYVQEKYILGAQYYLYVHSYLNYGQLASRAEIFKASGNSTNPCVLEGYDGYYTYNDV  893
             GE+PYV  +Y+ G  Y +Y HSYL+YG  ASRAEI KA     + C+L G+ G YTYN+ 
Sbjct  235   GEDPYVIREYLKGKDYNIYAHSYLHYGAFASRAEILKAKNGPFSSCMLRGFIGQYTYNEE  294

Query  894   SYKVTAPPNGSSLKNCRKLARKVVDFRAPCKYQNCTFNGVWSGGGGAGMENVYISSFFYD  1073
              Y  TA P G+    CR+   K ++  APC+ +NCTFNG+W+GGGGAG +N+Y++S FY 
Sbjct  295   QYDATAAPEGAVYYKCREEIGKALNLNAPCETKNCTFNGIWNGGGGAGQDNLYVASSFYY  354

Query  1074  IATDVGIIDQEKASKIVKPRSFLVAAKLACETKFEDVKSTFPNAVEKDYPYLCMDLVYEY  1253
             +A++VGIID    S    P +F  +A+  C+   E+ K  +PN  + D PYLCMDL Y+Y
Sbjct  355   VASEVGIIDGNAPSGETTPGAFRASAERVCQMSVEEAKIEYPNVNDVDVPYLCMDLAYQY  414

Query  1254  TLLVDGLGLHPYKEITLMKKVEYKNYMVEAAWPLG  1358
             TLLVDG G+   KEIT++ KV++  Y VEA WPL 
Sbjct  415   TLLVDGFGVEATKEITVVDKVKHGEYYVEAVWPLA  449



>ref|XP_010938111.1| PREDICTED: probable apyrase 1 [Elaeis guineensis]
Length=470

 Score =   430 bits (1105),  Expect = 1e-141, Method: Compositional matrix adjust.
 Identities = 217/404 (54%), Positives = 291/404 (72%), Gaps = 2/404 (0%)
 Frame = +3

Query  174   TGNYAVIFDAGSTGSRVHVFHFDENLDLLPIGDGVEFFLKTTPGLSSYANDPEAAAKSLE  353
             + +YAVIFDAGS+GSRVHV+ FDE LDLL IG  +E F +  PGLSS+A DPE AA SL 
Sbjct  67    SKSYAVIFDAGSSGSRVHVYCFDEKLDLLHIGKEIELFRQKKPGLSSFAKDPEEAANSLI  126

Query  354   PLLLEAEGVVPTELQPDTPLELGATAGLRLLEGDASDKILQAVRDMFKNESNFKSKAEWV  533
             PLL EAE VVP EL+  TP+ +GATAGLR L  + S+KILQAVRD+ K++S+ + +++WV
Sbjct  127   PLLEEAESVVPAELRWKTPVRVGATAGLRALGAETSEKILQAVRDLLKDKSSLRFQSDWV  186

Query  534   SILEGSQEGTYFWVAMNYLLGNLGKGYQNTIATIDLGGGSVQVSYAVSGDTFANAPTPDN  713
             S+L+GSQEG + WV +NYLLGNLGK Y +T+  +DLGGGSVQ++YA+S    A AP   +
Sbjct  187   SVLDGSQEGAFQWVTINYLLGNLGKTYSDTVGVVDLGGGSVQMAYAISEKDAAEAPKVTD  246

Query  714   GEEPYVQEKYILGAQYYLYVHSYLNYGQLASRAEIFKASGNSTNPCVLEGYDGYYTYNDV  893
             GE+ YV+  ++ G +YYLYVHSYL+YG LA+RAEI  A   ++N C+L GY G Y Y D 
Sbjct  247   GEDSYVKHLFLKGTKYYLYVHSYLHYGLLAARAEILMAGEGNSN-CILNGYRGTYKYGDD  305

Query  894   SYKVTAPPNGSSLKNCRKLARKVVDFRAP-CKYQNCTFNGVWSGGGGAGMENVYISSFFY  1070
              +K  + P+G+SL  CR  A K +    P C +  CTF G+W+GGGG G +N++++SFF+
Sbjct  306   VHKAISAPSGASLSKCRSDAVKALKVDEPVCTHIKCTFGGIWNGGGGDGQKNLFVASFFF  365

Query  1071  DIATDVGIIDQEKASKIVKPRSFLVAAKLACETKFEDVKSTFPNAVEKDYPYLCMDLVYE  1250
             D A + G +D +     V+P  F  AAK AC    +D ++T+P+   ++ P+LCMDLVY+
Sbjct  366   DRAAEAGFVDPKVPVAKVRPSEFEEAAKRACRLNIDDARTTYPHVSVENLPFLCMDLVYQ  425

Query  1251  YTLLVDGLGLHPYKEITLMKKVEYKNYMVEAAWPLGCAIDVISS  1382
             YTLLVDG  L P++EITL+KKV+Y +  VEAAWPLG AI+V SS
Sbjct  426   YTLLVDGFALDPHQEITLVKKVQYGDAFVEAAWPLGSAIEVASS  469



>emb|CDY38503.1| BnaA10g16550D [Brassica napus]
Length=472

 Score =   429 bits (1104),  Expect = 1e-141, Method: Compositional matrix adjust.
 Identities = 218/409 (53%), Positives = 291/409 (71%), Gaps = 5/409 (1%)
 Frame = +3

Query  165   SHETGNYAVIFDAGSTGSRVHVFHFDENLDLLPIGDGVEFFLKTTPGLSSYANDPEAAAK  344
             S    NYAV+FDAGS+GSRVHV+ FD+NLDL+P+G+ +E FL+  PGLS+Y  DP  AA 
Sbjct  65    SRPPKNYAVVFDAGSSGSRVHVYCFDKNLDLIPLGNELELFLQLKPGLSAYPTDPRQAAN  124

Query  345   SLEPLLLEAEGVVPTELQPDTPLELGATAGLRLLEGDASDKILQAVRDMFKNESNFKSKA  524
             SL  LL +AE  VP EL+P TP+ +GATAGLR L  +AS+ ILQAV+++ ++ S  K++A
Sbjct  125   SLVSLLDKAESSVPRELRPKTPVRVGATAGLRTLGHEASENILQAVKELLRDRSMLKTEA  184

Query  525   EWVSILEGSQEGTYFWVAMNYLLGNLGKGYQNTIATIDLGGGSVQVSYAVSGDTFANAPT  704
               V++L+G+QEG+Y WV +NYLL NLGK Y +T+  +DLGGGSVQ++YA+S +  A+AP 
Sbjct  185   NAVTVLDGTQEGSYQWVTINYLLRNLGKPYSDTVGVVDLGGGSVQMAYAISEEDAASAPK  244

Query  705   PDNGEEPYVQEKYILGAQYYLYVHSYLNYGQLASRAEIFKASGNSTNPCVLEGYDGYYTY  884
             P  GE+ YV+E Y+ G +Y+LYVHSYL+YG LA+RAEI K S +S NPC++ GYDG Y Y
Sbjct  245   PLEGEDAYVREMYLKGRKYFLYVHSYLHYGLLAARAEILKVSEDSNNPCIVTGYDGTYKY  304

Query  885   NDVSYKVTAPPNGSSLKNCRKL---ARKVVDFRAPCKYQNCTFNGVWSGGGGAGMENVYI  1055
                  K  A  +G+SL  CR+    A KV D    C +  CTF GVW+GG G G +N+++
Sbjct  305   GGEELKAAALQSGASLDECRRFTINALKVND--TLCTHMKCTFGGVWNGGRGGGQKNMFV  362

Query  1056  SSFFYDIATDVGIIDQEKASKIVKPRSFLVAAKLACETKFEDVKSTFPNAVEKDYPYLCM  1235
             +SFF+D A + G +D ++    V+P  F  AAK AC  K E+ KS FP   E + PYLC+
Sbjct  363   ASFFFDRAAEAGFVDPKQPVATVRPIDFEKAAKKACSMKMEEGKSKFPRVEEDNLPYLCV  422

Query  1236  DLVYEYTLLVDGLGLHPYKEITLMKKVEYKNYMVEAAWPLGCAIDVISS  1382
             DLVY+YTLLVDG GL P + ITL+KKV+Y  + VEAAWPLG AI+ +SS
Sbjct  423   DLVYQYTLLVDGFGLKPTQTITLVKKVKYGEHAVEAAWPLGSAIEAVSS  471



>ref|XP_004172762.1| PREDICTED: apyrase 2-like [Cucumis sativus]
 gb|KGN53950.1| hypothetical protein Csa_4G192220 [Cucumis sativus]
Length=466

 Score =   429 bits (1104),  Expect = 1e-141, Method: Compositional matrix adjust.
 Identities = 217/401 (54%), Positives = 293/401 (73%), Gaps = 5/401 (1%)
 Frame = +3

Query  183   YAVIFDAGSTGSRVHVFHFDENLDLLPIGDGVEFFLKTTPGLSSYANDPEAAAKSLEPLL  362
             +AVIFDAGS+GSRVHVF FD NLDLLP+G  +E FL+  PGLS+YA+ P+ AA SL  LL
Sbjct  68    FAVIFDAGSSGSRVHVFCFDHNLDLLPVGKDIELFLQLKPGLSAYADSPKDAAASLISLL  127

Query  363   LEAEGVVPTELQPDTPLELGATAGLRLLEGDASDKILQAVRDMFKNESNFKSKAEWVSIL  542
              +A+ VVP  L+P TP+ +GATAGLR L+GDASD+ILQAVRD+ +++S  + + + VS++
Sbjct  128   DKAQDVVPKGLRPMTPVRVGATAGLRALKGDASDRILQAVRDLLRDKSELRLEGDAVSVI  187

Query  543   EGSQEGTYFWVAMNYLLGNLGKGYQNTIATIDLGGGSVQVSYAVSGDTFANAPTPDNGEE  722
             +G+QEG+Y WV +NYLLGNLGK Y +T+  +DLGGGSVQ++YA+S +   +A      E 
Sbjct  188   DGTQEGSYLWVTLNYLLGNLGKKYSDTVGVVDLGGGSVQMAYAISEN---DAARLSEAEG  244

Query  723   PYVQEKYILGAQYYLYVHSYLNYGQLASRAEIFKASGNSTNPCVLEGYDGYYTYNDVSYK  902
              YV++ Y+ GA YYLYVHSYL+YG LA+RAE+   S +S+N C+L GY+G Y Y    YK
Sbjct  245   AYVKKMYLKGATYYLYVHSYLHYGLLAARAEVLSVSEDSSNDCILSGYEGEYHYGGKDYK  304

Query  903   VTAPPNGSSLKNCRKLARKVVDF-RAPCKYQNCTFNGVWSGGGGAGMENVYISSFFYDIA  1079
              +A  +GS+L  CR    K +    + C +  CTF GVW+GGGG G +N++++SFF+D A
Sbjct  305   ASASSSGSNLNGCRSTVLKALKVNESTCTHMKCTFGGVWNGGGGDGQKNLFVASFFFDRA  364

Query  1080  TDVGIIDQEKASKIVKPRSFLVAAKLACETKFEDVKSTFPNAVEKDYPYLCMDLVYEYTL  1259
              + G  D  +   IV+P  F  AAK AC+ K ED  ST+P+  + + PYLCMDLVY+YTL
Sbjct  365   AEAGFADPNEPVAIVRPADFNDAAKQACQIKVEDA-STYPHVEKDNLPYLCMDLVYQYTL  423

Query  1260  LVDGLGLHPYKEITLMKKVEYKNYMVEAAWPLGCAIDVISS  1382
             LVDG GL P++EITL+KKV+Y+N +VEAAWPLG AI+ +SS
Sbjct  424   LVDGFGLDPWQEITLVKKVKYQNSLVEAAWPLGSAIEAVSS  464



>dbj|BAM84273.1| apyrase [Medicago truncatula]
Length=455

 Score =   429 bits (1103),  Expect = 1e-141, Method: Compositional matrix adjust.
 Identities = 212/412 (51%), Positives = 295/412 (72%), Gaps = 1/412 (0%)
 Frame = +3

Query  150   RRVLLSHET-GNYAVIFDAGSTGSRVHVFHFDENLDLLPIGDGVEFFLKTTPGLSSYAND  326
             R++    ET  +YAV+FDAGSTGSRVHV+HFD+NLDLL IG+ VEF+ KTTPGLS+YA++
Sbjct  32    RKIFPKQETLTSYAVVFDAGSTGSRVHVYHFDQNLDLLHIGNDVEFYNKTTPGLSAYADN  91

Query  327   PEAAAKSLEPLLLEAEGVVPTELQPDTPLELGATAGLRLLEGDASDKILQAVRDMFKNES  506
             P+ AA+SL PLL +AE VVP  LQP TP++LGATAGLRLL+G++S+ IL+AV  + K  S
Sbjct  92    PKEAAESLIPLLEQAERVVPVNLQPKTPVKLGATAGLRLLDGNSSELILEAVSSLLKKRS  151

Query  507   NFKSKAEWVSILEGSQEGTYFWVAMNYLLGNLGKGYQNTIATIDLGGGSVQVSYAVSGDT  686
              F  +++ V I++G+QEG+Y WV +NY+LGNLGK +  T+A  DLGGGSVQ+ YAVS + 
Sbjct  152   TFNVQSDAVGIIDGTQEGSYLWVTINYVLGNLGKDFSETVAVADLGGGSVQMVYAVSREQ  211

Query  687   FANAPTPDNGEEPYVQEKYILGAQYYLYVHSYLNYGQLASRAEIFKASGNSTNPCVLEGY  866
                AP    GE+PY+++  + G +YYLYVHSYL +G+ ASRAEI K +  S NPC+L GY
Sbjct  212   AKKAPQVPQGEDPYIKKIVLKGKKYYLYVHSYLRFGKEASRAEILKVTNGSPNPCILAGY  271

Query  867   DGYYTYNDVSYKVTAPPNGSSLKNCRKLARKVVDFRAPCKYQNCTFNGVWSGGGGAGMEN  1046
              G YTY+   YK  +P +GS+   C+++  K +    PC Y  CTF G+W+GGGG+G + 
Sbjct  272   HGTYTYSGEEYKAFSPASGSNFDECKEIILKALKVNDPCPYGKCTFGGIWNGGGGSGQKT  331

Query  1047  VYISSFFYDIATDVGIIDQEKASKIVKPRSFLVAAKLACETKFEDVKSTFPNAVEKDYPY  1226
             +Y++S FY + T V I D  K +  ++       A+  C+TK++D K+T+P   E   PY
Sbjct  332   LYVTSSFYYVPTGVNIADPNKPNSKIRIEDLKTGAEQVCKTKYKDAKATYPLIYEDSLPY  391

Query  1227  LCMDLVYEYTLLVDGLGLHPYKEITLMKKVEYKNYMVEAAWPLGCAIDVISS  1382
              C+DL+Y+YTL VDG GL P ++IT+  ++EY++ +V+AAWPLG AI+ ISS
Sbjct  392   ACLDLIYQYTLFVDGFGLDPLQDITVANQIEYQDAVVDAAWPLGNAIEAISS  443



>ref|XP_004147528.1| PREDICTED: apyrase 2-like [Cucumis sativus]
Length=466

 Score =   429 bits (1103),  Expect = 1e-141, Method: Compositional matrix adjust.
 Identities = 217/401 (54%), Positives = 293/401 (73%), Gaps = 5/401 (1%)
 Frame = +3

Query  183   YAVIFDAGSTGSRVHVFHFDENLDLLPIGDGVEFFLKTTPGLSSYANDPEAAAKSLEPLL  362
             +AVIFDAGS+GSRVHVF FD NLDLLP+G  +E FL+  PGLS+YA+ P+ AA SL  LL
Sbjct  68    FAVIFDAGSSGSRVHVFCFDHNLDLLPVGKDIELFLQLKPGLSAYADSPKDAAASLISLL  127

Query  363   LEAEGVVPTELQPDTPLELGATAGLRLLEGDASDKILQAVRDMFKNESNFKSKAEWVSIL  542
              +A+ VVP  L+P TP+ +GATAGLR L+GDASD+ILQAVRD+ +++S  + + + VS++
Sbjct  128   DKAQDVVPKGLRPMTPVRVGATAGLRALKGDASDRILQAVRDLMRDKSELRLEGDAVSVI  187

Query  543   EGSQEGTYFWVAMNYLLGNLGKGYQNTIATIDLGGGSVQVSYAVSGDTFANAPTPDNGEE  722
             +G+QEG+Y WV +NYLLGNLGK Y +T+  +DLGGGSVQ++YA+S +   +A      E 
Sbjct  188   DGTQEGSYLWVTLNYLLGNLGKKYSDTVGVVDLGGGSVQMAYAISEN---DAARLSEAEG  244

Query  723   PYVQEKYILGAQYYLYVHSYLNYGQLASRAEIFKASGNSTNPCVLEGYDGYYTYNDVSYK  902
              YV++ Y+ GA YYLYVHSYL+YG LA+RAE+   S +S+N C+L GY+G Y Y    YK
Sbjct  245   AYVKKMYLKGATYYLYVHSYLHYGLLAARAEVLSVSEDSSNDCILSGYEGEYHYGGKDYK  304

Query  903   VTAPPNGSSLKNCRKLARKVVDF-RAPCKYQNCTFNGVWSGGGGAGMENVYISSFFYDIA  1079
              +A  +GS+L  CR    K +    + C +  CTF GVW+GGGG G +N++++SFF+D A
Sbjct  305   ASASSSGSNLNGCRSTVLKALKVNESTCTHMKCTFGGVWNGGGGDGQKNLFVASFFFDRA  364

Query  1080  TDVGIIDQEKASKIVKPRSFLVAAKLACETKFEDVKSTFPNAVEKDYPYLCMDLVYEYTL  1259
              + G  D  +   IV+P  F  AAK AC+ K ED  ST+P+  + + PYLCMDLVY+YTL
Sbjct  365   AEAGFADPNEPVAIVRPADFNDAAKQACQIKVEDA-STYPHVEKDNLPYLCMDLVYQYTL  423

Query  1260  LVDGLGLHPYKEITLMKKVEYKNYMVEAAWPLGCAIDVISS  1382
             LVDG GL P++EITL+KKV+Y+N +VEAAWPLG AI+ +SS
Sbjct  424   LVDGFGLDPWQEITLVKKVKYQNSLVEAAWPLGSAIEAVSS  464



>ref|XP_007202024.1| hypothetical protein PRUPE_ppa005076mg [Prunus persica]
 gb|EMJ03223.1| hypothetical protein PRUPE_ppa005076mg [Prunus persica]
Length=478

 Score =   429 bits (1103),  Expect = 2e-141, Method: Compositional matrix adjust.
 Identities = 220/402 (55%), Positives = 295/402 (73%), Gaps = 1/402 (0%)
 Frame = +3

Query  180   NYAVIFDAGSTGSRVHVFHFDENLDLLPIGDGVEFFLKTTPGLSSYANDPEAAAKSLEPL  359
             +YAVIFDAGS+GSRVHVF FD NL LLPIG  +E FL   PGLS YA DP +AA+SL  L
Sbjct  76    SYAVIFDAGSSGSRVHVFCFDHNLQLLPIGKDLELFLHVEPGLSFYAKDPRSAAESLTGL  135

Query  360   LLEAEGVVPTELQPDTPLELGATAGLRLLEGDASDKILQAVRDMFKNESNFKSKAEWVSI  539
             L +AE  VP +L+  TP+ +GATAGLR LEGDASD+ILQAVRD+ K  S+  SK + V++
Sbjct  136   LDKAESAVPKDLRSFTPVRVGATAGLRALEGDASDRILQAVRDLLKERSSLSSKPDSVTV  195

Query  540   LEGSQEGTYFWVAMNYLLGNLGKGYQNTIATIDLGGGSVQVSYAVSGDTFANAPTPDNGE  719
             ++G+QEG++ WV +NYLLGN+GK Y +T+  +DLGGGSVQ++YA+S    A AP   +G+
Sbjct  196   IDGTQEGSFQWVTINYLLGNVGKKYSDTVGVVDLGGGSVQMAYAISEADAAKAPRLSDGD  255

Query  720   EPYVQEKYILGAQYYLYVHSYLNYGQLASRAEIFKASGNSTNPCVLEGYDGYYTYNDVSY  899
             + YV+E  + G +Y LYVHSYL+YG LA+RAEI K S +S NPC+L GY+G Y Y    Y
Sbjct  256   DSYVREMTLKGTKYNLYVHSYLHYGLLAARAEILKVSDDSGNPCILAGYNGSYKYGGQIY  315

Query  900   KVTAPPNGSSLKNCRKLARKVVDF-RAPCKYQNCTFNGVWSGGGGAGMENVYISSFFYDI  1076
             K +A  +GSS++ C ++A K +    A C +  CTF GVW+GGGG G  N++++SFF+D 
Sbjct  316   KASASSSGSSVEGCMRVAMKALKVNEATCTHMKCTFGGVWNGGGGDGQRNLFVASFFFDR  375

Query  1077  ATDVGIIDQEKASKIVKPRSFLVAAKLACETKFEDVKSTFPNAVEKDYPYLCMDLVYEYT  1256
             A + G ++  +    V+P +F  AAK ACETK ED KS +P+  + + P+LCMDLVY++T
Sbjct  376   AAEAGFVNPNEPVAKVRPGNFEEAAKRACETKLEDAKSAYPDVKQDNLPFLCMDLVYQFT  435

Query  1257  LLVDGLGLHPYKEITLMKKVEYKNYMVEAAWPLGCAIDVISS  1382
             LLV+G GL P++EITL+KKV+Y N +VEAAWPLG AI+ +SS
Sbjct  436   LLVNGFGLDPWQEITLVKKVKYNNALVEAAWPLGSAIEAVSS  477



>ref|XP_010485779.1| PREDICTED: apyrase 1-like [Camelina sativa]
Length=471

 Score =   429 bits (1102),  Expect = 3e-141, Method: Compositional matrix adjust.
 Identities = 218/416 (52%), Positives = 294/416 (71%), Gaps = 8/416 (2%)
 Frame = +3

Query  159   LLSHETG-------NYAVIFDAGSTGSRVHVFHFDENLDLLPIGDGVEFFLKTTPGLSSY  317
             + SHE G       NYAVIFDAGS+GSRVHV+ FD+NLDL+P+ + +E FL+  PGLS+Y
Sbjct  55    MKSHEGGSNSRGPKNYAVIFDAGSSGSRVHVYCFDQNLDLVPLENELELFLQLKPGLSAY  114

Query  318   ANDPEAAAKSLEPLLLEAEGVVPTELQPDTPLELGATAGLRLLEGDASDKILQAVRDMFK  497
              NDP  +A SL  LL +AE  VP EL+P TP+ +GATAGLR L   AS+ ILQAVR++ K
Sbjct  115   PNDPRQSANSLVSLLDKAEASVPRELRPKTPVRVGATAGLRALGHKASENILQAVRELLK  174

Query  498   NESNFKSKAEWVSILEGSQEGTYFWVAMNYLLGNLGKGYQNTIATIDLGGGSVQVSYAVS  677
             + S  K++A  V++L+G+QEG+Y WV +NYLL  LGK Y +T+  +DLGGGSVQ++YA+S
Sbjct  175   DRSRLKTEANAVTVLDGTQEGSYQWVTINYLLRTLGKPYSDTVGVVDLGGGSVQMAYAIS  234

Query  678   GDTFANAPTPDNGEEPYVQEKYILGAQYYLYVHSYLNYGQLASRAEIFKASGNSTNPCVL  857
              +  A+AP P  GE+ YV+E Y+ G +Y+LYVHSYL+YG LA+RAEI K S  S NPC++
Sbjct  235   EEDAASAPKPLEGEDSYVREMYLKGRKYFLYVHSYLHYGLLAARAEILKVSEGSNNPCIV  294

Query  858   EGYDGYYTYNDVSYKVTAPPNGSSLKNCRKLARKVVDFR-APCKYQNCTFNGVWSGGGGA  1034
              GY G Y Y    +K TA  +G+SL  CR++A   +    + C +  CTF GVW+GGGG 
Sbjct  295   TGYTGTYKYGGKGFKATASSSGASLDECRRVAINALKVNDSLCTHMKCTFGGVWNGGGGG  354

Query  1035  GMENVYISSFFYDIATDVGIIDQEKASKIVKPRSFLVAAKLACETKFEDVKSTFPNAVEK  1214
             G + ++++SFF+D A + G +D ++    V+P  F  AA  AC  + E+ KS FP+  E 
Sbjct  355   GQKKMFVASFFFDRAAEAGFVDPKQPVAEVRPLDFEKAANKACNMRMEEGKSKFPHVEED  414

Query  1215  DYPYLCMDLVYEYTLLVDGLGLHPYKEITLMKKVEYKNYMVEAAWPLGCAIDVISS  1382
             + PYLC+DLVY+YTLLVDG GL P + ITL+KKV+Y +Y VEAAWPLG AI+ +SS
Sbjct  415   NLPYLCLDLVYQYTLLVDGFGLKPSQTITLVKKVKYGDYAVEAAWPLGSAIEAVSS  470



>ref|XP_008793372.1| PREDICTED: probable apyrase 1 [Phoenix dactylifera]
Length=477

 Score =   429 bits (1102),  Expect = 3e-141, Method: Compositional matrix adjust.
 Identities = 221/404 (55%), Positives = 291/404 (72%), Gaps = 4/404 (1%)
 Frame = +3

Query  180   NYAVIFDAGSTGSRVHVFHFDENLDLLPIGDGVEFFLKTTPGLSSYANDPEAAAKSLEPL  359
             +YAVIFDAGS+GSRVHV+ FDENLDLL IG  +E F +   GLSSYA DP+ AA SL PL
Sbjct  76    SYAVIFDAGSSGSRVHVYCFDENLDLLHIGKEIELFRRIGTGLSSYAKDPQEAANSLIPL  135

Query  360   LLEAEGVVPTELQPDTPLELGATAGLRLLEGDASDKILQAVRDMFKNESNFKSKAEWVSI  539
             L EAE VVP EL+  TP+ +GATAGLR L  + S+KILQAVRD+ K++S+ K + +WVS+
Sbjct  136   LEEAESVVPVELRWKTPVRVGATAGLRALGAETSEKILQAVRDLLKDKSSLKFQPDWVSV  195

Query  540   LEGSQEGTYFWVAMNYLLGNLGKGYQNTIATIDLGGGSVQVSYAVSGDTFANAPTPDNGE  719
             L+GSQEG + WV +NYLLG+LGK Y +T+  +DLGGGSVQ++YA+S    A AP   +GE
Sbjct  196   LDGSQEGAFQWVTINYLLGHLGKTYSDTVGVVDLGGGSVQMAYAISEKDAAEAPKVTDGE  255

Query  720   EPYVQEKYILGAQYYLYVHSYLNYGQLASRAEIFKASGNSTNPCVLEGYDGYYTYNDVSY  899
             + YV++ ++ G +YYLYVHSY++YG LA+RAEI  A  N +N C+L GY G Y Y D  +
Sbjct  256   DSYVKQLFLKGTKYYLYVHSYMHYGLLAARAEILTAGDNYSN-CILNGYRGTYKYGDEVH  314

Query  900   KVTAPPNGSSLKNCRKLARKV--VDFRAPCKYQNCTFNGVWSGGGGAGMENVYISSFFYD  1073
             K  A P+G+SL  CR  A K   VD R  C +  CTF GVW+GGGG G  N++++SFF+D
Sbjct  315   KAIAAPSGASLSKCRNEAVKALKVDGRV-CTHMKCTFGGVWNGGGGDGQRNLFVASFFFD  373

Query  1074  IATDVGIIDQEKASKIVKPRSFLVAAKLACETKFEDVKSTFPNAVEKDYPYLCMDLVYEY  1253
              A + G +D +     V+P  F  AAK AC+   +D ++T+ +   ++ P+LCMDLVY+Y
Sbjct  374   RAAEAGFVDPKVPVAKVRPSDFEEAAKRACKLNVDDARTTYSHVSVENLPFLCMDLVYQY  433

Query  1254  TLLVDGLGLHPYKEITLMKKVEYKNYMVEAAWPLGCAIDVISSS  1385
             TLLVDG  L P++EITL+KKV+Y N  VEAAWPLG AI+V SS+
Sbjct  434   TLLVDGFALDPHQEITLVKKVQYGNAFVEAAWPLGSAIEVASSA  477



>emb|CDY51237.1| BnaA03g07010D [Brassica napus]
Length=580

 Score =   432 bits (1110),  Expect = 6e-141, Method: Compositional matrix adjust.
 Identities = 220/409 (54%), Positives = 289/409 (71%), Gaps = 5/409 (1%)
 Frame = +3

Query  165   SHETGNYAVIFDAGSTGSRVHVFHFDENLDLLPIGDGVEFFLKTTPGLSSYANDPEAAAK  344
             S    NYAVIFDAGS+GSRVHV+ FD NLDLLP+G+ +E F++  PGLS+Y  DP  AA 
Sbjct  173   SRPPKNYAVIFDAGSSGSRVHVYCFDRNLDLLPLGNELELFVQLKPGLSAYPTDPRQAAN  232

Query  345   SLEPLLLEAEGVVPTELQPDTPLELGATAGLRLLEGDASDKILQAVRDMFKNESNFKSKA  524
             SL  LL +AE  VP EL+P TP+ +GATAGLR L  +AS+ ILQAV+++ ++ S  K++A
Sbjct  233   SLVSLLDKAEASVPRELRPKTPVRVGATAGLRTLGHEASENILQAVKELLRDRSMLKTEA  292

Query  525   EWVSILEGSQEGTYFWVAMNYLLGNLGKGYQNTIATIDLGGGSVQVSYAVSGDTFANAPT  704
               V++L+G+QEG Y WV +NYLL NLGK Y +T+  +DLGGGSVQ++YA+S +  A AP 
Sbjct  293   NAVTVLDGTQEGAYQWVTINYLLRNLGKPYSDTVGVVDLGGGSVQMAYAISEEDAATAPK  352

Query  705   PDNGEEPYVQEKYILGAQYYLYVHSYLNYGQLASRAEIFKASGNSTNPCVLEGYDGYYTY  884
             P  GE+ YV+E Y+ G +Y+LYVHSYL+YG LA+RAEI K S +S NPC++ GYDG Y Y
Sbjct  353   PLEGEDSYVREMYLKGRKYFLYVHSYLHYGLLAARAEILKVSEDSNNPCIVAGYDGTYKY  412

Query  885   NDVSYKVTAPPNGSSLKNCRKL---ARKVVDFRAPCKYQNCTFNGVWSGGGGAGMENVYI  1055
                 +K  A  +G+SL  CR+L   A KV D    C +  CTF GVW+GG G G +N+++
Sbjct  413   GGDGFKAAAVQSGASLNECRRLTVNALKVND--TLCTHMKCTFGGVWNGGRGGGQKNMFV  470

Query  1056  SSFFYDIATDVGIIDQEKASKIVKPRSFLVAAKLACETKFEDVKSTFPNAVEKDYPYLCM  1235
             +SFF+D A + G +D ++    V+P  F  AAK AC  K E+ KS FP   E + PYLCM
Sbjct  471   ASFFFDRAAEAGFVDPKQPVATVRPMDFEKAAKKACSMKIEEGKSKFPRVEEDNLPYLCM  530

Query  1236  DLVYEYTLLVDGLGLHPYKEITLMKKVEYKNYMVEAAWPLGCAIDVISS  1382
             DLVY+YTLLVDG GL   + ITL+KKV+Y  + VEAAWPLG AI+ +SS
Sbjct  531   DLVYQYTLLVDGFGLEASQTITLVKKVKYGEHAVEAAWPLGSAIEAVSS  579



>ref|XP_009120988.1| PREDICTED: apyrase 2 [Brassica rapa]
Length=472

 Score =   428 bits (1100),  Expect = 6e-141, Method: Compositional matrix adjust.
 Identities = 217/409 (53%), Positives = 291/409 (71%), Gaps = 5/409 (1%)
 Frame = +3

Query  165   SHETGNYAVIFDAGSTGSRVHVFHFDENLDLLPIGDGVEFFLKTTPGLSSYANDPEAAAK  344
             S    NYAV+FDAGS+GSRVHV+ FD+NLDL+P+G+ +E FL+  PGLS+Y  DP  AA 
Sbjct  65    SRPPKNYAVVFDAGSSGSRVHVYCFDKNLDLVPLGNELELFLQLKPGLSAYPTDPRQAAN  124

Query  345   SLEPLLLEAEGVVPTELQPDTPLELGATAGLRLLEGDASDKILQAVRDMFKNESNFKSKA  524
             SL  LL +AE  VP EL+P TP+ +GATAGLR L  +AS+ ILQAV+++ ++ S  K++A
Sbjct  125   SLVSLLDKAESSVPRELRPKTPVRVGATAGLRTLGHEASENILQAVKELLRDRSMLKTEA  184

Query  525   EWVSILEGSQEGTYFWVAMNYLLGNLGKGYQNTIATIDLGGGSVQVSYAVSGDTFANAPT  704
               V++L+G+QEG+Y WV +NYLL NLGK Y +T+  +DLGGGSVQ++YA+S +  A+AP 
Sbjct  185   NAVTVLDGTQEGSYQWVTINYLLRNLGKPYSDTVGVVDLGGGSVQMAYAISEEDAASAPK  244

Query  705   PDNGEEPYVQEKYILGAQYYLYVHSYLNYGQLASRAEIFKASGNSTNPCVLEGYDGYYTY  884
             P  GE+ YV+E Y+ G +Y+LYVHSYL+YG LA+RAEI K S +S +PC++ GYDG Y Y
Sbjct  245   PLEGEDAYVREMYLKGRKYFLYVHSYLHYGLLAARAEILKVSEDSNSPCIVTGYDGTYKY  304

Query  885   NDVSYKVTAPPNGSSLKNCRKL---ARKVVDFRAPCKYQNCTFNGVWSGGGGAGMENVYI  1055
                  K  A  +G+SL  CR+    A KV D    C +  CTF GVW+GG G G +N+++
Sbjct  305   GGEELKAAALQSGASLDECRRFTINALKVND--TLCTHMKCTFGGVWNGGRGGGQKNMFV  362

Query  1056  SSFFYDIATDVGIIDQEKASKIVKPRSFLVAAKLACETKFEDVKSTFPNAVEKDYPYLCM  1235
             +SFF+D A + G +D ++    V+P  F  AAK AC  K E+ KS FP   E + PYLC+
Sbjct  363   ASFFFDRAAEAGFVDPKQPVATVRPIDFEKAAKKACSMKMEEGKSKFPRVEEDNLPYLCV  422

Query  1236  DLVYEYTLLVDGLGLHPYKEITLMKKVEYKNYMVEAAWPLGCAIDVISS  1382
             DLVY+YTLLVDG GL P + ITL+KKV+Y  + VEAAWPLG AI+ +SS
Sbjct  423   DLVYQYTLLVDGFGLKPTQTITLVKKVKYGEHAVEAAWPLGSAIEAVSS  471



>gb|KEH25611.1| GDA1/CD39 nucleoside phosphatase family protein [Medicago truncatula]
Length=483

 Score =   427 bits (1099),  Expect = 9e-141, Method: Compositional matrix adjust.
 Identities = 217/404 (54%), Positives = 294/404 (73%), Gaps = 1/404 (0%)
 Frame = +3

Query  174   TGNYAVIFDAGSTGSRVHVFHFDENLDLLPIGDGVEFFLKTTPGLSSYANDPEAAAKSLE  353
             + ++AV+FDAGS+GSRVHVF FD NL+L+ IG+ +E FL+  PGLS+YA DP+ AAKSL 
Sbjct  78    SDSFAVVFDAGSSGSRVHVFRFDRNLELVKIGNDLEVFLQIKPGLSAYARDPQQAAKSLV  137

Query  354   PLLLEAEGVVPTELQPDTPLELGATAGLRLLEGDASDKILQAVRDMFKNESNFKSKAEWV  533
              LL +AE VVP E +  TP+ +GATAGLR LEGDASD+ILQAVR++ K  S  KS+   V
Sbjct  138   SLLDKAESVVPMEFRSMTPVRVGATAGLRALEGDASDRILQAVRELLKQRSTLKSEPNAV  197

Query  534   SILEGSQEGTYFWVAMNYLLGNLGKGYQNTIATIDLGGGSVQVSYAVSGDTFANAPTPDN  713
             ++L+G+QEG + WV +NYLLG LG+ Y +T+  +DLGGGSVQ++YA+S  + A AP   +
Sbjct  198   AVLDGTQEGAFQWVTINYLLGKLGRDYSDTVGVVDLGGGSVQMAYAISETSAAEAPKVPD  257

Query  714   GEEPYVQEKYILGAQYYLYVHSYLNYGQLASRAEIFKASGNSTNPCVLEGYDGYYTYNDV  893
             G EPYV+E ++ G +YYLYVHSYL +G LA+RAEI KAS +  NPC+L GYDG Y Y   
Sbjct  258   GGEPYVKEMFLRGRKYYLYVHSYLRFGLLAARAEILKASDDFGNPCILAGYDGSYKYGGK  317

Query  894   SYKVTAPPNGSSLKNCRKLARKVVDF-RAPCKYQNCTFNGVWSGGGGAGMENVYISSFFY  1070
             S+  ++ P+GSSL  C+ +A   +    + C +  CTF G+W+GGGG G +N++++SFF+
Sbjct  318   SFNASSSPSGSSLNECKSIALNALTVNESTCAHMKCTFGGIWNGGGGDGQKNLFVASFFF  377

Query  1071  DIATDVGIIDQEKASKIVKPRSFLVAAKLACETKFEDVKSTFPNAVEKDYPYLCMDLVYE  1250
             D A   G  + +     V+P  F  AAK AC+TK ED KST+P   + + PYLCMDLVY+
Sbjct  378   DRAAQAGFANPKSPVAKVRPVDFKNAAKQACQTKLEDAKSTYPLVDDGNLPYLCMDLVYQ  437

Query  1251  YTLLVDGLGLHPYKEITLMKKVEYKNYMVEAAWPLGCAIDVISS  1382
             YTLLVDG GL P ++ITL+K+V+Y + +VEAAWPLG AI+ +SS
Sbjct  438   YTLLVDGFGLDPLQDITLVKQVKYHDSLVEAAWPLGSAIEAVSS  481



>dbj|BAM84275.1| apyrase, partial [Medicago truncatula]
Length=500

 Score =   428 bits (1100),  Expect = 1e-140, Method: Compositional matrix adjust.
 Identities = 218/404 (54%), Positives = 292/404 (72%), Gaps = 1/404 (0%)
 Frame = +3

Query  174   TGNYAVIFDAGSTGSRVHVFHFDENLDLLPIGDGVEFFLKTTPGLSSYANDPEAAAKSLE  353
             + ++AV+FDAGS+GSRVHVF FD NL+L+ IG+ +E FL+  PGLS+YA DP+ AAKSL 
Sbjct  95    SDSFAVVFDAGSSGSRVHVFRFDRNLELVKIGNDLEVFLQIKPGLSAYARDPQQAAKSLV  154

Query  354   PLLLEAEGVVPTELQPDTPLELGATAGLRLLEGDASDKILQAVRDMFKNESNFKSKAEWV  533
              LL +AE VVP E +  TP+ +GATAGLR LEGDASD+ILQAVR++ K  S  KS+   V
Sbjct  155   SLLDKAESVVPMEFRSMTPVRVGATAGLRALEGDASDRILQAVRELLKQRSTLKSEPNAV  214

Query  534   SILEGSQEGTYFWVAMNYLLGNLGKGYQNTIATIDLGGGSVQVSYAVSGDTFANAPTPDN  713
             ++L+G+QEG + WV +NYLLG LG+ Y  T+  +DLGGGSVQ++YA+S  + A A    N
Sbjct  215   AVLDGTQEGAFQWVTINYLLGKLGRDYSETVGVVDLGGGSVQMAYAISETSAAEASKIPN  274

Query  714   GEEPYVQEKYILGAQYYLYVHSYLNYGQLASRAEIFKASGNSTNPCVLEGYDGYYTYNDV  893
             G EPYV+E ++ G +YYLYVHSYL YG LA+RAEI KAS +  NPC+L GYDG Y Y   
Sbjct  275   GGEPYVKEMFLRGRKYYLYVHSYLRYGLLAARAEILKASDDFGNPCILAGYDGSYKYGGK  334

Query  894   SYKVTAPPNGSSLKNCRKLARKVVDF-RAPCKYQNCTFNGVWSGGGGAGMENVYISSFFY  1070
             S+  ++ P+GSSL  C+ +A   +    + C +  CTF G+W+GGGG G +N++++SFF+
Sbjct  335   SFNASSSPSGSSLNECKSMALNALTVNESTCTHMKCTFGGIWNGGGGDGQKNLFVASFFF  394

Query  1071  DIATDVGIIDQEKASKIVKPRSFLVAAKLACETKFEDVKSTFPNAVEKDYPYLCMDLVYE  1250
             D A   G  + +     V+P  F  AAK AC+TK ED KST+P   + + PYLCMDLVY+
Sbjct  395   DRAAQAGFANPKSPVAKVRPVDFKSAAKQACQTKLEDAKSTYPLVDDGNLPYLCMDLVYQ  454

Query  1251  YTLLVDGLGLHPYKEITLMKKVEYKNYMVEAAWPLGCAIDVISS  1382
             YTLLVDG GL P ++ITL+K+V+Y + +VEAAWPLG AI+ +SS
Sbjct  455   YTLLVDGFGLDPLQDITLVKQVKYHDSLVEAAWPLGSAIEAVSS  498



>ref|XP_009366414.1| PREDICTED: apyrase 2-like [Pyrus x bretschneideri]
Length=468

 Score =   427 bits (1097),  Expect = 1e-140, Method: Compositional matrix adjust.
 Identities = 227/403 (56%), Positives = 298/403 (74%), Gaps = 1/403 (0%)
 Frame = +3

Query  177   GNYAVIFDAGSTGSRVHVFHFDENLDLLPIGDGVEFFLKTTPGLSSYANDPEAAAKSLEP  356
              ++AVIFDAGS+GSRVHVF FD NL LLPIG  +E FL+  PGLS+YA DP +AA+SL  
Sbjct  65    ASFAVIFDAGSSGSRVHVFCFDHNLQLLPIGKDLELFLQVKPGLSAYAKDPRSAAESLTS  124

Query  357   LLLEAEGVVPTELQPDTPLELGATAGLRLLEGDASDKILQAVRDMFKNESNFKSKAEWVS  536
             LL +AE  VP EL+  TP+ +GATAGLR L+GDASD+ILQAVRD+ K  S+  S+ + V+
Sbjct  125   LLDKAESAVPKELRSFTPVRVGATAGLRALKGDASDRILQAVRDLLKQRSSLSSRPDAVT  184

Query  537   ILEGSQEGTYFWVAMNYLLGNLGKGYQNTIATIDLGGGSVQVSYAVSGDTFANAPTPDNG  716
             +++G+QEG++ WV +NYLLGNLGK Y +T+  +DLGGGSVQ++YA+S    A AP   +G
Sbjct  185   VIDGTQEGSFQWVTINYLLGNLGKKYSDTVGVVDLGGGSVQMAYAISEADAAKAPKLSDG  244

Query  717   EEPYVQEKYILGAQYYLYVHSYLNYGQLASRAEIFKASGNSTNPCVLEGYDGYYTYNDVS  896
             E+ YV+E  + GA+Y LYVHSYL+YG LA+RAEI K S +S NPC+L GY G YTY   S
Sbjct  245   EDVYVREMNLKGAKYNLYVHSYLHYGLLAARAEILKVSEDSANPCILAGYYGSYTYGGQS  304

Query  897   YKVTAPPNGSSLKNCRKLARKVVDF-RAPCKYQNCTFNGVWSGGGGAGMENVYISSFFYD  1073
             YK +A  +GSS++ CR +  K +    A C +  CTF GVW+GGGG G  N++++SFF+D
Sbjct  305   YKASASSSGSSVEECRGVVTKALKVNEATCSHMKCTFGGVWNGGGGDGQRNLFVASFFFD  364

Query  1074  IATDVGIIDQEKASKIVKPRSFLVAAKLACETKFEDVKSTFPNAVEKDYPYLCMDLVYEY  1253
              A + G ++ ++    V P +F  AAK ACETK ED KST+P   E + P+LCMDLVY+ 
Sbjct  365   RAAEAGFVNPDEPVAKVHPGNFEEAAKRACETKLEDAKSTYPQVEEGNLPFLCMDLVYQS  424

Query  1254  TLLVDGLGLHPYKEITLMKKVEYKNYMVEAAWPLGCAIDVISS  1382
             TLLVDG GL P++EITL+KKVEY+N +VEAAWPLG AI+ +SS
Sbjct  425   TLLVDGFGLDPWQEITLVKKVEYQNSLVEAAWPLGSAIEAVSS  467



>sp|Q8H7L6.1|APY1_ORYSJ RecName: Full=Probable apyrase 1; Short=OsAPY1; AltName: Full=ATP-diphosphatase; 
AltName: Full=ATP-diphosphohydrolase; AltName: 
Full=Adenosine diphosphatase; Short=ADPase [Oryza sativa 
Japonica Group]
 gb|AAN65004.1| Putative apyrase [Oryza sativa Japonica Group]
 gb|ABF95735.1| Nucleoside-triphosphatase, putative, expressed [Oryza sativa 
Japonica Group]
Length=489

 Score =   427 bits (1098),  Expect = 2e-140, Method: Compositional matrix adjust.
 Identities = 218/410 (53%), Positives = 291/410 (71%), Gaps = 2/410 (0%)
 Frame = +3

Query  162   LSHETGNYAVIFDAGSTGSRVHVFHFDENLDLLPIGDGVEFFLKTTPGLSSYANDPEAAA  341
             L   +  YAVIFDAGS+GSRVHV+ FD NLDLLPIG  +E F +  PGLS+YA DP+ AA
Sbjct  80    LGDGSTRYAVIFDAGSSGSRVHVYCFDGNLDLLPIGKEIELFKQKKPGLSAYAMDPQEAA  139

Query  342   KSLEPLLLEAEGVVPTELQPDTPLELGATAGLRLLEGDASDKILQAVRDMFKNESNFKSK  521
             KSL  LL EAE V+P EL+  TP+ +GATAGLR L  + S++ILQAVRD+ +++S+F+S+
Sbjct  140   KSLVSLLEEAEKVIPVELREQTPVRVGATAGLRALGTEKSEEILQAVRDLLQDKSSFRSQ  199

Query  522   AEWVSILEGSQEGTYFWVAMNYLLGNLGKGYQNTIATIDLGGGSVQVSYAVSGDTFANAP  701
              EWV++L+GSQEG + WV +NYLLGNLGK Y +T+  +DLGGGSVQ++YA+S      AP
Sbjct  200   PEWVTVLDGSQEGAFQWVTINYLLGNLGKPYSHTVGVVDLGGGSVQMAYAISEKDAGKAP  259

Query  702   TPDNGEEPYVQEKYILGAQYYLYVHSYLNYGQLASRAEIFKA-SGNSTNPCVLEGYDGYY  878
                 GE+ YV+E  + G  YYLYVHSYL YG LA+RAEI KA  GN    C+LEG+ G Y
Sbjct  260   PVAEGEDSYVKELLLKGTTYYLYVHSYLRYGLLAARAEILKAGEGNDYRNCMLEGHHGQY  319

Query  879   TYNDVSYKVTAPPNGSSLKNCRKLARKVVDFRAP-CKYQNCTFNGVWSGGGGAGMENVYI  1055
              Y D  ++ +   +G+S   CR +A + +    P C +  CTF GVW+GGGG G +N+++
Sbjct  320   RYGDDIFEASGLSSGASYSKCRAVAVRALKVDEPACTHMKCTFGGVWNGGGGDGQKNLFV  379

Query  1056  SSFFYDIATDVGIIDQEKASKIVKPRSFLVAAKLACETKFEDVKSTFPNAVEKDYPYLCM  1235
             +SFF+D A + G ++ +     VKP  F  AA+  C+   +D ++T+P+  E++ PYLCM
Sbjct  380   ASFFFDRAAEAGFVNPKAPFAKVKPSDFEEAARRVCKLNVKDAQATYPDVSEENVPYLCM  439

Query  1236  DLVYEYTLLVDGLGLHPYKEITLMKKVEYKNYMVEAAWPLGCAIDVISSS  1385
             DLVY+YTLLVDG G+ PY++ITL+KKV Y N  VEAAWPLG AI+V SSS
Sbjct  440   DLVYQYTLLVDGFGVDPYQDITLVKKVPYSNSFVEAAWPLGSAIEVASSS  489



>gb|EPS65035.1| apyrase-like protein, partial [Genlisea aurea]
Length=536

 Score =   429 bits (1102),  Expect = 2e-140, Method: Compositional matrix adjust.
 Identities = 229/460 (50%), Positives = 288/460 (63%), Gaps = 49/460 (11%)
 Frame = +3

Query  150   RRVLLSHETGNYAVIFDAGSTGSRVHVFHFDENLDLLPIGDGVEFF--------------  287
             RR+     +  YAV+FDAGS+GSRVHVF F+  LDL+P+G  +E F              
Sbjct  77    RRLSPEFGSRKYAVVFDAGSSGSRVHVFSFNRKLDLVPMGQDLELFVQVSLMASSALFLY  136

Query  288   ----------------------------------LKTTPGLSSYANDPEAAAKSLEPLLL  365
                                               L+  PGLS YA DPEAAA SL  LL 
Sbjct  137   FTSPFDNEGNGLCPFCRLECRIVFPPFYIFRCFVLQRKPGLSGYAKDPEAAANSLSELLE  196

Query  366   EAEGVVPTELQPDTPLELGATAGLRLLEGDASDKILQAVRDMFKNESNFKSKAEWVSILE  545
             +AE VVP ELQ  TP+++GATAGLR LEGD SD+IL  VR   K +S  KS+AEWV++L+
Sbjct  197   QAEAVVPLELQSMTPVKVGATAGLRQLEGDTSDRILHEVRQFLKTKSKLKSQAEWVTVLD  256

Query  546   GSQEGTYFWVAMNYLLGNLGKGYQNTIATIDLGGGSVQVSYAVSGDTFANAPTPDNGEEP  725
             G+QEG Y WV +NYLLGNLGK Y  ++  +DLGGGSVQ++YA+S    A AP      E 
Sbjct  257   GNQEGAYQWVTINYLLGNLGKKYSESVGVVDLGGGSVQMAYAISDSDAAKAPKLSGEGES  316

Query  726   YVQEKYILGAQYYLYVHSYLNYGQLASRAEIFKASGNSTNPCVLEGYDGYYTYNDVSYKV  905
             YVQ   + G  Y LYVHSYL+YG LA+RAEI K S  S NPC+L GYDG Y Y    YK 
Sbjct  317   YVQRMILKGTTYNLYVHSYLHYGLLAARAEILKTSEESGNPCILAGYDGSYKYGQAVYKA  376

Query  906   TAPPNGSSLKNCRKLARKVVDFRAP-CKYQNCTFNGVWSGGGGAGMENVYISSFFYDIAT  1082
              A P+GSSL  CR+ A K +    P C +  CTF GVW+GGGG G +N++++SFF+D A 
Sbjct  377   AALPSGSSLLKCREAAIKALKINEPACTHMKCTFGGVWNGGGGDGQKNLFVASFFFDRAA  436

Query  1083  DVGIIDQEKASKIVKPRSFLVAAKLACETKFEDVKSTFPNAVEKDYPYLCMDLVYEYTLL  1262
             + G++D   A   V+P  F  AAK AC+T+ ED  S +P     + PYLCMDLVY+ TLL
Sbjct  437   EAGLVDPSAAVAKVRPSDFEDAAKRACQTRIEDGNSAYPQVEADNLPYLCMDLVYQLTLL  496

Query  1263  VDGLGLHPYKEITLMKKVEYKNYMVEAAWPLGCAIDVISS  1382
             VDG GL P++EITL+KKV+Y+N+ VEAAWPLG AI+ +SS
Sbjct  497   VDGFGLDPWQEITLVKKVKYQNHFVEAAWPLGSAIEAVSS  536



>ref|XP_009132257.1| PREDICTED: apyrase 2-like [Brassica rapa]
Length=597

 Score =   431 bits (1107),  Expect = 2e-140, Method: Compositional matrix adjust.
 Identities = 219/409 (54%), Positives = 288/409 (70%), Gaps = 5/409 (1%)
 Frame = +3

Query  165   SHETGNYAVIFDAGSTGSRVHVFHFDENLDLLPIGDGVEFFLKTTPGLSSYANDPEAAAK  344
             S    NYAVIFDAGS+GSRVHV+ FD NLDLLP+G+ +E F++  PGLS+Y  DP  AA 
Sbjct  190   SRPPKNYAVIFDAGSSGSRVHVYCFDRNLDLLPLGNELELFVQLKPGLSAYPTDPRQAAN  249

Query  345   SLEPLLLEAEGVVPTELQPDTPLELGATAGLRLLEGDASDKILQAVRDMFKNESNFKSKA  524
             SL  LL +AE  VP EL+P TP+ +GATAGLR L  +AS+ ILQAV+++ ++ S  K++A
Sbjct  250   SLVSLLDKAEASVPRELRPKTPVRVGATAGLRTLGHEASENILQAVKELLRDRSMLKTEA  309

Query  525   EWVSILEGSQEGTYFWVAMNYLLGNLGKGYQNTIATIDLGGGSVQVSYAVSGDTFANAPT  704
               V++L+G+QEG Y WV +NYLL NLGK Y +T+  +DLGGGSVQ++YA+S +  A AP 
Sbjct  310   NAVTVLDGTQEGAYQWVTINYLLRNLGKPYSDTVGVVDLGGGSVQMAYAISEEDAATAPK  369

Query  705   PDNGEEPYVQEKYILGAQYYLYVHSYLNYGQLASRAEIFKASGNSTNPCVLEGYDGYYTY  884
             P  GE+ YV+E Y+ G +Y+LYVHSYL+YG LA+RAEI K S +S NPC++ GYDG Y Y
Sbjct  370   PLEGEDSYVREMYLKGRKYFLYVHSYLHYGLLAARAEILKVSEDSNNPCIVAGYDGTYKY  429

Query  885   NDVSYKVTAPPNGSSLKNCRKL---ARKVVDFRAPCKYQNCTFNGVWSGGGGAGMENVYI  1055
                 +K  A  +G+SL  CR+L   A KV D    C +  CTF GVW+GG G G +N+++
Sbjct  430   GGDGFKAAAVQSGASLNECRRLTVNALKVND--TLCTHMKCTFGGVWNGGRGGGQKNMFV  487

Query  1056  SSFFYDIATDVGIIDQEKASKIVKPRSFLVAAKLACETKFEDVKSTFPNAVEKDYPYLCM  1235
             +SFF+D A + G +D ++    V+P  F  AAK AC  K E+ KS FP   E + PYLCM
Sbjct  488   ASFFFDRAAEAGFVDPKQPVATVRPMDFEKAAKKACSMKIEEGKSKFPRVEEDNLPYLCM  547

Query  1236  DLVYEYTLLVDGLGLHPYKEITLMKKVEYKNYMVEAAWPLGCAIDVISS  1382
             DLVY+YTLLVDG GL   +  TL+KKV+Y  + VEAAWPLG AI+ +SS
Sbjct  548   DLVYQYTLLVDGFGLEASQTTTLVKKVKYGEHAVEAAWPLGSAIEAVSS  596



>ref|XP_002442736.1| hypothetical protein SORBIDRAFT_08g001970 [Sorghum bicolor]
 gb|EES16574.1| hypothetical protein SORBIDRAFT_08g001970 [Sorghum bicolor]
Length=468

 Score =   426 bits (1095),  Expect = 2e-140, Method: Compositional matrix adjust.
 Identities = 200/401 (50%), Positives = 278/401 (69%), Gaps = 0/401 (0%)
 Frame = +3

Query  177   GNYAVIFDAGSTGSRVHVFHFDENLDLLPIGDGVEFFLKTTPGLSSYANDPEAAAKSLEP  356
             G YAVIFDAGSTG+R+HVF FD  +DL+ IG G+EFF K  PGLSSYA  P+ AA S+ P
Sbjct  60    GRYAVIFDAGSTGTRMHVFRFDNKMDLVGIGHGIEFFAKVKPGLSSYAERPQEAANSILP  119

Query  357   LLLEAEGVVPTELQPDTPLELGATAGLRLLEGDASDKILQAVRDMFKNESNFKSKAEWVS  536
             L+ +A+ +VP++L   TPL+LGATAGLRL+  + +DKILQAVRD+  ++S F+   +W++
Sbjct  120   LVKKAKSIVPSQLTERTPLKLGATAGLRLIGDEQADKILQAVRDLVHSKSQFQYNPDWIN  179

Query  537   ILEGSQEGTYFWVAMNYLLGNLGKGYQNTIATIDLGGGSVQVSYAVSGDTFANAPTPDNG  716
             ++EG QEG+Y WVA+NYLL  LG  Y  T+  +D+GGGS+Q++YA+S +  A AP   +G
Sbjct  180   VIEGYQEGSYLWVALNYLLDKLGGDYSQTVGVVDMGGGSMQMAYAISANDAAKAPKVPDG  239

Query  717   EEPYVQEKYILGAQYYLYVHSYLNYGQLASRAEIFKASGNSTNPCVLEGYDGYYTYNDVS  896
             ++ YV ++Y+ G  Y +Y HSYL+YG LA+R +I  A     + C+L G+ G YTYN   
Sbjct  240   KDRYVTKEYLKGKDYNIYAHSYLHYGALAARVKILNAKNGQFSLCMLRGFRGNYTYNGQQ  299

Query  897   YKVTAPPNGSSLKNCRKLARKVVDFRAPCKYQNCTFNGVWSGGGGAGMENVYISSFFYDI  1076
             Y  TA P G+  + CR+   K ++  APC  ++CTF+GVW+GG GAG +N+Y+SS F+ +
Sbjct  300   YDATASPQGAVYEKCREEIAKALNMNAPCNTKSCTFDGVWNGGRGAGQDNLYLSSSFHYV  359

Query  1077  ATDVGIIDQEKASKIVKPRSFLVAAKLACETKFEDVKSTFPNAVEKDYPYLCMDLVYEYT  1256
             AT VGIID +  S    P +F V AK  C+   ++VK  +P   +   PYLC+DL Y YT
Sbjct  360   ATRVGIIDGKLPSARSTPSAFRVVAKRVCQMSVKEVKVAYPMVEDISVPYLCLDLTYLYT  419

Query  1257  LLVDGLGLHPYKEITLMKKVEYKNYMVEAAWPLGCAIDVIS  1379
             +LVDG GL   K+ITL+ KV++  Y VEAAWPLG AI+ +S
Sbjct  420   VLVDGFGLKSIKKITLVSKVKHGEYYVEAAWPLGTAIEALS  460



>ref|XP_002461227.1| hypothetical protein SORBIDRAFT_02g043200 [Sorghum bicolor]
 gb|EER97748.1| hypothetical protein SORBIDRAFT_02g043200 [Sorghum bicolor]
Length=467

 Score =   426 bits (1095),  Expect = 3e-140, Method: Compositional matrix adjust.
 Identities = 212/403 (53%), Positives = 289/403 (72%), Gaps = 1/403 (0%)
 Frame = +3

Query  180   NYAVIFDAGSTGSRVHVFHFDENLDLLPIGDGVEFFLKTTPGLSSYANDPEAAAKSLEPL  359
              YAVIFDAGS+GSRVHVF FD NLDL+ IG  +E F++  PGLS+Y NDP  AA+SL  L
Sbjct  65    KYAVIFDAGSSGSRVHVFRFDSNLDLVHIGSEIELFVQKKPGLSAYGNDPREAAESLVSL  124

Query  360   LLEAEGVVPTELQPDTPLELGATAGLRLLEGDASDKILQAVRDMFKNESNFKSKAEWVSI  539
             L EA+ VVP EL+  TP+ +GATAGLR L    S+ ILQAVRD+ + +S+FK+K +WV++
Sbjct  125   LDEAKRVVPVELRDQTPVRVGATAGLRNLGAQKSEAILQAVRDLLREKSSFKNKEDWVTV  184

Query  540   LEGSQEGTYFWVAMNYLLGNLGKGYQNTIATIDLGGGSVQVSYAVSGDTFANAPTPDNGE  719
             L+G+QEG Y WV +NYLLGNLGK Y +T+  +DLGGGSVQ++YA++      AP P +GE
Sbjct  185   LDGTQEGAYEWVTINYLLGNLGKTYADTVGVVDLGGGSVQMAYAIAEKDAEKAPKPSDGE  244

Query  720   EPYVQEKYILGAQYYLYVHSYLNYGQLASRAEIFKA-SGNSTNPCVLEGYDGYYTYNDVS  896
             + YV++ ++ G  YYLYVHSYL+YG LA+RAE+ KA +GN  + C+LEG+ G Y Y D S
Sbjct  245   DAYVKKLFLKGTTYYLYVHSYLHYGLLAARAEVLKAGNGNGYSNCMLEGFQGQYKYGDDS  304

Query  897   YKVTAPPNGSSLKNCRKLARKVVDFRAPCKYQNCTFNGVWSGGGGAGMENVYISSFFYDI  1076
             ++ +A P+G+S   C+  A K +     C +  C+F G+W+GGGGAG +N++++SFF+D 
Sbjct  305   FEASASPSGASYSKCKDDAVKALKVDEACTHMKCSFGGIWNGGGGAGQKNLFVASFFFDR  364

Query  1077  ATDVGIIDQEKASKIVKPRSFLVAAKLACETKFEDVKSTFPNAVEKDYPYLCMDLVYEYT  1256
             A + G ++   A   VKP  F  AA+ AC    ++ ++TFP   + + PY+CMDLVY+YT
Sbjct  365   AAEAGFVNANAAVAKVKPSDFRQAAERACSLSVKNAEATFPGVPKDNIPYICMDLVYQYT  424

Query  1257  LLVDGLGLHPYKEITLMKKVEYKNYMVEAAWPLGCAIDVISSS  1385
             LLVDG G+ P  E+TL+KKV Y +  VEAAWPLG AI+V SSS
Sbjct  425   LLVDGFGVDPNHEMTLVKKVPYSDAYVEAAWPLGSAIEVASSS  467



>ref|XP_006297596.1| hypothetical protein CARUB_v10013618mg [Capsella rubella]
 gb|EOA30494.1| hypothetical protein CARUB_v10013618mg [Capsella rubella]
Length=471

 Score =   426 bits (1095),  Expect = 3e-140, Method: Compositional matrix adjust.
 Identities = 213/402 (53%), Positives = 289/402 (72%), Gaps = 1/402 (0%)
 Frame = +3

Query  180   NYAVIFDAGSTGSRVHVFHFDENLDLLPIGDGVEFFLKTTPGLSSYANDPEAAAKSLEPL  359
             NYAVIFDAGS+GSRVHV+ FD+NLDL+P+ + +E FL+  PGLS+Y NDP  +A SL  L
Sbjct  69    NYAVIFDAGSSGSRVHVYCFDQNLDLVPLENELELFLQLKPGLSAYPNDPRQSANSLVSL  128

Query  360   LLEAEGVVPTELQPDTPLELGATAGLRLLEGDASDKILQAVRDMFKNESNFKSKAEWVSI  539
             L +AE  VP EL+P TP+ +GATAGLR L   AS+ ILQAVR++ K+ S  K++A  V++
Sbjct  129   LDKAEASVPRELRPKTPVRVGATAGLRALGHKASENILQAVRELLKDRSRLKTEANAVTV  188

Query  540   LEGSQEGTYFWVAMNYLLGNLGKGYQNTIATIDLGGGSVQVSYAVSGDTFANAPTPDNGE  719
             L+G+QEG+Y WV +NYLL  LGK Y +T+  +DLGGGSVQ++YA+  +  A AP P  GE
Sbjct  189   LDGTQEGSYQWVTINYLLRTLGKPYSDTVGVVDLGGGSVQMAYAIPEEDAATAPKPLEGE  248

Query  720   EPYVQEKYILGAQYYLYVHSYLNYGQLASRAEIFKASGNSTNPCVLEGYDGYYTYNDVSY  899
             + YV+E Y+ G +Y+LYVHSYL+YG LA+RAEI K S +S NPC++ GY G Y Y   ++
Sbjct  249   DSYVREMYLKGRKYFLYVHSYLHYGLLAARAEILKVSEDSNNPCMVTGYAGNYKYGGKAF  308

Query  900   KVTAPPNGSSLKNCRKLARKVVDFR-APCKYQNCTFNGVWSGGGGAGMENVYISSFFYDI  1076
             K TA  +G+SL  CR++A   +    + C +  CTF GVW+GGGG G + ++++SFF+D 
Sbjct  309   KATASSSGASLDECRRVAINALKVNDSLCTHMKCTFGGVWNGGGGGGQKKMFVASFFFDR  368

Query  1077  ATDVGIIDQEKASKIVKPRSFLVAAKLACETKFEDVKSTFPNAVEKDYPYLCMDLVYEYT  1256
             A + G +D ++    V+P  F  AA  AC  + E+ KS FP+  E + PYLC+DLVY+YT
Sbjct  369   AAEAGFVDPKQPVAEVRPLDFEKAANKACSMRMEEGKSKFPHVEEDNLPYLCLDLVYQYT  428

Query  1257  LLVDGLGLHPYKEITLMKKVEYKNYMVEAAWPLGCAIDVISS  1382
             LLVDG GL P + ITL+KKV+Y +Y VEAAWPLG AI+ +SS
Sbjct  429   LLVDGFGLKPSQTITLVKKVKYGDYAVEAAWPLGSAIEAVSS  470



>ref|XP_010518233.1| PREDICTED: apyrase 1-like [Camelina sativa]
Length=468

 Score =   426 bits (1094),  Expect = 4e-140, Method: Compositional matrix adjust.
 Identities = 215/416 (52%), Positives = 292/416 (70%), Gaps = 8/416 (2%)
 Frame = +3

Query  159   LLSHETG-------NYAVIFDAGSTGSRVHVFHFDENLDLLPIGDGVEFFLKTTPGLSSY  317
             + SHE G       NYAVIFDAGS+GSRVHV+ FD+NLDL+P+ + +E FL+  PGLS+Y
Sbjct  52    MKSHEGGSNSRGPKNYAVIFDAGSSGSRVHVYCFDQNLDLVPLENELELFLQLKPGLSAY  111

Query  318   ANDPEAAAKSLEPLLLEAEGVVPTELQPDTPLELGATAGLRLLEGDASDKILQAVRDMFK  497
              NDP  +A SL  LL +AE  VP EL+P TP+ +GATAGLR L   AS+ ILQAVR++ K
Sbjct  112   PNDPRQSANSLVSLLDKAEASVPRELRPKTPVRVGATAGLRALGHKASENILQAVRELLK  171

Query  498   NESNFKSKAEWVSILEGSQEGTYFWVAMNYLLGNLGKGYQNTIATIDLGGGSVQVSYAVS  677
             + S  K++A  V++L+G+QEG+Y WV +NYLL  LGK Y +T+  +DLGGGSVQ++YA+S
Sbjct  172   DRSRLKTEANAVTVLDGTQEGSYQWVTINYLLRTLGKPYSDTVGVVDLGGGSVQMAYAIS  231

Query  678   GDTFANAPTPDNGEEPYVQEKYILGAQYYLYVHSYLNYGQLASRAEIFKASGNSTNPCVL  857
              +  A AP P  GE+ YV+E Y+ G +Y+LYVHSYL+YG LA+RAEI K S +S NPC++
Sbjct  232   EEDAATAPKPLEGEDSYVREMYLKGRKYFLYVHSYLHYGLLAARAEILKVSEDSNNPCIV  291

Query  858   EGYDGYYTYNDVSYKVTAPPNGSSLKNCRKLARKVVDFR-APCKYQNCTFNGVWSGGGGA  1034
              G+ G Y Y   ++K     +G+SL  CR++A   +    + C +  CTF GVW+GGGG 
Sbjct  292   TGHSGTYKYGGNAFKAIGSSSGASLDECRRVAINALKVNDSLCTHMKCTFGGVWNGGGGG  351

Query  1035  GMENVYISSFFYDIATDVGIIDQEKASKIVKPRSFLVAAKLACETKFEDVKSTFPNAVEK  1214
             G + ++++SFF+D A + G +D ++    V+P  F  AA  AC  + E+ KS FP   E 
Sbjct  352   GQKKIFVASFFFDRAAEAGFVDPKQPVAEVRPLDFEKAANKACNMRMEEGKSKFPRVEED  411

Query  1215  DYPYLCMDLVYEYTLLVDGLGLHPYKEITLMKKVEYKNYMVEAAWPLGCAIDVISS  1382
             + PYLC+DLVY+YTLLVDG GL P + ITL+KKV+Y +Y VEAAWPLG AI+ +SS
Sbjct  412   NLPYLCLDLVYQYTLLVDGFGLKPSQTITLVKKVKYGDYAVEAAWPLGSAIEAVSS  467



>gb|EAZ26787.1| hypothetical protein OsJ_10698 [Oryza sativa Japonica Group]
Length=505

 Score =   427 bits (1097),  Expect = 5e-140, Method: Compositional matrix adjust.
 Identities = 218/410 (53%), Positives = 291/410 (71%), Gaps = 2/410 (0%)
 Frame = +3

Query  162   LSHETGNYAVIFDAGSTGSRVHVFHFDENLDLLPIGDGVEFFLKTTPGLSSYANDPEAAA  341
             L   +  YAVIFDAGS+GSRVHV+ FD NLDLLPIG  +E F +  PGLS+YA DP+ AA
Sbjct  96    LGDGSTRYAVIFDAGSSGSRVHVYCFDGNLDLLPIGKEIELFKQKKPGLSAYAMDPQEAA  155

Query  342   KSLEPLLLEAEGVVPTELQPDTPLELGATAGLRLLEGDASDKILQAVRDMFKNESNFKSK  521
             KSL  LL EAE V+P EL+  TP+ +GATAGLR L  + S++ILQAVRD+ +++S+F+S+
Sbjct  156   KSLVSLLEEAEKVIPVELREQTPVRVGATAGLRALGTEKSEEILQAVRDLLQDKSSFRSQ  215

Query  522   AEWVSILEGSQEGTYFWVAMNYLLGNLGKGYQNTIATIDLGGGSVQVSYAVSGDTFANAP  701
              EWV++L+GSQEG + WV +NYLLGNLGK Y +T+  +DLGGGSVQ++YA+S      AP
Sbjct  216   PEWVTVLDGSQEGAFQWVTINYLLGNLGKPYSHTVGVVDLGGGSVQMAYAISEKDAGKAP  275

Query  702   TPDNGEEPYVQEKYILGAQYYLYVHSYLNYGQLASRAEIFKA-SGNSTNPCVLEGYDGYY  878
                 GE+ YV+E  + G  YYLYVHSYL YG LA+RAEI KA  GN    C+LEG+ G Y
Sbjct  276   PVAEGEDSYVKELLLKGTTYYLYVHSYLRYGLLAARAEILKAGEGNDYRNCMLEGHHGQY  335

Query  879   TYNDVSYKVTAPPNGSSLKNCRKLARKVVDFRAP-CKYQNCTFNGVWSGGGGAGMENVYI  1055
              Y D  ++ +   +G+S   CR +A + +    P C +  CTF GVW+GGGG G +N+++
Sbjct  336   RYGDDIFEASGLSSGASYSKCRAVAVRALKVDEPACTHMKCTFGGVWNGGGGDGQKNLFV  395

Query  1056  SSFFYDIATDVGIIDQEKASKIVKPRSFLVAAKLACETKFEDVKSTFPNAVEKDYPYLCM  1235
             +SFF+D A + G ++ +     VKP  F  AA+  C+   +D ++T+P+  E++ PYLCM
Sbjct  396   ASFFFDRAAEAGFVNPKAPFAKVKPSDFEEAARRVCKLNVKDAQATYPDVSEENVPYLCM  455

Query  1236  DLVYEYTLLVDGLGLHPYKEITLMKKVEYKNYMVEAAWPLGCAIDVISSS  1385
             DLVY+YTLLVDG G+ PY++ITL+KKV Y N  VEAAWPLG AI+V SSS
Sbjct  456   DLVYQYTLLVDGFGVDPYQDITLVKKVPYSNSFVEAAWPLGSAIEVASSS  505



>ref|NP_187058.1| apyrase 1 [Arabidopsis thaliana]
 sp|Q9SQG2.1|APY1_ARATH RecName: Full=Apyrase 1; Short=AtAPY1; AltName: Full=ATP-diphosphatase; 
AltName: Full=ATP-diphosphohydrolase; AltName: Full=Adenosine 
diphosphatase; Short=ADPase; AltName: Full=NTPDase; 
AltName: Full=Nucleoside triphosphate diphosphohydrolase 
1 [Arabidopsis thaliana]
 gb|AAF00071.1|AF093604_1 apyrase [Arabidopsis thaliana]
 gb|AAF26805.1|AC016829_29 apyrase (Atapy1) [Arabidopsis thaliana]
 gb|ABJ17092.1| At3g04080 [Arabidopsis thaliana]
 gb|AEE74035.1| apyrase 1 [Arabidopsis thaliana]
 gb|AFI41199.1| apyrase 1, partial [Arabidopsis thaliana]
Length=471

 Score =   425 bits (1093),  Expect = 5e-140, Method: Compositional matrix adjust.
 Identities = 213/402 (53%), Positives = 285/402 (71%), Gaps = 1/402 (0%)
 Frame = +3

Query  180   NYAVIFDAGSTGSRVHVFHFDENLDLLPIGDGVEFFLKTTPGLSSYANDPEAAAKSLEPL  359
             NYAVIFDAGS+GSRVHV+ FD+NLDL+P+ + +E FL+  PGLS+Y NDP  +A SL  L
Sbjct  69    NYAVIFDAGSSGSRVHVYCFDQNLDLVPLENELELFLQLKPGLSAYPNDPRQSANSLVTL  128

Query  360   LLEAEGVVPTELQPDTPLELGATAGLRLLEGDASDKILQAVRDMFKNESNFKSKAEWVSI  539
             L +AE  VP EL+P TP+ +GATAGLR L   AS+ ILQAVR++ K  S  K++A  V++
Sbjct  129   LDKAEASVPRELRPKTPVRVGATAGLRALGHQASENILQAVRELLKGRSRLKTEANAVTV  188

Query  540   LEGSQEGTYFWVAMNYLLGNLGKGYQNTIATIDLGGGSVQVSYAVSGDTFANAPTPDNGE  719
             L+G+QEG+Y WV +NYLL  LGK Y +T+  +DLGGGSVQ++YA+  +  A AP P  GE
Sbjct  189   LDGTQEGSYQWVTINYLLRTLGKPYSDTVGVVDLGGGSVQMAYAIPEEDAATAPKPVEGE  248

Query  720   EPYVQEKYILGAQYYLYVHSYLNYGQLASRAEIFKASGNSTNPCVLEGYDGYYTYNDVSY  899
             + YV+E Y+ G +Y+LYVHSYL+YG LA+RAEI K S +S NPC+  GY G Y Y   ++
Sbjct  249   DSYVREMYLKGRKYFLYVHSYLHYGLLAARAEILKVSEDSNNPCIATGYAGTYKYGGKAF  308

Query  900   KVTAPPNGSSLKNCRKLARKVVDF-RAPCKYQNCTFNGVWSGGGGAGMENVYISSFFYDI  1076
             K  A P+G+SL  CR++A   +    + C +  CTF GVW+GGGG G + ++++SFF+D 
Sbjct  309   KAAASPSGASLDECRRVAINALKVNNSLCTHMKCTFGGVWNGGGGGGQKKMFVASFFFDR  368

Query  1077  ATDVGIIDQEKASKIVKPRSFLVAAKLACETKFEDVKSTFPNAVEKDYPYLCMDLVYEYT  1256
             A + G +D  +    V+P  F  AA  AC  + E+ KS FP   E + PYLC+DLVY+YT
Sbjct  369   AAEAGFVDPNQPVAEVRPLDFEKAANKACNMRMEEGKSKFPRVEEDNLPYLCLDLVYQYT  428

Query  1257  LLVDGLGLHPYKEITLMKKVEYKNYMVEAAWPLGCAIDVISS  1382
             LLVDG GL P + ITL+KKV+Y +Y VEAAWPLG AI+ +SS
Sbjct  429   LLVDGFGLKPSQTITLVKKVKYGDYAVEAAWPLGSAIEAVSS  470



>gb|AES80807.2| Nod factor-binding lectin-nucleotide phosphohydrolase [Medicago 
truncatula]
Length=457

 Score =   425 bits (1092),  Expect = 5e-140, Method: Compositional matrix adjust.
 Identities = 212/414 (51%), Positives = 295/414 (71%), Gaps = 3/414 (1%)
 Frame = +3

Query  150   RRVLLSHET-GNYAVIFDAGSTGSRVHVFHFDENLDLLPIGDGVEFFLKTTPGLSSYAND  326
             R++    ET  +YAV+FDAGSTGSRVHV+HFD+NLDLL IG+ VEF+ KTTPGLS+YA++
Sbjct  32    RKIFPKQETLTSYAVVFDAGSTGSRVHVYHFDQNLDLLHIGNDVEFYNKTTPGLSAYADN  91

Query  327   PEAAAKSLEPLLLEAEGVVPTELQPDTPLELGATAGLRLLEGDASDKILQAV--RDMFKN  500
             P+ AA+SL PLL +AE VVP  LQP TP++LGATAGLRLL+G++S+ IL+AV    + K 
Sbjct  92    PKEAAESLIPLLEQAERVVPVNLQPKTPVKLGATAGLRLLDGNSSELILEAVIVSSLLKK  151

Query  501   ESNFKSKAEWVSILEGSQEGTYFWVAMNYLLGNLGKGYQNTIATIDLGGGSVQVSYAVSG  680
              S F  +++ V I++G+QEG+Y WV +NY+LGNLGK +  T+A  DLGGGSVQ+ YAVS 
Sbjct  152   RSTFNVQSDAVGIIDGTQEGSYLWVTINYVLGNLGKDFSETVAVADLGGGSVQMVYAVSR  211

Query  681   DTFANAPTPDNGEEPYVQEKYILGAQYYLYVHSYLNYGQLASRAEIFKASGNSTNPCVLE  860
             +    AP    GE+PY+++  + G +YYLYVHSYL +G+ ASRAEI K +  S NPC+L 
Sbjct  212   EQAKKAPQVPQGEDPYIKKIVLKGKKYYLYVHSYLRFGKEASRAEILKVTNGSPNPCILA  271

Query  861   GYDGYYTYNDVSYKVTAPPNGSSLKNCRKLARKVVDFRAPCKYQNCTFNGVWSGGGGAGM  1040
             GY G YTY+   YK  +P +GS+   C+++  K +    PC Y  C+F G+W+GGGG+G 
Sbjct  272   GYHGTYTYSGEEYKAFSPASGSNFDECKEIILKALKVNDPCPYGKCSFGGIWNGGGGSGQ  331

Query  1041  ENVYISSFFYDIATDVGIIDQEKASKIVKPRSFLVAAKLACETKFEDVKSTFPNAVEKDY  1220
             + +Y++S FY + T V I D  K +  ++       A+  C+TK++D K+T+P   E   
Sbjct  332   KTLYVTSSFYYVPTGVNIADPNKPNSKIRIEDLKTGAEQVCKTKYKDAKATYPLIYEDSL  391

Query  1221  PYLCMDLVYEYTLLVDGLGLHPYKEITLMKKVEYKNYMVEAAWPLGCAIDVISS  1382
             PY C+DL+Y+YTL VDG GL P +EIT+  ++EY++ +V+AAWPLG AI+ ISS
Sbjct  392   PYACLDLIYQYTLFVDGFGLDPLQEITVANQIEYQDALVDAAWPLGNAIEAISS  445



>dbj|BAJ91877.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ88546.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=457

 Score =   424 bits (1091),  Expect = 8e-140, Method: Compositional matrix adjust.
 Identities = 212/412 (51%), Positives = 282/412 (68%), Gaps = 0/412 (0%)
 Frame = +3

Query  162   LSHETGNYAVIFDAGSTGSRVHVFHFDENLDLLPIGDGVEFFLKTTPGLSSYANDPEAAA  341
             L    G YAVIFDAGSTG+RVHVF FD+ ++L+ +GD +E F K  PGLSSYA  P+ AA
Sbjct  44    LKAAPGKYAVIFDAGSTGTRVHVFRFDKKMELVDVGDDIEVFAKVEPGLSSYAGRPQEAA  103

Query  342   KSLEPLLLEAEGVVPTELQPDTPLELGATAGLRLLEGDASDKILQAVRDMFKNESNFKSK  521
             KS+ PLL +A+  VP  L   TP++LGATAGLRL+  D +++IL+AVRD   +++ F+  
Sbjct  104   KSITPLLEKAKSAVPRWLMKKTPVKLGATAGLRLIGDDKAEQILEAVRDAVHSKTKFQYN  163

Query  522   AEWVSILEGSQEGTYFWVAMNYLLGNLGKGYQNTIATIDLGGGSVQVSYAVSGDTFANAP  701
               W+++L+GSQEG+Y WVA+NYLLG LG  Y  T+A IDLGGGSVQ++YA+S +  A AP
Sbjct  164   PSWINVLKGSQEGSYLWVALNYLLGKLGGDYSKTVAVIDLGGGSVQMAYAISANAAAAAP  223

Query  702   TPDNGEEPYVQEKYILGAQYYLYVHSYLNYGQLASRAEIFKASGNSTNPCVLEGYDGYYT  881
             T    E+PYV ++Y+ G  Y +YVHSYL+YG  ASR EIFKA     + CVL GYDG YT
Sbjct  224   TVPQREDPYVTKEYLKGKDYNVYVHSYLHYGAQASRVEIFKAKNGPVSYCVLRGYDGKYT  283

Query  882   YNDVSYKVTAPPNGSSLKNCRKLARKVVDFRAPCKYQNCTFNGVWSGGGGAGMENVYISS  1061
             YN   Y   A P G++ + CR+   + +   APC  +NCTFNG W+GGGG G   +Y++S
Sbjct  284   YNGEQYDAIAAPQGAAYEKCREDVTRALRISAPCAAKNCTFNGAWNGGGGPGQAELYVTS  343

Query  1062  FFYDIATDVGIIDQEKASKIVKPRSFLVAAKLACETKFEDVKSTFPNAVEKDYPYLCMDL  1241
              FY +A DVG+ID E +S    P +F  AA+  C   F + K+ +P     D PY+CMDL
Sbjct  344   SFYYMAADVGLIDSEASSGKTTPAAFRAAAEEICPMSFLEAKAAYPKVRSVDAPYICMDL  403

Query  1242  VYEYTLLVDGLGLHPYKEITLMKKVEYKNYMVEAAWPLGCAIDVISSSSANN  1397
             VY+Y+LLVDG GL P KEIT+ +KV++  Y +EAAWPLG AI+ +S +   N
Sbjct  404   VYQYSLLVDGFGLEPTKEITVAQKVKHGEYFIEAAWPLGEAIEAVSPTKRLN  455



>ref|XP_009399920.1| PREDICTED: probable apyrase 2 isoform X2 [Musa acuminata subsp. 
malaccensis]
Length=470

 Score =   424 bits (1091),  Expect = 1e-139, Method: Compositional matrix adjust.
 Identities = 216/405 (53%), Positives = 288/405 (71%), Gaps = 4/405 (1%)
 Frame = +3

Query  174   TGNYAVIFDAGSTGSRVHVFHFDENLDLLPIGDGVEFFLKTTPGLSSYANDPEAAAKSLE  353
             + +YAVIFDAGS+GSRVHV+ FD NLDLL IG  +E F + TPGLS YA +P+ AA SL 
Sbjct  67    SKSYAVIFDAGSSGSRVHVYCFDVNLDLLSIGKEIELFEQRTPGLSFYAKNPQEAANSLL  126

Query  354   PLLLEAEGVVPTELQPDTPLELGATAGLRLLEGDASDKILQAVRDMFKNESNFKSKAEWV  533
             PLL +AE V+P EL+  TP+ +GATAGLR L    +++ILQAVRD+ + +S+ K +++WV
Sbjct  127   PLLEKAESVIPAELRRTTPVRVGATAGLRALGAVTAEQILQAVRDLLRQKSSLKFQSDWV  186

Query  534   SILEGSQEGTYFWVAMNYLLGNLGKGYQNTIATIDLGGGSVQVSYAVSGDTFANAPTPDN  713
             ++L+G+QEG + WV +NYLLG LGK Y +T+  +DLGGGSVQ++YA+S +  ANAP   N
Sbjct  187   TVLDGTQEGAFQWVTINYLLGKLGKSYWDTVGVVDLGGGSVQMAYAISENDAANAPKISN  246

Query  714   GEEPYVQEKYILGAQYYLYVHSYLNYGQLASRAEIFKAS-GNSTNPCVLEGYDGYYTYND  890
              E  YVQ+ ++ G  Y+LYVHSYL+YG LA RAEI KA+ GNS   C+L+GY+G Y Y +
Sbjct  247   EEHSYVQQLFLKGTSYHLYVHSYLHYGLLAVRAEILKAADGNSK--CILDGYNGSYKYGE  304

Query  891   VSYKVTAPPNGSSLKNCRKLARKVVDFRAP-CKYQNCTFNGVWSGGGGAGMENVYISSFF  1067
               YK  A P+G+S   CR    K +    P C +  CTF GVW+GGGG G  N++++SFF
Sbjct  305   KEYKAVASPSGASYSKCRSDTIKALKVDEPTCTHMKCTFGGVWNGGGGDGQRNLFVASFF  364

Query  1068  YDIATDVGIIDQEKASKIVKPRSFLVAAKLACETKFEDVKSTFPNAVEKDYPYLCMDLVY  1247
             +D A + G +D +     VKP  F V AK AC+   E  K+T+P   + + PYLCMDLVY
Sbjct  365   FDRAVEAGFVDHKVPVAKVKPAEFKVVAKHACKLNVEKAKATYPRVQDNNLPYLCMDLVY  424

Query  1248  EYTLLVDGLGLHPYKEITLMKKVEYKNYMVEAAWPLGCAIDVISS  1382
             ++TLLVDG GL PY+EITL+KKV+Y +  VEAAWPLG AI+V S+
Sbjct  425   QFTLLVDGFGLDPYQEITLVKKVKYGDAFVEAAWPLGSAIEVAST  469



>gb|EEC67580.1| hypothetical protein OsI_34933 [Oryza sativa Indica Group]
Length=457

 Score =   424 bits (1089),  Expect = 1e-139, Method: Compositional matrix adjust.
 Identities = 209/401 (52%), Positives = 276/401 (69%), Gaps = 2/401 (0%)
 Frame = +3

Query  177   GNYAVIFDAGSTGSRVHVFHFDENLDLLPIGDGVEFFLKTTPGLSSYANDPEAAAKSLEP  356
             G YAVI DAGSTG+RVHVF FD+ +DLL IGD +E F K  PGLSSYA  P+ AAKS+ P
Sbjct  51    GRYAVILDAGSTGTRVHVFRFDKKIDLLKIGDDIEVFAKVDPGLSSYAGRPQEAAKSIMP  110

Query  357   LLLEAEGVVPTELQPDTPLELGATAGLRLLEGDASDKILQAVRDMFKNESNFKSKAEWVS  536
             LL  A   VPT L   TPLELGATAGLRL+  D +++IL+AVRD+   ++ F+    W++
Sbjct  111   LLDRANHAVPTWLMNKTPLELGATAGLRLIGDDKANQILEAVRDVVHTKTKFQYNPNWIN  170

Query  537   ILEGSQEGTYFWVAMNYLLGNLGKGYQNTIATIDLGGGSVQVSYAVSGDTFANAPTPDNG  716
             +L GSQEG+Y WVA+NYLL  LG  Y  T+  IDLGGGSVQ++YA+S  T ANAP   +G
Sbjct  171   VLSGSQEGSYMWVALNYLLDRLGGDYSKTVGVIDLGGGSVQMAYAISTGTAANAPEVLDG  230

Query  717   EEPYVQEKYILGAQYYLYVHSYLNYGQLASRAEIFKASGNSTNPCVLEGYDGYYTYNDVS  896
             ++PY+ ++Y+ G  Y +YVHSYL+YG  ASR EI K    + + C+L G+ G Y YN   
Sbjct  231   QDPYITKEYLKGRDYNVYVHSYLHYGARASRVEILKRKNGTFSNCMLRGFSGKYIYNGEQ  290

Query  897   YKVTAPPNGSSLKNCRKLARKVVDFRAPCKYQNCTFNGVWSGGGGAGMENVYISSFFYDI  1076
             Y  TA P G+    CR    K ++  APC+  NC+FNGVW+GGGGAG + +Y+++ FY +
Sbjct  291   YDATAAPQGADYHKCRDDVVKALNLDAPCETNNCSFNGVWNGGGGAGQDELYVATSFYYM  350

Query  1077  ATDVGIIDQEKASKIVKPRSFLVAAKLACETKFEDVKSTFPNAVEKDYPYLCMDLVYEYT  1256
             A+D+G ID E  S    P ++ VAA+  C    E+ K+ +P A   D+ YLCMDLVY+YT
Sbjct  351   ASDIGFIDSEAPSAKSTPAAYKVAAEKVCSLSVEEAKAAYPRAC--DHAYLCMDLVYQYT  408

Query  1257  LLVDGLGLHPYKEITLMKKVEYKNYMVEAAWPLGCAIDVIS  1379
             LLVDG GL   KE+TL++KV++  Y +EAAWPLG AI+ +S
Sbjct  409   LLVDGFGLEATKEMTLVEKVKHGEYYIEAAWPLGTAIEAVS  449



>ref|XP_009125008.1| PREDICTED: apyrase 1-like [Brassica rapa]
Length=462

 Score =   424 bits (1089),  Expect = 2e-139, Method: Compositional matrix adjust.
 Identities = 211/405 (52%), Positives = 287/405 (71%), Gaps = 1/405 (0%)
 Frame = +3

Query  171   ETGNYAVIFDAGSTGSRVHVFHFDENLDLLPIGDGVEFFLKTTPGLSSYANDPEAAAKSL  350
             ++  YAVIFDAGS+GSRVHV+ FD+NLDL+P+ + +E FL+  PGLS+Y NDP  +A SL
Sbjct  57    DSKKYAVIFDAGSSGSRVHVYCFDKNLDLVPLENELELFLQLKPGLSAYPNDPRQSANSL  116

Query  351   EPLLLEAEGVVPTELQPDTPLELGATAGLRLLEGDASDKILQAVRDMFKNESNFKSKAEW  530
               LL +AE  VP EL+P T + +GATAGLR L  +AS+ ILQAVR++ K+ S  K++A  
Sbjct  117   VTLLDKAEDSVPNELRPKTHVRVGATAGLRALGHEASENILQAVRELLKDRSRLKTEANA  176

Query  531   VSILEGSQEGTYFWVAMNYLLGNLGKGYQNTIATIDLGGGSVQVSYAVSGDTFANAPTPD  710
             V++L+G+QEG+Y WV +NYLL  LGK Y  T+  +DLGGGSVQ++YA+S    A AP P 
Sbjct  177   VTVLDGTQEGSYQWVTINYLLKTLGKPYSETVGVVDLGGGSVQMAYAISEKDAATAPKPL  236

Query  711   NGEEPYVQEKYILGAQYYLYVHSYLNYGQLASRAEIFKASGNSTNPCVLEGYDGYYTYND  890
              GE+ YV+E Y+ G +Y+LYVHSYL+YG LA+RAEI K S  S NPC++ GYDG Y Y  
Sbjct  237   QGEDSYVREMYLKGRKYFLYVHSYLHYGLLAARAEILKVSEGSNNPCIVTGYDGTYKYGG  296

Query  891   VSYKVTAPPNGSSLKNCRKLARKVVD-FRAPCKYQNCTFNGVWSGGGGAGMENVYISSFF  1067
              ++K  A P+G+S+  C+++A K +    + C +  CTF GVW+GGGG G +N++++SFF
Sbjct  297   TAFKAAASPSGASVDECKRVALKALKVIDSVCTHMKCTFGGVWNGGGGGGQKNMFVASFF  356

Query  1068  YDIATDVGIIDQEKASKIVKPRSFLVAAKLACETKFEDVKSTFPNAVEKDYPYLCMDLVY  1247
             +D A + G +D  +    V+P  F  AA  AC  K  + K+ FP   E + PYLC+DLVY
Sbjct  357   FDRAAEAGFVDPSQPVATVRPADFEKAASQACNMKMGEGKTKFPRVEEDNLPYLCLDLVY  416

Query  1248  EYTLLVDGLGLHPYKEITLMKKVEYKNYMVEAAWPLGCAIDVISS  1382
             +YTLLVDG GL P + ITL+KKV+Y  + VEAAWPLG AI+ +SS
Sbjct  417   QYTLLVDGFGLKPSQTITLVKKVKYGEHAVEAAWPLGSAIEAVSS  461



>gb|EMT14858.1| Nucleoside-triphosphatase [Aegilops tauschii]
Length=526

 Score =   426 bits (1094),  Expect = 2e-139, Method: Compositional matrix adjust.
 Identities = 210/423 (50%), Positives = 283/423 (67%), Gaps = 21/423 (5%)
 Frame = +3

Query  177   GNYAVIFDAGSTGSRVHVFHFDENLDLLPIGDGVEFFLKTTPGLSSYANDPEAAAKSLEP  356
             G YAVIFDAGSTG+RVHVF FD+ +DL+ IGD +E + K  PGLSSYA  P+ AAKS+ P
Sbjct  44    GKYAVIFDAGSTGTRVHVFQFDKKMDLVEIGDDIEVYAKVEPGLSSYAGRPQEAAKSIIP  103

Query  357   LLLEAEGVVPTELQPDTPLELGATAGLRLLEGDASDKILQAVRDMFKNESNFKSKAEWVS  536
             LL +A+  VP  L   TP++LGATAGLRL+  D +++IL+AVRD+  ++S F+    W++
Sbjct  104   LLDKAKSTVPRWLMGKTPVKLGATAGLRLIGDDKAEQILEAVRDVIHSKSKFQYNPSWIN  163

Query  537   ILEGSQEGTYFW---------------------VAMNYLLGNLGKGYQNTIATIDLGGGS  653
             ++EGSQEG+Y W                     VA+NYLLG LG  Y  T+  IDLGGGS
Sbjct  164   VIEGSQEGSYIWVYATTATVVAAANSTTDLVADVALNYLLGKLGGDYVKTVGVIDLGGGS  223

Query  654   VQVSYAVSGDTFANAPTPDNGEEPYVQEKYILGAQYYLYVHSYLNYGQLASRAEIFKASG  833
             VQ++YA+S    A AP   +G+EPYV ++Y+ G  Y +Y +SYL+YG LASR EIFKAS 
Sbjct  224   VQMTYAISSAAAAAAPVVSDGKEPYVTKEYLKGRDYNVYAYSYLHYGALASRVEIFKASN  283

Query  834   NSTNPCVLEGYDGYYTYNDVSYKVTAPPNGSSLKNCRKLARKVVDFRAPCKYQNCTFNGV  1013
                N C+L G++G YTYN   Y   APP G++   CR+   K +   APC+ +NCTFN V
Sbjct  284   GPFNYCMLRGFNGKYTYNGEQYDAIAPPQGAAYDKCREDITKALKLNAPCETKNCTFNSV  343

Query  1014  WSGGGGAGMENVYISSFFYDIATDVGIIDQEKASKIVKPRSFLVAAKLACETKFEDVKST  1193
             WSGGGGAG+ ++YI++ FY  A+ VG+ID E +S    P ++  AA+  C   F++ K  
Sbjct  344   WSGGGGAGLSDLYITTSFYYTASQVGLIDSEASSAKTTPAAWRAAAEKICPLSFKEAKDA  403

Query  1194  FPNAVEKDYPYLCMDLVYEYTLLVDGLGLHPYKEITLMKKVEYKNYMVEAAWPLGCAIDV  1373
             +P     D PY+CMDL+Y+Y+LLVDG GL P KEIT+ +KV+Y  Y +EAAWPLG AI+ 
Sbjct  404   YPRVRAIDTPYICMDLIYQYSLLVDGFGLEPTKEITVAEKVKYGEYFIEAAWPLGEAIEG  463

Query  1374  ISS  1382
             + +
Sbjct  464   VQN  466



>ref|XP_006658972.1| PREDICTED: probable apyrase 2-like [Oryza brachyantha]
Length=423

 Score =   421 bits (1083),  Expect = 4e-139, Method: Compositional matrix adjust.
 Identities = 208/402 (52%), Positives = 288/402 (72%), Gaps = 1/402 (0%)
 Frame = +3

Query  180   NYAVIFDAGSTGSRVHVFHFDENLDLLPIGDGVEFFLKTTPGLSSYANDPEAAAKSLEPL  359
              YAVIFDAGS+GSRVHVF FD  LDLL IGD +E F++  PGLS+YA DP+ AA+SL PL
Sbjct  22    RYAVIFDAGSSGSRVHVFRFDGKLDLLHIGDDIELFVQKKPGLSAYAKDPQEAAESLVPL  81

Query  360   LLEAEGVVPTELQPDTPLELGATAGLRLLEGDASDKILQAVRDMFKNESNFKSKAEWVSI  539
             L +A+ VVP EL+  TP+ +GATAGLR L  + S++ILQAVRD+ + +S+FK++ +WV++
Sbjct  82    LEDAKRVVPAELRDKTPVRVGATAGLRALGAEKSEQILQAVRDLLREKSSFKTQPDWVTV  141

Query  540   LEGSQEGTYFWVAMNYLLGNLGKGYQNTIATIDLGGGSVQVSYAVSGDTFANAPTPDNGE  719
             L+G+QEG Y WV +NYLLG LGK Y +T+  +DLGGGSVQ++YA++      AP P  GE
Sbjct  142   LDGTQEGAYEWVTINYLLGKLGKTYADTVGVVDLGGGSVQMAYAIAEKDAGKAPKPSEGE  201

Query  720   EPYVQEKYILGAQYYLYVHSYLNYGQLASRAEIFKA-SGNSTNPCVLEGYDGYYTYNDVS  896
             + YV++ ++ GA YYLYVHSYL+YG LA+RAEI KA +G   + C L+G+ G Y Y D  
Sbjct  202   DTYVKKLFLKGATYYLYVHSYLHYGLLAARAEILKAGNGKGYSYCTLKGHQGQYKYGDGK  261

Query  897   YKVTAPPNGSSLKNCRKLARKVVDFRAPCKYQNCTFNGVWSGGGGAGMENVYISSFFYDI  1076
             ++  A P+G+S   C+    K +     C +  C+F G+W+GGGGAG +N++++SFF+D 
Sbjct  262   FEALASPSGASFSKCKADVVKALKVDQACTHMKCSFGGIWNGGGGAGQKNLFVASFFFDR  321

Query  1077  ATDVGIIDQEKASKIVKPRSFLVAAKLACETKFEDVKSTFPNAVEKDYPYLCMDLVYEYT  1256
             A + G ++ + A   VKP  F  AAK AC+   +D ++ +P   + + PY+CMDLVY+YT
Sbjct  322   AAEAGFVNPKAAVAKVKPSDFEKAAKRACKLNLKDAEAAYPGVQKDNIPYICMDLVYQYT  381

Query  1257  LLVDGLGLHPYKEITLMKKVEYKNYMVEAAWPLGCAIDVISS  1382
             LLVDG G+  ++E+TL+KKV Y N  VEAAWPLG AI+V SS
Sbjct  382   LLVDGFGVGSHQEMTLVKKVPYSNAFVEAAWPLGSAIEVASS  423



>gb|EEC75177.1| hypothetical protein OsI_11404 [Oryza sativa Indica Group]
Length=489

 Score =   423 bits (1087),  Expect = 8e-139, Method: Compositional matrix adjust.
 Identities = 218/410 (53%), Positives = 289/410 (70%), Gaps = 2/410 (0%)
 Frame = +3

Query  162   LSHETGNYAVIFDAGSTGSRVHVFHFDENLDLLPIGDGVEFFLKTTPGLSSYANDPEAAA  341
             L   +  YAVIFDAGS+GSRVHV+ FD NLDLLPIG  +E F +  PGLS+YA DP+ AA
Sbjct  80    LGDGSTRYAVIFDAGSSGSRVHVYCFDGNLDLLPIGKEIELFKQKKPGLSAYAMDPQEAA  139

Query  342   KSLEPLLLEAEGVVPTELQPDTPLELGATAGLRLLEGDASDKILQAVRDMFKNESNFKSK  521
             KSL  LL EAE VVP EL+  TP+ +GATAGLR L  + S++ILQAVRD+ +++S+F+S+
Sbjct  140   KSLVSLLEEAEKVVPVELREQTPVRVGATAGLRALGTEKSEEILQAVRDLLQDKSSFRSQ  199

Query  522   AEWVSILEGSQEGTYFWVAMNYLLGNLGKGYQNTIATIDLGGGSVQVSYAVSGDTFANAP  701
              EWV++L+GSQEG + WV +NYLLGNLGK Y +T+  +DLGGGSVQ++YA+S      AP
Sbjct  200   PEWVTVLDGSQEGAFQWVTINYLLGNLGKPYSHTVGVVDLGGGSVQMAYAISEKDAGKAP  259

Query  702   TPDNGEEPYVQEKYILGAQYYLYVHSYLNYGQLASRAEIFKA-SGNSTNPCVLEGYDGYY  878
                 GE+ YV+E  + G  YYLYVHSYL YG LA+RAEI KA  GN    C+LE   G Y
Sbjct  260   PVAEGEDSYVKELLLKGTTYYLYVHSYLRYGLLAARAEILKAGEGNDYRNCMLEDIMGQY  319

Query  879   TYNDVSYKVTAPPNGSSLKNCRKLARKVVDFRAP-CKYQNCTFNGVWSGGGGAGMENVYI  1055
              Y D  ++ +   +G+S   CR +A + +    P C +  CTF GVW+GGGG G +N+++
Sbjct  320   RYGDDIFEASGLSSGASYSKCRAVAVRALKVDEPACTHMKCTFGGVWNGGGGDGQKNLFV  379

Query  1056  SSFFYDIATDVGIIDQEKASKIVKPRSFLVAAKLACETKFEDVKSTFPNAVEKDYPYLCM  1235
             +SFF+D A + G ++ +     VKP  F  AA+  C+   +D ++T+P+  E++ PYLCM
Sbjct  380   ASFFFDRAAEAGFVNPKAPFAKVKPSDFEEAARRVCKLNVKDAQATYPDVSEENVPYLCM  439

Query  1236  DLVYEYTLLVDGLGLHPYKEITLMKKVEYKNYMVEAAWPLGCAIDVISSS  1385
             DLVY+YTLLVDG G+ PY++ITL+KKV Y N  VEAAWPLG AI+V SSS
Sbjct  440   DLVYQYTLLVDGFGVDPYQDITLVKKVPYSNSFVEAAWPLGSAIEVASSS  489



>ref|XP_008365001.1| PREDICTED: apyrase 2-like [Malus domestica]
Length=468

 Score =   421 bits (1083),  Expect = 2e-138, Method: Compositional matrix adjust.
 Identities = 227/416 (55%), Positives = 301/416 (72%), Gaps = 3/416 (1%)
 Frame = +3

Query  138   RPHLRRVLLSHETGNYAVIFDAGSTGSRVHVFHFDENLDLLPIGDGVEFFLKTTPGLSSY  317
             R  L R L S  +  YAVIFDAGS+GSR+HVF FD NL LLPIG  +E FL+  PGLS+Y
Sbjct  54    RNQLPRKLPSKTS--YAVIFDAGSSGSRIHVFCFDHNLQLLPIGKDLELFLQVKPGLSAY  111

Query  318   ANDPEAAAKSLEPLLLEAEGVVPTELQPDTPLELGATAGLRLLEGDASDKILQAVRDMFK  497
             A DP +AA+SL  LL +AE  VP EL+  TP+ +GATAGLR LEGDASD+ILQAVRD+ K
Sbjct  112   AKDPRSAAESLTGLLDKAESAVPKELRSFTPVRVGATAGLRALEGDASDRILQAVRDLLK  171

Query  498   NESNFKSKAEWVSILEGSQEGTYFWVAMNYLLGNLGKGYQNTIATIDLGGGSVQVSYAVS  677
               S+  S+ + V++++G+QEG++ WV +NYLLGNLGK Y +T+  +DLGGGSVQ++YA+S
Sbjct  172   QRSSLSSRPDAVTVIDGTQEGSFQWVTINYLLGNLGKKYSDTVGVVDLGGGSVQMAYAIS  231

Query  678   GDTFANAPTPDNGEEPYVQEKYILGAQYYLYVHSYLNYGQLASRAEIFKASGNSTNPCVL  857
                 A AP   +GE+ YV++  + G +Y LYVHSYL+YG LA+RAEI K S +S NPC+L
Sbjct  232   EADAAKAPKLSDGEDVYVRQMNLKGVKYNLYVHSYLHYGLLAARAEILKVSEDSGNPCIL  291

Query  858   EGYDGYYTYNDVSYKVTAPPNGSSLKNCRKLARKVVDF-RAPCKYQNCTFNGVWSGGGGA  1034
              GY G Y Y   SYK +A  +GSS++ CR++  K +    A C +  CTF GVW+GGGG 
Sbjct  292   AGYYGSYAYGGQSYKASASSSGSSVEECRRVVTKALKVNEATCSHMKCTFGGVWNGGGGD  351

Query  1035  GMENVYISSFFYDIATDVGIIDQEKASKIVKPRSFLVAAKLACETKFEDVKSTFPNAVEK  1214
             G  N++++SFF+D A + G ++  +    V P +F  AAK ACETK ED KST+P   E 
Sbjct  352   GQRNLFVASFFFDRAAEAGFVNPNEPIAKVHPGNFEEAAKRACETKLEDAKSTYPRVEEG  411

Query  1215  DYPYLCMDLVYEYTLLVDGLGLHPYKEITLMKKVEYKNYMVEAAWPLGCAIDVISS  1382
             + P+LCMDLVY+ +LLVDG GL P+++ITL+KKV+Y+N +VEAAWPLG AI+ +SS
Sbjct  412   NLPFLCMDLVYQSSLLVDGFGLDPWQDITLVKKVKYQNSLVEAAWPLGSAIEAVSS  467



>dbj|BAD13517.1| apyrase [Pisum sativum]
Length=455

 Score =   421 bits (1082),  Expect = 2e-138, Method: Compositional matrix adjust.
 Identities = 214/413 (52%), Positives = 288/413 (70%), Gaps = 2/413 (0%)
 Frame = +3

Query  150   RRVLLSHE-TGNYAVIFDAGSTGSRVHVFHFDENLDLLPIGDGVEFFLKTTPGLSSYAND  326
             R++ L  E   +YAV+FDAGSTGSR+HV+HF++NLDLL IG GVE++ K TPGLSSYAN+
Sbjct  32    RKIFLKQEEISSYAVVFDAGSTGSRIHVYHFNQNLDLLHIGKGVEYYNKITPGLSSYANN  91

Query  327   PEAAAKSLEPLLLEAEGVVPTELQPDTPLELGATAGLRLLEGDASDKILQAVRDMFKNES  506
             PE AAKSL PLL + E VVP +LQP TP+ LGA AGLRLL GDA +KILQ+VRDM  N S
Sbjct  92    PEQAAKSLIPLLEQGEDVVPDDLQPITPVRLGAPAGLRLLNGDAFEKILQSVRDMLSNRS  151

Query  507   NFKSKAEWVSILEGSQEGTYFWVAMNYLLGNLGKGYQNTIATIDLGGGSVQVSYAVSGDT  686
              F  +    SI++G+ +G+Y WV +NY LGNLGK     +  IDLGGGSVQ++YAVS  T
Sbjct  152   TFNVQPHXASIIDGTHDGSYLWVTVNYALGNLGKRSTKPVGVIDLGGGSVQMAYAVSKKT  211

Query  687   FANAPTPDNGEEPYVQEKYILGAQYYLYVHSYLNYGQLASRAEIFKASGNSTNPCVLEGY  866
               NAP   +G++PY+++  + G  Y LYVHSYL+ G+ A RAEI K +  S NPC+L G+
Sbjct  212   AKNAPKVADGDDPYIKKVVLKGIPYDLYVHSYLHLGREAFRAEILKLTPRSPNPCLLAGF  271

Query  867   DGYYTYNDVSYKVTAPPNGSSLKNCRKLARKVVDFRAPCKYQNCTFNGVWSGGGGAGMEN  1046
             +G YTY+   +K TA  +G++   C+   RK +    PC YQNCTF G+W+GGGG   +N
Sbjct  272   NGIYTYSGEEFKETAYTSGANFNKCKNTIRKALKLNYPCPYQNCTFGGIWNGGGGNEQKN  331

Query  1047  VYISSFFYDIATDVGIIDQEKASKIVKPRSFLVAAKLACETKFEDVKSTFPNAVEKDYP-  1223
             ++  S F+ +  D G++D    + I++P      AK AC   FED KST+P   +K+   
Sbjct  332   LFACSSFFYLPEDTGMVDASTPNFILRPVDIETKAKEACALNFEDAKSTYPFLDKKNVAS  391

Query  1224  YLCMDLVYEYTLLVDGLGLHPYKEITLMKKVEYKNYMVEAAWPLGCAIDVISS  1382
             Y+CMDL+Y+Y LLVDG GL P ++IT  K++EY++ +VEAAWPLG A++ IS+
Sbjct  392   YVCMDLIYQYVLLVDGFGLDPLQKITSGKEIEYQDAIVEAAWPLGNAVEAISA  444



>ref|XP_006664294.1| PREDICTED: probable apyrase 3-like [Oryza brachyantha]
Length=455

 Score =   420 bits (1080),  Expect = 3e-138, Method: Compositional matrix adjust.
 Identities = 205/401 (51%), Positives = 281/401 (70%), Gaps = 2/401 (0%)
 Frame = +3

Query  177   GNYAVIFDAGSTGSRVHVFHFDENLDLLPIGDGVEFFLKTTPGLSSYANDPEAAAKSLEP  356
             G YAVI DAGSTG+RVHVF FD+ +DLL IGD +E F K  PGLSSYA  P+ AAKS+ P
Sbjct  49    GRYAVILDAGSTGTRVHVFRFDKKMDLLKIGDDIEVFAKVNPGLSSYAGRPQEAAKSILP  108

Query  357   LLLEAEGVVPTELQPDTPLELGATAGLRLLEGDASDKILQAVRDMFKNESNFKSKAEWVS  536
             LL +A   VP  L   TPLELGATAGLRL+  + +++IL+AVRD+  ++S F+    W++
Sbjct  109   LLDKANHAVPAGLMNKTPLELGATAGLRLIGDEKANQILEAVRDVVHSKSKFQYDPNWIN  168

Query  537   ILEGSQEGTYFWVAMNYLLGNLGKGYQNTIATIDLGGGSVQVSYAVSGDTFANAPTPDNG  716
             +L GSQEG+Y WVA+NYLL  LG  Y  T+  IDLGGGSVQ++YA+S  T ANAP   +G
Sbjct  169   VLTGSQEGSYMWVALNYLLDRLGGDYSETVGVIDLGGGSVQMAYAISSSTAANAPRVPHG  228

Query  717   EEPYVQEKYILGAQYYLYVHSYLNYGQLASRAEIFKASGNSTNPCVLEGYDGYYTYNDVS  896
             ++PYV ++Y+ G  Y +YVHSYL+YG  A+R E+ K      + C+L G++G YTYN   
Sbjct  229   QDPYVTKEYLKGRDYNVYVHSYLHYGARAARVEVLKRKNGPFSNCMLRGFNGKYTYNGEE  288

Query  897   YKVTAPPNGSSLKNCRKLARKVVDFRAPCKYQNCTFNGVWSGGGGAGMENVYISSFFYDI  1076
             Y   A P G+    CR+   K ++ +APC+  +CTFNGVW+GGGGAG + +Y++S FY +
Sbjct  289   YDAMAAPQGADYHKCRQDVVKALNLKAPCQTNSCTFNGVWNGGGGAGQDELYVASSFYFM  348

Query  1077  ATDVGIIDQEKASKIVKPRSFLVAAKLACETKFEDVKSTFPNAVEKDYPYLCMDLVYEYT  1256
             A+D+  ID    S    P ++  AA+  C+   ++ K+ +P+A  +D+ YLCMDLVY+YT
Sbjct  349   ASDIRFIDNNAPSAKSTPAAYKDAAEKVCKLSVQEAKAVYPSA--RDHAYLCMDLVYQYT  406

Query  1257  LLVDGLGLHPYKEITLMKKVEYKNYMVEAAWPLGCAIDVIS  1379
             LLVDG GL P K+ITL++KV+++ Y +EAAWPLG AI+ +S
Sbjct  407   LLVDGFGLAPTKKITLVEKVKHEEYYIEAAWPLGTAIEAVS  447



>dbj|BAD13519.1| apyrase [Pisum sativum]
Length=455

 Score =   419 bits (1078),  Expect = 5e-138, Method: Compositional matrix adjust.
 Identities = 223/413 (54%), Positives = 296/413 (72%), Gaps = 2/413 (0%)
 Frame = +3

Query  150   RRVLLSHE-TGNYAVIFDAGSTGSRVHVFHFDENLDLLPIGDGVEFFLKTTPGLSSYAND  326
             R++ L  E   +YAV+FDAGSTGSR+HV+HF++NLDLL IG GVE++ K TPGLSSYAN+
Sbjct  32    RKIFLKQEEISSYAVVFDAGSTGSRIHVYHFNQNLDLLHIGKGVEYYNKITPGLSSYANN  91

Query  327   PEAAAKSLEPLLLEAEGVVPTELQPDTPLELGATAGLRLLEGDASDKILQAVRDMFKNES  506
             PE AAKSL PLL +AE VVP +LQP TP+ LGA AGLRLL GDAS+KILQ+VRDM  N S
Sbjct  92    PEQAAKSLIPLLEQAEDVVPDDLQPKTPVRLGALAGLRLLNGDASEKILQSVRDMLSNRS  151

Query  507   NFKSKAEWVSILEGSQEGTYFWVAMNYLLGNLGKGYQNTIATIDLGGGSVQVSYAVSGDT  686
              F  + + VSI++G+QEG+Y WV +NY LGNLGK Y  T+  IDLGGGSVQ++YAVS  T
Sbjct  152   TFNVQPDAVSIIDGTQEGSYLWVTVNYALGNLGKKYTKTVGVIDLGGGSVQMAYAVSKKT  211

Query  687   FANAPTPDNGEEPYVQEKYILGAQYYLYVHSYLNYGQLASRAEIFKASGNSTNPCVLEGY  866
               NAP   +G++PY+++  + G  Y LYVHSYL++G+ ASRAEI K +  S NPC+L G+
Sbjct  212   AKNAPKVADGDDPYIKKVVLKGIPYDLYVHSYLHFGREASRAEILKLTPRSPNPCLLAGF  271

Query  867   DGYYTYNDVSYKVTAPPNGSSLKNCRKLARKVVDFRAPCKYQNCTFNGVWSGGGGAGMEN  1046
             +G YTY+   +K TA   G++   C+   RK +    PC YQNCTF G+W+GGGG G + 
Sbjct  272   NGIYTYSGREFKATAYTFGATFNKCKNTIRKALKLNYPCPYQNCTFGGIWNGGGGNGQKT  331

Query  1047  VYISSFFYDIATDVGIIDQEKASKIVKPRSFLVAAKLACETKFEDVKSTFPNAVEKDYP-  1223
             +  SS F+ +  D G++D    + I++P      AK AC   FED KST+P   +K+   
Sbjct  332   LVASSSFFYLPEDAGMVDASTPNFILRPVDIETKAKEACALNFEDAKSTYPFLDKKNVAS  391

Query  1224  YLCMDLVYEYTLLVDGLGLHPYKEITLMKKVEYKNYMVEAAWPLGCAIDVISS  1382
             Y+CMDL+Y+Y LLVDG GL P ++IT  K++EY++ +VEAAWPLG A++ IS+
Sbjct  392   YVCMDLIYQYVLLVDGFGLDPLQKITSGKEIEYQDAIVEAAWPLGNAVEAISA  444



>ref|XP_008782749.1| PREDICTED: probable apyrase 2 [Phoenix dactylifera]
Length=472

 Score =   420 bits (1080),  Expect = 5e-138, Method: Compositional matrix adjust.
 Identities = 217/405 (54%), Positives = 292/405 (72%), Gaps = 4/405 (1%)
 Frame = +3

Query  174   TGNYAVIFDAGSTGSRVHVFHFDENLDLLPIGDGVEFFLKTTPGLSSYANDPEAAAKSLE  353
             + +YAVIFDAGS+GSRVHV+ FDE LDLL IG+ +E F++  PGLS++A DP+ AA SL 
Sbjct  69    SKSYAVIFDAGSSGSRVHVYCFDEKLDLLHIGEEIELFIQIKPGLSAFAKDPQEAANSLI  128

Query  354   PLLLEAEGVVPTELQPDTPLELGATAGLRLLEGDASDKILQAVRDMFKNESNFKSKAEWV  533
             PLL +AE VVP +L+  TP+ +GATAGLR L  + S+KILQAVRD+ K +S+ K + +WV
Sbjct  129   PLLDKAESVVPADLREKTPVRVGATAGLRALGAETSEKILQAVRDLLKGKSSLKFQDDWV  188

Query  534   SILEGSQEGTYFWVAMNYLLGNLGKGYQNTIATIDLGGGSVQVSYAVSGDTFANAPTPDN  713
             S+L+G+QEG + WV +NYLLGNLGK Y +T+  +DLGGGSVQ++YA+S +  A AP   +
Sbjct  189   SVLDGAQEGAFQWVTINYLLGNLGKTYSDTVGVVDLGGGSVQMAYAISEEDAAKAPKVTD  248

Query  714   GEEPYVQEKYILGAQYYLYVHSYLNYGQLASRAEIFKASGNSTNPCVLEGYDGYYTYNDV  893
             GE+ YV++ ++ G +YYLYVHSYL+YG LA RAEI KA G+  + C+L GY G Y Y D 
Sbjct  249   GEDTYVKQLFLKGTKYYLYVHSYLHYGLLAGRAEILKA-GDDYSTCILNGYRGKYKYGDE  307

Query  894   SYKVTAPPNGSSLKNCRKLARKV--VDFRAPCKYQNCTFNGVWSGGGGAGMENVYISSFF  1067
              YK  A  +G+SL  CR  A K   VD R  C +  CTF GVW+GGGGAG +N++++SFF
Sbjct  308   VYKALAAHSGASLSKCRSDAIKALKVDGRV-CTHMKCTFGGVWNGGGGAGQKNLFVASFF  366

Query  1068  YDIATDVGIIDQEKASKIVKPRSFLVAAKLACETKFEDVKSTFPNAVEKDYPYLCMDLVY  1247
             +D A + G ID +     V+P  F  AAK AC+   +D K+T+ +   ++ P+LCMDLVY
Sbjct  367   FDRAAEAGFIDPKVPVAKVRPSDFEEAAKRACKLNVDDAKTTYSHVSVENLPFLCMDLVY  426

Query  1248  EYTLLVDGLGLHPYKEITLMKKVEYKNYMVEAAWPLGCAIDVISS  1382
             +YTLLVDG  L P++EITL+K+V Y +  VEAAWPLG AI+  S+
Sbjct  427   QYTLLVDGFALDPHQEITLVKQVPYGDAFVEAAWPLGSAIEAASA  471



>gb|ACB38287.1| apyrase [Lolium perenne]
Length=454

 Score =   419 bits (1078),  Expect = 7e-138, Method: Compositional matrix adjust.
 Identities = 208/408 (51%), Positives = 286/408 (70%), Gaps = 0/408 (0%)
 Frame = +3

Query  162   LSHETGNYAVIFDAGSTGSRVHVFHFDENLDLLPIGDGVEFFLKTTPGLSSYANDPEAAA  341
             L+   G YAVIFDAGSTG+RVHVFHFD+ ++L+ IGD +E F K  PGLS+YA  P+ AA
Sbjct  41    LAAAPGKYAVIFDAGSTGTRVHVFHFDKRMELVEIGDDIEVFAKVQPGLSAYAGRPQEAA  100

Query  342   KSLEPLLLEAEGVVPTELQPDTPLELGATAGLRLLEGDASDKILQAVRDMFKNESNFKSK  521
              S+ PLL  A+ +VP  L   TPL+LGATAGLR++  + +++IL+AVRD+   +SNF+  
Sbjct  101   TSIVPLLETAKTIVPRWLMRRTPLKLGATAGLRIIGEEQAEQILEAVRDVVHTKSNFQYN  160

Query  522   AEWVSILEGSQEGTYFWVAMNYLLGNLGKGYQNTIATIDLGGGSVQVSYAVSGDTFANAP  701
               W+++LEGSQEG+Y WVA+NYLL  LG  Y  T+  IDLGG SVQ++YA+S DT A+AP
Sbjct  161   PSWINVLEGSQEGSYLWVALNYLLDKLGGDYAKTVGVIDLGGASVQMAYAISPDTAASAP  220

Query  702   TPDNGEEPYVQEKYILGAQYYLYVHSYLNYGQLASRAEIFKASGNSTNPCVLEGYDGYYT  881
                +G++PYV ++Y+ G  Y +Y HSYL+YG  ASR EIFKA   S + C+L G+ G YT
Sbjct  221   VKPDGKDPYVTKEYLKGRDYNVYAHSYLHYGSDASRVEIFKAKNGSFSNCMLRGFIGNYT  280

Query  882   YNDVSYKVTAPPNGSSLKNCRKLARKVVDFRAPCKYQNCTFNGVWSGGGGAGMENVYISS  1061
             YN   Y  TA P G++ + CR+   K ++  APC+ +NCTFNG W+GGGGAG  ++Y+ S
Sbjct  281   YNGDQYDATASPQGAAYERCREDVTKALNLSAPCETRNCTFNGAWNGGGGAGQADLYVMS  340

Query  1062  FFYDIATDVGIIDQEKASKIVKPRSFLVAAKLACETKFEDVKSTFPNAVEKDYPYLCMDL  1241
              FY +A+ VG+ID +  S    P +F  AA+  C   FE+ K+ +P     + PY+CMDL
Sbjct  341   SFYYMASQVGLIDGDATSGKTTPAAFRAAAEEICPLSFEESKAAYPRVRASNAPYVCMDL  400

Query  1242  VYEYTLLVDGLGLHPYKEITLMKKVEYKNYMVEAAWPLGCAIDVISSS  1385
             VY+YTLLVDG GL P KE+T+++KV++  Y +EA WPLG AI+ +S +
Sbjct  401   VYQYTLLVDGFGLEPTKEVTVVQKVKHGEYFIEAKWPLGEAIEAVSDT  448



>ref|XP_004291701.1| PREDICTED: apyrase 2-like [Fragaria vesca subsp. vesca]
Length=456

 Score =   419 bits (1077),  Expect = 7e-138, Method: Compositional matrix adjust.
 Identities = 222/402 (55%), Positives = 297/402 (74%), Gaps = 3/402 (1%)
 Frame = +3

Query  180   NYAVIFDAGSTGSRVHVFHFDENLDLLPIGDGVEFFLKTTPGLSSYANDPEAAAKSLEPL  359
             +YAVIFDAGS+GSRVHVF FD NL+LLPIG  +E FL+T PGLSSYA++P +AA SL  L
Sbjct  55    SYAVIFDAGSSGSRVHVFCFDHNLNLLPIGKDLELFLQTKPGLSSYASNPRSAALSLSDL  114

Query  360   LLEAEGVVPTELQPDTPLELGATAGLRLLEGDASDKILQAVRDMFKNESNFKSKAEWVSI  539
             L +AE  VP +L+P TP+ +GATAGLR L  DAS++ILQAVRD+ K  S+  S+ + V++
Sbjct  115   LHKAEAAVPKDLRPFTPVRVGATAGLRALGVDASNRILQAVRDLLKQSSSLSSQPDAVTV  174

Query  540   LEGSQEGTYFWVAMNYLLGNLGKGYQNTIATIDLGGGSVQVSYAVSGDTFANAPTPDNGE  719
             ++G+QEG++ WV +NYLLGNLGK Y +T+  +DLGGGSVQ++YA+S    A AP   +GE
Sbjct  175   IDGTQEGSFQWVTINYLLGNLGKEYSDTVGVVDLGGGSVQMAYAISEADAAKAPKLSDGE  234

Query  720   EPYVQEKYILGAQYYLYVHSYLNYGQLASRAEIFKASGNSTNPCVLEGYDGYYTYNDVSY  899
             + YV++  + G  Y LYVHSYL+YG LA+RAEI K S +S NPC+LEGY+G Y Y   S+
Sbjct  235   DIYVRKMSLKGTNYNLYVHSYLHYGLLAARAEILKVSEDSGNPCILEGYNGSYNYGGESF  294

Query  900   KVTAPPNGSSLKNCRKLARKVVDFRA-PCKYQNCTFNGVWSGGGGAGMENVYISSFFYDI  1076
             K  A  +GSS+  CR++A K +      C +  CTF GVW+GGGG G  N++++SFF+D 
Sbjct  295   K--ASSSGSSIDGCRRVATKALKVNEDTCTHMKCTFGGVWNGGGGDGQRNLFVASFFFDR  352

Query  1077  ATDVGIIDQEKASKIVKPRSFLVAAKLACETKFEDVKSTFPNAVEKDYPYLCMDLVYEYT  1256
             A + G ++ ++    V P  F  AAK AC+TK ED KST+P+  + + PYLCMDLVY+YT
Sbjct  353   AAEAGFVNAKEPVAKVHPGDFEEAAKRACQTKLEDAKSTYPHVDKDNLPYLCMDLVYQYT  412

Query  1257  LLVDGLGLHPYKEITLMKKVEYKNYMVEAAWPLGCAIDVISS  1382
             LLVDG G+ P++EITL+KKV+Y N +VEAAWPLG AI+ +SS
Sbjct  413   LLVDGFGIDPWQEITLVKKVKYNNALVEAAWPLGSAIEAVSS  454



>gb|EEE52675.1| hypothetical protein OsJ_35057 [Oryza sativa Japonica Group]
Length=457

 Score =   419 bits (1077),  Expect = 8e-138, Method: Compositional matrix adjust.
 Identities = 208/401 (52%), Positives = 275/401 (69%), Gaps = 2/401 (0%)
 Frame = +3

Query  177   GNYAVIFDAGSTGSRVHVFHFDENLDLLPIGDGVEFFLKTTPGLSSYANDPEAAAKSLEP  356
             G YAVI DAGSTG+RVHVF FD+ +DLL IGD +E F K  PGLSSYA  P+ AAKS+ P
Sbjct  51    GRYAVILDAGSTGTRVHVFRFDKKIDLLKIGDDIEVFAKVDPGLSSYAGRPQEAAKSIMP  110

Query  357   LLLEAEGVVPTELQPDTPLELGATAGLRLLEGDASDKILQAVRDMFKNESNFKSKAEWVS  536
             LL  A   VPT L   TPLELGATAGLRL+  D +++IL+AVRD+   ++ F+    W++
Sbjct  111   LLDRANHAVPTWLMNKTPLELGATAGLRLIGDDKANQILEAVRDVVHTKTKFQYNPNWIN  170

Query  537   ILEGSQEGTYFWVAMNYLLGNLGKGYQNTIATIDLGGGSVQVSYAVSGDTFANAPTPDNG  716
             +L GSQEG+Y WVA+NYLL  LG  Y  T+  IDLGGGSVQ++YA+S  T ANAP   +G
Sbjct  171   VLSGSQEGSYMWVALNYLLDRLGGDYSKTVGVIDLGGGSVQMAYAISTGTAANAPEVLDG  230

Query  717   EEPYVQEKYILGAQYYLYVHSYLNYGQLASRAEIFKASGNSTNPCVLEGYDGYYTYNDVS  896
             ++PY+ ++Y+    Y +YVHSYL+YG  ASR EI K    + + C+L G+ G Y YN   
Sbjct  231   QDPYIIKEYLKERDYNVYVHSYLHYGARASRVEILKRKNGTFSNCMLRGFSGKYIYNGEQ  290

Query  897   YKVTAPPNGSSLKNCRKLARKVVDFRAPCKYQNCTFNGVWSGGGGAGMENVYISSFFYDI  1076
             Y  TA P G+    CR    K ++  APC+  NC+FNGVW+GGGGAG + +Y+++ FY +
Sbjct  291   YDATAAPQGADYHKCRDDVVKALNLDAPCETNNCSFNGVWNGGGGAGQDELYVATSFYYM  350

Query  1077  ATDVGIIDQEKASKIVKPRSFLVAAKLACETKFEDVKSTFPNAVEKDYPYLCMDLVYEYT  1256
             A+D+G ID E  S    P ++ VAA+  C    E+ K+ +P A   D+ YLCMDLVY+YT
Sbjct  351   ASDIGFIDSEAPSAKSTPAAYKVAAEKVCSLSVEEAKAAYPRAC--DHAYLCMDLVYQYT  408

Query  1257  LLVDGLGLHPYKEITLMKKVEYKNYMVEAAWPLGCAIDVIS  1379
             LLVDG GL   KE+TL++KV++  Y +EAAWPLG AI+ +S
Sbjct  409   LLVDGFGLEATKEMTLVEKVKHGEYYIEAAWPLGTAIEAVS  449



>ref|XP_002884427.1| ATAPY1 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH60686.1| ATAPY1 [Arabidopsis lyrata subsp. lyrata]
Length=471

 Score =   420 bits (1079),  Expect = 8e-138, Method: Compositional matrix adjust.
 Identities = 212/402 (53%), Positives = 288/402 (72%), Gaps = 1/402 (0%)
 Frame = +3

Query  180   NYAVIFDAGSTGSRVHVFHFDENLDLLPIGDGVEFFLKTTPGLSSYANDPEAAAKSLEPL  359
             NYAVIFDAGS+GSRVHV+ FD+NLDL+P+ + +E FL+  PGLS+Y NDP  +A SL  L
Sbjct  69    NYAVIFDAGSSGSRVHVYCFDQNLDLVPLENELELFLQLKPGLSAYPNDPRQSANSLVSL  128

Query  360   LLEAEGVVPTELQPDTPLELGATAGLRLLEGDASDKILQAVRDMFKNESNFKSKAEWVSI  539
             L +AE  VP EL+P TP+ +GATAGLR L   AS+ ILQAVR++ K+ S  K++A  V++
Sbjct  129   LDKAEASVPRELRPKTPVRVGATAGLRALGHQASENILQAVRELLKDRSRLKTEANAVTV  188

Query  540   LEGSQEGTYFWVAMNYLLGNLGKGYQNTIATIDLGGGSVQVSYAVSGDTFANAPTPDNGE  719
             L+G+QEG+Y WV +NYLL  LGK Y +T+  +DLGGGSVQ++YA+  +  A AP P  GE
Sbjct  189   LDGAQEGSYQWVTINYLLRTLGKPYSDTVGVVDLGGGSVQMAYAIPEEDAATAPKPLEGE  248

Query  720   EPYVQEKYILGAQYYLYVHSYLNYGQLASRAEIFKASGNSTNPCVLEGYDGYYTYNDVSY  899
             + YV+E Y+ G +Y+LYVHSYL+YG LA+RAEI K S +S NPC++ G+ G Y Y   ++
Sbjct  249   DSYVKEMYLKGRKYFLYVHSYLHYGLLAARAEILKVSEDSNNPCIVTGFAGTYKYGGKAF  308

Query  900   KVTAPPNGSSLKNCRKLARKVVDFR-APCKYQNCTFNGVWSGGGGAGMENVYISSFFYDI  1076
             K  A P+G+SL  CR++A   +    + C +  CTF GVW+GGGG G + ++++SFF+D 
Sbjct  309   KAAAAPSGASLDECRRVAINALKVNDSLCTHMKCTFGGVWNGGGGGGQKKMFVASFFFDR  368

Query  1077  ATDVGIIDQEKASKIVKPRSFLVAAKLACETKFEDVKSTFPNAVEKDYPYLCMDLVYEYT  1256
             A + G +D ++    V+P  F  AA  AC  + E+ KS FP   E + PYLC+DLVY+YT
Sbjct  369   AAEAGFVDPKQPVAEVRPLDFEKAANKACNMRMEEGKSKFPRVEEDNLPYLCLDLVYQYT  428

Query  1257  LLVDGLGLHPYKEITLMKKVEYKNYMVEAAWPLGCAIDVISS  1382
             LLVDG GL P + ITL+KKV+Y +Y VEAAWPLG AI+ +SS
Sbjct  429   LLVDGFGLKPSQTITLVKKVKYGDYAVEAAWPLGSAIEAVSS  470



>gb|EMT30219.1| Nucleoside-triphosphatase [Aegilops tauschii]
Length=463

 Score =   419 bits (1077),  Expect = 1e-137, Method: Compositional matrix adjust.
 Identities = 210/414 (51%), Positives = 285/414 (69%), Gaps = 2/414 (0%)
 Frame = +3

Query  162   LSHETGNYAVIFDAGSTGSRVHVFHFDENLDLLPIGDG--VEFFLKTTPGLSSYANDPEA  335
             L    G YAVIFDAGSTG+RVHVF FD+ ++L+ IGDG  +E F K  PGLS+YA  P+ 
Sbjct  48    LKAAPGKYAVIFDAGSTGTRVHVFRFDKKMELIDIGDGDDIEVFAKVEPGLSAYAGRPQE  107

Query  336   AAKSLEPLLLEAEGVVPTELQPDTPLELGATAGLRLLEGDASDKILQAVRDMFKNESNFK  515
             AAKS+ PLL +A+  VP  L   TP++LGATAGLRL+  + +++IL+AVRD   ++S F+
Sbjct  108   AAKSIVPLLEKAKSTVPRWLMKKTPVKLGATAGLRLIGDEKAEQILEAVRDAVHSQSKFQ  167

Query  516   SKAEWVSILEGSQEGTYFWVAMNYLLGNLGKGYQNTIATIDLGGGSVQVSYAVSGDTFAN  695
                 W+++L+GSQEG+Y WVA+NYLLGNLG  Y  T+  IDLGGGSVQ++YA+S D  A 
Sbjct  168   YNPSWINVLKGSQEGSYLWVALNYLLGNLGGDYSKTVGVIDLGGGSVQMAYAISADAAAA  227

Query  696   APTPDNGEEPYVQEKYILGAQYYLYVHSYLNYGQLASRAEIFKASGNSTNPCVLEGYDGY  875
             AP    G++PYV ++Y+ G  Y +YVHSYL+YG +ASR EIFKA     + C+L GY+G 
Sbjct  228   APGVPQGDDPYVTKEYLKGRDYNVYVHSYLHYGAMASRVEIFKAKNGPVSYCMLRGYNGK  287

Query  876   YTYNDVSYKVTAPPNGSSLKNCRKLARKVVDFRAPCKYQNCTFNGVWSGGGGAGMENVYI  1055
             YTYN   Y   APP G++   CR+   + +   APC+ +NCTFNG W+GGGG G  ++Y+
Sbjct  288   YTYNGEQYDAIAPPQGAAYDKCREDVTRALKISAPCQAKNCTFNGAWNGGGGPGQADLYV  347

Query  1056  SSFFYDIATDVGIIDQEKASKIVKPRSFLVAAKLACETKFEDVKSTFPNAVEKDYPYLCM  1235
             +S FY +A+DVG+ID E  S    P +F  AA+  C   F + K+ +P     D PY+CM
Sbjct  348   TSSFYYMASDVGLIDSEATSGKTTPAAFRAAAEKICPMGFVEAKAAYPKVRSADAPYICM  407

Query  1236  DLVYEYTLLVDGLGLHPYKEITLMKKVEYKNYMVEAAWPLGCAIDVISSSSANN  1397
             DL+Y+Y+LLVDG GL P KEIT+ +KV++  Y +EAAW LG AI+ +S +   N
Sbjct  408   DLIYQYSLLVDGFGLEPTKEITVAQKVKHGEYFIEAAWALGEAIEAVSPTKRLN  461



>ref|XP_009399919.1| PREDICTED: probable apyrase 2 isoform X1 [Musa acuminata subsp. 
malaccensis]
Length=472

 Score =   419 bits (1077),  Expect = 1e-137, Method: Compositional matrix adjust.
 Identities = 216/407 (53%), Positives = 288/407 (71%), Gaps = 6/407 (1%)
 Frame = +3

Query  174   TGNYAVIFDAGSTGSRVHVFHFDENLDLLPIGDGVEFFLKTTPGLSSYANDPEAAAKSLE  353
             + +YAVIFDAGS+GSRVHV+ FD NLDLL IG  +E F + TPGLS YA +P+ AA SL 
Sbjct  67    SKSYAVIFDAGSSGSRVHVYCFDVNLDLLSIGKEIELFEQRTPGLSFYAKNPQEAANSLL  126

Query  354   PLLLEAEGVVPTELQPDTPLELGATAGLRLLEGDASDKILQAVR--DMFKNESNFKSKAE  527
             PLL +AE V+P EL+  TP+ +GATAGLR L    +++ILQAVR  D+ + +S+ K +++
Sbjct  127   PLLEKAESVIPAELRRTTPVRVGATAGLRALGAVTAEQILQAVRFLDLLRQKSSLKFQSD  186

Query  528   WVSILEGSQEGTYFWVAMNYLLGNLGKGYQNTIATIDLGGGSVQVSYAVSGDTFANAPTP  707
             WV++L+G+QEG + WV +NYLLG LGK Y +T+  +DLGGGSVQ++YA+S +  ANAP  
Sbjct  187   WVTVLDGTQEGAFQWVTINYLLGKLGKSYWDTVGVVDLGGGSVQMAYAISENDAANAPKI  246

Query  708   DNGEEPYVQEKYILGAQYYLYVHSYLNYGQLASRAEIFKAS-GNSTNPCVLEGYDGYYTY  884
              N E  YVQ+ ++ G  Y+LYVHSYL+YG LA RAEI KA+ GNS   C+L+GY+G Y Y
Sbjct  247   SNEEHSYVQQLFLKGTSYHLYVHSYLHYGLLAVRAEILKAADGNSK--CILDGYNGSYKY  304

Query  885   NDVSYKVTAPPNGSSLKNCRKLARKVVDFRAP-CKYQNCTFNGVWSGGGGAGMENVYISS  1061
              +  YK  A P+G+S   CR    K +    P C +  CTF GVW+GGGG G  N++++S
Sbjct  305   GEKEYKAVASPSGASYSKCRSDTIKALKVDEPTCTHMKCTFGGVWNGGGGDGQRNLFVAS  364

Query  1062  FFYDIATDVGIIDQEKASKIVKPRSFLVAAKLACETKFEDVKSTFPNAVEKDYPYLCMDL  1241
             FF+D A + G +D +     VKP  F V AK AC+   E  K+T+P   + + PYLCMDL
Sbjct  365   FFFDRAVEAGFVDHKVPVAKVKPAEFKVVAKHACKLNVEKAKATYPRVQDNNLPYLCMDL  424

Query  1242  VYEYTLLVDGLGLHPYKEITLMKKVEYKNYMVEAAWPLGCAIDVISS  1382
             VY++TLLVDG GL PY+EITL+KKV+Y +  VEAAWPLG AI+V S+
Sbjct  425   VYQFTLLVDGFGLDPYQEITLVKKVKYGDAFVEAAWPLGSAIEVAST  471



>emb|CAN80801.1| hypothetical protein VITISV_019811 [Vitis vinifera]
Length=465

 Score =   419 bits (1076),  Expect = 2e-137, Method: Compositional matrix adjust.
 Identities = 215/417 (52%), Positives = 294/417 (71%), Gaps = 18/417 (4%)
 Frame = +3

Query  150   RRVLLSHETGNYAVIFDAGSTGSRVHVFHFDENLDLLPIGDGVEFFLKTTPGLSSYANDP  329
             R+     ++  YAVIFDAGS+GSRVHVF FD +L+L+ IG  +E FL+  PGLS+Y   P
Sbjct  59    RKASPHSQSRTYAVIFDAGSSGSRVHVFCFDSDLNLVHIGKDLELFLQRKPGLSAYPTXP  118

Query  330   EAAAKSLEPLLLEAEGVVPTELQPDTPLELGATAGLRLLEGDASDKILQA-----VRDMF  494
             + AA+SL PLL +AE VVP +L+  TP+++GATAGLR L  DASD+ILQA     V++  
Sbjct  119   QQAAESLLPLLDKAENVVPADLRRKTPVKVGATAGLRALGIDASDRILQALSVPKVKNFL  178

Query  495   KNESNFKSKAEWVSILEGSQEGTYFWVAMNYLLGNLGKGYQNTIATIDLGGGSVQVSYAV  674
             K++S  KSK EWV++L+GSQEG + WV +NYLLGNLG+ Y +T+  +DLGGGSVQ++YA+
Sbjct  179   KDKSTLKSKPEWVTVLDGSQEGAFQWVTINYLLGNLGRKYSHTVGVVDLGGGSVQMAYAI  238

Query  675   SGDTFANAPTPDNGEEPYVQEKYILGAQYYLYVHSYLNYGQLASRAEIFKASGNSTNPCV  854
             S      AP   +GE+ YV+E Y+ G +Y+LYVHSYL+YG LA+RAEI K   +S NPC+
Sbjct  239   SETAAEKAPKISDGEDTYVKEMYLKGTKYFLYVHSYLHYGLLAARAEILKVE-SSENPCL  297

Query  855   LEGYDGYYTYNDVSYKVTAPPNGSSLKNCRKLARKVVDF-RAPCKYQNCTFNGVWSGGGG  1031
             L G+ G YTY  V+Y+ +A P+GSS++ CR++A + +    + C +  CTF G+W+GGGG
Sbjct  298   LGGFHGTYTYGGVTYEASAHPSGSSMERCRRVAFRALKVNESTCTHMKCTFGGIWNGGGG  357

Query  1032  AGMENVYISSFFYDIATDVGIIDQEKASKIVKPRSFLVAAKLACETKFEDVKSTFPNAVE  1211
              G +N++            G +D+ +    V+P  F  AAK  CETK ED KS FP   E
Sbjct  358   DGQKNLF-----------AGFVDRNQPVAKVQPMDFEDAAKRVCETKLEDAKSKFPLVEE  406

Query  1212  KDYPYLCMDLVYEYTLLVDGLGLHPYKEITLMKKVEYKNYMVEAAWPLGCAIDVISS  1382
              + PYLCMDLVY++TLL+DG GL P++EITL+K+V+Y + +VEAAWPLG AID +SS
Sbjct  407   ANLPYLCMDLVYQFTLLIDGFGLDPWQEITLVKQVKYGDALVEAAWPLGSAIDAVSS  463



>ref|XP_004958720.1| PREDICTED: probable apyrase 2-like [Setaria italica]
Length=470

 Score =   419 bits (1076),  Expect = 2e-137, Method: Compositional matrix adjust.
 Identities = 210/402 (52%), Positives = 290/402 (72%), Gaps = 1/402 (0%)
 Frame = +3

Query  180   NYAVIFDAGSTGSRVHVFHFDENLDLLPIGDGVEFFLKTTPGLSSYANDPEAAAKSLEPL  359
              YAVIFDAGS+GSRVHVF FD NLDL+ IG  +E F++  PGLS+YA+DP  AA+SL  L
Sbjct  69    KYAVIFDAGSSGSRVHVFCFDANLDLVNIGSEIELFVQKKPGLSAYASDPREAAESLVSL  128

Query  360   LLEAEGVVPTELQPDTPLELGATAGLRLLEGDASDKILQAVRDMFKNESNFKSKAEWVSI  539
             L EA+ VVP EL+  TP+ +GATAGLR L  + S++ILQAVRD+ + +S+FK++A+WV++
Sbjct  129   LDEAKRVVPAELRDQTPVRVGATAGLRNLGAEKSEEILQAVRDLLREKSSFKNQADWVTV  188

Query  540   LEGSQEGTYFWVAMNYLLGNLGKGYQNTIATIDLGGGSVQVSYAVSGDTFANAPTPDNGE  719
             L+GSQEG Y WV +NYLLGNLGK Y +T+  +DLGGGSVQ++YA++       P P +GE
Sbjct  189   LDGSQEGAYEWVTINYLLGNLGKTYADTVGVVDLGGGSVQMAYAIAEKDAEKVPKPSDGE  248

Query  720   EPYVQEKYILGAQYYLYVHSYLNYGQLASRAEIFKA-SGNSTNPCVLEGYDGYYTYNDVS  896
             + YV++ Y+ G  Y LYVHSYL+YG LA+RAE+ KA +GN  + C+LEGY G Y Y   +
Sbjct  249   DTYVKKLYLKGTTYNLYVHSYLHYGLLAARAEVLKAGNGNGYSNCMLEGYQGQYKYGSET  308

Query  897   YKVTAPPNGSSLKNCRKLARKVVDFRAPCKYQNCTFNGVWSGGGGAGMENVYISSFFYDI  1076
             ++ +A P+G+S   C+  A K +     C +  C+F G+W+GGGGAG +N++++SFF+D 
Sbjct  309   FEASASPSGASYSKCKDDAVKALKVDEACTHMKCSFGGIWNGGGGAGQKNLFVASFFFDR  368

Query  1077  ATDVGIIDQEKASKIVKPRSFLVAAKLACETKFEDVKSTFPNAVEKDYPYLCMDLVYEYT  1256
             A +VG ++ + A   VKP  F  AAK AC+   +D ++ +P   + + PY+C+DLVY+YT
Sbjct  369   AAEVGFVNPKAAVAKVKPSDFEQAAKRACKLSVKDAEAAYPGVQKDNLPYICLDLVYQYT  428

Query  1257  LLVDGLGLHPYKEITLMKKVEYKNYMVEAAWPLGCAIDVISS  1382
             LLVDG G+ P  E+TL+KKV Y    VEAAWPLG AI+V SS
Sbjct  429   LLVDGFGVDPNHEMTLVKKVPYNGAYVEAAWPLGSAIEVASS  470



>emb|CDY29985.1| BnaC01g40230D [Brassica napus]
Length=757

 Score =   428 bits (1100),  Expect = 2e-137, Method: Compositional matrix adjust.
 Identities = 212/405 (52%), Positives = 289/405 (71%), Gaps = 1/405 (0%)
 Frame = +3

Query  171   ETGNYAVIFDAGSTGSRVHVFHFDENLDLLPIGDGVEFFLKTTPGLSSYANDPEAAAKSL  350
             ++  YAVIFDAGS+GSRVHV+ FD+NLDL+P+ + +E FL+  PGLS+Y NDP  +A SL
Sbjct  352   DSKKYAVIFDAGSSGSRVHVYCFDKNLDLVPLENELELFLQLKPGLSAYPNDPRQSANSL  411

Query  351   EPLLLEAEGVVPTELQPDTPLELGATAGLRLLEGDASDKILQAVRDMFKNESNFKSKAEW  530
               LL +AE  VP+EL+P TP+ +GATAGLR L  +AS+ ILQAVR++ K+ S  K++A  
Sbjct  412   VTLLDKAEDSVPSELRPKTPVRVGATAGLRALGHEASENILQAVRELLKDRSRLKTEANA  471

Query  531   VSILEGSQEGTYFWVAMNYLLGNLGKGYQNTIATIDLGGGSVQVSYAVSGDTFANAPTPD  710
             V++L+G+QEG+Y WV +NYLL  LGK Y  T+  +DLGGGSVQ++YA+S    A AP P 
Sbjct  472   VTVLDGTQEGSYQWVTINYLLKTLGKPYSETVGVVDLGGGSVQMAYAISEKDAATAPKPL  531

Query  711   NGEEPYVQEKYILGAQYYLYVHSYLNYGQLASRAEIFKASGNSTNPCVLEGYDGYYTYND  890
              GE+ YV+E Y+ G +Y+LYVHSYL+YG LA+RAEI K S  S NPC++ GYDG Y Y  
Sbjct  532   QGEDSYVREMYLKGRKYFLYVHSYLHYGLLAARAEILKVSEGSNNPCIVTGYDGTYKYGG  591

Query  891   VSYKVTAPPNGSSLKNCRKLARKVVDFR-APCKYQNCTFNGVWSGGGGAGMENVYISSFF  1067
              ++K  A P+G+S+  C+++A K +    + C +  CTF GVW+GGGG G +N++++SFF
Sbjct  592   TAFKAAASPSGASVDECKRVALKALKVNDSVCTHMKCTFGGVWNGGGGGGQKNMFVASFF  651

Query  1068  YDIATDVGIIDQEKASKIVKPRSFLVAAKLACETKFEDVKSTFPNAVEKDYPYLCMDLVY  1247
             +D A + G +D  +    V+P  F  AA  AC  K  + K+ FP   E + PYLC+DLVY
Sbjct  652   FDRAAEAGFVDPSQPVATVRPADFEKAASQACNMKMGEGKTKFPRVEEDNLPYLCLDLVY  711

Query  1248  EYTLLVDGLGLHPYKEITLMKKVEYKNYMVEAAWPLGCAIDVISS  1382
             +YTLLVDG GL P + ITL+KKV+Y  + VEAAWPLG AI+ +SS
Sbjct  712   QYTLLVDGFGLKPSQTITLVKKVKYGEHAVEAAWPLGSAIEAVSS  756



>gb|EEC68772.1| hypothetical protein OsI_37304 [Oryza sativa Indica Group]
Length=451

 Score =   417 bits (1073),  Expect = 3e-137, Method: Compositional matrix adjust.
 Identities = 204/401 (51%), Positives = 278/401 (69%), Gaps = 2/401 (0%)
 Frame = +3

Query  177   GNYAVIFDAGSTGSRVHVFHFDENLDLLPIGDGVEFFLKTTPGLSSYANDPEAAAKSLEP  356
             G YAVI DAGSTG+RVHVF FD  LDLL +GD +E F K  PGLSSYA  P+ AA S+ P
Sbjct  43    GRYAVILDAGSTGTRVHVFRFDNKLDLLKVGDNIELFAKVDPGLSSYAGRPQDAANSILP  102

Query  357   LLLEAEGVVPTELQPDTPLELGATAGLRLLEGDASDKILQAVRDMFKNESNFKSKAEWVS  536
             LL +A  VVP  L   TPL+LGATAGLRL+  + +++IL+AVRD+   +S ++    W++
Sbjct  103   LLDKANTVVPARLMNKTPLKLGATAGLRLIGDEKANQILEAVRDVVHTKSKYQYNPNWIN  162

Query  537   ILEGSQEGTYFWVAMNYLLGNLGKGYQNTIATIDLGGGSVQVSYAVSGDTFANAPTPDNG  716
             +LEGSQEG+Y WVA+NYLL  LG  Y  T+  +DLGGGSVQ++YA+S +T A AP    G
Sbjct  163   VLEGSQEGSYIWVALNYLLDKLGGDYSKTVGVVDLGGGSVQMAYAISSNTAATAPKVPEG  222

Query  717   EEPYVQEKYILGAQYYLYVHSYLNYGQLASRAEIFKASGNSTNPCVLEGYDGYYTYNDVS  896
             ++PYV ++Y+ G  Y +YVHSYL+YG  ASRA I +      + C+L G+ G +TYN   
Sbjct  223   KDPYVVKEYLKGKDYNIYVHSYLHYGGFASRAHILERKDGPFSNCMLRGFSGNFTYNGKQ  282

Query  897   YKVTAPPNGSSLKNCRKLARKVVDFRAPCKYQNCTFNGVWSGGGGAGMENVYISSFFYDI  1076
             Y  TA P+G+    CR+   K++   APC+ +NC+FNGVW+GGGGAG +++Y++S FY I
Sbjct  283   YDATAAPHGADYHKCREEVVKLLKVNAPCETKNCSFNGVWNGGGGAGQDDLYVASAFYYI  342

Query  1077  ATDVGIIDQEKASKIVKPRSFLVAAKLACETKFEDVKSTFPNAVEKDYPYLCMDLVYEYT  1256
             A+ VG I+ +  S    P +F   A+  C+   ++ K  +PN   +D+ YLCMDL+YEY+
Sbjct  343   ASHVGFINSDAPSAKSTPATFKAVAEKVCKLSVKEAKVEYPNV--RDHAYLCMDLIYEYS  400

Query  1257  LLVDGLGLHPYKEITLMKKVEYKNYMVEAAWPLGCAIDVIS  1379
             LLVDG GLHP KEITL+ KV++  Y ++AAWPLG AI+ +S
Sbjct  401   LLVDGFGLHPSKEITLVDKVKHGEYYIDAAWPLGTAIEAVS  441



>ref|NP_001066032.1| Os12g0123500 [Oryza sativa Japonica Group]
 sp|Q2QYE1.2|APY3_ORYSJ RecName: Full=Probable apyrase 3; Short=OsAPY3; AltName: Full=ATP-diphosphatase; 
AltName: Full=ATP-diphosphohydrolase; AltName: 
Full=Adenosine diphosphatase; Short=ADPase; Flags: Precursor 
[Oryza sativa Japonica Group]
 gb|ABA95698.2| GDA1/CD39 family protein, expressed [Oryza sativa Japonica Group]
 dbj|BAF29051.1| Os12g0123500 [Oryza sativa Japonica Group]
 gb|EEE52674.1| hypothetical protein OsJ_35056 [Oryza sativa Japonica Group]
Length=451

 Score =   417 bits (1072),  Expect = 5e-137, Method: Compositional matrix adjust.
 Identities = 204/401 (51%), Positives = 277/401 (69%), Gaps = 2/401 (0%)
 Frame = +3

Query  177   GNYAVIFDAGSTGSRVHVFHFDENLDLLPIGDGVEFFLKTTPGLSSYANDPEAAAKSLEP  356
             G YAVI DAGSTG+RVHVF FD  LDLL +GD +E F K  PGLSSYA  P+ AA S+ P
Sbjct  43    GRYAVILDAGSTGTRVHVFRFDNKLDLLKVGDNIELFAKVDPGLSSYAGRPQDAANSILP  102

Query  357   LLLEAEGVVPTELQPDTPLELGATAGLRLLEGDASDKILQAVRDMFKNESNFKSKAEWVS  536
             LL +A  VVP  L   TPL+LGATAGLRL+  + +++IL+AVRD+   +S ++    W++
Sbjct  103   LLDKANTVVPARLMNKTPLKLGATAGLRLIGDEKANQILEAVRDVVHTKSKYQYNPNWIN  162

Query  537   ILEGSQEGTYFWVAMNYLLGNLGKGYQNTIATIDLGGGSVQVSYAVSGDTFANAPTPDNG  716
             +LEGSQEG+Y WVA+NYLL  LG  Y  T+  +DLGGGSVQ++YA+S +T A AP    G
Sbjct  163   VLEGSQEGSYIWVALNYLLDKLGGDYSKTVGVVDLGGGSVQMAYAISSNTAATAPKVPEG  222

Query  717   EEPYVQEKYILGAQYYLYVHSYLNYGQLASRAEIFKASGNSTNPCVLEGYDGYYTYNDVS  896
             ++PYV ++Y+ G  Y +YVHSYL+YG  ASRA I +      + C+L G+ G +TYN   
Sbjct  223   KDPYVVKEYLKGKDYNIYVHSYLHYGGFASRAHILERKDGPFSNCMLRGFSGNFTYNGKQ  282

Query  897   YKVTAPPNGSSLKNCRKLARKVVDFRAPCKYQNCTFNGVWSGGGGAGMENVYISSFFYDI  1076
             Y  TA P G+    CR+   K++   APC+ +NC+FNGVW+GGGGAG +++Y++S FY I
Sbjct  283   YDATAAPQGADYHKCREEVVKLLKVNAPCETKNCSFNGVWNGGGGAGQDDLYVASAFYYI  342

Query  1077  ATDVGIIDQEKASKIVKPRSFLVAAKLACETKFEDVKSTFPNAVEKDYPYLCMDLVYEYT  1256
             A+ VG I+ +  S    P +F   A+  C+   ++ K  +PN   +D+ YLCMDL+YEY+
Sbjct  343   ASHVGFINSDAPSAKSTPATFKAVAEKVCKLSVKEAKVEYPNV--RDHAYLCMDLIYEYS  400

Query  1257  LLVDGLGLHPYKEITLMKKVEYKNYMVEAAWPLGCAIDVIS  1379
             LLVDG GLHP KEITL+ KV++  Y ++AAWPLG AI+ +S
Sbjct  401   LLVDGFGLHPSKEITLVDKVKHGEYYIDAAWPLGTAIEAVS  441



>gb|EMS57965.1| Nucleoside-triphosphatase [Triticum urartu]
Length=462

 Score =   417 bits (1072),  Expect = 6e-137, Method: Compositional matrix adjust.
 Identities = 211/422 (50%), Positives = 286/422 (68%), Gaps = 6/422 (1%)
 Frame = +3

Query  138   RPHLRRVLLSHETGNYAVIFDAGSTGSRVHVFHFDENLDLLPIGDG--VEFFLKTTPGLS  311
              P L++       G YAVIFDAGSTG+RVHVF FD+ ++L+ IGDG  +E F K  PGLS
Sbjct  43    EPELKKA----APGKYAVIFDAGSTGTRVHVFRFDKKMELIDIGDGDDIEVFAKVEPGLS  98

Query  312   SYANDPEAAAKSLEPLLLEAEGVVPTELQPDTPLELGATAGLRLLEGDASDKILQAVRDM  491
             +YA  P+ AAKS+ PLL +A+  VP  L   TP++LGATAGLRL+  + +++IL+AVRD 
Sbjct  99    AYAGRPQEAAKSIVPLLEKAKSTVPRWLMKKTPVKLGATAGLRLIGDEKAEQILEAVRDA  158

Query  492   FKNESNFKSKAEWVSILEGSQEGTYFWVAMNYLLGNLGKGYQNTIATIDLGGGSVQVSYA  671
               ++S F+    W+++L GSQEG+Y WVA+NYLLGNLG  Y  T+  IDLGGGSVQ++YA
Sbjct  159   VHSKSKFQYNPSWINVLTGSQEGSYLWVALNYLLGNLGGDYSKTVGVIDLGGGSVQMAYA  218

Query  672   VSGDTFANAPTPDNGEEPYVQEKYILGAQYYLYVHSYLNYGQLASRAEIFKASGNSTNPC  851
             +S D  A AP    G++PYV ++Y+ G  Y +YVHSYL+YG +ASR EIFKA     + C
Sbjct  219   ISADAAAAAPVVPQGDDPYVTKEYLKGRDYNVYVHSYLHYGAMASRVEIFKAKNGPVSYC  278

Query  852   VLEGYDGYYTYNDVSYKVTAPPNGSSLKNCRKLARKVVDFRAPCKYQNCTFNGVWSGGGG  1031
             +L GY+G YTYN   Y   APP G++   CR+   K +   APC+ +NCTFNG W+GGGG
Sbjct  279   MLRGYNGKYTYNGEQYDAVAPPQGAAYDKCREDVTKALKISAPCQAKNCTFNGAWNGGGG  338

Query  1032  AGMENVYISSFFYDIATDVGIIDQEKASKIVKPRSFLVAAKLACETKFEDVKSTFPNAVE  1211
              G  ++Y++S FY +A DVG+ID E  S    P +F  AA+  C   F + K+ +P    
Sbjct  339   PGQADLYVTSSFYYMAADVGLIDSEATSGKTTPAAFRAAAEKICPMGFVEAKAAYPKVRS  398

Query  1212  KDYPYLCMDLVYEYTLLVDGLGLHPYKEITLMKKVEYKNYMVEAAWPLGCAIDVISSSSA  1391
              D P++CMDL+Y+Y+LLVDG GL P KEIT+ +KV++  Y +EAAW LG AI+ +S +  
Sbjct  399   VDAPFICMDLIYQYSLLVDGFGLEPTKEITVAQKVKHGEYFIEAAWALGEAIEAVSPTKR  458

Query  1392  NN  1397
              N
Sbjct  459   LN  460



>ref|XP_008670667.1| PREDICTED: probable apyrase 2 [Zea mays]
 tpg|DAA41782.1| TPA: putative apyrase family protein [Zea mays]
Length=466

 Score =   417 bits (1072),  Expect = 6e-137, Method: Compositional matrix adjust.
 Identities = 208/402 (52%), Positives = 285/402 (71%), Gaps = 1/402 (0%)
 Frame = +3

Query  180   NYAVIFDAGSTGSRVHVFHFDENLDLLPIGDGVEFFLKTTPGLSSYANDPEAAAKSLEPL  359
              YAVIFDAGS+GSRVHVF FD NLDL+ IG  +E F++  PGLS YANDP  AA+SL  L
Sbjct  65    KYAVIFDAGSSGSRVHVFRFDANLDLVHIGSEIELFVQIKPGLSHYANDPREAAESLVSL  124

Query  360   LLEAEGVVPTELQPDTPLELGATAGLRLLEGDASDKILQAVRDMFKNESNFKSKAEWVSI  539
             L +A+ VVP EL+  TP+ +GATAGLR L    S+ ILQAVRD+ + +S+FK++ +WV++
Sbjct  125   LDDAKRVVPAELRDQTPVRVGATAGLRNLGAQKSEAILQAVRDILREKSSFKNQPDWVTV  184

Query  540   LEGSQEGTYFWVAMNYLLGNLGKGYQNTIATIDLGGGSVQVSYAVSGDTFANAPTPDNGE  719
             L+G+QEG Y WV +NYLLGNLGK Y +T+  +DLGGGSVQ++YA++      AP P  GE
Sbjct  185   LDGTQEGAYEWVTINYLLGNLGKTYADTVGVVDLGGGSVQMAYAIAEKDAEKAPKPSEGE  244

Query  720   EPYVQEKYILGAQYYLYVHSYLNYGQLASRAEIFKA-SGNSTNPCVLEGYDGYYTYNDVS  896
             + YV++ ++ G  YYLYVHSYL+YG LA+RAE+ KA +GN  + C+LEG+ G Y Y D S
Sbjct  245   DAYVKKLFLKGTTYYLYVHSYLHYGLLAARAEVLKAGNGNGYSNCMLEGFQGKYKYGDDS  304

Query  897   YKVTAPPNGSSLKNCRKLARKVVDFRAPCKYQNCTFNGVWSGGGGAGMENVYISSFFYDI  1076
             ++ + PP+G+S   C+  A K +     C +  C+F G+W+GGGGAG +N++++SFF+D 
Sbjct  305   FEASGPPSGASYSKCKDDAVKALKVDEACTHMKCSFGGIWNGGGGAGQKNLFVASFFFDR  364

Query  1077  ATDVGIIDQEKASKIVKPRSFLVAAKLACETKFEDVKSTFPNAVEKDYPYLCMDLVYEYT  1256
             A + G ++       VKP  F  AA+ AC    ++ ++TFP   +   PY+CMDLVY+YT
Sbjct  365   AAEAGFVNANAPVAKVKPSDFRQAAERACSLSVKNAEATFPGVQKDSIPYICMDLVYQYT  424

Query  1257  LLVDGLGLHPYKEITLMKKVEYKNYMVEAAWPLGCAIDVISS  1382
             LLV+G G+ P  E+TL+KKV Y +  VEAAWPLG AI+V SS
Sbjct  425   LLVEGFGVDPDHEMTLVKKVPYSDAYVEAAWPLGSAIEVASS  466



>ref|XP_003576205.1| PREDICTED: LOW QUALITY PROTEIN: probable apyrase 3 [Brachypodium 
distachyon]
Length=446

 Score =   416 bits (1070),  Expect = 7e-137, Method: Compositional matrix adjust.
 Identities = 198/401 (49%), Positives = 272/401 (68%), Gaps = 6/401 (1%)
 Frame = +3

Query  177   GNYAVIFDAGSTGSRVHVFHFDENLDLLPIGDGVEFFLKTTPGLSSYANDPEAAAKSLEP  356
             G YAVIFDAGSTG+RVHVF FD  ++L+ IGD ++ F K  PGLSSYA  PE AA S+ P
Sbjct  44    GKYAVIFDAGSTGTRVHVFRFDTKMELVEIGDDIKVFAKVEPGLSSYAGRPEEAADSILP  103

Query  357   LLLEAEGVVPTELQPDTPLELGATAGLRLLEGDASDKILQAVRDMFKNESNFKSKAEWVS  536
             LL +A+ VVP  L   T ++LGATAGLRL   + +++IL+A +D+   +S F+    W++
Sbjct  104   LLQKAKSVVPRWLMRRTAVKLGATAGLRLTGDEKAEQILEAAKDVIHTKSKFQYDPSWIN  163

Query  537   ILEGSQEGTYFWVAMNYLLGNLGKGYQNTIATIDLGGGSVQVSYAVSGDTFANAPTPDNG  716
             +LEGSQEG+Y WVA+N+LL  LG  Y  T+  IDLGGGSVQ++Y +S D  A AP   +G
Sbjct  164   VLEGSQEGSYLWVALNHLLDKLGGDYGKTVGVIDLGGGSVQMAYDISEDAAATAPVVPDG  223

Query  717   EEPYVQEKYILGAQYYLYVHSYLNYGQLASRAEIFKASGNSTNPCVLEGYDGYYTYNDVS  896
             ++PY  ++Y  G  Y +Y HSYL+YG +ASRAEIFKA    T+ C+L G+ G Y+YN V 
Sbjct  224   KDPYXTKEYFKGRDYNIYAHSYLHYGAMASRAEIFKAKNGPTSYCMLRGFVGEYSYNGVQ  283

Query  897   YKVTAPPNGSSLKNCRKLARKVVDFRAPCKYQNCTFNGVWSGGGGAGMENVYISSFFYDI  1076
             +  TA P G++   CR+   K +   APC+++NCTFNG W+G       ++Y++S FY +
Sbjct  284   FDATASPQGAAYGKCREDVTKALKLGAPCEHKNCTFNGAWNG------XDLYVTSTFYYV  337

Query  1077  ATDVGIIDQEKASKIVKPRSFLVAAKLACETKFEDVKSTFPNAVEKDYPYLCMDLVYEYT  1256
             A++VG+ID E  S    P +F  AA+  C   FE+ K+ +      D PY+CMDLVY+Y+
Sbjct  338   ASEVGLIDSEATSGKTTPAAFGSAAEKICAMSFEETKAAYTRVRASDAPYICMDLVYQYS  397

Query  1257  LLVDGLGLHPYKEITLMKKVEYKNYMVEAAWPLGCAIDVIS  1379
             LLVDG GL P KEIT+ +KV++  Y +EAAWPLG AI+ +S
Sbjct  398   LLVDGFGLEPMKEITVAQKVKHGEYFLEAAWPLGEAIEAVS  438



>ref|XP_003624589.1| Nucleoside-triphosphatase [Medicago truncatula]
Length=808

 Score =   428 bits (1101),  Expect = 7e-137, Method: Compositional matrix adjust.
 Identities = 212/412 (51%), Positives = 295/412 (72%), Gaps = 1/412 (0%)
 Frame = +3

Query  150   RRVLLSHET-GNYAVIFDAGSTGSRVHVFHFDENLDLLPIGDGVEFFLKTTPGLSSYAND  326
             R++    ET  +YAV+FDAGSTGSRVHV+HFD+NLDLL IG+ VEF+ KTTPGLS+YA++
Sbjct  32    RKIFPKQETLTSYAVVFDAGSTGSRVHVYHFDQNLDLLHIGNDVEFYNKTTPGLSAYADN  91

Query  327   PEAAAKSLEPLLLEAEGVVPTELQPDTPLELGATAGLRLLEGDASDKILQAVRDMFKNES  506
             P+ AA+SL PLL +AE VVP  LQP TP++LGATAGLRLL+G++S+ IL+AV  + K  S
Sbjct  92    PKEAAESLIPLLEQAERVVPVNLQPKTPVKLGATAGLRLLDGNSSELILEAVSSLLKKRS  151

Query  507   NFKSKAEWVSILEGSQEGTYFWVAMNYLLGNLGKGYQNTIATIDLGGGSVQVSYAVSGDT  686
              F  +++ V I++G+QEG+Y WV +NY+LGNLGK +  T+A  DLGGGSVQ+ YAVS + 
Sbjct  152   TFNVQSDAVGIIDGTQEGSYLWVTINYVLGNLGKDFSETVAVADLGGGSVQMVYAVSREQ  211

Query  687   FANAPTPDNGEEPYVQEKYILGAQYYLYVHSYLNYGQLASRAEIFKASGNSTNPCVLEGY  866
                AP    GE+PY+++  + G +YYLYVHSYL +G+ ASRAEI K +  S NPC+L GY
Sbjct  212   AKKAPQVPQGEDPYIKKIVLKGKKYYLYVHSYLRFGKEASRAEILKVTNGSPNPCILAGY  271

Query  867   DGYYTYNDVSYKVTAPPNGSSLKNCRKLARKVVDFRAPCKYQNCTFNGVWSGGGGAGMEN  1046
              G YTY+   YK  +P +GS+   C+++  K +    PC Y  C+F G+W+GGGG+G + 
Sbjct  272   HGTYTYSGEEYKAFSPASGSNFDECKEIILKALKVNDPCPYGKCSFGGIWNGGGGSGQKT  331

Query  1047  VYISSFFYDIATDVGIIDQEKASKIVKPRSFLVAAKLACETKFEDVKSTFPNAVEKDYPY  1226
             +Y++S FY + T V I D  K +  ++       A+  C+TK++D K+T+P   E   PY
Sbjct  332   LYVTSSFYYVPTGVNIADPNKPNSKIRIEDLKTGAEQVCKTKYKDAKATYPLIYEDSLPY  391

Query  1227  LCMDLVYEYTLLVDGLGLHPYKEITLMKKVEYKNYMVEAAWPLGCAIDVISS  1382
              C+DL+Y+YTL VDG GL P +EIT+  ++EY++ +V+AAWPLG AI+ ISS
Sbjct  392   ACLDLIYQYTLFVDGFGLDPLQEITVANQIEYQDALVDAAWPLGNAIEAISS  443


 Score =   218 bits (554),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 117/289 (40%), Positives = 177/289 (61%), Gaps = 21/289 (7%)
 Frame = +3

Query  573   VAMNYLLGNLGKGYQN-------------------TIATIDLGGGSVQVSYAVSGDTFAN  695
             V +NY+LGNLG   ++                   ++A  D+GGG + +  AVS +    
Sbjct  519   VTINYVLGNLGNTQKDFSEAMSVLENVVVELGNTLSVALGDIGGG-ITID-AVSREQAKK  576

Query  696   APTPDNGEEPYVQEKYILGAQYYLYVHSYLNYGQLASRAEIFKASGNSTNPCVLEGYDGY  875
             AP    GE+PY+++  + G +YYLYVHSYL +G+ ASRAEI K +  S NPC+L GY G 
Sbjct  577   APQVPQGEDPYIKKIVLKGKKYYLYVHSYLRFGKEASRAEILKVTNGSPNPCILAGYHGT  636

Query  876   YTYNDVSYKVTAPPNGSSLKNCRKLARKVVDFRAPCKYQNCTFNGVWSGGGGAGMENVYI  1055
             YTY+   YK  +P +G +   C+++  K +    PC Y  C+F G+W+GGGG+G + +Y+
Sbjct  637   YTYSGEEYKAFSPASGPNFDECKEIILKALKVNDPCPYGKCSFGGIWNGGGGSGQKTLYV  696

Query  1056  SSFFYDIATDVGIIDQEKASKIVKPRSFLVAAKLACETKFEDVKSTFPNAVEKDYPYLCM  1235
             +S FY + T V I D  K +  ++       A+  C+TK++D K+T+P   E   PY C+
Sbjct  697   TSSFYYVPTGVNIADPNKPNSKIRIEDLKTGAEQVCKTKYKDAKATYPLIYEDSLPYACL  756

Query  1236  DLVYEYTLLVDGLGLHPYKEITLMKKVEYKNYMVEAAWPLGCAIDVISS  1382
             DL+Y+YTL VDG GL P ++IT+  ++EY++ +V+AAWPLG AI+ +SS
Sbjct  757   DLIYQYTLFVDGFGLDPLQDITVANQIEYQDALVDAAWPLGNAIEAVSS  805



>ref|XP_008679360.1| PREDICTED: probable apyrase 3 isoform X1 [Zea mays]
 gb|AFW64668.1| putative apyrase family protein [Zea mays]
Length=471

 Score =   417 bits (1072),  Expect = 9e-137, Method: Compositional matrix adjust.
 Identities = 214/405 (53%), Positives = 287/405 (71%), Gaps = 1/405 (0%)
 Frame = +3

Query  174   TGNYAVIFDAGSTGSRVHVFHFDENLDLLPIGD-GVEFFLKTTPGLSSYANDPEAAAKSL  350
             TG YAVIFDAGSTG+RVHVF FD  L+LL IGD G+E F K  PGLSSYA  P+ AA S+
Sbjct  60    TGRYAVIFDAGSTGTRVHVFRFDRKLELLEIGDDGIEVFAKVKPGLSSYAGHPQEAANSM  119

Query  351   EPLLLEAEGVVPTELQPDTPLELGATAGLRLLEGDASDKILQAVRDMFKNESNFKSKAEW  530
              PLL +A+  VP +L   TPL LGATAGLRL+  + S++IL+AVR++   +S F+ K EW
Sbjct  120   LPLLDKAKSAVPKQLTKRTPLRLGATAGLRLIGEEQSEQILEAVRNLIHTKSKFQYKPEW  179

Query  531   VSILEGSQEGTYFWVAMNYLLGNLGKGYQNTIATIDLGGGSVQVSYAVSGDTFANAPTPD  710
             ++++EGSQEG+Y WVA+NYLL  LG  Y  T+A +D+GGGSVQ++YAVS +  A+AP P 
Sbjct  180   INVIEGSQEGSYLWVALNYLLDKLGGDYSQTVAVLDMGGGSVQMAYAVSANAAASAPAPT  239

Query  711   NGEEPYVQEKYILGAQYYLYVHSYLNYGQLASRAEIFKASGNSTNPCVLEGYDGYYTYND  890
             +GE+PYV  +Y+ G  Y +Y HSYL+YG  ASRAEI KA     + C+L G+ G YTYN+
Sbjct  240   HGEDPYVTREYLKGKDYNIYTHSYLHYGAFASRAEILKAKDGPFSSCMLRGFIGQYTYNE  299

Query  891   VSYKVTAPPNGSSLKNCRKLARKVVDFRAPCKYQNCTFNGVWSGGGGAGMENVYISSFFY  1070
               Y  TA P G+    CR+   + ++  APC+ +NCTFNG+W+GGGGAG  ++Y++S FY
Sbjct  300   EQYDATAAPEGAVYGKCREEIGRALNLNAPCEMKNCTFNGIWNGGGGAGQGSIYVASSFY  359

Query  1071  DIATDVGIIDQEKASKIVKPRSFLVAAKLACETKFEDVKSTFPNAVEKDYPYLCMDLVYE  1250
              +A++VGI+D    S    P +F  +A+ AC+   E+ K  +PN  + D PYLCMDL Y+
Sbjct  360   FVASEVGIVDGNAPSGNTTPGAFGASAEKACQMSVEEAKIEYPNVNDVDVPYLCMDLAYQ  419

Query  1251  YTLLVDGLGLHPYKEITLMKKVEYKNYMVEAAWPLGCAIDVISSS  1385
             YTLLVDG G+   KEIT++ KV++  Y VEAAWPLG AI+ +SS+
Sbjct  420   YTLLVDGFGVERTKEITVVDKVKHGEYYVEAAWPLGSAIEAVSST  464



>emb|CDY21139.1| BnaA01g33700D [Brassica napus]
Length=751

 Score =   426 bits (1096),  Expect = 9e-137, Method: Compositional matrix adjust.
 Identities = 212/402 (53%), Positives = 286/402 (71%), Gaps = 1/402 (0%)
 Frame = +3

Query  180   NYAVIFDAGSTGSRVHVFHFDENLDLLPIGDGVEFFLKTTPGLSSYANDPEAAAKSLEPL  359
              YAVIFDAGS+GSRVHV+ FD+NLDL+P+ + +E FL+  PGLS+Y NDP  +A SL  L
Sbjct  349   KYAVIFDAGSSGSRVHVYCFDKNLDLVPLENELELFLQLKPGLSAYPNDPRQSANSLVTL  408

Query  360   LLEAEGVVPTELQPDTPLELGATAGLRLLEGDASDKILQAVRDMFKNESNFKSKAEWVSI  539
             L +AE  VP EL+P TP+ +GATAGLR L  +AS+ ILQAVR++ K+ S  K++A  V++
Sbjct  409   LDKAEDSVPNELRPKTPVRVGATAGLRALGHEASENILQAVRELLKDRSRLKTEANAVTV  468

Query  540   LEGSQEGTYFWVAMNYLLGNLGKGYQNTIATIDLGGGSVQVSYAVSGDTFANAPTPDNGE  719
             L+G+QEG+Y WV +NYLL  LGK Y  T+  +DLGGGSVQ++YA+S    A AP P  GE
Sbjct  469   LDGTQEGSYQWVTINYLLKTLGKPYSETVGVVDLGGGSVQMAYAISEKDAATAPKPLQGE  528

Query  720   EPYVQEKYILGAQYYLYVHSYLNYGQLASRAEIFKASGNSTNPCVLEGYDGYYTYNDVSY  899
             + YV+E Y+ G +Y+LYVHSYL+YG LA+RAEI K S  S NPC++ GYDG Y Y   ++
Sbjct  529   DSYVREMYLKGRKYFLYVHSYLHYGLLAARAEILKVSEGSNNPCIVTGYDGTYKYGGTAF  588

Query  900   KVTAPPNGSSLKNCRKLARKVVDFR-APCKYQNCTFNGVWSGGGGAGMENVYISSFFYDI  1076
             K  A P+G+S+  C+++A K +    + C +  CTF GVW+GGGG G +N++++SFF+D 
Sbjct  589   KAAASPSGASVDECKRVALKALKVNDSVCTHMKCTFGGVWNGGGGGGQKNMFVASFFFDR  648

Query  1077  ATDVGIIDQEKASKIVKPRSFLVAAKLACETKFEDVKSTFPNAVEKDYPYLCMDLVYEYT  1256
             A + G +D  +    V+P  F  AA  AC  K  + K+ FP   E + PYLC+DLVY+YT
Sbjct  649   AAEAGFVDPSQPVATVRPADFEKAANQACNMKMGEGKTKFPRVEEDNLPYLCLDLVYQYT  708

Query  1257  LLVDGLGLHPYKEITLMKKVEYKNYMVEAAWPLGCAIDVISS  1382
             LLVDG GL P + ITL+KKV+Y  + VEAAWPLG AI+ +SS
Sbjct  709   LLVDGFGLKPSQTITLVKKVKYGEHAVEAAWPLGSAIEAVSS  750



>ref|NP_001060663.1| Os07g0682800 [Oryza sativa Japonica Group]
 sp|Q6Z4P2.1|APY2_ORYSJ RecName: Full=Probable apyrase 2; Short=OsAPY2; AltName: Full=ATP-diphosphatase; 
AltName: Full=ATP-diphosphohydrolase; AltName: 
Full=Adenosine diphosphatase; Short=ADPase [Oryza sativa 
Japonica Group]
 dbj|BAC83798.1| putative nucleoside-triphosphatase [Oryza sativa Japonica Group]
 dbj|BAF22577.1| Os07g0682800 [Oryza sativa Japonica Group]
 gb|EAZ41118.1| hypothetical protein OsJ_25612 [Oryza sativa Japonica Group]
Length=467

 Score =   417 bits (1071),  Expect = 1e-136, Method: Compositional matrix adjust.
 Identities = 207/404 (51%), Positives = 286/404 (71%), Gaps = 1/404 (0%)
 Frame = +3

Query  171   ETGNYAVIFDAGSTGSRVHVFHFDENLDLLPIGDGVEFFLKTTPGLSSYANDPEAAAKSL  350
             +   YAVIFDAGS+GSRVHVF FD NLDLL IGD +E F++  PGLS YAN+P+ AAKSL
Sbjct  64    DANKYAVIFDAGSSGSRVHVFRFDANLDLLHIGDQIELFVQKKPGLSEYANNPQEAAKSL  123

Query  351   EPLLLEAEGVVPTELQPDTPLELGATAGLRLLEGDASDKILQAVRDMFKNESNFKSKAEW  530
               LL +A+ VVP EL+  TP+ +GATAGLR L  + S++ILQAVRD+ + +S+FK++ +W
Sbjct  124   VSLLEDAKRVVPVELRGQTPVRVGATAGLRALGAEKSEEILQAVRDLLREKSSFKTQPDW  183

Query  531   VSILEGSQEGTYFWVAMNYLLGNLGKGYQNTIATIDLGGGSVQVSYAVSGDTFANAPTPD  710
             V++L+G QEG Y WV +NYLLG LGK Y +T+  +DLGGGSVQ++YA++      AP P 
Sbjct  184   VTVLDGPQEGAYEWVTINYLLGKLGKTYADTVGVVDLGGGSVQMAYAIAEKDAVKAPKPS  243

Query  711   NGEEPYVQEKYILGAQYYLYVHSYLNYGQLASRAEIFKA-SGNSTNPCVLEGYDGYYTYN  887
              GE+ YV++ ++ G  YYLYVHSYL+YG LA+RAEI KA +G   + C LEG+ G Y Y 
Sbjct  244   EGEDSYVKKLFLKGTTYYLYVHSYLHYGLLAARAEILKAGNGKGYSYCTLEGHQGQYKYG  303

Query  888   DVSYKVTAPPNGSSLKNCRKLARKVVDFRAPCKYQNCTFNGVWSGGGGAGMENVYISSFF  1067
             +  ++ +A P+G+S   CR    K +     C +  C+F G+W+GGGGAG +N++++SFF
Sbjct  304   NGKFEASASPSGASYSKCRDDVVKALKVDQACTHMKCSFGGIWNGGGGAGQKNLFVASFF  363

Query  1068  YDIATDVGIIDQEKASKIVKPRSFLVAAKLACETKFEDVKSTFPNAVEKDYPYLCMDLVY  1247
             +D A + G ++ +     VKP  F  AAK AC+   +D ++ +P   + + PY+CMDLVY
Sbjct  364   FDRAAEAGFVNPKAPVAKVKPSDFEKAAKRACKLNLKDAEAAYPGVQKDNIPYICMDLVY  423

Query  1248  EYTLLVDGLGLHPYKEITLMKKVEYKNYMVEAAWPLGCAIDVIS  1379
             +YTLLVDG G+  ++E+TL+KKV Y N  VEAAWPLG AI+V S
Sbjct  424   QYTLLVDGFGVGSHQEMTLVKKVPYSNAFVEAAWPLGSAIEVAS  467



>ref|XP_009386978.1| PREDICTED: probable apyrase 2 [Musa acuminata subsp. malaccensis]
Length=450

 Score =   416 bits (1069),  Expect = 1e-136, Method: Compositional matrix adjust.
 Identities = 217/421 (52%), Positives = 297/421 (71%), Gaps = 7/421 (2%)
 Frame = +3

Query  153   RVLLSH-----ETGNYAVIFDAGSTGSRVHVFHFDENLDLLPIGDGVEFFLKTTPGLSSY  317
             RVL++      E+  YAVIFDAGSTGSRVHV+ FD+ L+L+ IG  +E F+K  PGLS+Y
Sbjct  26    RVLVASGAAAVESRRYAVIFDAGSTGSRVHVYCFDDGLELVHIGSDIELFVKVKPGLSAY  85

Query  318   ANDPEAAAKSLEPLLLEAEGVVPTELQPDTPLELGATAGLRLLEGDASDKILQAVRDMFK  497
             A+DP+AAA SL PLL +A GV+P EL+  TP+ +GATAGLR L  D S++ILQAVRD+ +
Sbjct  86    ADDPQAAANSLLPLLEKAVGVIPEELRNKTPIRVGATAGLRSLGTDKSNQILQAVRDLLR  145

Query  498   NESNFKSKAEWVSILEGSQEGTYFWVAMNYLLGNLGKGYQNTIATIDLGGGSVQVSYAVS  677
              +S+ +   +WV++L G QEG+Y WVA+NYLLG+LG  Y  +I  +DLGGGSVQ++YA+S
Sbjct  146   EKSSLELVDDWVTVLSGYQEGSYLWVAINYLLGHLGNKYSESIGVVDLGGGSVQMAYAIS  205

Query  678   GDTFANAPTPDNGEEPYVQEKYILGAQYYLYVHSYLNYGQLASRAEIFKASGNSTNPCVL  857
                 ANAP   +GEE YV+E ++ GA+YYLYVHSYLNYG LA+RA+I K +  S + C+L
Sbjct  206   EKAAANAPNVPSGEETYVKELFLQGAKYYLYVHSYLNYGLLAARAQILKVATKSYSYCIL  265

Query  858   EGYDGYYTYNDVSYKVTAPPNGSSLKNCRKLARKVVDFRAPCKYQNCTFNGVWSGGGGAG  1037
              GY+G Y Y+   Y  ++ P+GSS   CR    K +    PCKY +CTF GVW+GGGGAG
Sbjct  266   GGYNGVYDYDGELYNASSSPSGSSFTKCRNEVIKALKIDEPCKYSSCTFGGVWNGGGGAG  325

Query  1038  MENVYISSFFYDIATDVGIIDQEKASKIVKPRSFLVAAKLACETKFEDVKSTFPNAVEKD  1217
              + +Y +S+F+D  +DVG +D    S + KP  F+ AAK AC+     V++ +PN  + D
Sbjct  326   QKTLYGASYFFDRPSDVGFVDPAATSALAKPSDFMEAAKHACKVTMNTVETKYPNVRKND  385

Query  1218  YPYLCMDLVYEYTLLVDGLGLHPYKEITLMKKVEY--KNYMVEAAWPLGCAIDVISSSSA  1391
              PY+CMDL+Y+YTLLV+G GL P + ITL+++V Y   ++  EAAWPLG AI+ ++S   
Sbjct  386   LPYVCMDLIYQYTLLVNGFGLKPRQNITLVRQVRYGDSDFFGEAAWPLGSAIEAVTSEKI  445

Query  1392  N  1394
             N
Sbjct  446   N  446



>ref|XP_009130420.1| PREDICTED: apyrase 1 [Brassica rapa]
 emb|CDY50882.1| BnaA05g37430D [Brassica napus]
Length=468

 Score =   416 bits (1070),  Expect = 1e-136, Method: Compositional matrix adjust.
 Identities = 213/402 (53%), Positives = 284/402 (71%), Gaps = 1/402 (0%)
 Frame = +3

Query  180   NYAVIFDAGSTGSRVHVFHFDENLDLLPIGDGVEFFLKTTPGLSSYANDPEAAAKSLEPL  359
              YAVIFDAGS+GSRVHV+ FDENLDL+P+ + +E FL+  PGLS+Y NDP  +A SL  L
Sbjct  66    KYAVIFDAGSSGSRVHVYCFDENLDLVPLENELELFLQLKPGLSAYPNDPRQSANSLVSL  125

Query  360   LLEAEGVVPTELQPDTPLELGATAGLRLLEGDASDKILQAVRDMFKNESNFKSKAEWVSI  539
             L +AE  VP EL+P TP+ +GATAGLR L   AS+ IL+AVR++ K+ S  K++A  V++
Sbjct  126   LDKAEASVPHELRPKTPVRVGATAGLRALGHKASENILEAVRELLKDRSRLKTEANAVTV  185

Query  540   LEGSQEGTYFWVAMNYLLGNLGKGYQNTIATIDLGGGSVQVSYAVSGDTFANAPTPDNGE  719
             L+G+QEG+Y WV +NYLL  LGK Y  T+  +DLGGGSVQ++YA+S +  A AP P  GE
Sbjct  186   LDGTQEGSYQWVTINYLLKTLGKPYSETVGVVDLGGGSVQMAYAISEEDAATAPKPLQGE  245

Query  720   EPYVQEKYILGAQYYLYVHSYLNYGQLASRAEIFKASGNSTNPCVLEGYDGYYTYNDVSY  899
             + YV+E Y+ G +Y+LYVHSYL+YG LA+RAEI K S  S NPC++ GYDG Y Y   ++
Sbjct  246   DSYVREMYLKGRKYFLYVHSYLHYGLLAARAEILKVSEGSNNPCIVTGYDGTYKYGGKAF  305

Query  900   KVTAPPNGSSLKNCRKLARKVVDFR-APCKYQNCTFNGVWSGGGGAGMENVYISSFFYDI  1076
             K  A  +G+SL  CR++A   +    + C +  CTF GVW+GGGG G +N++++SFF+D 
Sbjct  306   KAAASSSGASLDECRRVALNALKVNDSVCTHMKCTFGGVWNGGGGGGQKNMFVASFFFDR  365

Query  1077  ATDVGIIDQEKASKIVKPRSFLVAAKLACETKFEDVKSTFPNAVEKDYPYLCMDLVYEYT  1256
             A + G +D  +    V+P  F  AA  AC  K  + KS FP   E + PYLC+DLVY+YT
Sbjct  366   AAEAGFVDPTQPVATVRPADFEKAASQACNMKMGEGKSKFPRVEEDNIPYLCLDLVYQYT  425

Query  1257  LLVDGLGLHPYKEITLMKKVEYKNYMVEAAWPLGCAIDVISS  1382
             LLVDG GL P + ITL+KKV+Y  + VEAAWPLG AI+ +SS
Sbjct  426   LLVDGFGLKPSQTITLVKKVKYGEHAVEAAWPLGSAIEAVSS  467



>ref|XP_002465325.1| hypothetical protein SORBIDRAFT_01g036510 [Sorghum bicolor]
 gb|EER92323.1| hypothetical protein SORBIDRAFT_01g036510 [Sorghum bicolor]
Length=479

 Score =   417 bits (1071),  Expect = 2e-136, Method: Compositional matrix adjust.
 Identities = 214/404 (53%), Positives = 291/404 (72%), Gaps = 3/404 (1%)
 Frame = +3

Query  180   NYAVIFDAGSTGSRVHVFHFDENLDLLPIGDGVEFFLKTTPGLSSYANDPEAAAKSLEPL  359
              YAVIFDAGS+GSRVHV+ FDENLDL+PIG  +E F +  PGLS+ A  P+ AA+SL  L
Sbjct  77    KYAVIFDAGSSGSRVHVYCFDENLDLVPIGKEIELFKQKKPGLSA-AKGPQEAAESLISL  135

Query  360   LLEAEGVVPTELQPDTPLELGATAGLRLLEGDASDKILQAVRDMFKNESNFKSKAEWVSI  539
             L EAE VVP EL+  TP+ +GATAGLR L  + S++ILQAVR++ +++S+FKS+  WVS+
Sbjct  136   LEEAEKVVPAELRGQTPVRVGATAGLRALGTERSEEILQAVRELLRDKSSFKSQPNWVSV  195

Query  540   LEGSQEGTYFWVAMNYLLGNLGKGYQNTIATIDLGGGSVQVSYAVSGDTFANAPTPDNGE  719
             L+GSQEG + WV +NYLLG LGK Y NT+  +DLGGGSVQ++YA+S    A AP   +GE
Sbjct  196   LDGSQEGAFQWVTINYLLGKLGKPYSNTVGVVDLGGGSVQMAYAISEKDAAKAPEVADGE  255

Query  720   EPYVQEKYILGAQYYLYVHSYLNYGQLASRAEIFKA-SGNSTNPCVLEGYDGYYTYNDVS  896
             + YV+E  + G  YYLYVHSYL+YG LA+RAEI KA  G+  + C+LEG+ G Y Y   +
Sbjct  256   DSYVKELLLKGTTYYLYVHSYLHYGLLAARAEILKAGEGSDYSDCMLEGHLGKYNYGGNT  315

Query  897   YKVTAPPNGSSLKNCRKLARKVVDFRAP-CKYQNCTFNGVWSGGGGAGMENVYISSFFYD  1073
             ++ +  P+G+S   CR LA + +    P C +  CTF GVW+GGGG G +N++++SFF+D
Sbjct  316   FEASGSPSGASYSKCRALAVRALKVDEPACTHMKCTFGGVWNGGGGDGQKNLFVASFFFD  375

Query  1074  IATDVGIIDQEKASKIVKPRSFLVAAKLACETKFEDVKSTFPNAVEKDYPYLCMDLVYEY  1253
              A + G ++ + A   VKP  F   A+  C+   +D ++T+P+  E++ PYLC+DLVY+Y
Sbjct  376   RAAEAGFVNPKAAVAKVKPSDFEETARRVCKLNLKDAQATYPDVSEENIPYLCIDLVYQY  435

Query  1254  TLLVDGLGLHPYKEITLMKKVEYKNYMVEAAWPLGCAIDVISSS  1385
             TLLVDG G+ PY++ITL+KKV Y +  VEAAWPLG AI+V SSS
Sbjct  436   TLLVDGFGVDPYQDITLVKKVPYGDSYVEAAWPLGSAIEVASSS  479



>gb|EEC82701.1| hypothetical protein OsI_27366 [Oryza sativa Indica Group]
Length=467

 Score =   415 bits (1067),  Expect = 4e-136, Method: Compositional matrix adjust.
 Identities = 206/404 (51%), Positives = 286/404 (71%), Gaps = 1/404 (0%)
 Frame = +3

Query  171   ETGNYAVIFDAGSTGSRVHVFHFDENLDLLPIGDGVEFFLKTTPGLSSYANDPEAAAKSL  350
             +   YAVIFDAGS+GSRVHVF FD NLDLL IGD +E F++  PGLS+YA +P+ AAKSL
Sbjct  64    DANKYAVIFDAGSSGSRVHVFRFDANLDLLHIGDQIELFVQKKPGLSAYAKNPQEAAKSL  123

Query  351   EPLLLEAEGVVPTELQPDTPLELGATAGLRLLEGDASDKILQAVRDMFKNESNFKSKAEW  530
               LL +A+ VVP EL+  TP+ +GATAGLR L  + S++ILQAVRD+ + +S+FK++ +W
Sbjct  124   VSLLEDAKRVVPAELRGQTPVRVGATAGLRALGAEKSEEILQAVRDLLREKSSFKTQPDW  183

Query  531   VSILEGSQEGTYFWVAMNYLLGNLGKGYQNTIATIDLGGGSVQVSYAVSGDTFANAPTPD  710
             V++L+G QEG Y WV +NYLLG LGK Y +T+  +DLGGGSVQ++YA++      AP P 
Sbjct  184   VTVLDGPQEGAYEWVTINYLLGKLGKTYADTVGVVDLGGGSVQMAYAIAEKDAVKAPKPS  243

Query  711   NGEEPYVQEKYILGAQYYLYVHSYLNYGQLASRAEIFKA-SGNSTNPCVLEGYDGYYTYN  887
              GE+ YV++ ++ G  YYLYVHSYL+YG LA+RAEI KA +G   + C LEG+ G Y Y 
Sbjct  244   EGEDSYVKKLFLKGTTYYLYVHSYLHYGLLAARAEILKAGNGKGYSYCTLEGHQGQYKYG  303

Query  888   DVSYKVTAPPNGSSLKNCRKLARKVVDFRAPCKYQNCTFNGVWSGGGGAGMENVYISSFF  1067
             +  ++ +A P+G+S   CR    K +     C +  C+F G+W+GGGGAG +N++++SFF
Sbjct  304   NGKFEASASPSGASYSKCRDDVVKALKVDQACTHMKCSFGGIWNGGGGAGQKNLFVASFF  363

Query  1068  YDIATDVGIIDQEKASKIVKPRSFLVAAKLACETKFEDVKSTFPNAVEKDYPYLCMDLVY  1247
             +D A + G ++ +     VKP  F  AAK AC+   +D ++ +P   + + PY+CMDLVY
Sbjct  364   FDRAAEAGFVNPKAPVAKVKPSDFEKAAKRACKLNLKDAEAAYPGVQKDNIPYICMDLVY  423

Query  1248  EYTLLVDGLGLHPYKEITLMKKVEYKNYMVEAAWPLGCAIDVIS  1379
             +YTLLVDG G+  ++E+TL+KKV Y N  VEAAWPLG AI+V S
Sbjct  424   QYTLLVDGFGVGSHQEMTLVKKVPYSNAFVEAAWPLGSAIEVAS  467



>ref|XP_008441968.1| PREDICTED: apyrase 2-like [Cucumis melo]
Length=466

 Score =   415 bits (1067),  Expect = 4e-136, Method: Compositional matrix adjust.
 Identities = 215/402 (53%), Positives = 292/402 (73%), Gaps = 5/402 (1%)
 Frame = +3

Query  180   NYAVIFDAGSTGSRVHVFHFDENLDLLPIGDGVEFFLKTTPGLSSYANDPEAAAKSLEPL  359
             ++AVIFDAGS+GSRVHVF FD NLDLLP+G  +E F +  PGLS+YA+ P+ AA SL  L
Sbjct  67    SFAVIFDAGSSGSRVHVFCFDHNLDLLPVGKDIELFEQLKPGLSAYADSPKDAAASLISL  126

Query  360   LLEAEGVVPTELQPDTPLELGATAGLRLLEGDASDKILQAVRDMFKNESNFKSKAEWVSI  539
             L +A+ VVP  L+P TP+ +GATAGLR L+GDASD+ILQAVRD+ +++S  + + + VS+
Sbjct  127   LDKAQDVVPKGLRPMTPVRVGATAGLRALKGDASDRILQAVRDLLRDKSELRLEGDAVSV  186

Query  540   LEGSQEGTYFWVAMNYLLGNLGKGYQNTIATIDLGGGSVQVSYAVSGDTFANAPTPDNGE  719
             ++G+QEG+Y WV +NYLLGNLGK Y +T+  +DLGGGSVQ++YA+S     +A    + E
Sbjct  187   IDGTQEGSYLWVTLNYLLGNLGKKYSDTVGVVDLGGGSVQMAYAISE---KDAARLSDAE  243

Query  720   EPYVQEKYILGAQYYLYVHSYLNYGQLASRAEIFKASGNSTNPCVLEGYDGYYTYNDVSY  899
               Y+++ Y+ GA YYLYVHSYL+YG LA+RAE+   S +S+N C+L GY+G Y Y    Y
Sbjct  244   GAYIKKMYLKGATYYLYVHSYLHYGLLAARAEVLSVSEDSSNDCILSGYEGAYHYGGKDY  303

Query  900   KVTAPPNGSSLKNCRKLARKVVDF-RAPCKYQNCTFNGVWSGGGGAGMENVYISSFFYDI  1076
             K +A  +GSSL  CR    K +    + C +  CTF GVW+GGGG G +N++++SFF+D 
Sbjct  304   KASASSSGSSLNGCRSTVLKALKVNESTCTHMKCTFGGVWNGGGGDGQKNLFVASFFFDR  363

Query  1077  ATDVGIIDQEKASKIVKPRSFLVAAKLACETKFEDVKSTFPNAVEKDYPYLCMDLVYEYT  1256
             A + G  D  +    V+P  F  AAK AC+ K ED  ST+P+  + + PYLCMDLVY+YT
Sbjct  364   AAEAGFADPNEPVAKVRPADFSDAAKQACQIKLEDA-STYPHVEKDNLPYLCMDLVYQYT  422

Query  1257  LLVDGLGLHPYKEITLMKKVEYKNYMVEAAWPLGCAIDVISS  1382
             LLVDG GL P++EITL+KKV+Y+N +VEAAWPLG AI+ +SS
Sbjct  423   LLVDGFGLDPWQEITLVKKVKYQNSLVEAAWPLGSAIEAVSS  464



>ref|XP_008651023.1| PREDICTED: putative apyrase family protein isoform X1 [Zea mays]
 tpg|DAA64157.1| TPA: putative apyrase family protein [Zea mays]
Length=467

 Score =   414 bits (1064),  Expect = 1e-135, Method: Compositional matrix adjust.
 Identities = 209/403 (52%), Positives = 285/403 (71%), Gaps = 1/403 (0%)
 Frame = +3

Query  180   NYAVIFDAGSTGSRVHVFHFDENLDLLPIGDGVEFFLKTTPGLSSYANDPEAAAKSLEPL  359
              YAVIFDAGS+GSRVHVF FD NLDL+ IG  +E F++  PGLS YANDP  AA+SL  L
Sbjct  65    RYAVIFDAGSSGSRVHVFRFDANLDLVRIGSEIELFVQIKPGLSHYANDPREAAESLVSL  124

Query  360   LLEAEGVVPTELQPDTPLELGATAGLRLLEGDASDKILQAVRDMFKNESNFKSKAEWVSI  539
             L +A+ VVP EL+  TP+ +GATAGLR L    S+ ILQAVRD+ + +S+FK++ +WV++
Sbjct  125   LDDAKRVVPAELRDQTPVRVGATAGLRNLGAQKSEAILQAVRDLLREKSSFKNQPDWVTV  184

Query  540   LEGSQEGTYFWVAMNYLLGNLGKGYQNTIATIDLGGGSVQVSYAVSGDTFANAPTPDNGE  719
             L+G+QEG Y WV +NYLLGNLGK Y +T+  +DLGGGSVQ++YA++      AP P +GE
Sbjct  185   LDGTQEGAYEWVTINYLLGNLGKTYADTVGVVDLGGGSVQMAYAIAEKDAEKAPKPSDGE  244

Query  720   EPYVQEKYILGAQYYLYVHSYLNYGQLASRAEIFKA-SGNSTNPCVLEGYDGYYTYNDVS  896
             + YV++ ++ G  YYLYVHSYL+YG LA+RAE+ KA +GN  + C+LEG+ G Y Y D S
Sbjct  245   DAYVKKLFLKGTTYYLYVHSYLHYGLLAARAEVLKAGNGNGYSNCMLEGFQGQYKYGDNS  304

Query  897   YKVTAPPNGSSLKNCRKLARKVVDFRAPCKYQNCTFNGVWSGGGGAGMENVYISSFFYDI  1076
             ++ +A P+G+S   C+  A K +     C +  C+F G+W+GGGGAG  N++++SFF+D 
Sbjct  305   FEASASPSGASYSKCKDDAVKALKVDEACTHMKCSFGGIWNGGGGAGQNNLFVASFFFDR  364

Query  1077  ATDVGIIDQEKASKIVKPRSFLVAAKLACETKFEDVKSTFPNAVEKDYPYLCMDLVYEYT  1256
             A + G ++       VKP  F  AA+ AC    ++ ++TFP   + + PY+CMDLVY+YT
Sbjct  365   AAEAGFVNANAPVAKVKPSDFRQAAERACSLSVKNAEATFPGVQKDNIPYICMDLVYQYT  424

Query  1257  LLVDGLGLHPYKEITLMKKVEYKNYMVEAAWPLGCAIDVISSS  1385
             LLV G G+ P  E+TL+KKV Y    VEAAWPLG AI+V SSS
Sbjct  425   LLVHGFGVDPDHEMTLVKKVPYSGAYVEAAWPLGSAIEVASSS  467



>ref|XP_010088479.1| hypothetical protein L484_013684 [Morus notabilis]
 gb|EXB36249.1| hypothetical protein L484_013684 [Morus notabilis]
Length=625

 Score =   419 bits (1078),  Expect = 1e-135, Method: Compositional matrix adjust.
 Identities = 220/402 (55%), Positives = 296/402 (74%), Gaps = 0/402 (0%)
 Frame = +3

Query  180   NYAVIFDAGSTGSRVHVFHFDENLDLLPIGDGVEFFLKTTPGLSSYANDPEAAAKSLEPL  359
             +YAVIFDAGS+GSRVHVF FD NLDL+PIGD +E F +  PGLS+YA+DP+AAA+SL  L
Sbjct  224   SYAVIFDAGSSGSRVHVFSFDRNLDLVPIGDDLELFEQIKPGLSAYASDPKAAAESLIGL  283

Query  360   LLEAEGVVPTELQPDTPLELGATAGLRLLEGDASDKILQAVRDMFKNESNFKSKAEWVSI  539
             L +A  VVP  L+  TP+ +GATAGLR L GD S++ILQAVRD+ K+ S FK +++ VS+
Sbjct  284   LDKAVNVVPKNLRASTPVRVGATAGLRSLPGDTSERILQAVRDLLKDRSTFKLESDAVSV  343

Query  540   LEGSQEGTYFWVAMNYLLGNLGKGYQNTIATIDLGGGSVQVSYAVSGDTFANAPTPDNGE  719
             ++G+QEG+Y WV +N+LLGNLG+ Y +T+  +DLGGGSVQ++YA+S    A AP P +GE
Sbjct  344   IDGTQEGSYQWVTINFLLGNLGQKYGSTVGVVDLGGGSVQMAYAISEAAAAKAPKPTDGE  403

Query  720   EPYVQEKYILGAQYYLYVHSYLNYGQLASRAEIFKASGNSTNPCVLEGYDGYYTYNDVSY  899
             E YV+E ++ G +Y+LYVHSYL YG LA RAE+ K +G S NPC+L GYDG +TY   +Y
Sbjct  404   ETYVKEMFLKGKKYFLYVHSYLRYGLLAGRAELLKVTGESGNPCILSGYDGSFTYGGNTY  463

Query  900   KVTAPPNGSSLKNCRKLARKVVDFRAPCKYQNCTFNGVWSGGGGAGMENVYISSFFYDIA  1079
             K +A  +GSS+  CR +A K +  +  C +  CTF GVW+GGGG G  N++++SFF+D A
Sbjct  464   KASASSSGSSVDGCRMVADKALKIKDTCTHMKCTFGGVWNGGGGDGQRNLFVASFFFDRA  523

Query  1080  TDVGIIDQEKASKIVKPRSFLVAAKLACETKFEDVKSTFPNAVEKDYPYLCMDLVYEYTL  1259
              + G ++ ++    V P  F  AAK AC+T   + KS +P   E + PYLCMDLVY+Y L
Sbjct  524   AEAGFVNPKEPVAKVHPADFEDAAKRACQTTHNEAKSIYPRVEESNLPYLCMDLVYQYKL  583

Query  1260  LVDGLGLHPYKEITLMKKVEYKNYMVEAAWPLGCAIDVISSS  1385
             LVDG GL P++EI L+K+VEY N +VEAAWPLG AI+ +SS+
Sbjct  584   LVDGFGLDPWQEIKLVKQVEYHNNLVEAAWPLGSAIEAVSSA  625



>dbj|BAJ85095.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=472

 Score =   413 bits (1062),  Expect = 2e-135, Method: Compositional matrix adjust.
 Identities = 208/403 (52%), Positives = 284/403 (70%), Gaps = 1/403 (0%)
 Frame = +3

Query  180   NYAVIFDAGSTGSRVHVFHFDENLDLLPIGDGVEFFLKTTPGLSSYANDPEAAAKSLEPL  359
              YAVIFDAGS+GSRVHVF FD NLDL+ IG  +E F++  PGLS++ANDP  AA+SL  L
Sbjct  70    KYAVIFDAGSSGSRVHVFCFDGNLDLVHIGTDIELFVQKKPGLSAFANDPREAAQSLVSL  129

Query  360   LLEAEGVVPTELQPDTPLELGATAGLRLLEGDASDKILQAVRDMFKNESNFKSKAEWVSI  539
             + +A+ VVP EL+  TP+ +GATAGLR L    S++ILQAVRD+ + +S+FK++ +WV++
Sbjct  130   IEKAKEVVPAELRDQTPVRVGATAGLRALGAGKSEEILQAVRDLLREKSSFKNQPDWVTV  189

Query  540   LEGSQEGTYFWVAMNYLLGNLGKGYQNTIATIDLGGGSVQVSYAVSGDTFANAPTPDNGE  719
             L+G+QEG Y WV +NYLLG LGK Y +T+  +DLGGGSVQ++YA+       AP P +GE
Sbjct  190   LDGTQEGAYEWVTINYLLGKLGKTYADTVGVVDLGGGSVQMAYAIPEKDAEKAPKPADGE  249

Query  720   EPYVQEKYILGAQYYLYVHSYLNYGQLASRAEIFKA-SGNSTNPCVLEGYDGYYTYNDVS  896
             E Y+++ ++ G  Y+LYVHSYL YG LA+RAEI KA + N  + CVL G+ G Y Y    
Sbjct  250   ESYMKKLFLKGTTYHLYVHSYLRYGLLAARAEILKAGNANGYSNCVLAGHQGQYKYGGNI  309

Query  897   YKVTAPPNGSSLKNCRKLARKVVDFRAPCKYQNCTFNGVWSGGGGAGMENVYISSFFYDI  1076
             ++ +A P+GSS   CR    K +     C +  C+F G+W+GGGGAG +N++++SFF+D 
Sbjct  310   FEASAAPSGSSFSECRADVVKALKVDEACTHMKCSFGGIWNGGGGAGQKNLFVASFFFDR  369

Query  1077  ATDVGIIDQEKASKIVKPRSFLVAAKLACETKFEDVKSTFPNAVEKDYPYLCMDLVYEYT  1256
             A + G I+   A   VKP  F  AAK AC+    D +S++P   + + PY+CMDLVY+YT
Sbjct  370   AAEAGFINSNAAVAKVKPSDFEEAAKRACKLNVNDAQSSYPAVQKDNVPYICMDLVYQYT  429

Query  1257  LLVDGLGLHPYKEITLMKKVEYKNYMVEAAWPLGCAIDVISSS  1385
             LLVDG G+ P +E+TL+KKV Y +  VEAAWPLG AI+V SSS
Sbjct  430   LLVDGFGVDPQQEMTLVKKVPYSDAFVEAAWPLGSAIEVASSS  472



>ref|XP_003624590.1| Nucleoside-triphosphatase [Medicago truncatula]
Length=810

 Score =   423 bits (1088),  Expect = 5e-135, Method: Compositional matrix adjust.
 Identities = 212/414 (51%), Positives = 295/414 (71%), Gaps = 3/414 (1%)
 Frame = +3

Query  150   RRVLLSHET-GNYAVIFDAGSTGSRVHVFHFDENLDLLPIGDGVEFFLKTTPGLSSYAND  326
             R++    ET  +YAV+FDAGSTGSRVHV+HFD+NLDLL IG+ VEF+ KTTPGLS+YA++
Sbjct  32    RKIFPKQETLTSYAVVFDAGSTGSRVHVYHFDQNLDLLHIGNDVEFYNKTTPGLSAYADN  91

Query  327   PEAAAKSLEPLLLEAEGVVPTELQPDTPLELGATAGLRLLEGDASDKILQAV--RDMFKN  500
             P+ AA+SL PLL +AE VVP  LQP TP++LGATAGLRLL+G++S+ IL+AV    + K 
Sbjct  92    PKEAAESLIPLLEQAERVVPVNLQPKTPVKLGATAGLRLLDGNSSELILEAVIVSSLLKK  151

Query  501   ESNFKSKAEWVSILEGSQEGTYFWVAMNYLLGNLGKGYQNTIATIDLGGGSVQVSYAVSG  680
              S F  +++ V I++G+QEG+Y WV +NY+LGNLGK +  T+A  DLGGGSVQ+ YAVS 
Sbjct  152   RSTFNVQSDAVGIIDGTQEGSYLWVTINYVLGNLGKDFSETVAVADLGGGSVQMVYAVSR  211

Query  681   DTFANAPTPDNGEEPYVQEKYILGAQYYLYVHSYLNYGQLASRAEIFKASGNSTNPCVLE  860
             +    AP    GE+PY+++  + G +YYLYVHSYL +G+ ASRAEI K +  S NPC+L 
Sbjct  212   EQAKKAPQVPQGEDPYIKKIVLKGKKYYLYVHSYLRFGKEASRAEILKVTNGSPNPCILA  271

Query  861   GYDGYYTYNDVSYKVTAPPNGSSLKNCRKLARKVVDFRAPCKYQNCTFNGVWSGGGGAGM  1040
             GY G YTY+   YK  +P +GS+   C+++  K +    PC Y  C+F G+W+GGGG+G 
Sbjct  272   GYHGTYTYSGEEYKAFSPASGSNFDECKEIILKALKVNDPCPYGKCSFGGIWNGGGGSGQ  331

Query  1041  ENVYISSFFYDIATDVGIIDQEKASKIVKPRSFLVAAKLACETKFEDVKSTFPNAVEKDY  1220
             + +Y++S FY + T V I D  K +  ++       A+  C+TK++D K+T+P   E   
Sbjct  332   KTLYVTSSFYYVPTGVNIADPNKPNSKIRIEDLKTGAEQVCKTKYKDAKATYPLIYEDSL  391

Query  1221  PYLCMDLVYEYTLLVDGLGLHPYKEITLMKKVEYKNYMVEAAWPLGCAIDVISS  1382
             PY C+DL+Y+YTL VDG GL P +EIT+  ++EY++ +V+AAWPLG AI+ ISS
Sbjct  392   PYACLDLIYQYTLFVDGFGLDPLQEITVANQIEYQDALVDAAWPLGNAIEAISS  445


 Score =   218 bits (554),  Expect = 4e-58, Method: Compositional matrix adjust.
 Identities = 117/289 (40%), Positives = 177/289 (61%), Gaps = 21/289 (7%)
 Frame = +3

Query  573   VAMNYLLGNLGKGYQN-------------------TIATIDLGGGSVQVSYAVSGDTFAN  695
             V +NY+LGNLG   ++                   ++A  D+GGG + +  AVS +    
Sbjct  521   VTINYVLGNLGNTQKDFSEAMSVLENVVVELGNTLSVALGDIGGG-ITID-AVSREQAKK  578

Query  696   APTPDNGEEPYVQEKYILGAQYYLYVHSYLNYGQLASRAEIFKASGNSTNPCVLEGYDGY  875
             AP    GE+PY+++  + G +YYLYVHSYL +G+ ASRAEI K +  S NPC+L GY G 
Sbjct  579   APQVPQGEDPYIKKIVLKGKKYYLYVHSYLRFGKEASRAEILKVTNGSPNPCILAGYHGT  638

Query  876   YTYNDVSYKVTAPPNGSSLKNCRKLARKVVDFRAPCKYQNCTFNGVWSGGGGAGMENVYI  1055
             YTY+   YK  +P +G +   C+++  K +    PC Y  C+F G+W+GGGG+G + +Y+
Sbjct  639   YTYSGEEYKAFSPASGPNFDECKEIILKALKVNDPCPYGKCSFGGIWNGGGGSGQKTLYV  698

Query  1056  SSFFYDIATDVGIIDQEKASKIVKPRSFLVAAKLACETKFEDVKSTFPNAVEKDYPYLCM  1235
             +S FY + T V I D  K +  ++       A+  C+TK++D K+T+P   E   PY C+
Sbjct  699   TSSFYYVPTGVNIADPNKPNSKIRIEDLKTGAEQVCKTKYKDAKATYPLIYEDSLPYACL  758

Query  1236  DLVYEYTLLVDGLGLHPYKEITLMKKVEYKNYMVEAAWPLGCAIDVISS  1382
             DL+Y+YTL VDG GL P ++IT+  ++EY++ +V+AAWPLG AI+ +SS
Sbjct  759   DLIYQYTLFVDGFGLDPLQDITVANQIEYQDALVDAAWPLGNAIEAVSS  807



>gb|ABA91264.2| GDA1/CD39 family protein [Oryza sativa Japonica Group]
Length=465

 Score =   412 bits (1059),  Expect = 5e-135, Method: Compositional matrix adjust.
 Identities = 208/409 (51%), Positives = 275/409 (67%), Gaps = 10/409 (2%)
 Frame = +3

Query  177   GNYAVIFDAGSTGSRVHVFHFDENLDLLPIGDGVEFFLKTTPGLSSYANDPEAAAKSLEP  356
             G YAVI DAGSTG+RVHVF FD+ +DLL IGD +E F K  PGLSSYA  P+ AAKS+ P
Sbjct  51    GRYAVILDAGSTGTRVHVFRFDKKIDLLKIGDDIEVFAKVDPGLSSYAGRPQEAAKSIMP  110

Query  357   LLLEAEGVVPTELQPDTPLELGATAGLRLLEGDASDKILQAVRDMFKNESNFKSKAEWVS  536
             LL  A   VPT L   TPLELGATAGLRL+  D +++IL+AVRD+   ++ F+    W++
Sbjct  111   LLDRANHAVPTWLMNKTPLELGATAGLRLIGDDKANQILEAVRDVVHTKTKFQYNPNWIN  170

Query  537   ILEGSQEGTYFWVAMNYLLGNLGKGYQNTIATIDLGGGSVQVSYAVSGDTFANAPTPDNG  716
             +L GSQEG+Y WVA+NYLL  LG  Y  T+  IDLGGGSVQ++YA+S  T ANAP   +G
Sbjct  171   VLSGSQEGSYMWVALNYLLDRLGGDYSKTVGVIDLGGGSVQMAYAISTGTAANAPEVLDG  230

Query  717   EEPYVQEKYILGAQYYLYVHSYLNYGQLASRAEIFKASGNSTNPCVLEGYDGYYTYNDVS  896
             ++PY+ ++Y+    Y +YVHSYL+YG  ASR EI K    + + C+L G+ G Y YN   
Sbjct  231   QDPYIIKEYLKERDYNVYVHSYLHYGARASRVEILKRKNGTFSNCMLRGFSGKYIYNGEQ  290

Query  897   YKVTAPPNGSSLKNCRKLARKVVDFRAPCKYQNCTFNGVWSGGGGAGMENVYISSFFYDI  1076
             Y  TA P G+    CR    K ++  APC+  NC+FNGVW+GGGGAG + +Y+++ FY +
Sbjct  291   YDATAAPQGADYHKCRDDVVKALNLDAPCETNNCSFNGVWNGGGGAGQDELYVATSFYYM  350

Query  1077  ATD--------VGIIDQEKASKIVKPRSFLVAAKLACETKFEDVKSTFPNAVEKDYPYLC  1232
             A+D        +G ID E  S    P ++ VAA+  C    E+ K+ +P A   D+ YLC
Sbjct  351   ASDHEQGRLQQIGFIDSEAPSAKSTPAAYKVAAEKVCSLSVEEAKAAYPRAC--DHAYLC  408

Query  1233  MDLVYEYTLLVDGLGLHPYKEITLMKKVEYKNYMVEAAWPLGCAIDVIS  1379
             MDLVY+YTLLVDG GL   KE+TL++KV++  Y +EAAWPLG AI+ +S
Sbjct  409   MDLVYQYTLLVDGFGLEATKEMTLVEKVKHGEYYIEAAWPLGTAIEAVS  457



>gb|EAY96392.1| hypothetical protein OsI_18291 [Oryza sativa Indica Group]
Length=475

 Score =   409 bits (1052),  Expect = 1e-133, Method: Compositional matrix adjust.
 Identities = 207/406 (51%), Positives = 277/406 (68%), Gaps = 2/406 (0%)
 Frame = +3

Query  180   NYAVIFDAGSTGSRVHVFHFDENLDLLPIGDGVEFFLKTTPGLSSYANDPEAAAKSLEPL  359
              YAVIFDAGSTGSRVHVF FD+ +DL+ IGD +E F K  PGLSSYA  P+ AA S+ PL
Sbjct  70    KYAVIFDAGSTGSRVHVFRFDKQMDLVKIGDDMELFAKVKPGLSSYAGKPQEAANSIAPL  129

Query  360   LLEAEGVVPTELQPDTPLELGATAGLRLLEGDASDKILQAVRDMFKNESNFKSKAEWVSI  539
             L +A+GVVP +LQ  TPL+LGATAGLRL+  + S++IL+AVRD+  ++SNF+ K EW+S+
Sbjct  130   LEKAKGVVPKQLQKRTPLKLGATAGLRLIGDEKSEQILEAVRDLVHSKSNFQYKPEWISV  189

Query  540   LEGSQEGTYFWVAMNYLLGNLGKGYQNTIATIDLGGGSVQVSYAVSGDTFANAPTPDNGE  719
             L GSQEG+  WVA+NYLLG LG  Y  T+  IDLGGGSVQ++YA+S D   NAP    G+
Sbjct  190   LGGSQEGSNLWVALNYLLGKLGGDYSKTVGVIDLGGGSVQMAYAISSDAAENAPPVPVGK  249

Query  720   EPYVQEKYILGAQYYLYVHSYLNYGQLASRAEIFKASGNSTNPCVLEGYDGYYTYNDVSY  899
             +PYV ++Y+ G  Y LYVHSYL+YG  ASR EI K      + C+L G++G Y YN   Y
Sbjct  250   DPYVTKEYLKGKDYNLYVHSYLHYGLQASRVEILKTKNGQFSSCMLRGFNGTYKYNGEEY  309

Query  900   KVTAPPNGSSLKNCRKLARKVVDFRAPCKYQNCTFNGVWSGGGGAGMENVYISSFFYDIA  1079
                A P G+    C + A   +   APC+ +NC+FNGVW+GGGGAGM ++Y++S+FYD A
Sbjct  310   DAAASPEGADHGKCGEEAAAALGLDAPCESRNCSFNGVWNGGGGAGMADLYVASYFYDRA  369

Query  1080  TDVGIIDQEKASKIVKPRSFLVAAKLACETKFEDVKSTFPNAVEKDYPYLCMDLVYEYTL  1259
                G +  +  S +  P +F  AA  AC     +  + +P A   D  ++CMDL Y+YTL
Sbjct  370   VHGGFVVDDAPSAVTTPAAFAEAASKACSLSSGEAAAAYPEAF--DVQFICMDLTYQYTL  427

Query  1260  LVDGLGLHPYKEITLMKKVEYKNYMVEAAWPLGCAIDVISSSSANN  1397
             L  G GL P +E+TL+K+V+Y +  VE+AWPLG AI+ +SS  ++ 
Sbjct  428   LTKGFGLKPTREMTLVKQVKYGDCYVESAWPLGTAIEALSSQKSHQ  473



>ref|XP_008655272.1| PREDICTED: probable apyrase 1 isoform X1 [Zea mays]
 ref|XP_008655278.1| PREDICTED: probable apyrase 1 isoform X1 [Zea mays]
 ref|XP_008655286.1| PREDICTED: probable apyrase 1 isoform X1 [Zea mays]
 tpg|DAA45163.1| TPA: putative apyrase family protein [Zea mays]
Length=478

 Score =   409 bits (1050),  Expect = 2e-133, Method: Compositional matrix adjust.
 Identities = 212/404 (52%), Positives = 287/404 (71%), Gaps = 4/404 (1%)
 Frame = +3

Query  180   NYAVIFDAGSTGSRVHVFHFDENLDLLPIGDGVEFFLKTTPGLSSYANDPEAAAKSLEPL  359
              YAVIFDAGS+GSRVHV+ FDENLDL+PIG  +E F +  PGLS+ A  P+ AA+SL  L
Sbjct  77    KYAVIFDAGSSGSRVHVYCFDENLDLVPIGKEIELFKQKKPGLSA-AKGPQEAAESLISL  135

Query  360   LLEAEGVVPTELQPDTPLELGATAGLRLLEGDASDKILQAVRDMFKNESNFKSKAEWVSI  539
             L EAE VVP EL+  TP+ +GATAGLR L    S++ILQAVR++  ++S+FKS+  WV++
Sbjct  136   LEEAEKVVPAELREQTPVRVGATAGLRALGTQRSEEILQAVRELL-HDSSFKSQPNWVTV  194

Query  540   LEGSQEGTYFWVAMNYLLGNLGKGYQNTIATIDLGGGSVQVSYAVSGDTFANAPTPDNGE  719
             L+GSQEG + WV +NYLLG LGK Y NT+  +DLGGGSVQ++YA+S    A AP   +GE
Sbjct  195   LDGSQEGAFQWVTINYLLGKLGKPYSNTVGVVDLGGGSVQMAYAISEKDAAKAPLVADGE  254

Query  720   EPYVQEKYILGAQYYLYVHSYLNYGQLASRAEIFKA-SGNSTNPCVLEGYDGYYTYNDVS  896
             + YV+E  + G  YYLYVHSYL+YG LA+R EI KA  G+  + C+LEG+ G Y Y   +
Sbjct  255   DSYVKELLLKGTTYYLYVHSYLHYGLLAARGEILKAGEGSDYSDCMLEGHLGKYNYGGNT  314

Query  897   YKVTAPPNGSSLKNCRKLARKVVDFRAP-CKYQNCTFNGVWSGGGGAGMENVYISSFFYD  1073
             ++ +  P+G+S   CR LA + +    P C +  CTF GVW+GGGG G +N++++SFF+D
Sbjct  315   FEASGSPSGASYSKCRALAVRALKVDEPACTHMKCTFGGVWNGGGGDGQKNLFVASFFFD  374

Query  1074  IATDVGIIDQEKASKIVKPRSFLVAAKLACETKFEDVKSTFPNAVEKDYPYLCMDLVYEY  1253
              A + G +D + A   VKP  F   A+  C+   +D  +T+P+  E++ PYLC+DLVY+Y
Sbjct  375   RAAEAGFVDPKAAVAKVKPSDFEETARRVCKLNLKDAHATYPDVSEENIPYLCIDLVYQY  434

Query  1254  TLLVDGLGLHPYKEITLMKKVEYKNYMVEAAWPLGCAIDVISSS  1385
             TLLVDG G+ PY++ITL+KKV Y +  VEAAWPLG AI++ SSS
Sbjct  435   TLLVDGFGVDPYQDITLVKKVPYGDSYVEAAWPLGSAIEIASSS  478



>dbj|BAD13524.1| apyrase [Vicia faba]
Length=440

 Score =   407 bits (1047),  Expect = 2e-133, Method: Compositional matrix adjust.
 Identities = 211/413 (51%), Positives = 283/413 (69%), Gaps = 17/413 (4%)
 Frame = +3

Query  150   RRVLLSHE-TGNYAVIFDAGSTGSRVHVFHFDENLDLLPIGDGVEFFLKTTPGLSSYAND  326
             R++ L  E   +YAV+FDAGSTGSR+HV+HF++NLDLL IG GVE++ K TPGLSSYAN+
Sbjct  32    RKIFLKQEEISSYAVVFDAGSTGSRIHVYHFNQNLDLLHIGKGVEYYNKITPGLSSYANN  91

Query  327   PEAAAKSLEPLLLEAEGVVPTELQPDTPLELGATAGLRLLEGDASDKILQAVRDMFKNES  506
             PE AAKSL PLL +AE VVP +LQP TP+ LG               ILQ+VRDM  N S
Sbjct  92    PEQAAKSLIPLLEQAEDVVPDDLQPKTPVRLG---------------ILQSVRDMLSNRS  136

Query  507   NFKSKAEWVSILEGSQEGTYFWVAMNYLLGNLGKGYQNTIATIDLGGGSVQVSYAVSGDT  686
              F  + + VSI++G+QEG+Y WV +NY LGNLGK Y  T+  IDLGGGSVQ++YAVS  T
Sbjct  137   TFNVQPDAVSIIDGTQEGSYLWVTVNYALGNLGKKYTKTVGVIDLGGGSVQMAYAVSKKT  196

Query  687   FANAPTPDNGEEPYVQEKYILGAQYYLYVHSYLNYGQLASRAEIFKASGNSTNPCVLEGY  866
               NAP   +G++PY+++  + G  Y LYVHSYL++G+ ASRAEI K +  S NPC+L G+
Sbjct  197   AKNAPKVADGDDPYIKKVVLKGIPYDLYVHSYLHFGREASRAEILKLTPRSPNPCLLAGF  256

Query  867   DGYYTYNDVSYKVTAPPNGSSLKNCRKLARKVVDFRAPCKYQNCTFNGVWSGGGGAGMEN  1046
             +G YTY+    K TA  + +    C+   RK +    PC YQNCTF G+W+GGGG G +N
Sbjct  257   NGIYTYSGEEVKATAYTSWAQFNKCKNTIRKALKLNYPCPYQNCTFGGIWNGGGGNGQKN  316

Query  1047  VYISSFFYDIATDVGIIDQEKASKIVKPRSFLVAAKLACETKFEDVKSTFPNAVEKDYP-  1223
             ++ SS F+ +  D G++D    + I++P      AK AC   FED KST+P   +K+   
Sbjct  317   LFASSSFFYLPEDTGMVDASTPNFILRPVDIETKAKEACALNFEDAKSTYPFLDKKNVAS  376

Query  1224  YLCMDLVYEYTLLVDGLGLHPYKEITLMKKVEYKNYMVEAAWPLGCAIDVISS  1382
             Y+CMDL+Y+Y LLVDG GL P ++IT  K++EY++ +VEAAWPLG A++ IS+
Sbjct  377   YVCMDLIYQYVLLVDGFGLDPLQKITSGKEIEYQDAIVEAAWPLGNAVEAISA  429



>gb|EMS65821.1| Apyrase [Triticum urartu]
Length=436

 Score =   407 bits (1045),  Expect = 3e-133, Method: Compositional matrix adjust.
 Identities = 200/402 (50%), Positives = 269/402 (67%), Gaps = 2/402 (0%)
 Frame = +3

Query  174   TGNYAVIFDAGSTGSRVHVFHFDENLDLLPIGDGVEFFLKTTPGLSSYANDPEAAAKSLE  353
              G YAVI DAGSTG+R+HVF FD+ +DL+ IGD +E F K  PGLSSY+  P+ A +S+ 
Sbjct  32    VGKYAVILDAGSTGTRMHVFRFDKRMDLVKIGDDIEVFAKVNPGLSSYSGRPKEATESIL  91

Query  354   PLLLEAEGVVPTELQPDTPLELGATAGLRLLEGDASDKILQAVRDMFKNESNFKSKAEWV  533
             PLL +A  VVP  L   TP++LGATAGLRL+    + +IL AVR      + F+   +W+
Sbjct  92    PLLQKANSVVPQRLMKTTPVKLGATAGLRLIGDKQAKQILDAVRGAVHTNTKFQYNPKWI  151

Query  534   SILEGSQEGTYFWVAMNYLLGNLGKGYQNTIATIDLGGGSVQVSYAVSGDTFANAPTPDN  713
             ++LEGSQEG+Y WVA+NYLL NLG  Y  T+  IDLGGGSVQ++YA+S  T   AP   +
Sbjct  152   NVLEGSQEGSYLWVALNYLLDNLGGDYSKTVGVIDLGGGSVQMAYAISPATVVAAPGVPH  211

Query  714   GEEPYVQEKYILGAQYYLYVHSYLNYGQLASRAEIFKASGNSTNPCVLEGYDGYYTYNDV  893
             G++PYV ++Y+ G  Y +YVHSYL YG LASR EIFKA     + C+L G+ G YTYN  
Sbjct  212   GKDPYVTKEYLKGRDYNIYVHSYLRYGALASRVEIFKAKEGPFSYCMLRGFSGKYTYNGE  271

Query  894   SYKVTAPPNGSSLKNCRKLARKVVDFRAPCKYQNCTFNGVWSGGGGAGMENVYISSFFYD  1073
              Y  TA   G+    CR    K +   APC+ + CTF+GVW+GGGG G  N+Y++S FY 
Sbjct  272   EYNATASTGGAQYGKCRGDVMKALKLDAPCQAKKCTFDGVWNGGGGPGQANLYVASSFYY  331

Query  1074  IATDVGIIDQEKASKIVKPRSFLVAAKLACETKFEDVKSTFPNAVEKDYPYLCMDLVYEY  1253
             +A+ VG+ID +  S    P +F   A+  C    ++VK+ +P    +D PY+CMDLVY+Y
Sbjct  332   MASQVGLIDSDAPSGTSTPMAFRAVAQKICRMSLKEVKAKYPKV--RDIPYICMDLVYQY  389

Query  1254  TLLVDGLGLHPYKEITLMKKVEYKNYMVEAAWPLGCAIDVIS  1379
             +LLVDG GL P K ITL++KV++  Y +EAAWPLG AI+ ++
Sbjct  390   SLLVDGFGLEPTKNITLVEKVKHGEYFIEAAWPLGEAIEAVA  431



>ref|NP_001154717.1| apyrase 2 [Arabidopsis thaliana]
 gb|AED92533.1| apyrase 2 [Arabidopsis thaliana]
Length=630

 Score =   413 bits (1062),  Expect = 4e-133, Method: Compositional matrix adjust.
 Identities = 220/456 (48%), Positives = 294/456 (64%), Gaps = 57/456 (13%)
 Frame = +3

Query  180   NYAVIFDAGSTGSRVHVFHFDENLDLLPIGDGVEFFLKT---------------------  296
             NYAVIFDAGS+GSRVHV+ FD+NLDL+P+G+ +E FL++                     
Sbjct  176   NYAVIFDAGSSGSRVHVYCFDQNLDLIPLGNELELFLQSLVKKLASPNGSNRANMTLFDH  235

Query  297   -------------------------------TPGLSSYANDPEAAAKSLEPLLLEAEGVV  383
                                             PGLS+Y  DP  AA SL  LL +AE  V
Sbjct  236   GNISCPEVKLNRINGKLRTLLSMYIIDLCSLKPGLSAYPTDPRQAANSLVSLLDKAEASV  295

Query  384   PTELQPDTPLELGATAGLRLLEGDASDKILQAVRDMFKNESNFKSKAEWVSILEGSQEGT  563
             P EL+P T + +GATAGLR L  DAS+ ILQAVR++ ++ S  K++A  V++L+G+QEG+
Sbjct  296   PRELRPKTHVRVGATAGLRTLGHDASENILQAVRELLRDRSMLKTEANAVTVLDGTQEGS  355

Query  564   YFWVAMNYLLGNLGKGYQNTIATIDLGGGSVQVSYAVSGDTFANAPTPDNGEEPYVQEKY  743
             Y WV +NYLL NLGK Y +T+  +DLGGGSVQ++YA+S +  A+AP P  GE+ YV+E Y
Sbjct  356   YQWVTINYLLRNLGKPYSDTVGVVDLGGGSVQMAYAISEEDAASAPKPLEGEDSYVREMY  415

Query  744   ILGAQYYLYVHSYLNYGQLASRAEIFKASGNSTNPCVLEGYDGYYTYNDVSYKVTAPPNG  923
             + G +Y+LYVHSYL+YG LA+RAEI K S +S NPC++ GYDG Y Y    +K  A  +G
Sbjct  416   LKGRKYFLYVHSYLHYGLLAARAEILKVSEDSENPCIVAGYDGMYKYGGKEFKAPASQSG  475

Query  924   SSLKNCRKL---ARKVVDFRAPCKYQNCTFNGVWSGGGGAGMENVYISSFFYDIATDVGI  1094
             +SL  CR++   A KV D    C +  CTF GVW+GG G G +N++++SFF+D A + G 
Sbjct  476   ASLDECRRITINALKVND--TLCTHMKCTFGGVWNGGRGGGQKNMFVASFFFDRAAEAGF  533

Query  1095  IDQEKASKIVKPRSFLVAAKLACETKFEDVKSTFPNAVEKDYPYLCMDLVYEYTLLVDGL  1274
             +D ++    V+P  F  AAK AC  K E+ KSTFP   E++ PYLCMDLVY+YTLL+DG 
Sbjct  534   VDPKQPVATVRPMDFEKAAKKACSMKLEEGKSTFPLVEEENLPYLCMDLVYQYTLLIDGF  593

Query  1275  GLHPYKEITLMKKVEYKNYMVEAAWPLGCAIDVISS  1382
             GL P + ITL+KKV+Y +  VEAAWPLG AI+ +SS
Sbjct  594   GLEPSQTITLVKKVKYGDQAVEAAWPLGSAIEAVSS  629



>ref|XP_003557997.1| PREDICTED: probable apyrase 1 [Brachypodium distachyon]
Length=484

 Score =   408 bits (1048),  Expect = 4e-133, Method: Compositional matrix adjust.
 Identities = 212/406 (52%), Positives = 290/406 (71%), Gaps = 3/406 (1%)
 Frame = +3

Query  174   TGNYAVIFDAGSTGSRVHVFHFDENLDLLPIGDGVEFFLKTTPGLSSYANDPEAAAKSLE  353
             +  YAVIFDAGS+GSRVHV+ FD NLDL+PIG+ +E F +   GLS+YA DP+ AA+SL 
Sbjct  80    SNRYAVIFDAGSSGSRVHVYCFDANLDLVPIGNEIELFKQQKLGLSAYAKDPQEAAESLV  139

Query  354   PLLLEAEGVVPTELQPDTPLELGATAGLRLLEGDASDKILQAVRDMFKNESNFKSKAEWV  533
              LL EAE VVP EL+  TP+ +GATAGLR L  + SD+ILQAVRD+ +++S+FKS+ +WV
Sbjct  140   SLLEEAEKVVPVELREQTPVRVGATAGLRALGTERSDEILQAVRDLLRDKSSFKSQPDWV  199

Query  534   SILEGSQEGTYFWVAMNYLLGNLGKGYQNTIATIDLGGGSVQVSYAVSGDTFANAPTPDN  713
             ++L+GSQEG + WV +NYLL  LGK Y +T+  +DLGGGSVQ++YA+S    A AP   +
Sbjct  200   TVLDGSQEGAFQWVTINYLLEKLGKPYSHTVGVVDLGGGSVQMAYAISEKDAAKAPEVSD  259

Query  714   GEEPYVQEKYILGAQYYLYVHSYLNYGQLASRAEIFKA-SGNSTNPCVLEGYDGYYTYND  890
             GE+ YV++  + G  YYLYVHSYL+YG LA+RAEI KA   N  + C+L+GY G Y Y D
Sbjct  260   GEDSYVKKLVLKGTTYYLYVHSYLHYGLLAARAEILKAGESNDYSNCMLDGYHGKYKYGD  319

Query  891   VSYKVTAPPNGSSLKNCRKLARKVVDFRAP-CKYQNCTFNGVWSGGGGAGMENVYISSFF  1067
              +++ +   + S  K CR +A   +    P C +  CTF GVW+GGGG G +N++++SFF
Sbjct  320   DTFEASGSSSASYSK-CRAIAVSALKVDEPACTHMKCTFGGVWNGGGGDGQKNLFVASFF  378

Query  1068  YDIATDVGIIDQEKASKIVKPRSFLVAAKLACETKFEDVKSTFPNAVEKDYPYLCMDLVY  1247
             +D A + G ++ + A   VKP  F  AA+  C+   ++ ++T+P+  E + PYLCMDLVY
Sbjct  379   FDRAAEAGFVNPKAAVPKVKPSDFEEAARRVCKLNVKEARATYPDVSEDNIPYLCMDLVY  438

Query  1248  EYTLLVDGLGLHPYKEITLMKKVEYKNYMVEAAWPLGCAIDVISSS  1385
             ++TLLVDG G+ PY++ITL+KKV Y N  VEAAWPLG AI+V SSS
Sbjct  439   QHTLLVDGFGVDPYQDITLVKKVPYGNSFVEAAWPLGSAIEVASSS  484



>ref|XP_002442734.1| hypothetical protein SORBIDRAFT_08g001950 [Sorghum bicolor]
 gb|EES16572.1| hypothetical protein SORBIDRAFT_08g001950 [Sorghum bicolor]
Length=442

 Score =   406 bits (1044),  Expect = 6e-133, Method: Compositional matrix adjust.
 Identities = 206/407 (51%), Positives = 271/407 (67%), Gaps = 21/407 (5%)
 Frame = +3

Query  177   GNYAVIFDAGSTGSRVHVFHFDENLDLLPIGDGVEFFLKTTPGLSSYANDPEAAAKSLEP  356
             G YAVIFDAGSTGSRVHVF FD+ LDL+PIGD +EFF K  PGLSS+A  P+ AA S+ P
Sbjct  55    GRYAVIFDAGSTGSRVHVFKFDKKLDLVPIGDDIEFFTKIKPGLSSFAGKPQEAANSILP  114

Query  357   LLLEAEGVVPTELQPDTPLELGATAGLRLLEGDASDKILQAVRDMFKNESNFKSKAEWVS  536
             LL +A+ +VP  LQ DTPL+LGATAGLRL+  + +++IL+AVRD+   +S F+   +W++
Sbjct  115   LLEQAKEIVPLRLQKDTPLKLGATAGLRLIGDEKAEEILEAVRDLVHTKSKFQYNPKWIT  174

Query  537   ILEGSQEGTYFWVAMNYLLGNLGKGYQNTIATIDLGGGSVQVSYAVSGDTFANAPTPDNG  716
             +LEG+QEG+Y WVA+NYLLG LG  Y  T+  IDLG                    PD G
Sbjct  175   VLEGTQEGSYLWVALNYLLGKLGGDYSKTVGVIDLGA------------------VPD-G  215

Query  717   EEPYVQEKYILGAQYYLYVHSYLNYGQLASRAEIFKASGNSTNPCVLEGYDGYYTYNDVS  896
             ++PY+ ++Y+ G  Y LYVHSYL YG  A R EI KA     + CVL G+ G Y+YN   
Sbjct  216   KDPYITKEYLKGKYYNLYVHSYLYYGLSAVRVEILKAKNGPFSHCVLRGFSGTYSYNGKD  275

Query  897   YKVTAPPNGSSLKNCRKLARKVVDFRAPCKYQNCTFNGVWSGGGGAGMENVYISSFFYDI  1076
             Y  TA P G+    CR+   K ++  APC  +NCTFNGVW+GGGGAG +N+Y++SFF+D 
Sbjct  276   YDATASPEGAVYDKCREEIIKALNQSAPCNAKNCTFNGVWNGGGGAGQDNLYVASFFFDK  335

Query  1077  ATDVGIIDQEKASKIVKPRSFLVAAKLACETKFEDVKSTFPNAVEKDYPYLCMDLVYEYT  1256
             A+ VG ID E  S    P +F  AA+  C    ++ K+ +P+    D PY+CMDL+Y+YT
Sbjct  336   ASQVGFIDSEAPSVKSTPSAFKAAAEKVCLLSADEAKAGYPDLY--DVPYICMDLIYQYT  393

Query  1257  LLVDGLGLHPYKEITLMKKVEYKNYMVEAAWPLGCAIDVISSSSANN  1397
             LLVDG GL P KEITL+ +V+Y  + VEAAWPLG AI+ ++    N 
Sbjct  394   LLVDGFGLAPTKEITLVSRVKYGEFDVEAAWPLGTAIEAVAPKKMNQ  440



>ref|XP_006664293.1| PREDICTED: probable apyrase 3-like [Oryza brachyantha]
Length=445

 Score =   405 bits (1042),  Expect = 1e-132, Method: Compositional matrix adjust.
 Identities = 199/404 (49%), Positives = 276/404 (68%), Gaps = 3/404 (1%)
 Frame = +3

Query  171   ETGNYAVIFDAGSTGSRVHVFHFD-ENLDLLPIGDGVEFFLKTTPGLSSYANDPEAAAKS  347
             + G Y VI DAGSTG+R+HVF FD + LDLL IGD +E F K  PGLSSYA  P+ AAKS
Sbjct  43    KAGRYVVILDAGSTGTRLHVFRFDVKRLDLLDIGDHIEVFAKVDPGLSSYAGRPQEAAKS  102

Query  348   LEPLLLEAEGVVPTELQPDTPLELGATAGLRLLEGDASDKILQAVRDMFKNESNFKSKAE  527
             + PLL +A   VP  L   TPL LGATAGLRL+  + +++IL+AVRD+  ++S ++    
Sbjct  103   ILPLLHDANKAVPAPLINKTPLRLGATAGLRLVGDEKANQILEAVRDVVHSKSKYQYNPN  162

Query  528   WVSILEGSQEGTYFWVAMNYLLGNLGKGYQNTIATIDLGGGSVQVSYAVSGDTFANAPTP  707
             W+++L GSQEG+Y WVA+NYLL  LG+ Y  T+  IDLGG SVQ++YA+S  T ANAP  
Sbjct  163   WINVLTGSQEGSYMWVALNYLLDRLGRDYSKTVGVIDLGGASVQMAYAISSSTAANAPKV  222

Query  708   DNGEEPYVQEKYILGAQYYLYVHSYLNYGQLASRAEIFKASGNSTNPCVLEGYDGYYTYN  887
              +G++PY+ ++Y+ G  Y +YVHSYL YG LA+R EI K      + C+L G++G +TYN
Sbjct  223   PHGKDPYITKEYLNGKDYNIYVHSYLRYGGLAARVEILKRKTGQYSNCMLHGFNGNFTYN  282

Query  888   DVSYKVTAPPNGSSLKNCRKLARKVVDFRAPCKYQNCTFNGVWSGGGGAGMENVYISSFF  1067
                Y  TA P G+   NCR      ++  APCK +NCTFNGVW+GGGG G +++Y++S F
Sbjct  283   GKQYDATAAPQGADYHNCRDDVVNTLNLDAPCKTKNCTFNGVWNGGGGKGQDDLYVASGF  342

Query  1068  YDIATDVGIIDQEKASKIVKPRSFLVAAKLACETKFEDVKSTFPNAVEKDYPYLCMDLVY  1247
             Y +A+++G ID +  S    P +F   A+  C    ++ K+ +P A  +D+ YLCMDL+Y
Sbjct  343   YYLASNLGFIDNDAPSAKSTPTAFKDGAEKVCRMSIQEAKAAYPKA--RDHAYLCMDLIY  400

Query  1248  EYTLLVDGLGLHPYKEITLMKKVEYKNYMVEAAWPLGCAIDVIS  1379
             +Y+LLVDG GL   K+ITL+ KV++  Y ++AAWPLG AI+ +S
Sbjct  401   QYSLLVDGYGLDSNKKITLVAKVKHGEYYIDAAWPLGTAIEAVS  444



>ref|XP_003562437.1| PREDICTED: probable apyrase 2 [Brachypodium distachyon]
Length=465

 Score =   406 bits (1044),  Expect = 1e-132, Method: Compositional matrix adjust.
 Identities = 202/401 (50%), Positives = 281/401 (70%), Gaps = 1/401 (0%)
 Frame = +3

Query  183   YAVIFDAGSTGSRVHVFHFDENLDLLPIGDGVEFFLKTTPGLSSYANDPEAAAKSLEPLL  362
             YAVIFDAGS+GSRVHVF FD NLDL+ IG  +E F++  PGLS+YA+DP  AA+SL  L+
Sbjct  65    YAVIFDAGSSGSRVHVFCFDANLDLVHIGTEIELFVQKKPGLSAYASDPREAAESLVSLI  124

Query  363   LEAEGVVPTELQPDTPLELGATAGLRLLEGDASDKILQAVRDMFKNESNFKSKAEWVSIL  542
               A+ VVP EL+  TP+ +GATAGLR L  + S++IL AVRD+ + +S+FK++ +WV++L
Sbjct  125   DAAKQVVPAELRDQTPVRVGATAGLRALGAEKSEQILDAVRDLLREKSSFKNQPDWVTVL  184

Query  543   EGSQEGTYFWVAMNYLLGNLGKGYQNTIATIDLGGGSVQVSYAVSGDTFANAPTPDNGEE  722
             +G QEG Y WV +NYLLG LGK Y +T+  +DLGGGSVQ++YA+       AP P +GEE
Sbjct  185   DGYQEGAYEWVTINYLLGKLGKTYADTVGVVDLGGGSVQMAYAIPEKDAEKAPKPTDGEE  244

Query  723   PYVQEKYILGAQYYLYVHSYLNYGQLASRAEIFKAS-GNSTNPCVLEGYDGYYTYNDVSY  899
              YV++ ++ G  Y+LYVHSYL YG LA+RAEI KA   N  + C+L G+ G Y Y   ++
Sbjct  245   SYVKKLFLKGTTYHLYVHSYLRYGLLAARAEILKAGIANGYSDCILGGHQGQYKYGGNTF  304

Query  900   KVTAPPNGSSLKNCRKLARKVVDFRAPCKYQNCTFNGVWSGGGGAGMENVYISSFFYDIA  1079
             + +A P+G+S   CR    K +     C +  C+F G+W+GGGG G +N++++SFF+D A
Sbjct  305   EASAAPSGASYSKCRDDVVKALKVDEACTHMKCSFGGIWNGGGGDGQKNLFVASFFFDRA  364

Query  1080  TDVGIIDQEKASKIVKPRSFLVAAKLACETKFEDVKSTFPNAVEKDYPYLCMDLVYEYTL  1259
              + G I+ + A   VKP  F  AAK AC+    D +S++P   + + P++CMDLVY+Y+L
Sbjct  365   AEAGFINPKAAVAKVKPSDFEEAAKRACKLNVNDAQSSYPGVQQDNVPFICMDLVYQYSL  424

Query  1260  LVDGLGLHPYKEITLMKKVEYKNYMVEAAWPLGCAIDVISS  1382
             LVDG G+ P +E+TL+KKV Y +  VEAAWPLG AI+V SS
Sbjct  425   LVDGFGVDPQQEMTLVKKVPYSDAFVEAAWPLGSAIEVASS  465



>ref|XP_008792532.1| PREDICTED: probable apyrase 2 isoform X1 [Phoenix dactylifera]
Length=428

 Score =   404 bits (1037),  Expect = 4e-132, Method: Compositional matrix adjust.
 Identities = 219/413 (53%), Positives = 271/413 (66%), Gaps = 31/413 (8%)
 Frame = +3

Query  171   ETGNYAVIFDAGSTGSRVHVFHFDENLDLLPIGDGVEFFLKTTPGLSSYANDPEAAAKSL  350
             ET +YAVIFDAGSTGSRVHVF FDEN+DL+ IGD +E ++   PGLSSYA+DP+ AA SL
Sbjct  38    ETESYAVIFDAGSTGSRVHVFRFDENMDLVNIGDDIELYVAVKPGLSSYADDPQEAANSL  97

Query  351   EPLLLEAEGVVPTELQPDTPLELGATAGLRLLEGDASDKILQAVRDMFKNESNFKSKAEW  530
              PLL EAE VVP ELQP TP+ LGATAGLR L  + S++ILQAV                
Sbjct  98    IPLLEEAESVVPEELQPTTPVRLGATAGLRNLGDEKSEEILQAV----------------  141

Query  531   VSILEGSQEGTYFWVAMNYLLGNLGKGYQNTIATIDLGGGSVQVSYAVSGDTFANAPTPD  710
                            AMNYLLGNLG  Y +T+  +DLGGGSVQ++YAVS +  ANAP   
Sbjct  142   ---------------AMNYLLGNLGNKYSDTVGVVDLGGGSVQMAYAVSEEAAANAPNIS  186

Query  711   NGEEPYVQEKYILGAQYYLYVHSYLNYGQLASRAEIFKASGNSTNPCVLEGYDGYYTYND  890
             NG++PYV ++ +    YYLY +SYLN+G LA+RAEI +A  +  + C+L GY G Y YN 
Sbjct  187   NGDDPYVTKQLLNETNYYLYAYSYLNFGLLAARAEILEAVDDPYSYCMLGGYTGTYEYNG  246

Query  891   VSYKVTAPPNGSSLKNCRKLARKVVDFRAPCKYQNCTFNGVWSGGGGAGMENVYISSFFY  1070
               Y  +A P+GSS   CR  A K +     C Y++C+F GVWSGGGG G +N+Y++SFFY
Sbjct  247   EVYNASASPSGSSYNKCRTDAIKTLKINETCTYEDCSFGGVWSGGGGDGQKNIYVASFFY  306

Query  1071  DIATDVGIIDQEKASKIVKPRSFLVAAKLACETKFEDVKSTFPNAVEKDYPYLCMDLVYE  1250
             D A  VG ID E+ S +V P  F  AAK AC    E+   T+PN    D PY+CMDL YE
Sbjct  307   DRAAQVGFIDPEEPSALVTPSDFEEAAKTACNLSLEEANVTYPNVAADDLPYICMDLAYE  366

Query  1251  YTLLVDGLGLHPYKEITLMKKVEYKNYMVEAAWPLGCAIDVISSSSANNLLSK  1409
             YTLLVDG GL P +EITL+ KV+Y +  V AAWPLG AI+V+SS S  +L  K
Sbjct  367   YTLLVDGFGLEPSQEITLVSKVKYGDSYVGAAWPLGSAIEVVSSQSTQSLAMK  419



>ref|NP_001067813.1| Os11g0439600 [Oryza sativa Japonica Group]
 gb|AAX94975.1| apyrase [Oryza sativa Japonica Group]
 gb|ABA93335.1| GDA1/CD39 family protein, expressed [Oryza sativa Japonica Group]
 dbj|BAF28176.1| Os11g0439600 [Oryza sativa Japonica Group]
 dbj|BAG96402.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG91697.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG96675.1| unnamed protein product [Oryza sativa Japonica Group]
Length=475

 Score =   405 bits (1041),  Expect = 5e-132, Method: Compositional matrix adjust.
 Identities = 209/421 (50%), Positives = 281/421 (67%), Gaps = 4/421 (1%)
 Frame = +3

Query  141   PHLRRVLLSHETGN--YAVIFDAGSTGSRVHVFHFDENLDLLPIGDGVEFFLKTTPGLSS  314
             P L+        GN  YAVIFDAGSTGSRVHVF FD+ +DL+ IGD +E F K  PGLSS
Sbjct  55    PALQISARKDGAGNDKYAVIFDAGSTGSRVHVFRFDKQMDLVKIGDDMELFAKVKPGLSS  114

Query  315   YANDPEAAAKSLEPLLLEAEGVVPTELQPDTPLELGATAGLRLLEGDASDKILQAVRDMF  494
             YA  P+ AA S+ PLL +A+GVVP +LQ  TPL+LGATAGLRL+  + S++IL+AVRD+ 
Sbjct  115   YAGKPQEAANSIAPLLEKAKGVVPKQLQKRTPLKLGATAGLRLIGDEKSEQILEAVRDLV  174

Query  495   KNESNFKSKAEWVSILEGSQEGTYFWVAMNYLLGNLGKGYQNTIATIDLGGGSVQVSYAV  674
              ++SNF+ K EW+S+L GSQEG+  WVA+NYLLG LG  Y  T+  IDLGGGSVQ++YA+
Sbjct  175   HSKSNFQYKPEWISVLGGSQEGSNLWVALNYLLGKLGGDYSKTVGVIDLGGGSVQMAYAI  234

Query  675   SGDTFANAPTPDNGEEPYVQEKYILGAQYYLYVHSYLNYGQLASRAEIFKASGNSTNPCV  854
             S D   N+P    G++PYV ++Y+ G  Y LYVHSYL+YG  ASR EI K      + C+
Sbjct  235   SSDAAENSPPVPVGKDPYVTKEYLKGKDYNLYVHSYLHYGLQASRVEILKTKNGQFSSCM  294

Query  855   LEGYDGYYTYNDVSYKVTAPPNGSSLKNCRKLARKVVDFRAPCKYQNCTFNGVWSGGGGA  1034
             L  ++G Y YN   Y   A P G+    C + A   +   APC+ +NC+FNGVW+GGGGA
Sbjct  295   LREFNGTYKYNGEEYDAAASPEGADHGKCGEEAAAALGLDAPCESRNCSFNGVWNGGGGA  354

Query  1035  GMENVYISSFFYDIATDVGIIDQEKASKIVKPRSFLVAAKLACETKFEDVKSTFPNAVEK  1214
             GM ++Y++S+FYD A   G +  +  S +  P +F  AA  AC     +  + +P A   
Sbjct  355   GMADLYVASYFYDRAVHGGFVVDDAPSAVTTPAAFAEAASKACSLSSGEAAAAYPEAF--  412

Query  1215  DYPYLCMDLVYEYTLLVDGLGLHPYKEITLMKKVEYKNYMVEAAWPLGCAIDVISSSSAN  1394
             D  ++CMDL Y+YTLL  G GL P +E+TL+K+V+Y +  VE+AWPLG AI+ +SS  ++
Sbjct  413   DVQFICMDLTYQYTLLTKGFGLKPTREMTLVKQVKYGDCYVESAWPLGTAIEALSSQKSH  472

Query  1395  N  1397
              
Sbjct  473   Q  473



>gb|EEC67579.1| hypothetical protein OsI_34932 [Oryza sativa Indica Group]
Length=519

 Score =   406 bits (1043),  Expect = 7e-132, Method: Compositional matrix adjust.
 Identities = 204/407 (50%), Positives = 276/407 (68%), Gaps = 2/407 (0%)
 Frame = +3

Query  177   GNYAVIFDAGSTGSRVHVFHFDENLDLLPIGDGVEFFLKTTPGLSSYANDPEAAAKSLEP  356
             G YAVI DAGSTG+RVHVF FD  +DLL IGD +E F K  PGLSSYA  P  AA S++P
Sbjct  54    GKYAVILDAGSTGTRVHVFRFDRKMDLLKIGDDIEVFAKVDPGLSSYAGRPREAANSIQP  113

Query  357   LLLEAEGVVPTELQPDTPLELGATAGLRLLEGDASDKILQAVRDMFKNESNFKSKAEWVS  536
             LL +A  VVP  L   TPL+LGATAGLRL+  + +++IL+AVRD+   +S F+    W++
Sbjct  114   LLDKAIHVVPNWLMKKTPLKLGATAGLRLIGDEKANQILEAVRDVVHTKSKFQYNPNWIN  173

Query  537   ILEGSQEGTYFWVAMNYLLGNLGKGYQNTIATIDLGGGSVQVSYAVSGDTFANAPTPDNG  716
             +L GSQEG+Y WVA+NYLL  LG+ Y  T+  IDLGGGSVQ++YAVS    ANAP   NG
Sbjct  174   VLTGSQEGSYMWVALNYLLDRLGEDYSKTVGVIDLGGGSVQMAYAVSSSIAANAPEVSNG  233

Query  717   EEPYVQEKYILGAQYYLYVHSYLNYGQLASRAEIFKASGNSTNPCVLEGYDGYYTYNDVS  896
             ++PY+ ++Y+ G  Y +YVHSYL+YG  ASR EI K      + C+L G+ G +TYN   
Sbjct  234   QDPYITKEYLKGRDYNIYVHSYLHYGAQASRVEILKRKNGPFSNCMLRGFKGKFTYNGEQ  293

Query  897   YKVTAPPNGSSLKNCRKLARKVVDFRAPCKYQNCTFNGVWSGGGGAGMENVYISSFFYDI  1076
             Y+  A P G+    CR+   K ++  +PC+ +NC+FNGVW+GGGG G + +Y++S FY I
Sbjct  294   YEAMAAPQGADYHKCRQDVVKALNLDSPCETKNCSFNGVWNGGGGVGQDEIYVTSSFYYI  353

Query  1077  ATDVGIIDQEKASKIVKPRSFLVAAKLACETKFEDVKSTFPNAVEKDYPYLCMDLVYEYT  1256
             A+ +G ID E  S    P ++  A++  C    E+ K+ +P  + +D+ YLCMDL+Y+YT
Sbjct  354   ASGIGFIDSEAPSAKSTPAAYKAASEKVCILSIEEAKAAYP--IARDHAYLCMDLIYQYT  411

Query  1257  LLVDGLGLHPYKEITLMKKVEYKNYMVEAAWPLGCAIDVISSSSANN  1397
             LLVDG GL   KEITL++KV++  Y +EAAWPLG AI+     +A N
Sbjct  412   LLVDGFGLEATKEITLVEKVKHGEYYIEAAWPLGTAIEARRPQAAAN  458


 Score = 61.6 bits (148),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 31/71 (44%), Positives = 46/71 (65%), Gaps = 0/71 (0%)
 Frame = +3

Query  303  GLSSYANDPEAAAKSLEPLLLEAEGVVPTELQPDTPLELGATAGLRLLEGDASDKILQAV  482
            G +  A  P+AAA S+ PLL +A  VVP  L   TPL+LGAT G RL+  + +++IL+AV
Sbjct  445  GTAIEARRPQAAANSILPLLDKANTVVPARLMNKTPLKLGATTGPRLIGDEKANQILEAV  504

Query  483  RDMFKNESNFK  515
            RD+   +  ++
Sbjct  505  RDVVHTKRKYQ  515



>ref|XP_002449272.1| hypothetical protein SORBIDRAFT_05g007000 [Sorghum bicolor]
 gb|EES08260.1| hypothetical protein SORBIDRAFT_05g007000 [Sorghum bicolor]
Length=460

 Score =   404 bits (1037),  Expect = 9e-132, Method: Compositional matrix adjust.
 Identities = 214/401 (53%), Positives = 279/401 (70%), Gaps = 0/401 (0%)
 Frame = +3

Query  177   GNYAVIFDAGSTGSRVHVFHFDENLDLLPIGDGVEFFLKTTPGLSSYANDPEAAAKSLEP  356
             G YAVIFDAGSTGSRV+VF FD  +DLL IGD +EFF K  PGLSSYA  P+ AAKS+ P
Sbjct  54    GRYAVIFDAGSTGSRVYVFRFDRQMDLLRIGDEIEFFAKVKPGLSSYAGQPQEAAKSILP  113

Query  357   LLLEAEGVVPTELQPDTPLELGATAGLRLLEGDASDKILQAVRDMFKNESNFKSKAEWVS  536
             LL +A+ +VP+ L   TPL+LGATAGLRL+    +D+IL AVRD+   +S F+ K+  ++
Sbjct  114   LLDKAKRIVPSWLMKRTPLKLGATAGLRLIGNQQADQILDAVRDLVHKKSKFQCKSNCIN  173

Query  537   ILEGSQEGTYFWVAMNYLLGNLGKGYQNTIATIDLGGGSVQVSYAVSGDTFANAPTPDNG  716
             +LEGSQEG+Y WVA+NYLL  LG  Y  T+  ID+GGGSVQ++YAVS  + A AP   +G
Sbjct  174   VLEGSQEGSYLWVALNYLLDKLGGDYSQTVGVIDMGGGSVQMAYAVSSYSAARAPAVPDG  233

Query  717   EEPYVQEKYILGAQYYLYVHSYLNYGQLASRAEIFKASGNSTNPCVLEGYDGYYTYNDVS  896
             E+PY+ ++Y  G +Y +YVHSYL+YG  ASRAEI K+     + C+L G+ G YTYN   
Sbjct  234   EDPYITKEYFKGKEYNVYVHSYLHYGSFASRAEILKSKNGPFSFCMLRGFSGKYTYNGQQ  293

Query  897   YKVTAPPNGSSLKNCRKLARKVVDFRAPCKYQNCTFNGVWSGGGGAGMENVYISSFFYDI  1076
             Y   A P G+  + CR+   K ++ +APCK +NCTF GVW+GGGGAG  N+Y++S FY +
Sbjct  294   YDAIARPEGALYEKCREEITKALNLKAPCKTKNCTFGGVWNGGGGAGQNNIYVASGFYYL  353

Query  1077  ATDVGIIDQEKASKIVKPRSFLVAAKLACETKFEDVKSTFPNAVEKDYPYLCMDLVYEYT  1256
             A+ VG ID +  S    P +F  AAK AC+   +  K  +PN  + D PYLCMDL Y YT
Sbjct  354   ASHVGFIDSKAPSAKAAPAAFRAAAKKACQLDVKKAKVAYPNISDSDVPYLCMDLTYTYT  413

Query  1257  LLVDGLGLHPYKEITLMKKVEYKNYMVEAAWPLGCAIDVIS  1379
             LLVDG GL P K+IT + KV++  Y +EAAWPLG AI+ +S
Sbjct  414   LLVDGFGLQPMKKITFVSKVKHGEYYMEAAWPLGTAIEAVS  454



>dbj|BAD13520.1| apyrase [Vicia faba]
Length=455

 Score =   403 bits (1036),  Expect = 1e-131, Method: Compositional matrix adjust.
 Identities = 215/413 (52%), Positives = 289/413 (70%), Gaps = 2/413 (0%)
 Frame = +3

Query  150   RRVLLSHE-TGNYAVIFDAGSTGSRVHVFHFDENLDLLPIGDGVEFFLKTTPGLSSYAND  326
             R++ L  E   +YAV+FDAGSTGSR+HV+HF++NLDLL IG GVE++ K TPG SSYAN+
Sbjct  32    RKIFLKQEEISSYAVVFDAGSTGSRIHVYHFNQNLDLLHIGKGVEYYNKITPGFSSYANN  91

Query  327   PEAAAKSLEPLLLEAEGVVPTELQPDTPLELGATAGLRLLEGDASDKILQAVRDMFKNES  506
             PE AAKSL PLL +AE VVP +LQP TP+ LGA  GL LL GDAS+KILQ+VRDM  N S
Sbjct  92    PEQAAKSLIPLLEQAEDVVPDDLQPKTPVRLGALPGLGLLNGDASEKILQSVRDMLSNRS  151

Query  507   NFKSKAEWVSILEGSQEGTYFWVAMNYLLGNLGKGYQNTIATIDLGGGSVQVSYAVSGDT  686
              F    + VSI++G+QEG+Y WV +NY LGNLGK Y  T+  IDLGGGSVQ++YAVS  T
Sbjct  152   TFTVPPDAVSIIDGTQEGSYLWVTVNYALGNLGKKYTKTVGVIDLGGGSVQMAYAVSKKT  211

Query  687   FANAPTPDNGEEPYVQEKYILGAQYYLYVHSYLNYGQLASRAEIFKASGNSTNPCVLEGY  866
                AP   +G++P +++  + G  Y LYVHSYL++ + ASRAE  K +  S  P +L G+
Sbjct  212   AKTAPKVADGDDPSIKKVALKGIPYDLYVHSYLHFAREASRAETLKLTPRSPTPFLLAGF  271

Query  867   DGYYTYNDVSYKVTAPPNGSSLKNCRKLARKVVDFRAPCKYQNCTFNGVWSGGGGAGMEN  1046
             +G YTY+   +K TA  +G++   C+   RK +    PC YQNCTF G+W+GGGG G +N
Sbjct  272   NGIYTYSGEEFKATAYTSGANFNKCKNTIRKALKLNYPCPYQNCTFGGIWNGGGGNGQKN  331

Query  1047  VYISSFFYDIATDVGIIDQEKASKIVKPRSFLVAAKLACETKFEDVKSTFPNAVEKDYP-  1223
             ++ SS F+ +  D G++D    + I++P      AK AC   FED KST+P   +K+   
Sbjct  332   LFASSSFFYLPEDAGMVDASTPNFILRPVDIETKAKEACALNFEDAKSTYPFLDKKNVAS  391

Query  1224  YLCMDLVYEYTLLVDGLGLHPYKEITLMKKVEYKNYMVEAAWPLGCAIDVISS  1382
             Y+CMDL+Y+Y LLVDG GL P ++IT  K++EY++ +VEAAWPLG A++ IS+
Sbjct  392   YVCMDLIYQYVLLVDGFGLDPLQKITSGKEIEYQDAIVEAAWPLGNAVEAISA  444



>gb|EMT24071.1| Apyrase [Aegilops tauschii]
Length=458

 Score =   401 bits (1031),  Expect = 8e-131, Method: Compositional matrix adjust.
 Identities = 209/402 (52%), Positives = 271/402 (67%), Gaps = 2/402 (0%)
 Frame = +3

Query  174   TGNYAVIFDAGSTGSRVHVFHFDENLDLLPIGDGVEFFLKTTPGLSSYANDPEAAAKSLE  353
              G YAVIFDAGSTG+RVHVF FD  +DLL IGD +E F K +PGLSS++  P+ AAKS+ 
Sbjct  45    VGKYAVIFDAGSTGTRVHVFKFDNKMDLLEIGDDIEVFAKVSPGLSSFSGRPKEAAKSMI  104

Query  354   PLLLEAEGVVPTELQPDTPLELGATAGLRLLEGDASDKILQAVRDMFKNESNFKSKAEWV  533
             PLL +A  VVP      TPL+LGATAGLRL+    S++ILQAVRD+   +S F+   +W+
Sbjct  105   PLLDKANSVVPWWQMNRTPLKLGATAGLRLIGDKPSEQILQAVRDIVHTKSKFQYNPKWI  164

Query  534   SILEGSQEGTYFWVAMNYLLGNLGKGYQNTIATIDLGGGSVQVSYAVSGDTFANAPTPDN  713
             ++LEGSQEG+Y WVA+NYLL  LG  Y  T+  IDLGGGSVQ++YAVS +T ANAP   +
Sbjct  165   NVLEGSQEGSYMWVALNYLLDRLGGDYSKTVGVIDLGGGSVQMAYAVSPNTAANAPATPD  224

Query  714   GEEPYVQEKYILGAQYYLYVHSYLNYGQLASRAEIFKASGNSTNPCVLEGYDGYYTYNDV  893
             G++PY+ ++Y+ G  Y +YVHSYL YG LA+R EI KA     + C+L G  G YTYN  
Sbjct  225   GKDPYITKEYLKGNDYNVYVHSYLYYGNLAARVEILKAKSGPFSSCMLRGSTGNYTYNGE  284

Query  894   SYKVTAPPNGSSLKNCRKLARKVVDFRAPCKYQNCTFNGVWSGGGGAGMENVYISSFFYD  1073
              Y   A P G+    CRK   K +   APC  +NC F GVW GGGGAG   +Y +SFFY 
Sbjct  285   VYDAAASPEGAVYTKCRKEVAKALKLDAPCASKNCPFGGVWGGGGGAGQATLYAASFFYG  344

Query  1074  IATDVGIIDQEKASKIVKPRSFLVAAKLACETKFEDVKSTFPNAVEKDYPYLCMDLVYEY  1253
              AT VG + ++  S    P +F  AAK  C    E+ K+ +P    ++ PY+CMDLVY+Y
Sbjct  345   KATQVGWVKKDAPSAKSSPGAFRAAAKKICPLSLEEAKAAYPGV--RETPYICMDLVYQY  402

Query  1254  TLLVDGLGLHPYKEITLMKKVEYKNYMVEAAWPLGCAIDVIS  1379
             TLLV G GL P +EITL++KV++  Y +EAAWPLG AI+ ++
Sbjct  403   TLLVYGFGLAPAREITLVEKVKHGEYFMEAAWPLGEAIEAVA  444



>ref|XP_004978978.1| PREDICTED: probable apyrase 3-like [Setaria italica]
Length=462

 Score =   398 bits (1022),  Expect = 2e-129, Method: Compositional matrix adjust.
 Identities = 212/401 (53%), Positives = 276/401 (69%), Gaps = 0/401 (0%)
 Frame = +3

Query  177   GNYAVIFDAGSTGSRVHVFHFDENLDLLPIGDGVEFFLKTTPGLSSYANDPEAAAKSLEP  356
             G YAVIFDAGSTGSRV+VF FD  +DL  IGD +EFF K  PGLSSYA  P+ AA S+ P
Sbjct  55    GRYAVIFDAGSTGSRVYVFRFDRQMDLARIGDDIEFFAKVKPGLSSYAGQPKEAANSILP  114

Query  357   LLLEAEGVVPTELQPDTPLELGATAGLRLLEGDASDKILQAVRDMFKNESNFKSKAEWVS  536
             LL +A+ VVP+ L   TPL+LGATAGLRL+    +++IL AVRD+   +S F+ KA W++
Sbjct  115   LLDKAKSVVPSRLTKTTPLKLGATAGLRLIGNQKAEQILDAVRDLVHKKSKFQYKANWIN  174

Query  537   ILEGSQEGTYFWVAMNYLLGNLGKGYQNTIATIDLGGGSVQVSYAVSGDTFANAPTPDNG  716
             +LEG+QEG+Y WVA+NYLL  LG  Y  T+  ID+GGGSVQ++YA+S    A AP   NG
Sbjct  175   VLEGTQEGSYLWVALNYLLDKLGGDYSQTVGVIDMGGGSVQMAYAISATAAARAPAAANG  234

Query  717   EEPYVQEKYILGAQYYLYVHSYLNYGQLASRAEIFKASGNSTNPCVLEGYDGYYTYNDVS  896
             E+PY+ ++Y  G  Y +YVHSYL YG  A+RAEI K+     + C+L G+ G YTY+   
Sbjct  235   EDPYITKEYFKGKDYNVYVHSYLRYGAFAARAEILKSKNGPFSSCMLRGFSGNYTYHGKE  294

Query  897   YKVTAPPNGSSLKNCRKLARKVVDFRAPCKYQNCTFNGVWSGGGGAGMENVYISSFFYDI  1076
             Y  TA P G+  +NCR+   K +   APC  +NCTFNGVW+GGGGAG  N+Y S+ FY +
Sbjct  295   YDATARPEGAVYENCREEITKALKLNAPCHTKNCTFNGVWNGGGGAGQNNIYASTGFYYL  354

Query  1077  ATDVGIIDQEKASKIVKPRSFLVAAKLACETKFEDVKSTFPNAVEKDYPYLCMDLVYEYT  1256
             A+ VG ID +  S    P +F+ AAK AC+   +  K  +PN  + D PYLCMDL Y+YT
Sbjct  355   ASHVGFIDSKAPSAKAAPAAFMAAAKKACQLDVKKAKVAYPNVDDMDVPYLCMDLSYKYT  414

Query  1257  LLVDGLGLHPYKEITLMKKVEYKNYMVEAAWPLGCAIDVIS  1379
             LLVDG GL P K+IT + KV++  Y +EAAWPLG AI+ ++
Sbjct  415   LLVDGFGLQPMKKITFVDKVKHGEYYIEAAWPLGTAIEAVT  455



>dbj|BAK78979.1| apyrase [Mimosa pudica]
Length=468

 Score =   398 bits (1022),  Expect = 3e-129, Method: Compositional matrix adjust.
 Identities = 197/404 (49%), Positives = 283/404 (70%), Gaps = 1/404 (0%)
 Frame = +3

Query  183   YAVIFDAGSTGSRVHVFHFDENLDLLPIGDGVEFFLKTTPGLSSYANDPEAAAKSLEPLL  362
             YAVI D+GSTG+R+HVF F+++  +  I D  E+  K TPGLSSYA++PE AA+S+  LL
Sbjct  57    YAVILDSGSTGTRLHVFSFNQSTQIQYIDDDFEYLYKVTPGLSSYASNPEGAAESVMALL  116

Query  363   LEAEGVVPTELQPDTPLELGATAGLRLLEGDASDKILQAVRDMFKNESNFKSKAE-WVSI  539
              +AE VVP E Q  TP+ LGATAGLR L  + S+ IL+A+R++ K+ ++F  +++  ++I
Sbjct  117   EKAEAVVPEEYQASTPVRLGATAGLRALSSNTSELILEAIREVVKSNTSFALESDDAIAI  176

Query  540   LEGSQEGTYFWVAMNYLLGNLGKGYQNTIATIDLGGGSVQVSYAVSGDTFANAPTPDNGE  719
             L G+QEG Y WV +NYLL NLG+ Y  TI   DLGGGSVQ++YA+S D  +NAP      
Sbjct  177   LSGNQEGYYLWVTVNYLLNNLGEEYPKTIGVADLGGGSVQMAYAISDDVASNAPDYAPNG  236

Query  720   EPYVQEKYILGAQYYLYVHSYLNYGQLASRAEIFKASGNSTNPCVLEGYDGYYTYNDVSY  899
             + YV +  +  + Y++YVHSYLN G  +SRA I K +G+S NPC+L G++G Y Y+DV Y
Sbjct  237   DAYVTKISLSNSTYHIYVHSYLNPGTESSRAAILKLTGDSDNPCILTGFNGTYNYSDVEY  296

Query  900   KVTAPPNGSSLKNCRKLARKVVDFRAPCKYQNCTFNGVWSGGGGAGMENVYISSFFYDIA  1079
             K ++P NGSS   CR    K+ DF A C ++NCTF GVW+GGGGAG   +Y+++ FY +A
Sbjct  297   KASSPANGSSYDECRSTVLKLFDFNATCAHKNCTFAGVWNGGGGAGQSELYLATSFYYLA  356

Query  1080  TDVGIIDQEKASKIVKPRSFLVAAKLACETKFEDVKSTFPNAVEKDYPYLCMDLVYEYTL  1259
              D GI+++      V+P  + + A+LAC+T +E+ K+ F N  E   PY+CMDLVY+YTL
Sbjct  357   ADAGIVNKNAMIGKVRPIDYKIMAELACKTTYEEAKTVFSNMDEVWLPYICMDLVYQYTL  416

Query  1260  LVDGLGLHPYKEITLMKKVEYKNYMVEAAWPLGCAIDVISSSSA  1391
             LVD  GL P++ +T++KK+EY++  ++A+W LG AI+ +SS S+
Sbjct  417   LVDAFGLDPWEVVTVVKKIEYEDSQLDASWALGSAIESVSSLSS  460



>ref|XP_003577116.1| PREDICTED: probable apyrase 3 [Brachypodium distachyon]
Length=463

 Score =   397 bits (1020),  Expect = 4e-129, Method: Compositional matrix adjust.
 Identities = 211/400 (53%), Positives = 275/400 (69%), Gaps = 2/400 (1%)
 Frame = +3

Query  180   NYAVIFDAGSTGSRVHVFHFDENLDLLPIGDGVEFFLKTTPGLSSYANDPEAAAKSLEPL  359
              YAVIFDAGSTG+RVHVF FD  +DLL IGD VE F K +PGLSSYA  P+ AAK+L PL
Sbjct  57    KYAVIFDAGSTGTRVHVFKFDRKMDLLKIGDDVEVFAKVSPGLSSYAGRPQEAAKTLLPL  116

Query  360   LLEAEGVVPTELQPDTPLELGATAGLRLLEGDASDKILQAVRDMFKNESNFKSKAEWVSI  539
             L  A+  VP      TP++LGATAGLRL+  + S++IL+AVRD+    S F+   +W+++
Sbjct  117   LDRAKSAVPWWQMSLTPVKLGATAGLRLIGDEQSEQILEAVRDVIWRRSIFQYNPKWINV  176

Query  540   LEGSQEGTYFWVAMNYLLGNLGKGYQNTIATIDLGGGSVQVSYAVSGDTFANAPTPDNGE  719
             LEGSQEG+Y WVA+NYLL  LG  Y NT+  IDLGGGSVQ++YAVS +  ANAP   +G+
Sbjct  177   LEGSQEGSYIWVALNYLLDRLGGDYSNTVGVIDLGGGSVQMAYAVSANAAANAPAVPDGK  236

Query  720   EPYVQEKYILGAQYYLYVHSYLNYGQLASRAEIFKASGNSTNPCVLEGYDGYYTYNDVSY  899
             +PY+ ++Y+ G  Y +YVHSYL YG LA+R EI KAS    + C+L G  G YTYN   Y
Sbjct  237   DPYITKEYLKGKDYSVYVHSYLYYGNLAARVEILKASPRPFSDCMLLGSTGNYTYNGEDY  296

Query  900   KVTAPPNGSSLKNCRKLARKVVDFRAPCKYQNCTFNGVWSGGGGAGMENVYISSFFYDIA  1079
                A P G+S   CRK AR+ +   APCK +NCTFNGVW+GGGGAG + +Y +SFFY  A
Sbjct  297   PAVAAPWGASYGKCRKEARRALRLDAPCKAKNCTFNGVWNGGGGAGQKEIYAASFFYGKA  356

Query  1080  TDVGIIDQEKASKIVKPRSFLVAAKLACETKFEDVKSTFPNAVEKDYPYLCMDLVYEYTL  1259
             T VG +D+   S    P  F  AAK  C    E+ ++ FP   E +  ++CMDLVY+YTL
Sbjct  357   TQVGWVDKAAPSAKSSPAEFRAAAKEICPLSLEEARAAFPGVRETE--FICMDLVYQYTL  414

Query  1260  LVDGLGLHPYKEITLMKKVEYKNYMVEAAWPLGCAIDVIS  1379
             L DG GL   ++ITL++KV++  + +EAAWPLG AI+ ++
Sbjct  415   LKDGFGLRRRRQITLVEKVKHGEFFIEAAWPLGEAIEAVA  454



>ref|XP_004978980.1| PREDICTED: probable apyrase 3-like isoform X2 [Setaria italica]
Length=460

 Score =   396 bits (1018),  Expect = 8e-129, Method: Compositional matrix adjust.
 Identities = 208/401 (52%), Positives = 277/401 (69%), Gaps = 0/401 (0%)
 Frame = +3

Query  177   GNYAVIFDAGSTGSRVHVFHFDENLDLLPIGDGVEFFLKTTPGLSSYANDPEAAAKSLEP  356
             G YAVIFDAGSTGSR+HVF FD  +DLL IGD ++ F K  PGLSSYA  P+ AA S+ P
Sbjct  52    GRYAVIFDAGSTGSRLHVFRFDRQMDLLGIGDDIQVFAKVKPGLSSYAGRPQDAANSILP  111

Query  357   LLLEAEGVVPTELQPDTPLELGATAGLRLLEGDASDKILQAVRDMFKNESNFKSKAEWVS  536
             LL +A+ VVP+ L   T L+LGATAGLRL+  + S++IL+AVRD+   +S F+    W++
Sbjct  112   LLEKAKSVVPSRLMKTTTLKLGATAGLRLIGEEKSEEILEAVRDLVHTKSKFQYNPNWIN  171

Query  537   ILEGSQEGTYFWVAMNYLLGNLGKGYQNTIATIDLGGGSVQVSYAVSGDTFANAPTPDNG  716
             +LEGSQEG Y WVA+NYLL  LG  Y  T+  +DLGGGSVQ++YA+S    A+AP   +G
Sbjct  172   VLEGSQEGHYLWVALNYLLDKLGGDYSQTVGIVDLGGGSVQMAYAISAYAAASAPAVPDG  231

Query  717   EEPYVQEKYILGAQYYLYVHSYLNYGQLASRAEIFKASGNSTNPCVLEGYDGYYTYNDVS  896
             E+PYV ++Y+ G  Y +YVHSYL++G  A+RAEI KA     + C L G+ G Y+YN   
Sbjct  232   EDPYVTKEYLKGKDYSVYVHSYLSFGAFAARAEILKAKNGPFSSCTLRGFSGTYSYNGKK  291

Query  897   YKVTAPPNGSSLKNCRKLARKVVDFRAPCKYQNCTFNGVWSGGGGAGMENVYISSFFYDI  1076
             Y  TA P G++ + CR+   K ++  APCK +NCTF GVW+GGGGAG  N+Y++S F+ +
Sbjct  292   YDATASPKGANYEKCREEITKALNLNAPCKTKNCTFGGVWNGGGGAGQNNLYVTSSFHYL  351

Query  1077  ATDVGIIDQEKASKIVKPRSFLVAAKLACETKFEDVKSTFPNAVEKDYPYLCMDLVYEYT  1256
             A+ VG ID E  S    P +F +AA+ AC    + VK  FP   + + PYLC+DL Y+YT
Sbjct  352   ASRVGFIDSEAPSAKATPAAFRIAARKACRLGVKKVKVAFPKIEDSNVPYLCLDLTYQYT  411

Query  1257  LLVDGLGLHPYKEITLMKKVEYKNYMVEAAWPLGCAIDVIS  1379
             LLVDG GL P K+IT + KV++  Y +EAAWPLG AI+ +S
Sbjct  412   LLVDGFGLPPTKKITFVSKVKHGEYFIEAAWPLGTAIEALS  452



>gb|KEH23514.1| Nod factor-binding lectin-nucleotide phosphohydrolase [Medicago 
truncatula]
Length=439

 Score =   395 bits (1016),  Expect = 8e-129, Method: Compositional matrix adjust.
 Identities = 201/379 (53%), Positives = 272/379 (72%), Gaps = 3/379 (1%)
 Frame = +3

Query  150   RRVLLSHE-TGNYAVIFDAGSTGSRVHVFHFDENLDLLPIGDGVEFFLKTTPGLSSYAND  326
             R++    E   +YAV+FDAGSTGSRVHV+HFD+NL+LL +G  VEF+ KTTPGLS+YA++
Sbjct  54    RKIFPKQEPISSYAVVFDAGSTGSRVHVYHFDQNLNLLHVGKDVEFYNKTTPGLSAYADN  113

Query  327   PEAAAKSLEPLLLEAEGVVPTELQPDTPLELGATAGLRLLEGDASDKILQAVRDMFKNES  506
             PE AAKSL PLL +AE VVP + +  TP+ LGATAGLRLL GDAS+KILQ+VRD+F N S
Sbjct  114   PEEAAKSLIPLLEQAESVVPEDQRSKTPIRLGATAGLRLLNGDASEKILQSVRDLFSNRS  173

Query  507   NFKSKAEWVSILEGSQEGTYFWVAMNYLLGNLGKGYQNTIATIDLGGGSVQVSYAVSGDT  686
              F  + + VSI++G+QEG+Y WV +NY LG LGK +  T+  +DLGGGSVQ++YAVS  T
Sbjct  174   TFNVQPDAVSIIDGTQEGSYLWVTVNYALGKLGKKFTKTVGVMDLGGGSVQMAYAVSKYT  233

Query  687   FANAPTPDNGEEPYVQEKYILGAQYYLYVHSYLNYGQLASRAEIFKASGNSTNPCVLEGY  866
               NAP   +GE+PY+++  + G +Y LYVHSYL++G+ ASRAEI K + NS NPC+L G+
Sbjct  234   AKNAPKVADGEDPYIKKLVLKGKKYDLYVHSYLHFGREASRAEILKVTHNSPNPCILAGF  293

Query  867   DGYYTYNDVSYKVTAPPNGSSLKNCRKLARKVVDFRAPCKYQNCTFNGVWSGGGGAGMEN  1046
             DG YTY    +K  AP +G++ K C+K+ R+ +    PC YQNCTF G+WSGGGG+G   
Sbjct  294   DGTYTYAGEEFKANAPASGANFKKCKKIVREALKLNYPCPYQNCTFGGIWSGGGGSGQRI  353

Query  1047  VYISSFFYDIATDVGIIDQEKA-SKIVKPRSFLVAAKLACETKFEDVKSTFPNAVEKDY-  1220
             ++ +S F+ +A D+G++D     S  ++P      AK AC    E+ KST+P  V+ +  
Sbjct  354   LFAASSFFYLAEDIGLVDPNTPYSLTLRPVDLETEAKKACTLNLEEAKSTYPLLVDFNIV  413

Query  1221  PYLCMDLVYEYTLLVDGLG  1277
              Y+CMDL+Y+Y LLVDG G
Sbjct  414   EYVCMDLIYQYVLLVDGFG  432



>gb|EEE51563.1| hypothetical protein OsJ_32782 [Oryza sativa Japonica Group]
Length=527

 Score =   399 bits (1024),  Expect = 9e-129, Method: Compositional matrix adjust.
 Identities = 205/415 (49%), Positives = 277/415 (67%), Gaps = 8/415 (2%)
 Frame = +3

Query  177   GNYAVIFDAGSTGSRVHVFHFDENLDLLPIGDGVEFFLKTTPGLSSYANDPEAAAKSLEP  356
             G YAVI DAGSTG+RVHVF FD  +DLL IGD +E F K  PGLSSYA  P  AA S++P
Sbjct  54    GKYAVILDAGSTGTRVHVFRFDRMMDLLKIGDDIEVFAKVVPGLSSYAGRPREAANSIQP  113

Query  357   LLLEAEGVVPTELQPDTPLELGATAGLRLLEGDASDKILQAVRDMFKNESNFKSKAEWVS  536
             LL +A  VVP  L   TPL+LGATAGL L+  + +++IL+AVRD+   +S F+    W++
Sbjct  114   LLDKAIHVVPNWLMKKTPLKLGATAGLILIGDEKANQILEAVRDVVHTKSKFQYNPNWIN  173

Query  537   ILEGSQEGTYFWVAMNYLLGNLGKGYQNTIATIDLGGGSVQVSYAVSGDTFANAPTPDNG  716
             +L GSQEG+Y WVA+NYLL  LG+ Y  T+  IDLGGGSVQ++YAVS    ANAP   NG
Sbjct  174   VLTGSQEGSYMWVALNYLLDRLGEDYSKTVGVIDLGGGSVQMAYAVSSSIAANAPEVPNG  233

Query  717   EEPYVQEKYILGAQYYLYVHSYLNYGQLASRAEIFKASGNSTNPCVLEGYDGYYTYNDVS  896
             ++PY+ E+Y+ G  Y +YVHSYL+YG  ASR EI K      + C+L G+ G +TYN   
Sbjct  234   QDPYITEEYLKGRDYNIYVHSYLHYGAQASRVEILKRKNGPFSNCMLRGFKGKFTYNGEQ  293

Query  897   YKVTAPPNGSSLKNCRKLARKVVDFRAPCKYQNCTFNGVWSGGGGAGMENVYISSFFYDI  1076
             Y+  A P G+    CR+   K ++  +PC+ +NC+FNGVW+GGGG G + +Y++S FY I
Sbjct  294   YEAMAAPQGADYHKCRQDVVKALNLDSPCETKNCSFNGVWNGGGGVGQDEIYVTSSFYYI  353

Query  1077  ATDVGIIDQEKASKIVKPRSFLVAAKLACETKFEDVKSTFPNAVEKDYPYLCMDLVYEYT  1256
             A+ +G ID E  S    P ++  A++  C    E+ K+ +P  + +D+ YLCMDL+Y+YT
Sbjct  354   ASGIGFIDSEAPSAKSTPAAYKAASEKVCILSIEEAKAAYP--IARDHAYLCMDLIYQYT  411

Query  1257  LLVDGLGLHPYKEITLMKKVEYKNYMVEAAWPLGCAID------VISSSSANNLL  1403
             LLVDG GL   KEITL++KV++    +EAAWPLG AI+      +I    AN +L
Sbjct  412   LLVDGFGLEATKEITLVEKVKHGESYIEAAWPLGTAIEATTGPRLIGDEKANQIL  466



>dbj|BAJ86398.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ96465.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=437

 Score =   395 bits (1014),  Expect = 1e-128, Method: Compositional matrix adjust.
 Identities = 201/411 (49%), Positives = 270/411 (66%), Gaps = 2/411 (0%)
 Frame = +3

Query  147   LRRVLLSHETGNYAVIFDAGSTGSRVHVFHFDENLDLLPIGDGVEFFLKTTPGLSSYAND  326
             L R       G YAVI DAGSTG+R+HVF FD+ +DL+ IGD +E F K  PGLSSYA  
Sbjct  24    LARAATGPPAGKYAVILDAGSTGTRMHVFRFDKQMDLVKIGDDIEVFAKVNPGLSSYAGR  83

Query  327   PEAAAKSLEPLLLEAEGVVPTELQPDTPLELGATAGLRLLEGDASDKILQAVRDMFKNES  506
             P+ A KS+ PLL EA   VP  L   TP++LGATAGLRL+    +++IL AVR     ++
Sbjct  84    PKEATKSILPLLQEANTAVPQRLMKTTPVKLGATAGLRLIGDKQAEQILDAVRGAVHTKT  143

Query  507   NFKSKAEWVSILEGSQEGTYFWVAMNYLLGNLGKGYQNTIATIDLGGGSVQVSYAVSGDT  686
              F+   +W+++LEGSQEG+Y WVA+NYLL  LG  Y  T+  IDLGGGSVQ++YA+S   
Sbjct  144   KFQYNPKWINVLEGSQEGSYLWVALNYLLDKLGGDYSKTVGVIDLGGGSVQMAYAISPAA  203

Query  687   FANAPTPDNGEEPYVQEKYILGAQYYLYVHSYLNYGQLASRAEIFKASGNSTNPCVLEGY  866
              A AP   +G++PYV ++Y+ G  Y +YVHSYL YG LASR EIFKA     + C+L G+
Sbjct  204   AAAAPQVPHGKDPYVTKEYLKGRDYNVYVHSYLRYGALASRVEIFKAKEGPFSYCMLRGF  263

Query  867   DGYYTYNDVSYKVTAPPNGSSLKNCRKLARKVVDFRAPCKYQNCTFNGVWSGGGGAGMEN  1046
              G YTYN   Y  TA   G+    CR    K +   APC+ + C FNGVW+GGGG G  N
Sbjct  264   SGKYTYNGEEYNATASTGGAQYGKCRGDVVKALKLDAPCQAKKCAFNGVWNGGGGPGQAN  323

Query  1047  VYISSFFYDIATDVGIIDQEKASKIVKPRSFLVAAKLACETKFEDVKSTFPNAVEKDYPY  1226
             +Y++S FY +A+ VG+ID +  S    P +F   A+  C    ++VK+ +P    +D PY
Sbjct  324   LYVASSFYYMASQVGLIDSDAPSGTSTPAAFKAIAQKVCRMSMKEVKAKYPKV--RDIPY  381

Query  1227  LCMDLVYEYTLLVDGLGLHPYKEITLMKKVEYKNYMVEAAWPLGCAIDVIS  1379
             +CMDLVY+Y+LL+DG GL   K+ITL++KV++  Y +EAAWPLG AI+ ++
Sbjct  382   VCMDLVYQYSLLIDGFGLESTKKITLVEKVKHGEYFIEAAWPLGEAIEAVA  432



>dbj|BAD13526.1| apyrase [Glycine max]
Length=388

 Score =   390 bits (1001),  Expect = 2e-127, Method: Compositional matrix adjust.
 Identities = 201/392 (51%), Positives = 270/392 (69%), Gaps = 16/392 (4%)
 Frame = +3

Query  210   TGSRVHVFHFDENLDLLPIGDGVEFFLKTTPGLSSYANDPEAAAKSLEPLLLEAEGVVPT  389
             TGSR+HV+HF++NLDLL IG GVE++ K TPGLSSYAN+PE AAKSL PLL +AE VVP 
Sbjct  1     TGSRIHVYHFNQNLDLLHIGKGVEYYNKITPGLSSYANNPEQAAKSLIPLLEQAEDVVPD  60

Query  390   ELQPDTPLELGATAGLRLLEGDASDKILQAVRDMFKNESNFKSKAEWVSILEGSQEGTYF  569
             +LQP TP+ LG               ILQ+VRDM  N S F  + + VSI++G+QEG+Y 
Sbjct  61    DLQPKTPVRLG---------------ILQSVRDMLSNRSTFNVQPDAVSIIDGTQEGSYL  105

Query  570   WVAMNYLLGNLGKGYQNTIATIDLGGGSVQVSYAVSGDTFANAPTPDNGEEPYVQEKYIL  749
             WV +NY LGNLGK Y  T+  IDLGGGSVQ++YAVS  T  NAP   +G++PY+++  + 
Sbjct  106   WVTVNYALGNLGKKYTKTVGVIDLGGGSVQMAYAVSKKTAKNAPKVADGDDPYIKKVVLK  165

Query  750   GAQYYLYVHSYLNYGQLASRAEIFKASGNSTNPCVLEGYDGYYTYNDVSYKVTAPPNGSS  929
             G  Y LYVHSYL++G+ ASRAEI K +  S NPC+L G++G YTY+   +K TA  +G++
Sbjct  166   GIPYDLYVHSYLHFGREASRAEILKLTPRSPNPCLLAGFNGIYTYSGEEFKATAYTSGAN  225

Query  930   LKNCRKLARKVVDFRAPCKYQNCTFNGVWSGGGGAGMENVYISSFFYDIATDVGIIDQEK  1109
                C+   RK +    PC YQNCTF G+W+GGGG G +N++ SS F+ +  D G++D   
Sbjct  226   FNKCKNTIRKALKLNYPCPYQNCTFGGIWNGGGGNGQKNLFASSSFFYLPEDTGMVDAST  285

Query  1110  ASKIVKPRSFLVAAKLACETKFEDVKSTFPNAVEKDYP-YLCMDLVYEYTLLVDGLGLHP  1286
              + I++P      AK AC   FED KST+P   +K+   Y+CMDL+Y+Y LLVDG GL P
Sbjct  286   PNFILRPVDIETKAKEACALNFEDAKSTYPFLDKKNVASYVCMDLIYQYVLLVDGFGLDP  345

Query  1287  YKEITLMKKVEYKNYMVEAAWPLGCAIDVISS  1382
              ++IT  K++EY+  +VEAAWPLG A++ IS+
Sbjct  346   LQKITSGKEIEYQEAIVEAAWPLGNAVEAISA  377



>ref|XP_003570952.1| PREDICTED: probable apyrase 3 [Brachypodium distachyon]
Length=454

 Score =   391 bits (1005),  Expect = 5e-127, Method: Compositional matrix adjust.
 Identities = 203/401 (51%), Positives = 277/401 (69%), Gaps = 0/401 (0%)
 Frame = +3

Query  177   GNYAVIFDAGSTGSRVHVFHFDENLDLLPIGDGVEFFLKTTPGLSSYANDPEAAAKSLEP  356
             G YAVIFDAGSTG+RVHVF FD  ++L+ IG  +E F K  PGLSSYA  P+ AA S+ P
Sbjct  46    GKYAVIFDAGSTGTRVHVFRFDTEMELVEIGHDIEVFAKVEPGLSSYAGRPQEAADSILP  105

Query  357   LLLEAEGVVPTELQPDTPLELGATAGLRLLEGDASDKILQAVRDMFKNESNFKSKAEWVS  536
             LL +A+ VVP  L   T ++LGATAGLRL+  + +++IL+AVR +   +S F+    W++
Sbjct  106   LLQKAKSVVPRWLMRRTAVKLGATAGLRLIGDEKAEQILEAVRGVIHTKSKFQYDPSWIN  165

Query  537   ILEGSQEGTYFWVAMNYLLGNLGKGYQNTIATIDLGGGSVQVSYAVSGDTFANAPTPDNG  716
             +LEGSQEG+Y WVA+NYLL  LG  Y  T+  IDLGGGSVQ++YA+S D  A AP   +G
Sbjct  166   VLEGSQEGSYLWVALNYLLDKLGGDYGKTVGVIDLGGGSVQMAYAISEDAAAAAPVVPDG  225

Query  717   EEPYVQEKYILGAQYYLYVHSYLNYGQLASRAEIFKASGNSTNPCVLEGYDGYYTYNDVS  896
             ++PYV ++Y+ G  Y +Y HSYL+YG +ASRAEIFKA     + C+L G+ G Y+YN   
Sbjct  226   KDPYVTKEYLKGRDYNIYAHSYLHYGAMASRAEIFKAKNGPVSYCMLRGFVGEYSYNGEQ  285

Query  897   YKVTAPPNGSSLKNCRKLARKVVDFRAPCKYQNCTFNGVWSGGGGAGMENVYISSFFYDI  1076
             +  TA   G++   CR+   K +   A C+++NCTFNG W+GGGGAG  ++Y++S FY +
Sbjct  286   FDATASLQGAAYDKCREDVTKALKLGAACEHKNCTFNGAWNGGGGAGQTDLYVTSTFYYV  345

Query  1077  ATDVGIIDQEKASKIVKPRSFLVAAKLACETKFEDVKSTFPNAVEKDYPYLCMDLVYEYT  1256
             A++VG+ID E AS    P +F  AA+  C   FE+ K+ +      D PY+CMDLVY+Y+
Sbjct  346   ASEVGLIDGEAASGKTTPAAFGAAAEKICAMSFEETKAAYTRVRASDAPYICMDLVYQYS  405

Query  1257  LLVDGLGLHPYKEITLMKKVEYKNYMVEAAWPLGCAIDVIS  1379
             LLVDG GL P KEIT+ +KV++  Y +EAAWPLG AI+ +S
Sbjct  406   LLVDGFGLEPAKEITVAQKVKHGEYFLEAAWPLGEAIEAVS  446



>gb|ABA91303.1| GDA1/CD39 family protein, expressed [Oryza sativa Japonica Group]
Length=429

 Score =   389 bits (1000),  Expect = 1e-126, Method: Compositional matrix adjust.
 Identities = 200/401 (50%), Positives = 265/401 (66%), Gaps = 24/401 (6%)
 Frame = +3

Query  177   GNYAVIFDAGSTGSRVHVFHFDENLDLLPIGDGVEFFLKTTPGLSSYANDPEAAAKSLEP  356
             G YAVI DAGSTG+RVHVF FD  LDLL +GD +E F K  PGLSSYA  P+ AA S+ P
Sbjct  43    GRYAVILDAGSTGTRVHVFRFDNKLDLLKVGDDIELFAKVDPGLSSYAGRPQDAANSILP  102

Query  357   LLLEAEGVVPTELQPDTPLELGATAGLRLLEGDASDKILQAVRDMFKNESNFKSKAEWVS  536
             LL +A  VVPT L   TPL+LGATAGLRL+  + +++IL+A                   
Sbjct  103   LLDKANTVVPTRLMNKTPLKLGATAGLRLIGDEKANQILEA-------------------  143

Query  537   ILEGSQEGTYFWVAMNYLLGNLGKGYQNTIATIDLGGGSVQVSYAVSGDTFANAPTPDNG  716
                GSQEG+Y WVA+NYLL  LG  Y  T+  +DLGGGSVQ++YA+  +T ANAP    G
Sbjct  144   ---GSQEGSYMWVALNYLLDKLGGDYFKTVGVVDLGGGSVQMAYAMLSNTAANAPKVPEG  200

Query  717   EEPYVQEKYILGAQYYLYVHSYLNYGQLASRAEIFKASGNSTNPCVLEGYDGYYTYNDVS  896
             ++PYV ++Y+ G  Y +YVHSYL+YG  ASR +I +      + C+L G+ G YTYND  
Sbjct  201   KDPYVVKEYLKGKDYNIYVHSYLHYGGFASRVQILERKDGPFSNCMLRGFSGNYTYNDKQ  260

Query  897   YKVTAPPNGSSLKNCRKLARKVVDFRAPCKYQNCTFNGVWSGGGGAGMENVYISSFFYDI  1076
             Y  T  P G+    CR+   K++   APC+ +NC+FNGVW+GGGGAG +++Y++S FY I
Sbjct  261   YDATTAPQGADYHKCREEVVKLLKVNAPCETKNCSFNGVWNGGGGAGQDDLYVASAFYYI  320

Query  1077  ATDVGIIDQEKASKIVKPRSFLVAAKLACETKFEDVKSTFPNAVEKDYPYLCMDLVYEYT  1256
             A+ VG ID +  S    P +F   A+ AC+   ++ K  +PN   +D+ YLCMDL+YEY+
Sbjct  321   ASHVGFIDSDAPSAKSTPATFKAVAEKACKLSVKEAKVEYPNV--RDHAYLCMDLIYEYS  378

Query  1257  LLVDGLGLHPYKEITLMKKVEYKNYMVEAAWPLGCAIDVIS  1379
             LLVDG GLHP KEITL+ KV++  Y ++AAWPLG AI+ +S
Sbjct  379   LLVDGFGLHPSKEITLVDKVKHGEYYIDAAWPLGTAIEAVS  419



>dbj|BAK78980.1| apyrase [Mimosa pudica]
Length=468

 Score =   390 bits (1003),  Expect = 2e-126, Method: Compositional matrix adjust.
 Identities = 193/404 (48%), Positives = 278/404 (69%), Gaps = 1/404 (0%)
 Frame = +3

Query  183   YAVIFDAGSTGSRVHVFHFDENLDLLPIGDGVEFFLKTTPGLSSYANDPEAAAKSLEPLL  362
             YAVI D+GSTG+R+HVF F+++  +  I D  E+  K TPGLSSYA++PE AA+S+  LL
Sbjct  57    YAVILDSGSTGTRLHVFSFNQSTQIQYIDDDFEYLYKVTPGLSSYASNPEGAAESVMALL  116

Query  363   LEAEGVVPTELQPDTPLELGATAGLRLLEGDASDKILQAVRDMFKNESNFKSKAE-WVSI  539
              +AE VVP E Q  TP+ LGATAGLR L  + S+ IL+A+R++ K+ ++F  +++  ++I
Sbjct  117   EKAEAVVPEEYQASTPVRLGATAGLRALSSNTSELILEAIREVVKSNTSFALESDDAIAI  176

Query  540   LEGSQEGTYFWVAMNYLLGNLGKGYQNTIATIDLGGGSVQVSYAVSGDTFANAPTPDNGE  719
             L G+QEG Y WV +NYLL NLG+ Y  TI   DLGGGSV+++YA+S D  +NAP      
Sbjct  177   LSGNQEGYYLWVTVNYLLNNLGEEYPKTIGVADLGGGSVRMAYAISDDVASNAPDYAPNG  236

Query  720   EPYVQEKYILGAQYYLYVHSYLNYGQLASRAEIFKASGNSTNPCVLEGYDGYYTYNDVSY  899
             + YV +  +  + Y++YVHSYLN+G+ +SRA I   +G+S NPCVL G++G Y Y+DV Y
Sbjct  237   DAYVTKVSLSNSTYHIYVHSYLNFGKESSRAAILNLTGDSDNPCVLTGFNGTYNYSDVEY  296

Query  900   KVTAPPNGSSLKNCRKLARKVVDFRAPCKYQNCTFNGVWSGGGGAGMENVYISSFFYDIA  1079
             K ++P NGSS   CR    K+ DF A C + NCTF G+W+GGGGAG   +Y+++ FY +A
Sbjct  297   KASSPANGSSYDECRSTILKLFDFNATCTHDNCTFAGIWNGGGGAGQSELYLATSFYYLA  356

Query  1080  TDVGIIDQEKASKIVKPRSFLVAAKLACETKFEDVKSTFPNAVEKDYPYLCMDLVYEYTL  1259
              D G +D+      V+   + + A+LAC+T +E+ K+ FPN  E    Y CMDLVY+YTL
Sbjct  357   IDAGFVDENAMIAKVRLIDYKITAELACKTTYEEAKTVFPNMDEDVLAYTCMDLVYQYTL  416

Query  1260  LVDGLGLHPYKEITLMKKVEYKNYMVEAAWPLGCAIDVISSSSA  1391
             LVD  GL P++ +T++ K+EY+   ++A+W LG AI+ +SS S+
Sbjct  417   LVDAFGLDPWEVVTVVDKIEYEGSQLDASWALGSAIESVSSLSS  460



>dbj|BAK78977.1| apyrase [Mimosa pudica]
Length=468

 Score =   390 bits (1002),  Expect = 2e-126, Method: Compositional matrix adjust.
 Identities = 193/404 (48%), Positives = 277/404 (69%), Gaps = 1/404 (0%)
 Frame = +3

Query  183   YAVIFDAGSTGSRVHVFHFDENLDLLPIGDGVEFFLKTTPGLSSYANDPEAAAKSLEPLL  362
             YAVI D+GSTG+R+HVF F+++  +  I D  E+  K TPGLSSYA++PE AA+S+  LL
Sbjct  57    YAVILDSGSTGTRLHVFSFNQSTQIQYIDDDFEYLYKVTPGLSSYASNPEGAAESVMALL  116

Query  363   LEAEGVVPTELQPDTPLELGATAGLRLLEGDASDKILQAVRDMFKNESNFKSKAE-WVSI  539
              +AE VVP E Q  TP+ LGATAGLR L  + S+ IL+A+R++ K+ ++F  +++  ++I
Sbjct  117   EKAEAVVPEEYQASTPVRLGATAGLRALSSNTSELILEAIREVVKSNTSFALESDDAIAI  176

Query  540   LEGSQEGTYFWVAMNYLLGNLGKGYQNTIATIDLGGGSVQVSYAVSGDTFANAPTPDNGE  719
             L G+QEG Y WV +NYLL NLG+ Y  TI   DLGGGSVQ++YA+S D  +NAP      
Sbjct  177   LSGNQEGYYLWVTVNYLLNNLGEEYPKTIGVADLGGGSVQMAYAISDDVASNAPDYAPNG  236

Query  720   EPYVQEKYILGAQYYLYVHSYLNYGQLASRAEIFKASGNSTNPCVLEGYDGYYTYNDVSY  899
             + YV +  +  + Y++YVHSYLN+G+ +SRA I   +G+S NPCVL G++G Y Y+DV Y
Sbjct  237   DAYVTKVSLSNSTYHIYVHSYLNFGKESSRAAILNLTGDSDNPCVLTGFNGTYNYSDVEY  296

Query  900   KVTAPPNGSSLKNCRKLARKVVDFRAPCKYQNCTFNGVWSGGGGAGMENVYISSFFYDIA  1079
             K ++P NGSS   CR    K+ D  A C + NCTF G+W+GGGGAG   +Y+++ FY +A
Sbjct  297   KASSPANGSSYDECRSTILKLFDLNATCAHDNCTFAGIWNGGGGAGQSELYLATSFYYLA  356

Query  1080  TDVGIIDQEKASKIVKPRSFLVAAKLACETKFEDVKSTFPNAVEKDYPYLCMDLVYEYTL  1259
              D G +D+      V+   + + A+LAC+T +E+ K+ FPN  E    Y CMDLVY+YTL
Sbjct  357   IDAGFVDENATIAKVRLIDYKITAELACKTTYEEAKTVFPNMDEDVLAYTCMDLVYQYTL  416

Query  1260  LVDGLGLHPYKEITLMKKVEYKNYMVEAAWPLGCAIDVISSSSA  1391
             LVD  GL P++ +T++ K+EY+   ++A+W LG AI+ +SS S+
Sbjct  417   LVDAFGLDPWEVVTVVDKIEYEGSQLDASWALGSAIESVSSLSS  460



>ref|XP_004978979.1| PREDICTED: probable apyrase 3-like isoform X1 [Setaria italica]
Length=472

 Score =   387 bits (994),  Expect = 4e-125, Method: Compositional matrix adjust.
 Identities = 210/421 (50%), Positives = 280/421 (67%), Gaps = 14/421 (3%)
 Frame = +3

Query  177   GNYAVIFDAGSTGSRVHVFHFDENLDLLPIGDGVEFFLKT------------TPGLSSYA  320
             G YAVIFDAGSTGSR+HVF FD  +DLL IGD ++ F K              PGLSSYA
Sbjct  52    GRYAVIFDAGSTGSRLHVFRFDRQMDLLGIGDDIQVFAKVLIPYYLFLRIQVKPGLSSYA  111

Query  321   NDPEAAAKSLEPLLLEAEGVVPTELQPDTPLELGATAGLRLLEGDASDKILQAVRDMFKN  500
               P+ AA S+ PLL +A+ VVP+ L   T L+LGATAGLRL+  + S++IL+AVRD+   
Sbjct  112   GRPQDAANSILPLLEKAKSVVPSRLMKTTTLKLGATAGLRLIGEEKSEEILEAVRDLVHT  171

Query  501   ESNFKSKAEWVSILEGSQEGTYFWVAMNYLLGNLGKGYQNTIATIDLGGGSVQVSYAVSG  680
             +S F+    W+++LEGSQEG Y WVA+NYLL  LG  Y  T+  +DLGGGSVQ++YA+S 
Sbjct  172   KSKFQYNPNWINVLEGSQEGHYLWVALNYLLDKLGGDYSQTVGIVDLGGGSVQMAYAISA  231

Query  681   DTFANAPTPDNGEEPYVQEKYILGAQYYLYVHSYLNYGQLASRAEIFKASGNSTNPCVLE  860
                A+AP   +GE+PYV ++Y+ G  Y +YVHSYL++G  A+RAEI KA     + C L 
Sbjct  232   YAAASAPAVPDGEDPYVTKEYLKGKDYSVYVHSYLSFGAFAARAEILKAKNGPFSSCTLR  291

Query  861   GYDGYYTYNDVSYKVTAPPNGSSLKNCRKLARKVVDFRAPCKYQNCTFNGVWSGGGGAGM  1040
             G+ G Y+YN   Y  TA P G++ + CR+   K ++  APCK +NCTF GVW+GGGGAG 
Sbjct  292   GFSGTYSYNGKKYDATASPKGANYEKCREEITKALNLNAPCKTKNCTFGGVWNGGGGAGQ  351

Query  1041  ENVYISSFFYDIATDVGIIDQEKASKIVKPRSFLVAAKLACETKFEDVKSTFPNAVEKDY  1220
              N+Y++S F+ +A+ VG ID E  S    P +F +AA+ AC    + VK  FP   + + 
Sbjct  352   NNLYVTSSFHYLASRVGFIDSEAPSAKATPAAFRIAARKACRLGVKKVKVAFPKIEDSNV  411

Query  1221  PYLCMDLVYEYTLLVDGLGLHPYKEITLMKKVEYKNYMVEAAWPLGCAIDVIS--SSSAN  1394
             PYLC+DL Y+YTLLVDG GL P K+IT + KV++  Y +EAAWPLG AI+ +S    + N
Sbjct  412   PYLCLDLTYQYTLLVDGFGLPPTKKITFVSKVKHGEYFIEAAWPLGTAIEALSPKKQTGN  471

Query  1395  N  1397
             N
Sbjct  472   N  472



>gb|AFW55891.1| putative apyrase family protein [Zea mays]
Length=498

 Score =   387 bits (995),  Expect = 6e-125, Method: Compositional matrix adjust.
 Identities = 200/408 (49%), Positives = 277/408 (68%), Gaps = 7/408 (2%)
 Frame = +3

Query  177   GNYAVIFDAGSTGSRVHVFHFDENLDLLPIGDGVEFFLKTTPGLSSYANDPEAAAKSLEP  356
             G YAVIFDAGSTG+R+HVF FD ++DL+ IG G+EFF K  PGLSSYA +P+ AA S+ P
Sbjct  78    GRYAVIFDAGSTGTRMHVFRFDNHMDLVGIGHGIEFFAKVKPGLSSYAGEPQEAANSILP  137

Query  357   LLLEAEGVVPTELQPDTPLELGATAGLRLLEGDASDKILQAVRDMF--KNESNFKSKAEW  530
             LL +A+ VVP+EL   TPL+LGATAGLRL+  + +DKIL+AVRD+   K+++ F+   +W
Sbjct  138   LLKKAKRVVPSELIEKTPLKLGATAGLRLIGDEQADKILEAVRDLVHTKSKTQFQYNPDW  197

Query  531   VSILEGSQEGTYFWVAMNYLLGNLGKG-YQNTIATIDLGGGSVQVSYAVSGDTFANAPTP  707
             ++++EG QEG+Y WVA+NYLL  LG G Y  T+  +D+GGGS+Q++YA+S    A AP  
Sbjct  198   INVIEGYQEGSYLWVALNYLLDKLGVGDYSQTVGVVDMGGGSLQMAYAISAKDAAKAPKA  257

Query  708   DNGEEPYVQEKYILGAQYYLYVHSYLNYGQLASRAEIFKASG-NSTNPCVLEGYDGYYTY  884
              + ++ YV  +Y+ G  Y +Y HSYL+YG  A+R +I  A      + C+L G+ G YTY
Sbjct  258   PDADDRYVTREYLKGKDYNIYAHSYLHYGAFAARVKILDAKKYGQFSSCMLRGFKGNYTY  317

Query  885   NDVSYKVTAPPNGSSLKNCRKLARKVVDFRAPCKYQNC---TFNGVWSGGGGAGMENVYI  1055
             N   +  TA P G+    CR+   K ++  APC    C   TFNGVWSGGGG G++ +Y+
Sbjct  318   NGQQHDATASPEGAVYGKCREEVAKALNLSAPCVISCCGCCTFNGVWSGGGGPGLDTLYL  377

Query  1056  SSFFYDIATDVGIIDQEKASKIVKPRSFLVAAKLACETKFEDVKSTFPNAVEKDYPYLCM  1235
             +S F+ +A  VG+ID +  S    P +F VAAK AC+   E+ K+ +P   +   PYLCM
Sbjct  378   ASSFHFLAAQVGMIDGKLPSAKSTPSAFRVAAKKACQMSVEEAKAAYPGVQDIHVPYLCM  437

Query  1236  DLVYEYTLLVDGLGLHPYKEITLMKKVEYKNYMVEAAWPLGCAIDVIS  1379
             DL Y+YTLLVDG GL   K++TL+ KV++  Y V+AAWPLG AI+ +S
Sbjct  438   DLTYQYTLLVDGFGLKSIKKVTLVSKVKHGEYYVQAAWPLGTAIEALS  485



>ref|XP_006290233.1| hypothetical protein CARUB_v100030810mg, partial [Capsella rubella]
 gb|EOA23131.1| hypothetical protein CARUB_v100030810mg, partial [Capsella rubella]
Length=502

 Score =   387 bits (995),  Expect = 7e-125, Method: Compositional matrix adjust.
 Identities = 196/368 (53%), Positives = 264/368 (72%), Gaps = 5/368 (1%)
 Frame = +3

Query  180   NYAVIFDAGSTGSRVHVFHFDENLDLLPIGDGVEFFLKTTPGLSSYANDPEAAAKSLEPL  359
             NYAVIFDAGS+GSRVHV+ FD NLDL+P+G+ +E FL+  PGLS+Y  DP  AA SL  L
Sbjct  137   NYAVIFDAGSSGSRVHVYCFDHNLDLIPLGNELELFLQLKPGLSAYPTDPRQAANSLVSL  196

Query  360   LLEAEGVVPTELQPDTPLELGATAGLRLLEGDASDKILQAVRDMFKNESNFKSKAEWVSI  539
             L +AE  VP EL+P TP+ +GATAGLR L  +AS+ IL+AVR++ ++ S  K++A  V++
Sbjct  197   LDKAEASVPRELRPKTPVRVGATAGLRTLGHEASENILEAVRELLRDRSMLKTEANAVTV  256

Query  540   LEGSQEGTYFWVAMNYLLGNLGKGYQNTIATIDLGGGSVQVSYAVSGDTFANAPTPDNGE  719
             L+G+QEG+Y WV +NYLL NLGK Y +T+  +DLGGGSVQ++YA+S +  A+AP P +GE
Sbjct  257   LDGTQEGSYQWVTINYLLRNLGKPYSDTVGVVDLGGGSVQMAYAISEEDAASAPKPLDGE  316

Query  720   EPYVQEKYILGAQYYLYVHSYLNYGQLASRAEIFKASGNSTNPCVLEGYDGYYTYNDVSY  899
             + YV+E Y+ G +Y+LYVHSYL+YG LA+RAEI K S +S N C++ GYDG Y Y    +
Sbjct  317   DSYVREMYLKGRKYFLYVHSYLHYGLLAARAEILKVSEDSDNSCIVTGYDGMYKYGGKEF  376

Query  900   KVTAPPNGSSLKNCRKL---ARKVVDFRAPCKYQNCTFNGVWSGGGGAGMENVYISSFFY  1070
             K TA P+G+SL  CR++   A KV D    C +  CTF GVW+GG G G +N++++SFF+
Sbjct  377   KGTASPSGASLDECRRITINALKVND--TLCTHMKCTFGGVWNGGRGGGQKNMFVASFFF  434

Query  1071  DIATDVGIIDQEKASKIVKPRSFLVAAKLACETKFEDVKSTFPNAVEKDYPYLCMDLVYE  1250
             D A + G +D ++    V+P  F  AAK AC    E+ KS FP   E + PYLCMDLVY+
Sbjct  435   DRAAEAGFVDPKQPVATVRPMDFEKAAKKACSMNLEEGKSKFPLVEEDNLPYLCMDLVYQ  494

Query  1251  YTLLVDGL  1274
             YTLL+DG 
Sbjct  495   YTLLIDGF  502



>ref|XP_008679361.1| PREDICTED: probable apyrase 3 isoform X2 [Zea mays]
Length=452

 Score =   384 bits (987),  Expect = 3e-124, Method: Compositional matrix adjust.
 Identities = 203/405 (50%), Positives = 271/405 (67%), Gaps = 20/405 (5%)
 Frame = +3

Query  174   TGNYAVIFDAGSTGSRVHVFHFDENLDLLPIGD-GVEFFLKTTPGLSSYANDPEAAAKSL  350
             TG YAVIFDAGSTG+RVHVF FD  L+LL IGD G+E F K  PGLSSYA  P+ AA S+
Sbjct  60    TGRYAVIFDAGSTGTRVHVFRFDRKLELLEIGDDGIEVFAKVKPGLSSYAGHPQEAANSM  119

Query  351   EPLLLEAEGVVPTELQPDTPLELGATAGLRLLEGDASDKILQAVRDMFKNESNFKSKAEW  530
              PLL +A+  VP +L   TPL LG                   VR++   +S F+ K EW
Sbjct  120   LPLLDKAKSAVPKQLTKRTPLRLG-------------------VRNLIHTKSKFQYKPEW  160

Query  531   VSILEGSQEGTYFWVAMNYLLGNLGKGYQNTIATIDLGGGSVQVSYAVSGDTFANAPTPD  710
             ++++EGSQEG+Y WVA+NYLL  LG  Y  T+A +D+GGGSVQ++YAVS +  A+AP P 
Sbjct  161   INVIEGSQEGSYLWVALNYLLDKLGGDYSQTVAVLDMGGGSVQMAYAVSANAAASAPAPT  220

Query  711   NGEEPYVQEKYILGAQYYLYVHSYLNYGQLASRAEIFKASGNSTNPCVLEGYDGYYTYND  890
             +GE+PYV  +Y+ G  Y +Y HSYL+YG  ASRAEI KA     + C+L G+ G YTYN+
Sbjct  221   HGEDPYVTREYLKGKDYNIYTHSYLHYGAFASRAEILKAKDGPFSSCMLRGFIGQYTYNE  280

Query  891   VSYKVTAPPNGSSLKNCRKLARKVVDFRAPCKYQNCTFNGVWSGGGGAGMENVYISSFFY  1070
               Y  TA P G+    CR+   + ++  APC+ +NCTFNG+W+GGGGAG  ++Y++S FY
Sbjct  281   EQYDATAAPEGAVYGKCREEIGRALNLNAPCEMKNCTFNGIWNGGGGAGQGSIYVASSFY  340

Query  1071  DIATDVGIIDQEKASKIVKPRSFLVAAKLACETKFEDVKSTFPNAVEKDYPYLCMDLVYE  1250
              +A++VGI+D    S    P +F  +A+ AC+   E+ K  +PN  + D PYLCMDL Y+
Sbjct  341   FVASEVGIVDGNAPSGNTTPGAFGASAEKACQMSVEEAKIEYPNVNDVDVPYLCMDLAYQ  400

Query  1251  YTLLVDGLGLHPYKEITLMKKVEYKNYMVEAAWPLGCAIDVISSS  1385
             YTLLVDG G+   KEIT++ KV++  Y VEAAWPLG AI+ +SS+
Sbjct  401   YTLLVDGFGVERTKEITVVDKVKHGEYYVEAAWPLGSAIEAVSST  445



>ref|XP_002979160.1| hypothetical protein SELMODRAFT_233281 [Selaginella moellendorffii]
 gb|EFJ19568.1| hypothetical protein SELMODRAFT_233281 [Selaginella moellendorffii]
Length=471

 Score =   384 bits (987),  Expect = 4e-124, Method: Compositional matrix adjust.
 Identities = 202/411 (49%), Positives = 276/411 (67%), Gaps = 8/411 (2%)
 Frame = +3

Query  180   NYAVIFDAGSTGSRVHVFHFDENLDLLPIGDGVEFFLKTTPGLSSYANDPEAAAKSLEPL  359
             ++AVIFDAGS+GSRVHVF F  +L+LL + +G+E F +  PGLS YA+DP AAA SL+PL
Sbjct  63    SFAVIFDAGSSGSRVHVFRFSSDLELLAMDNGLELFRQLKPGLSYYASDPRAAANSLKPL  122

Query  360   LLEAEGVVPTELQPDTPLELGATAGLRLLEGDASDKILQAVRDMFKNESNFKSKAEWVSI  539
             L  A  VVP  LQ  TP+ LGATAGLR L G  +++IL+ VRD+  N S+FK    WVSI
Sbjct  123   LDAALKVVPENLQGKTPVRLGATAGLRTLPGGKANEILEEVRDLLSN-SSFKFDPSWVSI  181

Query  540   LEGSQEGTYFWVAMNYLLGNLGKGYQNTIATIDLGGGSVQVSYAVSGDTFANAPTPDNGE  719
             L+G+ EG++ WV +NYLLG LGK    T+  +DLGGGSVQ++YA++ +  A AP    GE
Sbjct  182   LDGADEGSFQWVTINYLLGRLGKDLSETVGIVDLGGGSVQMAYAIAEEDAAKAPKAAAGE  241

Query  720   EPYVQEKYILGAQYYLYVHSYLNYGQLASRAEIFK-ASGNSTNPCVLEGYDGYYTYNDVS  896
             + YV+   +LG  YYLYVHSYL+YG LA+RAE+ +    N  NPCV  G+ G Y Y   +
Sbjct  242   DAYVKTLTLLGKTYYLYVHSYLHYGLLAARAEVLRLVKTNDENPCVTSGFKGQYVYGSET  301

Query  897   YKVTAPPNGSSLKNCRKLARKVVDFRAPCKYQNCTFNGVWSGGGGAGMENVYISSFFYDI  1076
             +       G+    C  L    ++    C Y  CTF G+WSGGGGAG + ++++SFF+D 
Sbjct  302   FDAVG---GADFDRCSDLIVSALEINHTCNYLKCTFKGIWSGGGGAGQKKLFVASFFFDR  358

Query  1077  ATDVGII-DQEKASKIVKPRSFLVAAKLACETKFEDVKSTFPNAVEKDYPYLCMDLVYEY  1253
             A+++GII D + +  +V+P  F  AA+  C T +ED+   FP   E   PY+CMD++Y+Y
Sbjct  359   ASEIGIIKDPQVSEAVVEPSQFRDAARSICSTSYEDMPKKFPGVPELALPYICMDVLYQY  418

Query  1254  TLLVDGLGLHPYKEITLMKKVEYKNYMVEAAWPLGCAIDVIS--SSSANNL  1400
              LLV G G+   ++ITL+K+V+YK Y VEAAWPLG AI+V+S  SSS ++L
Sbjct  419   DLLVKGFGIPANEKITLVKRVQYKGYEVEAAWPLGSAIEVVSGHSSSTHSL  469



>gb|EMS59522.1| Nucleoside-triphosphatase [Triticum urartu]
Length=716

 Score =   392 bits (1006),  Expect = 9e-124, Method: Compositional matrix adjust.
 Identities = 197/392 (50%), Positives = 274/392 (70%), Gaps = 1/392 (0%)
 Frame = +3

Query  210   TGSRVHVFHFDENLDLLPIGDGVEFFLKTTPGLSSYANDPEAAAKSLEPLLLEAEGVVPT  389
             +GSRVHVF FD NLDL+ IG  +E F++  PGLS+YA DP  AA+SL  L+ +A+ VVP 
Sbjct  99    SGSRVHVFCFDGNLDLVHIGTDIELFVQKKPGLSAYAQDPREAAQSLVSLIEKAKEVVPA  158

Query  390   ELQPDTPLELGATAGLRLLEGDASDKILQAVRDMFKNESNFKSKAEWVSILEGSQEGTYF  569
             EL+  TP+ +GATAGLR L    S++ILQAVRD+ + +S+FK++ +WV++L+G+QEG Y 
Sbjct  159   ELRDQTPVRVGATAGLRALGAGKSEEILQAVRDLLREKSSFKNQPDWVTVLDGTQEGAYE  218

Query  570   WVAMNYLLGNLGKGYQNTIATIDLGGGSVQVSYAVSGDTFANAPTPDNGEEPYVQEKYIL  749
             WV +NYLLGNLGK Y +T+  +DLGGGSVQ++YA+       AP P +GEE YV++ ++ 
Sbjct  219   WVTINYLLGNLGKTYADTVGVVDLGGGSVQMAYAIPEKDAEKAPKPADGEESYVKKLFLK  278

Query  750   GAQYYLYVHSYLNYGQLASRAEIFKA-SGNSTNPCVLEGYDGYYTYNDVSYKVTAPPNGS  926
             G  Y+LYVHSYL YG LA+RAEI KA + N  + CVL G+ G Y Y   +++ +A P+GS
Sbjct  279   GTMYHLYVHSYLRYGLLAARAEILKAGNANGYSNCVLAGHQGQYKYGGNTFEASAAPSGS  338

Query  927   SLKNCRKLARKVVDFRAPCKYQNCTFNGVWSGGGGAGMENVYISSFFYDIATDVGIIDQE  1106
             S   CR    K +     C +  C+F G+W+GGGGAG +N++++SFF+D A + G I+  
Sbjct  339   SFSECRADVVKALKVDEACTHMKCSFGGIWNGGGGAGQKNLFVASFFFDRAAEAGFINSN  398

Query  1107  KASKIVKPRSFLVAAKLACETKFEDVKSTFPNAVEKDYPYLCMDLVYEYTLLVDGLGLHP  1286
              A   VK   F  AAK AC+    D +S++P   + + PY+CMDLVY+YTLLVDG G+ P
Sbjct  399   AAVAKVKSSDFEEAAKRACKLNVNDAQSSYPGVQKDNVPYICMDLVYQYTLLVDGFGVDP  458

Query  1287  YKEITLMKKVEYKNYMVEAAWPLGCAIDVISS  1382
              +E+TL+KKV Y +  VEAAWPLG AI+ ++S
Sbjct  459   QQEMTLVKKVPYSDAFVEAAWPLGSAIEYVAS  490



>ref|XP_001753690.1| predicted protein [Physcomitrella patens]
 gb|EDQ81442.1| predicted protein [Physcomitrella patens]
Length=471

 Score =   384 bits (985),  Expect = 1e-123, Method: Compositional matrix adjust.
 Identities = 199/405 (49%), Positives = 274/405 (68%), Gaps = 3/405 (1%)
 Frame = +3

Query  171   ETGNYAVIFDAGSTGSRVHVFHFDENLDLLPIGDGVEFFLKTTPGLSSYANDPEAAAKSL  350
             E   YAV+FDAGS+GSRVHVF FD++L L+ +GDG E F +  PGLSSYA +P+  A SL
Sbjct  64    EQKRYAVVFDAGSSGSRVHVFSFDKDLQLVKVGDGFEVFDQLKPGLSSYALNPKKGAASL  123

Query  351   EPLLLEAEGVVPTELQPDTPLELGATAGLRLLEGDASDKILQAVRDMFKNESNFKSKAEW  530
             +PLL +A  VVPTE +  TP+ LGATAGLRLL GD S  +L+ V D+   ES+FK K EW
Sbjct  124   QPLLDKALEVVPTEQRSTTPVLLGATAGLRLLPGDQSSNLLKEV-DVLLRESSFKFKPEW  182

Query  531   VSILEGSQEGTYFWVAMNYLLGNLGKGYQNTIATIDLGGGSVQVSYAVSGDTFANAPTPD  710
             VSI++G+QEG+Y WV +NYLL  LGK +  T+  +DLGGGSVQ+ YA+S + FA AP   
Sbjct  183   VSIIDGTQEGSYQWVTVNYLLKRLGKSFDETVGIVDLGGGSVQMGYAISDEDFAKAPKAR  242

Query  711   NGEEPYVQEKYILGAQYYLYVHSYLNYGQLASRAEIFKASGNSTN-PCVLEGYDGYYTYN  887
             +G++ YV++  ++GA Y LYVHSYLNYG LASRAEI K   ++ +  C+ +G+ G YTY 
Sbjct  243   DGQQSYVRKMSLMGASYNLYVHSYLNYGLLASRAEILKLLDDTESCSCLPKGFQGTYTYG  302

Query  888   DVSYKVTAPPNGSSLKNCRKLARKVVDFRAPCKYQNCTFNGVWSGGGGAGMENVYISSFF  1067
                Y+ +A  +G   + C+KL  K +     C+   CTF GVW GGGG GM++++++SFF
Sbjct  303   SQEYRASASVDGGEYEKCKKLVIKALKADQTCESLQCTFAGVWGGGGGVGMKSLFVASFF  362

Query  1068  YDIATDVGII-DQEKASKIVKPRSFLVAAKLACETKFEDVKSTFPNAVEKDYPYLCMDLV  1244
             +D A + GI+ D + A  ++ P  F  AAK  C    +++  ++P   E    +LCMDL 
Sbjct  363   FDRALESGIVTDPDAAEAVITPADFEAAAKKICRLSLDELAQSYPKVQEDTRKFLCMDLT  422

Query  1245  YEYTLLVDGLGLHPYKEITLMKKVEYKNYMVEAAWPLGCAIDVIS  1379
             Y+YTL+V G  + P  +ITL+KKV+Y    VE AWPLG AI+++S
Sbjct  423   YQYTLIVTGFQVKPDTKITLVKKVKYSGSYVETAWPLGSAIELVS  467



>emb|CDX70805.1| BnaC03g08890D [Brassica napus]
Length=1541

 Score =   408 bits (1048),  Expect = 1e-123, Method: Compositional matrix adjust.
 Identities = 219/462 (47%), Positives = 291/462 (63%), Gaps = 58/462 (13%)
 Frame = +3

Query  165   SHETGNYAVIFDAGSTGSRVHVFHFDENLDLLPIGDG-----------------------  275
             S    NYAVIFDAGS+GSRVHV+ FD NLDLLP+G+                        
Sbjct  1081  SRPPKNYAVIFDAGSSGSRVHVYCFDRNLDLLPLGNELELFVQRMFLIDACISCDVSLIQ  1140

Query  276   -----------------------VEFFLKTT-------PGLSSYANDPEAAAKSLEPLLL  365
                                    ++F +  +       PGLS+Y  DP  AA SL  LL 
Sbjct  1141  FVMVIRGTFVLFKLTYISLDVSLIQFLMVNSWYICVLKPGLSAYPTDPRQAANSLVSLLD  1200

Query  366   EAEGVVPTELQPDTPLELGATAGLRLLEGDASDKILQAVRDMFKNESNFKSKAEWVSILE  545
             +AE  VP EL+P TP+ +GATAGLR L  +AS+ ILQAV+++ ++ S  K++A  V++L+
Sbjct  1201  KAEASVPRELRPKTPVRVGATAGLRTLGHEASENILQAVKELLRDRSMLKTEANAVTVLD  1260

Query  546   GSQEGTYFWVAMNYLLGNLGKGYQNTIATIDLGGGSVQVSYAVSGDTFANAPTPDNGEEP  725
             G+QEG Y WV +NYLL NLGK Y +T+  +DLGGGSVQ++YA+S +  A AP P  GE+ 
Sbjct  1261  GTQEGAYQWVTINYLLRNLGKPYSDTVGVVDLGGGSVQMAYAISEEDAATAPKPLEGEDS  1320

Query  726   YVQEKYILGAQYYLYVHSYLNYGQLASRAEIFKASGNSTNPCVLEGYDGYYTYNDVSYKV  905
             YV+E Y+ G +Y+LYVHSYL+YG LA+RAEI K S +S NPC++ GYDG Y Y    +K 
Sbjct  1321  YVREMYLKGRKYFLYVHSYLHYGLLAARAEILKVSEDSNNPCIVAGYDGTYKYGGDGFKA  1380

Query  906   TAPPNGSSLKNCRKL---ARKVVDFRAPCKYQNCTFNGVWSGGGGAGMENVYISSFFYDI  1076
              A  +G+SL  CR+L   A KV D    C +  CTF GVW+GG G G +N++++SFF+D 
Sbjct  1381  AAVQSGASLNECRRLTVNALKVND--TLCTHMKCTFGGVWNGGRGGGQKNMFVASFFFDR  1438

Query  1077  ATDVGIIDQEKASKIVKPRSFLVAAKLACETKFEDVKSTFPNAVEKDYPYLCMDLVYEYT  1256
             A + G +D ++    V+P  F  AAK AC  K ++ KS FP   E ++PYLCMDLVY+YT
Sbjct  1439  AAEAGFVDPKQPVATVRPIDFEKAAKKACSMKMDEGKSKFPRVEEDNFPYLCMDLVYQYT  1498

Query  1257  LLVDGLGLHPYKEITLMKKVEYKNYMVEAAWPLGCAIDVISS  1382
             LLVDG GL P + ITL+KKV+Y  + VEAAWPLG AI+ +SS
Sbjct  1499  LLVDGFGLEPSQTITLVKKVKYGEHAVEAAWPLGSAIEAVSS  1540



>ref|NP_001065624.1| Os11g0126400 [Oryza sativa Japonica Group]
 gb|ABA91311.1| GDA1/CD39 family protein [Oryza sativa Japonica Group]
 dbj|BAF27469.1| Os11g0126400 [Oryza sativa Japonica Group]
Length=548

 Score =   386 bits (991),  Expect = 1e-123, Method: Compositional matrix adjust.
 Identities = 205/436 (47%), Positives = 277/436 (64%), Gaps = 29/436 (7%)
 Frame = +3

Query  177   GNYAVIFDAGSTGSRVHVFHFDENLDLLPIGDGVEFFLK---------------------  293
             G YAVI DAGSTG+RVHVF FD  +DLL IGD +E F K                     
Sbjct  54    GKYAVILDAGSTGTRVHVFRFDRMMDLLKIGDDIEVFAKNKTLINKYRILIGYYFVVKIN  113

Query  294   TTPGLSSYANDPEAAAKSLEPLLLEAEGVVPTELQPDTPLELGATAGLRLLEGDASDKIL  473
               PGLSSYA  P  AA S++PLL +A  VVP  L   TPL+LGATAGL L+  + +++IL
Sbjct  114   VVPGLSSYAGRPREAANSIQPLLDKAIHVVPNWLMKKTPLKLGATAGLILIGDEKANQIL  173

Query  474   QAVRDMFKNESNFKSKAEWVSILEGSQEGTYFWVAMNYLLGNLGKGYQNTIATIDLGGGS  653
             +AVRD+   +S F+    W+++L GSQEG+Y WVA+NYLL  LG+ Y  T+  IDLGGGS
Sbjct  174   EAVRDVVHTKSKFQYNPNWINVLTGSQEGSYMWVALNYLLDRLGEDYSKTVGVIDLGGGS  233

Query  654   VQVSYAVSGDTFANAPTPDNGEEPYVQEKYILGAQYYLYVHSYLNYGQLASRAEIFKASG  833
             VQ++YAVS    ANAP   NG++PY+ E+Y+ G  Y +YVHSYL+YG  ASR EI K   
Sbjct  234   VQMAYAVSSSIAANAPEVPNGQDPYITEEYLKGRDYNIYVHSYLHYGAQASRVEILKRKN  293

Query  834   NSTNPCVLEGYDGYYTYNDVSYKVTAPPNGSSLKNCRKLARKVVDFRAPCKYQNCTFNGV  1013
                + C+L G+ G +TYN   Y+  A P G+    CR+   K ++  +PC+ +NC+FNGV
Sbjct  294   GPFSNCMLRGFKGKFTYNGEQYEAMAAPQGADYHKCRQDVVKALNLDSPCETKNCSFNGV  353

Query  1014  WSGGGGAGMENVYISSFFYDIATDVGIIDQEKASKIVKPRSFLVAAKLACETKFEDVKST  1193
             W+GGGG G + +Y++S FY IA+ +G ID E  S    P ++  A++  C    E+ K+ 
Sbjct  354   WNGGGGVGQDEIYVTSSFYYIASGIGFIDSEAPSAKSTPAAYKAASEKVCILSIEEAKAA  413

Query  1194  FPNAVEKDYPYLCMDLVYEYTLLVDGLGLHPYKEITLMKKVEYKNYMVEAAWPLGCAID-  1370
             +P  + +D+ YLCMDL+Y+YTLLVDG GL   KEITL++KV++    +EAAWPLG AI+ 
Sbjct  414   YP--IARDHAYLCMDLIYQYTLLVDGFGLEATKEITLVEKVKHGESYIEAAWPLGTAIEA  471

Query  1371  -----VISSSSANNLL  1403
                  +I    AN +L
Sbjct  472   TTGPRLIGDEKANQIL  487



>ref|XP_002988529.1| hypothetical protein SELMODRAFT_183978 [Selaginella moellendorffii]
 gb|EFJ10325.1| hypothetical protein SELMODRAFT_183978 [Selaginella moellendorffii]
Length=471

 Score =   383 bits (983),  Expect = 2e-123, Method: Compositional matrix adjust.
 Identities = 202/411 (49%), Positives = 275/411 (67%), Gaps = 8/411 (2%)
 Frame = +3

Query  180   NYAVIFDAGSTGSRVHVFHFDENLDLLPIGDGVEFFLKTTPGLSSYANDPEAAAKSLEPL  359
             ++AVIFDAGS+GSRVHVF F  +L+LL + +G+E F +  PGLS YA+DP AAA SL+PL
Sbjct  63    SFAVIFDAGSSGSRVHVFRFSSDLELLAMDNGLELFRQLKPGLSYYASDPRAAANSLKPL  122

Query  360   LLEAEGVVPTELQPDTPLELGATAGLRLLEGDASDKILQAVRDMFKNESNFKSKAEWVSI  539
             L  A  VVP  LQ  TP+ LGATAGLR L G  +++IL+ VRD+  N S+FK    WVSI
Sbjct  123   LDAALKVVPENLQGKTPVRLGATAGLRTLPGGKANEILEEVRDLLTN-SSFKFDPSWVSI  181

Query  540   LEGSQEGTYFWVAMNYLLGNLGKGYQNTIATIDLGGGSVQVSYAVSGDTFANAPTPDNGE  719
             L+G+ EG++ WV +NYLLG LGK    T+  +DLGGGSVQ++YA++ +  A AP    GE
Sbjct  182   LDGADEGSFQWVTVNYLLGRLGKDLSETVGIVDLGGGSVQMAYAITEEDAAKAPKAAAGE  241

Query  720   EPYVQEKYILGAQYYLYVHSYLNYGQLASRAEIFK-ASGNSTNPCVLEGYDGYYTYNDVS  896
             + YV+   +LG  YYLYVHSYL+YG LA+RAE+ +    N  NPCV  G+ G Y Y   +
Sbjct  242   DAYVKTLTLLGKTYYLYVHSYLHYGLLAARAEVLRLVKTNDENPCVTSGFKGQYVYGSET  301

Query  897   YKVTAPPNGSSLKNCRKLARKVVDFRAPCKYQNCTFNGVWSGGGGAGMENVYISSFFYDI  1076
             +       G+    C  L    ++    C Y  CTF G+WSGGGGAG + ++++SFF+D 
Sbjct  302   FDAVG---GADFDRCSDLIVSALEINHTCNYLKCTFKGIWSGGGGAGQKKLFVASFFFDR  358

Query  1077  ATDVGII-DQEKASKIVKPRSFLVAAKLACETKFEDVKSTFPNAVEKDYPYLCMDLVYEY  1253
             A+++GII D + +  +V+P  F  AA   C T +ED+   FP   E   PY+CMD++Y+Y
Sbjct  359   ASEIGIIKDPQVSEAVVEPSQFRDAATSICSTSYEDMPKKFPGVPELALPYICMDVLYQY  418

Query  1254  TLLVDGLGLHPYKEITLMKKVEYKNYMVEAAWPLGCAIDVIS--SSSANNL  1400
              LLV G G+   ++ITL+K+V+YK Y VEAAWPLG AI+V+S  SSS ++L
Sbjct  419   DLLVKGFGIPANEKITLVKRVQYKGYEVEAAWPLGSAIEVVSGHSSSTHSL  469



>gb|EMT18791.1| Nucleoside-triphosphatase [Aegilops tauschii]
Length=439

 Score =   382 bits (980),  Expect = 2e-123, Method: Compositional matrix adjust.
 Identities = 202/423 (48%), Positives = 278/423 (66%), Gaps = 38/423 (9%)
 Frame = +3

Query  174   TGNYAVIFDAGSTGSRVHVFHFDENLDLLPIGDGVEFFLKTTPGLSSYANDPEAAAKSLE  353
             +  YAVIFDAGS+GSRVHV+ FDE+LDL+PIG+ +E F +  PGLSSYA DP+ AA+SL 
Sbjct  36    SNRYAVIFDAGSSGSRVHVYCFDESLDLVPIGNAIELFKQKKPGLSSYAKDPQEAAESLV  95

Query  354   PLLLEAEGVVPTELQPDTPLELGATAGLRLLEGDASDKILQAVRDMFKNESNFKSKAEWV  533
              LL EAE VVP EL+  TP+ +G                   VRD+ +++S+FKS+ +WV
Sbjct  96    SLLEEAEKVVPVELREQTPVRVG-------------------VRDLLRDKSSFKSQPDWV  136

Query  534   SILEGSQEGTYFWVAMNYLLGNLGKGYQNTIATIDLGGGSVQVSYAVSGDTFANAPTPDN  713
             S+L+GSQEG + WV +NYLL  LGK Y +T+  +DLGGGSVQ++YA+S    A AP   +
Sbjct  137   SVLDGSQEGAFAWVTINYLLEKLGKPYSHTVGVVDLGGGSVQMAYAISEKDAAKAPQVSD  196

Query  714   GEEPYVQEKYILGAQYYLYVHS-----------------YLNYGQLASRAEIFKASGNST  842
             GE+ YV++  + G  YYLYVH                  YL+YG LA+RAEI KA  NS 
Sbjct  197   GEDSYVKKLVLKGTTYYLYVHRVATNPAICPILKDVKAFYLHYGLLAARAEILKAGENSD  256

Query  843   -NPCVLEGYDGYYTYNDVSYKVTAPPNGSSLKNCRKLARKVVDFRAP-CKYQNCTFNGVW  1016
              + C+L+GY G Y Y D +++ +   +G++   CR +A + +    P C +  CTF GVW
Sbjct  257   YSNCMLDGYHGKYQYGDDTFEASGSSSGATYSKCRAVAVRALKVDEPACTHMKCTFGGVW  316

Query  1017  SGGGGAGMENVYISSFFYDIATDVGIIDQEKASKIVKPRSFLVAAKLACETKFEDVKSTF  1196
             +GGGG G +N++++SFFYD A   G ++ + A   VKP  F  AA+  C+   ++  +T+
Sbjct  317   NGGGGDGQKNLFVASFFYDRAAQAGFVNPKAAVAKVKPSDFEEAARRVCKLNVKEAHATY  376

Query  1197  PNAVEKDYPYLCMDLVYEYTLLVDGLGLHPYKEITLMKKVEYKNYMVEAAWPLGCAIDVI  1376
             P+  E+D P+LCMDLVY++TLLVDG G+ PY++ITL+KKV Y N  VEAAWPLG AI+V 
Sbjct  377   PDVSEEDIPFLCMDLVYQHTLLVDGFGVDPYQDITLVKKVRYGNSFVEAAWPLGSAIEVA  436

Query  1377  SSS  1385
             SSS
Sbjct  437   SSS  439



>dbj|BAJ96614.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=464

 Score =   381 bits (979),  Expect = 5e-123, Method: Compositional matrix adjust.
 Identities = 201/402 (50%), Positives = 270/402 (67%), Gaps = 2/402 (0%)
 Frame = +3

Query  174   TGNYAVIFDAGSTGSRVHVFHFDENLDLLPIGDGVEFFLKTTPGLSSYANDPEAAAKSLE  353
              G YAVIFDAGSTG+RVHVF FD  +DLL IGD +E F K +PGLSSY+  P  AAKS+ 
Sbjct  51    VGKYAVIFDAGSTGTRVHVFKFDNRMDLLQIGDQIEVFAKVSPGLSSYSGRPLEAAKSMI  110

Query  354   PLLLEAEGVVPTELQPDTPLELGATAGLRLLEGDASDKILQAVRDMFKNESNFKSKAEWV  533
             PLL +A+ +VP      TPL+LGATAGLRL+    S++IL+AVRD+   ++ F+   +W+
Sbjct  111   PLLDKAKSIVPWWQMNRTPLKLGATAGLRLIGDKQSEQILEAVRDIVHTKTKFQYNPKWI  170

Query  534   SILEGSQEGTYFWVAMNYLLGNLGKGYQNTIATIDLGGGSVQVSYAVSGDTFANAPTPDN  713
             ++LEGSQEG+Y WVA+NYLL  LG  Y  T+  IDLGGGSVQ++YAVS +  ANAP   +
Sbjct  171   NVLEGSQEGSYMWVALNYLLDRLGGDYSKTVGVIDLGGGSVQMAYAVSPNAAANAPAAPH  230

Query  714   GEEPYVQEKYILGAQYYLYVHSYLNYGQLASRAEIFKASGNSTNPCVLEGYDGYYTYNDV  893
             G +PY+ ++Y+ G  Y +YVHSYL YG +A+R EI KA     + C+L G  G YTYN  
Sbjct  231   GMDPYITKEYLKGKDYNVYVHSYLYYGSMAARVEILKAKSGPFSSCMLRGSTGNYTYNGE  290

Query  894   SYKVTAPPNGSSLKNCRKLARKVVDFRAPCKYQNCTFNGVWSGGGGAGMENVYISSFFYD  1073
             +Y  +A P G+  + CRK   + +   APC+ +NCTF GVW GGGGAG   +Y +S FY 
Sbjct  291   AYDASASPEGAVYRKCRKEVARALKIDAPCEAKNCTFGGVWGGGGGAGQATLYAASSFYA  350

Query  1074  IATDVGIIDQEKASKIVKPRSFLVAAKLACETKFEDVKSTFPNAVEKDYPYLCMDLVYEY  1253
             +A+ VG + +   S    P +F  AAK  C    E+ K+ +P    +D PY+CMDLVY+Y
Sbjct  351   MASQVGWVKKGTPSARSSPAAFRAAAKKMCPLSLEEAKAAYPGV--RDTPYVCMDLVYQY  408

Query  1254  TLLVDGLGLHPYKEITLMKKVEYKNYMVEAAWPLGCAIDVIS  1379
             TLL  G GL   +EITL++KV++  Y +EA WPLG AI+ ++
Sbjct  409   TLLAYGFGLARSREITLVEKVKHGEYFMEAKWPLGEAIEAVA  450



>ref|NP_001167731.1| putative apyrase family protein precursor [Zea mays]
 gb|ACN25910.1| unknown [Zea mays]
 gb|AFW60555.1| putative apyrase family protein [Zea mays]
Length=464

 Score =   381 bits (979),  Expect = 6e-123, Method: Compositional matrix adjust.
 Identities = 209/404 (52%), Positives = 271/404 (67%), Gaps = 1/404 (0%)
 Frame = +3

Query  177   GNYAVIFDAGSTGSRVHVFHFDENLDLLPIGDGVEFFLKTTPGLSSYANDPEAAAKSLEP  356
             G YAVIFDAGSTGSRV++F F   +DLL IGD +EFF K  PGLSSYA  P+ AAKS+ P
Sbjct  56    GRYAVIFDAGSTGSRVYIFRFGRQMDLLRIGDEIEFFAKLKPGLSSYAGRPQEAAKSILP  115

Query  357   LLLEAEGVVPTELQPDTPLELGATAGLRLLEGDASDKILQAVRDMFKNESNFKSKAEWVS  536
             LL +A+ +VP+ L   TP++LGATAGLRL+    +D+IL AVRD+   +S F+ K  W++
Sbjct  116   LLEKAKSIVPSWLMKRTPVKLGATAGLRLIGNQQADQILDAVRDLVHKKSKFQYKPNWIN  175

Query  537   ILEGSQEGTYFWVAMNYLLGNLGKGYQNTIATIDLGGGSVQVSYAVSGDTFANAPTPDNG  716
             +LEGSQE +Y WVA+NYLL  LG  Y  T+  IDLGGGSVQ++YAVS +  A AP   +G
Sbjct  176   VLEGSQEASYLWVALNYLLDKLGGEYSQTVGVIDLGGGSVQMAYAVSANAAARAPAVPDG  235

Query  717   EEPYVQEKYILGAQYYLYVHSYLNYGQLASRAEIFKASGNSTNPCVLEGYDGYYTYNDVS  896
             E+PY+ ++Y  G QY +YVHSYL YG  ASRAEI  +     + C+L G+ G YTYN   
Sbjct  236   EDPYITKEYFKGKQYNVYVHSYLRYGSFASRAEILMSKNGPFSSCMLRGFSGKYTYNGQQ  295

Query  897   YKVTAPPNGSSLKNCRKLARKVVDFRAPCKY-QNCTFNGVWSGGGGAGMENVYISSFFYD  1073
             +  TA P G+    CR    K ++ +APCK  +NCTF GVW GGGGAG  ++Y++S FY 
Sbjct  296   FDATARPEGALYDKCRGEIAKAMNLKAPCKTAKNCTFCGVWKGGGGAGQNDIYVASGFYY  355

Query  1074  IATDVGIIDQEKASKIVKPRSFLVAAKLACETKFEDVKSTFPNAVEKDYPYLCMDLVYEY  1253
             +A+ VG ID +  S    P +F  AAK AC+      K  +P+    D PYLCMDL Y Y
Sbjct  356   LASHVGFIDSKAPSAKAPPAAFRAAAKKACKFDVNRAKVAYPDVSNSDVPYLCMDLTYTY  415

Query  1254  TLLVDGLGLHPYKEITLMKKVEYKNYMVEAAWPLGCAIDVISSS  1385
             TLLVDG GL P K+IT + KV++  Y +EA WPLG AI+ +S +
Sbjct  416   TLLVDGFGLQPMKKITFVSKVKHGEYYIEATWPLGTAIEAVSPT  459



>ref|XP_003605672.1| Nucleoside-triphosphatase [Medicago truncatula]
 gb|AES87869.1| Nod factor-binding lectin-nucleotide phosphohydrolase [Medicago 
truncatula]
Length=433

 Score =   380 bits (975),  Expect = 8e-123, Method: Compositional matrix adjust.
 Identities = 197/413 (48%), Positives = 274/413 (66%), Gaps = 35/413 (8%)
 Frame = +3

Query  150   RRVLLSHET-GNYAVIFDAGSTGSRVHVFHFDENLDLLPIGDGVEFFLKTTPGLSSYAND  326
             R++    ET  +YAV+FDAGSTGSRVHV+HFD+NL+LL +G  VEF+ KTTPGLS+YA++
Sbjct  43    RKIFPKQETISSYAVVFDAGSTGSRVHVYHFDQNLNLLHVGKDVEFYNKTTPGLSAYADN  102

Query  327   PEAAAKSLEPLLLEAEGVVPTELQPDTPLELGATAGLRLLEGDASDKILQAVRDMFKNES  506
             PE AAKSL PLL +AE VVP + +  TP+ LG                   VRD+  N S
Sbjct  103   PEQAAKSLIPLLEQAESVVPEDQRSKTPVRLG-------------------VRDLLSNRS  143

Query  507   NFKSKAEWVSILEGSQEGTYFWVAMNYLLGNLGKGYQNTIATIDLGGGSVQVSYAVSGDT  686
              F  + + VSI++G+QEG+Y WV +NY LG LGK +  T+  +DLGGGSVQ++YAVS +T
Sbjct  144   TFNVQPDAVSIIDGTQEGSYLWVTVNYALGTLGKKFTKTVGVMDLGGGSVQMAYAVSRNT  203

Query  687   FANAPTPDNGEEPYVQEKYILGAQYYLYVHSYLNYGQLASRAEIFKASGNSTNPCVLEGY  866
               NAP   +G++PY++              +YL++G  ASRAEI K + NS NPC+L G+
Sbjct  204   AKNAPKVADGDDPYIK--------------NYLHFGTEASRAEILKVTHNSPNPCILAGF  249

Query  867   DGYYTYNDVSYKVTAPPNGSSLKNCRKLARKVVDFRAPCKYQNCTFNGVWSGGGGAGMEN  1046
             DG Y Y    +K  A  +G+S K C+K+  + +    PC YQNCTF G+W+GGGG+G   
Sbjct  250   DGTYRYAGEEFKANALASGASFKKCKKIVHQALKLNYPCPYQNCTFGGIWNGGGGSGQRK  309

Query  1047  VYISSFFYDIATDVGIIDQEKASKIVKPRSFLVAAKLACETKFEDVKSTFPNAVEKDYP-  1223
             ++ +SFF+ +A +VG++D  K +  ++P  F   AK AC   FED KS++P   +K+   
Sbjct  310   LFAASFFFYLAAEVGMVDPNKPNFKIRPVDFESEAKKACALNFEDAKSSYPFLAKKNIAS  369

Query  1224  YLCMDLVYEYTLLVDGLGLHPYKEITLMKKVEYKNYMVEAAWPLGCAIDVISS  1382
             Y+CMDL+Y+Y LLVDG GL P +EIT  K++EY++ +VEAAWPLG A++ ISS
Sbjct  370   YVCMDLIYQYVLLVDGFGLDPLQEITAGKQIEYQDSLVEAAWPLGNAVEAISS  422



>gb|EMT13113.1| Nucleoside-triphosphatase [Aegilops tauschii]
Length=480

 Score =   381 bits (979),  Expect = 1e-122, Method: Compositional matrix adjust.
 Identities = 199/410 (49%), Positives = 274/410 (67%), Gaps = 18/410 (4%)
 Frame = +3

Query  210   TGSRVHVFHFDENLDLLPIGDGVEFFLKTTPGLSSYANDPEAAAKSLEPLLLEAEGVVPT  389
             +GSRVHVF FD NLDL+ IG  +E F++  PGLS+YA DP  AA+SL  L+ +A+ VVP 
Sbjct  71    SGSRVHVFCFDGNLDLVHIGTDIELFVQKKPGLSAYAQDPREAAQSLVSLIEKAKEVVPA  130

Query  390   ELQPDTPLELGATAGLRLLEGDASDKILQAVRDMFKNESNFKSKAEWVSILEGSQEGTYF  569
             EL+  TP+ +GATAGLR L    S++ILQAVRD+ + +S+FK++ +WV++L+G+QE  Y 
Sbjct  131   ELRDQTPVRVGATAGLRALGAGKSEEILQAVRDLLREKSSFKNQPDWVTVLDGTQEEDYM  190

Query  570   -----------------WVAMNYLLGNLGKGYQNTIATIDLGGGSVQVSYAVSGDTFANA  698
                               V +NYLLGNLGK Y +T+  +DLGGGSVQ++YA+       A
Sbjct  191   PFSLSYELIFGGLLVSDKVTINYLLGNLGKTYADTVGVVDLGGGSVQMAYAIPEKDAEKA  250

Query  699   PTPDNGEEPYVQEKYILGAQYYLYVHSYLNYGQLASRAEIFKA-SGNSTNPCVLEGYDGY  875
             P P +GEE YV++ ++ G  Y+LYVHSYL YG LA+RAEI KA + N  + CVL G+ G 
Sbjct  251   PKPADGEESYVKKLFLKGTTYHLYVHSYLRYGLLAARAEILKAGNANGYSNCVLAGHQGQ  310

Query  876   YTYNDVSYKVTAPPNGSSLKNCRKLARKVVDFRAPCKYQNCTFNGVWSGGGGAGMENVYI  1055
             Y Y   +++ +A P+GSS   CR    K +     C +  C+F G+W+GGGGAG +N+++
Sbjct  311   YKYGGNTFEASAAPSGSSFSECRADVVKALKVDEACTHMKCSFGGIWNGGGGAGQKNLFV  370

Query  1056  SSFFYDIATDVGIIDQEKASKIVKPRSFLVAAKLACETKFEDVKSTFPNAVEKDYPYLCM  1235
             +SFF+D A + G I+   A   VKP  F  AAK AC+    D +S++P   + + PY+CM
Sbjct  371   ASFFFDRAAEAGFINSNAAVAKVKPSDFEEAAKRACKLNVNDAQSSYPGVQKDNVPYICM  430

Query  1236  DLVYEYTLLVDGLGLHPYKEITLMKKVEYKNYMVEAAWPLGCAIDVISSS  1385
             DLVY+YTLLVDG G+ P +E+TL+KKV Y +  VEAAWPLG AI+V SSS
Sbjct  431   DLVYQYTLLVDGFGVDPQQEMTLVKKVPYSDAFVEAAWPLGSAIEVASSS  480



>gb|KHN00658.1| Nucleoside-triphosphatase [Glycine soja]
Length=382

 Score =   376 bits (966),  Expect = 4e-122, Method: Compositional matrix adjust.
 Identities = 188/363 (52%), Positives = 258/363 (71%), Gaps = 1/363 (0%)
 Frame = +3

Query  300   PGLSSYANDPEAAAKSLEPLLLEAEGVVPTELQPDTPLELGATAGLRLLEGDASDKILQA  479
             PGLS+YA +P  AA+SL  LL +AE VVP E +P TP+ +GATAGLR LEGDAS +ILQA
Sbjct  20    PGLSAYAQNPRQAAESLISLLDKAESVVPREFRPKTPVRVGATAGLRALEGDASGRILQA  79

Query  480   VRDMFKNESNFKSKAEWVSILEGSQEGTYFWVAMNYLLGNLGKGYQNTIATIDLGGGSVQ  659
             VRD+ K  S  KS+ + V++L+G+QEG + WV +NYLLG LGK +  T+  +DLGGGSVQ
Sbjct  80    VRDLLKQRSTLKSEPDAVTVLDGTQEGAFQWVTINYLLGKLGKDFSETVGVVDLGGGSVQ  139

Query  660   VSYAVSGDTFANAPTPDNGEEPYVQEKYILGAQYYLYVHSYLNYGQLASRAEIFKASGNS  839
             ++YA+S    A AP    GE+PYV+E ++ G +YYLYVHSYL YG LA+RA+I + S +S
Sbjct  140   MAYAISETDAAKAPKLSVGEDPYVKEMFLRGRKYYLYVHSYLGYGLLAARAKILEVSDDS  199

Query  840   TNPCVLEGYDGYYTYNDVSYKVTAPPNGSSLKNCRKLARKVVDF-RAPCKYQNCTFNGVW  1016
              NPC+L G++G Y Y   S K ++ P+G+SL  C+ +A + +    + C +  CTF G+W
Sbjct  200   GNPCILNGFNGSYIYGGKSVKASSAPSGASLNECKNIAFQALKVNESKCTHMKCTFGGIW  259

Query  1017  SGGGGAGMENVYISSFFYDIATDVGIIDQEKASKIVKPRSFLVAAKLACETKFEDVKSTF  1196
             +GGGG G +N++++SFF+D A + G  +       V+P  F  AAK AC+TK ED KST+
Sbjct  260   NGGGGDGQKNLFVASFFFDRAAEAGFANPNLPVVKVRPVDFEAAAKQACKTKLEDAKSTY  319

Query  1197  PNAVEKDYPYLCMDLVYEYTLLVDGLGLHPYKEITLMKKVEYKNYMVEAAWPLGCAIDVI  1376
                 E + PYLCMDL+Y+YTLLV G GL P+++ITL+KKV+Y +  VEAAWPLG AI+ +
Sbjct  320   QRVEEGNLPYLCMDLLYQYTLLVVGFGLDPWQQITLVKKVKYHDAFVEAAWPLGSAIEAV  379

Query  1377  SSS  1385
             SS+
Sbjct  380   SST  382



>tpg|DAA41781.1| TPA: putative apyrase family protein [Zea mays]
Length=441

 Score =   376 bits (965),  Expect = 3e-121, Method: Compositional matrix adjust.
 Identities = 186/368 (51%), Positives = 258/368 (70%), Gaps = 1/368 (0%)
 Frame = +3

Query  180   NYAVIFDAGSTGSRVHVFHFDENLDLLPIGDGVEFFLKTTPGLSSYANDPEAAAKSLEPL  359
              YAVIFDAGS+GSRVHVF FD NLDL+ IG  +E F++  PGLS YANDP  AA+SL  L
Sbjct  65    KYAVIFDAGSSGSRVHVFRFDANLDLVHIGSEIELFVQIKPGLSHYANDPREAAESLVSL  124

Query  360   LLEAEGVVPTELQPDTPLELGATAGLRLLEGDASDKILQAVRDMFKNESNFKSKAEWVSI  539
             L +A+ VVP EL+  TP+ +GATAGLR L    S+ ILQAVRD+ + +S+FK++ +WV++
Sbjct  125   LDDAKRVVPAELRDQTPVRVGATAGLRNLGAQKSEAILQAVRDILREKSSFKNQPDWVTV  184

Query  540   LEGSQEGTYFWVAMNYLLGNLGKGYQNTIATIDLGGGSVQVSYAVSGDTFANAPTPDNGE  719
             L+G+QEG Y WV +NYLLGNLGK Y +T+  +DLGGGSVQ++YA++      AP P  GE
Sbjct  185   LDGTQEGAYEWVTINYLLGNLGKTYADTVGVVDLGGGSVQMAYAIAEKDAEKAPKPSEGE  244

Query  720   EPYVQEKYILGAQYYLYVHSYLNYGQLASRAEIFKA-SGNSTNPCVLEGYDGYYTYNDVS  896
             + YV++ ++ G  YYLYVHSYL+YG LA+RAE+ KA +GN  + C+LEG+ G Y Y D S
Sbjct  245   DAYVKKLFLKGTTYYLYVHSYLHYGLLAARAEVLKAGNGNGYSNCMLEGFQGKYKYGDDS  304

Query  897   YKVTAPPNGSSLKNCRKLARKVVDFRAPCKYQNCTFNGVWSGGGGAGMENVYISSFFYDI  1076
             ++ + PP+G+S   C+  A K +     C +  C+F G+W+GGGGAG +N++++SFF+D 
Sbjct  305   FEASGPPSGASYSKCKDDAVKALKVDEACTHMKCSFGGIWNGGGGAGQKNLFVASFFFDR  364

Query  1077  ATDVGIIDQEKASKIVKPRSFLVAAKLACETKFEDVKSTFPNAVEKDYPYLCMDLVYEYT  1256
             A + G ++       VKP  F  AA+ AC    ++ ++TFP   +   PY+CMDLVY+YT
Sbjct  365   AAEAGFVNANAPVAKVKPSDFRQAAERACSLSVKNAEATFPGVQKDSIPYICMDLVYQYT  424

Query  1257  LLVDGLGL  1280
             LLV+G   
Sbjct  425   LLVEGFAF  432



>dbj|BAJ96497.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ97240.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=448

 Score =   374 bits (961),  Expect = 2e-120, Method: Compositional matrix adjust.
 Identities = 198/403 (49%), Positives = 271/403 (67%), Gaps = 3/403 (1%)
 Frame = +3

Query  177   GNYAVIFDAGSTGSRVHVFHFDENLDLLPIGDGVEFFLKTTPGLSSYANDPEAAAKSLEP  356
             G YAVI DAGSTG+RVHVF FD+ ++L+ +GD +E F    PGLSSYA  P+ AA S+ P
Sbjct  43    GKYAVIMDAGSTGTRVHVFRFDKKMELVDVGDDIEVFATVNPGLSSYAGRPQEAANSIVP  102

Query  357   LLLEAEGVVPTELQPDTPLELGATAGLRLLEGDASDKILQAVRDMFKNESNFKSKAEWVS  536
             LL +A   VP  L   TP++LGATAGLRL+  + +++IL+AVR +   +S F+    W++
Sbjct  103   LLEKANSAVPRSLMKRTPVKLGATAGLRLIGDEQAEQILEAVRGVVHTKSKFQYNPSWIN  162

Query  537   ILEGSQEGTYFWVAMNYLLGNLGKGYQNTIATIDLGGGSVQVSYAVSGDTFANAPTPDNG  716
             +LEGSQEG+Y WVA+NYLL  LG  Y  T+  IDLGGGSVQ++YA+S D  A AP     
Sbjct  163   VLEGSQEGSYLWVALNYLLDKLGGEYTKTVGVIDLGGGSVQMAYAISADAAATAPVV---  219

Query  717   EEPYVQEKYILGAQYYLYVHSYLNYGQLASRAEIFKASGNSTNPCVLEGYDGYYTYNDVS  896
             ++PYV ++Y+ G  Y +Y HSYL+YG +A+R EIFKA     + C+L G+ G YTYN   
Sbjct  220   KDPYVTKEYLKGRDYNVYAHSYLHYGAMAARGEIFKAKNGPISYCMLRGFIGKYTYNGDK  279

Query  897   YKVTAPPNGSSLKNCRKLARKVVDFRAPCKYQNCTFNGVWSGGGGAGMENVYISSFFYDI  1076
             Y   A P G++   CR+   K +   APC+ +NCTFNG W+GGGGAG  ++Y +S FY +
Sbjct  280   YDAIASPTGAAYDKCREDVIKALKLSAPCEAKNCTFNGAWNGGGGAGQADLYAASSFYYM  339

Query  1077  ATDVGIIDQEKASKIVKPRSFLVAAKLACETKFEDVKSTFPNAVEKDYPYLCMDLVYEYT  1256
             A+ VG+ID +  S    P ++  AA+  C    E+ K+ +P A   D PYLCMDLVY+Y+
Sbjct  340   ASRVGLIDSDSTSGKTTPAAYRAAAEKICRLSLEEAKALYPRARATDVPYLCMDLVYQYS  399

Query  1257  LLVDGLGLHPYKEITLMKKVEYKNYMVEAAWPLGCAIDVISSS  1385
             LLV G GL P K IT+++KV++  Y +EAAWPLG AI+ +S +
Sbjct  400   LLVYGFGLEPTKVITVVEKVKHGEYFIEAAWPLGEAIEAVSPT  442



>dbj|BAJ99958.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=370

 Score =   371 bits (953),  Expect = 2e-120, Method: Compositional matrix adjust.
 Identities = 189/364 (52%), Positives = 261/364 (72%), Gaps = 2/364 (1%)
 Frame = +3

Query  300   PGLSSYANDPEAAAKSLEPLLLEAEGVVPTELQPDTPLELGATAGLRLLEGDASDKILQA  479
             PGLSSYA DP+ AA+SL  LL EAE VVP EL+  TP+ +GATAGLR L  + S++ILQA
Sbjct  7     PGLSSYAKDPQEAAESLVSLLEEAEKVVPVELREQTPVRVGATAGLRALGAERSEEILQA  66

Query  480   VRDMFKNESNFKSKAEWVSILEGSQEGTYFWVAMNYLLGNLGKGYQNTIATIDLGGGSVQ  659
             VRD+ +++S+FKS+ +WVS+L+GSQEG + WV +NYLL  LGK Y +T+  +DLGGGSVQ
Sbjct  67    VRDLLRDKSSFKSQPDWVSVLDGSQEGAFAWVTINYLLEKLGKPYSHTVGVVDLGGGSVQ  126

Query  660   VSYAVSGDTFANAPTPDNGEEPYVQEKYILGAQYYLYVHSYLNYGQLASRAEIFKASGNS  839
             ++YA+S    A AP   +GE+ YV++  + G  YYLYVHSYL+YG LA+RAEI KAS  S
Sbjct  127   MAYAISEKDAAKAPQVSDGEDSYVKKLVLKGTTYYLYVHSYLHYGLLAARAEILKASERS  186

Query  840   T-NPCVLEGYDGYYTYNDVSYKVTAPPNGSSLKNCRKLARKVVDFRAP-CKYQNCTFNGV  1013
               + C+L+GY G Y Y D +++ +   +G++   CR +A + +    P C +  CTF GV
Sbjct  187   DYSNCMLDGYHGKYQYGDDTFEASGSSSGATYSKCRAVAVRALKVDEPACTHMKCTFGGV  246

Query  1014  WSGGGGAGMENVYISSFFYDIATDVGIIDQEKASKIVKPRSFLVAAKLACETKFEDVKST  1193
             W+GGGG G +N++++SFFYD A + G ++ + A   VKP  F  AA+  C+   ++  +T
Sbjct  247   WNGGGGDGQKNLFVASFFYDRAAEAGFVNPKAAVAKVKPSDFEEAARRVCKLNVKEAHAT  306

Query  1194  FPNAVEKDYPYLCMDLVYEYTLLVDGLGLHPYKEITLMKKVEYKNYMVEAAWPLGCAIDV  1373
             +P+  E+D P+LCMDLVY++TLLVDG G+ PY++ITL+KKV Y N  VEAAWPLG AI+V
Sbjct  307   YPDVSEEDIPFLCMDLVYQHTLLVDGFGVDPYQDITLVKKVPYGNSFVEAAWPLGSAIEV  366

Query  1374  ISSS  1385
              SSS
Sbjct  367   ASSS  370



>dbj|BAD13525.1| apyrase [Glycine max]
Length=389

 Score =   367 bits (943),  Expect = 1e-118, Method: Compositional matrix adjust.
 Identities = 193/393 (49%), Positives = 263/393 (67%), Gaps = 16/393 (4%)
 Frame = +3

Query  207   STGSRVHVFHFDENLDLLPIGDGVEFFLKTTPGLSSYANDPEAAAKSLEPLLLEAEGVVP  386
             STGSR+HV+HF++NL LL IG GVE++ K TPGLSSYAN+PE AAKSL PLL +AE VVP
Sbjct  1     STGSRIHVYHFNQNLRLLHIGKGVEYYNKITPGLSSYANNPEQAAKSLIPLLEQAEDVVP  60

Query  387   TELQPDTPLELGATAGLRLLEGDASDKILQAVRDMFKNESNFKSKAEWVSILEGSQEGTY  566
              +LQP TP+ LG               ILQ+ RDM  N S F  + + VSI++G+QEG+Y
Sbjct  61    DDLQPKTPVRLG---------------ILQSGRDMLSNRSTFNVQPDAVSIIDGTQEGSY  105

Query  567   FWVAMNYLLGNLGKGYQNTIATIDLGGGSVQVSYAVSGDTFANAPTPDNGEEPYVQEKYI  746
              WV +NY  GNLGK Y  T+  IDLG GSVQ++ AVS  T  NAP   +G++PY+++  +
Sbjct  106   LWVTVNYAWGNLGKKYTETVGVIDLGVGSVQMADAVSKKTAKNAPKVADGDDPYIKKVVL  165

Query  747   LGAQYYLYVHSYLNYGQLASRAEIFKASGNSTNPCVLEGYDGYYTYNDVSYKVTAPPNGS  926
              G  Y  YV  +L++G+ ASRAEI K +  S NPC+L G +G YTY+   +K TA  +G+
Sbjct  166   KGIPYDRYVQQFLHFGREASRAEILKLTPRSPNPCLLAGLNGIYTYSGEEFKATAYTSGA  225

Query  927   SLKNCRKLARKVVDFRAPCKYQNCTFNGVWSGGGGAGMENVYISSFFYDIATDVGIIDQE  1106
             +   C+   RK +    PC YQNCTF G+W+GGGG G +N++ SS F+ +  D G++D  
Sbjct  226   NFNKCKNTIRKALKLNYPCPYQNCTFGGIWNGGGGNGQKNLFASSSFFYLPEDTGMVDAS  285

Query  1107  KASKIVKPRSFLVAAKLACETKFEDVKSTFPNAVEKDYP-YLCMDLVYEYTLLVDGLGLH  1283
               + I++P      AK AC   FED KST+P   +K+   Y+CMDL+Y+Y LLVDG GL 
Sbjct  286   TPNFILRPVDIETKAKKACALNFEDAKSTYPFLDKKNVASYVCMDLIYQYVLLVDGFGLD  345

Query  1284  PYKEITLMKKVEYKNYMVEAAWPLGCAIDVISS  1382
             P ++IT  K++EY++ +VEAAWPLG A++ IS+
Sbjct  346   PLQKITSGKEIEYQDAIVEAAWPLGNAVEAISA  378



>ref|XP_009399921.1| PREDICTED: probable apyrase 2 isoform X3 [Musa acuminata subsp. 
malaccensis]
Length=379

 Score =   367 bits (942),  Expect = 1e-118, Method: Compositional matrix adjust.
 Identities = 190/370 (51%), Positives = 258/370 (70%), Gaps = 6/370 (2%)
 Frame = +3

Query  285   FLKTTPGLSSYANDPEAAAKSLEPLLLEAEGVVPTELQPDTPLELGATAGLRLLEGDASD  464
              ++ TPGLS YA +P+ AA SL PLL +AE V+P EL+  TP+ +GATAGLR L    ++
Sbjct  11    LVQRTPGLSFYAKNPQEAANSLLPLLEKAESVIPAELRRTTPVRVGATAGLRALGAVTAE  70

Query  465   KILQAVR--DMFKNESNFKSKAEWVSILEGSQEGTYFWVAMNYLLGNLGKGYQNTIATID  638
             +ILQAVR  D+ + +S+ K +++WV++L+G+QEG + WV +NYLLG LGK Y +T+  +D
Sbjct  71    QILQAVRFLDLLRQKSSLKFQSDWVTVLDGTQEGAFQWVTINYLLGKLGKSYWDTVGVVD  130

Query  639   LGGGSVQVSYAVSGDTFANAPTPDNGEEPYVQEKYILGAQYYLYVHSYLNYGQLASRAEI  818
             LGGGSVQ++YA+S +  ANAP   N E  YVQ+ ++ G  Y+LYVHSYL+YG LA RAEI
Sbjct  131   LGGGSVQMAYAISENDAANAPKISNEEHSYVQQLFLKGTSYHLYVHSYLHYGLLAVRAEI  190

Query  819   FKAS-GNSTNPCVLEGYDGYYTYNDVSYKVTAPPNGSSLKNCRKLARKVVDFRAP-CKYQ  992
              KA+ GNS   C+L+GY+G Y Y +  YK  A P+G+S   CR    K +    P C + 
Sbjct  191   LKAADGNSK--CILDGYNGSYKYGEKEYKAVASPSGASYSKCRSDTIKALKVDEPTCTHM  248

Query  993   NCTFNGVWSGGGGAGMENVYISSFFYDIATDVGIIDQEKASKIVKPRSFLVAAKLACETK  1172
              CTF GVW+GGGG G  N++++SFF+D A + G +D +     VKP  F V AK AC+  
Sbjct  249   KCTFGGVWNGGGGDGQRNLFVASFFFDRAVEAGFVDHKVPVAKVKPAEFKVVAKHACKLN  308

Query  1173  FEDVKSTFPNAVEKDYPYLCMDLVYEYTLLVDGLGLHPYKEITLMKKVEYKNYMVEAAWP  1352
              E  K+T+P   + + PYLCMDLVY++TLLVDG GL PY+EITL+KKV+Y +  VEAAWP
Sbjct  309   VEKAKATYPRVQDNNLPYLCMDLVYQFTLLVDGFGLDPYQEITLVKKVKYGDAFVEAAWP  368

Query  1353  LGCAIDVISS  1382
             LG AI+V S+
Sbjct  369   LGSAIEVAST  378



>ref|XP_001785876.1| predicted protein [Physcomitrella patens]
 gb|EDQ49304.1| predicted protein [Physcomitrella patens]
Length=471

 Score =   369 bits (946),  Expect = 5e-118, Method: Compositional matrix adjust.
 Identities = 198/407 (49%), Positives = 264/407 (65%), Gaps = 3/407 (1%)
 Frame = +3

Query  171   ETGNYAVIFDAGSTGSRVHVFHFDENLDLLPIGDGVEFFLKTTPGLSSYANDPEAAAKSL  350
             E   YAVIFDAGS+GSRVHVF FD+NL L+ +GD  E F +   GLSSYA  P+  A SL
Sbjct  64    EQKRYAVIFDAGSSGSRVHVFSFDKNLQLVKVGDEFEVFKQLPHGLSSYALSPKEGAASL  123

Query  351   EPLLLEAEGVVPTELQPDTPLELGATAGLRLLEGDASDKILQAVRDMFKNESNFKSKAEW  530
             +PLL  A  VVP E    TP+ LGATAGLRLL GD +  +L+ V D    ES+FK K EW
Sbjct  124   QPLLDIALKVVPAEQYRTTPVLLGATAGLRLLPGDQATNLLKEV-DTLLMESSFKFKPEW  182

Query  531   VSILEGSQEGTYFWVAMNYLLGNLGKGYQNTIATIDLGGGSVQVSYAVSGDTFANAPTPD  710
             VSI++G+QEG+Y WV +NYLL  LG+ +  T+  +DLGGGSVQ++YA+S + F +AP P 
Sbjct  183   VSIIDGTQEGSYQWVTVNYLLKRLGQSFDQTVGIVDLGGGSVQMAYAISDNDFLSAPKPR  242

Query  711   NGEEPYVQEKYILGAQYYLYVHSYLNYGQLASRAEIFKASGNSTN-PCVLEGYDGYYTYN  887
             +GE+ YV+   +LG  Y LYVHSYL+YG LA+RAE+ K    S + PC+ +G++G Y Y 
Sbjct  243   SGEQAYVRRMSLLGTSYNLYVHSYLSYGLLAARAEVLKLVDESKSCPCLAKGFEGSYIYA  302

Query  888   DVSYKVTAPPNGSSLKNCRKLARKVVDFRAPCKYQNCTFNGVWSGGGGAGMENVYISSFF  1067
                YK +A  +G   K CR L    +     C    CTF G WSGGGGAGM++++++SFF
Sbjct  303   GQEYKASASADGGDYKKCRTLVVNALKVDQTCDSLKCTFGGTWSGGGGAGMKSLFVASFF  362

Query  1068  YDIATDVGII-DQEKASKIVKPRSFLVAAKLACETKFEDVKSTFPNAVEKDYPYLCMDLV  1244
             +D A + GI+ D + A  +V P  F  AAK  C    +++   +P   E    +LCMDL 
Sbjct  363   FDRALEAGIVTDPDAAEAVVMPSDFEAAAKKICVLSIDELAEEYPKLKEDTRKFLCMDLT  422

Query  1245  YEYTLLVDGLGLHPYKEITLMKKVEYKNYMVEAAWPLGCAIDVISSS  1385
             Y+Y+LLV G  + P  +ITL+KKV Y    VE AWPLG AI+++S +
Sbjct  423   YQYSLLVSGFQVQPDTKITLVKKVRYSGSFVETAWPLGSAIELVSQN  469



>ref|XP_006443348.1| hypothetical protein CICLE_v10019963mg [Citrus clementina]
 gb|ESR56588.1| hypothetical protein CICLE_v10019963mg [Citrus clementina]
Length=379

 Score =   364 bits (935),  Expect = 2e-117, Method: Compositional matrix adjust.
 Identities = 178/305 (58%), Positives = 236/305 (77%), Gaps = 0/305 (0%)
 Frame = +3

Query  174   TGNYAVIFDAGSTGSRVHVFHFDENLDLLPIGDGVEFFLKTTPGLSSYANDPEAAAKSLE  353
             + +YAVIFDAGS+GSRVHV+ FD+NLDL+PIG  +E F++T PGLS+YA+DP+AAA SL 
Sbjct  67    SKSYAVIFDAGSSGSRVHVYCFDQNLDLVPIGKDLELFVQTKPGLSAYASDPQAAANSLA  126

Query  354   PLLLEAEGVVPTELQPDTPLELGATAGLRLLEGDASDKILQAVRDMFKNESNFKSKAEWV  533
              LL +A+ VVP +L+P TP+++GATAGLR L  DASD+ILQAVRD+ K +S FKSK EWV
Sbjct  127   SLLDKAQSVVPQDLRPKTPVKVGATAGLRQLGVDASDRILQAVRDLLKYKSAFKSKPEWV  186

Query  534   SILEGSQEGTYFWVAMNYLLGNLGKGYQNTIATIDLGGGSVQVSYAVSGDTFANAPTPDN  713
             ++L+GSQEG+Y WV +NYLLGNLGK Y NT+  +DLGGGSVQ++YA+S    ANAPT   
Sbjct  187   TVLDGSQEGSYQWVTINYLLGNLGKKYSNTVGVVDLGGGSVQMAYAISEKDAANAPTVPE  246

Query  714   GEEPYVQEKYILGAQYYLYVHSYLNYGQLASRAEIFKASGNSTNPCVLEGYDGYYTYNDV  893
             GE+ YV E Y++G +YYLYVHSYL+YG LA+R EI K + +S NPC+L GYDG Y Y   
Sbjct  247   GEDQYVNEMYLMGTKYYLYVHSYLHYGLLAARTEILKVTKDSDNPCILAGYDGSYKYGGQ  306

Query  894   SYKVTAPPNGSSLKNCRKLARKVVDFRAPCKYQNCTFNGVWSGGGGAGMENVYISSFFYD  1073
              YK +A P+GS+++ C+ +A K +     C +  CTF GVW+GGGG G +N++++SFF+D
Sbjct  307   EYKASASPSGSNIEECQSVAIKALKVNDTCTHMQCTFGGVWNGGGGDGQKNMFVASFFFD  366

Query  1074  IATDV  1088
              A +V
Sbjct  367   RAAEV  371



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 4602237909976