BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c25594_g1_i1 len=2260 path=[2732:0-328 3061:329-346 8719:347-387
3120:388-484 3217:485-534 3267:535-553 8802:554-558 8807:559-577
3310:578-616 3349:617-699 3432:700-725 3458:726-783 3516:784-855
8879:856-879 3612:880-898 3631:899-1071 3804:1072-1141
3874:1142-1399 4132:1400-1521 4254:1522-1552 4285:1553-1598
4331:1599-1670 4403:1671-1671 4404:1672-1695 9033:1696-1710
4443:1711-1726 4459:1727-1732 4465:1733-1788 6163:1789-1854
4587:1855-2110 4843:2111-2259]

Length=2260
                                                                      Score     E

ref|XP_011069784.1|  PREDICTED: oligopeptide transporter 5-like        1011   0.0     
ref|XP_009600998.1|  PREDICTED: oligopeptide transporter 1-like        1010   0.0     
ref|XP_009777242.1|  PREDICTED: oligopeptide transporter 1-like        1007   0.0     
gb|KCW76554.1|  hypothetical protein EUGRSUZ_D00943                     982   0.0     
ref|XP_010096486.1|  Oligopeptide transporter 1                         982   0.0     
ref|XP_010096485.1|  Oligopeptide transporter 1                         981   0.0     
ref|XP_010052485.1|  PREDICTED: oligopeptide transporter 1-like         977   0.0     
gb|EPS60835.1|  hypothetical protein M569_13965                         970   0.0     
ref|XP_002323113.2|  hypothetical protein POPTR_0016s00650g             967   0.0     Populus trichocarpa [western balsam poplar]
ref|XP_007026393.1|  Oligopeptide transporter 5                         966   0.0     
gb|KDP35526.1|  hypothetical protein JCGZ_08964                         960   0.0     
ref|XP_011040149.1|  PREDICTED: oligopeptide transporter 1-like i...    951   0.0     
ref|XP_011040150.1|  PREDICTED: oligopeptide transporter 1-like i...    948   0.0     
ref|XP_008218454.1|  PREDICTED: oligopeptide transporter 1-like         937   0.0     
ref|XP_006474840.1|  PREDICTED: oligopeptide transporter 1-like         931   0.0     
ref|XP_006452634.1|  hypothetical protein CICLE_v10007552mg             931   0.0     
gb|KGN44392.1|  hypothetical protein Csa_7G279240                       931   0.0     
ref|XP_004151247.1|  PREDICTED: oligopeptide transporter 1-like         931   0.0     
ref|XP_008384590.1|  PREDICTED: oligopeptide transporter 1-like         930   0.0     
ref|XP_008463021.1|  PREDICTED: oligopeptide transporter 1-like i...    930   0.0     
gb|KDO59178.1|  hypothetical protein CISIN_1g0044241mg                  930   0.0     
ref|XP_008366195.1|  PREDICTED: LOW QUALITY PROTEIN: oligopeptide...    929   0.0     
ref|XP_008219410.1|  PREDICTED: oligopeptide transporter 1-like         928   0.0     
ref|XP_004160259.1|  PREDICTED: LOW QUALITY PROTEIN: oligopeptide...    927   0.0     
ref|XP_008463020.1|  PREDICTED: oligopeptide transporter 1-like i...    927   0.0     
ref|XP_006474839.1|  PREDICTED: oligopeptide transporter 1-like         925   0.0     
ref|XP_007207290.1|  hypothetical protein PRUPE_ppa014997mg             924   0.0     
ref|NP_001062118.1|  Os08g0492000                                       922   0.0     Oryza sativa Japonica Group [Japonica rice]
ref|XP_006452635.1|  hypothetical protein CICLE_v10007550mg             922   0.0     
ref|XP_006660244.1|  PREDICTED: oligopeptide transporter 5-like         921   0.0     
gb|KDO59179.1|  hypothetical protein CISIN_1g004845mg                   921   0.0     
ref|XP_006452637.1|  hypothetical protein CICLE_v10007550mg             920   0.0     
ref|XP_009334674.1|  PREDICTED: oligopeptide transporter 1-like         918   0.0     
ref|XP_006857743.1|  hypothetical protein AMTR_s00061p00190940          917   0.0     
ref|XP_009367241.1|  PREDICTED: oligopeptide transporter 1-like         917   0.0     
ref|XP_006474841.1|  PREDICTED: oligopeptide transporter 1-like         914   0.0     
ref|XP_009349149.1|  PREDICTED: oligopeptide transporter 1-like         914   0.0     
ref|XP_004973781.1|  PREDICTED: oligopeptide transporter 1-like         914   0.0     
ref|XP_004148255.1|  PREDICTED: oligopeptide transporter 5-like         910   0.0     
ref|XP_009367290.1|  PREDICTED: oligopeptide transporter 1-like         909   0.0     
ref|XP_010092336.1|  Oligopeptide transporter 1                         908   0.0     
ref|XP_009379497.1|  PREDICTED: oligopeptide transporter 1-like         906   0.0     
ref|XP_006595683.1|  PREDICTED: oligopeptide transporter 1-like         906   0.0     
ref|XP_004295186.1|  PREDICTED: LOW QUALITY PROTEIN: oligopeptide...    905   0.0     
ref|XP_008449039.1|  PREDICTED: oligopeptide transporter 5-like         905   0.0     
ref|XP_008218466.1|  PREDICTED: oligopeptide transporter 1-like         904   0.0     
ref|XP_002445962.1|  hypothetical protein SORBIDRAFT_07g028740          903   0.0     Sorghum bicolor [broomcorn]
gb|KDP39296.1|  hypothetical protein JCGZ_01053                         902   0.0     
ref|XP_010097383.1|  Oligopeptide transporter 1                         902   0.0     
ref|XP_007142437.1|  hypothetical protein PHAVU_008G280400g             900   0.0     
ref|XP_002267184.1|  PREDICTED: oligopeptide transporter 1-like         899   0.0     Vitis vinifera
ref|XP_004491523.1|  PREDICTED: oligopeptide transporter 1-like         898   0.0     
ref|XP_003625171.1|  Oligopeptide transporter OPT family                897   0.0     
ref|XP_002522788.1|  Oligopeptide transporter, putative                 897   0.0     Ricinus communis
gb|AET00810.2|  oligopeptide transporter OPT family protein             895   0.0     
gb|AES81389.2|  oligopeptide transporter OPT family protein             895   0.0     
ref|XP_003520525.1|  PREDICTED: oligopeptide transporter 5-like i...    894   0.0     
ref|XP_003519637.1|  PREDICTED: oligopeptide transporter 1-like         893   0.0     
ref|XP_003617851.1|  Oligopeptide transporter OPT family                892   0.0     
ref|XP_010644607.1|  PREDICTED: oligopeptide transporter 1-like         892   0.0     
gb|EEE68909.1|  hypothetical protein OsJ_27765                          892   0.0     Oryza sativa Japonica Group [Japonica rice]
ref|XP_010064977.1|  PREDICTED: oligopeptide transporter 1-like         889   0.0     
ref|XP_008663011.1|  PREDICTED: oligopeptide transporter 5-like         888   0.0     
ref|XP_007162246.1|  hypothetical protein PHAVU_001G136300g             887   0.0     
ref|XP_010064976.1|  PREDICTED: oligopeptide transporter 1-like         886   0.0     
ref|XP_007020440.1|  Oligopeptide transporter 5                         886   0.0     
ref|XP_003617854.1|  Oligopeptide transporter OPT family                886   0.0     
gb|AET00813.2|  oligopeptide transporter OPT family protein             885   0.0     
gb|KCW76552.1|  hypothetical protein EUGRSUZ_D00942                     884   0.0     
gb|EYU27647.1|  hypothetical protein MIMGU_mgv1a002615mg                884   0.0     
gb|KCW70462.1|  hypothetical protein EUGRSUZ_F03679                     884   0.0     
emb|CBI39770.3|  unnamed protein product                                884   0.0     
ref|XP_003617856.1|  Oligopeptide transporter OPT family                883   0.0     
ref|XP_003572326.1|  PREDICTED: oligopeptide transporter 5-like         882   0.0     
gb|AET00815.2|  oligopeptide transporter OPT family protein             881   0.0     
ref|XP_006475109.1|  PREDICTED: oligopeptide transporter 1-like         881   0.0     
gb|KDP39297.1|  hypothetical protein JCGZ_01054                         880   0.0     
ref|XP_006452632.1|  hypothetical protein CICLE_v10010604mg             879   0.0     
ref|XP_003625172.1|  Oligopeptide transporter OPT family                875   0.0     
ref|XP_006380863.1|  hypothetical protein POPTR_0006s00560g             874   0.0     
ref|XP_007020441.1|  Oligopeptide transporter 5                         872   0.0     
ref|XP_003625173.1|  Oligopeptide transporter OPT family                872   0.0     
gb|AES81391.2|  oligopeptide transporter OPT family protein             871   0.0     
ref|XP_002867556.1|  ATOPT5                                             869   0.0     
ref|NP_194389.1|  oligopeptide transporter 5                            868   0.0     Arabidopsis thaliana [mouse-ear cress]
ref|XP_002298879.1|  oligopeptide transporter OPT family protein        867   0.0     Populus trichocarpa [western balsam poplar]
ref|XP_002298878.2|  hypothetical protein POPTR_0001s37840g             864   0.0     Populus trichocarpa [western balsam poplar]
ref|XP_011038843.1|  PREDICTED: oligopeptide transporter 1 isofor...    862   0.0     
ref|XP_011038841.1|  PREDICTED: oligopeptide transporter 1 isofor...    861   0.0     
gb|EYU33718.1|  hypothetical protein MIMGU_mgv1a002007mg                861   0.0     
gb|KFK29177.1|  hypothetical protein AALP_AA7G099400                    860   0.0     
ref|XP_011097739.1|  PREDICTED: oligopeptide transporter 1-like         858   0.0     
ref|XP_009137603.1|  PREDICTED: oligopeptide transporter 5-like         857   0.0     
gb|EPS68970.1|  hypothetical protein M569_05793                         856   0.0     
ref|XP_009126974.1|  PREDICTED: oligopeptide transporter 1              850   0.0     
emb|CDY06549.1|  BnaC02g12730D                                          850   0.0     
ref|XP_009142514.1|  PREDICTED: oligopeptide transporter 5              847   0.0     
emb|CDX94308.1|  BnaC01g18760D                                          846   0.0     
ref|XP_010545870.1|  PREDICTED: oligopeptide transporter 1-like         846   0.0     
ref|XP_008366120.1|  PREDICTED: oligopeptide transporter 1-like         843   0.0     
ref|XP_010448244.1|  PREDICTED: oligopeptide transporter 5-like         845   0.0     
emb|CDX89322.1|  BnaA01g15710D                                          843   0.0     
gb|KFK27168.1|  hypothetical protein AALP_AA8G344300                    843   0.0     
ref|XP_010536754.1|  PREDICTED: oligopeptide transporter 5-like         842   0.0     
emb|CCO06497.1|  oligopeptide transporter                               841   0.0     
ref|XP_010438730.1|  PREDICTED: oligopeptide transporter 5              840   0.0     
ref|XP_006401399.1|  hypothetical protein EUTSA_v10012759mg             837   0.0     
ref|XP_010433474.1|  PREDICTED: oligopeptide transporter 5-like         836   0.0     
ref|XP_009414376.1|  PREDICTED: oligopeptide transporter 5-like         832   0.0     
ref|NP_200404.1|  oligopeptide transporter 1                            831   0.0     Arabidopsis thaliana [mouse-ear cress]
ref|XP_003571640.1|  PREDICTED: oligopeptide transporter 1-like         830   0.0     
ref|XP_009414381.1|  PREDICTED: oligopeptide transporter 5-like         827   0.0     
ref|XP_009414393.1|  PREDICTED: oligopeptide transporter 5-like         827   0.0     
ref|XP_010483061.1|  PREDICTED: oligopeptide transporter 1              827   0.0     
ref|XP_006279740.1|  hypothetical protein CARUB_v10027572mg             827   0.0     
ref|XP_009414367.1|  PREDICTED: oligopeptide transporter 5-like         828   0.0     
ref|XP_010450442.1|  PREDICTED: oligopeptide transporter 1-like         826   0.0     
ref|XP_002864417.1|  ATOPT1                                             826   0.0     
ref|XP_010443233.1|  PREDICTED: oligopeptide transporter 1-like         825   0.0     
gb|AFW63888.1|  hypothetical protein ZEAMMB73_458110                    820   0.0     
ref|XP_002454835.1|  hypothetical protein SORBIDRAFT_04g038240          820   0.0     Sorghum bicolor [broomcorn]
dbj|BAK04842.1|  predicted protein                                      819   0.0     
gb|KDP39295.1|  hypothetical protein JCGZ_01052                         811   0.0     
ref|XP_006660037.1|  PREDICTED: LOW QUALITY PROTEIN: oligopeptide...    811   0.0     
gb|EEE68464.1|  hypothetical protein OsJ_26860                          809   0.0     Oryza sativa Japonica Group [Japonica rice]
gb|EYU33719.1|  hypothetical protein MIMGU_mgv1a024635mg                809   0.0     
ref|NP_001175518.1|  Os08g0320200                                       808   0.0     
ref|XP_010536755.1|  PREDICTED: oligopeptide transporter 1-like         808   0.0     
ref|XP_004974596.1|  PREDICTED: oligopeptide transporter 1-like         807   0.0     
emb|CDP13696.1|  unnamed protein product                                805   0.0     
ref|XP_006576835.1|  PREDICTED: oligopeptide transporter 5-like i...    796   0.0     
ref|XP_003636647.1|  Oligopeptide transporter OPT family                787   0.0     
emb|CBI39769.3|  unnamed protein product                                787   0.0     
emb|CDX92812.1|  BnaC07g40700D                                          785   0.0     
emb|CAN79818.1|  hypothetical protein VITISV_040328                     783   0.0     Vitis vinifera
gb|KCW76549.1|  hypothetical protein EUGRSUZ_D00938                     778   0.0     
ref|XP_008344715.1|  PREDICTED: oligopeptide transporter 1-like         774   0.0     
ref|XP_007162247.1|  hypothetical protein PHAVU_001G136300g             772   0.0     
tpg|DAA47797.1|  TPA: hypothetical protein ZEAMMB73_939928              771   0.0     
dbj|BAK04511.1|  predicted protein                                      761   0.0     
ref|XP_011038844.1|  PREDICTED: oligopeptide transporter 1 isofor...    759   0.0     
emb|CDY42726.1|  BnaA03g48130D                                          750   0.0     
ref|XP_010267482.1|  PREDICTED: oligopeptide transporter 7-like         752   0.0     
ref|XP_004245468.1|  PREDICTED: oligopeptide transporter 7-like         745   0.0     
ref|XP_009765351.1|  PREDICTED: oligopeptide transporter 7-like         744   0.0     
gb|KDP46770.1|  hypothetical protein JCGZ_06558                         741   0.0     
ref|XP_007208018.1|  hypothetical protein PRUPE_ppa003195mg             735   0.0     
ref|XP_009608843.1|  PREDICTED: oligopeptide transporter 7-like         741   0.0     
ref|XP_010246854.1|  PREDICTED: oligopeptide transporter 7-like         740   0.0     
ref|XP_006851884.1|  hypothetical protein AMTR_s00041p00121000          739   0.0     
ref|XP_010436760.1|  PREDICTED: oligopeptide transporter 7-like         738   0.0     
ref|XP_004964383.1|  PREDICTED: oligopeptide transporter 7-like i...    736   0.0     
ref|XP_006343795.1|  PREDICTED: oligopeptide transporter 7-like         735   0.0     
gb|EEC79904.1|  hypothetical protein OsI_21444                          735   0.0     Oryza sativa Indica Group [Indian rice]
ref|XP_003519862.1|  PREDICTED: oligopeptide transporter 7-like         734   0.0     
ref|XP_008806363.1|  PREDICTED: oligopeptide transporter 7-like         734   0.0     
ref|XP_010676881.1|  PREDICTED: oligopeptide transporter 7              734   0.0     
ref|XP_010252553.1|  PREDICTED: oligopeptide transporter 7-like         733   0.0     
ref|XP_008239237.1|  PREDICTED: oligopeptide transporter 7              734   0.0     
ref|XP_008239235.1|  PREDICTED: oligopeptide transporter 7-like         733   0.0     
ref|XP_010422002.1|  PREDICTED: oligopeptide transporter 7              734   0.0     
ref|XP_010934151.1|  PREDICTED: oligopeptide transporter 7-like         732   0.0     
ref|XP_009407958.1|  PREDICTED: oligopeptide transporter 7-like         732   0.0     
ref|XP_006397011.1|  hypothetical protein EUTSA_v10028453mg             732   0.0     
ref|XP_007039426.1|  Oligopeptide transporter 7 isoform 1               732   0.0     
ref|XP_006289826.1|  hypothetical protein CARUB_v10003431mg             732   0.0     
ref|XP_009359568.1|  PREDICTED: LOW QUALITY PROTEIN: oligopeptide...    731   0.0     
ref|XP_011022429.1|  PREDICTED: oligopeptide transporter 7-like         731   0.0     
ref|XP_002437735.1|  hypothetical protein SORBIDRAFT_10g001530          732   0.0     Sorghum bicolor [broomcorn]
ref|XP_006380596.1|  hypothetical protein POPTR_0007s09650g             731   0.0     
ref|XP_008390299.1|  PREDICTED: oligopeptide transporter 7 isofor...    731   0.0     
ref|XP_008806360.1|  PREDICTED: oligopeptide transporter 7-like         731   0.0     
ref|XP_007046673.1|  Oligopeptide transporter 7 isoform 1               730   0.0     
ref|XP_003555686.1|  PREDICTED: oligopeptide transporter 7              730   0.0     
ref|XP_008790539.1|  PREDICTED: oligopeptide transporter 7-like         731   0.0     
ref|XP_009412736.1|  PREDICTED: oligopeptide transporter 7-like         730   0.0     
gb|KFK31865.1|  hypothetical protein AALP_AA6G168500                    729   0.0     
ref|XP_010934487.1|  PREDICTED: oligopeptide transporter 7              729   0.0     
ref|XP_004502063.1|  PREDICTED: oligopeptide transporter 7-like         729   0.0     
emb|CDY11969.1|  BnaC03g13950D                                          728   0.0     
gb|KDP35527.1|  hypothetical protein JCGZ_08965                         722   0.0     
ref|XP_010455470.1|  PREDICTED: oligopeptide transporter 7-like         729   0.0     
ref|XP_010053083.1|  PREDICTED: oligopeptide transporter 7              729   0.0     
emb|CDX86844.1|  BnaA09g22340D                                          729   0.0     
dbj|BAD67732.1|  putative sexual differentiation process protein ...    729   0.0     Oryza sativa Japonica Group [Japonica rice]
ref|XP_007156167.1|  hypothetical protein PHAVU_003G263800g             728   0.0     
ref|XP_002272972.2|  PREDICTED: oligopeptide transporter 7              728   0.0     Vitis vinifera
ref|XP_002529653.1|  Oligopeptide transporter, putative                 728   0.0     Ricinus communis
ref|XP_009108224.1|  PREDICTED: oligopeptide transporter 7              728   0.0     
ref|XP_010676880.1|  PREDICTED: oligopeptide transporter 7-like         728   0.0     
ref|XP_007210345.1|  hypothetical protein PRUPE_ppa001827mg             728   0.0     
ref|XP_010538850.1|  PREDICTED: oligopeptide transporter 7              728   0.0     
ref|XP_002303684.2|  hypothetical protein POPTR_0003s14540g             729   0.0     Populus trichocarpa [western balsam poplar]
ref|XP_011008821.1|  PREDICTED: oligopeptide transporter 7-like         727   0.0     
ref|XP_010040072.1|  PREDICTED: oligopeptide transporter 7-like         727   0.0     
ref|NP_001130398.1|  uncharacterized protein LOC100191494               728   0.0     Zea mays [maize]
ref|XP_002971950.1|  hypothetical protein SELMODRAFT_148240             725   0.0     
gb|KCW76553.1|  hypothetical protein EUGRSUZ_D00943                     718   0.0     
ref|XP_009358688.1|  PREDICTED: LOW QUALITY PROTEIN: oligopeptide...    726   0.0     
ref|XP_007156168.1|  hypothetical protein PHAVU_003G263900g             725   0.0     
gb|KHG17687.1|  Oligopeptide transporter 7                              725   0.0     
ref|XP_003564333.1|  PREDICTED: oligopeptide transporter 7-like         726   0.0     
gb|KHG17686.1|  Oligopeptide transporter 7                              726   0.0     
ref|XP_004309550.1|  PREDICTED: oligopeptide transporter 7-like         724   0.0     
ref|XP_008394097.1|  PREDICTED: oligopeptide transporter 7-like         724   0.0     
ref|XP_010649021.1|  PREDICTED: oligopeptide transporter 7-like         724   0.0     
ref|XP_002874647.1|  ATOPT7                                             725   0.0     
ref|XP_008241834.1|  PREDICTED: oligopeptide transporter 7-like         724   0.0     
gb|AES71704.2|  oligopeptide transporter OPT family protein             724   0.0     
ref|XP_003601453.1|  Oligopeptide transporter                           724   0.0     
ref|XP_010267481.1|  PREDICTED: oligopeptide transporter 7-like         723   0.0     
ref|XP_006425445.1|  hypothetical protein CICLE_v10024968mg             723   0.0     
ref|XP_002991411.1|  hypothetical protein SELMODRAFT_269808             721   0.0     
ref|XP_009379386.1|  PREDICTED: oligopeptide transporter 7-like         721   0.0     
ref|XP_009391956.1|  PREDICTED: oligopeptide transporter 7-like         722   0.0     
emb|CBI39772.3|  unnamed protein product                                717   0.0     
ref|NP_001056665.1|  Os06g0127700                                       722   0.0     Oryza sativa Japonica Group [Japonica rice]
ref|XP_010228050.1|  PREDICTED: oligopeptide transporter 7-like i...    720   0.0     
ref|XP_004964382.1|  PREDICTED: oligopeptide transporter 7-like i...    723   0.0     
ref|XP_003557106.2|  PREDICTED: oligopeptide transporter 7-like i...    721   0.0     
ref|XP_007204095.1|  hypothetical protein PRUPE_ppa002122mg             719   0.0     
gb|KDP25233.1|  hypothetical protein JCGZ_20389                         721   0.0     
ref|XP_006655730.1|  PREDICTED: oligopeptide transporter 7-like         720   0.0     
ref|XP_004511249.1|  PREDICTED: oligopeptide transporter 7-like         718   0.0     
ref|XP_009591882.1|  PREDICTED: oligopeptide transporter 7-like         718   0.0     
ref|XP_010553673.1|  PREDICTED: oligopeptide transporter 2              717   0.0     
gb|KHG27803.1|  Oligopeptide transporter 7 -like protein                717   0.0     
ref|XP_002967597.1|  hypothetical protein SELMODRAFT_88962              718   0.0     
gb|KGN48927.1|  hypothetical protein Csa_6G506530                       717   0.0     
ref|XP_007145948.1|  hypothetical protein PHAVU_006G000100g             717   0.0     
emb|CDP01884.1|  unnamed protein product                                717   0.0     
emb|CDP12213.1|  unnamed protein product                                717   0.0     
ref|XP_008440830.1|  PREDICTED: oligopeptide transporter 7-like         717   0.0     
ref|XP_002981747.1|  hypothetical protein SELMODRAFT_179057             717   0.0     
ref|XP_011078837.1|  PREDICTED: oligopeptide transporter 7-like i...    716   0.0     
ref|XP_004135024.1|  PREDICTED: oligopeptide transporter 7-like         720   0.0     
ref|XP_007156166.1|  hypothetical protein PHAVU_003G263700g             716   0.0     
ref|XP_011078828.1|  PREDICTED: oligopeptide transporter 7-like i...    716   0.0     
ref|XP_006655737.1|  PREDICTED: oligopeptide transporter 7-like         716   0.0     
ref|XP_009795933.1|  PREDICTED: oligopeptide transporter 7-like i...    716   0.0     
ref|XP_004169608.1|  PREDICTED: oligopeptide transporter 7-like         718   0.0     
ref|XP_002993852.1|  hypothetical protein SELMODRAFT_137672             714   0.0     
ref|XP_010034698.1|  PREDICTED: oligopeptide transporter 7-like         714   0.0     
gb|EPS60258.1|  hypothetical protein M569_14546                         713   0.0     
ref|XP_006856596.1|  hypothetical protein AMTR_s00046p00213370          713   0.0     
ref|XP_004287803.1|  PREDICTED: oligopeptide transporter 7-like         713   0.0     
ref|XP_004143945.1|  PREDICTED: oligopeptide transporter 7-like         713   0.0     
ref|NP_192815.1|  oligopeptide transporter 7                            713   0.0     Arabidopsis thaliana [mouse-ear cress]
ref|XP_003628537.1|  Oligopeptide transporter                           712   0.0     
ref|NP_001056651.1|  Os06g0125500                                       713   0.0     Oryza sativa Japonica Group [Japonica rice]
ref|XP_004502694.1|  PREDICTED: oligopeptide transporter 6-like         711   0.0     
gb|EMS45172.1|  Oligopeptide transporter 7                              718   0.0     
ref|XP_006343361.1|  PREDICTED: oligopeptide transporter 7-like         712   0.0     
ref|XP_004163578.1|  PREDICTED: oligopeptide transporter 7-like         714   0.0     
ref|XP_011070370.1|  PREDICTED: oligopeptide transporter 7              711   0.0     
ref|XP_008437437.1|  PREDICTED: LOW QUALITY PROTEIN: oligopeptide...    709   0.0     
ref|XP_010317692.1|  PREDICTED: oligopeptide transporter 7-like         709   0.0     
ref|XP_006851891.1|  hypothetical protein AMTR_s00041p00133990          711   0.0     
ref|XP_006364982.1|  PREDICTED: oligopeptide transporter 4-like         709   0.0     
dbj|BAJ85948.1|  predicted protein                                      708   0.0     
ref|XP_009128701.1|  PREDICTED: LOW QUALITY PROTEIN: oligopeptide...    708   0.0     
ref|XP_010475851.1|  PREDICTED: oligopeptide transporter 2-like         707   0.0     
gb|KDP41518.1|  hypothetical protein JCGZ_15925                         706   0.0     
gb|EPS62495.1|  hypothetical protein M569_12295                         706   0.0     
ref|XP_002963418.1|  hypothetical protein SELMODRAFT_166204             707   0.0     
ref|XP_006417516.1|  hypothetical protein EUTSA_v10009349mg             705   0.0     
ref|XP_009366376.1|  PREDICTED: oligopeptide transporter 2-like         704   0.0     
ref|XP_002518892.1|  Oligopeptide transporter, putative                 704   0.0     Ricinus communis
ref|XP_006304646.1|  hypothetical protein CARUB_v10011782mg             703   0.0     
ref|XP_003581597.1|  PREDICTED: oligopeptide transporter 4-like         702   0.0     
ref|XP_010048814.1|  PREDICTED: oligopeptide transporter 6              702   0.0     
ref|XP_010109222.1|  Oligopeptide transporter 6                         702   0.0     
ref|XP_009773684.1|  PREDICTED: oligopeptide transporter 7-like i...    702   0.0     
ref|XP_006340746.1|  PREDICTED: oligopeptide transporter 7-like         701   0.0     
ref|XP_006472993.1|  PREDICTED: oligopeptide transporter 2-like         702   0.0     
ref|XP_006433764.1|  hypothetical protein CICLE_v10003491mg             701   0.0     
ref|XP_001767301.1|  predicted protein                                  699   0.0     
ref|XP_002977317.1|  hypothetical protein SELMODRAFT_232939             700   0.0     
ref|XP_006476310.1|  PREDICTED: oligopeptide transporter 7-like i...    701   0.0     
gb|EMT07894.1|  Oligopeptide transporter 7                              701   0.0     
ref|XP_006452633.1|  hypothetical protein CICLE_v10007763mg             696   0.0     
ref|XP_002971556.1|  hypothetical protein SELMODRAFT_172313             701   0.0     
ref|XP_010501399.1|  PREDICTED: oligopeptide transporter 2              699   0.0     
ref|XP_006476309.1|  PREDICTED: oligopeptide transporter 7-like i...    700   0.0     
ref|XP_011075935.1|  PREDICTED: oligopeptide transporter 6              699   0.0     
gb|EYU19483.1|  hypothetical protein MIMGU_mgv1a023929mg                697   0.0     
ref|XP_002892535.1|  ATOPT2                                             698   0.0     
gb|EYU30413.1|  hypothetical protein MIMGU_mgv1a002159mg                697   0.0     
ref|XP_002283691.1|  PREDICTED: oligopeptide transporter 2              699   0.0     
ref|XP_007136469.1|  hypothetical protein PHAVU_009G047800g             698   0.0     
ref|XP_008445079.1|  PREDICTED: oligopeptide transporter 6-like         698   0.0     
ref|NP_172464.1|  oligopeptide transporter 2                            698   0.0     
gb|KCW77331.1|  hypothetical protein EUGRSUZ_D01692                     696   0.0     
ref|XP_002967106.1|  hypothetical protein SELMODRAFT_87413              697   0.0     
ref|XP_010254620.1|  PREDICTED: oligopeptide transporter 4-like         697   0.0     
gb|KHG09371.1|  Oligopeptide transporter 4 -like protein                697   0.0     
ref|XP_006439250.1|  hypothetical protein CICLE_v10018971mg             697   0.0     
ref|XP_006376657.1|  hypothetical protein POPTR_0012s02650g             696   0.0     
gb|ABE65610.1|  oligopeptide transporter OPT family protein             696   0.0     
ref|XP_002960906.1|  hypothetical protein SELMODRAFT_229868             696   0.0     
ref|XP_004160803.1|  PREDICTED: oligopeptide transporter 6-like         696   0.0     
ref|XP_006439249.1|  hypothetical protein CICLE_v10018971mg             697   0.0     
ref|XP_008222894.1|  PREDICTED: oligopeptide transporter 1-like         689   0.0     
ref|XP_008648099.1|  PREDICTED: uncharacterized protein LOC100383...    696   0.0     
ref|XP_004238028.1|  PREDICTED: oligopeptide transporter 4-like         696   0.0     
ref|XP_010458316.1|  PREDICTED: oligopeptide transporter 2-like         695   0.0     
ref|XP_002317799.2|  hypothetical protein POPTR_0012s02660g             694   0.0     
ref|XP_006444102.1|  hypothetical protein CICLE_v10024169mg             694   0.0     
emb|CBI19303.3|  unnamed protein product                                698   0.0     
ref|XP_004138881.1|  PREDICTED: oligopeptide transporter 6-like         694   0.0     
emb|CBI34570.3|  unnamed protein product                                691   0.0     
ref|XP_011043664.1|  PREDICTED: oligopeptide transporter 9-like         693   0.0     
ref|XP_008338986.1|  PREDICTED: oligopeptide transporter 2-like         693   0.0     
emb|CDY25261.1|  BnaA02g21950D                                          692   0.0     
ref|XP_009801973.1|  PREDICTED: oligopeptide transporter 6-like         692   0.0     
ref|XP_011016978.1|  PREDICTED: oligopeptide transporter 2              692   0.0     
ref|XP_009118291.1|  PREDICTED: oligopeptide transporter 2              691   0.0     
gb|EYU21027.1|  hypothetical protein MIMGU_mgv1a026700mg                691   0.0     
emb|CDY69955.1|  BnaCnng66090D                                          691   0.0     
ref|XP_008219191.1|  PREDICTED: oligopeptide transporter 2-like         691   0.0     
ref|XP_009790410.1|  PREDICTED: oligopeptide transporter 4              691   0.0     
gb|KHG27446.1|  Oligopeptide transporter 4 -like protein                691   0.0     
ref|XP_007225210.1|  hypothetical protein PRUPE_ppa002011mg             691   0.0     
ref|XP_009615073.1|  PREDICTED: oligopeptide transporter 4-like         691   0.0     
ref|XP_003527991.1|  PREDICTED: oligopeptide transporter 9-like         691   0.0     
ref|XP_002518328.1|  Oligopeptide transporter, putative                 691   0.0     
ref|XP_004147543.1|  PREDICTED: oligopeptide transporter 4-like         691   0.0     
ref|XP_008445076.1|  PREDICTED: oligopeptide transporter 6-like         690   0.0     
ref|XP_002313213.2|  hypothetical protein POPTR_0009s08290g             691   0.0     
ref|XP_004136415.1|  PREDICTED: oligopeptide transporter 2-like         690   0.0     
ref|XP_002301110.1|  oligopeptide transporter OPT family protein        689   0.0     
ref|XP_007220230.1|  hypothetical protein PRUPE_ppa002014mg             689   0.0     
ref|XP_007018306.1|  Oligopeptide transporter 4                         690   0.0     
ref|XP_010065749.1|  PREDICTED: oligopeptide transporter 4-like         689   0.0     
ref|XP_011003045.1|  PREDICTED: oligopeptide transporter 4              689   0.0     
ref|XP_011078507.1|  PREDICTED: oligopeptide transporter 4-like         689   0.0     
ref|XP_002436389.1|  hypothetical protein SORBIDRAFT_10g001670          689   0.0     
ref|XP_010933427.1|  PREDICTED: oligopeptide transporter 4-like         689   0.0     
ref|XP_006422648.1|  hypothetical protein CICLE_v10027887mg             688   0.0     
ref|XP_008366119.1|  PREDICTED: oligopeptide transporter 1-like         679   0.0     
ref|XP_010482752.1|  PREDICTED: oligopeptide transporter 9              687   0.0     
gb|KCW63396.1|  hypothetical protein EUGRSUZ_G01042                     687   0.0     
ref|XP_009773685.1|  PREDICTED: oligopeptide transporter 7-like i...    687   0.0     
gb|KFK26970.1|  hypothetical protein AALP_AA8G317000                    687   0.0     
ref|XP_010104574.1|  Oligopeptide transporter 4                         687   0.0     
ref|XP_008234693.1|  PREDICTED: oligopeptide transporter 6-like         686   0.0     
ref|XP_010029956.1|  PREDICTED: oligopeptide transporter 4-like         687   0.0     
ref|XP_011043662.1|  PREDICTED: oligopeptide transporter 9-like         686   0.0     
gb|KCW56911.1|  hypothetical protein EUGRSUZ_I02587                     686   0.0     
ref|XP_006486776.1|  PREDICTED: oligopeptide transporter 4-like         686   0.0     
ref|XP_009601745.1|  PREDICTED: oligopeptide transporter 7-like         686   0.0     
gb|KDO59180.1|  hypothetical protein CISIN_1g004845mg                   679   0.0     
ref|XP_010691453.1|  PREDICTED: oligopeptide transporter 4              686   0.0     
ref|XP_002263530.1|  PREDICTED: oligopeptide transporter 4              686   0.0     
ref|XP_002527347.1|  Oligopeptide transporter, putative                 686   0.0     
ref|XP_009612437.1|  PREDICTED: oligopeptide transporter 4              686   0.0     
gb|KCW56912.1|  hypothetical protein EUGRSUZ_I02589                     687   0.0     
ref|XP_009361323.1|  PREDICTED: oligopeptide transporter 6-like         685   0.0     
ref|XP_008800083.1|  PREDICTED: oligopeptide transporter 4-like         686   0.0     
emb|CDY22616.1|  BnaC08g42500D                                          691   0.0     
ref|XP_003522539.1|  PREDICTED: oligopeptide transporter 9-like         685   0.0     
ref|XP_004288878.1|  PREDICTED: oligopeptide transporter 2-like         686   0.0     
ref|XP_010030911.1|  PREDICTED: oligopeptide transporter 4-like         685   0.0     
ref|XP_008466130.1|  PREDICTED: oligopeptide transporter 2              685   0.0     
ref|XP_009119900.1|  PREDICTED: oligopeptide transporter 9              684   0.0     
ref|XP_004160804.1|  PREDICTED: oligopeptide transporter 6-like         684   0.0     
ref|XP_002306519.1|  hypothetical protein POPTR_0005s19410g             684   0.0     
ref|XP_008376782.1|  PREDICTED: oligopeptide transporter 6              684   0.0     
ref|XP_002864247.1|  ATOPT9                                             683   0.0     
ref|XP_006452636.1|  hypothetical protein CICLE_v10007550mg             677   0.0     
ref|XP_004138770.1|  PREDICTED: oligopeptide transporter 6-like         688   0.0     
ref|XP_008454451.1|  PREDICTED: oligopeptide transporter 4              682   0.0     
gb|KGN53886.1|  hypothetical protein Csa_4G179700                       682   0.0     
ref|XP_007042780.1|  Oligopeptide transporter 4                         689   0.0     
ref|XP_010065750.1|  PREDICTED: oligopeptide transporter 4-like         682   0.0     
emb|CDY28832.1|  BnaA02g10240D                                          682   0.0     
ref|XP_010064243.1|  PREDICTED: oligopeptide transporter 4-like         682   0.0     
ref|XP_009127158.1|  PREDICTED: oligopeptide transporter 8              682   0.0     
ref|XP_010064240.1|  PREDICTED: oligopeptide transporter 4-like         682   0.0     
ref|XP_002275134.2|  PREDICTED: oligopeptide transporter 6-like         681   0.0     
ref|XP_002447030.1|  hypothetical protein SORBIDRAFT_06g027230          681   0.0     
ref|XP_006351838.1|  PREDICTED: oligopeptide transporter 4-like         681   0.0     
ref|XP_003570148.1|  PREDICTED: oligopeptide transporter 4-like         681   0.0     
ref|XP_003593303.1|  Oligopeptide transporter                           680   0.0     
dbj|BAJ90957.1|  predicted protein                                      680   0.0     
gb|EMT01286.1|  Oligopeptide transporter 4                              679   0.0     
ref|XP_010484229.1|  PREDICTED: oligopeptide transporter 4              679   0.0     
emb|CDY35662.1|  BnaC09g29840D                                          680   0.0     
ref|XP_006441174.1|  hypothetical protein CICLE_v10019012mg             679   0.0     
ref|XP_004231372.1|  PREDICTED: oligopeptide transporter 4              679   0.0     
ref|XP_007018304.1|  Oligopeptide transporter 2                         679   0.0     
ref|XP_006401695.1|  hypothetical protein EUTSA_v10016096mg             679   0.0     
ref|XP_004972025.1|  PREDICTED: oligopeptide transporter 4-like         680   0.0     
ref|XP_010029951.1|  PREDICTED: oligopeptide transporter 4-like         679   0.0     
ref|XP_008237085.1|  PREDICTED: oligopeptide transporter 4-like         679   0.0     
emb|CDP00949.1|  unnamed protein product                                679   0.0     
gb|EMS68344.1|  Oligopeptide transporter 4                              677   0.0     
gb|KCW66677.1|  hypothetical protein EUGRSUZ_F00450                     678   0.0     
emb|CDY47076.1|  BnaA03g12220D                                          677   0.0     
ref|XP_008803571.1|  PREDICTED: oligopeptide transporter 4-like i...    678   0.0     
ref|XP_011015796.1|  PREDICTED: oligopeptide transporter 4-like         678   0.0     
ref|XP_010461766.1|  PREDICTED: oligopeptide transporter 4-like         677   0.0     
ref|XP_006394156.1|  hypothetical protein EUTSA_v10003716mg             677   0.0     
emb|CDY38751.1|  BnaC03g14980D                                          677   0.0     
ref|XP_006491962.1|  PREDICTED: oligopeptide transporter 9-like         677   0.0     
emb|CDX96230.1|  BnaC02g14210D                                          677   0.0     
ref|XP_010520694.1|  PREDICTED: oligopeptide transporter 4              677   0.0     
ref|XP_010444374.1|  PREDICTED: oligopeptide transporter 4-like         676   0.0     
ref|XP_011087976.1|  PREDICTED: oligopeptide transporter 4              676   0.0     
ref|XP_010113336.1|  Oligopeptide transporter 7                         687   0.0     
ref|XP_006280078.1|  hypothetical protein CARUB_v10025959mg             676   0.0     
ref|XP_009413226.1|  PREDICTED: oligopeptide transporter 4-like         676   0.0     
ref|XP_009130453.1|  PREDICTED: oligopeptide transporter 4              675   0.0     
ref|XP_007137663.1|  hypothetical protein PHAVU_009G145300g             675   0.0     
ref|XP_009143920.1|  PREDICTED: oligopeptide transporter 6              675   0.0     
ref|XP_010671377.1|  PREDICTED: oligopeptide transporter 6              675   0.0     
ref|XP_010030910.1|  PREDICTED: oligopeptide transporter 4-like         675   0.0     
ref|XP_009366375.1|  PREDICTED: oligopeptide transporter 2-like         675   0.0     
ref|XP_006449924.1|  hypothetical protein CICLE_v10014396mg             674   0.0     
gb|EAY75055.1|  hypothetical protein OsI_02950                          675   0.0     
ref|NP_200163.1|  oligopeptide transporter 9                            674   0.0     
ref|XP_008378664.1|  PREDICTED: oligopeptide transporter 2-like         674   0.0     
ref|XP_004953568.1|  PREDICTED: oligopeptide transporter 4-like i...    674   0.0     
gb|AAM64614.1|  Isp4-like protein                                       673   0.0     
emb|CDY46800.1|  BnaC02g43080D                                          673   0.0     
emb|CDY31321.1|  BnaA02g34200D                                          673   0.0     
ref|XP_002866614.1|  hypothetical protein ARALYDRAFT_496649             672   0.0     
ref|XP_010445886.1|  PREDICTED: oligopeptide transporter 8              673   0.0     
ref|NP_201246.1|  oligopeptide transporter 4                            672   0.0     
emb|CDP19590.1|  unnamed protein product                                673   0.0     
ref|XP_004235114.1|  PREDICTED: oligopeptide transporter 6              672   0.0     
ref|XP_010537060.1|  PREDICTED: oligopeptide transporter 6-like         672   0.0     
ref|XP_009775420.1|  PREDICTED: oligopeptide transporter 2-like         672   0.0     
ref|NP_194503.1|  oligopeptide transporter                              672   0.0     
ref|XP_007200086.1|  hypothetical protein PRUPE_ppa021086mg             672   0.0     
gb|KDO78542.1|  hypothetical protein CISIN_1g004659mg                   672   0.0     
ref|XP_009132467.1|  PREDICTED: oligopeptide transporter 8-like         672   0.0     
ref|XP_006467278.1|  PREDICTED: oligopeptide transporter 3-like         671   0.0     
ref|XP_002867483.1|  ATOPT6                                             671   0.0     
ref|XP_006472404.1|  PREDICTED: oligopeptide transporter 4-like         672   0.0     
emb|CDY19030.1|  BnaC01g20380D                                          671   0.0     
dbj|BAB89477.1|  isp4 protein-like                                      671   0.0     
ref|XP_010442919.1|  PREDICTED: oligopeptide transporter 8-like         670   0.0     
ref|XP_006652734.1|  PREDICTED: oligopeptide transporter 4-like         670   0.0     
ref|XP_009615074.1|  PREDICTED: oligopeptide transporter 4-like         670   0.0     
ref|XP_006433763.1|  hypothetical protein CICLE_v10003230mg             669   0.0     
emb|CAN81605.1|  hypothetical protein VITISV_025060                     669   0.0     
ref|XP_002515831.1|  Oligopeptide transporter, putative                 669   0.0     
ref|XP_004953566.1|  PREDICTED: oligopeptide transporter 4-like         670   0.0     
ref|XP_006350626.1|  PREDICTED: oligopeptide transporter 7-like         669   0.0     
ref|NP_200164.1|  oligopeptide transporter 8                            668   0.0     
ref|XP_004976663.1|  PREDICTED: oligopeptide transporter 4-like         668   0.0     
ref|XP_003608353.1|  Oligopeptide transporter                           668   0.0     
ref|XP_002864248.1|  predicted protein                                  668   0.0     
ref|XP_010112260.1|  Oligopeptide transporter 4                         668   0.0     
ref|XP_007159179.1|  hypothetical protein PHAVU_002G215700g             667   0.0     
ref|XP_002452706.1|  hypothetical protein SORBIDRAFT_04g031070          668   0.0     
ref|XP_011002414.1|  PREDICTED: oligopeptide transporter 1-like         665   0.0     
ref|XP_007039132.1|  Oligopeptide transporter 1 isoform 1               666   0.0     
gb|KDP42149.1|  hypothetical protein JCGZ_03016                         667   0.0     
ref|XP_006281882.1|  hypothetical protein CARUB_v10028080mg             666   0.0     
ref|XP_006401694.1|  hypothetical protein EUTSA_v10015543mg             665   0.0     
ref|XP_008663549.1|  PREDICTED: oligopeptide transporter 4-like         665   0.0     
ref|XP_009398499.1|  PREDICTED: oligopeptide transporter 4-like         665   0.0     
ref|XP_007224505.1|  hypothetical protein PRUPE_ppa022679mg             665   0.0     
ref|XP_002283680.1|  PREDICTED: oligopeptide transporter 4              665   0.0     
ref|XP_010244695.1|  PREDICTED: oligopeptide transporter 4-like         665   0.0     
ref|XP_006364985.1|  PREDICTED: oligopeptide transporter 2-like i...    664   0.0     
ref|XP_010270227.1|  PREDICTED: oligopeptide transporter 3              665   0.0     
ref|XP_006281558.1|  hypothetical protein CARUB_v10027665mg             664   0.0     
ref|XP_011074283.1|  PREDICTED: oligopeptide transporter 4-like         665   0.0     
ref|XP_003522744.1|  PREDICTED: LOW QUALITY PROTEIN: oligopeptide...    664   0.0     
ref|XP_009368318.1|  PREDICTED: oligopeptide transporter 4              664   0.0     
ref|XP_003545740.1|  PREDICTED: oligopeptide transporter 4              663   0.0     
ref|XP_010520948.1|  PREDICTED: oligopeptide transporter 6              663   0.0     
ref|XP_011095913.1|  PREDICTED: oligopeptide transporter 3              663   0.0     
ref|XP_009404107.1|  PREDICTED: oligopeptide transporter 3-like         663   0.0     
ref|XP_009780017.1|  PREDICTED: oligopeptide transporter 4-like         662   0.0     
gb|KFK28135.1|  hypothetical protein AALP_AA8G476800                    671   0.0     
ref|XP_011040169.1|  PREDICTED: oligopeptide transporter 3              662   0.0     
gb|KFK29294.1|  hypothetical protein AALP_AA7G114600                    662   0.0     
emb|CBI18634.3|  unnamed protein product                                662   0.0     
gb|KHG20373.1|  Oligopeptide transporter 3 -like protein                662   0.0     
ref|XP_009380132.1|  PREDICTED: oligopeptide transporter 3-like         661   0.0     
ref|XP_002273768.2|  PREDICTED: oligopeptide transporter 3              661   0.0     
ref|XP_002308764.1|  OLIGOPEPTIDE TRANSPORTER family protein            661   0.0     
ref|XP_004289821.1|  PREDICTED: oligopeptide transporter 4-like         660   0.0     
ref|XP_011002374.1|  PREDICTED: oligopeptide transporter 3-like         661   0.0     
gb|EMS65129.1|  Oligopeptide transporter 7                              663   0.0     
dbj|BAJ87692.1|  predicted protein                                      660   0.0     
ref|XP_004164894.1|  PREDICTED: oligopeptide transporter 4-like         660   0.0     
ref|XP_006364984.1|  PREDICTED: oligopeptide transporter 2-like i...    660   0.0     
ref|XP_004136414.1|  PREDICTED: oligopeptide transporter 4-like         660   0.0     
ref|XP_010438561.1|  PREDICTED: oligopeptide transporter 6              659   0.0     
ref|XP_003547106.1|  PREDICTED: oligopeptide transporter 4-like         659   0.0     
ref|XP_006285678.1|  hypothetical protein CARUB_v10007142mg             659   0.0     
emb|CBI19304.3|  unnamed protein product                                660   0.0     
ref|XP_003528403.1|  PREDICTED: oligopeptide transporter 4-like         660   0.0     
ref|XP_010907563.1|  PREDICTED: oligopeptide transporter 3-like         659   0.0     
ref|XP_004288877.1|  PREDICTED: oligopeptide transporter 2-like         659   0.0     



>ref|XP_011069784.1| PREDICTED: oligopeptide transporter 5-like [Sesamum indicum]
Length=755

 Score =  1011 bits (2613),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 490/679 (72%), Positives = 589/679 (87%), Gaps = 0/679 (0%)
 Frame = -1

Query  2038  SAVESSADEINDSPVEEVRLTVPITDDPTMPCVTFRTWVLGVTSCVILAFLNQFFGYRQN  1859
             +A   + DE+NDSP+EEVRLTVPITDDPT+PC+TFRTWVLG+ SC  L FLNQFFGYRQN
Sbjct  24    NATLEALDEVNDSPIEEVRLTVPITDDPTLPCLTFRTWVLGIISCATLGFLNQFFGYRQN  83

Query  1858  ALYVSSVPAQIVVLPMGKLMAAYLPTKVVQIPGTKWSFSLNPGPFNIKEHVLITIFASSG  1679
             AL V+SV AQI+VLP+GKLMA  LP K ++IPGTKW+FSLNPGPF+IKEH LITIFA++G
Sbjct  84    ALSVTSVSAQILVLPLGKLMAVSLPRKEIRIPGTKWTFSLNPGPFSIKEHCLITIFANTG  143

Query  1678  SDFSYAVSIITMMKAFYYRDIHPLAAVLLTFSTQMLGYGLAGIFKKFLIDSPYMWWPSNL  1499
             S+  YAV+IIT++KAFY+R ++P+AA+LLT STQMLGYG AGIF+KFL+DSPYMWWP NL
Sbjct  144   SNSVYAVNIITIVKAFYHRRLNPVAAMLLTHSTQMLGYGWAGIFRKFLVDSPYMWWPINL  203

Query  1498  VQVSLFRALHDVETRPKGGLTRLQFFIIVLVCSFAYYVVPNYLFPSLTALSLLCWIWKNS  1319
             VQVSLFRALH+VE R KGGLTRLQFFIIVLV SF+YY+VPNYLFPS+TALS +CWIWK+S
Sbjct  204   VQVSLFRALHEVEVRRKGGLTRLQFFIIVLVSSFSYYIVPNYLFPSITALSFVCWIWKDS  263

Query  1318  VTAQQlgsglkglgigSFALDWATVAAFQGSPLVTPDFAIINMLIGYVLVAYIAIPVWYW  1139
             VTAQQ+GSG+ GLG+GSFA DWATVA F GSPL TP FAIINML+G+VLV Y+  P+ YW
Sbjct  264   VTAQQIGSGIYGLGVGSFAFDWATVAGFLGSPLATPGFAIINMLVGFVLVLYVVTPIAYW  323

Query  1138  TNLFDAKKFPLFSSNVFDSNGQVYNISRVLNKKTFGFDQPGYDSYSNIYLSTAFVYTYGL  959
              N ++AK+FP+ S++VFD+NG  YNIS +L ++TF F+  GYD+YS + LS  FV  YG+
Sbjct  324   NNFYNAKRFPIISAHVFDANGAKYNISAILTERTFEFNNQGYDNYSKVNLSIFFVLAYGI  383

Query  958   SFATLAATVSHVALFHGRTIWEQTKESVQDKFSDIHTRLMRKNYEPVPQWWFYlllviiv  779
             SFATLAATVSHVALFHGRTIW+QTK+S QDKF D+HTRLMRKNY+PVPQWWF+ LL++++
Sbjct  384   SFATLAATVSHVALFHGRTIWQQTKKSFQDKFGDVHTRLMRKNYDPVPQWWFHALLLLVI  443

Query  778   gvalvACQRFGGQLQLPVWGVLLAVLLSLIFTLPVGVITATTNQQTGLNVIAELIIGYMY  599
              ++L +C+ FG QLQLP WGV+LA+ L+ IFTLP GVITATTNQQ GLNV++E+IIGYMY
Sbjct  444   AMSLFSCEGFGRQLQLPYWGVILAMALAFIFTLPAGVITATTNQQIGLNVVSEMIIGYMY  503

Query  598   PGRPLASVTFKMYGlsslsqslmflSDFKLGHYMKIPPKSMFMVQLVGTLISCCVHFGTG  419
             PG+PLA+V FK Y   S++Q++ FLSDFKLGHYMKIPPKSMF+VQLVGTL+S  V+FG+ 
Sbjct  504   PGKPLANVAFKTYSTISMAQAITFLSDFKLGHYMKIPPKSMFLVQLVGTLVSSLVYFGSA  563

Query  418   WWLLTTVENICNPSKLPEGSQWTCPGDDVFYNASIIWGVVSPRRMFGNLGIYQATNYFFL  239
             WWLLT++ENICNPSKLP+GS WTCPGDDVFYNASIIWGVV P RMFG LG+Y   NYFFL
Sbjct  564   WWLLTSIENICNPSKLPDGSPWTCPGDDVFYNASIIWGVVGPLRMFGKLGLYPGMNYFFL  623

Query  238   VGFLAPIPVWYLGRKYPEKRWVSLINMPILISGAEGIPIVKSVNYVCWFAVGLYFNLYVY  59
              G +AP+PVWY  RKYPEK+W+ LIN+PILISGA  +P+ K+VNY+CWF+VGL+FNLYVY
Sbjct  624   FGAIAPVPVWYFSRKYPEKKWIRLINVPILISGAGAMPVAKAVNYMCWFSVGLFFNLYVY  683

Query  58    RKHKGWWARHNYILSAGLD  2
             R+ K WW RHNYILSAGLD
Sbjct  684   RRFKHWWVRHNYILSAGLD  702



>ref|XP_009600998.1| PREDICTED: oligopeptide transporter 1-like [Nicotiana tomentosiformis]
Length=737

 Score =  1010 bits (2612),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 499/676 (74%), Positives = 599/676 (89%), Gaps = 0/676 (0%)
 Frame = -1

Query  2029  ESSADEINDSPVEEVRLTVPITDDPTMPCVTFRTWVLGVTSCVILAFLNQFFGYRQNALY  1850
             ESS + +NDSP+E+VRLTVP TDDP++PC+TFRTW LG+TSC ILAFLNQFFGYRQNALY
Sbjct  9     ESSDEVVNDSPIEQVRLTVPTTDDPSLPCLTFRTWALGITSCAILAFLNQFFGYRQNALY  68

Query  1849  VSSVPAQIVVLPMGKLMAAYLPTKVVQIPGTKWSFSLNPGPFNIKEHVLITIFASSGSDF  1670
             +SSV AQI+VLP+GKLMAAY PTK++ IP TKWSFSLNPGPFN+KEHVLITIFA++G+  
Sbjct  69    ISSVSAQILVLPLGKLMAAYFPTKIIIIPATKWSFSLNPGPFNLKEHVLITIFANAGATS  128

Query  1669  SYAVSIITMMKAFYYRDIHPLAAVLLTFSTQMLGYGLAGIFKKFLIDSPYMWWPSNLVQV  1490
              YAVSIIT++KAFY   IHPLAA+LLT +TQ+LGYG AGIF+KFL+DSPYMWWPSNLVQV
Sbjct  129   VYAVSIITIVKAFYGSQIHPLAALLLTHTTQLLGYGWAGIFRKFLVDSPYMWWPSNLVQV  188

Query  1489  SLFRALHDVETRPKGGLTRLQFFIIVLVCSFAYYVVPNYLFPSLTALSLLCWIWKNSVTA  1310
             SLFRALHDVE RPKGGLTRLQFFI+VLV SF+YY+VPNYLFPS+TALS +C IWK+SVTA
Sbjct  189   SLFRALHDVEKRPKGGLTRLQFFIVVLVSSFSYYIVPNYLFPSITALSFVCLIWKDSVTA  248

Query  1309  QQlgsglkglgigSFALDWATVAAFQGSPLVTPDFAIINMLIGYVLVAYIAIPVWYWTNL  1130
             QQ+GSGLKGLGIGSFALDW+TVA F  SPL TP FA++N L+G++L+ YIAIP  YWTNL
Sbjct  249   QQIGSGLKGLGIGSFALDWSTVAGFLASPLATPGFAVMNTLVGFILIVYIAIPFCYWTNL  308

Query  1129  FDAKKFPLFSSNVFDSNGQVYNISRVLNKKTFGFDQPGYDSYSNIYLSTAFVYTYGLSFA  950
             F AK+FP+FSS++FDS+GQ YN++R+ NK+TF F+Q GYD YS ++LS  FV+TYGLSFA
Sbjct  309   FQAKRFPIFSSHLFDSDGQAYNLTRIFNKETFDFNQQGYDHYSQVHLSIFFVFTYGLSFA  368

Query  949   TLAATVSHVALFHGRTIWEQTKESVQDKFSDIHTRLMRKNYEPVPQWWFYlllviivgva  770
             TLAATV+HVALFHGRTIW+QTK S Q+KF D+HTR+M+KNYEPVPQWWFY +L++++G++
Sbjct  369   TLAATVTHVALFHGRTIWQQTKGSFQEKFEDVHTRIMKKNYEPVPQWWFYTILIVVLGLS  428

Query  769   lvACQRFGGQLQLPVWGVLLAVLLSLIFTLPVGVITATTNQQTGLNVIAELIIGYMYPGR  590
             L+A + FG QLQLP WGV+LA+ L+L FTLP+ VITATTNQ  G+NVIAELIIGYMYPG+
Sbjct  429   LLASEGFGRQLQLPYWGVILAMALALFFTLPIAVITATTNQAPGINVIAELIIGYMYPGK  488

Query  589   PLASVTFKMYGlsslsqslmflSDFKLGHYMKIPPKSMFMVQLVGTLISCCVHFGTGWWL  410
             PLA+VTFK YGL S+SQ++ FL+DFKLGHYMKIPPKSMF+VQLVGT+++  V+FGT WWL
Sbjct  489   PLANVTFKTYGLISVSQAISFLADFKLGHYMKIPPKSMFIVQLVGTVVASSVYFGTAWWL  548

Query  409   LTTVENICNPSKLPEGSQWTCPGDDVFYNASIIWGVVSPRRMFGNLGIYQATNYFFLVGF  230
             L TV+NICNPSKLPEGS WTCPGDDVFY+ASIIWGVV P RMFG LG+Y   NYFFL+G 
Sbjct  549   LDTVDNICNPSKLPEGSPWTCPGDDVFYSASIIWGVVGPLRMFGKLGLYSTVNYFFLLGI  608

Query  229   LAPIPVWYLGRKYPEKRWVSLINMPILISGAEGIPIVKSVNYVCWFAVGLYFNLYVYRKH  50
             LAP+PVW L RK+P++ W+ LINMP+L+SG+ G+P  ++VNYVCW +VGL+FN YVYRK+
Sbjct  609   LAPVPVWLLSRKFPDQEWIRLINMPVLLSGSGGMPPARAVNYVCWLSVGLFFNFYVYRKY  668

Query  49    KGWWARHNYILSAGLD  2
             K WWARHNYILSAGLD
Sbjct  669   KSWWARHNYILSAGLD  684



>ref|XP_009777242.1| PREDICTED: oligopeptide transporter 1-like [Nicotiana sylvestris]
Length=737

 Score =  1007 bits (2604),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 497/676 (74%), Positives = 599/676 (89%), Gaps = 0/676 (0%)
 Frame = -1

Query  2029  ESSADEINDSPVEEVRLTVPITDDPTMPCVTFRTWVLGVTSCVILAFLNQFFGYRQNALY  1850
             ESS + +NDSP+E+VRLTVP TDDP++PC+TFRTW LG+TSC ILAFLNQFFGYRQN LY
Sbjct  9     ESSDEVVNDSPIEQVRLTVPTTDDPSLPCLTFRTWALGITSCAILAFLNQFFGYRQNTLY  68

Query  1849  VSSVPAQIVVLPMGKLMAAYLPTKVVQIPGTKWSFSLNPGPFNIKEHVLITIFASSGSDF  1670
             +SSV AQI+VLP+GKLMAAY PTK++QIP TKWSFSLNPGPFN+KEHVLITIFA++G+  
Sbjct  69    ISSVSAQILVLPLGKLMAAYFPTKIIQIPATKWSFSLNPGPFNLKEHVLITIFANAGATS  128

Query  1669  SYAVSIITMMKAFYYRDIHPLAAVLLTFSTQMLGYGLAGIFKKFLIDSPYMWWPSNLVQV  1490
              YAVSIIT++KAFY   IHPLAA+LLT +TQ+LGYG AGIF+KFL+DSPYMWWPSNLVQV
Sbjct  129   VYAVSIITIVKAFYGSQIHPLAALLLTHTTQLLGYGWAGIFRKFLVDSPYMWWPSNLVQV  188

Query  1489  SLFRALHDVETRPKGGLTRLQFFIIVLVCSFAYYVVPNYLFPSLTALSLLCWIWKNSVTA  1310
             SLFRALHDVE RPKGGLTRLQFFI+VLV SF+YY+VPNYLFPS+TALS +CWIWK+SVTA
Sbjct  189   SLFRALHDVEKRPKGGLTRLQFFIVVLVSSFSYYIVPNYLFPSITALSFVCWIWKDSVTA  248

Query  1309  QQlgsglkglgigSFALDWATVAAFQGSPLVTPDFAIINMLIGYVLVAYIAIPVWYWTNL  1130
             QQLGSGLKGLGIGSFALDW+TVA F GSPL TP FA++N L+G++L+ YIAIP  YWT++
Sbjct  249   QQLGSGLKGLGIGSFALDWSTVAGFLGSPLATPGFAVMNTLVGFMLIVYIAIPFCYWTDM  308

Query  1129  FDAKKFPLFSSNVFDSNGQVYNISRVLNKKTFGFDQPGYDSYSNIYLSTAFVYTYGLSFA  950
             F  K+FP+FSS++FDS+GQ YN++R+ NK+TF F+Q GYD YS ++LS  FV+TYGLSFA
Sbjct  309   FHVKRFPIFSSHLFDSDGQAYNLTRIFNKETFDFNQQGYDHYSQVHLSIFFVFTYGLSFA  368

Query  949   TLAATVSHVALFHGRTIWEQTKESVQDKFSDIHTRLMRKNYEPVPQWWFYlllviivgva  770
             TLAATV+HVALFHGRTIWEQTK S Q+KF D+HTR+M+KNYEPVPQWWFY +L++++G++
Sbjct  369   TLAATVTHVALFHGRTIWEQTKGSFQEKFEDVHTRIMKKNYEPVPQWWFYTILIVVLGLS  428

Query  769   lvACQRFGGQLQLPVWGVLLAVLLSLIFTLPVGVITATTNQQTGLNVIAELIIGYMYPGR  590
             L+A + FG QLQLP WGV+LA+ L+L FTLP+ VITATTNQ  G+NVI+ELIIGYMYPG+
Sbjct  429   LLASEGFGRQLQLPYWGVILAMALALTFTLPIAVITATTNQAPGINVISELIIGYMYPGK  488

Query  589   PLASVTFKMYGlsslsqslmflSDFKLGHYMKIPPKSMFMVQLVGTLISCCVHFGTGWWL  410
             PLA+VTFK YGL S+SQ++ FL+DFKLGHYMKIPPKSMF+VQLVGT+++  V+FGT WWL
Sbjct  489   PLANVTFKTYGLISVSQAISFLADFKLGHYMKIPPKSMFIVQLVGTVVASSVYFGTAWWL  548

Query  409   LTTVENICNPSKLPEGSQWTCPGDDVFYNASIIWGVVSPRRMFGNLGIYQATNYFFLVGF  230
             L TV+NICNPSKLPEGS WTCPGDDVFY+ASIIWGVV P RMFG LG+Y   NYFFL+G 
Sbjct  549   LDTVDNICNPSKLPEGSPWTCPGDDVFYSASIIWGVVGPLRMFGKLGLYTNVNYFFLIGI  608

Query  229   LAPIPVWYLGRKYPEKRWVSLINMPILISGAEGIPIVKSVNYVCWFAVGLYFNLYVYRKH  50
             LAP+PVW L RK+P++ W+ LINMP+L+SG+ G+P  ++VNY+ W +VGL+FN YVYRK+
Sbjct  609   LAPVPVWLLSRKFPDQEWIRLINMPVLLSGSGGMPPARAVNYIGWLSVGLFFNFYVYRKY  668

Query  49    KGWWARHNYILSAGLD  2
             K WWARHNYILSAGLD
Sbjct  669   KSWWARHNYILSAGLD  684



>gb|KCW76554.1| hypothetical protein EUGRSUZ_D00943 [Eucalyptus grandis]
Length=732

 Score =   982 bits (2538),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 481/676 (71%), Positives = 578/676 (86%), Gaps = 0/676 (0%)
 Frame = -1

Query  2029  ESSADEINDSPVEEVRLTVPITDDPTMPCVTFRTWVLGVTSCVILAFLNQFFGYRQNALY  1850
             E SADE+ND P+E+VRLTV I DDPT+PC+T RTW+LG+T+C  LAFLNQFFGYRQNAL 
Sbjct  4     EISADEVNDCPIEQVRLTVSIKDDPTLPCLTIRTWILGITACTTLAFLNQFFGYRQNALS  63

Query  1849  VSSVPAQIVVLPMGKLMAAYLPTKVVQIPGTKWSFSLNPGPFNIKEHVLITIFASSGSDF  1670
             ++SV AQIVVLP+GK MAA LP KVV +PGTKWSFSLNPGPFN+KEHVLITIFA++GS  
Sbjct  64    LTSVSAQIVVLPLGKFMAAVLPKKVVHVPGTKWSFSLNPGPFNLKEHVLITIFANTGSTN  123

Query  1669  SYAVSIITMMKAFYYRDIHPLAAVLLTFSTQMLGYGLAGIFKKFLIDSPYMWWPSNLVQV  1490
              YA++IIT++ AFY+R IH LAA+LLT +TQMLGYG AGIF+KFL+DSPYMWWP+NLVQV
Sbjct  124   VYAMNIITIVMAFYHRHIHFLAAMLLTLTTQMLGYGWAGIFRKFLVDSPYMWWPANLVQV  183

Query  1489  SLFRALHDVETRPKGGLTRLQFFIIVLVCSFAYYVVPNYLFPSLTALSLLCWIWKNSVTA  1310
             SLFRALH+ E RPKGGL RLQFF+IVL+ SFAYYVVPNYLFPS+TALS +CWIWK+SVTA
Sbjct  184   SLFRALHEEEVRPKGGLMRLQFFLIVLISSFAYYVVPNYLFPSITALSFVCWIWKDSVTA  243

Query  1309  QQlgsglkglgigSFALDWATVAAFQGSPLVTPDFAIINMLIGYVLVAYIAIPVWYWTNL  1130
             QQ+GSG +GLGIGSFALDWATVAAF GSPL TP FA+IN+ IG+ L+ Y+ IP+ YWTN 
Sbjct  244   QQIGSGRRGLGIGSFALDWATVAAFIGSPLATPGFALINISIGFFLMLYVLIPIAYWTNA  303

Query  1129  FDAKKFPLFSSNVFDSNGQVYNISRVLNKKTFGFDQPGYDSYSNIYLSTAFVYTYGLSFA  950
             F+AK+FP+ SS+VFD+NG  YN+  VLN+ TF F+Q GYD YS ++LS  F + YGLSFA
Sbjct  304   FEAKRFPIISSHVFDANGGKYNVGLVLNETTFQFNQQGYDDYSKVHLSIFFAFAYGLSFA  363

Query  949   TLAATVSHVALFHGRTIWEQTKESVQDKFSDIHTRLMRKNYEPVPQWWFYlllviivgva  770
             TLAAT+SHVALFHGRTIW+QT+ + +DKF D+HTRLM+KNY+ VPQWWFY L +I++G+A
Sbjct  364   TLAATISHVALFHGRTIWQQTQAAFRDKFDDVHTRLMKKNYDAVPQWWFYSLWLIMIGLA  423

Query  769   lvACQRFGGQLQLPVWGVLLAVLLSLIFTLPVGVITATTNQQTGLNVIAELIIGYMYPGR  590
             +VAC+ FGGQLQLP WGV+LA+ + L F LP+GVITATTNQQ GLNVI+ELI+GYMYPGR
Sbjct  424   MVACEGFGGQLQLPYWGVILAIGVVLFFMLPIGVITATTNQQFGLNVISELIVGYMYPGR  483

Query  589   PLASVTFKMYGlsslsqslmflSDFKLGHYMKIPPKSMFMVQLVGTLISCCVHFGTGWWL  410
             PLA+V FK Y   S+ Q++ FLSDFKLGHYMKIPPKSMF+VQLVGT+++  V+F T WWL
Sbjct  484   PLANVVFKTYSYVSMVQAITFLSDFKLGHYMKIPPKSMFIVQLVGTVVASSVYFSTAWWL  543

Query  409   LTTVENICNPSKLPEGSQWTCPGDDVFYNASIIWGVVSPRRMFGNLGIYQATNYFFLVGF  230
             LT+V+NIC+PSKLP GS WTCPGDDVFYNASIIWGVV P RMFG LG+Y   NYFFL G 
Sbjct  544   LTSVDNICDPSKLPMGSPWTCPGDDVFYNASIIWGVVGPLRMFGRLGVYAKMNYFFLFGI  603

Query  229   LAPIPVWYLGRKYPEKRWVSLINMPILISGAEGIPIVKSVNYVCWFAVGLYFNLYVYRKH  50
             LAP+PVW L R +PEK+W+ LINMPI+ISG+  +P   +VN +CW  VG++FN+YVYR++
Sbjct  604   LAPVPVWILSRMFPEKKWIRLINMPIIISGSPSMPPGTAVNNICWLTVGIFFNVYVYRRY  663

Query  49    KGWWARHNYILSAGLD  2
             K WW RHNYILSAGLD
Sbjct  664   KSWWVRHNYILSAGLD  679



>ref|XP_010096486.1| Oligopeptide transporter 1 [Morus notabilis]
 gb|EXB64606.1| Oligopeptide transporter 1 [Morus notabilis]
Length=749

 Score =   982 bits (2538),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 480/676 (71%), Positives = 583/676 (86%), Gaps = 0/676 (0%)
 Frame = -1

Query  2029  ESSADEINDSPVEEVRLTVPITDDPTMPCVTFRTWVLGVTSCVILAFLNQFFGYRQNALY  1850
              S  DE+NDSP+E+VRLTVPITDDPT+PC+TFRTW LG+ SC +LAFLNQFFGYRQNALY
Sbjct  21    NSDEDEVNDSPIEQVRLTVPITDDPTLPCLTFRTWFLGIVSCAVLAFLNQFFGYRQNALY  80

Query  1849  VSSVPAQIVVLPMGKLMAAYLPTKVVQIPGTKWSFSLNPGPFNIKEHVLITIFASSGSDF  1670
             VSSV AQIVVLP+G LMAA LP K ++IP T WSFSLNPGPFN+KEHVLITIFA+SGS  
Sbjct  81    VSSVSAQIVVLPIGVLMAAKLPRKSIRIPATSWSFSLNPGPFNLKEHVLITIFANSGSSG  140

Query  1669  SYAVSIITMMKAFYYRDIHPLAAVLLTFSTQMLGYGLAGIFKKFLIDSPYMWWPSNLVQV  1490
              YAV+IIT++KAFY R IH LAA LLT +TQMLGYG AGIF+KFL+DSPYMWWPSNLVQV
Sbjct  141   VYAVNIITIVKAFYRRGIHILAAFLLTQTTQMLGYGWAGIFRKFLVDSPYMWWPSNLVQV  200

Query  1489  SLFRALHDVETRPKGGLTRLQFFIIVLVCSFAYYVVPNYLFPSLTALSLLCWIWKNSVTA  1310
             SLFRALH+VE RPKGGLTRLQFF++VL  SFAYY+VPNYLFPS+TALS +CW+WK+SVTA
Sbjct  201   SLFRALHEVEKRPKGGLTRLQFFLMVLASSFAYYIVPNYLFPSITALSFVCWVWKDSVTA  260

Query  1309  QQlgsglkglgigSFALDWATVAAFQGSPLVTPDFAIINMLIGYVLVAYIAIPVWYWTNL  1130
             QQ+GSGL+GLG+GSFALDW+TVA+F GSPL TP FAI+N+++G+ +  YI IP+ YWTN 
Sbjct  261   QQIGSGLRGLGVGSFALDWSTVASFLGSPLATPGFAIVNIMVGFCITLYILIPIAYWTNA  320

Query  1129  FDAKKFPLFSSNVFDSNGQVYNISRVLNKKTFGFDQPGYDSYSNIYLSTAFVYTYGLSFA  950
             + AK+FP+FSS+VFD+NG  Y++S VLN+ TF F+Q GYD YS I LS  FVY YGLSFA
Sbjct  321   YQAKRFPIFSSHVFDANGTQYDVSVVLNETTFAFNQQGYDDYSKINLSIFFVYAYGLSFA  380

Query  949   TLAATVSHVALFHGRTIWEQTKESVQDKFSDIHTRLMRKNYEPVPQWWFYlllviivgva  770
             TLAA++SHVALFHGR IW+QTK +++DKF D+HTRLM+KNYE VP WWFY++L++++ +A
Sbjct  381   TLAASLSHVALFHGREIWQQTKATLRDKFGDVHTRLMKKNYEAVPDWWFYVILIVVLALA  440

Query  769   lvACQRFGGQLQLPVWGVLLAVLLSLIFTLPVGVITATTNQQTGLNVIAELIIGYMYPGR  590
             ++AC+ FG QLQLP WG+LLA+ ++L+FTLP+GVITATTNQQ GLNVI EL+IGY+YPG+
Sbjct  441   ILACEGFGRQLQLPYWGILLAMGMALLFTLPIGVITATTNQQPGLNVITELVIGYLYPGK  500

Query  589   PLASVTFKMYGlsslsqslmflSDFKLGHYMKIPPKSMFMVQLVGTLISCCVHFGTGWWL  410
             PLA+V FK YG  S++Q++MFLSDFKLGHYMKIPPKSMF+VQLVGT+++  V+FGT WWL
Sbjct  501   PLANVAFKTYGYISMTQAIMFLSDFKLGHYMKIPPKSMFVVQLVGTIVASSVYFGTAWWL  560

Query  409   LTTVENICNPSKLPEGSQWTCPGDDVFYNASIIWGVVSPRRMFGNLGIYQATNYFFLVGF  230
             LT+V +IC PSKLP GS WTCPGDDVFYNAS+IWGVV P RMFG LG Y A NY FL+GF
Sbjct  561   LTSVTDICQPSKLPVGSPWTCPGDDVFYNASVIWGVVGPLRMFGRLGHYPAMNYLFLIGF  620

Query  229   LAPIPVWYLGRKYPEKRWVSLINMPILISGAEGIPIVKSVNYVCWFAVGLYFNLYVYRKH  50
             LAP+P + L R +P  R++ LI++PI++ GA G+P  ++VNY+CW AVGL+FN  VYR+ 
Sbjct  621   LAPLPFYLLSRAFPRYRFLRLIHVPIILGGAGGMPPARAVNYICWGAVGLFFNFVVYRRF  680

Query  49    KGWWARHNYILSAGLD  2
             KGWWARHNYILSAGLD
Sbjct  681   KGWWARHNYILSAGLD  696



>ref|XP_010096485.1| Oligopeptide transporter 1 [Morus notabilis]
 gb|EXB64605.1| Oligopeptide transporter 1 [Morus notabilis]
Length=749

 Score =   981 bits (2537),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 480/685 (70%), Positives = 587/685 (86%), Gaps = 0/685 (0%)
 Frame = -1

Query  2056  MENTGISAVESSADEINDSPVEEVRLTVPITDDPTMPCVTFRTWVLGVTSCVILAFLNQF  1877
             M    +    S  DE+NDSP+E+VRLTVP+TDDPT+PC+TFRTW LG+ SC +LAFLNQF
Sbjct  12    MSYQTVKPENSDEDEVNDSPIEQVRLTVPVTDDPTLPCLTFRTWFLGIVSCAVLAFLNQF  71

Query  1876  FGYRQNALYVSSVPAQIVVLPMGKLMAAYLPTKVVQIPGTKWSFSLNPGPFNIKEHVLIT  1697
             FGYRQNALYVSSV AQIVVLP+G LMAA LP K ++IP T WSFSLNPGPFN+KEHVLIT
Sbjct  72    FGYRQNALYVSSVSAQIVVLPIGVLMAAKLPRKSIRIPATSWSFSLNPGPFNLKEHVLIT  131

Query  1696  IFASSGSDFSYAVSIITMMKAFYYRDIHPLAAVLLTFSTQMLGYGLAGIFKKFLIDSPYM  1517
             IFA+SGS   YAV+IIT++KAFY R IH LAA LLT +TQMLGYG AGIF+KFL+DSPYM
Sbjct  132   IFANSGSSGVYAVNIITIVKAFYRRGIHILAAFLLTQTTQMLGYGWAGIFRKFLVDSPYM  191

Query  1516  WWPSNLVQVSLFRALHDVETRPKGGLTRLQFFIIVLVCSFAYYVVPNYLFPSLTALSLLC  1337
             WWPSNLVQVSLFRALH+VE RPKGGLTRLQFF+IVL  SFAYY+VPNYLFPS+TALS +C
Sbjct  192   WWPSNLVQVSLFRALHEVEKRPKGGLTRLQFFLIVLASSFAYYIVPNYLFPSITALSFVC  251

Query  1336  WIWKNSVTAQQlgsglkglgigSFALDWATVAAFQGSPLVTPDFAIINMLIGYVLVAYIA  1157
             W+WK+SVTAQQ+GSGL+GLG+GSFALDW+TVA+F GSPL TP FAI+N+++G+ +  YI 
Sbjct  252   WVWKDSVTAQQIGSGLRGLGVGSFALDWSTVASFLGSPLATPGFAIVNIMVGFCITLYIL  311

Query  1156  IPVWYWTNLFDAKKFPLFSSNVFDSNGQVYNISRVLNKKTFGFDQPGYDSYSNIYLSTAF  977
             IP+ YWTN + AK+FP+FSS+VFD+NG  Y++S VLN+ TF F+Q GYD YS I LS  F
Sbjct  312   IPIAYWTNAYQAKRFPIFSSHVFDANGTQYDVSVVLNETTFAFNQQGYDDYSKINLSIFF  371

Query  976   VYTYGLSFATLAATVSHVALFHGRTIWEQTKESVQDKFSDIHTRLMRKNYEPVPQWWFYl  797
             VY YGLSFATLAA++SHVALFHGR IW+QTK +++D+F D+HTRLM+KNYE VP WWFY+
Sbjct  372   VYAYGLSFATLAASLSHVALFHGREIWQQTKATLRDEFRDVHTRLMKKNYEAVPDWWFYV  431

Query  796   llviivgvalvACQRFGGQLQLPVWGVLLAVLLSLIFTLPVGVITATTNQQTGLNVIAEL  617
             +L++++ +A++AC+ FG QLQLP WG+LLA+ ++L+FTLP+GVITATTNQQ GLNVI EL
Sbjct  432   ILIVVLALAILACEGFGRQLQLPYWGILLAMGMALLFTLPIGVITATTNQQPGLNVITEL  491

Query  616   IIGYMYPGRPLASVTFKMYGlsslsqslmflSDFKLGHYMKIPPKSMFMVQLVGTLISCC  437
             +IGY+YPG+PLA+V FK+YG +S++Q++MFLSDFKLGHYMKIPPKSMF+VQLVGT+++  
Sbjct  492   VIGYLYPGKPLANVAFKIYGYTSMTQAIMFLSDFKLGHYMKIPPKSMFVVQLVGTIVASS  551

Query  436   VHFGTGWWLLTTVENICNPSKLPEGSQWTCPGDDVFYNASIIWGVVSPRRMFGNLGIYQA  257
             V+FGT WWLLT+V +IC PSKLP GS WTCPGDDVFYNAS+IWGVV P RMFG LG Y A
Sbjct  552   VYFGTAWWLLTSVTDICQPSKLPVGSPWTCPGDDVFYNASVIWGVVGPLRMFGRLGHYPA  611

Query  256   TNYFFLVGFLAPIPVWYLGRKYPEKRWVSLINMPILISGAEGIPIVKSVNYVCWFAVGLY  77
              NY FL+GFLAP+P + L R +P  R++ LI++PI++ GA G+P  ++VNY+CW AVGL+
Sbjct  612   MNYLFLIGFLAPLPFYLLSRAFPRYRFLRLIHVPIILGGAGGMPPARAVNYICWGAVGLF  671

Query  76    FNLYVYRKHKGWWARHNYILSAGLD  2
             FN  VYR+ KGWWARHNYILSAGLD
Sbjct  672   FNFVVYRRFKGWWARHNYILSAGLD  696



>ref|XP_010052485.1| PREDICTED: oligopeptide transporter 1-like [Eucalyptus grandis]
Length=754

 Score =   977 bits (2525),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 479/675 (71%), Positives = 577/675 (85%), Gaps = 0/675 (0%)
 Frame = -1

Query  2026  SSADEINDSPVEEVRLTVPITDDPTMPCVTFRTWVLGVTSCVILAFLNQFFGYRQNALYV  1847
              S+DE+ND P+E+VRLTV I DDPT+PC+T RTW+LG+T+C  LAFLNQFFGYRQNAL +
Sbjct  27    DSSDEVNDCPIEQVRLTVSIKDDPTLPCLTIRTWILGITACTTLAFLNQFFGYRQNALSL  86

Query  1846  SSVPAQIVVLPMGKLMAAYLPTKVVQIPGTKWSFSLNPGPFNIKEHVLITIFASSGSDFS  1667
             +SV AQIVVLP+GK MAA LP KVV +PGTKWSFSLNPGPFN+KEHVLITIFA++GS   
Sbjct  87    TSVSAQIVVLPLGKFMAAVLPKKVVHVPGTKWSFSLNPGPFNLKEHVLITIFANTGSTNV  146

Query  1666  YAVSIITMMKAFYYRDIHPLAAVLLTFSTQMLGYGLAGIFKKFLIDSPYMWWPSNLVQVS  1487
             YA++IIT++ AFY+R IH LAA+LLT +TQMLGYG AGIF+KFL+DSPYMWWP+NLVQVS
Sbjct  147   YAMNIITIVMAFYHRHIHFLAAMLLTLTTQMLGYGWAGIFRKFLVDSPYMWWPANLVQVS  206

Query  1486  LFRALHDVETRPKGGLTRLQFFIIVLVCSFAYYVVPNYLFPSLTALSLLCWIWKNSVTAQ  1307
             LFRALH+ E RPKGGL RLQFF+IVL+ SFAYYVVPNYLFPS+TALS +CWIWK+SVTAQ
Sbjct  207   LFRALHEEEVRPKGGLMRLQFFLIVLISSFAYYVVPNYLFPSITALSFVCWIWKDSVTAQ  266

Query  1306  QlgsglkglgigSFALDWATVAAFQGSPLVTPDFAIINMLIGYVLVAYIAIPVWYWTNLF  1127
             Q+GSG +GLGIGSFALDWATVAAF GSPL TP FA+IN+ IG+ L+ Y+ IP+ YWTN F
Sbjct  267   QIGSGRRGLGIGSFALDWATVAAFIGSPLATPGFALINISIGFFLMLYVLIPIAYWTNAF  326

Query  1126  DAKKFPLFSSNVFDSNGQVYNISRVLNKKTFGFDQPGYDSYSNIYLSTAFVYTYGLSFAT  947
             +AK+FP+ SS+VFD+NG  YN+  VLN+ TF F+Q GYD YS ++LS  F + YGLSFAT
Sbjct  327   EAKRFPIISSHVFDANGGKYNVGLVLNETTFQFNQQGYDDYSKVHLSIFFAFAYGLSFAT  386

Query  946   LAATVSHVALFHGRTIWEQTKESVQDKFSDIHTRLMRKNYEPVPQWWFYlllviivgval  767
             LAAT+SHVALFHGRTIW+QT+ + +DKF D+HTRLM+KNY+ VPQWWFY L +I++G+A+
Sbjct  387   LAATISHVALFHGRTIWQQTQAAFRDKFDDVHTRLMKKNYDAVPQWWFYSLWLIMIGLAM  446

Query  766   vACQRFGGQLQLPVWGVLLAVLLSLIFTLPVGVITATTNQQTGLNVIAELIIGYMYPGRP  587
             VAC+ FGGQLQLP WGV+LA+ + L F LP+GVITATTNQQ GLNVI+ELI+GYMYPGRP
Sbjct  447   VACEGFGGQLQLPYWGVILAIGVVLFFMLPIGVITATTNQQFGLNVISELIVGYMYPGRP  506

Query  586   LASVTFKMYGlsslsqslmflSDFKLGHYMKIPPKSMFMVQLVGTLISCCVHFGTGWWLL  407
             LA+V FK Y   S+ Q++ FLSDFKLGHYMKIPPKSMF+VQLVGT+++  V+F T WWLL
Sbjct  507   LANVVFKTYSYVSMVQAITFLSDFKLGHYMKIPPKSMFIVQLVGTVVASSVYFSTAWWLL  566

Query  406   TTVENICNPSKLPEGSQWTCPGDDVFYNASIIWGVVSPRRMFGNLGIYQATNYFFLVGFL  227
             T+V+NIC+PSKLP GS WTCPGDDVFYNASIIWGVV P RMFG LG+Y   NYFFL G L
Sbjct  567   TSVDNICDPSKLPMGSPWTCPGDDVFYNASIIWGVVGPLRMFGRLGVYAKMNYFFLFGIL  626

Query  226   APIPVWYLGRKYPEKRWVSLINMPILISGAEGIPIVKSVNYVCWFAVGLYFNLYVYRKHK  47
             AP+PVW L R +PEK+W+ LINMPI+ISG+  +P   +VN +CW  VG++FN+YVYR++K
Sbjct  627   APVPVWILSRMFPEKKWIRLINMPIIISGSPSMPPGTAVNNICWLTVGIFFNVYVYRRYK  686

Query  46    GWWARHNYILSAGLD  2
              WW RHNYILSAGLD
Sbjct  687   SWWVRHNYILSAGLD  701



>gb|EPS60835.1| hypothetical protein M569_13965 [Genlisea aurea]
Length=743

 Score =   970 bits (2508),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 474/684 (69%), Positives = 577/684 (84%), Gaps = 0/684 (0%)
 Frame = -1

Query  2053  ENTGISAVESSADEINDSPVEEVRLTVPITDDPTMPCVTFRTWVLGVTSCVILAFLNQFF  1874
             +N    +   + + +NDSP+EEVRLTVP TDDP++PC+TFRTW LG+ SC  L++LNQFF
Sbjct  8     QNHFPESAAKNDEPLNDSPIEEVRLTVPTTDDPSLPCLTFRTWFLGIISCAALSYLNQFF  67

Query  1873  GYRQNALYVSSVPAQIVVLPMGKLMAAYLPTKVVQIPGTKWSFSLNPGPFNIKEHVLITI  1694
              YR+N L ++SV AQI+VLP+GK MAA LP +  + PGT WSFSLNPGPFN+KEH LITI
Sbjct  68    SYRRNPLSITSVSAQILVLPVGKFMAATLPERRFRFPGTNWSFSLNPGPFNMKEHCLITI  127

Query  1693  FASSGSDFSYAVSIITMMKAFYYRDIHPLAAVLLTFSTQMLGYGLAGIFKKFLIDSPYMW  1514
             FA++G+   YA+ I+T++KAFY+R +HPLAA++LT STQ+LGYG AGIF+KFL+DSPYMW
Sbjct  128   FANAGASGVYAIGIVTIVKAFYHRKLHPLAAMILTHSTQLLGYGWAGIFRKFLVDSPYMW  187

Query  1513  WPSNLVQVSLFRALHDVETRPKGGLTRLQFFIIVLVCSFAYYVVPNYLFPSLTALSLLCW  1334
             WPSNLVQVSLFRALHDVE R KGGLTRLQFF IVLV SF+YYVVP YLFPS+TALS +CW
Sbjct  188   WPSNLVQVSLFRALHDVEVRRKGGLTRLQFFAIVLVSSFSYYVVPGYLFPSITALSFVCW  247

Query  1333  IWKNSVTAQQlgsglkglgigSFALDWATVAAFQGSPLVTPDFAIINMLIGYVLVAYIAI  1154
             IWK+SVTAQQ+GSGL GLG+GSFA DWAT  +F GSPL TP FA+IN+L+G+VL  Y+ +
Sbjct  248   IWKDSVTAQQIGSGLNGLGLGSFAFDWATTVSFIGSPLATPGFAMINILVGFVLTVYVFL  307

Query  1153  PVWYWTNLFDAKKFPLFSSNVFDSNGQVYNISRVLNKKTFGFDQPGYDSYSNIYLSTAFV  974
             P+ YWTNL+DAKKFP+ SS+VFDS G  YN+S++L  ++F F++ GYDSYS I LS  FV
Sbjct  308   PLAYWTNLYDAKKFPIISSHVFDSTGHPYNVSKILTGRSFEFNREGYDSYSKINLSIFFV  367

Query  973   YTYGLSFATLAATVSHVALFHGRTIWEQTKESVQDKFSDIHTRLMRKNYEPVPQWWFYll  794
             + YGLSFA+L++T+SHVALFHGRTIW+QTK S QD F DIHTRLMRKNYEPVPQWWFY L
Sbjct  368   FVYGLSFASLSSTISHVALFHGRTIWKQTKASFQDTFGDIHTRLMRKNYEPVPQWWFYSL  427

Query  793   lviivgvalvACQRFGGQLQLPVWGVLLAVLLSLIFTLPVGVITATTNQQTGLNVIAELI  614
             L+++VG+ L+AC+ FG QLQLP WG+LLA+ L+ +FTLP+GVI ATTNQQ GLNVI+E+I
Sbjct  428   LIVVVGMGLLACEGFGRQLQLPYWGILLAMALASVFTLPIGVIAATTNQQAGLNVISEMI  487

Query  613   IGYMYPGRPLASVTFKMYGlsslsqslmflSDFKLGHYMKIPPKSMFMVQLVGTLISCCV  434
             IGYMYPGRPLA++TFK Y   S SQ+LMFL DFKLGHYMKIPPKSMF+VQLVGT++S  V
Sbjct  488   IGYMYPGRPLANITFKTYSTISTSQALMFLQDFKLGHYMKIPPKSMFIVQLVGTVVSSGV  547

Query  433   HFGTGWWLLTTVENICNPSKLPEGSQWTCPGDDVFYNASIIWGVVSPRRMFGNLGIYQAT  254
             +FGT WWLLTTV NIC+ S L  GS WTCP DDVFYNASIIWGV  P RMFG LG+Y   
Sbjct  548   YFGTAWWLLTTVPNICDKSNLQNGSPWTCPYDDVFYNASIIWGVAGPLRMFGKLGLYPGM  607

Query  253   NYFFLVGFLAPIPVWYLGRKYPEKRWVSLINMPILISGAEGIPIVKSVNYVCWFAVGLYF  74
             NYFFL G +APIPVWY+ RKYPEK+W++LIN+PI+ISGA  +P  K+VNY+CWFA+G++F
Sbjct  608   NYFFLFGLVAPIPVWYMARKYPEKKWIALINVPIVISGAGAMPSAKTVNYLCWFAIGIFF  667

Query  73    NLYVYRKHKGWWARHNYILSAGLD  2
             N+YVYR+ KGWWARHNY++SAGLD
Sbjct  668   NVYVYRRFKGWWARHNYVMSAGLD  691



>ref|XP_002323113.2| hypothetical protein POPTR_0016s00650g [Populus trichocarpa]
 gb|EEF04874.2| hypothetical protein POPTR_0016s00650g [Populus trichocarpa]
Length=748

 Score =   967 bits (2501),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 481/677 (71%), Positives = 588/677 (87%), Gaps = 0/677 (0%)
 Frame = -1

Query  2032  VESSADEINDSPVEEVRLTVPITDDPTMPCVTFRTWVLGVTSCVILAFLNQFFGYRQNAL  1853
             V    +E NDSP+E+VRLTVPITDDPT+PC+TFRTWVLG+TSC +LAF NQFFGYRQN L
Sbjct  19    VLDEKEEANDSPIEQVRLTVPITDDPTLPCLTFRTWVLGITSCALLAFANQFFGYRQNIL  78

Query  1852  YVSSVPAQIVVLPMGKLMAAYLPTKVVQIPGTKWSFSLNPGPFNIKEHVLITIFASSGSD  1673
              V+SV AQIVVLP+G+LMAA LP KV++ P TKWSFSLNPGPFN+KEHVLITIFA+SGS+
Sbjct  79    SVTSVSAQIVVLPVGRLMAAILPNKVIRFPRTKWSFSLNPGPFNLKEHVLITIFANSGSN  138

Query  1672  FSYAVSIITMMKAFYYRDIHPLAAVLLTFSTQMLGYGLAGIFKKFLIDSPYMWWPSNLVQ  1493
               YAV IIT++KAFY+ +I  + A+LL+ +TQ+LGYG AGIF+KFL+DSPYMWWPSNLVQ
Sbjct  139   PVYAVGIITIVKAFYHGNIDAVPAMLLSQTTQLLGYGWAGIFRKFLVDSPYMWWPSNLVQ  198

Query  1492  VSLFRALHDVETRPKGGLTRLQFFIIVLVCSFAYYVVPNYLFPSLTALSLLCWIWKNSVT  1313
             VSLFRALH+VE R KGGLTRLQFF++VL+ SFAYY+VP YLF S+TALS +CWIWK+SVT
Sbjct  199   VSLFRALHEVEIRRKGGLTRLQFFLVVLISSFAYYIVPGYLFQSITALSFVCWIWKDSVT  258

Query  1312  AQQlgsglkglgigSFALDWATVAAFQGSPLVTPDFAIINMLIGYVLVAYIAIPVWYWTN  1133
             AQQ+GSGL GLG+GSFA DW+TVA F GSPL TP FAIIN+L GY+++ YI IP+ YWTN
Sbjct  259   AQQIGSGLHGLGVGSFAFDWSTVAGFLGSPLATPGFAIINILFGYIIILYIIIPISYWTN  318

Query  1132  LFDAKKFPLFSSNVFDSNGQVYNISRVLNKKTFGFDQPGYDSYSNIYLSTAFVYTYGLSF  953
              ++AK+FP+FSS+VFD+NG+ Y++S VLN+ TF F++ GYD YS + LS  FVYTYGLSF
Sbjct  319   SYNAKRFPIFSSHVFDANGKPYDVSTVLNETTFEFNRAGYDGYSKVNLSIFFVYTYGLSF  378

Query  952   ATLAATVSHVALFHGRTIWEQTKESVQDKFSDIHTRLMRKNYEPVPQWWFYlllviivgv  773
             A LAAT++HVALFHGR IW QTKE+++DK++D+HTR+M++NYE VPQWWF+++L+++ G+
Sbjct  379   AILAATLTHVALFHGREIWYQTKETLKDKYADVHTRIMKRNYEAVPQWWFHIILIVVTGL  438

Query  772   alvACQRFGGQLQLPVWGVLLAVLLSLIFTLPVGVITATTNQQTGLNVIAELIIGYMYPG  593
             AL+ C+ FG QLQLP WGVLLA+ L+ IFTLP+GVITATTNQQ GLNVI ELIIGYMYPG
Sbjct  439   ALLTCEGFGRQLQLPYWGVLLAIGLAFIFTLPIGVITATTNQQPGLNVITELIIGYMYPG  498

Query  592   RPLASVTFKMYGlsslsqslmflSDFKLGHYMKIPPKSMFMVQLVGTLISCCVHFGTGWW  413
             RPLA++TFK YG  S+SQ++MFLSDFKLGHYMKIPPKSMF+VQLVGT+I+  V+FGT WW
Sbjct  499   RPLANITFKTYGYISMSQAIMFLSDFKLGHYMKIPPKSMFVVQLVGTVIASSVYFGTAWW  558

Query  412   LLTTVENICNPSKLPEGSQWTCPGDDVFYNASIIWGVVSPRRMFGNLGIYQATNYFFLVG  233
             LLT+VENICNPS+LPEGS WTCPGDDVFYNASIIWGVV P RMFG LG+Y   NYFFL+G
Sbjct  559   LLTSVENICNPSRLPEGSPWTCPGDDVFYNASIIWGVVGPMRMFGRLGLYSKMNYFFLIG  618

Query  232   FLAPIPVWYLGRKYPEKRWVSLINMPILISGAEGIPIVKSVNYVCWFAVGLYFNLYVYRK  53
              LAP+PVW L R +PEK+W+ LIN+PI+I G  G+P  ++VNY+CWFAVG++FN  VY++
Sbjct  619   LLAPVPVWILSRMFPEKKWIKLINVPIIIGGTGGMPSARAVNYMCWFAVGIFFNFVVYKR  678

Query  52    HKGWWARHNYILSAGLD  2
             ++GWW RHNYILSAGLD
Sbjct  679   YRGWWVRHNYILSAGLD  695



>ref|XP_007026393.1| Oligopeptide transporter 5 [Theobroma cacao]
 gb|EOY29015.1| Oligopeptide transporter 5 [Theobroma cacao]
Length=754

 Score =   966 bits (2496),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 470/693 (68%), Positives = 580/693 (84%), Gaps = 2/693 (0%)
 Frame = -1

Query  2080  SLSRLLH*MENTGISAVESSADEINDSPVEEVRLTVPITDDPTMPCVTFRTWVLGVTSCV  1901
             +LS     ++NT I+  E + DE+NDSP+E+VRLTVPI DDPT+PC+TFRTW LG+TSCV
Sbjct  10    TLSHQTKQIDNTEIT--EDTDDEVNDSPIEQVRLTVPIRDDPTLPCLTFRTWALGITSCV  67

Query  1900  ILAFLNQFFGYRQNALYVSSVPAQIVVLPMGKLMAAYLPTKVVQIPGTKWSFSLNPGPFN  1721
             +L FLNQFF YRQN+L++SSV AQI+VLP+GKLMAAYLP K ++IP TKWSFSLNPGPFN
Sbjct  68    VLGFLNQFFQYRQNSLHISSVSAQILVLPVGKLMAAYLPRKSIRIPSTKWSFSLNPGPFN  127

Query  1720  IKEHVLITIFASSGSDFSYAVSIITMMKAFYYRDIHPLAAVLLTFSTQMLGYGLAGIFKK  1541
             +KEHVLITIFA++ S   YAV+IIT++KAFY+ +IHPLAA+LL  STQMLGYG AGIF+K
Sbjct  128   LKEHVLITIFANTSSINLYAVNIITLVKAFYHGEIHPLAAMLLAQSTQMLGYGWAGIFRK  187

Query  1540  FLIDSPYMWWPSNLVQVSLFRALHDVETRPKGGLTRLQFFIIVLVCSFAYYVVPNYLFPS  1361
             FL+DSPYMWWP+NL+QVSLFRALH+VE R KGGLTRLQFF++V + SFAYY+VPNY FPS
Sbjct  188   FLVDSPYMWWPNNLIQVSLFRALHNVEVRSKGGLTRLQFFLVVFISSFAYYIVPNYFFPS  247

Query  1360  LTALSLLCWIWKNSVTAQQlgsglkglgigSFALDWATVAAFQGSPLVTPDFAIINMLIG  1181
             +TALS +CW+WK+SVTAQ +G+G  GLGIGSFALDW+TVA+F  SPL TP FAIIN+++G
Sbjct  248   ITALSFVCWVWKDSVTAQIIGAGRGGLGIGSFALDWSTVASFLQSPLATPAFAIINIMVG  307

Query  1180  YVLVAYIAIPVWYWTNLFDAKKFPLFSSNVFDSNGQVYNISRVLNKKTFGFDQPGYDSYS  1001
             +V+V YI +P+ YW+N ++A++FP+ SS+VF ++G+ Y++SRVLN   F F+Q GYD YS
Sbjct  308   FVIVVYILLPIAYWSNSYEARRFPIISSHVFTADGEKYDVSRVLNYTAFEFNQQGYDGYS  367

Query  1000  NIYLSTAFVYTYGLSFATLAATVSHVALFHGRTIWEQTKESVQDKFSDIHTRLMRKNYEP  821
              I LS  FVY+YGLSFATLAAT+SHV  F GRTIW+Q   + QDKFSD+H RLM+K YEP
Sbjct  368   KINLSVFFVYSYGLSFATLAATMSHVVFFDGRTIWQQAISAFQDKFSDVHYRLMKKTYEP  427

Query  820   VPQWWFYlllviivgvalvACQRFGGQLQLPVWGVLLAVLLSLIFTLPVGVITATTNQQT  641
             VPQWWFY LL I++G+A++ C+ FG QLQLP WGVLLA+ L+LIFTLP+GVI ATTNQQ 
Sbjct  428   VPQWWFYTLLTIVIGLAMLTCEGFGRQLQLPYWGVLLAIGLALIFTLPIGVIMATTNQQL  487

Query  640   GLNVIAELIIGYMYPGRPLASVTFKMYGlsslsqslmflSDFKLGHYMKIPPKSMFMVQL  461
             GLNVI ELIIGY+Y G+PLA+V FK YG  S +Q+++FL DFKLGHYMKIPPKSMF+VQL
Sbjct  488   GLNVITELIIGYIYSGKPLANVVFKTYGYISTAQAILFLQDFKLGHYMKIPPKSMFLVQL  547

Query  460   VGTLISCCVHFGTGWWLLTTVENICNPSKLPEGSQWTCPGDDVFYNASIIWGVVSPRRMF  281
             V T+I+  V+FGT WWLLTTV++IC+PS LPEGS WTCPGDD+FYNASIIWGVV P RM 
Sbjct  548   VETVIASSVYFGTAWWLLTTVKHICDPSNLPEGSPWTCPGDDIFYNASIIWGVVGPLRMS  607

Query  280   GNLGIYQATNYFFLVGFLAPIPVWYLGRKYPEKRWVSLINMPILISGAEGIPIVKSVNYV  101
             G LG+Y   NYFFL+G LAP PVW L   +PE++W+ LINMP++I G+  +P  + VNY 
Sbjct  608   GRLGLYSKMNYFFLIGILAPFPVWVLSHMFPEQKWIKLINMPLIIGGSGALPAARVVNYW  667

Query  100   CWFAVGLYFNLYVYRKHKGWWARHNYILSAGLD  2
             CW  VG++FN +VYR+ KGWWARHNYILSAGLD
Sbjct  668   CWGVVGMFFNFFVYRRFKGWWARHNYILSAGLD  700



>gb|KDP35526.1| hypothetical protein JCGZ_08964 [Jatropha curcas]
Length=745

 Score =   960 bits (2481),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 465/672 (69%), Positives = 576/672 (86%), Gaps = 0/672 (0%)
 Frame = -1

Query  2017  DEINDSPVEEVRLTVPITDDPTMPCVTFRTWVLGVTSCVILAFLNQFFGYRQNALYVSSV  1838
             +E NDSP+++VRLTVPITDDPT+PC+TFRTWVLG+ SC +LAF+NQFF YRQN LYVSSV
Sbjct  22    EEENDSPIDQVRLTVPITDDPTLPCLTFRTWVLGLISCAVLAFVNQFFQYRQNPLYVSSV  81

Query  1837  PAQIVVLPMGKLMAAYLPTKVVQIPGTKWSFSLNPGPFNIKEHVLITIFASSGSDFSYAV  1658
              AQIVVLP+GKLMAA LP K++Q+PGTKWSFSLNPGPFN+KEHVLITIFA+SGS+  YAV
Sbjct  82    AAQIVVLPIGKLMAASLPEKLIQVPGTKWSFSLNPGPFNLKEHVLITIFANSGSNPVYAV  141

Query  1657  SIITMMKAFYYRDIHPLAAVLLTFSTQMLGYGLAGIFKKFLIDSPYMWWPSNLVQVSLFR  1478
             +IIT++KAFY+R IH LAA LLT +TQMLGYG AG+F+KFL+DSPYMWWP+NLVQVSLFR
Sbjct  142   NIITIVKAFYHRKIHALAAFLLTLTTQMLGYGWAGVFRKFLVDSPYMWWPANLVQVSLFR  201

Query  1477  ALHDVETRPKGGLTRLQFFIIVLVCSFAYYVVPNYLFPSLTALSLLCWIWKNSVTAQQlg  1298
             ALH+ E RPKGGL+RLQFF+IVLV SFAYY+VPNYLF S+TALS +CWIWK+S+TAQQ+G
Sbjct  202   ALHEDEARPKGGLSRLQFFLIVLVSSFAYYIVPNYLFQSITALSFVCWIWKDSITAQQIG  261

Query  1297  sglkglgigSFALDWATVAAFQGSPLVTPDFAIINMLIGYVLVAYIAIPVWYWTNLFDAK  1118
             SGL GLGIGSFA DW+T+++F GSPL TP FA++N+L G+V++ YI IPV YWTN ++AK
Sbjct  262   SGLYGLGIGSFAFDWSTISSFLGSPLATPGFAVMNLLAGFVIILYIMIPVAYWTNSYEAK  321

Query  1117  KFPLFSSNVFDSNGQVYNISRVLNKKTFGFDQPGYDSYSNIYLSTAFVYTYGLSFATLAA  938
             +FPLFS +VF++ GQ Y+++ VLN  TF F++  YDSYS ++LS  FVY YGLSFA LAA
Sbjct  322   RFPLFSPHVFNATGQPYDVNLVLNSSTFSFNEQAYDSYSKVHLSIFFVYAYGLSFALLAA  381

Query  937   TVSHVALFHGRTIWEQTKESVQDKFSDIHTRLMRKNYEPVPQWWFYlllviivgvalvAC  758
             T+SHV LFHGRTIW QTK + +D F D+HTR+M++NYE VPQWWFY +L++++ ++++AC
Sbjct  382   TLSHVVLFHGRTIWHQTKATFEDNFGDLHTRIMKRNYEVVPQWWFYTILIVVIALSMLAC  441

Query  757   QRFGGQLQLPVWGVLLAVLLSLIFTLPVGVITATTNQQTGLNVIAELIIGYMYPGRPLAS  578
             + FG QLQLP WGVLL++ L+L FTLPVGVI ATTNQQ GLNVI ELIIGYMYPG+PLA+
Sbjct  442   EGFGRQLQLPYWGVLLSISLALFFTLPVGVIQATTNQQPGLNVITELIIGYMYPGKPLAN  501

Query  577   VTFKMYGlsslsqslmflSDFKLGHYMKIPPKSMFMVQLVGTLISCCVHFGTGWWLLTTV  398
             V FK YG  S+SQ++MFLSDFKLGHYMKIPPKSMF+VQLVGT+++   +FGTGWWLLT++
Sbjct  502   VAFKTYGYISMSQAIMFLSDFKLGHYMKIPPKSMFVVQLVGTVVASAAYFGTGWWLLTSI  561

Query  397   ENICNPSKLPEGSQWTCPGDDVFYNASIIWGVVSPRRMFGNLGIYQATNYFFLVGFLAPI  218
             + IC+  KLPEGS WTCPGDDVFYNASIIWG+V P RMFG LG+Y   NYFFL+G LAP+
Sbjct  562   DFICDVEKLPEGSPWTCPGDDVFYNASIIWGLVGPLRMFGRLGLYSKMNYFFLIGLLAPV  621

Query  217   PVWYLGRKYPEKRWVSLINMPILISGAEGIPIVKSVNYVCWFAVGLYFNLYVYRKHKGWW  38
              VW   R +PEK+W+ LIN+P+++SG   +P  ++VNY+ WF VG++FN  VY++ + WW
Sbjct  622   VVWGFSRMFPEKKWIKLINIPVILSGTGAMPPARAVNYISWFTVGIFFNFVVYKRFRKWW  681

Query  37    ARHNYILSAGLD  2
             ARHNYILSAGLD
Sbjct  682   ARHNYILSAGLD  693



>ref|XP_011040149.1| PREDICTED: oligopeptide transporter 1-like isoform X1 [Populus 
euphratica]
Length=766

 Score =   951 bits (2459),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 476/674 (71%), Positives = 586/674 (87%), Gaps = 0/674 (0%)
 Frame = -1

Query  2023  SADEINDSPVEEVRLTVPITDDPTMPCVTFRTWVLGVTSCVILAFLNQFFGYRQNALYVS  1844
             SA+E ND+P+E+VRLTVPITDDPT+PC+TFRTW+LG+TSC +LAF NQFFGYRQN L V+
Sbjct  40    SAEEANDTPIEQVRLTVPITDDPTLPCLTFRTWILGITSCALLAFANQFFGYRQNILSVT  99

Query  1843  SVPAQIVVLPMGKLMAAYLPTKVVQIPGTKWSFSLNPGPFNIKEHVLITIFASSGSDFSY  1664
             SV AQIVVLP+G+LMAA LP KV++ PGTKWSFSLNPGPFN+KEHVLITIFA+SGS+  Y
Sbjct  100   SVSAQIVVLPVGRLMAAILPHKVIRFPGTKWSFSLNPGPFNLKEHVLITIFANSGSNPVY  159

Query  1663  AVSIITMMKAFYYRDIHPLAAVLLTFSTQMLGYGLAGIFKKFLIDSPYMWWPSNLVQVSL  1484
             AV IIT++KAFY+  I  + A+ L+ +TQ+LGYG AGIF+KFL+DSPYMWWPSNLVQVSL
Sbjct  160   AVGIITIVKAFYHGRIDAVPAMFLSQTTQLLGYGWAGIFRKFLVDSPYMWWPSNLVQVSL  219

Query  1483  FRALHDVETRPKGGLTRLQFFIIVLVCSFAYYVVPNYLFPSLTALSLLCWIWKNSVTAQQ  1304
             FRALH+VE R KGGLTRLQFF++VL+ SFAYY+VP YLF S+TALS +CWIWK+SVTAQQ
Sbjct  220   FRALHEVEIRRKGGLTRLQFFLVVLISSFAYYIVPGYLFQSITALSFVCWIWKDSVTAQQ  279

Query  1303  lgsglkglgigSFALDWATVAAFQGSPLVTPDFAIINMLIGYVLVAYIAIPVWYWTNLFD  1124
             +GSGL+GLG+GSFA DW+TVA F GSPL TP FAIIN++ GY+++ YI IP+ YWTN ++
Sbjct  280   IGSGLRGLGVGSFAFDWSTVAGFLGSPLATPGFAIINIIFGYIIILYIIIPISYWTNSYN  339

Query  1123  AKKFPLFSSNVFDSNGQVYNISRVLNKKTFGFDQPGYDSYSNIYLSTAFVYTYGLSFATL  944
             AK+FP+FSS+VFD+NG+ Y++S VLN+ TF F++ GYD YS + LS  FVYTYGLSFA L
Sbjct  340   AKRFPIFSSHVFDANGKPYDVSTVLNETTFEFNRAGYDGYSKVNLSIFFVYTYGLSFAIL  399

Query  943   AATVSHVALFHGRTIWEQTKESVQDKFSDIHTRLMRKNYEPVPQWWFYlllviivgvalv  764
             AAT++HVALFHGR IW QTKE+++DK++D+HTR+M++NYE VPQWWF+++L+++ G+AL+
Sbjct  400   AATLTHVALFHGREIWYQTKETLKDKYADVHTRIMKRNYEAVPQWWFHIILIVVTGLALL  459

Query  763   ACQRFGGQLQLPVWGVLLAVLLSLIFTLPVGVITATTNQQTGLNVIAELIIGYMYPGRPL  584
              C+ FG QLQLP WGVLLA+ L+ +FTLP+GVITATTNQQ GLNVI ELIIGYMYPGRPL
Sbjct  460   TCEGFGRQLQLPYWGVLLAIGLAFVFTLPIGVITATTNQQPGLNVITELIIGYMYPGRPL  519

Query  583   ASVTFKMYGlsslsqslmflSDFKLGHYMKIPPKSMFMVQLVGTLISCCVHFGTGWWLLT  404
             A++TFK YG  S+SQ++MFLSDFKLGHYMKIPPKSMF+VQLVGTLI+  V+FGT WWLL 
Sbjct  520   ANITFKTYGYISMSQAIMFLSDFKLGHYMKIPPKSMFVVQLVGTLIASSVYFGTAWWLLN  579

Query  403   TVENICNPSKLPEGSQWTCPGDDVFYNASIIWGVVSPRRMFGNLGIYQATNYFFLVGFLA  224
             +VENICNPSKLPEGS WTCPGDDVFYNASIIWGVV P RMFG LG+Y   NYFFL+G LA
Sbjct  580   SVENICNPSKLPEGSPWTCPGDDVFYNASIIWGVVGPMRMFGRLGLYSKMNYFFLIGLLA  639

Query  223   PIPVWYLGRKYPEKRWVSLINMPILISGAEGIPIVKSVNYVCWFAVGLYFNLYVYRKHKG  44
             P+PVW + R +P  +W+ LIN+PI++ G  G+P  ++VNY+CWFAVG++FN  VY+++KG
Sbjct  640   PVPVWIVSRMFPNTKWIKLINVPIILGGTGGMPSARAVNYMCWFAVGIFFNFVVYKRYKG  699

Query  43    WWARHNYILSAGLD  2
             WW RHNYILSAGLD
Sbjct  700   WWVRHNYILSAGLD  713



>ref|XP_011040150.1| PREDICTED: oligopeptide transporter 1-like isoform X2 [Populus 
euphratica]
Length=748

 Score =   948 bits (2451),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 475/677 (70%), Positives = 585/677 (86%), Gaps = 0/677 (0%)
 Frame = -1

Query  2032  VESSADEINDSPVEEVRLTVPITDDPTMPCVTFRTWVLGVTSCVILAFLNQFFGYRQNAL  1853
             V    +E ND+P+E+VRLTVPITDDPT+PC+TFRTW+LG+TSC +LAF NQFFGYRQN L
Sbjct  19    VLDEKEEANDTPIEQVRLTVPITDDPTLPCLTFRTWILGITSCALLAFANQFFGYRQNIL  78

Query  1852  YVSSVPAQIVVLPMGKLMAAYLPTKVVQIPGTKWSFSLNPGPFNIKEHVLITIFASSGSD  1673
              V+SV AQIVVLP+G+LMAA LP KV++ PGTKWSFSLNPGPFN+KEHVLITIFA+SGS+
Sbjct  79    SVTSVSAQIVVLPVGRLMAAILPHKVIRFPGTKWSFSLNPGPFNLKEHVLITIFANSGSN  138

Query  1672  FSYAVSIITMMKAFYYRDIHPLAAVLLTFSTQMLGYGLAGIFKKFLIDSPYMWWPSNLVQ  1493
               YAV IIT++KAFY+  I  + A+ L+ +TQ+LGYG AGIF+KFL+DSPYMWWPSNLVQ
Sbjct  139   PVYAVGIITIVKAFYHGRIDAVPAMFLSQTTQLLGYGWAGIFRKFLVDSPYMWWPSNLVQ  198

Query  1492  VSLFRALHDVETRPKGGLTRLQFFIIVLVCSFAYYVVPNYLFPSLTALSLLCWIWKNSVT  1313
             VSLFRALH+VE R KGGLTRLQFF++VL+ SFAYY+VP YLF S+TALS +CWIWK+SVT
Sbjct  199   VSLFRALHEVEIRRKGGLTRLQFFLVVLISSFAYYIVPGYLFQSITALSFVCWIWKDSVT  258

Query  1312  AQQlgsglkglgigSFALDWATVAAFQGSPLVTPDFAIINMLIGYVLVAYIAIPVWYWTN  1133
             AQQ+GSGL+GLG+GSFA DW+TVA F GSPL TP FAIIN++ GY+++ YI IP+ YWTN
Sbjct  259   AQQIGSGLRGLGVGSFAFDWSTVAGFLGSPLATPGFAIINIIFGYIIILYIIIPISYWTN  318

Query  1132  LFDAKKFPLFSSNVFDSNGQVYNISRVLNKKTFGFDQPGYDSYSNIYLSTAFVYTYGLSF  953
              ++AK+FP+FSS+VFD+NG+ Y++S VLN+ TF F++ GYD YS + LS  FVYTYGLSF
Sbjct  319   SYNAKRFPIFSSHVFDANGKPYDVSTVLNETTFEFNRAGYDGYSKVNLSIFFVYTYGLSF  378

Query  952   ATLAATVSHVALFHGRTIWEQTKESVQDKFSDIHTRLMRKNYEPVPQWWFYlllviivgv  773
             A LAAT++HVALFHGR IW QTKE+++DK++D+HTR+M++NYE VPQWWF+++L+++ G+
Sbjct  379   AILAATLTHVALFHGREIWYQTKETLKDKYADVHTRIMKRNYEAVPQWWFHIILIVVTGL  438

Query  772   alvACQRFGGQLQLPVWGVLLAVLLSLIFTLPVGVITATTNQQTGLNVIAELIIGYMYPG  593
             AL+ C+ FG QLQLP WGVLLA+ L+ +FTLP+GVITATTNQQ GLNVI ELIIGYMYPG
Sbjct  439   ALLTCEGFGRQLQLPYWGVLLAIGLAFVFTLPIGVITATTNQQPGLNVITELIIGYMYPG  498

Query  592   RPLASVTFKMYGlsslsqslmflSDFKLGHYMKIPPKSMFMVQLVGTLISCCVHFGTGWW  413
             RPLA++TFK YG  S+SQ++MFLSDFKLGHYMKIPPKSMF+VQLVGTLI+  V+FGT WW
Sbjct  499   RPLANITFKTYGYISMSQAIMFLSDFKLGHYMKIPPKSMFVVQLVGTLIASSVYFGTAWW  558

Query  412   LLTTVENICNPSKLPEGSQWTCPGDDVFYNASIIWGVVSPRRMFGNLGIYQATNYFFLVG  233
             LL +VENICNPSKLPEGS WTCPGDDVFYNASIIWGVV P RMFG LG+Y   NYFFL+G
Sbjct  559   LLNSVENICNPSKLPEGSPWTCPGDDVFYNASIIWGVVGPMRMFGRLGLYSKMNYFFLIG  618

Query  232   FLAPIPVWYLGRKYPEKRWVSLINMPILISGAEGIPIVKSVNYVCWFAVGLYFNLYVYRK  53
              LAP+PVW + R +P  +W+ LIN+PI++ G  G+P  ++VNY+CWFAVG++FN  VY++
Sbjct  619   LLAPVPVWIVSRMFPNTKWIKLINVPIILGGTGGMPSARAVNYMCWFAVGIFFNFVVYKR  678

Query  52    HKGWWARHNYILSAGLD  2
             +KGWW RHNYILSAGLD
Sbjct  679   YKGWWVRHNYILSAGLD  695



>ref|XP_008218454.1| PREDICTED: oligopeptide transporter 1-like [Prunus mume]
Length=753

 Score =   937 bits (2422),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 455/682 (67%), Positives = 568/682 (83%), Gaps = 3/682 (0%)
 Frame = -1

Query  2038  SAVESSADEINDSPVEEVRLTVPITDDPTMPCVTFRTWVLGVTSCVILAFLNQFFGYRQN  1859
             S V+   DE+ND+P+E+VRLTV  TDDP++P +TFRTWVLG+ SC +LAF+NQFFGYRQN
Sbjct  20    SDVDVIDDEVNDNPIEQVRLTVSTTDDPSLPTLTFRTWVLGIISCSVLAFMNQFFGYRQN  79

Query  1858  ALYVSSVPAQIVVLPMGKLMAAYLPTKVVQIPGTKWSFSLNPGPFNIKEHVLITIFASSG  1679
              LYVSSV AQI+VLP+GKLMAA LP K ++ P TKWSFSLNPGPFN+KEHVLITIFA+SG
Sbjct  80    QLYVSSVSAQILVLPVGKLMAATLPEKPIRFPFTKWSFSLNPGPFNLKEHVLITIFANSG  139

Query  1678  SDFSYAVSIITMMKAFYYRDIHPLAAVLLTFSTQMLGYGLAGIFKKFLIDSPYMWWPSNL  1499
             S+  YAV+IIT++ AFY+R +HP AA LL  +TQMLGYG AGIF+K+L+DSPYMWWPSNL
Sbjct  140   SNSVYAVNIITIVLAFYHRKMHPAAAFLLAQTTQMLGYGWAGIFRKYLVDSPYMWWPSNL  199

Query  1498  VQVSLFRALHDVETRPKGGLTRLQFFIIVLVCSFAYYVVPNYLFPSLTALSLLCWIWKNS  1319
             VQVSLFRALH+ E RPKGG TRLQFF +V +CSF+YY+VP++LFPS++A S +CWIWK+S
Sbjct  200   VQVSLFRALHEKEKRPKGGRTRLQFFFMVFICSFSYYIVPSFLFPSISAFSFVCWIWKDS  259

Query  1318  VTAQQlgsglkglgigSFALDWATVAAFQGSPLVTPDFAIINMLIGYVLVAYIAIPVWYW  1139
             +TAQQ+GSG+ GLGIGSF +DW+TVA F GSPL TP FA IN+LIG+VL+ Y+  P+ YW
Sbjct  260   ITAQQIGSGMHGLGIGSFGIDWSTVAGFLGSPLATPGFATINILIGFVLIVYVVTPIAYW  319

Query  1138  TNLFDAKKFPLFSSNVFDSNGQVYNISRVLNKKTFGFDQPGYDSYSNIYLSTAFVYTYGL  959
              N +DA+KFP+FSS+ FDS GQ+YNIS VL++K F  +   Y+ YS +YLST F ++YGL
Sbjct  320   NNAYDARKFPIFSSHTFDSTGQIYNISSVLDQKNFDINMVRYNGYSKLYLSTFFAFSYGL  379

Query  958   SFATLAATVSHVALFHGRTIWE---QTKESVQDKFSDIHTRLMRKNYEPVPQWWFYlllv  788
             SFATL AT+SHV LFHGRTIW+   +T  +V+D+  DIHTRLM+KNYE VPQWWF+++LV
Sbjct  380   SFATLTATISHVGLFHGRTIWQMWKKTTSAVRDQVGDIHTRLMKKNYEAVPQWWFHIILV  439

Query  787   iivgvalvACQRFGGQLQLPVWGVLLAVLLSLIFTLPVGVITATTNQQTGLNVIAELIIG  608
             ++V +A+  C+ FG QLQLP WGVL+A  ++L FTLP+G+I ATTNQQ GLNVI EL+IG
Sbjct  440   LMVALAIFCCEGFGKQLQLPWWGVLMACGIALFFTLPIGIIQATTNQQPGLNVITELVIG  499

Query  607   YMYPGRPLASVTFKMYGlsslsqslmflSDFKLGHYMKIPPKSMFMVQLVGTLISCCVHF  428
             Y+YPG+PLA+V FK YG  S+SQ LMFL DFKLGHYMKIPPKSMF+VQLVGT+++  V+F
Sbjct  500   YIYPGKPLANVAFKTYGYISMSQGLMFLQDFKLGHYMKIPPKSMFVVQLVGTIVASSVYF  559

Query  427   GTGWWLLTTVENICNPSKLPEGSQWTCPGDDVFYNASIIWGVVSPRRMFGNLGIYQATNY  248
             GT WWLLTT+E+IC+PSKLPEGS WTCPGDDVFYNASIIWGV+ P RMF + G+Y   N+
Sbjct  560   GTSWWLLTTIEHICDPSKLPEGSPWTCPGDDVFYNASIIWGVIGPLRMFTDKGVYPELNW  619

Query  247   FFLVGFLAPIPVWYLGRKYPEKRWVSLINMPILISGAEGIPIVKSVNYVCWFAVGLYFNL  68
             FFL+G LAP+PVW L +++P +RW+ LINMPI++     +P  ++VNY+ W  VG++FN 
Sbjct  620   FFLIGLLAPVPVWLLSKQFPNQRWIKLINMPIILGATGYMPPARAVNYLTWLTVGIFFNF  679

Query  67    YVYRKHKGWWARHNYILSAGLD  2
             YVYRK+KGWWARHNYILSA LD
Sbjct  680   YVYRKYKGWWARHNYILSAALD  701



>ref|XP_006474840.1| PREDICTED: oligopeptide transporter 1-like [Citrus sinensis]
Length=754

 Score =   931 bits (2407),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 460/678 (68%), Positives = 558/678 (82%), Gaps = 3/678 (0%)
 Frame = -1

Query  2026  SSADEINDSPVEEVRLTVPITDDPTMPCVTFRTWVLGVTSCVILAFLNQFFGYRQNALYV  1847
             +  +E+ND+P+EEVRLTVPITDDP+ P +TFRTW+LG+TSC +LAF+NQFFGYRQN L V
Sbjct  25    NGGEEVNDNPIEEVRLTVPITDDPSQPVLTFRTWILGITSCGLLAFVNQFFGYRQNQLSV  84

Query  1846  SSVPAQIVVLPMGKLMAAYLPTKVVQIPGTKWSFSLNPGPFNIKEHVLITIFASSGSDFS  1667
              SV AQI+VLP+GKLMAA LPTK +++P TKWSFSLNPGPFN+KEHVLITIFA  G+   
Sbjct  85    GSVSAQILVLPIGKLMAATLPTKQMRVPFTKWSFSLNPGPFNLKEHVLITIFAGCGASGV  144

Query  1666  YAVSIITMMKAFYYRDIHPLAAVLLTFSTQMLGYGLAGIFKKFLIDSPYMWWPSNLVQVS  1487
             YAV+IIT++KAFY R +HP+AA+LL  +TQ+LGYG AGIF+K+L+DSPYMWWPSNLVQVS
Sbjct  145   YAVNIITIVKAFYNRSLHPVAAMLLVQTTQLLGYGWAGIFRKYLVDSPYMWWPSNLVQVS  204

Query  1486  LFRALHDVETRPKGGLTRLQFFIIVLVCSFAYYVVPNYLFPSLTALSLLCWIWKNSVTAQ  1307
             LFRALH+ E RPKGGLTRLQFF++V V SF YY++P YLFPSL+ALS +C IWK+S+TAQ
Sbjct  205   LFRALHEKERRPKGGLTRLQFFLLVFVSSFGYYIIPGYLFPSLSALSFVCLIWKDSITAQ  264

Query  1306  QlgsglkglgigSFALDWATVAAFQGSPLVTPDFAIINMLIGYVLVAYIAIPVWYWTNLF  1127
             +LGSG  GLGIGSF LDW+TVA F GSPL TP FAI N+L GY L  Y+ +P+ YW+N F
Sbjct  265   KLGSGQHGLGIGSFGLDWSTVAGFLGSPLATPFFAIANILAGYFLFLYVLVPIAYWSNAF  324

Query  1126  DAKKFPLFSSNVFDSNGQVYNISRVLNKKTFGFDQPGYDSYSNIYLSTAFVYTYGLSFAT  947
             +AKKFPLFSS  FDS+GQVYNI+R+LN K F  ++ GY +YS +Y+S  F Y YGLSFAT
Sbjct  325   EAKKFPLFSSKTFDSDGQVYNITRILNDKAFDLNEIGYRNYSKLYVSVIFAYIYGLSFAT  384

Query  946   LAATVSHVALFHGRTIWE---QTKESVQDKFSDIHTRLMRKNYEPVPQWWFYlllviivg  776
             L A++SHVALF G+TIWE   +T  +V DKF D+HTRLM+KNYE VPQWWF  +LV+   
Sbjct  385   LMASISHVALFEGKTIWEMWKKTAAAVNDKFGDVHTRLMKKNYEAVPQWWFQAILVLTFA  444

Query  775   valvACQRFGGQLQLPVWGVLLAVLLSLIFTLPVGVITATTNQQTGLNVIAELIIGYMYP  596
             ++L AC+ FG QLQLP WG+LLA  ++  FTLPVGVI ATTN QTGLNVI EL+IGYMYP
Sbjct  445   LSLYACEGFGKQLQLPWWGLLLACGMAFFFTLPVGVIQATTNLQTGLNVITELVIGYMYP  504

Query  595   GRPLASVTFKMYGlsslsqslmflSDFKLGHYMKIPPKSMFMVQLVGTLISCCVHFGTGW  416
             G+PLA+VTFK YG  S+SQ+L FL DFKLGHYMK+PPKSMF+VQLVGTL++   +FGT W
Sbjct  505   GKPLANVTFKTYGYISMSQALSFLGDFKLGHYMKVPPKSMFIVQLVGTLVASTAYFGTAW  564

Query  415   WLLTTVENICNPSKLPEGSQWTCPGDDVFYNASIIWGVVSPRRMFGNLGIYQATNYFFLV  236
             WLLT++++ICNPS LPEGS WTCPGD+VFYNASIIWGVV P RMF N G Y   N+FFL+
Sbjct  565   WLLTSIDHICNPSLLPEGSPWTCPGDEVFYNASIIWGVVGPLRMFTNYGNYPQMNWFFLI  624

Query  235   GFLAPIPVWYLGRKYPEKRWVSLINMPILISGAEGIPIVKSVNYVCWFAVGLYFNLYVYR  56
             GFLAP P W L RK+PEK+W+  I+MPIL+ G   +P  K+VNY  W AVG++FN YV+R
Sbjct  625   GFLAPFPGWLLSRKFPEKKWIKNIHMPILLGGPLNLPSAKAVNYTSWAAVGIFFNYYVFR  684

Query  55    KHKGWWARHNYILSAGLD  2
             ++KGWWARHNYILSA LD
Sbjct  685   RYKGWWARHNYILSAALD  702



>ref|XP_006452634.1| hypothetical protein CICLE_v10007552mg [Citrus clementina]
 gb|ESR65874.1| hypothetical protein CICLE_v10007552mg [Citrus clementina]
Length=754

 Score =   931 bits (2406),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 460/678 (68%), Positives = 558/678 (82%), Gaps = 3/678 (0%)
 Frame = -1

Query  2026  SSADEINDSPVEEVRLTVPITDDPTMPCVTFRTWVLGVTSCVILAFLNQFFGYRQNALYV  1847
             +  +E+ND+P+EEVRLTVPITDDP+ P +TFRTW+LG+TSC +LAF+NQFFGYRQN L V
Sbjct  25    NGGEEVNDNPIEEVRLTVPITDDPSQPVLTFRTWILGITSCGLLAFVNQFFGYRQNQLSV  84

Query  1846  SSVPAQIVVLPMGKLMAAYLPTKVVQIPGTKWSFSLNPGPFNIKEHVLITIFASSGSDFS  1667
              SV AQI+VLP+GKLMAA LPTK +++P TKWSFSLNPGPFN+KEHVLITIFA  G+   
Sbjct  85    GSVSAQILVLPIGKLMAATLPTKQMRVPFTKWSFSLNPGPFNLKEHVLITIFAGCGASGV  144

Query  1666  YAVSIITMMKAFYYRDIHPLAAVLLTFSTQMLGYGLAGIFKKFLIDSPYMWWPSNLVQVS  1487
             YAV+IIT++KAFY R +HP+AA+LL  +TQ+LGYG AGIF+K+L+DSPYMWWPSNLVQVS
Sbjct  145   YAVNIITIVKAFYNRSLHPVAAMLLVQTTQLLGYGWAGIFRKYLVDSPYMWWPSNLVQVS  204

Query  1486  LFRALHDVETRPKGGLTRLQFFIIVLVCSFAYYVVPNYLFPSLTALSLLCWIWKNSVTAQ  1307
             LFRALH+ E RPKGGLTRLQFF++V V SF YY++P YLFPSL+ALS +C IWK+S+TAQ
Sbjct  205   LFRALHEKERRPKGGLTRLQFFLLVFVSSFGYYIIPGYLFPSLSALSFVCLIWKDSITAQ  264

Query  1306  QlgsglkglgigSFALDWATVAAFQGSPLVTPDFAIINMLIGYVLVAYIAIPVWYWTNLF  1127
             +LGSG  GLGIGSF LDW+TVA F GSPL TP FAI N+L GY L  Y+ +P+ YW+N F
Sbjct  265   KLGSGQHGLGIGSFGLDWSTVAGFLGSPLATPFFAIANILAGYFLFLYVLVPIAYWSNAF  324

Query  1126  DAKKFPLFSSNVFDSNGQVYNISRVLNKKTFGFDQPGYDSYSNIYLSTAFVYTYGLSFAT  947
             +AKKFPLFSS  FDS+GQVYNI+R+LN K F  ++ GY +YS +Y+S  F Y YGLSFAT
Sbjct  325   EAKKFPLFSSKTFDSDGQVYNITRILNDKAFDLNEIGYRNYSKLYVSVIFAYIYGLSFAT  384

Query  946   LAATVSHVALFHGRTIWE---QTKESVQDKFSDIHTRLMRKNYEPVPQWWFYlllviivg  776
             L A++SHVALF G+TIWE   +T  +V DKF D+HTRLM+KNYE VPQWWF  +LV+   
Sbjct  385   LMASISHVALFEGKTIWEMWKKTATAVNDKFGDVHTRLMKKNYEAVPQWWFQAILVLTFA  444

Query  775   valvACQRFGGQLQLPVWGVLLAVLLSLIFTLPVGVITATTNQQTGLNVIAELIIGYMYP  596
             ++L AC+ FG QLQLP WG+LLA  ++  FTLPVGVI ATTN QTGLNVI EL+IGYMYP
Sbjct  445   LSLYACEGFGKQLQLPWWGLLLACGMAFFFTLPVGVIQATTNLQTGLNVITELVIGYMYP  504

Query  595   GRPLASVTFKMYGlsslsqslmflSDFKLGHYMKIPPKSMFMVQLVGTLISCCVHFGTGW  416
             G+PLA+VTFK YG  S+SQ+L FL DFKLGHYMK+PPKSMF+VQLVGTL++   +FGT W
Sbjct  505   GKPLANVTFKTYGYISMSQALSFLGDFKLGHYMKVPPKSMFIVQLVGTLVASTAYFGTAW  564

Query  415   WLLTTVENICNPSKLPEGSQWTCPGDDVFYNASIIWGVVSPRRMFGNLGIYQATNYFFLV  236
             WLLT++++ICNPS LPEGS WTCPGD+VFYNASIIWGVV P RMF N G Y   N+FFL+
Sbjct  565   WLLTSIDHICNPSLLPEGSPWTCPGDEVFYNASIIWGVVGPLRMFTNYGNYPQMNWFFLI  624

Query  235   GFLAPIPVWYLGRKYPEKRWVSLINMPILISGAEGIPIVKSVNYVCWFAVGLYFNLYVYR  56
             GFLAP P W L RK+PEK+W+  I+MPIL+ G   +P  K+VNY  W AVG++FN YV+R
Sbjct  625   GFLAPFPGWLLSRKFPEKKWIKNIHMPILLGGPLNLPSAKAVNYTSWAAVGIFFNYYVFR  684

Query  55    KHKGWWARHNYILSAGLD  2
             ++KGWWARHNYILSA LD
Sbjct  685   RYKGWWARHNYILSAALD  702



>gb|KGN44392.1| hypothetical protein Csa_7G279240 [Cucumis sativus]
Length=755

 Score =   931 bits (2405),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 452/687 (66%), Positives = 572/687 (83%), Gaps = 3/687 (0%)
 Frame = -1

Query  2053  ENTGISAVESSADEINDSPVEEVRLTVPITDDPTMPCVTFRTWVLGVTSCVILAFLNQFF  1874
             E    S  + + +E NDSP+EEVRLTVP TDDP+ P +TFRTW+LG+TSC +LAF+NQFF
Sbjct  17    EENLESNFQKTREEENDSPIEEVRLTVPPTDDPSEPALTFRTWILGLTSCCLLAFVNQFF  76

Query  1873  GYRQNALYVSSVPAQIVVLPMGKLMAAYLPTKVVQIPGTKWSFSLNPGPFNIKEHVLITI  1694
             G+RQN LYVSSV AQI+VLP+GKLMAA +P+   ++P TKWSFSLNPGPF +KEHVLITI
Sbjct  77    GFRQNQLYVSSVSAQILVLPLGKLMAATIPSSSFRVPFTKWSFSLNPGPFTLKEHVLITI  136

Query  1693  FASSGSDFSYAVSIITMMKAFYYRDIHPLAAVLLTFSTQMLGYGLAGIFKKFLIDSPYMW  1514
             FA+SGS+  YA++I+T++KAFY+R++HPLAA+LL+ +TQMLGYG AG+F+++L+DSPYMW
Sbjct  137   FANSGSNSVYALNIVTIVKAFYHRNLHPLAAMLLSQTTQMLGYGWAGLFRRYLVDSPYMW  196

Query  1513  WPSNLVQVSLFRALHDVETRPKGGLTRLQFFIIVLVCSFAYYVVPNYLFPSLTALSLLCW  1334
             WP+NLVQVSLFRALH+ + RP+GG TRLQFF +V + SFAYY+VP+YLFPS++ +S +C 
Sbjct  197   WPANLVQVSLFRALHEKDKRPRGGHTRLQFFFMVFISSFAYYLVPSYLFPSISCISFVCL  256

Query  1333  IWKNSVTAQQlgsglkglgigSFALDWATVAAFQGSPLVTPDFAIINMLIGYVLVAYIAI  1154
             IW+NS+TAQQ+GSGL+GLGIGSF +DW+TVA F GSPL TP FAI+N+LIG+ +V Y+  
Sbjct  257   IWRNSITAQQIGSGLRGLGIGSFGIDWSTVAGFLGSPLATPGFAIVNILIGFFMVVYVIN  316

Query  1153  PVWYWTNLFDAKKFPLFSSNVFDSNGQVYNISRVLNKKTFGFDQPGYDSYSNIYLSTAFV  974
             P+ YW+N ++AK+FP+ S++ FD  G+ YNISR+LN KTF  DQ  YD YS +YLS  F 
Sbjct  317   PIVYWSNFYEAKRFPMISAHTFDFTGKTYNISRILNAKTFDIDQANYDGYSKLYLSAFFA  376

Query  973   YTYGLSFATLAATVSHVALFHGRTIWE---QTKESVQDKFSDIHTRLMRKNYEPVPQWWF  803
             +TYGLSFATLAAT+SHVALFHG+TIW+   +T  +V D+  D+HTRLM+KNY+ VPQWWF
Sbjct  377   FTYGLSFATLAATISHVALFHGKTIWQMWRRTTSAVGDQLGDVHTRLMKKNYKEVPQWWF  436

Query  802   YlllviivgvalvACQRFGGQLQLPVWGVLLAVLLSLIFTLPVGVITATTNQQTGLNVIA  623
             Y +L+I+V +AL AC+ F  QLQLP WG+LLA  ++L FTLP+G+I ATTN Q GLNVI 
Sbjct  437   YTVLIIMVALALYACEGFDKQLQLPWWGILLACGIALFFTLPIGIIQATTNWQPGLNVIT  496

Query  622   ELIIGYMYPGRPLASVTFKMYGlsslsqslmflSDFKLGHYMKIPPKSMFMVQLVGTLIS  443
             ELIIGYMYPGRPLA+VTFK YG  S+SQ+L F+SDFKLGHYMKIPP+SMF+VQLVGT+++
Sbjct  497   ELIIGYMYPGRPLANVTFKTYGYISMSQALTFVSDFKLGHYMKIPPRSMFLVQLVGTVVA  556

Query  442   CCVHFGTGWWLLTTVENICNPSKLPEGSQWTCPGDDVFYNASIIWGVVSPRRMFGNLGIY  263
               V+FGT WWLLTT+++IC+P+ LPEGS WTCPGDDVFYNASIIWGVV P RMFG LG+Y
Sbjct  557   SSVYFGTAWWLLTTIDHICDPALLPEGSPWTCPGDDVFYNASIIWGVVGPLRMFGKLGVY  616

Query  262   QATNYFFLVGFLAPIPVWYLGRKYPEKRWVSLINMPILISGAEGIPIVKSVNYVCWFAVG  83
                N+FFLVG LAP+PVW+L R++P + W+ LIN+PI+     GIP  +SVNY+ W  VG
Sbjct  617   PEMNWFFLVGLLAPVPVWWLSRQFPNQEWIRLINVPIIFGAGLGIPPARSVNYLMWGVVG  676

Query  82    LYFNLYVYRKHKGWWARHNYILSAGLD  2
             ++FN Y+YRKHKGWWARHNYILSA LD
Sbjct  677   IFFNFYIYRKHKGWWARHNYILSAALD  703



>ref|XP_004151247.1| PREDICTED: oligopeptide transporter 1-like, partial [Cucumis 
sativus]
Length=764

 Score =   931 bits (2405),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 452/687 (66%), Positives = 572/687 (83%), Gaps = 3/687 (0%)
 Frame = -1

Query  2053  ENTGISAVESSADEINDSPVEEVRLTVPITDDPTMPCVTFRTWVLGVTSCVILAFLNQFF  1874
             E    S  + + +E NDSP+EEVRLTVP TDDP+ P +TFRTW+LG+TSC +LAF+NQFF
Sbjct  26    EENLESNFQKTREEENDSPIEEVRLTVPPTDDPSEPALTFRTWILGLTSCCLLAFVNQFF  85

Query  1873  GYRQNALYVSSVPAQIVVLPMGKLMAAYLPTKVVQIPGTKWSFSLNPGPFNIKEHVLITI  1694
             G+RQN LYVSSV AQI+VLP+GKLMAA +P+   ++P TKWSFSLNPGPF +KEHVLITI
Sbjct  86    GFRQNQLYVSSVSAQILVLPLGKLMAATIPSSSFRVPFTKWSFSLNPGPFTLKEHVLITI  145

Query  1693  FASSGSDFSYAVSIITMMKAFYYRDIHPLAAVLLTFSTQMLGYGLAGIFKKFLIDSPYMW  1514
             FA+SGS+  YA++I+T++KAFY+R++HPLAA+LL+ +TQMLGYG AG+F+++L+DSPYMW
Sbjct  146   FANSGSNSVYALNIVTIVKAFYHRNLHPLAAMLLSQTTQMLGYGWAGLFRRYLVDSPYMW  205

Query  1513  WPSNLVQVSLFRALHDVETRPKGGLTRLQFFIIVLVCSFAYYVVPNYLFPSLTALSLLCW  1334
             WP+NLVQVSLFRALH+ + RP+GG TRLQFF +V + SFAYY+VP+YLFPS++ +S +C 
Sbjct  206   WPANLVQVSLFRALHEKDKRPRGGHTRLQFFFMVFISSFAYYLVPSYLFPSISCISFVCL  265

Query  1333  IWKNSVTAQQlgsglkglgigSFALDWATVAAFQGSPLVTPDFAIINMLIGYVLVAYIAI  1154
             IW+NS+TAQQ+GSGL+GLGIGSF +DW+TVA F GSPL TP FAI+N+LIG+ +V Y+  
Sbjct  266   IWRNSITAQQIGSGLRGLGIGSFGIDWSTVAGFLGSPLATPGFAIVNILIGFFMVVYVIN  325

Query  1153  PVWYWTNLFDAKKFPLFSSNVFDSNGQVYNISRVLNKKTFGFDQPGYDSYSNIYLSTAFV  974
             P+ YW+N ++AK+FP+ S++ FD  G+ YNISR+LN KTF  DQ  YD YS +YLS  F 
Sbjct  326   PIVYWSNFYEAKRFPMISAHTFDFTGKTYNISRILNAKTFDIDQANYDGYSKLYLSAFFA  385

Query  973   YTYGLSFATLAATVSHVALFHGRTIWE---QTKESVQDKFSDIHTRLMRKNYEPVPQWWF  803
             +TYGLSFATLAAT+SHVALFHG+TIW+   +T  +V D+  D+HTRLM+KNY+ VPQWWF
Sbjct  386   FTYGLSFATLAATISHVALFHGKTIWQMWRRTTSAVGDQLGDVHTRLMKKNYKEVPQWWF  445

Query  802   YlllviivgvalvACQRFGGQLQLPVWGVLLAVLLSLIFTLPVGVITATTNQQTGLNVIA  623
             Y +L+I+V +AL AC+ F  QLQLP WG+LLA  ++L FTLP+G+I ATTN Q GLNVI 
Sbjct  446   YTVLIIMVALALYACEGFDKQLQLPWWGILLACGIALFFTLPIGIIQATTNWQPGLNVIT  505

Query  622   ELIIGYMYPGRPLASVTFKMYGlsslsqslmflSDFKLGHYMKIPPKSMFMVQLVGTLIS  443
             ELIIGYMYPGRPLA+VTFK YG  S+SQ+L F+SDFKLGHYMKIPP+SMF+VQLVGT+++
Sbjct  506   ELIIGYMYPGRPLANVTFKTYGYISMSQALTFVSDFKLGHYMKIPPRSMFLVQLVGTVVA  565

Query  442   CCVHFGTGWWLLTTVENICNPSKLPEGSQWTCPGDDVFYNASIIWGVVSPRRMFGNLGIY  263
               V+FGT WWLLTT+++IC+P+ LPEGS WTCPGDDVFYNASIIWGVV P RMFG LG+Y
Sbjct  566   SSVYFGTAWWLLTTIDHICDPALLPEGSPWTCPGDDVFYNASIIWGVVGPLRMFGKLGVY  625

Query  262   QATNYFFLVGFLAPIPVWYLGRKYPEKRWVSLINMPILISGAEGIPIVKSVNYVCWFAVG  83
                N+FFLVG LAP+PVW+L R++P + W+ LIN+PI+     GIP  +SVNY+ W  VG
Sbjct  626   PEMNWFFLVGLLAPVPVWWLSRQFPNQEWIRLINVPIIFGAGLGIPPARSVNYLMWGVVG  685

Query  82    LYFNLYVYRKHKGWWARHNYILSAGLD  2
             ++FN Y+YRKHKGWWARHNYILSA LD
Sbjct  686   IFFNFYIYRKHKGWWARHNYILSAALD  712



>ref|XP_008384590.1| PREDICTED: oligopeptide transporter 1-like [Malus domestica]
Length=750

 Score =   930 bits (2404),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 450/682 (66%), Positives = 565/682 (83%), Gaps = 3/682 (0%)
 Frame = -1

Query  2038  SAVESSADEINDSPVEEVRLTVPITDDPTMPCVTFRTWVLGVTSCVILAFLNQFFGYRQN  1859
             S V+   DE+NDSP+E+VRLTVPITDDP+ P +TFRTWVLG+ SC +LAF+NQFFGYRQN
Sbjct  17    SNVDVIDDEVNDSPIEQVRLTVPITDDPSEPTLTFRTWVLGIISCSVLAFVNQFFGYRQN  76

Query  1858  ALYVSSVPAQIVVLPMGKLMAAYLPTKVVQIPGTKWSFSLNPGPFNIKEHVLITIFASSG  1679
              LYVSSV AQI+VLP+GKLMAA LP + +++P   WSFSLNPGPFN+KEHVLITIFA+SG
Sbjct  77    QLYVSSVSAQILVLPLGKLMAATLPKRRIRLPFRNWSFSLNPGPFNLKEHVLITIFANSG  136

Query  1678  SDFSYAVSIITMMKAFYYRDIHPLAAVLLTFSTQMLGYGLAGIFKKFLIDSPYMWWPSNL  1499
             S+  YAV+IIT++ AFY+R +HP AA LL  +TQMLGYG AG+F+K+L+DSPYMWWPSNL
Sbjct  137   SNSVYAVNIITIVMAFYHRPMHPAAAFLLAQTTQMLGYGWAGLFRKYLVDSPYMWWPSNL  196

Query  1498  VQVSLFRALHDVETRPKGGLTRLQFFIIVLVCSFAYYVVPNYLFPSLTALSLLCWIWKNS  1319
             VQVSLFRALH+ E RPKGG TRLQFF +V +CSFAYY+VP++LFPS++A S +CWI+K+S
Sbjct  197   VQVSLFRALHEKEKRPKGGRTRLQFFFMVFICSFAYYIVPSFLFPSISAFSFVCWIYKDS  256

Query  1318  VTAQQlgsglkglgigSFALDWATVAAFQGSPLVTPDFAIINMLIGYVLVAYIAIPVWYW  1139
             +TAQQ+GSG+ GLGIGSF LDW+TVA F GSPL TP FA IN+LIG+VL+ YI  P+ YW
Sbjct  257   ITAQQIGSGMHGLGIGSFGLDWSTVAGFLGSPLATPGFATINILIGFVLIVYIVTPIAYW  316

Query  1138  TNLFDAKKFPLFSSNVFDSNGQVYNISRVLNKKTFGFDQPGYDSYSNIYLSTAFVYTYGL  959
              N +DA+KFP+ +S+ FDS GQ YNISRVL++K F  +  GY+ YS +YLST F ++YGL
Sbjct  317   NNAYDAQKFPIITSHTFDSTGQSYNISRVLDQKNFDINMVGYNGYSKLYLSTFFAFSYGL  376

Query  958   SFATLAATVSHVALFHGRTI---WEQTKESVQDKFSDIHTRLMRKNYEPVPQWWFYlllv  788
             SFATL AT+SHVALFHGRTI   W++T  +V+D+  DIHTRLM+KNY+ VPQWWF ++LV
Sbjct  377   SFATLTATISHVALFHGRTIWKMWKKTTSAVKDQIGDIHTRLMKKNYDAVPQWWFQIILV  436

Query  787   iivgvalvACQRFGGQLQLPVWGVLLAVLLSLIFTLPVGVITATTNQQTGLNVIAELIIG  608
              +V +A+  C+ FG QLQLP WGVL+A  ++L FTLP+G+I ATTNQQ GLNVI EL+IG
Sbjct  437   SMVALAIFTCEGFGKQLQLPWWGVLMACGIALFFTLPIGIIQATTNQQPGLNVITELLIG  496

Query  607   YMYPGRPLASVTFKMYGlsslsqslmflSDFKLGHYMKIPPKSMFMVQLVGTLISCCVHF  428
             Y+YPG+P+A+V FK YG  S+SQ+L FL DFKLGHYMKIPPKSMF+VQLVGTL++  V+F
Sbjct  497   YIYPGKPVANVAFKTYGYISMSQALNFLGDFKLGHYMKIPPKSMFVVQLVGTLVASSVYF  556

Query  427   GTGWWLLTTVENICNPSKLPEGSQWTCPGDDVFYNASIIWGVVSPRRMFGNLGIYQATNY  248
             GT WWL+T++E IC+P+KLP GS WTCPGDDVFYNASIIWGV+ P RMF   G+Y   N+
Sbjct  557   GTSWWLITSIEYICDPAKLPTGSPWTCPGDDVFYNASIIWGVIGPLRMFAGKGVYPEMNW  616

Query  247   FFLVGFLAPIPVWYLGRKYPEKRWVSLINMPILISGAEGIPIVKSVNYVCWFAVGLYFNL  68
             FFL+G LAP+P+W+L +K+P ++W+ LINMPI++     +P  + VNY+ W +VG++FN 
Sbjct  617   FFLIGLLAPVPIWFLSKKFPNQKWIKLINMPIILGATGSMPPARXVNYLTWLSVGIFFNF  676

Query  67    YVYRKHKGWWARHNYILSAGLD  2
             YVYRK+KGWWARHNYILSA LD
Sbjct  677   YVYRKYKGWWARHNYILSAALD  698



>ref|XP_008463021.1| PREDICTED: oligopeptide transporter 1-like isoform X2 [Cucumis 
melo]
Length=755

 Score =   930 bits (2403),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 453/687 (66%), Positives = 574/687 (84%), Gaps = 3/687 (0%)
 Frame = -1

Query  2053  ENTGISAVESSADEINDSPVEEVRLTVPITDDPTMPCVTFRTWVLGVTSCVILAFLNQFF  1874
             E T  S  + + +E NDSP+EEVRLTVP TDDP+ P +TFRTW+LG+TSC +LAF+NQFF
Sbjct  17    EETLESNFQKTREEENDSPIEEVRLTVPPTDDPSEPALTFRTWILGLTSCCLLAFVNQFF  76

Query  1873  GYRQNALYVSSVPAQIVVLPMGKLMAAYLPTKVVQIPGTKWSFSLNPGPFNIKEHVLITI  1694
             G+RQN LYVSSV AQI+VLP+GKLMAA +P+   ++P TKWSFSLNPGPF +KEHVLITI
Sbjct  77    GFRQNQLYVSSVSAQILVLPLGKLMAATIPSTSFRVPLTKWSFSLNPGPFTLKEHVLITI  136

Query  1693  FASSGSDFSYAVSIITMMKAFYYRDIHPLAAVLLTFSTQMLGYGLAGIFKKFLIDSPYMW  1514
             FA+SGS+  YA++I+T++KAFY+R++HPLAA+LL+ +TQMLGYG AG+F+++L+DSPYMW
Sbjct  137   FANSGSNSVYALNIVTIVKAFYHRNLHPLAAMLLSQTTQMLGYGWAGLFRRYLVDSPYMW  196

Query  1513  WPSNLVQVSLFRALHDVETRPKGGLTRLQFFIIVLVCSFAYYVVPNYLFPSLTALSLLCW  1334
             WP+NLVQVSLFRALH+ + RP+GG TRLQFF +V + SFAYY+VP+YLFPS++ +S +C 
Sbjct  197   WPANLVQVSLFRALHEKDKRPRGGHTRLQFFFMVFISSFAYYLVPSYLFPSISCISFVCL  256

Query  1333  IWKNSVTAQQlgsglkglgigSFALDWATVAAFQGSPLVTPDFAIINMLIGYVLVAYIAI  1154
             IW+NS+TAQQ+GSGL+GLGIGSF +DW+TVA F GSPL TP FAI+N+LIG+ +V Y+  
Sbjct  257   IWRNSITAQQIGSGLRGLGIGSFGIDWSTVAGFLGSPLATPAFAIVNVLIGFFMVVYVIN  316

Query  1153  PVWYWTNLFDAKKFPLFSSNVFDSNGQVYNISRVLNKKTFGFDQPGYDSYSNIYLSTAFV  974
             P+ YW+N +DAK+FP+ S++ FD  G+ YNISR+LN KTF  DQ  YD YS +YLS  F 
Sbjct  317   PIVYWSNFYDAKRFPMISAHTFDFTGKTYNISRILNAKTFDIDQANYDGYSKLYLSAFFA  376

Query  973   YTYGLSFATLAATVSHVALFHGRTIWE---QTKESVQDKFSDIHTRLMRKNYEPVPQWWF  803
             +TYGLSFATLAAT+SHVALFHG+TIW+   +T  +V D+  D+HTRLM+KNY+ VPQWWF
Sbjct  377   FTYGLSFATLAATISHVALFHGKTIWQMWRRTTSAVGDQLGDVHTRLMKKNYKEVPQWWF  436

Query  802   YlllviivgvalvACQRFGGQLQLPVWGVLLAVLLSLIFTLPVGVITATTNQQTGLNVIA  623
             Y +L+I+V +AL AC+ F  QLQLP WG+LLA  ++L FTLP+G+I ATTN Q GLNVI 
Sbjct  437   YTVLIIMVALALYACEGFDKQLQLPWWGILLACGIALFFTLPIGIIQATTNWQPGLNVIT  496

Query  622   ELIIGYMYPGRPLASVTFKMYGlsslsqslmflSDFKLGHYMKIPPKSMFMVQLVGTLIS  443
             ELIIGYMYPG+PLA+VTFK YG  S+SQ+L F+SDFKLGHYMKIPP+SMF+VQLVGT+++
Sbjct  497   ELIIGYMYPGKPLANVTFKTYGYISMSQALTFVSDFKLGHYMKIPPRSMFLVQLVGTVVA  556

Query  442   CCVHFGTGWWLLTTVENICNPSKLPEGSQWTCPGDDVFYNASIIWGVVSPRRMFGNLGIY  263
               V+FGT WWLLTTV++IC+P+ LPEGS WTCPGDDVFYNASIIWGVV P RMFG LG+Y
Sbjct  557   SSVYFGTAWWLLTTVDHICDPALLPEGSPWTCPGDDVFYNASIIWGVVGPLRMFGKLGVY  616

Query  262   QATNYFFLVGFLAPIPVWYLGRKYPEKRWVSLINMPILISGAEGIPIVKSVNYVCWFAVG  83
                N+FFLVG LAP+PVW+L R++P ++W+ LIN+PI+     GIP  +SVNY+ W  VG
Sbjct  617   PEMNWFFLVGLLAPVPVWWLSRQFPNQKWIRLINVPIIFGAGLGIPPARSVNYLMWGVVG  676

Query  82    LYFNLYVYRKHKGWWARHNYILSAGLD  2
             ++FN Y+YRK+KGWWARHNYILSA LD
Sbjct  677   IFFNFYIYRKYKGWWARHNYILSAALD  703



>gb|KDO59178.1| hypothetical protein CISIN_1g0044241mg, partial [Citrus sinensis]
Length=728

 Score =   930 bits (2403),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 460/676 (68%), Positives = 557/676 (82%), Gaps = 3/676 (0%)
 Frame = -1

Query  2020  ADEINDSPVEEVRLTVPITDDPTMPCVTFRTWVLGVTSCVILAFLNQFFGYRQNALYVSS  1841
              +E+ND+P+EEVRLTVPITDDP+ P +TFRTW+LG+TSC +LAF+NQFFGYRQN L V S
Sbjct  1     GEEVNDNPIEEVRLTVPITDDPSQPVLTFRTWILGITSCGLLAFVNQFFGYRQNQLSVGS  60

Query  1840  VPAQIVVLPMGKLMAAYLPTKVVQIPGTKWSFSLNPGPFNIKEHVLITIFASSGSDFSYA  1661
             V AQI+VLP+GKLMAA LPTK +++P TKWSFSLNPGPFN+KEHVLITIFA  G+   YA
Sbjct  61    VSAQILVLPIGKLMAATLPTKQMRVPFTKWSFSLNPGPFNLKEHVLITIFAGCGASGVYA  120

Query  1660  VSIITMMKAFYYRDIHPLAAVLLTFSTQMLGYGLAGIFKKFLIDSPYMWWPSNLVQVSLF  1481
             V+IIT++KAFY R +HP+AA+LL  +TQ+LGYG AGIF+K+L+DSPYMWWPSNLVQVSLF
Sbjct  121   VNIITIVKAFYNRSLHPVAAMLLVQTTQLLGYGWAGIFRKYLVDSPYMWWPSNLVQVSLF  180

Query  1480  RALHDVETRPKGGLTRLQFFIIVLVCSFAYYVVPNYLFPSLTALSLLCWIWKNSVTAQQl  1301
             RALH+ E RPKGGLTRLQFF++V V SF YY++P YLFPSL+ALS +C IWK+S+TAQ+L
Sbjct  181   RALHEKERRPKGGLTRLQFFLLVFVSSFGYYIIPGYLFPSLSALSFVCLIWKDSITAQKL  240

Query  1300  gsglkglgigSFALDWATVAAFQGSPLVTPDFAIINMLIGYVLVAYIAIPVWYWTNLFDA  1121
             GSG  GLGIGSF LDW+TVA F GSPL TP FAI N+L GY L  Y+ +P+ YW+N F+A
Sbjct  241   GSGQHGLGIGSFGLDWSTVAGFLGSPLATPFFAIANILAGYFLFLYVLVPIAYWSNAFEA  300

Query  1120  KKFPLFSSNVFDSNGQVYNISRVLNKKTFGFDQPGYDSYSNIYLSTAFVYTYGLSFATLA  941
             KKFPLFSS  FDS+GQVYNI+R+LN K F  ++ GY +YS +Y+S  F Y YGLSFATL 
Sbjct  301   KKFPLFSSKTFDSDGQVYNITRILNDKAFDLNEIGYRNYSKLYVSVIFAYIYGLSFATLM  360

Query  940   ATVSHVALFHGRTIWE---QTKESVQDKFSDIHTRLMRKNYEPVPQWWFYlllviivgva  770
             A++SHVALF G+TIWE   +T  +V DKF D+HTRLM+KNYE VPQWWF  +LV+   ++
Sbjct  361   ASISHVALFEGKTIWEMWKKTAAAVNDKFGDVHTRLMKKNYEAVPQWWFQAILVLTFALS  420

Query  769   lvACQRFGGQLQLPVWGVLLAVLLSLIFTLPVGVITATTNQQTGLNVIAELIIGYMYPGR  590
             L AC+ FG QLQLP WG+LLA  ++  FTLPVGVI ATTN QTGLNVI EL+IGYMYPG+
Sbjct  421   LYACEGFGKQLQLPWWGLLLACGMAFFFTLPVGVIQATTNLQTGLNVITELVIGYMYPGK  480

Query  589   PLASVTFKMYGlsslsqslmflSDFKLGHYMKIPPKSMFMVQLVGTLISCCVHFGTGWWL  410
             PLA+VTFK YG  S+SQ+L FL DFKLGHYMK+PPKSMF+VQLVGTL++   +FGT WWL
Sbjct  481   PLANVTFKTYGYISMSQALSFLGDFKLGHYMKVPPKSMFIVQLVGTLVASTAYFGTAWWL  540

Query  409   LTTVENICNPSKLPEGSQWTCPGDDVFYNASIIWGVVSPRRMFGNLGIYQATNYFFLVGF  230
             LT++++ICNPS LPEGS WTCPGD+VFYNASIIWGVV P RMF N G Y   N+FFL+GF
Sbjct  541   LTSIDHICNPSLLPEGSPWTCPGDEVFYNASIIWGVVGPLRMFTNYGNYPQMNWFFLIGF  600

Query  229   LAPIPVWYLGRKYPEKRWVSLINMPILISGAEGIPIVKSVNYVCWFAVGLYFNLYVYRKH  50
             LAP P W L RK+PEK+W+  I+MPIL+ G   +P  K+VNY  W AVG++FN YV+R++
Sbjct  601   LAPFPGWLLSRKFPEKKWIKNIHMPILLGGPLNLPSAKAVNYTSWAAVGIFFNYYVFRRY  660

Query  49    KGWWARHNYILSAGLD  2
             KGWWARHNYILSA LD
Sbjct  661   KGWWARHNYILSAALD  676



>ref|XP_008366195.1| PREDICTED: LOW QUALITY PROTEIN: oligopeptide transporter 1-like 
[Malus domestica]
Length=750

 Score =   929 bits (2400),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 449/682 (66%), Positives = 565/682 (83%), Gaps = 3/682 (0%)
 Frame = -1

Query  2038  SAVESSADEINDSPVEEVRLTVPITDDPTMPCVTFRTWVLGVTSCVILAFLNQFFGYRQN  1859
             S V+   DE+NDSP+E+VRLTVPITDDP+ P +TFRTWVLG+ SC +LAF+NQFFGYRQN
Sbjct  17    SNVDVIDDEVNDSPIEQVRLTVPITDDPSEPTLTFRTWVLGIISCSVLAFVNQFFGYRQN  76

Query  1858  ALYVSSVPAQIVVLPMGKLMAAYLPTKVVQIPGTKWSFSLNPGPFNIKEHVLITIFASSG  1679
              LYVSSV AQI+VLP+GKLMAA LP + +++P   WSFSLNPGPFN+KEHVLITIFA+SG
Sbjct  77    QLYVSSVSAQILVLPLGKLMAATLPKRRIRLPFRNWSFSLNPGPFNLKEHVLITIFANSG  136

Query  1678  SDFSYAVSIITMMKAFYYRDIHPLAAVLLTFSTQMLGYGLAGIFKKFLIDSPYMWWPSNL  1499
             S+  YAV+IIT++ AFY+R +HP AA LL  +TQMLGYG AG+F+K+L+DSPYMWWPSNL
Sbjct  137   SNSVYAVNIITIVMAFYHRPMHPAAAFLLAQTTQMLGYGWAGLFRKYLVDSPYMWWPSNL  196

Query  1498  VQVSLFRALHDVETRPKGGLTRLQFFIIVLVCSFAYYVVPNYLFPSLTALSLLCWIWKNS  1319
             VQVSLFRALH+ E RPKGG TRL FF++V +CSFAYY+VP++LFPS++A S +CWI+K+S
Sbjct  197   VQVSLFRALHEKEKRPKGGRTRLXFFLMVFICSFAYYIVPSFLFPSISAFSFVCWIYKDS  256

Query  1318  VTAQQlgsglkglgigSFALDWATVAAFQGSPLVTPDFAIINMLIGYVLVAYIAIPVWYW  1139
             +TAQQ+GSG+ GLGIGSF LDW+TVA F GSPL TP FA IN+LIG+VL+ YI  P+ YW
Sbjct  257   ITAQQIGSGMHGLGIGSFGLDWSTVAGFLGSPLATPGFATINILIGFVLIVYIVTPIAYW  316

Query  1138  TNLFDAKKFPLFSSNVFDSNGQVYNISRVLNKKTFGFDQPGYDSYSNIYLSTAFVYTYGL  959
              N +DA+KFP+ +S+ FDS GQ YNISRVL++K F  +  GY+ YS +YLST F ++YGL
Sbjct  317   NNAYDAQKFPIITSHTFDSTGQSYNISRVLDQKNFDINMVGYNGYSKLYLSTFFAFSYGL  376

Query  958   SFATLAATVSHVALFHGRTI---WEQTKESVQDKFSDIHTRLMRKNYEPVPQWWFYlllv  788
             SFATL AT+SHVALFHGRTI   W++T  +V+D+  DIHTRLM+KNY+ VPQWWF ++LV
Sbjct  377   SFATLTATISHVALFHGRTIWKMWKKTTSAVKDQIGDIHTRLMKKNYDAVPQWWFQIILV  436

Query  787   iivgvalvACQRFGGQLQLPVWGVLLAVLLSLIFTLPVGVITATTNQQTGLNVIAELIIG  608
              +V +A+  C+ FG QLQLP WGVL+A  ++L FTLP+G+I ATTNQQ GLNVI EL+IG
Sbjct  437   SMVALAIFTCEGFGKQLQLPWWGVLMACGIALFFTLPIGIIQATTNQQPGLNVITELLIG  496

Query  607   YMYPGRPLASVTFKMYGlsslsqslmflSDFKLGHYMKIPPKSMFMVQLVGTLISCCVHF  428
             Y+YPG+P+A+V FK YG  S+SQ+L FL DFKLGHYMKIPPKSMF+VQLVGTL++  V+F
Sbjct  497   YIYPGKPVANVAFKTYGYISMSQALNFLGDFKLGHYMKIPPKSMFVVQLVGTLVASSVYF  556

Query  427   GTGWWLLTTVENICNPSKLPEGSQWTCPGDDVFYNASIIWGVVSPRRMFGNLGIYQATNY  248
             GT WWL+T++E IC+P+KLP GS WTCPGDDVFYNASIIWGV+ P RMF   G+Y   N+
Sbjct  557   GTSWWLITSIEYICDPAKLPTGSPWTCPGDDVFYNASIIWGVIGPLRMFAGKGVYPEMNW  616

Query  247   FFLVGFLAPIPVWYLGRKYPEKRWVSLINMPILISGAEGIPIVKSVNYVCWFAVGLYFNL  68
             FFL+G LAP+P+W+L +K+P ++W+ LINMPI++     +P  + VNY+ W +VG++FN 
Sbjct  617   FFLIGLLAPVPIWFLSKKFPNQKWIKLINMPIILGATGSMPPARXVNYLTWLSVGIFFNF  676

Query  67    YVYRKHKGWWARHNYILSAGLD  2
             YVYRK+KGWWARHNYILSA LD
Sbjct  677   YVYRKYKGWWARHNYILSAALD  698



>ref|XP_008219410.1| PREDICTED: oligopeptide transporter 1-like [Prunus mume]
Length=755

 Score =   928 bits (2399),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 450/678 (66%), Positives = 564/678 (83%), Gaps = 3/678 (0%)
 Frame = -1

Query  2026  SSADEINDSPVEEVRLTVPITDDPTMPCVTFRTWVLGVTSCVILAFLNQFFGYRQNALYV  1847
             +  DE+NDSP+EEVRLTVPITDDP+ P +TFRTWVLG+ SC +LAF+N+FFGYR N L V
Sbjct  27    TGDDEVNDSPIEEVRLTVPITDDPSQPTLTFRTWVLGILSCAVLAFVNKFFGYRTNQLSV  86

Query  1846  SSVPAQIVVLPMGKLMAAYLPTKVVQIPGTKWSFSLNPGPFNIKEHVLITIFASSGSDFS  1667
             SSV AQIVVLP+GKLMAA LPT+  ++P TK SFS+NPGPFN+KEHVLITIFA+SG+   
Sbjct  87    SSVSAQIVVLPLGKLMAATLPTRKFRVPFTKLSFSMNPGPFNLKEHVLITIFANSGAGGV  146

Query  1666  YAVSIITMMKAFYYRDIHPLAAVLLTFSTQMLGYGLAGIFKKFLIDSPYMWWPSNLVQVS  1487
             YAV IIT++KAFY R  HP AA LL  +TQ+LGYG AGIF+K+L+DSPYMWWPSNLVQVS
Sbjct  147   YAVHIITIVKAFYKRGQHPAAAFLLAQTTQLLGYGWAGIFRKYLVDSPYMWWPSNLVQVS  206

Query  1486  LFRALHDVETRPKGGLTRLQFFIIVLVCSFAYYVVPNYLFPSLTALSLLCWIWKNSVTAQ  1307
             LFRALH+ E RPKGGLTRLQFF++V + SFAYY++P YLFP+++A S++C+IWKNS+TAQ
Sbjct  207   LFRALHEKEKRPKGGLTRLQFFLVVFISSFAYYIIPGYLFPTISAFSIVCFIWKNSITAQ  266

Query  1306  QlgsglkglgigSFALDWATVAAFQGSPLVTPDFAIINMLIGYVLVAYIAIPVWYWTNLF  1127
             Q+GSG+ GLGIGSF LDW+T+A F GSPL TP FAIINMLIG+VL+ YI  P+ YW+N +
Sbjct  267   QIGSGMNGLGIGSFGLDWSTIAGFLGSPLATPGFAIINMLIGFVLILYILTPISYWSNAY  326

Query  1126  DAKKFPLFSSNVFDSNGQVYNISRVLNKKTFGFDQPGYDSYSNIYLSTAFVYTYGLSFAT  947
             DAKKFP+F+S+ F S G+ Y ISR+LN  TF  D   Y+SYS +YLST F + YGLSFAT
Sbjct  327   DAKKFPIFTSHTFASTGKTYEISRILNATTFNIDLNAYNSYSKLYLSTFFAFNYGLSFAT  386

Query  946   LAATVSHVALFHGRTIWE---QTKESVQDKFSDIHTRLMRKNYEPVPQWWFYlllviivg  776
             L AT+SHVALFHG++IW+   +T  +V+D+  DIHTRLM+KNYE VPQWWF+++LV++V 
Sbjct  387   LTATISHVALFHGKSIWDMWKKTTSAVKDQIGDIHTRLMKKNYEAVPQWWFHIILVLMVA  446

Query  775   valvACQRFGGQLQLPVWGVLLAVLLSLIFTLPVGVITATTNQQTGLNVIAELIIGYMYP  596
             +++  C+ FG QLQLP WGVL+A  ++L FTLP+G+I ATTNQQ GLNVI EL+IGY+YP
Sbjct  447   LSIFTCEGFGKQLQLPWWGVLMACGIALFFTLPIGIIQATTNQQPGLNVITELVIGYIYP  506

Query  595   GRPLASVTFKMYGlsslsqslmflSDFKLGHYMKIPPKSMFMVQLVGTLISCCVHFGTGW  416
             GRPLA+V+FK YG  S+SQ+L FL DFKLGHYMKIPPKSMFM QLVGT+++  V+FGT W
Sbjct  507   GRPLANVSFKTYGYISMSQALTFLGDFKLGHYMKIPPKSMFMAQLVGTVVASSVYFGTAW  566

Query  415   WLLTTVENICNPSKLPEGSQWTCPGDDVFYNASIIWGVVSPRRMFGNLGIYQATNYFFLV  236
             WLLT+V++IC+ S LPEGS WTCPGDDVFYNASIIWGV+ P RMF + G+Y   N+FFL+
Sbjct  567   WLLTSVDHICDVSNLPEGSPWTCPGDDVFYNASIIWGVIGPLRMFTSKGVYPEMNWFFLI  626

Query  235   GFLAPIPVWYLGRKYPEKRWVSLINMPILISGAEGIPIVKSVNYVCWFAVGLYFNLYVYR  56
             G LAP+P W+L +K+P ++W+ LINMPI++     +P  K+V+Y+ WFAVG++F+LYVY+
Sbjct  627   GLLAPVPGWFLSKKFPNQKWIRLINMPIILGSTSSMPPAKAVHYITWFAVGIFFSLYVYK  686

Query  55    KHKGWWARHNYILSAGLD  2
             +HKGWWARHNYILSA LD
Sbjct  687   RHKGWWARHNYILSAALD  704



>ref|XP_004160259.1| PREDICTED: LOW QUALITY PROTEIN: oligopeptide transporter 1-like 
[Cucumis sativus]
Length=755

 Score =   927 bits (2396),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 451/687 (66%), Positives = 571/687 (83%), Gaps = 3/687 (0%)
 Frame = -1

Query  2053  ENTGISAVESSADEINDSPVEEVRLTVPITDDPTMPCVTFRTWVLGVTSCVILAFLNQFF  1874
             E    S  + + +E NDSP+EEVRLTVP TDDP+ P +TFRTW+LG+TSC +LAF+N  F
Sbjct  17    EENLESNFQKTREEENDSPIEEVRLTVPPTDDPSEPALTFRTWILGLTSCCLLAFVNXIF  76

Query  1873  GYRQNALYVSSVPAQIVVLPMGKLMAAYLPTKVVQIPGTKWSFSLNPGPFNIKEHVLITI  1694
             G+RQN LYVSSV AQI+VLP+GKLMAA +P+   ++P TKWSFSLNPGPF +KEHVLITI
Sbjct  77    GFRQNQLYVSSVSAQILVLPLGKLMAATIPSSSFRVPFTKWSFSLNPGPFTLKEHVLITI  136

Query  1693  FASSGSDFSYAVSIITMMKAFYYRDIHPLAAVLLTFSTQMLGYGLAGIFKKFLIDSPYMW  1514
             FA+SGS+  YA++I+T++KAFY+R++HPLAA+LL+ +TQMLGYG AG+F+++L+DSPYMW
Sbjct  137   FANSGSNSVYALNIVTIVKAFYHRNLHPLAAMLLSQTTQMLGYGWAGLFRRYLVDSPYMW  196

Query  1513  WPSNLVQVSLFRALHDVETRPKGGLTRLQFFIIVLVCSFAYYVVPNYLFPSLTALSLLCW  1334
             WP+NLVQVSLFRALH+ + RP+GG TRLQFF +V + SFAYY+VP+YLFPS++ +S +C 
Sbjct  197   WPANLVQVSLFRALHEKDKRPRGGHTRLQFFFMVFISSFAYYLVPSYLFPSISCISFVCL  256

Query  1333  IWKNSVTAQQlgsglkglgigSFALDWATVAAFQGSPLVTPDFAIINMLIGYVLVAYIAI  1154
             IW+NS+TAQQ+GSGL+GLGIGSF +DW+TVA F GSPL TP FAI+N+LIG+ +V Y+  
Sbjct  257   IWRNSITAQQIGSGLRGLGIGSFGIDWSTVAGFLGSPLATPGFAIVNILIGFFMVVYVIN  316

Query  1153  PVWYWTNLFDAKKFPLFSSNVFDSNGQVYNISRVLNKKTFGFDQPGYDSYSNIYLSTAFV  974
             P+ YW+N ++AK+FP+ S++ FD  G+ YNISR+LN KTF  DQ  YD YS +YLS  F 
Sbjct  317   PIVYWSNFYEAKRFPMISAHTFDFTGKTYNISRILNAKTFDIDQANYDGYSKLYLSAFFA  376

Query  973   YTYGLSFATLAATVSHVALFHGRTIWE---QTKESVQDKFSDIHTRLMRKNYEPVPQWWF  803
             +TYGLSFATLAAT+SHVALFHG+TIW+   +T  +V D+  D+HTRLM+KNY+ VPQWWF
Sbjct  377   FTYGLSFATLAATISHVALFHGKTIWQMWRRTTSAVGDQLGDVHTRLMKKNYKEVPQWWF  436

Query  802   YlllviivgvalvACQRFGGQLQLPVWGVLLAVLLSLIFTLPVGVITATTNQQTGLNVIA  623
             Y +L+I+V +AL AC+ F  QLQLP WG+LLA  ++L FTLP+G+I ATTN Q GLNVI 
Sbjct  437   YTVLIIMVALALYACEGFDKQLQLPWWGILLACGIALFFTLPIGIIQATTNWQPGLNVIT  496

Query  622   ELIIGYMYPGRPLASVTFKMYGlsslsqslmflSDFKLGHYMKIPPKSMFMVQLVGTLIS  443
             ELIIGYMYPGRPLA+VTFK YG  S+SQ+L F+SDFKLGHYMKIPP+SMF+VQLVGT+++
Sbjct  497   ELIIGYMYPGRPLANVTFKTYGYISMSQALTFVSDFKLGHYMKIPPRSMFLVQLVGTVVA  556

Query  442   CCVHFGTGWWLLTTVENICNPSKLPEGSQWTCPGDDVFYNASIIWGVVSPRRMFGNLGIY  263
               V+FGT WWLLTT+++IC+P+ LPEGS WTCPGDDVFYNASIIWGVV P RMFG LG+Y
Sbjct  557   SSVYFGTAWWLLTTIDHICDPALLPEGSPWTCPGDDVFYNASIIWGVVGPLRMFGKLGVY  616

Query  262   QATNYFFLVGFLAPIPVWYLGRKYPEKRWVSLINMPILISGAEGIPIVKSVNYVCWFAVG  83
                N+FFLVG LAP+PVW+L R++P + W+ LIN+PI+     GIP  +SVNY+ W AVG
Sbjct  617   PEMNWFFLVGLLAPVPVWWLSRQFPNQEWIRLINVPIIFGAGLGIPPARSVNYLMWGAVG  676

Query  82    LYFNLYVYRKHKGWWARHNYILSAGLD  2
             ++FN Y+YRKHKGWWARHNYILSA LD
Sbjct  677   IFFNFYIYRKHKGWWARHNYILSAALD  703



>ref|XP_008463020.1| PREDICTED: oligopeptide transporter 1-like isoform X1 [Cucumis 
melo]
Length=756

 Score =   927 bits (2395),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 450/679 (66%), Positives = 571/679 (84%), Gaps = 3/679 (0%)
 Frame = -1

Query  2029  ESSADEINDSPVEEVRLTVPITDDPTMPCVTFRTWVLGVTSCVILAFLNQFFGYRQNALY  1850
             ++  +E NDSP+EEVRLTVP TDDP+ P +TFRTW+LG+TSC +LAF+NQFFG+RQN LY
Sbjct  26    KTREEEENDSPIEEVRLTVPPTDDPSEPALTFRTWILGLTSCCLLAFVNQFFGFRQNQLY  85

Query  1849  VSSVPAQIVVLPMGKLMAAYLPTKVVQIPGTKWSFSLNPGPFNIKEHVLITIFASSGSDF  1670
             VSSV AQI+VLP+GKLMAA +P+   ++P TKWSFSLNPGPF +KEHVLITIFA+SGS+ 
Sbjct  86    VSSVSAQILVLPLGKLMAATIPSTSFRVPLTKWSFSLNPGPFTLKEHVLITIFANSGSNS  145

Query  1669  SYAVSIITMMKAFYYRDIHPLAAVLLTFSTQMLGYGLAGIFKKFLIDSPYMWWPSNLVQV  1490
              YA++I+T++KAFY+R++HPLAA+LL+ +TQMLGYG AG+F+++L+DSPYMWWP+NLVQV
Sbjct  146   VYALNIVTIVKAFYHRNLHPLAAMLLSQTTQMLGYGWAGLFRRYLVDSPYMWWPANLVQV  205

Query  1489  SLFRALHDVETRPKGGLTRLQFFIIVLVCSFAYYVVPNYLFPSLTALSLLCWIWKNSVTA  1310
             SLFRALH+ + RP+GG TRLQFF +V + SFAYY+VP+YLFPS++ +S +C IW+NS+TA
Sbjct  206   SLFRALHEKDKRPRGGHTRLQFFFMVFISSFAYYLVPSYLFPSISCISFVCLIWRNSITA  265

Query  1309  QQlgsglkglgigSFALDWATVAAFQGSPLVTPDFAIINMLIGYVLVAYIAIPVWYWTNL  1130
             QQ+GSGL+GLGIGSF +DW+TVA F GSPL TP FAI+N+LIG+ +V Y+  P+ YW+N 
Sbjct  266   QQIGSGLRGLGIGSFGIDWSTVAGFLGSPLATPAFAIVNVLIGFFMVVYVINPIVYWSNF  325

Query  1129  FDAKKFPLFSSNVFDSNGQVYNISRVLNKKTFGFDQPGYDSYSNIYLSTAFVYTYGLSFA  950
             +DAK+FP+ S++ FD  G+ YNISR+LN KTF  DQ  YD YS +YLS  F +TYGLSFA
Sbjct  326   YDAKRFPMISAHTFDFTGKTYNISRILNAKTFDIDQANYDGYSKLYLSAFFAFTYGLSFA  385

Query  949   TLAATVSHVALFHGRTIWE---QTKESVQDKFSDIHTRLMRKNYEPVPQWWFYlllviiv  779
             TLAAT+SHVALFHG+TIW+   +T  +V D+  D+HTRLM+KNY+ VPQWWFY +L+I+V
Sbjct  386   TLAATISHVALFHGKTIWQMWRRTTSAVGDQLGDVHTRLMKKNYKEVPQWWFYTVLIIMV  445

Query  778   gvalvACQRFGGQLQLPVWGVLLAVLLSLIFTLPVGVITATTNQQTGLNVIAELIIGYMY  599
              +AL AC+ F  QLQLP WG+LLA  ++L FTLP+G+I ATTN Q GLNVI ELIIGYMY
Sbjct  446   ALALYACEGFDKQLQLPWWGILLACGIALFFTLPIGIIQATTNWQPGLNVITELIIGYMY  505

Query  598   PGRPLASVTFKMYGlsslsqslmflSDFKLGHYMKIPPKSMFMVQLVGTLISCCVHFGTG  419
             PG+PLA+VTFK YG  S+SQ+L F+SDFKLGHYMKIPP+SMF+VQLVGT+++  V+FGT 
Sbjct  506   PGKPLANVTFKTYGYISMSQALTFVSDFKLGHYMKIPPRSMFLVQLVGTVVASSVYFGTA  565

Query  418   WWLLTTVENICNPSKLPEGSQWTCPGDDVFYNASIIWGVVSPRRMFGNLGIYQATNYFFL  239
             WWLLTTV++IC+P+ LPEGS WTCPGDDVFYNASIIWGVV P RMFG LG+Y   N+FFL
Sbjct  566   WWLLTTVDHICDPALLPEGSPWTCPGDDVFYNASIIWGVVGPLRMFGKLGVYPEMNWFFL  625

Query  238   VGFLAPIPVWYLGRKYPEKRWVSLINMPILISGAEGIPIVKSVNYVCWFAVGLYFNLYVY  59
             VG LAP+PVW+L R++P ++W+ LIN+PI+     GIP  +SVNY+ W  VG++FN Y+Y
Sbjct  626   VGLLAPVPVWWLSRQFPNQKWIRLINVPIIFGAGLGIPPARSVNYLMWGVVGIFFNFYIY  685

Query  58    RKHKGWWARHNYILSAGLD  2
             RK+KGWWARHNYILSA LD
Sbjct  686   RKYKGWWARHNYILSAALD  704



>ref|XP_006474839.1| PREDICTED: oligopeptide transporter 1-like [Citrus sinensis]
Length=773

 Score =   925 bits (2391),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 452/682 (66%), Positives = 559/682 (82%), Gaps = 3/682 (0%)
 Frame = -1

Query  2038  SAVESSADEINDSPVEEVRLTVPITDDPTMPCVTFRTWVLGVTSCVILAFLNQFFGYRQN  1859
             +  +   +E ND+P+EEVRLTVPITDDPT+P +TFRTWVLG+TSC +LAF+NQFFGYRQN
Sbjct  40    TRTKGDMEEANDNPIEEVRLTVPITDDPTIPALTFRTWVLGLTSCCLLAFVNQFFGYRQN  99

Query  1858  ALYVSSVPAQIVVLPMGKLMAAYLPTKVVQIPGTKWSFSLNPGPFNIKEHVLITIFASSG  1679
              LY+SS+ AQI+VLP+GKLMAA LP+K + +P T WSFSLNPGPFN+KEHVLITIFA  G
Sbjct  100   QLYLSSISAQILVLPIGKLMAATLPSKPIPVPLTPWSFSLNPGPFNLKEHVLITIFAGCG  159

Query  1678  SDFSYAVSIITMMKAFYYRDIHPLAAVLLTFSTQMLGYGLAGIFKKFLIDSPYMWWPSNL  1499
             S   YAV IIT++KAFY R +H + A++L  +TQ+LGYG AG+F+K+L+DSPYMWWP+NL
Sbjct  160   SSGVYAVGIITIVKAFYKRSLHVVPAMMLVQTTQLLGYGWAGLFRKYLVDSPYMWWPANL  219

Query  1498  VQVSLFRALHDVETRPKGGLTRLQFFIIVLVCSFAYYVVPNYLFPSLTALSLLCWIWKNS  1319
             VQVSLFRALH+ E R KGGLTRLQFF+IV + SFAYYVVP YLFPS++ALS +CWIWK+S
Sbjct  220   VQVSLFRALHEEEKRTKGGLTRLQFFVIVFISSFAYYVVPGYLFPSISALSFVCWIWKDS  279

Query  1318  VTAQQlgsglkglgigSFALDWATVAAFQGSPLVTPDFAIINMLIGYVLVAYIAIPVWYW  1139
             VTAQ+LGSGL+GLG+GSF LDWATVA F GSPL TP FAI N+L+G+ L  YI IP+ YW
Sbjct  280   VTAQKLGSGLQGLGMGSFGLDWATVAGFLGSPLATPFFAIANILVGFFLFLYILIPIAYW  339

Query  1138  TNLFDAKKFPLFSSNVFDSNGQVYNISRVLNKKTFGFDQPGYDSYSNIYLSTAFVYTYGL  959
              N F+A++FPLFSS+ FDS+GQ+YN+SR+LN+K F FD+  YD+YS +YLS  F + YGL
Sbjct  340   CNAFEAQRFPLFSSHTFDSDGQIYNVSRILNEKEFSFDREAYDNYSRLYLSVLFAFIYGL  399

Query  958   SFATLAATVSHVALFHGRTIWE---QTKESVQDKFSDIHTRLMRKNYEPVPQWWFYlllv  788
              FATL A++SHVALF G+TIW+   +T  +V+ +F D+HTRLM+KNYE VPQWWF+ +L+
Sbjct  400   GFATLMASISHVALFEGKTIWQMWRKTTAAVKQQFGDVHTRLMKKNYEAVPQWWFHAILI  459

Query  787   iivgvalvACQRFGGQLQLPVWGVLLAVLLSLIFTLPVGVITATTNQQTGLNVIAELIIG  608
             I   ++L  C+ F  Q QLP WG+LLA  ++  FTLPVGVI ATTN Q GLN+I E++IG
Sbjct  460   ITFALSLFTCEGFDKQFQLPWWGLLLACAMAFFFTLPVGVIQATTNLQPGLNIITEMVIG  519

Query  607   YMYPGRPLASVTFKMYGlsslsqslmflSDFKLGHYMKIPPKSMFMVQLVGTLISCCVHF  428
             YMYPG+PLA+V FK YG  S+ Q+L FL DFKLGHYMK+PPKSMF+VQLVGT+++  V+F
Sbjct  520   YMYPGKPLANVAFKTYGYISMVQALGFLGDFKLGHYMKVPPKSMFVVQLVGTIVASTVYF  579

Query  427   GTGWWLLTTVENICNPSKLPEGSQWTCPGDDVFYNASIIWGVVSPRRMFGNLGIYQATNY  248
             GT WWLLT+VE+ICNPS LPEGS WTCPGDDVFYNASIIWGVV P RMF N G Y   N+
Sbjct  580   GTAWWLLTSVEHICNPSLLPEGSPWTCPGDDVFYNASIIWGVVGPLRMFTNYGNYPQMNW  639

Query  247   FFLVGFLAPIPVWYLGRKYPEKRWVSLINMPILISGAEGIPIVKSVNYVCWFAVGLYFNL  68
             FFL+GFLAP PVW L RK+PEK+W+  I+MP+L++G  G+P  K+VNY+ W AVG++FN 
Sbjct  640   FFLIGFLAPFPVWLLSRKFPEKKWIKNIHMPLLLAGPGGLPSAKAVNYLSWGAVGIFFNY  699

Query  67    YVYRKHKGWWARHNYILSAGLD  2
             YVYR+ KGWWARH YILSA LD
Sbjct  700   YVYRRFKGWWARHTYILSAALD  721



>ref|XP_007207290.1| hypothetical protein PRUPE_ppa014997mg [Prunus persica]
 gb|EMJ08489.1| hypothetical protein PRUPE_ppa014997mg [Prunus persica]
Length=755

 Score =   924 bits (2389),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 448/678 (66%), Positives = 564/678 (83%), Gaps = 3/678 (0%)
 Frame = -1

Query  2026  SSADEINDSPVEEVRLTVPITDDPTMPCVTFRTWVLGVTSCVILAFLNQFFGYRQNALYV  1847
             +  DE+ND P+EEVRLTVPITDDP+ P +TFRTWVLG+ SC +L+F+N+FFGYR N L V
Sbjct  27    TGDDEVNDCPIEEVRLTVPITDDPSQPTLTFRTWVLGILSCAVLSFVNKFFGYRTNQLSV  86

Query  1846  SSVPAQIVVLPMGKLMAAYLPTKVVQIPGTKWSFSLNPGPFNIKEHVLITIFASSGSDFS  1667
             SSV AQIVVLP+GKLMAA LPT+  ++P TK SFS+NPGPFN+KEHVLITIFA+SG+   
Sbjct  87    SSVSAQIVVLPLGKLMAATLPTRKFRVPFTKLSFSMNPGPFNLKEHVLITIFANSGAGGV  146

Query  1666  YAVSIITMMKAFYYRDIHPLAAVLLTFSTQMLGYGLAGIFKKFLIDSPYMWWPSNLVQVS  1487
             YAV IIT++KAFY RD HP AA LL  +TQ+LGYG AGIF+K+L+DSPYMWWPSNLVQVS
Sbjct  147   YAVHIITIVKAFYKRDQHPAAAFLLAQTTQLLGYGWAGIFRKYLVDSPYMWWPSNLVQVS  206

Query  1486  LFRALHDVETRPKGGLTRLQFFIIVLVCSFAYYVVPNYLFPSLTALSLLCWIWKNSVTAQ  1307
             LFRALH+ E RPKGGLTRLQFF+IV +CSFAYY++P YLFP+++A S++C+I K S+TAQ
Sbjct  207   LFRALHEREKRPKGGLTRLQFFLIVFICSFAYYIIPGYLFPTISAFSIVCFIRKKSITAQ  266

Query  1306  QlgsglkglgigSFALDWATVAAFQGSPLVTPDFAIINMLIGYVLVAYIAIPVWYWTNLF  1127
             Q+GSG+ GLGIGSF LDW+T+A F GSPL TP FAIINMLIG+VLV YI  P+ YW+N +
Sbjct  267   QIGSGMNGLGIGSFGLDWSTIAGFLGSPLATPGFAIINMLIGFVLVLYILTPISYWSNAY  326

Query  1126  DAKKFPLFSSNVFDSNGQVYNISRVLNKKTFGFDQPGYDSYSNIYLSTAFVYTYGLSFAT  947
             DAKKFP+F+S+ F S G+ Y ISR+LN  TF  D   Y+SYS +YLST F + YGLSFAT
Sbjct  327   DAKKFPIFTSHTFASTGKTYEISRILNATTFNIDLNAYNSYSKLYLSTFFAFNYGLSFAT  386

Query  946   LAATVSHVALFHGRTI---WEQTKESVQDKFSDIHTRLMRKNYEPVPQWWFYlllviivg  776
             L AT+SHVALFHG++I   W++T  +V+D+  DIHTRLM+KNYE VPQWWF+++LV++V 
Sbjct  387   LTATISHVALFHGKSIWYMWKKTTSAVKDQIGDIHTRLMKKNYEAVPQWWFHIILVLMVA  446

Query  775   valvACQRFGGQLQLPVWGVLLAVLLSLIFTLPVGVITATTNQQTGLNVIAELIIGYMYP  596
             +++ AC+ FG QLQLP WGVL+A  ++L FTLP+G+I ATTNQQ GLNVI EL+IGY+YP
Sbjct  447   LSIFACEGFGKQLQLPWWGVLMACGIALFFTLPIGIIQATTNQQPGLNVITELVIGYIYP  506

Query  595   GRPLASVTFKMYGlsslsqslmflSDFKLGHYMKIPPKSMFMVQLVGTLISCCVHFGTGW  416
             GRPLA+V+FK YG  S++Q+L FL DFKLGHYMKIPPKSMF+ QLVGT+++  V+FGT W
Sbjct  507   GRPLANVSFKTYGYISMAQALTFLGDFKLGHYMKIPPKSMFVAQLVGTIVASSVYFGTAW  566

Query  415   WLLTTVENICNPSKLPEGSQWTCPGDDVFYNASIIWGVVSPRRMFGNLGIYQATNYFFLV  236
             WLLT+V++IC+ S LPEGS WTCPGDDVFYNASIIWGV+ P RMF + G+Y   N+FFL+
Sbjct  567   WLLTSVDHICDVSNLPEGSPWTCPGDDVFYNASIIWGVIGPLRMFTSKGVYPEMNWFFLI  626

Query  235   GFLAPIPVWYLGRKYPEKRWVSLINMPILISGAEGIPIVKSVNYVCWFAVGLYFNLYVYR  56
             G LAP+P+W+L +K+P ++W+ LINMPI++     +P  K+V+Y+ WFAVG++F+ YVY+
Sbjct  627   GLLAPVPIWFLSKKFPNQKWIRLINMPIILGSTGNMPPAKAVHYITWFAVGIFFSFYVYK  686

Query  55    KHKGWWARHNYILSAGLD  2
             +HKGWWARHNYILSA LD
Sbjct  687   RHKGWWARHNYILSAALD  704



>ref|NP_001062118.1| Os08g0492000 [Oryza sativa Japonica Group]
 dbj|BAD09683.1| putative glutathione transporter [Oryza sativa Japonica Group]
 dbj|BAD10005.1| putative glutathione transporter [Oryza sativa Japonica Group]
 dbj|BAF24032.1| Os08g0492000 [Oryza sativa Japonica Group]
 gb|EEC83792.1| hypothetical protein OsI_29707 [Oryza sativa Indica Group]
Length=752

 Score =   922 bits (2384),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 446/679 (66%), Positives = 557/679 (82%), Gaps = 0/679 (0%)
 Frame = -1

Query  2038  SAVESSADEINDSPVEEVRLTVPITDDPTMPCVTFRTWVLGVTSCVILAFLNQFFGYRQN  1859
             S  E + +E++D P+EEVRLTVPITDDP +P +TFRTW+LG+ SC +LAF NQFFGYRQN
Sbjct  22    SRDEKTEEEVDDCPIEEVRLTVPITDDPALPALTFRTWLLGLISCAMLAFSNQFFGYRQN  81

Query  1858  ALYVSSVPAQIVVLPMGKLMAAYLPTKVVQIPGTKWSFSLNPGPFNIKEHVLITIFASSG  1679
              LY+SS+  QIVVLP+GKLMAA LP KV ++ GT WSFSLNPGPFN+KEHVLITIFA++G
Sbjct  82    PLYISSLSVQIVVLPLGKLMAACLPKKVFRVKGTAWSFSLNPGPFNLKEHVLITIFANTG  141

Query  1678  SDFSYAVSIITMMKAFYYRDIHPLAAVLLTFSTQMLGYGLAGIFKKFLIDSPYMWWPSNL  1499
             S+  YAV IIT++KAFY R+IHPLAA+LLT +TQ++GYG AG+F+KFL+DSPYMWWPSNL
Sbjct  142   SNSVYAVGIITIVKAFYRREIHPLAAMLLTQTTQLMGYGWAGLFRKFLVDSPYMWWPSNL  201

Query  1498  VQVSLFRALHDVETRPKGGLTRLQFFIIVLVCSFAYYVVPNYLFPSLTALSLLCWIWKNS  1319
             VQVSLFRALH+ E RPKGG TRLQFF+ VL+ SFAYY+VPNYLFP+++ +S++C +WK S
Sbjct  202   VQVSLFRALHEKEKRPKGGTTRLQFFLTVLITSFAYYIVPNYLFPTISTISVVCLVWKKS  261

Query  1318  VTAQQlgsglkglgigSFALDWATVAAFQGSPLVTPDFAIINMLIGYVLVAYIAIPVWYW  1139
             VTAQQ+GSG+ GLG+GSF LDWATVA F G+PL TP FAI+N++ G+ L+ Y+ +P  YW
Sbjct  262   VTAQQIGSGVYGLGVGSFGLDWATVAGFLGTPLSTPAFAIVNIMAGFFLIVYVIVPAAYW  321

Query  1138  TNLFDAKKFPLFSSNVFDSNGQVYNISRVLNKKTFGFDQPGYDSYSNIYLSTAFVYTYGL  959
              + + AK+FP+ SS+VF +NG  Y++++VL+  TF F Q GYD+   I LS  F +TYGL
Sbjct  322   ADAYGAKRFPIISSHVFSANGSRYDVNQVLDTATFEFSQAGYDAAGKINLSIFFAFTYGL  381

Query  958   SFATLAATVSHVALFHGRTIWEQTKESVQDKFSDIHTRLMRKNYEPVPQWWFYlllviiv  779
             SFATLAAT+SHVALFHG +IW QTK +V  +  D+HTRLM++NY  VPQWWF ++LV ++
Sbjct  382   SFATLAATLSHVALFHGGSIWRQTKAAVSGQGGDVHTRLMKRNYAAVPQWWFQVMLVAVL  441

Query  778   gvalvACQRFGGQLQLPVWGVLLAVLLSLIFTLPVGVITATTNQQTGLNVIAELIIGYMY  599
             G+++  C+ FG QLQLP WGVLLA  L+  FTLP+G+ITATTNQQ GLNVI ELIIGY+Y
Sbjct  442   GLSVFTCEGFGQQLQLPYWGVLLAAGLAFFFTLPIGIITATTNQQPGLNVITELIIGYLY  501

Query  598   PGRPLASVTFKMYGlsslsqslmflSDFKLGHYMKIPPKSMFMVQLVGTLISCCVHFGTG  419
             PGRPLA+V FK YG  S+SQ++MFL DFKLGHYMKIPP+SMF+VQLVGT+++  V+FGT 
Sbjct  502   PGRPLANVAFKTYGYISMSQAIMFLQDFKLGHYMKIPPRSMFIVQLVGTVLASSVYFGTS  561

Query  418   WWLLTTVENICNPSKLPEGSQWTCPGDDVFYNASIIWGVVSPRRMFGNLGIYQATNYFFL  239
             WWLL +V NIC+P+KLPEGS WTCPGDDVF+NASIIWGVV P RMFG LG+Y   NYFFL
Sbjct  562   WWLLESVSNICDPAKLPEGSPWTCPGDDVFFNASIIWGVVGPLRMFGRLGLYAKMNYFFL  621

Query  238   VGFLAPIPVWYLGRKYPEKRWVSLINMPILISGAEGIPIVKSVNYVCWFAVGLYFNLYVY  59
              G LAP+PVW L R +P + W+ L+NMP+L+     +P  +SVNY+ W AVGL FN  VY
Sbjct  622   AGALAPVPVWALSRAFPGRAWIGLVNMPVLLGATGMMPPARSVNYLMWGAVGLAFNYVVY  681

Query  58    RKHKGWWARHNYILSAGLD  2
             R++KGWWARHNY+LSAGLD
Sbjct  682   RRYKGWWARHNYVLSAGLD  700



>ref|XP_006452635.1| hypothetical protein CICLE_v10007550mg [Citrus clementina]
 gb|ESR65875.1| hypothetical protein CICLE_v10007550mg [Citrus clementina]
Length=755

 Score =   922 bits (2383),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 450/682 (66%), Positives = 558/682 (82%), Gaps = 3/682 (0%)
 Frame = -1

Query  2038  SAVESSADEINDSPVEEVRLTVPITDDPTMPCVTFRTWVLGVTSCVILAFLNQFFGYRQN  1859
             +  +   +E ND+P+EEVRLTVPITDDPT+P +TFRTWVLG+TSC +LAF+NQFFGYRQN
Sbjct  22    TRTKGDMEEANDNPIEEVRLTVPITDDPTIPALTFRTWVLGLTSCCLLAFVNQFFGYRQN  81

Query  1858  ALYVSSVPAQIVVLPMGKLMAAYLPTKVVQIPGTKWSFSLNPGPFNIKEHVLITIFASSG  1679
              LY+SS+ AQI+VLP+GKLMAA LP+K + +P T WSFSLNPGPFN+KEHVLITIFA  G
Sbjct  82    QLYLSSISAQILVLPIGKLMAATLPSKPIPVPLTPWSFSLNPGPFNLKEHVLITIFAGCG  141

Query  1678  SDFSYAVSIITMMKAFYYRDIHPLAAVLLTFSTQMLGYGLAGIFKKFLIDSPYMWWPSNL  1499
             S   YAVSIIT++KAFY R +H + A++L  +TQ+LGYG AG+F+K+L+DSPYMWWP+NL
Sbjct  142   SSGVYAVSIITIVKAFYKRSLHVVPAMMLVHTTQLLGYGWAGLFRKYLVDSPYMWWPANL  201

Query  1498  VQVSLFRALHDVETRPKGGLTRLQFFIIVLVCSFAYYVVPNYLFPSLTALSLLCWIWKNS  1319
             VQVSLFRALH+ E R KGGLTRLQFF+IV + SFAYYVVP YLFPS++ALS +CWIWK+S
Sbjct  202   VQVSLFRALHEEEKRTKGGLTRLQFFVIVFISSFAYYVVPGYLFPSISALSFVCWIWKDS  261

Query  1318  VTAQQlgsglkglgigSFALDWATVAAFQGSPLVTPDFAIINMLIGYVLVAYIAIPVWYW  1139
             VTAQ+LGSGL+GLG+GSF LDWATVA F GSPL TP FAI N+L+G+ L  YI IP+ YW
Sbjct  262   VTAQKLGSGLQGLGMGSFGLDWATVAGFLGSPLATPFFAIANILVGFFLFLYILIPIAYW  321

Query  1138  TNLFDAKKFPLFSSNVFDSNGQVYNISRVLNKKTFGFDQPGYDSYSNIYLSTAFVYTYGL  959
              N F+A++FPLFSS+ FD +GQ+YN+SR+LN+K F FD+  YD+YS +YLS  F + YGL
Sbjct  322   CNAFEAQRFPLFSSHTFDYDGQIYNVSRILNEKEFSFDREAYDNYSRLYLSVLFAFIYGL  381

Query  958   SFATLAATVSHVALFHGRTIWE---QTKESVQDKFSDIHTRLMRKNYEPVPQWWFYlllv  788
              FATL A++SHVALF G+TIW+   +T  +V+ +F D+HTRLM+KNYE VPQWWF+ +L+
Sbjct  382   GFATLMASISHVALFEGKTIWQMWRKTTAAVKQQFGDVHTRLMKKNYESVPQWWFHAILI  441

Query  787   iivgvalvACQRFGGQLQLPVWGVLLAVLLSLIFTLPVGVITATTNQQTGLNVIAELIIG  608
             +   ++L  C+ F  Q QLP WG+LLA  ++  FTLPVGVI ATTN Q GLN+I E++IG
Sbjct  442   LTFALSLFTCEGFDKQFQLPWWGLLLACAMAFFFTLPVGVIQATTNLQPGLNIITEMVIG  501

Query  607   YMYPGRPLASVTFKMYGlsslsqslmflSDFKLGHYMKIPPKSMFMVQLVGTLISCCVHF  428
             YMYPG+PLA+V FK YG  S+ Q+L FL DFKLGHYMK+PPKSMF+VQLVGT+++  V+F
Sbjct  502   YMYPGKPLANVAFKTYGYISMVQALGFLGDFKLGHYMKVPPKSMFVVQLVGTIVASTVYF  561

Query  427   GTGWWLLTTVENICNPSKLPEGSQWTCPGDDVFYNASIIWGVVSPRRMFGNLGIYQATNY  248
             GT WWLLT+VE+ICNPS LPEGS WTCPGDDVFYNASIIWGVV P RMF N G Y   N+
Sbjct  562   GTAWWLLTSVEHICNPSLLPEGSPWTCPGDDVFYNASIIWGVVGPLRMFTNYGNYPQMNW  621

Query  247   FFLVGFLAPIPVWYLGRKYPEKRWVSLINMPILISGAEGIPIVKSVNYVCWFAVGLYFNL  68
             FFL+GFLAP PVW L RK+PEK+W+  I+MP+L++G   +P  K+VNY+ W AVG++FN 
Sbjct  622   FFLIGFLAPFPVWLLSRKFPEKKWIKNIHMPLLLAGPGSLPSAKAVNYLSWGAVGIFFNY  681

Query  67    YVYRKHKGWWARHNYILSAGLD  2
             YVYR+ KGWWARH YILSA LD
Sbjct  682   YVYRRFKGWWARHTYILSAALD  703



>ref|XP_006660244.1| PREDICTED: oligopeptide transporter 5-like [Oryza brachyantha]
Length=757

 Score =   921 bits (2381),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 445/675 (66%), Positives = 558/675 (83%), Gaps = 0/675 (0%)
 Frame = -1

Query  2026  SSADEINDSPVEEVRLTVPITDDPTMPCVTFRTWVLGVTSCVILAFLNQFFGYRQNALYV  1847
              + +E++D P+EEVRLTVPITDDP +P +TFRTW+LG+ SC +LAF NQFFGYRQN LY+
Sbjct  31    KTEEEVDDCPIEEVRLTVPITDDPALPALTFRTWLLGIVSCALLAFSNQFFGYRQNPLYI  90

Query  1846  SSVPAQIVVLPMGKLMAAYLPTKVVQIPGTKWSFSLNPGPFNIKEHVLITIFASSGSDFS  1667
             SS+  QIVVLP+GKLMAA LP +V+++ GT WSFSLNPGPFN+KEHVLITIFA++GS+  
Sbjct  91    SSLSVQIVVLPLGKLMAACLPRRVLRVAGTPWSFSLNPGPFNLKEHVLITIFANTGSNSV  150

Query  1666  YAVSIITMMKAFYYRDIHPLAAVLLTFSTQMLGYGLAGIFKKFLIDSPYMWWPSNLVQVS  1487
             YAV IIT++KAFY R+IHPLAA+LLT +TQ++GYG AG+F+ FL+DSPYMWWPSNLVQVS
Sbjct  151   YAVGIITIVKAFYRREIHPLAAMLLTQTTQLMGYGWAGLFRTFLVDSPYMWWPSNLVQVS  210

Query  1486  LFRALHDVETRPKGGLTRLQFFIIVLVCSFAYYVVPNYLFPSLTALSLLCWIWKNSVTAQ  1307
             LFRALH+ E RPKGG+TRLQFF+ VL+ SFAYY+VPNYLFP+++ +SL+C +WK SVTAQ
Sbjct  211   LFRALHEKEKRPKGGMTRLQFFLTVLITSFAYYIVPNYLFPTISTISLVCLVWKKSVTAQ  270

Query  1306  QlgsglkglgigSFALDWATVAAFQGSPLVTPDFAIINMLIGYVLVAYIAIPVWYWTNLF  1127
             Q+GSG+ GLG+GSF LDWATVA F G+PL TP FAI+N++ G+ L+ Y+ +P  YWT+ +
Sbjct  271   QIGSGVYGLGVGSFGLDWATVAGFLGTPLSTPAFAIVNIMAGFFLIVYVIVPAAYWTDAY  330

Query  1126  DAKKFPLFSSNVFDSNGQVYNISRVLNKKTFGFDQPGYDSYSNIYLSTAFVYTYGLSFAT  947
              AK+FP+ SS+VF +N   Y++++VL+  TF F Q GYD+   I LS  F +TYGLSFAT
Sbjct  331   GAKRFPIISSHVFTANASRYDVNQVLDPATFKFSQAGYDAAGKINLSIFFAFTYGLSFAT  390

Query  946   LAATVSHVALFHGRTIWEQTKESVQDKFSDIHTRLMRKNYEPVPQWWFYlllviivgval  767
             LAAT+SHVALFHG +IW QTK +V  +  D+HTRLM++NY  VPQWWF ++LV+++G+++
Sbjct  391   LAATLSHVALFHGGSIWRQTKATVSSQAGDVHTRLMKRNYAVVPQWWFQVMLVLVLGLSV  450

Query  766   vACQRFGGQLQLPVWGVLLAVLLSLIFTLPVGVITATTNQQTGLNVIAELIIGYMYPGRP  587
               C+ FG QLQLP WGVLLA  L+  FTLP+G+ITATTNQQ GLNVI ELIIGY+YPGRP
Sbjct  451   FTCEGFGQQLQLPYWGVLLAAGLAFFFTLPIGIITATTNQQPGLNVITELIIGYLYPGRP  510

Query  586   LASVTFKMYGlsslsqslmflSDFKLGHYMKIPPKSMFMVQLVGTLISCCVHFGTGWWLL  407
             LA+V FK YG  S+SQ++MFL DFKLGHYMKIPP+SMF+VQLVGT+++  V+FGT WWLL
Sbjct  511   LANVAFKTYGYISMSQAIMFLGDFKLGHYMKIPPRSMFIVQLVGTVLASSVYFGTSWWLL  570

Query  406   TTVENICNPSKLPEGSQWTCPGDDVFYNASIIWGVVSPRRMFGNLGIYQATNYFFLVGFL  227
              +V NIC+P+KLPEGS WTCPGDDVF+NASIIWGVV P RMFG LG+Y   NYFFL G L
Sbjct  571   ESVSNICDPTKLPEGSPWTCPGDDVFFNASIIWGVVGPLRMFGRLGLYAKMNYFFLAGAL  630

Query  226   APIPVWYLGRKYPEKRWVSLINMPILISGAEGIPIVKSVNYVCWFAVGLYFNLYVYRKHK  47
             AP+PVW L R +P+K W+ LINMP+L+     +P  +SVNY+ W AVGL FN  VYR++K
Sbjct  631   APVPVWALSRAFPDKAWIRLINMPVLLGATGMMPPARSVNYLMWGAVGLAFNYVVYRRYK  690

Query  46    GWWARHNYILSAGLD  2
             GWWARHNY+LSAGLD
Sbjct  691   GWWARHNYVLSAGLD  705



>gb|KDO59179.1| hypothetical protein CISIN_1g004845mg [Citrus sinensis]
Length=728

 Score =   921 bits (2380),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 451/675 (67%), Positives = 556/675 (82%), Gaps = 3/675 (0%)
 Frame = -1

Query  2017  DEINDSPVEEVRLTVPITDDPTMPCVTFRTWVLGVTSCVILAFLNQFFGYRQNALYVSSV  1838
             +E ND+P+EEVRLTVPITDDPT+P +TFRTWVLG+TSC +LAF+NQFFGYRQN LY+SS+
Sbjct  2     EEANDNPIEEVRLTVPITDDPTIPALTFRTWVLGLTSCCLLAFVNQFFGYRQNQLYLSSI  61

Query  1837  PAQIVVLPMGKLMAAYLPTKVVQIPGTKWSFSLNPGPFNIKEHVLITIFASSGSDFSYAV  1658
              AQI+VLP+GKLMAA LP+K + +P T WSFSLNPGPFN+KEHVLITIFA  GS   YAV
Sbjct  62    SAQILVLPIGKLMAATLPSKPIPVPLTPWSFSLNPGPFNLKEHVLITIFAGCGSSGVYAV  121

Query  1657  SIITMMKAFYYRDIHPLAAVLLTFSTQMLGYGLAGIFKKFLIDSPYMWWPSNLVQVSLFR  1478
              IIT++KAFY R +H + A++L  +TQ+LGYG AG+F+K+L+DSPYMWWP+NLVQVSLFR
Sbjct  122   GIITIVKAFYKRSLHVVPAMMLVQTTQLLGYGWAGLFRKYLVDSPYMWWPANLVQVSLFR  181

Query  1477  ALHDVETRPKGGLTRLQFFIIVLVCSFAYYVVPNYLFPSLTALSLLCWIWKNSVTAQQlg  1298
             ALH+ E R KGGLTRLQFF+IV + SFAYYVVP YLFPS++ALS +CWIWK+SVTAQ+LG
Sbjct  182   ALHEEEKRTKGGLTRLQFFVIVFISSFAYYVVPGYLFPSISALSFVCWIWKDSVTAQKLG  241

Query  1297  sglkglgigSFALDWATVAAFQGSPLVTPDFAIINMLIGYVLVAYIAIPVWYWTNLFDAK  1118
             SGL+GLG+GSF LDWATVA F GSPL TP FAI N+L+G+ L  YI IP+ YW N F+A+
Sbjct  242   SGLQGLGMGSFGLDWATVAGFLGSPLATPFFAIANILVGFFLFLYILIPIAYWCNAFEAQ  301

Query  1117  KFPLFSSNVFDSNGQVYNISRVLNKKTFGFDQPGYDSYSNIYLSTAFVYTYGLSFATLAA  938
             +FPLFSS+ FDS+GQ+YN+SR+LN+K F FD+  YD+YS +YLS  F + YGL FATL A
Sbjct  302   RFPLFSSHTFDSDGQIYNVSRILNEKEFSFDREAYDNYSRLYLSVLFAFIYGLGFATLMA  361

Query  937   TVSHVALFHGRTIWE---QTKESVQDKFSDIHTRLMRKNYEPVPQWWFYlllviivgval  767
             ++SHVALF G+TIW+   +T  +V+ +F D+HTRLM+KNYE VPQWWF+ +L+I   ++L
Sbjct  362   SISHVALFEGKTIWQMWRKTTAAVKQQFGDVHTRLMKKNYEAVPQWWFHAILIITFALSL  421

Query  766   vACQRFGGQLQLPVWGVLLAVLLSLIFTLPVGVITATTNQQTGLNVIAELIIGYMYPGRP  587
               C+ F  Q QLP WG+LLA  ++  FTLPVGVI ATTN Q GLN+I E++IGYMYPG+P
Sbjct  422   FTCEGFDKQFQLPWWGLLLACAMAFFFTLPVGVIQATTNLQPGLNIITEMVIGYMYPGKP  481

Query  586   LASVTFKMYGlsslsqslmflSDFKLGHYMKIPPKSMFMVQLVGTLISCCVHFGTGWWLL  407
             LA+V FK YG  S+ Q+L FL DFKLGHYMK+PPKSMF+VQLVGT+++  V+FGT WWLL
Sbjct  482   LANVAFKTYGYISMVQALGFLGDFKLGHYMKVPPKSMFVVQLVGTIVASTVYFGTAWWLL  541

Query  406   TTVENICNPSKLPEGSQWTCPGDDVFYNASIIWGVVSPRRMFGNLGIYQATNYFFLVGFL  227
             T+VE+ICNPS LPEGS WTCPGDDVFYNASIIWGVV P RMF N G Y   N+FFL+GFL
Sbjct  542   TSVEHICNPSLLPEGSPWTCPGDDVFYNASIIWGVVGPLRMFTNYGNYPQMNWFFLIGFL  601

Query  226   APIPVWYLGRKYPEKRWVSLINMPILISGAEGIPIVKSVNYVCWFAVGLYFNLYVYRKHK  47
             AP PVW L RK+PEK+W+  I+MP+L++G   +P  K+VNY+ W AVG++FN YVYR+ K
Sbjct  602   APFPVWLLSRKFPEKKWIKNIHMPLLLAGPGSLPSAKAVNYLSWGAVGIFFNYYVYRRFK  661

Query  46    GWWARHNYILSAGLD  2
             GWWARH YILSA LD
Sbjct  662   GWWARHTYILSAALD  676



>ref|XP_006452637.1| hypothetical protein CICLE_v10007550mg [Citrus clementina]
 gb|ESR65877.1| hypothetical protein CICLE_v10007550mg [Citrus clementina]
Length=728

 Score =   920 bits (2379),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 450/675 (67%), Positives = 556/675 (82%), Gaps = 3/675 (0%)
 Frame = -1

Query  2017  DEINDSPVEEVRLTVPITDDPTMPCVTFRTWVLGVTSCVILAFLNQFFGYRQNALYVSSV  1838
             +E ND+P+EEVRLTVPITDDPT+P +TFRTWVLG+TSC +LAF+NQFFGYRQN LY+SS+
Sbjct  2     EEANDNPIEEVRLTVPITDDPTIPALTFRTWVLGLTSCCLLAFVNQFFGYRQNQLYLSSI  61

Query  1837  PAQIVVLPMGKLMAAYLPTKVVQIPGTKWSFSLNPGPFNIKEHVLITIFASSGSDFSYAV  1658
              AQI+VLP+GKLMAA LP+K + +P T WSFSLNPGPFN+KEHVLITIFA  GS   YAV
Sbjct  62    SAQILVLPIGKLMAATLPSKPIPVPLTPWSFSLNPGPFNLKEHVLITIFAGCGSSGVYAV  121

Query  1657  SIITMMKAFYYRDIHPLAAVLLTFSTQMLGYGLAGIFKKFLIDSPYMWWPSNLVQVSLFR  1478
             SIIT++KAFY R +H + A++L  +TQ+LGYG AG+F+K+L+DSPYMWWP+NLVQVSLFR
Sbjct  122   SIITIVKAFYKRSLHVVPAMMLVHTTQLLGYGWAGLFRKYLVDSPYMWWPANLVQVSLFR  181

Query  1477  ALHDVETRPKGGLTRLQFFIIVLVCSFAYYVVPNYLFPSLTALSLLCWIWKNSVTAQQlg  1298
             ALH+ E R KGGLTRLQFF+IV + SFAYYVVP YLFPS++ALS +CWIWK+SVTAQ+LG
Sbjct  182   ALHEEEKRTKGGLTRLQFFVIVFISSFAYYVVPGYLFPSISALSFVCWIWKDSVTAQKLG  241

Query  1297  sglkglgigSFALDWATVAAFQGSPLVTPDFAIINMLIGYVLVAYIAIPVWYWTNLFDAK  1118
             SGL+GLG+GSF LDWATVA F GSPL TP FAI N+L+G+ L  YI IP+ YW N F+A+
Sbjct  242   SGLQGLGMGSFGLDWATVAGFLGSPLATPFFAIANILVGFFLFLYILIPIAYWCNAFEAQ  301

Query  1117  KFPLFSSNVFDSNGQVYNISRVLNKKTFGFDQPGYDSYSNIYLSTAFVYTYGLSFATLAA  938
             +FPLFSS+ FD +GQ+YN+SR+LN+K F FD+  YD+YS +YLS  F + YGL FATL A
Sbjct  302   RFPLFSSHTFDYDGQIYNVSRILNEKEFSFDREAYDNYSRLYLSVLFAFIYGLGFATLMA  361

Query  937   TVSHVALFHGRTIWE---QTKESVQDKFSDIHTRLMRKNYEPVPQWWFYlllviivgval  767
             ++SHVALF G+TIW+   +T  +V+ +F D+HTRLM+KNYE VPQWWF+ +L++   ++L
Sbjct  362   SISHVALFEGKTIWQMWRKTTAAVKQQFGDVHTRLMKKNYESVPQWWFHAILILTFALSL  421

Query  766   vACQRFGGQLQLPVWGVLLAVLLSLIFTLPVGVITATTNQQTGLNVIAELIIGYMYPGRP  587
               C+ F  Q QLP WG+LLA  ++  FTLPVGVI ATTN Q GLN+I E++IGYMYPG+P
Sbjct  422   FTCEGFDKQFQLPWWGLLLACAMAFFFTLPVGVIQATTNLQPGLNIITEMVIGYMYPGKP  481

Query  586   LASVTFKMYGlsslsqslmflSDFKLGHYMKIPPKSMFMVQLVGTLISCCVHFGTGWWLL  407
             LA+V FK YG  S+ Q+L FL DFKLGHYMK+PPKSMF+VQLVGT+++  V+FGT WWLL
Sbjct  482   LANVAFKTYGYISMVQALGFLGDFKLGHYMKVPPKSMFVVQLVGTIVASTVYFGTAWWLL  541

Query  406   TTVENICNPSKLPEGSQWTCPGDDVFYNASIIWGVVSPRRMFGNLGIYQATNYFFLVGFL  227
             T+VE+ICNPS LPEGS WTCPGDDVFYNASIIWGVV P RMF N G Y   N+FFL+GFL
Sbjct  542   TSVEHICNPSLLPEGSPWTCPGDDVFYNASIIWGVVGPLRMFTNYGNYPQMNWFFLIGFL  601

Query  226   APIPVWYLGRKYPEKRWVSLINMPILISGAEGIPIVKSVNYVCWFAVGLYFNLYVYRKHK  47
             AP PVW L RK+PEK+W+  I+MP+L++G   +P  K+VNY+ W AVG++FN YVYR+ K
Sbjct  602   APFPVWLLSRKFPEKKWIKNIHMPLLLAGPGSLPSAKAVNYLSWGAVGIFFNYYVYRRFK  661

Query  46    GWWARHNYILSAGLD  2
             GWWARH YILSA LD
Sbjct  662   GWWARHTYILSAALD  676



>ref|XP_009334674.1| PREDICTED: oligopeptide transporter 1-like [Pyrus x bretschneideri]
Length=750

 Score =   918 bits (2373),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 444/670 (66%), Positives = 557/670 (83%), Gaps = 3/670 (0%)
 Frame = -1

Query  2002  SPVEEVRLTVPITDDPTMPCVTFRTWVLGVTSCVILAFLNQFFGYRQNALYVSSVPAQIV  1823
             SP+E+VRLTVPITDDP+ P +TFRTWVLG+ SC +LAF+NQFFGYRQN LYVSSV AQI+
Sbjct  29    SPIEQVRLTVPITDDPSEPTLTFRTWVLGIISCSVLAFVNQFFGYRQNQLYVSSVSAQIL  88

Query  1822  VLPMGKLMAAYLPTKVVQIPGTKWSFSLNPGPFNIKEHVLITIFASSGSDFSYAVSIITM  1643
             VLP+GKLMAA LP + +++P   WSFSLNPGPFN+KEHVLITIFA+SGS+  YAV+IIT+
Sbjct  89    VLPLGKLMAATLPKRRIRLPYRNWSFSLNPGPFNLKEHVLITIFANSGSNSVYAVNIITI  148

Query  1642  MKAFYYRDIHPLAAVLLTFSTQMLGYGLAGIFKKFLIDSPYMWWPSNLVQVSLFRALHDV  1463
             + AFY+R +HP AA LL  +TQMLGYG AGIF+K+L+DSPYMWWPSNLVQVSLFRALH+ 
Sbjct  149   VMAFYHRPMHPAAAFLLAQTTQMLGYGWAGIFRKYLVDSPYMWWPSNLVQVSLFRALHEK  208

Query  1462  ETRPKGGLTRLQFFIIVLVCSFAYYVVPNYLFPSLTALSLLCWIWKNSVTAQQlgsglkg  1283
             E RPKGG TRLQFF +V +CSFAYY+VP++LFPS++A S +CWI+K+S+TAQQ+GSG+ G
Sbjct  209   EKRPKGGRTRLQFFFMVFICSFAYYIVPSFLFPSISAFSFVCWIYKDSITAQQIGSGMHG  268

Query  1282  lgigSFALDWATVAAFQGSPLVTPDFAIINMLIGYVLVAYIAIPVWYWTNLFDAKKFPLF  1103
             LGIGSF  DW+TVA F GSPL TP FA IN+LIG+VL+ YI  P+ YW N +DA+KFP+ 
Sbjct  269   LGIGSFGFDWSTVAGFLGSPLATPGFATINILIGFVLIVYIVTPIAYWNNAYDAQKFPII  328

Query  1102  SSNVFDSNGQVYNISRVLNKKTFGFDQPGYDSYSNIYLSTAFVYTYGLSFATLAATVSHV  923
             +S+ FDS GQ+YNISRVL++K F  +  GY+ YS +YLST F ++YGLSFATL AT+SHV
Sbjct  329   TSHTFDSTGQIYNISRVLDQKNFDINMVGYNGYSKLYLSTFFAFSYGLSFATLTATISHV  388

Query  922   ALFHGRTI---WEQTKESVQDKFSDIHTRLMRKNYEPVPQWWFYlllviivgvalvACQR  752
             ALFHGRTI   W++T  +V+D+  DIHTRLM+KNY+ VPQWWF ++LV +V +A+  C+ 
Sbjct  389   ALFHGRTIWKMWKKTTSAVKDQIGDIHTRLMKKNYDAVPQWWFQIILVSMVALAIYTCEG  448

Query  751   FGGQLQLPVWGVLLAVLLSLIFTLPVGVITATTNQQTGLNVIAELIIGYMYPGRPLASVT  572
             FG QLQLP WGVL+A  ++L FTLP+G+I ATTNQQ GLNVI EL+IGY+YPG+P+A+V 
Sbjct  449   FGKQLQLPWWGVLMACGIALFFTLPIGIIQATTNQQPGLNVITELLIGYIYPGKPVANVA  508

Query  571   FKMYGlsslsqslmflSDFKLGHYMKIPPKSMFMVQLVGTLISCCVHFGTGWWLLTTVEN  392
             FK YG  S+SQ+L FL DFKLGHYMKIPPKSMF+VQLVGTL++  V+FGT WWL+T++E 
Sbjct  509   FKTYGYISMSQALNFLGDFKLGHYMKIPPKSMFVVQLVGTLVASSVYFGTSWWLITSIEY  568

Query  391   ICNPSKLPEGSQWTCPGDDVFYNASIIWGVVSPRRMFGNLGIYQATNYFFLVGFLAPIPV  212
             IC+P KLP GS WTCPGDDVFYNASIIWGV+ P RMF   G+Y   N+FFL+G LAP+P+
Sbjct  569   ICDPLKLPTGSPWTCPGDDVFYNASIIWGVIGPLRMFAGKGVYPEMNWFFLIGLLAPVPI  628

Query  211   WYLGRKYPEKRWVSLINMPILISGAEGIPIVKSVNYVCWFAVGLYFNLYVYRKHKGWWAR  32
             W+L +K+P ++W+ LINMPI++     +P  ++VNY+ W +VG++FN YVYRK+KGWWAR
Sbjct  629   WFLSKKFPNQKWIKLINMPIILGATGSMPPARAVNYLTWLSVGIFFNFYVYRKYKGWWAR  688

Query  31    HNYILSAGLD  2
             HNYILSA LD
Sbjct  689   HNYILSAALD  698



>ref|XP_006857743.1| hypothetical protein AMTR_s00061p00190940 [Amborella trichopoda]
 gb|ERN19210.1| hypothetical protein AMTR_s00061p00190940 [Amborella trichopoda]
Length=743

 Score =   917 bits (2371),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 441/676 (65%), Positives = 560/676 (83%), Gaps = 0/676 (0%)
 Frame = -1

Query  2029  ESSADEINDSPVEEVRLTVPITDDPTMPCVTFRTWVLGVTSCVILAFLNQFFGYRQNALY  1850
             +   +EIND+P+E+VRLTVPITDDPT+P +TFRTWVLG+ +C +LAFLNQFFGYRQN+LY
Sbjct  16    DDETEEINDNPIEQVRLTVPITDDPTLPVLTFRTWVLGIITCSVLAFLNQFFGYRQNSLY  75

Query  1849  VSSVPAQIVVLPMGKLMAAYLPTKVVQIPGTKWSFSLNPGPFNIKEHVLITIFASSGSDF  1670
             V +V AQIV LP+GKLMA  LPT  + IPGTKW FS+NPGPFN+KEHVLITIFA+SGS+ 
Sbjct  76    VPAVAAQIVTLPLGKLMAKTLPTNSITIPGTKWKFSMNPGPFNLKEHVLITIFANSGSNS  135

Query  1669  SYAVSIITMMKAFYYRDIHPLAAVLLTFSTQMLGYGLAGIFKKFLIDSPYMWWPSNLVQV  1490
              YAV+IIT++KAFY+R ++P AA+LL+ +TQMLGYG AG+F+KFL+DSPYMWWP+NLVQV
Sbjct  136   VYAVNIITIVKAFYHRQLNPFAALLLSQTTQMLGYGWAGVFRKFLVDSPYMWWPANLVQV  195

Query  1489  SLFRALHDVETRPKGGLTRLQFFIIVLVCSFAYYVVPNYLFPSLTALSLLCWIWKNSVTA  1310
             SLFRALH+ E R KG +TRLQFF+ V + SF+YYVVPNY FPS+T+LS +CWIWK+SVTA
Sbjct  196   SLFRALHEKEVRSKGSMTRLQFFLAVFLTSFSYYVVPNYFFPSITSLSFVCWIWKDSVTA  255

Query  1309  QQlgsglkglgigSFALDWATVAAFQGSPLVTPDFAIINMLIGYVLVAYIAIPVWYWTNL  1130
             QQ+GSGL GLGIGSFALDW+ VA+F GSPL TP FAI N++ G+ L  Y+ +P+ YWTN 
Sbjct  256   QQIGSGLYGLGIGSFALDWSAVASFLGSPLATPGFAIANIMFGFFLTMYVVLPITYWTNS  315

Query  1129  FDAKKFPLFSSNVFDSNGQVYNISRVLNKKTFGFDQPGYDSYSNIYLSTAFVYTYGLSFA  950
             F AK+FP+FSS+VFD  GQ YNISRVL+  TF F++ GY  YS ++LS  FV+ YG+ FA
Sbjct  316   FQAKRFPIFSSHVFDGVGQPYNISRVLDDATFSFNEVGYQGYSKVHLSIFFVFAYGIGFA  375

Query  949   TLAATVSHVALFHGRTIWEQTKESVQDKFSDIHTRLMRKNYEPVPQWWFYlllviivgva  770
             TLAATVSHVALFHG+ IW   + + +++  D+HTR+M+KNY+ VPQ+WFY++LV ++ +A
Sbjct  376   TLAATVSHVALFHGKNIWGHFRATFRNQKGDVHTRIMKKNYKEVPQYWFYIILVAMIVLA  435

Query  769   lvACQRFGGQLQLPVWGVLLAVLLSLIFTLPVGVITATTNQQTGLNVIAELIIGYMYPGR  590
             +  C+ FGGQLQLP WGV +A  L+L FTLP+G+I ATTN Q GLNVI ELIIGY+YPG+
Sbjct  436   ISCCEGFGGQLQLPYWGVFMACGLALFFTLPIGIIQATTNMQPGLNVITELIIGYIYPGK  495

Query  589   PLASVTFKMYGlsslsqslmflSDFKLGHYMKIPPKSMFMVQLVGTLISCCVHFGTGWWL  410
             PLA+V+FK YG  S+SQ++MFL DFKLGHYMKIPP+SMF+ QLVGT++S  ++FGT WWL
Sbjct  496   PLANVSFKTYGYISMSQAIMFLQDFKLGHYMKIPPRSMFVAQLVGTVLSTSIYFGTSWWL  555

Query  409   LTTVENICNPSKLPEGSQWTCPGDDVFYNASIIWGVVSPRRMFGNLGIYQATNYFFLVGF  230
             L +V +IC+ S+LP+GS WTCPGDDVFYNASIIWGVV P RMFG+ G+YQ  N FFL+GF
Sbjct  556   LESVPHICDRSQLPDGSPWTCPGDDVFYNASIIWGVVGPLRMFGSKGLYQLQNLFFLIGF  615

Query  229   LAPIPVWYLGRKYPEKRWVSLINMPILISGAEGIPIVKSVNYVCWFAVGLYFNLYVYRKH  50
             LAP+PVW L +K+P K+W+SLINMP++I     +P  ++VN++CW  VG  FN  +Y+++
Sbjct  616   LAPVPVWILSKKFPNKKWISLINMPLIIGATGNMPPARAVNFICWGIVGYIFNFLIYKRY  675

Query  49    KGWWARHNYILSAGLD  2
             KGWWARH Y+LSAGLD
Sbjct  676   KGWWARHTYVLSAGLD  691



>ref|XP_009367241.1| PREDICTED: oligopeptide transporter 1-like [Pyrus x bretschneideri]
Length=750

 Score =   917 bits (2370),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 444/670 (66%), Positives = 556/670 (83%), Gaps = 3/670 (0%)
 Frame = -1

Query  2002  SPVEEVRLTVPITDDPTMPCVTFRTWVLGVTSCVILAFLNQFFGYRQNALYVSSVPAQIV  1823
             SP+E+VRLTVPITDDP+ P +TFRTWVLG+ SC +LAF+NQFFGYRQN LYVSSV AQI+
Sbjct  29    SPIEQVRLTVPITDDPSEPTLTFRTWVLGIISCSVLAFVNQFFGYRQNQLYVSSVSAQIL  88

Query  1822  VLPMGKLMAAYLPTKVVQIPGTKWSFSLNPGPFNIKEHVLITIFASSGSDFSYAVSIITM  1643
             VLP+GKLMAA LP + +++P   WSFSLNPGPFN+KEHVLITIFA+SGS+  YAV+IIT+
Sbjct  89    VLPLGKLMAATLPKRRIRLPYRNWSFSLNPGPFNLKEHVLITIFANSGSNSVYAVNIITI  148

Query  1642  MKAFYYRDIHPLAAVLLTFSTQMLGYGLAGIFKKFLIDSPYMWWPSNLVQVSLFRALHDV  1463
             + AFY+R +HP AA LL  +TQMLGYG AGIF+K+L+DSPYMWWPSNLVQVSLFRALH+ 
Sbjct  149   VMAFYHRPMHPAAAFLLAQTTQMLGYGWAGIFRKYLVDSPYMWWPSNLVQVSLFRALHEK  208

Query  1462  ETRPKGGLTRLQFFIIVLVCSFAYYVVPNYLFPSLTALSLLCWIWKNSVTAQQlgsglkg  1283
             E RPKGG TRLQFF +V +CSFAYY+VP++LFPS++A S +CWI+K+S+TAQQ+GSG+ G
Sbjct  209   EKRPKGGRTRLQFFFMVFICSFAYYIVPSFLFPSISAFSFVCWIYKDSITAQQIGSGMHG  268

Query  1282  lgigSFALDWATVAAFQGSPLVTPDFAIINMLIGYVLVAYIAIPVWYWTNLFDAKKFPLF  1103
             LGIGSF  DW+TVA F GSPL TP FA IN+LIG+VL+ YI  P+ YW N +DA+KFP+ 
Sbjct  269   LGIGSFGFDWSTVAGFLGSPLATPGFATINILIGFVLIVYIVTPIAYWNNAYDAQKFPII  328

Query  1102  SSNVFDSNGQVYNISRVLNKKTFGFDQPGYDSYSNIYLSTAFVYTYGLSFATLAATVSHV  923
             +S+ FDS GQ YNISRVL++K F  +  GY+ YS +YLST F ++YGLSFATL AT+SHV
Sbjct  329   TSHTFDSTGQSYNISRVLDQKNFDINMVGYNGYSKLYLSTFFAFSYGLSFATLTATISHV  388

Query  922   ALFHGRTI---WEQTKESVQDKFSDIHTRLMRKNYEPVPQWWFYlllviivgvalvACQR  752
             ALFHGRTI   W++T  +V+D+  DIHTRLM+KNY+ VPQWWF ++LV +V +A+  C+ 
Sbjct  389   ALFHGRTIWKMWKKTTSAVKDQIGDIHTRLMKKNYDAVPQWWFQIILVSMVALAIYTCEG  448

Query  751   FGGQLQLPVWGVLLAVLLSLIFTLPVGVITATTNQQTGLNVIAELIIGYMYPGRPLASVT  572
             FG QLQLP WGVL+A  ++L FTLP+G+I ATTNQQ GLNVI EL+IGY+YPG+P+A+V 
Sbjct  449   FGKQLQLPWWGVLMACGIALFFTLPIGIIQATTNQQPGLNVITELLIGYIYPGKPVANVA  508

Query  571   FKMYGlsslsqslmflSDFKLGHYMKIPPKSMFMVQLVGTLISCCVHFGTGWWLLTTVEN  392
             FK YG  S+SQ+L FL DFKLGHYMKIPPKSMF+VQLVGTL++  V+FGT WWL+T++E 
Sbjct  509   FKTYGYISMSQALNFLGDFKLGHYMKIPPKSMFVVQLVGTLVASSVYFGTSWWLITSIEY  568

Query  391   ICNPSKLPEGSQWTCPGDDVFYNASIIWGVVSPRRMFGNLGIYQATNYFFLVGFLAPIPV  212
             IC+P KLP GS WTCPGDDVFYNASIIWGV+ P RMF   G+Y   N+FFL+G LAP+P+
Sbjct  569   ICDPLKLPTGSPWTCPGDDVFYNASIIWGVIGPLRMFAGKGVYPEMNWFFLIGLLAPVPI  628

Query  211   WYLGRKYPEKRWVSLINMPILISGAEGIPIVKSVNYVCWFAVGLYFNLYVYRKHKGWWAR  32
             W+L +K+P ++W+ LINMPI++     +P  ++VNY+ W +VG++FN YVYRK+KGWWAR
Sbjct  629   WFLSKKFPNQKWIKLINMPIILGATGSMPPARAVNYLTWLSVGIFFNFYVYRKYKGWWAR  688

Query  31    HNYILSAGLD  2
             HNYILSA LD
Sbjct  689   HNYILSAALD  698



>ref|XP_006474841.1| PREDICTED: oligopeptide transporter 1-like [Citrus sinensis]
Length=756

 Score =   914 bits (2363),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 443/675 (66%), Positives = 562/675 (83%), Gaps = 3/675 (0%)
 Frame = -1

Query  2017  DEINDSPVEEVRLTVPITDDPTMPCVTFRTWVLGVTSCVILAFLNQFFGYRQNALYVSSV  1838
             +E+NDSP+E+VRLTVPITDDP+ P +TFRTW LG+ SCV+L+FLN+FFG+RQN L V S+
Sbjct  30    EEVNDSPIEQVRLTVPITDDPSQPALTFRTWFLGIISCVVLSFLNRFFGFRQNQLSVGSI  89

Query  1837  PAQIVVLPMGKLMAAYLPTKVVQIPGTKWSFSLNPGPFNIKEHVLITIFASSGSDFSYAV  1658
              AQI+VLP+GKLMAA LP+K +++P TKW+FS+NPGPFN+KEHVLITIFA+ G+   YAV
Sbjct  90    SAQIIVLPLGKLMAATLPSKPIRVPLTKWTFSMNPGPFNLKEHVLITIFANCGAGGVYAV  149

Query  1657  SIITMMKAFYYRDIHPLAAVLLTFSTQMLGYGLAGIFKKFLIDSPYMWWPSNLVQVSLFR  1478
              IIT++KAFY R ++PLAA+LL  +TQ+LGYG AG+F+K+L+DSP+MWWP+NLVQVSLFR
Sbjct  150   YIITIVKAFYKRKLNPLAAMLLAQTTQLLGYGWAGLFRKYLVDSPFMWWPANLVQVSLFR  209

Query  1477  ALHDVETRPKGGLTRLQFFIIVLVCSFAYYVVPNYLFPSLTALSLLCWIWKNSVTAQQlg  1298
             ALH+ E RPKGGLTRLQFF +V   SFAYYVVP YLFP+L+ALS +CWIWKNSVTAQQ+G
Sbjct  210   ALHEKEKRPKGGLTRLQFFFMVFASSFAYYVVPGYLFPTLSALSFVCWIWKNSVTAQQIG  269

Query  1297  sglkglgigSFALDWATVAAFQGSPLVTPDFAIINMLIGYVLVAYIAIPVWYWTNLFDAK  1118
             +GL GLGIGSF LDW+TVA+F GSPL +P FAIIN+L G++L  Y+ +P+ YWTN ++AK
Sbjct  270   AGLNGLGIGSFGLDWSTVASFLGSPLASPVFAIINVLAGFILNLYVLVPIAYWTNTYEAK  329

Query  1117  KFPLFSSNVFDSNGQVYNISRVLNKKTFGFDQPGYDSYSNIYLSTAFVYTYGLSFATLAA  938
             +FP+FSS+ FDS GQ YNISR+LN+ TF  D   ++SYS +YLS  F + YGLSFATL A
Sbjct  330   RFPIFSSHTFDSTGQPYNISRILNEATFDLDHDAFNSYSKLYLSPFFAFNYGLSFATLTA  389

Query  937   TVSHVALFHGRTIWE---QTKESVQDKFSDIHTRLMRKNYEPVPQWWFYlllviivgval  767
             T+SHVALF G  IW+   +T  + +DKF+D+HTRLM+K+YE VPQWWF+++LV  V +++
Sbjct  390   TISHVALFDGSDIWQMWKRTTSAARDKFADVHTRLMKKHYEAVPQWWFHIILVATVALSI  449

Query  766   vACQRFGGQLQLPVWGVLLAVLLSLIFTLPVGVITATTNQQTGLNVIAELIIGYMYPGRP  587
              AC+ F  QLQLP WG+LLA  ++L FTLP+G+I ATTNQQ GLNVI ELIIGYMYPGRP
Sbjct  450   YACEGFDKQLQLPWWGILLACAIALFFTLPIGIIQATTNQQPGLNVITELIIGYMYPGRP  509

Query  586   LASVTFKMYGlsslsqslmflSDFKLGHYMKIPPKSMFMVQLVGTLISCCVHFGTGWWLL  407
             LA+V FK YG  S+SQ+L FL+DFKLGHYMKIPPKSMF+VQL+GT+++  V+FGT WWLL
Sbjct  510   LANVAFKTYGYISMSQALSFLADFKLGHYMKIPPKSMFLVQLIGTVVASSVYFGTAWWLL  569

Query  406   TTVENICNPSKLPEGSQWTCPGDDVFYNASIIWGVVSPRRMFGNLGIYQATNYFFLVGFL  227
             T+VE+IC+PS LPEGS WTCPGDDVFY+ASIIWG+V P +MF   G+Y A N+FFLVG L
Sbjct  570   TSVEHICDPSALPEGSPWTCPGDDVFYSASIIWGIVGPGKMFTKEGVYPALNWFFLVGLL  629

Query  226   APIPVWYLGRKYPEKRWVSLINMPILISGAEGIPIVKSVNYVCWFAVGLYFNLYVYRKHK  47
             AP+P+W+L RK+PE +W+ LI++PI+  G   +P  ++V+Y+ W AVG++FN YVYR+ K
Sbjct  630   APVPIWFLSRKFPEIKWIRLIHIPIIFGGTGNMPPARAVHYLSWAAVGIFFNYYVYRRFK  689

Query  46    GWWARHNYILSAGLD  2
             GWWARH YILSA LD
Sbjct  690   GWWARHTYILSAALD  704



>ref|XP_009349149.1| PREDICTED: oligopeptide transporter 1-like [Pyrus x bretschneideri]
Length=753

 Score =   914 bits (2361),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 440/675 (65%), Positives = 561/675 (83%), Gaps = 3/675 (0%)
 Frame = -1

Query  2017  DEINDSPVEEVRLTVPITDDPTMPCVTFRTWVLGVTSCVILAFLNQFFGYRQNALYVSSV  1838
             D +ND P+EEVRLTVPITDDP+ P +TFRTWVLG+ SC ILAF+N+FFG+R N L VSSV
Sbjct  27    DAVNDCPIEEVRLTVPITDDPSQPTLTFRTWVLGILSCAILAFVNKFFGFRTNQLSVSSV  86

Query  1837  PAQIVVLPMGKLMAAYLPTKVVQIPGTKWSFSLNPGPFNIKEHVLITIFASSGSDFSYAV  1658
              AQIVVLP+GKLMAA LPT+  ++P TKWSF++NPGPFN+KEHVLITIFA+SG+   YAV
Sbjct  87    SAQIVVLPLGKLMAATLPTRKFRVPFTKWSFTMNPGPFNLKEHVLITIFANSGAGGVYAV  146

Query  1657  SIITMMKAFYYRDIHPLAAVLLTFSTQMLGYGLAGIFKKFLIDSPYMWWPSNLVQVSLFR  1478
              IIT++KAFY+R  +P AA LL  +TQMLGYG AG+F+K+L+DSPYMWWPSNLVQVSLFR
Sbjct  147   HIITIVKAFYHRPQNPAAAFLLAQTTQMLGYGWAGLFRKYLVDSPYMWWPSNLVQVSLFR  206

Query  1477  ALHDVETRPKGGLTRLQFFIIVLVCSFAYYVVPNYLFPSLTALSLLCWIWKNSVTAQQlg  1298
             ALH+ E RPKGGLTRLQFF+ V  CSFAYY++P +LFPS++A S++C IWK+S+TAQQ+G
Sbjct  207   ALHEKEKRPKGGLTRLQFFLTVFACSFAYYIIPGFLFPSISAFSIVCLIWKSSITAQQIG  266

Query  1297  sglkglgigSFALDWATVAAFQGSPLVTPDFAIINMLIGYVLVAYIAIPVWYWTNLFDAK  1118
             SG+ GLGIGSF  DW+T+A F GSPL TP FAIINML+G++L+ Y+  P+ YW+N +DAK
Sbjct  267   SGMGGLGIGSFGFDWSTIAGFLGSPLATPGFAIINMLVGFILILYVLTPISYWSNAYDAK  326

Query  1117  KFPLFSSNVFDSNGQVYNISRVLNKKTFGFDQPGYDSYSNIYLSTAFVYTYGLSFATLAA  938
             KFP+F+S+ FDS G+ +NISRVLN+ TF  D   Y++YS +YLST F +TYGLSFATL A
Sbjct  327   KFPIFTSHTFDSTGKTFNISRVLNETTFDIDLEAYNNYSKLYLSTFFAFTYGLSFATLTA  386

Query  937   TVSHVALFHGRTI---WEQTKESVQDKFSDIHTRLMRKNYEPVPQWWFYlllviivgval  767
             T+SHV LFHG++I   W++T   V+D+  DIHTRLM+KNY+ VPQWWF L+LV++VG+++
Sbjct  387   TISHVGLFHGKSIWHMWKKTASVVKDQVGDIHTRLMKKNYDSVPQWWFQLILVLMVGLSI  446

Query  766   vACQRFGGQLQLPVWGVLLAVLLSLIFTLPVGVITATTNQQTGLNVIAELIIGYMYPGRP  587
              AC+ FG QLQLP WGVL+A  ++L FTLP+G+I ATTNQQ GLNVI EL+IGY+YPG+P
Sbjct  447   FACEGFGKQLQLPWWGVLMACGIALFFTLPIGIIQATTNQQPGLNVITELVIGYIYPGKP  506

Query  586   LASVTFKMYGlsslsqslmflSDFKLGHYMKIPPKSMFMVQLVGTLISCCVHFGTGWWLL  407
             LA+V FK YG  S++Q+L FL DFKLGHYMKIPPKSMF+ QLVGT+++  V+FGT WWLL
Sbjct  507   LANVAFKTYGYISMAQALTFLGDFKLGHYMKIPPKSMFIAQLVGTVVASGVYFGTAWWLL  566

Query  406   TTVENICNPSKLPEGSQWTCPGDDVFYNASIIWGVVSPRRMFGNLGIYQATNYFFLVGFL  227
              ++E+IC+ S LPEGS WTCPGDDVFYNASIIWGV+ P RMF + G+Y+  N+FFL+G L
Sbjct  567   ESIEHICDTSNLPEGSPWTCPGDDVFYNASIIWGVIGPLRMFTSYGVYKEMNWFFLIGLL  626

Query  226   APIPVWYLGRKYPEKRWVSLINMPILISGAEGIPIVKSVNYVCWFAVGLYFNLYVYRKHK  47
             AP+PVW+L +K+P ++W+ LINMPI++     +P  K+V+++ WF VG++F+ YVY++HK
Sbjct  627   APVPVWFLSKKFPNQKWIRLINMPIILGATGNMPPAKAVHFITWFTVGIFFSFYVYKRHK  686

Query  46    GWWARHNYILSAGLD  2
             GWWARHNYILSA LD
Sbjct  687   GWWARHNYILSAALD  701



>ref|XP_004973781.1| PREDICTED: oligopeptide transporter 1-like [Setaria italica]
Length=756

 Score =   914 bits (2361),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 450/679 (66%), Positives = 561/679 (83%), Gaps = 4/679 (1%)
 Frame = -1

Query  2026  SSADEINDSPVEEVRLTVPITDDPTMPCVTFRTWVLGVTSCVILAFLNQFFGYRQNALYV  1847
              SA+E++D P+EEVRLTVPITD+P +P +TFRTW LG+ SC +LAF NQFFGYRQN LY+
Sbjct  26    DSAEEVDDCPIEEVRLTVPITDNPALPALTFRTWFLGLISCALLAFSNQFFGYRQNPLYI  85

Query  1846  SSVPAQIVVLPMGKLMAAYLPTKVVQIPGTKWSFSLNPGPFNIKEHVLITIFASSGSDFS  1667
             SS+  QIVVLP+GKLMAA LP K V+I GTKWSFSLNPGPFN+KEHVLITIFA++GS+  
Sbjct  86    SSLSVQIVVLPLGKLMAACLPKKAVRIRGTKWSFSLNPGPFNLKEHVLITIFANTGSNSV  145

Query  1666  YAVSIITMMKAFYYRDIHPLAAVLLTFSTQMLGYGLAGIFKKFLIDSPYMWWPSNLVQVS  1487
             YAV IIT++KAFY+R+IHPLAA+LLT +TQ++GYG AG+F+KFL+DSPYMWWP+NLVQVS
Sbjct  146   YAVGIITIVKAFYHREIHPLAAMLLTQTTQLMGYGWAGLFRKFLVDSPYMWWPANLVQVS  205

Query  1486  LFRALHDVETRPKGGLTRLQFFIIVLVCSFAYYVVPNYLFPSLTALSLLCWIWKNSVTAQ  1307
             LFRALH+ E RPKGG TRLQFF+ VL+ SFAYY+VPNYLFP+++ +SL+C +WKNSVTAQ
Sbjct  206   LFRALHEKEKRPKGGTTRLQFFLTVLITSFAYYIVPNYLFPTISTISLVCLVWKNSVTAQ  265

Query  1306  QlgsglkglgigSFALDWATVAAFQGSPLVTPDFAIINMLIGYVLVAYIAIPVWYWTNLF  1127
             Q+GSG+ GLG+GSF LDWATVA F G+PL TP FAI N++ G+ L+ Y+ +PV YWT+ +
Sbjct  266   QIGSGVYGLGVGSFGLDWATVAGFLGTPLSTPAFAIANIMAGFFLIVYVIVPVAYWTDAY  325

Query  1126  DAKKFPLFSSNVFDSNGQVYNISRVLNKKTFGFDQPGYDSYSNIYLSTAFVYTYGLSFAT  947
              AK+FP+ SS+VF +NG  Y++++VL+  TF F Q GYD    I LS  F +TYGLSFAT
Sbjct  326   GAKRFPIISSHVFMANGSRYDVNKVLDPATFQFSQAGYDGAGQINLSIFFSFTYGLSFAT  385

Query  946   LAATVSHVALFHGRTIWEQTKESVQDKFS-DIHTRLMRKNYEPVPQWWFYlllviivgva  770
             LAAT+SHVAL+HGR+IWEQTK +V+ + + D+HTRLM++NY  VPQWWF ++LV+++G++
Sbjct  386   LAATLSHVALYHGRSIWEQTKATVRAQNAGDVHTRLMKRNYAAVPQWWFQVMLVLVLGLS  445

Query  769   lvACQRFGGQLQLPVWGVLLAVLLSLIFTLPVGVITATTNQQTGLNVIAELIIGYMYPGR  590
             +  C+ FG QLQLP WGVLLA  L+  FTLP+G+ITATTNQQ GLNV+ ELIIGY+YPGR
Sbjct  446   VFTCEGFGRQLQLPYWGVLLAAGLAFFFTLPIGIITATTNQQPGLNVVTELIIGYLYPGR  505

Query  589   PLASVTFKMYGlsslsqslmflSDFKLGHYMKIPPKSMFMVQLVGTLISCCVHFGTGWWL  410
             PLA+V FK YG  S+SQ++MFL DFKLGHYMKIPP+SMF+VQLVGT+++  V+FGT WWL
Sbjct  506   PLANVAFKTYGYISMSQAIMFLQDFKLGHYMKIPPRSMFIVQLVGTVLASSVYFGTSWWL  565

Query  409   LTTVENICNPSKLPEGSQWTCPGDDVFYNASIIWGVVSPRRMFGNLGIYQATNYFFLVGF  230
             L +V NIC+PSKLPEGS WTCPGDDVF+NASIIWGVV P RMFG LG+Y   NYFFL G 
Sbjct  566   LESVPNICDPSKLPEGSPWTCPGDDVFFNASIIWGVVGPLRMFGRLGLYAKMNYFFLAGA  625

Query  229   LAPIPVWYLGRKYPEKR---WVSLINMPILISGAEGIPIVKSVNYVCWFAVGLYFNLYVY  59
             LAP+P W L R +P      W+ L+NMP+L+     +P  +SVNY+ W AVGL FN  VY
Sbjct  626   LAPVPFWALSRVFPGSAWAPWLRLVNMPVLLGATGMMPPARSVNYLMWGAVGLAFNHVVY  685

Query  58    RKHKGWWARHNYILSAGLD  2
             R++KGWWARHNY+LSAGLD
Sbjct  686   RRYKGWWARHNYVLSAGLD  704



>ref|XP_004148255.1| PREDICTED: oligopeptide transporter 5-like [Cucumis sativus]
 ref|XP_004164633.1| PREDICTED: oligopeptide transporter 5-like [Cucumis sativus]
 gb|KGN56026.1| hypothetical protein Csa_3G047870 [Cucumis sativus]
Length=759

 Score =   910 bits (2352),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 441/697 (63%), Positives = 564/697 (81%), Gaps = 3/697 (0%)
 Frame = -1

Query  2086  NSSLSRLLH*MENTGISAVESSADEINDSPVEEVRLTVPITDDPTMPCVTFRTWVLGVTS  1907
              S L+  +H  +N    +++   +E ND P+EEVRLTVPITDDP+   +TFRTW LG+ S
Sbjct  12    QSKLTDDMHDHKNHSSFSIQGEVEE-NDCPIEEVRLTVPITDDPSEAALTFRTWFLGLVS  70

Query  1906  CVILAFLNQFFGYRQNALYVSSVPAQIVVLPMGKLMAAYLPTKVVQIPGTKWSFSLNPGP  1727
             C +LAF+NQFFGYRQN LY+SSV AQIV LP+GKLMA  LPTKV ++P   WSFSLNPGP
Sbjct  71    CCLLAFVNQFFGYRQNQLYISSVSAQIVALPLGKLMATTLPTKVFKLPIFNWSFSLNPGP  130

Query  1726  FNIKEHVLITIFASSGSDFSYAVSIITMMKAFYYRDIHPLAAVLLTFSTQMLGYGLAGIF  1547
             F +KEHVLITIFA+ GS   YAV+IIT++KAFY+R++HP AA++L+ +TQMLGYG AGIF
Sbjct  131   FTLKEHVLITIFANCGSSSVYAVNIITIVKAFYHRNLHPAAALMLSMTTQMLGYGWAGIF  190

Query  1546  KKFLIDSPYMWWPSNLVQVSLFRALHDVETRPKGGLTRLQFFIIVLVCSFAYYVVPNYLF  1367
             +KFL+DSPYMWWP+NLVQVSLFRALH+ E RP+GG TRLQFF+++ + SF+YY++P+YLF
Sbjct  191   RKFLVDSPYMWWPANLVQVSLFRALHEKEKRPRGGHTRLQFFLLIFISSFSYYLIPSYLF  250

Query  1366  PSLTALSLLCWIWKNSVTAQQlgsglkglgigSFALDWATVAAFQGSPLVTPDFAIINML  1187
             PS++ +S+ C IWK+S+ AQQ+GSG  GLGIGSF +DW+TVAAF GSPL TP FAI+N+L
Sbjct  251   PSISCISIACLIWKDSIVAQQIGSGFYGLGIGSFGIDWSTVAAFLGSPLATPGFAILNIL  310

Query  1186  IGYVLVAYIAIPVWYWTNLFDAKKFPLFSSNVFDSNGQVYNISRVLNKKTFGFDQPGYDS  1007
             +G+ L+ Y+ +P+ YW+N+++AK+FP  SS+ FDS G  YNISRVLN KTF  DQ GY+S
Sbjct  311   VGFFLIVYVMLPIAYWSNVYEAKRFPFISSHTFDSLGNPYNISRVLNSKTFDLDQVGYES  370

Query  1006  YSNIYLSTAFVYTYGLSFATLAATVSHVALFHGRTIWEQTKE--SVQDKFSDIHTRLMRK  833
             YS +YLS  F ++YGLSFATL AT+SHVALFHG+TIW+  K+  +  ++  D+HTR+M+K
Sbjct  371   YSKLYLSVFFAFSYGLSFATLTATISHVALFHGKTIWQLWKKTTTAMNQIGDVHTRIMKK  430

Query  832   NYEPVPQWWFYlllviivgvalvACQRFGGQLQLPVWGVLLAVLLSLIFTLPVGVITATT  653
             NY+ VPQWWF+++L+ +V +AL AC+ F  QLQLP WG+LLA  ++L FTLP+G+I ATT
Sbjct  431   NYKEVPQWWFHIILIAMVALALYACEGFDKQLQLPWWGILLACAIALFFTLPIGIIQATT  490

Query  652   NQQTGLNVIAELIIGYMYPGRPLASVTFKMYGlsslsqslmflSDFKLGHYMKIPPKSMF  473
             N Q GLNVI ELIIGY+YPG+PLA+V FK YG  S++Q+L F+ DFKLGHYMKIPP+SMF
Sbjct  491   NMQPGLNVITELIIGYIYPGKPLANVAFKTYGYISMAQALSFVGDFKLGHYMKIPPRSMF  550

Query  472   MVQLVGTLISCCVHFGTGWWLLTTVENICNPSKLPEGSQWTCPGDDVFYNASIIWGVVSP  293
              VQLVGT++S  V+FGT WWLLTT+ NIC+ + LPEGS WTCPGDDVFYNASIIWGVV P
Sbjct  551   TVQLVGTVVSSSVYFGTAWWLLTTIPNICDTNVLPEGSPWTCPGDDVFYNASIIWGVVGP  610

Query  292   RRMFGNLGIYQATNYFFLVGFLAPIPVWYLGRKYPEKRWVSLINMPILISGAEGIPIVKS  113
              RMF   G+Y   N+FFL+G LAP+P+W L  K+PEK+W+ LINMPI+I    G+P  ++
Sbjct  611   LRMFTKYGVYGQMNWFFLIGLLAPLPIWLLSLKFPEKKWIKLINMPIIIGATGGMPPARA  670

Query  112   VNYVCWFAVGLYFNLYVYRKHKGWWARHNYILSAGLD  2
             VNY+ W  VG++FN YVY+K+KGWWARHNYILSA LD
Sbjct  671   VNYITWGIVGIFFNFYVYKKYKGWWARHNYILSAALD  707



>ref|XP_009367290.1| PREDICTED: oligopeptide transporter 1-like [Pyrus x bretschneideri]
Length=755

 Score =   909 bits (2349),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 440/675 (65%), Positives = 560/675 (83%), Gaps = 3/675 (0%)
 Frame = -1

Query  2017  DEINDSPVEEVRLTVPITDDPTMPCVTFRTWVLGVTSCVILAFLNQFFGYRQNALYVSSV  1838
             DE+NDSP+EEV LTVPI DDP+ P +TFRTWVLG+ SCVIL+F+N+FFG+R N L VSSV
Sbjct  30    DEVNDSPIEEVWLTVPINDDPSQPTLTFRTWVLGILSCVILSFVNKFFGFRTNQLSVSSV  89

Query  1837  PAQIVVLPMGKLMAAYLPTKVVQIPGTKWSFSLNPGPFNIKEHVLITIFASSGSDFSYAV  1658
              AQIVVLP+GKLMAA LPT+  ++P TKWSF++NPGPFN+KEHVLITIFA+SG+   YAV
Sbjct  90    SAQIVVLPLGKLMAATLPTRKFRVPFTKWSFTMNPGPFNLKEHVLITIFANSGAGGVYAV  149

Query  1657  SIITMMKAFYYRDIHPLAAVLLTFSTQMLGYGLAGIFKKFLIDSPYMWWPSNLVQVSLFR  1478
              IIT++KAFY+R  HP AA LL  +TQMLGYG AG+F+K+L+DSPYMWWP+NLVQVSLFR
Sbjct  150   HIITIVKAFYHRKQHPAAAFLLAQTTQMLGYGWAGLFRKYLVDSPYMWWPANLVQVSLFR  209

Query  1477  ALHDVETRPKGGLTRLQFFIIVLVCSFAYYVVPNYLFPSLTALSLLCWIWKNSVTAQQlg  1298
             ALH+ E RPKGGLTRLQFF++V VCSFAYY+ P +LFPS++A S++C IWK+S+TAQQ+G
Sbjct  210   ALHEKEKRPKGGLTRLQFFLMVFVCSFAYYIFPGFLFPSISAFSIVCLIWKSSITAQQIG  269

Query  1297  sglkglgigSFALDWATVAAFQGSPLVTPDFAIINMLIGYVLVAYIAIPVWYWTNLFDAK  1118
             SG+ GLGIGSF  DW+T+A F GSPL TP FAIIN+L+G+VL+ YI  P+ YW+N +DAK
Sbjct  270   SGMNGLGIGSFGFDWSTIAGFLGSPLATPGFAIINLLVGFVLILYILTPISYWSNAYDAK  329

Query  1117  KFPLFSSNVFDSNGQVYNISRVLNKKTFGFDQPGYDSYSNIYLSTAFVYTYGLSFATLAA  938
             KFP+F+S+ FDS GQ Y++SRVLN+ TF  D+  +++YS +YLST F ++YGLSFATL  
Sbjct  330   KFPIFTSHTFDSTGQTYDLSRVLNQTTFDIDREAHNNYSKLYLSTFFAFSYGLSFATLTG  389

Query  937   TVSHVALFHGRTI---WEQTKESVQDKFSDIHTRLMRKNYEPVPQWWFYlllviivgval  767
             T+SHVALFHG++I   W++T   V+D+  D+HTRLM+KNY+ VPQ WF L+LV++VG+++
Sbjct  390   TISHVALFHGKSIWLMWKKTTSVVKDQVGDVHTRLMKKNYDSVPQSWFQLILVLMVGLSI  449

Query  766   vACQRFGGQLQLPVWGVLLAVLLSLIFTLPVGVITATTNQQTGLNVIAELIIGYMYPGRP  587
              AC+ FG QLQLP WGVLLA  ++L FTLP+G+I ATTNQQ GLNVI EL IGY+YPG+P
Sbjct  450   FACEGFGKQLQLPWWGVLLACGIALFFTLPIGIIQATTNQQPGLNVITELFIGYIYPGKP  509

Query  586   LASVTFKMYGlsslsqslmflSDFKLGHYMKIPPKSMFMVQLVGTLISCCVHFGTGWWLL  407
             +A+VTFK YG  S+ Q+L FL DFKLGHYMKIPPKSMF+ QLVGT+++  V+FGT WWLL
Sbjct  510   IANVTFKTYGYISMVQALTFLGDFKLGHYMKIPPKSMFIAQLVGTVVASSVYFGTAWWLL  569

Query  406   TTVENICNPSKLPEGSQWTCPGDDVFYNASIIWGVVSPRRMFGNLGIYQATNYFFLVGFL  227
              ++E+IC+ S LPEGS WTCPGDDVFY+ASIIWGV+ P RMF + G+Y+  N+FFL+G L
Sbjct  570   ESIEHICDTSSLPEGSPWTCPGDDVFYHASIIWGVIGPLRMFTSYGVYKEMNWFFLIGLL  629

Query  226   APIPVWYLGRKYPEKRWVSLINMPILISGAEGIPIVKSVNYVCWFAVGLYFNLYVYRKHK  47
             AP+PVW+L +K+P   W+ LINMPI++     +P  K+V+Y+ WF VG++F+ YVYR+HK
Sbjct  630   APVPVWFLSKKFPNHMWIRLINMPIILGATGSMPPAKAVHYITWFTVGIFFSFYVYRRHK  689

Query  46    GWWARHNYILSAGLD  2
             GWWARHNYILSA LD
Sbjct  690   GWWARHNYILSASLD  704



>ref|XP_010092336.1| Oligopeptide transporter 1 [Morus notabilis]
 gb|EXB51012.1| Oligopeptide transporter 1 [Morus notabilis]
Length=758

 Score =   908 bits (2347),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 450/678 (66%), Positives = 562/678 (83%), Gaps = 4/678 (1%)
 Frame = -1

Query  2026  SSADEINDSPVEEVRLTVPITDDPTMPCVTFRTWVLGVTSCVILAFLNQFFGYRQNALYV  1847
             +  +EIN++P+EEVRLTV ITDDP+ P +TFRTWVLG+ SCV+LAF+N FFGYRQN L+V
Sbjct  30    TDNEEINNNPIEEVRLTVSITDDPSQPALTFRTWVLGLFSCVLLAFVNMFFGYRQNQLWV  89

Query  1846  SSVPAQIVVLPMGKLMAAYLPTKVVQIPGTKWSFSLNPGPFNIKEHVLITIFASSGSDFS  1667
             SSV AQIVVLP+GKLMAA LPTK V++P T WSFS+NPGPFN+KEHVLITIFA+SG+   
Sbjct  90    SSVSAQIVVLPIGKLMAATLPTKPVKVPLTGWSFSMNPGPFNLKEHVLITIFANSGAGGV  149

Query  1666  YAVSIITMMKAFYYRDIHPLAAVLLTFSTQMLGYGLAGIFKKFLIDSPYMWWPSNLVQVS  1487
             YAV+IIT++KAFY+R +HP+AA LL  +TQMLGYG AG+F+ +L+DSPYMWWP+NLVQVS
Sbjct  150   YAVNIITIVKAFYHRSLHPVAAFLLAQTTQMLGYGWAGLFRTYLVDSPYMWWPANLVQVS  209

Query  1486  LFRALHDVETRPKGGLTRLQFFIIVLVCSFAYYVVPNYLFPSLTALSLLCWIWKNSVTAQ  1307
             LFRALH+ E RPKGG TRLQFF++V +CSFAYY+VP Y FPS++ +S++C IWK+S+TAQ
Sbjct  210   LFRALHEKEKRPKGGHTRLQFFVLVFICSFAYYIVPGYFFPSISVISVVCLIWKDSITAQ  269

Query  1306  QlgsglkglgigSFALDWATVAAFQGSPLVTPDFAIINMLIGYVLVAYIAIPVWYWTNLF  1127
             QLGSGLKGLG+GSF +DW+T+A F GSPL TP FAIIN+L+G+V   YI  P++YWTN +
Sbjct  270   QLGSGLKGLGLGSFGIDWSTIAGFLGSPLATPGFAIINILVGFVFFLYIVTPIFYWTNAY  329

Query  1126  DAKKFPLFSSNVFDSNGQVYNISRVLNKKTFGFDQPGYDSYSNIYLSTAFVYTYGLSFAT  947
             +A+KFPL SS+ FDS G+ YN+SRVL++KTF  DQ GY+SYS +YLS  F   YGLSFAT
Sbjct  330   EARKFPLISSHTFDSTGKSYNLSRVLDEKTFTLDQEGYNSYSKLYLSILFALNYGLSFAT  389

Query  946   LAATVSHVALFHGRTI---WEQTKESVQDKFSDIHTRLMRKNYEPVPQWWFYlllviivg  776
             L AT+SHV LFHG++I   W++T  +V+ + +DIHTRLM+KNY+ VPQWWF+ +L++ VG
Sbjct  390   LTATISHVVLFHGKSIWKLWKKTTSTVKGE-ADIHTRLMKKNYDVVPQWWFHTILILTVG  448

Query  775   valvACQRFGGQLQLPVWGVLLAVLLSLIFTLPVGVITATTNQQTGLNVIAELIIGYMYP  596
             +++ AC+ F  QLQLP WG+L+A  ++L FTLP+G+I ATTN Q GLNVI ELIIGY+YP
Sbjct  449   LSIAACEGFDKQLQLPWWGILMACGIALFFTLPIGIIQATTNTQPGLNVITELIIGYIYP  508

Query  595   GRPLASVTFKMYGlsslsqslmflSDFKLGHYMKIPPKSMFMVQLVGTLISCCVHFGTGW  416
             G+PLA+V FK YG  S+SQ+L FL DFKLGHYMKIPPKSMF+VQLVGT+++  V+FGT W
Sbjct  509   GKPLANVAFKTYGYISMSQALGFLGDFKLGHYMKIPPKSMFLVQLVGTVVASSVYFGTAW  568

Query  415   WLLTTVENICNPSKLPEGSQWTCPGDDVFYNASIIWGVVSPRRMFGNLGIYQATNYFFLV  236
             WLL+TV NIC+ S LPEGS WTCPGDDVFYNASIIWGVV P RMF   GIY   N+FF++
Sbjct  569   WLLSTVPNICDMSLLPEGSPWTCPGDDVFYNASIIWGVVGPARMFTKQGIYPEMNWFFII  628

Query  235   GFLAPIPVWYLGRKYPEKRWVSLINMPILISGAEGIPIVKSVNYVCWFAVGLYFNLYVYR  56
             G LAP+PVW L  KYP K+W+  INMPI+ +   G+P  +SVNY+ W AVG+YFN YVYR
Sbjct  629   GLLAPVPVWLLSHKYPNKKWIKYINMPIIFAATGGMPPARSVNYITWGAVGIYFNFYVYR  688

Query  55    KHKGWWARHNYILSAGLD  2
             K+KGWWA+HNYILSA LD
Sbjct  689   KYKGWWAKHNYILSAALD  706



>ref|XP_009379497.1| PREDICTED: oligopeptide transporter 1-like [Pyrus x bretschneideri]
Length=755

 Score =   906 bits (2342),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 439/675 (65%), Positives = 559/675 (83%), Gaps = 3/675 (0%)
 Frame = -1

Query  2017  DEINDSPVEEVRLTVPITDDPTMPCVTFRTWVLGVTSCVILAFLNQFFGYRQNALYVSSV  1838
             DE+NDSP+EEV LTVPI DDP+ P +TFRTWVLG+ SCVIL+F+N+FFG+R N L VSSV
Sbjct  30    DEVNDSPIEEVWLTVPINDDPSQPTLTFRTWVLGILSCVILSFVNKFFGFRTNQLSVSSV  89

Query  1837  PAQIVVLPMGKLMAAYLPTKVVQIPGTKWSFSLNPGPFNIKEHVLITIFASSGSDFSYAV  1658
              AQIVVLP+GKLMAA LPT+  ++P TKWSF++NPGPFN+KEHVLITIFA+SG+   YAV
Sbjct  90    SAQIVVLPLGKLMAATLPTRKFRVPFTKWSFTMNPGPFNLKEHVLITIFANSGAGGVYAV  149

Query  1657  SIITMMKAFYYRDIHPLAAVLLTFSTQMLGYGLAGIFKKFLIDSPYMWWPSNLVQVSLFR  1478
              IIT++KAFY+R  HP AA LL  +TQMLGYG AG+F+K+L+DSPYMWWP+NLVQVSLFR
Sbjct  150   HIITIVKAFYHRKQHPAAAFLLAQTTQMLGYGWAGLFRKYLVDSPYMWWPANLVQVSLFR  209

Query  1477  ALHDVETRPKGGLTRLQFFIIVLVCSFAYYVVPNYLFPSLTALSLLCWIWKNSVTAQQlg  1298
             ALH+ E RPKGGLTRLQFF++V VCSFAYY+ P +LFPS++A S++C IWK+S+TAQQ+G
Sbjct  210   ALHEKEKRPKGGLTRLQFFLMVFVCSFAYYIFPGFLFPSISAFSIVCLIWKSSITAQQIG  269

Query  1297  sglkglgigSFALDWATVAAFQGSPLVTPDFAIINMLIGYVLVAYIAIPVWYWTNLFDAK  1118
             SG+ GLGIGSF  DW+T+A F GSPL TP FAIIN+L+G+VL+ YI  P+ YW+N +DAK
Sbjct  270   SGMNGLGIGSFGFDWSTIAGFLGSPLATPGFAIINLLVGFVLILYILTPISYWSNAYDAK  329

Query  1117  KFPLFSSNVFDSNGQVYNISRVLNKKTFGFDQPGYDSYSNIYLSTAFVYTYGLSFATLAA  938
             KFP+F+S+ FDS GQ Y++SRVLN+ TF  D+  +++YS +YLST F ++YGLSFATL  
Sbjct  330   KFPIFTSHTFDSTGQTYDLSRVLNQTTFDIDREAHNNYSKLYLSTFFAFSYGLSFATLTG  389

Query  937   TVSHVALFHGRTI---WEQTKESVQDKFSDIHTRLMRKNYEPVPQWWFYlllviivgval  767
             T+SHVALFHG++I   W++T   V+D+  D+HTRLM+KNY+ VPQ WF L+LV++VG+++
Sbjct  390   TISHVALFHGKSIWLMWKKTTSVVKDQVGDVHTRLMKKNYDSVPQSWFQLILVLMVGLSI  449

Query  766   vACQRFGGQLQLPVWGVLLAVLLSLIFTLPVGVITATTNQQTGLNVIAELIIGYMYPGRP  587
              AC+ FG QLQLP WGVLLA  ++L FTLP+G+I ATTNQQ GLNVI EL IGY+YPG+P
Sbjct  450   FACEGFGKQLQLPWWGVLLACGIALFFTLPIGIIQATTNQQPGLNVITELFIGYIYPGKP  509

Query  586   LASVTFKMYGlsslsqslmflSDFKLGHYMKIPPKSMFMVQLVGTLISCCVHFGTGWWLL  407
             +A+VTFK YG  S+ Q+L FL DFKLGHYMKIPPKSMF+ QL GT+++  V+FGT WWLL
Sbjct  510   IANVTFKTYGYISMVQALTFLGDFKLGHYMKIPPKSMFIAQLEGTVVASSVYFGTAWWLL  569

Query  406   TTVENICNPSKLPEGSQWTCPGDDVFYNASIIWGVVSPRRMFGNLGIYQATNYFFLVGFL  227
              ++E+IC+ S LPEGS WTCPGDDVFY+ASIIWGV+ P RMF + G+Y+  N+FFL+G L
Sbjct  570   ESIEHICDTSSLPEGSPWTCPGDDVFYHASIIWGVIGPLRMFTSYGVYKEMNWFFLIGLL  629

Query  226   APIPVWYLGRKYPEKRWVSLINMPILISGAEGIPIVKSVNYVCWFAVGLYFNLYVYRKHK  47
             AP+PVW+L +K+P   W+ LINMPI++     +P  K+V+Y+ WF VG++F+ YVYR+HK
Sbjct  630   APVPVWFLSKKFPNHMWIRLINMPIILGATGSMPPAKAVHYITWFTVGIFFSFYVYRRHK  689

Query  46    GWWARHNYILSAGLD  2
             GWWARHNYILSA LD
Sbjct  690   GWWARHNYILSASLD  704



>ref|XP_006595683.1| PREDICTED: oligopeptide transporter 1-like [Glycine max]
 gb|KHN23831.1| Oligopeptide transporter 1 [Glycine soja]
Length=747

 Score =   906 bits (2342),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 441/682 (65%), Positives = 555/682 (81%), Gaps = 4/682 (1%)
 Frame = -1

Query  2035  AVESSADEINDSPVEEVRLTVPITDDPTMPCVTFRTWVLGVTSCVILAFLNQFFGYRQNA  1856
              +   ++E++DSP+E+VRLTVP TDDPT P +TFRTW LG+ SC+IL+F+NQFFGYR N 
Sbjct  14    GIPDESEEVDDSPIEQVRLTVPTTDDPTQPALTFRTWTLGLASCIILSFVNQFFGYRTNP  73

Query  1855  LYVSSVPAQIVVLPMGKLMAAYLPTKVVQIPGTKWSFSLNPGPFNIKEHVLITIFASSGS  1676
             LY+SSV AQI+ LP+GKLMAA LPTK +++P TKWSFSLNPGPFN+KEH LITIFAS+GS
Sbjct  74    LYISSVSAQILSLPVGKLMAATLPTKPIRVPLTKWSFSLNPGPFNLKEHALITIFASAGS  133

Query  1675  DFSYAVSIITMMKAFYYRDIHPLAAVLLTFSTQMLGYGLAGIFKKFLIDSPYMWWPSNLV  1496
                YA++IIT++KAFY+R+IHPLAA LL  STQMLGYG AGIF+K L+DSPYMWWPSNLV
Sbjct  134   SGVYAINIITIVKAFYHRNIHPLAAFLLALSTQMLGYGWAGIFRKCLVDSPYMWWPSNLV  193

Query  1495  QVSLFRALHDVETRPKGGLTRLQFFIIVLVCSFAYYVVPNYLFPSLTALSLLCWIWKNSV  1316
             QVSLFRA H+ E RPKGG TRLQFF +V V SFAYYV+P Y F ++T +S +C +WKNS+
Sbjct  194   QVSLFRAFHEKEKRPKGGNTRLQFFFLVFVASFAYYVIPGYFFQAITTISFVCLVWKNSI  253

Query  1315  TAQQlgsglkglgigSFALDWATVAAFQGSPLVTPDFAIINMLIGYVLVAYIAIPVWYWT  1136
             TAQQ+GSG+KGLGIGSF LDW TVA F GSPL  P FAIIN+L+G+VL  Y+ +P+ YW 
Sbjct  254   TAQQIGSGMKGLGIGSFGLDWNTVAGFLGSPLAVPGFAIINILVGFVLFMYVLVPISYWN  313

Query  1135  NLFDAKKFPLFSSNVFDSNGQVYNISRVLNKKTFGFDQPGYDSYSNIYLSTAFVYTYGLS  956
             NL+DAKKFP+ SS+ FDS+G  YN++RVLN KTF  D   Y++YS +YLS  F + YGLS
Sbjct  314   NLYDAKKFPIISSHTFDSSGATYNVTRVLNDKTFDIDMDSYNNYSKLYLSITFAFDYGLS  373

Query  955   FATLAATVSHVALFHGRTI---WEQTKESVQ-DKFSDIHTRLMRKNYEPVPQWWFYlllv  788
             FATL AT++HVALFHG+TI   W++T  +++  +  D+HTR+M++NYE VP+WWF  +L+
Sbjct  374   FATLTATIAHVALFHGKTIYQMWKKTTSALKGQQLGDVHTRIMKRNYEQVPEWWFVSILL  433

Query  787   iivgvalvACQRFGGQLQLPVWGVLLAVLLSLIFTLPVGVITATTNQQTGLNVIAELIIG  608
             +++ V+L+ C+ FG QLQLP WGVL++++++L+FTLP+GVI ATTN Q GLNVI ELIIG
Sbjct  434   LMIVVSLITCEGFGKQLQLPWWGVLMSLVIALVFTLPIGVIQATTNTQVGLNVITELIIG  493

Query  607   YMYPGRPLASVTFKMYGlsslsqslmflSDFKLGHYMKIPPKSMFMVQLVGTLISCCVHF  428
             Y+YPGRPLA+V FK YG  S+SQ+L FL DFKLGHYMKIPPKSMF+VQLVGT+++  V+F
Sbjct  494   YIYPGRPLANVAFKTYGYISMSQALGFLQDFKLGHYMKIPPKSMFVVQLVGTIVASGVYF  553

Query  427   GTGWWLLTTVENICNPSKLPEGSQWTCPGDDVFYNASIIWGVVSPRRMFGNLGIYQATNY  248
             GT WWLLT++ +IC+ + LP GS WTCPGD+VFYNASIIWGVV P+RMF   GIY   N+
Sbjct  554   GTAWWLLTSIPHICDETSLPAGSPWTCPGDEVFYNASIIWGVVGPQRMFTKDGIYPGMNW  613

Query  247   FFLVGFLAPIPVWYLGRKYPEKRWVSLINMPILISGAEGIPIVKSVNYVCWFAVGLYFNL  68
             FFL+G LAP+PVW L RK+P  +W+ LINMP++I+G  GIP  +SVNY+ W  VG++FN 
Sbjct  614   FFLIGLLAPVPVWLLARKFPNHKWIELINMPLIIAGGGGIPPARSVNYITWGFVGIFFNF  673

Query  67    YVYRKHKGWWARHNYILSAGLD  2
             YVY K K WWARH YILSA LD
Sbjct  674   YVYSKFKAWWARHTYILSAALD  695



>ref|XP_004295186.1| PREDICTED: LOW QUALITY PROTEIN: oligopeptide transporter 1-like 
[Fragaria vesca subsp. vesca]
Length=753

 Score =   905 bits (2340),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 444/675 (66%), Positives = 552/675 (82%), Gaps = 3/675 (0%)
 Frame = -1

Query  2017  DEINDSPVEEVRLTVPITDDPTMPCVTFRTWVLGVTSCVILAFLNQFFGYRQNALYVSSV  1838
             DE+ND+P+E+VRLTV  TDDP+ P +TFRTWVLG+ SC ILAF+NQFFGYR N LYVSSV
Sbjct  27    DEVNDNPIEQVRLTVSTTDDPSQPTLTFRTWVLGLLSCSILAFVNQFFGYRTNQLYVSSV  86

Query  1837  PAQIVVLPMGKLMAAYLPTKVVQIPGTKWSFSLNPGPFNIKEHVLITIFASSGSDFSYAV  1658
              AQI+VLP+GKLMAA LPT   + P T W+FS+NPGPFN+KEHVLITIFA+SGS+  YAV
Sbjct  87    SAQILVLPLGKLMAATLPTNKYRFPFTNWTFSMNPGPFNLKEHVLITIFANSGSNSVYAV  146

Query  1657  SIITMMKAFYYRDIHPLAAVLLTFSTQMLGYGLAGIFKKFLIDSPYMWWPSNLVQVSLFR  1478
             +IIT++ AFY R +HP +A LL  +TQMLGYG AG+F+++L+DSPYMWWP+NLVQVSLFR
Sbjct  147   NIITIVLAFYKRKLHPASAFLLAQTTQMLGYGWAGLFRRYLVDSPYMWWPANLVQVSLFR  206

Query  1477  ALHDVETRPKGGLTRLQFFIIVLVCSFAYYVVPNYLFPSLTALSLLCWIWKNSVTAQQlg  1298
             ALH+ E RPKGG TRLQ F +V +CSFAYY+VP YLFPSL+ +S++C IWKNS+TAQQ+G
Sbjct  207   ALHEKEKRPKGGRTRLQXFFLVFICSFAYYIVPGYLFPSLSTISIVCLIWKNSITAQQIG  266

Query  1297  sglkglgigSFALDWATVAAFQGSPLVTPDFAIINMLIGYVLVAYIAIPVWYWTNLFDAK  1118
             SG  GLGIGSF +DW+TVA F GSPL TP FA IN+L+G+VL+ YI  P+ YW N + A 
Sbjct  267   SGAHGLGIGSFGIDWSTVAGFLGSPLATPGFATINILLGFVLIVYIVTPIAYWNNAYGAH  326

Query  1117  KFPLFSSNVFDSNGQVYNISRVLNKKTFGFDQPGYDSYSNIYLSTAFVYTYGLSFATLAA  938
             KFP+ SS+ FDS G  YNISR++N+KTF  D   Y+SYS ++LST F ++YGLSFATL A
Sbjct  327   KFPIISSHTFDSTGTTYNISRIINQKTFNIDMDEYNSYSKLHLSTFFAFSYGLSFATLTA  386

Query  937   TVSHVALFHGRTIWE---QTKESVQDKFSDIHTRLMRKNYEPVPQWWFYlllviivgval  767
             T+SHVALFHG+TIW+   +T  +V+D+  DIHTRLM+KNY+ VPQWWF+++LV +VG+A+
Sbjct  387   TISHVALFHGKTIWQMWRKTASAVKDQVGDIHTRLMKKNYQAVPQWWFHIILVSMVGLAI  446

Query  766   vACQRFGGQLQLPVWGVLLAVLLSLIFTLPVGVITATTNQQTGLNVIAELIIGYMYPGRP  587
              AC+ FG QLQLP WGVL+A  ++L FTLP+G+I ATTNQQ GLNVI EL+IGY+YPGRP
Sbjct  447   FACEGFGKQLQLPWWGVLMACGIALFFTLPIGIIQATTNQQPGLNVITELVIGYIYPGRP  506

Query  586   LASVTFKMYGlsslsqslmflSDFKLGHYMKIPPKSMFMVQLVGTLISCCVHFGTGWWLL  407
             LA+V FK YG  S+SQ+LMFL DFKLGHYMKIPPKSMF+VQL GT+++  V+F T WWLL
Sbjct  507   LANVAFKTYGYISMSQALMFLGDFKLGHYMKIPPKSMFIVQLAGTVVASSVYFATSWWLL  566

Query  406   TTVENICNPSKLPEGSQWTCPGDDVFYNASIIWGVVSPRRMFGNLGIYQATNYFFLVGFL  227
              ++ENIC+ S LPEGS WTCPGDDVFYNASIIWGVV P RMF   GIY   N+FFL+G +
Sbjct  567   HSIENICDVSLLPEGSPWTCPGDDVFYNASIIWGVVGPLRMFTKKGIYPELNWFFLIGLI  626

Query  226   APIPVWYLGRKYPEKRWVSLINMPILISGAEGIPIVKSVNYVCWFAVGLYFNLYVYRKHK  47
             AP+P+W+  +K+P ++W+ LINMPI++     +P  +SVNY+ W AVG++FN YVYRK K
Sbjct  627   APVPIWFFAKKFPNQKWIRLINMPIILGATGYMPPARSVNYITWLAVGIFFNFYVYRKFK  686

Query  46    GWWARHNYILSAGLD  2
             GWWARHNYILSA LD
Sbjct  687   GWWARHNYILSAALD  701



>ref|XP_008449039.1| PREDICTED: oligopeptide transporter 5-like [Cucumis melo]
Length=760

 Score =   905 bits (2339),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 440/695 (63%), Positives = 561/695 (81%), Gaps = 3/695 (0%)
 Frame = -1

Query  2080  SLSRLLH*MENTGISAVESSADEINDSPVEEVRLTVPITDDPTMPCVTFRTWVLGVTSCV  1901
              L   +H  +N    +++   +E ND P+EEVRLTVPITDDP+   +TFRTW LG+ SC 
Sbjct  15    ELKDGIHDDKNLSSFSIQGDGEE-NDCPIEEVRLTVPITDDPSEAALTFRTWFLGLISCC  73

Query  1900  ILAFLNQFFGYRQNALYVSSVPAQIVVLPMGKLMAAYLPTKVVQIPGTKWSFSLNPGPFN  1721
             +LAF+NQFFGYRQN LY+SSV AQIV LP+GKLMAA LPTKV+++P   WS SLNPGPF 
Sbjct  74    LLAFVNQFFGYRQNQLYISSVSAQIVALPLGKLMAATLPTKVIKLPIFNWSLSLNPGPFT  133

Query  1720  IKEHVLITIFASSGSDFSYAVSIITMMKAFYYRDIHPLAAVLLTFSTQMLGYGLAGIFKK  1541
             +KEHVLITIFA+ GS   YAV+IIT++KAFY+R++HP AA++L+ +TQMLGYG AGIF+K
Sbjct  134   LKEHVLITIFANCGSSSVYAVNIITIVKAFYHRNLHPAAALMLSMTTQMLGYGWAGIFRK  193

Query  1540  FLIDSPYMWWPSNLVQVSLFRALHDVETRPKGGLTRLQFFIIVLVCSFAYYVVPNYLFPS  1361
              L+DSPYMWWP+NLVQVSLFRALH+ E RP+GG TRLQFF+++ + SF+YY++P+YLFPS
Sbjct  194   VLVDSPYMWWPANLVQVSLFRALHEKEKRPRGGHTRLQFFLLIFISSFSYYLIPSYLFPS  253

Query  1360  LTALSLLCWIWKNSVTAQQlgsglkglgigSFALDWATVAAFQGSPLVTPDFAIINMLIG  1181
             ++ +S+ C IWK+S+ AQQ+GSG  GLGIGSF +DW+TVAAF GSPL TP FAIIN+L+G
Sbjct  254   ISCISIACLIWKDSIFAQQIGSGFYGLGIGSFGIDWSTVAAFLGSPLATPGFAIINILVG  313

Query  1180  YVLVAYIAIPVWYWTNLFDAKKFPLFSSNVFDSNGQVYNISRVLNKKTFGFDQPGYDSYS  1001
             + L+ Y+ +P+ YW+N ++AK+FP  SS+ FDS G  YNISRVLN KTF  DQ GY+SYS
Sbjct  314   FFLIVYVMLPIAYWSNAYEAKRFPFISSHTFDSLGNPYNISRVLNSKTFDLDQVGYESYS  373

Query  1000  NIYLSTAFVYTYGLSFATLAATVSHVALFHGRTIWEQTKE--SVQDKFSDIHTRLMRKNY  827
              +YLS  F ++YGLSFATL AT+SHVALFHG+TIW+  K+  +  ++  D+HTR+M+KNY
Sbjct  374   KLYLSVFFAFSYGLSFATLTATISHVALFHGKTIWQLWKKTTTAMNQIGDVHTRIMKKNY  433

Query  826   EPVPQWWFYlllviivgvalvACQRFGGQLQLPVWGVLLAVLLSLIFTLPVGVITATTNQ  647
             + VPQWWF+++L+ +V +AL AC+ F  QLQLP WG+LLA  ++L FTLP+G+I ATTN 
Sbjct  434   KEVPQWWFHVILISMVALALYACEGFDKQLQLPWWGILLACGIALFFTLPIGIIQATTNM  493

Query  646   QTGLNVIAELIIGYMYPGRPLASVTFKMYGlsslsqslmflSDFKLGHYMKIPPKSMFMV  467
             Q GLNVI ELIIGY+YPG+PLA+V FK YG  S++Q+L F+ DFKLGHYMKIPP+SMF+V
Sbjct  494   QPGLNVITELIIGYIYPGKPLANVAFKTYGYISMAQALSFVGDFKLGHYMKIPPRSMFIV  553

Query  466   QLVGTLISCCVHFGTGWWLLTTVENICNPSKLPEGSQWTCPGDDVFYNASIIWGVVSPRR  287
             QLVGT++S  V+FGT WWLLTT+ NIC+   LPEGS WTCPGDDVFYNASIIWGVV P R
Sbjct  554   QLVGTIVSSSVYFGTAWWLLTTIPNICDTEVLPEGSPWTCPGDDVFYNASIIWGVVGPLR  613

Query  286   MFGNLGIYQATNYFFLVGFLAPIPVWYLGRKYPEKRWVSLINMPILISGAEGIPIVKSVN  107
             MF   G+Y   N+FFL+G LAP+P+W +  K+PEK+W+ LINMPI+I    G+P  +SVN
Sbjct  614   MFTKYGVYGQMNWFFLIGLLAPLPIWLISLKFPEKKWIKLINMPIIIGATGGMPPARSVN  673

Query  106   YVCWFAVGLYFNLYVYRKHKGWWARHNYILSAGLD  2
             Y+ W  VG++FN YVY+K+KGWWARHNYILSA LD
Sbjct  674   YITWGIVGIFFNFYVYKKYKGWWARHNYILSAALD  708



>ref|XP_008218466.1| PREDICTED: oligopeptide transporter 1-like [Prunus mume]
Length=748

 Score =   904 bits (2337),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 442/687 (64%), Positives = 555/687 (81%), Gaps = 3/687 (0%)
 Frame = -1

Query  2053  ENTGISAVESSADEINDSPVEEVRLTVPITDDPTMPCVTFRTWVLGVTSCVILAFLNQFF  1874
             E    S +  + DE++D+P+E+VRLTVPITDDP+ P +TFRTWVLG+ SC  LAF+NQFF
Sbjct  10    ETKSHSKIHVNDDEVDDNPIEQVRLTVPITDDPSEPTITFRTWVLGLLSCTTLAFINQFF  69

Query  1873  GYRQNALYVSSVPAQIVVLPMGKLMAAYLPTKVVQIPGTKWSFSLNPGPFNIKEHVLITI  1694
             GYRQN L+VSSV AQIVVLP+GKLMAA LPT    +P TKWSFS NPGPF++KEHVLITI
Sbjct  70    GYRQNQLFVSSVSAQIVVLPLGKLMAAVLPTTQFSVPFTKWSFSFNPGPFSMKEHVLITI  129

Query  1693  FASSGSDFSYAVSIITMMKAFYYRDIHPLAAVLLTFSTQMLGYGLAGIFKKFLIDSPYMW  1514
             FA+SGS+  YAV+IIT++KA+Y+R IH +AA LL  +TQMLGYG AG+F+++L+DSPYMW
Sbjct  130   FANSGSNSVYAVNIITIVKAYYHRSIHVMAAFLLAHTTQMLGYGWAGLFRRYLVDSPYMW  189

Query  1513  WPSNLVQVSLFRALHDVETRPKGGLTRLQFFIIVLVCSFAYYVVPNYLFPSLTALSLLCW  1334
             WPSNLVQVSLFRALH+ E RP+GG T++QFFII+   SFAYY++P++ FPS+TALSL+CW
Sbjct  190   WPSNLVQVSLFRALHEKEKRPRGGRTKMQFFIIIFTSSFAYYIIPSFFFPSITALSLVCW  249

Query  1333  IWKNSVTAQQlgsglkglgigSFALDWATVAAFQGSPLVTPDFAIINMLIGYVLVAYIAI  1154
             IWK+S+TAQQ+GSGLKGLGIGSFA+DW+T+A+F GSPL  PD A+INMLIG+ ++ YI  
Sbjct  250   IWKDSITAQQIGSGLKGLGIGSFAIDWSTIASFLGSPLAYPDVAVINMLIGFTVIFYIVT  309

Query  1153  PVWYWTNLFDAKKFPLFSSNVFDSNGQVYNISRVLNKKTFGFDQPGYDSYSNIYLSTAFV  974
             P+ YWTN +DAK+FPLFSS+ FD +GQ YN+SRVL++KTF  +   Y  YS +YLS  F 
Sbjct  310   PIIYWTNTYDAKRFPLFSSHTFDHDGQTYNVSRVLDEKTFDMNLKEYSGYSKLYLSAYFA  369

Query  973   YTYGLSFATLAATVSHVALFHGRTIWE---QTKESVQDKFSDIHTRLMRKNYEPVPQWWF  803
             Y YG  FATL AT+SHVALF+G+ IW+   +T  +++++  DIH R+M++NYE VP+WWF
Sbjct  370   YGYGWGFATLTATISHVALFYGKEIWQLWKKTTGAMKNQLGDIHMRIMKRNYESVPEWWF  429

Query  802   YlllviivgvalvACQRFGGQLQLPVWGVLLAVLLSLIFTLPVGVITATTNQQTGLNVIA  623
               +LV++V +A+  C+ FG QLQLP WGVLLA  ++L FTLP+GVI ATTN Q GLN+I 
Sbjct  430   QTILVLMVALAIFTCEGFGKQLQLPWWGVLLACAIALSFTLPIGVIAATTNTQPGLNIIT  489

Query  622   ELIIGYMYPGRPLASVTFKMYGlsslsqslmflSDFKLGHYMKIPPKSMFMVQLVGTLIS  443
             ELIIGYMYPG+PLA+V FK YG  S+SQ+LMFL DFKLGHYMKIPPK MF VQL GTL +
Sbjct  490   ELIIGYMYPGKPLANVAFKTYGYISMSQALMFLGDFKLGHYMKIPPKDMFFVQLAGTLAA  549

Query  442   CCVHFGTGWWLLTTVENICNPSKLPEGSQWTCPGDDVFYNASIIWGVVSPRRMFGNLGIY  263
                +F T WWLLTTVENICNP+KLPEGS WTCPGDDVFYNASIIWGV+ P RMF + G Y
Sbjct  550   TSAYFATSWWLLTTVENICNPAKLPEGSPWTCPGDDVFYNASIIWGVIGPLRMFTSKGNY  609

Query  262   QATNYFFLVGFLAPIPVWYLGRKYPEKRWVSLINMPILISGAEGIPIVKSVNYVCWFAVG  83
                N+FFL+G L+PIP W L +K+P K+W+  INMP+++     +P  K+VN+  WFAVG
Sbjct  610   PELNWFFLIGLLSPIPGWLLHKKFPNKKWIRHINMPVILGATSLMPPAKAVNFSSWFAVG  669

Query  82    LYFNLYVYRKHKGWWARHNYILSAGLD  2
             ++FN +VYR++K WWARHNYILSA LD
Sbjct  670   IFFNFFVYRRYKEWWARHNYILSAALD  696



>ref|XP_002445962.1| hypothetical protein SORBIDRAFT_07g028740 [Sorghum bicolor]
 gb|EES15457.1| hypothetical protein SORBIDRAFT_07g028740 [Sorghum bicolor]
Length=761

 Score =   903 bits (2334),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 443/686 (65%), Positives = 556/686 (81%), Gaps = 5/686 (1%)
 Frame = -1

Query  2050  NTGISAVESSADEINDSPVEEVRLTVPITDDPTMPCVTFRTWVLGVTSCVILAFLNQFFG  1871
               G SA     +E++D P+EEVRLTVPITDDPT+P +TFRTW LG+ SC +LAF NQFFG
Sbjct  26    TNGGSARTEKVEEVDDCPIEEVRLTVPITDDPTLPALTFRTWFLGLLSCALLAFSNQFFG  85

Query  1870  YRQNALYVSSVPAQIVVLPMGKLMAAYLPTKVVQIPGTKWSFSLNPGPFNIKEHVLITIF  1691
             YRQN LY+SS+  QIVVLP+GKLMAA LPTK V I G   SFSLNPGPFN+KEHVLITIF
Sbjct  86    YRQNPLYISSLSVQIVVLPLGKLMAACLPTKAVHIMGC--SFSLNPGPFNLKEHVLITIF  143

Query  1690  ASSGSDFSYAVSIITMMKAFYYRDIHPLAAVLLTFSTQMLGYGLAGIFKKFLIDSPYMWW  1511
             A++GS+  YAV IIT++KAFY+RDIHPLAA+LLT +TQ++GYG AG+F+KFL+DSPYMWW
Sbjct  144   ANTGSNSVYAVGIITIVKAFYHRDIHPLAAMLLTQTTQLMGYGWAGLFRKFLVDSPYMWW  203

Query  1510  PSNLVQVSLFRALHDVETRPKGGLTRLQFFIIVLVCSFAYYVVPNYLFPSLTALSLLCWI  1331
             P+NLVQVSLFRALH+ E RP+GG TRLQFF+ VL  SFAYY+VPNYLFP+++ +S++C+I
Sbjct  204   PANLVQVSLFRALHEKEKRPRGGTTRLQFFLTVLAASFAYYIVPNYLFPTISTISVVCFI  263

Query  1330  WKNSVTAQQlgsglkglgigSFALDWATVAAFQGSPLVTPDFAIINMLIGYVLVAYIAIP  1151
             WK SVTAQQ+GSG+ GLG+GSF LDWATVA F G+PL TP FAI+N++ G+ L+ Y+ +P
Sbjct  264   WKKSVTAQQIGSGVYGLGVGSFGLDWATVAGFLGTPLSTPAFAIVNIMAGFFLIVYVIVP  323

Query  1150  VWYWTNLFDAKKFPLFSSNVFDSNGQVYNISRVLNKKTFGFDQPGYDSYSNIYLSTAFVY  971
             + YW++ + A++FP+ SS+VF +NG  Y++++VL+  TF F Q GYD    I+LS  F +
Sbjct  324   LAYWSDAYGARRFPIISSHVFMANGSRYDVNKVLDPATFQFSQAGYDGAGQIHLSIFFAF  383

Query  970   TYGLSFATLAATVSHVALFHGRTIWEQTKESVQDKFSDIHTRLMRKNYEPVPQWWFYlll  791
             TYGLSFATLAAT+SHVAL+HGR+IWEQTK +V+    D+H RLMR+NY  VPQWWF ++L
Sbjct  384   TYGLSFATLAATLSHVALYHGRSIWEQTKATVRSAGGDVHARLMRRNYAAVPQWWFQVML  443

Query  790   viivgvalvACQRFGGQLQLPVWGVLLAVLLSLIFTLPVGVITATTNQQTGLNVIAELII  611
             V+++G++L  C+ FG QLQLP WGVLLA  ++  FTLP+G+ITATTNQQ GLNV+ ELII
Sbjct  444   VVVLGLSLFTCEGFGRQLQLPYWGVLLAAGIAFFFTLPIGIITATTNQQPGLNVVTELII  503

Query  610   GYMYPGRPLASVTFKMYGlsslsqslmflSDFKLGHYMKIPPKSMFMVQLVGTLISCCVH  431
             GY+YPGRPLA+V FK YG  S+SQ++MFL DFKLGHYMKIPP+SMF VQLVGT+++  V+
Sbjct  504   GYLYPGRPLANVAFKTYGYISMSQAIMFLQDFKLGHYMKIPPRSMFAVQLVGTVLASSVY  563

Query  430   FGTGWWLLTTVENICNPSKLPEGSQWTCPGDDVFYNASIIWGVVSPRRMFGNLGIYQATN  251
             F T WWLL TV +IC+P+KLPEGS WTCPGDDVF+NASIIWGVV P RMFG LG+Y   N
Sbjct  564   FATSWWLLETVPSICDPTKLPEGSPWTCPGDDVFFNASIIWGVVGPLRMFGRLGLYSKMN  623

Query  250   YFFLVGFLAPIPVWYLGRKYPEKR---WVSLINMPILISGAEGIPIVKSVNYVCWFAVGL  80
             YFFL G LAP+P W + R +P+     W+ L+NMP+L+     +P  +SVNY+ W AVGL
Sbjct  624   YFFLAGALAPVPFWAVARAFPDSAWAPWLRLVNMPVLLGATGMMPPARSVNYLMWGAVGL  683

Query  79    YFNLYVYRKHKGWWARHNYILSAGLD  2
              FN  VYR++K WWARHNY+LSAGLD
Sbjct  684   AFNYVVYRRYKAWWARHNYVLSAGLD  709



>gb|KDP39296.1| hypothetical protein JCGZ_01053 [Jatropha curcas]
Length=776

 Score =   902 bits (2330),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 452/721 (63%), Positives = 561/721 (78%), Gaps = 23/721 (3%)
 Frame = -1

Query  2107  ERVSSFKNSSLSRLLH*MENTGISAVESSADEINDSPVEEVRLTVPITDDPTMPCVTFRT  1928
             E+V S    S +R      N  +  +    +E+ND+P+EEVRLTVPITDDPT P +TFRT
Sbjct  8     EKVESPPQFSENR----QSNIRMEEIVKGDEEVNDNPIEEVRLTVPITDDPTEPALTFRT  63

Query  1927  WVLGVTSCVILAFLNQFFGYRQNALYVSSVPAQIVVLPMGKLMAAYLPTKVVQIPGTKWS  1748
             WVLG+ SC +LAF+NQFF YR N L V++V AQIVVLP+GKLMA  +P K ++IP TKWS
Sbjct  64    WVLGIASCALLAFVNQFFSYRTNQLTVTAVAAQIVVLPLGKLMARVIPNKQIKIPLTKWS  123

Query  1747  FSLNPGPFNIKEHVLITIFASSGSDFSYAVSIITMMKAFYYRDIHPLAAVLLTFSTQ---  1577
             FSLNPGPF +KEHVLITIFAS G+   YAV+IIT +KAFY R ++P+AA+LL  +TQ   
Sbjct  124   FSLNPGPFTLKEHVLITIFASCGAGGVYAVNIITAVKAFYRRPLNPVAAMLLVQTTQASF  183

Query  1576  -------------MLGYGLAGIFKKFLIDSPYMWWPSNLVQVSLFRALHDVETRPKGGLT  1436
                          +LGYG AGIF+K+L+DSPYMWWPSNLVQVSLFRAL++ E RPKG LT
Sbjct  184   SFFLLLMFCHKTWLLGYGWAGIFRKYLVDSPYMWWPSNLVQVSLFRALNEKEKRPKGRLT  243

Query  1435  RLQFFIIVLVCSFAYYVVPNYLFPSLTALSLLCWIWKNSVTAQQlgsglkglgigSFALD  1256
             RLQFF IV + S+AYY++P YLFPSL+ +S +CWIWK+SVTAQQ+GSG  GLGI SF LD
Sbjct  244   RLQFFTIVFISSYAYYIIPGYLFPSLSTISFICWIWKDSVTAQQIGSGQNGLGIASFGLD  303

Query  1255  WATVAAFQGSPLVTPDFAIINMLIGYVLVAYIAIPVWYWTNLFDAKKFPLFSSNVFDSNG  1076
             W+TVA F G+PL  P FAI N L G+ LV YI +P+ YWTN++DAKKFP++SS+ FDS+G
Sbjct  304   WSTVAGFLGTPLAVPFFAIANTLAGFFLVQYIIVPISYWTNMYDAKKFPIYSSHTFDSDG  363

Query  1075  QVYNISRVLNKKTFGFDQPGYDSYSNIYLSTAFVYTYGLSFATLAATVSHVALFHGRTIW  896
             Q YNISR+LN+K F  +   Y++YS +YLS  F + YGL+FA +AATVSHVALF G+TIW
Sbjct  364   QTYNISRILNQKNFDINLDAYNNYSKLYLSILFAFNYGLNFAAVAATVSHVALFEGKTIW  423

Query  895   ---EQTKESVQDKFSDIHTRLMRKNYEPVPQWWFYlllviivgvalvACQRFGGQLQLPV  725
                ++T  + +++F+D+HTRLM+KNYE VPQWWF  LLVI V ++ +A + F  QLQLP 
Sbjct  424   TSWKKTTGAFKNQFTDVHTRLMKKNYEEVPQWWFVTLLVISVALSFLAVEGFNRQLQLPW  483

Query  724   WGVLLAVLLSLIFTLPVGVITATTNQQTGLNVIAELIIGYMYPGRPLASVTFKMYGlssl  545
             WG+LLA  ++L FTLP+GV+ ATTN Q GLNVI ELIIGYMYPG+PLA+V FK YG  S+
Sbjct  484   WGLLLACSIALFFTLPIGVVQATTNMQMGLNVITELIIGYMYPGKPLANVAFKTYGYISM  543

Query  544   sqslmflSDFKLGHYMKIPPKSMFMVQLVGTLISCCVHFGTGWWLLTTVENICNPSKLPE  365
             SQ+L  + DFKLGHYMKIPPKSMF+VQLVGT++S  V+FGT WWLL+TVENIC P  LPE
Sbjct  544   SQALYLVQDFKLGHYMKIPPKSMFLVQLVGTIVSSTVYFGTAWWLLSTVENICLPDLLPE  603

Query  364   GSQWTCPGDDVFYNASIIWGVVSPRRMFGNLGIYQATNYFFLVGFLAPIPVWYLGRKYPE  185
             GS WTCPGDDVFYNASIIWGV+ P RMFG LG+Y   ++FFL+G LAP+PVW L RK+PE
Sbjct  604   GSPWTCPGDDVFYNASIIWGVIGPLRMFGKLGVYYKISWFFLIGALAPVPVWLLSRKFPE  663

Query  184   KRWVSLINMPILISGAEGIPIVKSVNYVCWFAVGLYFNLYVYRKHKGWWARHNYILSAGL  5
             K+W+ LI+MPI +S   G+P  ++V+Y  W AVG++FN YVYRK+K WWARHNYILSAGL
Sbjct  664   KKWIKLIHMPIFLSATSGMPPARAVHYWSWGAVGVFFNFYVYRKYKAWWARHNYILSAGL  723

Query  4     D  2
             D
Sbjct  724   D  724



>ref|XP_010097383.1| Oligopeptide transporter 1 [Morus notabilis]
 gb|EXB67889.1| Oligopeptide transporter 1 [Morus notabilis]
Length=752

 Score =   902 bits (2330),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 442/678 (65%), Positives = 560/678 (83%), Gaps = 3/678 (0%)
 Frame = -1

Query  2026  SSADEINDSPVEEVRLTVPITDDPTMPCVTFRTWVLGVTSCVILAFLNQFFGYRQNALYV  1847
             +  +EI+D+P+E+VRLTV  TDDP+ P +TFRTW LG+ SCV+LA++N FFGYRQN L+V
Sbjct  23    TDNEEIDDNPIEQVRLTVSTTDDPSQPALTFRTWFLGIFSCVLLAYVNMFFGYRQNQLWV  82

Query  1846  SSVPAQIVVLPMGKLMAAYLPTKVVQIPGTKWSFSLNPGPFNIKEHVLITIFASSGSDFS  1667
             SSV AQIVVLP+GKLMAA LP + V++P T WSFS+NPGPFN+KEHVLITIFA+SG+   
Sbjct  83    SSVSAQIVVLPIGKLMAATLPKRPVKLPFTGWSFSMNPGPFNLKEHVLITIFANSGAGGV  142

Query  1666  YAVSIITMMKAFYYRDIHPLAAVLLTFSTQMLGYGLAGIFKKFLIDSPYMWWPSNLVQVS  1487
             YAV+IIT++KAFY+R++HP+AA LL+ +TQMLGYG AGIF+ +L+DSPYMWWP+NLVQVS
Sbjct  143   YAVNIITIVKAFYHRNLHPVAAFLLSQTTQMLGYGWAGIFRTYLVDSPYMWWPANLVQVS  202

Query  1486  LFRALHDVETRPKGGLTRLQFFIIVLVCSFAYYVVPNYLFPSLTALSLLCWIWKNSVTAQ  1307
             LFRALH+ E R KGG TRLQFF +V +CSFAYY+VP Y FPS++ +S++C +WKNS+TAQ
Sbjct  203   LFRALHEKEKRSKGGHTRLQFFFLVFICSFAYYIVPGYFFPSISVISVVCLVWKNSITAQ  262

Query  1306  QlgsglkglgigSFALDWATVAAFQGSPLVTPDFAIINMLIGYVLVAYIAIPVWYWTNLF  1127
             QLGSGLKGLG+GSF LDW+T+A F GSPL TP FAIIN+L+G+VL  Y+  P++YWTN +
Sbjct  263   QLGSGLKGLGLGSFGLDWSTIAGFLGSPLATPGFAIINILVGFVLFVYVITPIFYWTNAY  322

Query  1126  DAKKFPLFSSNVFDSNGQVYNISRVLNKKTFGFDQPGYDSYSNIYLSTAFVYTYGLSFAT  947
             +A+KFPL SS+ FDS G+ YNISRVL++ TF  DQ GY++YS +YLS  F   YGLSFAT
Sbjct  323   EARKFPLISSHTFDSTGKTYNISRVLDENTFNLDQEGYNNYSKLYLSVFFALNYGLSFAT  382

Query  946   LAATVSHVALFHGRTIWEQTKES---VQDKFSDIHTRLMRKNYEPVPQWWFYlllviivg  776
             L AT+SHVALFHG+T WE  K++   V+D  +DIHTRLM+KNY+ VPQWWF+++L+ +V 
Sbjct  383   LTATISHVALFHGKTTWEMWKKTTSVVKDHSADIHTRLMKKNYDAVPQWWFHIILISMVA  442

Query  775   valvACQRFGGQLQLPVWGVLLAVLLSLIFTLPVGVITATTNQQTGLNVIAELIIGYMYP  596
             +++ AC+ F  QLQLP WG+L+A  ++L FTLP+G+I ATTN Q GLNVI EL+IGY+YP
Sbjct  443   LSIFACEGFDKQLQLPWWGILMACGIALFFTLPIGIIQATTNMQPGLNVITELVIGYIYP  502

Query  595   GRPLASVTFKMYGlsslsqslmflSDFKLGHYMKIPPKSMFMVQLVGTLISCCVHFGTGW  416
             G+PLA+V FK YG  S+SQ+L FL DFKLGHYMKIPPKSMF+VQLVGT+++  V+FGT W
Sbjct  503   GKPLANVAFKTYGYISMSQALGFLGDFKLGHYMKIPPKSMFVVQLVGTVVASSVYFGTAW  562

Query  415   WLLTTVENICNPSKLPEGSQWTCPGDDVFYNASIIWGVVSPRRMFGNLGIYQATNYFFLV  236
             WLL+T+ NIC+ S LP+GS WTCPGDDVFYNASIIWGVV P RMF   G+Y   N+FFL+
Sbjct  563   WLLSTIPNICDTSLLPDGSPWTCPGDDVFYNASIIWGVVGPARMFTKKGVYPEMNWFFLI  622

Query  235   GFLAPIPVWYLGRKYPEKRWVSLINMPILISGAEGIPIVKSVNYVCWFAVGLYFNLYVYR  56
             G +AP+PVW L RK+P K+W+  INMPI+ +   G+P  +SVNY+ W AVG+YFN YVYR
Sbjct  623   GLVAPVPVWLLSRKFPNKKWIKYINMPIIFAATGGMPPTRSVNYITWGAVGIYFNFYVYR  682

Query  55    KHKGWWARHNYILSAGLD  2
             K+KGWWA+HNYILSA LD
Sbjct  683   KYKGWWAKHNYILSAALD  700



>ref|XP_007142437.1| hypothetical protein PHAVU_008G280400g [Phaseolus vulgaris]
 gb|ESW14431.1| hypothetical protein PHAVU_008G280400g [Phaseolus vulgaris]
Length=746

 Score =   900 bits (2325),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 441/681 (65%), Positives = 548/681 (80%), Gaps = 4/681 (1%)
 Frame = -1

Query  2032  VESSADEINDSPVEEVRLTVPITDDPTMPCVTFRTWVLGVTSCVILAFLNQFFGYRQNAL  1853
             +   +DE++DSP+E+VRLTVPITDDPT P +TFRTW LG+ SC++LAF+NQFFGYR   L
Sbjct  15    ISEESDEVDDSPIEQVRLTVPITDDPTQPVLTFRTWTLGLASCIVLAFINQFFGYRTTPL  74

Query  1852  YVSSVPAQIVVLPMGKLMAAYLPTKVVQIPGTKWSFSLNPGPFNIKEHVLITIFASSGSD  1673
              +SSV AQI+ LP+GKLMA  LPTKV  +P T WSFS+NPGPFN+KEH LITIFAS+GS 
Sbjct  75    SISSVSAQIISLPLGKLMARTLPTKVFTLPFTNWSFSMNPGPFNLKEHALITIFASAGSS  134

Query  1672  FSYAVSIITMMKAFYYRDIHPLAAVLLTFSTQMLGYGLAGIFKKFLIDSPYMWWPSNLVQ  1493
               YA++IIT++KAFY+R+IHP+AA LL  STQMLGYG AGIF+KFL+DSPYMWWPSNLVQ
Sbjct  135   GVYAINIITIVKAFYHRNIHPVAAFLLALSTQMLGYGWAGIFRKFLVDSPYMWWPSNLVQ  194

Query  1492  VSLFRALHDVETRPKGGLTRLQFFIIVLVCSFAYYVVPNYLFPSLTALSLLCWIWKNSVT  1313
             VSLFRA H+ E RPKGG TRLQFF++V V SFAYY++P YLFP L  +S +C +WK S+ 
Sbjct  195   VSLFRAFHEKEKRPKGGNTRLQFFLLVFVSSFAYYIIPGYLFPGLATISWVCLVWKKSIL  254

Query  1312  AQQlgsglkglgigSFALDWATVAAFQGSPLVTPDFAIINMLIGYVLVAYIAIPVWYWTN  1133
             AQQ+GSG+ GLGIGSF LDW TVA F G+PL  P FAIIN+L+G+VL  Y+ IP+ YW N
Sbjct  255   AQQIGSGITGLGIGSFGLDWNTVAGFLGTPLAVPGFAIINILVGFVLFMYVLIPISYWNN  314

Query  1132  LFDAKKFPLFSSNVFDSNGQVYNISRVLNKKTFGFDQPGYDSYSNIYLSTAFVYTYGLSF  953
             ++DAKKFP+ SS  FDS G  YN++R+LN   F  +   Y++YS +YLS  F + YGLSF
Sbjct  315   VYDAKKFPIISSKTFDSTGAKYNVTRILNAANFDINMDNYNNYSKLYLSITFAFDYGLSF  374

Query  952   ATLAATVSHVALFHGRTI---WEQTKESVQDK-FSDIHTRLMRKNYEPVPQWWFYlllvi  785
             ATL AT+SHVALFHG+TI   W++T  ++++K F D+HTRLM+KNYE VP+WWF  +LV+
Sbjct  375   ATLTATISHVALFHGKTIVQMWKKTTSALREKGFGDVHTRLMKKNYEQVPEWWFVSILVL  434

Query  784   ivgvalvACQRFGGQLQLPVWGVLLAVLLSLIFTLPVGVITATTNQQTGLNVIAELIIGY  605
             +V VAL+ C+ FG QLQLP WGVLL+++++L+FTLP+GVI ATTN Q GLNVI ELIIGY
Sbjct  435   MVVVALITCEGFGKQLQLPWWGVLLSLVIALVFTLPIGVIQATTNMQAGLNVITELIIGY  494

Query  604   MYPGRPLASVTFKMYGlsslsqslmflSDFKLGHYMKIPPKSMFMVQLVGTLISCCVHFG  425
             +YPG+PLA+V FK YG  S+SQ+L FL DFKLGHYMKIPPKSMF+VQLVGT+++  V+FG
Sbjct  495   LYPGKPLANVAFKTYGYISMSQALGFLGDFKLGHYMKIPPKSMFIVQLVGTIVASGVYFG  554

Query  424   TGWWLLTTVENICNPSKLPEGSQWTCPGDDVFYNASIIWGVVSPRRMFGNLGIYQATNYF  245
             T WWLLTTV NIC+ +KLP+ S W CPGDDVFYNASIIWGVV P+RMF   GIY   N+F
Sbjct  555   TAWWLLTTVPNICDQTKLPDNSPWQCPGDDVFYNASIIWGVVGPKRMFTKDGIYPGMNWF  614

Query  244   FLVGFLAPIPVWYLGRKYPEKRWVSLINMPILISGAEGIPIVKSVNYVCWFAVGLYFNLY  65
             FL+G + P+PVW L RKYP ++W+ LINMP++I+GA GIP  ++VNY  W  VG++FN +
Sbjct  615   FLIGAVLPVPVWILARKYPNQKWIELINMPLIIAGAGGIPPARTVNYTTWGMVGIFFNFF  674

Query  64    VYRKHKGWWARHNYILSAGLD  2
             VY K K WWARH YILSA LD
Sbjct  675   VYYKFKAWWARHTYILSAALD  695



>ref|XP_002267184.1| PREDICTED: oligopeptide transporter 1-like [Vitis vinifera]
Length=753

 Score =   899 bits (2324),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 445/681 (65%), Positives = 562/681 (83%), Gaps = 4/681 (1%)
 Frame = -1

Query  2032  VESSADE-INDSPVEEVRLTVPITDDPTMPCVTFRTWVLGVTSCVILAFLNQFFGYRQNA  1856
             +E++ DE +ND P+E+VRLTVPITDDPT P +TFRTWVLGV SCVIL+F+NQFFGYR N 
Sbjct  21    IEATGDEEVNDCPIEQVRLTVPITDDPTEPVLTFRTWVLGVASCVILSFVNQFFGYRSNQ  80

Query  1855  LYVSSVPAQIVVLPMGKLMAAYLPTKVVQIPGTKWSFSLNPGPFNIKEHVLITIFASSGS  1676
             L +SSV AQIV LP+GK MAA LP K +++P TKWSFSLNPGPFNIKEHVLIT+FA+SGS
Sbjct  81    LSISSVSAQIVTLPLGKFMAATLPEKPIKVPCTKWSFSLNPGPFNIKEHVLITMFANSGS  140

Query  1675  DFSYAVSIITMMKAFYYRDIHPLAAVLLTFSTQMLGYGLAGIFKKFLIDSPYMWWPSNLV  1496
                YAV I+T++KAFY R + P A  LL  +TQ+LGYG AG+F+K+L+DSPYMWWPSNLV
Sbjct  141   GGVYAVGILTIVKAFYKRSLSPGAGYLLVQTTQLLGYGWAGLFRKYLVDSPYMWWPSNLV  200

Query  1495  QVSLFRALHDVETRPKGGLTRLQFFIIVLVCSFAYYVVPNYLFPSLTALSLLCWIWKNSV  1316
             QVSLFRALH+ E R KGGLTRLQFF+IV + SFAYY+VPNYLFPS+  +S++C IWKNS+
Sbjct  201   QVSLFRALHEKEKRSKGGLTRLQFFLIVFISSFAYYLVPNYLFPSIGTVSIICLIWKNSI  260

Query  1315  TAQQlgsglkglgigSFALDWATVAAFQGSPLVTPDFAIINMLIGYVLVAYIAIPVWYWT  1136
             TAQQ+GSGL G+G+GSF LDWATVA+F GSPL TP FAIIN+L+G+ ++ YI +P+ Y+ 
Sbjct  261   TAQQIGSGLYGMGLGSFGLDWATVASFLGSPLATPGFAIINILVGFFIIVYILLPLTYYN  320

Query  1135  NLFDAKKFPLFSSNVFDSNGQVYNISRVLNKKTFGFDQPGYDSYSNIYLSTAFVYTYGLS  956
             N ++AKKFP+FSS+ FDS GQ YN++R+LN KTF  D   Y++YS +YLS  F  TYG+S
Sbjct  321   NAYEAKKFPIFSSHTFDSTGQPYNLTRILNPKTFSVDLAEYNAYSKLYLSVFFSVTYGIS  380

Query  955   FATLAATVSHVALFHGRTIWE---QTKESVQDKFSDIHTRLMRKNYEPVPQWWFYlllvi  785
             FATLAA+VSHVALF+G TIW+   +T+ +  +KF D+HTRLM+KNY+ VPQWWFYL+L++
Sbjct  381   FATLAASVSHVALFNGSTIWQMWTKTRAAAGEKFGDVHTRLMKKNYKIVPQWWFYLILIV  440

Query  784   ivgvalvACQRFGGQLQLPVWGVLLAVLLSLIFTLPVGVITATTNQQTGLNVIAELIIGY  605
             ++G++L+AC+ F  QLQLP WG+LL   L+  FTLP+G+ITATTNQQ GLNVI ELIIG+
Sbjct  441   VLGLSLLACEGFDKQLQLPWWGILLCCALAFFFTLPIGIITATTNQQPGLNVITELIIGF  500

Query  604   MYPGRPLASVTFKMYGlsslsqslmflSDFKLGHYMKIPPKSMFMVQLVGTLISCCVHFG  425
             +YPG+PLA+V FK YG  S+SQ+L FLSDFKLGHYMKIPP+SMF+VQLVGT+I+  V+FG
Sbjct  501   IYPGKPLANVVFKTYGYISMSQALTFLSDFKLGHYMKIPPRSMFLVQLVGTVIASSVYFG  560

Query  424   TGWWLLTTVENICNPSKLPEGSQWTCPGDDVFYNASIIWGVVSPRRMFGNLGIYQATNYF  245
             T WWLLTTV++IC+   LPEGS WTCPGDDVFYNAS+IWGV+ P RMFG LG+Y   N+F
Sbjct  561   TAWWLLTTVKHICDRDLLPEGSPWTCPGDDVFYNASVIWGVIGPLRMFGRLGVYPEMNWF  620

Query  244   FLVGFLAPIPVWYLGRKYPEKRWVSLINMPILISGAEGIPIVKSVNYVCWFAVGLYFNLY  65
             FL GFLAP+PVW+L RK+P ++W+ LI+MPI+I     +P  ++V++V W  VG++FN Y
Sbjct  621   FLAGFLAPVPVWFLSRKFPNQKWIRLIHMPIIIGATGNMPPARAVHFVMWGIVGVFFNFY  680

Query  64    VYRKHKGWWARHNYILSAGLD  2
             VY ++K WWA+H YILSA LD
Sbjct  681   VYNRYKQWWAKHTYILSAALD  701



>ref|XP_004491523.1| PREDICTED: oligopeptide transporter 1-like [Cicer arietinum]
Length=751

 Score =   898 bits (2321),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 438/681 (64%), Positives = 545/681 (80%), Gaps = 3/681 (0%)
 Frame = -1

Query  2035  AVESSADEINDSPVEEVRLTVPITDDPTMPCVTFRTWVLGVTSCVILAFLNQFFGYRQNA  1856
             ++     E++DSP+E+VRLTVPITDDPT P +TFRTWV+G+ SCVIL+F+NQFFGYR N 
Sbjct  19    SIADEETEVDDSPIEQVRLTVPITDDPTQPALTFRTWVIGLASCVILSFVNQFFGYRTNP  78

Query  1855  LYVSSVPAQIVVLPMGKLMAAYLPTKVVQIPGTKWSFSLNPGPFNIKEHVLITIFASSGS  1676
             L+VSSV AQIV LP+GKLMAA LP    ++P TKW FSLNPGPFN+KEH LITIFAS+GS
Sbjct  79    LFVSSVSAQIVSLPIGKLMAATLPKTQYKVPFTKWFFSLNPGPFNMKEHALITIFASAGS  138

Query  1675  DFSYAVSIITMMKAFYYRDIHPLAAVLLTFSTQMLGYGLAGIFKKFLIDSPYMWWPSNLV  1496
                YA++IIT++KAFY+R I+P+AA LL  STQMLGYG AGIF+KFL+DSPYMWWPSNLV
Sbjct  139   SGVYAINIITIVKAFYHRQINPVAAFLLAMSTQMLGYGWAGIFRKFLVDSPYMWWPSNLV  198

Query  1495  QVSLFRALHDVETRPKGGLTRLQFFIIVLVCSFAYYVVPNYLFPSLTALSLLCWIWKNSV  1316
             QVSLFRA H+ E RP+GG TRLQFF +V V SFAYY++P Y F +++ +S+ C IWKNSV
Sbjct  199   QVSLFRAFHEKEKRPRGGNTRLQFFFLVFVASFAYYIIPGYFFQAISTISIGCLIWKNSV  258

Query  1315  TAQQlgsglkglgigSFALDWATVAAFQGSPLVTPDFAIINMLIGYVLVAYIAIPVWYWT  1136
             TAQQ+ SG+KGLGIGS + DW TVA F GSPL  P FAIIN+L+G+VL  Y+ +P+ YW 
Sbjct  259   TAQQISSGMKGLGIGSISFDWNTVAGFLGSPLPVPGFAIINILVGFVLFIYVVVPISYWN  318

Query  1135  NLFDAKKFPLFSSNVFDSNGQVYNISRVLNKKTFGFDQPGYDSYSNIYLSTAFVYTYGLS  956
             N ++AKKFPL SS+ FDS G  YN+SR+LN  TF  D   Y+ YS +YLS  F + YGLS
Sbjct  319   NFYEAKKFPLISSHTFDSTGATYNVSRILNDATFEIDMDAYNKYSKLYLSITFAFDYGLS  378

Query  955   FATLAATVSHVALFHGRTI---WEQTKESVQDKFSDIHTRLMRKNYEPVPQWWFYlllvi  785
             FATL AT+SHV LFHG+ I   W +T  +++++  D+HTR+M++NYE VP+WWF  +L +
Sbjct  379   FATLTATISHVMLFHGKMIIQLWRKTTTALKEQAGDVHTRIMKRNYEQVPEWWFMTILFL  438

Query  784   ivgvalvACQRFGGQLQLPVWGVLLAVLLSLIFTLPVGVITATTNQQTGLNVIAELIIGY  605
             +V +AL+ C+ FG QLQLP WGVLL++ ++L+FTLP+GVI ATTNQQ GLNVI ELIIGY
Sbjct  439   MVIMALMCCEGFGKQLQLPWWGVLLSLTIALVFTLPIGVIQATTNQQAGLNVITELIIGY  498

Query  604   MYPGRPLASVTFKMYGlsslsqslmflSDFKLGHYMKIPPKSMFMVQLVGTLISCCVHFG  425
             +YPG+PLA+V FK YG  S+SQ+L FLSDFKLGHYMKIPPK+MF+VQLVGTL++  V+F 
Sbjct  499   LYPGKPLANVAFKTYGYISMSQALGFLSDFKLGHYMKIPPKAMFLVQLVGTLVASSVYFS  558

Query  424   TGWWLLTTVENICNPSKLPEGSQWTCPGDDVFYNASIIWGVVSPRRMFGNLGIYQATNYF  245
             T WWLLTT+ NIC+ + LPEGS WTCPGDDVFYNASIIWGVV P+RMF   GIY   N+F
Sbjct  559   TAWWLLTTIPNICDETMLPEGSPWTCPGDDVFYNASIIWGVVGPQRMFTKDGIYPGMNWF  618

Query  244   FLVGFLAPIPVWYLGRKYPEKRWVSLINMPILISGAEGIPIVKSVNYVCWFAVGLYFNLY  65
             FL+G LAP+PVW L RKYP  +W+ LINMP++I+GA G+P  +SVNY+ W  VG++FN Y
Sbjct  619   FLIGLLAPVPVWLLARKYPNHKWIELINMPLIIAGANGLPPARSVNYITWGIVGIFFNFY  678

Query  64    VYRKHKGWWARHNYILSAGLD  2
             +Y+  K WWARH YILSA LD
Sbjct  679   IYKNFKSWWARHTYILSAALD  699



>ref|XP_003625171.1| Oligopeptide transporter OPT family [Medicago truncatula]
Length=795

 Score =   897 bits (2319),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 439/681 (64%), Positives = 545/681 (80%), Gaps = 5/681 (1%)
 Frame = -1

Query  2029  ESSADE--INDSPVEEVRLTVPITDDPTMPCVTFRTWVLGVTSCVILAFLNQFFGYRQNA  1856
             ++  DE  INDSP+E+VRLTVPITDDP+ P +TFRTW+LG+ SCV+LAF+NQF GYR N 
Sbjct  64    DAEKDEYNINDSPIEQVRLTVPITDDPSQPALTFRTWILGLASCVLLAFVNQFLGYRTNP  123

Query  1855  LYVSSVPAQIVVLPMGKLMAAYLPTKVVQIPGTKWSFSLNPGPFNIKEHVLITIFASSGS  1676
             L ++SV AQI+ LP+G+LMAA LPTK +QIP T   FSLNPGPF++KEHVLITIFASSGS
Sbjct  124   LRITSVSAQIITLPLGRLMAATLPTKPIQIPFTTCYFSLNPGPFSLKEHVLITIFASSGS  183

Query  1675  DFSYAVSIITMMKAFYYRDIHPLAAVLLTFSTQMLGYGLAGIFKKFLIDSPYMWWPSNLV  1496
             +  YA+ I+T++KAFY++DIHP+AA LL  STQMLGYG AGIF++FL+DSPYMWWP NLV
Sbjct  184   NSVYAIGIVTIVKAFYHKDIHPVAAYLLALSTQMLGYGWAGIFRRFLVDSPYMWWPENLV  243

Query  1495  QVSLFRALHDVETRPKGGLTRLQFFIIVLVCSFAYYVVPNYLFPSLTALSLLCWIWKNSV  1316
             QVSLFRA H+ E RPKGG +RLQFF +V V SF YY+VP Y F +++A+S +C IWK+S+
Sbjct  244   QVSLFRAFHEKEKRPKGGTSRLQFFSVVFVASFTYYIVPGYFFQAISAVSFVCLIWKDSI  303

Query  1315  TAQQlgsglkglgigSFALDWATVAAFQGSPLVTPDFAIINMLIGYVLVAYIAIPVWYWT  1136
             TAQQ+GSG+KGLGIGSF LDW TVA F GSPL  P FA+IN+  G+ L  Y+ IP+ YW 
Sbjct  304   TAQQIGSGMKGLGIGSFGLDWNTVAGFLGSPLAVPGFAVINITAGFFLYMYVLIPIAYWN  363

Query  1135  NLFDAKKFPLFSSNVFDSNGQVYNISRVLNKKTFGFDQPGYDSYSNIYLSTAFVYTYGLS  956
             NL+DA+KFPL SS+ FDS G  YN++R+LN KTF  D   Y++YS IYLS  F + YGLS
Sbjct  364   NLYDAQKFPLISSHTFDSTGATYNVTRILNTKTFDIDMESYNNYSKIYLSVTFAFQYGLS  423

Query  955   FATLAATVSHVALFHGRTI---WEQTKESVQDKFSDIHTRLMRKNYEPVPQWWFYlllvi  785
             FA L AT+SHV LFHG  I   W++TK S+  +  D+HTR+M+KNYE VP WWF  +L++
Sbjct  424   FAALTATISHVVLFHGEMILLMWKKTKSSLTHQLGDVHTRIMKKNYEQVPDWWFVAILIL  483

Query  784   ivgvalvACQRFGGQLQLPVWGVLLAVLLSLIFTLPVGVITATTNQQTGLNVIAELIIGY  605
             +V +A VAC+ FG QLQLP WG+LL++ ++LIFTLP+GVI ATTN + GLNVI EL+IG+
Sbjct  484   MVMIAFVACEGFGKQLQLPWWGILLSLAIALIFTLPIGVIQATTNIRKGLNVITELVIGF  543

Query  604   MYPGRPLASVTFKMYGlsslsqslmflSDFKLGHYMKIPPKSMFMVQLVGTLISCCVHFG  425
             +YPG+PLA+V FK YG  S+ Q+L FL DFKLGHYMKIPPKSMF+VQLVGT++S  VHFG
Sbjct  544   IYPGKPLANVAFKTYGHISMVQALGFLEDFKLGHYMKIPPKSMFIVQLVGTVVSSSVHFG  603

Query  424   TGWWLLTTVENICNPSKLPEGSQWTCPGDDVFYNASIIWGVVSPRRMFGNLGIYQATNYF  245
             T WWLLT++ENIC+ S LP+GS WTCPGDDVFYNASIIWGVV P+RMF   G+Y   N+F
Sbjct  604   TAWWLLTSIENICDESLLPKGSPWTCPGDDVFYNASIIWGVVGPKRMFTKDGVYPEMNWF  663

Query  244   FLVGFLAPIPVWYLGRKYPEKRWVSLINMPILISGAEGIPIVKSVNYVCWFAVGLYFNLY  65
             FL+G LAP+PVW L  K+  ++W+ LIN+PI+ +GA GIP V+SVNY+ W  VG+ FN Y
Sbjct  664   FLIGLLAPVPVWLLSLKFRNQKWIQLINIPIIAAGASGIPPVRSVNYITWGIVGMVFNFY  723

Query  64    VYRKHKGWWARHNYILSAGLD  2
             VYRK K WWARH YILSAGLD
Sbjct  724   VYRKFKAWWARHTYILSAGLD  744



>ref|XP_002522788.1| Oligopeptide transporter, putative [Ricinus communis]
 gb|EEF39639.1| Oligopeptide transporter, putative [Ricinus communis]
Length=757

 Score =   897 bits (2317),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 436/675 (65%), Positives = 548/675 (81%), Gaps = 3/675 (0%)
 Frame = -1

Query  2017  DEINDSPVEEVRLTVPITDDPTMPCVTFRTWVLGVTSCVILAFLNQFFGYRQNALYVSSV  1838
             +E++DSPVE+VRL VPITDDPT P +TFRTWVLG+ SC +LA+LNQFF YR N L V+SV
Sbjct  30    EEVDDSPVEQVRLIVPITDDPTQPVLTFRTWVLGIASCALLAYLNQFFAYRTNQLIVTSV  89

Query  1837  PAQIVVLPMGKLMAAYLPTKVVQIPGTKWSFSLNPGPFNIKEHVLITIFASSGSDFSYAV  1658
              AQIVVLP+G  MAA LP   + IP  KWSFSLNPGPFN+KEH LITIFAS G++  YAV
Sbjct  90    SAQIVVLPLGNFMAAVLPKNQITIPFAKWSFSLNPGPFNMKEHALITIFASCGANGVYAV  149

Query  1657  SIITMMKAFYYRDIHPLAAVLLTFSTQMLGYGLAGIFKKFLIDSPYMWWPSNLVQVSLFR  1478
              I+T +KAFY R +HP AA+LL  +TQ+LGYG AG+F+KFL++SPYMWWP++LVQVSLFR
Sbjct  150   YILTSVKAFYRRPLHPAAAMLLVQTTQLLGYGWAGMFRKFLVESPYMWWPADLVQVSLFR  209

Query  1477  ALHDVETRPKGGLTRLQFFIIVLVCSFAYYVVPNYLFPSLTALSLLCWIWKNSVTAQQlg  1298
             ALH+ E RP+ GLTRLQFF IV V SFAYY++P YLFPS++ALS +CWIWK+SV AQQ+G
Sbjct  210   ALHEKEKRPRKGLTRLQFFAIVFVASFAYYIIPGYLFPSISALSFVCWIWKDSVLAQQIG  269

Query  1297  sglkglgigSFALDWATVAAFQGSPLVTPDFAIINMLIGYVLVAYIAIPVWYWTNLFDAK  1118
             SGL GLGIGSF +DW++VA+F GSPL  P FAI N ++G+V+V YI +P+ YW+N F+AK
Sbjct  270   SGLNGLGIGSFGVDWSSVASFLGSPLAVPFFAIANTMLGFVMVLYIIVPIAYWSNAFEAK  329

Query  1117  KFPLFSSNVFDSNGQVYNISRVLNKKTFGFDQPGYDSYSNIYLSTAFVYTYGLSFATLAA  938
             K+P+ SS+ FDS+GQ YNISRVL++K F  D   Y++YS +YLS  F + YG+SFA+L +
Sbjct  330   KYPILSSHTFDSDGQTYNISRVLDEKNFDIDLVAYNNYSKLYLSVLFAFAYGMSFASLMS  389

Query  937   TVSHVALFHGRTI---WEQTKESVQDKFSDIHTRLMRKNYEPVPQWWFYlllviivgval  767
             T+SHVALF G+TI   W+ TK +++D+F+D+HTRLMRKNYE VP+WWF ++ V+ + ++L
Sbjct  390   TLSHVALFEGKTIWTMWKNTKSAIKDQFTDVHTRLMRKNYEEVPEWWFLMIAVVSLVLSL  449

Query  766   vACQRFGGQLQLPVWGVLLAVLLSLIFTLPVGVITATTNQQTGLNVIAELIIGYMYPGRP  587
             +A + F  QLQLP WG+LLA  +S +FTLPVGV+ ATTN Q GLNVI ELIIGYMYPG+P
Sbjct  450   IAVEGFNKQLQLPWWGLLLACAISFLFTLPVGVVQATTNMQMGLNVITELIIGYMYPGKP  509

Query  586   LASVTFKMYGlsslsqslmflSDFKLGHYMKIPPKSMFMVQLVGTLISCCVHFGTGWWLL  407
             LA+V FK YG  S++Q+L F+ DFKLGHYMKIPPK+MF+VQL GTL++  V FGT WWLL
Sbjct  510   LANVAFKTYGYISMAQALTFIQDFKLGHYMKIPPKAMFLVQLAGTLVASTVCFGTAWWLL  569

Query  406   TTVENICNPSKLPEGSQWTCPGDDVFYNASIIWGVVSPRRMFGNLGIYQATNYFFLVGFL  227
             TT+ENIC P  LP+GS WTCPGDDVFY+AS+IWGV+ PRRMFG+LGIY   N+FFL+G L
Sbjct  570   TTIENICIPELLPDGSPWTCPGDDVFYHASVIWGVIGPRRMFGDLGIYSKMNWFFLIGLL  629

Query  226   APIPVWYLGRKYPEKRWVSLINMPILISGAEGIPIVKSVNYVCWFAVGLYFNLYVYRKHK  47
             AP PVW+  +KYPEK+W+  I+MPI ISG  G+P  K+V+Y  W A+G  FN ++YRK+K
Sbjct  630   APFPVWFFSQKYPEKKWIKNIHMPIFISGITGMPPAKAVHYWSWGAIGTLFNYFIYRKNK  689

Query  46    GWWARHNYILSAGLD  2
             GWWARHNYILSAGL 
Sbjct  690   GWWARHNYILSAGLS  704



>gb|AET00810.2| oligopeptide transporter OPT family protein [Medicago truncatula]
Length=752

 Score =   895 bits (2313),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 431/681 (63%), Positives = 546/681 (80%), Gaps = 3/681 (0%)
 Frame = -1

Query  2035  AVESSADEINDSPVEEVRLTVPITDDPTMPCVTFRTWVLGVTSCVILAFLNQFFGYRQNA  1856
             A+     E++DSP+E+VRLTV  TDDPT P +TFRTW++G+  C++LAF+NQFFGYR N 
Sbjct  20    AIADDDTEVDDSPIEQVRLTVSTTDDPTQPALTFRTWIIGLACCIVLAFVNQFFGYRTNP  79

Query  1855  LYVSSVPAQIVVLPMGKLMAAYLPTKVVQIPGTKWSFSLNPGPFNIKEHVLITIFASSGS  1676
             L +++V AQIV LP+GKLMAA LPT + ++P TKWSF+LNPGPFN+KEH LITIFAS+G+
Sbjct  80    LTITAVSAQIVSLPIGKLMAATLPTTIYKVPFTKWSFTLNPGPFNLKEHALITIFASAGA  139

Query  1675  DFSYAVSIITMMKAFYYRDIHPLAAVLLTFSTQMLGYGLAGIFKKFLIDSPYMWWPSNLV  1496
                YA++IIT++KAFY+R+I+P+AA LL  +TQMLGYG AG+F++FL+DSPYMWWPSNLV
Sbjct  140   GGVYAINIITIVKAFYHRNINPIAAFLLAITTQMLGYGWAGMFRRFLVDSPYMWWPSNLV  199

Query  1495  QVSLFRALHDVETRPKGGLTRLQFFIIVLVCSFAYYVVPNYLFPSLTALSLLCWIWKNSV  1316
             QVSLFRA H+ E R KGG TRLQFF ++ V SF YY++P Y F  ++ +S++C IWKNSV
Sbjct  200   QVSLFRAFHEKEKRLKGGTTRLQFFFLIFVASFGYYIIPGYFFQRISTISVVCLIWKNSV  259

Query  1315  TAQQlgsglkglgigSFALDWATVAAFQGSPLVTPDFAIINMLIGYVLVAYIAIPVWYWT  1136
             TAQQ+GSG+KGLGIG+F+LDW TV +F GSPL  P FAIIN+L+G+VL  Y+ IP+ YW 
Sbjct  260   TAQQIGSGMKGLGIGAFSLDWNTVVSFTGSPLAVPGFAIINVLVGFVLFLYVIIPISYWN  319

Query  1135  NLFDAKKFPLFSSNVFDSNGQVYNISRVLNKKTFGFDQPGYDSYSNIYLSTAFVYTYGLS  956
             N ++AKKFP  SS+ FDS G  YN+SR+LN+ TF  D   Y+ YS +YLS  F + YGLS
Sbjct  320   NFYEAKKFPFISSHTFDSTGATYNVSRILNEATFEIDMDAYNKYSKLYLSIIFAFDYGLS  379

Query  955   FATLAATVSHVALFHGRTI---WEQTKESVQDKFSDIHTRLMRKNYEPVPQWWFYlllvi  785
             FATL ATVSHV LFHG+TI   W +T  ++++   D+HTRLM++NYE VP+WWF ++LV+
Sbjct  380   FATLTATVSHVCLFHGKTIIQMWRKTTNALKENAGDVHTRLMKRNYEQVPEWWFMIILVL  439

Query  784   ivgvalvACQRFGGQLQLPVWGVLLAVLLSLIFTLPVGVITATTNQQTGLNVIAELIIGY  605
             +V +AL  C+ FG QLQLP WGVLL++L++L+FTLP+GVI ATTNQQ GLNVI ELIIG+
Sbjct  440   MVILALACCEGFGKQLQLPWWGVLLSLLIALVFTLPIGVIQATTNQQAGLNVITELIIGF  499

Query  604   MYPGRPLASVTFKMYGlsslsqslmflSDFKLGHYMKIPPKSMFMVQLVGTLISCCVHFG  425
             +YPG+PLA+V FK YG  S++Q+L FL DFKLGHYMKIPPK+MF+VQLVGTL++  V+F 
Sbjct  500   LYPGKPLANVAFKTYGYISMAQALSFLEDFKLGHYMKIPPKAMFIVQLVGTLVASSVYFS  559

Query  424   TGWWLLTTVENICNPSKLPEGSQWTCPGDDVFYNASIIWGVVSPRRMFGNLGIYQATNYF  245
             T WWLLTT+ NIC+ S LPEGS WTCPGDDVFYNASIIWGVV P+RMF   GIY   N+F
Sbjct  560   TAWWLLTTIPNICDASMLPEGSPWTCPGDDVFYNASIIWGVVGPQRMFTKDGIYPGMNWF  619

Query  244   FLVGFLAPIPVWYLGRKYPEKRWVSLINMPILISGAEGIPIVKSVNYVCWFAVGLYFNLY  65
             FL+G LAP+PVW L RKYP  +W+ LINMP++I GA GIP  +S+NY+ W  VG++FN Y
Sbjct  620   FLIGLLAPVPVWLLARKYPNHKWIELINMPLIIGGASGIPPARSINYISWGVVGIFFNFY  679

Query  64    VYRKHKGWWARHNYILSAGLD  2
             VY+  K WWARH YILSA LD
Sbjct  680   VYKNFKAWWARHTYILSAALD  700



>gb|AES81389.2| oligopeptide transporter OPT family protein [Medicago truncatula]
Length=752

 Score =   895 bits (2313),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 439/681 (64%), Positives = 545/681 (80%), Gaps = 5/681 (1%)
 Frame = -1

Query  2029  ESSADE--INDSPVEEVRLTVPITDDPTMPCVTFRTWVLGVTSCVILAFLNQFFGYRQNA  1856
             ++  DE  INDSP+E+VRLTVPITDDP+ P +TFRTW+LG+ SCV+LAF+NQF GYR N 
Sbjct  21    DAEKDEYNINDSPIEQVRLTVPITDDPSQPALTFRTWILGLASCVLLAFVNQFLGYRTNP  80

Query  1855  LYVSSVPAQIVVLPMGKLMAAYLPTKVVQIPGTKWSFSLNPGPFNIKEHVLITIFASSGS  1676
             L ++SV AQI+ LP+G+LMAA LPTK +QIP T   FSLNPGPF++KEHVLITIFASSGS
Sbjct  81    LRITSVSAQIITLPLGRLMAATLPTKPIQIPFTTCYFSLNPGPFSLKEHVLITIFASSGS  140

Query  1675  DFSYAVSIITMMKAFYYRDIHPLAAVLLTFSTQMLGYGLAGIFKKFLIDSPYMWWPSNLV  1496
             +  YA+ I+T++KAFY++DIHP+AA LL  STQMLGYG AGIF++FL+DSPYMWWP NLV
Sbjct  141   NSVYAIGIVTIVKAFYHKDIHPVAAYLLALSTQMLGYGWAGIFRRFLVDSPYMWWPENLV  200

Query  1495  QVSLFRALHDVETRPKGGLTRLQFFIIVLVCSFAYYVVPNYLFPSLTALSLLCWIWKNSV  1316
             QVSLFRA H+ E RPKGG +RLQFF +V V SF YY+VP Y F +++A+S +C IWK+S+
Sbjct  201   QVSLFRAFHEKEKRPKGGTSRLQFFSVVFVASFTYYIVPGYFFQAISAVSFVCLIWKDSI  260

Query  1315  TAQQlgsglkglgigSFALDWATVAAFQGSPLVTPDFAIINMLIGYVLVAYIAIPVWYWT  1136
             TAQQ+GSG+KGLGIGSF LDW TVA F GSPL  P FA+IN+  G+ L  Y+ IP+ YW 
Sbjct  261   TAQQIGSGMKGLGIGSFGLDWNTVAGFLGSPLAVPGFAVINITAGFFLYMYVLIPIAYWN  320

Query  1135  NLFDAKKFPLFSSNVFDSNGQVYNISRVLNKKTFGFDQPGYDSYSNIYLSTAFVYTYGLS  956
             NL+DA+KFPL SS+ FDS G  YN++R+LN KTF  D   Y++YS IYLS  F + YGLS
Sbjct  321   NLYDAQKFPLISSHTFDSTGATYNVTRILNTKTFDIDMESYNNYSKIYLSVTFAFQYGLS  380

Query  955   FATLAATVSHVALFHGRTI---WEQTKESVQDKFSDIHTRLMRKNYEPVPQWWFYlllvi  785
             FA L AT+SHV LFHG  I   W++TK S+  +  D+HTR+M+KNYE VP WWF  +L++
Sbjct  381   FAALTATISHVVLFHGEMILLMWKKTKSSLTHQLGDVHTRIMKKNYEQVPDWWFVAILIL  440

Query  784   ivgvalvACQRFGGQLQLPVWGVLLAVLLSLIFTLPVGVITATTNQQTGLNVIAELIIGY  605
             +V +A VAC+ FG QLQLP WG+LL++ ++LIFTLP+GVI ATTN + GLNVI EL+IG+
Sbjct  441   MVMIAFVACEGFGKQLQLPWWGILLSLAIALIFTLPIGVIQATTNIRKGLNVITELVIGF  500

Query  604   MYPGRPLASVTFKMYGlsslsqslmflSDFKLGHYMKIPPKSMFMVQLVGTLISCCVHFG  425
             +YPG+PLA+V FK YG  S+ Q+L FL DFKLGHYMKIPPKSMF+VQLVGT++S  VHFG
Sbjct  501   IYPGKPLANVAFKTYGHISMVQALGFLEDFKLGHYMKIPPKSMFIVQLVGTVVSSSVHFG  560

Query  424   TGWWLLTTVENICNPSKLPEGSQWTCPGDDVFYNASIIWGVVSPRRMFGNLGIYQATNYF  245
             T WWLLT++ENIC+ S LP+GS WTCPGDDVFYNASIIWGVV P+RMF   G+Y   N+F
Sbjct  561   TAWWLLTSIENICDESLLPKGSPWTCPGDDVFYNASIIWGVVGPKRMFTKDGVYPEMNWF  620

Query  244   FLVGFLAPIPVWYLGRKYPEKRWVSLINMPILISGAEGIPIVKSVNYVCWFAVGLYFNLY  65
             FL+G LAP+PVW L  K+  ++W+ LIN+PI+ +GA GIP V+SVNY+ W  VG+ FN Y
Sbjct  621   FLIGLLAPVPVWLLSLKFRNQKWIQLINIPIIAAGASGIPPVRSVNYITWGIVGMVFNFY  680

Query  64    VYRKHKGWWARHNYILSAGLD  2
             VYRK K WWARH YILSAGLD
Sbjct  681   VYRKFKAWWARHTYILSAGLD  701



>ref|XP_003520525.1| PREDICTED: oligopeptide transporter 5-like isoform X1 [Glycine 
max]
 gb|KHN07390.1| Oligopeptide transporter 5 [Glycine soja]
Length=778

 Score =   894 bits (2309),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 445/683 (65%), Positives = 551/683 (81%), Gaps = 3/683 (0%)
 Frame = -1

Query  2041  ISAVESSADEINDSPVEEVRLTVPITDDPTMPCVTFRTWVLGVTSCVILAFLNQFFGYRQ  1862
             I   E    +++D P+E+VRLTVPITDDPT P +TFRTWVLG+ SCV LAF+NQFFGYR 
Sbjct  45    IEDAEKDEFQVDDCPIEQVRLTVPITDDPTQPALTFRTWVLGLASCVFLAFVNQFFGYRT  104

Query  1861  NALYVSSVPAQIVVLPMGKLMAAYLPTKVVQIPGTKWSFSLNPGPFNIKEHVLITIFASS  1682
             N L +SSV AQI+ LP+GKLMAA L TK +++P TKWSFSLNPGPF++KEHVLITIFA+S
Sbjct  105   NPLKISSVSAQIITLPLGKLMAATLSTKPIRVPFTKWSFSLNPGPFSLKEHVLITIFATS  164

Query  1681  GSDFSYAVSIITMMKAFYYRDIHPLAAVLLTFSTQMLGYGLAGIFKKFLIDSPYMWWPSN  1502
             GS   YA+SIIT++KAFY+R+IHP+AA LL  STQMLGYG AGIF++FL++SPYMWWP+N
Sbjct  165   GSSGVYAISIITIVKAFYHRNIHPVAAYLLALSTQMLGYGWAGIFRRFLVNSPYMWWPAN  224

Query  1501  LVQVSLFRALHDVETRPKGGLTRLQFFIIVLVCSFAYYVVPNYLFPSLTALSLLCWIWKN  1322
             LVQVSLFRA H+ E RPKGG TRLQFF +V V SFAYY +P YLF +++ +S +C IWK+
Sbjct  225   LVQVSLFRAFHEKEKRPKGGNTRLQFFFLVFVVSFAYYTIPGYLFQAISTISFVCLIWKD  284

Query  1321  SVTAQQlgsglkglgigSFALDWATVAAFQGSPLVTPDFAIINMLIGYVLVAYIAIPVWY  1142
             S+TAQQ+GSG+ GLGIGSF LDW TVA F GSPL  P FAIINMLIG+VL  Y+ IP+ Y
Sbjct  285   SITAQQIGSGMNGLGIGSFGLDWNTVAGFLGSPLAIPGFAIINMLIGFVLDIYVLIPLAY  344

Query  1141  WTNLFDAKKFPLFSSNVFDSNGQVYNISRVLNKKTFGFDQPGYDSYSNIYLSTAFVYTYG  962
             W+NL+DAKKFPL SS+ FDS G  YN+SR+LN KTF  D   Y++YS IYLS  F + YG
Sbjct  345   WSNLYDAKKFPLISSHTFDSTGATYNVSRILNPKTFDIDLNSYNNYSKIYLSITFAFEYG  404

Query  961   LSFATLAATVSHVALFHGRTI---WEQTKESVQDKFSDIHTRLMRKNYEPVPQWWFYlll  791
              SFATL AT+SHVALFHG  I   W +T  +++++  D+HTR+M++NYE VP+WWF  +L
Sbjct  405   FSFATLTATISHVALFHGEMILQMWRKTTRALKEQLGDVHTRIMKRNYEQVPEWWFVTIL  464

Query  790   viivgvalvACQRFGGQLQLPVWGVLLAVLLSLIFTLPVGVITATTNQQTGLNVIAELII  611
             +++V +ALVAC+ FG QLQLP WG+LL++ ++L+FTLP+GVI ATTN QTGLNVIAELII
Sbjct  465   ILMVVIALVACEGFGKQLQLPWWGILLSLTIALVFTLPIGVIQATTNIQTGLNVIAELII  524

Query  610   GYMYPGRPLASVTFKMYGlsslsqslmflSDFKLGHYMKIPPKSMFMVQLVGTLISCCVH  431
             G++YPG+PLA+V FK YG  S+ Q+L FL DFKLGHYMKIPPKSMF+VQLVGT+++  V+
Sbjct  525   GFIYPGKPLANVAFKTYGHVSMVQALGFLGDFKLGHYMKIPPKSMFIVQLVGTVVASSVY  584

Query  430   FGTGWWLLTTVENICNPSKLPEGSQWTCPGDDVFYNASIIWGVVSPRRMFGNLGIYQATN  251
             F T WWLLT++ENIC+   LP+GS WTCPGDDVFYNASIIWGVV P+RMF   G+Y   N
Sbjct  585   FATAWWLLTSIENICDEELLPKGSPWTCPGDDVFYNASIIWGVVGPKRMFTKDGVYPGMN  644

Query  250   YFFLVGFLAPIPVWYLGRKYPEKRWVSLINMPILISGAEGIPIVKSVNYVCWFAVGLYFN  71
             +FFL+G LAP+PVW L +K+P  +W+ LIN PI+I+GA  IP  +SVNY+ W  VG++FN
Sbjct  645   WFFLIGLLAPLPVWLLSKKFPNHKWIQLINFPIIIAGASNIPPFRSVNYITWGIVGIFFN  704

Query  70    LYVYRKHKGWWARHNYILSAGLD  2
              YVYRK K WWARH YILSA LD
Sbjct  705   FYVYRKFKAWWARHTYILSAALD  727



>ref|XP_003519637.1| PREDICTED: oligopeptide transporter 1-like [Glycine max]
 gb|KHN43906.1| Oligopeptide transporter 1 [Glycine soja]
Length=748

 Score =   893 bits (2307),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 443/681 (65%), Positives = 553/681 (81%), Gaps = 4/681 (1%)
 Frame = -1

Query  2032  VESSADEINDSPVEEVRLTVPITDDPTMPCVTFRTWVLGVTSCVILAFLNQFFGYRQNAL  1853
             +   +DE++DSP+E+VRLTVP TDDPT   +TFRTW LG+ SC+IL+F+NQFFGYR N L
Sbjct  16    IPDESDEVDDSPIEQVRLTVPTTDDPTQAALTFRTWTLGLASCIILSFVNQFFGYRTNPL  75

Query  1852  YVSSVPAQIVVLPMGKLMAAYLPTKVVQIPGTKWSFSLNPGPFNIKEHVLITIFASSGSD  1673
              +SSV AQIV LP+GKLMAA LPTK +++P TKWSFSLNPGPFN+KEH LITIFAS+GS 
Sbjct  76    SISSVSAQIVSLPVGKLMAATLPTKPIRVPLTKWSFSLNPGPFNVKEHALITIFASAGSS  135

Query  1672  FSYAVSIITMMKAFYYRDIHPLAAVLLTFSTQMLGYGLAGIFKKFLIDSPYMWWPSNLVQ  1493
               YA++IIT++KAFY+R+IHPLAA LL  STQMLGYG AGIF++FL+DSPYMWWPSNLVQ
Sbjct  136   GVYAINIITIVKAFYHRNIHPLAAFLLALSTQMLGYGWAGIFRRFLVDSPYMWWPSNLVQ  195

Query  1492  VSLFRALHDVETRPKGGLTRLQFFIIVLVCSFAYYVVPNYLFPSLTALSLLCWIWKNSVT  1313
             VSLFRA H+ E RPKGG TRLQFF +V V SFAYYV+P Y F ++T +S +C IWKNS+T
Sbjct  196   VSLFRAFHEKEKRPKGGNTRLQFFFLVFVSSFAYYVIPAYFFQAITTISFVCLIWKNSIT  255

Query  1312  AQQlgsglkglgigSFALDWATVAAFQGSPLVTPDFAIINMLIGYVLVAYIAIPVWYWTN  1133
             AQQ+GSG++GLGIGSF LDW TVA F GSPL  P FAIIN+L+G+VL  Y+ +P+ YW N
Sbjct  256   AQQIGSGMRGLGIGSFGLDWNTVAGFLGSPLAVPGFAIINILVGFVLFMYVLVPISYWNN  315

Query  1132  LFDAKKFPLFSSNVFDSNGQVYNISRVLNKKTFGFDQPGYDSYSNIYLSTAFVYTYGLSF  953
             L+DAKKFP+ SS+ FDS+G  YN++RVLN KTF  D   Y +YS +YLS  F Y YGLSF
Sbjct  316   LYDAKKFPIISSHTFDSSGATYNVTRVLNAKTFDIDMDSYKNYSKLYLSITFAYDYGLSF  375

Query  952   ATLAATVSHVALFHGRTI---WEQTKESVQ-DKFSDIHTRLMRKNYEPVPQWWFYlllvi  785
             ATL AT++HVALFHG+ I   W++T+ +++  +  D+HTR+M++NYE VP+WWF  +L++
Sbjct  376   ATLTATIAHVALFHGKMILQLWKKTRSALKGQEAGDVHTRIMKRNYEQVPEWWFVSILLL  435

Query  784   ivgvalvACQRFGGQLQLPVWGVLLAVLLSLIFTLPVGVITATTNQQTGLNVIAELIIGY  605
             ++ VAL+ C+ FG QLQLP WGVL++++++L+FTLP+GVI ATTN Q GLNVI ELIIGY
Sbjct  436   MIVVALITCEGFGKQLQLPWWGVLMSLVIALVFTLPIGVIQATTNMQVGLNVITELIIGY  495

Query  604   MYPGRPLASVTFKMYGlsslsqslmflSDFKLGHYMKIPPKSMFMVQLVGTLISCCVHFG  425
             +YPGRPLA+V FK YG  S+SQ+L FL DFKLGHYMKIPPKSMF VQLVGT+++  V+FG
Sbjct  496   IYPGRPLANVAFKTYGYISMSQALGFLQDFKLGHYMKIPPKSMFAVQLVGTIVASGVYFG  555

Query  424   TGWWLLTTVENICNPSKLPEGSQWTCPGDDVFYNASIIWGVVSPRRMFGNLGIYQATNYF  245
             T WWLLTT+ +IC+ + LP GS WTCPGD+VFYNASIIWG+V P+RMF   GIY   N+F
Sbjct  556   TAWWLLTTIPDICDDANLPAGSPWTCPGDEVFYNASIIWGIVGPQRMFTKDGIYPGMNWF  615

Query  244   FLVGFLAPIPVWYLGRKYPEKRWVSLINMPILISGAEGIPIVKSVNYVCWFAVGLYFNLY  65
             FL+G LAP+PVW L RK+P  +W+ LINMP++I+G+ GIP  +SVNY+ W  VG+ FN Y
Sbjct  616   FLIGLLAPVPVWMLSRKFPNHKWIELINMPLIIAGSGGIPPARSVNYITWGMVGILFNFY  675

Query  64    VYRKHKGWWARHNYILSAGLD  2
             VY K K WWARHNYILSA LD
Sbjct  676   VYNKFKAWWARHNYILSAALD  696



>ref|XP_003617851.1| Oligopeptide transporter OPT family [Medicago truncatula]
Length=754

 Score =   892 bits (2305),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 429/683 (63%), Positives = 546/683 (80%), Gaps = 5/683 (1%)
 Frame = -1

Query  2035  AVESSADEINDSPVEEVRLTVPITDDPTMPCVTFRTWVLGVTSCVILAFLNQFFGYRQNA  1856
             A+     E++DSP+E+VRLTV  TDDPT P +TFRTW++G+  C++LAF+NQFFGYR N 
Sbjct  20    AIADDDTEVDDSPIEQVRLTVSTTDDPTQPALTFRTWIIGLACCIVLAFVNQFFGYRTNP  79

Query  1855  LYVSSVPAQIVVLPMGKLMAAYLPTKVVQIPGTKWSFSLNPGPFNIKEHVLITIFASSGS  1676
             L +++V AQIV LP+GKLMAA LPT + ++P TKWSF+LNPGPFN+KEH LITIFAS+G+
Sbjct  80    LTITAVSAQIVSLPIGKLMAATLPTTIYKVPFTKWSFTLNPGPFNLKEHALITIFASAGA  139

Query  1675  DFSYAVSIITMMKAFYYRDIHPLAAVLLTFSTQMLGYGLAGIFKKFLIDSPYMWWPSNLV  1496
                YA++IIT++KAFY+R+I+P+AA LL  +TQMLGYG AG+F++FL+DSPYMWWPSNLV
Sbjct  140   GGVYAINIITIVKAFYHRNINPIAAFLLAITTQMLGYGWAGMFRRFLVDSPYMWWPSNLV  199

Query  1495  QVSLFRALHDVETRPKGGLTRLQFFIIVLVCSFAYYVVPNYLFPSLTALSLLCWIWKNSV  1316
             QVSLFRA H+ E R KGG TRLQFF ++ V SF YY++P Y F  ++ +S++C IWKNSV
Sbjct  200   QVSLFRAFHEKEKRLKGGTTRLQFFFLIFVASFGYYIIPGYFFQRISTISVVCLIWKNSV  259

Query  1315  TAQQlgsglkglgigSFALDWATVAAFQGSPLVTPDFAIINMLIGYVLVAYIAIPVWYWT  1136
             TAQQ+GSG+KGLGIG+F+LDW TV +F GSPL  P FAIIN+L+G+VL  Y+ IP+ YW 
Sbjct  260   TAQQIGSGMKGLGIGAFSLDWNTVVSFTGSPLAVPGFAIINVLVGFVLFLYVIIPISYWN  319

Query  1135  NLFDAKKFPLFSSNVFDSNGQVYNISRVLNKKTFGFDQPGYDSYSNIYLSTAFVYTYGLS  956
             N ++AKKFP  SS+ FDS G  YN+SR+LN+ TF  D   Y+ YS +YLS  F + YGLS
Sbjct  320   NFYEAKKFPFISSHTFDSTGATYNVSRILNEATFEIDMDAYNKYSKLYLSIIFAFDYGLS  379

Query  955   FATLAATVSHVALFHGR-----TIWEQTKESVQDKFSDIHTRLMRKNYEPVPQWWFYlll  791
             FATL ATVSHV LFHG+     ++W +T  ++++   D+HTRLM++NYE VP+WWF ++L
Sbjct  380   FATLTATVSHVCLFHGKYVSLDSMWRKTTNALKENAGDVHTRLMKRNYEQVPEWWFMIIL  439

Query  790   viivgvalvACQRFGGQLQLPVWGVLLAVLLSLIFTLPVGVITATTNQQTGLNVIAELII  611
             V++V +AL  C+ FG QLQLP WGVLL++L++L+FTLP+GVI ATTNQQ GLNVI ELII
Sbjct  440   VLMVILALACCEGFGKQLQLPWWGVLLSLLIALVFTLPIGVIQATTNQQAGLNVITELII  499

Query  610   GYMYPGRPLASVTFKMYGlsslsqslmflSDFKLGHYMKIPPKSMFMVQLVGTLISCCVH  431
             G++YPG+PLA+V FK YG  S++Q+L FL DFKLGHYMKIPPK+MF+VQLVGTL++  V+
Sbjct  500   GFLYPGKPLANVAFKTYGYISMAQALSFLEDFKLGHYMKIPPKAMFIVQLVGTLVASSVY  559

Query  430   FGTGWWLLTTVENICNPSKLPEGSQWTCPGDDVFYNASIIWGVVSPRRMFGNLGIYQATN  251
             F T WWLLTT+ NIC+ S LPEGS WTCPGDDVFYNASIIWGVV P+RMF   GIY   N
Sbjct  560   FSTAWWLLTTIPNICDASMLPEGSPWTCPGDDVFYNASIIWGVVGPQRMFTKDGIYPGMN  619

Query  250   YFFLVGFLAPIPVWYLGRKYPEKRWVSLINMPILISGAEGIPIVKSVNYVCWFAVGLYFN  71
             +FFL+G LAP+PVW L RKYP  +W+ LINMP++I GA GIP  +S+NY+ W  VG++FN
Sbjct  620   WFFLIGLLAPVPVWLLARKYPNHKWIELINMPLIIGGASGIPPARSINYISWGVVGIFFN  679

Query  70    LYVYRKHKGWWARHNYILSAGLD  2
              YVY+  K WWARH YILSA LD
Sbjct  680   FYVYKNFKAWWARHTYILSAALD  702



>ref|XP_010644607.1| PREDICTED: oligopeptide transporter 1-like [Vitis vinifera]
Length=745

 Score =   892 bits (2304),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 439/675 (65%), Positives = 556/675 (82%), Gaps = 3/675 (0%)
 Frame = -1

Query  2017  DEINDSPVEEVRLTVPITDDPTMPCVTFRTWVLGVTSCVILAFLNQFFGYRQNALYVSSV  1838
             +E ND P+E+VRLTVPITDDPT P +TFRTWVLGV +CVIL+F+NQFFGYR N L +SSV
Sbjct  19    EEENDCPIEQVRLTVPITDDPTEPVLTFRTWVLGVAACVILSFVNQFFGYRSNQLSISSV  78

Query  1837  PAQIVVLPMGKLMAAYLPTKVVQIPGTKWSFSLNPGPFNIKEHVLITIFASSGSDFSYAV  1658
              AQIV LP+GK MAA LP K +++P TKWSFSLNPGPFNIKEHVLIT+FA+SGS   YAV
Sbjct  79    SAQIVTLPLGKFMAATLPEKPIKVPCTKWSFSLNPGPFNIKEHVLITMFANSGSGGVYAV  138

Query  1657  SIITMMKAFYYRDIHPLAAVLLTFSTQMLGYGLAGIFKKFLIDSPYMWWPSNLVQVSLFR  1478
              I+T++KAFY R + P A  LL  +TQ+LGYG AG+F+K+L+DSPYMWWPSNLVQVSLFR
Sbjct  139   GILTIVKAFYKRSLSPGAGYLLVQTTQLLGYGWAGLFRKYLVDSPYMWWPSNLVQVSLFR  198

Query  1477  ALHDVETRPKGGLTRLQFFIIVLVCSFAYYVVPNYLFPSLTALSLLCWIWKNSVTAQQlg  1298
             ALH+ E R KGG+TRLQFF+IV + SFAYY+VPNYLFPS++ +S++C IWKNS+TAQQ+G
Sbjct  199   ALHEKEKRSKGGVTRLQFFLIVFISSFAYYLVPNYLFPSISTVSIICLIWKNSITAQQIG  258

Query  1297  sglkglgigSFALDWATVAAFQGSPLVTPDFAIINMLIGYVLVAYIAIPVWYWTNLFDAK  1118
             SGL G+G+GSF LDWATVA+F GSPL TP FAIIN+L+G+ ++ YI +P+ Y+ N +DAK
Sbjct  259   SGLYGMGLGSFGLDWATVASFLGSPLATPGFAIINILVGFFIIVYILLPLTYYNNAYDAK  318

Query  1117  KFPLFSSNVFDSNGQVYNISRVLNKKTFGFDQPGYDSYSNIYLSTAFVYTYGLSFATLAA  938
             KFP+FSS+ FDS GQ YN++R+L+ KTF  +   Y++YS +YLS  F  TYG+SFATLAA
Sbjct  319   KFPIFSSHTFDSTGQPYNLTRILDPKTFSINLDEYNAYSKLYLSVFFSVTYGISFATLAA  378

Query  937   TVSHVALFHGRTIWE---QTKESVQDKFSDIHTRLMRKNYEPVPQWWFYlllviivgval  767
              VSHVALF+G TIW+   +T+ +  +KF D+HTRLM+KNY+ VPQWWF+L+L++++G++L
Sbjct  379   AVSHVALFNGSTIWQMWSKTRAAAGEKFGDVHTRLMKKNYKIVPQWWFHLILIVVLGLSL  438

Query  766   vACQRFGGQLQLPVWGVLLAVLLSLIFTLPVGVITATTNQQTGLNVIAELIIGYMYPGRP  587
             +AC+ F  QLQLP WG+LL   L+L FTLP+G+ITATTNQQ GLNVI ELIIG+MYPG+P
Sbjct  439   LACEGFDKQLQLPWWGILLCCALALFFTLPIGIITATTNQQPGLNVITELIIGFMYPGKP  498

Query  586   LASVTFKMYGlsslsqslmflSDFKLGHYMKIPPKSMFMVQLVGTLISCCVHFGTGWWLL  407
             LA+V FK YG  S+ Q+L FLSDFKLGHYMKIPP+SMF+VQLVGT+I+  V+FGT WWLL
Sbjct  499   LANVVFKTYGYISMVQALTFLSDFKLGHYMKIPPRSMFLVQLVGTVIASSVYFGTAWWLL  558

Query  406   TTVENICNPSKLPEGSQWTCPGDDVFYNASIIWGVVSPRRMFGNLGIYQATNYFFLVGFL  227
             TTVE+IC+   LPEGS WTCPGDDVFYNAS+IWGV+ P RMFG LG+Y   N+FFL G L
Sbjct  559   TTVEHICDLDLLPEGSPWTCPGDDVFYNASVIWGVIGPLRMFGRLGVYPEMNWFFLAGLL  618

Query  226   APIPVWYLGRKYPEKRWVSLINMPILISGAEGIPIVKSVNYVCWFAVGLYFNLYVYRKHK  47
             AP+PVW+L RK+P ++W+ LI+MPI+I     +P  ++V++V W  VG++FN YVY +++
Sbjct  619   APVPVWFLSRKFPNQKWIRLIHMPIIIGATGNMPPARAVHFVMWGIVGVFFNFYVYNRYR  678

Query  46    GWWARHNYILSAGLD  2
              WWA+H YILSA LD
Sbjct  679   QWWAKHTYILSAALD  693



>gb|EEE68909.1| hypothetical protein OsJ_27765 [Oryza sativa Japonica Group]
Length=702

 Score =   892 bits (2304),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 432/665 (65%), Positives = 542/665 (82%), Gaps = 0/665 (0%)
 Frame = -1

Query  2038  SAVESSADEINDSPVEEVRLTVPITDDPTMPCVTFRTWVLGVTSCVILAFLNQFFGYRQN  1859
             S  E + +E++D P+EEVRLTVPITDDP +P +TFRTW+LG+ SC +LAF NQFFGYRQN
Sbjct  22    SRDEKTEEEVDDCPIEEVRLTVPITDDPALPALTFRTWLLGLISCAMLAFSNQFFGYRQN  81

Query  1858  ALYVSSVPAQIVVLPMGKLMAAYLPTKVVQIPGTKWSFSLNPGPFNIKEHVLITIFASSG  1679
              LY+SS+  QIVVLP+GKLMAA LP KV ++ GT WSFSLNPGPFN+KEHVLITIFA++G
Sbjct  82    PLYISSLSVQIVVLPLGKLMAACLPKKVFRVKGTAWSFSLNPGPFNLKEHVLITIFANTG  141

Query  1678  SDFSYAVSIITMMKAFYYRDIHPLAAVLLTFSTQMLGYGLAGIFKKFLIDSPYMWWPSNL  1499
             S+  YAV IIT++KAFY R+IHPLAA+LLT +TQ++GYG AG+F+KFL+DSPYMWWPSNL
Sbjct  142   SNSVYAVGIITIVKAFYRREIHPLAAMLLTQTTQLMGYGWAGLFRKFLVDSPYMWWPSNL  201

Query  1498  VQVSLFRALHDVETRPKGGLTRLQFFIIVLVCSFAYYVVPNYLFPSLTALSLLCWIWKNS  1319
             VQVSLFRALH+ E RPKGG TRLQFF+ VL+ SFAYY+VPNYLFP+++ +S++C +WK S
Sbjct  202   VQVSLFRALHEKEKRPKGGTTRLQFFLTVLITSFAYYIVPNYLFPTISTISVVCLVWKKS  261

Query  1318  VTAQQlgsglkglgigSFALDWATVAAFQGSPLVTPDFAIINMLIGYVLVAYIAIPVWYW  1139
             VTAQQ+GSG+ GLG+GSF LDWATVA F G+PL TP FAI+N++ G+ L+ Y+ +P  YW
Sbjct  262   VTAQQIGSGVYGLGVGSFGLDWATVAGFLGTPLSTPAFAIVNIMAGFFLIVYVIVPAAYW  321

Query  1138  TNLFDAKKFPLFSSNVFDSNGQVYNISRVLNKKTFGFDQPGYDSYSNIYLSTAFVYTYGL  959
              + + AK+FP+ SS+VF +NG  Y++++VL+  TF F Q GYD+   I LS  F +TYGL
Sbjct  322   ADAYGAKRFPIISSHVFSANGSRYDVNQVLDTATFEFSQAGYDAAGKINLSIFFAFTYGL  381

Query  958   SFATLAATVSHVALFHGRTIWEQTKESVQDKFSDIHTRLMRKNYEPVPQWWFYlllviiv  779
             SFATLAAT+SHVALFHG +IW QTK +   +  D+HTRLM++NY  VPQWWF ++LV ++
Sbjct  382   SFATLAATLSHVALFHGGSIWRQTKAAFNRQGGDVHTRLMKRNYAAVPQWWFQVMLVAVL  441

Query  778   gvalvACQRFGGQLQLPVWGVLLAVLLSLIFTLPVGVITATTNQQTGLNVIAELIIGYMY  599
             G+++  C+ FG QLQLP WGVLLA  L+  FTLP+G+ITATTNQQ GLNVI ELIIGY+Y
Sbjct  442   GLSVFTCEGFGQQLQLPYWGVLLAAGLAFFFTLPIGIITATTNQQPGLNVITELIIGYLY  501

Query  598   PGRPLASVTFKMYGlsslsqslmflSDFKLGHYMKIPPKSMFMVQLVGTLISCCVHFGTG  419
             PGRPLA+V FK YG  S+SQ++MFL DFKLGHYMKIPP+SMF+VQLVGT+++  V+FGT 
Sbjct  502   PGRPLANVAFKTYGYISMSQAIMFLQDFKLGHYMKIPPRSMFIVQLVGTVLASSVYFGTS  561

Query  418   WWLLTTVENICNPSKLPEGSQWTCPGDDVFYNASIIWGVVSPRRMFGNLGIYQATNYFFL  239
             WWLL +V NIC+P+KLPEGS WTCPGDDVF+NASIIWGVV P RMFG LG+Y   NYFFL
Sbjct  562   WWLLESVSNICDPAKLPEGSPWTCPGDDVFFNASIIWGVVGPLRMFGRLGLYAKMNYFFL  621

Query  238   VGFLAPIPVWYLGRKYPEKRWVSLINMPILISGAEGIPIVKSVNYVCWFAVGLYFNLYVY  59
              G LAP+PVW L R +P + W+ L+NMP+L+     +P  +SVNY+ W AVGL FN  VY
Sbjct  622   AGALAPVPVWALSRAFPGRAWIGLVNMPVLLGATGMMPPARSVNYLMWGAVGLAFNYVVY  681

Query  58    RKHKG  44
             R++KG
Sbjct  682   RRYKG  686



>ref|XP_010064977.1| PREDICTED: oligopeptide transporter 1-like [Eucalyptus grandis]
 gb|KCW70463.1| hypothetical protein EUGRSUZ_F03680 [Eucalyptus grandis]
Length=735

 Score =   889 bits (2298),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 433/681 (64%), Positives = 555/681 (81%), Gaps = 3/681 (0%)
 Frame = -1

Query  2035  AVESSADEINDSPVEEVRLTVPITDDPTMPCVTFRTWVLGVTSCVILAFLNQFFGYRQNA  1856
             A  +  DE ND P+EEVRLTV   DDP++P +TFRTWVLGV SCVIL+F+N+FFGYR N 
Sbjct  2     AYRAGIDEDNDCPIEEVRLTVSTADDPSLPSLTFRTWVLGVASCVILSFVNKFFGYRSNQ  61

Query  1855  LYVSSVPAQIVVLPMGKLMAAYLPTKVVQIPGTKWSFSLNPGPFNIKEHVLITIFASSGS  1676
             L VSSV AQIVVLP+G+LMAA LP+K +Q+P T+WSFSLNPGPFN+KEHVLITIFA+SG+
Sbjct  62    LSVSSVSAQIVVLPIGRLMAATLPSKPIQVPFTRWSFSLNPGPFNLKEHVLITIFANSGA  121

Query  1675  DFSYAVSIITMMKAFYYRDIHPLAAVLLTFSTQMLGYGLAGIFKKFLIDSPYMWWPSNLV  1496
                YA+ IIT++KAFY + IH +AA +L  +TQMLGYG AG+F+K+L+DSPYMWWP+NLV
Sbjct  122   GGVYAMHIITIVKAFYRKGIHIVAAFMLAQTTQMLGYGWAGLFRKYLVDSPYMWWPANLV  181

Query  1495  QVSLFRALHDVETRPKGGLTRLQFFIIVLVCSFAYYVVPNYLFPSLTALSLLCWIWKNSV  1316
             QVSLFRALH+ E RPKGG TRLQFFI   + SFAYYV+P Y  PS++A+S +C IW  S+
Sbjct  182   QVSLFRALHENEKRPKGGSTRLQFFITAFIASFAYYVIPAYFIPSISAISFVCLIWTKSI  241

Query  1315  TAQQlgsglkglgigSFALDWATVAAFQGSPLVTPDFAIINMLIGYVLVAYIAIPVWYWT  1136
             TAQQ+GSGL GLG+GSF LDW+TVA+F GSPL  P FAI+N LIG+ L+ Y+A+P+ YW+
Sbjct  242   TAQQIGSGLHGLGLGSFGLDWSTVASFLGSPLAYPAFAIVNTLIGFFLMIYVALPILYWS  301

Query  1135  NLFDAKKFPLFSSNVFDSNGQVYNISRVLNKKTFGFDQPGYDSYSNIYLSTAFVYTYGLS  956
             N ++AK+FP+ +S+ FDS GQ YNI+R+LN KTF  D   Y+ YS +YLS  F +TYGLS
Sbjct  302   NAYEAKRFPILTSHTFDSAGQTYNITRILNAKTFDIDMEAYNGYSKLYLSVMFAFTYGLS  361

Query  955   FATLAATVSHVALFHGRTIWE---QTKESVQDKFSDIHTRLMRKNYEPVPQWWFYlllvi  785
             FATL AT+SHVALF+G++IW+   +T +++Q    D+HTR+M++NYE VPQWWF+++L++
Sbjct  362   FATLTATISHVALFNGKSIWQMWKKTTQTLQGHLGDVHTRIMKENYEAVPQWWFHIILIV  421

Query  784   ivgvalvACQRFGGQLQLPVWGVLLAVLLSLIFTLPVGVITATTNQQTGLNVIAELIIGY  605
             ++G+AL  C+ F  QLQLP WGVLLA  ++  FTLP+G+I ATTN   GLNVI EL+IGY
Sbjct  422   MMGLALWTCEGFDKQLQLPWWGVLLACGMAFFFTLPIGIIAATTNSPPGLNVITELVIGY  481

Query  604   MYPGRPLASVTFKMYGlsslsqslmflSDFKLGHYMKIPPKSMFMVQLVGTLISCCVHFG  425
             MYPG+PLA+V FK YG  S++Q+L FLSDFKLGHYMK+PPKSMF+VQLVGTL++  V+F 
Sbjct  482   MYPGKPLANVAFKTYGYISMTQALSFLSDFKLGHYMKVPPKSMFLVQLVGTLLASSVYFF  541

Query  424   TGWWLLTTVENICNPSKLPEGSQWTCPGDDVFYNASIIWGVVSPRRMFGNLGIYQATNYF  245
             TGWWLLTTVENIC+PS LPEGS WTCPGDDVFYNASIIWGV+ P RMF  LG+Y   N+F
Sbjct  542   TGWWLLTTVENICDPSLLPEGSPWTCPGDDVFYNASIIWGVIGPLRMFTKLGVYPEMNWF  601

Query  244   FLVGFLAPIPVWYLGRKYPEKRWVSLINMPILISGAEGIPIVKSVNYVCWFAVGLYFNLY  65
             FL+GFLAP+PVWYL RK+P ++W+  +NMP+L+   + +P  K V+Y+ W AVG++FN Y
Sbjct  602   FLIGFLAPVPVWYLSRKFPNQKWIPYVNMPVLLGATQMMPPAKPVHYLSWGAVGIFFNFY  661

Query  64    VYRKHKGWWARHNYILSAGLD  2
             +Y++++GWWAR+NY+LSA LD
Sbjct  662   IYKRYRGWWARYNYVLSAALD  682



>ref|XP_008663011.1| PREDICTED: oligopeptide transporter 5-like [Zea mays]
 tpg|DAA47796.1| TPA: hypothetical protein ZEAMMB73_939928 [Zea mays]
Length=759

 Score =   888 bits (2295),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 437/687 (64%), Positives = 551/687 (80%), Gaps = 6/687 (1%)
 Frame = -1

Query  2050  NTGISAVESSADEINDSPVEEVRLTVPITDDPTMPCVTFRTWVLGVTSCVILAFLNQFFG  1871
               G SA     +E++D P+EEVRLTVPITDDP +P +TFRTW LG+ SC +LAF NQFFG
Sbjct  23    TNGGSARTEKEEEVDDCPIEEVRLTVPITDDPALPALTFRTWFLGLLSCALLAFSNQFFG  82

Query  1870  YRQNALYVSSVPAQIVVLPMGKLMAAYLPTKVVQIPGTKWSFSLNPGPFNIKEHVLITIF  1691
             YRQN LY+SS+  QIVVLP+GKLMAA LPTK V++ G   SFSLNPGPFN+KEHVLITIF
Sbjct  83    YRQNPLYISSLSVQIVVLPLGKLMAACLPTKAVRVMGR--SFSLNPGPFNLKEHVLITIF  140

Query  1690  ASSGSDFSYAVSIITMMKAFYYRDIHPLAAVLLTFSTQMLGYGLAGIFKKFLIDSPYMWW  1511
             A++GS+  YAV IIT++KAFY+R+IHPLAA+LLT +TQ++GYG AG+F+KFL+DSPYMWW
Sbjct  141   ANTGSNSVYAVGIITIVKAFYHREIHPLAAMLLTQTTQLMGYGWAGLFRKFLVDSPYMWW  200

Query  1510  PSNLVQVSLFRALHDVETR-PKGGLTRLQFFIIVLVCSFAYYVVPNYLFPSLTALSLLCW  1334
             P+NLVQVSLFRALH+ ETR P+GG TRLQFF+ VL  SFAYY+VPNYLFP+++ +S+ C 
Sbjct  201   PANLVQVSLFRALHERETRRPRGGTTRLQFFLTVLATSFAYYIVPNYLFPTISTVSVACL  260

Query  1333  IWKNSVTAQQlgsglkglgigSFALDWATVAAFQGSPLVTPDFAIINMLIGYVLVAYIAI  1154
             +W+ SVTAQQ+GSG+ GLG+G+F LDWATVA F G+PL TP FAI N++ G+ L+ Y+ +
Sbjct  261   VWRRSVTAQQIGSGVYGLGVGAFGLDWATVAGFLGTPLSTPAFAIANIMAGFFLIVYVIV  320

Query  1153  PVWYWTNLFDAKKFPLFSSNVFDSNGQVYNISRVLNKKTFGFDQPGYDSYSNIYLSTAFV  974
             P  YW++ + A++FP+ SS+VF +NG  Y+++RVL   TF F Q GYD    I+LS  F 
Sbjct  321   PFAYWSDAYGARRFPIISSHVFMANGSRYDVNRVLGAGTFQFSQAGYDGAGQIHLSIFFA  380

Query  973   YTYGLSFATLAATVSHVALFHGRTIWEQTKESVQDKFSDIHTRLMRKNYEPVPQWWFYll  794
             ++YGLSFATLAAT+SHVAL+HGR+IWEQT+ +V+    D+H RLMR+NY  VPQWWF +L
Sbjct  381   FSYGLSFATLAATLSHVALYHGRSIWEQTRATVRAAGGDVHARLMRRNYAAVPQWWFQVL  440

Query  793   lviivgvalvACQRFGGQLQLPVWGVLLAVLLSLIFTLPVGVITATTNQQTGLNVIAELI  614
             L++++G++L  C+ FG QLQLP WGVLLA  L+  FTLP+G+ITATTNQQ GLNV+ ELI
Sbjct  441   LLLVLGLSLFTCEGFGRQLQLPYWGVLLAAGLAFFFTLPIGIITATTNQQPGLNVVTELI  500

Query  613   IGYMYPGRPLASVTFKMYGlsslsqslmflSDFKLGHYMKIPPKSMFMVQLVGTLISCCV  434
             IGY+YPGRPLA+V FK YG  S+SQ++MFL DFKLGHYMKIPP+SMF VQLVGT+++  V
Sbjct  501   IGYLYPGRPLANVAFKTYGYISMSQAIMFLQDFKLGHYMKIPPRSMFAVQLVGTVLASSV  560

Query  433   HFGTGWWLLTTVENICNPSKLPEGSQWTCPGDDVFYNASIIWGVVSPRRMFGNLGIYQAT  254
             +F T WWLL +V  IC+P++LPEGS WTCPGDDVF+NASIIWGVV P RMFG LG+Y   
Sbjct  561   YFATSWWLLESVPGICDPARLPEGSPWTCPGDDVFFNASIIWGVVGPLRMFGRLGLYAKM  620

Query  253   NYFFLVGFLAPIPVWYLGRKYPEKR---WVSLINMPILISGAEGIPIVKSVNYVCWFAVG  83
             NYFFL G LAP+P W L R +P+     W+ L+NMP+L+     +P  +SVNY+ W AVG
Sbjct  621   NYFFLAGALAPVPFWALARAFPDSAWAPWLRLVNMPVLLGATGMMPPARSVNYLMWGAVG  680

Query  82    LYFNLYVYRKHKGWWARHNYILSAGLD  2
             L FN  VYR++K WWARHNY+LSAGLD
Sbjct  681   LAFNYVVYRRYKAWWARHNYVLSAGLD  707



>ref|XP_007162246.1| hypothetical protein PHAVU_001G136300g [Phaseolus vulgaris]
 gb|ESW34240.1| hypothetical protein PHAVU_001G136300g [Phaseolus vulgaris]
Length=779

 Score =   887 bits (2292),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 439/708 (62%), Positives = 553/708 (78%), Gaps = 14/708 (2%)
 Frame = -1

Query  2083  SSLSRLLH*MENTGISAVESSAD-----------EINDSPVEEVRLTVPITDDPTMPCVT  1937
             S  + LL+  + TG S++  S +           E +DSP+E+VRLTVPITDDPT P +T
Sbjct  21    SVTTHLLYLEKETGESSIGVSQERVTEDAEKYELEFDDSPIEQVRLTVPITDDPTQPALT  80

Query  1936  FRTWVLGVTSCVILAFLNQFFGYRQNALYVSSVPAQIVVLPMGKLMAAYLPTKVVQIPGT  1757
             FRTWVLG+ SCV LAF+NQF GYR N L +SSV AQI  LP+GKLMAA LPTK +++P T
Sbjct  81    FRTWVLGLASCVFLAFVNQFLGYRTNPLKISSVSAQIATLPLGKLMAATLPTKPIRVPFT  140

Query  1756  KWSFSLNPGPFNIKEHVLITIFASSGSDFSYAVSIITMMKAFYYRDIHPLAAVLLTFSTQ  1577
             KWSFS+NPGPF +KEHVLITIFA+SGS    AV +IT++KAFY+R IHP+AA LL  STQ
Sbjct  141   KWSFSMNPGPFTLKEHVLITIFATSGSSGVDAVDVITIVKAFYHRSIHPVAAYLLVLSTQ  200

Query  1576  MLGYGLAGIFKKFLIDSPYMWWPSNLVQVSLFRALHDVETRPKGGLTRLQFFIIVLVCSF  1397
             MLGYG AGIF++FL+DSP+MWWP NLVQVSLF+A H+ E RPKGG TR+QFF +V V SF
Sbjct  201   MLGYGWAGIFRRFLVDSPFMWWPENLVQVSLFKAFHEKEKRPKGGYTRMQFFFLVFVASF  260

Query  1396  AYYVVPNYLFPSLTALSLLCWIWKNSVTAQQlgsglkglgigSFALDWATVAAFQGSPLV  1217
             AYY +P YLF +++ +S +C IW +S+TAQQ+GSG+  +GIGSF LDW TVAAF GSPL 
Sbjct  261   AYYTLPGYLFQAISTISFVCLIWNDSITAQQIGSGMNEIGIGSFGLDWNTVAAFLGSPLA  320

Query  1216  TPDFAIINMLIGYVLVAYIAIPVWYWTNLFDAKKFPLFSSNVFDSNGQVYNISRVLNKKT  1037
              P FAIINMLIG++L  Y+ IP+ YW+NL+DAK+FPL SS+ FDS G  YN++RVLN +T
Sbjct  321   VPGFAIINMLIGFMLDIYVLIPLAYWSNLYDAKRFPLISSHTFDSTGVTYNVTRVLNPRT  380

Query  1036  FGFDQPGYDSYSNIYLSTAFVYTYGLSFATLAATVSHVALFHGRTI---WEQTKESVQDK  866
             F  D   Y++YS IYLS  F + YGLSFATL AT+SHV LFHG  I   W +T  + +++
Sbjct  381   FDIDLDSYNNYSKIYLSITFAFEYGLSFATLTATISHVVLFHGDMILQTWRKTTRAPKEQ  440

Query  865   FSDIHTRLMRKNYEPVPQWWFYlllviivgvalvACQRFGGQLQLPVWGVLLAVLLSLIF  686
               D+HTR+M++NYE VP+WWF  +L+++V VALVAC+ FG QLQLP WG+LL++ ++L+F
Sbjct  441   LGDVHTRIMKRNYEQVPEWWFVTILILMVVVALVACECFGKQLQLPWWGILLSLTIALVF  500

Query  685   TLPVGVITATTNQQTGLNVIAELIIGYMYPGRPLASVTFKMYGlsslsqslmflSDFKLG  506
             TLP+G+I ATTN + GLNVI+ELIIGY+YPG+PLA+V FK+YG  S+ Q+L FLSDFKLG
Sbjct  501   TLPIGIIQATTNIKIGLNVISELIIGYIYPGKPLANVAFKVYGHDSMLQALAFLSDFKLG  560

Query  505   HYMKIPPKSMFMVQLVGTLISCCVHFGTGWWLLTTVENICNPSKLPEGSQWTCPGDDVFY  326
             HYMKIPPKSMF+ QLVGT+++  V+F T WWLLT++ENIC+ + LP+GS WTCPGDDVFY
Sbjct  561   HYMKIPPKSMFIAQLVGTVVASSVYFATSWWLLTSIENICDEALLPKGSPWTCPGDDVFY  620

Query  325   NASIIWGVVSPRRMFGNLGIYQATNYFFLVGFLAPIPVWYLGRKYPEKRWVSLINMPILI  146
             NASIIWGVV P+RMF   G+Y   N+FFL+G LAPIPVW L  K+P  +W+ LIN+PI+ 
Sbjct  621   NASIIWGVVGPQRMFAKDGVYPGMNWFFLIGLLAPIPVWLLSCKFPNHKWIQLINIPIIA  680

Query  145   SGAEGIPIVKSVNYVCWFAVGLYFNLYVYRKHKGWWARHNYILSAGLD  2
             +GA  IP  +SVNY+ W  VG++FN YVYRK K WW RH YILSA LD
Sbjct  681   AGACNIPPARSVNYITWGTVGIFFNFYVYRKFKAWWVRHTYILSAALD  728



>ref|XP_010064976.1| PREDICTED: oligopeptide transporter 1-like [Eucalyptus grandis]
Length=735

 Score =   886 bits (2289),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 434/681 (64%), Positives = 559/681 (82%), Gaps = 3/681 (0%)
 Frame = -1

Query  2035  AVESSADEINDSPVEEVRLTVPITDDPTMPCVTFRTWVLGVTSCVILAFLNQFFGYRQNA  1856
             A  +  +E ND P+EEVRLTV  TDDP++P +TFRTWVLG+ SC+ILAF+NQFFGYR N 
Sbjct  2     AYRAGINEDNDCPIEEVRLTVLTTDDPSLPVLTFRTWVLGIVSCIILAFVNQFFGYRSNQ  61

Query  1855  LYVSSVPAQIVVLPMGKLMAAYLPTKVVQIPGTKWSFSLNPGPFNIKEHVLITIFASSGS  1676
             LY+SSV AQIVVLP+GKLMAA LP+K +Q+P TKWSFSLNPGPFN+KEHVLITIFA+SG+
Sbjct  62    LYISSVSAQIVVLPIGKLMAATLPSKPIQVPFTKWSFSLNPGPFNLKEHVLITIFANSGA  121

Query  1675  DFSYAVSIITMMKAFYYRDIHPLAAVLLTFSTQMLGYGLAGIFKKFLIDSPYMWWPSNLV  1496
                YA+SI+T++KAFY+++IH +AA +L  +TQMLGYG AG+F+K+L+DSPYMWWPSNLV
Sbjct  122   GGVYALSIVTIVKAFYHKNIHIMAAFMLAQTTQMLGYGWAGLFRKYLVDSPYMWWPSNLV  181

Query  1495  QVSLFRALHDVETRPKGGLTRLQFFIIVLVCSFAYYVVPNYLFPSLTALSLLCWIWKNSV  1316
             QVSLFRAL++ E RPKGGLTRLQFF++  + SFAYYV+P Y  PS++A S++C IW  SV
Sbjct  182   QVSLFRALNEKERRPKGGLTRLQFFLMAFIASFAYYVIPGYFVPSISAFSVVCLIWTKSV  241

Query  1315  TAQQlgsglkglgigSFALDWATVAAFQGSPLVTPDFAIINMLIGYVLVAYIAIPVWYWT  1136
             TAQQ+GSGL GLG+GSF LDW+TVAAF GSPL  P +AI+N++IG+ L+ Y+ +P+ YW+
Sbjct  242   TAQQIGSGLHGLGLGSFGLDWSTVAAFLGSPLAYPAYAIVNIMIGFFLMVYVVLPISYWS  301

Query  1135  NLFDAKKFPLFSSNVFDSNGQVYNISRVLNKKTFGFDQPGYDSYSNIYLSTAFVYTYGLS  956
             NL++AK+FP+ SSN FDS GQ YNI+R+LN K F  +   Y+ YS +YLS  F +TYGLS
Sbjct  302   NLYEAKRFPIVSSNTFDSTGQTYNITRILNAKAFDINMEAYNGYSKLYLSIMFAFTYGLS  361

Query  955   FATLAATVSHVALFHGRTI---WEQTKESVQDKFSDIHTRLMRKNYEPVPQWWFYlllvi  785
             FATL AT+SHVALFHG++I   W++T E+++  F D+HTR+M++NYE VPQWWF+++L++
Sbjct  362   FATLTATLSHVALFHGKSIWRMWKKTTETLEGNFGDVHTRIMKENYEAVPQWWFHIILIM  421

Query  784   ivgvalvACQRFGGQLQLPVWGVLLAVLLSLIFTLPVGVITATTNQQTGLNVIAELIIGY  605
             +V +++  C+ F  QLQLP WG+LLA  L+L FTLP+G+ITATTN   GLNVI EL+IGY
Sbjct  422   MVALSMWTCEGFNHQLQLPWWGLLLACALALFFTLPIGIITATTNMMPGLNVITELVIGY  481

Query  604   MYPGRPLASVTFKMYGlsslsqslmflSDFKLGHYMKIPPKSMFMVQLVGTLISCCVHFG  425
             +YPG+PLA+V FK YG  S++Q+L FLSDFKLGHYMKIPPKSMF+ QLVGTL++  V+F 
Sbjct  482   LYPGKPLANVAFKTYGYISMTQALSFLSDFKLGHYMKIPPKSMFVAQLVGTLLASSVYFA  541

Query  424   TGWWLLTTVENICNPSKLPEGSQWTCPGDDVFYNASIIWGVVSPRRMFGNLGIYQATNYF  245
             T WWLLTTVE+IC+ S LPEGS WTCPGDDVFYNASIIWGVV P RMF   GIY   N+F
Sbjct  542   TAWWLLTTVEHICDTSLLPEGSPWTCPGDDVFYNASIIWGVVGPLRMFAKYGIYPEINWF  601

Query  244   FLVGFLAPIPVWYLGRKYPEKRWVSLINMPILISGAEGIPIVKSVNYVCWFAVGLYFNLY  65
             FL+GFLAP+PVW+L RK+P ++W+  INMPI+I   + +P  ++V+Y+ W AVG++FN Y
Sbjct  602   FLIGFLAPVPVWFLSRKFPNQKWILSINMPIIIGATQMMPPARAVHYLTWGAVGIFFNFY  661

Query  64    VYRKHKGWWARHNYILSAGLD  2
             +Y++ KGWW R+NY+LSA LD
Sbjct  662   IYKRFKGWWTRYNYVLSAALD  682



>ref|XP_007020440.1| Oligopeptide transporter 5 [Theobroma cacao]
 gb|EOY11965.1| Oligopeptide transporter 5 [Theobroma cacao]
Length=753

 Score =   886 bits (2289),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 433/681 (64%), Positives = 554/681 (81%), Gaps = 3/681 (0%)
 Frame = -1

Query  2035  AVESSADEINDSPVEEVRLTVPITDDPTMPCVTFRTWVLGVTSCVILAFLNQFFGYRQNA  1856
             A     +E++D+P+EEVRLTVPITDDPT   +TFRTWVLG+ SC ILAF+NQFF YRQN 
Sbjct  21    AKNVEEEEVDDNPIEEVRLTVPITDDPTESALTFRTWVLGLISCCILAFVNQFFAYRQNQ  80

Query  1855  LYVSSVPAQIVVLPMGKLMAAYLPTKVVQIPGTKWSFSLNPGPFNIKEHVLITIFASSGS  1676
             L +SS+ AQIVVLP+GKLMAA LP KV+++P TKWSFSLNPGPF +KEH LITIFA+ G+
Sbjct  81    LSISSISAQIVVLPIGKLMAATLPKKVIRVPFTKWSFSLNPGPFTLKEHALITIFANCGA  140

Query  1675  DFSYAVSIITMMKAFYYRDIHPLAAVLLTFSTQMLGYGLAGIFKKFLIDSPYMWWPSNLV  1496
                YAV+IIT++KAFY+R +HP+AA+LL  +TQ+LGYG AG+F+KFL+DSPYMWWP+NLV
Sbjct  141   GGVYAVNIITIVKAFYHRSLHPVAAMLLAQTTQLLGYGWAGLFRKFLVDSPYMWWPANLV  200

Query  1495  QVSLFRALHDVETRPKGGLTRLQFFIIVLVCSFAYYVVPNYLFPSLTALSLLCWIWKNSV  1316
             QVSLFRALH+ E R KGG TRLQFFII+ + SFAYY+VP YLF S++A+S +CWIWK+S+
Sbjct  201   QVSLFRALHEKEKRTKGGHTRLQFFIIIFISSFAYYIVPGYLFQSISAVSFVCWIWKDSI  260

Query  1315  TAQQlgsglkglgigSFALDWATVAAFQGSPLVTPDFAIINMLIGYVLVAYIAIPVWYWT  1136
               QQ+GSGL G GIGSF LDW+TVAAF GSPL TP FAIIN+L G++L  Y+  P+ YW+
Sbjct  261   VVQQIGSGLNGFGIGSFGLDWSTVAAFLGSPLATPLFAIINILFGFILFLYVLTPIAYWS  320

Query  1135  NLFDAKKFPLFSSNVFDSNGQVYNISRVLNKKTFGFDQPGYDSYSNIYLSTAFVYTYGLS  956
             N F A++FPL SS+ FD+ GQ YNI+R+LN+KTF  + P Y++YS +YLS  F + YGLS
Sbjct  321   NSFQARRFPLISSHTFDAAGQTYNITRILNQKTFDINLPEYNNYSKLYLSVTFAFLYGLS  380

Query  955   FATLAATVSHVALFHGRTI---WEQTKESVQDKFSDIHTRLMRKNYEPVPQWWFYlllvi  785
             FATL AT+SHVALF G+TI   W++T  + +D  +D+HTRLM+KNYE VPQWWF+++L+ 
Sbjct  381   FATLMATISHVALFEGKTIWKLWKKTTYAAKDNLTDVHTRLMKKNYEAVPQWWFHIILIS  440

Query  784   ivgvalvACQRFGGQLQLPVWGVLLAVLLSLIFTLPVGVITATTNQQTGLNVIAELIIGY  605
             I+ ++++AC+ FG QLQLP WGVLLA  ++L FTLP+G+I ATTN Q GLNVI EL+IGY
Sbjct  441   IMVLSIIACEGFGKQLQLPWWGVLLACAIALFFTLPIGIIQATTNMQPGLNVITELVIGY  500

Query  604   MYPGRPLASVTFKMYGlsslsqslmflSDFKLGHYMKIPPKSMFMVQLVGTLISCCVHFG  425
             MYPG+PLA+V FK YG  S+ Q+L  + DFKLGHYMKIPPKSMF+VQLVGT+++   +FG
Sbjct  501   MYPGKPLANVAFKTYGYISMVQALNLVGDFKLGHYMKIPPKSMFIVQLVGTVVASSCYFG  560

Query  424   TGWWLLTTVENICNPSKLPEGSQWTCPGDDVFYNASIIWGVVSPRRMFGNLGIYQATNYF  245
             T WWLL+++E+IC+P+ LPEGS WTCPGDDVFYNASIIWGVV P RMF   G Y   N+F
Sbjct  561   TAWWLLSSIEHICDPALLPEGSPWTCPGDDVFYNASIIWGVVGPLRMFSKYGNYPQMNWF  620

Query  244   FLVGFLAPIPVWYLGRKYPEKRWVSLINMPILISGAEGIPIVKSVNYVCWFAVGLYFNLY  65
             FL+G LAP+PVW+L RK+PEK+W+ LI+MP+++   +G+P  K+V+Y+CW  VG++FN Y
Sbjct  621   FLIGLLAPVPVWWLSRKFPEKKWIRLIHMPMILGATQGMPPAKAVHYICWGTVGIFFNWY  680

Query  64    VYRKHKGWWARHNYILSAGLD  2
             VY ++K WW +H YILSA LD
Sbjct  681   VYNRYKRWWGKHTYILSAALD  701



>ref|XP_003617854.1| Oligopeptide transporter OPT family [Medicago truncatula]
Length=831

 Score =   886 bits (2289),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 428/680 (63%), Positives = 545/680 (80%), Gaps = 3/680 (0%)
 Frame = -1

Query  2032  VESSADEINDSPVEEVRLTVPITDDPTMPCVTFRTWVLGVTSCVILAFLNQFFGYRQNAL  1853
             +     E++DSP+E+VRLTV ITDDPT P +TFRTWV+G  SC+ LAF+NQFFG+R N L
Sbjct  23    IADDDTEVDDSPIEQVRLTVSITDDPTQPALTFRTWVIGFVSCIALAFVNQFFGFRTNPL  82

Query  1852  YVSSVPAQIVVLPMGKLMAAYLPTKVVQIPGTKWSFSLNPGPFNIKEHVLITIFASSGSD  1673
              ++SV AQI+ LP+GKLMAA LPT + ++P TKWSF+LNPGPFN+KEH LITIFAS G+ 
Sbjct  83    SITSVSAQIIALPVGKLMAATLPTTIYKVPFTKWSFTLNPGPFNLKEHALITIFASVGAG  142

Query  1672  FSYAVSIITMMKAFYYRDIHPLAAVLLTFSTQMLGYGLAGIFKKFLIDSPYMWWPSNLVQ  1493
               YA+SII ++KAFY+R I+P+AA LL  +TQMLGYG AGIF++FL+DSPYMWWP NLVQ
Sbjct  143   GVYAISIIDIVKAFYHRSINPVAAFLLAITTQMLGYGWAGIFRRFLVDSPYMWWPKNLVQ  202

Query  1492  VSLFRALHDVETRPKGGLTRLQFFIIVLVCSFAYYVVPNYLFPSLTALSLLCWIWKNSVT  1313
             VSLFRA H+ E RPKGG TRLQFF +V V SFAYY++P Y F S++A+S++C IWKNSVT
Sbjct  203   VSLFRAFHEHEKRPKGGNTRLQFFFLVFVASFAYYIIPGYFFQSISAISVVCLIWKNSVT  262

Query  1312  AQQlgsglkglgigSFALDWATVAAFQGSPLVTPDFAIINMLIGYVLVAYIAIPVWYWTN  1133
             AQQ+GSG+ GLG+G+F LDW TVA F  SPL  P FAI+N+L+G+VL  Y+ IP+ YW N
Sbjct  263   AQQIGSGMSGLGVGAFTLDWNTVAGFLESPLAYPGFAIVNILVGFVLFIYVVIPISYWNN  322

Query  1132  LFDAKKFPLFSSNVFDSNGQVYNISRVLNKKTFGFDQPGYDSYSNIYLSTAFVYTYGLSF  953
              ++AKKFPL +S+ FDS G  YNISR+LN+ TF  D   Y++YS +YLS  F + YGLSF
Sbjct  323   FYEAKKFPLITSSTFDSTGTKYNISRILNEATFEIDMDAYNNYSKLYLSILFAFDYGLSF  382

Query  952   ATLAATVSHVALFHGRTI---WEQTKESVQDKFSDIHTRLMRKNYEPVPQWWFYlllvii  782
             A+L ATVSHV LFHG+ I   W +T  +++ +  D+HTR+M++NYE  P+WWF  +LV++
Sbjct  383   ASLTATVSHVFLFHGKMIIQAWRKTTTALKGQAGDVHTRIMKRNYEQAPEWWFMTILVLM  442

Query  781   vgvalvACQRFGGQLQLPVWGVLLAVLLSLIFTLPVGVITATTNQQTGLNVIAELIIGYM  602
             + +AL  C+ F  QLQLP WGVLL++L++L+FTLPVGVI ATTNQQ GLNVI ELIIGY+
Sbjct  443   IILALACCEGFDKQLQLPWWGVLLSLLIALVFTLPVGVIQATTNQQAGLNVITELIIGYL  502

Query  601   YPGRPLASVTFKMYGlsslsqslmflSDFKLGHYMKIPPKSMFMVQLVGTLISCCVHFGT  422
             YPG+PLA+V FK YG  S++Q+L FL DFKLG YMKIPPKSMF+VQLVGTL++  V+FGT
Sbjct  503   YPGKPLANVAFKTYGYISMAQALSFLQDFKLGLYMKIPPKSMFIVQLVGTLVASSVYFGT  562

Query  421   GWWLLTTVENICNPSKLPEGSQWTCPGDDVFYNASIIWGVVSPRRMFGNLGIYQATNYFF  242
              WWLLTT+ +IC+ S LP+GS WTCPGD+VFYNASIIWG+V P+RMF   GIY   N+FF
Sbjct  563   AWWLLTTIPHICDKSMLPDGSPWTCPGDEVFYNASIIWGIVGPKRMFTKDGIYPGLNWFF  622

Query  241   LVGFLAPIPVWYLGRKYPEKRWVSLINMPILISGAEGIPIVKSVNYVCWFAVGLYFNLYV  62
             L+G LAP+PVW L RKYP ++W+ L+NMPI+I+GA+GIP  +S++Y+ W  VG++FN+YV
Sbjct  623   LIGLLAPVPVWLLARKYPNRKWIELVNMPIIIAGAKGIPPARSISYISWGVVGIFFNIYV  682

Query  61    YRKHKGWWARHNYILSAGLD  2
             Y+K K WWARH YILSA LD
Sbjct  683   YKKFKVWWARHTYILSAALD  702



>gb|AET00813.2| oligopeptide transporter OPT family protein [Medicago truncatula]
Length=754

 Score =   885 bits (2286),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 428/680 (63%), Positives = 545/680 (80%), Gaps = 3/680 (0%)
 Frame = -1

Query  2032  VESSADEINDSPVEEVRLTVPITDDPTMPCVTFRTWVLGVTSCVILAFLNQFFGYRQNAL  1853
             +     E++DSP+E+VRLTV ITDDPT P +TFRTWV+G  SC+ LAF+NQFFG+R N L
Sbjct  23    IADDDTEVDDSPIEQVRLTVSITDDPTQPALTFRTWVIGFVSCIALAFVNQFFGFRTNPL  82

Query  1852  YVSSVPAQIVVLPMGKLMAAYLPTKVVQIPGTKWSFSLNPGPFNIKEHVLITIFASSGSD  1673
              ++SV AQI+ LP+GKLMAA LPT + ++P TKWSF+LNPGPFN+KEH LITIFAS G+ 
Sbjct  83    SITSVSAQIIALPVGKLMAATLPTTIYKVPFTKWSFTLNPGPFNLKEHALITIFASVGAG  142

Query  1672  FSYAVSIITMMKAFYYRDIHPLAAVLLTFSTQMLGYGLAGIFKKFLIDSPYMWWPSNLVQ  1493
               YA+SII ++KAFY+R I+P+AA LL  +TQMLGYG AGIF++FL+DSPYMWWP NLVQ
Sbjct  143   GVYAISIIDIVKAFYHRSINPVAAFLLAITTQMLGYGWAGIFRRFLVDSPYMWWPKNLVQ  202

Query  1492  VSLFRALHDVETRPKGGLTRLQFFIIVLVCSFAYYVVPNYLFPSLTALSLLCWIWKNSVT  1313
             VSLFRA H+ E RPKGG TRLQFF +V V SFAYY++P Y F S++A+S++C IWKNSVT
Sbjct  203   VSLFRAFHEHEKRPKGGNTRLQFFFLVFVASFAYYIIPGYFFQSISAISVVCLIWKNSVT  262

Query  1312  AQQlgsglkglgigSFALDWATVAAFQGSPLVTPDFAIINMLIGYVLVAYIAIPVWYWTN  1133
             AQQ+GSG+ GLG+G+F LDW TVA F  SPL  P FAI+N+L+G+VL  Y+ IP+ YW N
Sbjct  263   AQQIGSGMSGLGVGAFTLDWNTVAGFLESPLAYPGFAIVNILVGFVLFIYVVIPISYWNN  322

Query  1132  LFDAKKFPLFSSNVFDSNGQVYNISRVLNKKTFGFDQPGYDSYSNIYLSTAFVYTYGLSF  953
              ++AKKFPL +S+ FDS G  YNISR+LN+ TF  D   Y++YS +YLS  F + YGLSF
Sbjct  323   FYEAKKFPLITSSTFDSTGTKYNISRILNEATFEIDMDAYNNYSKLYLSILFAFDYGLSF  382

Query  952   ATLAATVSHVALFHGRTI---WEQTKESVQDKFSDIHTRLMRKNYEPVPQWWFYlllvii  782
             A+L ATVSHV LFHG+ I   W +T  +++ +  D+HTR+M++NYE  P+WWF  +LV++
Sbjct  383   ASLTATVSHVFLFHGKMIIQAWRKTTTALKGQAGDVHTRIMKRNYEQAPEWWFMTILVLM  442

Query  781   vgvalvACQRFGGQLQLPVWGVLLAVLLSLIFTLPVGVITATTNQQTGLNVIAELIIGYM  602
             + +AL  C+ F  QLQLP WGVLL++L++L+FTLPVGVI ATTNQQ GLNVI ELIIGY+
Sbjct  443   IILALACCEGFDKQLQLPWWGVLLSLLIALVFTLPVGVIQATTNQQAGLNVITELIIGYL  502

Query  601   YPGRPLASVTFKMYGlsslsqslmflSDFKLGHYMKIPPKSMFMVQLVGTLISCCVHFGT  422
             YPG+PLA+V FK YG  S++Q+L FL DFKLG YMKIPPKSMF+VQLVGTL++  V+FGT
Sbjct  503   YPGKPLANVAFKTYGYISMAQALSFLQDFKLGLYMKIPPKSMFIVQLVGTLVASSVYFGT  562

Query  421   GWWLLTTVENICNPSKLPEGSQWTCPGDDVFYNASIIWGVVSPRRMFGNLGIYQATNYFF  242
              WWLLTT+ +IC+ S LP+GS WTCPGD+VFYNASIIWG+V P+RMF   GIY   N+FF
Sbjct  563   AWWLLTTIPHICDKSMLPDGSPWTCPGDEVFYNASIIWGIVGPKRMFTKDGIYPGLNWFF  622

Query  241   LVGFLAPIPVWYLGRKYPEKRWVSLINMPILISGAEGIPIVKSVNYVCWFAVGLYFNLYV  62
             L+G LAP+PVW L RKYP ++W+ L+NMPI+I+GA+GIP  +S++Y+ W  VG++FN+YV
Sbjct  623   LIGLLAPVPVWLLARKYPNRKWIELVNMPIIIAGAKGIPPARSISYISWGVVGIFFNIYV  682

Query  61    YRKHKGWWARHNYILSAGLD  2
             Y+K K WWARH YILSA LD
Sbjct  683   YKKFKVWWARHTYILSAALD  702



>gb|KCW76552.1| hypothetical protein EUGRSUZ_D00942 [Eucalyptus grandis]
Length=707

 Score =   884 bits (2285),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 451/676 (67%), Positives = 535/676 (79%), Gaps = 49/676 (7%)
 Frame = -1

Query  2029  ESSADEINDSPVEEVRLTVPITDDPTMPCVTFRTWVLGVTSCVILAFLNQFFGYRQNALY  1850
             E SADEINDSP+EEVRLTV I DDPT+PC+TFRTW LG+T+C ILAFLNQFFG+RQN+L 
Sbjct  28    ELSADEINDSPIEEVRLTVSIKDDPTLPCLTFRTWFLGITTCAILAFLNQFFGFRQNSLS  87

Query  1849  VSSVPAQIVVLPMGKLMAAYLPTKVVQIPGTKWSFSLNPGPFNIKEHVLITIFASSGSDF  1670
             ++SV AQIVVLP+GK MAA LP +V+++PGTKWS SLNPGPFN+KEHVLITIFA++GS  
Sbjct  88    LTSVSAQIVVLPLGKFMAAVLPQEVIRVPGTKWSSSLNPGPFNLKEHVLITIFANAGSRG  147

Query  1669  SYAVSIITMMKAFYYRDIHPLAAVLLTFSTQMLGYGLAGIFKKFLIDSPYMWWPSNLVQV  1490
              YA++IIT++ AFY+R IHPLAA+LL  STQML YG AGIF+KFL+DSPYMWWP+NLVQV
Sbjct  148   VYAINIITIVIAFYHRHIHPLAAMLLALSTQMLRYGWAGIFRKFLVDSPYMWWPANLVQV  207

Query  1489  SLFRALHDVETRPKGGLTRLQFFIIVLVCSFAYYVVPNYLFPSLTALSLLCWIWKNSVTA  1310
             SLFRALH+ E RPK GLTRLQFF++VL+ SFAYYVVPNYLFPS+TALS +CWIWK+SVTA
Sbjct  208   SLFRALHEEEVRPKRGLTRLQFFLVVLISSFAYYVVPNYLFPSITALSFVCWIWKHSVTA  267

Query  1309  QQlgsglkglgigSFALDWATVAAFQGSPLVTPDFAIINMLIGYVLVAYIAIPVWYWTNL  1130
             QQ+GSG +GLGIGSFALDWATVAA+ GSPL  P FAIIN+ IG+ L  Y+ IP+ Y TN 
Sbjct  268   QQIGSGRRGLGIGSFALDWATVAAWNGSPLAYPGFAIINISIGFFLTLYVLIPIAYQTNA  327

Query  1129  FDAKKFPLFSSNVFDSNGQVYNISRVLNKKTFGFDQPGYDSYSNIYLSTAFVYTYGLSFA  950
             F+AK+FPL SS VFD+NG  YN+  VLN+  F F+Q GYD YS + LS  F + YGLSFA
Sbjct  328   FEAKRFPLISSPVFDANGNKYNVGLVLNETNFQFNQHGYDDYSKVRLSIFFAFVYGLSFA  387

Query  949   TLAATVSHVALFHGRTIWEQTKESVQDKFSDIHTRLMRKNYEPVPQWWFYlllviivgva  770
             TLAAT+SHVALFHGRTIW+QT+ + QDKF D+HTRLM+KNY+ VPQWWFY L++I+  +A
Sbjct  388   TLAATISHVALFHGRTIWQQTRTTFQDKFDDVHTRLMKKNYDAVPQWWFYSLMLIMTVLA  447

Query  769   lvACQRFGGQLQLPVWGVLLAVLLSLIFTLPVGVITATTNQQTGLNVIAELIIGYMYPGR  590
             +VAC+ FG QLQLP WGVLLA+ L++ F LP+GVITATTNQQ GLNVI ELIIG+MYPGR
Sbjct  448   MVACEGFGRQLQLPYWGVLLALGLAVFFLLPIGVITATTNQQPGLNVITELIIGFMYPGR  507

Query  589   PLASVTFKMYGlsslsqslmflSDFKLGHYMKIPPKSMFMVQLVGTLISCCVHFGTGWWL  410
             PLA+V FK YG  S+ Q++ FLSDFKLGHYMKIPPKSMF+VQLVGT+++  V+FGT WWL
Sbjct  508   PLANVAFKTYGYISMVQAITFLSDFKLGHYMKIPPKSMFIVQLVGTVVASSVYFGTAWWL  567

Query  409   LTTVENICNPSKLPEGSQWTCPGDDVFYNASIIWGVVSPRRMFGNLGIYQATNYFFLVGF  230
             L +V+NIC+PSKLPEGS WTCPG DVFY ASIIWGVV P RMFG LG+Y   NYFFL G 
Sbjct  568   LASVDNICDPSKLPEGSPWTCPGYDVFYYASIIWGVVGPLRMFGRLGVYARMNYFFLFG-  626

Query  229   LAPIPVWYLGRKYPEKRWVSLINMPILISGAEGIPIVKSVNYVCWFAVGLYFNLYVYRKH  50
                                                             G+ FN+YV+R++
Sbjct  627   ------------------------------------------------GVLFNIYVFRRY  638

Query  49    KGWWARHNYILSAGLD  2
             K WWARHNYILSAGLD
Sbjct  639   KSWWARHNYILSAGLD  654



>gb|EYU27647.1| hypothetical protein MIMGU_mgv1a002615mg [Erythranthe guttata]
Length=653

 Score =   884 bits (2285),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 433/600 (72%), Positives = 519/600 (87%), Gaps = 0/600 (0%)
 Frame = -1

Query  1801  MAAYLPTKVVQIPGTKWSFSLNPGPFNIKEHVLITIFASSGSDFSYAVSIITMMKAFYYR  1622
             MAA LPTK ++ PGTKWSFSLNPGPFN+KEH LITIFA++GS   YAV+I+T++KAFY+R
Sbjct  1     MAASLPTKQIKFPGTKWSFSLNPGPFNLKEHCLITIFANAGSTSVYAVNIVTIIKAFYHR  60

Query  1621  DIHPLAAVLLTFSTQMLGYGLAGIFKKFLIDSPYMWWPSNLVQVSLFRALHDVETRPKGG  1442
              ++P+ A+LLT STQMLGYG AGIF+KFL+DSPYMWWPSNLVQVSLFRALH+ ETR KGG
Sbjct  61    KLNPVPAMLLTLSTQMLGYGWAGIFRKFLVDSPYMWWPSNLVQVSLFRALHENETRRKGG  120

Query  1441  LTRLQFFIIVLVCSFAYYVVPNYLFPSLTALSLLCWIWKNSVTAQQlgsglkglgigSFA  1262
             LTRLQFFI+VL+ SF+YY+VPNYLFPS+TALS +CWIW++SVTAQQLG+G+ GLGIGSFA
Sbjct  121   LTRLQFFIVVLISSFSYYIVPNYLFPSITALSFVCWIWRDSVTAQQLGAGVHGLGIGSFA  180

Query  1261  LDWATVAAFQGSPLVTPDFAIINMLIGYVLVAYIAIPVWYWTNLFDAKKFPLFSSNVFDS  1082
              DW+TVA F GSPL TP FAI+NML+G++LV Y+  P+ YW N +DA+KFP+FSS+VFD+
Sbjct  181   FDWSTVAGFLGSPLATPGFAIVNMLVGFILVLYVVTPIAYWNNFYDARKFPIFSSHVFDA  240

Query  1081  NGQVYNISRVLNKKTFGFDQPGYDSYSNIYLSTAFVYTYGLSFATLAATVSHVALFHGRT  902
             +G  YNIS +LN+K F F++  YD+YS + LS  FV  YGLSFATLAATVSHVALFHGRT
Sbjct  241   SGAPYNISAILNEKAFDFNREAYDNYSKVNLSIIFVLVYGLSFATLAATVSHVALFHGRT  300

Query  901   IWEQTKESVQDKFSDIHTRLMRKNYEPVPQWWFYlllviivgvalvACQRFGGQLQLPVW  722
             I +Q K S QDKF D+HTRLMRKNYEPVPQWWF+ +L+ ++ V+L AC+ FG QLQLP W
Sbjct  301   ICKQMKASFQDKFGDVHTRLMRKNYEPVPQWWFHSILIFVIAVSLFACEGFGRQLQLPYW  360

Query  721   GVLLAVLLSLIFTLPVGVITATTNQQTGLNVIAELIIGYMYPGRPLASVTFKMYGlssls  542
             GVLLA+ L+ IFTLPVGVITATTNQQ GLNVI+E+IIGYMYPG+PLA++ FK YG  S+S
Sbjct  361   GVLLAMALAFIFTLPVGVITATTNQQAGLNVISEMIIGYMYPGKPLANIVFKTYGTISMS  420

Query  541   qslmflSDFKLGHYMKIPPKSMFMVQLVGTLISCCVHFGTGWWLLTTVENICNPSKLPEG  362
             Q++ FLSDFKLGHYMKIPPKSMF+VQ+VGT++S  V+FGT WWLLT++E ICNP+KLP G
Sbjct  421   QAITFLSDFKLGHYMKIPPKSMFLVQVVGTVVSSLVYFGTAWWLLTSIEYICNPAKLPAG  480

Query  361   SQWTCPGDDVFYNASIIWGVVSPRRMFGNLGIYQATNYFFLVGFLAPIPVWYLGRKYPEK  182
             S WTCPGDDVFYNASIIWGVV P RMFG LG+Y   NYFFL G LAP+PVWY  RKYPEK
Sbjct  481   SPWTCPGDDVFYNASIIWGVVGPLRMFGKLGLYPGMNYFFLFGLLAPVPVWYFSRKYPEK  540

Query  181   RWVSLINMPILISGAEGIPIVKSVNYVCWFAVGLYFNLYVYRKHKGWWARHNYILSAGLD  2
             +W+ +IN PILISGA G+P+ KSVNY+CWF+VGL+FNLYVY++ KGWWARHNY+LSAGLD
Sbjct  541   KWIRMINAPILISGAGGLPLAKSVNYMCWFSVGLFFNLYVYKRFKGWWARHNYLLSAGLD  600



>gb|KCW70462.1| hypothetical protein EUGRSUZ_F03679, partial [Eucalyptus grandis]
Length=729

 Score =   884 bits (2284),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 433/675 (64%), Positives = 557/675 (83%), Gaps = 3/675 (0%)
 Frame = -1

Query  2017  DEINDSPVEEVRLTVPITDDPTMPCVTFRTWVLGVTSCVILAFLNQFFGYRQNALYVSSV  1838
             +E ND P+EEVRLTV  TDDP++P +TFRTWVLG+ SC+ILAF+NQFFGYR N LY+SSV
Sbjct  2     NEDNDCPIEEVRLTVLTTDDPSLPVLTFRTWVLGIVSCIILAFVNQFFGYRSNQLYISSV  61

Query  1837  PAQIVVLPMGKLMAAYLPTKVVQIPGTKWSFSLNPGPFNIKEHVLITIFASSGSDFSYAV  1658
              AQIVVLP+GKLMAA LP+K +Q+P TKWSFSLNPGPFN+KEHVLITIFA+SG+   YA+
Sbjct  62    SAQIVVLPIGKLMAATLPSKPIQVPFTKWSFSLNPGPFNLKEHVLITIFANSGAGGVYAL  121

Query  1657  SIITMMKAFYYRDIHPLAAVLLTFSTQMLGYGLAGIFKKFLIDSPYMWWPSNLVQVSLFR  1478
             SI+T++KAFY+++IH +AA +L  +TQMLGYG AG+F+K+L+DSPYMWWPSNLVQVSLFR
Sbjct  122   SIVTIVKAFYHKNIHIMAAFMLAQTTQMLGYGWAGLFRKYLVDSPYMWWPSNLVQVSLFR  181

Query  1477  ALHDVETRPKGGLTRLQFFIIVLVCSFAYYVVPNYLFPSLTALSLLCWIWKNSVTAQQlg  1298
             AL++ E RPKGGLTRLQFF++  + SFAYYV+P Y  PS++A S++C IW  SVTAQQ+G
Sbjct  182   ALNEKERRPKGGLTRLQFFLMAFIASFAYYVIPGYFVPSISAFSVVCLIWTKSVTAQQIG  241

Query  1297  sglkglgigSFALDWATVAAFQGSPLVTPDFAIINMLIGYVLVAYIAIPVWYWTNLFDAK  1118
             SGL GLG+GSF LDW+TVAAF GSPL  P +AI+N++IG+ L+ Y+ +P+ YW+NL++AK
Sbjct  242   SGLHGLGLGSFGLDWSTVAAFLGSPLAYPAYAIVNIMIGFFLMVYVVLPISYWSNLYEAK  301

Query  1117  KFPLFSSNVFDSNGQVYNISRVLNKKTFGFDQPGYDSYSNIYLSTAFVYTYGLSFATLAA  938
             +FP+ SSN FDS GQ YNI+R+LN K F  +   Y+ YS +YLS  F +TYGLSFATL A
Sbjct  302   RFPIVSSNTFDSTGQTYNITRILNAKAFDINMEAYNGYSKLYLSIMFAFTYGLSFATLTA  361

Query  937   TVSHVALFHGRTI---WEQTKESVQDKFSDIHTRLMRKNYEPVPQWWFYlllviivgval  767
             T+SHVALFHG++I   W++T E+++  F D+HTR+M++NYE VPQWWF+++L+++V +++
Sbjct  362   TLSHVALFHGKSIWRMWKKTTETLEGNFGDVHTRIMKENYEAVPQWWFHIILIMMVALSM  421

Query  766   vACQRFGGQLQLPVWGVLLAVLLSLIFTLPVGVITATTNQQTGLNVIAELIIGYMYPGRP  587
               C+ F  QLQLP WG+LLA  L+L FTLP+G+ITATTN   GLNVI EL+IGY+YPG+P
Sbjct  422   WTCEGFNHQLQLPWWGLLLACALALFFTLPIGIITATTNMMPGLNVITELVIGYLYPGKP  481

Query  586   LASVTFKMYGlsslsqslmflSDFKLGHYMKIPPKSMFMVQLVGTLISCCVHFGTGWWLL  407
             LA+V FK YG  S++Q+L FLSDFKLGHYMKIPPKSMF+ QLVGTL++  V+F T WWLL
Sbjct  482   LANVAFKTYGYISMTQALSFLSDFKLGHYMKIPPKSMFVAQLVGTLLASSVYFATAWWLL  541

Query  406   TTVENICNPSKLPEGSQWTCPGDDVFYNASIIWGVVSPRRMFGNLGIYQATNYFFLVGFL  227
             TTVE+IC+ S LPEGS WTCPGDDVFYNASIIWGVV P RMF   GIY   N+FFL+GFL
Sbjct  542   TTVEHICDTSLLPEGSPWTCPGDDVFYNASIIWGVVGPLRMFAKYGIYPEINWFFLIGFL  601

Query  226   APIPVWYLGRKYPEKRWVSLINMPILISGAEGIPIVKSVNYVCWFAVGLYFNLYVYRKHK  47
             AP+PVW+L RK+P ++W+  INMPI+I   + +P  ++V+Y+ W AVG++FN Y+Y++ K
Sbjct  602   APVPVWFLSRKFPNQKWILSINMPIIIGATQMMPPARAVHYLTWGAVGIFFNFYIYKRFK  661

Query  46    GWWARHNYILSAGLD  2
             GWW R+NY+LSA LD
Sbjct  662   GWWTRYNYVLSAALD  676



>emb|CBI39770.3| unnamed protein product [Vitis vinifera]
Length=749

 Score =   884 bits (2284),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 438/679 (65%), Positives = 555/679 (82%), Gaps = 7/679 (1%)
 Frame = -1

Query  2017  DEINDSPVEEVRLTVPITDDPTMPCVTFRTWVLGVTSCVILAFLNQFFGYRQNALYVSSV  1838
             +E ND P+E+VRLTVPITDDPT P +TFRTWVLGV +CVIL+F+NQFFGYR N L +SSV
Sbjct  19    EEENDCPIEQVRLTVPITDDPTEPVLTFRTWVLGVAACVILSFVNQFFGYRSNQLSISSV  78

Query  1837  PAQIVVLPMGKLMAAYLPTKVVQIPGTKWSFSLNPGPFNIKEHVLITIFASSGSDFSYAV  1658
              AQIV LP+GK MAA LP K +++P TKWSFSLNPGPFNIKEHVLIT+FA+SGS   YAV
Sbjct  79    SAQIVTLPLGKFMAATLPEKPIKVPCTKWSFSLNPGPFNIKEHVLITMFANSGSGGVYAV  138

Query  1657  SIITMMKAFYYRDIHPLAAVLLTFSTQMLGYGLAGIFKKFLIDSPYMWWPSNLVQVSLFR  1478
              I+T++KAFY R + P A  LL  +TQ+LGYG AG+F+K+L+DSPYMWWPSNLVQVSLFR
Sbjct  139   GILTIVKAFYKRSLSPGAGYLLVQTTQLLGYGWAGLFRKYLVDSPYMWWPSNLVQVSLFR  198

Query  1477  ALHDVETRPKGGLTRLQFFIIVLVCSFAYYVVPNYLFPSLTALSLLCWIWKNSVTAQQlg  1298
             ALH+ E R KGG+TRLQFF+IV + SFAYY+VPNYLFPS++ +S++C IWKNS+TAQQ+G
Sbjct  199   ALHEKEKRSKGGVTRLQFFLIVFISSFAYYLVPNYLFPSISTVSIICLIWKNSITAQQIG  258

Query  1297  sglkglgigSFALDWATVAAFQGSPLVTPDFAIINMLIGYVLVAYIAIPVWYWTNLFDAK  1118
             SGL G+G+GSF LDWATVA+F GSPL TP FAIIN+L+G+ ++ YI +P+ Y+ N +DAK
Sbjct  259   SGLYGMGLGSFGLDWATVASFLGSPLATPGFAIINILVGFFIIVYILLPLTYYNNAYDAK  318

Query  1117  KFPLFSSNVFDSNGQVYNISRVLNKKTFGFDQPGYDSYSNIYLSTAFVYTYGLSFATLAA  938
             KFP+FSS+ FDS GQ YN++R+L+ KTF  +   Y++YS +YLS  F  TYG+SFATLAA
Sbjct  319   KFPIFSSHTFDSTGQPYNLTRILDPKTFSINLDEYNAYSKLYLSVFFSVTYGISFATLAA  378

Query  937   TVSHVALFHGRTIWE---QTKESVQDKFSDIHTRLMRKNYEPVPQWWFYlllviivgval  767
              VSHVALF+G TIW+   +T+ +  +KF D+HTRLM+KNY+ VPQWWF+L+L++++G++L
Sbjct  379   AVSHVALFNGSTIWQMWSKTRAAAGEKFGDVHTRLMKKNYKIVPQWWFHLILIVVLGLSL  438

Query  766   vACQRFGGQLQLPVWGVLLAVLLSLIFTLPVGVITATTNQQ----TGLNVIAELIIGYMY  599
             +AC+ F  QLQLP WG+LL   L+L FTLP+G+ITATTNQ      GLNVI ELIIG+MY
Sbjct  439   LACEGFDKQLQLPWWGILLCCALALFFTLPIGIITATTNQAWLFYMGLNVITELIIGFMY  498

Query  598   PGRPLASVTFKMYGlsslsqslmflSDFKLGHYMKIPPKSMFMVQLVGTLISCCVHFGTG  419
             PG+PLA+V FK YG  S+ Q+L FLSDFKLGHYMKIPP+SMF+VQLVGT+I+  V+FGT 
Sbjct  499   PGKPLANVVFKTYGYISMVQALTFLSDFKLGHYMKIPPRSMFLVQLVGTVIASSVYFGTA  558

Query  418   WWLLTTVENICNPSKLPEGSQWTCPGDDVFYNASIIWGVVSPRRMFGNLGIYQATNYFFL  239
             WWLLTTVE+IC+   LPEGS WTCPGDDVFYNAS+IWGV+ P RMFG LG+Y   N+FFL
Sbjct  559   WWLLTTVEHICDLDLLPEGSPWTCPGDDVFYNASVIWGVIGPLRMFGRLGVYPEMNWFFL  618

Query  238   VGFLAPIPVWYLGRKYPEKRWVSLINMPILISGAEGIPIVKSVNYVCWFAVGLYFNLYVY  59
              G LAP+PVW+L RK+P ++W+ LI+MPI+I     +P  ++V++V W  VG++FN YVY
Sbjct  619   AGLLAPVPVWFLSRKFPNQKWIRLIHMPIIIGATGNMPPARAVHFVMWGIVGVFFNFYVY  678

Query  58    RKHKGWWARHNYILSAGLD  2
              +++ WWA+H YILSA LD
Sbjct  679   NRYRQWWAKHTYILSAALD  697



>ref|XP_003617856.1| Oligopeptide transporter OPT family [Medicago truncatula]
Length=754

 Score =   883 bits (2282),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 429/681 (63%), Positives = 541/681 (79%), Gaps = 3/681 (0%)
 Frame = -1

Query  2035  AVESSADEINDSPVEEVRLTVPITDDPTMPCVTFRTWVLGVTSCVILAFLNQFFGYRQNA  1856
             A+     E++DSP+E+VRLTV  TDDPT P +TFRTW++G+  C++LAF+NQFFGYR N 
Sbjct  22    AIADDDTEVDDSPIEQVRLTVSTTDDPTQPALTFRTWIIGLACCIVLAFVNQFFGYRTNP  81

Query  1855  LYVSSVPAQIVVLPMGKLMAAYLPTKVVQIPGTKWSFSLNPGPFNIKEHVLITIFASSGS  1676
             L +++V AQIV LP+GKLMAA LPT + ++P TKWSF+LNPGPFN+KEH LITIFAS+G+
Sbjct  82    LTITAVSAQIVSLPIGKLMAATLPTTIYKVPFTKWSFTLNPGPFNLKEHALITIFASAGA  141

Query  1675  DFSYAVSIITMMKAFYYRDIHPLAAVLLTFSTQMLGYGLAGIFKKFLIDSPYMWWPSNLV  1496
                YA+ I+ ++KAFY+R I+P+AA LL  +TQMLGYG AGIF++FL+DSPYMWWPSNLV
Sbjct  142   GGVYAIYIVDVVKAFYHRSINPIAAFLLAITTQMLGYGWAGIFRRFLVDSPYMWWPSNLV  201

Query  1495  QVSLFRALHDVETRPKGGLTRLQFFIIVLVCSFAYYVVPNYLFPSLTALSLLCWIWKNSV  1316
             QVSLFRA H+ E RPKGG TRLQFF ++ V SFAYY++P Y F + + +S++C IWKNS+
Sbjct  202   QVSLFRAFHEPEKRPKGGNTRLQFFFMIFVASFAYYIIPGYFFQAASCISVVCLIWKNSI  261

Query  1315  TAQQlgsglkglgigSFALDWATVAAFQGSPLVTPDFAIINMLIGYVLVAYIAIPVWYWT  1136
             TAQQ+GSG+ GLGIG+FALDW TV +F  SPL  P FAIIN+L+G+VL  Y+ IP+ YW 
Sbjct  262   TAQQIGSGMNGLGIGAFALDWNTVVSFLYSPLAYPGFAIINVLVGFVLFIYVVIPISYWN  321

Query  1135  NLFDAKKFPLFSSNVFDSNGQVYNISRVLNKKTFGFDQPGYDSYSNIYLSTAFVYTYGLS  956
             N ++AKKFP  +SN FDS G  YNISR+LN+ TF  D   Y++YS +YLS  F + YGLS
Sbjct  322   NFYEAKKFPFITSNTFDSTGTKYNISRILNEATFEIDMDAYNNYSKLYLSIIFAFDYGLS  381

Query  955   FATLAATVSHVALFHGRTI---WEQTKESVQDKFSDIHTRLMRKNYEPVPQWWFYlllvi  785
             FA+L ATVSHV LFHG+TI   W +T  +++ +  D+HTRLM++NYE VP+WWF  +LV+
Sbjct  382   FASLTATVSHVFLFHGKTIIQSWRKTTTALKKQAGDVHTRLMKRNYEQVPEWWFMTILVL  441

Query  784   ivgvalvACQRFGGQLQLPVWGVLLAVLLSLIFTLPVGVITATTNQQTGLNVIAELIIGY  605
             +V +AL  C+ F  QLQLP WGVLL++ ++L+FTLPVGVI ATTNQQ GLNVI ELIIGY
Sbjct  442   MVILALACCEGFDKQLQLPWWGVLLSLSIALVFTLPVGVIQATTNQQAGLNVITELIIGY  501

Query  604   MYPGRPLASVTFKMYGlsslsqslmflSDFKLGHYMKIPPKSMFMVQLVGTLISCCVHFG  425
             +YPG+PLA+V FK YG  S+SQ+L FL DFKLGHYMKIPPKSMF+VQLVGTL+S  V F 
Sbjct  502   LYPGKPLANVAFKTYGYMSMSQALSFLQDFKLGHYMKIPPKSMFIVQLVGTLVSSSVCFS  561

Query  424   TGWWLLTTVENICNPSKLPEGSQWTCPGDDVFYNASIIWGVVSPRRMFGNLGIYQATNYF  245
             T WWLLTT+ +IC+ S LP+GS WTCPGD+VFYNASIIWG+V P+RMF   GIY   N+F
Sbjct  562   TAWWLLTTIPHICDKSMLPDGSPWTCPGDEVFYNASIIWGIVGPKRMFTKDGIYPGMNWF  621

Query  244   FLVGFLAPIPVWYLGRKYPEKRWVSLINMPILISGAEGIPIVKSVNYVCWFAVGLYFNLY  65
             FL+G LAP+PVW+L RKYP  +W+ LINMP++I GA GIP  +S+NY+ W  VG++FN Y
Sbjct  622   FLIGLLAPVPVWFLARKYPNHKWIELINMPLIIGGASGIPPARSINYISWGVVGIFFNFY  681

Query  64    VYRKHKGWWARHNYILSAGLD  2
             VY+  K WWARH YILSA LD
Sbjct  682   VYKNFKAWWARHTYILSAALD  702



>ref|XP_003572326.1| PREDICTED: oligopeptide transporter 5-like [Brachypodium distachyon]
Length=757

 Score =   882 bits (2280),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 431/691 (62%), Positives = 548/691 (79%), Gaps = 6/691 (1%)
 Frame = -1

Query  2056  MENTG-ISAVESSADEINDSPVEEVRLTVPITDDPTMPCVTFRTWVLGVTSCVILAFLNQ  1880
             ++N G +   +   DE++D P+EEVRLTVPITDDP +P +TFRTW LG+ SC +LAF NQ
Sbjct  14    IQNAGAVDTSDGKTDEVDDCPIEEVRLTVPITDDPALPALTFRTWFLGLISCALLAFSNQ  73

Query  1879  FFGYRQNALYVSSVPAQIVVLPMGKLMAAYLPTKVVQIPGTKWSFSLNPGPFNIKEHVLI  1700
             FFGYRQN LY+SS+  QIVVLP+G+LMAA LP  ++ + GT+WSFSLNPGPFN+KEHVLI
Sbjct  74    FFGYRQNPLYISSLSVQIVVLPLGRLMAACLPPAIIGVKGTRWSFSLNPGPFNLKEHVLI  133

Query  1699  TIFASSGSDFSYAVSIITMMKAFYYRDIHPLAAVLLTFSTQMLGYGLAGIFKKFLIDSPY  1520
             TIFA++GS+  YAV IIT++KAFY+RDIHPLAA+LLT +TQ++GYG AG+F+KFL++SPY
Sbjct  134   TIFANTGSNSVYAVGIITIVKAFYHRDIHPLAAMLLTQTTQLMGYGWAGLFRKFLVESPY  193

Query  1519  MWWPSNLVQVSLFRALHDVE-TRPKGGLTRLQFFIIVLVCSFAYYVVPNYLFPSLTALSL  1343
             MWWP+NLVQVSLFRALH+ E  RPKGG TRLQFF+ VL  SFAYY+VPNYLFP+++ +S+
Sbjct  194   MWWPANLVQVSLFRALHEKEQKRPKGGTTRLQFFLTVLATSFAYYIVPNYLFPTISTISV  253

Query  1342  LCWIWKNSVTAQQlgsglkglgigSFALDWATVAAFQGSPLVTPDFAIINMLIGYVLVAY  1163
              C IW+NS+TAQQ+GSG  GLG+GSF LDWATVA F G+PL TP FAI N++ G+ LV Y
Sbjct  254   ACLIWRNSITAQQIGSGAHGLGVGSFGLDWATVAGFLGTPLSTPAFAIANVMAGFFLVVY  313

Query  1162  IAIPVWYWTNLFDAKKFPLFSSNVFDSNGQVYNISRVLNKKTFGFDQPGYDSYSNIYLST  983
             + +PV YW+N ++A++FP+ SS+VF +NG  Y+++RVL+  TF F   GY     I LS 
Sbjct  314   VILPVAYWSNAYNARRFPIISSHVFMANGTRYDVARVLDPATFRFSSAGYAEAGQINLSV  373

Query  982   AFVYTYGLSFATLAATVSHVALFHGRTIWEQTKESVQDKFS---DIHTRLMRKNYEPVPQ  812
              F + YGLSFATLAAT+SHVALFHGR+IW+QTK +V    +   D+H RLM++NY  VPQ
Sbjct  374   FFAFAYGLSFATLAATLSHVALFHGRSIWQQTKATVARGHAGGGDVHARLMKRNYAAVPQ  433

Query  811   WWFYlllviivgvalvACQRFGGQLQLPVWGVLLAVLLSLIFTLPVGVITATTNQQTGLN  632
             WWF +LLV+++ +++  C+ FG QLQLP WGV+LA  L+  FTLP+G+ITATTNQQ GLN
Sbjct  434   WWFQVLLVVVLALSIFTCEGFGQQLQLPYWGVMLAAGLAFFFTLPIGIITATTNQQPGLN  493

Query  631   VIAELIIGYMYPGRPLASVTFKMYGlsslsqslmflSDFKLGHYMKIPPKSMFMVQLVGT  452
             V+ ELIIGY+YPGRPLA+V FK YG  S+SQ++MFL DFKLGHYMKIPP+SMF VQLVGT
Sbjct  494   VMTELIIGYLYPGRPLANVAFKTYGYISMSQAIMFLQDFKLGHYMKIPPRSMFAVQLVGT  553

Query  451   LISCCVHFGTGWWLLTTVENICNPSKLPEGSQWTCPGDDVFYNASIIWGVVSPRRMFGNL  272
             +++  V+FGT WWLL TV  +C+P++LP GS WTCPGDDVFYNAS+IWGVV P RMFG L
Sbjct  554   VLASSVYFGTSWWLLETVSGVCDPARLPAGSPWTCPGDDVFYNASVIWGVVGPLRMFGRL  613

Query  271   GIYQATNYFFLVGFLAPIPVWYLGRKYPEKRWV-SLINMPILISGAEGIPIVKSVNYVCW  95
             G Y   N+FFL G LAP+P W + R +P K W   L+N P+L+     +P  ++VNY+ W
Sbjct  614   GRYAGMNWFFLAGALAPVPGWAMARAFPGKAWAFRLVNTPVLLGATGMMPPARAVNYLMW  673

Query  94    FAVGLYFNLYVYRKHKGWWARHNYILSAGLD  2
              AVGL FN  VYR++K WWARHNY++SA LD
Sbjct  674   GAVGLLFNHVVYRRYKAWWARHNYVMSAALD  704



>gb|AET00815.2| oligopeptide transporter OPT family protein [Medicago truncatula]
Length=746

 Score =   881 bits (2276),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 428/674 (64%), Positives = 539/674 (80%), Gaps = 3/674 (0%)
 Frame = -1

Query  2014  EINDSPVEEVRLTVPITDDPTMPCVTFRTWVLGVTSCVILAFLNQFFGYRQNALYVSSVP  1835
             E++DSP+E+VRLTV  TDDPT P +TFRTW++G+  C++LAF+NQFFGYR N L +++V 
Sbjct  21    EVDDSPIEQVRLTVSTTDDPTQPALTFRTWIIGLACCIVLAFVNQFFGYRTNPLTITAVS  80

Query  1834  AQIVVLPMGKLMAAYLPTKVVQIPGTKWSFSLNPGPFNIKEHVLITIFASSGSDFSYAVS  1655
             AQIV LP+GKLMAA LPT + ++P TKWSF+LNPGPFN+KEH LITIFAS+G+   YA+ 
Sbjct  81    AQIVSLPIGKLMAATLPTTIYKVPFTKWSFTLNPGPFNLKEHALITIFASAGAGGVYAIY  140

Query  1654  IITMMKAFYYRDIHPLAAVLLTFSTQMLGYGLAGIFKKFLIDSPYMWWPSNLVQVSLFRA  1475
             I+ ++KAFY+R I+P+AA LL  +TQMLGYG AGIF++FL+DSPYMWWPSNLVQVSLFRA
Sbjct  141   IVDVVKAFYHRSINPIAAFLLAITTQMLGYGWAGIFRRFLVDSPYMWWPSNLVQVSLFRA  200

Query  1474  LHDVETRPKGGLTRLQFFIIVLVCSFAYYVVPNYLFPSLTALSLLCWIWKNSVTAQQlgs  1295
              H+ E RPKGG TRLQFF ++ V SFAYY++P Y F + + +S++C IWKNS+TAQQ+GS
Sbjct  201   FHEPEKRPKGGNTRLQFFFMIFVASFAYYIIPGYFFQAASCISVVCLIWKNSITAQQIGS  260

Query  1294  glkglgigSFALDWATVAAFQGSPLVTPDFAIINMLIGYVLVAYIAIPVWYWTNLFDAKK  1115
             G+ GLGIG+FALDW TV +F  SPL  P FAIIN+L+G+VL  Y+ IP+ YW N ++AKK
Sbjct  261   GMNGLGIGAFALDWNTVVSFLYSPLAYPGFAIINVLVGFVLFIYVVIPISYWNNFYEAKK  320

Query  1114  FPLFSSNVFDSNGQVYNISRVLNKKTFGFDQPGYDSYSNIYLSTAFVYTYGLSFATLAAT  935
             FP  +SN FDS G  YNISR+LN+ TF  D   Y++YS +YLS  F + YGLSFA+L AT
Sbjct  321   FPFITSNTFDSTGTKYNISRILNEATFEIDMDAYNNYSKLYLSIIFAFDYGLSFASLTAT  380

Query  934   VSHVALFHGRTI---WEQTKESVQDKFSDIHTRLMRKNYEPVPQWWFYlllviivgvalv  764
             VSHV LFHG+TI   W +T  +++ +  D+HTRLM++NYE VP+WWF  +LV++V +AL 
Sbjct  381   VSHVFLFHGKTIIQSWRKTTTALKKQAGDVHTRLMKRNYEQVPEWWFMTILVLMVILALA  440

Query  763   ACQRFGGQLQLPVWGVLLAVLLSLIFTLPVGVITATTNQQTGLNVIAELIIGYMYPGRPL  584
              C+ F  QLQLP WGVLL++ ++L+FTLPVGVI ATTNQQ GLNVI ELIIGY+YPG+PL
Sbjct  441   CCEGFDKQLQLPWWGVLLSLSIALVFTLPVGVIQATTNQQAGLNVITELIIGYLYPGKPL  500

Query  583   ASVTFKMYGlsslsqslmflSDFKLGHYMKIPPKSMFMVQLVGTLISCCVHFGTGWWLLT  404
             A+V FK YG  S+SQ+L FL DFKLGHYMKIPPKSMF+VQLVGTL+S  V F T WWLLT
Sbjct  501   ANVAFKTYGYMSMSQALSFLQDFKLGHYMKIPPKSMFIVQLVGTLVSSSVCFSTAWWLLT  560

Query  403   TVENICNPSKLPEGSQWTCPGDDVFYNASIIWGVVSPRRMFGNLGIYQATNYFFLVGFLA  224
             T+ +IC+ S LP+GS WTCPGD+VFYNASIIWG+V P+RMF   GIY   N+FFL+G LA
Sbjct  561   TIPHICDKSMLPDGSPWTCPGDEVFYNASIIWGIVGPKRMFTKDGIYPGMNWFFLIGLLA  620

Query  223   PIPVWYLGRKYPEKRWVSLINMPILISGAEGIPIVKSVNYVCWFAVGLYFNLYVYRKHKG  44
             P+PVW+L RKYP  +W+ LINMP++I GA GIP  +S+NY+ W  VG++FN YVY+  K 
Sbjct  621   PVPVWFLARKYPNHKWIELINMPLIIGGASGIPPARSINYISWGVVGIFFNFYVYKNFKA  680

Query  43    WWARHNYILSAGLD  2
             WWARH YILSA LD
Sbjct  681   WWARHTYILSAALD  694



>ref|XP_006475109.1| PREDICTED: oligopeptide transporter 1-like [Citrus sinensis]
Length=729

 Score =   881 bits (2276),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 438/676 (65%), Positives = 552/676 (82%), Gaps = 3/676 (0%)
 Frame = -1

Query  2020  ADEINDSPVEEVRLTVPITDDPTMPCVTFRTWVLGVTSCVILAFLNQFFGYRQNALYVSS  1841
             A E+ND+P+EEVRLTVPITDDP++P +TFRTWVLG+ SC +LAFLN+FFG+RQN L VSS
Sbjct  2     AKELNDNPIEEVRLTVPITDDPSLPVLTFRTWVLGILSCGLLAFLNRFFGFRQNQLTVSS  61

Query  1840  VPAQIVVLPMGKLMAAYLPTKVVQIPGTKWSFSLNPGPFNIKEHVLITIFASSGSDFSYA  1661
             V AQI+VLP+GKLMAA LPTK  + P T WSFS NPGPFNIKEHVLITIFAS G+   YA
Sbjct  62    VSAQILVLPIGKLMAATLPTKKFKCPITNWSFSFNPGPFNIKEHVLITIFASCGASGVYA  121

Query  1660  VSIITMMKAFYYRDIHPLAAVLLTFSTQMLGYGLAGIFKKFLIDSPYMWWPSNLVQVSLF  1481
             V II M++AFY R IHP+AA+LL  +TQMLGYG AGIF+++L+DSPYMWWP+NLVQVSLF
Sbjct  122   VHIIAMLRAFYKRSIHPVAALLLALTTQMLGYGWAGIFRRYLVDSPYMWWPANLVQVSLF  181

Query  1480  RALHDVETRPKGGLTRLQFFIIVLVCSFAYYVVPNYLFPSLTALSLLCWIWKNSVTAQQl  1301
             RALH+ E RPKG LTR+QFF +V V SFAYY+VP YLFPSLTALS +CWIWK SVTAQQ+
Sbjct  182   RALHEKEKRPKGRLTRIQFFFVVFVSSFAYYIVPGYLFPSLTALSFVCWIWKRSVTAQQI  241

Query  1300  gsglkglgigSFALDWATVAAFQGSPLVTPDFAIINMLIGYVLVAYIAIPVWYWTNLFDA  1121
             GSGL GLGIG+  +DW+TV++F GSPL TP FAI+N L+G+ LV YI +P++YW N+++A
Sbjct  242   GSGLSGLGIGAIGIDWSTVSSFLGSPLATPLFAIVNTLVGFALVMYILLPIFYWNNVYEA  301

Query  1120  KKFPLFSSNVFDSNGQVYNISRVLNKKTFGFDQPGYDSYSNIYLSTAFVYTYGLSFATLA  941
             K+FP+F +  FD+ G  YN+ RVLNK+TF  +   Y+ YS +YLS  F +TYGLSFATL 
Sbjct  302   KRFPIFGAATFDAQGHKYNVDRVLNKETFDLNVEAYNGYSKLYLSVFFAFTYGLSFATLT  361

Query  940   ATVSHVALFHGRTI---WEQTKESVQDKFSDIHTRLMRKNYEPVPQWWFYlllviivgva  770
             A++SHVALF G++I   W +TK++V DKF+D+HTR+MR+NY+ VP WWF+ +LV+ V +A
Sbjct  362   ASISHVALFDGKSIMEMWMKTKDAVGDKFADVHTRMMRRNYDSVPGWWFHAVLVVSVALA  421

Query  769   lvACQRFGGQLQLPVWGVLLAVLLSLIFTLPVGVITATTNQQTGLNVIAELIIGYMYPGR  590
             L AC+ FG  LQLP WG+LLA L++L FTLP+G+I ATTNQQ GLNVI ELIIG++YPG+
Sbjct  422   LYACEGFGKVLQLPWWGLLLACLIALGFTLPIGIINATTNQQPGLNVITELIIGFLYPGK  481

Query  589   PLASVTFKMYGlsslsqslmflSDFKLGHYMKIPPKSMFMVQLVGTLISCCVHFGTGWWL  410
             P+A+V FK YG  S++Q+L FLSDFKLGHYMKIPPKSMF+VQLVGT+++  V+FGT WWL
Sbjct  482   PVANVVFKTYGYISMAQALAFLSDFKLGHYMKIPPKSMFIVQLVGTVVASSVYFGTAWWL  541

Query  409   LTTVENICNPSKLPEGSQWTCPGDDVFYNASIIWGVVSPRRMFGNLGIYQATNYFFLVGF  230
             L ++++IC+ + LPEGS WTCPGDDVFY+ASIIWGV+ P +MF   GIY   N+ FL+GF
Sbjct  542   LGSIKDICDTAALPEGSPWTCPGDDVFYSASIIWGVIGPGKMFTKEGIYPEMNWCFLIGF  601

Query  229   LAPIPVWYLGRKYPEKRWVSLINMPILISGAEGIPIVKSVNYVCWFAVGLYFNLYVYRKH  50
             LAP+PVW L RK+P+KRW+  I+MPI+I  A  +P  K+V++  W  VG++FN Y+YRK+
Sbjct  602   LAPVPVWLLSRKFPKKRWIKQIHMPIIIGTASSMPTAKAVHFNTWGVVGIFFNYYIYRKY  661

Query  49    KGWWARHNYILSAGLD  2
             K WWARH YILS  LD
Sbjct  662   KAWWARHTYILSGALD  677



>gb|KDP39297.1| hypothetical protein JCGZ_01054 [Jatropha curcas]
Length=750

 Score =   880 bits (2273),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 442/705 (63%), Positives = 546/705 (77%), Gaps = 18/705 (3%)
 Frame = -1

Query  2107  ERVSSFKNSSLSRLLH*MENTGISAVESSADEINDSPVEEVRLTVPITDDPTMPCVTFRT  1928
             E+V S    S +R      N  +  +    +E+ND+P+EEVRLTVPITDDPT P +TFRT
Sbjct  8     EKVESPPQFSENR----QSNIRMEEIVKGDEEVNDNPIEEVRLTVPITDDPTEPALTFRT  63

Query  1927  WVLGVTSCVILAFLNQFFGYRQNALYVSSVPAQIVVLPMGKLMAAYLPTKVVQIPGTKWS  1748
             WVLG+ SC            R N LYV SV AQIVVLP+GKLMA  LPTK ++IP TKWS
Sbjct  64    WVLGIASCA-----------RSNQLYVGSVSAQIVVLPLGKLMAKVLPTKQIKIPLTKWS  112

Query  1747  FSLNPGPFNIKEHVLITIFASSGSDFSYAVSIITMMKAFYYRDIHPLAAVLLTFSTQMLG  1568
             FSLNPGPF +KEHVLITIFAS G+   YAV+IIT +KAFY R ++P+AA+LL  +TQ+LG
Sbjct  113   FSLNPGPFTLKEHVLITIFASCGAGGVYAVNIITAVKAFYRRPLNPVAAMLLVQTTQLLG  172

Query  1567  YGLAGIFKKFLIDSPYMWWPSNLVQVSLFRALHDVETRPKGGLTRLQFFIIVLVCSFAYY  1388
             YG AGIF+K+L+DSPYMW PSNLVQVSLFRAL++ E RPKG LTRLQFF IV + S+AYY
Sbjct  173   YGWAGIFRKYLVDSPYMWCPSNLVQVSLFRALNEKEKRPKGRLTRLQFFTIVFISSYAYY  232

Query  1387  VVPNYLFPSLTALSLLCWIWKNSVTAQQlgsglkglgigSFALDWATVAAFQGSPLVTPD  1208
             ++P YLFPSL+ +S +CWIWK+SVTAQQ+GSG  GLGI SF LDW+TVA F G+PL  P 
Sbjct  233   IIPGYLFPSLSTISFICWIWKDSVTAQQIGSGQNGLGIASFGLDWSTVAGFLGTPLAVPF  292

Query  1207  FAIINMLIGYVLVAYIAIPVWYWTNLFDAKKFPLFSSNVFDSNGQVYNISRVLNKKTFGF  1028
             FAI N L G+ LV YI +P+ YW+N FDAKKFP++SS+ FDS+GQ YNI R+LN+K F  
Sbjct  293   FAIANTLAGFFLVQYIIVPISYWSNTFDAKKFPIYSSHTFDSDGQTYNIRRILNQKNFDI  352

Query  1027  DQPGYDSYSNIYLSTAFVYTYGLSFATLAATVSHVALFHGRTIWE---QTKESVQDKFSD  857
             +   Y++YS ++LS  F + YGLSFA L AT+SHVALF G+TIW+   +T  +++ +F+D
Sbjct  353   NLDAYNNYSKLHLSVLFAFVYGLSFAALMATISHVALFEGKTIWKMWRKTTSALKGQFTD  412

Query  856   IHTRLMRKNYEPVPQWWFYlllviivgvalvACQRFGGQLQLPVWGVLLAVLLSLIFTLP  677
             +HTRLM+KNYE VPQWWF  LLVI V ++ +A + F  QLQLP WG+LLA  ++L FTLP
Sbjct  413   VHTRLMKKNYEAVPQWWFVTLLVISVALSFLAVEGFNKQLQLPWWGLLLACGIALFFTLP  472

Query  676   VGVITATTNQQTGLNVIAELIIGYMYPGRPLASVTFKMYGlsslsqslmflSDFKLGHYM  497
             +GV+ ATTN Q GLNVI ELIIG +YPG+PLA+V FK YG  S+SQ+L  + DFKLGHYM
Sbjct  473   IGVVQATTNMQMGLNVITELIIGNIYPGKPLANVAFKTYGYISMSQALYLVQDFKLGHYM  532

Query  496   KIPPKSMFMVQLVGTLISCCVHFGTGWWLLTTVENICNPSKLPEGSQWTCPGDDVFYNAS  317
             KIPPKSMF+VQLVGT++   V+FGT WWLL+TVENIC P  LPEGS WTCPGDDVFYNAS
Sbjct  533   KIPPKSMFLVQLVGTIVGSTVYFGTAWWLLSTVENICVPDLLPEGSPWTCPGDDVFYNAS  592

Query  316   IIWGVVSPRRMFGNLGIYQATNYFFLVGFLAPIPVWYLGRKYPEKRWVSLINMPILISGA  137
             IIWGV+ P RMFG LG+Y   ++FFL+G LAP+PVW L RK+PEK+W+ LI+MPI +S  
Sbjct  593   IIWGVIGPLRMFGKLGVYSKMSWFFLIGALAPVPVWLLSRKFPEKKWIKLIHMPIFLSAT  652

Query  136   EGIPIVKSVNYVCWFAVGLYFNLYVYRKHKGWWARHNYILSAGLD  2
               +P  ++V+Y  W AVG++FN YVYRK+KGWWARHNYILSAGLD
Sbjct  653   SAMPPARAVHYWSWGAVGVFFNFYVYRKYKGWWARHNYILSAGLD  697



>ref|XP_006452632.1| hypothetical protein CICLE_v10010604mg, partial [Citrus clementina]
 gb|ESR65872.1| hypothetical protein CICLE_v10010604mg, partial [Citrus clementina]
Length=728

 Score =   879 bits (2272),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 436/674 (65%), Positives = 552/674 (82%), Gaps = 3/674 (0%)
 Frame = -1

Query  2014  EINDSPVEEVRLTVPITDDPTMPCVTFRTWVLGVTSCVILAFLNQFFGYRQNALYVSSVP  1835
             E+ND+P+EEVRLTVPITDDP++P +TFRTWVLG+ SC +LAFLN+FFG+RQN L VSSV 
Sbjct  3     EVNDNPIEEVRLTVPITDDPSLPVLTFRTWVLGILSCGLLAFLNRFFGFRQNQLTVSSVS  62

Query  1834  AQIVVLPMGKLMAAYLPTKVVQIPGTKWSFSLNPGPFNIKEHVLITIFASSGSDFSYAVS  1655
             AQI+VLP+GKLMAA LPTK  + P T WSFS NPGPFNIKEHVLITIFAS G+   YAV 
Sbjct  63    AQILVLPIGKLMAATLPTKKFKCPITNWSFSFNPGPFNIKEHVLITIFASCGASGVYAVH  122

Query  1654  IITMMKAFYYRDIHPLAAVLLTFSTQMLGYGLAGIFKKFLIDSPYMWWPSNLVQVSLFRA  1475
             II M++AFY R IHP+AA+LL  +TQMLGYG AG+F+++L+DSPYMWWP+NLVQVSLFRA
Sbjct  123   IIAMLRAFYKRSIHPVAALLLALTTQMLGYGWAGLFRRYLVDSPYMWWPANLVQVSLFRA  182

Query  1474  LHDVETRPKGGLTRLQFFIIVLVCSFAYYVVPNYLFPSLTALSLLCWIWKNSVTAQQlgs  1295
             LH+ E RPKGGLTR+QFF +V V SFAYY+VP YLFPSLTALS +CWIWK SVTAQQ+GS
Sbjct  183   LHEKEKRPKGGLTRIQFFFVVFVSSFAYYIVPGYLFPSLTALSFVCWIWKRSVTAQQIGS  242

Query  1294  glkglgigSFALDWATVAAFQGSPLVTPDFAIINMLIGYVLVAYIAIPVWYWTNLFDAKK  1115
             GL GLGIG+  +DW+TV++F GSPL TP F+I+N L+G+ LV YI +P++YW N+++AK+
Sbjct  243   GLSGLGIGAIGIDWSTVSSFLGSPLATPLFSIVNTLVGFALVMYILLPIFYWNNVYEAKR  302

Query  1114  FPLFSSNVFDSNGQVYNISRVLNKKTFGFDQPGYDSYSNIYLSTAFVYTYGLSFATLAAT  935
             FP+FS+  FD+ G  YN+ RVLNK+TF  +   Y+ YS +YLS  F + YGLSFATL A+
Sbjct  303   FPIFSAATFDAQGHKYNVDRVLNKETFDLNVEAYNGYSKLYLSVFFAFIYGLSFATLTAS  362

Query  934   VSHVALFHGRTI---WEQTKESVQDKFSDIHTRLMRKNYEPVPQWWFYlllviivgvalv  764
             +SHVALF G+ I   W +TK++V DKF+D+HTR+M++NY+ VP WWF+ +LV+ V +AL 
Sbjct  363   ISHVALFDGKNIMEMWMKTKDAVGDKFADVHTRMMKRNYDSVPGWWFHAVLVVSVALALY  422

Query  763   ACQRFGGQLQLPVWGVLLAVLLSLIFTLPVGVITATTNQQTGLNVIAELIIGYMYPGRPL  584
             AC+ FG  LQLP WG+LLA L++L FTLP+G+I ATTNQQ GLNVI ELIIG++YPG+P+
Sbjct  423   ACEGFGKVLQLPWWGLLLACLIALGFTLPIGIINATTNQQPGLNVITELIIGFLYPGKPV  482

Query  583   ASVTFKMYGlsslsqslmflSDFKLGHYMKIPPKSMFMVQLVGTLISCCVHFGTGWWLLT  404
             A+V FK YG  S++Q+L FLSDFKLGHYMKIPPKSMF+VQLVGT+++  V+FGT WWLL 
Sbjct  483   ANVVFKTYGYISMAQALAFLSDFKLGHYMKIPPKSMFIVQLVGTVVASSVYFGTAWWLLG  542

Query  403   TVENICNPSKLPEGSQWTCPGDDVFYNASIIWGVVSPRRMFGNLGIYQATNYFFLVGFLA  224
             ++++IC+P+ LPEGS WTCPGDDVFY+ASIIWGV+ P +MF   GIY   N+ FL+GFLA
Sbjct  543   SIKDICDPAALPEGSPWTCPGDDVFYSASIIWGVIGPGKMFTKEGIYPEMNWCFLIGFLA  602

Query  223   PIPVWYLGRKYPEKRWVSLINMPILISGAEGIPIVKSVNYVCWFAVGLYFNLYVYRKHKG  44
             P+PVW L RK+P+KRW+  I+MPI+I  A  +P  K+V++  W  VG++FN Y+YRK+K 
Sbjct  603   PVPVWLLSRKFPKKRWIKQIHMPIIIGTASSMPTAKAVHFNTWGVVGIFFNYYIYRKYKA  662

Query  43    WWARHNYILSAGLD  2
             WWARH YILS  LD
Sbjct  663   WWARHTYILSGALD  676



>ref|XP_003625172.1| Oligopeptide transporter OPT family [Medicago truncatula]
 gb|AES81390.1| oligopeptide transporter OPT family protein [Medicago truncatula]
Length=773

 Score =   875 bits (2260),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 437/687 (64%), Positives = 549/687 (80%), Gaps = 3/687 (0%)
 Frame = -1

Query  2053  ENTGISAVESSADEINDSPVEEVRLTVPITDDPTMPCVTFRTWVLGVTSCVILAFLNQFF  1874
             +NT I   E     INDSP+E+VRLTVPITDDP+ P +TFRTWVLG+ SC++LAF+NQF 
Sbjct  36    QNTVIEDAEIDEYSINDSPIEQVRLTVPITDDPSQPALTFRTWVLGLASCILLAFVNQFL  95

Query  1873  GYRQNALYVSSVPAQIVVLPMGKLMAAYLPTKVVQIPGTKWSFSLNPGPFNIKEHVLITI  1694
             GYR N L ++SV AQI+ LP+GKLMAA LPTK +Q+P T WSFSLNPGPF++KEHVLITI
Sbjct  96    GYRTNPLKITSVSAQIIALPLGKLMAATLPTKPIQVPFTTWSFSLNPGPFSLKEHVLITI  155

Query  1693  FASSGSDFSYAVSIITMMKAFYYRDIHPLAAVLLTFSTQMLGYGLAGIFKKFLIDSPYMW  1514
             FASSGS   YA++IIT++KAFY+R IHP+AA LL  STQMLGYG AGIF++FL+DSPYMW
Sbjct  156   FASSGSSGVYAINIITIVKAFYHRSIHPVAAYLLALSTQMLGYGWAGIFRRFLVDSPYMW  215

Query  1513  WPSNLVQVSLFRALHDVETRPKGGLTRLQFFIIVLVCSFAYYVVPNYLFPSLTALSLLCW  1334
             WP +LVQVSLFRA H+ E RP+GG +RLQFF +V V SFAYY++P Y F +++ +S +C 
Sbjct  216   WPESLVQVSLFRAFHEKEKRPRGGTSRLQFFFVVFVASFAYYIIPGYFFQAISTVSFVCL  275

Query  1333  IWKNSVTAQQlgsglkglgigSFALDWATVAAFQGSPLVTPDFAIINMLIGYVLVAYIAI  1154
             IWK S+TAQQ+GSG+KGLGIGSF LDW TVA F GSPL  P FAIIN++ G+ L  Y+ I
Sbjct  276   IWKESITAQQIGSGMKGLGIGSFGLDWNTVAGFLGSPLAVPGFAIINIMAGFFLYMYVLI  335

Query  1153  PVWYWTNLFDAKKFPLFSSNVFDSNGQVYNISRVLNKKTFGFDQPGYDSYSNIYLSTAFV  974
             P+ YW NL+DAKKFPL SS+ FDS G  YN++R+LN +TF  D   Y +YS IYLS AF 
Sbjct  336   PISYWNNLYDAKKFPLISSHTFDSTGATYNVTRILNTETFDIDMESYSNYSKIYLSVAFA  395

Query  973   YTYGLSFATLAATVSHVALFHGRTI---WEQTKESVQDKFSDIHTRLMRKNYEPVPQWWF  803
             + YG  FA L AT+SHV LFHG  I   W++T  S++++  D+HTR+M+KNYE VP+WWF
Sbjct  396   FEYGFCFAALTATISHVVLFHGEMIVQMWKKTTTSLKNQLGDVHTRIMKKNYEQVPEWWF  455

Query  802   YlllviivgvalvACQRFGGQLQLPVWGVLLAVLLSLIFTLPVGVITATTNQQTGLNVIA  623
               +L+++V +AL+AC+ FG QLQLP WG+LL++ ++LIFTLP+GVI ATTN ++GLNVI 
Sbjct  456   VTILILMVMMALLACEGFGKQLQLPWWGILLSLTIALIFTLPIGVIEATTNIRSGLNVIT  515

Query  622   ELIIGYMYPGRPLASVTFKMYGlsslsqslmflSDFKLGHYMKIPPKSMFMVQLVGTLIS  443
             EL+IG++YPG+PLA+V FK YG  S+ Q+L FL DFKLGHYMKI PKSMF+VQLVGT+++
Sbjct  516   ELVIGFIYPGKPLANVAFKTYGHISMVQALGFLGDFKLGHYMKIAPKSMFIVQLVGTVVA  575

Query  442   CCVHFGTGWWLLTTVENICNPSKLPEGSQWTCPGDDVFYNASIIWGVVSPRRMFGNLGIY  263
               VHFGT WWLLT++ENIC+ S LP+GS WTCPGDDVFYNASIIWGVV P+RMF   G+Y
Sbjct  576   SSVHFGTAWWLLTSIENICDESLLPKGSPWTCPGDDVFYNASIIWGVVGPKRMFTKDGVY  635

Query  262   QATNYFFLVGFLAPIPVWYLGRKYPEKRWVSLINMPILISGAEGIPIVKSVNYVCWFAVG  83
                N+FFL+G +AP+PVW L  K+P ++W+  IN+PI+I+GA  IP V+SVNY+ W  VG
Sbjct  636   PELNWFFLIGLIAPVPVWLLSLKFPNQKWIQFINIPIIIAGASDIPPVRSVNYITWGIVG  695

Query  82    LYFNLYVYRKHKGWWARHNYILSAGLD  2
             ++FN YVYRK K WWARH YILSAGLD
Sbjct  696   IFFNFYVYRKFKAWWARHTYILSAGLD  722



>ref|XP_006380863.1| hypothetical protein POPTR_0006s00560g, partial [Populus trichocarpa]
 gb|ERP58660.1| hypothetical protein POPTR_0006s00560g, partial [Populus trichocarpa]
Length=679

 Score =   874 bits (2258),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 442/671 (66%), Positives = 538/671 (80%), Gaps = 45/671 (7%)
 Frame = -1

Query  2014  EINDSPVEEVRLTVPITDDPTMPCVTFRTWVLGVTSCVILAFLNQFFGYRQNALYVSSVP  1835
             E+NDSP+E+V+LTVPITDDPT+PC+TFRTWVLG+  C +LAF+NQFFGYRQN LYV+SV 
Sbjct  1     EVNDSPIEQVKLTVPITDDPTLPCLTFRTWVLGIACCALLAFVNQFFGYRQNILYVTSVS  60

Query  1834  AQIVVLPMGKLMAAYLPTKVVQIPGTKWSFSLNPGPFNIKEHVLITIFASSGSDFSYAVS  1655
             AQI +LP+G+LM + LP K ++ P TKW+ SLNPGPFNIKEHVLITIFA++GS+  +AV 
Sbjct  61    AQIALLPIGRLMESVLPNKFIRFPRTKWALSLNPGPFNIKEHVLITIFANAGSNNVFAVG  120

Query  1654  IITMMKAFYYRDIHPLAAVLLTFSTQMLGYGLAGIFKKFLIDSPYMWWPSNLVQVSLFRA  1475
             IIT++KAFY+  I  + A+LLT +TQ+LGYG AG+F+KFL+DSPYMWWPS LVQVSLFRA
Sbjct  121   IITIVKAFYHGRIDAIPAMLLTQTTQLLGYGWAGLFRKFLVDSPYMWWPSILVQVSLFRA  180

Query  1474  LHDVETRPKGGLTRLQFFIIVLVCSFAYYVVPNYLFPSLTALSLLCWIWKNSVTAQQlgs  1295
             LH+VE R KGGLTRLQFF++VLV SFAYY+VP YLF S+TALS +CWIWK+SVTAQQ+GS
Sbjct  181   LHEVEIRRKGGLTRLQFFLVVLVSSFAYYIVPGYLFQSVTALSFVCWIWKDSVTAQQVGS  240

Query  1294  glkglgigSFALDWATVAAFQGSPLVTPDFAIINMLIGYVLVAYIAIPVWYWTNLFDAKK  1115
             GL GLG+ SFA+DW+T                                    TN + AK+
Sbjct  241   GLHGLGVDSFAIDWST------------------------------------TNSYGAKR  264

Query  1114  FPLFSSNVFDSNGQVYNISRVLNKKTFGFDQPGYDSYSNIYLSTAFVYTYGLSFATLAAT  935
             FP+FSS+VFD+ GQ Y++SRVLN+ TF F+QPGYD YS + LS  FVYTYGL+FA LAA 
Sbjct  265   FPIFSSHVFDAYGQPYDVSRVLNETTFEFNQPGYDGYSKVNLSIFFVYTYGLNFAILAAA  324

Query  934   VSHVALFHGRTIWEQTKESVQDKFSDIHTRLMRKNYEPVPQWWFYlllviivgvalvACQ  755
             ++HVALF+ R IW QTK + QDK++D+HTR+M+KNYE VPQWWFY LL+I++ + L+ C+
Sbjct  325   LTHVALFYEREIWHQTKAAYQDKYADVHTRIMKKNYEDVPQWWFYSLLIIVIALTLLTCE  384

Query  754   RFGGQLQLPVWGVLLAVLLSLIFTLPVGVITATTNQQTGLNVIAELIIGYMYPGRPLASV  575
              FG QLQLP WGVLLAV L+L+FTLPVGV+ ATTNQQ  LNVI ELIIGYMYPGR LA+V
Sbjct  385   GFGKQLQLPYWGVLLAVGLALMFTLPVGVLAATTNQQPELNVITELIIGYMYPGRLLANV  444

Query  574   TFKMYGlsslsqslmflSDFKLGHYMKIPPKSMFMVQLVGTLISCCVHFGTGWWLLTTVE  395
             TFK YG +S+SQ++ FLSDFKLGHYMKIPPKSMF+VQ+VGTLIS  V+FGTGWWLLT+VE
Sbjct  445   TFKNYGYTSMSQAISFLSDFKLGHYMKIPPKSMFVVQIVGTLISSSVYFGTGWWLLTSVE  504

Query  394   NICNPSKLPEGSQWTCPGDDVFYNASIIWGVVSPRRMFGNLGIYQATNYFFLVGFLAPIP  215
             NIC+PSKLPEGSQWTCPG DVFYNAS+IWGVV P RMFG LG+Y   NYFFLVG LAP  
Sbjct  505   NICDPSKLPEGSQWTCPGVDVFYNASVIWGVVGPMRMFGRLGLYSKMNYFFLVGLLAP--  562

Query  214   VWYLGRKYPEKRWVSLINMPILISGAEGIPIVKSVNYVCWFAVGLYFNLYVYRKHKGWWA  35
                    +PEK W+  IN+PI++SG  G+P VK+VNY+CW +VG+ FNL VY +++GWW 
Sbjct  563   -------FPEKTWIKYINVPIILSGTGGMPAVKAVNYMCWLSVGIVFNLVVYNRYRGWWV  615

Query  34    RHNYILSAGLD  2
             RHNYILSAGLD
Sbjct  616   RHNYILSAGLD  626



>ref|XP_007020441.1| Oligopeptide transporter 5 [Theobroma cacao]
 gb|EOY11966.1| Oligopeptide transporter 5 [Theobroma cacao]
Length=751

 Score =   872 bits (2254),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 432/684 (63%), Positives = 550/684 (80%), Gaps = 6/684 (1%)
 Frame = -1

Query  2044  GISAVESSADEINDSPVEEVRLTVPITDDPTMPCVTFRTWVLGVTSCVILAFLNQFFGYR  1865
             GI+  E   +E+ND P+EEVRLTVPITDDPT   +TFRTW LG+ S  ILAF+N FF YR
Sbjct  18    GITGKED--EEVNDCPIEEVRLTVPITDDPTEAALTFRTWFLGLLSLCILAFVNDFFSYR  75

Query  1864  QNALYVSSVPAQIVVLPMGKLMAAYLPTKVVQIPGTKWSFSLNPGPFNIKEHVLITIFAS  1685
              N LYV+SV AQIVVLP+GKLMAA LP   + +P TKWSFSLNPGPF++KEHVLITI AS
Sbjct  76    VNQLYVTSVSAQIVVLPLGKLMAATLPNTQISVPFTKWSFSLNPGPFSMKEHVLITILAS  135

Query  1684  SGSDFSYAVSIITMMKAFYYRDIHPLAAVLLTFSTQMLGYGLAGIFKKFLIDSPYMWWPS  1505
              GS   YA  IIT++KA Y+R +HP+AA+LL+ +TQ+LGYG AG+F+K+L+DSPYMWWPS
Sbjct  136   CGSGSVYATHIITIVKALYHRGMHPVAALLLSQTTQLLGYGWAGLFRKYLVDSPYMWWPS  195

Query  1504  NLVQVSLFRALHDVETRPKGGLTRLQFFIIVLVCSFAYYVVPNYLFPSLTALSLLCWIWK  1325
             NLVQVSLFRAL++ E RPK G+TRLQFFIIV +CSFAYY+VP YL PS++A+S +CWIWK
Sbjct  196   NLVQVSLFRALNEKEARPKKGVTRLQFFIIVFICSFAYYIVPGYLVPSISAISFICWIWK  255

Query  1324  NSVTAQQlgsglkglgigSFALDWATVAAFQGSPLVTPDFAIINMLIGYVLVAYIAIPVW  1145
             +S+TAQQ+GSGL+G GIGSF LDW+T+A F GSPL TP FAI+N L+G+ L+ Y+ +P+ 
Sbjct  256   DSITAQQIGSGLRGFGIGSFGLDWSTIA-FLGSPLPTPLFAIVNTLVGFFLIFYVVVPIA  314

Query  1144  YWTNLFDAKKFPLFSSNVFDSNGQVYNISRVLNKKTFGFDQPGYDSYSNIYLSTAFVYTY  965
             Y+TN F A++FPL +S+ +D+ G +YNI+R+LN KTF  +   Y+ YS +Y+S  F  TY
Sbjct  315   YYTNAFQARRFPLLTSSTYDAAGNIYNITRILNDKTFDINLASYNDYSRLYMSVVFAMTY  374

Query  964   GLSFATLAATVSHVALFHGRTIW---EQTKESVQDKFSDIHTRLMRKNYEPVPQWWFYll  794
             GLSFATL A++SHVALF G+TIW    +TK +V+DKFSD+HTRLM+KNY+ VP WWFY++
Sbjct  375   GLSFATLMASLSHVALFEGKTIWTMWRKTKSAVKDKFSDVHTRLMKKNYDEVPDWWFYVV  434

Query  793   lviivgvalvACQRFGGQLQLPVWGVLLAVLLSLIFTLPVGVITATTNQQTGLNVIAELI  614
             LV  + +++  C+ FG QLQLP WGVLLA  ++L FTLPVG+I ATTN Q GLNVI ELI
Sbjct  435   LVSTMVLSIFVCEGFGKQLQLPWWGVLLACAIALFFTLPVGIIQATTNMQPGLNVITELI  494

Query  613   IGYMYPGRPLASVTFKMYGlsslsqslmflSDFKLGHYMKIPPKSMFMVQLVGTLISCCV  434
             IGYMYPG+PLA+V FK YG  S++Q+L F+ D KLGHYMKIPPKSMF+VQLVGT+++   
Sbjct  495   IGYMYPGKPLANVCFKTYGYISMAQALTFIQDLKLGHYMKIPPKSMFIVQLVGTIVASFC  554

Query  433   HFGTGWWLLTTVENICNPSKLPEGSQWTCPGDDVFYNASIIWGVVSPRRMFGNLGIYQAT  254
             +FGT WWLL+TVENIC P  LP GS W CPGD+VFYNASIIWGV+ P RMF +LG Y   
Sbjct  555   YFGTTWWLLSTVENICVPDLLPTGSPWVCPGDNVFYNASIIWGVIGPLRMFTSLGNYPQL  614

Query  253   NYFFLVGFLAPIPVWYLGRKYPEKRWVSLINMPILISGAEGIPIVKSVNYVCWFAVGLYF  74
             N+FF++GFLAP PVW L  K+PEK+W+  I+MP++++GA G+P  K V+Y+CW  VG++F
Sbjct  615   NWFFVIGFLAPFPVWLLSLKFPEKKWIRFIHMPVILAGATGLPSAKPVHYICWGVVGIFF  674

Query  73    NLYVYRKHKGWWARHNYILSAGLD  2
             N Y+Y+++KGWWARH Y+LSA +D
Sbjct  675   NWYIYKRYKGWWARHTYVLSAAMD  698



>ref|XP_003625173.1| Oligopeptide transporter OPT family [Medicago truncatula]
Length=804

 Score =   872 bits (2252),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 432/687 (63%), Positives = 547/687 (80%), Gaps = 3/687 (0%)
 Frame = -1

Query  2053  ENTGISAVESSADEINDSPVEEVRLTVPITDDPTMPCVTFRTWVLGVTSCVILAFLNQFF  1874
             +N  I   E+    I+DSP+E+VRLTVPITDDP+ P +TFRTWVLG+ SCV+LAF+NQF 
Sbjct  36    QNRVIEYAETDEYSIDDSPIEQVRLTVPITDDPSQPALTFRTWVLGLASCVLLAFMNQFL  95

Query  1873  GYRQNALYVSSVPAQIVVLPMGKLMAAYLPTKVVQIPGTKWSFSLNPGPFNIKEHVLITI  1694
             GY+ N L ++SV AQI+ LP+GKLMAA LP K +Q+P T  +FSLNPG F++KEHVLI+I
Sbjct  96    GYKTNPLKITSVSAQIITLPLGKLMAATLPIKTIQVPFTSLTFSLNPGSFSVKEHVLISI  155

Query  1693  FASSGSDFSYAVSIITMMKAFYYRDIHPLAAVLLTFSTQMLGYGLAGIFKKFLIDSPYMW  1514
             FA+SGS   YA++IIT++K FY+R+IHP+AA LL  STQ+LGYG AGIF++FL+DSPYMW
Sbjct  156   FATSGSSGVYAINIITIVKGFYHRNIHPIAAYLLALSTQILGYGWAGIFRRFLVDSPYMW  215

Query  1513  WPSNLVQVSLFRALHDVETRPKGGLTRLQFFIIVLVCSFAYYVVPNYLFPSLTALSLLCW  1334
             WP  LVQVSLFRA H+ E RPKGG +RLQFF +V V SFAYY+VP Y F +++ +S  C 
Sbjct  216   WPEILVQVSLFRAFHEKEKRPKGGTSRLQFFFLVFVASFAYYIVPGYFFQAISTVSFFCL  275

Query  1333  IWKNSVTAQQlgsglkglgigSFALDWATVAAFQGSPLVTPDFAIINMLIGYVLVAYIAI  1154
             IWK+S+TAQQ+GSG+KGLGIGSF LDW TVA F GSPL  P FAIIN++ G+VL  Y+ I
Sbjct  276   IWKDSITAQQIGSGMKGLGIGSFGLDWNTVAGFLGSPLAVPGFAIINIMAGFVLYMYVLI  335

Query  1153  PVWYWTNLFDAKKFPLFSSNVFDSNGQVYNISRVLNKKTFGFDQPGYDSYSNIYLSTAFV  974
             P+ YW N++DAKKFPL SS+ FDS G  YNI+R+LN KTF  D   Y++YS IYLS  F 
Sbjct  336   PIAYWNNVYDAKKFPLISSHTFDSTGATYNITRILNTKTFDIDMESYNNYSKIYLSVTFA  395

Query  973   YTYGLSFATLAATVSHVALFHGRTI---WEQTKESVQDKFSDIHTRLMRKNYEPVPQWWF  803
             + YGLSFA L AT+SHV LFHG  I   W++T  S++++  D+HTR+M+KNYE VP+WWF
Sbjct  396   FQYGLSFAALTATISHVVLFHGEMIVQMWKKTTTSLKNQLGDVHTRIMKKNYEQVPEWWF  455

Query  802   YlllviivgvalvACQRFGGQLQLPVWGVLLAVLLSLIFTLPVGVITATTNQQTGLNVIA  623
               +L+++V +AL+AC+ FG QLQLP WG+LL++ ++L+FTLP+GVI ATT+ +TGLNVI 
Sbjct  456   VAILILMVMMALLACEGFGKQLQLPWWGILLSLSIALVFTLPIGVIEATTSARTGLNVIT  515

Query  622   ELIIGYMYPGRPLASVTFKMYGlsslsqslmflSDFKLGHYMKIPPKSMFMVQLVGTLIS  443
             EL+IG+ YPG+PLA+V FK YG +S+ Q+L FL DFKLGHYMKIPPKSMF+VQLVGT++S
Sbjct  516   ELVIGFTYPGKPLANVAFKTYGHTSMVQALGFLGDFKLGHYMKIPPKSMFIVQLVGTVVS  575

Query  442   CCVHFGTGWWLLTTVENICNPSKLPEGSQWTCPGDDVFYNASIIWGVVSPRRMFGNLGIY  263
               VHFGT WWLLT++ENIC+ S LP+GS WTCPGDD FYNASIIWGVV P+RMF N G+Y
Sbjct  576   LSVHFGTAWWLLTSIENICDESLLPKGSPWTCPGDDAFYNASIIWGVVGPKRMFTNDGVY  635

Query  262   QATNYFFLVGFLAPIPVWYLGRKYPEKRWVSLINMPILISGAEGIPIVKSVNYVCWFAVG  83
                N+FFL+G +AP+PVW L  K+P  +W+ LIN+PI+I GA  IP  +SVNY+ W  VG
Sbjct  636   PGMNWFFLIGLIAPVPVWLLSIKFPNHKWIKLINIPIIIVGASTIPPRRSVNYITWGIVG  695

Query  82    LYFNLYVYRKHKGWWARHNYILSAGLD  2
             ++FN YVYRK + WWARH YILSAGLD
Sbjct  696   MFFNFYVYRKFRVWWARHTYILSAGLD  722



>gb|AES81391.2| oligopeptide transporter OPT family protein [Medicago truncatula]
Length=773

 Score =   871 bits (2250),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 432/687 (63%), Positives = 547/687 (80%), Gaps = 3/687 (0%)
 Frame = -1

Query  2053  ENTGISAVESSADEINDSPVEEVRLTVPITDDPTMPCVTFRTWVLGVTSCVILAFLNQFF  1874
             +N  I   E+    I+DSP+E+VRLTVPITDDP+ P +TFRTWVLG+ SCV+LAF+NQF 
Sbjct  36    QNRVIEYAETDEYSIDDSPIEQVRLTVPITDDPSQPALTFRTWVLGLASCVLLAFMNQFL  95

Query  1873  GYRQNALYVSSVPAQIVVLPMGKLMAAYLPTKVVQIPGTKWSFSLNPGPFNIKEHVLITI  1694
             GY+ N L ++SV AQI+ LP+GKLMAA LP K +Q+P T  +FSLNPG F++KEHVLI+I
Sbjct  96    GYKTNPLKITSVSAQIITLPLGKLMAATLPIKTIQVPFTSLTFSLNPGSFSVKEHVLISI  155

Query  1693  FASSGSDFSYAVSIITMMKAFYYRDIHPLAAVLLTFSTQMLGYGLAGIFKKFLIDSPYMW  1514
             FA+SGS   YA++IIT++K FY+R+IHP+AA LL  STQ+LGYG AGIF++FL+DSPYMW
Sbjct  156   FATSGSSGVYAINIITIVKGFYHRNIHPIAAYLLALSTQILGYGWAGIFRRFLVDSPYMW  215

Query  1513  WPSNLVQVSLFRALHDVETRPKGGLTRLQFFIIVLVCSFAYYVVPNYLFPSLTALSLLCW  1334
             WP  LVQVSLFRA H+ E RPKGG +RLQFF +V V SFAYY+VP Y F +++ +S  C 
Sbjct  216   WPEILVQVSLFRAFHEKEKRPKGGTSRLQFFFLVFVASFAYYIVPGYFFQAISTVSFFCL  275

Query  1333  IWKNSVTAQQlgsglkglgigSFALDWATVAAFQGSPLVTPDFAIINMLIGYVLVAYIAI  1154
             IWK+S+TAQQ+GSG+KGLGIGSF LDW TVA F GSPL  P FAIIN++ G+VL  Y+ I
Sbjct  276   IWKDSITAQQIGSGMKGLGIGSFGLDWNTVAGFLGSPLAVPGFAIINIMAGFVLYMYVLI  335

Query  1153  PVWYWTNLFDAKKFPLFSSNVFDSNGQVYNISRVLNKKTFGFDQPGYDSYSNIYLSTAFV  974
             P+ YW N++DAKKFPL SS+ FDS G  YNI+R+LN KTF  D   Y++YS IYLS  F 
Sbjct  336   PIAYWNNVYDAKKFPLISSHTFDSTGATYNITRILNTKTFDIDMESYNNYSKIYLSVTFA  395

Query  973   YTYGLSFATLAATVSHVALFHGRTI---WEQTKESVQDKFSDIHTRLMRKNYEPVPQWWF  803
             + YGLSFA L AT+SHV LFHG  I   W++T  S++++  D+HTR+M+KNYE VP+WWF
Sbjct  396   FQYGLSFAALTATISHVVLFHGEMIVQMWKKTTTSLKNQLGDVHTRIMKKNYEQVPEWWF  455

Query  802   YlllviivgvalvACQRFGGQLQLPVWGVLLAVLLSLIFTLPVGVITATTNQQTGLNVIA  623
               +L+++V +AL+AC+ FG QLQLP WG+LL++ ++L+FTLP+GVI ATT+ +TGLNVI 
Sbjct  456   VAILILMVMMALLACEGFGKQLQLPWWGILLSLSIALVFTLPIGVIEATTSARTGLNVIT  515

Query  622   ELIIGYMYPGRPLASVTFKMYGlsslsqslmflSDFKLGHYMKIPPKSMFMVQLVGTLIS  443
             EL+IG+ YPG+PLA+V FK YG +S+ Q+L FL DFKLGHYMKIPPKSMF+VQLVGT++S
Sbjct  516   ELVIGFTYPGKPLANVAFKTYGHTSMVQALGFLGDFKLGHYMKIPPKSMFIVQLVGTVVS  575

Query  442   CCVHFGTGWWLLTTVENICNPSKLPEGSQWTCPGDDVFYNASIIWGVVSPRRMFGNLGIY  263
               VHFGT WWLLT++ENIC+ S LP+GS WTCPGDD FYNASIIWGVV P+RMF N G+Y
Sbjct  576   LSVHFGTAWWLLTSIENICDESLLPKGSPWTCPGDDAFYNASIIWGVVGPKRMFTNDGVY  635

Query  262   QATNYFFLVGFLAPIPVWYLGRKYPEKRWVSLINMPILISGAEGIPIVKSVNYVCWFAVG  83
                N+FFL+G +AP+PVW L  K+P  +W+ LIN+PI+I GA  IP  +SVNY+ W  VG
Sbjct  636   PGMNWFFLIGLIAPVPVWLLSIKFPNHKWIKLINIPIIIVGASTIPPRRSVNYITWGIVG  695

Query  82    LYFNLYVYRKHKGWWARHNYILSAGLD  2
             ++FN YVYRK + WWARH YILSAGLD
Sbjct  696   MFFNFYVYRKFRVWWARHTYILSAGLD  722



>ref|XP_002867556.1| ATOPT5 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH43815.1| ATOPT5 [Arabidopsis lyrata subsp. lyrata]
Length=753

 Score =   869 bits (2246),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 428/672 (64%), Positives = 542/672 (81%), Gaps = 3/672 (0%)
 Frame = -1

Query  2008  NDSPVEEVRLTVPITDDPTMPCVTFRTWVLGVTSCVILAFLNQFFGYRQNALYVSSVPAQ  1829
             NDSP+EEVRLTVPITDDP++P +TFRTW LG+ SCV+LAF+N FFGYR N L VSSV AQ
Sbjct  30    NDSPIEEVRLTVPITDDPSLPVLTFRTWFLGMVSCVVLAFVNNFFGYRSNQLMVSSVVAQ  89

Query  1828  IVVLPMGKLMAAYLPTKVVQIPGTKWSFSLNPGPFNIKEHVLITIFASSGSDFSYAVSII  1649
             IV LP+GKLMA  LPT  +++PGT WS SLNPGPFN+KEHVLITIFA++G+  +YA SII
Sbjct  90    IVTLPLGKLMATTLPTTKLRLPGTNWSCSLNPGPFNMKEHVLITIFANTGAGGAYATSII  149

Query  1648  TMMKAFYYRDIHPLAAVLLTFSTQMLGYGLAGIFKKFLIDSPYMWWPSNLVQVSLFRALH  1469
             T++KAFY+R+++P AA+LL  +TQ+LGYG AG+F+KFL+DSPYMWWP+NLVQVSLFRALH
Sbjct  150   TIVKAFYHRNLNPAAAMLLLQTTQLLGYGWAGMFRKFLVDSPYMWWPANLVQVSLFRALH  209

Query  1468  DVETRPKGGLTRLQFFIIVLVCSFAYYVVPNYLFPSLTALSLLCWIWKNSVTAQQlgsgl  1289
             + E + +G  TRL+FF+IV   SF YY+VP YLFPS+++LS +CWIW  SVTAQQ+GSGL
Sbjct  210   EKEEKREGKQTRLRFFLIVFFLSFTYYIVPGYLFPSISSLSFVCWIWTRSVTAQQIGSGL  269

Query  1288  kglgigSFALDWATVAAFQGSPLVTPDFAIINMLIGYVLVAYIAIPVWYWTNLFDAKKFP  1109
              GLGIGSF LDW+TVA F GSPL  P FAI N   G+V+  YI +P++YW+N ++AKKFP
Sbjct  270   HGLGIGSFGLDWSTVAGFLGSPLAVPFFAIANSFGGFVIFFYIILPIFYWSNAYEAKKFP  329

Query  1108  LFSSNVFDSNGQVYNISRVLNKKTFGFDQPGYDSYSNIYLSTAFVYTYGLSFATLAATVS  929
              ++S+ FD  GQ YN +R+LN KTF  D P Y+SYS +YLS  F   YGLSF TL AT+S
Sbjct  330   FYTSHAFDHTGQRYNTTRILNHKTFDIDLPAYESYSKLYLSILFALIYGLSFGTLTATIS  389

Query  928   HVALFHGRTIWEQTKE---SVQDKFSDIHTRLMRKNYEPVPQWWFYlllviivgvalvAC  758
             HVALF G+ IWE  K+   + +DKF D+HTRLM+KNY+ VPQWWF  +L +   +AL AC
Sbjct  390   HVALFDGKFIWELWKKATLATKDKFGDVHTRLMKKNYKEVPQWWFVAVLAVSFVLALYAC  449

Query  757   QRFGGQLQLPVWGVLLAVLLSLIFTLPVGVITATTNQQTGLNVIAELIIGYMYPGRPLAS  578
             + FG QLQLP WG+LLA  ++  FTLP+GVI ATTNQ+ GLNVI+ELIIG++YPG+PLA+
Sbjct  450   EGFGKQLQLPWWGLLLACAIAFTFTLPIGVILATTNQKMGLNVISELIIGFLYPGKPLAN  509

Query  577   VTFKMYGlsslsqslmflSDFKLGHYMKIPPKSMFMVQLVGTLISCCVHFGTGWWLLTTV  398
             VTFK YG  S+SQ+L F+ DFKLGHYMKIPP+SMF+VQLV T+++  V FGT WWLL++V
Sbjct  510   VTFKTYGTVSMSQALNFVGDFKLGHYMKIPPRSMFLVQLVATIVASTVSFGTTWWLLSSV  569

Query  397   ENICNPSKLPEGSQWTCPGDDVFYNASIIWGVVSPRRMFGNLGIYQATNYFFLVGFLAPI  218
             ENICN  KLP+ S WTCPGD+VFYNASIIWG++ P RMF + G+Y   N+FFL+G LAP+
Sbjct  570   ENICNTDKLPKSSPWTCPGDEVFYNASIIWGIIGPGRMFTSKGVYPGMNWFFLIGLLAPV  629

Query  217   PVWYLGRKYPEKRWVSLINMPILISGAEGIPIVKSVNYVCWFAVGLYFNLYVYRKHKGWW  38
             PVW+  RK+PEK+W+ LI++P++ SGA  +P+ K+V+Y  WF VG+ FN Y++R++KGWW
Sbjct  630   PVWFFARKFPEKKWIQLIHIPLIFSGANAMPMAKAVHYWSWFVVGIVFNYYIFRRYKGWW  689

Query  37    ARHNYILSAGLD  2
             ARHNYILSA LD
Sbjct  690   ARHNYILSAALD  701



>ref|NP_194389.1| oligopeptide transporter 5 [Arabidopsis thaliana]
 sp|Q9SUA4.1|OPT5_ARATH RecName: Full=Oligopeptide transporter 5; Short=AtOPT5 [Arabidopsis 
thaliana]
 gb|AAK26002.1|AF360292_1 putative isp4 protein [Arabidopsis thaliana]
 emb|CAB43855.1| isp4 like protein [Arabidopsis thaliana]
 emb|CAB79514.1| isp4 like protein [Arabidopsis thaliana]
 gb|AAK93725.1| putative isp4 protein [Arabidopsis thaliana]
 gb|AEE85224.1| oligopeptide transporter 5 [Arabidopsis thaliana]
Length=753

 Score =   868 bits (2243),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 422/672 (63%), Positives = 539/672 (80%), Gaps = 3/672 (0%)
 Frame = -1

Query  2008  NDSPVEEVRLTVPITDDPTMPCVTFRTWVLGVTSCVILAFLNQFFGYRQNALYVSSVPAQ  1829
             NDSP+EEVRLTVPITDDP++P +TFRTW LG+ SCV+LAF+N FFGYR N L VSSV AQ
Sbjct  30    NDSPIEEVRLTVPITDDPSLPVLTFRTWFLGMVSCVVLAFVNNFFGYRSNPLTVSSVVAQ  89

Query  1828  IVVLPMGKLMAAYLPTKVVQIPGTKWSFSLNPGPFNIKEHVLITIFASSGSDFSYAVSII  1649
             I+ LP+GKLMA  LPT  +++PGT WS SLNPGPFN+KEHVLITIFA++G+  +YA SI+
Sbjct  90    IITLPLGKLMATTLPTTKLRLPGTNWSCSLNPGPFNMKEHVLITIFANTGAGGAYATSIL  149

Query  1648  TMMKAFYYRDIHPLAAVLLTFSTQMLGYGLAGIFKKFLIDSPYMWWPSNLVQVSLFRALH  1469
             T++KAFY+R+++P AA+LL  +TQ+LGYG AG+F+K+L+DSPYMWWP+NLVQVSLFRALH
Sbjct  150   TIVKAFYHRNLNPAAAMLLVQTTQLLGYGWAGMFRKYLVDSPYMWWPANLVQVSLFRALH  209

Query  1468  DVETRPKGGLTRLQFFIIVLVCSFAYYVVPNYLFPSLTALSLLCWIWKNSVTAQQlgsgl  1289
             + E + +G  T+L+FF+IV   SF YY+VP YLFPS++ LS +CWIW  SVTAQQ+GSGL
Sbjct  210   EKEEKREGKQTKLRFFLIVFFLSFTYYIVPGYLFPSISYLSFVCWIWTRSVTAQQIGSGL  269

Query  1288  kglgigSFALDWATVAAFQGSPLVTPDFAIINMLIGYVLVAYIAIPVWYWTNLFDAKKFP  1109
              GLGIGSF LDW+TVA F GSPL  P FAI N   G+++  YI +P++YW+N ++AKKFP
Sbjct  270   HGLGIGSFGLDWSTVAGFLGSPLAVPFFAIANSFGGFIIFFYIILPIFYWSNAYEAKKFP  329

Query  1108  LFSSNVFDSNGQVYNISRVLNKKTFGFDQPGYDSYSNIYLSTAFVYTYGLSFATLAATVS  929
              ++S+ FD  GQ YN +R+LN+KTF  D P Y+SYS +YLS  F   YGLSF TL AT+S
Sbjct  330   FYTSHPFDHTGQRYNTTRILNQKTFNIDLPAYESYSKLYLSILFALIYGLSFGTLTATIS  389

Query  928   HVALFHGRTIWEQTKE---SVQDKFSDIHTRLMRKNYEPVPQWWFYlllviivgvalvAC  758
             HVALF G+ IWE  K+   + +DKF D+HTRLM+KNY+ VPQWWF  +L     +AL AC
Sbjct  390   HVALFDGKFIWELWKKATLTTKDKFGDVHTRLMKKNYKEVPQWWFVAVLAASFVLALYAC  449

Query  757   QRFGGQLQLPVWGVLLAVLLSLIFTLPVGVITATTNQQTGLNVIAELIIGYMYPGRPLAS  578
             + FG QLQLP WG+LLA  ++  FTLP+GVI ATTNQ+ GLNVI+ELIIG++YPG+PLA+
Sbjct  450   EGFGKQLQLPWWGLLLACAIAFTFTLPIGVILATTNQRMGLNVISELIIGFLYPGKPLAN  509

Query  577   VTFKMYGlsslsqslmflSDFKLGHYMKIPPKSMFMVQLVGTLISCCVHFGTGWWLLTTV  398
             V FK YG  S++Q+L F+ DFKLGHYMKIPP+SMF+VQLV T+++  V FGT WWLL++V
Sbjct  510   VAFKTYGSVSIAQALYFVGDFKLGHYMKIPPRSMFIVQLVATIVASTVSFGTTWWLLSSV  569

Query  397   ENICNPSKLPEGSQWTCPGDDVFYNASIIWGVVSPRRMFGNLGIYQATNYFFLVGFLAPI  218
             ENICN   LP+ S WTCPGD VFYNASIIWG++ P RMF + GIY   N+FFL+GFLAP+
Sbjct  570   ENICNTDMLPKSSPWTCPGDVVFYNASIIWGIIGPGRMFTSKGIYPGMNWFFLIGFLAPV  629

Query  217   PVWYLGRKYPEKRWVSLINMPILISGAEGIPIVKSVNYVCWFAVGLYFNLYVYRKHKGWW  38
             PVW+  RK+PEK+W+  I++P++ SGA  +P+ K+V+Y  WFAVG+ FN Y++R++KGWW
Sbjct  630   PVWFFARKFPEKKWIHQIHIPLIFSGANVMPMAKAVHYWSWFAVGIVFNYYIFRRYKGWW  689

Query  37    ARHNYILSAGLD  2
             ARHNYILSA LD
Sbjct  690   ARHNYILSAALD  701



>ref|XP_002298879.1| oligopeptide transporter OPT family protein [Populus trichocarpa]
 gb|EEE83684.1| oligopeptide transporter OPT family protein [Populus trichocarpa]
Length=756

 Score =   867 bits (2239),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 421/679 (62%), Positives = 547/679 (81%), Gaps = 3/679 (0%)
 Frame = -1

Query  2029  ESSADEINDSPVEEVRLTVPITDDPTMPCVTFRTWVLGVTSCVILAFLNQFFGYRQNALY  1850
             E+ A+E+ND+P+E+VRLTVPITDDPT   +TFRTWVLG+ +C++L+F+NQFF YR N L 
Sbjct  26    EAEAEEVNDNPIEQVRLTVPITDDPTQAVLTFRTWVLGLAACILLSFVNQFFQYRSNQLS  85

Query  1849  VSSVPAQIVVLPMGKLMAAYLPTKVVQIPGTKWSFSLNPGPFNIKEHVLITIFASSGSDF  1670
             + SV  QI+VLP+GK MAA LP K + IP TK SFSLNPGPFN+KEHVLITIFA+ G+  
Sbjct  86    IGSVTIQILVLPIGKFMAAKLPKKQISIPFTKCSFSLNPGPFNMKEHVLITIFANCGAGG  145

Query  1669  SYAVSIITMMKAFYYRDIHPLAAVLLTFSTQMLGYGLAGIFKKFLIDSPYMWWPSNLVQV  1490
              YAV IIT++KAFY+R +HP+AA+LL  +TQ+LGYG AG F+  L+DSPYMWWP+ L+QV
Sbjct  146   VYAVYIITIIKAFYHRGLHPVAAMLLAQTTQLLGYGWAGTFRNILVDSPYMWWPATLIQV  205

Query  1489  SLFRALHDVETRPKGGLTRLQFFIIVLVCSFAYYVVPNYLFPSLTALSLLCWIWKNSVTA  1310
             SLFRALH+ E R KG  TRLQFF +V V SFAYY+VP + FPSL+ALS +CWIWK S+TA
Sbjct  206   SLFRALHEKEKRKKGERTRLQFFAVVFVASFAYYIVPGHFFPSLSALSFVCWIWKRSITA  265

Query  1309  QQlgsglkglgigSFALDWATVAAFQGSPLVTPDFAIINMLIGYVLVAYIAIPVWYWTNL  1130
             QQ+G+GL GLGIGSF LDWATVA+F G+PL  P FAI+N ++G++LV Y+ +P+ YW+N 
Sbjct  266   QQIGAGLNGLGIGSFGLDWATVASFLGTPLAYPFFAIVNTMVGFILVMYVLVPIAYWSNF  325

Query  1129  FDAKKFPLFSSNVFDSNGQVYNISRVLNKKTFGFDQPGYDSYSNIYLSTAFVYTYGLSFA  950
              +AK+FP+F+S+ FD +GQ++NI+RVLN+KTF  +   Y++YS +YLS  F + YGLSFA
Sbjct  326   REAKRFPIFTSHTFDEDGQIFNITRVLNEKTFDLNLVEYENYSKLYLSIFFAFLYGLSFA  385

Query  949   TLAATVSHVALFHGRTI---WEQTKESVQDKFSDIHTRLMRKNYEPVPQWWFYlllviiv  779
             +L AT++HVALF G+ I   W++T  +V+D+FSD+HTR+M+KNY  VPQWWF  +LVI +
Sbjct  386   SLTATLTHVALFDGKNIINMWKKTTTAVKDEFSDVHTRIMKKNYAVVPQWWFTAILVISL  445

Query  778   gvalvACQRFGGQLQLPVWGVLLAVLLSLIFTLPVGVITATTNQQTGLNVIAELIIGYMY  599
              ++L+A + F  QLQLP WG+LLA  ++LIFTLPVGV+ ATTN Q GLNVI EL+IGYMY
Sbjct  446   ALSLLAVEGFDHQLQLPWWGLLLACFIALIFTLPVGVVQATTNMQIGLNVITELVIGYMY  505

Query  598   PGRPLASVTFKMYGlsslsqslmflSDFKLGHYMKIPPKSMFMVQLVGTLISCCVHFGTG  419
             PG+PLA+V FK YG  S++Q+L FL DFK+GHYMKIPPKSMF+VQLVGT++S  V+F T 
Sbjct  506   PGKPLANVAFKTYGYISMTQALSFLGDFKIGHYMKIPPKSMFIVQLVGTVVSSFVYFATA  565

Query  418   WWLLTTVENICNPSKLPEGSQWTCPGDDVFYNASIIWGVVSPRRMFGNLGIYQATNYFFL  239
             WWLL++VENICNP  LP+GS WTCPG DVFYNASIIWGVV P RMF + G+Y   N++FL
Sbjct  566   WWLLSSVENICNPDLLPDGSPWTCPGSDVFYNASIIWGVVGPLRMFTDKGVYPEQNWWFL  625

Query  238   VGFLAPIPVWYLGRKYPEKRWVSLINMPILISGAEGIPIVKSVNYVCWFAVGLYFNLYVY  59
             +GFLAP P+W+L RK+PEK+W+ LI++P+++S +  +P  K+V+Y  W  VG  FN  +Y
Sbjct  626   IGFLAPFPMWFLQRKFPEKKWIKLIHIPLILSASSAMPSAKTVHYWSWAFVGFIFNYIIY  685

Query  58    RKHKGWWARHNYILSAGLD  2
             R++KGWWA+H YILSA LD
Sbjct  686   RRYKGWWAKHTYILSAALD  704



>ref|XP_002298878.2| hypothetical protein POPTR_0001s37840g [Populus trichocarpa]
 gb|EEE83683.2| hypothetical protein POPTR_0001s37840g [Populus trichocarpa]
Length=747

 Score =   864 bits (2233),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 424/679 (62%), Positives = 546/679 (80%), Gaps = 3/679 (0%)
 Frame = -1

Query  2029  ESSADEINDSPVEEVRLTVPITDDPTMPCVTFRTWVLGVTSCVILAFLNQFFGYRQNALY  1850
             ++  +E ND+P+EEVRLTVPITDDPT   +T RTWVLG+ +C++L+F+NQFF YR N L 
Sbjct  17    KAEDEEGNDNPIEEVRLTVPITDDPTQAVLTVRTWVLGLAACILLSFVNQFFQYRSNQLS  76

Query  1849  VSSVPAQIVVLPMGKLMAAYLPTKVVQIPGTKWSFSLNPGPFNIKEHVLITIFASSGSDF  1670
             + SV  QI+VLP+GK MAA LP K V IP TKWSFSLNPGPF++KEHVLITIFA+ G+  
Sbjct  77    IGSVTIQILVLPIGKFMAAKLPKKQVSIPFTKWSFSLNPGPFSMKEHVLITIFANCGAGG  136

Query  1669  SYAVSIITMMKAFYYRDIHPLAAVLLTFSTQMLGYGLAGIFKKFLIDSPYMWWPSNLVQV  1490
              YAV IIT+ KAFY++ +HP+AA+LL  +TQ+LGYG AG+F+K L+DSPYMWWP+ LVQV
Sbjct  137   VYAVYIITITKAFYHKGLHPVAAMLLAQTTQLLGYGWAGMFRKILVDSPYMWWPATLVQV  196

Query  1489  SLFRALHDVETRPKGGLTRLQFFIIVLVCSFAYYVVPNYLFPSLTALSLLCWIWKNSVTA  1310
             SLFRALH+ E R KG  TRLQFF IV V SFAYY+VP + FPSL+ALS +CWIWK S+TA
Sbjct  197   SLFRALHEKERRKKGERTRLQFFAIVFVASFAYYIVPGHFFPSLSALSFVCWIWKRSITA  256

Query  1309  QQlgsglkglgigSFALDWATVAAFQGSPLVTPDFAIINMLIGYVLVAYIAIPVWYWTNL  1130
             QQ+G+GL GLGIGSF LDWATVA+F G+PL  P FAI N ++G++LV Y+ +P+ YW+N 
Sbjct  257   QQIGAGLNGLGIGSFGLDWATVASFLGTPLAYPFFAIANTMVGFILVMYVLVPIAYWSNF  316

Query  1129  FDAKKFPLFSSNVFDSNGQVYNISRVLNKKTFGFDQPGYDSYSNIYLSTAFVYTYGLSFA  950
              +AK+FP+F+S+ FD +GQ++NI+RVLN+KTF  +   Y++YS +YLS  F + YGLSFA
Sbjct  317   REAKRFPIFTSHTFDEDGQIFNITRVLNEKTFDLNLAEYENYSKLYLSIFFAFLYGLSFA  376

Query  949   TLAATVSHVALFHGRTI---WEQTKESVQDKFSDIHTRLMRKNYEPVPQWWFYlllviiv  779
             +L AT++HVALF G+ I   W++T  +V+D+FSD+HTR+M+KNY  VPQWWF ++LVI +
Sbjct  377   SLTATLTHVALFDGKNIIKMWKKTTTAVKDEFSDVHTRIMKKNYAVVPQWWFTVILVISL  436

Query  778   gvalvACQRFGGQLQLPVWGVLLAVLLSLIFTLPVGVITATTNQQTGLNVIAELIIGYMY  599
              ++L+A + F  QLQLP WG+LLA  ++LIFTLPVGV+ ATTN Q GLNVI EL+IGYMY
Sbjct  437   ALSLLAVEGFDRQLQLPWWGLLLACFIALIFTLPVGVVQATTNMQIGLNVITELVIGYMY  496

Query  598   PGRPLASVTFKMYGlsslsqslmflSDFKLGHYMKIPPKSMFMVQLVGTLISCCVHFGTG  419
             PG+PLA+V FK YG  S++Q+L FL DFK+GHYMKIPPKSMF+VQLVGT++S  V+F T 
Sbjct  497   PGKPLANVAFKTYGYISMTQALSFLGDFKIGHYMKIPPKSMFIVQLVGTVVSSTVYFATA  556

Query  418   WWLLTTVENICNPSKLPEGSQWTCPGDDVFYNASIIWGVVSPRRMFGNLGIYQATNYFFL  239
             WWLL++VENICNP  LP+GS WTCPG DVFYNASIIWGVV P RMF + G+Y   N++FL
Sbjct  557   WWLLSSVENICNPDLLPDGSPWTCPGSDVFYNASIIWGVVGPLRMFTDKGVYPEQNWWFL  616

Query  238   VGFLAPIPVWYLGRKYPEKRWVSLINMPILISGAEGIPIVKSVNYVCWFAVGLYFNLYVY  59
             VGFLAPIP W+L RK+PEK+W+ LI++P+++S    +P  K+V+Y  W +VG  FN  +Y
Sbjct  617   VGFLAPIPKWFLERKFPEKKWIKLIHIPLILSATASMPTAKTVHYWSWASVGFIFNYIIY  676

Query  58    RKHKGWWARHNYILSAGLD  2
             R++KGWWA+H YILSA LD
Sbjct  677   RRYKGWWAKHTYILSAALD  695



>ref|XP_011038843.1| PREDICTED: oligopeptide transporter 1 isoform X2 [Populus euphratica]
Length=746

 Score =   862 bits (2227),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 420/680 (62%), Positives = 545/680 (80%), Gaps = 3/680 (0%)
 Frame = -1

Query  2032  VESSADEINDSPVEEVRLTVPITDDPTMPCVTFRTWVLGVTSCVILAFLNQFFGYRQNAL  1853
             ++ + DE+ND+P+EEVRLTVPITDD T   +T RTWVLG+ +C++L+F+NQFF YR N L
Sbjct  15    IDKAEDEVNDNPIEEVRLTVPITDDTTQAVLTIRTWVLGLAACILLSFVNQFFQYRSNQL  74

Query  1852  YVSSVPAQIVVLPMGKLMAAYLPTKVVQIPGTKWSFSLNPGPFNIKEHVLITIFASSGSD  1673
              + SV  QI+VLP+GK MAA LP K V IP TKWSFSLNPGPF++KEHVLITIFA+ G+ 
Sbjct  75    SIGSVTIQILVLPIGKFMAAKLPKKQVSIPFTKWSFSLNPGPFSMKEHVLITIFANCGAG  134

Query  1672  FSYAVSIITMMKAFYYRDIHPLAAVLLTFSTQMLGYGLAGIFKKFLIDSPYMWWPSNLVQ  1493
               YAV IIT+ KAFY++ +HP+AA+LL  +TQ+LGYG AG+F+K L+DSPYMWWP+ LVQ
Sbjct  135   GVYAVYIITITKAFYHKGLHPVAAMLLAQTTQLLGYGWAGMFRKILVDSPYMWWPATLVQ  194

Query  1492  VSLFRALHDVETRPKGGLTRLQFFIIVLVCSFAYYVVPNYLFPSLTALSLLCWIWKNSVT  1313
             VSLFRALH+ E R KG  TRLQFF IV V SFAYY+VP + FPSL+ALS +CWIWK S+T
Sbjct  195   VSLFRALHEKEKRKKGERTRLQFFAIVFVASFAYYIVPGHFFPSLSALSFVCWIWKRSIT  254

Query  1312  AQQlgsglkglgigSFALDWATVAAFQGSPLVTPDFAIINMLIGYVLVAYIAIPVWYWTN  1133
             AQQ+G+GL GLGIGSF LDWATVA+F G+PL  P FAI+N ++G++LV Y+ +P+ YW+N
Sbjct  255   AQQIGAGLNGLGIGSFGLDWATVASFLGTPLAYPFFAIVNTMVGFILVMYVLVPIAYWSN  314

Query  1132  LFDAKKFPLFSSNVFDSNGQVYNISRVLNKKTFGFDQPGYDSYSNIYLSTAFVYTYGLSF  953
               +AK+FP+ +S+ FD +GQ++NI+RVLN+KTF  +   Y++YS +YLS  F + YGLSF
Sbjct  315   FREAKRFPIVTSHTFDEDGQIFNITRVLNEKTFDLNLVEYENYSKLYLSIFFAFLYGLSF  374

Query  952   ATLAATVSHVALFHGRTI---WEQTKESVQDKFSDIHTRLMRKNYEPVPQWWFYlllvii  782
             A+L AT++HVALF G+ I   W++T  +V+D+FSD+HTR+M+KNY  VPQWWF  +LVI 
Sbjct  375   ASLTATLTHVALFDGKNIIKMWKKTTTAVKDEFSDVHTRIMKKNYAVVPQWWFTAILVIS  434

Query  781   vgvalvACQRFGGQLQLPVWGVLLAVLLSLIFTLPVGVITATTNQQTGLNVIAELIIGYM  602
             + ++L+A + F  QLQLP WG+LLA  ++LIFTLPVGV+ ATTN Q GLNVI EL+IGYM
Sbjct  435   LALSLLAVEGFDRQLQLPWWGLLLACFIALIFTLPVGVVQATTNMQIGLNVITELVIGYM  494

Query  601   YPGRPLASVTFKMYGlsslsqslmflSDFKLGHYMKIPPKSMFMVQLVGTLISCCVHFGT  422
             YPG+PLA+V FK YG  S++Q+L FL DFK+GHYMKIPPKSMF+VQLVGT++S  V+F T
Sbjct  495   YPGKPLANVAFKTYGYISMTQALSFLGDFKIGHYMKIPPKSMFIVQLVGTVVSSTVYFAT  554

Query  421   GWWLLTTVENICNPSKLPEGSQWTCPGDDVFYNASIIWGVVSPRRMFGNLGIYQATNYFF  242
              WWLL++VENICNP  L +GS WTCPG DVFYNASIIWGVV P RMF + G+Y   N++F
Sbjct  555   AWWLLSSVENICNPDLLSDGSPWTCPGSDVFYNASIIWGVVGPLRMFTDKGVYPEQNWWF  614

Query  241   LVGFLAPIPVWYLGRKYPEKRWVSLINMPILISGAEGIPIVKSVNYVCWFAVGLYFNLYV  62
             L+GFLAP+P W+L RK+PEK+W+ LI++P+++S    +P  K+V+Y  W +VG  FN  +
Sbjct  615   LIGFLAPVPKWFLERKFPEKKWIKLIHIPLILSATASMPSAKTVHYWSWASVGFIFNYII  674

Query  61    YRKHKGWWARHNYILSAGLD  2
             YR++KGWWA+H YILSA LD
Sbjct  675   YRRYKGWWAKHTYILSAALD  694



>ref|XP_011038841.1| PREDICTED: oligopeptide transporter 1 isoform X1 [Populus euphratica]
 ref|XP_011038842.1| PREDICTED: oligopeptide transporter 1 isoform X1 [Populus euphratica]
Length=747

 Score =   861 bits (2224),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 418/679 (62%), Positives = 547/679 (81%), Gaps = 3/679 (0%)
 Frame = -1

Query  2029  ESSADEINDSPVEEVRLTVPITDDPTMPCVTFRTWVLGVTSCVILAFLNQFFGYRQNALY  1850
             ++ A+E+ND+P+E+VRLTVP TDDPT+  +TFRTWVLG+ +C++L+F+NQFF YR N L 
Sbjct  17    KAEAEEVNDNPIEQVRLTVPTTDDPTLAVLTFRTWVLGLAACILLSFVNQFFQYRSNQLS  76

Query  1849  VSSVPAQIVVLPMGKLMAAYLPTKVVQIPGTKWSFSLNPGPFNIKEHVLITIFASSGSDF  1670
             + SV  QI+VLP+GKLMAA LP K + IP TK SFSLNPGPFN+KEHVLITIFA+ G+  
Sbjct  77    IGSVTIQILVLPIGKLMAAKLPKKQISIPFTKCSFSLNPGPFNMKEHVLITIFANCGAGG  136

Query  1669  SYAVSIITMMKAFYYRDIHPLAAVLLTFSTQMLGYGLAGIFKKFLIDSPYMWWPSNLVQV  1490
              YAV IIT++KAFY+R +HP+AA+LL  +TQ+LGYG AG F+K L+DSPYMWWP+ L+QV
Sbjct  137   VYAVYIITIIKAFYHRGLHPVAAMLLAQTTQLLGYGWAGTFRKILVDSPYMWWPATLIQV  196

Query  1489  SLFRALHDVETRPKGGLTRLQFFIIVLVCSFAYYVVPNYLFPSLTALSLLCWIWKNSVTA  1310
             SLFRALH+ E R KG  TRLQFF IV V SFAYY+VP + FPSL+ALS +CWIWK S+TA
Sbjct  197   SLFRALHEKEKRKKGERTRLQFFAIVFVASFAYYIVPGHFFPSLSALSFVCWIWKRSITA  256

Query  1309  QQlgsglkglgigSFALDWATVAAFQGSPLVTPDFAIINMLIGYVLVAYIAIPVWYWTNL  1130
             QQ+G+GL GLGIGSF LDWATVA+F G+PL  P FAI+N ++G++LV Y+ +P+ YW+N 
Sbjct  257   QQIGAGLNGLGIGSFGLDWATVASFLGTPLAYPFFAIVNTMVGFILVMYVLVPIAYWSNF  316

Query  1129  FDAKKFPLFSSNVFDSNGQVYNISRVLNKKTFGFDQPGYDSYSNIYLSTAFVYTYGLSFA  950
              +A++FP+F+S+ FD +GQ +NI+RVLN+KTF  +   Y++YS +YLS  F + YGLSFA
Sbjct  317   REARRFPIFTSHTFDEDGQKFNITRVLNEKTFDLNLAEYENYSKLYLSIFFAFLYGLSFA  376

Query  949   TLAATVSHVALFHGRTI---WEQTKESVQDKFSDIHTRLMRKNYEPVPQWWFYlllviiv  779
             +L AT++HVALF G+ I   W++T  +V+D+FSD+HTR+M+KNY  VPQWWF  +LVI +
Sbjct  377   SLTATLTHVALFDGKNIINMWKKTTTAVKDEFSDVHTRIMKKNYAVVPQWWFTAILVISL  436

Query  778   gvalvACQRFGGQLQLPVWGVLLAVLLSLIFTLPVGVITATTNQQTGLNVIAELIIGYMY  599
              ++L+A + F  QLQLP WG+LLA  ++L+FTLPVGV+ ATTN Q GLNVI EL+IGYMY
Sbjct  437   ALSLLAVEGFDHQLQLPWWGLLLACFIALVFTLPVGVVQATTNMQIGLNVITELVIGYMY  496

Query  598   PGRPLASVTFKMYGlsslsqslmflSDFKLGHYMKIPPKSMFMVQLVGTLISCCVHFGTG  419
             PG+PLA+V FK YG  S++Q+L FL DFK+GHYMKIPPKSMF+VQLVGT++S  V+F T 
Sbjct  497   PGKPLANVAFKTYGYISMTQALSFLGDFKIGHYMKIPPKSMFIVQLVGTVVSSTVYFATA  556

Query  418   WWLLTTVENICNPSKLPEGSQWTCPGDDVFYNASIIWGVVSPRRMFGNLGIYQATNYFFL  239
             WWLL++VENICNP  L +GS WTCPG DVFYNASIIWGVV P RMF + G+Y   N++FL
Sbjct  557   WWLLSSVENICNPDLLSDGSPWTCPGSDVFYNASIIWGVVGPLRMFTDKGVYPEQNWWFL  616

Query  238   VGFLAPIPVWYLGRKYPEKRWVSLINMPILISGAEGIPIVKSVNYVCWFAVGLYFNLYVY  59
             +G LAP+P+W+L RK+PEK+W+ LI++P+++S +  +P  K+V+Y  W  VG  FN  +Y
Sbjct  617   IGLLAPVPMWFLQRKFPEKKWIKLIHIPLILSASSAMPSAKTVHYWSWAFVGFIFNYVIY  676

Query  58    RKHKGWWARHNYILSAGLD  2
             R++KGWWA+H YILSA LD
Sbjct  677   RRYKGWWAQHTYILSAALD  695



>gb|EYU33718.1| hypothetical protein MIMGU_mgv1a002007mg [Erythranthe guttata]
Length=727

 Score =   861 bits (2224),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 432/675 (64%), Positives = 544/675 (81%), Gaps = 7/675 (1%)
 Frame = -1

Query  2017  DEINDSPVEEVRLTVPITDDPTMPCVTFRTWVLGVTSCVILAFLNQFFGYRQNALYVSSV  1838
             DE N  P+E+VRLTVP TDDPTMP +TFRTW LG+TSCV+LAF+NQFFGYRQN+LY+SSV
Sbjct  5     DEENYHPIEQVRLTVPPTDDPTMPALTFRTWTLGLTSCVMLAFVNQFFGYRQNSLYISSV  64

Query  1837  PAQIVVLPMGKLMAAYLPTKVVQIPGTKWSFSLNPGPFNIKEHVLITIFASSGSDFSYAV  1658
              AQIV LP+GK MA  LP K   + G  WSFS NPGPFN+KEHVLITIFAS GS   YAV
Sbjct  65    TAQIVTLPLGKFMARVLPEKKFAVAG--WSFSFNPGPFNLKEHVLITIFASCGSSGVYAV  122

Query  1657  SIITMMKAFYYRDIHPLAAVLLTFSTQMLGYGLAGIFKKFLIDSPYMWWPSNLVQVSLFR  1478
             SI+T++KAFY+R +HP+AA LL  +TQMLGYG AGIF+K L+DSPYMWWP N+V VSLFR
Sbjct  123   SIVTIVKAFYHRQLHPVAAWLLAQTTQMLGYGWAGIFRKILVDSPYMWWPDNMVAVSLFR  182

Query  1477  ALHDVETRPKGGLTRLQFFIIVLVCSFAYYVVPNYLFPSLTALSLLCWIWKNSVTAQQlg  1298
             ALH+ E RPKGGL+RLQFF+IV V SFAYY++P Y FPS++A+S+LC IWK+S+  QQLG
Sbjct  183   ALHEEEARPKGGLSRLQFFLIVFVTSFAYYIIPAYFFPSISAVSVLCLIWKDSIFPQQLG  242

Query  1297  sglkglgigSFALDWATVAAFQGSPLVTPDFAIINMLIGYVLVAYIAIPVWYWTNLFDAK  1118
             SGL G+GIGSFA DWATV+ F G+P+ TP FAIIN+LIG+VLV YI  P+ Y+ N++ A+
Sbjct  243   SGLHGMGIGSFAFDWATVS-FIGNPISTPAFAIINILIGFVLVMYIMTPLTYFNNVYGAR  301

Query  1117  KFPLFSSNVFDSNGQVYNISRVLNKKTFGFDQPGYDSYSNIYLSTAFVYTYGLSFATLAA  938
             KFP+FSS+ FD  GQ YNISRVLN++TF  D  GY SYS +YLS  F +TYGL FA+L+A
Sbjct  302   KFPIFSSHTFDYAGQPYNISRVLNEETFNLDLVGYASYSKLYLSVFFAFTYGLGFASLSA  361

Query  937   TVSHVALFHGRTIWE---QTKESVQDKFSDIHTRLMRKNYEPVPQWWFYlllviivgval  767
             T++HVAL HG+TIW    + K +++ K  D+HTRLM+ NYE VP WWFY +LV++ G++L
Sbjct  362   TITHVALHHGKTIWTLWTKAKSNLKGKM-DVHTRLMKTNYEAVPDWWFYSILVVVFGLSL  420

Query  766   vACQRFGGQLQLPVWGVLLAVLLSLIFTLPVGVITATTNQQTGLNVIAELIIGYMYPGRP  587
              AC+ F  QLQLP WG++LA  ++L FTLPVG+I ATTNQQ GLN+I E++IGY+YPGRP
Sbjct  421   WACEGFNKQLQLPWWGLMLACAMALFFTLPVGIIQATTNQQIGLNIITEMVIGYIYPGRP  480

Query  586   LASVTFKMYGlsslsqslmflSDFKLGHYMKIPPKSMFMVQLVGTLISCCVHFGTGWWLL  407
             LA+V FK YG  S+SQ+L FLSDFK+GHYMKIPPKSMF+ QLVGT+++  V+F T WWLL
Sbjct  481   LANVAFKTYGYISMSQALGFLSDFKIGHYMKIPPKSMFIAQLVGTVVASSVYFSTAWWLL  540

Query  406   TTVENICNPSKLPEGSQWTCPGDDVFYNASIIWGVVSPRRMFGNLGIYQATNYFFLVGFL  227
             T+VE IC+P+ LP+GS WTCPGDDVFYNASIIWGV+ P RMF   G+Y A N++FL G +
Sbjct  541   TSVEYICDPANLPDGSPWTCPGDDVFYNASIIWGVIGPLRMFTGQGVYGAMNWWFLAGAI  600

Query  226   APIPVWYLGRKYPEKRWVSLINMPILISGAEGIPIVKSVNYVCWFAVGLYFNLYVYRKHK  47
             AP+P + LG+KYPEK+WV LIN+P+++S    +P  ++VNY+ W   GL+FN+Y+YR HK
Sbjct  601   APVPAYLLGKKYPEKKWVQLINVPLILSATMSMPPARAVNYIMWGVAGLFFNVYIYRLHK  660

Query  46    GWWARHNYILSAGLD  2
              WWARH Y+++A L+
Sbjct  661   RWWARHAYVMAAALN  675



>gb|KFK29177.1| hypothetical protein AALP_AA7G099400 [Arabis alpina]
Length=755

 Score =   860 bits (2223),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 419/688 (61%), Positives = 535/688 (78%), Gaps = 3/688 (0%)
 Frame = -1

Query  2056  MENTGISAVESSADEINDSPVEEVRLTVPITDDPTMPCVTFRTWVLGVTSCVILAFLNQF  1877
             +  + I       +E NDSP+EEVRLTVPITDDPT P +TFRTW+LG+ SC++LAF+NQF
Sbjct  16    ISESNIVITGEEGNEENDSPIEEVRLTVPITDDPTQPVLTFRTWLLGIVSCMVLAFVNQF  75

Query  1876  FGYRQNALYVSSVPAQIVVLPMGKLMAAYLPTKVVQIPGTKWSFSLNPGPFNIKEHVLIT  1697
             FGYR N L VSSV AQIV LP+GKLMA  LPT+ +++P T WS +LNPGPFN+KEHVLIT
Sbjct  76    FGYRSNQLMVSSVVAQIVTLPLGKLMATTLPTRKIRLPSTNWSGTLNPGPFNMKEHVLIT  135

Query  1696  IFASSGSDFSYAVSIITMMKAFYYRDIHPLAAVLLTFSTQMLGYGLAGIFKKFLIDSPYM  1517
             IFA++GS  +YA +IIT++KAFY+RD++P AA+LL  +TQ+LGYG AG+F+KFL+DSPYM
Sbjct  136   IFANTGSGGAYATNIITIVKAFYHRDLNPAAAMLLVQTTQLLGYGWAGMFRKFLVDSPYM  195

Query  1516  WWPSNLVQVSLFRALHDVETRPKGGLTRLQFFIIVLVCSFAYYVVPNYLFPSLTALSLLC  1337
             WWPSNLVQVSLFRALH+ E + +G  TRL+FF+IV   SF YY++P Y+FPS+++LS +C
Sbjct  196   WWPSNLVQVSLFRALHEKEEKREGKQTRLRFFLIVFFISFVYYIIPGYIFPSISSLSFIC  255

Query  1336  WIWKNSVTAQQlgsglkglgigSFALDWATVAAFQGSPLVTPDFAIINMLIGYVLVAYIA  1157
             WIW  SVTAQQ+GSGL GLGIGS  LDW+TVA F GSPL  P FAI N   G+ +  YI 
Sbjct  256   WIWTRSVTAQQIGSGLHGLGIGSLGLDWSTVAGFLGSPLAVPFFAIANFFWGFFIYFYII  315

Query  1156  IPVWYWTNLFDAKKFPLFSSNVFDSNGQVYNISRVLNKKTFGFDQPGYDSYSNIYLSTAF  977
             +P++YW+N + AKKFP ++S  FD  GQ YNI+ +LN KTF  +   Y +YS ++LS  F
Sbjct  316   LPLFYWSNAYQAKKFPFYTSQTFDHTGQRYNITHILNLKTFDINLSAYQNYSKLHLSVMF  375

Query  976   VYTYGLSFATLAATVSHVALFHGRTIWEQTKE---SVQDKFSDIHTRLMRKNYEPVPQWW  806
                YGLSF TL AT+SHVA F G+ IW   K+   + ++KF D+HTRLM+KNY+ VPQWW
Sbjct  376   ALIYGLSFGTLTATISHVAFFDGKFIWGMWKKVTMATKEKFGDVHTRLMKKNYKEVPQWW  435

Query  805   FYlllviivgvalvACQRFGGQLQLPVWGVLLAVLLSLIFTLPVGVITATTNQQTGLNVI  626
             F ++L +   +AL  C+ FG QLQLP WG+LLA  ++  FTLP+GVI ATTNQQ GLNVI
Sbjct  436   FLVVLAVSFVLALYTCEGFGKQLQLPWWGLLLACAIAFTFTLPIGVILATTNQQMGLNVI  495

Query  625   AELIIGYMYPGRPLASVTFKMYGlsslsqslmflSDFKLGHYMKIPPKSMFMVQLVGTLI  446
              ELIIGY+YPG+PLA+VTFK YG  S+SQ+L F+ DFKLGHYMKIPP+SMF+VQLV T++
Sbjct  496   TELIIGYLYPGKPLANVTFKTYGYMSMSQALYFVGDFKLGHYMKIPPRSMFLVQLVATMV  555

Query  445   SCCVHFGTGWWLLTTVENICNPSKLPEGSQWTCPGDDVFYNASIIWGVVSPRRMFGNLGI  266
             +  V FGT WWLL++VENICN  KLP+ S WTCP D+VFYNASIIWGV+ P RMF + G+
Sbjct  556   ASTVCFGTTWWLLSSVENICNRDKLPKSSPWTCPADEVFYNASIIWGVIGPGRMFTSKGV  615

Query  265   YQATNYFFLVGFLAPIPVWYLGRKYPEKRWVSLINMPILISGAEGIPIVKSVNYVCWFAV  86
             Y   N+FFL+GFLAPIPVW+  RK+PEK+W+  I++P++ S    +P+ K+V+Y  W  V
Sbjct  616   YPGMNWFFLIGFLAPIPVWFFARKFPEKKWIKQIHIPLIFSATSAMPMAKAVHYWSWVIV  675

Query  85    GLYFNLYVYRKHKGWWARHNYILSAGLD  2
             G+ FN Y++R++KGWWARHNYILSA LD
Sbjct  676   GVIFNYYIFRRYKGWWARHNYILSAALD  703



>ref|XP_011097739.1| PREDICTED: oligopeptide transporter 1-like [Sesamum indicum]
Length=755

 Score =   858 bits (2217),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 420/680 (62%), Positives = 547/680 (80%), Gaps = 4/680 (1%)
 Frame = -1

Query  2032  VESSADEINDSPVEEVRLTVPITDDPTMPCVTFRTWVLGVTSCVILAFLNQFFGYRQNAL  1853
             V S  +E  +SP+E+VRLTVP TDDP++P +TFRTW LG+  CV+LAFLNQFF YRQNAL
Sbjct  25    VISEVEENENSPIEQVRLTVPATDDPSLPVLTFRTWCLGLIFCVVLAFLNQFFSYRQNAL  84

Query  1852  YVSSVPAQIVVLPMGKLMAAYLPTKVVQIPGTKWSFSLNPGPFNIKEHVLITIFASSGSD  1673
             ++  V AQI+ LP+GK MA  LPT+   +P  KWSFSLNPGPFN+KEHVLI+IFA+ GS 
Sbjct  85    FIYPVTAQIITLPLGKFMARVLPTRKFTVPLVKWSFSLNPGPFNLKEHVLISIFANCGSA  144

Query  1672  FSYAVSIITMMKAFYYRDIHPLAAVLLTFSTQMLGYGLAGIFKKFLIDSPYMWWPSNLVQ  1493
               YAVSIIT++KAFY R +HPLAA +L  +TQMLGYG AGIF++ L+DSPYMWWP N+V 
Sbjct  145   GVYAVSIITIVKAFYRRQLHPLAAFMLAQTTQMLGYGWAGIFRRILVDSPYMWWPENMVA  204

Query  1492  VSLFRALHDVETRPKGGLTRLQFFIIVLVCSFAYYVVPNYLFPSLTALSLLCWIWKNSVT  1313
             VSLFRALH+ + RPKGGL+RLQFF++V V SFAYY+VP YLFPS++++S+LC IWKNSV 
Sbjct  205   VSLFRALHEEDVRPKGGLSRLQFFLVVFVSSFAYYLVPAYLFPSISSISVLCLIWKNSVF  264

Query  1312  AQQlgsglkglgigSFALDWATVAAFQGSPLVTPDFAIINMLIGYVLVAYIAIPVWYWTN  1133
              QQLGSGL+G+GIGSFALDW+ + +F G+P+ +P FAIIN L+G+ LV Y+ +P+ Y+ N
Sbjct  265   PQQLGSGLRGMGIGSFALDWSAIVSFVGNPISSPGFAIINTLVGFFLVMYVMLPLTYFNN  324

Query  1132  LFDAKKFPLFSSNVFDSNGQVYNISRVLNKKTFGFDQPGYDSYSNIYLSTAFVYTYGLSF  953
             +FDAKKFP+FSS+ FD  G  YNISRVLN +TF  D  GY+ YS +YLS  F +TYGL F
Sbjct  325   VFDAKKFPIFSSHTFDHYGNPYNISRVLNPETFNLDMAGYEGYSKLYLSVFFAFTYGLGF  384

Query  952   ATLAATVSHVALFHGRTI---WEQTKESVQDKFSDIHTRLMRKNYEPVPQWWFYlllvii  782
             A+L+AT++HVAL HG+TI   W + K S+  K  D+HTR+M+KNYE VP+WWF ++LV++
Sbjct  385   ASLSATITHVALHHGKTIWSLWSKAKSSLNRKM-DVHTRIMKKNYEQVPEWWFVIILVVV  443

Query  781   vgvalvACQRFGGQLQLPVWGVLLAVLLSLIFTLPVGVITATTNQQTGLNVIAELIIGYM  602
               ++LVAC+ F  QLQLP WG+++A +++L FTLP+G+I ATTN Q GLN+I E+IIGY+
Sbjct  444   FCLSLVACEGFDKQLQLPWWGLIMACIMALFFTLPIGIIQATTNMQIGLNIITEMIIGYI  503

Query  601   YPGRPLASVTFKMYGlsslsqslmflSDFKLGHYMKIPPKSMFMVQLVGTLISCCVHFGT  422
             YPGRPLA+V FK YG  S++Q+L FLSDFKLG YMKIPPKSMF+ QLVGT+++  V+FGT
Sbjct  504   YPGRPLANVAFKTYGYISMAQALGFLSDFKLGTYMKIPPKSMFIAQLVGTIVASSVYFGT  563

Query  421   GWWLLTTVENICNPSKLPEGSQWTCPGDDVFYNASIIWGVVSPRRMFGNLGIYQATNYFF  242
              WWLLT++++IC+P  LPEGS WTCPGDDVFYNASIIWGV+ P RMF NLG+Y + N++F
Sbjct  564   AWWLLTSIKHICDPHNLPEGSPWTCPGDDVFYNASIIWGVIGPLRMFTNLGVYGSMNWWF  623

Query  241   LVGFLAPIPVWYLGRKYPEKRWVSLINMPILISGAEGIPIVKSVNYVCWFAVGLYFNLYV  62
             LVG + P+PV+ L RKYPEK+W+ LIN+P+++     +P  ++VN++ W A G++FN+Y+
Sbjct  624   LVGAVLPVPVYLLARKYPEKKWIQLINVPLILGSTMSMPPARAVNFIMWGAAGIFFNIYI  683

Query  61    YRKHKGWWARHNYILSAGLD  2
             YR HK WWARH YIL+A L+
Sbjct  684   YRVHKKWWARHAYILAAALN  703



>ref|XP_009137603.1| PREDICTED: oligopeptide transporter 5-like [Brassica rapa]
Length=752

 Score =   857 bits (2214),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 429/683 (63%), Positives = 539/683 (79%), Gaps = 2/683 (0%)
 Frame = -1

Query  2050  NTGISAVESSADEINDSPVEEVRLTVPITDDPTMPCVTFRTWVLGVTSCVILAFLNQFFG  1871
              + I   +    E NDSP+EEVRLTVPITDDP+ P +TFRTW LG++SCV+LAF+N FFG
Sbjct  20    ESNIVISDEEGVEENDSPIEEVRLTVPITDDPSQPVLTFRTWFLGMSSCVVLAFVNIFFG  79

Query  1870  YRQNALYVSSVPAQIVVLPMGKLMAAYLPTKVVQIPGTKWSFSLNPGPFNIKEHVLITIF  1691
             YR N L VSSV AQIV LP+GKLMA  LPT+  ++PGT WS SLNPGPFN+KEHVLITIF
Sbjct  80    YRSNPLMVSSVVAQIVTLPLGKLMATTLPTRKFRLPGTSWSGSLNPGPFNMKEHVLITIF  139

Query  1690  ASSGSDFSYAVSIITMMKAFYYRDIHPLAAVLLTFSTQMLGYGLAGIFKKFLIDSPYMWW  1511
             A++G+  +YA SIIT++KAFY+R+++P AA+LL  +TQ+LGYG AG+F+KFL++SPYMWW
Sbjct  140   ANTGAGGAYATSIITIVKAFYHRNLNPTAAMLLLQTTQLLGYGWAGMFRKFLVESPYMWW  199

Query  1510  PSNLVQVSLFRALHDVETRPKGGLTRLQFFIIVLVCSFAYYVVPNYLFPSLTALSLLCWI  1331
             PSNLVQVSLFRALH+ E + +G  TRL+FF+IV   SFAYY++P Y+FPS+++LS LCWI
Sbjct  200   PSNLVQVSLFRALHEKEEKREGQQTRLRFFLIVFFLSFAYYIIPGYIFPSISSLSFLCWI  259

Query  1330  WKNSVTAQQlgsglkglgigSFALDWATVAAFQGSPLVTPDFAIINMLIGYVLVAYIAIP  1151
             W  SVTAQQ+GSGL+GLGIGSF+LDW+ VA F GSPL  P FAI N   G+++  YI +P
Sbjct  260   WIRSVTAQQIGSGLQGLGIGSFSLDWSVVAGFLGSPLAVPFFAIANFFAGFLIFFYIVLP  319

Query  1150  VWYWTNLFDAKKFPLFSSNVFDSNGQVYNISRVLNKKTFGFDQPGYDSYSNIYLSTAFVY  971
             ++YW+N +DAKKFPLF+S  FD  GQ +N +R+LN+KTF  +   Y+SYS +YLS  F  
Sbjct  320   IFYWSNAYDAKKFPLFTSTTFDHTGQKFNTTRILNQKTFDINLAAYESYSKLYLSVVFAL  379

Query  970   TYGLSFATLAATVSHVALFHGRTIWEQTKESVQDKFSDIHTRLMRKNYEPVPQWWFYlll  791
              YGLSF TL ATVSHVALF G+ IW   K+S   K  D+HTRLM+KNY+ VP WWF  +L
Sbjct  380   IYGLSFGTLTATVSHVALFDGKFIWGMWKKST--KAGDVHTRLMKKNYKEVPHWWFVTVL  437

Query  790   viivgvalvACQRFGGQLQLPVWGVLLAVLLSLIFTLPVGVITATTNQQTGLNVIAELII  611
              +   +AL AC+ FG QLQLP WG+LLA  ++  FTLP+GVI ATTNQQ GLNVIAELII
Sbjct  438   FLSFVLALYACEGFGKQLQLPWWGLLLACSVAFTFTLPIGVIQATTNQQMGLNVIAELII  497

Query  610   GYMYPGRPLASVTFKMYGlsslsqslmflSDFKLGHYMKIPPKSMFMVQLVGTLISCCVH  431
             GY+YPG+PLA+V FK YG  S+SQ+L F+ DFKLGHYMKIPP+SMF+VQLV T++S  V 
Sbjct  498   GYLYPGKPLANVAFKTYGYVSMSQALSFVGDFKLGHYMKIPPRSMFLVQLVATMVSTTVC  557

Query  430   FGTGWWLLTTVENICNPSKLPEGSQWTCPGDDVFYNASIIWGVVSPRRMFGNLGIYQATN  251
             FGT WWLL++V+NIC   KLP GS WTCPGD VFYNASIIWG++ P RMF + G+Y   N
Sbjct  558   FGTTWWLLSSVDNICVQEKLPTGSPWTCPGDQVFYNASIIWGIIGPGRMFTSKGVYSGMN  617

Query  250   YFFLVGFLAPIPVWYLGRKYPEKRWVSLINMPILISGAEGIPIVKSVNYVCWFAVGLYFN  71
             +FFL+GFLAP+PVW+  RK+PEK+W+  I++P++ S A  +P  K+VNY  WF VG+ FN
Sbjct  618   WFFLIGFLAPVPVWFFARKFPEKKWIKQIHVPLIFSAASAMPRAKAVNYWSWFIVGVVFN  677

Query  70    LYVYRKHKGWWARHNYILSAGLD  2
              Y++R++KGWWARHNYILSAGLD
Sbjct  678   YYIFRRYKGWWARHNYILSAGLD  700



>gb|EPS68970.1| hypothetical protein M569_05793, partial [Genlisea aurea]
Length=724

 Score =   856 bits (2212),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 413/673 (61%), Positives = 547/673 (81%), Gaps = 1/673 (0%)
 Frame = -1

Query  2020  ADEINDSPVEEVRLTVPITDDPTMPCVTFRTWVLGVTSCVILAFLNQFFGYRQNALYVSS  1841
             A++ ND P+E+VRLTVP TDDP++P +TFRTW LG+ SC +L+FLNQFFGYRQN + +SS
Sbjct  1     AEDDNDCPIEQVRLTVPPTDDPSLPALTFRTWTLGLISCALLSFLNQFFGYRQNPIGISS  60

Query  1840  VPAQIVVLPMGKLMAAYLPTKVVQIPGTKWSFSLNPGPFNIKEHVLITIFASSGSDFSYA  1661
             V AQIV LP+GK MA  LPT+   +PGT W FS NPGPFN+KEHVLITIFAS G+   YA
Sbjct  61    VTAQIVTLPLGKFMARVLPTRRFGVPGTDWKFSFNPGPFNLKEHVLITIFASCGASGVYA  120

Query  1660  VSIITMMKAFYYRDIHPLAAVLLTFSTQMLGYGLAGIFKKFLIDSPYMWWPSNLVQVSLF  1481
             +SI+T++KAFY R+IH +AA LL+ +TQ+LGYG AGIF++ L+DSPYMWWP +++QVSLF
Sbjct  121   LSIVTIVKAFYKREIHSVAAWLLSQTTQLLGYGWAGIFRRLLVDSPYMWWPDSMIQVSLF  180

Query  1480  RALHDVETRPKGGLTRLQFFIIVLVCSFAYYVVPNYLFPSLTALSLLCWIWKNSVTAQQl  1301
             RALH+ +TRPKGGL+RLQFF++V V SFAYY+VP Y FP+++++S+LC IWKNS   QQ+
Sbjct  181   RALHEEDTRPKGGLSRLQFFLMVFVSSFAYYIVPGYFFPTISSISVLCLIWKNSTLIQQI  240

Query  1300  gsglkglgigSFALDWATVAAFQGSPLVTPDFAIINMLIGYVLVAYIAIPVWYWTNLFDA  1121
             GSGL G+G+GSFALDWAT++ + G+P+ +P FAI+N L+G+ LV Y+ +P+ Y+ N++DA
Sbjct  241   GSGLHGMGVGSFALDWATMS-YIGNPIASPGFAIVNSLVGFFLVMYVMLPITYFNNIYDA  299

Query  1120  KKFPLFSSNVFDSNGQVYNISRVLNKKTFGFDQPGYDSYSNIYLSTAFVYTYGLSFATLA  941
             +KFP+FSS+ FD++G+ YNISRVL+ KTF  D  GYDSYS +YLS  F +TYGL FA+LA
Sbjct  300   RKFPIFSSHTFDTHGRPYNISRVLDSKTFSLDVAGYDSYSKLYLSVFFSFTYGLGFASLA  359

Query  940   ATVSHVALFHGRTIWEQTKESVQDKFSDIHTRLMRKNYEPVPQWWFYlllviivgvalvA  761
             AT++HVAL+HG+TIW+   ++      DIH RLM+KNYE VP+WWF+ +L+ + G++L A
Sbjct  360   ATITHVALYHGKTIWKLWSKAKTSVKPDIHGRLMKKNYESVPEWWFHGILIAVFGLSLFA  419

Query  760   CQRFGGQLQLPVWGVLLAVLLSLIFTLPVGVITATTNQQTGLNVIAELIIGYMYPGRPLA  581
              + FG QLQLP WG++ A +++L FTLPVG+I ATTNQQ GLN+I E++IGY+YPGRPLA
Sbjct  420   IEGFGKQLQLPWWGLIAACVMALFFTLPVGIIQATTNQQIGLNIITEMVIGYVYPGRPLA  479

Query  580   SVTFKMYGlsslsqslmflSDFKLGHYMKIPPKSMFMVQLVGTLISCCVHFGTGWWLLTT  401
             +V+FK YG  S+ Q+L FL DFKLGHYMKIPPKSMF+VQLVGT++S  V+F T WWLLTT
Sbjct  480   NVSFKTYGYISMVQALGFLRDFKLGHYMKIPPKSMFIVQLVGTVVSSSVYFHTAWWLLTT  539

Query  400   VENICNPSKLPEGSQWTCPGDDVFYNASIIWGVVSPRRMFGNLGIYQATNYFFLVGFLAP  221
             VENICNP+ LP GS WTCPGDDVFYNASIIWGV+ P RMF + G+Y A N++FLVG + P
Sbjct  540   VENICNPALLPAGSPWTCPGDDVFYNASIIWGVIGPMRMFTSKGVYGALNWWFLVGGVLP  599

Query  220   IPVWYLGRKYPEKRWVSLINMPILISGAEGIPIVKSVNYVCWFAVGLYFNLYVYRKHKGW  41
             IP++ L RKYPE++W+ L+N+P+++S    +P  ++VNY+ W  VG++FN+Y++R  K W
Sbjct  600   IPIYLLARKYPERKWLQLVNVPLILSATMSMPPARAVNYIMWGIVGIFFNIYLFRLFKKW  659

Query  40    WARHNYILSAGLD  2
             WARH Y+L+A LD
Sbjct  660   WARHAYVLAAALD  672



>ref|XP_009126974.1| PREDICTED: oligopeptide transporter 1 [Brassica rapa]
 ref|XP_009126976.1| PREDICTED: oligopeptide transporter 1 [Brassica rapa]
 emb|CDY64979.1| BnaA02g35410D [Brassica napus]
Length=753

 Score =   850 bits (2196),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 420/680 (62%), Positives = 532/680 (78%), Gaps = 3/680 (0%)
 Frame = -1

Query  2032  VESSADEINDSPVEEVRLTVPITDDPTMPCVTFRTWVLGVTSCVILAFLNQFFGYRQNAL  1853
             +    +E NDSP+EEVRLTVPITDDPT+P +TFRTW LG+ SC++LAF+NQFF +R N L
Sbjct  22    IHGEEEEENDSPIEEVRLTVPITDDPTLPVLTFRTWFLGLLSCILLAFVNQFFSFRSNQL  81

Query  1852  YVSSVPAQIVVLPMGKLMAAYLPTKVVQIPGTKWSFSLNPGPFNIKEHVLITIFASSGSD  1673
             +VSSV AQIV LP+GKLMAA LPTK    PGT WS+S NPGPFN+KEHVLI+IFA++G+ 
Sbjct  82    WVSSVAAQIVTLPLGKLMAATLPTKKFGFPGTNWSWSFNPGPFNVKEHVLISIFANTGAG  141

Query  1672  FSYAVSIITMMKAFYYRDIHPLAAVLLTFSTQMLGYGLAGIFKKFLIDSPYMWWPSNLVQ  1493
              +YA  IIT++KAFY+R +   AA+LLT +TQ+LGYG AGIF+KFL++SPYMWWPSNLVQ
Sbjct  142   GAYATGIITIVKAFYHRQLSVAAAMLLTQTTQLLGYGWAGIFRKFLVESPYMWWPSNLVQ  201

Query  1492  VSLFRALHDVETRPKGGLTRLQFFIIVLVCSFAYYVVPNYLFPSLTALSLLCWIWKNSVT  1313
             VSLFRALH+ E   KG  TRL+FF++V   SFAYY++P YLFPS++A+S +CWIWK+SVT
Sbjct  202   VSLFRALHEKEELQKGQQTRLKFFLVVFGISFAYYIIPGYLFPSISAISFVCWIWKSSVT  261

Query  1312  AQQlgsglkglgigSFALDWATVAAFQGSPLVTPDFAIINMLIGYVLVAYIAIPVWYWTN  1133
             AQ LGSGLKGLGIGSF LDW+TVA F GSPL  P FAI N   G+ +  YI +P++YW+N
Sbjct  262   AQILGSGLKGLGIGSFGLDWSTVAGFLGSPLAVPFFAIANFFAGFFIFLYIVLPIFYWSN  321

Query  1132  LFDAKKFPLFSSNVFDSNGQVYNISRVLNKKTFGFDQPGYDSYSNIYLSTAFVYTYGLSF  953
              +DA+KFP ++S  FD  G  YNI+R+LN+K F  +   Y+ YS +YLS  F   YGLSF
Sbjct  322   AYDAQKFPFYTSKTFDQTGHSYNITRILNEKDFDINLDAYNDYSKLYLSVMFALLYGLSF  381

Query  952   ATLAATVSHVALFHGRTI---WEQTKESVQDKFSDIHTRLMRKNYEPVPQWWFYlllvii  782
              +L AT+SHVAL+ G+ I   W++   + +DKF D+H+RLM+KNY+ VPQWWF  +L+I 
Sbjct  382   GSLFATISHVALYDGKFIWGMWKKATTATKDKFGDVHSRLMKKNYQAVPQWWFIAVLIIS  441

Query  781   vgvalvACQRFGGQLQLPVWGVLLAVLLSLIFTLPVGVITATTNQQTGLNVIAELIIGYM  602
               +AL AC+ F  QLQLP WG++LA  +++ FTLP+GVI ATTNQQ GLNVI ELIIGY+
Sbjct  442   FALALYACEGFDKQLQLPWWGLVLACAIAMFFTLPIGVIQATTNQQMGLNVITELIIGYL  501

Query  601   YPGRPLASVTFKMYGlsslsqslmflSDFKLGHYMKIPPKSMFMVQLVGTLISCCVHFGT  422
             YPGRPLA+V+FK YG  S+SQ+L F+ DFKLGHYMKIPP+SMF+VQLV T++S  V FGT
Sbjct  502   YPGRPLANVSFKTYGYISMSQALYFVGDFKLGHYMKIPPRSMFIVQLVATVVSSSVCFGT  561

Query  421   GWWLLTTVENICNPSKLPEGSQWTCPGDDVFYNASIIWGVVSPRRMFGNLGIYQATNYFF  242
              WWL+++VENICN   LP GS WTCPGD+VFYNASIIWGV+ PRRMF   GIY   N+FF
Sbjct  562   TWWLISSVENICNTDLLPVGSPWTCPGDEVFYNASIIWGVIGPRRMFTKEGIYPGMNWFF  621

Query  241   LVGFLAPIPVWYLGRKYPEKRWVSLINMPILISGAEGIPIVKSVNYVCWFAVGLYFNLYV  62
             L+G LAP+P WYL +K+PEK+W+ LI++P++ S    +P  K+V+Y  W  VG+ FN Y+
Sbjct  622   LIGILAPVPFWYLSKKFPEKKWLKLIHIPLIFSAVSPMPQAKAVHYWSWTIVGVVFNYYI  681

Query  61    YRKHKGWWARHNYILSAGLD  2
             +R+ K WWARHNYILSA LD
Sbjct  682   FRRFKSWWARHNYILSAALD  701



>emb|CDY06549.1| BnaC02g12730D [Brassica napus]
Length=753

 Score =   850 bits (2196),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 420/680 (62%), Positives = 532/680 (78%), Gaps = 3/680 (0%)
 Frame = -1

Query  2032  VESSADEINDSPVEEVRLTVPITDDPTMPCVTFRTWVLGVTSCVILAFLNQFFGYRQNAL  1853
             +    +E NDSP+EEVRLTVPITDDPT+P +TFRTW LG+ SC++LAF+NQFF +R N L
Sbjct  22    IHGEEEEENDSPIEEVRLTVPITDDPTLPVLTFRTWFLGLLSCILLAFVNQFFSFRSNQL  81

Query  1852  YVSSVPAQIVVLPMGKLMAAYLPTKVVQIPGTKWSFSLNPGPFNIKEHVLITIFASSGSD  1673
             +VSSV AQIV LP+GKLMAA LPTK    PGT WS+S NPGPFN+KEHVLI+IFA++G+ 
Sbjct  82    WVSSVAAQIVTLPLGKLMAATLPTKKFGFPGTNWSWSFNPGPFNVKEHVLISIFANTGAG  141

Query  1672  FSYAVSIITMMKAFYYRDIHPLAAVLLTFSTQMLGYGLAGIFKKFLIDSPYMWWPSNLVQ  1493
              +YA  IIT++KAFY+R +   AA+LLT +TQ+LGYG AGIF+KFL++SPYMWWPSNLVQ
Sbjct  142   GAYATGIITIVKAFYHRQLSVAAAMLLTQTTQLLGYGWAGIFRKFLVESPYMWWPSNLVQ  201

Query  1492  VSLFRALHDVETRPKGGLTRLQFFIIVLVCSFAYYVVPNYLFPSLTALSLLCWIWKNSVT  1313
             VSLFRALH+ E   KG  TRL+FF++V   SFAYY++P YLFPS++A+S +CWIWK+SVT
Sbjct  202   VSLFRALHEKEELQKGQQTRLKFFLVVFGISFAYYIIPGYLFPSISAISFVCWIWKSSVT  261

Query  1312  AQQlgsglkglgigSFALDWATVAAFQGSPLVTPDFAIINMLIGYVLVAYIAIPVWYWTN  1133
             AQ LGSGLKGLGIGSF LDW+TVA F GSPL  P FAI N   G+ +  YI +P++YW+N
Sbjct  262   AQILGSGLKGLGIGSFGLDWSTVAGFLGSPLAVPFFAIANFFAGFFIFLYIVLPIFYWSN  321

Query  1132  LFDAKKFPLFSSNVFDSNGQVYNISRVLNKKTFGFDQPGYDSYSNIYLSTAFVYTYGLSF  953
              +DA+KFP ++S  FD  G  YNI+R+LN+K F  +   Y+ YS +YLS  F   YGLSF
Sbjct  322   AYDAQKFPFYTSKTFDQTGHSYNITRILNEKDFDINLDAYNDYSKLYLSVMFALLYGLSF  381

Query  952   ATLAATVSHVALFHGRTI---WEQTKESVQDKFSDIHTRLMRKNYEPVPQWWFYlllvii  782
              +L AT+SHVAL+ G+ I   W++   + +DKF D+H+RLM+KNY+ VPQWWF  +L+I 
Sbjct  382   GSLFATISHVALYDGKFIWGMWKKATTATKDKFGDVHSRLMKKNYQAVPQWWFIAVLIIS  441

Query  781   vgvalvACQRFGGQLQLPVWGVLLAVLLSLIFTLPVGVITATTNQQTGLNVIAELIIGYM  602
               +AL AC+ F  QLQLP WG++LA  +++ FTLP+GVI ATTNQQ GLNVI ELIIGY+
Sbjct  442   FALALYACEGFDKQLQLPWWGLVLACAIAMFFTLPIGVIQATTNQQMGLNVITELIIGYL  501

Query  601   YPGRPLASVTFKMYGlsslsqslmflSDFKLGHYMKIPPKSMFMVQLVGTLISCCVHFGT  422
             YPGRPLA+V+FK YG  S+SQ+L F+ DFKLGHYMKIPP+SMF+VQLV T++S  V FGT
Sbjct  502   YPGRPLANVSFKTYGYISMSQALYFVGDFKLGHYMKIPPRSMFIVQLVATVVSSSVCFGT  561

Query  421   GWWLLTTVENICNPSKLPEGSQWTCPGDDVFYNASIIWGVVSPRRMFGNLGIYQATNYFF  242
              WWL+++VENICN   LP GS WTCPGD+VFYNASIIWGV+ PRRMF   GIY   N+FF
Sbjct  562   TWWLISSVENICNTDLLPVGSPWTCPGDEVFYNASIIWGVIGPRRMFTKEGIYPGMNWFF  621

Query  241   LVGFLAPIPVWYLGRKYPEKRWVSLINMPILISGAEGIPIVKSVNYVCWFAVGLYFNLYV  62
             L+G LAP+P WYL +K+PEK+W+ LI++P++ S    +P  K+V+Y  W  VG+ FN Y+
Sbjct  622   LIGILAPVPFWYLSKKFPEKKWLKLIHIPLIFSAVSPMPQAKAVHYWSWTIVGVVFNYYI  681

Query  61    YRKHKGWWARHNYILSAGLD  2
             +R+ K WWARHNYILSA LD
Sbjct  682   FRRFKSWWARHNYILSAALD  701



>ref|XP_009142514.1| PREDICTED: oligopeptide transporter 5 [Brassica rapa]
Length=757

 Score =   847 bits (2188),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 427/686 (62%), Positives = 540/686 (79%), Gaps = 3/686 (0%)
 Frame = -1

Query  2050  NTGISAVESSADEINDSPVEEVRLTVPITDDPTMPCVTFRTWVLGVTSCVILAFLNQFFG  1871
              + I   +   +E NDSP+EEVRLTVPITDDP+ P +TFRTW LG+ SCV+LAF+NQFFG
Sbjct  20    ESNIVIADEDGEEENDSPIEEVRLTVPITDDPSQPVLTFRTWFLGIISCVVLAFVNQFFG  79

Query  1870  YRQNALYVSSVPAQIVVLPMGKLMAAYLPTKVVQIPGTKWSFSLNPGPFNIKEHVLITIF  1691
             YR N L VSSV AQIV LP+GKLMA  LPT+  ++PGT WS SLNPGPFN+KEHVLITIF
Sbjct  80    YRSNQLMVSSVVAQIVTLPVGKLMATALPTRKFRLPGTNWSGSLNPGPFNMKEHVLITIF  139

Query  1690  ASSGSDFSYAVSIITMMKAFYYRDIHPLAAVLLTFSTQMLGYGLAGIFKKFLIDSPYMWW  1511
             AS+G+  +YA SIIT++KAFY+R+++P AA+LL  +TQ+LGYG AG+F+KFL+DSPYMWW
Sbjct  140   ASAGAGGAYATSIITIVKAFYHRNLNPTAAMLLLQTTQLLGYGWAGMFRKFLVDSPYMWW  199

Query  1510  PSNLVQVSLFRALHDVETRPKGGLTRLQFFIIVLVCSFAYYVVPNYLFPSLTALSLLCWI  1331
             PSNLVQVSLFRALH+ E + +G  TRL+FF+IV   SFAYY+VP Y+FPS+++LS +CWI
Sbjct  200   PSNLVQVSLFRALHEKEEKCEGKQTRLRFFLIVFFVSFAYYIVPGYIFPSISSLSFVCWI  259

Query  1330  WKNSVTAQQlgsglkglgigSFALDWATVAAFQGSPLVTPDFAIINMLIGYVLVAYIAIP  1151
             W  SVTAQQ+GSGL GLGIGSF LDW+TVA F GSPL  P FAI N   G+++  YI +P
Sbjct  260   WTRSVTAQQIGSGLHGLGIGSFGLDWSTVAGFLGSPLAVPFFAIANFFGGFIVYFYIILP  319

Query  1150  VWYWTNLFDAKKFPLFSSNVFDSNGQVYNISRVLNKKTFGFDQPGYDSYSNIYLSTAFVY  971
             ++YW+N +DAKKFP ++S  FD  GQ +N +R+LN+KTF  + P Y+SYS +YLS  F  
Sbjct  320   IFYWSNAYDAKKFPFYTSQTFDFTGQQFNTTRILNQKTFDINLPAYESYSKLYLSVMFAL  379

Query  970   TYGLSFATLAATVSHVALFHGRTIWEQTKE---SVQDKFSDIHTRLMRKNYEPVPQWWFY  800
              YGLSF TL AT+SHVALF G+ IWE  K+   + +DKF D+HTRLM+KNY+ VPQWWF 
Sbjct  380   IYGLSFGTLTATISHVALFDGKFIWEMWKKATLTTKDKFGDVHTRLMKKNYKEVPQWWFV  439

Query  799   lllviivgvalvACQRFGGQLQLPVWGVLLAVLLSLIFTLPVGVITATTNQQTGLNVIAE  620
              +L++   +AL AC+ F  QLQLP WG+LLA  ++  FTLP+GVI ATTNQQ GLNVI E
Sbjct  440   SVLIVSFCLALYACEGFNKQLQLPWWGLLLACSIAFTFTLPIGVILATTNQQMGLNVITE  499

Query  619   LIIGYMYPGRPLASVTFKMYGlsslsqslmflSDFKLGHYMKIPPKSMFMVQLVGTLISC  440
             LIIGY+YPG+PLA+V FK YG  S+SQ+L F+ DFKLGHYMKIPP+SMF+VQLV TL+S 
Sbjct  500   LIIGYLYPGKPLANVAFKTYGYISMSQALYFVGDFKLGHYMKIPPRSMFLVQLVATLVSS  559

Query  439   CVHFGTGWWLLTTVENICNPSKLPEGSQWTCPGDDVFYNASIIWGVVSPRRMFGNLGIYQ  260
              V FGT WWLL+++ENICN  KLP  S WTCPGD+VFYNASIIWG++ P RMF + G+Y 
Sbjct  560   TVCFGTTWWLLSSIENICNKDKLPVSSPWTCPGDEVFYNASIIWGIIGPGRMFTSKGVYP  619

Query  259   ATNYFFLVGFLAPIPVWYLGRKYPEKRWVSLINMPILISGAEGIPIVKSVNYVCWFAVGL  80
               N+FFL+G LAP+PVW+  RK+PEK+W+  I++P++ S    +P+ K+V+Y  W  VG+
Sbjct  620   GMNWFFLIGLLAPVPVWFFARKFPEKKWIKKIHIPLIFSATTAMPVAKAVHYWSWAFVGV  679

Query  79    YFNLYVYRKHKGWWARHNYILSAGLD  2
              FN Y++R++K WWARHNYILSA LD
Sbjct  680   VFNYYIFRRYKAWWARHNYILSAALD  705



>emb|CDX94308.1| BnaC01g18760D [Brassica napus]
Length=757

 Score =   846 bits (2185),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 425/686 (62%), Positives = 540/686 (79%), Gaps = 3/686 (0%)
 Frame = -1

Query  2050  NTGISAVESSADEINDSPVEEVRLTVPITDDPTMPCVTFRTWVLGVTSCVILAFLNQFFG  1871
              + I   +   +E NDSP+EEVRLTVPITDDP+ P +TFRTW LG+ SCV+LAF+NQFFG
Sbjct  20    ESNIVIADEEGEEENDSPIEEVRLTVPITDDPSQPVLTFRTWFLGIISCVVLAFVNQFFG  79

Query  1870  YRQNALYVSSVPAQIVVLPMGKLMAAYLPTKVVQIPGTKWSFSLNPGPFNIKEHVLITIF  1691
             YR N L VSSV AQIV LP+GKLMA  LPT+  ++PGT WS SLNPGPFN+KEHVLITIF
Sbjct  80    YRSNQLMVSSVVAQIVTLPVGKLMATALPTRKFRLPGTNWSGSLNPGPFNMKEHVLITIF  139

Query  1690  ASSGSDFSYAVSIITMMKAFYYRDIHPLAAVLLTFSTQMLGYGLAGIFKKFLIDSPYMWW  1511
             AS+G+  +YA SIIT++KAFY+R+++P AA+LL  +TQ+LGYG AG+F+KFL+DSPYMWW
Sbjct  140   ASAGAGGAYATSIITIVKAFYHRNLNPTAAMLLLQTTQLLGYGWAGMFRKFLVDSPYMWW  199

Query  1510  PSNLVQVSLFRALHDVETRPKGGLTRLQFFIIVLVCSFAYYVVPNYLFPSLTALSLLCWI  1331
             PSNLVQVSLFRALH+ E + +G  TRL+FF+IV   SFAYY++P Y+FPS+++LS +CWI
Sbjct  200   PSNLVQVSLFRALHEKEEKCEGKQTRLRFFLIVFFVSFAYYIIPGYIFPSISSLSFVCWI  259

Query  1330  WKNSVTAQQlgsglkglgigSFALDWATVAAFQGSPLVTPDFAIINMLIGYVLVAYIAIP  1151
             W  SVTAQQ+GSGL GLGIGSF LDW+TVA F GSPL  P FAI N   G+++  YI +P
Sbjct  260   WTRSVTAQQIGSGLHGLGIGSFGLDWSTVAGFLGSPLAVPFFAIANFFGGFIVYFYIILP  319

Query  1150  VWYWTNLFDAKKFPLFSSNVFDSNGQVYNISRVLNKKTFGFDQPGYDSYSNIYLSTAFVY  971
             ++YW+N +DAKKFP ++S  FD  GQ +N +R+LN+KTF  + P Y+SYS +YLS  F  
Sbjct  320   IFYWSNAYDAKKFPFYTSQTFDFTGQHFNTTRILNQKTFDINLPAYESYSKLYLSVMFAL  379

Query  970   TYGLSFATLAATVSHVALFHGRTIWEQTKE---SVQDKFSDIHTRLMRKNYEPVPQWWFY  800
              YGLSF TL AT+SHVALF G+ IWE  K+   + +DKF D+HTRLM+KNY+ VPQWWF 
Sbjct  380   IYGLSFGTLTATISHVALFDGKFIWEMWKKATLTTKDKFGDVHTRLMKKNYKEVPQWWFV  439

Query  799   lllviivgvalvACQRFGGQLQLPVWGVLLAVLLSLIFTLPVGVITATTNQQTGLNVIAE  620
              +L++   +AL AC+ F  QLQLP WG+LLA  ++  FTLP+GVI ATTNQQ GLNVI E
Sbjct  440   AVLIVSFCLALYACEGFNKQLQLPWWGLLLACAIAFTFTLPIGVILATTNQQMGLNVITE  499

Query  619   LIIGYMYPGRPLASVTFKMYGlsslsqslmflSDFKLGHYMKIPPKSMFMVQLVGTLISC  440
             LIIGY+YPG+PLA+V FK YG  S+SQ+L F+ DFKLGHYMKIPP+SMF+VQLV T++S 
Sbjct  500   LIIGYLYPGKPLANVAFKTYGYMSMSQALYFVGDFKLGHYMKIPPRSMFLVQLVATMVSS  559

Query  439   CVHFGTGWWLLTTVENICNPSKLPEGSQWTCPGDDVFYNASIIWGVVSPRRMFGNLGIYQ  260
              V FGT WWLL+++ENICN  KLP  S WTCPGD+VFYNASIIWG++ P RMF + G+Y 
Sbjct  560   TVCFGTTWWLLSSIENICNKDKLPVSSPWTCPGDEVFYNASIIWGIIGPGRMFTSKGVYP  619

Query  259   ATNYFFLVGFLAPIPVWYLGRKYPEKRWVSLINMPILISGAEGIPIVKSVNYVCWFAVGL  80
               N+FFL+G LAP+PVW+  RK+PEK+W+  I++P++ S    +P+ K+V+Y  W  VG+
Sbjct  620   GMNWFFLIGLLAPVPVWFFARKFPEKKWIKKIHIPLIFSATTAMPVAKAVHYWSWGFVGV  679

Query  79    YFNLYVYRKHKGWWARHNYILSAGLD  2
              FN Y++R++K WWARHNYILSA LD
Sbjct  680   VFNYYIFRRYKAWWARHNYILSAALD  705



>ref|XP_010545870.1| PREDICTED: oligopeptide transporter 1-like [Tarenaya hassleriana]
Length=772

 Score =   846 bits (2185),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 415/681 (61%), Positives = 531/681 (78%), Gaps = 3/681 (0%)
 Frame = -1

Query  2035  AVESSADEINDSPVEEVRLTVPITDDPTMPCVTFRTWVLGVTSCVILAFLNQFFGYRQNA  1856
             A E +  E+ND+P+EEVRLTVPITDDPT P +TFRTW LG+ SCV LAF+N+FF +R N+
Sbjct  40    ADEEAQVEVNDNPIEEVRLTVPITDDPTEPVLTFRTWTLGIISCVALAFVNEFFSFRTNS  99

Query  1855  LYVSSVPAQIVVLPMGKLMAAYLPTKVVQIPGTKWSFSLNPGPFNIKEHVLITIFASSGS  1676
             L VS+V AQI+ LP+G+LMAA LP +    PGT W +SLNPGPF++KEH LITIFASSGS
Sbjct  100   LTVSAVSAQIITLPIGRLMAATLPKRKFGFPGTNWKWSLNPGPFSMKEHALITIFASSGS  159

Query  1675  DFSYAVSIITMMKAFYYRDIHPLAAVLLTFSTQMLGYGLAGIFKKFLIDSPYMWWPSNLV  1496
               +YA  I+ ++KAFY++ ++P+AA+LL  +TQ+LGYG AG+F+K+L+DSPYMWWPSNLV
Sbjct  160   GGAYATYIVAIVKAFYHQALNPVAAMLLVQTTQLLGYGWAGMFRKYLVDSPYMWWPSNLV  219

Query  1495  QVSLFRALHDVETRPKGGLTRLQFFIIVLVCSFAYYVVPNYLFPSLTALSLLCWIWKNSV  1316
             QVSLFR LH+ E   KG  TRLQFF+IV   SF YY+VP YLFPS++ALS +CWIWKNSV
Sbjct  220   QVSLFRVLHEKEEIRKGQRTRLQFFLIVFFASFVYYIVPGYLFPSISALSFVCWIWKNSV  279

Query  1315  TAQQlgsglkglgigSFALDWATVAAFQGSPLVTPDFAIINMLIGYVLVAYIAIPVWYWT  1136
             TAQQ+GSGL GLGIGSF LDW+TVA+F  SPL  P FAI+N  +G+ +  Y+ +P +YW 
Sbjct  280   TAQQIGSGLNGLGIGSFGLDWSTVASFLDSPLAVPFFAIVNFFVGFFIFLYMVVPFFYWG  339

Query  1135  NLFDAKKFPLFSSNVFDSNGQVYNISRVLNKKTFGFDQPGYDSYSNIYLSTAFVYTYGLS  956
             N++DAKKFPL+ S VF  NG  Y I R+L++KTF  D P Y+SYS +Y+S +F   YG+S
Sbjct  340   NIYDAKKFPLYGSKVFGQNGDKYEIKRILDEKTFDIDLPAYESYSKLYMSVSFALVYGIS  399

Query  955   FATLAATVSHVALFHGRTIWE---QTKESVQDKFSDIHTRLMRKNYEPVPQWWFYlllvi  785
             FATL AT+SHVAL+ G+ IW+   +T  + +D F D+HTRLM++NY+ VPQWWF ++LVI
Sbjct  400   FATLTATISHVALYDGKFIWDMWRKTSSAAKDAFGDVHTRLMKRNYKAVPQWWFIVILVI  459

Query  784   ivgvalvACQRFGGQLQLPVWGVLLAVLLSLIFTLPVGVITATTNQQTGLNVIAELIIGY  605
                ++L AC+ F  QLQLP WG++LA  ++L FTLP+GVI ATTNQQ GLNVI ELIIG+
Sbjct  460   SFALSLYACEGFNKQLQLPWWGLVLACTIALFFTLPIGVIQATTNQQMGLNVITELIIGF  519

Query  604   MYPGRPLASVTFKMYGlsslsqslmflSDFKLGHYMKIPPKSMFMVQLVGTLISCCVHFG  425
             +YPG+PLA+VTFK YG  S++Q+L FL DFKLGHYMKIPP+SMF+VQLV T+I+  V F 
Sbjct  520   LYPGKPLANVTFKTYGYISMAQALSFLGDFKLGHYMKIPPRSMFIVQLVSTIIASTVSFA  579

Query  424   TGWWLLTTVENICNPSKLPEGSQWTCPGDDVFYNASIIWGVVSPRRMFGNLGIYQATNYF  245
             T WWL+T+V++IC    LP+GS WTCPG  VFYNASIIWGV+ P RMF   G+Y   N+F
Sbjct  580   TTWWLITSVKDICQQDLLPKGSLWTCPGHTVFYNASIIWGVIGPGRMFTTKGVYPELNWF  639

Query  244   FLVGFLAPIPVWYLGRKYPEKRWVSLINMPILISGAEGIPIVKSVNYVCWFAVGLYFNLY  65
             FL+G L+P+P W+L RKYPEK+W+  I+MP++ SG   +P  K+V+Y  WF VG+ FN Y
Sbjct  640   FLIGLLSPVPGWFLSRKYPEKKWIKNIHMPLIFSGTSAVPSAKAVHYWSWFVVGVIFNYY  699

Query  64    VYRKHKGWWARHNYILSAGLD  2
             V+R+ K WWARH YILSA LD
Sbjct  700   VFRRFKEWWARHTYILSAALD  720



>ref|XP_008366120.1| PREDICTED: oligopeptide transporter 1-like [Malus domestica]
Length=709

 Score =   843 bits (2178),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 422/682 (62%), Positives = 530/682 (78%), Gaps = 44/682 (6%)
 Frame = -1

Query  2038  SAVESSADEINDSPVEEVRLTVPITDDPTMPCVTFRTWVLGVTSCVILAFLNQFFGYRQN  1859
             S V+   DE+NDSP+E+VRLTVPITDDP+ P +TFRTWVLG+ SC +LAF+NQFFGYRQN
Sbjct  17    SNVDVIDDEVNDSPIEQVRLTVPITDDPSEPTLTFRTWVLGIISCSVLAFVNQFFGYRQN  76

Query  1858  ALYVSSVPAQIVVLPMGKLMAAYLPTKVVQIPGTKWSFSLNPGPFNIKEHVLITIFASSG  1679
              LYVSSV AQI+VLP+GKLMAA LP + +++P   WSFSLNPGPFN+KEHVLITIFA+SG
Sbjct  77    QLYVSSVSAQILVLPLGKLMAATLPKRRIRLPFRNWSFSLNPGPFNLKEHVLITIFANSG  136

Query  1678  SDFSYAVSIITMMKAFYYRDIHPLAAVLLTFSTQMLGYGLAGIFKKFLIDSPYMWWPSNL  1499
             S+  YAV+IIT++ AFY+R +HP AA LL  +TQ                          
Sbjct  137   SNSVYAVNIITIVMAFYHRPMHPAAAFLLAQTTQA-------------------------  171

Query  1498  VQVSLFRALHDVETRPKGGLTRLQFFIIVLVCSFAYYVVPNYLFPSLTALSLLCWIWKNS  1319
                             +G  TRLQFF +V +CSFAYY+VP+YLFPS++A S +CWIWK+S
Sbjct  172   ----------------EGRXTRLQFFFMVFICSFAYYIVPSYLFPSISAFSFVCWIWKDS  215

Query  1318  VTAQQlgsglkglgigSFALDWATVAAFQGSPLVTPDFAIINMLIGYVLVAYIAIPVWYW  1139
             +TAQQ+GSG+ GLGIGSF  DW+TVA F GSPL TP FA IN+LIG++L+ YI  P+ YW
Sbjct  216   ITAQQIGSGMHGLGIGSFGFDWSTVAGFLGSPLATPGFATINILIGFILIVYIVTPIAYW  275

Query  1138  TNLFDAKKFPLFSSNVFDSNGQVYNISRVLNKKTFGFDQPGYDSYSNIYLSTAFVYTYGL  959
              N ++A+KFP+F+S+ +DS+GQ YNISRVL++K F  +  GY+ YS +YLST F +TYGL
Sbjct  276   NNAYEAQKFPIFTSHTYDSSGQRYNISRVLDQKNFDINMVGYNGYSKLYLSTFFAFTYGL  335

Query  958   SFATLAATVSHVALFHGRTIWE---QTKESVQDKFSDIHTRLMRKNYEPVPQWWFYlllv  788
             SFATL AT+SHVALFHGRTIW+   +T  +V+D+  D+HTRLM+KNY+ VPQWWF ++LV
Sbjct  336   SFATLTATISHVALFHGRTIWKMWKKTTSAVKDQIGDVHTRLMKKNYDSVPQWWFQIILV  395

Query  787   iivgvalvACQRFGGQLQLPVWGVLLAVLLSLIFTLPVGVITATTNQQTGLNVIAELIIG  608
              +V +A+  C+ FG QLQLP WGVL+A  ++L FTLP+G+I ATTNQQ GLNVI ELIIG
Sbjct  396   SMVALAVFTCEGFGKQLQLPWWGVLMACGIALFFTLPIGIIQATTNQQPGLNVITELIIG  455

Query  607   YMYPGRPLASVTFKMYGlsslsqslmflSDFKLGHYMKIPPKSMFMVQLVGTLISCCVHF  428
             Y+YPGRPLA+V FK YG  S+SQ+LMFLSDFKLGHYMKIPPKSMF VQLVGTL++  V+F
Sbjct  456   YIYPGRPLANVAFKTYGYISMSQALMFLSDFKLGHYMKIPPKSMFXVQLVGTLVASSVYF  515

Query  427   GTGWWLLTTVENICNPSKLPEGSQWTCPGDDVFYNASIIWGVVSPRRMFGNLGIYQATNY  248
             GT WWLLT++E IC+PSKLPEGS WTCPGDDVFYNASIIWGV+ P RMF N G+Y   N+
Sbjct  516   GTSWWLLTSIEYICDPSKLPEGSPWTCPGDDVFYNASIIWGVIGPLRMFSNKGVYPEMNW  575

Query  247   FFLVGFLAPIPVWYLGRKYPEKRWVSLINMPILISGAEGIPIVKSVNYVCWFAVGLYFNL  68
             FFL+G LAP+P+W+L +K+P ++W+ LINMPI++     +P  ++VNY+ W +VG++FN 
Sbjct  576   FFLIGLLAPVPIWFLSKKFPNQKWIKLINMPIILGATGMMPPARAVNYLTWLSVGIFFNF  635

Query  67    YVYRKHKGWWARHNYILSAGLD  2
             YVYRK+KGWWARHNYILSA LD
Sbjct  636   YVYRKYKGWWARHNYILSAALD  657



>ref|XP_010448244.1| PREDICTED: oligopeptide transporter 5-like [Camelina sativa]
Length=754

 Score =   845 bits (2182),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 419/670 (63%), Positives = 527/670 (79%), Gaps = 3/670 (0%)
 Frame = -1

Query  2002  SPVEEVRLTVPITDDPTMPCVTFRTWVLGVTSCVILAFLNQFFGYRQNALYVSSVPAQIV  1823
             SP+EEVR  VPITDDP++P +TFRTW LG+ SCV+LAF+N FFGYR N L VSSV AQIV
Sbjct  33    SPIEEVRFAVPITDDPSLPVLTFRTWFLGMLSCVVLAFVNNFFGYRSNQLMVSSVVAQIV  92

Query  1822  VLPMGKLMAAYLPTKVVQIPGTKWSFSLNPGPFNIKEHVLITIFASSGSDFSYAVSIITM  1643
              LP+GKLMA  LPT+  ++ GT W  SLNPGPFN+KEHVLITIFA++G+   YA SIIT+
Sbjct  93    TLPLGKLMATTLPTRKFRLLGTIWFGSLNPGPFNMKEHVLITIFANTGAGAVYATSIITI  152

Query  1642  MKAFYYRDIHPLAAVLLTFSTQMLGYGLAGIFKKFLIDSPYMWWPSNLVQVSLFRALHDV  1463
             +KAFY+RD++P AA+LL  +TQ+LGYG AG+F+KFL+DSPYMWWP+NLVQVSLFRALH+ 
Sbjct  153   VKAFYHRDLNPTAAMLLLQTTQLLGYGWAGMFRKFLVDSPYMWWPANLVQVSLFRALHEK  212

Query  1462  ETRPKGGLTRLQFFIIVLVCSFAYYVVPNYLFPSLTALSLLCWIWKNSVTAQQlgsglkg  1283
             E + +G  TRL+FF+IV   SF YY+VP YLFPS+++LS  CWIW  SVTAQQ+GSGL G
Sbjct  213   EEKREGKQTRLRFFLIVFFVSFTYYIVPGYLFPSISSLSFFCWIWTRSVTAQQIGSGLHG  272

Query  1282  lgigSFALDWATVAAFQGSPLVTPDFAIINMLIGYVLVAYIAIPVWYWTNLFDAKKFPLF  1103
             LGIGSF LDW+TV  F GSPL  P FAI N   G+V+  YI +P++YW+N ++AKKFP +
Sbjct  273   LGIGSFGLDWSTVVGFLGSPLAVPFFAIANCFGGFVIFFYIILPIFYWSNAYEAKKFPFY  332

Query  1102  SSNVFDSNGQVYNISRVLNKKTFGFDQPGYDSYSNIYLSTAFVYTYGLSFATLAATVSHV  923
             +S+ FD  GQ YN +R+LN+K F  D P Y+SYS +YLS  F   YGLSF TL AT+SHV
Sbjct  333   TSHTFDHTGQRYNTTRILNQKAFDIDLPAYESYSKLYLSILFALIYGLSFGTLTATISHV  392

Query  922   ALFHGRTIWEQTKE---SVQDKFSDIHTRLMRKNYEPVPQWWFYlllviivgvalvACQR  752
             ALF G+ IW   K+   + +DKF D+HTRLM+KNY+ VPQWWF  +L +   +AL AC+ 
Sbjct  393   ALFDGKFIWGMWKKATLATKDKFGDVHTRLMKKNYKEVPQWWFVAVLAVSFVLALYACEG  452

Query  751   FGGQLQLPVWGVLLAVLLSLIFTLPVGVITATTNQQTGLNVIAELIIGYMYPGRPLASVT  572
             FG QLQLP WG+LLA  ++  FTLP+GVI ATTNQQ GLNVI+ELIIG++YPG+PL +V 
Sbjct  453   FGKQLQLPWWGLLLACAIAFTFTLPIGVILATTNQQMGLNVISELIIGFLYPGKPLTNVA  512

Query  571   FKMYGlsslsqslmflSDFKLGHYMKIPPKSMFMVQLVGTLISCCVHFGTGWWLLTTVEN  392
             FK YG  S+SQ+L F+ DFKLGHYMKIPP+SMF+VQLV T+++  V FGT WWLL++VEN
Sbjct  513   FKTYGSVSMSQALYFVGDFKLGHYMKIPPRSMFLVQLVATIVASTVSFGTTWWLLSSVEN  572

Query  391   ICNPSKLPEGSQWTCPGDDVFYNASIIWGVVSPRRMFGNLGIYQATNYFFLVGFLAPIPV  212
             ICN  KLP+ S WTCPGD+VFYNASIIWG++ P RMF + GIY   N+FFL+GFLAP+PV
Sbjct  573   ICNIDKLPKSSPWTCPGDEVFYNASIIWGIIGPARMFTSKGIYSGMNWFFLIGFLAPVPV  632

Query  211   WYLGRKYPEKRWVSLINMPILISGAEGIPIVKSVNYVCWFAVGLYFNLYVYRKHKGWWAR  32
             W+  RK+PEK+W+  I++P++ S    +P+ K+VNY  WF VG  FN Y++R++KGWWAR
Sbjct  633   WFFARKFPEKKWIQKIHIPLIFSATNMMPMAKAVNYWSWFVVGFIFNYYIFRRYKGWWAR  692

Query  31    HNYILSAGLD  2
             HNYILSA LD
Sbjct  693   HNYILSAALD  702



>emb|CDX89322.1| BnaA01g15710D [Brassica napus]
Length=757

 Score =   843 bits (2179),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 425/686 (62%), Positives = 539/686 (79%), Gaps = 3/686 (0%)
 Frame = -1

Query  2050  NTGISAVESSADEINDSPVEEVRLTVPITDDPTMPCVTFRTWVLGVTSCVILAFLNQFFG  1871
              + I   +   +E NDSP+EEVRLTVPITDDP+ P +TFRTW LG+ SCV+LAF+NQFFG
Sbjct  20    ESNIVIADEEGEEENDSPIEEVRLTVPITDDPSQPVLTFRTWFLGIISCVVLAFVNQFFG  79

Query  1870  YRQNALYVSSVPAQIVVLPMGKLMAAYLPTKVVQIPGTKWSFSLNPGPFNIKEHVLITIF  1691
             YR N L VSSV AQIV LP+GKLMA  LPT+  ++PGT WS SLNPGPFN+KEHVLITIF
Sbjct  80    YRSNQLMVSSVVAQIVTLPVGKLMATALPTRKFRLPGTNWSGSLNPGPFNMKEHVLITIF  139

Query  1690  ASSGSDFSYAVSIITMMKAFYYRDIHPLAAVLLTFSTQMLGYGLAGIFKKFLIDSPYMWW  1511
             AS+G+  +YA SIIT++KAFY+R+++P AA+LL  +TQ+LGYG AG+F+KFL+DSPYMWW
Sbjct  140   ASAGAGGAYATSIITIVKAFYHRNLNPTAAMLLLQTTQLLGYGWAGMFRKFLVDSPYMWW  199

Query  1510  PSNLVQVSLFRALHDVETRPKGGLTRLQFFIIVLVCSFAYYVVPNYLFPSLTALSLLCWI  1331
             PSNLVQVSLFRALH+ E + +G  TRL+FF+IV   SFAYY+VP Y+FPS+++LS +CWI
Sbjct  200   PSNLVQVSLFRALHEKEEKCEGKQTRLRFFLIVFFVSFAYYIVPGYIFPSISSLSFVCWI  259

Query  1330  WKNSVTAQQlgsglkglgigSFALDWATVAAFQGSPLVTPDFAIINMLIGYVLVAYIAIP  1151
             W  SVTAQQ+GSGL GLGIGSF LDW+TVA F GSPL  P FAI N   G+++  YI +P
Sbjct  260   WTRSVTAQQIGSGLHGLGIGSFGLDWSTVAGFLGSPLAVPFFAIANFFGGFIVYFYIILP  319

Query  1150  VWYWTNLFDAKKFPLFSSNVFDSNGQVYNISRVLNKKTFGFDQPGYDSYSNIYLSTAFVY  971
             ++YW+N +DAKKFP ++S  FD  GQ +N +R+LN+KTF  + P Y+SYS +YLS  F  
Sbjct  320   IFYWSNAYDAKKFPFYTSQTFDHTGQHFNTTRILNQKTFDINLPAYESYSKLYLSVMFAL  379

Query  970   TYGLSFATLAATVSHVALFHGRTIWEQTKE---SVQDKFSDIHTRLMRKNYEPVPQWWFY  800
              YGLSF TL AT+SHVALF G+ IW   K+   + +DKF D+HTRLM+KNY+ VPQWWF 
Sbjct  380   IYGLSFGTLTATISHVALFDGKFIWGMWKKATLTTKDKFGDVHTRLMKKNYKEVPQWWFV  439

Query  799   lllviivgvalvACQRFGGQLQLPVWGVLLAVLLSLIFTLPVGVITATTNQQTGLNVIAE  620
              +L++   +AL AC+ F  QLQLP WG+LLA  ++  FTLP+GVI ATTNQQ GLNVI E
Sbjct  440   SVLIVSFCLALYACEGFNKQLQLPWWGLLLACSIAFTFTLPIGVILATTNQQMGLNVITE  499

Query  619   LIIGYMYPGRPLASVTFKMYGlsslsqslmflSDFKLGHYMKIPPKSMFMVQLVGTLISC  440
             LIIGY+YPG+PLA+V FK YG  S+SQ+L F+ DFKLGHYMKIPP+SMF+VQLV T++S 
Sbjct  500   LIIGYLYPGKPLANVAFKTYGYISMSQALYFVGDFKLGHYMKIPPRSMFLVQLVATMVSS  559

Query  439   CVHFGTGWWLLTTVENICNPSKLPEGSQWTCPGDDVFYNASIIWGVVSPRRMFGNLGIYQ  260
              V FGT WWLL+++ENICN  KLP  S WTCPGD+VFYNASIIWG++ P RMF + G+Y 
Sbjct  560   TVCFGTTWWLLSSIENICNKDKLPVSSPWTCPGDEVFYNASIIWGIIGPGRMFTSKGVYP  619

Query  259   ATNYFFLVGFLAPIPVWYLGRKYPEKRWVSLINMPILISGAEGIPIVKSVNYVCWFAVGL  80
               N+FFL+G LAP+PVW+  RK+PEK+W+  I++P++ S    +P+ K+V+Y  W  VG+
Sbjct  620   GMNWFFLIGLLAPVPVWFFARKFPEKKWIKKIHIPLIFSATTAMPVAKAVHYWSWGFVGV  679

Query  79    YFNLYVYRKHKGWWARHNYILSAGLD  2
              FN Y++R++K WWARHNYILSA LD
Sbjct  680   VFNYYIFRRYKAWWARHNYILSAALD  705



>gb|KFK27168.1| hypothetical protein AALP_AA8G344300 [Arabis alpina]
Length=754

 Score =   843 bits (2178),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 411/672 (61%), Positives = 530/672 (79%), Gaps = 3/672 (0%)
 Frame = -1

Query  2008  NDSPVEEVRLTVPITDDPTMPCVTFRTWVLGVTSCVILAFLNQFFGYRQNALYVSSVPAQ  1829
             ND+P+EEVRLTVPITDDP++P +TFRTW LG+ SC++L+F+NQFFG+R N L+VSSV AQ
Sbjct  31    NDNPIEEVRLTVPITDDPSLPVLTFRTWFLGLLSCIVLSFVNQFFGFRSNPLWVSSVAAQ  90

Query  1828  IVVLPMGKLMAAYLPTKVVQIPGTKWSFSLNPGPFNIKEHVLITIFASSGSDFSYAVSII  1649
             I+ LP+GK MAA LPTK   +PGT W +S NPGPFN+KEHVLITIFA++G+   YA +II
Sbjct  91    ILTLPLGKFMAATLPTKKFGVPGTNWMWSFNPGPFNMKEHVLITIFANTGAAGVYATNII  150

Query  1648  TMMKAFYYRDIHPLAAVLLTFSTQMLGYGLAGIFKKFLIDSPYMWWPSNLVQVSLFRALH  1469
             T++KAFY+R ++  AA+LLT +TQ+LGYG AG+F+KFL+DSPYMWWPSNLVQVSLFRALH
Sbjct  151   TIVKAFYHRQLNVTAAMLLTQTTQLLGYGWAGLFRKFLVDSPYMWWPSNLVQVSLFRALH  210

Query  1468  DVETRPKGGLTRLQFFIIVLVCSFAYYVVPNYLFPSLTALSLLCWIWKNSVTAQQlgsgl  1289
             + E    G  TRL+FFIIV   S AYY++P YLFPS++A+S +CWIWK+SVTAQ +GSGL
Sbjct  211   EKEDVQNGQQTRLRFFIIVFSISLAYYIIPGYLFPSISAISFVCWIWKSSVTAQIVGSGL  270

Query  1288  kglgigSFALDWATVAAFQGSPLVTPDFAIINMLIGYVLVAYIAIPVWYWTNLFDAKKFP  1109
              GLGIGSF LDWATVA F GSPL  P FAI N+  G+ +  YI +P++YWTN +DA+KFP
Sbjct  271   NGLGIGSFGLDWATVAGFLGSPLAVPFFAIANVFCGFFIFLYIVLPIFYWTNAYDAQKFP  330

Query  1108  LFSSNVFDSNGQVYNISRVLNKKTFGFDQPGYDSYSNIYLSTAFVYTYGLSFATLAATVS  929
              ++S+ FD  GQ YNI+R+LN+K F  +   Y+ YS +Y+S  F   YGLSFA+L AT+S
Sbjct  331   FYTSHTFDQTGQRYNITRILNEKDFDINLDAYNDYSKLYVSVMFALLYGLSFASLTATIS  390

Query  928   HVALFHGRTI---WEQTKESVQDKFSDIHTRLMRKNYEPVPQWWFYlllviivgvalvAC  758
             HV L  G+ I   W + K++ +DK+SD+H+RLM+KNY+ VPQWWF ++L + + ++L AC
Sbjct  391   HVTLHDGKFIWGMWNKAKKATKDKYSDVHSRLMKKNYQAVPQWWFMVVLFVSLALSLYAC  450

Query  757   QRFGGQLQLPVWGVLLAVLLSLIFTLPVGVITATTNQQTGLNVIAELIIGYMYPGRPLAS  578
             + F  QLQLP WG++LA  ++L FTLP+GVI ATTN Q GLNVI ELIIGY+YPG+PLA+
Sbjct  451   EGFDKQLQLPWWGLILACAIALFFTLPIGVIQATTNVQMGLNVITELIIGYLYPGKPLAN  510

Query  577   VTFKMYGlsslsqslmflSDFKLGHYMKIPPKSMFMVQLVGTLISCCVHFGTGWWLLTTV  398
             V FK YG  S++Q L F++DFKLGHYMKIPP+SMF+VQLV T+++  V FGT WWL+T++
Sbjct  511   VVFKTYGYISMAQGLSFVADFKLGHYMKIPPRSMFIVQLVATVVASSVCFGTTWWLVTSI  570

Query  397   ENICNPSKLPEGSQWTCPGDDVFYNASIIWGVVSPRRMFGNLGIYQATNYFFLVGFLAPI  218
             ENICNP  LP GS WTCPGDDVFYNASIIWGV+ P RMF   GIY   N+FFL+G LAP+
Sbjct  571   ENICNPDLLPVGSPWTCPGDDVFYNASIIWGVIGPGRMFTKEGIYPGLNWFFLIGILAPV  630

Query  217   PVWYLGRKYPEKRWVSLINMPILISGAEGIPIVKSVNYVCWFAVGLYFNLYVYRKHKGWW  38
             P WYL +K+PEK+W+ L+++P++ +    +P  K+VNY  W  VG+ FN Y++R+ K WW
Sbjct  631   PFWYLSKKFPEKKWLRLVHIPLIFTSVSSMPQAKAVNYWSWSIVGVIFNYYIFRRFKSWW  690

Query  37    ARHNYILSAGLD  2
             ARHNYILSA LD
Sbjct  691   ARHNYILSAALD  702



>ref|XP_010536754.1| PREDICTED: oligopeptide transporter 5-like [Tarenaya hassleriana]
Length=755

 Score =   842 bits (2175),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 407/683 (60%), Positives = 532/683 (78%), Gaps = 3/683 (0%)
 Frame = -1

Query  2041  ISAVESSADEINDSPVEEVRLTVPITDDPTMPCVTFRTWVLGVTSCVILAFLNQFFGYRQ  1862
             I A E + +E+ DSP+EEVRLTVPITDDP+ P +TFRTW LG+ SC  LAF+NQFF YR 
Sbjct  21    IIADEEAQEEVADSPIEEVRLTVPITDDPSEPVLTFRTWTLGIISCAALAFVNQFFSYRT  80

Query  1861  NALYVSSVPAQIVVLPMGKLMAAYLPTKVVQIPGTKWSFSLNPGPFNIKEHVLITIFASS  1682
             N L VSSV AQI+ LP+G+LMA  LPT+    PGT W++SLNPGPFN+KEHVLITIFAS+
Sbjct  81    NNLTVSSVAAQIIALPVGRLMAKTLPTRKFTFPGTNWTWSLNPGPFNMKEHVLITIFASA  140

Query  1681  GSDFSYAVSIITMMKAFYYRDIHPLAAVLLTFSTQMLGYGLAGIFKKFLIDSPYMWWPSN  1502
             G   +YA +I+T++K FY+R + P+AA+LL  +TQ+LGYG AGIF+KFL+DSPYMWWPSN
Sbjct  141   GYGGAYATNIVTIVKTFYHRKLDPVAAMLLVQTTQLLGYGWAGIFRKFLVDSPYMWWPSN  200

Query  1501  LVQVSLFRALHDVETRPKGGLTRLQFFIIVLVCSFAYYVVPNYLFPSLTALSLLCWIWKN  1322
             LVQVSLFR LH+ E + +G  TRLQFF+I+   SFAYY+VP YLFPS++A+S +CWIWKN
Sbjct  201   LVQVSLFRVLHEKEEKREGQHTRLQFFLIIFFASFAYYIVPGYLFPSISAISFVCWIWKN  260

Query  1321  SVTAQQlgsglkglgigSFALDWATVAAFQGSPLVTPDFAIINMLIGYVLVAYIAIPVWY  1142
             SVT QQ+GSG+ GLGIGSF +DW+TVA F GSPL  P FAI N   G+V+  YI +P++Y
Sbjct  261   SVTGQQIGSGMHGLGIGSFGVDWSTVAGFLGSPLAVPFFAIANFFAGFVIFFYIVLPIFY  320

Query  1141  WTNLFDAKKFPLFSSNVFDSNGQVYNISRVLNKKTFGFDQPGYDSYSNIYLSTAFVYTYG  962
             W N+++AKKFP ++S ++D +GQ YNI++++N++TF  + P Y+SYS +Y++  F   YG
Sbjct  321   WGNIYEAKKFPFYTSALYDHSGQRYNITQIINQETFDINLPAYESYSKLYMAVMFALVYG  380

Query  961   LSFATLAATVSHVALFHGRTIWE---QTKESVQDKFSDIHTRLMRKNYEPVPQWWFYlll  791
             LSFATL AT+SHVALF G+ IW+   +T  + +DKF D+HTRLM+KNY+ VP+WWF  +L
Sbjct  381   LSFATLTATISHVALFDGKFIWDMWRKTSTAAKDKFGDVHTRLMKKNYKAVPEWWFVTIL  440

Query  790   viivgvalvACQRFGGQLQLPVWGVLLAVLLSLIFTLPVGVITATTNQQTGLNVIAELII  611
             V+   ++L AC+ FG QLQLP WG++LA  ++  FTLP+GV+ ATTN Q GLNVI ELII
Sbjct  441   VLSFALSLYACEGFGRQLQLPWWGLILACSIAFFFTLPIGVVQATTNTQMGLNVITELII  500

Query  610   GYMYPGRPLASVTFKMYGlsslsqslmflSDFKLGHYMKIPPKSMFMVQLVGTLISCCVH  431
             G++YPG+PLA+VTFK YG  S++Q+L FL DFKLGHYMKIPP+SMF+VQ V T+I+    
Sbjct  501   GFIYPGKPLANVTFKTYGYISMAQALYFLGDFKLGHYMKIPPRSMFVVQFVATIIASTFS  560

Query  430   FGTGWWLLTTVENICNPSKLPEGSQWTCPGDDVFYNASIIWGVVSPRRMFGNLGIYQATN  251
             FGT WWL+T+VENIC+   LPE S WTCP   VFYNASIIWGV+ P RMF   G+Y   N
Sbjct  561   FGTTWWLITSVENICDTDLLPESSPWTCPNHTVFYNASIIWGVIGPGRMFTKKGVYPELN  620

Query  250   YFFLVGFLAPIPVWYLGRKYPEKRWVSLINMPILISGAEGIPIVKSVNYVCWFAVGLYFN  71
             +FFL+G LAP+P WYL RK+PEK+W+  I+MP++ +    +P+ ++V+Y  WF VG+ FN
Sbjct  621   WFFLIGLLAPVPGWYLSRKFPEKKWIKHIHMPLIFAATSPVPVARAVHYWSWFIVGVIFN  680

Query  70    LYVYRKHKGWWARHNYILSAGLD  2
              Y++++ K WWAR+ YILSA LD
Sbjct  681   YYIFKRFKEWWARNTYILSASLD  703



>emb|CCO06497.1| oligopeptide transporter [Arabis alpina]
Length=754

 Score =   841 bits (2173),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 410/672 (61%), Positives = 530/672 (79%), Gaps = 3/672 (0%)
 Frame = -1

Query  2008  NDSPVEEVRLTVPITDDPTMPCVTFRTWVLGVTSCVILAFLNQFFGYRQNALYVSSVPAQ  1829
             ND+P+EEVRLTVPITDDP++P +TFRTW LG+ SC++L+F+NQFFG+R N L+VSSV AQ
Sbjct  31    NDNPIEEVRLTVPITDDPSLPVLTFRTWFLGLLSCIVLSFVNQFFGFRSNPLWVSSVAAQ  90

Query  1828  IVVLPMGKLMAAYLPTKVVQIPGTKWSFSLNPGPFNIKEHVLITIFASSGSDFSYAVSII  1649
             I+ LP+GK MAA LPTK   +PGT W +S NPGPFN+KEHVLITIFA++G+   YA +II
Sbjct  91    ILTLPLGKFMAATLPTKKFGVPGTNWMWSFNPGPFNMKEHVLITIFANTGAAGVYATNII  150

Query  1648  TMMKAFYYRDIHPLAAVLLTFSTQMLGYGLAGIFKKFLIDSPYMWWPSNLVQVSLFRALH  1469
             T++KAFY+R ++  AA+LLT +TQ+LGYG AG+F+KFL+DSPYMWWPSNLVQVSLFRALH
Sbjct  151   TIVKAFYHRQLNVTAAMLLTQTTQLLGYGWAGLFRKFLVDSPYMWWPSNLVQVSLFRALH  210

Query  1468  DVETRPKGGLTRLQFFIIVLVCSFAYYVVPNYLFPSLTALSLLCWIWKNSVTAQQlgsgl  1289
             + E    G  TRL+FFIIV   S AYY++P YLFPS++A+S +CWIWK+SVTAQ +GSGL
Sbjct  211   EKEDVQNGQQTRLRFFIIVFSISLAYYIIPGYLFPSISAISFVCWIWKSSVTAQIVGSGL  270

Query  1288  kglgigSFALDWATVAAFQGSPLVTPDFAIINMLIGYVLVAYIAIPVWYWTNLFDAKKFP  1109
              GLGIGSF LDWATVA F GSPL  P FAI N+  G+ +  YI +P++YWTN +DA+KFP
Sbjct  271   NGLGIGSFGLDWATVAGFLGSPLAVPFFAIANVFCGFFIFLYIVLPIFYWTNAYDAQKFP  330

Query  1108  LFSSNVFDSNGQVYNISRVLNKKTFGFDQPGYDSYSNIYLSTAFVYTYGLSFATLAATVS  929
              ++S+ FD  GQ YNI+R+LN+K F  +   Y+ YS +Y+S  F   YGLSFA+L AT+S
Sbjct  331   FYTSHTFDQTGQRYNITRILNEKDFDINLDAYNDYSKLYVSVMFALLYGLSFASLTATIS  390

Query  928   HVALFHGRTI---WEQTKESVQDKFSDIHTRLMRKNYEPVPQWWFYlllviivgvalvAC  758
             HV L  G+ I   W + K++ +DK+SD+H+RLM+KNY+ VPQWWF ++L + + ++L AC
Sbjct  391   HVTLHDGKFIWGMWNKAKKATKDKYSDVHSRLMKKNYQAVPQWWFMVVLFVSLALSLYAC  450

Query  757   QRFGGQLQLPVWGVLLAVLLSLIFTLPVGVITATTNQQTGLNVIAELIIGYMYPGRPLAS  578
             + F  QLQLP WG++LA  ++L FTLP+GVI ATTN Q GLNVI ELIIGY+YPG+PLA+
Sbjct  451   EGFDKQLQLPWWGLILACAIALFFTLPIGVIQATTNVQMGLNVITELIIGYLYPGKPLAN  510

Query  577   VTFKMYGlsslsqslmflSDFKLGHYMKIPPKSMFMVQLVGTLISCCVHFGTGWWLLTTV  398
             V FK YG  S++Q L F++DFKLGHYMKIPP+SMF+VQLV T+++  V FGT WWL+T++
Sbjct  511   VVFKTYGYISMAQGLSFVADFKLGHYMKIPPRSMFIVQLVATVVASSVCFGTTWWLVTSI  570

Query  397   ENICNPSKLPEGSQWTCPGDDVFYNASIIWGVVSPRRMFGNLGIYQATNYFFLVGFLAPI  218
             ENICNP  LP GS WTCPGD+VFYNASIIWGV+ P RMF   GIY   N+FFL+G LAP+
Sbjct  571   ENICNPDLLPVGSPWTCPGDEVFYNASIIWGVIGPGRMFTKEGIYPGLNWFFLIGILAPV  630

Query  217   PVWYLGRKYPEKRWVSLINMPILISGAEGIPIVKSVNYVCWFAVGLYFNLYVYRKHKGWW  38
             P WYL +K+PEK+W+ L+++P++ +    +P  K+VNY  W  VG+ FN Y++R+ K WW
Sbjct  631   PFWYLSKKFPEKKWLRLVHIPLIFTSVSSMPQAKAVNYWSWSIVGVIFNYYIFRRFKSWW  690

Query  37    ARHNYILSAGLD  2
             ARHNYILSA LD
Sbjct  691   ARHNYILSAALD  702



>ref|XP_010438730.1| PREDICTED: oligopeptide transporter 5 [Camelina sativa]
Length=754

 Score =   840 bits (2169),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 427/687 (62%), Positives = 540/687 (79%), Gaps = 3/687 (0%)
 Frame = -1

Query  2053  ENTGISAVESSADEINDSPVEEVRLTVPITDDPTMPCVTFRTWVLGVTSCVILAFLNQFF  1874
             E+  + A E   ++ NDSP+EEVRLTVPITDDP++P +TFRTW LG+ SCV+LAF+N FF
Sbjct  16    ESKIVIADEEEEEDENDSPIEEVRLTVPITDDPSLPVLTFRTWFLGMLSCVVLAFVNNFF  75

Query  1873  GYRQNALYVSSVPAQIVVLPMGKLMAAYLPTKVVQIPGTKWSFSLNPGPFNIKEHVLITI  1694
             GYR N L VSSV AQIV LP+GKLMA  LPT+  ++ GT W  SLNPGPFN+KEHVLITI
Sbjct  76    GYRSNELMVSSVVAQIVTLPLGKLMATTLPTRKFRLLGTIWFGSLNPGPFNMKEHVLITI  135

Query  1693  FASSGSDFSYAVSIITMMKAFYYRDIHPLAAVLLTFSTQMLGYGLAGIFKKFLIDSPYMW  1514
             FA++G+   YA SIIT++KAFY+RD++P AA+LL  +TQ+LGYG AG+F+KFL+DSPYMW
Sbjct  136   FANTGAGGVYATSIITIVKAFYHRDLNPTAAMLLLQTTQLLGYGWAGMFRKFLVDSPYMW  195

Query  1513  WPSNLVQVSLFRALHDVETRPKGGLTRLQFFIIVLVCSFAYYVVPNYLFPSLTALSLLCW  1334
             WP+NLVQVSLFRALH+ E + +G  TRL+FF+IV   SF YY+VP YLFPS+++LS +CW
Sbjct  196   WPANLVQVSLFRALHEKEEKREGKQTRLRFFLIVFFVSFTYYIVPGYLFPSISSLSFVCW  255

Query  1333  IWKNSVTAQQlgsglkglgigSFALDWATVAAFQGSPLVTPDFAIINMLIGYVLVAYIAI  1154
             IW  SVTAQQ+GSGL GLGIGSF LDW+TVA F GSPL  P FAI N   G+V+  YI  
Sbjct  256   IWSRSVTAQQIGSGLHGLGIGSFGLDWSTVAGFLGSPLAVPFFAIANCFGGFVIFFYIIF  315

Query  1153  PVWYWTNLFDAKKFPLFSSNVFDSNGQVYNISRVLNKKTFGFDQPGYDSYSNIYLSTAFV  974
             P++YW+N ++AKKFP ++S+ FD  GQ YN +R+LN+K F  D P Y++YS +YLS  F 
Sbjct  316   PIFYWSNTYEAKKFPFYTSHTFDHTGQRYNTTRILNQKAFDIDLPAYENYSKLYLSILFA  375

Query  973   YTYGLSFATLAATVSHVALFHGRTIWEQTKE---SVQDKFSDIHTRLMRKNYEPVPQWWF  803
               YGLSF TL AT+SHVALF G+ IW   K+   + +DKF D+HTRLM+KNY+ VPQWWF
Sbjct  376   LIYGLSFGTLTATISHVALFDGKFIWGMWKKATLATKDKFGDVHTRLMKKNYKEVPQWWF  435

Query  802   YlllviivgvalvACQRFGGQLQLPVWGVLLAVLLSLIFTLPVGVITATTNQQTGLNVIA  623
               +L +   VAL AC+ FG QLQLP WG LLA  ++  FTLP+GVI ATTNQ+ GLNVI+
Sbjct  436   VAVLAVSFVVALYACEGFGKQLQLPWWGFLLACAIAFTFTLPIGVILATTNQEMGLNVIS  495

Query  622   ELIIGYMYPGRPLASVTFKMYGlsslsqslmflSDFKLGHYMKIPPKSMFMVQLVGTLIS  443
             ELIIG++YPG+PLA+V FK YG  S+SQ+L F+ DFKLGHYMKIPP+SMF+VQLV T+++
Sbjct  496   ELIIGFLYPGKPLANVAFKTYGSVSMSQALYFVGDFKLGHYMKIPPRSMFLVQLVATIVA  555

Query  442   CCVHFGTGWWLLTTVENICNPSKLPEGSQWTCPGDDVFYNASIIWGVVSPRRMFGNLGIY  263
               V FGT WWLL++VENICN  KLP+ S WTCPGD+VFYNASIIWG++ P RMF + GIY
Sbjct  556   STVSFGTTWWLLSSVENICNIDKLPKSSPWTCPGDEVFYNASIIWGIIGPARMFTSKGIY  615

Query  262   QATNYFFLVGFLAPIPVWYLGRKYPEKRWVSLINMPILISGAEGIPIVKSVNYVCWFAVG  83
                N+FFL+GFLAP+PVW+  RK+PEK+W+  I++P++ S    +P+ K+VNY  WF VG
Sbjct  616   PGMNWFFLIGFLAPVPVWFFARKFPEKKWIQKIHIPLIFSATNMMPMAKAVNYWSWFVVG  675

Query  82    LYFNLYVYRKHKGWWARHNYILSAGLD  2
             + FN Y++R++KGWWARHNYILSA LD
Sbjct  676   VVFNYYIFRRYKGWWARHNYILSAALD  702



>ref|XP_006401399.1| hypothetical protein EUTSA_v10012759mg [Eutrema salsugineum]
 gb|ESQ42852.1| hypothetical protein EUTSA_v10012759mg [Eutrema salsugineum]
Length=756

 Score =   837 bits (2163),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 421/673 (63%), Positives = 528/673 (78%), Gaps = 3/673 (0%)
 Frame = -1

Query  2011  INDSPVEEVRLTVPITDDPTMPCVTFRTWVLGVTSCVILAFLNQFFGYRQNALYVSSVPA  1832
             IND+P+EEVRLTVPITDDPT+P +TFRTW LG+ SC++LAF+NQFF +R N L+VSSV A
Sbjct  32    INDNPIEEVRLTVPITDDPTLPVLTFRTWFLGLLSCILLAFVNQFFSFRSNQLWVSSVAA  91

Query  1831  QIVVLPMGKLMAAYLPTKVVQIPGTKWSFSLNPGPFNIKEHVLITIFASSGSDFSYAVSI  1652
             QIV LP+GKLMAA LPTK    PGT WS+S NPGPFN+KEHVLITIFA++G+  +YA SI
Sbjct  92    QIVTLPLGKLMAATLPTKKFGFPGTNWSWSFNPGPFNMKEHVLITIFANTGAGGAYATSI  151

Query  1651  ITMMKAFYYRDIHPLAAVLLTFSTQMLGYGLAGIFKKFLIDSPYMWWPSNLVQVSLFRAL  1472
             IT++KAFY+R ++  AA+LLT +TQ+LGYG AG+F+KFL++SPYMWWPSNLVQVSLFRAL
Sbjct  152   ITIVKAFYHRQLNVAAAMLLTQTTQLLGYGWAGLFRKFLVESPYMWWPSNLVQVSLFRAL  211

Query  1471  HDVETRPKGGLTRLQFFIIVLVCSFAYYVVPNYLFPSLTALSLLCWIWKNSVTAQQlgsg  1292
             H+ E   K   TRL+FF+IV   SFAYY++P YLFPS++A+S +CWIWK+SVTAQ +GSG
Sbjct  212   HEKEDPEKKQQTRLRFFLIVFGISFAYYIIPGYLFPSISAISFVCWIWKSSVTAQIVGSG  271

Query  1291  lkglgigSFALDWATVAAFQGSPLVTPDFAIINMLIGYVLVAYIAIPVWYWTNLFDAKKF  1112
             LKGLG+GSF LDW+TVA F GSPL  P FAI N   G+ +  YI +P++YWTN +DA+KF
Sbjct  272   LKGLGVGSFGLDWSTVAGFLGSPLAVPFFAIANFFGGFFIFLYIVLPIFYWTNAYDAQKF  331

Query  1111  PLFSSNVFDSNGQVYNISRVLNKKTFGFDQPGYDSYSNIYLSTAFVYTYGLSFATLAATV  932
             P ++S  FD  G  YNI+R+LN+K F  +   Y+ Y  +YLS  F   YGLSF +L AT+
Sbjct  332   PFYTSQTFDQTGNSYNITRILNEKNFDINLDAYNGYGKLYLSVMFALLYGLSFGSLFATI  391

Query  931   SHVALFHGRTIWEQ---TKESVQDKFSDIHTRLMRKNYEPVPQWWFYlllviivgvalvA  761
             SHVAL+ G+ IW      K + +DKF D+H+RLM+KNY+ VPQWWF  +LV+    AL A
Sbjct  392   SHVALYDGKFIWGMWKKAKTATKDKFGDVHSRLMKKNYQSVPQWWFIAVLVVSFAFALYA  451

Query  760   CQRFGGQLQLPVWGVLLAVLLSLIFTLPVGVITATTNQQTGLNVIAELIIGYMYPGRPLA  581
             C+ F  QLQLP WG++LA  ++L FTLP+GVI ATTNQQ GLNVI ELIIGY+YPGRPLA
Sbjct  452   CEGFDKQLQLPWWGLILACTIALFFTLPIGVIQATTNQQMGLNVITELIIGYLYPGRPLA  511

Query  580   SVTFKMYGlsslsqslmflSDFKLGHYMKIPPKSMFMVQLVGTLISCCVHFGTGWWLLTT  401
             +V FK YG  S+SQ+L F+ DFKLGHYMK+PPKSMF+VQLV T+++  V FGT WWL+T+
Sbjct  512   NVAFKTYGYISMSQALYFVGDFKLGHYMKVPPKSMFIVQLVATVVASSVCFGTTWWLITS  571

Query  400   VENICNPSKLPEGSQWTCPGDDVFYNASIIWGVVSPRRMFGNLGIYQATNYFFLVGFLAP  221
             VENICNP  LP GS WTCPGD+VFYNASIIWGV+ PRRMF   GIY   N+FFL+G LAP
Sbjct  572   VENICNPDLLPVGSPWTCPGDEVFYNASIIWGVIGPRRMFTKEGIYPGMNWFFLIGILAP  631

Query  220   IPVWYLGRKYPEKRWVSLINMPILISGAEGIPIVKSVNYVCWFAVGLYFNLYVYRKHKGW  41
             +P WYL RK+PEK+W+  I++P++ S    +P  K+V+Y  W  VG+ FN Y++R++K W
Sbjct  632   VPFWYLSRKFPEKKWLKQIHIPLIFSAVSAMPQAKAVHYWSWAFVGVVFNYYIFRRYKAW  691

Query  40    WARHNYILSAGLD  2
             WARHNYILSA LD
Sbjct  692   WARHNYILSAALD  704



>ref|XP_010433474.1| PREDICTED: oligopeptide transporter 5-like [Camelina sativa]
Length=754

 Score =   836 bits (2159),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 422/687 (61%), Positives = 539/687 (78%), Gaps = 3/687 (0%)
 Frame = -1

Query  2053  ENTGISAVESSADEINDSPVEEVRLTVPITDDPTMPCVTFRTWVLGVTSCVILAFLNQFF  1874
             E+  + A +   ++ NDSP+EEVRLTVPITDDP++P +TFRTW LG+ SCV+L+F+N FF
Sbjct  16    ESKIVIADDEEEEDENDSPIEEVRLTVPITDDPSLPVLTFRTWFLGMLSCVVLSFVNNFF  75

Query  1873  GYRQNALYVSSVPAQIVVLPMGKLMAAYLPTKVVQIPGTKWSFSLNPGPFNIKEHVLITI  1694
             GYR N L VSSV AQIV LP+GKLMA  LPT+  ++ GT W  SLNPGPFNIKEHVLITI
Sbjct  76    GYRSNELMVSSVVAQIVTLPLGKLMATTLPTRKFRLLGTIWFGSLNPGPFNIKEHVLITI  135

Query  1693  FASSGSDFSYAVSIITMMKAFYYRDIHPLAAVLLTFSTQMLGYGLAGIFKKFLIDSPYMW  1514
             FA++G+   YA S+IT++KAFY+RD++P AA+LL  +TQ+LGYG AG+F+KFL+DSPYMW
Sbjct  136   FANTGAGGDYATSVITIVKAFYHRDLNPTAAMLLLQTTQLLGYGWAGMFRKFLVDSPYMW  195

Query  1513  WPSNLVQVSLFRALHDVETRPKGGLTRLQFFIIVLVCSFAYYVVPNYLFPSLTALSLLCW  1334
             WP+NLVQVSLFRALH+ E + +G  TRL+FF+IV   SF YY+VP YLFPS+++LS +CW
Sbjct  196   WPANLVQVSLFRALHEKEEKREGKQTRLRFFLIVFFVSFTYYIVPGYLFPSISSLSFVCW  255

Query  1333  IWKNSVTAQQlgsglkglgigSFALDWATVAAFQGSPLVTPDFAIINMLIGYVLVAYIAI  1154
             IW  SVT QQ+GSGL GLGIGSF LDW+TV  F GSPL  P FAI N   G+V+  YI  
Sbjct  256   IWSRSVTTQQIGSGLHGLGIGSFGLDWSTVVGFLGSPLAVPFFAIANCFGGFVIFFYIIF  315

Query  1153  PVWYWTNLFDAKKFPLFSSNVFDSNGQVYNISRVLNKKTFGFDQPGYDSYSNIYLSTAFV  974
             P++YW+N ++AKKFP ++S+ FD  GQ YN +R+LN+K F  D P Y++YS +YLS  F 
Sbjct  316   PIFYWSNAYEAKKFPFYTSHTFDHTGQRYNTTRILNQKAFDIDLPAYENYSKLYLSILFA  375

Query  973   YTYGLSFATLAATVSHVALFHGRTIWEQTKE---SVQDKFSDIHTRLMRKNYEPVPQWWF  803
               YGLSF TL AT+SHVALF G+ IW   K+   + +DKF D+HTRLM+KNY+ VPQWWF
Sbjct  376   LIYGLSFGTLTATISHVALFDGKFIWGMWKKATLATKDKFGDVHTRLMKKNYKEVPQWWF  435

Query  802   YlllviivgvalvACQRFGGQLQLPVWGVLLAVLLSLIFTLPVGVITATTNQQTGLNVIA  623
               +L +   +AL AC+ FG QLQLP WG+LLA  ++  FTLP+GVI ATTNQ+ GLNVI+
Sbjct  436   VAVLAVSFVLALYACEGFGKQLQLPWWGLLLACAIAFTFTLPIGVILATTNQEMGLNVIS  495

Query  622   ELIIGYMYPGRPLASVTFKMYGlsslsqslmflSDFKLGHYMKIPPKSMFMVQLVGTLIS  443
             ELIIG++YPG+PLA+V FK YG  S+SQ+L F+ DFKLGHYMKIPP+SMF+VQLV T+++
Sbjct  496   ELIIGFLYPGKPLANVAFKTYGSVSMSQALYFVGDFKLGHYMKIPPRSMFLVQLVATVVA  555

Query  442   CCVHFGTGWWLLTTVENICNPSKLPEGSQWTCPGDDVFYNASIIWGVVSPRRMFGNLGIY  263
               V FGT WWLL++VENICN  KLP+ S WTCPGD+VFYNASIIWG++ P RMF + GIY
Sbjct  556   STVSFGTTWWLLSSVENICNIDKLPKSSPWTCPGDEVFYNASIIWGIIGPARMFTSKGIY  615

Query  262   QATNYFFLVGFLAPIPVWYLGRKYPEKRWVSLINMPILISGAEGIPIVKSVNYVCWFAVG  83
                N+FFL+GFLAP+PVW+  RK+PEK+W+  I++P++ S    +P+ K+VNY  WF VG
Sbjct  616   PGMNWFFLIGFLAPVPVWFFARKFPEKKWIQKIHIPLIFSATNMMPMAKAVNYWSWFVVG  675

Query  82    LYFNLYVYRKHKGWWARHNYILSAGLD  2
             + FN Y++R++KGWWARHNYILSA LD
Sbjct  676   VVFNYYIFRRYKGWWARHNYILSAALD  702



>ref|XP_009414376.1| PREDICTED: oligopeptide transporter 5-like [Musa acuminata subsp. 
malaccensis]
Length=730

 Score =   832 bits (2148),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 402/676 (59%), Positives = 530/676 (78%), Gaps = 3/676 (0%)
 Frame = -1

Query  2020  ADEINDSPVEEVRLTVPITDDPTMPCVTFRTWVLGVTSCVILAFLNQFFGYRQNALYVSS  1841
             A+E  DSP+E+VRLTVP TDDP++PC+TFRTW LG+ SCV+L+F+NQF GYR+N + +SS
Sbjct  2     AEETYDSPIEQVRLTVPATDDPSLPCLTFRTWTLGLVSCVLLSFVNQFLGYRENQISLSS  61

Query  1840  VPAQIVVLPMGKLMAAYLPTKVVQIPGTKWSFSLNPGPFNIKEHVLITIFASSGSDFSYA  1661
             V  QI+ LP+G+ MAA LPT  ++IP T WSFS+NPGPFN+KEHVLITIFA++G+   YA
Sbjct  62    VCVQILALPVGRAMAAILPTTRIKIPLTNWSFSMNPGPFNLKEHVLITIFANAGAGGVYA  121

Query  1660  VSIITMMKAFYYRDIHPLAAVLLTFSTQMLGYGLAGIFKKFLIDSPYMWWPSNLVQVSLF  1481
             V+I+T+MKAFY+R I+ +AA+LL+ +TQ+LG+G AG+F+K+L+DSPYMWWP NLVQVSLF
Sbjct  122   VNIVTIMKAFYHRGINIIAALLLSETTQLLGFGWAGLFRKYLVDSPYMWWPGNLVQVSLF  181

Query  1480  RALHDVETRPKGGLTRLQFFIIVLVCSFAYYVVPNYLFPSLTALSLLCWIWKNSVTAQQl  1301
             RALH+ E RPKGG++R QFF+IV+ CSFAYYVVPN LFPS+TA+S++C IWK SVTA Q+
Sbjct  182   RALHEEEKRPKGGVSRFQFFLIVITCSFAYYVVPNVLFPSITAISVICLIWKKSVTAHQI  241

Query  1300  gsglkglgigSFALDWATVAAFQGSPLVTPDFAIINMLIGYVLVAYIAIPVWYWTNLFDA  1121
             GSGL GLG+GSF LDW+T+A F GSPL +P FA  N+L GY+ + Y+ +P+ YW+N + +
Sbjct  242   GSGLHGLGVGSFGLDWSTIAGFLGSPLASPAFATFNILAGYIFLVYVIVPIAYWSNAYGS  301

Query  1120  KKFPLFSSNVFDSNGQVYNISRVLNKKTFGFDQPGYDSYSNIYLSTAFVYTYGLSFATLA  941
             K FP+++S+++D  G+ Y++ RVL++KTF  +   Y+ YS+I LS  F  +YGL FATL 
Sbjct  302   KNFPVYTSSLYDVYGKKYDLGRVLDQKTFTLNITEYEKYSDIRLSIMFAISYGLGFATLT  361

Query  940   ATVSHVALFHGRTI---WEQTKESVQDKFSDIHTRLMRKNYEPVPQWWFYlllviivgva  770
             AT++HV LF+G  I   W QT   + D + DIH RLM+ NYE VPQWWF+++LV++  +A
Sbjct  362   ATLAHVFLFNGSYILKLWRQTASKMHDNYLDIHGRLMKANYESVPQWWFHIILVVVTALA  421

Query  769   lvACQRFGGQLQLPVWGVLLAVLLSLIFTLPVGVITATTNQQTGLNVIAELIIGYMYPGR  590
             +  C+ FG QLQLP WG+LLA+ ++ IFTLP+GVI AT NQ+ GLN+I E++IGY+ PG+
Sbjct  422   IFTCEGFGKQLQLPYWGILLAMAMAFIFTLPIGVILATANQEPGLNIITEMVIGYIMPGK  481

Query  589   PLASVTFKMYGlsslsqslmflSDFKLGHYMKIPPKSMFMVQLVGTLISCCVHFGTGWWL  410
             PLA+V FK YG  S++Q+  FLSDFKLG YMKIPPK+MF VQLVGT+++  V+FGT WWL
Sbjct  482   PLANVVFKTYGYISMTQAHTFLSDFKLGQYMKIPPKAMFFVQLVGTVVASAVYFGTAWWL  541

Query  409   LTTVENICNPSKLPEGSQWTCPGDDVFYNASIIWGVVSPRRMFGNLGIYQATNYFFLVGF  230
             L T+ +IC+ SKLPEGS WTCP D VF++ASIIWGVV P RMFG   IY + NYFFL G 
Sbjct  542   LGTITSICDTSKLPEGSPWTCPSDAVFFSASIIWGVVGPLRMFGPESIYSSLNYFFLAGA  601

Query  229   LAPIPVWYLGRKYPEKRWVSLINMPILISGAEGIPIVKSVNYVCWFAVGLYFNLYVYRKH  50
             LAP  VW L R +P+K+W+ LIN P+L+     +P   +VNY  WF VG+ FN YVY K+
Sbjct  602   LAPFFVWLLSRFFPQKKWIKLINFPVLLGATAMMPPAHAVNYTSWFVVGIIFNYYVYNKY  661

Query  49    KGWWARHNYILSAGLD  2
             K WW R+ Y+LSAGLD
Sbjct  662   KNWWGRYTYVLSAGLD  677



>ref|NP_200404.1| oligopeptide transporter 1 [Arabidopsis thaliana]
 sp|Q9FG72.1|OPT1_ARATH RecName: Full=Oligopeptide transporter 1; Short=AtOPT1 [Arabidopsis 
thaliana]
 dbj|BAB08658.1| sexual differentiation process protein ISP4-like [Arabidopsis 
thaliana]
 gb|AAL50067.1| AT5g55930/MYN21_4 [Arabidopsis thaliana]
 gb|AAO42774.1| At5g55930/MYN21_4 [Arabidopsis thaliana]
 gb|AED96700.1| oligopeptide transporter 1 [Arabidopsis thaliana]
Length=755

 Score =   831 bits (2147),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 421/672 (63%), Positives = 524/672 (78%), Gaps = 3/672 (0%)
 Frame = -1

Query  2008  NDSPVEEVRLTVPITDDPTMPCVTFRTWVLGVTSCVILAFLNQFFGYRQNALYVSSVPAQ  1829
             ND+P+EEVRLTVPITDDPT+P +TFRTW LG+ SC++LAF+NQFFG+R N L+VSSV AQ
Sbjct  32    NDNPIEEVRLTVPITDDPTLPVLTFRTWTLGLFSCILLAFVNQFFGFRSNQLWVSSVAAQ  91

Query  1828  IVVLPMGKLMAAYLPTKVVQIPGTKWSFSLNPGPFNIKEHVLITIFASSGSDFSYAVSII  1649
             IV LP+GKLMA  LPTK    PGT WS+S NPGPFN+KEHVLITIFA++G+   YA SII
Sbjct  92    IVTLPLGKLMAKTLPTKKFGFPGTNWSWSFNPGPFNMKEHVLITIFANTGAGGVYATSII  151

Query  1648  TMMKAFYYRDIHPLAAVLLTFSTQMLGYGLAGIFKKFLIDSPYMWWPSNLVQVSLFRALH  1469
             T++KAFY R ++  AA+LLT +TQ+LGYG AGIF+KFL+DSPYMWWPSNLVQVSLFRALH
Sbjct  152   TIVKAFYNRQLNVAAAMLLTQTTQLLGYGWAGIFRKFLVDSPYMWWPSNLVQVSLFRALH  211

Query  1468  DVETRPKGGLTRLQFFIIVLVCSFAYYVVPNYLFPSLTALSLLCWIWKNSVTAQQlgsgl  1289
             + E   KG  TR +FFIIV   SFAYY++P YLFPS++A+S +CWIWK+SVTAQ +GSGL
Sbjct  212   EKEDLQKGQQTRFRFFIIVFCVSFAYYIIPGYLFPSISAISFVCWIWKSSVTAQIVGSGL  271

Query  1288  kglgigSFALDWATVAAFQGSPLVTPDFAIINMLIGYVLVAYIAIPVWYWTNLFDAKKFP  1109
             KGLGIGSF LDW+TVA F GSPL  P FAI N   G+ +  YI +P++YWTN +DA+KFP
Sbjct  272   KGLGIGSFGLDWSTVAGFLGSPLAVPFFAIANFFGGFFIFLYIVLPIFYWTNAYDAQKFP  331

Query  1108  LFSSNVFDSNGQVYNISRVLNKKTFGFDQPGYDSYSNIYLSTAFVYTYGLSFATLAATVS  929
              ++S+ FD  G  YNI+R+LN+K F  +   Y+ YS +YLS  F   YGLSF +L AT+S
Sbjct  332   FYTSHTFDQTGHTYNITRILNEKNFDINLDAYNGYSKLYLSVMFALLYGLSFGSLCATIS  391

Query  928   HVALFHGRTIWEQ---TKESVQDKFSDIHTRLMRKNYEPVPQWWFYlllviivgvalvAC  758
             HVAL+ G+ IW      K + +DK+ D+H+RLM+KNY+ VPQWWF  +LVI    AL AC
Sbjct  392   HVALYDGKFIWGMWKKAKTATKDKYGDVHSRLMKKNYQSVPQWWFIAVLVISFAFALYAC  451

Query  757   QRFGGQLQLPVWGVLLAVLLSLIFTLPVGVITATTNQQTGLNVIAELIIGYMYPGRPLAS  578
             + F  QLQLP WG++LA  ++L FTLP+GVI ATTNQQ GLNVI ELIIGY+YPG+PLA+
Sbjct  452   EGFDKQLQLPWWGLILACAIALFFTLPIGVIQATTNQQMGLNVITELIIGYLYPGKPLAN  511

Query  577   VTFKMYGlsslsqslmflSDFKLGHYMKIPPKSMFMVQLVGTLISCCVHFGTGWWLLTTV  398
             V FK YG  S+SQ+L F+ DFKLGHYMKIPP+SMF+VQLV T+++  V FGT WWL+T+V
Sbjct  512   VAFKTYGYISMSQALYFVGDFKLGHYMKIPPRSMFIVQLVATVVASTVCFGTTWWLITSV  571

Query  397   ENICNPSKLPEGSQWTCPGDDVFYNASIIWGVVSPRRMFGNLGIYQATNYFFLVGFLAPI  218
             ENICN   LP GS WTCPGD+VFYNASIIWGV+ P RMF   GIY   N+FFL+G LAP+
Sbjct  572   ENICNVDLLPVGSPWTCPGDEVFYNASIIWGVIGPGRMFTKEGIYPGMNWFFLIGLLAPV  631

Query  217   PVWYLGRKYPEKRWVSLINMPILISGAEGIPIVKSVNYVCWFAVGLYFNLYVYRKHKGWW  38
             P WYL +K+PEK+W+  I++P++ S    +P  K+V+Y  W  VG+ FN Y++R+ K WW
Sbjct  632   PFWYLSKKFPEKKWLKQIHVPLIFSAVSAMPQAKAVHYWSWAIVGVVFNYYIFRRFKTWW  691

Query  37    ARHNYILSAGLD  2
             ARHNYILSA LD
Sbjct  692   ARHNYILSAALD  703



>ref|XP_003571640.1| PREDICTED: oligopeptide transporter 1-like [Brachypodium distachyon]
Length=734

 Score =   830 bits (2143),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 404/680 (59%), Positives = 534/680 (79%), Gaps = 2/680 (0%)
 Frame = -1

Query  2035  AVESSADEINDSPVEEVRLTVPITDDPTMPCVTFRTWVLGVTSCVILAFLNQFFGYRQNA  1856
             A   + +E+ND P+EEVR TVP+TDDP+ PC+TFRTWVLG++SC++LAF+N+FF YR N 
Sbjct  2     AKYDAEEEVNDHPIEEVRNTVPVTDDPSEPCLTFRTWVLGLSSCILLAFVNEFFMYRSNQ  61

Query  1855  LYVSSVPAQIVVLPMGKLMAAYLPTKVVQIPGTKWSFSLNPGPFNIKEHVLITIFASSGS  1676
             L + +V  QIV LP+G+ MA+ LP++ +++PG   SFSLNP PF++KEH LITIFA +G+
Sbjct  62    LSIGTVVVQIVTLPIGRFMASTLPSRPLRVPGPGRSFSLNPAPFSLKEHCLITIFAGAGA  121

Query  1675  DFSYAVSIITMMKAFYYRDIHPLAAVLLTFSTQMLGYGLAGIFKKFLIDSPYMWWPSNLV  1496
                YA++II ++K FY R I+P AA+LL  +TQ+LGYG AG+F+ +L+DS YMWWP NLV
Sbjct  122   SGVYAMNIIAIVKVFYKRQINPYAAMLLAQTTQLLGYGWAGLFRTYLVDSAYMWWPLNLV  181

Query  1495  QVSLFRALHDVETRPKGGLTRLQFFIIVLVCSFAYYVVPNYLFPSLTALSLLCWIWKNSV  1316
             QV+LFRA+H+ E RPKG LTRLQFFIIV+VCSFAYY+VP+YLFP  + LS+LCW +K+SV
Sbjct  182   QVTLFRAMHEEEKRPKGQLTRLQFFIIVMVCSFAYYLVPSYLFPVASTLSVLCWFYKDSV  241

Query  1315  TAQQlgsglkglgigSFALDWATVAAFQGSPLVTPDFAIINMLIGYVLVAYIAIPVWYWT  1136
             TAQQ+GSGLKGLG+GS  LDW TVA F G+PL +P FAI N+++G+ L  Y+A+P+ YWT
Sbjct  242   TAQQIGSGLKGLGVGSVGLDWNTVAGFIGNPLASPAFAIFNVMVGFALTTYVAVPLLYWT  301

Query  1135  NLFDAKKFPLFSSNVFDSNGQVYNISRVLNKKTFGFDQPGYDSYSNIYLSTAFVYTYGLS  956
             N ++AK+FP+ SS+VFD++G+ Y+ +R+L+ +TF  + P Y+SYS I LS  F   YG  
Sbjct  302   NAYNAKRFPIISSHVFDASGKRYDTNRILDPETFTLNLPEYNSYSRINLSVLFAINYGFG  361

Query  955   FATLAATVSHVALFHGRTIWEQTKESVQDK--FSDIHTRLMRKNYEPVPQWWFYlllvii  782
             FA L +T+SHVAL+HG++I++  +++  +K    D+HTR+M++NYE VPQWWF+L+LV++
Sbjct  362   FAGLMSTLSHVALYHGKSIFDLWRKAASEKGQEQDVHTRIMKRNYEAVPQWWFHLMLVLV  421

Query  781   vgvalvACQRFGGQLQLPVWGVLLAVLLSLIFTLPVGVITATTNQQTGLNVIAELIIGYM  602
             V ++L  C+ FG QLQLP WG+LLA  ++  FTLP+G+ITATTN Q GLN+I ELIIGY+
Sbjct  422   VALSLFTCEGFGRQLQLPYWGLLLACAIAFTFTLPIGIITATTNMQPGLNIITELIIGYL  481

Query  601   YPGRPLASVTFKMYGlsslsqslmflSDFKLGHYMKIPPKSMFMVQLVGTLISCCVHFGT  422
             YPG+PLA+V FK YG  S+ Q+L F+SDFKLGHYMKIPP+SMF  QL GT+ +  VHF T
Sbjct  482   YPGKPLANVVFKTYGYISMGQALTFVSDFKLGHYMKIPPRSMFFAQLAGTVTASTVHFAT  541

Query  421   GWWLLTTVENICNPSKLPEGSQWTCPGDDVFYNASIIWGVVSPRRMFGNLGIYQATNYFF  242
              WWLLTTV NICN   LPEGS WTCPGDDVFYNASIIWGVV P RMFG LG Y   NYFF
Sbjct  542   AWWLLTTVNNICNVESLPEGSPWTCPGDDVFYNASIIWGVVGPLRMFGRLGNYWQMNYFF  601

Query  241   LVGFLAPIPVWYLGRKYPEKRWVSLINMPILISGAEGIPIVKSVNYVCWFAVGLYFNLYV  62
             LVG LAP+P W L R+YP   ++  IN+P++ +GA G+   +SVN+V W  VG+ FN ++
Sbjct  602   LVGLLAPVPFWILSRRYPRHAFLKNINIPLIFAGAGGLLPARSVNFVMWGLVGILFNHFI  661

Query  61    YRKHKGWWARHNYILSAGLD  2
             YR++K WW RHNY+L+AGLD
Sbjct  662   YRRYKAWWMRHNYVLAAGLD  681



>ref|XP_009414381.1| PREDICTED: oligopeptide transporter 5-like [Musa acuminata subsp. 
malaccensis]
Length=730

 Score =   827 bits (2136),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 398/676 (59%), Positives = 527/676 (78%), Gaps = 3/676 (0%)
 Frame = -1

Query  2020  ADEINDSPVEEVRLTVPITDDPTMPCVTFRTWVLGVTSCVILAFLNQFFGYRQNALYVSS  1841
             A+E  +SP+E+VRLTVP TDDP++PC+TFRTW LG+ SCV+LAF+NQF GYR+N + +SS
Sbjct  2     AEENYESPIEQVRLTVPATDDPSLPCLTFRTWTLGLVSCVMLAFVNQFLGYRENQISLSS  61

Query  1840  VPAQIVVLPMGKLMAAYLPTKVVQIPGTKWSFSLNPGPFNIKEHVLITIFASSGSDFSYA  1661
             V  QI+ LP+G+ MAA LPT  ++IP T WSFS+NPGPFN+KEHVLITIFA++G+   YA
Sbjct  62    VCIQILALPVGRAMAAILPTTPIKIPLTNWSFSMNPGPFNLKEHVLITIFANAGAGGVYA  121

Query  1660  VSIITMMKAFYYRDIHPLAAVLLTFSTQMLGYGLAGIFKKFLIDSPYMWWPSNLVQVSLF  1481
             V I+T+M+AFY+R I+ +AA+LL+ +TQ+LG+G AG+F+K+L+DSPYMWWP NLVQVSLF
Sbjct  122   VGIVTIMRAFYHRGINIIAALLLSETTQLLGFGWAGLFRKYLVDSPYMWWPGNLVQVSLF  181

Query  1480  RALHDVETRPKGGLTRLQFFIIVLVCSFAYYVVPNYLFPSLTALSLLCWIWKNSVTAQQl  1301
             RALH+ E RPKGG++R QFF+IV+ CSFAYYVVPN LFPS+TA+S++C IWK SVTA Q+
Sbjct  182   RALHEEEKRPKGGVSRFQFFLIVVTCSFAYYVVPNVLFPSITAISVICLIWKKSVTAHQI  241

Query  1300  gsglkglgigSFALDWATVAAFQGSPLVTPDFAIINMLIGYVLVAYIAIPVWYWTNLFDA  1121
             GSGL GLG+GSF LDW+T+A F GSPL +P FA  N+L GY+ + Y+ +P+ YW+N + +
Sbjct  242   GSGLHGLGVGSFGLDWSTIAGFLGSPLASPAFATFNILAGYIFLVYVIVPIAYWSNAYGS  301

Query  1120  KKFPLFSSNVFDSNGQVYNISRVLNKKTFGFDQPGYDSYSNIYLSTAFVYTYGLSFATLA  941
             K FP+++S+++D  G+ Y + RVL++KTF  +   Y+ YSNI LS  F  +YGL FATL 
Sbjct  302   KNFPVYTSSLYDVYGKKYELDRVLDQKTFTLNVTEYEKYSNIRLSIMFAISYGLGFATLT  361

Query  940   ATVSHVALFHGRTI---WEQTKESVQDKFSDIHTRLMRKNYEPVPQWWFYlllviivgva  770
             AT++HV LF+G  I   W QT   + D + DIH RLM+ NYE VPQWWF+++LV+++ +A
Sbjct  362   ATLAHVFLFNGSYILKLWRQTASKMHDNYLDIHGRLMKANYEAVPQWWFHIILVVVMALA  421

Query  769   lvACQRFGGQLQLPVWGVLLAVLLSLIFTLPVGVITATTNQQTGLNVIAELIIGYMYPGR  590
             +  C+ FG QLQLP WG+ LA+ ++ +FTLP+GVI AT NQ+ GLN+I E++IGY+ PG+
Sbjct  422   IFTCEGFGKQLQLPYWGIFLAIAMAFVFTLPIGVILATANQEPGLNIITEMVIGYIMPGK  481

Query  589   PLASVTFKMYGlsslsqslmflSDFKLGHYMKIPPKSMFMVQLVGTLISCCVHFGTGWWL  410
             PLA+V FK YG  S++Q+  FL+DFKLG YMKIPPK+MF  QLVGT+++  V+FGT WWL
Sbjct  482   PLANVVFKTYGYISMTQAHTFLADFKLGQYMKIPPKAMFFAQLVGTVVASAVYFGTAWWL  541

Query  409   LTTVENICNPSKLPEGSQWTCPGDDVFYNASIIWGVVSPRRMFGNLGIYQATNYFFLVGF  230
             L T+ +IC+ SKLPEGS WTCP D VF++ASIIWGVV P RMFG   IY + NYFFL G 
Sbjct  542   LGTITSICDTSKLPEGSPWTCPSDAVFFSASIIWGVVGPLRMFGPESIYSSLNYFFLAGA  601

Query  229   LAPIPVWYLGRKYPEKRWVSLINMPILISGAEGIPIVKSVNYVCWFAVGLYFNLYVYRKH  50
             LAP  VW L R +P+K+W+ LIN P+L+     +P   +VNY  WF VG+ FN YVY K+
Sbjct  602   LAPFFVWLLSRFFPQKKWIKLINFPVLLGATAMMPPAHAVNYTSWFVVGIIFNYYVYNKY  661

Query  49    KGWWARHNYILSAGLD  2
             K WW R+ Y+LSAGLD
Sbjct  662   KNWWGRYTYVLSAGLD  677



>ref|XP_009414393.1| PREDICTED: oligopeptide transporter 5-like [Musa acuminata subsp. 
malaccensis]
Length=748

 Score =   827 bits (2136),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 401/687 (58%), Positives = 532/687 (77%), Gaps = 3/687 (0%)
 Frame = -1

Query  2053  ENTGISAVESSADEINDSPVEEVRLTVPITDDPTMPCVTFRTWVLGVTSCVILAFLNQFF  1874
             + +G  ++  + +E  D P+EEVRLTVP+TDDP+ PC+TFRTW LG+ SCV+L+F+NQF 
Sbjct  9     QGSGDESLAENTEENYDCPIEEVRLTVPVTDDPSQPCLTFRTWSLGLISCVLLSFVNQFL  68

Query  1873  GYRQNALYVSSVPAQIVVLPMGKLMAAYLPTKVVQIPGTKWSFSLNPGPFNIKEHVLITI  1694
             GYR+N + +SSV  QI+ LP+G+ MAA LPT  ++IP + WSFSLNPGPFN+KEHVLITI
Sbjct  69    GYRENQISLSSVCVQILALPVGRAMAATLPTTPIKIPLSNWSFSLNPGPFNLKEHVLITI  128

Query  1693  FASSGSDFSYAVSIITMMKAFYYRDIHPLAAVLLTFSTQMLGYGLAGIFKKFLIDSPYMW  1514
             FA++G+   YAV I+T+M+AFY+R I+ +AA+LL+ +TQ+LG+G AG+F+K+L+DSPYMW
Sbjct  129   FANAGAGGVYAVGIVTIMRAFYHRGINIIAALLLSETTQLLGFGWAGLFRKYLVDSPYMW  188

Query  1513  WPSNLVQVSLFRALHDVETRPKGGLTRLQFFIIVLVCSFAYYVVPNYLFPSLTALSLLCW  1334
             WP NLVQVSLFRALH+ E R KGG++R QFF+IV+ CSFAYYVVPN LFPS+TA+S++C 
Sbjct  189   WPGNLVQVSLFRALHEEEKRSKGGVSRFQFFLIVIACSFAYYVVPNVLFPSITAISVICL  248

Query  1333  IWKNSVTAQQlgsglkglgigSFALDWATVAAFQGSPLVTPDFAIINMLIGYVLVAYIAI  1154
             IWK SVTA Q+GSG++GLG+GSF LDW+T++ F GSPL +P FA  N+L G++ + YI +
Sbjct  249   IWKKSVTAHQIGSGMRGLGVGSFGLDWSTISGFLGSPLASPAFATFNVLAGFIALVYIIV  308

Query  1153  PVWYWTNLFDAKKFPLFSSNVFDSNGQVYNISRVLNKKTFGFDQPGYDSYSNIYLSTAFV  974
             P+ YW+N +D+K FPLF+S+++D +G+ Y++ RVL++KTF  +   Y+ YS+I LS  F 
Sbjct  309   PIAYWSNAYDSKNFPLFTSSLYDVHGKKYDLDRVLDQKTFSLNIHEYERYSDIRLSIMFA  368

Query  973   YTYGLSFATLAATVSHVALFHGRTI---WEQTKESVQDKFSDIHTRLMRKNYEPVPQWWF  803
              +YGL FATL AT+SHV LF+G  I   W QT    QD + DIH RLM+ NYE VPQWWF
Sbjct  369   ISYGLGFATLTATLSHVFLFNGAYILKLWRQTATKAQDNYLDIHGRLMKANYEAVPQWWF  428

Query  802   YlllviivgvalvACQRFGGQLQLPVWGVLLAVLLSLIFTLPVGVITATTNQQTGLNVIA  623
             +++LV++  +A++ C+ FG QLQLP WG+ LA+ ++ +FTLP+GVI AT NQ  GLN+I 
Sbjct  429   HIILVVVTALAILTCEGFGKQLQLPYWGIFLAIAMAFVFTLPIGVILATANQAPGLNIIT  488

Query  622   ELIIGYMYPGRPLASVTFKMYGlsslsqslmflSDFKLGHYMKIPPKSMFMVQLVGTLIS  443
             E++IGYM PG+PLA+V FK YG  S++Q+L FLSDFKLG YMKIPPKSMF  QLVGT+++
Sbjct  489   EMVIGYMMPGKPLANVVFKTYGYISMTQALTFLSDFKLGLYMKIPPKSMFFAQLVGTIVA  548

Query  442   CCVHFGTGWWLLTTVENICNPSKLPEGSQWTCPGDDVFYNASIIWGVVSPRRMFGNLGIY  263
               V+FGT WWLL T+ +IC+ SKLPEGS WTCP D VF++ASIIWGVV P RMFG   IY
Sbjct  549   SAVYFGTAWWLLGTITSICDTSKLPEGSPWTCPSDAVFFSASIIWGVVGPLRMFGPKSIY  608

Query  262   QATNYFFLVGFLAPIPVWYLGRKYPEKRWVSLINMPILISGAEGIPIVKSVNYVCWFAVG  83
              + NY+FL G LAP  VW L   +P K+W+ LIN P+L+     +P   +VNY  WF VG
Sbjct  609   LSLNYYFLAGALAPFFVWLLSLLFPHKKWIKLINFPVLLGATAMMPPAHAVNYTSWFVVG  668

Query  82    LYFNLYVYRKHKGWWARHNYILSAGLD  2
             + FN YVY K+K WW R+ Y+LSAGLD
Sbjct  669   IIFNYYVYNKYKSWWGRYTYVLSAGLD  695



>ref|XP_010483061.1| PREDICTED: oligopeptide transporter 1 [Camelina sativa]
 ref|XP_010483062.1| PREDICTED: oligopeptide transporter 1 [Camelina sativa]
Length=755

 Score =   827 bits (2136),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 417/669 (62%), Positives = 524/669 (78%), Gaps = 3/669 (0%)
 Frame = -1

Query  1999  PVEEVRLTVPITDDPTMPCVTFRTWVLGVTSCVILAFLNQFFGYRQNALYVSSVPAQIVV  1820
             P+EEVRLTVPITDDP++P +TFRTW LG+ SC++LAF+NQFF +R N L+VSSV AQIV 
Sbjct  35    PIEEVRLTVPITDDPSIPVLTFRTWFLGLFSCILLAFVNQFFSFRSNQLWVSSVAAQIVT  94

Query  1819  LPMGKLMAAYLPTKVVQIPGTKWSFSLNPGPFNIKEHVLITIFASSGSDFSYAVSIITMM  1640
             LP+GKLMAA LPTK    PGT WS+SLNPGPF++KEHVLITIFA++G+  +YA +IIT++
Sbjct  95    LPLGKLMAATLPTKKFGFPGTNWSWSLNPGPFSMKEHVLITIFANTGAGGAYATNIITIV  154

Query  1639  KAFYYRDIHPLAAVLLTFSTQMLGYGLAGIFKKFLIDSPYMWWPSNLVQVSLFRALHDVE  1460
             KAFY+R ++  AA+LLT +TQ+LGYG AGIF+KFL+DSPYMWWPSNLVQVSLFRALH+ E
Sbjct  155   KAFYHRQLNVAAAMLLTQTTQLLGYGWAGIFRKFLVDSPYMWWPSNLVQVSLFRALHEKE  214

Query  1459  TRPKGGLTRLQFFIIVLVCSFAYYVVPNYLFPSLTALSLLCWIWKNSVTAQQlgsglkgl  1280
                KG  TRL+FF+IV   SFAYY++P YLFPS++A+S +CWIWK+SVTAQ +GSGLKGL
Sbjct  215   DLQKGQQTRLRFFLIVFSISFAYYIIPGYLFPSISAISFVCWIWKSSVTAQIIGSGLKGL  274

Query  1279  gigSFALDWATVAAFQGSPLVTPDFAIINMLIGYVLVAYIAIPVWYWTNLFDAKKFPLFS  1100
             GIGSF LDW+TVA F GSPL  P FAI N   G+ +  YI +P++YWTN +DA+KFP ++
Sbjct  275   GIGSFGLDWSTVAGFLGSPLAVPFFAIANFFAGFFIFLYIVLPIFYWTNAYDAQKFPFYT  334

Query  1099  SNVFDSNGQVYNISRVLNKKTFGFDQPGYDSYSNIYLSTAFVYTYGLSFATLAATVSHVA  920
             S  FD  G  YNI+R+LN+K F  +   Y+ YS +YLS  F   YGLSF +L AT+SHVA
Sbjct  335   SQTFDHTGHSYNITRILNEKNFDINLDAYNDYSKLYLSVMFALLYGLSFGSLFATISHVA  394

Query  919   LFHGRTIWEQ---TKESVQDKFSDIHTRLMRKNYEPVPQWWFYlllviivgvalvACQRF  749
             L+ G+ IW      K + +DK+ D+H+RLM+KNY+ VPQWWF  +L+I    AL AC+ F
Sbjct  395   LYDGKFIWGMWKKAKTATKDKYGDVHSRLMKKNYQSVPQWWFVTILIISFAFALYACEGF  454

Query  748   GGQLQLPVWGVLLAVLLSLIFTLPVGVITATTNQQTGLNVIAELIIGYMYPGRPLASVTF  569
               QLQLP WG++LA  ++L FTLP+GVI ATTNQQ GLNVI ELIIGY+YPGRPLA+V F
Sbjct  455   DKQLQLPWWGLILACAIALFFTLPIGVIQATTNQQMGLNVITELIIGYLYPGRPLANVAF  514

Query  568   KMYGlsslsqslmflSDFKLGHYMKIPPKSMFMVQLVGTLISCCVHFGTGWWLLTTVENI  389
             K YG  S+SQ+L F+ DFKLGHYMKIPP+SMF+VQLV T+++  V FGT WWL+T+VENI
Sbjct  515   KTYGYISMSQALYFVGDFKLGHYMKIPPRSMFIVQLVATVVASTVCFGTTWWLITSVENI  574

Query  388   CNPSKLPEGSQWTCPGDDVFYNASIIWGVVSPRRMFGNLGIYQATNYFFLVGFLAPIPVW  209
             CN   LP GS WTCPGD+VFYNASIIWGV+ P RMF   GIY   N+FFL+G LAP+P W
Sbjct  575   CNTDLLPVGSPWTCPGDEVFYNASIIWGVIGPGRMFTKEGIYPGMNWFFLIGLLAPVPFW  634

Query  208   YLGRKYPEKRWVSLINMPILISGAEGIPIVKSVNYVCWFAVGLYFNLYVYRKHKGWWARH  29
             YL +K+PEK+W+  I++P++ S    +P  K+V+Y  W  VG+ FN Y++R+ K WWARH
Sbjct  635   YLSKKFPEKKWLKQIHIPLIFSAVSAMPQAKAVHYWSWAIVGVIFNYYIFRRFKSWWARH  694

Query  28    NYILSAGLD  2
             NYILSA LD
Sbjct  695   NYILSAALD  703



>ref|XP_006279740.1| hypothetical protein CARUB_v10027572mg [Capsella rubella]
 gb|EOA12638.1| hypothetical protein CARUB_v10027572mg [Capsella rubella]
Length=758

 Score =   827 bits (2135),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 416/669 (62%), Positives = 523/669 (78%), Gaps = 3/669 (0%)
 Frame = -1

Query  1999  PVEEVRLTVPITDDPTMPCVTFRTWVLGVTSCVILAFLNQFFGYRQNALYVSSVPAQIVV  1820
             P+EEVRLTVPITDDPT+P +TFRTW LG+ SC++LAF+NQFF +R N L+VSSV AQIV 
Sbjct  38    PIEEVRLTVPITDDPTLPVLTFRTWSLGLVSCILLAFVNQFFSFRSNQLWVSSVAAQIVT  97

Query  1819  LPMGKLMAAYLPTKVVQIPGTKWSFSLNPGPFNIKEHVLITIFASSGSDFSYAVSIITMM  1640
             LP+GKLMAA LPTK    PGT WS+SLNPGPFN+KEHVLITIFA++G+   YA SIIT++
Sbjct  98    LPLGKLMAATLPTKRFGFPGTNWSWSLNPGPFNMKEHVLITIFANTGAGGVYATSIITIV  157

Query  1639  KAFYYRDIHPLAAVLLTFSTQMLGYGLAGIFKKFLIDSPYMWWPSNLVQVSLFRALHDVE  1460
             KAFY+R ++  AA+LLT +TQ+LGYG AG+F+KFL+DSPYMWWPSNLVQVSLFRALH+ E
Sbjct  158   KAFYHRKLNVAAAMLLTQTTQLLGYGWAGLFRKFLVDSPYMWWPSNLVQVSLFRALHEKE  217

Query  1459  TRPKGGLTRLQFFIIVLVCSFAYYVVPNYLFPSLTALSLLCWIWKNSVTAQQlgsglkgl  1280
                KG  TRL+FF++V   SFAYY++P YLFPS++A+S +CWIWK+SVTAQ +GSGLKGL
Sbjct  218   DLQKGQQTRLRFFLVVFSISFAYYIIPGYLFPSISAISFICWIWKSSVTAQIVGSGLKGL  277

Query  1279  gigSFALDWATVAAFQGSPLVTPDFAIINMLIGYVLVAYIAIPVWYWTNLFDAKKFPLFS  1100
             GIGSF LDW+TVA F GSPL  P FAI N   G+ +  YI +P++YW+N +DA+KFP ++
Sbjct  278   GIGSFGLDWSTVAGFLGSPLAVPFFAIANFFAGFFIFLYIVLPIFYWSNAYDAQKFPFYT  337

Query  1099  SNVFDSNGQVYNISRVLNKKTFGFDQPGYDSYSNIYLSTAFVYTYGLSFATLAATVSHVA  920
             S  FD  G  YNISR+LN+K F  +   Y+ YS +Y+S  F   YGLSF +L AT+SHVA
Sbjct  338   SQTFDHTGHSYNISRILNEKDFDINLGAYNDYSKLYVSVMFALLYGLSFGSLFATISHVA  397

Query  919   LFHGRTIWEQ---TKESVQDKFSDIHTRLMRKNYEPVPQWWFYlllviivgvalvACQRF  749
             L+ G+ IW      K + +DK+ D+H+RLM+KNY+ VPQWWF  +L+I    A+ AC+ F
Sbjct  398   LYDGKFIWGMWKKAKTATKDKYGDVHSRLMKKNYQAVPQWWFITVLIISFAFAVYACEGF  457

Query  748   GGQLQLPVWGVLLAVLLSLIFTLPVGVITATTNQQTGLNVIAELIIGYMYPGRPLASVTF  569
               QLQLP WG++LA  ++L FTLP+GVI ATTNQQ GLNVI ELIIGY+YPG+PLA+V F
Sbjct  458   DKQLQLPWWGLVLACAIALFFTLPIGVIQATTNQQMGLNVITELIIGYLYPGKPLANVAF  517

Query  568   KMYGlsslsqslmflSDFKLGHYMKIPPKSMFMVQLVGTLISCCVHFGTGWWLLTTVENI  389
             K YG  S+SQ+L F+ DFKLGHYMKIPPKSMF+VQLV T+++  V FGT WWL+T+VENI
Sbjct  518   KTYGYISMSQALYFVGDFKLGHYMKIPPKSMFIVQLVATVVASTVCFGTTWWLITSVENI  577

Query  388   CNPSKLPEGSQWTCPGDDVFYNASIIWGVVSPRRMFGNLGIYQATNYFFLVGFLAPIPVW  209
             CN   LP GS WTCPGD+VFYNASIIWGV+ P RMF   GIY   N+FFL+G LAP+P W
Sbjct  578   CNTDLLPVGSPWTCPGDEVFYNASIIWGVIGPGRMFTKEGIYPGMNWFFLIGILAPVPFW  637

Query  208   YLGRKYPEKRWVSLINMPILISGAEGIPIVKSVNYVCWFAVGLYFNLYVYRKHKGWWARH  29
             YL +K+PEK+W+  I++P++ S    +P  K+V+Y  W  VG+ FN Y++R+ K WWARH
Sbjct  638   YLSKKFPEKKWLKQIHIPLIFSAVSAMPQAKAVHYWSWAIVGVVFNYYIFRRFKSWWARH  697

Query  28    NYILSAGLD  2
             NYILSA LD
Sbjct  698   NYILSAALD  706



>ref|XP_009414367.1| PREDICTED: oligopeptide transporter 5-like [Musa acuminata subsp. 
malaccensis]
Length=811

 Score =   828 bits (2140),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 400/672 (60%), Positives = 524/672 (78%), Gaps = 3/672 (0%)
 Frame = -1

Query  2008  NDSPVEEVRLTVPITDDPTMPCVTFRTWVLGVTSCVILAFLNQFFGYRQNALYVSSVPAQ  1829
              +SP+E+VRLTVP+TDDPT PC+TFRTW +G+ SCV+LAF+NQF  YRQN + +SSV  Q
Sbjct  87    EESPIEQVRLTVPVTDDPTQPCLTFRTWTMGLISCVLLAFVNQFLDYRQNQIVLSSVCVQ  146

Query  1828  IVVLPMGKLMAAYLPTKVVQIPGTKWSFSLNPGPFNIKEHVLITIFASSGSDFSYAVSII  1649
             I+ LP+G+ MAA LPT  +++P T WSFSLNPGPFN+KEHVLITI A++G+   YAV+I+
Sbjct  147   ILTLPVGRAMAATLPTTPIKVPLTNWSFSLNPGPFNLKEHVLITILANAGAGGVYAVNIV  206

Query  1648  TMMKAFYYRDIHPLAAVLLTFSTQMLGYGLAGIFKKFLIDSPYMWWPSNLVQVSLFRALH  1469
             T+MKAFY+R+I+ +AA+LL+ +TQ+LGYG AG+F+K+L+DSPYMWWP NLVQVSLFRALH
Sbjct  207   TIMKAFYHRNINIVAALLLSVTTQLLGYGWAGLFRKYLVDSPYMWWPGNLVQVSLFRALH  266

Query  1468  DVETRPKGGLTRLQFFIIVLVCSFAYYVVPNYLFPSLTALSLLCWIWKNSVTAQQlgsgl  1289
             + E RPKGG++R QFF+IV+ CSFAYYVVPN+ FP++T++S++C IW  SVTAQQ+GSGL
Sbjct  267   EEEKRPKGGVSRFQFFLIVIACSFAYYVVPNFFFPAITSISVVCLIWTKSVTAQQIGSGL  326

Query  1288  kglgigSFALDWATVAAFQGSPLVTPDFAIINMLIGYVLVAYIAIPVWYWTNLFDAKKFP  1109
              GLG+GSF LDW+T++ F GSPL +P FA  N+L G++++ Y+  P+ YWTN + AK FP
Sbjct  327   HGLGVGSFGLDWSTISGFLGSPLASPAFATFNVLAGFIVLVYVIAPIAYWTNAYSAKNFP  386

Query  1108  LFSSNVFDSNGQVYNISRVLNKKTFGFDQPGYDSYSNIYLSTAFVYTYGLSFATLAATVS  929
             +F+S +FD +G+ Y++SRVL+ KTF  +   YDSYS+I LS  F  +YGL FATL AT+S
Sbjct  387   MFTSGLFDVDGKKYDLSRVLDPKTFSLNVQEYDSYSDIRLSIMFAISYGLGFATLTATLS  446

Query  928   HVALFHGR---TIWEQTKESVQDKFSDIHTRLMRKNYEPVPQWWFYlllviivgvalvAC  758
             HV  F+G    T+W QT     D + D+H RLM+ NYE VPQWWF+++LV+++ +A+  C
Sbjct  447   HVFFFNGSYILTLWRQTASKAHDHYLDVHGRLMKANYEAVPQWWFHIVLVVVMALAIFTC  506

Query  757   QRFGGQLQLPVWGVLLAVLLSLIFTLPVGVITATTNQQTGLNVIAELIIGYMYPGRPLAS  578
             + F  QLQLP WGVLLA+ ++ +FTLP+GVI ATTN + GLNVI E++IGY+ PG+PLA+
Sbjct  507   EGFDKQLQLPYWGVLLAMAMAFVFTLPIGVILATTNMEPGLNVITEMVIGYIMPGKPLAN  566

Query  577   VTFKMYGlsslsqslmflSDFKLGHYMKIPPKSMFMVQLVGTLISCCVHFGTGWWLLTTV  398
             V FK YG  S+SQ+  FL+DFKLG YMKIPPK+MF+ QLVGT+++  V+FGT WWLL TV
Sbjct  567   VVFKTYGYISMSQAHTFLADFKLGQYMKIPPKAMFIAQLVGTVVASAVYFGTAWWLLGTV  626

Query  397   ENICNPSKLPEGSQWTCPGDDVFYNASIIWGVVSPRRMFGNLGIYQATNYFFLVGFLAPI  218
               IC+ S LPEGS WTCP D VFY+ASIIWGVV P RMFG   IY + NY+FLVG L P 
Sbjct  627   TAICDTSNLPEGSPWTCPNDAVFYSASIIWGVVGPLRMFGPKSIYSSLNYYFLVGMLLPF  686

Query  217   PVWYLGRKYPEKRWVSLINMPILISGAEGIPIVKSVNYVCWFAVGLYFNLYVYRKHKGWW  38
              VW L R +P K+W+ LIN P+L+     +P   +VNY  WF VG++FN YVY K+K WW
Sbjct  687   AVWLLARTFPRKKWIKLINFPVLLGSTSMMPPAHAVNYTSWFVVGIFFNYYVYNKYKNWW  746

Query  37    ARHNYILSAGLD  2
              R+ Y+LSAGLD
Sbjct  747   GRYVYVLSAGLD  758



>ref|XP_010450442.1| PREDICTED: oligopeptide transporter 1-like [Camelina sativa]
 ref|XP_010450449.1| PREDICTED: oligopeptide transporter 1-like [Camelina sativa]
Length=754

 Score =   826 bits (2133),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 415/669 (62%), Positives = 524/669 (78%), Gaps = 3/669 (0%)
 Frame = -1

Query  1999  PVEEVRLTVPITDDPTMPCVTFRTWVLGVTSCVILAFLNQFFGYRQNALYVSSVPAQIVV  1820
             P+EEVRLTVPITDDP++P +TFRTW LG+ SC++LAF+NQFF +R N L+VSSV AQIV 
Sbjct  34    PIEEVRLTVPITDDPSIPVLTFRTWFLGLLSCILLAFVNQFFSFRSNQLWVSSVAAQIVT  93

Query  1819  LPMGKLMAAYLPTKVVQIPGTKWSFSLNPGPFNIKEHVLITIFASSGSDFSYAVSIITMM  1640
             LP+GKLMAA LPTK    PGT WS+SLNPGPF++KEHVLITIFA++G+  +YA +IIT++
Sbjct  94    LPLGKLMAATLPTKKFGFPGTNWSWSLNPGPFSMKEHVLITIFANTGAGGAYATNIITIV  153

Query  1639  KAFYYRDIHPLAAVLLTFSTQMLGYGLAGIFKKFLIDSPYMWWPSNLVQVSLFRALHDVE  1460
             KAFY+R ++  AA+LLT +TQ+LGYG AG+F+KFL+DSPYMWWPSNLVQVSLFRALH+ E
Sbjct  154   KAFYHRQLNVAAAMLLTQTTQLLGYGWAGLFRKFLVDSPYMWWPSNLVQVSLFRALHEKE  213

Query  1459  TRPKGGLTRLQFFIIVLVCSFAYYVVPNYLFPSLTALSLLCWIWKNSVTAQQlgsglkgl  1280
                KG  TRL+FF+IV   SFAYY++P YLFPS++A+S +CWIWK+SVTAQ +GSGL+GL
Sbjct  214   DLQKGQQTRLRFFLIVFSISFAYYIIPGYLFPSISAISFVCWIWKSSVTAQIIGSGLRGL  273

Query  1279  gigSFALDWATVAAFQGSPLVTPDFAIINMLIGYVLVAYIAIPVWYWTNLFDAKKFPLFS  1100
             GIGSF LDW+TVA F GSPL  P FAI N   G+ +  YI +P++YWTN +DA+KFP ++
Sbjct  274   GIGSFGLDWSTVAGFLGSPLAVPFFAIANFFAGFFIFLYIVLPIFYWTNAYDAQKFPFYT  333

Query  1099  SNVFDSNGQVYNISRVLNKKTFGFDQPGYDSYSNIYLSTAFVYTYGLSFATLAATVSHVA  920
             S  FD  G  YNI+R+LN+K F  +   Y+ YS +YLS  F   YGLSF +L AT+SHVA
Sbjct  334   SQTFDHTGHSYNITRILNEKNFDINLEAYNDYSKLYLSVMFALLYGLSFGSLFATISHVA  393

Query  919   LFHGRTIWEQ---TKESVQDKFSDIHTRLMRKNYEPVPQWWFYlllviivgvalvACQRF  749
             L+ G+ IW      K + +DK+ D+H+RLM+KNY+ VPQWWF  +L+I    AL AC+ F
Sbjct  394   LYDGKFIWGMWKKAKTATKDKYGDVHSRLMKKNYQSVPQWWFVTILIISFAFALYACEGF  453

Query  748   GGQLQLPVWGVLLAVLLSLIFTLPVGVITATTNQQTGLNVIAELIIGYMYPGRPLASVTF  569
               QLQLP WG++LA  ++L FTLP+GVI ATTNQQ GLNVI ELIIGY+YPGRPLA+V F
Sbjct  454   DKQLQLPWWGLILACAIALFFTLPIGVIQATTNQQMGLNVITELIIGYLYPGRPLANVAF  513

Query  568   KMYGlsslsqslmflSDFKLGHYMKIPPKSMFMVQLVGTLISCCVHFGTGWWLLTTVENI  389
             K YG  S+SQ+L F+ DFKLGHYMKIPP+SMF+VQLV T+++  V FGT WWL+T+VENI
Sbjct  514   KTYGYISMSQALYFVGDFKLGHYMKIPPRSMFIVQLVATVVASTVCFGTTWWLITSVENI  573

Query  388   CNPSKLPEGSQWTCPGDDVFYNASIIWGVVSPRRMFGNLGIYQATNYFFLVGFLAPIPVW  209
             CN   LP GS WTCPGD+VFYNASIIWGV+ P RMF   GIY   N+FFL+G LAP+P W
Sbjct  574   CNTDLLPVGSPWTCPGDEVFYNASIIWGVIGPGRMFTKEGIYPGMNWFFLIGLLAPVPFW  633

Query  208   YLGRKYPEKRWVSLINMPILISGAEGIPIVKSVNYVCWFAVGLYFNLYVYRKHKGWWARH  29
             YL +K+PEK+W+  I++P++ S    +P  K+V+Y  W  VG+ FN Y++R+ K WWARH
Sbjct  634   YLSKKFPEKKWLKQIHIPLIFSAVSAMPQAKAVHYWSWAIVGVIFNYYIFRRFKTWWARH  693

Query  28    NYILSAGLD  2
             NYILSA LD
Sbjct  694   NYILSAALD  702



>ref|XP_002864417.1| ATOPT1 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH40676.1| ATOPT1 [Arabidopsis lyrata subsp. lyrata]
Length=755

 Score =   826 bits (2133),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 422/683 (62%), Positives = 530/683 (78%), Gaps = 3/683 (0%)
 Frame = -1

Query  2041  ISAVESSADEINDSPVEEVRLTVPITDDPTMPCVTFRTWVLGVTSCVILAFLNQFFGYRQ  1862
             I+A E   +E ND+P+EEVRLTVPITDDPT+P +TFRTW LG+ SC++LAF+NQFF +R 
Sbjct  21    INAGEEEKEEENDNPIEEVRLTVPITDDPTLPVLTFRTWFLGLLSCILLAFVNQFFSFRS  80

Query  1861  NALYVSSVPAQIVVLPMGKLMAAYLPTKVVQIPGTKWSFSLNPGPFNIKEHVLITIFASS  1682
             N L+VSSV AQIV LP+GKLMA  LPTK    PGT WS+SLNPGPFN+KEHVLITIFA++
Sbjct  81    NQLWVSSVAAQIVTLPLGKLMAKTLPTKKFGFPGTNWSWSLNPGPFNMKEHVLITIFANT  140

Query  1681  GSDFSYAVSIITMMKAFYYRDIHPLAAVLLTFSTQMLGYGLAGIFKKFLIDSPYMWWPSN  1502
             G+   YA SIIT++KAFY R ++  AA+LLT +TQ+LGYG AG+F+KFL+DSPYMWWPSN
Sbjct  141   GAGGVYATSIITIVKAFYNRQLNVAAAMLLTQTTQLLGYGWAGMFRKFLVDSPYMWWPSN  200

Query  1501  LVQVSLFRALHDVETRPKGGLTRLQFFIIVLVCSFAYYVVPNYLFPSLTALSLLCWIWKN  1322
             LVQVSLFRALH+ E   KG  TR +FF+IV   SFAYY++P YLFPS++ +S +CWIWK+
Sbjct  201   LVQVSLFRALHEKEDLQKGQQTRFRFFLIVFGVSFAYYIIPGYLFPSISTISFVCWIWKS  260

Query  1321  SVTAQQlgsglkglgigSFALDWATVAAFQGSPLVTPDFAIINMLIGYVLVAYIAIPVWY  1142
             SVTAQ +GSGLKGLGIGSF LDW+TVA F GSPL  P FAI N   G+ +  YI +P++Y
Sbjct  261   SVTAQIVGSGLKGLGIGSFGLDWSTVAGFLGSPLAVPFFAIANFFGGFFIFLYIVLPIFY  320

Query  1141  WTNLFDAKKFPLFSSNVFDSNGQVYNISRVLNKKTFGFDQPGYDSYSNIYLSTAFVYTYG  962
             WTN +DA+KFP ++S+ FD  G  YNI+R+LN+K F  +   Y+ YS +YLS  F   YG
Sbjct  321   WTNAYDAQKFPFYTSHTFDQTGHTYNITRILNEKNFDINLDAYNGYSKLYLSVMFALLYG  380

Query  961   LSFATLAATVSHVALFHGRTIWEQ---TKESVQDKFSDIHTRLMRKNYEPVPQWWFYlll  791
             LSF +L AT+SHVAL+ G+ IW      K + +DK+ D+H+RLM+KNY+ VPQWWF ++L
Sbjct  381   LSFGSLFATISHVALYDGKFIWGMWKKAKTATKDKYGDVHSRLMKKNYQSVPQWWFIVVL  440

Query  790   viivgvalvACQRFGGQLQLPVWGVLLAVLLSLIFTLPVGVITATTNQQTGLNVIAELII  611
             VI    AL AC+ F  QLQLP WG++LA  ++L FTLP+GVI ATTNQQ GLNVI ELII
Sbjct  441   VISFAFALYACEGFDKQLQLPWWGLILACAIALFFTLPIGVIQATTNQQMGLNVITELII  500

Query  610   GYMYPGRPLASVTFKMYGlsslsqslmflSDFKLGHYMKIPPKSMFMVQLVGTLISCCVH  431
             GY+YPG+PLA+V FK YG  S+SQ+L F+ DFKLGHYMKIPP+SMF+VQLV T+++  V 
Sbjct  501   GYLYPGKPLANVAFKTYGYISMSQALYFVGDFKLGHYMKIPPRSMFIVQLVATVVASTVC  560

Query  430   FGTGWWLLTTVENICNPSKLPEGSQWTCPGDDVFYNASIIWGVVSPRRMFGNLGIYQATN  251
             FGT WWL+T+VENICN   LP GS WTCPGD+VFYNASIIWGV+ P RMF   GIY   N
Sbjct  561   FGTTWWLITSVENICNVDLLPVGSPWTCPGDEVFYNASIIWGVIGPGRMFTKEGIYPGMN  620

Query  250   YFFLVGFLAPIPVWYLGRKYPEKRWVSLINMPILISGAEGIPIVKSVNYVCWFAVGLYFN  71
             +FFL+G LAP+P WYL +K+PEK+W+  I++P++ S    +P  K+V+Y  W  VG+ FN
Sbjct  621   WFFLIGLLAPVPFWYLSKKFPEKKWLKQIHVPLIFSAVSAMPQAKAVHYWSWAIVGVVFN  680

Query  70    LYVYRKHKGWWARHNYILSAGLD  2
              Y++R+ K WWARHNYILSA LD
Sbjct  681   YYIFRRFKTWWARHNYILSAALD  703



>ref|XP_010443233.1| PREDICTED: oligopeptide transporter 1-like [Camelina sativa]
Length=754

 Score =   825 bits (2132),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 416/669 (62%), Positives = 524/669 (78%), Gaps = 3/669 (0%)
 Frame = -1

Query  1999  PVEEVRLTVPITDDPTMPCVTFRTWVLGVTSCVILAFLNQFFGYRQNALYVSSVPAQIVV  1820
             P+EEVRLTVPITDDP++P +TFRTW LG+ SC++LAF+NQFF +R N L+VSSV AQIV 
Sbjct  34    PIEEVRLTVPITDDPSIPVLTFRTWFLGLFSCILLAFVNQFFSFRSNQLWVSSVAAQIVT  93

Query  1819  LPMGKLMAAYLPTKVVQIPGTKWSFSLNPGPFNIKEHVLITIFASSGSDFSYAVSIITMM  1640
             LP+GKLMAA LPTK    PGT WS+SLNPGPF++KEHVLITIFA++G+  +YA +IIT++
Sbjct  94    LPLGKLMAATLPTKKFGFPGTNWSWSLNPGPFSMKEHVLITIFANTGAGGAYATNIITIV  153

Query  1639  KAFYYRDIHPLAAVLLTFSTQMLGYGLAGIFKKFLIDSPYMWWPSNLVQVSLFRALHDVE  1460
             KAFY+R ++  AA+LLT +TQ+LGYG AGIF+KFL+DSPYMWWPSNLVQVSLFRALH+ E
Sbjct  154   KAFYHRQLNVAAAMLLTQTTQLLGYGWAGIFRKFLVDSPYMWWPSNLVQVSLFRALHEKE  213

Query  1459  TRPKGGLTRLQFFIIVLVCSFAYYVVPNYLFPSLTALSLLCWIWKNSVTAQQlgsglkgl  1280
                KG  TR++FF+IV   SFAYY++P YLFPS++A+S +CWIWK+SVTAQ +GSGLKGL
Sbjct  214   DLQKGQQTRVRFFLIVFSISFAYYIIPGYLFPSISAISFVCWIWKSSVTAQIIGSGLKGL  273

Query  1279  gigSFALDWATVAAFQGSPLVTPDFAIINMLIGYVLVAYIAIPVWYWTNLFDAKKFPLFS  1100
             GIGSF LDW+TVA F GSPL  P FAI N   G+ +  YI +P++YWTN +DA+KFP ++
Sbjct  274   GIGSFGLDWSTVAGFLGSPLAVPFFAIANFFAGFFIFLYIVLPIFYWTNAYDAQKFPFYT  333

Query  1099  SNVFDSNGQVYNISRVLNKKTFGFDQPGYDSYSNIYLSTAFVYTYGLSFATLAATVSHVA  920
             S  FD  G  YNI+R+LN+K F  +   Y+ YS +YLS  F   YGLSF +L AT+SHVA
Sbjct  334   SQTFDHTGHSYNITRILNEKNFDINLDAYNDYSKLYLSVMFALLYGLSFGSLFATISHVA  393

Query  919   LFHGRTIWEQ---TKESVQDKFSDIHTRLMRKNYEPVPQWWFYlllviivgvalvACQRF  749
             L+ G+ IW      K + +DK+ D+H+RLM+KNY+ VPQWWF  +L+I    AL AC+ F
Sbjct  394   LYDGKFIWGMWKKAKTATKDKYGDVHSRLMKKNYQSVPQWWFVTILIISFAFALYACEGF  453

Query  748   GGQLQLPVWGVLLAVLLSLIFTLPVGVITATTNQQTGLNVIAELIIGYMYPGRPLASVTF  569
               QLQLP WG++LA  ++L FTLP+GVI ATTNQQ GLNVI ELIIGY+YPGRPLA+V F
Sbjct  454   DKQLQLPWWGLILACAIALFFTLPIGVIQATTNQQMGLNVITELIIGYLYPGRPLANVAF  513

Query  568   KMYGlsslsqslmflSDFKLGHYMKIPPKSMFMVQLVGTLISCCVHFGTGWWLLTTVENI  389
             K YG  S+SQ+L F+ DFKLGHYMKIPP+SMF+VQLV T+++  V FGT WWL+T+VENI
Sbjct  514   KTYGYISMSQALYFVGDFKLGHYMKIPPRSMFIVQLVATVVASTVCFGTTWWLITSVENI  573

Query  388   CNPSKLPEGSQWTCPGDDVFYNASIIWGVVSPRRMFGNLGIYQATNYFFLVGFLAPIPVW  209
             CN   LP GS WTCPGD+VFYNASIIWGV+ P RMF   GIY   N+FFL+G LAP+P W
Sbjct  574   CNTDLLPVGSPWTCPGDEVFYNASIIWGVIGPGRMFTKEGIYPGMNWFFLIGLLAPVPFW  633

Query  208   YLGRKYPEKRWVSLINMPILISGAEGIPIVKSVNYVCWFAVGLYFNLYVYRKHKGWWARH  29
             YL +K+PEK+W+  I++P++ S    +P  K+V+Y  W  VG+ FN Y++R+ K WWARH
Sbjct  634   YLSKKFPEKKWLKQIHIPLIFSAVSAMPQAKAVHYWSWAIVGVIFNYYIFRRFKSWWARH  693

Query  28    NYILSAGLD  2
             NYILSA LD
Sbjct  694   NYILSAALD  702



>gb|AFW63888.1| hypothetical protein ZEAMMB73_458110 [Zea mays]
Length=743

 Score =   820 bits (2119),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 395/688 (57%), Positives = 533/688 (77%), Gaps = 3/688 (0%)
 Frame = -1

Query  2056  MENTGISAVESSADEINDSPVEEVRLTVPITDDPTMPCVTFRTWVLGVTSCVILAFLNQF  1877
             M  T      + A+E+N+ P+EEVR TVP TDDP+ PC+TFRTWVLG++SCV+L+F+N+F
Sbjct  1     MAKTHEEGAGAEAEEVNEHPIEEVRNTVPTTDDPSEPCLTFRTWVLGMSSCVLLSFVNEF  60

Query  1876  FGYRQNALYVSSVPAQIVVLPMGKLMAAYLPTKVVQIPGTKWSFSLNPGPFNIKEHVLIT  1697
             F YR + L + +V  QI  LP+G+LMA+ LP + V++P   WSFSLNPGPF++KEH LIT
Sbjct  61    FNYRSSQLSIGTVLVQIASLPIGRLMASTLPGRPVRVPLIAWSFSLNPGPFSLKEHCLIT  120

Query  1696  IFASSGSDFSYAVSIITMMKAFYYRDIHPLAAVLLTFSTQMLGYGLAGIFKKFLIDSPYM  1517
             IFA +G    YA++I+ ++K FY R I+P AA+LL  +TQ+LGYG AG+F+KFL+DS YM
Sbjct  121   IFAGAGCSGVYALNIVAIVKVFYRRQINPYAAMLLAQTTQLLGYGWAGLFRKFLVDSAYM  180

Query  1516  WWPSNLVQVSLFRALHDVETRPKGGLTRLQFFIIVLVCSFAYYVVPNYLFPSLTALSLLC  1337
             WWP NLVQV+L RA+H+ E RP+GG+TRLQFF+IV++CSFAYY++P+YLFPSL+ +S+LC
Sbjct  181   WWPINLVQVTLLRAMHEEEKRPRGGVTRLQFFVIVVICSFAYYLIPSYLFPSLSTVSVLC  240

Query  1336  WIWKNSVTAQQlgsglkglgigSFALDWATVAAFQGSPLVTPDFAIINMLIGYVLVAYIA  1157
             W++++SVTAQQ+GSGL+GLGIGSF LDW TVA F G+PLV+P F ++N++ G+ L  Y+A
Sbjct  241   WLYRDSVTAQQIGSGLRGLGIGSFGLDWNTVAGFLGNPLVSPAFTVVNVMAGFALTTYVA  300

Query  1156  IPVWYWTNLFDAKKFPLFSSNVFDSNGQVYNISRVLNKKTFGFDQPGYDSYSNIYLSTAF  977
             +P+ YWT+ ++A++FPL S +V+D  G+ Y+  RVLN+ TF  +  GYD+YS I +S  F
Sbjct  301   LPLLYWTDTYNARRFPLISPHVYDDAGRPYDTGRVLNRDTFTLNLVGYDAYSRINVSVLF  360

Query  976   VYTYGLSFATLAATVSHVALFHGRTIWE---QTKESVQDKFSDIHTRLMRKNYEPVPQWW  806
                YG+ FA+L +T+SHVAL+HGR +W+   + ++  +    D+HTR+MR+NY+PVPQWW
Sbjct  361   AVNYGIGFASLMSTLSHVALYHGREVWDGLCRKRQHQKTDVDDVHTRIMRRNYKPVPQWW  420

Query  805   FYlllviivgvalvACQRFGGQLQLPVWGVLLAVLLSLIFTLPVGVITATTNQQTGLNVI  626
             F+L+L +++ ++L  C+ FG QLQLP WG+LLA  ++  FTLPVGVI ATTN Q GLN++
Sbjct  421   FHLMLAVVLALSLFTCEGFGQQLQLPYWGLLLACAIAFAFTLPVGVIFATTNMQPGLNIV  480

Query  625   AELIIGYMYPGRPLASVTFKMYGlsslsqslmflSDFKLGHYMKIPPKSMFMVQLVGTLI  446
              ELIIGY+YPG+PLA+V FK YG  S+ Q+L FL+D KLGHYMKIPP+SMF  QL GTL 
Sbjct  481   TELIIGYLYPGKPLANVVFKTYGFISMGQALAFLADLKLGHYMKIPPRSMFFAQLAGTLT  540

Query  445   SCCVHFGTGWWLLTTVENICNPSKLPEGSQWTCPGDDVFYNASIIWGVVSPRRMFGNLGI  266
             +  VHF T WWLLTTV++IC+  +LP GS WTCPGDDVFYNASIIWGVV P RMFG+LG 
Sbjct  541   ASTVHFATAWWLLTTVKDICDVGRLPAGSPWTCPGDDVFYNASIIWGVVGPLRMFGSLGN  600

Query  265   YQATNYFFLVGFLAPIPVWYLGRKYPEKRWVSLINMPILISGAEGIPIVKSVNYVCWFAV  86
             Y   NY FLVG LAP+PVW L R YP  R ++ +N+P++ +GA G+   +SVN++ W  +
Sbjct  601   YWQMNYLFLVGLLAPLPVWLLQRAYPTNRVLAGVNLPLVFAGASGLLPARSVNFIMWGLL  660

Query  85    GLYFNLYVYRKHKGWWARHNYILSAGLD  2
             G  FN  VYR++K WW RHNY+L+AGLD
Sbjct  661   GFIFNHVVYRRYKAWWMRHNYVLAAGLD  688



>ref|XP_002454835.1| hypothetical protein SORBIDRAFT_04g038240 [Sorghum bicolor]
 gb|EES07811.1| hypothetical protein SORBIDRAFT_04g038240 [Sorghum bicolor]
Length=742

 Score =   820 bits (2117),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 404/686 (59%), Positives = 533/686 (78%), Gaps = 4/686 (1%)
 Frame = -1

Query  2047  TGISAVESSADEINDSPVEEVRLTVPITDDPTMPCVTFRTWVLGVTSCVILAFLNQFFGY  1868
             T  +A  S  +E+N+ P+EEVR TVPITDDP+ PC+TFRTWVLG++SCV+LAF+N+FF Y
Sbjct  2     TTAAAKYSEKEEVNEHPIEEVRNTVPITDDPSEPCLTFRTWVLGMSSCVLLAFVNEFFNY  61

Query  1867  RQNALYVSSVPAQIVVLPMGKLMAAYLPTKVVQIPGTKW-SFSLNPGPFNIKEHVLITIF  1691
             R + L + +V  QI  LP+G+LMA+ LP +V+   G +W SFSLNPGPF++KEH LITIF
Sbjct  62    RSSQLSIGTVLVQIASLPIGRLMASTLPERVIGGGGCRWWSFSLNPGPFSLKEHCLITIF  121

Query  1690  ASSGSDFSYAVSIITMMKAFYYRDIHPLAAVLLTFSTQMLGYGLAGIFKKFLIDSPYMWW  1511
             A +G+   YA++I+ ++K FY R I+P AA+LL  +TQ+LGYG AG+F+KFL+DS YMWW
Sbjct  122   AGAGASGVYALNIVAIVKVFYRRQINPYAAMLLAQTTQLLGYGWAGLFRKFLVDSAYMWW  181

Query  1510  PSNLVQVSLFRALHDVETRPKGGLTRLQFFIIVLVCSFAYYVVPNYLFPSLTALSLLCWI  1331
             P NLVQV+LFRA+H+ E RP+GG+TRLQFFIIV++CSFAYY++P+YLFPSL+ +S+LCW+
Sbjct  182   PMNLVQVTLFRAMHEEEKRPRGGVTRLQFFIIVMICSFAYYLIPSYLFPSLSTVSVLCWV  241

Query  1330  WKNSVTAQQlgsglkglgigSFALDWATVAAFQGSPLVTPDFAIINMLIGYVLVAYIAIP  1151
             +++SVTAQQ+GSGL GLG+GSF LDW TVA F G+PL +P F I+N++ G+ L  Y+A+P
Sbjct  242   YRDSVTAQQIGSGLGGLGVGSFGLDWNTVAGFLGNPLASPAFTIVNVMAGFALTTYVALP  301

Query  1150  VWYWTNLFDAKKFPLFSSNVFDSNGQVYNISRVLNKKTFGFDQPGYDSYSNIYLSTAFVY  971
             + YW++ ++A++FPL S +V+D  G+ Y+  RV+N+ TF  D  GYD+YS I +S  F  
Sbjct  302   LLYWSDTYNARRFPLMSPHVYDDAGRPYDTGRVINRDTFTLDLAGYDAYSRINVSVLFAV  361

Query  970   TYGLSFATLAATVSHVALFHGRTIWEQ---TKESVQDKFSDIHTRLMRKNYEPVPQWWFY  800
              YG+ FA+L +T+SHVAL+HG+ IWE       S +D   D+HTR+ R+NY+ VPQWWF+
Sbjct  362   NYGIGFASLMSTLSHVALYHGKEIWELWWLQSSSEEDVDVDVHTRITRRNYKAVPQWWFH  421

Query  799   lllviivgvalvACQRFGGQLQLPVWGVLLAVLLSLIFTLPVGVITATTNQQTGLNVIAE  620
             LLL +++ ++L  C+ FG QLQLP WG+LLA  ++L FTLPVGVI+ATTN Q GLNV+ E
Sbjct  422   LLLAVVLALSLFTCEGFGRQLQLPYWGLLLACAIALAFTLPVGVISATTNMQPGLNVVTE  481

Query  619   LIIGYMYPGRPLASVTFKMYGlsslsqslmflSDFKLGHYMKIPPKSMFMVQLVGTLISC  440
             LIIGY+YPG+PLA+V FK YG  S+ Q+L  LSD KLGHYMKIPP+SMF+ QL GT+ + 
Sbjct  482   LIIGYLYPGKPLANVVFKTYGFISMGQALALLSDLKLGHYMKIPPRSMFLAQLAGTVTAS  541

Query  439   CVHFGTGWWLLTTVENICNPSKLPEGSQWTCPGDDVFYNASIIWGVVSPRRMFGNLGIYQ  260
              VHF T WWLLTTVENIC+  +LP GS WTCPGDDVFYNASIIWGVV P RMFG+LG Y 
Sbjct  542   TVHFATAWWLLTTVENICDVERLPRGSPWTCPGDDVFYNASIIWGVVGPLRMFGSLGNYW  601

Query  259   ATNYFFLVGFLAPIPVWYLGRKYPEKRWVSLINMPILISGAEGIPIVKSVNYVCWFAVGL  80
               NY FLVG LAP+PVW L R YP  R ++ +N+P++ +GA G+   +SVN++ W  VG 
Sbjct  602   QMNYLFLVGLLAPLPVWLLQRAYPRNRVLAAVNLPLVFAGASGLLPARSVNFLMWGLVGF  661

Query  79    YFNLYVYRKHKGWWARHNYILSAGLD  2
              FN  VYR+HK WW RHNY+L+AGLD
Sbjct  662   LFNHVVYRRHKAWWMRHNYVLAAGLD  687



>dbj|BAK04842.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=736

 Score =   819 bits (2115),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 399/677 (59%), Positives = 526/677 (78%), Gaps = 2/677 (0%)
 Frame = -1

Query  2026  SSADEINDSPVEEVRLTVPITDDPTMPCVTFRTWVLGVTSCVILAFLNQFFGYRQNALYV  1847
              + +E+ND P+EEVR TVPITDDP+ P +TFRTWVLG+ SCV+LAF+N+FF YR N L +
Sbjct  7     DAEEEVNDHPIEEVRNTVPITDDPSEPSLTFRTWVLGMPSCVLLAFVNEFFMYRSNQLSI  66

Query  1846  SSVPAQIVVLPMGKLMAAYLPTKVVQIPGTKWSFSLNPGPFNIKEHVLITIFASSGSDFS  1667
              +V  QI  LP+G+ MA+ LP K++++P   W+F+LNPGPF++KEH LITIFA +G+   
Sbjct  67    GTVVVQIATLPIGRFMASALPAKLIRVPLMGWTFTLNPGPFSLKEHCLITIFAGAGASGV  126

Query  1666  YAVSIITMMKAFYYRDIHPLAAVLLTFSTQMLGYGLAGIFKKFLIDSPYMWWPSNLVQVS  1487
             YA++II ++K FY R I+P AA+LL  +TQ+LGYG AG+F+ +L+DS YMWWP NLVQV+
Sbjct  127   YAMNIIAIVKVFYKRQINPYAAMLLAQTTQLLGYGWAGLFRTYLVDSAYMWWPLNLVQVT  186

Query  1486  LFRALHDVETRPKGGLTRLQFFIIVLVCSFAYYVVPNYLFPSLTALSLLCWIWKNSVTAQ  1307
             LFRA+H+ E RPKG LTRLQFF IV++CSFAYY++P+YLFP+ + LS LCW +K+S+TAQ
Sbjct  187   LFRAMHEEEKRPKGQLTRLQFFFIVMICSFAYYLIPSYLFPAASTLSALCWFYKDSITAQ  246

Query  1306  QlgsglkglgigSFALDWATVAAFQGSPLVTPDFAIINMLIGYVLVAYIAIPVWYWTNLF  1127
             Q+GSGLKGLG+GS  LDW TVA F G+PL +P FAI NM+ G+ L  Y A+P+ YWTN +
Sbjct  247   QIGSGLKGLGVGSLGLDWNTVAGFIGNPLASPAFAIFNMMAGFSLNNYFAVPLLYWTNTY  306

Query  1126  DAKKFPLFSSNVFDSNGQVYNISRVLNKKTFGFDQPGYDSYSNIYLSTAFVYTYGLSFAT  947
             +AK+FP+ SS+VFD+ G  Y+ +R+L+ KTF  +   Y++YS I+LS  F   YG  FA 
Sbjct  307   NAKRFPIISSHVFDAAGNRYDTNRILDPKTFTLNLHEYNAYSRIHLSVLFALNYGFGFAG  366

Query  946   LAATVSHVALFHGRTIWE--QTKESVQDKFSDIHTRLMRKNYEPVPQWWFYlllviivgv  773
             L +T+SHVAL+HG+ I++  +   S + K  D+HTR+M++NY  VPQWWF+L+LV+++ +
Sbjct  367   LLSTLSHVALYHGKEIFDLWRKTSSEKGKEQDVHTRIMKRNYRSVPQWWFHLMLVLVLAL  426

Query  772   alvACQRFGGQLQLPVWGVLLAVLLSLIFTLPVGVITATTNQQTGLNVIAELIIGYMYPG  593
             +L  C+ FGGQLQLP WG+LLA  ++L FTLP+G+ITATTN Q GLN+I ELIIGY+YPG
Sbjct  427   SLFTCEGFGGQLQLPYWGLLLACAIALTFTLPIGIITATTNMQPGLNIITELIIGYLYPG  486

Query  592   RPLASVTFKMYGlsslsqslmflSDFKLGHYMKIPPKSMFMVQLVGTLISCCVHFGTGWW  413
             +PLA+V FK YG  S+ Q+L F+SDFKLGHYMKIPP+SMF VQL GT+ S  VHF T WW
Sbjct  487   KPLANVVFKTYGYISMGQALTFVSDFKLGHYMKIPPRSMFFVQLAGTVTSSTVHFATAWW  546

Query  412   LLTTVENICNPSKLPEGSQWTCPGDDVFYNASIIWGVVSPRRMFGNLGIYQATNYFFLVG  233
             LLTTV+N+C+   LPEGS WTCPGDDVFYNASIIWGVV P RMFG LG Y   NYFFLVG
Sbjct  547   LLTTVKNVCDVDVLPEGSPWTCPGDDVFYNASIIWGVVGPLRMFGRLGNYWQMNYFFLVG  606

Query  232   FLAPIPVWYLGRKYPEKRWVSLINMPILISGAEGIPIVKSVNYVCWFAVGLYFNLYVYRK  53
              LAP+P+W L R YP   ++  IN+P++ +GA G+   +SVN++ W  VG+ FN ++YR+
Sbjct  607   VLAPLPIWLLCRWYPHNTFLKSINIPLIFAGAGGLLPARSVNFLMWGLVGIVFNHFIYRR  666

Query  52    HKGWWARHNYILSAGLD  2
             HK WW RH Y+L+AGLD
Sbjct  667   HKAWWMRHTYVLAAGLD  683



>gb|KDP39295.1| hypothetical protein JCGZ_01052 [Jatropha curcas]
Length=716

 Score =   811 bits (2095),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 417/690 (60%), Positives = 516/690 (75%), Gaps = 49/690 (7%)
 Frame = -1

Query  2062  H*MENTGISAVESSADEINDSPVEEVRLTVPITDDPTMPCVTFRTWVLGVTSCVILAFLN  1883
             H ++  G+ A+    +E+ND+P+E+VRLTVPI DDPT P +TFRTWVLG+ SCV+LAF+N
Sbjct  20    HNVDIAGV-ALGDKEEEVNDNPIEQVRLTVPIRDDPTEPALTFRTWVLGIMSCVLLAFVN  78

Query  1882  QFFGYRQNALYVSSVPAQIVVLPMGKLMAAYLPTKVVQIPGTKWSFSLNPGPFNIKEHVL  1703
             QFF YR N L                                        GPF +KEHVL
Sbjct  79    QFFSYRSNPL----------------------------------------GPFTLKEHVL  98

Query  1702  ITIFASSGSDFSYAVSIITMMKAFYYRDIHPLAAVLLTFSTQMLGYGLAGIFKKFLIDSP  1523
             ITIFAS G+   YAV+I+T +KAFY R IHP+AA+LL     +LGYG AGIF+K L+DSP
Sbjct  99    ITIFASCGASGVYAVNILTAVKAFYRRPIHPVAAMLL-----LLGYGWAGIFRKILVDSP  153

Query  1522  YMWWPSNLVQVSLFRALHDVETRPKGGLTRLQFFIIVLVCSFAYYVVPNYLFPSLTALSL  1343
             YMWWPSNLVQVSLFRAL+D E RPKG LTRLQFF IV + S+AYY++P YLFPS++ +S 
Sbjct  154   YMWWPSNLVQVSLFRALNDKEKRPKGRLTRLQFFTIVFIASYAYYIIPGYLFPSISTISF  213

Query  1342  LCWIWKNSVTAQQlgsglkglgigSFALDWATVAAFQGSPLVTPDFAIINMLIGYVLVAY  1163
             +CWIWK+SVTAQQ+GSG KGLGI SF LDW+TVA+F G+PL  P FAI N L G+ +V Y
Sbjct  214   ICWIWKDSVTAQQIGSGRKGLGIVSFGLDWSTVASFLGTPLAMPLFAIANTLAGFFVVQY  273

Query  1162  IAIPVWYWTNLFDAKKFPLFSSNVFDSNGQVYNISRVLNKKTFGFDQPGYDSYSNIYLST  983
             I +P  YW+N +DAKKFP+FSS  FD+ GQ+YNI+R+LN+K F  +   Y++YS +YLS 
Sbjct  274   IIVPSLYWSNTYDAKKFPIFSSRTFDNAGQIYNITRILNQKNFDVNLDAYNNYSKLYLSV  333

Query  982   AFVYTYGLSFATLAATVSHVALFHGRTIW---EQTKESVQDKFSDIHTRLMRKNYEPVPQ  812
              F   YGLSFA+L AT+SHV LF G+TIW    +T  +++D+F+D+HTRLM+KNYE VPQ
Sbjct  334   LFAINYGLSFASLTATISHVLLFEGKTIWNMWRKTAGALKDQFTDVHTRLMKKNYEEVPQ  393

Query  811   WWFYlllviivgvalvACQRFGGQLQLPVWGVLLAVLLSLIFTLPVGVITATTNQQTGLN  632
             WWF  +LVI V ++L+A + F  QLQLP WG+LLA  ++L FTLP+GV+ ATTN Q GLN
Sbjct  394   WWFVTILVISVALSLLAVEGFNKQLQLPWWGLLLACGIALFFTLPIGVVQATTNMQMGLN  453

Query  631   VIAELIIGYMYPGRPLASVTFKMYGlsslsqslmflSDFKLGHYMKIPPKSMFMVQLVGT  452
             VI ELIIGY+YPG+PLA+VTFK YG  S+SQ+L F+ DFKLGHYMKIPPKSMF+VQLVGT
Sbjct  454   VITELIIGYIYPGKPLANVTFKTYGYISMSQALTFVQDFKLGHYMKIPPKSMFLVQLVGT  513

Query  451   LISCCVHFGTGWWLLTTVENICNPSKLPEGSQWTCPGDDVFYNASIIWGVVSPRRMFGNL  272
             ++   V+F T WWLL+TVENIC P  LP+GS WTCPGDDVFYNASIIWGV+ P RMFG L
Sbjct  514   IVGSTVYFATAWWLLSTVENICLPDLLPDGSPWTCPGDDVFYNASIIWGVIGPLRMFGKL  573

Query  271   GIYQATNYFFLVGFLAPIPVWYLGRKYPEKRWVSLINMPILISGAEGIPIVKSVNYVCWF  92
             G+Y   N+FFL+G +APIPVW L RK+PEK+W+ LI+MPI +S    +P    V+Y  W 
Sbjct  574   GVYSQLNWFFLIGAVAPIPVWLLTRKFPEKKWIKLIHMPIFLSATISMPPAGPVHYWSWG  633

Query  91    AVGLYFNLYVYRKHKGWWARHNYILSAGLD  2
             AVGL+FN YVYRK+K WWARHNYILSAGLD
Sbjct  634   AVGLFFNFYVYRKYKRWWARHNYILSAGLD  663



>ref|XP_006660037.1| PREDICTED: LOW QUALITY PROTEIN: oligopeptide transporter 1-like 
[Oryza brachyantha]
Length=756

 Score =   811 bits (2095),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 399/679 (59%), Positives = 525/679 (77%), Gaps = 10/679 (1%)
 Frame = -1

Query  2011  INDSPVEEVRLTVPITDDPTMPCVTFRTWVLGVTSCVILAFLNQFFGYRQNALYVSSVPA  1832
             +ND P+EEVR TVP+ DDP+ PC+TFRTWVLG++SCV+LAF+N+FF YR   L + +V  
Sbjct  24    VNDHPIEEVRNTVPVRDDPSEPCLTFRTWVLGLSSCVLLAFVNEFFMYRTTQLSIGTVVV  83

Query  1831  QIVVLPMGKLMAAYLPTKVVQIPGTKWSFSLNPGPFNIKEHVLITIFASSGSDFSYAVSI  1652
             QI  LP+G+LMA+ LPT+  ++PG  WSFSLNPGPF++KEH LITIFA +G+   YA++I
Sbjct  84    QIATLPIGRLMASVLPTRRFRVPG-GWSFSLNPGPFSLKEHCLITIFAGAGASGVYAMNI  142

Query  1651  ITMMKAFYYRDIHPLAAVLLTFSTQMLGYGLAGIFKKFLIDSPYMWWPSNLVQVSLFRAL  1472
             I ++K FY R I+P AA+LL  +TQ+LGYG AG+F+K+L+DS YMWWPSNLVQV+LFRA+
Sbjct  143   IAIVKVFYKRQINPYAAMLLAQTTQLLGYGWAGLFRKYLVDSAYMWWPSNLVQVTLFRAM  202

Query  1471  HDVETRPKGGLTRLQFFIIVLVCSFAYYVVPNYLFPSLTALSLLCWIWKNSVTAQQlgsg  1292
             H+ E R KG LTRLQFFIIV+ CSFAYY+VP+YLFP+++ +S++CW++++SVTAQQ+GSG
Sbjct  203   HEEEKRAKGQLTRLQFFIIVMTCSFAYYIVPSYLFPAISTISVVCWMYRDSVTAQQIGSG  262

Query  1291  lkglgigSFALDWATVAAFQGSPLVTPDFAIINMLIGYVLVAYIAIPVWYWTNLFDAKKF  1112
               GLG+GSF LDW TVA F G+PL +P FAI N++ G+ L  Y+A+P+ YWT+ ++AK+F
Sbjct  263   ASGLGLGSFGLDWNTVAGFLGNPLASPAFAIFNIMAGFALSTYVALPLLYWTDTYNAKRF  322

Query  1111  PLFSSNVFDSNGQVYNISRVLNKKTFGFDQPGYDSYSNIYLSTAFVYTYGLSFATLAATV  932
             PL SS+VFD+ G  Y+ +R+L+  TF  +   Y+SYS I LS  F   YG+ FA L  T+
Sbjct  323   PLVSSHVFDAAGGRYDTARILDPDTFTLNLKEYNSYSRINLSVLFAINYGIGFAGLMCTL  382

Query  931   SHVALFHGRTIWEQTKESVQDKFS------DIHTRLMRKNYEPVPQWWFYlllviivgva  770
             SHV L+HGR IW   +++  ++ S      D+HTR+M++NY+ VPQWWF+L+LVI++ ++
Sbjct  383   SHVLLYHGRDIWGLWRKTAAEQASGGSKEQDVHTRIMKRNYKAVPQWWFHLMLVIVMALS  442

Query  769   lvACQRFGGQLQLPVWGVLLAVLLSLIFTLPVGVITATTNQQTGLNVIAELIIGYMYPGR  590
             L  C+ FG QLQLP WG+LLA  ++  FTLP+GVI+ATTN Q GLN+I ELIIGY+YPG+
Sbjct  443   LYTCEGFGRQLQLPYWGLLLACGIAFTFTLPIGVISATTNMQPGLNIITELIIGYLYPGK  502

Query  589   PLASVTFKMYGlsslsqslmflSDFKLGHYMKIPPKSMFMVQLVGTLISCCVHFGTGWWL  410
             PLA+V FK YG  S++Q+L F++DFKLGHYMKIPP+SMF+VQL GT+++  VHFGT WWL
Sbjct  503   PLANVVFKTYGYISMAQALTFVADFKLGHYMKIPPRSMFVVQLAGTVVASTVHFGTAWWL  562

Query  409   LTTVENICNPSKLPEGSQWTCPGDDVFYNASIIWGVVSPRRMFGNLGIYQATNYFFLVGF  230
             LTTV NIC+   LP GS WTCPGDDVFYNASIIWGVV P RMFG LG Y   NYFFLVG 
Sbjct  563   LTTVRNICDMDSLPAGSPWTCPGDDVFYNASIIWGVVGPLRMFGRLGNYWQMNYFFLVGL  622

Query  229   LAPIPVWYLGRKYPEKRWVSLINMPILISGAEGIPIVKSVNYVCWFAVGLYFNLYVYRKH  50
             LAP+PVW L R+YP    +  +NMP++ +GA G+   +SVN++ W  VG  FN  VYR+ 
Sbjct  623   LAPVPVWLLSRRYPRSAVLRNVNMPLIFAGASGLLPARSVNFIMWGLVGFVFNHVVYRRC  682

Query  49    KG---WWARHNYILSAGLD  2
             K    WW RHNY+L+AGLD
Sbjct  683   KAGGCWWMRHNYVLAAGLD  701



>gb|EEE68464.1| hypothetical protein OsJ_26860 [Oryza sativa Japonica Group]
Length=733

 Score =   809 bits (2089),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 395/680 (58%), Positives = 522/680 (77%), Gaps = 11/680 (2%)
 Frame = -1

Query  2017  DEINDSPVEEVRLTVPITDDPTMPCVTFRTWVLGVTSCVILAFLNQFFGYRQNALYVSSV  1838
             +E+ND P+EEVR TVP+TDDP+ PC+TFR WVLG++SCV LAF+N+FF YR   L + +V
Sbjct  3     EEVNDHPIEEVRNTVPVTDDPSEPCLTFRVWVLGLSSCVFLAFVNEFFMYRTTQLSIGTV  62

Query  1837  PAQIVVLPMGKLMAAYLPTKVVQIPGTKWSFSLNPGPFNIKEHVLITIFASSGSDFSYAV  1658
               QI+ LP+G+LMA+ LP + +++ G  WSFSLNPGPF++KEH LI IFA +G+   YA+
Sbjct  63    VVQIITLPIGRLMASTLPARRLRVGG--WSFSLNPGPFSLKEHCLIIIFAGAGASGVYAM  120

Query  1657  SIITMMKAFYYRDIHPLAAVLLTFSTQMLGYGLAGIFKKFLIDSPYMWWPSNLVQVSLFR  1478
             +II ++K FY R I P AA+LL  +TQ+LGYG AG+F+K+L+DS YMWWPSNLVQV+LFR
Sbjct  121   NIIAIVKVFYKRQISPYAAMLLAQTTQLLGYGWAGLFRKYLVDSAYMWWPSNLVQVTLFR  180

Query  1477  ALHDVETRPKGGLTRLQFFIIVLVCSFAYYVVPNYLFPSLTALSLLCWIWKNSVTAQQlg  1298
             A+H+ E R KG LTRLQFFI+V+ CSFAYY+VP+YLFP+++ +S+LCW++++SVTAQQ+G
Sbjct  181   AMHEEEKRNKGQLTRLQFFIMVMTCSFAYYIVPSYLFPAISTISVLCWLYRDSVTAQQIG  240

Query  1297  sglkglgigSFALDWATVAAFQGSPLVTPDFAIINMLIGYVLVAYIAIPVWYWTNLFDAK  1118
             SG  GLG+GSF LDW TV  F G+PL +P FAI N++ G+ L  Y+A+P+ YWT+ ++AK
Sbjct  241   SGASGLGVGSFGLDWNTVVGFLGNPLASPAFAIFNVMAGFALSTYVAVPILYWTDTYNAK  300

Query  1117  KFPLFSSNVFDSNGQVYNISRVLNKKTFGFDQPGYDSYSNIYLSTAFVYTYGLSFATLAA  938
             +FPL SS+VF++ G  Y+ +R+L+  TF  +   YD+Y  I LS  F   YG+ FA L +
Sbjct  301   RFPLVSSHVFNAAGGRYDTARILDPATFTLNLREYDAYGRINLSILFAINYGIGFAGLMS  360

Query  937   TVSHVALFHGRTIW--------EQTKESVQDKFSDIHTRLMRKNYEPVPQWWFYlllvii  782
             T+SHVAL+HG+ IW        EQ     +++  D+HTR+M++NY+ VPQWWF+L+L I+
Sbjct  361   TLSHVALYHGKDIWGLWRKATAEQANGGGKER-QDVHTRIMKRNYKAVPQWWFHLMLAIV  419

Query  781   vgvalvACQRFGGQLQLPVWGVLLAVLLSLIFTLPVGVITATTNQQTGLNVIAELIIGYM  602
             + ++L  C+ FG QLQLP WG+LLA  ++  FTLP+GVI+ATTN Q GLN+I ELIIGY+
Sbjct  420   MALSLYTCEGFGRQLQLPYWGLLLACAIAFTFTLPIGVISATTNMQPGLNIITELIIGYL  479

Query  601   YPGRPLASVTFKMYGlsslsqslmflSDFKLGHYMKIPPKSMFMVQLVGTLISCCVHFGT  422
             YPG+PLA+V FK YG  S++Q+L F+SDFKLGHYMKIPP+SMFMVQL GT+++  VHF T
Sbjct  480   YPGKPLANVVFKTYGYISMTQALTFVSDFKLGHYMKIPPRSMFMVQLAGTVVASTVHFAT  539

Query  421   GWWLLTTVENICNPSKLPEGSQWTCPGDDVFYNASIIWGVVSPRRMFGNLGIYQATNYFF  242
              WWLLTTV NIC+   LP GS WTCPG+DVFYNASIIWGVV P RMFG LG Y   NYFF
Sbjct  540   AWWLLTTVRNICDVDSLPLGSPWTCPGEDVFYNASIIWGVVGPLRMFGRLGNYWQMNYFF  599

Query  241   LVGFLAPIPVWYLGRKYPEKRWVSLINMPILISGAEGIPIVKSVNYVCWFAVGLYFNLYV  62
             LVG LAP+PVW L R+YP +R    IN+P +++GA G+   +SVN+V W  VG  FN  V
Sbjct  600   LVGVLAPVPVWLLSRRYPAQRVAPDINLPFVLAGASGLLPARSVNFVMWGLVGFVFNHVV  659

Query  61    YRKHKGWWARHNYILSAGLD  2
             YR+ + WW RHNY+L+AGLD
Sbjct  660   YRRCRAWWMRHNYVLAAGLD  679



>gb|EYU33719.1| hypothetical protein MIMGU_mgv1a024635mg [Erythranthe guttata]
Length=744

 Score =   809 bits (2089),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 398/672 (59%), Positives = 524/672 (78%), Gaps = 14/672 (2%)
 Frame = -1

Query  2008  NDSPVEEVRLTVPITDDPTMPCVTFRTWVLGVTSCVILAFLNQFFGYRQNALYVSSVPAQ  1829
             N  P+E+VRLTVP TDDP++P +TFRTW LG+ SCV+L+FLNQFFGYRQN + +S+V AQ
Sbjct  32    NYHPIEQVRLTVPPTDDPSLPALTFRTWFLGLLSCVLLSFLNQFFGYRQNNISISAVAAQ  91

Query  1828  IVVLPMGKLMAAYLPTKVVQIPGTKWSFSLNPGPFNIKEHVLITIFASSGSDFSYAVSII  1649
             I+ L MG  MA  LP K   +P TKW FSLNPGPFN+KEHVLITIFA+ G+   YA+SI+
Sbjct  92    IITLAMGNFMARVLPEKKFTVPVTKWKFSLNPGPFNLKEHVLITIFANCGASGVYALSIV  151

Query  1648  TMMKAFYYRDIHPLAAVLLTFSTQMLGYGLAGIFKKFLIDSPYMWWPSNLVQVSLFRALH  1469
             T++KAFY+R +HP AA LL  +TQMLGYG AGIF++ L+DSPYMWWP N++         
Sbjct  152   TIVKAFYHRQLHPFAAWLLAQTTQMLGYGWAGIFRQVLVDSPYMWWPENMI---------  202

Query  1468  DVETRPKGGLTRLQFFIIVLVCSFAYYVVPNYLFPSLTALSLLCWIWKNSVTAQQlgsgl  1289
                  PKGGL+RLQFF+IV V SFAYY++P Y FPS++A+S+LC IWK+S+  QQLGSGL
Sbjct  203   -ATYGPKGGLSRLQFFLIVFVSSFAYYIIPAYFFPSISAISVLCLIWKDSIFPQQLGSGL  261

Query  1288  kglgigSFALDWATVAAFQGSPLVTPDFAIINMLIGYVLVAYIAIPVWYWTNLFDAKKFP  1109
              G+GIGSF+LDW+ V +F G+P+ TP FAI+N+L+G+ LV Y+  P+ Y+ N++ AKKFP
Sbjct  262   HGMGIGSFSLDWSAVVSFIGNPISTPAFAIVNVLVGFFLVMYVMTPLTYYNNVYSAKKFP  321

Query  1108  LFSSNVFDSNGQVYNISRVLNKKTFGFDQPGYDSYSNIYLSTAFVYTYGLSFATLAATVS  929
             +FS + FD NGQ YNISRVLN ++F  +  GY+ YS +YLS  F +TYGL FA+LAAT++
Sbjct  322   IFSPHTFDQNGQTYNISRVLNSESFDLNMAGYEGYSKLYLSVLFAFTYGLGFASLAATIT  381

Query  928   HVALFHGRTIWE---QTKESVQDKFSDIHTRLMRKNYEPVPQWWFYlllviivgvalvAC  758
             HV L+HG+TIW    + K ++  K  D+HTR+M+KNYE VP WWFY +LV++  ++L A 
Sbjct  382   HVGLYHGKTIWSLWSKAKRNLHGK-QDVHTRIMKKNYETVPNWWFYAILVLVFCLSLYAI  440

Query  757   QRFGGQLQLPVWGVLLAVLLSLIFTLPVGVITATTNQQTGLNVIAELIIGYMYPGRPLAS  578
             + F  QLQLP WG+++A  ++L FTLPVG+I ATTNQQ GLN+I E++IGY+YPGRPLA+
Sbjct  441   EGFNRQLQLPWWGLVMACGMALFFTLPVGIIQATTNQQIGLNIITEMVIGYVYPGRPLAN  500

Query  577   VTFKMYGlsslsqslmflSDFKLGHYMKIPPKSMFMVQLVGTLISCCVHFGTGWWLLTTV  398
             V FK YG  S++Q+L F+SDFKLGHYMKIPPKSMF+VQLVGTL++  V+F T WWLLTTV
Sbjct  501   VAFKTYGYISMTQALSFISDFKLGHYMKIPPKSMFLVQLVGTLVASSVYFSTAWWLLTTV  560

Query  397   ENICNPSKLPEGSQWTCPGDDVFYNASIIWGVVSPRRMFGNLGIYQATNYFFLVGFLAPI  218
             E+IC+ +KLP GS WTCPGD+VFYNASIIWGV+ P RMF + G+Y   N++FL G LAPI
Sbjct  561   EHICDKTKLPLGSPWTCPGDEVFYNASIIWGVIGPMRMFTSKGVYGNLNWWFLAGGLAPI  620

Query  217   PVWYLGRKYPEKRWVSLINMPILISGAEGIPIVKSVNYVCWFAVGLYFNLYVYRKHKGWW  38
             P + LGRKYP+K+W+ LIN+P+++     +P  ++VNY+ W  VG+YFN+Y++R HK WW
Sbjct  621   PAYLLGRKYPDKKWIRLINVPLILGATMSMPPARAVNYIMWGVVGIYFNMYLFRVHKKWW  680

Query  37    ARHNYILSAGLD  2
             AR+ Y+L+A L+
Sbjct  681   ARNAYVLAAALN  692



>ref|NP_001175518.1| Os08g0320200 [Oryza sativa Japonica Group]
 dbj|BAD10427.1| putative sexual differentiation process protein isp4 [Oryza sativa 
Japonica Group]
 dbj|BAD30723.1| putative sexual differentiation process protein isp4 [Oryza sativa 
Japonica Group]
 dbj|BAH00400.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEC83359.1| hypothetical protein OsI_28765 [Oryza sativa Indica Group]
 dbj|BAH94246.1| Os08g0320200 [Oryza sativa Japonica Group]
 dbj|BAI39890.1| sexual differentiation process protein isp4-like [Oryza sativa 
Indica Group]
Length=733

 Score =   808 bits (2087),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 394/680 (58%), Positives = 522/680 (77%), Gaps = 11/680 (2%)
 Frame = -1

Query  2017  DEINDSPVEEVRLTVPITDDPTMPCVTFRTWVLGVTSCVILAFLNQFFGYRQNALYVSSV  1838
             +E+ND P+EEVR TVP+TDDP+ PC+TFR WVLG++SCV LAF+N+FF YR   L + +V
Sbjct  3     EEVNDHPIEEVRNTVPVTDDPSEPCLTFRVWVLGLSSCVFLAFVNEFFMYRTTQLSIGTV  62

Query  1837  PAQIVVLPMGKLMAAYLPTKVVQIPGTKWSFSLNPGPFNIKEHVLITIFASSGSDFSYAV  1658
               QI+ LP+G+LMA+ LP + +++ G  WSFSLNPGPF++KEH LI IFA +G+   YA+
Sbjct  63    VVQIITLPIGRLMASTLPARRLRVGG--WSFSLNPGPFSLKEHCLIIIFAGAGASGVYAM  120

Query  1657  SIITMMKAFYYRDIHPLAAVLLTFSTQMLGYGLAGIFKKFLIDSPYMWWPSNLVQVSLFR  1478
             +II ++K FY R I P AA+LL  +TQ+LGYG AG+F+K+L+DS YMWWPSNLVQV+LFR
Sbjct  121   NIIAIVKVFYKRQISPYAAMLLAQTTQLLGYGWAGLFRKYLVDSAYMWWPSNLVQVTLFR  180

Query  1477  ALHDVETRPKGGLTRLQFFIIVLVCSFAYYVVPNYLFPSLTALSLLCWIWKNSVTAQQlg  1298
             A+H+ E R KG LTRLQFFI+V+ CSFAYY+VP+YLFP+++ +S+LCW++++SVTAQQ+G
Sbjct  181   AMHEEEKRNKGQLTRLQFFIMVMTCSFAYYIVPSYLFPAISTISVLCWLYRDSVTAQQIG  240

Query  1297  sglkglgigSFALDWATVAAFQGSPLVTPDFAIINMLIGYVLVAYIAIPVWYWTNLFDAK  1118
             SG  GLG+GSF LDW TV  F G+PL +P FAI N++ G+ L  Y+A+P+ YWT+ ++AK
Sbjct  241   SGASGLGVGSFGLDWNTVVGFLGNPLASPAFAIFNVMAGFALSTYVAVPILYWTDTYNAK  300

Query  1117  KFPLFSSNVFDSNGQVYNISRVLNKKTFGFDQPGYDSYSNIYLSTAFVYTYGLSFATLAA  938
             +FPL SS+VF++ G  Y+ +R+L+  TF  +   YD+Y  I LS  F   YG+ FA L +
Sbjct  301   RFPLVSSHVFNAAGGRYDTARILDPATFTLNLREYDAYGRINLSILFAINYGIGFAGLMS  360

Query  937   TVSHVALFHGRTIW--------EQTKESVQDKFSDIHTRLMRKNYEPVPQWWFYlllvii  782
             T+SHVAL+HG+ IW        EQ     +++  D+HTR+M++NY+ VPQWWF+L+L I+
Sbjct  361   TLSHVALYHGKDIWGLWRKATAEQANGGGKER-QDVHTRIMKRNYKAVPQWWFHLMLAIV  419

Query  781   vgvalvACQRFGGQLQLPVWGVLLAVLLSLIFTLPVGVITATTNQQTGLNVIAELIIGYM  602
             + ++L  C+ FG QLQLP WG+LLA  ++  FTLP+GVI+ATTN Q GLN+I ELIIGY+
Sbjct  420   MALSLYTCEGFGRQLQLPYWGLLLACAIAFTFTLPIGVISATTNMQPGLNIITELIIGYL  479

Query  601   YPGRPLASVTFKMYGlsslsqslmflSDFKLGHYMKIPPKSMFMVQLVGTLISCCVHFGT  422
             YPG+PLA+V FK YG  S++Q+L F+SDFKLGHYMKIPP+SMFMVQL GT+++  VHF T
Sbjct  480   YPGKPLANVVFKTYGYISMTQALTFVSDFKLGHYMKIPPRSMFMVQLAGTVVASTVHFAT  539

Query  421   GWWLLTTVENICNPSKLPEGSQWTCPGDDVFYNASIIWGVVSPRRMFGNLGIYQATNYFF  242
              WWLLTTV NIC+   LP GS WTCPG+DVFYNASIIWGVV P RMFG LG Y   NYFF
Sbjct  540   AWWLLTTVRNICDVDSLPLGSPWTCPGEDVFYNASIIWGVVGPLRMFGRLGNYWQMNYFF  599

Query  241   LVGFLAPIPVWYLGRKYPEKRWVSLINMPILISGAEGIPIVKSVNYVCWFAVGLYFNLYV  62
             LVG LAP+PVW L R+YP    +  IN+P++++GA G+   +SVN+V W  VG  FN  V
Sbjct  600   LVGVLAPVPVWLLSRRYPRSALLRDINLPLVLAGASGLLPARSVNFVMWGLVGFVFNHVV  659

Query  61    YRKHKGWWARHNYILSAGLD  2
             YR+ + WW RHNY+L+AGLD
Sbjct  660   YRRCRAWWMRHNYVLAAGLD  679



>ref|XP_010536755.1| PREDICTED: oligopeptide transporter 1-like [Tarenaya hassleriana]
Length=755

 Score =   808 bits (2087),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 400/688 (58%), Positives = 516/688 (75%), Gaps = 4/688 (1%)
 Frame = -1

Query  2056  MENTGISAVESSADEINDSPVEEVRLTVPITDDPTMPCVTFRTWVLGVTSCVILAFLNQF  1877
             M N  I+  E    E NDSPVEEVRLTVPITDDPT P +TFRTW LG  SCV+LAF+NQF
Sbjct  17    MSNIIITDEEIGEKEENDSPVEEVRLTVPITDDPTEPALTFRTWTLGTISCVLLAFVNQF  76

Query  1876  FGYRQNALYVSSVPAQIVVLPMGKLMAAYLPTKVVQIPGTKWSFSLNPGPFNIKEHVLIT  1697
             F  R N L V++V  QI+ LP+GKLMA  L  +    PGT W++SLNPGPF+ KEHVLIT
Sbjct  77    FQLRTNVLSVTAVSVQIIALPLGKLMAGTLSRRRFGFPGTNWTWSLNPGPFSKKEHVLIT  136

Query  1696  IFASSGSDFSYAVSIITMMKAFYYRDIHPLAAVLLTFSTQMLGYGLAGIFKKFLIDSPYM  1517
             IFAS+G   +YA +II  +K FY++ +  L A+LL  +TQ+LGYG AG+F+KFL+DSPYM
Sbjct  137   IFASAGYSVAYATNIIIAVKVFYHQKLDALPAMLLVQTTQLLGYGWAGLFRKFLVDSPYM  196

Query  1516  WWPSNLVQVSLFRALHDVETRPKGGLTRLQFFIIVLVCSFAYYVVPNYLFPSLTALSLLC  1337
             WWPSNLVQVSLFR LH+ E + +G  TRLQFF++V +  FAY + PNY+FPS++A+S++C
Sbjct  197   WWPSNLVQVSLFRVLHEKEEKREGQRTRLQFFLLVFLAGFAYAIAPNYIFPSISAISVVC  256

Query  1336  WIWKNSVTAQQlgsglkglgigSFALDWATVAAFQGSPLVTPDFAIINMLIGYVLVAYIA  1157
             WIWKNSVTA Q+GSG+ GLGIGSF LDW+TVA   GSPL  P FAI+N+ +G+ +  YI 
Sbjct  257   WIWKNSVTAHQIGSGMNGLGIGSFGLDWSTVAML-GSPLAVPFFAILNIFVGFAIFIYIV  315

Query  1156  IPVWYWTNLFDAKKFPLFSSNVFDSNGQVYNISRVLNKKTFGFDQPGYDSYSNIYLSTAF  977
             +P+ YW N +DAKKFP++  +V+D  G  +N + +LN  TF  + P Y+SYS +Y+S   
Sbjct  316   LPILYWGNFYDAKKFPIYIQDVYDQTGAQFNTTHILNHSTFDINLPAYESYSKLYMSVVL  375

Query  976   VYTYGLSFATLAATVSHVALFHGRTIWEQTKES---VQDKFSDIHTRLMRKNYEPVPQWW  806
                YGLSF  L AT+SHVALF G+ IWE  ++S    +DKF D+HTRLM+KNY+ VPQWW
Sbjct  376   ALVYGLSFGNLTATISHVALFDGKFIWEMWRKSSSAAKDKFGDVHTRLMKKNYKAVPQWW  435

Query  805   FYlllviivgvalvACQRFGGQLQLPVWGVLLAVLLSLIFTLPVGVITATTNQQTGLNVI  626
             F ++LVI  G++L AC+ F  QLQLP WG++LA  ++L FTLPVGVI ATTNQQ GLNVI
Sbjct  436   FTVILVISFGLSLWACEGFDKQLQLPWWGLILACAIALFFTLPVGVIQATTNQQMGLNVI  495

Query  625   AELIIGYMYPGRPLASVTFKMYGlsslsqslmflSDFKLGHYMKIPPKSMFMVQLVGTLI  446
              EL+IGY+YPG+PLA+V+FK YG  S+SQ+L FL DFKLGHYMKIPP+SMF+VQLV T++
Sbjct  496   TELVIGYLYPGKPLANVSFKTYGYISMSQALTFLQDFKLGHYMKIPPRSMFLVQLVSTIV  555

Query  445   SCCVHFGTGWWLLTTVENICNPSKLPEGSQWTCPGDDVFYNASIIWGVVSPRRMFGNLGI  266
             +  V F T WW +  +EN+C    LP+ S W CPG  +FYNASIIWGV+ P RMF N G+
Sbjct  556   ASTVCFATIWWQIINIENVCQTDLLPKDSPWKCPGPRLFYNASIIWGVIGPGRMFTNKGV  615

Query  265   YQATNYFFLVGFLAPIPVWYLGRKYPEKRWVSLINMPILISGAEGIPIVKSVNYVCWFAV  86
             Y   N+FFL+G LAP+P WYL RK+PEK+W+  +++P++ +G  G+P VK+V+Y  WF V
Sbjct  616   YPEMNWFFLIGILAPVPGWYLSRKFPEKKWIKQVHIPLIFAGLNGVPYVKAVHYWSWFIV  675

Query  85    GLYFNLYVYRKHKGWWARHNYILSAGLD  2
             G+ FN +++RK K WW RH YI+SA LD
Sbjct  676   GVIFNYFIFRKFKDWWVRHTYIMSAALD  703



>ref|XP_004974596.1| PREDICTED: oligopeptide transporter 1-like [Setaria italica]
Length=740

 Score =   807 bits (2084),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 400/692 (58%), Positives = 529/692 (76%), Gaps = 11/692 (2%)
 Frame = -1

Query  2056  MENTGISAVESSADEINDSPVEEVRLTVPITDDPTMPCVTFRTWVLGVTSCVILAFLNQF  1877
             ME TG        +E+ND P+EEVR TVPITDDP+ PC+TFRTWVLG++SCV+LAF+N+F
Sbjct  1     MEKTG----GGDEEEVNDHPIEEVRNTVPITDDPSEPCLTFRTWVLGMSSCVMLAFVNEF  56

Query  1876  FGYRQNALYVSSVPAQIVVLPMGKLMAAYLPTKVVQIP--GTKWSFSLNPGPFNIKEHVL  1703
             F YR + L + +V  QI  LP+G+LMA+ LP + +++P  G +W FSLNPGPF++KEH L
Sbjct  57    FKYRFSQLSIGTVLVQIASLPIGRLMASTLPEQPIRVPLTGGRWYFSLNPGPFSLKEHCL  116

Query  1702  ITIFASSGSDFSYAVSIITMMKAFYYRDIHPLAAVLLTFSTQMLGYGLAGIFKKFLIDSP  1523
             ITIFA +GS   YA++II ++K FY R I+P AA+LL  +TQ+LGY  AG+F+KFL+DS 
Sbjct  117   ITIFAGAGSSTVYALNIIAIVKVFYKRQINPYAAMLLAQTTQLLGYEWAGLFRKFLVDSA  176

Query  1522  YMWWPSNLVQVSLFRALHDVETRPKGGLTRLQFFIIVLVCSFAYYVVPNYLFPSLTALSL  1343
             YMWWP NLVQV+LFRA+H+ E RP+GGLTRLQFFIIV++CSFAYY++P+YLFP+++ +S+
Sbjct  177   YMWWPINLVQVTLFRAMHEEEKRPRGGLTRLQFFIIVMICSFAYYLIPSYLFPTISTVSV  236

Query  1342  LCWIWKNSVTAQQlgsglkglgigSFALDWATVAAFQGSPLVTPDFAIINMLIGYVLVAY  1163
             LC ++K+SVTAQQ+GSGLKGLG+GSF LDW TVA F G+PL +P F I+N++ G+ +  Y
Sbjct  237   LCLVYKDSVTAQQIGSGLKGLGVGSFGLDWNTVAGFLGNPLASPAFTIVNVMAGFAISTY  296

Query  1162  IAIPVWYWTNLFDAKKFPLFSSNVFDSNGQVYNISRVLNKKTFGFDQPGYDSYSNIYLST  983
             IA+P+ YWTN ++A +FPL S +V+D  G  Y+ +RVL+ KTF  +   Y++YS I +S 
Sbjct  297   IAVPLLYWTNTYNAMRFPLVSPHVYDDAGGPYDTNRVLDPKTFALNLKEYNAYSRINVSV  356

Query  982   AFVYTYGLSFATLAATVSHVALFHGRTIWEQTKESVQDKFS-----DIHTRLMRKNYEPV  818
              F   YG+SFA+L +T+SHVAL+HG+ I +  +++   K       D+HTR+M++NY+PV
Sbjct  357   LFAINYGISFASLMSTLSHVALYHGKEIRDLCRKATAGKAEGGKEQDVHTRIMKRNYKPV  416

Query  817   PQWWFYlllviivgvalvACQRFGGQLQLPVWGVLLAVLLSLIFTLPVGVITATTNQQTG  638
             PQWWF+L+LVI++ ++L  C+ FG QLQLP WG+LL   ++  FTLP+GVI+ATTN Q G
Sbjct  417   PQWWFHLMLVIVLALSLFTCEGFGRQLQLPYWGLLLTCAIAFSFTLPIGVISATTNMQPG  476

Query  637   LNVIAELIIGYMYPGRPLASVTFKMYGlsslsqslmflSDFKLGHYMKIPPKSMFMVQLV  458
             LNVI ELIIGY+YPG+PLA+V FK YG  S+ Q+L F+SDFKLGHYMKIPP+SMF  QL 
Sbjct  477   LNVITELIIGYLYPGKPLANVVFKTYGFISMGQALSFVSDFKLGHYMKIPPRSMFFAQLA  536

Query  457   GTLISCCVHFGTGWWLLTTVENICNPSKLPEGSQWTCPGDDVFYNASIIWGVVSPRRMFG  278
             GTL +  +HF T WWLLTTV++IC+   LP GS WTCPGDDVFYNASIIWGVV P RMFG
Sbjct  537   GTLTASTMHFATAWWLLTTVKDICDVENLPAGSPWTCPGDDVFYNASIIWGVVGPLRMFG  596

Query  277   NLGIYQATNYFFLVGFLAPIPVWYLGRKYPEKRWVSLINMPILISGAEGIPIVKSVNYVC  98
              LG Y   NYFFLVG LAP+  W L R YP    +  +N+P++ +GA G+   +SVN++ 
Sbjct  597   RLGNYWQMNYFFLVGLLAPVLAWLLQRAYPRSHVLRGVNLPLIFAGASGLLPARSVNFLM  656

Query  97    WFAVGLYFNLYVYRKHKGWWARHNYILSAGLD  2
             W  VG  FN  VYR+HK WW R+NY+L+AGLD
Sbjct  657   WGLVGFLFNHVVYRQHKAWWMRYNYVLAAGLD  688



>emb|CDP13696.1| unnamed protein product [Coffea canephora]
Length=698

 Score =   805 bits (2078),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 391/645 (61%), Positives = 513/645 (80%), Gaps = 3/645 (0%)
 Frame = -1

Query  1927  WVLGVTSCVILAFLNQFFGYRQNALYVSSVPAQIVVLPMGKLMAAYLPTKVVQIPGTKWS  1748
             W+LG+ SC +LAF+N FF YRQN+L++ +V AQIV LP+GK MAA  P K + +P TKWS
Sbjct  2     WILGILSCALLAFVNTFFSYRQNSLWIGAVAAQIVTLPLGKFMAATFPDKSIGLPFTKWS  61

Query  1747  FSLNPGPFNIKEHVLITIFASSGSDFSYAVSIITMMKAFYYRDIHPLAAVLLTFSTQMLG  1568
             FSLNPGPFN+KEHVLITIFA+ G++  YA+SII ++KAFY R ++PLAA LL+ +T +LG
Sbjct  62    FSLNPGPFNLKEHVLITIFAACGANGVYAISIIDIVKAFYRRKLNPLAAFLLSQTTMLLG  121

Query  1567  YGLAGIFKKFLIDSPYMWWPSNLVQVSLFRALHDVETRPKGGLTRLQFFIIVLVCSFAYY  1388
             YG AG+ +  L+DSPYMWWP NLVQVSLFR LH+ E R +GGLTRLQFF+++   SFAYY
Sbjct  122   YGWAGMHRNVLVDSPYMWWPENLVQVSLFRTLHEKEKRSRGGLTRLQFFLLLFTTSFAYY  181

Query  1387  VVPNYLFPSLTALSLLCWIWKNSVTAQQlgsglkglgigSFALDWATVAAFQGSPLVTPD  1208
             +VP Y FP+++ +S+ C+IWKNSV  QQLGSGL G+GIGSFALDW TV +F  +P+ TP 
Sbjct  182   LVPGYFFPAISCISVACFIWKNSVLGQQLGSGLHGMGIGSFALDWNTVVSFLKTPISTPL  241

Query  1207  FAIINMLIGYVLVAYIAIPVWYWTNLFDAKKFPLFSSNVFDSNGQVYNISRVLNKKTFGF  1028
             FAI+N L+G+ L  Y+ IP  YW+N++DAKKFP +SS  FD+ G  YNISR+LN +TF F
Sbjct  242   FAIVNTLVGFFLFVYVVIPAAYWSNIYDAKKFPFYSSKTFDATGHKYNISRILNDETFTF  301

Query  1027  DQPGYDSYSNIYLSTAFVYTYGLSFATLAATVSHVALFHGRTIWE---QTKESVQDKFSD  857
             D  GY+SYS +Y+S  F  +YG+SFATL ATVSHVALF+  TI E   +T  +++ K  D
Sbjct  302   DLAGYNSYSKLYMSVFFALSYGISFATLTATVSHVALFYSGTIRELTTKTATTLKGKLGD  361

Query  856   IHTRLMRKNYEPVPQWWFYlllviivgvalvACQRFGGQLQLPVWGVLLAVLLSLIFTLP  677
             +HTRLM+KNY+ VP WWF+ +L+++ G++L+ C+ FG QLQLP WG++LA  ++  FTLP
Sbjct  362   VHTRLMKKNYKAVPNWWFHAILIVVFGLSLLTCEGFGKQLQLPWWGLILACGIAWFFTLP  421

Query  676   VGVITATTNQQTGLNVIAELIIGYMYPGRPLASVTFKMYGlsslsqslmflSDFKLGHYM  497
             +G+I ATTNQQ GLNV+ E++IGY+YPGRPLA+VTFK YG  S++Q+L FLSDFK+GHYM
Sbjct  422   IGIIQATTNQQVGLNVVTEMVIGYLYPGRPLANVTFKTYGYVSMTQALTFLSDFKVGHYM  481

Query  496   KIPPKSMFMVQLVGTLISCCVHFGTGWWLLTTVENICNPSKLPEGSQWTCPGDDVFYNAS  317
             K+PP+SMF+VQL+GTL+S  V FGT WWLLT++ENIC+ S LPEGS WTCPGD+VFYNAS
Sbjct  482   KVPPRSMFLVQLIGTLVSASVQFGTAWWLLTSIENICDTSLLPEGSPWTCPGDEVFYNAS  541

Query  316   IIWGVVSPRRMFGNLGIYQATNYFFLVGFLAPIPVWYLGRKYPEKRWVSLINMPILISGA  137
             IIWGV+ P++MF   G+Y   N+FFLVG LAP+PVW L RKYPEK W+ LIN+P+++   
Sbjct  542   IIWGVIGPKKMFTKEGVYPEVNWFFLVGLLAPVPVWLLSRKYPEKEWIKLINLPLILGAT  601

Query  136   EGIPIVKSVNYVCWFAVGLYFNLYVYRKHKGWWARHNYILSAGLD  2
               +P  +S+NY+ W AVG++FNLY+YRK KGWWA++ YI++A L+
Sbjct  602   SSMPPARSINYISWGAVGIFFNLYIYRKFKGWWAKYAYIMAAALN  646



>ref|XP_006576835.1| PREDICTED: oligopeptide transporter 5-like isoform X2 [Glycine 
max]
Length=721

 Score =   796 bits (2057),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 415/680 (61%), Positives = 511/680 (75%), Gaps = 54/680 (8%)
 Frame = -1

Query  2041  ISAVESSADEINDSPVEEVRLTVPITDDPTMPCVTFRTWVLGVTSCVILAFLNQFFGYRQ  1862
             I   E    +++D P+E+VRLTVPITDDPT P +TFRTWVLG+ SCV LAF+NQFFGYR 
Sbjct  45    IEDAEKDEFQVDDCPIEQVRLTVPITDDPTQPALTFRTWVLGLASCVFLAFVNQFFGYRT  104

Query  1861  NALYVSSVPAQIVVLPMGKLMAAYLPTKVVQIPGTKWSFSLNPGPFNIKEHVLITIFASS  1682
             N L +SSV AQI+ LP+GKLMAA L TK +++P TKWSFSLNPGPF++KEHVLITIFA+S
Sbjct  105   NPLKISSVSAQIITLPLGKLMAATLSTKPIRVPFTKWSFSLNPGPFSLKEHVLITIFATS  164

Query  1681  GSDFSYAVSIITMMKAFYYRDIHPLAAVLLTFSTQMLGYGLAGIFKKFLIDSPYMWWPSN  1502
             GS   YA+SIIT++KAFY+R+IHP+AA LL  STQMLGYG AGIF++FL++SPYMWWP+N
Sbjct  165   GSSGVYAISIITIVKAFYHRNIHPVAAYLLALSTQMLGYGWAGIFRRFLVNSPYMWWPAN  224

Query  1501  LVQVSLFRALHDVETRPKGGLTRLQFFIIVLVCSFAYYVVPNYLFPSLTALSLLCWIWKN  1322
             LVQVSLFRA H+ E RPKGG TRLQFF +V V SFAYY +P YLF +++ +S +C IWK+
Sbjct  225   LVQVSLFRAFHEKEKRPKGGNTRLQFFFLVFVVSFAYYTIPGYLFQAISTISFVCLIWKD  284

Query  1321  SVTAQQlgsglkglgigSFALDWATVAAFQGSPLVTPDFAIINMLIGYVLVAYIAIPVWY  1142
             S+TAQQ+GSG+ GLGIGSF LDW TVA F GSPL  P FAIINMLIG+VL  Y+ IP+ Y
Sbjct  285   SITAQQIGSGMNGLGIGSFGLDWNTVAGFLGSPLAIPGFAIINMLIGFVLDIYVLIPLAY  344

Query  1141  WTNLFDAKKFPLFSSNVFDSNGQVYNISRVLNKKTFGFDQPGYDSYSNIYLSTAFVYTYG  962
             W+NL+DAKKFPL SS+ FDS G  YN+ R   K T                         
Sbjct  345   WSNLYDAKKFPLISSHTFDSTGATYNMWR---KTT-------------------------  376

Query  961   LSFATLAATVSHVALFHGRTIWEQTKESVQDKFSDIHTRLMRKNYEPVPQWWFYlllvii  782
                               R + EQ          D+HTR+M++NYE VP+WWF  +L+++
Sbjct  377   ------------------RALKEQ--------LGDVHTRIMKRNYEQVPEWWFVTILILM  410

Query  781   vgvalvACQRFGGQLQLPVWGVLLAVLLSLIFTLPVGVITATTNQQTGLNVIAELIIGYM  602
             V +ALVAC+ FG QLQLP WG+LL++ ++L+FTLP+GVI ATTN QTGLNVIAELIIG++
Sbjct  411   VVIALVACEGFGKQLQLPWWGILLSLTIALVFTLPIGVIQATTNIQTGLNVIAELIIGFI  470

Query  601   YPGRPLASVTFKMYGlsslsqslmflSDFKLGHYMKIPPKSMFMVQLVGTLISCCVHFGT  422
             YPG+PLA+V FK YG  S+ Q+L FL DFKLGHYMKIPPKSMF+VQLVGT+++  V+F T
Sbjct  471   YPGKPLANVAFKTYGHVSMVQALGFLGDFKLGHYMKIPPKSMFIVQLVGTVVASSVYFAT  530

Query  421   GWWLLTTVENICNPSKLPEGSQWTCPGDDVFYNASIIWGVVSPRRMFGNLGIYQATNYFF  242
              WWLLT++ENIC+   LP+GS WTCPGDDVFYNASIIWGVV P+RMF   G+Y   N+FF
Sbjct  531   AWWLLTSIENICDEELLPKGSPWTCPGDDVFYNASIIWGVVGPKRMFTKDGVYPGMNWFF  590

Query  241   LVGFLAPIPVWYLGRKYPEKRWVSLINMPILISGAEGIPIVKSVNYVCWFAVGLYFNLYV  62
             L+G LAP+PVW L +K+P  +W+ LIN PI+I+GA  IP  +SVNY+ W  VG++FN YV
Sbjct  591   LIGLLAPLPVWLLSKKFPNHKWIQLINFPIIIAGASNIPPFRSVNYITWGIVGIFFNFYV  650

Query  61    YRKHKGWWARHNYILSAGLD  2
             YRK K WWARH YILSA LD
Sbjct  651   YRKFKAWWARHTYILSAALD  670



>ref|XP_003636647.1| Oligopeptide transporter OPT family [Medicago truncatula]
Length=699

 Score =   787 bits (2033),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 395/627 (63%), Positives = 500/627 (80%), Gaps = 3/627 (0%)
 Frame = -1

Query  1873  GYRQNALYVSSVPAQIVVLPMGKLMAAYLPTKVVQIPGTKWSFSLNPGPFNIKEHVLITI  1694
             GY+ N L ++SV AQI+ LP+GKLMAA LP K +Q+P T  +FSLNPG F++KEHVLI+I
Sbjct  22    GYKTNPLKITSVSAQIITLPLGKLMAATLPIKTIQVPFTSLTFSLNPGSFSVKEHVLISI  81

Query  1693  FASSGSDFSYAVSIITMMKAFYYRDIHPLAAVLLTFSTQMLGYGLAGIFKKFLIDSPYMW  1514
             FA+SGS   YA++IIT++K FY+R+IHP+AA LL  STQ+LGYG AGIF++FL+DSPYMW
Sbjct  82    FATSGSSGVYAINIITIVKGFYHRNIHPIAAYLLALSTQILGYGWAGIFRRFLVDSPYMW  141

Query  1513  WPSNLVQVSLFRALHDVETRPKGGLTRLQFFIIVLVCSFAYYVVPNYLFPSLTALSLLCW  1334
             WP  LVQVSLFRA H+ E RPKGG +RLQFF +V V SFAYY+VP Y F +++ +S  C 
Sbjct  142   WPEILVQVSLFRAFHEKEKRPKGGTSRLQFFFLVFVASFAYYIVPGYFFQAISTVSFFCL  201

Query  1333  IWKNSVTAQQlgsglkglgigSFALDWATVAAFQGSPLVTPDFAIINMLIGYVLVAYIAI  1154
             IWK+S+TAQQ+GSG+KGLGIGSF LDW TVA F GSPL  P FAIIN++ G+VL  Y+ I
Sbjct  202   IWKDSITAQQIGSGMKGLGIGSFGLDWNTVAGFLGSPLAVPGFAIINIMAGFVLYMYVLI  261

Query  1153  PVWYWTNLFDAKKFPLFSSNVFDSNGQVYNISRVLNKKTFGFDQPGYDSYSNIYLSTAFV  974
             P+ YW N++DAKKFPL SS+ FDS G  YNI+R+LN KTF  D   Y++YS IYLS  F 
Sbjct  262   PIAYWNNVYDAKKFPLISSHTFDSTGATYNITRILNTKTFDIDMESYNNYSKIYLSVTFA  321

Query  973   YTYGLSFATLAATVSHVALFHGRTI---WEQTKESVQDKFSDIHTRLMRKNYEPVPQWWF  803
             + YGLSFA L AT+SHV LFHG  I   W++T  S++++  D+HTR+M+KNYE VP+WWF
Sbjct  322   FQYGLSFAALTATISHVVLFHGEMIVQMWKKTTTSLKNQLGDVHTRIMKKNYEQVPEWWF  381

Query  802   YlllviivgvalvACQRFGGQLQLPVWGVLLAVLLSLIFTLPVGVITATTNQQTGLNVIA  623
               +L+++V +AL+AC+ FG QLQLP WG+LL++ ++L+FTLP+GVI ATT+ +TGLNVI 
Sbjct  382   VAILILMVMMALLACEGFGKQLQLPWWGILLSLSIALVFTLPIGVIEATTSARTGLNVIT  441

Query  622   ELIIGYMYPGRPLASVTFKMYGlsslsqslmflSDFKLGHYMKIPPKSMFMVQLVGTLIS  443
             EL+IG+ YPG+PLA+V FK YG +S+ Q+L FL DFKLGHYMKIPPKSMF+VQLVGT++S
Sbjct  442   ELVIGFTYPGKPLANVAFKTYGHTSMVQALGFLGDFKLGHYMKIPPKSMFIVQLVGTVVS  501

Query  442   CCVHFGTGWWLLTTVENICNPSKLPEGSQWTCPGDDVFYNASIIWGVVSPRRMFGNLGIY  263
               VHFGT WWLLT++ENIC+ S LP+GS WTCPGDD FYNASIIWGVV P+RMF N G+Y
Sbjct  502   LSVHFGTAWWLLTSIENICDESLLPKGSPWTCPGDDAFYNASIIWGVVGPKRMFTNDGVY  561

Query  262   QATNYFFLVGFLAPIPVWYLGRKYPEKRWVSLINMPILISGAEGIPIVKSVNYVCWFAVG  83
                N+FFL+G +AP+PVW L  K+P  +W+ LIN+PI+I GA  IP  +SVNY+ W  VG
Sbjct  562   PGMNWFFLIGLIAPVPVWLLSIKFPNHKWIKLINIPIIIVGASTIPPRRSVNYITWGIVG  621

Query  82    LYFNLYVYRKHKGWWARHNYILSAGLD  2
             ++FN YVYRK + WWARH YILSAGLD
Sbjct  622   MFFNFYVYRKFRVWWARHTYILSAGLD  648



>emb|CBI39769.3| unnamed protein product [Vitis vinifera]
Length=709

 Score =   787 bits (2033),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 405/678 (60%), Positives = 505/678 (74%), Gaps = 47/678 (7%)
 Frame = -1

Query  2026  SSADEINDSPVEEVRLTVPITDDPTMPCVTFRTWVLGVTSCVILAFLNQFFGYRQNALYV  1847
             +   E+ND P+EEVRLTVPITDDPT PC+TFRTWVLG+ SCV+LAF+NQFFGYR N L +
Sbjct  24    AGEKEVNDCPIEEVRLTVPITDDPTEPCLTFRTWVLGLISCVLLAFVNQFFGYRDNQLSI  83

Query  1846  SSVPAQIVVLPMGKLMAAYLPTKVVQIPGTKWSFSLNPGPFNIKEHVLITIFASSGSDFS  1667
             SSV AQIVVLP+GKLMA  LPTK V +P T WSFSLNPGPF++KEHVLIT+FA++GS   
Sbjct  84    SSVSAQIVVLPLGKLMATMLPTKQVNVPFTNWSFSLNPGPFSLKEHVLITMFANAGSGGV  143

Query  1666  YAVSIITMMKAFYYRDIHPLAAVLLTFSTQMLGYGLAGIFKKFLIDSPYMWWPSNLVQVS  1487
             YAV IIT++KAFY+R+++P+A  LL  +TQ+LGYG AG+F+K+L+DSPYMW         
Sbjct  144   YAVYIITIVKAFYHRNLNPVAGYLLLQTTQLLGYGWAGLFRKYLVDSPYMW---------  194

Query  1486  LFRALHDVETRPKGGLTRLQFFIIVLVCSFAYYVVPNYLFPSLTALSLLCWIWKNSVTAQ  1307
                 LH+ E R +GG+TRLQFF+IV + SFAYY+VP+YLFPS+T +S +C IWK S+TAQ
Sbjct  195   ---TLHEPEKRSRGGVTRLQFFLIVFISSFAYYLVPSYLFPSITTVSFICLIWKKSITAQ  251

Query  1306  QlgsglkglgigSFALDWATVAAFQGSPLVTPDFAIINMLIGYVLVAYIAIPVWYWTNLF  1127
             Q+GSGL GLG+GSF LDW TVA+F GSPL TP FAIIN+LIG+ L+ Y+ +P+ YWTNL+
Sbjct  252   QIGSGLSGLGLGSFGLDWTTVASFLGSPLATPAFAIINVLIGFFLIVYVMLPIAYWTNLY  311

Query  1126  DAKKFPLFSSNVFDSNGQVYNISRVLNKKTFGFDQPGYDSYSNIYLSTAFVYTYGLSFAT  947
             DAKKFP+ SS+VFDS GQ YN++R+L+ +TF  DQ GY+ Y  IYLS  F +TYG+SFA 
Sbjct  312   DAKKFPIISSHVFDSTGQPYNLTRILDSRTFQIDQAGYNGYGKIYLSVFFAFTYGISFAA  371

Query  946   LAATVSHVALFHGRTI---WEQTKESVQDKFSDIHTRLMRKNYEPVPQWWFYlllviivg  776
             L A +SHVALF+G+TI   W +T+ +V D+F D+HTRLM+KNYE VPQ            
Sbjct  372   LTAAISHVALFNGKTIMQMWRKTRSAVGDQFGDVHTRLMKKNYEAVPQ------------  419

Query  775   valvACQRFGGQLQLPVWGVLLAVLLSLIFTLPVGVITATTNQQTGLNVIAELIIGYMYP  596
                  C   G    L  W                           GLNVI EL+IGY+YP
Sbjct  420   -----CFCLGTIFHLTHWD---------------NNGHDKPGITLGLNVITELVIGYIYP  459

Query  595   GRPLASVTFKMYGlsslsqslmflSDFKLGHYMKIPPKSMFMVQLVGTLISCCVHFGTGW  416
             G+PLA+V+FK YG  S+ Q+L FL DFKLGHYMKIPPKSMF+VQLVGT+++  V+FGT W
Sbjct  460   GKPLANVSFKTYGYISMVQALTFLGDFKLGHYMKIPPKSMFVVQLVGTIVASSVYFGTAW  519

Query  415   WLLTTVENICNPSKLPEGSQWTCPGDDVFYNASIIWGVVSPRRMFGNLGIYQATNYFFLV  236
             WLL +V NIC+ + LPEGS WTCPGDDVFYNASIIWGVV P RMF  LG+Y   N+FFLV
Sbjct  520   WLLESVRNICDRALLPEGSPWTCPGDDVFYNASIIWGVVGPLRMFAKLGVYPGLNWFFLV  579

Query  235   GFLAPIPVWYLGRKYPEKRWVSLINMPILISGAEGIPIVKSVNYVCWFAVGLYFNLYVYR  56
             G LAP+PVW L RK+P ++W+ LI+MPI+I     +P  ++VNYV W AVGL+FNLYVYR
Sbjct  580   GLLAPVPVWLLSRKFPNQKWIKLIHMPIIIGATGNMPPARAVNYVMWGAVGLFFNLYVYR  639

Query  55    KHKGWWARHNYILSAGLD  2
             ++K WWA+H Y+LSA LD
Sbjct  640   RYKQWWAKHTYVLSAALD  657



>emb|CDX92812.1| BnaC07g40700D [Brassica napus]
Length=714

 Score =   785 bits (2028),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 401/683 (59%), Positives = 501/683 (73%), Gaps = 40/683 (6%)
 Frame = -1

Query  2050  NTGISAVESSADEINDSPVEEVRLTVPITDDPTMPCVTFRTWVLGVTSCVILAFLNQFFG  1871
              + I   +    E NDSP+EEVRLTVPITDDP+ P +TFRTW LG++SCV+LAF+N FFG
Sbjct  20    ESNIVISDEEGVEENDSPIEEVRLTVPITDDPSQPVLTFRTWFLGMSSCVVLAFVNIFFG  79

Query  1870  YRQNALYVSSVPAQIVVLPMGKLMAAYLPTKVVQIPGTKWSFSLNPGPFNIKEHVLITIF  1691
             YR N L VSSV AQIV LP+GKLMA  LPT+  ++PGT WS SLNPGPFN K HVLITIF
Sbjct  80    YRSNPLMVSSVVAQIVTLPLGKLMATTLPTRKFRLPGTSWSGSLNPGPFNTKGHVLITIF  139

Query  1690  ASSGSDFSYAVSIITMMKAFYYRDIHPLAAVLLTFSTQMLGYGLAGIFKKFLIDSPYMWW  1511
             A++G+  +YA SIIT++KAFY+R++ P AA+LL  +TQ+LGYG AG+F+KFL+DSPYMWW
Sbjct  140   ANTGAGGAYATSIITIVKAFYHRNLDPTAAMLLLQTTQLLGYGWAGMFRKFLVDSPYMWW  199

Query  1510  PSNLVQVSLFRALHDVETRPKGGLTRLQFFIIVLVCSFAYYVVPNYLFPSLTALSLLCWI  1331
             PSNLVQVSLFRALH+ E + +G  TRL+FF+IV   SFAYY++P Y+FPS+++LS LCWI
Sbjct  200   PSNLVQVSLFRALHEKEEKREGQQTRLRFFLIVFFLSFAYYIIPGYIFPSISSLSFLCWI  259

Query  1330  WKNSVTAQQlgsglkglgigSFALDWATVAAFQGSPLVTPDFAIINMLIGYVLVAYIAIP  1151
             W  SVTAQQ+GSGL+GLGIGSF LDW+ VA F GSPL  P FAI N   G+++  YI +P
Sbjct  260   WIRSVTAQQIGSGLQGLGIGSFGLDWSVVAGFLGSPLAVPFFAIANFFAGFLIFLYIVLP  319

Query  1150  VWYWTNLFDAKKFPLFSSNVFDSNGQVYNISRVLNKKTFGFDQPGYDSYSNIYLSTAFVY  971
             ++YW+N +DAKKFPLF+S  FD  GQ +N +R+LN+KTF  +   Y+SYS +YLS  F  
Sbjct  320   IFYWSNAYDAKKFPLFTSTTFDHTGQKFNTTRILNQKTFDINLAAYESYSKLYLSVVFAL  379

Query  970   TYGLSFATLAATVSHVALFHGRTIWEQTKESVQDKFSDIHTRLMRKNYEPVPQWWFYlll  791
              YGLSF TL ATVSHVALF G+ IW   K+S   K  D+HTRLM+KNY+ VP WWF  +L
Sbjct  380   IYGLSFGTLTATVSHVALFDGKFIWGMWKKST--KAEDVHTRLMKKNYKEVPHWWFLTVL  437

Query  790   viivgvalvACQRFGGQLQLPVWGVLLAVLLSLIFTLPVGVITATTNQQTGLNVIAELII  611
              +   +AL AC+ FG QLQLP WG+LLA  ++  FTLP+GVI ATTNQQ GLNVIAELII
Sbjct  438   FLSFVLALYACEGFGKQLQLPWWGLLLACAVAFTFTLPIGVIQATTNQQMGLNVIAELII  497

Query  610   GYMYPGRPLASVTFKMYGlsslsqslmflSDFKLGHYMKIPPKSMFMVQLVGTLISCCVH  431
             GY+YPG+PLA+                                      LV TL+S  V 
Sbjct  498   GYLYPGKPLAN--------------------------------------LVATLVSTTVC  519

Query  430   FGTGWWLLTTVENICNPSKLPEGSQWTCPGDDVFYNASIIWGVVSPRRMFGNLGIYQATN  251
             FGT WWLL++V+NIC   KLP GS WTCPGD VFYNASIIWG++ P RMF + G+Y   N
Sbjct  520   FGTTWWLLSSVDNICVQEKLPIGSPWTCPGDQVFYNASIIWGIIGPGRMFTSKGVYSGMN  579

Query  250   YFFLVGFLAPIPVWYLGRKYPEKRWVSLINMPILISGAEGIPIVKSVNYVCWFAVGLYFN  71
             +FFL+GFLA +PVW+  RK+PEK+W+  I++P++ S A  +P  K+VNY  W  VG+ FN
Sbjct  580   WFFLIGFLATVPVWFFARKFPEKKWIKQIHVPLIFSAASAMPRAKAVNYWSWVIVGVVFN  639

Query  70    LYVYRKHKGWWARHNYILSAGLD  2
              Y++R++KGWWARHNYILSAGLD
Sbjct  640   YYIFRRYKGWWARHNYILSAGLD  662



>emb|CAN79818.1| hypothetical protein VITISV_040328 [Vitis vinifera]
Length=701

 Score =   783 bits (2022),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 403/678 (59%), Positives = 504/678 (74%), Gaps = 50/678 (7%)
 Frame = -1

Query  2032  VESSADE-INDSPVEEVRLTVPITDDPTMPCVTFRTWVLGVTSCVILAFLNQFFGYRQNA  1856
             +E++ DE +ND P+E+VRLTVPITDDPT P +TFRTWVLGV SCVIL+F+NQFFGYR N 
Sbjct  21    IEATGDEEVNDCPIEQVRLTVPITDDPTEPVLTFRTWVLGVASCVILSFVNQFFGYRSNQ  80

Query  1855  LYVSSVPAQIVVLPMGKLMAAYLPTKVVQIPGTKWSFSLNPGPFNIKEHVLITIFASSGS  1676
             L +SSV AQIV LP+GK MAA LP K +++P TKWSFSLNPGPFNIKEHVLIT+FA+SGS
Sbjct  81    LSISSVSAQIVTLPLGKFMAATLPEKPIKVPCTKWSFSLNPGPFNIKEHVLITMFANSGS  140

Query  1675  DFSYAVSIITMMKAFYYRDIHPLAAVLLTFSTQMLGYGLAGIFKKFLIDSPYMWWPSNLV  1496
                YAV I+T++KAFY R + P A  LL  +TQ+LGYG AG+F+K+L+DSPYMWWPSNLV
Sbjct  141   GGVYAVGILTIVKAFYKRSLSPGAGYLLVQTTQLLGYGWAGLFRKYLVDSPYMWWPSNLV  200

Query  1495  QVSLFRALHDVETRPKGGLTRLQFFIIVLVCSFAYYVVPNYLFPSLTALSLLCWIWKNSV  1316
             QVSLFRALH+ E R KGGLTRLQFF+IV + SFAYY+VPNYLFPS+  +S++C IWKNS+
Sbjct  201   QVSLFRALHEKEKRSKGGLTRLQFFLIVFISSFAYYLVPNYLFPSIGTVSIICLIWKNSI  260

Query  1315  TAQQlgsglkglgigSFALDWATVAAFQGSPLVTPDFAIINMLIGYVLVAYIAIPVWYWT  1136
             TAQQ+GSGL G+G+GSF LDWATVA+F GSPL TP FAIIN+L+G+ ++ YI +P+ Y+ 
Sbjct  261   TAQQIGSGLYGMGLGSFGLDWATVASFLGSPLATPGFAIINILVGFFIIVYILLPLTYYN  320

Query  1135  NLFDAKKFPLFSSNVFDSNGQVYNISRVLNKKTFGFDQPGYDSYSNIYLSTAFVYTYGLS  956
             N ++AKKFP+FSS+ FDS GQ YN++R+LN KTF  D   Y++YS +YLS  F  TYG+S
Sbjct  321   NAYEAKKFPIFSSHTFDSTGQPYNLTRILNPKTFSVDLAEYNAYSKLYLSVFFSVTYGIS  380

Query  955   FATLAATVSHVALFHGRTIWEQTKESVQDKFSDIHTRLMRKNYEPVPQWWFYlllviivg  776
             FATLAA+VSHVALF+GR             F    +  M  N+                 
Sbjct  381   FATLAASVSHVALFNGR-------------FRQAASTTMVGNFA----------------  411

Query  775   valvACQRFGGQLQLPVWGVLLAVLLSLIFTLPVGVITATTNQQTGLNVIAELIIGYMYP  596
                + C               L +L  L      G     +  Q GLNVI ELIIG++YP
Sbjct  412   ---MLC---------------LGILFHLTHRHNNG--HDKSGMQPGLNVITELIIGFIYP  451

Query  595   GRPLASVTFKMYGlsslsqslmflSDFKLGHYMKIPPKSMFMVQLVGTLISCCVHFGTGW  416
             G+PLA+V FK YG  S+SQ+L FLSDFKLGHYMKIPP+SMF+VQLVGT+I+  V+FGT W
Sbjct  452   GKPLANVVFKTYGYISMSQALTFLSDFKLGHYMKIPPRSMFLVQLVGTVIASSVYFGTAW  511

Query  415   WLLTTVENICNPSKLPEGSQWTCPGDDVFYNASIIWGVVSPRRMFGNLGIYQATNYFFLV  236
             WLLTTV++IC+   LPEGS WTCPGDDVFYNAS+IWGV+ P RMFG LG+Y   N+FFL 
Sbjct  512   WLLTTVKHICDRDLLPEGSPWTCPGDDVFYNASVIWGVIGPLRMFGRLGVYPEMNWFFLA  571

Query  235   GFLAPIPVWYLGRKYPEKRWVSLINMPILISGAEGIPIVKSVNYVCWFAVGLYFNLYVYR  56
             GFLAP+PVW+L RK+P ++W+ LI+MPI+I     +P  ++V++V W  VG++FN YVY 
Sbjct  572   GFLAPVPVWFLSRKFPNQKWIRLIHMPIIIGATGNMPPARAVHFVMWGIVGVFFNFYVYN  631

Query  55    KHKGWWARHNYILSAGLD  2
             ++K WWA+H YILSA LD
Sbjct  632   RYKQWWAKHTYILSAALD  649



>gb|KCW76549.1| hypothetical protein EUGRSUZ_D00938 [Eucalyptus grandis]
Length=613

 Score =   778 bits (2008),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 393/600 (66%), Positives = 467/600 (78%), Gaps = 40/600 (7%)
 Frame = -1

Query  1801  MAAYLPTKVVQIPGTKWSFSLNPGPFNIKEHVLITIFASSGSDFSYAVSIITMMKAFYYR  1622
             MAA LP +V+++PGTKWSFSLNPGPFN+KEHVLITIFA++GS   YA++IIT++ AFY+R
Sbjct  1     MAAVLPQEVIRVPGTKWSFSLNPGPFNLKEHVLITIFANAGSSGVYAINIITIVIAFYHR  60

Query  1621  DIHPLAAVLLTFSTQMLGYGLAGIFKKFLIDSPYMWWPSNLVQVSLFRALHDVETRPKGG  1442
              IHPLAA+LL  +TQMLGYG AGIF+KFL+DSPYMWWP+NLVQVSLFRALH+ E RPK G
Sbjct  61    HIHPLAAMLLALTTQMLGYGWAGIFRKFLVDSPYMWWPANLVQVSLFRALHEEEVRPKRG  120

Query  1441  LTRLQFFIIVLVCSFAYYVVPNYLFPSLTALSLLCWIWKNSVTAQQlgsglkglgigSFA  1262
              TRLQFF++VL+ SFAYYVVPNYLFPS+TALS +CWIWK+SVTAQQ+GSG +GLGIGSFA
Sbjct  121   FTRLQFFLVVLISSFAYYVVPNYLFPSITALSFVCWIWKHSVTAQQIGSGRRGLGIGSFA  180

Query  1261  LDWATVAAFQGSPLVTPDFAIINMLIGYVLVAYIAIPVWYWTNLFDAKKFPLFSSNVFDS  1082
             LDWATVAA+ GSPL  P FAIIN+ IG+ L  Y+ IP+ Y TN F+AK+FPL SS+VFD+
Sbjct  181   LDWATVAAWNGSPLAYPGFAIINISIGFFLTLYVLIPIAYQTNAFEAKRFPLISSHVFDA  240

Query  1081  NGQVYNISRVLNKKTFGFDQPGYDSYSNIYLSTAFVYTYGLSFATLAATVSHVALFHGRT  902
             NG  YN+  VLN+  F F+Q GYD YS + LS  F + YGLSFATLAAT+SHV LFHGRT
Sbjct  241   NGNKYNVGLVLNETNFQFNQHGYDDYSKVRLSIFFAFVYGLSFATLAATISHVVLFHGRT  300

Query  901   IWEQTKESVQDKFSDIHTRLMRKNYEPVPQWWFYlllviivgvalvACQRFGGQLQLPVW  722
             IW+QT+ + QDKF D+HTRLM+KNY+ VPQWWFY                          
Sbjct  301   IWQQTRATFQDKFDDVHTRLMKKNYDAVPQWWFYS-------------------------  335

Query  721   GVLLAVLLSLIFTLPVGVITATTNQQTGLNVIAELIIGYMYPGRPLASVTFKMYGlssls  542
                    L LI T+           Q GLNVI ELIIG+MYPGRPLA+V FK YG  S+ 
Sbjct  336   -------LMLIMTV--------LAMQPGLNVITELIIGFMYPGRPLANVAFKTYGYISMV  380

Query  541   qslmflSDFKLGHYMKIPPKSMFMVQLVGTLISCCVHFGTGWWLLTTVENICNPSKLPEG  362
             Q++ FLSDFKLGHYMKIPPKSMF+VQLVGT+++  V+FGT WWLL +V+NIC+PSKLPEG
Sbjct  381   QAITFLSDFKLGHYMKIPPKSMFIVQLVGTVVASSVYFGTAWWLLASVDNICDPSKLPEG  440

Query  361   SQWTCPGDDVFYNASIIWGVVSPRRMFGNLGIYQATNYFFLVGFLAPIPVWYLGRKYPEK  182
             S WTCPG DVFY ASIIWGVV P RMFG LG+Y   NYFFL G LAP+PVW L R +PEK
Sbjct  441   SPWTCPGYDVFYYASIIWGVVGPLRMFGRLGVYARMNYFFLFGILAPVPVWILSRMFPEK  500

Query  181   RWVSLINMPILISGAEGIPIVKSVNYVCWFAVGLYFNLYVYRKHKGWWARHNYILSAGLD  2
             +W+ LINMPI+ISGA  +    SVNY+CW  VG+ FN+YV+R++K WWARHNYILSAGLD
Sbjct  501   KWIRLINMPIIISGAGNMLPATSVNYICWITVGVLFNIYVFRRYKSWWARHNYILSAGLD  560



>ref|XP_008344715.1| PREDICTED: oligopeptide transporter 1-like, partial [Malus domestica]
Length=633

 Score =   774 bits (1999),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 390/580 (67%), Positives = 474/580 (82%), Gaps = 3/580 (1%)
 Frame = -1

Query  1732  GPFNIKEHVLITIFASSGSDFSYAVSIITMMKAFYYRDIHPLAAVLLTFSTQMLGYGLAG  1553
             G F++KEHVLITIFA+SGS+  YAV+IIT++KA+Y+RDIH +AA LL+ +TQMLGYG AG
Sbjct  2     GAFSMKEHVLITIFANSGSNSVYAVNIITIVKAYYHRDIHIMAAFLLSQTTQMLGYGWAG  61

Query  1552  IFKKFLIDSPYMWWPSNLVQVSLFRALHDVETRPKGGLTRLQFFIIVLVCSFAYYVVPNY  1373
             +F+KFL+DSPYMWWPSNLVQVSLFRALH+ E RPKGG TR+QFFIIV VCSFAYY+VP+ 
Sbjct  62    LFRKFLVDSPYMWWPSNLVQVSLFRALHEREKRPKGGRTRMQFFIIVFVCSFAYYIVPSL  121

Query  1372  LFPSLTALSLLCWIWKNSVTAQQlgsglkglgigSFALDWATVAAFQGSPLVTPDFAIIN  1193
              FPSLTALS +CWIWK+S+TAQQ+GSGLKGLGIGSFALDW+T+AAF GSPL  PD A+IN
Sbjct  122   FFPSLTALSFVCWIWKDSITAQQIGSGLKGLGIGSFALDWSTIAAFLGSPLAYPDVAVIN  181

Query  1192  MLIGYVLVAYIAIPVWYWTNLFDAKKFPLFSSNVFDSNGQVYNISRVLNKKTFGFDQPGY  1013
             ML G+VL+ YI +P  YWTN +DAKKFP+FSS+ FD +GQ YN+SR+LN+KTF  D P Y
Sbjct  182   MLXGFVLIFYIILPXTYWTNTYDAKKFPIFSSHTFDVDGQKYNVSRILNQKTFDIDLPQY  241

Query  1012  DSYSNIYLSTAFVYTYGLSFATLAATVSHVALFHGRTIWE---QTKESVQDKFSDIHTRL  842
             +SYS ++LST F  TYG  FATL +T+SHV L+HG+ IW    +T  +V+++  D+HTRL
Sbjct  242   NSYSKLHLSTFFALTYGWGFATLTSTISHVGLYHGKEIWHLWRKTTGAVKNQLGDVHTRL  301

Query  841   MRKNYEPVPQWWFYlllviivgvalvACQRFGGQLQLPVWGVLLAVLLSLIFTLPVGVIT  662
             M++NYEPVP+WWF ++LV +VG+A+  C+ FG QLQLP WGVLLA  ++L FTLP+GVI 
Sbjct  302   MKRNYEPVPEWWFQIILVSMVGLAIFTCEGFGKQLQLPWWGVLLACTIALAFTLPIGVIA  361

Query  661   ATTNQQTGLNVIAELIIGYMYPGRPLASVTFKMYGlsslsqslmflSDFKLGHYMKIPPK  482
             ATTN Q GLN+I ELIIGY+YPGRPLA+V FK YG  S+SQ+LMFL DFKLGHYMKIPPK
Sbjct  362   ATTNMQPGLNIITELIIGYIYPGRPLANVAFKTYGYISMSQALMFLGDFKLGHYMKIPPK  421

Query  481   SMFMVQLVGTLISCCVHFGTGWWLLTTVENICNPSKLPEGSQWTCPGDDVFYNASIIWGV  302
             SMF VQL GT  +    FGT WWLLTTV+NIC+P+ LP GS WTCPGDDVFYNASIIWGV
Sbjct  422   SMFXVQLAGTXTATSAFFGTSWWLLTTVKNICDPANLPAGSPWTCPGDDVFYNASIIWGV  481

Query  301   VSPRRMFGNLGIYQATNYFFLVGFLAPIPVWYLGRKYPEKRWVSLINMPILISGAEGIPI  122
             + P RMF   G Y   N+FFL GFL+PIP W L +K+P K+W+  INMPI++     +P 
Sbjct  482   IGPLRMFTKKGNYPELNWFFLJGFLSPIPGWLLHKKFPNKKWIRHINMPIILGSTGVMPP  541

Query  121   VKSVNYVCWFAVGLYFNLYVYRKHKGWWARHNYILSAGLD  2
              K++NY+ WF+V L FNLYVYRKHKGWWARHNYILSA LD
Sbjct  542   AKAINYLSWFSVALVFNLYVYRKHKGWWARHNYILSAALD  581



>ref|XP_007162247.1| hypothetical protein PHAVU_001G136300g [Phaseolus vulgaris]
 gb|ESW34241.1| hypothetical protein PHAVU_001G136300g [Phaseolus vulgaris]
Length=654

 Score =   772 bits (1994),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 381/603 (63%), Positives = 481/603 (80%), Gaps = 3/603 (0%)
 Frame = -1

Query  1801  MAAYLPTKVVQIPGTKWSFSLNPGPFNIKEHVLITIFASSGSDFSYAVSIITMMKAFYYR  1622
             MAA LPTK +++P TKWSFS+NPGPF +KEHVLITIFA+SGS    AV +IT++KAFY+R
Sbjct  1     MAATLPTKPIRVPFTKWSFSMNPGPFTLKEHVLITIFATSGSSGVDAVDVITIVKAFYHR  60

Query  1621  DIHPLAAVLLTFSTQMLGYGLAGIFKKFLIDSPYMWWPSNLVQVSLFRALHDVETRPKGG  1442
              IHP+AA LL  STQMLGYG AGIF++FL+DSP+MWWP NLVQVSLF+A H+ E RPKGG
Sbjct  61    SIHPVAAYLLVLSTQMLGYGWAGIFRRFLVDSPFMWWPENLVQVSLFKAFHEKEKRPKGG  120

Query  1441  LTRLQFFIIVLVCSFAYYVVPNYLFPSLTALSLLCWIWKNSVTAQQlgsglkglgigSFA  1262
              TR+QFF +V V SFAYY +P YLF +++ +S +C IW +S+TAQQ+GSG+  +GIGSF 
Sbjct  121   YTRMQFFFLVFVASFAYYTLPGYLFQAISTISFVCLIWNDSITAQQIGSGMNEIGIGSFG  180

Query  1261  LDWATVAAFQGSPLVTPDFAIINMLIGYVLVAYIAIPVWYWTNLFDAKKFPLFSSNVFDS  1082
             LDW TVAAF GSPL  P FAIINMLIG++L  Y+ IP+ YW+NL+DAK+FPL SS+ FDS
Sbjct  181   LDWNTVAAFLGSPLAVPGFAIINMLIGFMLDIYVLIPLAYWSNLYDAKRFPLISSHTFDS  240

Query  1081  NGQVYNISRVLNKKTFGFDQPGYDSYSNIYLSTAFVYTYGLSFATLAATVSHVALFHGRT  902
              G  YN++RVLN +TF  D   Y++YS IYLS  F + YGLSFATL AT+SHV LFHG  
Sbjct  241   TGVTYNVTRVLNPRTFDIDLDSYNNYSKIYLSITFAFEYGLSFATLTATISHVVLFHGDM  300

Query  901   I---WEQTKESVQDKFSDIHTRLMRKNYEPVPQWWFYlllviivgvalvACQRFGGQLQL  731
             I   W +T  + +++  D+HTR+M++NYE VP+WWF  +L+++V VALVAC+ FG QLQL
Sbjct  301   ILQTWRKTTRAPKEQLGDVHTRIMKRNYEQVPEWWFVTILILMVVVALVACECFGKQLQL  360

Query  730   PVWGVLLAVLLSLIFTLPVGVITATTNQQTGLNVIAELIIGYMYPGRPLASVTFKMYGls  551
             P WG+LL++ ++L+FTLP+G+I ATTN + GLNVI+ELIIGY+YPG+PLA+V FK+YG  
Sbjct  361   PWWGILLSLTIALVFTLPIGIIQATTNIKIGLNVISELIIGYIYPGKPLANVAFKVYGHD  420

Query  550   slsqslmflSDFKLGHYMKIPPKSMFMVQLVGTLISCCVHFGTGWWLLTTVENICNPSKL  371
             S+ Q+L FLSDFKLGHYMKIPPKSMF+ QLVGT+++  V+F T WWLLT++ENIC+ + L
Sbjct  421   SMLQALAFLSDFKLGHYMKIPPKSMFIAQLVGTVVASSVYFATSWWLLTSIENICDEALL  480

Query  370   PEGSQWTCPGDDVFYNASIIWGVVSPRRMFGNLGIYQATNYFFLVGFLAPIPVWYLGRKY  191
             P+GS WTCPGDDVFYNASIIWGVV P+RMF   G+Y   N+FFL+G LAPIPVW L  K+
Sbjct  481   PKGSPWTCPGDDVFYNASIIWGVVGPQRMFAKDGVYPGMNWFFLIGLLAPIPVWLLSCKF  540

Query  190   PEKRWVSLINMPILISGAEGIPIVKSVNYVCWFAVGLYFNLYVYRKHKGWWARHNYILSA  11
             P  +W+ LIN+PI+ +GA  IP  +SVNY+ W  VG++FN YVYRK K WW RH YILSA
Sbjct  541   PNHKWIQLINIPIIAAGACNIPPARSVNYITWGTVGIFFNFYVYRKFKAWWVRHTYILSA  600

Query  10    GLD  2
              LD
Sbjct  601   ALD  603



>tpg|DAA47797.1| TPA: hypothetical protein ZEAMMB73_939928 [Zea mays]
Length=654

 Score =   771 bits (1992),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 383/604 (63%), Positives = 486/604 (80%), Gaps = 6/604 (1%)
 Frame = -1

Query  1801  MAAYLPTKVVQIPGTKWSFSLNPGPFNIKEHVLITIFASSGSDFSYAVSIITMMKAFYYR  1622
             MAA LPTK V++ G   SFSLNPGPFN+KEHVLITIFA++GS+  YAV IIT++KAFY+R
Sbjct  1     MAACLPTKAVRVMGR--SFSLNPGPFNLKEHVLITIFANTGSNSVYAVGIITIVKAFYHR  58

Query  1621  DIHPLAAVLLTFSTQMLGYGLAGIFKKFLIDSPYMWWPSNLVQVSLFRALHDVETR-PKG  1445
             +IHPLAA+LLT +TQ++GYG AG+F+KFL+DSPYMWWP+NLVQVSLFRALH+ ETR P+G
Sbjct  59    EIHPLAAMLLTQTTQLMGYGWAGLFRKFLVDSPYMWWPANLVQVSLFRALHERETRRPRG  118

Query  1444  GLTRLQFFIIVLVCSFAYYVVPNYLFPSLTALSLLCWIWKNSVTAQQlgsglkglgigSF  1265
             G TRLQFF+ VL  SFAYY+VPNYLFP+++ +S+ C +W+ SVTAQQ+GSG+ GLG+G+F
Sbjct  119   GTTRLQFFLTVLATSFAYYIVPNYLFPTISTVSVACLVWRRSVTAQQIGSGVYGLGVGAF  178

Query  1264  ALDWATVAAFQGSPLVTPDFAIINMLIGYVLVAYIAIPVWYWTNLFDAKKFPLFSSNVFD  1085
              LDWATVA F G+PL TP FAI N++ G+ L+ Y+ +P  YW++ + A++FP+ SS+VF 
Sbjct  179   GLDWATVAGFLGTPLSTPAFAIANIMAGFFLIVYVIVPFAYWSDAYGARRFPIISSHVFM  238

Query  1084  SNGQVYNISRVLNKKTFGFDQPGYDSYSNIYLSTAFVYTYGLSFATLAATVSHVALFHGR  905
             +NG  Y+++RVL   TF F Q GYD    I+LS  F ++YGLSFATLAAT+SHVAL+HGR
Sbjct  239   ANGSRYDVNRVLGAGTFQFSQAGYDGAGQIHLSIFFAFSYGLSFATLAATLSHVALYHGR  298

Query  904   TIWEQTKESVQDKFSDIHTRLMRKNYEPVPQWWFYlllviivgvalvACQRFGGQLQLPV  725
             +IWEQT+ +V+    D+H RLMR+NY  VPQWWF +LL++++G++L  C+ FG QLQLP 
Sbjct  299   SIWEQTRATVRAAGGDVHARLMRRNYAAVPQWWFQVLLLLVLGLSLFTCEGFGRQLQLPY  358

Query  724   WGVLLAVLLSLIFTLPVGVITATTNQQTGLNVIAELIIGYMYPGRPLASVTFKMYGlssl  545
             WGVLLA  L+  FTLP+G+ITATTNQQ GLNV+ ELIIGY+YPGRPLA+V FK YG  S+
Sbjct  359   WGVLLAAGLAFFFTLPIGIITATTNQQPGLNVVTELIIGYLYPGRPLANVAFKTYGYISM  418

Query  544   sqslmflSDFKLGHYMKIPPKSMFMVQLVGTLISCCVHFGTGWWLLTTVENICNPSKLPE  365
             SQ++MFL DFKLGHYMKIPP+SMF VQLVGT+++  V+F T WWLL +V  IC+P++LPE
Sbjct  419   SQAIMFLQDFKLGHYMKIPPRSMFAVQLVGTVLASSVYFATSWWLLESVPGICDPARLPE  478

Query  364   GSQWTCPGDDVFYNASIIWGVVSPRRMFGNLGIYQATNYFFLVGFLAPIPVWYLGRKYPE  185
             GS WTCPGDDVF+NASIIWGVV P RMFG LG+Y   NYFFL G LAP+P W L R +P+
Sbjct  479   GSPWTCPGDDVFFNASIIWGVVGPLRMFGRLGLYAKMNYFFLAGALAPVPFWALARAFPD  538

Query  184   KR---WVSLINMPILISGAEGIPIVKSVNYVCWFAVGLYFNLYVYRKHKGWWARHNYILS  14
                  W+ L+NMP+L+     +P  +SVNY+ W AVGL FN  VYR++K WWARHNY+LS
Sbjct  539   SAWAPWLRLVNMPVLLGATGMMPPARSVNYLMWGAVGLAFNYVVYRRYKAWWARHNYVLS  598

Query  13    AGLD  2
             AGLD
Sbjct  599   AGLD  602



>dbj|BAK04511.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=693

 Score =   761 bits (1966),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 374/638 (59%), Positives = 494/638 (77%), Gaps = 2/638 (0%)
 Frame = -1

Query  1909  SCVILAFLNQFFGYRQNALYVSSVPAQIVVLPMGKLMAAYLPTKVVQIPGTKWSFSLNPG  1730
             SCV+LAF+N+FF YR N L + +V  QI  LP+G+ MA+ LP K++++P   W+F+LNPG
Sbjct  3     SCVLLAFVNEFFMYRSNQLSIGTVVVQIATLPIGRFMASALPAKLIRVPLMGWTFTLNPG  62

Query  1729  PFNIKEHVLITIFASSGSDFSYAVSIITMMKAFYYRDIHPLAAVLLTFSTQMLGYGLAGI  1550
             PF++KEH LITIFA +G+   YA++II ++K FY R I+P AA+LL  +TQ+LGYG AG+
Sbjct  63    PFSLKEHCLITIFAGAGASGVYAMNIIAIVKVFYKRQINPYAAMLLAQTTQLLGYGWAGL  122

Query  1549  FKKFLIDSPYMWWPSNLVQVSLFRALHDVETRPKGGLTRLQFFIIVLVCSFAYYVVPNYL  1370
             F+ +L+DS YMWWP NLVQV+LFRA+H+ E RPKG LTRLQFF IV++CSFAYY++P+YL
Sbjct  123   FRTYLVDSAYMWWPLNLVQVTLFRAMHEEEKRPKGQLTRLQFFFIVMICSFAYYLIPSYL  182

Query  1369  FPSLTALSLLCWIWKNSVTAQQlgsglkglgigSFALDWATVAAFQGSPLVTPDFAIINM  1190
             FP+ + LS LCW +K+S+TAQQ+GSGLKGLG+GS  LDW TVA F G+PL +P FAI NM
Sbjct  183   FPAASTLSALCWFYKDSITAQQIGSGLKGLGVGSLGLDWNTVAGFIGNPLASPAFAIFNM  242

Query  1189  LIGYVLVAYIAIPVWYWTNLFDAKKFPLFSSNVFDSNGQVYNISRVLNKKTFGFDQPGYD  1010
             + G+ L  Y A+P+ YWTN ++AK+FP+ SS+VFD+ G  Y+ +R+L+ KTF  +   Y+
Sbjct  243   MAGFSLNNYFAVPLLYWTNTYNAKRFPIISSHVFDAAGNRYDTNRILDPKTFTLNLHEYN  302

Query  1009  SYSNIYLSTAFVYTYGLSFATLAATVSHVALFHGRTIWE--QTKESVQDKFSDIHTRLMR  836
             +YS I+LS  F   YG  FA L +T+SHVAL+HG+ I++  +   S + K  D+HTR+M+
Sbjct  303   AYSRIHLSVLFALNYGFGFAGLLSTLSHVALYHGKEIFDLWRKTSSEKGKEQDVHTRIMK  362

Query  835   KNYEPVPQWWFYlllviivgvalvACQRFGGQLQLPVWGVLLAVLLSLIFTLPVGVITAT  656
             +NY  VPQWWF+L+LV+++ ++L  C+ FGGQLQLP WG+LLA  ++L FTLP+G+ITAT
Sbjct  363   RNYRSVPQWWFHLMLVLVLALSLFTCEGFGGQLQLPYWGLLLACAIALTFTLPIGIITAT  422

Query  655   TNQQTGLNVIAELIIGYMYPGRPLASVTFKMYGlsslsqslmflSDFKLGHYMKIPPKSM  476
             TN Q GLN+I ELIIGY+YPG+PLA+V FK YG  S+ Q+L F+SDFKLGHYMKIPP+SM
Sbjct  423   TNMQPGLNIITELIIGYLYPGKPLANVVFKTYGYISMGQALTFVSDFKLGHYMKIPPRSM  482

Query  475   FMVQLVGTLISCCVHFGTGWWLLTTVENICNPSKLPEGSQWTCPGDDVFYNASIIWGVVS  296
             F VQL GT+ S  VHF T WWLLTTV+N+C+   LPEGS WTCPGDDVFYNASIIWGVV 
Sbjct  483   FFVQLAGTVTSSTVHFATAWWLLTTVKNVCDVDVLPEGSPWTCPGDDVFYNASIIWGVVG  542

Query  295   PRRMFGNLGIYQATNYFFLVGFLAPIPVWYLGRKYPEKRWVSLINMPILISGAEGIPIVK  116
             P RMFG LG Y   NYFFLVG LAP+P+W L R YP   ++  IN+P++ +GA G+   +
Sbjct  543   PLRMFGRLGNYWQMNYFFLVGVLAPLPIWLLCRWYPHNTFLKSINIPLIFAGAGGLLPAR  602

Query  115   SVNYVCWFAVGLYFNLYVYRKHKGWWARHNYILSAGLD  2
             SVN++ W  VG+ FN ++YR+HK WW RH Y+L+AGLD
Sbjct  603   SVNFLMWGLVGIVFNHFIYRRHKAWWMRHTYVLAAGLD  640



>ref|XP_011038844.1| PREDICTED: oligopeptide transporter 1 isoform X3 [Populus euphratica]
Length=655

 Score =   759 bits (1960),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 375/603 (62%), Positives = 484/603 (80%), Gaps = 3/603 (0%)
 Frame = -1

Query  1801  MAAYLPTKVVQIPGTKWSFSLNPGPFNIKEHVLITIFASSGSDFSYAVSIITMMKAFYYR  1622
             MAA LP K V IP TKWSFSLNPGPF++KEHVLITIFA+ G+   YAV IIT+ KAFY++
Sbjct  1     MAAKLPKKQVSIPFTKWSFSLNPGPFSMKEHVLITIFANCGAGGVYAVYIITITKAFYHK  60

Query  1621  DIHPLAAVLLTFSTQMLGYGLAGIFKKFLIDSPYMWWPSNLVQVSLFRALHDVETRPKGG  1442
              +HP+AA+LL  +TQ+LGYG AG+F+K L+DSPYMWWP+ LVQVSLFRALH+ E R KG 
Sbjct  61    GLHPVAAMLLAQTTQLLGYGWAGMFRKILVDSPYMWWPATLVQVSLFRALHEKEKRKKGE  120

Query  1441  LTRLQFFIIVLVCSFAYYVVPNYLFPSLTALSLLCWIWKNSVTAQQlgsglkglgigSFA  1262
              TRLQFF IV V SFAYY+VP + FPSL+ALS +CWIWK S+TAQQ+G+GL GLGIGSF 
Sbjct  121   RTRLQFFAIVFVASFAYYIVPGHFFPSLSALSFVCWIWKRSITAQQIGAGLNGLGIGSFG  180

Query  1261  LDWATVAAFQGSPLVTPDFAIINMLIGYVLVAYIAIPVWYWTNLFDAKKFPLFSSNVFDS  1082
             LDWATVA+F G+PL  P FAI+N ++G++LV Y+ +P+ YW+N  +AK+FP+ +S+ FD 
Sbjct  181   LDWATVASFLGTPLAYPFFAIVNTMVGFILVMYVLVPIAYWSNFREAKRFPIVTSHTFDE  240

Query  1081  NGQVYNISRVLNKKTFGFDQPGYDSYSNIYLSTAFVYTYGLSFATLAATVSHVALFHGRT  902
             +GQ++NI+RVLN+KTF  +   Y++YS +YLS  F + YGLSFA+L AT++HVALF G+ 
Sbjct  241   DGQIFNITRVLNEKTFDLNLVEYENYSKLYLSIFFAFLYGLSFASLTATLTHVALFDGKN  300

Query  901   I---WEQTKESVQDKFSDIHTRLMRKNYEPVPQWWFYlllviivgvalvACQRFGGQLQL  731
             I   W++T  +V+D+FSD+HTR+M+KNY  VPQWWF  +LVI + ++L+A + F  QLQL
Sbjct  301   IIKMWKKTTTAVKDEFSDVHTRIMKKNYAVVPQWWFTAILVISLALSLLAVEGFDRQLQL  360

Query  730   PVWGVLLAVLLSLIFTLPVGVITATTNQQTGLNVIAELIIGYMYPGRPLASVTFKMYGls  551
             P WG+LLA  ++LIFTLPVGV+ ATTN Q GLNVI EL+IGYMYPG+PLA+V FK YG  
Sbjct  361   PWWGLLLACFIALIFTLPVGVVQATTNMQIGLNVITELVIGYMYPGKPLANVAFKTYGYI  420

Query  550   slsqslmflSDFKLGHYMKIPPKSMFMVQLVGTLISCCVHFGTGWWLLTTVENICNPSKL  371
             S++Q+L FL DFK+GHYMKIPPKSMF+VQLVGT++S  V+F T WWLL++VENICNP  L
Sbjct  421   SMTQALSFLGDFKIGHYMKIPPKSMFIVQLVGTVVSSTVYFATAWWLLSSVENICNPDLL  480

Query  370   PEGSQWTCPGDDVFYNASIIWGVVSPRRMFGNLGIYQATNYFFLVGFLAPIPVWYLGRKY  191
              +GS WTCPG DVFYNASIIWGVV P RMF + G+Y   N++FL+GFLAP+P W+L RK+
Sbjct  481   SDGSPWTCPGSDVFYNASIIWGVVGPLRMFTDKGVYPEQNWWFLIGFLAPVPKWFLERKF  540

Query  190   PEKRWVSLINMPILISGAEGIPIVKSVNYVCWFAVGLYFNLYVYRKHKGWWARHNYILSA  11
             PEK+W+ LI++P+++S    +P  K+V+Y  W +VG  FN  +YR++KGWWA+H YILSA
Sbjct  541   PEKKWIKLIHIPLILSATASMPSAKTVHYWSWASVGFIFNYIIYRRYKGWWAKHTYILSA  600

Query  10    GLD  2
              LD
Sbjct  601   ALD  603



>emb|CDY42726.1| BnaA03g48130D [Brassica napus]
Length=694

 Score =   750 bits (1937),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 389/683 (57%), Positives = 491/683 (72%), Gaps = 60/683 (9%)
 Frame = -1

Query  2050  NTGISAVESSADEINDSPVEEVRLTVPITDDPTMPCVTFRTWVLGVTSCVILAFLNQFFG  1871
              + I   +    E NDSP+EEVRLTVPITDDP+ P +TFRTW LG++SCV+LAF+N FFG
Sbjct  20    ESNIVISDEEGVEENDSPIEEVRLTVPITDDPSQPVLTFRTWFLGMSSCVVLAFVNIFFG  79

Query  1870  YRQNALYVSSVPAQIVVLPMGKLMAAYLPTKVVQIPGTKWSFSLNPGPFNIKEHVLITIF  1691
             YR N L VSSV AQIV LP+GKLMA  LPT+  ++PGT WS SLN GPFN+KEHVLITIF
Sbjct  80    YRSNPLMVSSVVAQIVTLPLGKLMATTLPTRKFRLPGTSWSGSLNHGPFNMKEHVLITIF  139

Query  1690  ASSGSDFSYAVSIITMMKAFYYRDIHPLAAVLLTFSTQMLGYGLAGIFKKFLIDSPYMWW  1511
             A++G+  +YA SIIT++KAFY+R+++P AA+LL  +TQ+LGYG AG+F+KFL+DSPYMWW
Sbjct  140   ANTGAGGAYATSIITIVKAFYHRNLNPTAAMLLLQTTQLLGYGWAGMFRKFLVDSPYMWW  199

Query  1510  PSNLVQVSLFRALHDVETRPKGGLTRLQFFIIVLVCSFAYYVVPNYLFPSLTALSLLCWI  1331
             PSNLVQVSLFRALH+ E + +G  TRL+FF+IV   SFAYY++P Y+FPS+++LS LCWI
Sbjct  200   PSNLVQVSLFRALHEKEEKREGQQTRLRFFLIVFFLSFAYYIIPGYIFPSISSLSFLCWI  259

Query  1330  WKNSVTAQQlgsglkglgigSFALDWATVAAFQGSPLVTPDFAIINMLIGYVLVAYIAIP  1151
             W  SVTAQQ+GSGL+GLGIGSF +DW+ VA F GSPL  P FAI N   G+++  YI +P
Sbjct  260   WIRSVTAQQIGSGLQGLGIGSFGVDWSVVAGFLGSPLAVPFFAIANFFAGFLIFFYIVLP  319

Query  1150  VWYWTNLFDAKKFPLFSSNVFDSNGQVYNISRVLNKKTFGFDQPGYDSYSNIYLSTAFVY  971
             ++YW+N +DAKKFPLF+S  FD  GQ +N +R+LN+KTF F+                  
Sbjct  320   IFYWSNAYDAKKFPLFTSATFDHTGQKFNTTRILNQKTFDFNLA----------------  363

Query  970   TYGLSFATLAATVSHVALFHGRTIWEQTKESVQDKFSDIHTRLMRKNYEPVPQWWFYlll  791
                 +F TL ATVSHVALF G+ IW   K+S   K  D+HTRLM+KNY+ VP WWF  +L
Sbjct  364   ----AFGTLTATVSHVALFDGKFIWGMWKKST--KAGDVHTRLMKKNYKEVPHWWFVTVL  417

Query  790   viivgvalvACQRFGGQLQLPVWGVLLAVLLSLIFTLPVGVITATTNQQTGLNVIAELII  611
              +   +AL AC+ FG QLQLP WG+LLA  ++  FTLP+GVI ATTNQQ GLNVIAELII
Sbjct  418   FLSFVLALYACEGFGKQLQLPWWGLLLACSVAFTFTLPIGVIQATTNQQMGLNVIAELII  477

Query  610   GYMYPGRPLASVTFKMYGlsslsqslmflSDFKLGHYMKIPPKSMFMVQLVGTLISCCVH  431
             GY+YPG+PLA+                                      LV T++S  V 
Sbjct  478   GYLYPGKPLAN--------------------------------------LVATMVSTTVC  499

Query  430   FGTGWWLLTTVENICNPSKLPEGSQWTCPGDDVFYNASIIWGVVSPRRMFGNLGIYQATN  251
             FGT WWLL+ V+NIC   KLP GS WTCPGD VFYNASIIWG++ P RMF + G+Y   N
Sbjct  500   FGTTWWLLSLVDNICVQEKLPIGSPWTCPGDQVFYNASIIWGIIGPGRMFTSKGVYSGMN  559

Query  250   YFFLVGFLAPIPVWYLGRKYPEKRWVSLINMPILISGAEGIPIVKSVNYVCWFAVGLYFN  71
             +FFL+GFLAP+PVW+  RK+PEK+W+  I++P++ S A  +P  K+VNY  W  VG+ FN
Sbjct  560   WFFLIGFLAPVPVWFFARKFPEKKWIKQIHVPLIFSAASAMPRAKAVNYWSWVIVGVVFN  619

Query  70    LYVYRKHKGWWARHNYILSAGLD  2
              Y++R++KGWWARHNYILSAGLD
Sbjct  620   YYIFRRYKGWWARHNYILSAGLD  642



>ref|XP_010267482.1| PREDICTED: oligopeptide transporter 7-like [Nelumbo nucifera]
Length=766

 Score =   752 bits (1941),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 378/707 (53%), Positives = 512/707 (72%), Gaps = 8/707 (1%)
 Frame = -1

Query  2119  RDTRERVSSFKNS-SLSRLLH*MENTGISAVESSADEINDSPVEEVRLTVPITDDPTMPC  1943
             RD  E  S    S SLS++L    ++  SA + S  EI  SP+++V LTVP TDD T+P 
Sbjct  16    RDDAEDHSRPSTSYSLSQVL--ASSSQSSAHDFSESEI--SPIKQVALTVPTTDDHTLPV  71

Query  1942  VTFRTWVLGVTSCVILAFLNQFFGYRQNALYVSSVPAQIVVLPMGKLMAAYLPTKVVQIP  1763
             +TFR WVLG  SC++L+FLNQFF YR   L ++++ AQI V+P+G+LMA+ +  +V    
Sbjct  72    LTFRMWVLGTVSCILLSFLNQFFWYRTEPLTITAISAQIAVVPLGRLMASMITNRVF-FK  130

Query  1762  GTKWSFSLNPGPFNIKEHVLITIFASSGSDFSYAVSIITMMKAFYYRDIHPLAAVLLTFS  1583
             G++W F+LNPGPFN+KEHVLITIFA+SG+   YA+ I+T +K FY ++I    ++++  +
Sbjct  131   GSRWEFTLNPGPFNVKEHVLITIFANSGAGTVYAIHIVTAVKIFYKKNITFFVSLIVVIT  190

Query  1582  TQMLGYGLAGIFKKFLIDSPYMWWPSNLVQVSLFRALHDVETRPKGGLTRLQFFIIVLVC  1403
             TQ+LG+G AGIF+++L++   MWWP+NLVQVSLFRALH+ E R KGGLTR QFF+I  +C
Sbjct  191   TQVLGFGWAGIFRRYLVEPAAMWWPANLVQVSLFRALHEKEERGKGGLTRTQFFLIAFIC  250

Query  1402  SFAYYVVPNYLFPSLTALSLLCWIWKNSVTAQQlgsglkglgigSFALDWATVAAFQGSP  1223
             SFAYY+ P YLFP LT+LS +CWI+  S+ AQQLGSGL GLG+G+  +DW+T++++ GSP
Sbjct  251   SFAYYIFPGYLFPMLTSLSWVCWIFPKSILAQQLGSGLYGLGLGAIGVDWSTISSYLGSP  310

Query  1222  LVTPDFAIINMLIGYVLVAYIAIPVWYWTNLFDAKKFPLFSSNVFDSNGQVYNISRVLNK  1043
             L +P FA  N+  G+ +V YI  P+ YW N++ AK FP+FS ++F S+GQ YNIS +++ 
Sbjct  311   LASPWFATANVGAGFFIVMYILTPIMYWLNVYKAKTFPIFSEDLFTSSGQTYNISSIIDS  370

Query  1042  KTFGFDQPGYDSYSNIYLSTAFVYTYGLSFATLAATVSHVALFHGRTIWEQTKESVQDKF  863
               F  D   YD    +YLST F  TYG+ FA L AT+ HV LFHG  IWEQ+K + ++K 
Sbjct  371   N-FHLDIQAYDKNGPLYLSTFFAMTYGVGFAALTATIVHVLLFHGSEIWEQSKSAFKEKK  429

Query  862   SDIHTRLMRKNYEPVPQWWFYlllviivgvalvACQRFGGQLQLPVWGVLLAVLLSLIFT  683
              DIHTRLMR+ Y  VP+WWF  +LV  +   + AC+ +  QLQLP WGVLLA  L+++FT
Sbjct  430   MDIHTRLMRR-YNQVPEWWFVCILVANIAATIFACEYYNDQLQLPWWGVLLACGLAILFT  488

Query  682   LPVGVITATTNQQTGLNVIAELIIGYMYPGRPLASVTFKMYGlsslsqslmflSDFKLGH  503
             LP+G+ITATTNQ  GLN+I E IIGY+YPGRP+A++ FK+YG  S++Q++ FL DFKLGH
Sbjct  489   LPIGIITATTNQTPGLNIITEYIIGYLYPGRPVANICFKVYGYISMTQAVTFLQDFKLGH  548

Query  502   YMKIPPKSMFMVQLVGTLISCCVHFGTGWWLLTTVENICNPSKLPEGSQWTCPGDDVFYN  323
             YMKIPP++MFM Q+VGTLI+  V+ GTGWWL+ T+ NIC+ S LP  S WTCP D VFY+
Sbjct  549   YMKIPPRTMFMAQVVGTLIAGLVYLGTGWWLMETIPNICDTSVLPSDSPWTCPSDRVFYD  608

Query  322   ASIIWGVVSPRRMFGNLGIYQATNYFFLVGFLAPIPVWYLGRKYPEKRWVSLINMPILIS  143
             AS+IWG++ PRR+FG+LG Y+A N+FFL G +AP+ VW+  + +PE+ W+ LINMPILI 
Sbjct  609   ASVIWGLIGPRRIFGDLGTYEAINWFFLAGAVAPVLVWFAHKAFPEQNWIRLINMPILIG  668

Query  142   GAEGIPIVKSVNYVCWFAVGLYFNLYVYRKHKGWWARHNYILSAGLD  2
                 +P   +VNY  W  VG      +YR  + WW RHNY+LS  LD
Sbjct  669   ATGMMPPATAVNYTSWVIVGFLSGFLLYRYRQDWWQRHNYVLSGALD  715



>ref|XP_004245468.1| PREDICTED: oligopeptide transporter 7-like [Solanum lycopersicum]
Length=749

 Score =   745 bits (1924),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 378/703 (54%), Positives = 502/703 (71%), Gaps = 6/703 (1%)
 Frame = -1

Query  2110  RERVSSFKNSSLSRLLH*MENTGISAVESSADEINDSPVEEVRLTVPITDDPTMPCVTFR  1931
              E  S  K   LS   H + ++    V    DE  +SPVE+V LTVP TDDP++P +TFR
Sbjct  2     EESASEIKTPLLSNFDHGIASSSNVKVHKD-DEDENSPVEQVALTVPTTDDPSLPVLTFR  60

Query  1930  TWVLGVTSCVILAFLNQFFGYRQNALYVSSVPAQIVVLPMGKLMAAYLPTKVVQIPGTKW  1751
              W LG  SCV+L+FLNQFF YR   L ++++ AQI V+P+G+LMAA + TK V + G+KW
Sbjct  61    MWFLGTVSCVLLSFLNQFFWYRTEPLTITAISAQIAVVPLGQLMAAKI-TKRVFLQGSKW  119

Query  1750  SFSLNPGPFNIKEHVLITIFASSGSDFSYAVSIITMMKAFYYRDIHPLAAVLLTFSTQML  1571
              FSLNPGPFN+KEHVLITIFA+SG+   YA+ ++T +K FY +DI    ++++  +TQ+L
Sbjct  120   EFSLNPGPFNVKEHVLITIFANSGAGTVYAIHVVTAVKVFYKKDITFFVSLIVIITTQVL  179

Query  1570  GYGLAGIFKKFLIDSPYMWWPSNLVQVSLFRALHDVETRPKGGLTRLQFFIIVLVCSFAY  1391
             G+G AGIF+K+L++   MWWPSNLVQVSLFRALH+ E R KGGLTR QFFI+  +CSFAY
Sbjct  180   GFGWAGIFRKYLVEPAAMWWPSNLVQVSLFRALHEKEERCKGGLTRTQFFIVAFICSFAY  239

Query  1390  YVVPNYLFPSLTALSLLCWIWKNSVTAQQlgsglkglgigSFALDWATVAAFQGSPLVTP  1211
             Y+ P YLF  LT+LS +CWI+  SV AQQLGSGLKGLGIG+  LDW++++++ GSPL +P
Sbjct  240   YIFPGYLFSMLTSLSWICWIFPKSVFAQQLGSGLKGLGIGAIGLDWSSISSYLGSPLASP  299

Query  1210  DFAIINMLIGYVLVAYIAIPVWYWTNLFDAKKFPLFSSNVFDSNGQVYNISRVLNKKTFG  1031
              FA  N+  G++ V Y+  P+ YW ++F AK FP+FS  +F SNGQVYNIS +++   F 
Sbjct  300   WFATANVAAGFIFVMYVLTPICYWLDIFKAKTFPIFSDEMFTSNGQVYNISSIIDSN-FH  358

Query  1030  FDQPGYDSYSNIYLSTAFVYTYGLSFATLAATVSHVALFHGRTIWEQTKESVQDKFSDIH  851
              D   Y+   ++YLST F  TYG+ FA L+ATV HV LFHGR IWEQ+K S +D+  DIH
Sbjct  359   LDVDAYERQGHLYLSTFFAVTYGVGFAALSATVMHVLLFHGREIWEQSKSSFKDQKMDIH  418

Query  850   TRLMRKNYEPVPQWWFYlllviivgvalvACQRFGGQLQLPVWGVLLAVLLSLIFTLPVG  671
             TRLM K Y  VP+WWF+ +LV  + + + AC+ +  QLQLP WGV+LA +++  FTLP+G
Sbjct  419   TRLMSK-YNQVPEWWFWCILVANITLTIFACEYYNEQLQLPWWGVILACVIAFFFTLPIG  477

Query  670   VITATTNQQTGLNVIAELIIGYMYPGRPLASVTFKMYGlsslsqslmflSDFKLGHYMKI  491
             +ITA TNQ  GLNVI E IIGY+YPG P+A++ FK+YG  S++Q++ FL DFKLGHYMKI
Sbjct  478   IITAITNQTPGLNVITEYIIGYLYPGYPVANMCFKVYGYISMTQAITFLQDFKLGHYMKI  537

Query  490   PPKSMFMVQLVGTLISCCVHFGTGWWLLTTVENICNPSKLPEGSQWTCPGDDVFYNASII  311
             PP+ MFM Q+VGTLI+  V+ GT WWL+ T+ +IC+  K    + WTCP D VFY+AS+I
Sbjct  538   PPRIMFMAQVVGTLIAGFVYLGTAWWLMETIPDICD--KTLSNTVWTCPSDHVFYDASVI  595

Query  310   WGVVSPRRMFGNLGIYQATNYFFLVGFLAPIPVWYLGRKYPEKRWVSLINMPILISGAEG  131
             WG+++PRR+FG+LG Y   N+FFL G +AP+ VW   R +P++ W+ LINMP+LI     
Sbjct  596   WGLIAPRRIFGDLGTYGMVNWFFLFGAIAPVLVWLAARAFPKQEWIKLINMPVLIGATGM  655

Query  130   IPIVKSVNYVCWFAVGLYFNLYVYRKHKGWWARHNYILSAGLD  2
             +P   +VNY  W  VG      VYR    WW RHNY+LS  LD
Sbjct  656   MPPATAVNYTTWIIVGFLSGFVVYRYRPDWWQRHNYVLSGALD  698



>ref|XP_009765351.1| PREDICTED: oligopeptide transporter 7-like [Nicotiana sylvestris]
Length=757

 Score =   744 bits (1920),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 377/710 (53%), Positives = 507/710 (71%), Gaps = 12/710 (2%)
 Frame = -1

Query  2110  RERVSSFKNSSLSRLLH*MENTGISAVESS-------ADEINDSPVEEVRLTVPITDDPT  1952
              E  S  K   LS L H + ++  S V  S        DE  +SP+++V LTVPITDDP+
Sbjct  2     EESASEIKTPLLSNLDHGIASSSKSKVNDSLELKKQEEDEEENSPIKQVALTVPITDDPS  61

Query  1951  MPCVTFRTWVLGVTSCVILAFLNQFFGYRQNALYVSSVPAQIVVLPMGKLMAAYLPTKVV  1772
             +P +TFR W LG  SCV+L+FLNQFF YR   L ++++ AQI V+P+G+LMAA + TK V
Sbjct  62    LPVLTFRMWFLGTVSCVLLSFLNQFFWYRTEPLTITAISAQIAVVPLGQLMAAKI-TKRV  120

Query  1771  QIPGTKWSFSLNPGPFNIKEHVLITIFASSGSDFSYAVSIITMMKAFYYRDIHPLAAVLL  1592
                G+KW F+LNPGPFN+KEHVLITIFA+SG+   YA+ ++T +K FY ++I    ++++
Sbjct  121   FFQGSKWEFTLNPGPFNVKEHVLITIFANSGAGTVYAIHVVTAVKVFYQKNITFFVSLIV  180

Query  1591  TFSTQMLGYGLAGIFKKFLIDSPYMWWPSNLVQVSLFRALHDVETRPKGGLTRLQFFIIV  1412
               +TQ+LG+G AGIF+++L++   MWWP+NLVQVSLFRALH+ E R KGGLTR QFF+I 
Sbjct  181   VITTQVLGFGWAGIFRRYLVEPAAMWWPANLVQVSLFRALHEKEERSKGGLTRTQFFLIA  240

Query  1411  LVCSFAYYVVPNYLFPSLTALSLLCWIWKNSVTAQQlgsglkglgigSFALDWATVAAFQ  1232
              +CSFAYYV P YLF  LT+LS +CWI+  SV  QQLGSGL GLGIG+  LDW++++++ 
Sbjct  241   FICSFAYYVFPGYLFSMLTSLSWICWIFPKSVFVQQLGSGLNGLGIGAIGLDWSSISSYL  300

Query  1231  GSPLVTPDFAIINMLIGYVLVAYIAIPVWYWTNLFDAKKFPLFSSNVFDSNGQVYNISRV  1052
             GSPL +P FA  N+ +G+  + YI  P+ YW ++F AK FP+FSS +F S+GQVYNIS +
Sbjct  301   GSPLASPWFATANVAVGFFFIMYILTPICYWLDVFKAKTFPIFSSGLFTSSGQVYNISSI  360

Query  1051  LNKKTFGFDQPGYDSYSNIYLSTAFVYTYGLSFATLAATVSHVALFHGRTIWEQTKESVQ  872
             ++   F  D   Y+   ++YLST FV TYG+ FA L+ATV HV LFHGR IWEQ+K S +
Sbjct  361   IDSN-FHLDIAAYEQQGHLYLSTFFVITYGVGFAALSATVMHVLLFHGREIWEQSKSSFK  419

Query  871   DKFSDIHTRLMRKNYEPVPQWWFYlllviivgvalvACQRFGGQLQLPVWGVLLAVLLSL  692
             +K +DIHTRLM K Y  VP+WWF+ +LV  + + + AC+ +  QLQLP WGV+LA ++++
Sbjct  420   EKKTDIHTRLMSK-YNQVPEWWFWCILVANITLTVFACEYYNEQLQLPWWGVILACVIAI  478

Query  691   IFTLPVGVITATTNQQTGLNVIAELIIGYMYPGRPLASVTFKMYGlsslsqslmflSDFK  512
              FTLP+GVITA TNQ  GLNVI E IIGY+YPG P+A++ FK+YG  S++Q++ FL DFK
Sbjct  479   FFTLPIGVITAITNQTPGLNVITEYIIGYLYPGYPVANMCFKVYGYISMNQAITFLQDFK  538

Query  511   LGHYMKIPPKSMFMVQLVGTLISCCVHFGTGWWLLTTVENICNPSKLPEGSQWTCPGDDV  332
             LGHYMKIPP++MFM Q+VGTLI+  V+ GT WWL+ T+ +IC   K    + WTCP D V
Sbjct  539   LGHYMKIPPRTMFMAQVVGTLIAGFVYLGTAWWLMETIPDIC--IKTLSNTVWTCPSDHV  596

Query  331   FYNASIIWGVVSPRRMFGNLGIYQATNYFFLVGFLAPIPVWYLGRKYPEKRWVSLINMPI  152
             FY+AS+IWG+++PRR+FG+LG Y   N+FFL G +AP+ VW   R +P++ W+ LINMP+
Sbjct  597   FYDASVIWGLIAPRRIFGDLGTYGMVNWFFLFGAIAPVVVWLAARAFPKQEWIKLINMPV  656

Query  151   LISGAEGIPIVKSVNYVCWFAVGLYFNLYVYRKHKGWWARHNYILSAGLD  2
             LI     +P   +VNY  W  VG      VYR    WW RHNY+LS  LD
Sbjct  657   LIGATGMMPPATAVNYTTWIIVGFLSGYVVYRYRPDWWQRHNYVLSGALD  706



>gb|KDP46770.1| hypothetical protein JCGZ_06558 [Jatropha curcas]
Length=748

 Score =   741 bits (1914),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 369/679 (54%), Positives = 488/679 (72%), Gaps = 3/679 (0%)
 Frame = -1

Query  2038  SAVESSADEINDSPVEEVRLTVPITDDPTMPCVTFRTWVLGVTSCVILAFLNQFFGYRQN  1859
             ++ ++  +E  +SP+E+V LTV   DD T+P VTFRTW LG  +C++L+FLNQFF YR+ 
Sbjct  23    NSADNDDNEKENSPIEQVALTVSTADDQTLPTVTFRTWTLGTLACIVLSFLNQFFWYRRE  82

Query  1858  ALYVSSVPAQIVVLPMGKLMAAYLPTKVVQIPGTKWSFSLNPGPFNIKEHVLITIFASSG  1679
              L ++S+ AQIVV+P+G LMA+ +  KV    GT+W FSLN GPFN+KEHVLITIFA+SG
Sbjct  83    PLTITSISAQIVVVPLGHLMASIITDKVF-FKGTRWEFSLNRGPFNVKEHVLITIFANSG  141

Query  1678  SDFSYAVSIITMMKAFYYRDIHPLAAVLLTFSTQMLGYGLAGIFKKFLIDSPYMWWPSNL  1499
             +   YAV II+ +K FY +++  L A  +  +TQ+LG+G AG+F+++L++   MWWP NL
Sbjct  142   AGSVYAVHIISAVKIFYKKELSFLMAFFIVITTQVLGFGWAGVFRRYLVEPAAMWWPQNL  201

Query  1498  VQVSLFRALHDVETRPKGGLTRLQFFIIVLVCSFAYYVVPNYLFPSLTALSLLCWIWKNS  1319
             VQVSLFRALH+ E RPKGGLTR QFFII L+CSFAYYV P YL P L++LS +CWI+  S
Sbjct  202   VQVSLFRALHEKEERPKGGLTRNQFFIIALICSFAYYVFPGYLLPKLSSLSWICWIFPTS  261

Query  1318  VTAQQlgsglkglgigSFALDWATVAAFQGSPLVTPDFAIINMLIGYVLVAYIAIPVWYW  1139
             + A QLGSGL GLGIGS   DWA+++++ GSP+ TP FA  N+  G+ L+ Y+  P+ YW
Sbjct  262   ILAHQLGSGLHGLGIGSIGFDWASISSYLGSPMATPWFATANVACGFALIMYVITPISYW  321

Query  1138  TNLFDAKKFPLFSSNVFDSNGQVYNISRVLNKKTFGFDQPGYDSYSNIYLSTAFVYTYGL  959
              N + AK FP+FS  +F SNGQ YNIS +++ K F  D   Y+    +YLST F   YGL
Sbjct  322   HNFYKAKTFPIFSDGLFTSNGQKYNISAIIDPK-FHIDIDAYEREGPLYLSTNFAMIYGL  380

Query  958   SFATLAATVSHVALFHGRTIWEQTKESVQDKFSDIHTRLMRKNYEPVPQWWFYlllviiv  779
             +FATLAA + HV LFHGR++W  +K + Q+K  D+HTRLMRK Y+ VP+WWF  +L+  +
Sbjct  381   NFATLAAVIVHVFLFHGRSLWHLSKSAFQEKKMDVHTRLMRK-YKQVPEWWFLCILLFNI  439

Query  778   gvalvACQRFGGQLQLPVWGVLLAVLLSLIFTLPVGVITATTNQQTGLNVIAELIIGYMY  599
                +  C+ +  QLQLP WGVLLA  L+  FTLP+G+ITATTNQ  GLNVI E IIGY+Y
Sbjct  440   AATIFICEYYNDQLQLPWWGVLLACGLAFFFTLPIGIITATTNQTPGLNVITEYIIGYLY  499

Query  598   PGRPLASVTFKMYGlsslsqslmflSDFKLGHYMKIPPKSMFMVQLVGTLISCCVHFGTG  419
             PG P+A++ FK+YG  S+ Q + FL DFKLGHYMKIPP++MFM Q+VGT+I+  VH  T 
Sbjct  500   PGFPVANMCFKVYGYISMKQGITFLQDFKLGHYMKIPPRAMFMAQVVGTIIAAIVHLLTA  559

Query  418   WWLLTTVENICNPSKLPEGSQWTCPGDDVFYNASIIWGVVSPRRMFGNLGIYQATNYFFL  239
             WWL+ TV NIC+ + LP GS WTCPGD VFY+AS+IWG++ PRR+FG LG Y A N+FFL
Sbjct  560   WWLMETVPNICDRAVLPSGSPWTCPGDHVFYDASVIWGLIGPRRIFGGLGHYSAINWFFL  619

Query  238   VGFLAPIPVWYLGRKYPEKRWVSLINMPILISGAEGIPIVKSVNYVCWFAVGLYFNLYVY  59
              G +API VW   + +P + W+ LI+MP+L+ G   +P   +VNYV W  +G       Y
Sbjct  620   AGAIAPILVWLAHKAFPNQHWIKLISMPVLLGGTLQMPPATAVNYVTWILIGFCSGFIAY  679

Query  58    RKHKGWWARHNYILSAGLD  2
             R +  WW RHNY+ SAGLD
Sbjct  680   RYYNNWWRRHNYVFSAGLD  698



>ref|XP_007208018.1| hypothetical protein PRUPE_ppa003195mg [Prunus persica]
 gb|EMJ09217.1| hypothetical protein PRUPE_ppa003195mg [Prunus persica]
Length=594

 Score =   735 bits (1898),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 359/542 (66%), Positives = 449/542 (83%), Gaps = 3/542 (1%)
 Frame = -1

Query  1618  IHPLAAVLLTFSTQMLGYGLAGIFKKFLIDSPYMWWPSNLVQVSLFRALHDVETRPKGGL  1439
             +HP AA LL  +TQMLGYG AGIF+K+L+DSPYMWWPSNLVQVSLFRALH+ E RPKGG 
Sbjct  1     MHPAAAFLLAQTTQMLGYGWAGIFRKYLVDSPYMWWPSNLVQVSLFRALHEKEKRPKGGR  60

Query  1438  TRLQFFIIVLVCSFAYYVVPNYLFPSLTALSLLCWIWKNSVTAQQlgsglkglgigSFAL  1259
             TRLQFF +V +CSF+YY+VP++LFPS++A S +CWIWK+S+TAQQ+GSG+ GLGIGSF +
Sbjct  61    TRLQFFFMVFICSFSYYIVPSFLFPSISAFSFVCWIWKDSITAQQIGSGMHGLGIGSFGI  120

Query  1258  DWATVAAFQGSPLVTPDFAIINMLIGYVLVAYIAIPVWYWTNLFDAKKFPLFSSNVFDSN  1079
             DW+TVA F GSPL TP FA IN+LIG+VL+ Y+  P+ YW N +DA+KFP+FSS+ FDS 
Sbjct  121   DWSTVAGFLGSPLATPGFATINILIGFVLIVYVVTPIAYWNNAYDARKFPIFSSHTFDST  180

Query  1078  GQVYNISRVLNKKTFGFDQPGYDSYSNIYLSTAFVYTYGLSFATLAATVSHVALFHGRTI  899
             GQ+YNIS VL++K F  D   Y  YS +YLST F ++YGLSFATL AT+SHV LFHGRTI
Sbjct  181   GQIYNISSVLDQKNFDIDMVRYTGYSKLYLSTFFAFSYGLSFATLTATISHVGLFHGRTI  240

Query  898   WE---QTKESVQDKFSDIHTRLMRKNYEPVPQWWFYlllviivgvalvACQRFGGQLQLP  728
             W+   +T  +V+D+  DIHTRLM+KNYE VPQWWF+++LV++V +A+  C+ FG QLQLP
Sbjct  241   WQMWKKTTSAVRDQIGDIHTRLMKKNYEAVPQWWFHIILVLMVALAIFCCEGFGQQLQLP  300

Query  727   VWGVLLAVLLSLIFTLPVGVITATTNQQTGLNVIAELIIGYMYPGRPLASVTFKMYGlss  548
              WGVL+A  ++L FTLP+G+I ATTNQQ GLNVI EL+IGY+YPG+PLA+V FK YG  S
Sbjct  301   WWGVLMACGIALFFTLPIGIIQATTNQQPGLNVITELVIGYIYPGKPLANVAFKTYGYIS  360

Query  547   lsqslmflSDFKLGHYMKIPPKSMFMVQLVGTLISCCVHFGTGWWLLTTVENICNPSKLP  368
             +SQ+LMFL DFKLGHYMKIPPKSMF+VQLVGT+++  V+FGT WWLLTT+E+IC+PSKLP
Sbjct  361   MSQALMFLQDFKLGHYMKIPPKSMFVVQLVGTIVASSVYFGTSWWLLTTIEHICDPSKLP  420

Query  367   EGSQWTCPGDDVFYNASIIWGVVSPRRMFGNLGIYQATNYFFLVGFLAPIPVWYLGRKYP  188
             EGS WTCPGDDVFYNASIIWGV+ P RMF + G+Y   N+FFL+G LAP+PVW L +++P
Sbjct  421   EGSPWTCPGDDVFYNASIIWGVIGPLRMFTDKGVYPELNWFFLIGLLAPVPVWLLSKQFP  480

Query  187   EKRWVSLINMPILISGAEGIPIVKSVNYVCWFAVGLYFNLYVYRKHKGWWARHNYILSAG  8
              +RW+ LINMPI++     +P  ++VNY+ W AVG++FN YVYRK+KGWWARHNYILSA 
Sbjct  481   NQRWIKLINMPIILGATGYMPPARAVNYLAWLAVGIFFNFYVYRKYKGWWARHNYILSAA  540

Query  7     LD  2
             LD
Sbjct  541   LD  542



>ref|XP_009608843.1| PREDICTED: oligopeptide transporter 7-like [Nicotiana tomentosiformis]
Length=757

 Score =   741 bits (1912),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 373/710 (53%), Positives = 507/710 (71%), Gaps = 12/710 (2%)
 Frame = -1

Query  2110  RERVSSFKNSSLSRLLH*MENTGISAVESS-------ADEINDSPVEEVRLTVPITDDPT  1952
              E     K   LS L H + ++  S V  S        DE  +SP+++V LTVPITDDP+
Sbjct  2     EESALEIKTPLLSNLDHGIASSSKSKVNDSLELKKQEEDEEENSPIKQVALTVPITDDPS  61

Query  1951  MPCVTFRTWVLGVTSCVILAFLNQFFGYRQNALYVSSVPAQIVVLPMGKLMAAYLPTKVV  1772
             +P +TFR W LG  SCV+L+FLNQFF YR   L ++++ AQI V+P+G+LMAA + TK V
Sbjct  62    LPVLTFRMWFLGTLSCVLLSFLNQFFWYRTEPLTITAISAQIAVVPLGQLMAAKI-TKRV  120

Query  1771  QIPGTKWSFSLNPGPFNIKEHVLITIFASSGSDFSYAVSIITMMKAFYYRDIHPLAAVLL  1592
                G+KW F+LNPGPFN+KEHVLITIFA+SG+   YA+ ++T +K FY ++I    ++++
Sbjct  121   FFQGSKWEFTLNPGPFNVKEHVLITIFANSGAGTVYAIHVVTAVKVFYQKNITFFVSLIV  180

Query  1591  TFSTQMLGYGLAGIFKKFLIDSPYMWWPSNLVQVSLFRALHDVETRPKGGLTRLQFFIIV  1412
               +TQ+LG+G AGIF+++L++   MWWP+NLVQVSLFRALH+ E RPK GLTR QFF+I 
Sbjct  181   VITTQVLGFGWAGIFRRYLVEPAAMWWPANLVQVSLFRALHEKEERPKCGLTRTQFFLIA  240

Query  1411  LVCSFAYYVVPNYLFPSLTALSLLCWIWKNSVTAQQlgsglkglgigSFALDWATVAAFQ  1232
              +CSFAYYV P YLF  LT+LS +CWI+  SV AQQLGSGL GLGIG+  LDW++++++ 
Sbjct  241   FICSFAYYVFPGYLFSMLTSLSWICWIFPKSVFAQQLGSGLNGLGIGAIGLDWSSISSYL  300

Query  1231  GSPLVTPDFAIINMLIGYVLVAYIAIPVWYWTNLFDAKKFPLFSSNVFDSNGQVYNISRV  1052
             GSPL +P FA  N+ +G+  + YI  P+ YW ++F AK FP+FS  +F S+GQVYNIS +
Sbjct  301   GSPLASPWFATANVAVGFFFIMYILTPICYWLDVFKAKTFPIFSDGLFTSSGQVYNISSI  360

Query  1051  LNKKTFGFDQPGYDSYSNIYLSTAFVYTYGLSFATLAATVSHVALFHGRTIWEQTKESVQ  872
             ++   F  D   Y+   ++YLST FV TYG+ FA L+ATV HV +FHGR IWEQ+K S +
Sbjct  361   IDSN-FHLDIAAYEQQGHLYLSTFFVITYGVGFAALSATVMHVLIFHGREIWEQSKSSFK  419

Query  871   DKFSDIHTRLMRKNYEPVPQWWFYlllviivgvalvACQRFGGQLQLPVWGVLLAVLLSL  692
             +K  DIHT+LM K Y  VP+WWF+ +LV  + + + AC+ +  QLQLP WGV+LA ++++
Sbjct  420   EKKMDIHTKLMSK-YNQVPEWWFWCILVANITLTVFACEYYNEQLQLPWWGVILACVIAI  478

Query  691   IFTLPVGVITATTNQQTGLNVIAELIIGYMYPGRPLASVTFKMYGlsslsqslmflSDFK  512
              FTLP+G+ITA TNQ  GLN+I E IIGY+YPG P+A++ FK+YG  S++Q++ FL DFK
Sbjct  479   FFTLPIGIITAITNQTPGLNIITEYIIGYLYPGYPVANMCFKVYGYISMNQAITFLQDFK  538

Query  511   LGHYMKIPPKSMFMVQLVGTLISCCVHFGTGWWLLTTVENICNPSKLPEGSQWTCPGDDV  332
             LGHYMKIPP++MFM Q+VGTLI+  V+ GT WWL+ T+ +ICN  K    + WTCP D V
Sbjct  539   LGHYMKIPPRTMFMAQIVGTLIAGFVYLGTAWWLMETIPDICN--KTLSNTVWTCPSDHV  596

Query  331   FYNASIIWGVVSPRRMFGNLGIYQATNYFFLVGFLAPIPVWYLGRKYPEKRWVSLINMPI  152
             FY+AS+IWG+++PRR+FG+LG Y+  N+FFL G +AP+ VW   R +P++ W+ LINMP+
Sbjct  597   FYDASVIWGLIAPRRIFGDLGTYEMVNWFFLFGAIAPVLVWLAARAFPKQEWIKLINMPV  656

Query  151   LISGAEGIPIVKSVNYVCWFAVGLYFNLYVYRKHKGWWARHNYILSAGLD  2
             LI     +P   +VNY  W  VG      VYR    WW RHNY+LS  LD
Sbjct  657   LIGATGMMPPATAVNYATWIIVGFLSGYVVYRYRPDWWQRHNYVLSGALD  706



>ref|XP_010246854.1| PREDICTED: oligopeptide transporter 7-like [Nelumbo nucifera]
Length=757

 Score =   740 bits (1911),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 363/670 (54%), Positives = 488/670 (73%), Gaps = 3/670 (0%)
 Frame = -1

Query  2011  INDSPVEEVRLTVPITDDPTMPCVTFRTWVLGVTSCVILAFLNQFFGYRQNALYVSSVPA  1832
             +++SP+E+V LTVPITDDPT+P +TFR WVLG  +C +L+FLNQFF YR+  L ++S+ A
Sbjct  41    VDNSPIEQVALTVPITDDPTLPILTFRMWVLGTLACALLSFLNQFFWYRKEPLSITSISA  100

Query  1831  QIVVLPMGKLMAAYLPTKVVQIPGTKWSFSLNPGPFNIKEHVLITIFASSGSDFSYAVSI  1652
             QI V+P+G LMA+ +  +V     ++W F+LNPGPFNIKEHVLITIFA+SG+   YA+ I
Sbjct  101   QIAVVPLGHLMASTITDRVF-FKKSRWEFTLNPGPFNIKEHVLITIFANSGAGNVYAIHI  159

Query  1651  ITMMKAFYYRDIHPLAAVLLTFSTQMLGYGLAGIFKKFLIDSPYMWWPSNLVQVSLFRAL  1472
             ++ +K FY +++  L ++L+  ++Q+LG+G AG+F+++L++   MWWP NLVQVSLFRAL
Sbjct  160   VSAVKLFYKKNLTFLVSLLVVITSQVLGFGWAGLFRRYLVEPAAMWWPHNLVQVSLFRAL  219

Query  1471  HDVETRPKGGLTRLQFFIIVLVCSFAYYVVPNYLFPSLTALSLLCWIWKNSVTAQQlgsg  1292
             H+ E +PKGGLTR QFF++  +CSFAYYV P YLFP LT+LS +CWI+  S+ AQQLGSG
Sbjct  220   HEKEQKPKGGLTRNQFFLVAFMCSFAYYVFPGYLFPMLTSLSWICWIFPASILAQQLGSG  279

Query  1291  lkglgigSFALDWATVAAFQGSPLVTPDFAIINMLIGYVLVAYIAIPVWYWTNLFDAKKF  1112
             L GLG+G+   DW++++++ GSPL +P FA  N+ +G+VL+ Y+  P+ YW NL+ +K F
Sbjct  280   LHGLGLGALGFDWSSISSYLGSPLASPWFATANVAMGFVLITYVITPIAYWLNLYKSKSF  339

Query  1111  PLFSSNVFDSNGQVYNISRVLNKKTFGFDQPGYDSYSNIYLSTAFVYTYGLSFATLAATV  932
             P+FS N+F S GQ YNIS +++   F  D   Y+    +YLS  F  TYG+ FA L ATV
Sbjct  340   PVFSDNLFTSTGQRYNISAIIDPN-FQLDIKAYEREGPLYLSAFFTMTYGVGFACLTATV  398

Query  931   SHVALFHGRTIWEQTKESVQDKFSDIHTRLMRKNYEPVPQWWFYlllviivgvalvACQR  752
              HV LFHGR IW+ +K + Q++  DIHTRLM K Y+ VPQWWF  LL + +   +  CQ 
Sbjct  399   VHVFLFHGREIWQLSKSAFQEQGMDIHTRLMMK-YKQVPQWWFICLLCLNIAATIFTCQY  457

Query  751   FGGQLQLPVWGVLLAVLLSLIFTLPVGVITATTNQQTGLNVIAELIIGYMYPGRPLASVT  572
             +  QLQLP WGVLLA  L++ FTLP+GVITATTNQ   LNVI E IIGY+YPGRP+A++ 
Sbjct  458   YNDQLQLPWWGVLLACALAIFFTLPIGVITATTNQTPALNVITEYIIGYLYPGRPVANIC  517

Query  571   FKMYGlsslsqslmflSDFKLGHYMKIPPKSMFMVQLVGTLISCCVHFGTGWWLLTTVEN  392
             FK+YG  S+ Q + FL DFKLGHYMKIPP+ MFM Q+VGTL+S  VH GT WWL+ ++ N
Sbjct  518   FKVYGNISMKQGITFLQDFKLGHYMKIPPRDMFMAQVVGTLVSAVVHLGTAWWLMGSIPN  577

Query  391   ICNPSKLPEGSQWTCPGDDVFYNASIIWGVVSPRRMFGNLGIYQATNYFFLVGFLAPIPV  212
             IC+ + LP GS WTCP D VFY+AS+IWG++ PRR+FG+LG Y A N+FFLVG +API V
Sbjct  578   ICDRALLPAGSPWTCPSDHVFYDASVIWGLIGPRRIFGDLGHYSAINWFFLVGAVAPILV  637

Query  211   WYLGRKYPEKRWVSLINMPILISGAEGIPIVKSVNYVCWFAVGLYFNLYVYRKHKGWWAR  32
             W   + +P + W+ LI MP+L+     +P   +VNY  W  +G      VYR H+ WW R
Sbjct  638   WVAHKAFPHRHWIKLITMPVLLGATASMPPATAVNYTSWIVIGFVSGFIVYRYHRDWWRR  697

Query  31    HNYILSAGLD  2
             HNY+LS  LD
Sbjct  698   HNYVLSGALD  707



>ref|XP_006851884.1| hypothetical protein AMTR_s00041p00121000 [Amborella trichopoda]
 gb|ERN13351.1| hypothetical protein AMTR_s00041p00121000 [Amborella trichopoda]
Length=734

 Score =   739 bits (1909),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 370/679 (54%), Positives = 493/679 (73%), Gaps = 3/679 (0%)
 Frame = -1

Query  2038  SAVESSADEINDSPVEEVRLTVPITDDPTMPCVTFRTWVLGVTSCVILAFLNQFFGYRQN  1859
             + +E       +SP+E+V LTVP+TDDP++P +TFR W LG  SCV+L+FLNQFF YR  
Sbjct  9     TTIEEPNTSPENSPIEQVALTVPVTDDPSLPVLTFRMWFLGGLSCVVLSFLNQFFWYRTE  68

Query  1858  ALYVSSVPAQIVVLPMGKLMAAYLPTKVVQIPGTKWSFSLNPGPFNIKEHVLITIFASSG  1679
              L ++SV AQI V+P+G LMAA LPT+     G +W F+LNPGPFN+KEHVLITIFA+SG
Sbjct  69    PLSITSVSAQIAVVPLGHLMAAVLPTRPF-FKGKRWEFTLNPGPFNVKEHVLITIFANSG  127

Query  1678  SDFSYAVSIITMMKAFYYRDIHPLAAVLLTFSTQMLGYGLAGIFKKFLIDSPYMWWPSNL  1499
             +   YA+ I++ +K FY   +    A L+  +TQ+LG+G AGIF+K+L++   MWWP NL
Sbjct  128   AGSVYAIHIVSAVKIFYKETLSFFVAFLVVITTQVLGFGWAGIFRKYLVEPAAMWWPYNL  187

Query  1498  VQVSLFRALHDVETRPKGGLTRLQFFIIVLVCSFAYYVVPNYLFPSLTALSLLCWIWKNS  1319
             VQVSLF ALH+ E R KG LTR QFF+I L+CSFAYYV+P YLFP LT+LS +CWI+  S
Sbjct  188   VQVSLFGALHEKEERRKGSLTRNQFFLIALMCSFAYYVLPGYLFPMLTSLSWICWIFPKS  247

Query  1318  VTAQQlgsglkglgigSFALDWATVAAFQGSPLVTPDFAIINMLIGYVLVAYIAIPVWYW  1139
             V AQQLGSGL GLG+G+  LDW+T++++ GSPL +P FA  N+  G+ +V Y+  P+ YW
Sbjct  248   VLAQQLGSGLYGLGLGAIGLDWSTISSYLGSPLASPWFATANVAAGFFIVMYVITPLSYW  307

Query  1138  TNLFDAKKFPLFSSNVFDSNGQVYNISRVLNKKTFGFDQPGYDSYSNIYLSTAFVYTYGL  959
              +L+ AK+FP+FS ++F  +GQ YNI+ +++   F  D   Y+    +YLST F  TYG+
Sbjct  308   LDLYHAKRFPIFSEDLFTYSGQEYNITAIIDSN-FNIDLEAYEKEGKLYLSTFFAMTYGV  366

Query  958   SFATLAATVSHVALFHGRTIWEQTKESVQDKFSDIHTRLMRKNYEPVPQWWFYlllviiv  779
              FA+L+ATV HVALFHGR IW+ +K + Q+K  DIHTRLM K Y+ VP+WWF  +L+I +
Sbjct  367   GFASLSATVVHVALFHGREIWQLSKSAFQEKKMDIHTRLMSK-YKQVPEWWFITILIINI  425

Query  778   gvalvACQRFGGQLQLPVWGVLLAVLLSLIFTLPVGVITATTNQQTGLNVIAELIIGYMY  599
                + AC+ +  QLQLP WGVLLA  +++ FTLP+G+ITATTNQQ GLN+I E IIGY+Y
Sbjct  426   AATIFACEYYNAQLQLPWWGVLLACGIAISFTLPIGIITATTNQQPGLNIITEYIIGYLY  485

Query  598   PGRPLASVTFKMYGlsslsqslmflSDFKLGHYMKIPPKSMFMVQLVGTLISCCVHFGTG  419
             PGRP+A++ FK+YG  S++Q++ FL DFKLGHYMKIPP++MFM Q+VGTLI+  V+ GT 
Sbjct  486   PGRPVANICFKVYGYISMTQAVTFLQDFKLGHYMKIPPRAMFMAQIVGTLIAAMVYLGTA  545

Query  418   WWLLTTVENICNPSKLPEGSQWTCPGDDVFYNASIIWGVVSPRRMFGNLGIYQATNYFFL  239
             WWL+  + NIC+ S L   S WTCP D VFY+AS+IWG++ PRR+FG+LG Y A N+FFL
Sbjct  546   WWLMNAIPNICDTSVLSSDSPWTCPMDRVFYDASVIWGLIGPRRIFGDLGTYSAINWFFL  605

Query  238   VGFLAPIPVWYLGRKYPEKRWVSLINMPILISGAEGIPIVKSVNYVCWFAVGLYFNLYVY  59
              G +AP+ VW   R +P+K W+ LINMP+LI     +P    VNY  W  +G  F+  VY
Sbjct  606   GGAIAPLLVWLAHRAFPDKEWIRLINMPVLIGATSMMPPATVVNYTSWILMGFIFSFVVY  665

Query  58    RKHKGWWARHNYILSAGLD  2
             R  + WW RHNY+LS  LD
Sbjct  666   RYKRDWWTRHNYVLSGALD  684



>ref|XP_010436760.1| PREDICTED: oligopeptide transporter 7-like [Camelina sativa]
Length=766

 Score =   738 bits (1904),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 362/675 (54%), Positives = 498/675 (74%), Gaps = 6/675 (1%)
 Frame = -1

Query  2026  SSADEINDSPVEEVRLTVPITDDPTMPCVTFRTWVLGVTSCVILAFLNQFFGYRQNALYV  1847
             S  +E  +SP+ +V LTVP TDDP++P +TFR WVLG  SC++L+FLNQFF YR   L +
Sbjct  47    SGEEEEENSPIRQVALTVPTTDDPSLPVLTFRMWVLGTLSCILLSFLNQFFWYRTEPLTI  106

Query  1846  SSVPAQIVVLPMGKLMAAYLPTKVVQIPGTKWSFSLNPGPFNIKEHVLITIFASSGSDFS  1667
             S++ AQI V+P+G+LMAA +  +V    G+KW F+LNPGPFN+KEHVLITIFA++G+   
Sbjct  107   SAISAQIAVVPLGRLMAAKISERV-YFQGSKWQFTLNPGPFNVKEHVLITIFANAGAGSV  165

Query  1666  YAVSIITMMKAFYYRDIHPLAAVLLTFSTQMLGYGLAGIFKKFLIDSPYMWWPSNLVQVS  1487
             YA+ ++T++KAFY ++I    + L+  +TQ+LG+G AGIF+K+L++   MWWP+NLVQVS
Sbjct  166   YAIHVVTVVKAFYMKNITFFVSFLVIVTTQVLGFGWAGIFRKYLVEPAAMWWPANLVQVS  225

Query  1486  LFRALHDVETRPKGGLTRLQFFIIVLVCSFAYYVVPNYLFPSLTALSLLCWIWKNSVTAQ  1307
             LFRALH+ E R KGGLTR QFF+I  VCSFAYYV P YLF  +T+LS +CW + +SV AQ
Sbjct  226   LFRALHEKEERTKGGLTRTQFFVIAFVCSFAYYVFPGYLFQIMTSLSWVCWCFPSSVIAQ  285

Query  1306  QlgsglkglgigSFALDWATVAAFQGSPLVTPDFAIINMLIGYVLVAYIAIPVWYWTNLF  1127
             Q+GSGL GLG+G+  LDW+T++++ GSPL +P FA  N+ +G+VLV Y+ +P+ YW ++F
Sbjct  286   QIGSGLHGLGVGAIGLDWSTISSYLGSPLASPWFATANVGVGFVLVIYVLVPICYWLDVF  345

Query  1126  DAKKFPLFSSNVFDSNGQVYNISRVLNKKTFGFDQPGYDSYSNIYLSTAFVYTYGLSFAT  947
              AK FP+FSS++F + G  YNI+ +++   F  D P Y+    +YLST F  +YG+ FA 
Sbjct  346   KAKTFPIFSSSLFTNQGSKYNITSIIDSN-FHLDLPAYEREGPLYLSTFFAISYGVGFAA  404

Query  946   LAATVSHVALFHGRTIWEQTKESVQDKFSDIHTRLMRKNYEPVPQWWFYlllviivgval  767
             L+AT+ HVALFHGR IWEQ++ES+++K  DIH RLM++ Y+ VP+WWF+ +LV  +G  +
Sbjct  405   LSATIVHVALFHGREIWEQSRESLKEKKMDIHARLMQR-YKQVPEWWFWCILVTNIGATI  463

Query  766   vACQRFGGQLQLPVWGVLLAVLLSLIFTLPVGVITATTNQQTGLNVIAELIIGYMYPGRP  587
              +C+ +  QLQLP WGVLLA  +++IFTLP+G+ITA TNQ  GLN+I E IIGY+YPG P
Sbjct  464   FSCEYYKDQLQLPWWGVLLACTIAIIFTLPIGIITAITNQAPGLNIITEYIIGYIYPGYP  523

Query  586   LASVTFKMYGlsslsqslmflSDFKLGHYMKIPPKSMFMVQLVGTLISCCVHFGTGWWLL  407
             +A++ FK+YG  S+ Q++ FL DFKLGHYMKIPP++MFM Q+VGTLISC V+  T WWL+
Sbjct  524   VANMCFKVYGYISMRQAITFLQDFKLGHYMKIPPRTMFMAQIVGTLISCLVYLTTAWWLM  583

Query  406   TTVENICNPSKLPEGSQWTCPGDDVFYNASIIWGVVSPRRMFGNLGIYQATNYFFLVGFL  227
              T+ NIC+       S WTCP D VFY+AS+IWG++ PRR+FG+LG+Y++ N+FFLVG +
Sbjct  584   ETIPNICDTVS---NSVWTCPTDKVFYDASVIWGLIGPRRIFGDLGLYKSVNWFFLVGAI  640

Query  226   APIPVWYLGRKYPEKRWVSLINMPILISGAEGIPIVKSVNYVCWFAVGLYFNLYVYRKHK  47
             API VW   R +P + W+ LINMP+LIS    +P   +VNY  W   G      V+R   
Sbjct  641   APILVWLASRMFPRQEWIKLINMPVLISATSSMPPATAVNYTTWVLAGFLSGFVVFRYRP  700

Query  46    GWWARHNYILSAGLD  2
               W R+NY+LS  LD
Sbjct  701   NLWQRYNYVLSGALD  715



>ref|XP_004964383.1| PREDICTED: oligopeptide transporter 7-like isoform X2 [Setaria 
italica]
Length=775

 Score =   736 bits (1900),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 369/668 (55%), Positives = 490/668 (73%), Gaps = 3/668 (0%)
 Frame = -1

Query  2005  DSPVEEVRLTVPITDDPTMPCVTFRTWVLGVTSCVILAFLNQFFGYRQNALYVSSVPAQI  1826
             +SP+E+V LTVP+ DDP+ P +TFR WVLG  SC +L+FLNQFF YR+  L ++++ AQI
Sbjct  60    NSPIEQVALTVPVGDDPSTPVLTFRMWVLGTASCALLSFLNQFFWYRKEPLTITAISAQI  119

Query  1825  VVLPMGKLMAAYLPTKVVQIPGTKWSFSLNPGPFNIKEHVLITIFASSGSDFSYAVSIIT  1646
              V+P+G+LMAA LP +   + GT+W FSLNPGPFN+KEHVLITIFA+SG+   YA+ +IT
Sbjct  120   AVVPLGRLMAAALPERAF-LRGTRWEFSLNPGPFNVKEHVLITIFANSGAGTVYAIHVIT  178

Query  1645  MMKAFYYRDIHPLAAVLLTFSTQMLGYGLAGIFKKFLIDSPYMWWPSNLVQVSLFRALHD  1466
              ++ FY + I    ++L+  +TQ+LG+G AGIF+++L++   MWWPSNLVQVSLFRALH+
Sbjct  179   AVRVFYGKHITFFVSLLVVLTTQVLGFGWAGIFRRYLVEPAAMWWPSNLVQVSLFRALHE  238

Query  1465  VETRPKGGLTRLQFFIIVLVCSFAYYVVPNYLFPSLTALSLLCWIWKNSVTAQQlgsglk  1286
              E R KGGLTR QFF++  +CSFAYY+ P YLF  LT+LS +CW++ +SV AQQLGSGL+
Sbjct  239   KEQRVKGGLTRNQFFLVAFICSFAYYIFPGYLFQMLTSLSWVCWVFPHSVFAQQLGSGLR  298

Query  1285  glgigSFALDWATVAAFQGSPLVTPDFAIINMLIGYVLVAYIAIPVWYWTNLFDAKKFPL  1106
             GLGIG+  LDW+TV+++ GSPL +P FA  N+  G+V V YI  P+ YW N + A+ FP+
Sbjct  299   GLGIGAIGLDWSTVSSYLGSPLASPWFATANVAAGFVFVMYIVTPIAYWFNFYKAQNFPI  358

Query  1105  FSSNVFDSNGQVYNISRVLNKKTFGFDQPGYDSYSNIYLSTAFVYTYGLSFATLAATVSH  926
             FS  +F + GQ YNIS +++   F FD   Y+    +YLST F  TYG+ FA+L AT+ H
Sbjct  359   FSDGLFTTTGQKYNISSIVDSH-FHFDTKAYEKNGPLYLSTFFAVTYGVGFASLTATIVH  417

Query  925   VALFHGRTIWEQTKESVQDKFSDIHTRLMRKNYEPVPQWWFYlllviivgvalvACQRFG  746
             V LFHG  IW+ +K + Q+K  D+HT+LMR+ Y+ VP+WWF  +LV  + V + AC+ + 
Sbjct  418   VFLFHGSEIWQLSKSAFQEKKMDVHTKLMRR-YKQVPEWWFICILVANIAVTIFACEYYI  476

Query  745   GQLQLPVWGVLLAVLLSLIFTLPVGVITATTNQQTGLNVIAELIIGYMYPGRPLASVTFK  566
              QLQLP WGVLLA  ++  FTLPVG+ITATTNQ  GLN+I E I+GY+YPGRP+A++ FK
Sbjct  477   EQLQLPWWGVLLACAIAFFFTLPVGIITATTNQTPGLNIITEYIMGYLYPGRPVANMCFK  536

Query  565   MYGlsslsqslmflSDFKLGHYMKIPPKSMFMVQLVGTLISCCVHFGTGWWLLTTVENIC  386
             +YG  S+SQ+L FL DFKLGHYMKIPP++MFM Q+VGTLI+  V+ GT WWL+ TV NIC
Sbjct  537   VYGYISMSQALTFLQDFKLGHYMKIPPRTMFMAQVVGTLIAAFVYIGTAWWLMETVPNIC  596

Query  385   NPSKLPEGSQWTCPGDDVFYNASIIWGVVSPRRMFGNLGIYQATNYFFLVGFLAPIPVWY  206
             N   LP  S WTCPGD VFY+AS+IWG++SPRR+FG+LG Y A N+FFL G +AP+ VW 
Sbjct  597   NTELLPRDSPWTCPGDHVFYDASVIWGLISPRRIFGDLGTYSAVNWFFLGGAIAPLLVWL  656

Query  205   LGRKYPEKRWVSLINMPILISGAEGIPIVKSVNYVCWFAVGLYFNLYVYRKHKGWWARHN  26
               + +P + W+ LINMP+LI     +P   +VNY  W  VG      VYR  + WW RHN
Sbjct  657   AHKAFPGQSWILLINMPVLIGATGNMPPATAVNYTTWILVGFLSGYVVYRYRRDWWERHN  716

Query  25    YILSAGLD  2
             Y+LS  LD
Sbjct  717   YLLSGALD  724



>ref|XP_006343795.1| PREDICTED: oligopeptide transporter 7-like [Solanum tuberosum]
Length=749

 Score =   735 bits (1897),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 372/703 (53%), Positives = 502/703 (71%), Gaps = 6/703 (1%)
 Frame = -1

Query  2110  RERVSSFKNSSLSRLLH*MENTGISAVESSADEINDSPVEEVRLTVPITDDPTMPCVTFR  1931
              E     K   LS   H + ++  +   +  DE  +SP+E+V LTVP TDDP++P +TFR
Sbjct  2     EESAYEIKTPLLSNFDHGIASSS-NVKFNKDDEDENSPIEQVALTVPTTDDPSLPVLTFR  60

Query  1930  TWVLGVTSCVILAFLNQFFGYRQNALYVSSVPAQIVVLPMGKLMAAYLPTKVVQIPGTKW  1751
              W LG  SCV+L+FLNQFF YR   L ++++ AQI V+P+G+LMAA + TK V + G+KW
Sbjct  61    MWFLGTLSCVLLSFLNQFFWYRTEPLTITAISAQIAVVPLGQLMAAKI-TKRVFLQGSKW  119

Query  1750  SFSLNPGPFNIKEHVLITIFASSGSDFSYAVSIITMMKAFYYRDIHPLAAVLLTFSTQML  1571
              F+LNPGPFN+KEHVLITIFA+SG+   YA+ ++T +K FY +DI    ++++  +TQ+L
Sbjct  120   EFTLNPGPFNVKEHVLITIFANSGAGTVYAIHVVTAVKVFYKKDITFFVSLIVIITTQVL  179

Query  1570  GYGLAGIFKKFLIDSPYMWWPSNLVQVSLFRALHDVETRPKGGLTRLQFFIIVLVCSFAY  1391
             G+G AGIF+K+L++   MWWPSNLVQVSLFRALH+ E R KGGLTR QFFI+  +CSFAY
Sbjct  180   GFGWAGIFRKYLVEPAAMWWPSNLVQVSLFRALHEKEERSKGGLTRTQFFIVAFICSFAY  239

Query  1390  YVVPNYLFPSLTALSLLCWIWKNSVTAQQlgsglkglgigSFALDWATVAAFQGSPLVTP  1211
             Y+ P YLF  LT+LS +CWI+  SV AQQLGSGLKGLGIG+  LDW++++++ GSPL +P
Sbjct  240   YIFPGYLFSMLTSLSWVCWIFPKSVFAQQLGSGLKGLGIGAIGLDWSSISSYLGSPLASP  299

Query  1210  DFAIINMLIGYVLVAYIAIPVWYWTNLFDAKKFPLFSSNVFDSNGQVYNISRVLNKKTFG  1031
              FA  N+  G++ V Y+  P+ YW ++F AK FP+FS  ++ SNGQVYNIS +++   F 
Sbjct  300   WFATANVAAGFIFVMYVLTPICYWLDIFKAKTFPIFSDGMYTSNGQVYNISSIIDSN-FH  358

Query  1030  FDQPGYDSYSNIYLSTAFVYTYGLSFATLAATVSHVALFHGRTIWEQTKESVQDKFSDIH  851
              D   Y+   ++YLST F  TYG+ FA L+ATV HV LFHGR IWEQ+K S +D+  DIH
Sbjct  359   LDIDAYEQQGHLYLSTFFAVTYGVGFAALSATVMHVLLFHGREIWEQSKSSFKDQKMDIH  418

Query  850   TRLMRKNYEPVPQWWFYlllviivgvalvACQRFGGQLQLPVWGVLLAVLLSLIFTLPVG  671
             TRLM K Y  VP+WWF+ +LV  + + + AC+ +  QLQLP WGV+LA +++  FTLP+G
Sbjct  419   TRLMSK-YNQVPEWWFWCILVANITLTIFACEYYNEQLQLPWWGVILACVIAFFFTLPIG  477

Query  670   VITATTNQQTGLNVIAELIIGYMYPGRPLASVTFKMYGlsslsqslmflSDFKLGHYMKI  491
             +ITA TNQ  GLNVI E IIGY+YPG P+A++ FK+YG  S++Q++ FL DFKLGHYMKI
Sbjct  478   IITAITNQTPGLNVITEYIIGYLYPGYPVANMCFKVYGYISMTQAITFLQDFKLGHYMKI  537

Query  490   PPKSMFMVQLVGTLISCCVHFGTGWWLLTTVENICNPSKLPEGSQWTCPGDDVFYNASII  311
             PP+ MFM Q+VGTLI+  V+ GT WWL+ T+ ++CN  K    + WTCP D VFY+AS+I
Sbjct  538   PPRIMFMAQVVGTLIAGFVYLGTAWWLMETIPDMCN--KTLSNTVWTCPSDHVFYDASVI  595

Query  310   WGVVSPRRMFGNLGIYQATNYFFLVGFLAPIPVWYLGRKYPEKRWVSLINMPILISGAEG  131
             WG+++PRR+FG+LG Y   N+FFL G +AP+ VW   R +P++ W+ LI+MP+LI     
Sbjct  596   WGLIAPRRIFGDLGTYGMVNWFFLFGAIAPVLVWLAARAFPKQEWIKLISMPVLIGATGM  655

Query  130   IPIVKSVNYVCWFAVGLYFNLYVYRKHKGWWARHNYILSAGLD  2
             +P   +VNY  W  VG      VYR    WW RHNY+LS  LD
Sbjct  656   MPPATAVNYTTWIIVGFLSGFVVYRYRPDWWQRHNYVLSGALD  698



>gb|EEC79904.1| hypothetical protein OsI_21444 [Oryza sativa Indica Group]
 gb|EEE65007.1| hypothetical protein OsJ_19952 [Oryza sativa Japonica Group]
Length=758

 Score =   735 bits (1897),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 364/672 (54%), Positives = 488/672 (73%), Gaps = 3/672 (0%)
 Frame = -1

Query  2017  DEINDSPVEEVRLTVPITDDPTMPCVTFRTWVLGVTSCVILAFLNQFFGYRQNALYVSSV  1838
             +E  +SP+E+V LTVP++D+P  P +TFR WVLG  SC +L+FLNQFF YR+  L ++++
Sbjct  39    EEEENSPIEQVALTVPVSDEPETPVLTFRMWVLGTASCAVLSFLNQFFWYRKEPLTITAI  98

Query  1837  PAQIVVLPMGKLMAAYLPTKVVQIPGTKWSFSLNPGPFNIKEHVLITIFASSGSDFSYAV  1658
              AQI V+P+G+LMAA LP +     G  W F+LNPGPFN+KEHVLITIFA+SG+   YA+
Sbjct  99    SAQIAVVPLGRLMAAALPERAF-FRGRPWEFTLNPGPFNVKEHVLITIFANSGAGTVYAI  157

Query  1657  SIITMMKAFYYRDIHPLAAVLLTFSTQMLGYGLAGIFKKFLIDSPYMWWPSNLVQVSLFR  1478
              +IT ++ FY + I    ++L+  +TQ+LG+G AGIF+++L++   MWWPSNLVQVSLFR
Sbjct  158   HVITAVRVFYGKHISFFVSLLVVLTTQVLGFGWAGIFRRYLVEPAAMWWPSNLVQVSLFR  217

Query  1477  ALHDVETRPKGGLTRLQFFIIVLVCSFAYYVVPNYLFPSLTALSLLCWIWKNSVTAQQlg  1298
             ALH+ E R KGGLTR QFF++  +CSFAYY+ P YLF  LT+LS +CW++ +SV AQQLG
Sbjct  218   ALHEKEARSKGGLTRNQFFLVAFICSFAYYIFPGYLFQMLTSLSWICWVFPHSVLAQQLG  277

Query  1297  sglkglgigSFALDWATVAAFQGSPLVTPDFAIINMLIGYVLVAYIAIPVWYWTNLFDAK  1118
             SGL GLGIG+  LDW+TV+++ GSPL +P FA  N+  G+  + YI  P+ YW N + A+
Sbjct  278   SGLSGLGIGAIGLDWSTVSSYLGSPLASPWFATANVAAGFFFIMYIITPIAYWFNFYKAQ  337

Query  1117  KFPLFSSNVFDSNGQVYNISRVLNKKTFGFDQPGYDSYSNIYLSTAFVYTYGLSFATLAA  938
              FP+FS  +F S GQ YNIS +++   F FD   Y+    +YLST F  TYG+ FA+L A
Sbjct  338   NFPIFSDGLFTSTGQKYNISSIVDSH-FHFDTKAYEKNGPLYLSTFFAVTYGVGFASLTA  396

Query  937   TVSHVALFHGRTIWEQTKESVQDKFSDIHTRLMRKNYEPVPQWWFYlllviivgvalvAC  758
             T+ HV LFHG  IW+ +K + Q+K  DIHT+LMR+ Y+ VP+WWF  +L+  + V + AC
Sbjct  397   TIVHVLLFHGSEIWQLSKSAFQEKRMDIHTKLMRR-YKQVPEWWFVCILIANIAVTIFAC  455

Query  757   QRFGGQLQLPVWGVLLAVLLSLIFTLPVGVITATTNQQTGLNVIAELIIGYMYPGRPLAS  578
             + +  QLQLP WGVLLA  ++  FTLP+G+ITATTNQ  GLN+I E I+GY+YPGRP+A+
Sbjct  456   EYYIEQLQLPWWGVLLACAIAFFFTLPIGIITATTNQTPGLNIITEYIMGYLYPGRPVAN  515

Query  577   VTFKMYGlsslsqslmflSDFKLGHYMKIPPKSMFMVQLVGTLISCCVHFGTGWWLLTTV  398
             + FK+YG  S+SQ+L FL DFKLGHYMKIPP++MFM Q+VGTLI+  V+ GT WWL+ T+
Sbjct  516   MCFKVYGYISMSQALTFLQDFKLGHYMKIPPRTMFMAQVVGTLIAAFVYIGTAWWLMETI  575

Query  397   ENICNPSKLPEGSQWTCPGDDVFYNASIIWGVVSPRRMFGNLGIYQATNYFFLVGFLAPI  218
              NICN   LP  S WTCPGD VFY+AS+IWG++SPRR+FG+LG Y A N+FFL G +AP+
Sbjct  576   PNICNTELLPSDSPWTCPGDHVFYDASVIWGLISPRRIFGDLGTYSAVNWFFLGGAIAPV  635

Query  217   PVWYLGRKYPEKRWVSLINMPILISGAEGIPIVKSVNYVCWFAVGLYFNLYVYRKHKGWW  38
              VW+  + +P + W+ LINMP+LI     +P   +VNY  W  VG      VYR  + WW
Sbjct  636   LVWFAHKAFPNQNWILLINMPVLIGATGQMPPATAVNYTTWILVGFLSGYVVYRYRRDWW  695

Query  37    ARHNYILSAGLD  2
              RHNY+LS  LD
Sbjct  696   ERHNYLLSGALD  707



>ref|XP_003519862.1| PREDICTED: oligopeptide transporter 7-like [Glycine max]
Length=747

 Score =   734 bits (1895),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 359/683 (53%), Positives = 486/683 (71%), Gaps = 2/683 (0%)
 Frame = -1

Query  2050  NTGISAVESSADEINDSPVEEVRLTVPITDDPTMPCVTFRTWVLGVTSCVILAFLNQFFG  1871
             N   +   SS D   +SP+E+V LTVP+ DDP++P  TFRTW+LG  +C +L+FLNQFFG
Sbjct  17    NNADANTSSSPDGGENSPIEQVALTVPVGDDPSLPSFTFRTWILGTLACALLSFLNQFFG  76

Query  1870  YRQNALYVSSVPAQIVVLPMGKLMAAYLPTKVVQIPGTKWSFSLNPGPFNIKEHVLITIF  1691
             YR+  L V+++ AQI V+P G LMAA + T+ V + GTKW F+LNPG FN+KEHVLITIF
Sbjct  77    YRREPLSVTAISAQIAVVPAGHLMAAAV-TRRVFMRGTKWEFTLNPGKFNVKEHVLITIF  135

Query  1690  ASSGSDFSYAVSIITMMKAFYYRDIHPLAAVLLTFSTQMLGYGLAGIFKKFLIDSPYMWW  1511
             ASSG+   YA+  ++ +K FY +++  LAA+L+  +TQ+LG+G AG+F+++L++   MWW
Sbjct  136   ASSGAASVYAIHFVSAVKVFYRKELTVLAALLVVITTQVLGFGWAGVFRRYLVEPATMWW  195

Query  1510  PSNLVQVSLFRALHDVETRPKGGLTRLQFFIIVLVCSFAYYVVPNYLFPSLTALSLLCWI  1331
             P NLVQVSLFRALH+ E RPKGGLTR QFF+I  +CSFAYYV P YL P LT++S +CW+
Sbjct  196   PQNLVQVSLFRALHEQEKRPKGGLTRNQFFLIAFLCSFAYYVFPGYLIPMLTSISWICWV  255

Query  1330  WKNSVTAQQlgsglkglgigSFALDWATVAAFQGSPLVTPDFAIINMLIGYVLVAYIAIP  1151
             +  SV A QLGSGL GLG+G+   DW+++ ++ GSPL +P FA  N+  G+ +  Y+ +P
Sbjct  256   FPTSVIAHQLGSGLHGLGLGAIGFDWSSICSYLGSPLASPWFATANVAAGFAIFMYVIMP  315

Query  1150  VWYWTNLFDAKKFPLFSSNVFDSNGQVYNISRVLNKKTFGFDQPGYDSYSNIYLSTAFVY  971
             + YWTNL+ A+ FP+FS ++F SNGQ YNIS + + K F  D   Y+    +YLST F  
Sbjct  316   IAYWTNLYKARSFPIFSDDLFMSNGQKYNISAITDSK-FHLDMEAYEREGPLYLSTMFAM  374

Query  970   TYGLSFATLAATVSHVALFHGRTIWEQTKESVQDKFSDIHTRLMRKNYEPVPQWWFYlll  791
             +YG+ FA L+AT+ HV LFHG  IW  +K + Q+   DIHT++MRK+Y+ VP+WWF  +L
Sbjct  375   SYGIGFACLSATLVHVLLFHGSEIWRLSKSAFQENKIDIHTKIMRKHYKQVPEWWFLCIL  434

Query  790   viivgvalvACQRFGGQLQLPVWGVLLAVLLSLIFTLPVGVITATTNQQTGLNVIAELII  611
             +  +   +  C+ F  QLQLP WGV+LA ++++ FTLPVGVI ATTNQ   LN+I E II
Sbjct  435   LFNITATIFICEYFNNQLQLPWWGVVLACIVAISFTLPVGVIRATTNQAPALNIITEYII  494

Query  610   GYMYPGRPLASVTFKMYGlsslsqslmflSDFKLGHYMKIPPKSMFMVQLVGTLISCCVH  431
             GY+YPG P+A + FK+YG  S+ Q++ FL DFKLGHYMKIPP+ MF  Q++GTLIS  VH
Sbjct  495   GYIYPGYPVAIMLFKVYGNVSMKQAIFFLQDFKLGHYMKIPPREMFFAQVLGTLISAVVH  554

Query  430   FGTGWWLLTTVENICNPSKLPEGSQWTCPGDDVFYNASIIWGVVSPRRMFGNLGIYQATN  251
               T WWL+ TV NIC    LP GS WTCPGD VFY+AS++WG++ PRR+FG+LG Y A N
Sbjct  555   LLTAWWLMNTVPNICERELLPAGSPWTCPGDHVFYDASVVWGLIGPRRIFGDLGHYSAIN  614

Query  250   YFFLVGFLAPIPVWYLGRKYPEKRWVSLINMPILISGAEGIPIVKSVNYVCWFAVGLYFN  71
             +FFL G +AP  VW   + +P K+W+ LI +P+L+     +P   +VNY  W  VG    
Sbjct  615   WFFLAGAIAPFLVWLAHKAFPNKQWIRLITVPVLLGALADMPPATAVNYTSWVLVGFLSG  674

Query  70    LYVYRKHKGWWARHNYILSAGLD  2
               VYR ++ WW+RHNY+LS  LD
Sbjct  675   FVVYRYYRDWWSRHNYVLSGALD  697



>ref|XP_008806363.1| PREDICTED: oligopeptide transporter 7-like [Phoenix dactylifera]
Length=765

 Score =   734 bits (1896),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 366/668 (55%), Positives = 486/668 (73%), Gaps = 3/668 (0%)
 Frame = -1

Query  2005  DSPVEEVRLTVPITDDPTMPCVTFRTWVLGVTSCVILAFLNQFFGYRQNALYVSSVPAQI  1826
             +SP+E+V LTVP+ DDP++P +TFR WVLG  SC +L+FLNQFF YR+  L ++S+ AQI
Sbjct  51    NSPIEQVALTVPVGDDPSVPVLTFRMWVLGTISCALLSFLNQFFWYRKEPLSITSISAQI  110

Query  1825  VVLPMGKLMAAYLPTKVVQIPGTKWSFSLNPGPFNIKEHVLITIFASSGSDFSYAVSIIT  1646
              V+P+G LMA  +  +V    G +W F+LNPGPFNIKEHVLITIFA+SG+   YA+ ++T
Sbjct  111   AVVPLGHLMARTITDRVF-FKGRRWEFTLNPGPFNIKEHVLITIFANSGAGSVYAIHVVT  169

Query  1645  MMKAFYYRDIHPLAAVLLTFSTQMLGYGLAGIFKKFLIDSPYMWWPSNLVQVSLFRALHD  1466
              +K FY R I    ++L+  +TQ+LG+G AGIF+++L++   MWWP NLVQVSLFRALH+
Sbjct  170   AVKIFYRRHITFFVSLLVVLTTQVLGFGWAGIFRRYLVEPAAMWWPYNLVQVSLFRALHE  229

Query  1465  VETRPKGGLTRLQFFIIVLVCSFAYYVVPNYLFPSLTALSLLCWIWKNSVTAQQlgsglk  1286
              E RPK GLTR QFF++  +CSF+YYV P YLF  LT+LS +CWI+  SV AQQLGSGL 
Sbjct  230   KEARPKHGLTRNQFFMVAFICSFSYYVFPGYLFSMLTSLSWICWIFPRSVLAQQLGSGLY  289

Query  1285  glgigSFALDWATVAAFQGSPLVTPDFAIINMLIGYVLVAYIAIPVWYWTNLFDAKKFPL  1106
             GLGIG+  LDW+T++++ GSPL +P FA  N+  G+VL+ Y+  P  YW NL+ AK FP+
Sbjct  290   GLGIGAIGLDWSTISSYLGSPLASPWFATANVAAGFVLIMYVITPTAYWLNLYKAKTFPI  349

Query  1105  FSSNVFDSNGQVYNISRVLNKKTFGFDQPGYDSYSNIYLSTAFVYTYGLSFATLAATVSH  926
             FS ++F S GQ YNIS +++   F  D   Y+    +YLST F  TYG+ FA+L ATV H
Sbjct  350   FSDDLFTSTGQEYNISSIIDSD-FHLDVEAYEKEGPLYLSTFFAVTYGVGFASLTATVCH  408

Query  925   VALFHGRTIWEQTKESVQDKFSDIHTRLMRKNYEPVPQWWFYlllviivgvalvACQRFG  746
             V LFHGR IW+ +K + Q+K  D+HTRLMR+ Y+ VPQWWF  +LV  V + + AC+ + 
Sbjct  409   VLLFHGREIWQMSKSAFQEKKMDVHTRLMRQ-YKQVPQWWFICILVANVALTIFACEYYI  467

Query  745   GQLQLPVWGVLLAVLLSLIFTLPVGVITATTNQQTGLNVIAELIIGYMYPGRPLASVTFK  566
              QLQLP WGVLLA  L++ FTLP+G+ITATTNQ  GLN+I E I+GY+YPGRP+A++ FK
Sbjct  468   DQLQLPWWGVLLACGLAIFFTLPIGIITATTNQTPGLNIITEYIMGYLYPGRPVANMCFK  527

Query  565   MYGlsslsqslmflSDFKLGHYMKIPPKSMFMVQLVGTLISCCVHFGTGWWLLTTVENIC  386
             +YG  S++Q+L FL DFKLGHYMKIPP++MFM Q+VGTLI+  V+ GT WWL+ T+ NIC
Sbjct  528   VYGYISMTQALTFLQDFKLGHYMKIPPRTMFMAQVVGTLIAAIVYLGTAWWLMDTIPNIC  587

Query  385   NPSKLPEGSQWTCPGDDVFYNASIIWGVVSPRRMFGNLGIYQATNYFFLVGFLAPIPVWY  206
             +   L   S WTCP D VF++AS+IWG++ PRR+FG+LG Y A N+FFL G +AP+ +W 
Sbjct  588   DTDLLSSDSPWTCPSDQVFFDASVIWGLIGPRRIFGDLGTYSAINWFFLAGAIAPLLIWL  647

Query  205   LGRKYPEKRWVSLINMPILISGAEGIPIVKSVNYVCWFAVGLYFNLYVYRKHKGWWARHN  26
               + +P K+W+SLINMP+LI     +P   +VNY  W  VG      VYR  + WW RHN
Sbjct  648   AHKAFPNKKWISLINMPVLIGATGMMPPATAVNYTTWIIVGFLSGFVVYRYRRDWWQRHN  707

Query  25    YILSAGLD  2
             Y+LS  LD
Sbjct  708   YVLSGALD  715



>ref|XP_010676881.1| PREDICTED: oligopeptide transporter 7 [Beta vulgaris subsp. vulgaris]
Length=754

 Score =   734 bits (1895),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 370/706 (52%), Positives = 499/706 (71%), Gaps = 17/706 (2%)
 Frame = -1

Query  2119  RDTRERVSSFKNSSLSRLLH*MENTGISAVESSADEINDSPVEEVRLTVPITDDPTMPCV  1940
             RD  E     KN    RL+            SS     +SPV++V LTVPITDDP +P +
Sbjct  15    RD--EHHQDEKNEESQRLIS----------SSSTKSTENSPVKQVALTVPITDDPELPVL  62

Query  1939  TFRTWVLGVTSCVILAFLNQFFGYRQNALYVSSVPAQIVVLPMGKLMAAYLPTKVVQIPG  1760
             TFRTWVLG+ SC++L+FLNQFF YR   L V+ + AQI V+P+G  MA+ LP   +   G
Sbjct  63    TFRTWVLGMVSCIVLSFLNQFFWYRTEPLSVTGIAAQIAVVPLGHWMASNLPNGSL-FRG  121

Query  1759  TKWSFSLNPGPFNIKEHVLITIFASSGSDFSYAVSIITMMKAFYYRDIHPLAAVLLTFST  1580
             T+W FS+NPGPFN+KEHVLITIFA++G+   YA+ ++T +K FY ++I    ++L+  +T
Sbjct  122   TRWEFSMNPGPFNVKEHVLITIFANAGAGTVYAIHVVTAVKIFYKKNITFFVSLLVVLTT  181

Query  1579  QMLGYGLAGIFKKFLIDSPYMWWPSNLVQVSLFRALHDVETRPKGGLTRLQFFIIVLVCS  1400
             Q+LG+G AG+F+++L++   MWWP+NLVQVSLFRALH+ E RPKGGLTR QFF+I   CS
Sbjct  182   QVLGFGWAGVFRRYLVEPAEMWWPANLVQVSLFRALHEKEERPKGGLTRTQFFLIAFTCS  241

Query  1399  FAYYVVPNYLFPSLTALSLLCWIWKNSVTAQQlgsglkglgigSFALDWATVAAFQGSPL  1220
             FAYYV P Y+F  LT+LS +CW W  S+ AQQ+GSGL G+GIG+F +DW+T++++ GSPL
Sbjct  242   FAYYVFPGYIFQMLTSLSWICWAWPKSILAQQVGSGLHGIGIGAFGMDWSTISSYLGSPL  301

Query  1219  VTPDFAIINMLIGYVLVAYIAIPVWYWTNLFDAKKFPLFSSNVFDSNGQVYNISRVLNKK  1040
              +P FA  N+  GYVL+ Y+ +P+ YW N++ AK FP+FS+++F S G +YN+S +++  
Sbjct  302   ASPWFATANVAAGYVLLMYVVVPITYWLNIYKAKTFPIFSNHLFTSTGSIYNVSAIVDSN  361

Query  1039  TFGFDQPGYDSYSNIYLSTAFVYTYGLSFATLAATVSHVALFHGRTIWEQTKESVQDKFS  860
              F F+Q  YD    +YLST F  TYG+ FA L+AT+ HVALFHGR IW+Q+K S+++K  
Sbjct  362   -FHFNQEAYDKQGPLYLSTFFTMTYGVGFAALSATIVHVALFHGREIWDQSKASLKEKKM  420

Query  859   DIHTRLMRKNYEPVPQWWFYlllviivgvalvACQRFGGQLQLPVWGVLLAVLLSLIFTL  680
             DIHT+LMR+ Y+  P WWF+++LV+ + VA+ AC+ +  QLQLP WGVLLA  ++ IFTL
Sbjct  421   DIHTKLMRR-YKEAPDWWFWVILVVNIAVAIFACEYYKEQLQLPWWGVLLACAIAFIFTL  479

Query  679   PVGVITATTNQQTGLNVIAELIIGYMYPGRPLASVTFKMYGlsslsqslmflSDFKLGHY  500
             P+GVITA  NQ   LNVI E IIGY+YPG P+A++ FK+YG  S+ Q++ FL DFKLGHY
Sbjct  480   PIGVITAIANQAPHLNVITEYIIGYIYPGYPVANMCFKVYGNISMKQAVTFLQDFKLGHY  539

Query  499   MKIPPKSMFMVQLVGTLISCCVHFGTGWWLLTTVENICNPSKLPEGSQWTCPGDDVFYNA  320
             MKIPP+SMF+ Q+VGTLIS  V+  T WWL+ T+ +IC   +    S WTCPGD VFY+A
Sbjct  540   MKIPPRSMFIAQVVGTLISSLVYLSTAWWLMETIPDICE--RHNSSSVWTCPGDTVFYDA  597

Query  319   SIIWGVVSPRRMFGNLGIYQATNYFFLVGFLAPIPVWYLGRKYPEKRWVSLINMPILISG  140
             S+IWG++ PR++FG  GIY A N+FFLVG + PI VW   + +P + W+ LINMPILI  
Sbjct  598   SVIWGLIGPRKIFGGEGIYGAVNWFFLVGAIGPIFVWLATKSFPNQEWIRLINMPILIGA  657

Query  139   AEGIPIVKSVNYVCWFAVGLYFNLYVYRKHKGWWARHNYILSAGLD  2
                +P   +VNY  W  VG       +R    WW RHNY+LS  LD
Sbjct  658   TSSMPPATAVNYTTWILVGFLSGYVAFRYAPEWWKRHNYLLSGALD  703



>ref|XP_010252553.1| PREDICTED: oligopeptide transporter 7-like [Nelumbo nucifera]
Length=731

 Score =   733 bits (1891),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 366/683 (54%), Positives = 499/683 (73%), Gaps = 5/683 (1%)
 Frame = -1

Query  2050  NTGISAVESSADEINDSPVEEVRLTVPITDDPTMPCVTFRTWVLGVTSCVILAFLNQFFG  1871
             NT   AVES   E  +S +++V LTVP TDDP  P +TFR WVLG+ SCV+L+FLNQFF 
Sbjct  4     NTTSPAVESPESE--NSSIKQVALTVPTTDDPNQPVLTFRMWVLGIVSCVLLSFLNQFFW  61

Query  1870  YRQNALYVSSVPAQIVVLPMGKLMAAYLPTKVVQIPGTKWSFSLNPGPFNIKEHVLITIF  1691
             YR   + ++ + AQI V+P+G LMA+ + TK V   GT+W FS+NPGPFN+KEHVLITIF
Sbjct  62    YRTEPISITGLSAQIAVVPLGHLMASTV-TKRVFFKGTRWEFSMNPGPFNVKEHVLITIF  120

Query  1690  ASSGSDFSYAVSIITMMKAFYYRDIHPLAAVLLTFSTQMLGYGLAGIFKKFLIDSPYMWW  1511
             A++G+   YA  I++ +K FY R +  + A+L+  +TQMLG+G AG+F+++L++   MWW
Sbjct  121   ANAGAGTVYATHILSAVKLFYKRKLTFIPALLVILTTQMLGFGWAGLFRRYLVEPAEMWW  180

Query  1510  PSNLVQVSLFRALHDVETRPKGGLTRLQFFIIVLVCSFAYYVVPNYLFPSLTALSLLCWI  1331
             P+NLVQVSLFRALH+ E RPKGG+TR QFF++VLVCSFAYYV P YLFP LT+LS +CWI
Sbjct  181   PNNLVQVSLFRALHEKEKRPKGGVTRTQFFLMVLVCSFAYYVFPGYLFPMLTSLSWVCWI  240

Query  1330  WKNSVTAQQlgsglkglgigSFALDWATVAAFQGSPLVTPDFAIINMLIGYVLVAYIAIP  1151
             +  S+ AQQLGSGL+GLGIG+  LDW+TV+++ GSPL +P FA  N+ +G+ ++ Y+  P
Sbjct  241   FPKSILAQQLGSGLEGLGIGAIGLDWSTVSSYLGSPLASPWFATANIAVGFAILMYVITP  300

Query  1150  VWYWTNLFDAKKFPLFSSNVFDSNGQVYNISRVLNKKTFGFDQPGYDSYSNIYLSTAFVY  971
             + YW + + AK FPLFSS +F   GQ YNIS ++N K F  D   Y+    ++LST F  
Sbjct  301   ISYWFDFYQAKTFPLFSSGLFTRTGQKYNISSIINDK-FHIDMNAYEHNGPLHLSTFFAI  359

Query  970   TYGLSFATLAATVSHVALFHGRTIWEQTKESVQDKFSDIHTRLMRKNYEPVPQWWFYlll  791
             +YG  FA L ATV HV +FHGR IW+ ++ ++++   D+HTRLMR+ Y+ VPQWWF  +L
Sbjct  360   SYGAGFAALTATVVHVLVFHGREIWQLSRSALKESKMDVHTRLMRR-YKQVPQWWFICVL  418

Query  790   viivgvalvACQRFGGQLQLPVWGVLLAVLLSLIFTLPVGVITATTNQQTGLNVIAELII  611
             V+I+     AC  +  QLQLP WGVLLA  L+++FTLP+G+I ATTNQ  GLN+I E I+
Sbjct  419   VVIIATTFFACGYYNDQLQLPWWGVLLACFLAILFTLPIGIIAATTNQSPGLNIITEYIM  478

Query  610   GYMYPGRPLASVTFKMYGlsslsqslmflSDFKLGHYMKIPPKSMFMVQLVGTLISCCVH  431
             GY+YPGRP+A++ FK+YG  S++Q+L F+SDFKLGHYMKIPP++MFM Q++GTLI+  V+
Sbjct  479   GYLYPGRPVANICFKVYGYISMTQALTFISDFKLGHYMKIPPRAMFMAQMIGTLIAGFVY  538

Query  430   FGTGWWLLTTVENICNPSKLPEGSQWTCPGDDVFYNASIIWGVVSPRRMFGNLGIYQATN  251
               T WWL+ T+ N+C+ + LP+ S WTCP D VFY+AS+IWG++ PRR+FG+LG Y A N
Sbjct  539   LATAWWLMKTIPNLCDTNLLPDNSPWTCPMDRVFYDASVIWGLIGPRRIFGDLGTYPAVN  598

Query  250   YFFLVGFLAPIPVWYLGRKYPEKRWVSLINMPILISGAEGIPIVKSVNYVCWFAVGLYFN  71
             +FFL G +AP+ VW   + +P ++W+ LINMPILI     +P   +VN+  W  +G    
Sbjct  599   WFFLGGAVAPLLVWAAHKVFPNQKWIRLINMPILIGATGMMPPATAVNFTVWIIIGFLSG  658

Query  70    LYVYRKHKGWWARHNYILSAGLD  2
               +YR  +GWW RHNY+LS  LD
Sbjct  659   FVIYRYRQGWWQRHNYVLSGALD  681



>ref|XP_008239237.1| PREDICTED: oligopeptide transporter 7 [Prunus mume]
Length=760

 Score =   734 bits (1894),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 365/668 (55%), Positives = 491/668 (74%), Gaps = 7/668 (1%)
 Frame = -1

Query  2005  DSPVEEVRLTVPITDDPTMPCVTFRTWVLGVTSCVILAFLNQFFGYRQNALYVSSVPAQI  1826
             +SPVE+V LTVP TDDP++P +TFR WVLG  SCV+L+FLNQFF YR+  L ++++ AQI
Sbjct  49    NSPVEQVALTVPTTDDPSLPVLTFRMWVLGTLSCVLLSFLNQFFWYRKEPLSITAISAQI  108

Query  1825  VVLPMGKLMAAYLPTKVVQIPGTKWSFSLNPGPFNIKEHVLITIFASSGSDFSYAVSIIT  1646
              V+P+G+LMA+ + T      G++W F+LNPGPFN+KEHVLITIFA+SG+   YA+ I+T
Sbjct  109   AVVPLGQLMASKITTHAF-FKGSRWEFTLNPGPFNVKEHVLITIFANSGAGTVYAIHIVT  167

Query  1645  MMKAFYYRDIHPLAAVLLTFSTQMLGYGLAGIFKKFLIDSPYMWWPSNLVQVSLFRALHD  1466
             ++K FY + I    ++L+  +TQ+LG+G AGIF+++L++   MWWP+NLVQVSLFRALH+
Sbjct  168   VVKVFYKKHITFFVSLLVILTTQVLGFGWAGIFRRYLVEPAAMWWPANLVQVSLFRALHE  227

Query  1465  VETRPKGGLTRLQFFIIVLVCSFAYYVVPNYLFPSLTALSLLCWIWKNSVTAQQlgsglk  1286
              E RPKGGLTR QFF+I  +CSFAYYV P YLF  LT+LS +CWI+  SV AQQLGSGL 
Sbjct  228   KEARPKGGLTRTQFFLIAFICSFAYYVFPGYLFEMLTSLSWICWIFPKSVLAQQLGSGLY  287

Query  1285  glgigSFALDWATVAAFQGSPLVTPDFAIINMLIGYVLVAYIAIPVWYWTNLFDAKKFPL  1106
             GLGIG+  LDW+T++++ GSPL +P FA  N+  G+VLV YI  P  YW N++ AK FP+
Sbjct  288   GLGIGTIGLDWSTISSYLGSPLASPWFATANVAAGFVLVMYILTPFCYWFNVYKAKTFPI  347

Query  1105  FSSNVFDSNGQVYNISRVLNKKTFGFDQPGYDSYSNIYLSTAFVYTYGLSFATLAATVSH  926
             FSS +F S+G+ YNI+ +++   F  D   Y+    +YLS  FV TYG+ FA L AT+ H
Sbjct  348   FSSTMFKSDGEEYNITAIIDSN-FHLDSAAYNREGPLYLSIIFVITYGVGFAALTATIVH  406

Query  925   VALFHGRTIWEQTKESVQDKFSDIHTRLMRKNYEPVPQWWFYlllviivgvalvACQRFG  746
             VALFHGR IWEQ+K S ++K  DIHTRLM++ Y+ VP+WWF ++L++ + V +  CQ + 
Sbjct  407   VALFHGREIWEQSKASFKEKEMDIHTRLMQR-YKQVPEWWFVVILLVNIAVTIFTCQYYN  465

Query  745   GQLQLPVWGVLLAVLLSLIFTLPVGVITATTNQQTGLNVIAELIIGYMYPGRPLASVTFK  566
              QLQLP WGVLLA  +++ FTLP+G+ITA TNQ  GLN+I E IIGY+YPG P+A++ FK
Sbjct  466   DQLQLPWWGVLLACAIAIFFTLPIGIITAITNQTPGLNIITEYIIGYIYPGYPVANMCFK  525

Query  565   MYGlsslsqslmflSDFKLGHYMKIPPKSMFMVQLVGTLISCCVHFGTGWWLLTTVENIC  386
             +YG  S++Q++ FL DFKLGHYMKIPP++MFM Q+VGTLI+  V+ GT WWL+ T+ +IC
Sbjct  526   VYGYISMTQAITFLQDFKLGHYMKIPPRTMFMAQVVGTLIAAIVYLGTAWWLMETIPDIC  585

Query  385   NPSKLPEGSQWTCPGDDVFYNASIIWGVVSPRRMFGNLGIYQATNYFFLVGFLAPIPVWY  206
               +     S WTCPGD VFY+AS+IWG++ PRR+FGN G Y+A N+FFL G +AP+ VW 
Sbjct  586   EDTS----SVWTCPGDTVFYDASVIWGLIGPRRIFGNEGTYEAVNWFFLGGAVAPLVVWA  641

Query  205   LGRKYPEKRWVSLINMPILISGAEGIPIVKSVNYVCWFAVGLYFNLYVYRKHKGWWARHN  26
               + +P++ W+ LINMP+LI     +P   +VNY  W  +G      VYR    WW RHN
Sbjct  642   AAKAFPKQEWIRLINMPVLIGATGSMPPATAVNYTSWIILGFLSGFVVYRYRPDWWRRHN  701

Query  25    YILSAGLD  2
             Y+LS  LD
Sbjct  702   YVLSGALD  709



>ref|XP_008239235.1| PREDICTED: oligopeptide transporter 7-like [Prunus mume]
Length=759

 Score =   733 bits (1893),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 364/672 (54%), Positives = 489/672 (73%), Gaps = 7/672 (1%)
 Frame = -1

Query  2017  DEINDSPVEEVRLTVPITDDPTMPCVTFRTWVLGVTSCVILAFLNQFFGYRQNALYVSSV  1838
             +E  +SPVE+V LTVP TDDP++P +TFR WVLG  SCV+L+FLNQFF YR   L ++++
Sbjct  44    EEEENSPVEQVALTVPTTDDPSLPVLTFRMWVLGTLSCVLLSFLNQFFWYRTEPLSITAI  103

Query  1837  PAQIVVLPMGKLMAAYLPTKVVQIPGTKWSFSLNPGPFNIKEHVLITIFASSGSDFSYAV  1658
              AQI V+P+G+LMA+ + T      G++W F+LNPGPFN+KEHVLITIFA+SG+   YA+
Sbjct  104   SAQIAVVPLGQLMASKITTHAF-FKGSRWEFTLNPGPFNVKEHVLITIFANSGAGTVYAI  162

Query  1657  SIITMMKAFYYRDIHPLAAVLLTFSTQMLGYGLAGIFKKFLIDSPYMWWPSNLVQVSLFR  1478
              ++T++K FY + I    ++L+  +TQ+LG+G AGIF+++L++   MWWP+NLVQVSLFR
Sbjct  163   HVVTVVKVFYKKHITFFVSLLVILTTQVLGFGWAGIFRRYLVEPAAMWWPANLVQVSLFR  222

Query  1477  ALHDVETRPKGGLTRLQFFIIVLVCSFAYYVVPNYLFPSLTALSLLCWIWKNSVTAQQlg  1298
             ALH+ E RPKGGLTR QFF+I  +CSFAYYV P YLF  LT+LS +CWI+ N+V AQQLG
Sbjct  223   ALHEKEARPKGGLTRTQFFLIAFMCSFAYYVFPGYLFEMLTSLSWICWIFPNNVLAQQLG  282

Query  1297  sglkglgigSFALDWATVAAFQGSPLVTPDFAIINMLIGYVLVAYIAIPVWYWTNLFDAK  1118
             SGL GLGIG+  LDW+T++++ GSPL +P FA  N+  G+  V YI  P+ YW N++ AK
Sbjct  283   SGLYGLGIGAIGLDWSTISSYLGSPLASPWFATANVAAGFFFVMYILTPLCYWLNVYKAK  342

Query  1117  KFPLFSSNVFDSNGQVYNISRVLNKKTFGFDQPGYDSYSNIYLSTAFVYTYGLSFATLAA  938
              FP+FS  +F S+GQ YNI+ +++   F  D   YD    +YLST F  TYG+ FA L A
Sbjct  343   TFPIFSDTLFTSDGQEYNITAIIDSN-FHLDSAAYDREGPLYLSTFFAITYGVGFAALTA  401

Query  937   TVSHVALFHGRTIWEQTKESVQDKFSDIHTRLMRKNYEPVPQWWFYlllviivgvalvAC  758
             T+ HVALFHGR IWEQ+K S ++K  DIHTRLM++ Y  VP+WWF  +L++ + V +  C
Sbjct  402   TIIHVALFHGREIWEQSKASFKEKQMDIHTRLMQR-YNQVPEWWFVAILLVNIAVTIFTC  460

Query  757   QRFGGQLQLPVWGVLLAVLLSLIFTLPVGVITATTNQQTGLNVIAELIIGYMYPGRPLAS  578
             Q +  QLQLP WGVLLA  +++ FTLP+G+ITA TNQ  GLN+I E IIGY+YPG P+A+
Sbjct  461   QYYNDQLQLPWWGVLLACAIAIFFTLPIGIITAITNQTPGLNIITEYIIGYIYPGYPVAN  520

Query  577   VTFKMYGlsslsqslmflSDFKLGHYMKIPPKSMFMVQLVGTLISCCVHFGTGWWLLTTV  398
             + FK+YG  S++Q++ FL DFKLGHYMKIPP++MFM Q+VGTLI+  V+ GT WWL+ T+
Sbjct  521   MCFKVYGYISMTQAITFLQDFKLGHYMKIPPRTMFMAQVVGTLIAGIVYLGTAWWLMETI  580

Query  397   ENICNPSKLPEGSQWTCPGDDVFYNASIIWGVVSPRRMFGNLGIYQATNYFFLVGFLAPI  218
              +IC      + S WTCP D VFY+AS+IWG++ PRR+FGNLG Y+A N+FFL G +AP+
Sbjct  581   PDICE----DKSSVWTCPSDTVFYDASVIWGLIGPRRIFGNLGTYEAVNWFFLGGAVAPL  636

Query  217   PVWYLGRKYPEKRWVSLINMPILISGAEGIPIVKSVNYVCWFAVGLYFNLYVYRKHKGWW  38
              VW   + +P++ W+ LINMP+LI     +P   +VNY  W  +G      VYR    WW
Sbjct  637   VVWAAAKAFPKQEWIRLINMPVLIGSTGNMPPATAVNYTSWIILGFLSGFVVYRYRPDWW  696

Query  37    ARHNYILSAGLD  2
              RHNY+LS  LD
Sbjct  697   RRHNYVLSGALD  708



>ref|XP_010422002.1| PREDICTED: oligopeptide transporter 7 [Camelina sativa]
Length=769

 Score =   734 bits (1894),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 360/668 (54%), Positives = 492/668 (74%), Gaps = 6/668 (1%)
 Frame = -1

Query  2005  DSPVEEVRLTVPITDDPTMPCVTFRTWVLGVTSCVILAFLNQFFGYRQNALYVSSVPAQI  1826
             +SP+ +V LTVP TDDP++P +TFR WVLG  SC++L+FLNQFF YR   L +S++ AQI
Sbjct  57    NSPIRQVALTVPTTDDPSLPVLTFRMWVLGTLSCILLSFLNQFFWYRTEPLTISAISAQI  116

Query  1825  VVLPMGKLMAAYLPTKVVQIPGTKWSFSLNPGPFNIKEHVLITIFASSGSDFSYAVSIIT  1646
              V+P+G+LMAA +  +V    G+KW F+LNPGPFN+KEHVLITIFA++G+   YA+ ++T
Sbjct  117   AVVPLGRLMAAKISERV-YFQGSKWQFTLNPGPFNVKEHVLITIFANAGAGSVYAIHVVT  175

Query  1645  MMKAFYYRDIHPLAAVLLTFSTQMLGYGLAGIFKKFLIDSPYMWWPSNLVQVSLFRALHD  1466
             ++KAFY ++I    + L+  +TQ+LG+G AGIF+K+L++   MWWP+NLVQVSLFRALH+
Sbjct  176   VVKAFYMKNITFFVSFLVIVTTQVLGFGWAGIFRKYLVEPAAMWWPANLVQVSLFRALHE  235

Query  1465  VETRPKGGLTRLQFFIIVLVCSFAYYVVPNYLFPSLTALSLLCWIWKNSVTAQQlgsglk  1286
              E R KGGLTR QFF+I  VCSFAYYV P YLF  +T+LS +CW + +SV AQQ+GSGL 
Sbjct  236   KEERTKGGLTRTQFFVIAFVCSFAYYVFPGYLFQIMTSLSWVCWFFPSSVMAQQIGSGLH  295

Query  1285  glgigSFALDWATVAAFQGSPLVTPDFAIINMLIGYVLVAYIAIPVWYWTNLFDAKKFPL  1106
             GLG+G+  LDW+T++++ GSPL +P FA  N+ +G+VLV Y+ +P+ YW ++F AK FP+
Sbjct  296   GLGVGAIGLDWSTISSYLGSPLASPWFATANVGVGFVLVIYVLVPICYWLDVFKAKTFPI  355

Query  1105  FSSNVFDSNGQVYNISRVLNKKTFGFDQPGYDSYSNIYLSTAFVYTYGLSFATLAATVSH  926
             FSS++F   G  YNI+ +++   F  D P Y+    +YLST F  +YG+ FA L+AT+ H
Sbjct  356   FSSSLFTEQGSKYNITSIIDSN-FHLDLPAYEREGPLYLSTFFAISYGVGFAALSATIMH  414

Query  925   VALFHGRTIWEQTKESVQDKFSDIHTRLMRKNYEPVPQWWFYlllviivgvalvACQRFG  746
             VALFHGR IWEQ+KES ++K  D+H RLM++ Y+ VP+WWF+ +LV  +   + AC+ + 
Sbjct  415   VALFHGREIWEQSKESFKEKKLDVHARLMKR-YKQVPEWWFWCILVTNIAATIFACEYYN  473

Query  745   GQLQLPVWGVLLAVLLSLIFTLPVGVITATTNQQTGLNVIAELIIGYMYPGRPLASVTFK  566
              QLQLP WGVLLA  +++IFTLP+G+ITA TNQ  GLN+I E IIGY+YPG P+A++ FK
Sbjct  474   DQLQLPWWGVLLACTIAIIFTLPIGIITAITNQAPGLNIITEYIIGYIYPGYPVANMCFK  533

Query  565   MYGlsslsqslmflSDFKLGHYMKIPPKSMFMVQLVGTLISCCVHFGTGWWLLTTVENIC  386
             +YG  S+ Q++ FL DFKLGHYMKIPP++MFM Q+VGTLISC V+  T WWL+ T+ NIC
Sbjct  534   VYGYISMQQAITFLQDFKLGHYMKIPPRTMFMAQIVGTLISCLVYLTTAWWLMETIPNIC  593

Query  385   NPSKLPEGSQWTCPGDDVFYNASIIWGVVSPRRMFGNLGIYQATNYFFLVGFLAPIPVWY  206
             +       S WTCP D VFY+AS+IWG++ PRR+FG+LG+Y++ N+FFLVG +API VW 
Sbjct  594   DTV---SNSVWTCPSDKVFYDASVIWGLIGPRRIFGDLGLYKSVNWFFLVGAIAPILVWL  650

Query  205   LGRKYPEKRWVSLINMPILISGAEGIPIVKSVNYVCWFAVGLYFNLYVYRKHKGWWARHN  26
               R +P + W+ LINMP+LIS    +P   +VNY  W   G      V+R     W R+N
Sbjct  651   ASRMFPRQEWIKLINMPVLISATSSMPPATAVNYTTWVLAGFLSGFVVFRYRPNLWQRYN  710

Query  25    YILSAGLD  2
             Y+LS  LD
Sbjct  711   YVLSGALD  718



>ref|XP_010934151.1| PREDICTED: oligopeptide transporter 7-like [Elaeis guineensis]
Length=755

 Score =   732 bits (1889),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 367/669 (55%), Positives = 486/669 (73%), Gaps = 3/669 (0%)
 Frame = -1

Query  2008  NDSPVEEVRLTVPITDDPTMPCVTFRTWVLGVTSCVILAFLNQFFGYRQNALYVSSVPAQ  1829
             ++SPVE+V LTVP+ DDP++P +TFR WVLG  SCVIL+FLNQFF YR   L ++S+ AQ
Sbjct  40    DNSPVEQVALTVPVGDDPSIPVLTFRMWVLGTVSCVILSFLNQFFWYRNEPLSITSISAQ  99

Query  1828  IVVLPMGKLMAAYLPTKVVQIPGTKWSFSLNPGPFNIKEHVLITIFASSGSDFSYAVSII  1649
             I V+P+G LMA  LP ++    G+ W F+LNPGPFN+KEHVLITIFA+SG+   YAV II
Sbjct  100   IAVVPLGHLMATALPDRLF-FRGSPWEFTLNPGPFNVKEHVLITIFANSGAANVYAVHII  158

Query  1648  TMMKAFYYRDIHPLAAVLLTFSTQMLGYGLAGIFKKFLIDSPYMWWPSNLVQVSLFRALH  1469
             + +K FY +++    + ++  +TQ+LGYG AG+F+++L++   MWWP NLVQVSLF ALH
Sbjct  159   SAVKIFYKQNLTFFVSFIIIVTTQVLGYGWAGLFRRYLVEPAVMWWPYNLVQVSLFGALH  218

Query  1468  DVETRPKGGLTRLQFFIIVLVCSFAYYVVPNYLFPSLTALSLLCWIWKNSVTAQQlgsgl  1289
             + E RP+G LTR QFF+I  +CSFAYYV P YLF  LT+LS +CWI+ NS+ A QLGSG+
Sbjct  219   EKEKRPRGSLTRNQFFLIAFICSFAYYVFPGYLFKMLTSLSWICWIFPNSILAHQLGSGM  278

Query  1288  kglgigSFALDWATVAAFQGSPLVTPDFAIINMLIGYVLVAYIAIPVWYWTNLFDAKKFP  1109
             KGLGI +  LDW++V A+ GSPL +P FA  N+ +G+ L+ Y+  P+ YW +++ AK FP
Sbjct  279   KGLGIAAIGLDWSSVCAYLGSPLASPWFATANIAVGFFLLMYVVAPIAYWLDVYHAKTFP  338

Query  1108  LFSSNVFDSNGQVYNISRVLNKKTFGFDQPGYDSYSNIYLSTAFVYTYGLSFATLAATVS  929
             +FS  +F S+GQ YNIS ++N   F FD   Y+    +YLST F  TYG  FA+L+ATV 
Sbjct  339   IFSDGLFTSSGQKYNISTIINSN-FQFDAGAYEKQGPLYLSTFFTMTYGFGFASLSATVV  397

Query  928   HVALFHGRTIWEQTKESVQDKFSDIHTRLMRKNYEPVPQWWFYlllviivgvalvACQRF  749
             HV LFHGR IW+ +K + QDK  D+HTRLM + Y+ VP  WF  +LV  V + + AC+ +
Sbjct  398   HVLLFHGREIWQTSKLAFQDKKMDVHTRLMSR-YKQVPMRWFVCILVANVVLTIFACEYY  456

Query  748   GGQLQLPVWGVLLAVLLSLIFTLPVGVITATTNQQTGLNVIAELIIGYMYPGRPLASVTF  569
               QLQLP WGVLLA  ++L FTLP+G++TATTNQ  GLNVI E IIGY+YPGRP+A++ F
Sbjct  457   IDQLQLPWWGVLLACAVALFFTLPIGILTATTNQTPGLNVITEYIIGYVYPGRPVANMCF  516

Query  568   KMYGlsslsqslmflSDFKLGHYMKIPPKSMFMVQLVGTLISCCVHFGTGWWLLTTVENI  389
             K+YG  S+ Q+L FL DFKLGHYMKIPP++MFM Q+VGTLIS  VH GT WWL+ T+ NI
Sbjct  517   KVYGFISMKQALNFLQDFKLGHYMKIPPRTMFMAQVVGTLISAMVHLGTAWWLMNTIPNI  576

Query  388   CNPSKLPEGSQWTCPGDDVFYNASIIWGVVSPRRMFGNLGIYQATNYFFLVGFLAPIPVW  209
             C+ +KL   S WTCPGD VFY+AS++WG++ PRR+FG+LG Y A N+FFL+G + P+ VW
Sbjct  577   CDRTKLSPDSPWTCPGDHVFYDASVVWGLIGPRRIFGDLGSYSAINWFFLLGAIGPLLVW  636

Query  208   YLGRKYPEKRWVSLINMPILISGAEGIPIVKSVNYVCWFAVGLYFNLYVYRKHKGWWARH  29
                + +P  +W+ LI MPI+IS    +P   +VNY  W  VG  F   +YR  + WW RH
Sbjct  637   LAHKTFPRHQWIRLITMPIMISALGQMPPATAVNYTTWITVGFVFGFVIYRYRRDWWQRH  696

Query  28    NYILSAGLD  2
             NY+LS  LD
Sbjct  697   NYVLSGALD  705



>ref|XP_009407958.1| PREDICTED: oligopeptide transporter 7-like [Musa acuminata subsp. 
malaccensis]
Length=759

 Score =   732 bits (1889),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 362/668 (54%), Positives = 489/668 (73%), Gaps = 3/668 (0%)
 Frame = -1

Query  2005  DSPVEEVRLTVPITDDPTMPCVTFRTWVLGVTSCVILAFLNQFFGYRQNALYVSSVPAQI  1826
             +SP+E+V LTVP+ DDPTMP +TFR WVLG  SCV+L+FLNQFF YR+  L ++S+ AQI
Sbjct  45    NSPIEQVALTVPVEDDPTMPVLTFRMWVLGTASCVLLSFLNQFFWYRKEPLSITSISAQI  104

Query  1825  VVLPMGKLMAAYLPTKVVQIPGTKWSFSLNPGPFNIKEHVLITIFASSGSDFSYAVSIIT  1646
              V+P+G LMA+ +  +V    G++W F+LNPGPFNIKEHVLITIFA+SG+   YA+ ++T
Sbjct  105   AVVPLGHLMASTITDRVF-FKGSRWEFTLNPGPFNIKEHVLITIFANSGAGSVYAIHVVT  163

Query  1645  MMKAFYYRDIHPLAAVLLTFSTQMLGYGLAGIFKKFLIDSPYMWWPSNLVQVSLFRALHD  1466
              +K FY + I    ++L+  +TQ+LG+G AGIF+++L++   MWWP NLVQVSLFRALH+
Sbjct  164   AVKIFYGKHITFFVSLLVVITTQVLGFGWAGIFRRYLVEPAAMWWPYNLVQVSLFRALHE  223

Query  1465  VETRPKGGLTRLQFFIIVLVCSFAYYVVPNYLFPSLTALSLLCWIWKNSVTAQQlgsglk  1286
              E R KGG+TR QFF++  +CSFAYYV P YLF  LT+LS +CWI+ +S+ AQQLGSGL 
Sbjct  224   REDRAKGGMTRNQFFMMAFICSFAYYVFPGYLFSMLTSLSWICWIFPHSILAQQLGSGLY  283

Query  1285  glgigSFALDWATVAAFQGSPLVTPDFAIINMLIGYVLVAYIAIPVWYWTNLFDAKKFPL  1106
             GLG+G+  LDW+T++++ GSPL +P FA  N+  G+VL+ Y+  P  YW +L+DAK FP+
Sbjct  284   GLGLGAIGLDWSTISSYLGSPLASPWFATANVAAGFVLIMYVVTPTAYWLDLYDAKTFPI  343

Query  1105  FSSNVFDSNGQVYNISRVLNKKTFGFDQPGYDSYSNIYLSTAFVYTYGLSFATLAATVSH  926
             FS  +F S GQ YNIS +++   F  D   YD    +YLST F  TYG+ FA+L AT+SH
Sbjct  344   FSDGLFTSTGQSYNISSIIDSN-FHLDIEAYDKNGPLYLSTFFAVTYGVGFASLTATISH  402

Query  925   VALFHGRTIWEQTKESVQDKFSDIHTRLMRKNYEPVPQWWFYlllviivgvalvACQRFG  746
             V LFHG  IW+ +K + ++K  DIHT+LM + Y  VPQWWF ++LV  + + + AC+ + 
Sbjct  403   VLLFHGSEIWQMSKSAFEEKKMDIHTKLMSR-YTQVPQWWFIVILVANIALTIFACEYYI  461

Query  745   GQLQLPVWGVLLAVLLSLIFTLPVGVITATTNQQTGLNVIAELIIGYMYPGRPLASVTFK  566
              QLQLP WGVLLA  +++ FTLP+G+ITATTNQ  GLN+I E ++GY+YPGRP+A++ FK
Sbjct  462   DQLQLPWWGVLLACFIAIFFTLPIGIITATTNQTPGLNIITEYVMGYLYPGRPVANMCFK  521

Query  565   MYGlsslsqslmflSDFKLGHYMKIPPKSMFMVQLVGTLISCCVHFGTGWWLLTTVENIC  386
             +YG  S++Q+L FL DFKLGHYMKIPP++MFM Q+VGTL++  V+ GT WWL+ T+ NIC
Sbjct  522   VYGYISMTQALTFLQDFKLGHYMKIPPRTMFMAQVVGTLVAAIVYLGTAWWLMETIPNIC  581

Query  385   NPSKLPEGSQWTCPGDDVFYNASIIWGVVSPRRMFGNLGIYQATNYFFLVGFLAPIPVWY  206
             N   L   S WTCP D VFY+AS+IWG++ PRR+FG+LG Y A N+FFLVG +AP+ VW 
Sbjct  582   NTELLSSDSPWTCPSDHVFYDASVIWGLIGPRRIFGDLGTYSAINWFFLVGAVAPLLVWL  641

Query  205   LGRKYPEKRWVSLINMPILISGAEGIPIVKSVNYVCWFAVGLYFNLYVYRKHKGWWARHN  26
               + +P + W+ LINMP+LI     +P   +VNY  W  VG +    VYR  + WW RHN
Sbjct  642   AHKAFPGQDWIRLINMPVLIGATGMMPPATAVNYTTWIIVGFFSGYVVYRYRRDWWTRHN  701

Query  25    YILSAGLD  2
             Y+LS  LD
Sbjct  702   YVLSGALD  709



>ref|XP_006397011.1| hypothetical protein EUTSA_v10028453mg [Eutrema salsugineum]
 gb|ESQ38464.1| hypothetical protein EUTSA_v10028453mg [Eutrema salsugineum]
Length=764

 Score =   732 bits (1889),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 362/676 (54%), Positives = 499/676 (74%), Gaps = 7/676 (1%)
 Frame = -1

Query  2029  ESSADEINDSPVEEVRLTVPITDDPTMPCVTFRTWVLGVTSCVILAFLNQFFGYRQNALY  1850
             +S  DE N SP+ +V LTVP TDDP++P +TFR WVLG  SC++L+FLNQFF YR   L 
Sbjct  45    DSGEDEEN-SPIRQVALTVPTTDDPSLPVLTFRMWVLGTLSCILLSFLNQFFWYRTEPLT  103

Query  1849  VSSVPAQIVVLPMGKLMAAYLPTKVVQIPGTKWSFSLNPGPFNIKEHVLITIFASSGSDF  1670
             +S++ AQI V+P+G+LMAA +  +V  + G+KW F+LNPGPFN+KEHVLITIFA++G+  
Sbjct  104   ISAISAQIAVVPLGRLMAAKISDRVF-LQGSKWEFTLNPGPFNVKEHVLITIFANAGAGS  162

Query  1669  SYAVSIITMMKAFYYRDIHPLAAVLLTFSTQMLGYGLAGIFKKFLIDSPYMWWPSNLVQV  1490
              YA+ I+T+++AFY +++    + ++  +TQ+LG+G AGIF+K+L++   MWWP+NLVQV
Sbjct  163   VYAIHIVTVVRAFYMKNLTFFVSFIVIVTTQVLGFGWAGIFRKYLVEPAAMWWPANLVQV  222

Query  1489  SLFRALHDVETRPKGGLTRLQFFIIVLVCSFAYYVVPNYLFPSLTALSLLCWIWKNSVTA  1310
             SLFRALH+ E R KGGLTR QFF+I  VCSFAYYV P YLF  LT+LS +CW +  SV A
Sbjct  223   SLFRALHEKEERTKGGLTRTQFFLIAFVCSFAYYVFPGYLFQILTSLSWICWFFPASVMA  282

Query  1309  QQlgsglkglgigSFALDWATVAAFQGSPLVTPDFAIINMLIGYVLVAYIAIPVWYWTNL  1130
             QQ+GSGL GLG+G+  LDW+T++++ GSPL +P FA  N+ +G+VL+ Y+ +P+ YW ++
Sbjct  283   QQIGSGLHGLGVGAIGLDWSTISSYLGSPLASPWFATANVGVGFVLLVYVLVPICYWLDV  342

Query  1129  FDAKKFPLFSSNVFDSNGQVYNISRVLNKKTFGFDQPGYDSYSNIYLSTAFVYTYGLSFA  950
             + AK FPLFSS++F + G  YNI+ +++ K F  D   Y+    +YLST F  +YG+ FA
Sbjct  343   YKAKTFPLFSSSLFTNEGSKYNITSIIDSK-FHLDLQAYEREGPLYLSTFFAISYGVGFA  401

Query  949   TLAATVSHVALFHGRTIWEQTKESVQDKFSDIHTRLMRKNYEPVPQWWFYlllviivgva  770
              L+AT+ HVALFHGR IWEQ+KES ++K  DIH +LM++ Y+ VP+WWF+ +L   +GV 
Sbjct  402   ALSATIMHVALFHGREIWEQSKESFKEKKLDIHAKLMKR-YKQVPEWWFWCILATNIGVT  460

Query  769   lvACQRFGGQLQLPVWGVLLAVLLSLIFTLPVGVITATTNQQTGLNVIAELIIGYMYPGR  590
             + AC+ +  QLQLP WGVLLA  +++IFTLP+G++TA TNQ  GLN+I E IIGY+YPG 
Sbjct  461   IFACEYYKDQLQLPWWGVLLACTIAIIFTLPIGILTAITNQAPGLNIITEYIIGYIYPGY  520

Query  589   PLASVTFKMYGlsslsqslmflSDFKLGHYMKIPPKSMFMVQLVGTLISCCVHFGTGWWL  410
             P+A++ FK+YG  S+ Q++ FL DFKLGHYMKIPP++MFM Q+VGTLISC V+  T WWL
Sbjct  521   PVANMCFKVYGYISMQQAITFLQDFKLGHYMKIPPRTMFMAQIVGTLISCLVYLITAWWL  580

Query  409   LTTVENICNPSKLPEGSQWTCPGDDVFYNASIIWGVVSPRRMFGNLGIYQATNYFFLVGF  230
             + T+ NIC+       S WTCPGD VFY+AS+IWG++ PRR+FG+LG+Y++ N+FFLVG 
Sbjct  581   METIPNICDSVS---NSVWTCPGDKVFYDASVIWGLIGPRRIFGDLGLYKSVNWFFLVGA  637

Query  229   LAPIPVWYLGRKYPEKRWVSLINMPILISGAEGIPIVKSVNYVCWFAVGLYFNLYVYRKH  50
             +AP+ VW   R +P + W+ LINMP+LIS    +P   +VNY  W   G      V+R  
Sbjct  638   IAPVLVWLASRTFPRQEWIKLINMPVLISATSSMPPATAVNYTTWVLAGFLSGFVVFRYR  697

Query  49    KGWWARHNYILSAGLD  2
                W R+NY+LS  LD
Sbjct  698   PNLWQRYNYVLSGALD  713



>ref|XP_007039426.1| Oligopeptide transporter 7 isoform 1 [Theobroma cacao]
 gb|EOY23927.1| Oligopeptide transporter 7 isoform 1 [Theobroma cacao]
Length=762

 Score =   732 bits (1889),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 362/668 (54%), Positives = 492/668 (74%), Gaps = 5/668 (1%)
 Frame = -1

Query  2005  DSPVEEVRLTVPITDDPTMPCVTFRTWVLGVTSCVILAFLNQFFGYRQNALYVSSVPAQI  1826
             +SPV +V LTVP TDDP++P +TFR WVLG  SCV+L+FLNQFF YR   L ++++ AQI
Sbjct  49    NSPVRQVALTVPTTDDPSLPVLTFRMWVLGTISCVLLSFLNQFFWYRTEPLTITAISAQI  108

Query  1825  VVLPMGKLMAAYLPTKVVQIPGTKWSFSLNPGPFNIKEHVLITIFASSGSDFSYAVSIIT  1646
              V+P+G+LMAA +  +V    GT+W FSLNPGPFN+KEHVLITIFA+SG+   YA+ ++T
Sbjct  109   AVVPLGQLMAAKITDRVF-FKGTRWEFSLNPGPFNVKEHVLITIFANSGAGSVYAIHVVT  167

Query  1645  MMKAFYYRDIHPLAAVLLTFSTQMLGYGLAGIFKKFLIDSPYMWWPSNLVQVSLFRALHD  1466
             ++K FY + I    ++++  +TQ+LG+G AGIF+++L++   MWWP+NLVQVSLFRALH+
Sbjct  168   VVKVFYKKHITFFVSLIVIITTQVLGFGWAGIFRRYLVEPAAMWWPANLVQVSLFRALHE  227

Query  1465  VETRPKGGLTRLQFFIIVLVCSFAYYVVPNYLFPSLTALSLLCWIWKNSVTAQQlgsglk  1286
              E R KGG+TR QFF+I L+CSFAYYV P YLF  LT+LS +CWI+  SV AQQLGSGL 
Sbjct  228   KEERAKGGVTRTQFFLIALICSFAYYVFPGYLFQMLTSLSWICWIFPKSVLAQQLGSGLY  287

Query  1285  glgigSFALDWATVAAFQGSPLVTPDFAIINMLIGYVLVAYIAIPVWYWTNLFDAKKFPL  1106
             GLGIG+  LDW+T++++ GSPL +P FA  N+  G++L+ Y+  P+ YW N+++AK FP+
Sbjct  288   GLGIGAIGLDWSTISSYLGSPLASPWFATANVAAGFILIMYVLTPITYWLNVYNAKTFPI  347

Query  1105  FSSNVFDSNGQVYNISRVLNKKTFGFDQPGYDSYSNIYLSTAFVYTYGLSFATLAATVSH  926
             FS  +F S GQ YNI+ +++   F  D   Y+    +YLST F  TYG+ FA L AT+ H
Sbjct  348   FSDALFTSTGQEYNITAIIDSN-FHLDIAAYEKEGPLYLSTFFAMTYGVGFAALTATIVH  406

Query  925   VALFHGRTIWEQTKESVQDKFSDIHTRLMRKNYEPVPQWWFYlllviivgvalvACQRFG  746
             VALFHGR IWEQ+K S Q+K  D+HTRLMRK Y+ VP+WWF  +L++ +   ++AC+ + 
Sbjct  407   VALFHGREIWEQSKASFQEKKMDVHTRLMRK-YKQVPEWWFVCILLVNIAATILACEYYN  465

Query  745   GQLQLPVWGVLLAVLLSLIFTLPVGVITATTNQQTGLNVIAELIIGYMYPGRPLASVTFK  566
              QLQLP WGVLLA  ++++FTLP+G+ITA TNQ  GLN+I E IIGY+YPG P+A++ FK
Sbjct  466   DQLQLPWWGVLLACGIAIVFTLPIGIITAITNQTPGLNIITEYIIGYIYPGYPVANMCFK  525

Query  565   MYGlsslsqslmflSDFKLGHYMKIPPKSMFMVQLVGTLISCCVHFGTGWWLLTTVENIC  386
             +YG  S++Q++ FL DFKLGHYMKIPP++MFM Q+VGTLI+C V+ GT WWL+ T+ +IC
Sbjct  526   VYGYISMTQAVTFLQDFKLGHYMKIPPRTMFMAQVVGTLIACFVYLGTAWWLMETIPDIC  585

Query  385   NPSKLPEGSQWTCPGDDVFYNASIIWGVVSPRRMFGNLGIYQATNYFFLVGFLAPIPVWY  206
             + +     S WTCP D VFY+AS+IWG+V+PRR+FG+LG Y+A N+FFL G +AP+ VW 
Sbjct  586   DTTA--SNSVWTCPSDTVFYDASVIWGLVAPRRIFGDLGTYEAINWFFLAGAIAPLLVWL  643

Query  205   LGRKYPEKRWVSLINMPILISGAEGIPIVKSVNYVCWFAVGLYFNLYVYRKHKGWWARHN  26
               + +P + W+ LINMP+LI     +P   +VNY  W  VG      VYR     W R+N
Sbjct  644   ATKAFPHQEWIKLINMPVLIGATGMMPPATAVNYTTWIIVGFLSGFVVYRYRPDLWQRYN  703

Query  25    YILSAGLD  2
             Y+LS  LD
Sbjct  704   YVLSGSLD  711



>ref|XP_006289826.1| hypothetical protein CARUB_v10003431mg [Capsella rubella]
 gb|EOA22724.1| hypothetical protein CARUB_v10003431mg [Capsella rubella]
Length=766

 Score =   732 bits (1889),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 360/680 (53%), Positives = 497/680 (73%), Gaps = 6/680 (1%)
 Frame = -1

Query  2041  ISAVESSADEINDSPVEEVRLTVPITDDPTMPCVTFRTWVLGVTSCVILAFLNQFFGYRQ  1862
             I  + S  +E  +SP+ +V LTVP TDDP++P +TFR WVLG  SC++L+FLNQFF YR 
Sbjct  42    ILPISSEEEEEENSPIRQVALTVPTTDDPSLPVLTFRMWVLGTLSCILLSFLNQFFWYRT  101

Query  1861  NALYVSSVPAQIVVLPMGKLMAAYLPTKVVQIPGTKWSFSLNPGPFNIKEHVLITIFASS  1682
               L +S++ AQI V+P+G+LMAA +  +V    G+KW F+LNPGPFN+KEHVLITIFA++
Sbjct  102   EPLTISAISAQIAVVPLGRLMAAKISERV-YFQGSKWQFTLNPGPFNVKEHVLITIFANA  160

Query  1681  GSDFSYAVSIITMMKAFYYRDIHPLAAVLLTFSTQMLGYGLAGIFKKFLIDSPYMWWPSN  1502
             G+   YA+ ++T++KAFY ++I    + ++  +TQ+LG+G AGIF+K+L++   MWWP+N
Sbjct  161   GAGSVYAIHVVTVVKAFYMKNITFFVSFIVIVTTQVLGFGWAGIFRKYLVEPAAMWWPAN  220

Query  1501  LVQVSLFRALHDVETRPKGGLTRLQFFIIVLVCSFAYYVVPNYLFPSLTALSLLCWIWKN  1322
             LVQVSLFRALH+ E R KGGLTR QFF+I  +CSFAYYV P YLF  +T+LS +CW + +
Sbjct  221   LVQVSLFRALHEKEERTKGGLTRTQFFLIAFICSFAYYVFPGYLFQIMTSLSWVCWFFPS  280

Query  1321  SVTAQQlgsglkglgigSFALDWATVAAFQGSPLVTPDFAIINMLIGYVLVAYIAIPVWY  1142
             SV AQQ+GSGL GLG+G+  LDW+T++++ GSPL +P FA  N+ +G+VLV Y+ +P+ Y
Sbjct  281   SVMAQQIGSGLHGLGVGAIGLDWSTISSYLGSPLASPWFATANVGVGFVLVIYVLVPICY  340

Query  1141  WTNLFDAKKFPLFSSNVFDSNGQVYNISRVLNKKTFGFDQPGYDSYSNIYLSTAFVYTYG  962
             W ++F AK FP+FSS++F + G  YNI+ +++   F  D P Y+    +YLST F  +YG
Sbjct  341   WLDVFKAKTFPIFSSSLFTNQGSKYNITSIIDSN-FHLDLPAYEREGPLYLSTFFAISYG  399

Query  961   LSFATLAATVSHVALFHGRTIWEQTKESVQDKFSDIHTRLMRKNYEPVPQWWFYlllvii  782
             + FA L+AT+ HVALFHGR IWEQ+KES  +K  D+H RLM++ Y+ VP+WWF+ +LV  
Sbjct  400   VGFAALSATIMHVALFHGREIWEQSKESFNEKKLDVHARLMKR-YKQVPEWWFWSILVTN  458

Query  781   vgvalvACQRFGGQLQLPVWGVLLAVLLSLIFTLPVGVITATTNQQTGLNVIAELIIGYM  602
             +   + AC+ +  QLQLP WGVLLA  +++IFTLP+G+ITA TNQ  GLN+I E IIGY+
Sbjct  459   IAATIFACEYYNDQLQLPWWGVLLACTIAIIFTLPIGIITAITNQAPGLNIITEYIIGYI  518

Query  601   YPGRPLASVTFKMYGlsslsqslmflSDFKLGHYMKIPPKSMFMVQLVGTLISCCVHFGT  422
             YPG P+A++ FK+YG  S+ Q++ FL DFKLGHYMKIPP++MFM Q+VGTLISC V+  T
Sbjct  519   YPGYPVANMCFKVYGYISMQQAITFLQDFKLGHYMKIPPRTMFMAQIVGTLISCLVYLTT  578

Query  421   GWWLLTTVENICNPSKLPEGSQWTCPGDDVFYNASIIWGVVSPRRMFGNLGIYQATNYFF  242
              WWL+ T+ NIC+       S WTCP D VFY+AS+IWG++ PRR+FG+LG+Y++ N+FF
Sbjct  579   AWWLMETIPNICDTVT---NSVWTCPSDKVFYDASVIWGLIGPRRIFGDLGLYKSVNWFF  635

Query  241   LVGFLAPIPVWYLGRKYPEKRWVSLINMPILISGAEGIPIVKSVNYVCWFAVGLYFNLYV  62
             LVG +AP+ VW   R +P + W+ LINMP+LIS    +P   +VNY  W   G      V
Sbjct  636   LVGAIAPVLVWLASRTFPRQEWIKLINMPVLISATSSMPPATAVNYTTWVLAGFLSGFVV  695

Query  61    YRKHKGWWARHNYILSAGLD  2
             +R     W R+NY+LS  LD
Sbjct  696   FRYRPNLWQRYNYVLSGALD  715



>ref|XP_009359568.1| PREDICTED: LOW QUALITY PROTEIN: oligopeptide transporter 7-like 
[Pyrus x bretschneideri]
Length=757

 Score =   731 bits (1888),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 373/708 (53%), Positives = 509/708 (72%), Gaps = 9/708 (1%)
 Frame = -1

Query  2119  RDTRERVSSFKNSSLSRLLH*MENTGISA--VESSADEINDSPVEEVRLTVPITDDPTMP  1946
             R++ E  SS + +SL       ++ G       S + E  +SPVE+V LTVP TDDP++P
Sbjct  6     RESMEEASSHEITSLLIPKEEKKHEGFHGQSSSSGSTEEENSPVEQVALTVPTTDDPSLP  65

Query  1945  CVTFRTWVLGVTSCVILAFLNQFFGYRQNALYVSSVPAQIVVLPMGKLMAAYLPTKVVQI  1766
              +TFR WVLG  SCV+L+FLNQFF YR   L ++++ AQI V+P+G+LMA+ +  +V   
Sbjct  66    VLTFRMWVLGTLSCVLLSFLNQFFWYRTEPLSITAISAQIAVVPLGQLMASKITNRVF-F  124

Query  1765  PGTKWSFSLNPGPFNIKEHVLITIFASSGSDFSYAVSIITMMKAFYYRDIHPLAAVLLTF  1586
              G++W F+LNPGPFN+KEHVLITIFA+SG+   YA+ I+T++K FY + I    ++L+  
Sbjct  125   KGSRWEFTLNPGPFNVKEHVLITIFANSGAGTVYAIHIVTVVKVFYKKHITFFVSLLVIL  184

Query  1585  STQMLGYGLAGIFKKFLIDSPYMWWPSNLVQVSLFRALHDVETRPKGGLTRLQFFIIVLV  1406
             +TQ+LG+G AGIF+++L++   MWWP+NLVQVSLFRALH+ E RPKGGLTR QFF+I  +
Sbjct  185   TTQVLGFGWAGIFRRYLVEPAAMWWPANLVQVSLFRALHEKEARPKGGLTRTQFFLISFM  244

Query  1405  CSFAYYVVPNYLFPSLTALSLLCWIWKNSVTAQQlgsglkglgigSFALDWATVAAFQGS  1226
             CSFAYYV P YLF  LT+LS +CWI+ N+V AQQLGSGL GLGIG+  +DW+T++++ GS
Sbjct  245   CSFAYYVFPGYLFQMLTSLSWICWIFPNNVLAQQLGSGLYGLGIGAVGIDWSTISSYLGS  304

Query  1225  PLVTPDFAIINMLIGYVLVAYIAIPVWYWTNLFDAKKFPLFSSNVFDSNGQVYNISRVLN  1046
             PL +P FA  N+  G+  V YI  P+ YW N++ AK FP+FS  +F SNGQ YNI+ +++
Sbjct  305   PLASPWFATANVAAGFFFVMYILTPICYWFNIYKAKTFPIFSDTLFTSNGQEYNITAIID  364

Query  1045  KKTFGFDQPGYDSYSNIYLSTAFVYTYGLSFATLAATVSHVALFHGRTIWEQTKESVQDK  866
                F  D   Y+    +YLST F  TYG+ FA L ATV HVALFHGR IWEQ+K S ++K
Sbjct  365   SN-FHLDLEAYEREGPLYLSTFFAITYGVGFAALTATVVHVALFHGREIWEQSKASFKEK  423

Query  865   FSDIHTRLMRKNYEPVPQWWFYlllviivgvalvACQRFGGQLQLPVWGVLLAVLLSLIF  686
               D+HTRLM++ Y  VP+WWF ++L++ + V + +CQ +  QLQLP WGVLLA +++++F
Sbjct  424   KMDVHTRLMQR-YNQVPEWWFVIILLVNIAVTIFSCQYYIEQLQLPWWGVLLACVIAIVF  482

Query  685   TLPVGVITATTNQQTGLNVIAELIIGYMYPGRPLASVTFKMYGlsslsqslmflSDFKLG  506
             TLP+G+ITA TNQ  GLN+I E IIGY+YPG P+A++ FK+YG  S++Q++ FL DFKLG
Sbjct  483   TLPIGIITAITNQTPGLNIITEYIIGYIYPGYPVANMCFKVYGXISMTQAITFLQDFKLG  542

Query  505   HYMKIPPKSMFMVQLVGTLISCCVHFGTGWWLLTTVENICNPSKLPEGSQWTCPGDDVFY  326
             HYMKIPP++MF  Q+VGTLI+  V+ GT WWL+ T+ +IC  +     S WTCP D VFY
Sbjct  543   HYMKIPPRTMFTAQVVGTLIAAIVYLGTAWWLMETIPDICEDTS----SIWTCPSDTVFY  598

Query  325   NASIIWGVVSPRRMFGNLGIYQATNYFFLVGFLAPIPVWYLGRKYPEKRWVSLINMPILI  146
             +AS+IWG++ PRR+FG+LGIY+A N+FFLVG +API VW   + +P++ W+ LINMP+LI
Sbjct  599   DASVIWGLIGPRRIFGDLGIYEAINWFFLVGAIAPIFVWLAAKAFPQQEWIRLINMPVLI  658

Query  145   SGAEGIPIVKSVNYVCWFAVGLYFNLYVYRKHKGWWARHNYILSAGLD  2
                  +P   +VNY  W  +G      VYR    WW RHNY+LS  LD
Sbjct  659   GATGLMPPATAVNYTSWIILGFLSGFVVYRYRPNWWRRHNYVLSGALD  706



>ref|XP_011022429.1| PREDICTED: oligopeptide transporter 7-like [Populus euphratica]
Length=760

 Score =   731 bits (1888),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 372/706 (53%), Positives = 501/706 (71%), Gaps = 12/706 (2%)
 Frame = -1

Query  2119  RDTRERVSSFKNSSLSRLLH*MENTGISAVESSADEINDSPVEEVRLTVPITDDPTMPCV  1940
             RD ++  ++  N   S        +  S +  + DE N SPV++V LTVP TDDP++P +
Sbjct  16    RDEKDEDNTDNNLPSS------SKSQTSEINQAHDEEN-SPVKQVALTVPTTDDPSLPVL  68

Query  1939  TFRTWVLGVTSCVILAFLNQFFGYRQNALYVSSVPAQIVVLPMGKLMAAYLPTKVVQIPG  1760
             TFR WVLG  SCV+L+FLNQFF YR   L ++++ AQI V+P+G+LMAA +  +V    G
Sbjct  69    TFRMWVLGTISCVLLSFLNQFFWYRTEPLSITAISAQIAVVPLGQLMAAKITDRVF-FKG  127

Query  1759  TKWSFSLNPGPFNIKEHVLITIFASSGSDFSYAVSIITMMKAFYYRDIHPLAAVLLTFST  1580
             T+  F+LNPGPFN+KEHVLITIFA+SG+   YA+ I+T++KAFY ++I    + ++  +T
Sbjct  128   TRCEFTLNPGPFNVKEHVLITIFANSGAGSVYAIHIVTVVKAFYKKNITLFVSFIVIITT  187

Query  1579  QMLGYGLAGIFKKFLIDSPYMWWPSNLVQVSLFRALHDVETRPKGGLTRLQFFIIVLVCS  1400
             Q+LG+G AGIF+++L++   MWWP+NLVQVSLFRALH+ E R KGG+TR QFF+I   CS
Sbjct  188   QVLGFGWAGIFRRYLVEPAAMWWPANLVQVSLFRALHEKEERSKGGVTRTQFFLIAFTCS  247

Query  1399  FAYYVVPNYLFPSLTALSLLCWIWKNSVTAQQlgsglkglgigSFALDWATVAAFQGSPL  1220
             FAYYV P YLF  LT+LS +CWI+  S+ AQQLGSGL GLGIG+F LDW+T++++ GSPL
Sbjct  248   FAYYVFPGYLFEMLTSLSWICWIFPKSILAQQLGSGLYGLGIGAFGLDWSTISSYLGSPL  307

Query  1219  VTPDFAIINMLIGYVLVAYIAIPVWYWTNLFDAKKFPLFSSNVFDSNGQVYNISRVLNKK  1040
              +P FA  N+  G+V V YI  P+ YW N++ AK FP+FS ++F + GQ YNIS +++  
Sbjct  308   ASPWFATANVAAGFVFVMYILTPLCYWFNVYKAKTFPIFSDDLFTATGQEYNISAIIDSN  367

Query  1039  TFGFDQPGYDSYSNIYLSTAFVYTYGLSFATLAATVSHVALFHGRTIWEQTKESVQDKFS  860
              F  D   YD    +YLST F  TYG+ FA L AT+ HVALFHGR IWEQ+  S Q++  
Sbjct  368   -FHLDLAAYDRQGPLYLSTFFAVTYGVGFAALTATIVHVALFHGREIWEQSMASFQERTM  426

Query  859   DIHTRLMRKNYEPVPQWWFYlllviivgvalvACQRFGGQLQLPVWGVLLAVLLSLIFTL  680
             DIHTR MRK Y  VP+WWF  +L++ + + + AC+ +  QLQLP WGVLLA  +++ FTL
Sbjct  427   DIHTRHMRK-YNQVPEWWFVCILLVNIALTIFACEYYKDQLQLPWWGVLLACGIAITFTL  485

Query  679   PVGVITATTNQQTGLNVIAELIIGYMYPGRPLASVTFKMYGlsslsqslmflSDFKLGHY  500
             P+G+ITA TNQ  GLN+I E IIGY+YPG P+A++ FK+YG  S++Q++ FL DFKLGHY
Sbjct  486   PIGIITAITNQSPGLNIITEYIIGYIYPGYPVANMCFKVYGYISMTQAVTFLQDFKLGHY  545

Query  499   MKIPPKSMFMVQLVGTLISCCVHFGTGWWLLTTVENICNPSKLPEGSQWTCPGDDVFYNA  320
             MKIPP++MFM Q+VGT+I+C  + GT WWLL T+ +IC+ S     S WTCP D VFY+A
Sbjct  546   MKIPPRTMFMAQVVGTIIACITYLGTAWWLLETITDICDASA--SDSVWTCPSDHVFYDA  603

Query  319   SIIWGVVSPRRMFGNLGIYQATNYFFLVGFLAPIPVWYLGRKYPEKRWVSLINMPILISG  140
             S+IWG++ PRR+FGNLG Y+A N+FFLVG +API VW   + +P++ W+ LINMP+LI  
Sbjct  604   SVIWGLIGPRRIFGNLGTYEAVNWFFLVGAIAPILVWLAAKAFPQQEWIRLINMPVLIGA  663

Query  139   AEGIPIVKSVNYVCWFAVGLYFNLYVYRKHKGWWARHNYILSAGLD  2
                +P   +VNY  W  VG      VYR     W R+NY+LS  LD
Sbjct  664   TGMMPPATAVNYTTWVLVGFLSGFVVYRYKPDLWQRYNYVLSGSLD  709



>ref|XP_002437735.1| hypothetical protein SORBIDRAFT_10g001530 [Sorghum bicolor]
 gb|EER89102.1| hypothetical protein SORBIDRAFT_10g001530 [Sorghum bicolor]
Length=785

 Score =   732 bits (1890),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 364/674 (54%), Positives = 491/674 (73%), Gaps = 3/674 (0%)
 Frame = -1

Query  2023  SADEINDSPVEEVRLTVPITDDPTMPCVTFRTWVLGVTSCVILAFLNQFFGYRQNALYVS  1844
             S+ E  +SP+E+V LTVP+ DDPT P +TFR WVLG  SC +L+FLNQFF YR+  L ++
Sbjct  64    SSSEGENSPIEQVALTVPVGDDPTTPVLTFRMWVLGTASCALLSFLNQFFWYRKEPLTIT  123

Query  1843  SVPAQIVVLPMGKLMAAYLPTKVVQIPGTKWSFSLNPGPFNIKEHVLITIFASSGSDFSY  1664
             ++ AQI V+P+G+LMAA LP +   + GT+W FSLNPGPFN+KEHVLITIFA+SG+   Y
Sbjct  124   AISAQIAVVPLGRLMAAALPERAF-LRGTRWEFSLNPGPFNVKEHVLITIFANSGAGTVY  182

Query  1663  AVSIITMMKAFYYRDIHPLAAVLLTFSTQMLGYGLAGIFKKFLIDSPYMWWPSNLVQVSL  1484
             A+ +IT ++ FY ++I    ++L+  +TQ+LG+G AGIF+++L++   MWWPSNLVQVSL
Sbjct  183   AIHVITAVRVFYGKNITFFVSLLVVLTTQVLGFGWAGIFRRYLVEPAAMWWPSNLVQVSL  242

Query  1483  FRALHDVETRPKGGLTRLQFFIIVLVCSFAYYVVPNYLFPSLTALSLLCWIWKNSVTAQQ  1304
             FRALH+ E R KGG+TR QFF++  +CSFAYY+ P YLF  LT+LS +CW++ +SV AQQ
Sbjct  243   FRALHERERRVKGGMTRNQFFLVAFICSFAYYIFPGYLFQMLTSLSWICWVFPHSVLAQQ  302

Query  1303  lgsglkglgigSFALDWATVAAFQGSPLVTPDFAIINMLIGYVLVAYIAIPVWYWTNLFD  1124
             LGSGL GLGIG+  LDW+T++++ GSPL +P FA  N+  G+ ++ Y+  P+ YW N + 
Sbjct  303   LGSGLTGLGIGAIGLDWSTISSYLGSPLASPWFATANVAAGFFIIMYVITPIAYWFNFYK  362

Query  1123  AKKFPLFSSNVFDSNGQVYNISRVLNKKTFGFDQPGYDSYSNIYLSTAFVYTYGLSFATL  944
             A+ FP+FS  +F   GQ YNIS +++   F FD   Y+    +YLST F  TYG+ FA+L
Sbjct  363   AQNFPIFSDGLFTLTGQTYNISSIVDSH-FQFDTEAYEKNGPLYLSTFFAVTYGVGFASL  421

Query  943   AATVSHVALFHGRTIWEQTKESVQDKFSDIHTRLMRKNYEPVPQWWFYlllviivgvalv  764
              AT+ HV LFHG  I + +K + Q+K  DIHT+LMR+ Y+ VP+WWF  +L+  + V + 
Sbjct  422   TATIVHVFLFHGSEILQLSKSAFQEKKVDIHTKLMRR-YKQVPEWWFICILIANIAVTIF  480

Query  763   ACQRFGGQLQLPVWGVLLAVLLSLIFTLPVGVITATTNQQTGLNVIAELIIGYMYPGRPL  584
             AC+ +  QLQLP WGVLLA  ++  FTLP+G+ITATTNQ  GLN+I E I+GY+YPGRP+
Sbjct  481   ACEYYIEQLQLPWWGVLLACAIAFTFTLPIGIITATTNQTPGLNIITEYIMGYLYPGRPV  540

Query  583   ASVTFKMYGlsslsqslmflSDFKLGHYMKIPPKSMFMVQLVGTLISCCVHFGTGWWLLT  404
             A++ FK+YG  S+SQ+L FL DFKLGHYMKIPP++MFM Q+VGTLI+  V+ GT WWL+ 
Sbjct  541   ANMCFKVYGYISMSQALTFLQDFKLGHYMKIPPRTMFMAQVVGTLIAAFVYLGTAWWLMD  600

Query  403   TVENICNPSKLPEGSQWTCPGDDVFYNASIIWGVVSPRRMFGNLGIYQATNYFFLVGFLA  224
             TV NICN   LP  S WTCPGD VFY+AS+IWG++SPRR+FG+LG Y A N+FFL G +A
Sbjct  601   TVPNICNTELLPSDSPWTCPGDHVFYDASVIWGLISPRRIFGDLGTYSAVNWFFLGGAVA  660

Query  223   PIPVWYLGRKYPEKRWVSLINMPILISGAEGIPIVKSVNYVCWFAVGLYFNLYVYRKHKG  44
             P+ VW   + +P + W+ LINMP++I     +P   +VNY  W  VG      VYR  + 
Sbjct  661   PLLVWLAHKAFPSQSWILLINMPVMIGATGMMPPATAVNYTTWILVGFLSGYVVYRYRRD  720

Query  43    WWARHNYILSAGLD  2
             WW RHNY+LS  LD
Sbjct  721   WWERHNYLLSGALD  734



>ref|XP_006380596.1| hypothetical protein POPTR_0007s09650g [Populus trichocarpa]
 gb|ERP58393.1| hypothetical protein POPTR_0007s09650g [Populus trichocarpa]
Length=750

 Score =   731 bits (1886),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 365/672 (54%), Positives = 484/672 (72%), Gaps = 3/672 (0%)
 Frame = -1

Query  2017  DEINDSPVEEVRLTVPITDDPTMPCVTFRTWVLGVTSCVILAFLNQFFGYRQNALYVSSV  1838
             D   +SP+E+V LTVP TDDPT+P VTFRTW LG  +C++L+FLNQFF YR+  L ++S+
Sbjct  32    DSKENSPIEQVALTVPTTDDPTLPAVTFRTWTLGSLACILLSFLNQFFWYRREPLSITSI  91

Query  1837  PAQIVVLPMGKLMAAYLPTKVVQIPGTKWSFSLNPGPFNIKEHVLITIFASSGSDFSYAV  1658
              AQI V+P+G LMA+ +  K   I G KW F+LNPGPFN+KEHVLITIFA+SG+   YA+
Sbjct  92    CAQIAVVPLGHLMASTITNKTFFI-GKKWEFTLNPGPFNVKEHVLITIFANSGAGNVYAI  150

Query  1657  SIITMMKAFYYRDIHPLAAVLLTFSTQMLGYGLAGIFKKFLIDSPYMWWPSNLVQVSLFR  1478
              I++ +K FY +++    A+L+  +TQMLG+G AG+F+++L++   MWWP NLVQVSLFR
Sbjct  151   HIVSAVKLFYKKELTFFVALLVVLTTQMLGFGWAGLFRRYLVEPASMWWPQNLVQVSLFR  210

Query  1477  ALHDVETRPKGGLTRLQFFIIVLVCSFAYYVVPNYLFPSLTALSLLCWIWKNSVTAQQlg  1298
             ALH+ E R K GLTR QFFII  +CSFAYY  P YLFP LT++S LCWI+ +S+ A QLG
Sbjct  211   ALHEKEERHKDGLTRNQFFIIAFICSFAYYAFPGYLFPKLTSISWLCWIFPSSILAHQLG  270

Query  1297  sglkglgigSFALDWATVAAFQGSPLVTPDFAIINMLIGYVLVAYIAIPVWYWTNLFDAK  1118
             SGL GLGIG+F  DWAT++++ GSPL +P FA  N+  G+VL+ Y+  P+ YW N+++AK
Sbjct  271   SGLHGLGIGAFGFDWATISSYLGSPLASPWFATANIAAGFVLLMYVIAPIAYWLNIYEAK  330

Query  1117  KFPLFSSNVFDSNGQVYNISRVLNKKTFGFDQPGYDSYSNIYLSTAFVYTYGLSFATLAA  938
              FP+FS  +F S GQ YNIS +++ K F  D   YD    +YLST F   YGL+FA L A
Sbjct  331   NFPIFSDGLFTSTGQSYNISAIIDPK-FHIDLDAYDRQGPLYLSTIFAMIYGLNFACLTA  389

Query  937   TVSHVALFHGRTIWEQTKESVQDKFSDIHTRLMRKNYEPVPQWWFYlllviivgvalvAC  758
             TV HV LFHGR IW+ +K + + K  D+HT+LMRK Y  VP+WWF  +L + +   +  C
Sbjct  390   TVVHVFLFHGRDIWQLSKSAFRYKKMDVHTKLMRK-YNQVPEWWFLCILFLNIAATIFTC  448

Query  757   QRFGGQLQLPVWGVLLAVLLSLIFTLPVGVITATTNQQTGLNVIAELIIGYMYPGRPLAS  578
             + +  QLQLP WGVLLA  +++ FTLPVGVITATTN+  GLNVI E +IGY+YPG P+A+
Sbjct  449   EYYNEQLQLPWWGVLLACGIAVFFTLPVGVITATTNKTPGLNVITEYVIGYLYPGFPVAN  508

Query  577   VTFKMYGlsslsqslmflSDFKLGHYMKIPPKSMFMVQLVGTLISCCVHFGTGWWLLTTV  398
             + FK+YG  S+ Q + FL DFKLGHYMKIPP++MFM Q+VGT+IS  VH GT WWL+ T+
Sbjct  509   ICFKVYGYISMKQGITFLEDFKLGHYMKIPPRAMFMAQVVGTIISALVHLGTAWWLMETI  568

Query  397   ENICNPSKLPEGSQWTCPGDDVFYNASIIWGVVSPRRMFGNLGIYQATNYFFLVGFLAPI  218
              NIC+   L  GS WTCP D +FY+AS+IWG++ PRR+FG+LG Y ATN+FFL G +API
Sbjct  569   PNICDRELLSPGSPWTCPSDHLFYDASVIWGLIGPRRVFGDLGHYSATNWFFLGGAIAPI  628

Query  217   PVWYLGRKYPEKRWVSLINMPILISGAEGIPIVKSVNYVCWFAVGLYFNLYVYRKHKGWW  38
              VW   + +P K W+ LI++P+L+S    +    +VNY  W  VG       YR ++ WW
Sbjct  629   LVWLAHKAFPNKDWIGLISIPVLLSATLNMLPATAVNYTTWVVVGFASGFIAYRYYRDWW  688

Query  37    ARHNYILSAGLD  2
             +RHNY+LS  LD
Sbjct  689   SRHNYVLSGALD  700



>ref|XP_008390299.1| PREDICTED: oligopeptide transporter 7 isoform X1 [Malus domestica]
Length=757

 Score =   731 bits (1886),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 365/666 (55%), Positives = 490/666 (74%), Gaps = 7/666 (1%)
 Frame = -1

Query  1999  PVEEVRLTVPITDDPTMPCVTFRTWVLGVTSCVILAFLNQFFGYRQNALYVSSVPAQIVV  1820
             PV++V LTVP TDDP++P +TFR WVLG  SCV+L+FLNQFF YR   L ++++ AQI V
Sbjct  48    PVKQVALTVPTTDDPSLPVLTFRMWVLGTLSCVLLSFLNQFFWYRTEPLSITAISAQIAV  107

Query  1819  LPMGKLMAAYLPTKVVQIPGTKWSFSLNPGPFNIKEHVLITIFASSGSDFSYAVSIITMM  1640
             +P+G+LMA+ +  +V    G++W F+LNPGPFN+KEHVLITIFA+SG+   YA+ I+T++
Sbjct  108   VPLGQLMASKITNRVF-FKGSRWEFTLNPGPFNVKEHVLITIFANSGAGTVYAIHIVTVV  166

Query  1639  KAFYYRDIHPLAAVLLTFSTQMLGYGLAGIFKKFLIDSPYMWWPSNLVQVSLFRALHDVE  1460
             K FY R I    ++L+  +TQ+LG+G AGIF+++L++   MWWP+NLVQVSLFRALH+ E
Sbjct  167   KVFYKRHITFFVSLLVILTTQVLGFGWAGIFRRYLVEPAAMWWPANLVQVSLFRALHEKE  226

Query  1459  TRPKGGLTRLQFFIIVLVCSFAYYVVPNYLFPSLTALSLLCWIWKNSVTAQQlgsglkgl  1280
              RPKGGLTR QFF+I  +CSFAYYV P YLF  LT+LS +CWI+ N+V AQQLGSGL GL
Sbjct  227   ARPKGGLTRTQFFLISFMCSFAYYVFPGYLFQMLTSLSWICWIFPNNVLAQQLGSGLYGL  286

Query  1279  gigSFALDWATVAAFQGSPLVTPDFAIINMLIGYVLVAYIAIPVWYWTNLFDAKKFPLFS  1100
             GIG+  LDW+T++++ GSPL +P FA  N+  G+  V YI  P+ YW N++ AK FP+FS
Sbjct  287   GIGAVGLDWSTISSYLGSPLASPWFATANVAAGFFFVMYILTPICYWFNIYKAKTFPIFS  346

Query  1099  SNVFDSNGQVYNISRVLNKKTFGFDQPGYDSYSNIYLSTAFVYTYGLSFATLAATVSHVA  920
               +F S+GQ YNI+ +++   F  D   YD    +YLST F  TYG+ FA L ATV HVA
Sbjct  347   DTLFTSDGQEYNITAIIDSN-FHLDSEAYDREGPLYLSTFFAVTYGVGFAALTATVVHVA  405

Query  919   LFHGRTIWEQTKESVQDKFSDIHTRLMRKNYEPVPQWWFYlllviivgvalvACQRFGGQ  740
             LFHGR IWEQ+K S ++K  DIHTRLM++ Y  VP+WWF ++L++ + V + +CQ +  Q
Sbjct  406   LFHGREIWEQSKASFKEKKMDIHTRLMQR-YNQVPEWWFVIILLVNIAVTIFSCQYYIEQ  464

Query  739   LQLPVWGVLLAVLLSLIFTLPVGVITATTNQQTGLNVIAELIIGYMYPGRPLASVTFKMY  560
             LQLP WGVLLA  ++++FTLP+G+ITA TNQ  GLN+I E IIGY+YPG P+A++ FK+Y
Sbjct  465   LQLPWWGVLLACAIAIVFTLPIGIITAITNQTPGLNIITEYIIGYIYPGYPVANMCFKVY  524

Query  559   GlsslsqslmflSDFKLGHYMKIPPKSMFMVQLVGTLISCCVHFGTGWWLLTTVENICNP  380
             G  S++Q++ FL DFKLGHYMKIPP++MFM Q+VGTLI+  V+  T WWL+ T+ +IC  
Sbjct  525   GYISMTQAITFLQDFKLGHYMKIPPRTMFMAQVVGTLIAAIVYLSTAWWLMETIPDICED  584

Query  379   SKLPEGSQWTCPGDDVFYNASIIWGVVSPRRMFGNLGIYQATNYFFLVGFLAPIPVWYLG  200
             +     S WTCP D VFY+AS+IWG++ PRR+FG+LGIY+A N+FFLVG +API VW   
Sbjct  585   TS----SVWTCPSDKVFYDASVIWGLIGPRRIFGDLGIYEAINWFFLVGAIAPIFVWLAA  640

Query  199   RKYPEKRWVSLINMPILISGAEGIPIVKSVNYVCWFAVGLYFNLYVYRKHKGWWARHNYI  20
             + +P++ W+ LINMP+LI     +P   +VNY  W  +G      VYR    WW RHNY+
Sbjct  641   KAFPQQEWIRLINMPVLIGATGYMPPATAVNYTSWIILGFLSGFVVYRYRPEWWRRHNYV  700

Query  19    LSAGLD  2
             LS  LD
Sbjct  701   LSGALD  706



>ref|XP_008806360.1| PREDICTED: oligopeptide transporter 7-like [Phoenix dactylifera]
Length=766

 Score =   731 bits (1886),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 363/668 (54%), Positives = 484/668 (72%), Gaps = 3/668 (0%)
 Frame = -1

Query  2005  DSPVEEVRLTVPITDDPTMPCVTFRTWVLGVTSCVILAFLNQFFGYRQNALYVSSVPAQI  1826
             +SP+E+V LTVP+ DDP++P +TFR WVLG  SC +L+FLNQFF YR+  L ++S+ AQI
Sbjct  52    NSPIEQVALTVPVGDDPSVPVLTFRMWVLGTISCALLSFLNQFFWYRKEPLSITSISAQI  111

Query  1825  VVLPMGKLMAAYLPTKVVQIPGTKWSFSLNPGPFNIKEHVLITIFASSGSDFSYAVSIIT  1646
              V+P+G LMA  +  +V    G +W F+LNPGPFNIKEHVLITIFA+SG+   YA+ ++T
Sbjct  112   AVVPLGHLMARTITDRVF-FKGRRWEFTLNPGPFNIKEHVLITIFANSGAGSVYAIHVVT  170

Query  1645  MMKAFYYRDIHPLAAVLLTFSTQMLGYGLAGIFKKFLIDSPYMWWPSNLVQVSLFRALHD  1466
              +K FY + I    ++L+  +TQ+LG+G AGIF+++L++   MWWP NLVQVSLFRALH+
Sbjct  171   AVKIFYRQHITFFVSLLVVLTTQVLGFGWAGIFRRYLVEPAAMWWPYNLVQVSLFRALHE  230

Query  1465  VETRPKGGLTRLQFFIIVLVCSFAYYVVPNYLFPSLTALSLLCWIWKNSVTAQQlgsglk  1286
              E RPK GLTR QFF++  +CSF YYV P YLF  LT+LS +CWI+  S+ AQQLGSGL 
Sbjct  231   KEARPKHGLTRNQFFMVAFICSFGYYVFPGYLFSMLTSLSWICWIFPRSILAQQLGSGLY  290

Query  1285  glgigSFALDWATVAAFQGSPLVTPDFAIINMLIGYVLVAYIAIPVWYWTNLFDAKKFPL  1106
             GLGIG+  LDW+T++++ GSPL +P FA  N+  G+VL+ Y+  P  YW NL+ AK FP+
Sbjct  291   GLGIGAIGLDWSTISSYLGSPLASPWFATANVAAGFVLIMYVITPTAYWLNLYKAKTFPI  350

Query  1105  FSSNVFDSNGQVYNISRVLNKKTFGFDQPGYDSYSNIYLSTAFVYTYGLSFATLAATVSH  926
             FS  +F S GQ YNIS +++   F  D   Y+    +YLST F  TYG+ FA+L A VSH
Sbjct  351   FSDGLFSSTGQSYNISSIIDSN-FHLDVDAYEKEGPLYLSTFFAVTYGVGFASLTAIVSH  409

Query  925   VALFHGRTIWEQTKESVQDKFSDIHTRLMRKNYEPVPQWWFYlllviivgvalvACQRFG  746
             V LFHGR IW+ +K + Q+K  D+HTRLMR+ Y+ VPQWWF  +LV  V + + AC+ + 
Sbjct  410   VLLFHGREIWQMSKSAFQEKKMDVHTRLMRQ-YKQVPQWWFICILVANVALTIFACEYYI  468

Query  745   GQLQLPVWGVLLAVLLSLIFTLPVGVITATTNQQTGLNVIAELIIGYMYPGRPLASVTFK  566
              QLQLP WGVLLA  L++ FTLP+G+ITATTNQ  GLN+I E I+GY+YPGRP+A++ FK
Sbjct  469   DQLQLPWWGVLLACGLAIFFTLPIGIITATTNQTPGLNIITEYIMGYLYPGRPVANMCFK  528

Query  565   MYGlsslsqslmflSDFKLGHYMKIPPKSMFMVQLVGTLISCCVHFGTGWWLLTTVENIC  386
             +YG  S++Q+L FL DFKLGHYMKIPP++MFM Q+VGTLI+  V+ GT WWL+ T+ NIC
Sbjct  529   VYGYISMTQALTFLQDFKLGHYMKIPPRTMFMAQVVGTLIAAIVYLGTAWWLMDTIPNIC  588

Query  385   NPSKLPEGSQWTCPGDDVFYNASIIWGVVSPRRMFGNLGIYQATNYFFLVGFLAPIPVWY  206
             +   L   S WTCP D VF++AS+IWG++ PRR+FG+LG Y A N+FFL G +AP+ +W 
Sbjct  589   DTELLSSDSPWTCPSDHVFFDASVIWGLIGPRRIFGDLGTYSAINWFFLAGAIAPLLIWL  648

Query  205   LGRKYPEKRWVSLINMPILISGAEGIPIVKSVNYVCWFAVGLYFNLYVYRKHKGWWARHN  26
               + +P+K+W+SLINMP+LI     +P   + NY  W  VG      VYR  + WW RHN
Sbjct  649   AHKAFPKKQWISLINMPVLIGATHKMPPATAANYATWIIVGFLSGFVVYRYRRDWWQRHN  708

Query  25    YILSAGLD  2
             Y+LS  LD
Sbjct  709   YVLSGALD  716



>ref|XP_007046673.1| Oligopeptide transporter 7 isoform 1 [Theobroma cacao]
 ref|XP_007046674.1| Oligopeptide transporter 7 isoform 1 [Theobroma cacao]
 gb|EOX90830.1| Oligopeptide transporter 7 isoform 1 [Theobroma cacao]
 gb|EOX90831.1| Oligopeptide transporter 7 isoform 1 [Theobroma cacao]
Length=741

 Score =   730 bits (1884),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 357/674 (53%), Positives = 485/674 (72%), Gaps = 3/674 (0%)
 Frame = -1

Query  2023  SADEINDSPVEEVRLTVPITDDPTMPCVTFRTWVLGVTSCVILAFLNQFFGYRQNALYVS  1844
             S D++ +SP+E+V LTVP TDD ++P +TFRTW+LG  +CV+L+FLNQFF YR+  L +S
Sbjct  32    SPDDLENSPIEQVALTVPTTDDLSLPTLTFRTWILGTLACVLLSFLNQFFWYRREPLSIS  91

Query  1843  SVPAQIVVLPMGKLMAAYLPTKVVQIPGTKWSFSLNPGPFNIKEHVLITIFASSGSDFSY  1664
             S+ AQI V+P+G LMAA +  +V    G K+ F+LNPGPFN+KEHVLITIF +SG+   Y
Sbjct  92    SISAQIAVVPLGHLMAAMVTDRVF-FKGRKFEFTLNPGPFNVKEHVLITIFTNSGAGNVY  150

Query  1663  AVSIITMMKAFYYRDIHPLAAVLLTFSTQMLGYGLAGIFKKFLIDSPYMWWPSNLVQVSL  1484
             A+ +I+ +K FY +++  L A+L+ F+TQ+LG+G AG+F+++L++   MWWP NLVQVSL
Sbjct  151   AIHLISTVKIFYKKEMSFLVALLVVFTTQVLGFGWAGVFRRYLVEPAAMWWPQNLVQVSL  210

Query  1483  FRALHDVETRPKGGLTRLQFFIIVLVCSFAYYVVPNYLFPSLTALSLLCWIWKNSVTAQQ  1304
             FRALH+ E R KG LTR QFF+I  +CSFAYYV+P YLFP+L++LS LCW++  S+ A Q
Sbjct  211   FRALHEKEERAKGRLTRNQFFLIAFICSFAYYVLPGYLFPALSSLSWLCWVFPTSILAHQ  270

Query  1303  lgsglkglgigSFALDWATVAAFQGSPLVTPDFAIINMLIGYVLVAYIAIPVWYWTNLFD  1124
             LGSGL+GLGIG+   DW++++A+ GSPL +P FA +N+  G+ L+ YI  P+ YW N+F 
Sbjct  271   LGSGLRGLGIGAIGFDWSSISAYLGSPLASPWFATVNIAAGFALIMYIITPIAYWLNVFK  330

Query  1123  AKKFPLFSSNVFDSNGQVYNISRVLNKKTFGFDQPGYDSYSNIYLSTAFVYTYGLSFATL  944
             AK FP+FS  +F S GQ YNIS +++   F  D   Y+    +YLST F  +YG+ FA L
Sbjct  331   AKNFPIFSDGLFTSTGQSYNISAIIDSN-FHIDMEAYEREGPLYLSTVFAMSYGVGFACL  389

Query  943   AATVSHVALFHGRTIWEQTKESVQDKFSDIHTRLMRKNYEPVPQWWFYlllviivgvalv  764
              ATV HV +F+GR IW+ +K + ++K  D+HT+LMRK Y+ VP+WWF  +L + +   + 
Sbjct  390   TATVVHVIIFNGREIWQLSKSAFREKKMDVHTKLMRK-YKQVPEWWFTCILAVNISATIF  448

Query  763   ACQRFGGQLQLPVWGVLLAVLLSLIFTLPVGVITATTNQQTGLNVIAELIIGYMYPGRPL  584
              CQ +  QLQLP WG+LLA  L++ FTLPVGVI ATTNQ   LN+  E IIGY+YPG P+
Sbjct  449   TCQYYNDQLQLPWWGILLACGLAIFFTLPVGVIAATTNQTPALNIFTEYIIGYIYPGYPV  508

Query  583   ASVTFKMYGlsslsqslmflSDFKLGHYMKIPPKSMFMVQLVGTLISCCVHFGTGWWLLT  404
             AS+ FK+YG  S+ Q + FL DFKLGHYMKIPP++MF+ Q+ GT+IS   H GT WWL+ 
Sbjct  509   ASMCFKVYGYISMKQGITFLQDFKLGHYMKIPPRAMFIAQVGGTMISAFAHLGTAWWLMA  568

Query  403   TVENICNPSKLPEGSQWTCPGDDVFYNASIIWGVVSPRRMFGNLGIYQATNYFFLVGFLA  224
             TV +ICN   LP GS WTCP D VFY+AS+IWG++ PRR+FG+LG Y A N+FFL G +A
Sbjct  569   TVPDICNRELLPTGSPWTCPSDHVFYDASVIWGLIGPRRIFGDLGYYSAINWFFLAGAVA  628

Query  223   PIPVWYLGRKYPEKRWVSLINMPILISGAEGIPIVKSVNYVCWFAVGLYFNLYVYRKHKG  44
             P+ VW   + +P K W+ LI MP+L+     +P   +VNY  W  +G       YR H+G
Sbjct  629   PVLVWLATKTFPNKPWIKLITMPVLLGATVNMPPATAVNYTSWVLIGFASGFIAYRYHRG  688

Query  43    WWARHNYILSAGLD  2
             WW+RHNY+LS  LD
Sbjct  689   WWSRHNYVLSGALD  702



>ref|XP_003555686.1| PREDICTED: oligopeptide transporter 7 [Glycine max]
Length=749

 Score =   730 bits (1884),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 359/684 (52%), Positives = 493/684 (72%), Gaps = 8/684 (1%)
 Frame = -1

Query  2053  ENTGISAVESSADEINDSPVEEVRLTVPITDDPTMPCVTFRTWVLGVTSCVILAFLNQFF  1874
             +  G S      +E N SP+++V LTVP TDDP++P +TFR WVLG  SCV+L+FLNQFF
Sbjct  23    DEVGSSTSHRQQNEEN-SPIKQVALTVPTTDDPSLPVLTFRMWVLGTLSCVLLSFLNQFF  81

Query  1873  GYRQNALYVSSVPAQIVVLPMGKLMAAYLPTKVVQIPGTKWSFSLNPGPFNIKEHVLITI  1694
              YR   L ++++ AQI V+P+G+LMAA + TK V   GT+W F+LNPGPFN+KEHVLITI
Sbjct  82    WYRIQPLTITAISAQIAVVPLGQLMAATI-TKRVFFRGTRWEFTLNPGPFNVKEHVLITI  140

Query  1693  FASSGSDFSYAVSIITMMKAFYYRDIHPLAAVLLTFSTQMLGYGLAGIFKKFLIDSPYMW  1514
             FA+SG+   YA+ ++T +K FY++ I    ++L+  +TQ+LG+G AGIF+++L++   MW
Sbjct  141   FANSGAGTVYAIHVVTAVKIFYHKHISFFVSLLVVITTQVLGFGWAGIFRRYLVEPAAMW  200

Query  1513  WPSNLVQVSLFRALHDVETRPKGGLTRLQFFIIVLVCSFAYYVVPNYLFPSLTALSLLCW  1334
             WP+NLVQVSLFRALH+ + RPKGGLTR QFF+I  +CSFAYYV P Y+F  LT+LS +CW
Sbjct  201   WPANLVQVSLFRALHEKDERPKGGLTRSQFFVIAFLCSFAYYVFPGYIFQMLTSLSWICW  260

Query  1333  IWKNSVTAQQlgsglkglgigSFALDWATVAAFQGSPLVTPDFAIINMLIGYVLVAYIAI  1154
             ++ N+V AQQLGSGL GLGIG+  LDW+T++++ GSPL +P FA  N+ +G+V V Y+  
Sbjct  261   LYPNNVLAQQLGSGLNGLGIGAIGLDWSTISSYLGSPLASPWFATANVAVGFVFVMYVLT  320

Query  1153  PVWYWTNLFDAKKFPLFSSNVFDSNGQVYNISRVLNKKTFGFDQPGYDSYSNIYLSTAFV  974
             P+ YW +L++AK FP+FS  +F   GQVYNI+ +++   F  D   Y+    +Y+ST F 
Sbjct  321   PLCYWLDLYNAKTFPIFSDELFTEKGQVYNITAIIDSN-FHLDLAAYERQGRLYISTFFA  379

Query  973   YTYGLSFATLAATVSHVALFHGRTIWEQTKESVQDKFSDIHTRLMRKNYEPVPQWWFYll  794
              TYG+ FA L AT+ HVALFHGR IWEQ+K S ++K  DIHT+LMR+ Y+ VP+WWF  +
Sbjct  380   MTYGVGFAALTATIMHVALFHGREIWEQSKSSFKEKSVDIHTKLMRR-YKQVPEWWFVCI  438

Query  793   lviivgvalvACQRFGGQLQLPVWGVLLAVLLSLIFTLPVGVITATTNQQTGLNVIAELI  614
             L+  +   +  C+ +  QLQLP WGVLLA  +++ FTLP+G+ITA TNQ  GLN+I E I
Sbjct  439   LMATIAATVFTCEYYNDQLQLPWWGVLLACAIAIFFTLPIGIITAITNQSPGLNIITEYI  498

Query  613   IGYMYPGRPLASVTFKMYGlsslsqslmflSDFKLGHYMKIPPKSMFMVQLVGTLISCCV  434
             IGY+YPG P+A++ FK+YG  S++Q++ FL DFKLGHYMKIPP++MFM Q+VGTL++  V
Sbjct  499   IGYIYPGYPVANMCFKVYGYISMTQAITFLQDFKLGHYMKIPPRTMFMGQVVGTLVAGFV  558

Query  433   HFGTGWWLLTTVENICNPSKLPEGSQWTCPGDDVFYNASIIWGVVSPRRMFGNLGIYQAT  254
             + GT WWL+ T+ +IC  +     S WTCP D VFY+AS+IWG++ PRR+FG+LG Y+  
Sbjct  559   YLGTAWWLMETIPDICKDTS----SVWTCPSDTVFYDASVIWGLIGPRRIFGDLGTYEKV  614

Query  253   NYFFLVGFLAPIPVWYLGRKYPEKRWVSLINMPILISGAEGIPIVKSVNYVCWFAVGLYF  74
             N+FFL G +AP+ VW   R +P++ W+ LINMP+LI     +P   +VNY  W   G   
Sbjct  615   NWFFLGGAIAPLLVWLAARSFPQQEWIRLINMPVLIGATGMMPPATAVNYTSWIIAGFLS  674

Query  73    NLYVYRKHKGWWARHNYILSAGLD  2
                V+R    WW RHNY+LS  LD
Sbjct  675   GFVVFRYKPEWWKRHNYVLSGALD  698



>ref|XP_008790539.1| PREDICTED: oligopeptide transporter 7-like [Phoenix dactylifera]
Length=780

 Score =   731 bits (1887),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 363/669 (54%), Positives = 488/669 (73%), Gaps = 3/669 (0%)
 Frame = -1

Query  2008  NDSPVEEVRLTVPITDDPTMPCVTFRTWVLGVTSCVILAFLNQFFGYRQNALYVSSVPAQ  1829
             ++SPVE+V LTVP+ DDP++P +TFR WVLG  SCV+L+FLNQFF YR   L ++S+ AQ
Sbjct  65    DNSPVEQVALTVPVGDDPSIPVLTFRMWVLGTVSCVMLSFLNQFFWYRNEPLSITSISAQ  124

Query  1828  IVVLPMGKLMAAYLPTKVVQIPGTKWSFSLNPGPFNIKEHVLITIFASSGSDFSYAVSII  1649
             I V+P+G LMA+ LP +V    G++W F+LNPGPFN+KEHVLITIFA+SG+   YAV II
Sbjct  125   IAVVPLGHLMASALPDRVF-FRGSRWEFTLNPGPFNVKEHVLITIFANSGAANVYAVHII  183

Query  1648  TMMKAFYYRDIHPLAAVLLTFSTQMLGYGLAGIFKKFLIDSPYMWWPSNLVQVSLFRALH  1469
             + +K FY +++    + ++  +TQ+LGYG AG+F+++L++   MWWP NLVQVSLF ALH
Sbjct  184   SAVKIFYKKNLTFFVSFVVIVTTQVLGYGWAGLFRRYLVEPAAMWWPYNLVQVSLFGALH  243

Query  1468  DVETRPKGGLTRLQFFIIVLVCSFAYYVVPNYLFPSLTALSLLCWIWKNSVTAQQlgsgl  1289
             + E RP+G LTR QFF+I  +CSFAYYV P YLF  LT+LS +CWI+ NS+ AQQLGSG+
Sbjct  244   EKEKRPRGSLTRNQFFLIAFICSFAYYVFPGYLFKMLTSLSWICWIFPNSILAQQLGSGM  303

Query  1288  kglgigSFALDWATVAAFQGSPLVTPDFAIINMLIGYVLVAYIAIPVWYWTNLFDAKKFP  1109
             KGLGI +  LDW++V A+ GSPL +P FA  N+  G+  + Y   P  YW +++ AK FP
Sbjct  304   KGLGIAAIGLDWSSVCAYLGSPLASPWFATANIAAGFFFLMYFITPFTYWLDVYHAKTFP  363

Query  1108  LFSSNVFDSNGQVYNISRVLNKKTFGFDQPGYDSYSNIYLSTAFVYTYGLSFATLAATVS  929
             +FS ++F S+GQ YNIS +++   F FD   Y+    +YLST F  TYG  FA+L+ATV 
Sbjct  364   IFSDDLFTSSGQKYNISSIIDSN-FQFDAAAYEKQGPLYLSTFFAMTYGFGFASLSATVV  422

Query  928   HVALFHGRTIWEQTKESVQDKFSDIHTRLMRKNYEPVPQWWFYlllviivgvalvACQRF  749
             HV LFHGR IW+ +K + ++K  D+H RLMR+ Y  VP WWF  +L++ V + + AC+ +
Sbjct  423   HVLLFHGREIWQMSKLAFREKKMDVHARLMRR-YNQVPLWWFVCILLVNVALTIFACEYY  481

Query  748   GGQLQLPVWGVLLAVLLSLIFTLPVGVITATTNQQTGLNVIAELIIGYMYPGRPLASVTF  569
               QLQLP WGVLLA  +++ FTLP+G++TATTNQ  GLNVI E IIGY+YPGRP+A++ F
Sbjct  482   IDQLQLPWWGVLLACAVAIFFTLPIGILTATTNQTPGLNVITEYIIGYVYPGRPVANMCF  541

Query  568   KMYGlsslsqslmflSDFKLGHYMKIPPKSMFMVQLVGTLISCCVHFGTGWWLLTTVENI  389
             K+YG  S+ Q+L FL DFKLGHYMKIPP++MFM Q+VGTLIS  VH GT WWL++T+ NI
Sbjct  542   KVYGYISMKQALTFLQDFKLGHYMKIPPRTMFMAQVVGTLISALVHLGTAWWLMSTIPNI  601

Query  388   CNPSKLPEGSQWTCPGDDVFYNASIIWGVVSPRRMFGNLGIYQATNYFFLVGFLAPIPVW  209
             C+ +KL   S WTCPGD VFY+AS++WG++ PRR+FG LG Y A N+FFL+G + P+ VW
Sbjct  602   CDRTKLAPDSPWTCPGDHVFYDASVVWGLIGPRRIFGALGTYSAINWFFLLGAIGPLLVW  661

Query  208   YLGRKYPEKRWVSLINMPILISGAEGIPIVKSVNYVCWFAVGLYFNLYVYRKHKGWWARH  29
                + +P ++W+ LI MPI+IS    +P   +VNY  W  VG  F   +YR  + WW RH
Sbjct  662   LAHKTFPRQQWIRLITMPIMISALGQMPPATAVNYTTWIVVGFVFGFVIYRYRRDWWQRH  721

Query  28    NYILSAGLD  2
             NY+LS  LD
Sbjct  722   NYVLSGALD  730



>ref|XP_009412736.1| PREDICTED: oligopeptide transporter 7-like [Musa acuminata subsp. 
malaccensis]
Length=759

 Score =   730 bits (1884),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 360/668 (54%), Positives = 486/668 (73%), Gaps = 3/668 (0%)
 Frame = -1

Query  2005  DSPVEEVRLTVPITDDPTMPCVTFRTWVLGVTSCVILAFLNQFFGYRQNALYVSSVPAQI  1826
             +SP+E+V LTVP+ DDPT P +TFR WVLG  SCV+L+FLNQFF YR+  L ++S+ AQI
Sbjct  45    NSPIEQVALTVPVEDDPTTPVLTFRMWVLGTASCVLLSFLNQFFWYRKEPLSITSISAQI  104

Query  1825  VVLPMGKLMAAYLPTKVVQIPGTKWSFSLNPGPFNIKEHVLITIFASSGSDFSYAVSIIT  1646
              V+P+G LMA+ +  +V    G++W F+LNPGPFN+KEHVLITIFA+SG+   YA+ ++T
Sbjct  105   AVVPLGHLMASTITDRVF-FKGSRWEFTLNPGPFNMKEHVLITIFANSGAGSVYAIHVVT  163

Query  1645  MMKAFYYRDIHPLAAVLLTFSTQMLGYGLAGIFKKFLIDSPYMWWPSNLVQVSLFRALHD  1466
              +K FY + I    + L+  +TQ+LG+G AGIF+++L++   MWWP NLVQVSLFRALH+
Sbjct  164   AVKIFYQKHITFFVSFLVVITTQVLGFGWAGIFRRYLVEPAAMWWPYNLVQVSLFRALHE  223

Query  1465  VETRPKGGLTRLQFFIIVLVCSFAYYVVPNYLFPSLTALSLLCWIWKNSVTAQQlgsglk  1286
              E R KGG+TR QFF++  VCSFAYYV P YL   LT+LS +CWI+  S+ AQQLGSGL 
Sbjct  224   KEERVKGGMTRNQFFMVAFVCSFAYYVFPGYLVSMLTSLSWVCWIFPQSILAQQLGSGLY  283

Query  1285  glgigSFALDWATVAAFQGSPLVTPDFAIINMLIGYVLVAYIAIPVWYWTNLFDAKKFPL  1106
             GLGIG+  LDW+T++++ GSPL +P FA  N+  G+VL+ Y+  P+ YW NL+ AK FP+
Sbjct  284   GLGIGAIGLDWSTISSYIGSPLASPWFATANVAAGFVLIMYVITPISYWLNLYKAKTFPI  343

Query  1105  FSSNVFDSNGQVYNISRVLNKKTFGFDQPGYDSYSNIYLSTAFVYTYGLSFATLAATVSH  926
             FS  +F S GQ YNIS +++   F  D   Y+    +YLST F  TYG+ FA+L AT+SH
Sbjct  344   FSDGLFTSTGQGYNISSIIDSN-FHLDIMAYEKNGPLYLSTFFAVTYGIGFASLTATISH  402

Query  925   VALFHGRTIWEQTKESVQDKFSDIHTRLMRKNYEPVPQWWFYlllviivgvalvACQRFG  746
             V LFHG  IW+ +K + ++K  DIHT+LM + Y+ VPQWWF  +L+  + + + AC+ + 
Sbjct  403   VLLFHGSEIWQMSKSAFKEKKMDIHTKLMSR-YDQVPQWWFIAVLIANIALTIFACEYYI  461

Query  745   GQLQLPVWGVLLAVLLSLIFTLPVGVITATTNQQTGLNVIAELIIGYMYPGRPLASVTFK  566
              QLQLP WGVLLA  +++ FTLP+G+ITATTNQ  GLN+I E I+GY+YPGRP+A++ FK
Sbjct  462   DQLQLPWWGVLLACFIAIFFTLPIGIITATTNQTPGLNIITEYIMGYLYPGRPVANMCFK  521

Query  565   MYGlsslsqslmflSDFKLGHYMKIPPKSMFMVQLVGTLISCCVHFGTGWWLLTTVENIC  386
             +YG  S++Q+L FL DFKLGHYMKIPP++MFM Q+VGT+I+  V+ GT WWL+ T+ +IC
Sbjct  522   VYGYISMTQALTFLQDFKLGHYMKIPPRTMFMAQVVGTVIAAMVYLGTAWWLMETIPDIC  581

Query  385   NPSKLPEGSQWTCPGDDVFYNASIIWGVVSPRRMFGNLGIYQATNYFFLVGFLAPIPVWY  206
             N   LP  S WTCPGD VFY+AS+IWG++ PRR+FG+LG Y   N+FFL G LAP+ VW+
Sbjct  582   NKELLPSDSPWTCPGDHVFYDASVIWGLIGPRRIFGDLGTYSNVNWFFLAGALAPVLVWF  641

Query  205   LGRKYPEKRWVSLINMPILISGAEGIPIVKSVNYVCWFAVGLYFNLYVYRKHKGWWARHN  26
               + +P + W+ LINMP+LI     +P   +VNY+ W  VG      VYR  + WW RHN
Sbjct  642   GHKAFPNQEWIRLINMPVLIGATGSMPPATAVNYITWIIVGFLSGYVVYRYRRDWWQRHN  701

Query  25    YILSAGLD  2
             Y+LS  LD
Sbjct  702   YVLSGALD  709



>gb|KFK31865.1| hypothetical protein AALP_AA6G168500 [Arabis alpina]
Length=755

 Score =   729 bits (1883),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 360/674 (53%), Positives = 495/674 (73%), Gaps = 6/674 (1%)
 Frame = -1

Query  2023  SADEINDSPVEEVRLTVPITDDPTMPCVTFRTWVLGVTSCVILAFLNQFFGYRQNALYVS  1844
             S +E  +SP+ +V LTVP TDDP++P +TFR WVLG  SC++L+FLNQFF YR   L +S
Sbjct  37    SEEEEENSPIRQVALTVPTTDDPSLPVLTFRMWVLGTLSCILLSFLNQFFWYRTEPLTIS  96

Query  1843  SVPAQIVVLPMGKLMAAYLPTKVVQIPGTKWSFSLNPGPFNIKEHVLITIFASSGSDFSY  1664
             ++ AQI V+P+G+LMAA +  +V  + G+ W F+LNPGPFN+KEHVLITIFA++G+   Y
Sbjct  97    AISAQIAVVPLGRLMAAKISDRVF-LQGSYWEFTLNPGPFNVKEHVLITIFANAGAGSVY  155

Query  1663  AVSIITMMKAFYYRDIHPLAAVLLTFSTQMLGYGLAGIFKKFLIDSPYMWWPSNLVQVSL  1484
             A+ ++T++KAFY ++I    ++++  +TQ+LG+G AGIF+K+L++   MWWP+NLVQVSL
Sbjct  156   AIHVVTVVKAFYMKNITFFVSLIVIVTTQVLGFGWAGIFRKYLVEPAAMWWPANLVQVSL  215

Query  1483  FRALHDVETRPKGGLTRLQFFIIVLVCSFAYYVVPNYLFPSLTALSLLCWIWKNSVTAQQ  1304
             FRALH+ E R KGG+TR QFF+I  VCSFAYYV P YLF  +T+LS +CW +  SV AQQ
Sbjct  216   FRALHEKEERAKGGVTRTQFFLIAFVCSFAYYVFPGYLFQMMTSLSWVCWFFPTSVMAQQ  275

Query  1303  lgsglkglgigSFALDWATVAAFQGSPLVTPDFAIINMLIGYVLVAYIAIPVWYWTNLFD  1124
             +GSGL GLG+G+  LDW+T++++ GSPL +P FA  N+ +G+VL  Y+ IP+ YW +++ 
Sbjct  276   IGSGLHGLGVGAIGLDWSTISSYLGSPLASPWFATANVGVGFVLAIYVLIPICYWLDVYQ  335

Query  1123  AKKFPLFSSNVFDSNGQVYNISRVLNKKTFGFDQPGYDSYSNIYLSTAFVYTYGLSFATL  944
             AK FPLFSS++F + G  YNI+ +++   F  D   Y+    +YLST F  +YG+ FA L
Sbjct  336   AKTFPLFSSSLFTNQGSKYNITTIIDSN-FHLDLQAYEREGPLYLSTFFAISYGIGFAAL  394

Query  943   AATVSHVALFHGRTIWEQTKESVQDKFSDIHTRLMRKNYEPVPQWWFYlllviivgvalv  764
             +AT+ HVALFHGR IWEQ+KES ++K  D+H RLM++ Y+ VP WWF+ +LV  VG  + 
Sbjct  395   SATIMHVALFHGREIWEQSKESFKEKKLDVHARLMKR-YKQVPDWWFWCILVTNVGATIF  453

Query  763   ACQRFGGQLQLPVWGVLLAVLLSLIFTLPVGVITATTNQQTGLNVIAELIIGYMYPGRPL  584
             AC+ +  QLQLP WGVLLA  +++IFTLP+G+ITA TNQ  GLN+I E IIGY+YPG P+
Sbjct  454   ACEYYNDQLQLPWWGVLLACTIAIIFTLPIGIITAITNQAPGLNIITEYIIGYIYPGYPV  513

Query  583   ASVTFKMYGlsslsqslmflSDFKLGHYMKIPPKSMFMVQLVGTLISCCVHFGTGWWLLT  404
             A++ FK+YG  S+ Q++ FL DFKLGHYMKIPP++MFM Q+VGTLISC V+  T WWL+ 
Sbjct  514   ANMCFKVYGYISMQQAITFLQDFKLGHYMKIPPRTMFMAQIVGTLISCLVYLVTAWWLME  573

Query  403   TVENICNPSKLPEGSQWTCPGDDVFYNASIIWGVVSPRRMFGNLGIYQATNYFFLVGFLA  224
             T+ NIC+       S WTCPGD VFY+AS+IWG++ PRR+FG+LG+Y++ N+FFLVG +A
Sbjct  574   TIPNICDSVT---NSLWTCPGDKVFYDASVIWGLIGPRRIFGDLGLYKSVNWFFLVGAIA  630

Query  223   PIPVWYLGRKYPEKRWVSLINMPILISGAEGIPIVKSVNYVCWFAVGLYFNLYVYRKHKG  44
             PI VW   R +P + W+ L+NMP+LIS    +P   +VNY  W   G      V+R    
Sbjct  631   PILVWIASRMFPRQEWIKLVNMPVLISAISSMPPATAVNYTTWLLAGFLSGFVVFRYRPN  690

Query  43    WWARHNYILSAGLD  2
              W R+NY+LS  LD
Sbjct  691   LWQRYNYVLSGALD  704



>ref|XP_010934487.1| PREDICTED: oligopeptide transporter 7 [Elaeis guineensis]
Length=765

 Score =   729 bits (1883),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 365/668 (55%), Positives = 484/668 (72%), Gaps = 3/668 (0%)
 Frame = -1

Query  2005  DSPVEEVRLTVPITDDPTMPCVTFRTWVLGVTSCVILAFLNQFFGYRQNALYVSSVPAQI  1826
             +SP+E+V LTVP+ DDP++P +TFR WVLG  SC +L+FLNQFF YR+  L ++S+ AQI
Sbjct  51    NSPIEQVALTVPVGDDPSVPVLTFRMWVLGTVSCALLSFLNQFFWYRKEPLSITSISAQI  110

Query  1825  VVLPMGKLMAAYLPTKVVQIPGTKWSFSLNPGPFNIKEHVLITIFASSGSDFSYAVSIIT  1646
              V+P+G LMA  +  +V    G +W F+LNPGPFN+KEHVLITIFA+SG+   YA+ ++T
Sbjct  111   AVVPLGHLMARTITDRVF-FKGRRWEFTLNPGPFNMKEHVLITIFANSGAGSVYAIHVVT  169

Query  1645  MMKAFYYRDIHPLAAVLLTFSTQMLGYGLAGIFKKFLIDSPYMWWPSNLVQVSLFRALHD  1466
              +K FY + I    ++L+  +TQ+LG+G AGIF++ L++   MWWP NLVQVSLFRALH+
Sbjct  170   AVKIFYRQHITFFVSLLVVLTTQVLGFGWAGIFRQHLVEPAAMWWPYNLVQVSLFRALHE  229

Query  1465  VETRPKGGLTRLQFFIIVLVCSFAYYVVPNYLFPSLTALSLLCWIWKNSVTAQQlgsglk  1286
              E RPK GLTR QFF++  VCSFAYYV P YLF  LT+LS +CWI+  SV AQQLGSGL 
Sbjct  230   KEVRPKHGLTRNQFFMVAFVCSFAYYVFPGYLFSMLTSLSWICWIFPGSVLAQQLGSGLY  289

Query  1285  glgigSFALDWATVAAFQGSPLVTPDFAIINMLIGYVLVAYIAIPVWYWTNLFDAKKFPL  1106
             GLGIG+  LDW+T++++ GSPL +P FA  N+  G+V++ Y+  P  YW NL+ AK FP+
Sbjct  290   GLGIGAIGLDWSTISSYLGSPLASPWFATANVAAGFVIIMYVITPTAYWLNLYKAKTFPI  349

Query  1105  FSSNVFDSNGQVYNISRVLNKKTFGFDQPGYDSYSNIYLSTAFVYTYGLSFATLAATVSH  926
             FS  +F S GQ YNIS +++   F  D   Y+    +YLS  F  TYG+ FA+L ATVSH
Sbjct  350   FSDGLFTSTGQSYNISSIIDSD-FHLDVEAYEKEGPLYLSAFFAVTYGVGFASLTATVSH  408

Query  925   VALFHGRTIWEQTKESVQDKFSDIHTRLMRKNYEPVPQWWFYlllviivgvalvACQRFG  746
             V LFHGR IW+ +K + Q+K  D+HT+LMR+ Y+ VPQWWF  +LV  V + + AC+ + 
Sbjct  409   VLLFHGREIWQMSKSAFQEKKIDVHTKLMRQ-YKQVPQWWFICILVANVALTIFACEYYI  467

Query  745   GQLQLPVWGVLLAVLLSLIFTLPVGVITATTNQQTGLNVIAELIIGYMYPGRPLASVTFK  566
              QLQLP WGVLLA  +++ FTLP+G+ITATTNQ  GLN+I E I+GY+YPGRP+A++ FK
Sbjct  468   DQLQLPWWGVLLACGIAIFFTLPIGIITATTNQTPGLNIITEYIMGYLYPGRPVANMCFK  527

Query  565   MYGlsslsqslmflSDFKLGHYMKIPPKSMFMVQLVGTLISCCVHFGTGWWLLTTVENIC  386
             +YG  S++Q+L FL DFKLGHYMKIPP++MFM Q+VGTLI+  V+ GT WWL+ T+ NIC
Sbjct  528   VYGYISMTQALTFLQDFKLGHYMKIPPRTMFMAQVVGTLIAAIVYLGTAWWLMDTIPNIC  587

Query  385   NPSKLPEGSQWTCPGDDVFYNASIIWGVVSPRRMFGNLGIYQATNYFFLVGFLAPIPVWY  206
             N   L   S WTCP D VFY+AS+IWG++ PRR+FG+LG Y A N+FFL G +AP+ VW 
Sbjct  588   NTELLSSDSPWTCPSDHVFYDASVIWGLIGPRRIFGDLGTYSAINWFFLAGAIAPLLVWL  647

Query  205   LGRKYPEKRWVSLINMPILISGAEGIPIVKSVNYVCWFAVGLYFNLYVYRKHKGWWARHN  26
               + +P ++W+SLINMP+LI     +P   +VNY  W  VG      VYR  + WW RHN
Sbjct  648   AHKAFPNQKWISLINMPVLIGATGMMPPATAVNYTTWITVGFLSGFVVYRYRRDWWQRHN  707

Query  25    YILSAGLD  2
             Y+LS  LD
Sbjct  708   YVLSGALD  715



>ref|XP_004502063.1| PREDICTED: oligopeptide transporter 7-like [Cicer arietinum]
Length=740

 Score =   729 bits (1881),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 365/676 (54%), Positives = 485/676 (72%), Gaps = 7/676 (1%)
 Frame = -1

Query  2029  ESSADEINDSPVEEVRLTVPITDDPTMPCVTFRTWVLGVTSCVILAFLNQFFGYRQNALY  1850
             E       +SP+++V LTVP TDDP++P +TFR WVLG  SCV+L+FLNQFF YR   L 
Sbjct  21    EEDEKLEENSPIKQVALTVPTTDDPSLPVLTFRMWVLGTLSCVLLSFLNQFFWYRTEPLT  80

Query  1849  VSSVPAQIVVLPMGKLMAAYLPTKVVQIPGTKWSFSLNPGPFNIKEHVLITIFASSGSDF  1670
             ++++ AQI V+P+G+LMA+ + TK V   GT W F+LNPGPFN+KEHVLITIFA+SG+  
Sbjct  81    ITAISAQIAVVPLGQLMASKI-TKRVFFKGTSWEFTLNPGPFNVKEHVLITIFANSGAGT  139

Query  1669  SYAVSIITMMKAFYYRDIHPLAAVLLTFSTQMLGYGLAGIFKKFLIDSPYMWWPSNLVQV  1490
              YA+ I+T +K FY++ I    ++L+  +TQ+LG+G AGIF+++L++   MWWP+NLVQV
Sbjct  140   VYAIHIVTAVKVFYHKHISFSVSLLVVITTQVLGFGWAGIFRRYLVEPAAMWWPANLVQV  199

Query  1489  SLFRALHDVETRPKGGLTRLQFFIIVLVCSFAYYVVPNYLFPSLTALSLLCWIWKNSVTA  1310
             SLFRALH+ E RPKGGLTR QFF+I   CSFAYYV P Y+F  LT+LS +CWI+ NSV A
Sbjct  200   SLFRALHEKEERPKGGLTRSQFFVIAFFCSFAYYVFPGYIFQMLTSLSWICWIFPNSVLA  259

Query  1309  QQlgsglkglgigSFALDWATVAAFQGSPLVTPDFAIINMLIGYVLVAYIAIPVWYWTNL  1130
              QLGSGL GLGIG+  LDW+ ++A+ GSPL +P FA  N+  G+V V YI  P+ YW N+
Sbjct  260   HQLGSGLNGLGIGAIGLDWSAISAYLGSPLASPWFATANVAAGFVFVMYILTPLCYWFNI  319

Query  1129  FDAKKFPLFSSNVFDSNGQVYNISRVLNKKTFGFDQPGYDSYSNIYLSTAFVYTYGLSFA  950
             ++AK FP+FS+ +F S G VYNI+ +++   F  D   Y+    +YLST F  TYG+ FA
Sbjct  320   YNAKTFPIFSNKLFTSKGHVYNITDIIDSN-FHLDHAAYERQGRLYLSTFFAMTYGVGFA  378

Query  949   TLAATVSHVALFHGRTIWEQTKESVQDKFSDIHTRLMRKNYEPVPQWWFYlllviivgva  770
              L AT+ HVALFHGR IWEQ+K S  +K  DIHT+LMRK Y  VP+WWF  +L+  +   
Sbjct  379   ALTATIVHVALFHGREIWEQSKSSFNEKSMDIHTKLMRK-YNQVPEWWFVCILIATIATT  437

Query  769   lvACQRFGGQLQLPVWGVLLAVLLSLIFTLPVGVITATTNQQTGLNVIAELIIGYMYPGR  590
             + AC+ +  QLQLP WGVLLA  +++ FTLP+G+ITA TNQ  GLN+I E IIGY+YPG 
Sbjct  438   VFACEYYNEQLQLPWWGVLLACSIAIFFTLPIGIITAITNQSPGLNIITEYIIGYIYPGY  497

Query  589   PLASVTFKMYGlsslsqslmflSDFKLGHYMKIPPKSMFMVQLVGTLISCCVHFGTGWWL  410
             P+A++ FK+YG  S++Q++ FL DFKLGHYMKIPP++MFM Q+VGTLI+  V+  T WWL
Sbjct  498   PVANMCFKVYGYISMTQAITFLQDFKLGHYMKIPPRTMFMAQVVGTLIAALVYLSTAWWL  557

Query  409   LTTVENICNPSKLPEGSQWTCPGDDVFYNASIIWGVVSPRRMFGNLGIYQATNYFFLVGF  230
             L ++ +IC  +     S WTCPGD VFY+AS+IWG++ PRR+FG+LG Y+  N+FFL G 
Sbjct  558   LGSIPDICKDTS----SVWTCPGDTVFYDASVIWGLIGPRRIFGDLGTYEKINWFFLGGA  613

Query  229   LAPIPVWYLGRKYPEKRWVSLINMPILISGAEGIPIVKSVNYVCWFAVGLYFNLYVYRKH  50
             +AP+ V+   R +PE+ W+ LINMP+LI     +P   +VNY  W  VG      VYR  
Sbjct  614   IAPLLVYLATRAFPEQEWIKLINMPVLIGATGMMPPATAVNYTSWIVVGFLSGFVVYRYK  673

Query  49    KGWWARHNYILSAGLD  2
               WW RHNY+LS  LD
Sbjct  674   PDWWRRHNYVLSGALD  689



>emb|CDY11969.1| BnaC03g13950D [Brassica napus]
Length=721

 Score =   728 bits (1879),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 383/672 (57%), Positives = 490/672 (73%), Gaps = 38/672 (6%)
 Frame = -1

Query  2008  NDSPVEEVRLTVPITDDPTMPCVTFRTWVLGVTSCVILAFLNQFFGYRQNALYVSSVPAQ  1829
             +DSP+EEV LTVP TDDP++P +TFRTW LG+ SC++LAF+NQFF +R N L+VSSV AQ
Sbjct  33    DDSPIEEVGLTVPTTDDPSLPVLTFRTWFLGLVSCILLAFVNQFFSFRSNQLWVSSVAAQ  92

Query  1828  IVVLPMGKLMAAYLPTKVVQIPGTKWSFSLNPGPFNIKEHVLITIFASSGSDFSYAVSII  1649
             ++ LP+GK MAA LPT     P TKWS+S NPGPFN+KEHVLI+IFA++G+  +YA SII
Sbjct  93    VLTLPLGKFMAATLPTN----PWTKWSWSFNPGPFNVKEHVLISIFANTGAGGAYATSII  148

Query  1648  TMMKAFYYRDIHPLAAVLLTFSTQMLGYGLAGIFKKFLIDSPYMWWPSNLVQVSLFRALH  1469
             T++KAFY+R ++  AA+LLT +TQ+LGYG AGIF+KFL++SPYMW  SNLVQVSLFRALH
Sbjct  149   TIVKAFYHRQLNVAAAMLLTQTTQLLGYGWAGIFRKFLVESPYMWCLSNLVQVSLFRALH  208

Query  1468  DVETRPKGGLTRLQFFIIVLVCSFAYYVVPNYLFPSLTALSLLCWIWKNSVTAQQlgsgl  1289
             + + + KG  TRL+FF+IV V                              TAQ +GSGL
Sbjct  209   EKDLQ-KGQQTRLRFFLIVFV------------------------------TAQIVGSGL  237

Query  1288  kglgigSFALDWATVAAFQGSPLVTPDFAIINMLIGYVLVAYIAIPVWYWTNLFDAKKFP  1109
             KGLGIGSF LDW+ VA F GSPL  P FAI N   G+ +  YI +P++YW+N +DA+KFP
Sbjct  238   KGLGIGSFGLDWSRVAGFLGSPLAVPFFAIANFFAGFFIFLYILLPIFYWSNAYDAQKFP  297

Query  1108  LFSSNVFDSNGQVYNISRVLNKKTFGFDQPGYDSYSNIYLSTAFVYTYGLSFATLAATVS  929
              ++S  F+  G  YNI+R+LN+K F  +   Y+ YS +YLS  F   YGLSFA+L AT+S
Sbjct  298   FYTSQTFEQTGHSYNITRILNEKDFDINLDAYNDYSKLYLSVMFALLYGLSFASLFATIS  357

Query  928   HVALFHGR---TIWEQTKESVQDKFSDIHTRLMRKNYEPVPQWWFYlllviivgvalvAC  758
             HVAL+ G+    IW++T  + +DK  D+H+RLM+KNY+ VPQWWF  +LV     AL  C
Sbjct  358   HVALYDGKFIWGIWKKTTTATKDKLGDVHSRLMKKNYQAVPQWWFIAVLVASFAFALYTC  417

Query  757   QRFGGQLQLPVWGVLLAVLLSLIFTLPVGVITATTNQQTGLNVIAELIIGYMYPGRPLAS  578
             + F  QLQLP WG++LA  +++ FTLP+GVI ATTN Q GLNVI ELIIGY+YPG+PLA+
Sbjct  418   EGFDKQLQLPWWGLILACAIAMFFTLPIGVIQATTNHQVGLNVITELIIGYLYPGKPLAN  477

Query  577   VTFKMYGlsslsqslmflSDFKLGHYMKIPPKSMFMVQLVGTLISCCVHFGTGWWLLTTV  398
             V FK YG  S+SQ+L F+ DFKLGHYMKIPP+SMF+VQLV T++S  V FGT WWL+T+V
Sbjct  478   VAFKTYGYISMSQALCFVGDFKLGHYMKIPPRSMFIVQLVATVVSSTVCFGTTWWLITSV  537

Query  397   ENICNPSKLPEGSQWTCPGDDVFYNASIIWGVVSPRRMFGNLGIYQATNYFFLVGFLAPI  218
             ENICN   LP GS WTCPG +VFYNA IIWGV+ PRRMF   GIY   N+FFLV  LAP+
Sbjct  538   ENICNTDFLPVGSPWTCPGYEVFYNAPIIWGVIGPRRMFTKEGIYPGMNWFFLVSILAPV  597

Query  217   PVWYLGRKYPEKRWVSLINMPILISGAEGIPIVKSVNYVCWFAVGLYFNLYVYRKHKGWW  38
             P WY  +K+PEK+W+  I++P++ S    +P  K+V+Y  W  VG+ FN Y++R+ K WW
Sbjct  598   PFWYSSKKFPEKKWLKHIHIPLIFSAVSSMPQAKAVHYWSWTIVGVVFNYYIFRRFKSWW  657

Query  37    ARHNYILSAGLD  2
             ARHNYILSA LD
Sbjct  658   ARHNYILSAALD  669



>gb|KDP35527.1| hypothetical protein JCGZ_08965 [Jatropha curcas]
Length=577

 Score =   722 bits (1864),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 351/525 (67%), Positives = 443/525 (84%), Gaps = 0/525 (0%)
 Frame = -1

Query  1576  MLGYGLAGIFKKFLIDSPYMWWPSNLVQVSLFRALHDVETRPKGGLTRLQFFIIVLVCSF  1397
             MLGYG AG+F+KFL+DSPYMWWP+NLVQVSLFRALH+ ETRPKGGL+RLQFF++VLV SF
Sbjct  1     MLGYGWAGVFRKFLVDSPYMWWPANLVQVSLFRALHEDETRPKGGLSRLQFFLLVLVSSF  60

Query  1396  AYYVVPNYLFPSLTALSLLCWIWKNSVTAQQlgsglkglgigSFALDWATVAAFQGSPLV  1217
             AYY+VPNYLF S+TALS +CWIWK+S+TAQQ+GSG +GLGIGSF LDW+T+++F GSPL 
Sbjct  61    AYYIVPNYLFQSITALSFVCWIWKDSITAQQIGSGRRGLGIGSFGLDWSTISSFLGSPLA  120

Query  1216  TPDFAIINMLIGYVLVAYIAIPVWYWTNLFDAKKFPLFSSNVFDSNGQVYNISRVLNKKT  1037
             TP FA++N+L G++++ YI +P+ YWTN ++AK+FPL SS+VFD+ GQ Y+++ VLN  T
Sbjct  121   TPGFAVMNLLAGFIIILYIMLPITYWTNSYEAKRFPLVSSHVFDAMGQPYDVNLVLNSST  180

Query  1036  FGFDQPGYDSYSNIYLSTAFVYTYGLSFATLAATVSHVALFHGRTIWEQTKESVQDKFSD  857
             F FD+  YDSYS ++LS  FVY YGLSFA LAAT+SHV LFHGR IW++TK + +DKF D
Sbjct  181   FSFDEQAYDSYSKVHLSIFFVYAYGLSFAILAATLSHVVLFHGRQIWQETKATFEDKFGD  240

Query  856   IHTRLMRKNYEPVPQWWFYlllviivgvalvACQRFGGQLQLPVWGVLLAVLLSLIFTLP  677
             +HTR+M+KNYE VPQWWFY +L++ VG +++AC+ FG QLQLP WGVLL++ L+L+FTLP
Sbjct  241   VHTRIMKKNYEVVPQWWFYTILIVAVGFSILACEGFGRQLQLPYWGVLLSIGLALVFTLP  300

Query  676   VGVITATTNQQTGLNVIAELIIGYMYPGRPLASVTFKMYGlsslsqslmflSDFKLGHYM  497
             +GV+ ATTNQQ GLNVI ELIIGYMYPG+PLA+V FK YG +SLSQ++MFLSDFKLGHYM
Sbjct  301   IGVLQATTNQQVGLNVITELIIGYMYPGKPLANVAFKTYGFTSLSQAIMFLSDFKLGHYM  360

Query  496   KIPPKSMFMVQLVGTLISCCVHFGTGWWLLTTVENICNPSKLPEGSQWTCPGDDVFYNAS  317
             KIPPKSMF+VQLVGT+++   +FG  WWLLT+++ IC+  KLP GS WTCPGDDVFYNAS
Sbjct  361   KIPPKSMFIVQLVGTVVASAAYFGIAWWLLTSIDFICDVEKLPIGSPWTCPGDDVFYNAS  420

Query  316   IIWGVVSPRRMFGNLGIYQATNYFFLVGFLAPIPVWYLGRKYPEKRWVSLINMPILISGA  137
             IIWGVV P RMFG LG+Y   NYFFL+G L+PI VW   R +PEK+W+ LIN+P++++G 
Sbjct  421   IIWGVVGPLRMFGRLGLYSKMNYFFLIGLLSPIVVWGFSRMFPEKKWIKLINIPVILNGT  480

Query  136   EGIPIVKSVNYVCWFAVGLYFNLYVYRKHKGWWARHNYILSAGLD  2
               +P  ++VNY  WFAVG++FN  VYRK++ WWARHNYILS GLD
Sbjct  481   GSMPSARAVNYTSWFAVGIFFNFVVYRKYRKWWARHNYILSGGLD  525



>ref|XP_010455470.1| PREDICTED: oligopeptide transporter 7-like [Camelina sativa]
Length=767

 Score =   729 bits (1883),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 360/668 (54%), Positives = 492/668 (74%), Gaps = 6/668 (1%)
 Frame = -1

Query  2005  DSPVEEVRLTVPITDDPTMPCVTFRTWVLGVTSCVILAFLNQFFGYRQNALYVSSVPAQI  1826
             +SP+ +V LTVP TDDP++P +TFR WVLG  SC++L+FLNQFF YR   L +S++ AQI
Sbjct  55    NSPIRQVALTVPTTDDPSLPVLTFRMWVLGTLSCILLSFLNQFFWYRTEPLTISAISAQI  114

Query  1825  VVLPMGKLMAAYLPTKVVQIPGTKWSFSLNPGPFNIKEHVLITIFASSGSDFSYAVSIIT  1646
              V+P+G+LMAA +  +V    G+KW F+LNPGPFN+KEHVLITIFA++G+   YA+ ++T
Sbjct  115   AVVPLGRLMAAKISERV-YFQGSKWQFTLNPGPFNVKEHVLITIFANAGAGSVYAIHVVT  173

Query  1645  MMKAFYYRDIHPLAAVLLTFSTQMLGYGLAGIFKKFLIDSPYMWWPSNLVQVSLFRALHD  1466
             ++KAFY ++I    + ++  +TQ+LG+G AGIF+K+L++   MWWP+NLVQVSLFRALH+
Sbjct  174   VVKAFYMKNITFFVSFIVIVTTQVLGFGWAGIFRKYLVEPAAMWWPANLVQVSLFRALHE  233

Query  1465  VETRPKGGLTRLQFFIIVLVCSFAYYVVPNYLFPSLTALSLLCWIWKNSVTAQQlgsglk  1286
              E R KGGLTR QFF+I  VCSFAYYV P YLF  +T+LS +CW + +SV AQQ+GSGL 
Sbjct  234   KEERTKGGLTRTQFFLIAFVCSFAYYVFPGYLFQIMTSLSWVCWFFPSSVMAQQIGSGLH  293

Query  1285  glgigSFALDWATVAAFQGSPLVTPDFAIINMLIGYVLVAYIAIPVWYWTNLFDAKKFPL  1106
             GLG+G+  LDW+T++++ GSPL +P FA  N+ +G+VLV Y+ +P+ YW ++F AK FP+
Sbjct  294   GLGVGAIGLDWSTISSYLGSPLASPWFATANVGVGFVLVIYVLVPICYWLDVFKAKTFPI  353

Query  1105  FSSNVFDSNGQVYNISRVLNKKTFGFDQPGYDSYSNIYLSTAFVYTYGLSFATLAATVSH  926
             FSS++F   G  YNI  +++   F  D P Y+    +YLST F  +YG+ FA L+AT+ H
Sbjct  354   FSSSLFTEQGSKYNIKSIIDSN-FHLDLPAYEREGPLYLSTFFAISYGVGFAALSATIMH  412

Query  925   VALFHGRTIWEQTKESVQDKFSDIHTRLMRKNYEPVPQWWFYlllviivgvalvACQRFG  746
             VALFHGR IWEQ+ ES ++K  D+H RLM K+Y+ VP+WWF+ +LV  +G  + AC+ + 
Sbjct  413   VALFHGREIWEQSTESFKEKKLDVHARLM-KSYKQVPEWWFWCILVTNIGATIFACEYYN  471

Query  745   GQLQLPVWGVLLAVLLSLIFTLPVGVITATTNQQTGLNVIAELIIGYMYPGRPLASVTFK  566
              QLQLP WGVLLA  +++IFTLP+G+ITA TNQ  GLN+I E IIGY+YPG P+A++ FK
Sbjct  472   DQLQLPWWGVLLACAIAIIFTLPIGIITAITNQAPGLNIITEYIIGYIYPGYPVANMCFK  531

Query  565   MYGlsslsqslmflSDFKLGHYMKIPPKSMFMVQLVGTLISCCVHFGTGWWLLTTVENIC  386
             +YG  S+ Q++ FL DFKLGHYMKIPP++MFM Q+VGTLISC V+  T WWL+ T+ NIC
Sbjct  532   VYGYISMQQAITFLQDFKLGHYMKIPPRTMFMAQIVGTLISCLVYLTTAWWLMETIPNIC  591

Query  385   NPSKLPEGSQWTCPGDDVFYNASIIWGVVSPRRMFGNLGIYQATNYFFLVGFLAPIPVWY  206
             +   +   S WTCP D VFY+AS+IWG++ PRR+FG+LG+Y++ N+FFLVG +API VW 
Sbjct  592   D---MVSNSVWTCPTDKVFYDASVIWGLIGPRRIFGDLGLYKSVNWFFLVGAIAPILVWL  648

Query  205   LGRKYPEKRWVSLINMPILISGAEGIPIVKSVNYVCWFAVGLYFNLYVYRKHKGWWARHN  26
               R +P + W+ LINMP+LIS    +P   +VNY  W   G      V+R     W R+N
Sbjct  649   ASRMFPRQEWIKLINMPVLISATSSMPPATAVNYTTWVLAGFLSGFVVFRYRPNLWQRYN  708

Query  25    YILSAGLD  2
             Y+LS  LD
Sbjct  709   YVLSGALD  716



>ref|XP_010053083.1| PREDICTED: oligopeptide transporter 7 [Eucalyptus grandis]
Length=751

 Score =   729 bits (1881),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 362/669 (54%), Positives = 490/669 (73%), Gaps = 8/669 (1%)
 Frame = -1

Query  2008  NDSPVEEVRLTVPITDDPTMPCVTFRTWVLGVTSCVILAFLNQFFGYRQNALYVSSVPAQ  1829
              +SPV +V LTV  TDDP++P +TFR WVLG  SCV+L+FLNQFF YR   L ++++ AQ
Sbjct  40    ENSPVPQVALTVQTTDDPSLPVLTFRMWVLGTLSCVLLSFLNQFFWYRTEPLTITAISAQ  99

Query  1828  IVVLPMGKLMAAYLPTKVVQIPGTKWSFSLNPGPFNIKEHVLITIFASSGSDFSYAVSII  1649
             I V+P+G+LMAA +  +V  + GT+W F+LNPGPFN+KEHVLITIFA+SG+   YA+ ++
Sbjct  100   IAVVPLGRLMAARITDRVF-LKGTRWEFTLNPGPFNVKEHVLITIFANSGAGTVYAIYVV  158

Query  1648  TMMKAFYYRDIHPLAAVLLTFSTQMLGYGLAGIFKKFLIDSPYMWWPSNLVQVSLFRALH  1469
             T++K FY + I    ++++  +TQ+LG+G AGIF+K+L++   MWWP+NLVQVSLFRALH
Sbjct  159   TVVKVFYKKQITFFVSLIVVITTQVLGFGWAGIFRKYLVEPAAMWWPANLVQVSLFRALH  218

Query  1468  DVETRPKGGLTRLQFFIIVLVCSFAYYVVPNYLFPSLTALSLLCWIWKNSVTAQQlgsgl  1289
             + E RPKGG+TR QFF+I  +CSFAYYV P Y+F  LT++S +CWI+  SV AQQLGSGL
Sbjct  219   EKEERPKGGVTRTQFFLIAFICSFAYYVFPGYIFEMLTSMSWICWIFPKSVLAQQLGSGL  278

Query  1288  kglgigSFALDWATVAAFQGSPLVTPDFAIINMLIGYVLVAYIAIPVWYWTNLFDAKKFP  1109
              GLGI +F LDW+T++++ GSPL +P FA  N+ +G+V V Y+  P+ YW N++ AK FP
Sbjct  279   YGLGITAFGLDWSTISSYLGSPLASPWFATANVAVGFVFVMYVLTPICYWLNVYKAKTFP  338

Query  1108  LFSSNVFDSNGQVYNISRVLNKKTFGFDQPGYDSYSNIYLSTAFVYTYGLSFATLAATVS  929
             +FS ++F S GQ YNIS +++   F  D   Y+    +YLST F  TYG+ FA+L ATV 
Sbjct  339   IFSDDLFTSTGQEYNISSIIDAN-FHLDLAAYEKEGPLYLSTFFAMTYGVGFASLTATVV  397

Query  928   HVALFHGRTIWEQTKESVQDKFSDIHTRLMRKNYEPVPQWWFYlllviivgvalvACQRF  749
             HVALFHGR IW Q+K S QDK +DIHTR+MR+ Y+ VP+WWF+ +LV+ +   + AC+ +
Sbjct  398   HVALFHGREIWAQSKASFQDKTADIHTRMMRR-YQQVPEWWFWCILVVNIAATIFACEYY  456

Query  748   GGQLQLPVWGVLLAVLLSLIFTLPVGVITATTNQQTGLNVIAELIIGYMYPGRPLASVTF  569
               QLQLP WGVLLA L++++FTLP+G+ITA TNQ  GLN+I E IIGY+YPG P+A++ F
Sbjct  457   NSQLQLPWWGVLLACLIAIVFTLPIGIITAITNQTPGLNIITEYIIGYIYPGYPVANMCF  516

Query  568   KMYGlsslsqslmflSDFKLGHYMKIPPKSMFMVQLVGTLISCCVHFGTGWWLLTTVENI  389
             K+YG  S++Q++ FL DFKLGHYMKIPPK+MFM Q+VGTLI+  V+  T WWL+ T+ +I
Sbjct  517   KVYGYISMTQAVTFLQDFKLGHYMKIPPKTMFMAQVVGTLIAGVVYLSTAWWLMETIPDI  576

Query  388   CNPSKLPEGSQWTCPGDDVFYNASIIWGVVSPRRMFGNLGIYQATNYFFLVGFLAPIPVW  209
             C  S     S WTCP D VFY+AS+IWG++ PRR+FG+ G Y+A N+FFL G +API VW
Sbjct  577   CETS-----SVWTCPSDTVFYDASVIWGLIGPRRIFGDEGTYEAINWFFLGGAIAPILVW  631

Query  208   YLGRKYPEKRWVSLINMPILISGAEGIPIVKSVNYVCWFAVGLYFNLYVYRKHKGWWARH  29
                + +PE+ W+SLINMP+LI     +P   +VNY  W   G      VYR     W ++
Sbjct  632   LAHKAFPEQEWISLINMPVLIGATGYMPPATAVNYTTWIIAGFLSGFVVYRYRPELWKKY  691

Query  28    NYILSAGLD  2
             NY+LS  LD
Sbjct  692   NYVLSGALD  700



>emb|CDX86844.1| BnaA09g22340D [Brassica napus]
Length=765

 Score =   729 bits (1882),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 359/668 (54%), Positives = 497/668 (74%), Gaps = 6/668 (1%)
 Frame = -1

Query  2005  DSPVEEVRLTVPITDDPTMPCVTFRTWVLGVTSCVILAFLNQFFGYRQNALYVSSVPAQI  1826
             +SP+ EV LTVP TDDP++P +TFR WVLG  SC++L+FLNQFF YR+  L +S++ AQI
Sbjct  53    NSPIREVALTVPTTDDPSLPVLTFRMWVLGTLSCILLSFLNQFFWYRREPLSISAISAQI  112

Query  1825  VVLPMGKLMAAYLPTKVVQIPGTKWSFSLNPGPFNIKEHVLITIFASSGSDFSYAVSIIT  1646
              V+P+G+LMAA +  +V  + G+KW F+LNPGPFN+KEHVLITIFA++G+   YA+ ++T
Sbjct  113   AVVPLGRLMAAKISDRVF-LQGSKWEFTLNPGPFNVKEHVLITIFANAGAGSVYAIHVVT  171

Query  1645  MMKAFYYRDIHPLAAVLLTFSTQMLGYGLAGIFKKFLIDSPYMWWPSNLVQVSLFRALHD  1466
             ++KAFY ++I    + ++  +TQ+LG+G AGIF+K+L++   MWWP+NLVQVSLFRALH+
Sbjct  172   VVKAFYMKNITFFVSFVVIVTTQVLGFGWAGIFRKYLVEPAEMWWPANLVQVSLFRALHE  231

Query  1465  VETRPKGGLTRLQFFIIVLVCSFAYYVVPNYLFPSLTALSLLCWIWKNSVTAQQlgsglk  1286
              E R KGGLTR QFF+I  VCSFAYYV P YLF  LT+LS +CW +  SV AQQ+GSGL 
Sbjct  232   KEERTKGGLTRTQFFVIAFVCSFAYYVFPGYLFQMLTSLSWVCWFFPTSVMAQQIGSGLH  291

Query  1285  glgigSFALDWATVAAFQGSPLVTPDFAIINMLIGYVLVAYIAIPVWYWTNLFDAKKFPL  1106
             GLG+G+  LDW+T++++ GSPL +P FA  N+ +G+VL  Y+ +P+ YW ++F AK FPL
Sbjct  292   GLGVGAIGLDWSTISSYLGSPLASPWFATANVGVGFVLAIYVVVPICYWLDVFKAKTFPL  351

Query  1105  FSSNVFDSNGQVYNISRVLNKKTFGFDQPGYDSYSNIYLSTAFVYTYGLSFATLAATVSH  926
             +SS++F S G  YNI+ +++ K F  D   Y+    +YLST F  +YG+ FA L+AT+ H
Sbjct  352   YSSSLFTSEGSKYNITSIIDSK-FHLDLQAYEREGPLYLSTFFAISYGIGFAALSATIVH  410

Query  925   VALFHGRTIWEQTKESVQDKFSDIHTRLMRKNYEPVPQWWFYlllviivgvalvACQRFG  746
             V+LFHGR IW+Q+K+S ++K  DIHTRLMR+ Y+ VP+WWF+ +L I + V + AC+ + 
Sbjct  411   VSLFHGREIWDQSKQSFKEKKIDIHTRLMRR-YKAVPEWWFWCILAINISVTIFACEYYI  469

Query  745   GQLQLPVWGVLLAVLLSLIFTLPVGVITATTNQQTGLNVIAELIIGYMYPGRPLASVTFK  566
              QLQLP WGVLLA  +++IFTLP+G++TA TNQ  GLN+I E IIGY+YPG P+A++ FK
Sbjct  470   DQLQLPWWGVLLACSVAIIFTLPIGILTAITNQAPGLNIITEYIIGYIYPGYPVANMCFK  529

Query  565   MYGlsslsqslmflSDFKLGHYMKIPPKSMFMVQLVGTLISCCVHFGTGWWLLTTVENIC  386
             +YG  S+ Q+++FL DFKLGHYMKIPP++MFM Q+VGTL+SC V+  T WWL+ T+ NIC
Sbjct  530   VYGYISMKQAVLFLQDFKLGHYMKIPPRNMFMAQIVGTLLSCLVYLVTAWWLMETIPNIC  589

Query  385   NPSKLPEGSQWTCPGDDVFYNASIIWGVVSPRRMFGNLGIYQATNYFFLVGFLAPIPVWY  206
             +       S WTCP D VFY+AS+IWG++ PRR+FG+LG+Y++ N+FFLVG +AP+ VW 
Sbjct  590   DSI---SNSVWTCPSDKVFYDASVIWGLIGPRRIFGDLGLYKSVNWFFLVGAIAPVLVWL  646

Query  205   LGRKYPEKRWVSLINMPILISGAEGIPIVKSVNYVCWFAVGLYFNLYVYRKHKGWWARHN  26
               R +P ++W+ LINMP+LIS    +P   +VNY  W   G      V+R     W R+N
Sbjct  647   ASRMFPRQQWIKLINMPVLISAISSMPPATAVNYTTWLLAGFLSGFVVFRYRPHLWQRYN  706

Query  25    YILSAGLD  2
             Y+LS  LD
Sbjct  707   YVLSGALD  714



>dbj|BAD67732.1| putative sexual differentiation process protein isp4 [Oryza sativa 
Japonica Group]
Length=763

 Score =   729 bits (1882),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 364/677 (54%), Positives = 488/677 (72%), Gaps = 8/677 (1%)
 Frame = -1

Query  2017  DEINDSPVEEVRLTVPITDDPTMPCVTFRTWVLGVTSCVILAFLNQFFGYRQNALYVSSV  1838
             +E  +SP+E+V LTVP++D+P  P +TFR WVLG  SC +L+FLNQFF YR+  L ++++
Sbjct  39    EEEENSPIEQVALTVPVSDEPETPVLTFRMWVLGTASCAVLSFLNQFFWYRKEPLTITAI  98

Query  1837  PAQIVVLPMGKLMAAYLPTKVVQIPGTKWSFSLNPGPFNIKEHVLITIFASSGSDFSYAV  1658
              AQI V+P+G+LMAA LP +     G  W F+LNPGPFN+KEHVLITIFA+SG+   YA+
Sbjct  99    SAQIAVVPLGRLMAAALPERAF-FRGRPWEFTLNPGPFNVKEHVLITIFANSGAGTVYAI  157

Query  1657  SIITMMKAFYYRDIHPLAAVLLTFSTQM-----LGYGLAGIFKKFLIDSPYMWWPSNLVQ  1493
              +IT ++ FY + I    ++L+  +TQ+     LG+G AGIF+++L++   MWWPSNLVQ
Sbjct  158   HVITAVRVFYGKHISFFVSLLVVLTTQVVDDQVLGFGWAGIFRRYLVEPAAMWWPSNLVQ  217

Query  1492  VSLFRALHDVETRPKGGLTRLQFFIIVLVCSFAYYVVPNYLFPSLTALSLLCWIWKNSVT  1313
             VSLFRALH+ E R KGGLTR QFF++  +CSFAYY+ P YLF  LT+LS +CW++ +SV 
Sbjct  218   VSLFRALHEKEARSKGGLTRNQFFLVAFICSFAYYIFPGYLFQMLTSLSWICWVFPHSVL  277

Query  1312  AQQlgsglkglgigSFALDWATVAAFQGSPLVTPDFAIINMLIGYVLVAYIAIPVWYWTN  1133
             AQQLGSGL GLGIG+  LDW+TV+++ GSPL +P FA  N+  G+  + YI  P+ YW N
Sbjct  278   AQQLGSGLSGLGIGAIGLDWSTVSSYLGSPLASPWFATANVAAGFFFIMYIITPIAYWFN  337

Query  1132  LFDAKKFPLFSSNVFDSNGQVYNISRVLNKKTFGFDQPGYDSYSNIYLSTAFVYTYGLSF  953
              + A+ FP+FS  +F S GQ YNIS +++   F FD   Y+    +YLST F  TYG+ F
Sbjct  338   FYKAQNFPIFSDGLFTSTGQKYNISSIVDSH-FHFDTKAYEKNGPLYLSTFFAVTYGVGF  396

Query  952   ATLAATVSHVALFHGRTIWEQTKESVQDKFSDIHTRLMRKNYEPVPQWWFYlllviivgv  773
             A+L AT+ HV LFHG  IW+ +K + Q+K  DIHT+LMR+ Y+ VP+WWF  +L+  + V
Sbjct  397   ASLTATIVHVLLFHGSEIWQLSKSAFQEKRMDIHTKLMRR-YKQVPEWWFVCILIANIAV  455

Query  772   alvACQRFGGQLQLPVWGVLLAVLLSLIFTLPVGVITATTNQQTGLNVIAELIIGYMYPG  593
              + AC+ +  QLQLP WGVLLA  ++  FTLP+G+ITATTNQ  GLN+I E I+GY+YPG
Sbjct  456   TIFACEYYIEQLQLPWWGVLLACAIAFFFTLPIGIITATTNQTPGLNIITEYIMGYLYPG  515

Query  592   RPLASVTFKMYGlsslsqslmflSDFKLGHYMKIPPKSMFMVQLVGTLISCCVHFGTGWW  413
             RP+A++ FK+YG  S+SQ+L FL DFKLGHYMKIPP++MFM Q+VGTLI+  V+ GT WW
Sbjct  516   RPVANMCFKVYGYISMSQALTFLQDFKLGHYMKIPPRTMFMAQVVGTLIAAFVYIGTAWW  575

Query  412   LLTTVENICNPSKLPEGSQWTCPGDDVFYNASIIWGVVSPRRMFGNLGIYQATNYFFLVG  233
             L+ T+ NICN   LP  S WTCPGD VFY+AS+IWG++SPRR+FG+LG Y A N+FFL G
Sbjct  576   LMETIPNICNTELLPSDSPWTCPGDHVFYDASVIWGLISPRRIFGDLGTYSAVNWFFLGG  635

Query  232   FLAPIPVWYLGRKYPEKRWVSLINMPILISGAEGIPIVKSVNYVCWFAVGLYFNLYVYRK  53
              +AP+ VW+  + +P + W+ LINMP+LI     +P   +VNY  W  VG      VYR 
Sbjct  636   AIAPVLVWFAHKAFPNQNWILLINMPVLIGATGQMPPATAVNYTTWILVGFLSGYVVYRY  695

Query  52    HKGWWARHNYILSAGLD  2
              + WW RHNY+LS  LD
Sbjct  696   RRDWWERHNYLLSGALD  712



>ref|XP_007156167.1| hypothetical protein PHAVU_003G263800g [Phaseolus vulgaris]
 gb|ESW28161.1| hypothetical protein PHAVU_003G263800g [Phaseolus vulgaris]
Length=748

 Score =   728 bits (1880),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 360/695 (52%), Positives = 493/695 (71%), Gaps = 4/695 (1%)
 Frame = -1

Query  2086  NSSLSRLLH*MENTGISAVESSADEINDSPVEEVRLTVPITDDPTMPCVTFRTWVLGVTS  1907
             NS L +  H   N+   +V  ++    +SP+E+V LTVP++DDP+ P  TFRTW+LG  +
Sbjct  8     NSPLIKRRH--HNSDAISVAENSPAAENSPIEQVALTVPVSDDPSRPSFTFRTWILGTIA  65

Query  1906  CVILAFLNQFFGYRQNALYVSSVPAQIVVLPMGKLMAAYLPTKVVQIPGTKWSFSLNPGP  1727
             C +L+FLNQFFG+R+  L V+++ AQI V+P G LMAA + T+ V + GTKW F+LNPG 
Sbjct  66    CALLSFLNQFFGFRREPLSVTAISAQIAVVPAGHLMAAVV-TRRVFMKGTKWEFTLNPGS  124

Query  1726  FNIKEHVLITIFASSGSDFSYAVSIITMMKAFYYRDIHPLAAVLLTFSTQMLGYGLAGIF  1547
             FN+KEHVLITIFASSG+   YA+  ++ +K FY +D+  LAA+L+  ++Q+LG+G AGIF
Sbjct  125   FNVKEHVLITIFASSGAASVYAIHFVSAVKVFYQKDLTILAALLVVITSQVLGFGWAGIF  184

Query  1546  KKFLIDSPYMWWPSNLVQVSLFRALHDVETRPKGGLTRLQFFIIVLVCSFAYYVVPNYLF  1367
             +K+L++   MWWP NLVQVSLFRALH+ E R KG LTR QFF+I  +CSFAYYV P YLF
Sbjct  185   RKYLVEPATMWWPQNLVQVSLFRALHEKEERRKGALTRNQFFLIAFLCSFAYYVFPGYLF  244

Query  1366  PSLTALSLLCWIWKNSVTAQQlgsglkglgigSFALDWATVAAFQGSPLVTPDFAIINML  1187
             PSLT++S +CW++  SV A QLGSGL GLG+G+   DW+++ ++ GSPL +P FA  N+ 
Sbjct  245   PSLTSISWICWMFPTSVIAHQLGSGLHGLGVGAIGFDWSSICSYLGSPLASPWFATANVA  304

Query  1186  IGYVLVAYIAIPVWYWTNLFDAKKFPLFSSNVFDSNGQVYNISRVLNKKTFGFDQPGYDS  1007
              G+ +  Y  +P+ Y TNL++A++FP+FS  +F SNG+ YNIS +++   F  D   Y+ 
Sbjct  305   AGFAIFIYAIVPIAYSTNLYNARRFPIFSDELFMSNGRKYNISAIIDSN-FHLDMEAYER  363

Query  1006  YSNIYLSTAFVYTYGLSFATLAATVSHVALFHGRTIWEQTKESVQDKFSDIHTRLMRKNY  827
                +YLST F  +YG+ FA L+AT+ HV+LFHG  I   +K + Q+   DIHT++MRKNY
Sbjct  364   EGPLYLSTMFAMSYGIGFACLSATLVHVSLFHGSEILRLSKSAFQENKIDIHTKIMRKNY  423

Query  826   EPVPQWWFYlllviivgvalvACQRFGGQLQLPVWGVLLAVLLSLIFTLPVGVITATTNQ  647
             + VP+WWF  +L+  +   +  C+ F  +LQLP WGV+LA ++++ FTLPVGVI ATTNQ
Sbjct  424   KQVPEWWFLCILLFNIVATIFICEYFNNELQLPWWGVVLACVVAMSFTLPVGVIRATTNQ  483

Query  646   QTGLNVIAELIIGYMYPGRPLASVTFKMYGlsslsqslmflSDFKLGHYMKIPPKSMFMV  467
                LN+I E IIGY+YPG P+A++ FK+YG  S+ Q++ FL DFKLGHYMKIPP  MF+ 
Sbjct  484   APALNIITEYIIGYIYPGYPVANMLFKVYGNVSMKQAIFFLQDFKLGHYMKIPPTEMFLA  543

Query  466   QLVGTLISCCVHFGTGWWLLTTVENICNPSKLPEGSQWTCPGDDVFYNASIIWGVVSPRR  287
             Q+VGTL+S  VH  T WWL+ TV NIC  + LP GS WTCPGD VFY+AS+IWG++ PRR
Sbjct  544   QVVGTLMSGVVHLLTAWWLMNTVPNICERALLPAGSPWTCPGDHVFYDASVIWGLIGPRR  603

Query  286   MFGNLGIYQATNYFFLVGFLAPIPVWYLGRKYPEKRWVSLINMPILISGAEGIPIVKSVN  107
              FG+LG Y A N+FFL G +AP  VW   +  P+K+W+ LI +P+L+     +P   +VN
Sbjct  604   TFGDLGHYSAINWFFLAGAIAPFLVWLAHKALPQKQWIRLITVPVLLGALSDMPPATAVN  663

Query  106   YVCWFAVGLYFNLYVYRKHKGWWARHNYILSAGLD  2
             Y  W  VG      VYR ++GWW+RHNY+LS  LD
Sbjct  664   YTSWVIVGFVSGFVVYRYYRGWWSRHNYVLSGALD  698



>ref|XP_002272972.2| PREDICTED: oligopeptide transporter 7 [Vitis vinifera]
Length=749

 Score =   728 bits (1880),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 360/672 (54%), Positives = 488/672 (73%), Gaps = 6/672 (1%)
 Frame = -1

Query  2017  DEINDSPVEEVRLTVPITDDPTMPCVTFRTWVLGVTSCVILAFLNQFFGYRQNALYVSSV  1838
             DE N SP+++V LTVP TDDP++P +TFR WVLG  SCV+L+FLNQFF YR   L ++++
Sbjct  33    DEEN-SPIKQVALTVPTTDDPSLPVLTFRMWVLGTVSCVLLSFLNQFFWYRTEPLTITAI  91

Query  1837  PAQIVVLPMGKLMAAYLPTKVVQIPGTKWSFSLNPGPFNIKEHVLITIFASSGSDFSYAV  1658
              AQI V+P+G+LMAA +  +V    GT W F+LNPGPFN+KEHVLITIFA+SG+   YA+
Sbjct  92    SAQIAVVPLGRLMAAKITDRVF-FKGTPWEFTLNPGPFNVKEHVLITIFANSGAGTVYAI  150

Query  1657  SIITMMKAFYYRDIHPLAAVLLTFSTQMLGYGLAGIFKKFLIDSPYMWWPSNLVQVSLFR  1478
              ++T++K FY + I    ++++  +TQ+LG+G AGIF+++L++   MWWP+NLVQVSLFR
Sbjct  151   HVVTVVKVFYKKHISFFVSLIVVITTQVLGFGWAGIFRRYLVEPAAMWWPANLVQVSLFR  210

Query  1477  ALHDVETRPKGGLTRLQFFIIVLVCSFAYYVVPNYLFPSLTALSLLCWIWKNSVTAQQlg  1298
             ALH+ E RPKGG+TR QFF+I  +CSFAYYV P Y+F  LT+LS +CWI+  SV AQQLG
Sbjct  211   ALHEKEERPKGGVTRTQFFLIAFICSFAYYVFPGYMFEMLTSLSWICWIFPTSVLAQQLG  270

Query  1297  sglkglgigSFALDWATVAAFQGSPLVTPDFAIINMLIGYVLVAYIAIPVWYWTNLFDAK  1118
             SGL GLGI +  LDW+T++A+ GSPL +P FA  N+ +G+V V Y+  P+ YW N++ AK
Sbjct  271   SGLYGLGIAAVGLDWSTISAYLGSPLASPWFATANVAVGFVFVMYVLTPICYWLNVYKAK  330

Query  1117  KFPLFSSNVFDSNGQVYNISRVLNKKTFGFDQPGYDSYSNIYLSTAFVYTYGLSFATLAA  938
              FP+FS ++F S GQ YNIS ++    F  +   Y+    +YLST F  TYG+ FA L+A
Sbjct  331   TFPIFSDDLFTSTGQEYNISSIITSN-FHLNITAYEEEGPLYLSTFFAMTYGVGFAALSA  389

Query  937   TVSHVALFHGRTIWEQTKESVQDKFSDIHTRLMRKNYEPVPQWWFYlllviivgvalvAC  758
             T  HV LFHGR IWEQ+K S +DK  DIHTRLM + Y+ VP+WWF+ +L+  +   + AC
Sbjct  390   TAVHVLLFHGREIWEQSKSSFKDKGMDIHTRLMTR-YKQVPEWWFWSILIANIAFTIFAC  448

Query  757   QRFGGQLQLPVWGVLLAVLLSLIFTLPVGVITATTNQQTGLNVIAELIIGYMYPGRPLAS  578
             Q +  QLQLP WGVLLA  ++++FTLP+G+ITA TNQ  GLN+I E IIGY+YPG P+A+
Sbjct  449   QYYNDQLQLPWWGVLLACAIAIVFTLPIGIITAITNQTPGLNIITEYIIGYIYPGYPVAN  508

Query  577   VTFKMYGlsslsqslmflSDFKLGHYMKIPPKSMFMVQLVGTLISCCVHFGTGWWLLTTV  398
             + FK+YG  S++Q++ FL DFKLGHYMKIPP++MFM Q+VGTLI+  V+ GT WW++ T+
Sbjct  509   MCFKVYGYISMTQAVTFLQDFKLGHYMKIPPRTMFMAQVVGTLIAGFVYLGTAWWMMETI  568

Query  397   ENICNPSKLPEGSQWTCPGDDVFYNASIIWGVVSPRRMFGNLGIYQATNYFFLVGFLAPI  218
              +IC  +     S WTCP D VFY+AS+IWG++ PRR+FG+ G+Y+A N+FFL G +AP+
Sbjct  569   PDICETTA--SSSPWTCPSDRVFYDASVIWGLIGPRRIFGDEGVYEAVNWFFLAGAVAPV  626

Query  217   PVWYLGRKYPEKRWVSLINMPILISGAEGIPIVKSVNYVCWFAVGLYFNLYVYRKHKGWW  38
              VW   + +P++ W+ LINMP+LIS    +P   +VNY  W   G      VYR    WW
Sbjct  627   LVWLAHKAFPKQEWIGLINMPVLISSTGMMPPATAVNYTTWVIAGFLSGFVVYRYRPDWW  686

Query  37    ARHNYILSAGLD  2
              RHNY+LS  LD
Sbjct  687   QRHNYVLSGALD  698



>ref|XP_002529653.1| Oligopeptide transporter, putative [Ricinus communis]
 gb|EEF32740.1| Oligopeptide transporter, putative [Ricinus communis]
Length=763

 Score =   728 bits (1880),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 369/715 (52%), Positives = 500/715 (70%), Gaps = 5/715 (1%)
 Frame = -1

Query  2143  ERVRNWNLRDTRER-VSSFKNSSLSRLLH*MENTGISAVESSADEINDSPVEEVRLTVPI  1967
              + R    R+T+ER + S     ++  L+    +  SA++    E N SP+E+V LTVPI
Sbjct  2     SKQRRRRARNTKERMIGSHSTREITAPLNSPSVSATSALDDVNSEEN-SPIEQVALTVPI  60

Query  1966  TDDPTMPCVTFRTWVLGVTSCVILAFLNQFFGYRQNALYVSSVPAQIVVLPMGKLMAAYL  1787
             TDDP +P VTFRTW LG  +C++L+FLNQFF YR+  L ++S+ AQI VLP+G LMA+ +
Sbjct  61    TDDPMLPAVTFRTWTLGTLACILLSFLNQFFWYRREPLAITSIFAQIAVLPLGHLMASAI  120

Query  1786  PTKVVQIPGTKWSFSLNPGPFNIKEHVLITIFASSGSDFSYAVSIITMMKAFYYRDIHPL  1607
               KV    GTK  F+LNPGPFN+KEHVLITIFA+SG+   YA+ I++ +K FY +++  L
Sbjct  121   TDKVF-FRGTKLEFTLNPGPFNVKEHVLITIFANSGAGNVYAIHIVSAVKIFYKKELSFL  179

Query  1606  AAVLLTFSTQMLGYGLAGIFKKFLIDSPYMWWPSNLVQVSLFRALHDVETRPKGGLTRLQ  1427
              A+L+  +TQ+LG+G AG+F+++L++   MWWP NLVQVSLFRALH+ E R KG LTR Q
Sbjct  180   VALLVVITTQVLGFGWAGVFRRYLVEPAAMWWPQNLVQVSLFRALHEKEERHKGRLTRNQ  239

Query  1426  FFIIVLVCSFAYYVVPNYLFPSLTALSLLCWIWKNSVTAQQlgsglkglgigSFALDWAT  1247
             FFI   +CSFAYYV P Y+ P LT++S +C I+  S+ A QLGSGL GLGIG+   DWAT
Sbjct  240   FFIAAFICSFAYYVFPGYIIPKLTSVSWICLIFPASILAHQLGSGLHGLGIGAIGFDWAT  299

Query  1246  VAAFQGSPLVTPDFAIINMLIGYVLVAYIAIPVWYWTNLFDAKKFPLFSSNVFDSNGQVY  1067
              +++ GSPL +P FA  N+  G+ L+ Y+  P+ Y  N++ A  FP+FS  +F S+G+ Y
Sbjct  300   TSSYLGSPLASPWFATANVAAGFALIMYVITPIAYCLNIYKANTFPIFSDGLFTSSGRRY  359

Query  1066  NISRVLNKKTFGFDQPGYDSYSNIYLSTAFVYTYGLSFATLAATVSHVALFHGRTIWEQT  887
             N+S +++ K F  D   Y+    +YLST F   YGL+FA + AT+ HV LFHGR IW+ +
Sbjct  360   NVSAIIDPK-FHIDMDAYNRQGPLYLSTNFAMIYGLNFACMTATIVHVFLFHGRDIWQLS  418

Query  886   KESVQDKFSDIHTRLMRKNYEPVPQWWFYlllviivgvalvACQRFGGQLQLPVWGVLLA  707
             K + Q+K  D+HT+LMRK Y+PVP+WWF  +L++ +   +  CQ +  QLQLP WGVLLA
Sbjct  419   KSAFQEKKMDVHTKLMRK-YKPVPEWWFLCILLLNISATIFTCQYYNAQLQLPWWGVLLA  477

Query  706   VLLSLIFTLPVGVITATTNQQTGLNVIAELIIGYMYPGRPLASVTFKMYGlsslsqslmf  527
               L+L+FTLPVGVITATTNQ  GLNVI E IIGY+YPG P+A++ FK+YG  S+ Q + F
Sbjct  478   CSLALLFTLPVGVITATTNQTPGLNVITEYIIGYLYPGFPVANICFKVYGYISMKQGITF  537

Query  526   lSDFKLGHYMKIPPKSMFMVQLVGTLISCCVHFGTGWWLLTTVENICNPSKLPEGSQWTC  347
             L DFKLGHYMKIPP++MFM Q+VGT+I+  VH  T WWL+ TV NIC    LP+GS WTC
Sbjct  538   LHDFKLGHYMKIPPRAMFMAQVVGTVIAALVHLATAWWLMETVPNICERELLPKGSPWTC  597

Query  346   PGDDVFYNASIIWGVVSPRRMFGNLGIYQATNYFFLVGFLAPIPVWYLGRKYPEKRWVSL  167
             PGD VFY+AS+IWG++ PRR+FG+ G Y A N+FFL G +AP+ VW   + +P+K W+ L
Sbjct  598   PGDHVFYDASVIWGLIGPRRIFGDRGHYSAINWFFLAGAIAPVLVWLAHKTFPDKHWIRL  657

Query  166   INMPILISGAEGIPIVKSVNYVCWFAVGLYFNLYVYRKHKGWWARHNYILSAGLD  2
             I+MP+L+     +    +VNY  W  VG       YR ++ WW+RHNY+LS  LD
Sbjct  658   ISMPVLLGATLNMLPATAVNYTTWVLVGFASGFIAYRYYRDWWSRHNYVLSGALD  712



>ref|XP_009108224.1| PREDICTED: oligopeptide transporter 7 [Brassica rapa]
Length=765

 Score =   728 bits (1880),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 358/666 (54%), Positives = 495/666 (74%), Gaps = 6/666 (1%)
 Frame = -1

Query  1999  PVEEVRLTVPITDDPTMPCVTFRTWVLGVTSCVILAFLNQFFGYRQNALYVSSVPAQIVV  1820
             P+ EV LTVP TDDP++P +TFR WVLG  SC++L+FLNQFF YR+  L +S++ AQI V
Sbjct  55    PIREVALTVPTTDDPSLPVLTFRMWVLGTLSCILLSFLNQFFWYRREPLSISAISAQIAV  114

Query  1819  LPMGKLMAAYLPTKVVQIPGTKWSFSLNPGPFNIKEHVLITIFASSGSDFSYAVSIITMM  1640
             +P+G+LMAA +  +V  + G+KW F+LNPGPFN+KEHVLITIFA++G+   YA+ ++T++
Sbjct  115   VPLGRLMAAKISDRVF-LQGSKWEFTLNPGPFNVKEHVLITIFANAGAGSVYAIHVVTVV  173

Query  1639  KAFYYRDIHPLAAVLLTFSTQMLGYGLAGIFKKFLIDSPYMWWPSNLVQVSLFRALHDVE  1460
             KAFY ++I    + ++  +TQ+LG+G AGIF+K+L++   MWWP+NLVQVSLFRALH+ E
Sbjct  174   KAFYMKNITFFVSFVVIVTTQVLGFGWAGIFRKYLVEPAEMWWPANLVQVSLFRALHEKE  233

Query  1459  TRPKGGLTRLQFFIIVLVCSFAYYVVPNYLFPSLTALSLLCWIWKNSVTAQQlgsglkgl  1280
              R KGGLTR QFF+I  VCSFAYYV P YLF  LT+LS +CW +  SV AQQ+GSGL GL
Sbjct  234   ERTKGGLTRTQFFVIAFVCSFAYYVFPGYLFQMLTSLSWVCWFFPTSVMAQQIGSGLHGL  293

Query  1279  gigSFALDWATVAAFQGSPLVTPDFAIINMLIGYVLVAYIAIPVWYWTNLFDAKKFPLFS  1100
             G+G+  LDW+T++++ GSPL +P FA  N+ +G+VL  Y+ +P+ YW ++F AK FPL+S
Sbjct  294   GVGAIGLDWSTISSYLGSPLASPWFATANVGVGFVLAIYVVVPICYWLDVFKAKTFPLYS  353

Query  1099  SNVFDSNGQVYNISRVLNKKTFGFDQPGYDSYSNIYLSTAFVYTYGLSFATLAATVSHVA  920
             S++F S G  YNI+ +++ K F  D   Y+    +YLST F  +YG+ FA L+AT+ HV+
Sbjct  354   SSLFTSEGSKYNITSIIDSK-FHLDLQAYEREGPLYLSTFFAISYGIGFAALSATIVHVS  412

Query  919   LFHGRTIWEQTKESVQDKFSDIHTRLMRKNYEPVPQWWFYlllviivgvalvACQRFGGQ  740
             LFHGR IW+Q+K+S ++K  DIHTRLMR+ Y+ VP+WWF+ +L I + V + AC+ +  Q
Sbjct  413   LFHGREIWDQSKQSFKEKKIDIHTRLMRR-YKEVPEWWFWCILAINISVTIFACEYYIDQ  471

Query  739   LQLPVWGVLLAVLLSLIFTLPVGVITATTNQQTGLNVIAELIIGYMYPGRPLASVTFKMY  560
             LQLP WGVLLA  +++IFTLP+G++TA TNQ  GLN+I E IIGY+YPG P+A++ FK+Y
Sbjct  472   LQLPWWGVLLACSVAIIFTLPIGILTAITNQAPGLNIITEYIIGYIYPGYPVANMCFKVY  531

Query  559   GlsslsqslmflSDFKLGHYMKIPPKSMFMVQLVGTLISCCVHFGTGWWLLTTVENICNP  380
             G  S+ Q+++FL DFKLGHYMKIPP++MFM Q+VGTL+SC V+  T WWL+ T+ NIC+ 
Sbjct  532   GYISMKQAVLFLQDFKLGHYMKIPPRNMFMAQIVGTLLSCLVYLATAWWLMETIPNICDS  591

Query  379   SKLPEGSQWTCPGDDVFYNASIIWGVVSPRRMFGNLGIYQATNYFFLVGFLAPIPVWYLG  200
                   S WTCP D VFY+AS+IWG++ PRR+FG+LG+Y++ N+FFLVG +AP+ VW   
Sbjct  592   I---SNSVWTCPSDKVFYDASVIWGLIGPRRIFGDLGLYKSVNWFFLVGAIAPVLVWLAS  648

Query  199   RKYPEKRWVSLINMPILISGAEGIPIVKSVNYVCWFAVGLYFNLYVYRKHKGWWARHNYI  20
             R +P ++W+ LINMP+LIS    +P   +VNY  W   G      V+R     W R+NY+
Sbjct  649   RMFPRQQWIKLINMPVLISAISSMPPATAVNYTTWLLAGFLSGFVVFRYRPHLWQRYNYV  708

Query  19    LSAGLD  2
             LS  LD
Sbjct  709   LSGALD  714



>ref|XP_010676880.1| PREDICTED: oligopeptide transporter 7-like [Beta vulgaris subsp. 
vulgaris]
Length=763

 Score =   728 bits (1880),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 359/672 (53%), Positives = 489/672 (73%), Gaps = 5/672 (1%)
 Frame = -1

Query  2017  DEINDSPVEEVRLTVPITDDPTMPCVTFRTWVLGVTSCVILAFLNQFFGYRQNALYVSSV  1838
             D   +SPV++V +TVP  DDP +P +TFR W LG  SCV+L+FLNQFF YR   L ++++
Sbjct  45    DNKENSPVKQVAMTVPTIDDPELPVLTFRMWALGTLSCVVLSFLNQFFWYRTEPLSITAI  104

Query  1837  PAQIVVLPMGKLMAAYLPTKVVQIPGTKWSFSLNPGPFNIKEHVLITIFASSGSDFSYAV  1658
              AQI V+P+G+LMAA LP++   + GT+W F+LNPGPFNIKEHVLITIFA++G+   YA+
Sbjct  105   SAQIAVVPLGQLMAAKLPSRPF-LRGTRWEFTLNPGPFNIKEHVLITIFANAGAGSVYAI  163

Query  1657  SIITMMKAFYYRDIHPLAAVLLTFSTQMLGYGLAGIFKKFLIDSPYMWWPSNLVQVSLFR  1478
              ++T++K FY + I    ++++  +TQ+LG+G AGIF+++L++   MWWP+NLVQVSLFR
Sbjct  164   HVVTVVKIFYKKQITFFVSLIVVLTTQVLGFGWAGIFRRYLVEPAEMWWPANLVQVSLFR  223

Query  1477  ALHDVETRPKGGLTRLQFFIIVLVCSFAYYVVPNYLFPSLTALSLLCWIWKNSVTAQQlg  1298
             ALH+ E R KGGLTR QFF+I  +CSFAYYV P YLF  LT+LS +CW+W  S+ AQQLG
Sbjct  224   ALHEKEERAKGGLTRTQFFLISFICSFAYYVFPGYLFQMLTSLSWICWLWPKSILAQQLG  283

Query  1297  sglkglgigSFALDWATVAAFQGSPLVTPDFAIINMLIGYVLVAYIAIPVWYWTNLFDAK  1118
             SGL GLGI +F LDW+T++++ GSPL +P FA  N+  G+V V Y+  P+ YW N++ AK
Sbjct  284   SGLYGLGITAFGLDWSTISSYLGSPLASPWFATANVAAGFVFVMYVLTPISYWLNVYKAK  343

Query  1117  KFPLFSSNVFDSNGQVYNISRVLNKKTFGFDQPGYDSYSNIYLSTAFVYTYGLSFATLAA  938
              FP+FS ++F SNG +YNIS +++   F  +Q  Y+    +YLST F  TYG+ FA L+A
Sbjct  344   TFPIFSDDLFTSNGSIYNISAIVDSN-FHINQEAYEKQGPLYLSTFFSMTYGVGFAALSA  402

Query  937   TVSHVALFHGRTIWEQTKESVQDKFSDIHTRLMRKNYEPVPQWWFYlllviivgvalvAC  758
             TV HVALFHGR IWEQ+K S +DK  DIHT+LM + Y+  P+WWF+++LVI +   + AC
Sbjct  403   TVVHVALFHGREIWEQSKASFKDKKMDIHTKLMTR-YKEAPEWWFWVILVINIAATIFAC  461

Query  757   QRFGGQLQLPVWGVLLAVLLSLIFTLPVGVITATTNQQTGLNVIAELIIGYMYPGRPLAS  578
             + +  QLQLP WGVLLA  ++ IFTLP+G+ITA TNQ  GLN+I E IIGY+YPG P+A+
Sbjct  462   EYYKEQLQLPWWGVLLACAIAFIFTLPIGIITAITNQSPGLNIITEYIIGYIYPGYPVAN  521

Query  577   VTFKMYGlsslsqslmflSDFKLGHYMKIPPKSMFMVQLVGTLISCCVHFGTGWWLLTTV  398
             + FK+YG  S++Q++ FL DFKLGHYMKIPP++MFM Q+VGTLIS  V+ GT WWL+ ++
Sbjct  522   MCFKVYGYISMTQAIAFLQDFKLGHYMKIPPRTMFMAQVVGTLISAFVYLGTAWWLMESI  581

Query  397   ENICNPSKLPEGSQWTCPGDDVFYNASIIWGVVSPRRMFGNLGIYQATNYFFLVGFLAPI  218
              ++C   K    + WTCP D VFY+AS+IWG++ PRR+FGN G+Y+  N+FFL G +API
Sbjct  582   PDMCE--KTARNTVWTCPSDTVFYDASVIWGLIGPRRIFGNEGVYETINWFFLGGAIAPI  639

Query  217   PVWYLGRKYPEKRWVSLINMPILISGAEGIPIVKSVNYVCWFAVGLYFNLYVYRKHKGWW  38
              VW   + +P + W+ LINMP+LI+    +P   +VNY  W  VG       +R    WW
Sbjct  640   LVWLATKTFPNQEWIRLINMPVLIAATGMMPPATAVNYTTWILVGFLSGYVAFRYAPEWW  699

Query  37    ARHNYILSAGLD  2
              RHNY+LS  LD
Sbjct  700   ERHNYLLSGALD  711



>ref|XP_007210345.1| hypothetical protein PRUPE_ppa001827mg [Prunus persica]
 gb|EMJ11544.1| hypothetical protein PRUPE_ppa001827mg [Prunus persica]
Length=760

 Score =   728 bits (1879),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 360/668 (54%), Positives = 489/668 (73%), Gaps = 7/668 (1%)
 Frame = -1

Query  2005  DSPVEEVRLTVPITDDPTMPCVTFRTWVLGVTSCVILAFLNQFFGYRQNALYVSSVPAQI  1826
             +SPVE+V LTVP TDDP++P +TFR WVLG  SC++L+FLNQFF YR+  L ++++ AQI
Sbjct  49    NSPVEQVALTVPTTDDPSLPVLTFRMWVLGTLSCILLSFLNQFFWYRKEPLSITAISAQI  108

Query  1825  VVLPMGKLMAAYLPTKVVQIPGTKWSFSLNPGPFNIKEHVLITIFASSGSDFSYAVSIIT  1646
              V+P+G+LMA+ + T      G++W F+LNPGPFN+KEHVLITIFA+SG+   YA+ I+T
Sbjct  109   AVVPLGQLMASKITTHAF-FKGSRWEFTLNPGPFNVKEHVLITIFANSGAGTVYAIHIVT  167

Query  1645  MMKAFYYRDIHPLAAVLLTFSTQMLGYGLAGIFKKFLIDSPYMWWPSNLVQVSLFRALHD  1466
             ++K FY + I    ++L+  +TQ+LG+G AGIF+++L++   MWWP+NLVQVSLFRALH+
Sbjct  168   VVKVFYKKHITFFVSLLVILTTQVLGFGWAGIFRRYLVEPAAMWWPANLVQVSLFRALHE  227

Query  1465  VETRPKGGLTRLQFFIIVLVCSFAYYVVPNYLFPSLTALSLLCWIWKNSVTAQQlgsglk  1286
              E RPKGG+TR QFF+I  +CSFAYYV P YLF  LT+LS +CWI+  SV AQQLGSGL 
Sbjct  228   KEARPKGGVTRTQFFLIAFICSFAYYVFPGYLFEMLTSLSWICWIFPKSVLAQQLGSGLY  287

Query  1285  glgigSFALDWATVAAFQGSPLVTPDFAIINMLIGYVLVAYIAIPVWYWTNLFDAKKFPL  1106
             GLGIG+  +DW+T++++ GSPL +P FA  N+  G+ LV YI  P  YW N++ AK FP+
Sbjct  288   GLGIGTVGIDWSTISSYLGSPLASPWFATANVAAGFFLVMYILTPFCYWFNVYKAKTFPI  347

Query  1105  FSSNVFDSNGQVYNISRVLNKKTFGFDQPGYDSYSNIYLSTAFVYTYGLSFATLAATVSH  926
             FSS +F S+G+ YNI+ +++   F  D   Y+    +YLS  F  TYG+ FA L AT+ H
Sbjct  348   FSSTMFKSDGEEYNITAIIDSN-FHLDSAAYNREGPLYLSIIFAITYGVGFAALTATIVH  406

Query  925   VALFHGRTIWEQTKESVQDKFSDIHTRLMRKNYEPVPQWWFYlllviivgvalvACQRFG  746
             VALFHGR IWEQ+K S ++K  DIHTRLM++ Y+ VP+WWF ++L++ + V +  CQ + 
Sbjct  407   VALFHGREIWEQSKASFKEKQMDIHTRLMQR-YKQVPEWWFVVILLVNIAVTIFTCQYYN  465

Query  745   GQLQLPVWGVLLAVLLSLIFTLPVGVITATTNQQTGLNVIAELIIGYMYPGRPLASVTFK  566
              QLQLP WGVLLA  +++ FTLP+G+ITA TNQ  GLN+I E IIGY+YPG P+A++ FK
Sbjct  466   DQLQLPWWGVLLACAIAIFFTLPIGIITAITNQTPGLNIITEYIIGYIYPGYPVANMCFK  525

Query  565   MYGlsslsqslmflSDFKLGHYMKIPPKSMFMVQLVGTLISCCVHFGTGWWLLTTVENIC  386
             +YG  S++Q++ FL DFKLGHYMKIPP++MFM Q+VGTLI+  V+ GT WWL+ T+ +IC
Sbjct  526   VYGYISMTQAITFLQDFKLGHYMKIPPRTMFMAQVVGTLIAAIVYLGTAWWLMETIPDIC  585

Query  385   NPSKLPEGSQWTCPGDDVFYNASIIWGVVSPRRMFGNLGIYQATNYFFLVGFLAPIPVWY  206
               +     S WTCPGD VFY+AS+IWG++ PRR+FGN G Y+A N+FFL G +AP+ VW 
Sbjct  586   EDTS----SVWTCPGDTVFYDASVIWGLIGPRRIFGNKGTYEAINWFFLGGAVAPLVVWA  641

Query  205   LGRKYPEKRWVSLINMPILISGAEGIPIVKSVNYVCWFAVGLYFNLYVYRKHKGWWARHN  26
               + +P++ W+ LINMP+LI     +P   +VNY  W  +G      VYR    WW RHN
Sbjct  642   AAKAFPKQEWIRLINMPVLIGATGNMPPATAVNYTSWIILGFLSGFVVYRYRPDWWRRHN  701

Query  25    YILSAGLD  2
             Y+LS  LD
Sbjct  702   YVLSGALD  709



>ref|XP_010538850.1| PREDICTED: oligopeptide transporter 7 [Tarenaya hassleriana]
Length=757

 Score =   728 bits (1878),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 367/675 (54%), Positives = 494/675 (73%), Gaps = 5/675 (1%)
 Frame = -1

Query  2026  SSADEINDSPVEEVRLTVPITDDPTMPCVTFRTWVLGVTSCVILAFLNQFFGYRQNALYV  1847
             S + E  +SP+ +V LTVP TDDP++P +TFR WVLG  SCV+L+FLNQFF YR   L +
Sbjct  37    SGSGEEENSPIRQVALTVPTTDDPSLPVLTFRMWVLGTVSCVVLSFLNQFFWYRTEPLTI  96

Query  1846  SSVPAQIVVLPMGKLMAAYLPTKVVQIPGTKWSFSLNPGPFNIKEHVLITIFASSGSDFS  1667
             S++ AQI V+P+G+LMAA L  KV  + G+KW FSLNPGPFN+KEHVLITIFA++G+   
Sbjct  97    SAISAQIAVVPLGRLMAAKLSDKVF-LRGSKWEFSLNPGPFNVKEHVLITIFANAGAGSV  155

Query  1666  YAVSIITMMKAFYYRDIHPLAAVLLTFSTQMLGYGLAGIFKKFLIDSPYMWWPSNLVQVS  1487
             YA+ ++T++KAFY ++I    ++++  +TQ+LG+G AGIF+++L++   MWWPSNLVQVS
Sbjct  156   YAIHVVTVVKAFYMKNITFFVSLIVIITTQVLGFGWAGIFRRYLVEPAAMWWPSNLVQVS  215

Query  1486  LFRALHDVETRPKGGLTRLQFFIIVLVCSFAYYVVPNYLFPSLTALSLLCWIWKNSVTAQ  1307
             LFRALH+ E R KGGLTR QFF+I L CSFAYYV+P YLF  LT+LS LCW +  SV AQ
Sbjct  216   LFRALHEKEERTKGGLTRTQFFLIALACSFAYYVLPGYLFQMLTSLSWLCWAFPGSVLAQ  275

Query  1306  QlgsglkglgigSFALDWATVAAFQGSPLVTPDFAIINMLIGYVLVAYIAIPVWYWTNLF  1127
             Q+GSGL GLGIG+  LDW+T++++ GSPL +P FA  N+  G+VLV Y+  P++YW N++
Sbjct  276   QMGSGLHGLGIGAIGLDWSTISSYLGSPLASPWFATANVAAGFVLVMYVLTPIFYWKNVY  335

Query  1126  DAKKFPLFSSNVFDSNGQVYNISRVLNKKTFGFDQPGYDSYSNIYLSTAFVYTYGLSFAT  947
              AK FP+FSS++F   G  YNI+ +++   F  D   Y+    +Y++T F  TYG+ FA 
Sbjct  336   KAKTFPIFSSSLFTKEGSKYNITSIIDSN-FHLDLHSYELQGPLYITTFFAITYGVGFAA  394

Query  946   LAATVSHVALFHGRTIWEQTKESVQDKFSDIHTRLMRKNYEPVPQWWFYlllviivgval  767
             L+AT+ HVALFHGR IWEQ+K S ++K  DIHTRLM + Y+ VP WWF+ +LVI VG  +
Sbjct  395   LSATIVHVALFHGREIWEQSKASFKEKKMDIHTRLMSR-YKQVPDWWFWSILVINVGATI  453

Query  766   vACQRFGGQLQLPVWGVLLAVLLSLIFTLPVGVITATTNQQTGLNVIAELIIGYMYPGRP  587
              AC+ +  QLQLP WGVLLA  ++++FTLP+G+ITA TNQ  GLN+I E IIGY+YPG P
Sbjct  454   FACEYYKEQLQLPWWGVLLACSIAILFTLPIGIITAITNQAPGLNIITEYIIGYIYPGYP  513

Query  586   LASVTFKMYGlsslsqslmflSDFKLGHYMKIPPKSMFMVQLVGTLISCCVHFGTGWWLL  407
             +A++ FK+YG  S+ Q++ FL DFKLGHYMKIPP++MFM Q+VGTLISC V+  T WWLL
Sbjct  514   VANMCFKVYGYISMQQAITFLQDFKLGHYMKIPPRTMFMAQIVGTLISCLVYLVTAWWLL  573

Query  406   TTVENICNPSKLPEGSQWTCPGDDVFYNASIIWGVVSPRRMFGNLGIYQATNYFFLVGFL  227
              T+  IC+ +     S WTCPGD VF++AS+IWG++ PRR+FG+LG YQ+ N+FFLVG +
Sbjct  574   ETIPEICDTTI--SNSVWTCPGDKVFFDASVIWGLIGPRRIFGDLGTYQSVNWFFLVGAI  631

Query  226   APIPVWYLGRKYPEKRWVSLINMPILISGAEGIPIVKSVNYVCWFAVGLYFNLYVYRKHK  47
             AP+ VW L + +P + W+ LINMP+LIS    +P   +V    W   G      V+R   
Sbjct  632   APLLVWSLAKMFPRQEWIRLINMPVLISATSMMPPATAVXCTTWVMAGFLSGFVVFRFRP  691

Query  46    GWWARHNYILSAGLD  2
               W R+NY+LS  LD
Sbjct  692   DLWVRYNYVLSGALD  706



>ref|XP_002303684.2| hypothetical protein POPTR_0003s14540g [Populus trichocarpa]
 gb|EEE78663.2| hypothetical protein POPTR_0003s14540g [Populus trichocarpa]
Length=800

 Score =   729 bits (1882),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 371/706 (53%), Positives = 501/706 (71%), Gaps = 12/706 (2%)
 Frame = -1

Query  2119  RDTRERVSSFKNSSLSRLLH*MENTGISAVESSADEINDSPVEEVRLTVPITDDPTMPCV  1940
             RD ++  ++  N   S        +  S +  + DE N SPV++V LTVP TDDP++P +
Sbjct  56    RDEKDEDNTDNNLPSS------SKSQTSEINQAHDEEN-SPVKQVALTVPTTDDPSLPVL  108

Query  1939  TFRTWVLGVTSCVILAFLNQFFGYRQNALYVSSVPAQIVVLPMGKLMAAYLPTKVVQIPG  1760
             TFR WVLG  SCV+L+FLNQFF YR   L ++++ AQI V+P+G+LMAA +  +V    G
Sbjct  109   TFRMWVLGTLSCVLLSFLNQFFWYRTEPLSITAISAQIAVVPLGQLMAAKITDRVF-FKG  167

Query  1759  TKWSFSLNPGPFNIKEHVLITIFASSGSDFSYAVSIITMMKAFYYRDIHPLAAVLLTFST  1580
             T+  F+LNPGPFN+KEHVLITIFA+SG+   YA+ I+T++KAFY ++I    + ++  +T
Sbjct  168   TRCEFTLNPGPFNVKEHVLITIFANSGAGSVYAIHIVTVVKAFYKKNITFFVSFIVIITT  227

Query  1579  QMLGYGLAGIFKKFLIDSPYMWWPSNLVQVSLFRALHDVETRPKGGLTRLQFFIIVLVCS  1400
             Q+LG+G AGIF+++L++   MWWP+NLVQVSLFRALH+ E R KGG+TR QFF+I   CS
Sbjct  228   QVLGFGWAGIFRRYLVEPAAMWWPANLVQVSLFRALHEKEERSKGGVTRTQFFLIAFTCS  287

Query  1399  FAYYVVPNYLFPSLTALSLLCWIWKNSVTAQQlgsglkglgigSFALDWATVAAFQGSPL  1220
             FAYYV P YLF  LT+LS +CWI+  S+ AQQLGSGL GLGIG+F LDW+T++++ GSPL
Sbjct  288   FAYYVFPGYLFEMLTSLSWICWIFPKSILAQQLGSGLYGLGIGAFGLDWSTISSYLGSPL  347

Query  1219  VTPDFAIINMLIGYVLVAYIAIPVWYWTNLFDAKKFPLFSSNVFDSNGQVYNISRVLNKK  1040
              +P FA  N+  G+V V Y+  P+ YW N++ AK FP+FS ++F + GQ YNIS +++  
Sbjct  348   ASPWFATANVAAGFVFVMYVLTPLCYWFNVYKAKTFPIFSDDLFTATGQEYNISAIIDSN  407

Query  1039  TFGFDQPGYDSYSNIYLSTAFVYTYGLSFATLAATVSHVALFHGRTIWEQTKESVQDKFS  860
              F  D   YD    +YLST F  TYG+ FA L AT+ HVALFHGR IWEQ+  S Q+K  
Sbjct  408   -FHLDLAAYDREGPLYLSTFFAVTYGVGFAALTATIVHVALFHGREIWEQSMASFQEKTM  466

Query  859   DIHTRLMRKNYEPVPQWWFYlllviivgvalvACQRFGGQLQLPVWGVLLAVLLSLIFTL  680
             DIHTR MRK Y  VP+WWF  +L++ + + + AC+ +  QLQLP WGVLLA  +++ FTL
Sbjct  467   DIHTRHMRK-YNQVPEWWFVCILLVNIALTIFACEYYKDQLQLPWWGVLLACGIAITFTL  525

Query  679   PVGVITATTNQQTGLNVIAELIIGYMYPGRPLASVTFKMYGlsslsqslmflSDFKLGHY  500
             P+G+ITA TNQ  GLN+I E IIGY+YPG P+A++ FK+YG  S++Q++ FL DFKLGHY
Sbjct  526   PIGIITAITNQSPGLNIITEYIIGYIYPGYPVANMCFKVYGYISMTQAITFLQDFKLGHY  585

Query  499   MKIPPKSMFMVQLVGTLISCCVHFGTGWWLLTTVENICNPSKLPEGSQWTCPGDDVFYNA  320
             MKIPP++MFM Q+VGT+I+C  + GT WWLL T+ +IC+ +     S WTCP D VFY+A
Sbjct  586   MKIPPRTMFMAQVVGTIIACITYLGTAWWLLETITDICDSTA--SDSVWTCPSDHVFYDA  643

Query  319   SIIWGVVSPRRMFGNLGIYQATNYFFLVGFLAPIPVWYLGRKYPEKRWVSLINMPILISG  140
             S+IWG++ PRR+FGNLG Y+A N+FFLVG +API VW   + +P++ W+ LINMP+LI  
Sbjct  644   SVIWGLIGPRRIFGNLGTYEAVNWFFLVGAIAPILVWLAAKAFPQQEWIRLINMPVLIGA  703

Query  139   AEGIPIVKSVNYVCWFAVGLYFNLYVYRKHKGWWARHNYILSAGLD  2
                +P   +VNY  W  VG      VYR     W R+NY+LS  LD
Sbjct  704   TGMMPPATAVNYTTWVLVGFLSGFVVYRYKPDLWQRYNYVLSGSLD  749



>ref|XP_011008821.1| PREDICTED: oligopeptide transporter 7-like [Populus euphratica]
Length=750

 Score =   727 bits (1876),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 364/672 (54%), Positives = 483/672 (72%), Gaps = 3/672 (0%)
 Frame = -1

Query  2017  DEINDSPVEEVRLTVPITDDPTMPCVTFRTWVLGVTSCVILAFLNQFFGYRQNALYVSSV  1838
             D   +SP+ +V LTVP T DPT+P VTFRTW LG  +C++L+FLNQFF YR+  L ++S+
Sbjct  32    DSEENSPIVQVALTVPTTGDPTLPAVTFRTWTLGSLACILLSFLNQFFWYRREPLSITSI  91

Query  1837  PAQIVVLPMGKLMAAYLPTKVVQIPGTKWSFSLNPGPFNIKEHVLITIFASSGSDFSYAV  1658
              AQI V+P+G LMA+ +  K   + G KW F+LNPGPFN+KEHVLITIFA+SG+   YA+
Sbjct  92    CAQIAVVPLGHLMASTITNKTFFM-GKKWEFTLNPGPFNVKEHVLITIFANSGAGNVYAI  150

Query  1657  SIITMMKAFYYRDIHPLAAVLLTFSTQMLGYGLAGIFKKFLIDSPYMWWPSNLVQVSLFR  1478
              I++ +K FY +++    A+L+  +TQMLG+G AG+F+++L++   MWWP NLVQVSLFR
Sbjct  151   HIVSAVKLFYKKELTFFVALLVVITTQMLGFGWAGLFRRYLVEPASMWWPQNLVQVSLFR  210

Query  1477  ALHDVETRPKGGLTRLQFFIIVLVCSFAYYVVPNYLFPSLTALSLLCWIWKNSVTAQQlg  1298
             ALH+ E R K GLTR QFFII  +CSFAYY  P YLFP LT++S LCWI+ +S+ A QLG
Sbjct  211   ALHEKEERHKDGLTRNQFFIIAFICSFAYYAFPGYLFPKLTSISWLCWIFPSSLLAHQLG  270

Query  1297  sglkglgigSFALDWATVAAFQGSPLVTPDFAIINMLIGYVLVAYIAIPVWYWTNLFDAK  1118
             SGL GLGIG+F  DWAT++++ GSPL +P FA  N+  G+VL+ Y+  P+ YW N+++AK
Sbjct  271   SGLHGLGIGAFGFDWATISSYLGSPLASPWFATANVAAGFVLLMYVIAPIAYWLNIYEAK  330

Query  1117  KFPLFSSNVFDSNGQVYNISRVLNKKTFGFDQPGYDSYSNIYLSTAFVYTYGLSFATLAA  938
              FP+FS  +F S GQ YNIS +++ K F  D   YD    +YLST F   YGL+FA L A
Sbjct  331   NFPIFSDGLFTSTGQSYNISAIIDPK-FHIDLDAYDRQGPLYLSTIFAMIYGLNFACLTA  389

Query  937   TVSHVALFHGRTIWEQTKESVQDKFSDIHTRLMRKNYEPVPQWWFYlllviivgvalvAC  758
             TV HV LFHGR IW+ +K + + K  D+HT+LMRK Y  VP+WWF  +L + +   +  C
Sbjct  390   TVVHVFLFHGRDIWQLSKSAFRYKKMDVHTKLMRK-YNQVPEWWFLCILFLNIAATIFTC  448

Query  757   QRFGGQLQLPVWGVLLAVLLSLIFTLPVGVITATTNQQTGLNVIAELIIGYMYPGRPLAS  578
             + +  QLQLP WGVLLA  +++ FTLPVGVITATTN+  GLNVI E +IGYMYPG P+A+
Sbjct  449   EYYNEQLQLPWWGVLLACGIAVFFTLPVGVITATTNKTPGLNVITEYVIGYMYPGFPVAN  508

Query  577   VTFKMYGlsslsqslmflSDFKLGHYMKIPPKSMFMVQLVGTLISCCVHFGTGWWLLTTV  398
             + FK+YG  S+ Q + FL DFKLGHYMKIPP++MFM Q+VGT+IS  VH GT WWL+ T+
Sbjct  509   ICFKVYGYISMKQGITFLEDFKLGHYMKIPPRAMFMAQVVGTIISALVHLGTAWWLMETI  568

Query  397   ENICNPSKLPEGSQWTCPGDDVFYNASIIWGVVSPRRMFGNLGIYQATNYFFLVGFLAPI  218
              NIC+   L  GS WTCPGD +FY+AS+IWG++ PRR+FG+LG Y ATN+FFL G +API
Sbjct  569   PNICDRELLSPGSPWTCPGDHLFYDASVIWGLIGPRRVFGDLGRYSATNWFFLGGAIAPI  628

Query  217   PVWYLGRKYPEKRWVSLINMPILISGAEGIPIVKSVNYVCWFAVGLYFNLYVYRKHKGWW  38
              VW   + +P K W+ LI++P+L+S    +    +VNY  W  VG       YR ++ WW
Sbjct  629   LVWLAHKAFPNKDWIGLISIPVLLSATLNLLPATAVNYTTWVVVGFASGFIAYRYYRDWW  688

Query  37    ARHNYILSAGLD  2
             +RHNY+LS  LD
Sbjct  689   SRHNYVLSGALD  700



>ref|XP_010040072.1| PREDICTED: oligopeptide transporter 7-like [Eucalyptus grandis]
 gb|KCW45503.1| hypothetical protein EUGRSUZ_L00780 [Eucalyptus grandis]
Length=761

 Score =   727 bits (1876),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 366/667 (55%), Positives = 485/667 (73%), Gaps = 3/667 (0%)
 Frame = -1

Query  2002  SPVEEVRLTVPITDDPTMPCVTFRTWVLGVTSCVILAFLNQFFGYRQNALYVSSVPAQIV  1823
             SP+E+V LTVP  DDP++P VTFRT+VLG  +C +L+FLNQFF YR+  L VSSV AQI 
Sbjct  42    SPIEQVALTVPEGDDPSLPVVTFRTFVLGTLACSLLSFLNQFFWYRREPLSVSSVSAQIA  101

Query  1822  VLPMGKLMAAYLPTKVVQIPGTKWSFSLNPGPFNIKEHVLITIFASSGSDFSYAVSIITM  1643
             V+P+G LMA  + TK V   G+KW F+LNPGPFN+KEHVLITIFA+SG+   YA+ II++
Sbjct  102   VVPLGHLMAGVI-TKRVFFEGSKWQFTLNPGPFNVKEHVLITIFANSGAATVYAIHIISV  160

Query  1642  MKAFYYRDIHPLAAVLLTFSTQMLGYGLAGIFKKFLIDSPYMWWPSNLVQVSLFRALHDV  1463
             +K FY +++  L A+++  +TQ+LG+G AG+F+++L++   MWWP NLVQVSLFRALH+ 
Sbjct  161   VKIFYRKEMSFLVALVVVLTTQILGFGWAGMFRRYLVEPAAMWWPQNLVQVSLFRALHEK  220

Query  1462  ETRPKGGLTRLQFFIIVLVCSFAYYVVPNYLFPSLTALSLLCWIWKNSVTAQQlgsglkg  1283
             E R KG LTR  FF+I  VCSF+YYV P YLFP LT+LS +CWI+  SV AQQLGSGL G
Sbjct  221   EQRLKGRLTRNHFFLIAFVCSFSYYVFPGYLFPMLTSLSWICWIFPASVVAQQLGSGLHG  280

Query  1282  lgigSFALDWATVAAFQGSPLVTPDFAIINMLIGYVLVAYIAIPVWYWTNLFDAKKFPLF  1103
             LGIG+  LDW++++++ GSPL +P FA  N+ +G+ LV Y+  P  YW N++ ++ FP+F
Sbjct  281   LGIGAIGLDWSSISSYLGSPLASPWFATANIAVGFALVVYVITPFTYWLNIYRSRTFPIF  340

Query  1102  SSNVFDSNGQVYNISRVLNKKTFGFDQPGYDSYSNIYLSTAFVYTYGLSFATLAATVSHV  923
             S ++F S+GQ YNI  ++++  F  D    +    +YLST F   YG+SFA L ATV HV
Sbjct  341   SDSLFTSSGQKYNIETIIDEH-FHLDAEACEREGPLYLSTFFAVYYGISFACLTATVVHV  399

Query  922   ALFHGRTIWEQTKESVQDKFSDIHTRLMRKNYEPVPQWWFYlllviivgvalvACQRFGG  743
              LFHG+ IW  +K ++ +K  DIHT+LMR+ Y+ VP+WWF  +L++ +   +  CQ F  
Sbjct  400   FLFHGKEIWLLSKSALSEKKMDIHTKLMRR-YKQVPEWWFTCILLVNIAATIFTCQYFKD  458

Query  742   QLQLPVWGVLLAVLLSLIFTLPVGVITATTNQQTGLNVIAELIIGYMYPGRPLASVTFKM  563
             QLQLP WGVLLA  L+L FTLPVGVITATTNQ  GLNVI E IIGY+YPG P+A++ FK+
Sbjct  459   QLQLPWWGVLLACALALFFTLPVGVITATTNQTPGLNVITEFIIGYIYPGYPVANILFKV  518

Query  562   YGlsslsqslmflSDFKLGHYMKIPPKSMFMVQLVGTLISCCVHFGTGWWLLTTVENICN  383
             YG  S+ Q + FL DFKLGHYMKIPP++MFM Q+VGT+++  VH GT WWL+ TV +ICN
Sbjct  519   YGFISMKQGITFLQDFKLGHYMKIPPRAMFMAQVVGTIVAALVHLGTAWWLMDTVPDICN  578

Query  382   PSKLPEGSQWTCPGDDVFYNASIIWGVVSPRRMFGNLGIYQATNYFFLVGFLAPIPVWYL  203
                LP GS WTCPGD VFY+AS+IWG++ PRR+FG+LG Y A N+FFLVG +AP  VW  
Sbjct  579   RELLPAGSPWTCPGDHVFYDASVIWGLIGPRRIFGDLGHYSAINWFFLVGAIAPFIVWLA  638

Query  202   GRKYPEKRWVSLINMPILISGAEGIPIVKSVNYVCWFAVGLYFNLYVYRKHKGWWARHNY  23
              + +P+K W+ LI MP+L+     +P   +VNY  W   G       YR ++GWW+RHNY
Sbjct  639   RKAFPDKEWIRLITMPVLLGATLHMPPATAVNYTNWIIAGFLSGFIAYRYYQGWWSRHNY  698

Query  22    ILSAGLD  2
             +LS  LD
Sbjct  699   VLSGALD  705



>ref|NP_001130398.1| uncharacterized protein LOC100191494 [Zea mays]
 gb|ACG28837.1| oligopeptide transporter 9 [Zea mays]
 gb|ACL53218.1| unknown [Zea mays]
 gb|AFW86095.1| oligopeptide transporter 9 [Zea mays]
Length=781

 Score =   728 bits (1878),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 366/683 (54%), Positives = 490/683 (72%), Gaps = 4/683 (1%)
 Frame = -1

Query  2047  TGISAVESSADEINDSPVEEVRLTVPITDDPTMPCVTFRTWVLGVTSCVILAFLNQFFGY  1868
             T  S   S  D+  +SP+E+V LTVP+ DDP+ P +TFR WVLG  SC +L+FLNQFF Y
Sbjct  51    TTSSPSPSEGDDPENSPIEQVALTVPVGDDPSTPVLTFRMWVLGTASCALLSFLNQFFWY  110

Query  1867  RQNALYVSSVPAQIVVLPMGKLMAAYLPTKVVQIPGTKWSFSLNPGPFNIKEHVLITIFA  1688
             R+  L ++++ AQI V+P+G+LMAA LP + V + GT+W FSLNPGPF++KEHVL+TIFA
Sbjct  111   RKEPLTITAISAQIAVVPLGRLMAAALPARAV-LRGTRWEFSLNPGPFSVKEHVLVTIFA  169

Query  1687  SSGSDFSYAVSIITMMKAFYYRDIHPLAAVLLTFSTQMLGYGLAGIFKKFLIDSPYMWWP  1508
             +SG+   YA+ +IT ++ FY + I    ++L+  +TQ+LG+G AGIF+++L++   MWWP
Sbjct  170   NSGAGTVYAIHVITAVRVFYGKHITFFVSLLVVLTTQVLGFGWAGIFRRYLVEPAAMWWP  229

Query  1507  SNLVQVSLFRALHDVETRPKGGLTRLQFFIIVLVCSFAYYVVPNYLFPSLTALSLLCWIW  1328
             SNLVQVSLFRALH+ E R KGG+TR QFF++  VCSFAYYV P YLF  LT+LS LCW +
Sbjct  230   SNLVQVSLFRALHEKERRVKGGMTRNQFFLVAFVCSFAYYVFPGYLFQMLTSLSWLCWAF  289

Query  1327  KNSVTAQQlgsglkglgigSFALDWATVAAFQGSPLVTPDFAIINMLIGYVLVAYIAIPV  1148
               SV AQQLGSGL GLG+G+  LDW+T++++ GSPL +P FA  N+  G+VL+ Y+  P 
Sbjct  290   PRSVVAQQLGSGLSGLGVGAVGLDWSTISSYLGSPLASPWFATANVAAGFVLIMYVITPA  349

Query  1147  -WYWTNLFDAKKFPLFSSNVFDSNGQVYNISRVLNKKTFGFDQPGYDSYSNIYLSTAFVY  971
              +YW  L+ A+ FP+FS  +F + GQ YNIS +++   F FD   Y+    +YLST F  
Sbjct  350   AYYWLGLYGARSFPIFSDGLFTAAGQTYNISSIVDSN-FRFDTEAYERNGPLYLSTFFAV  408

Query  970   TYGLSFATLAATVSHVALFHGRTIWEQTKESVQDKFSDIHTRLMRKNYEPVPQWWFYlll  791
             TYG+ FA+L ATV HV LFHG  IW+ ++ + Q+K  D+HTRLMR+ Y  VP+WWF  +L
Sbjct  409   TYGVGFASLTATVVHVFLFHGSEIWQLSRSAFQEKKVDVHTRLMRR-YRQVPEWWFICIL  467

Query  790   viivgvalvACQRFGGQLQLPVWGVLLAVLLSLIFTLPVGVITATTNQQTGLNVIAELII  611
             V  V V + AC+ +  QLQLP WGVLLA  ++  FTLP+G+ITATTNQ  GLN+I E I+
Sbjct  468   VANVAVTIFACEYYIEQLQLPWWGVLLACAIAFFFTLPIGIITATTNQTPGLNIITEYIM  527

Query  610   GYMYPGRPLASVTFKMYGlsslsqslmflSDFKLGHYMKIPPKSMFMVQLVGTLISCCVH  431
             GY+YPGRP+A++ FK+YG  S++Q+L FL DFKLGHYMKIPP++MFM Q+VGTLI+  V+
Sbjct  528   GYLYPGRPVANMCFKVYGYISMTQALAFLQDFKLGHYMKIPPRTMFMAQVVGTLIAALVY  587

Query  430   FGTGWWLLTTVENICNPSKLPEGSQWTCPGDDVFYNASIIWGVVSPRRMFGNLGIYQATN  251
              GT WWL+ +V NIC+   LP  S WTCP D VFY+AS+IWG++ PRR+FG+LG Y A N
Sbjct  588   IGTAWWLMDSVPNICSTELLPADSPWTCPMDHVFYDASVIWGLIGPRRIFGDLGTYSAVN  647

Query  250   YFFLVGFLAPIPVWYLGRKYPEKRWVSLINMPILISGAEGIPIVKSVNYVCWFAVGLYFN  71
             +FFL G +AP+ VW   R +P + W+ L+NMP+LI     +P   +VNY  W   G    
Sbjct  648   WFFLGGAVAPLLVWLAHRVFPSQSWILLVNMPVLIGSTGMMPPATAVNYTTWIIAGFLSG  707

Query  70    LYVYRKHKGWWARHNYILSAGLD  2
               VYR  + WW RHNY+LS  LD
Sbjct  708   YVVYRYRRHWWERHNYLLSGALD  730



>ref|XP_002971950.1| hypothetical protein SELMODRAFT_148240 [Selaginella moellendorffii]
 gb|EFJ26867.1| hypothetical protein SELMODRAFT_148240 [Selaginella moellendorffii]
Length=740

 Score =   725 bits (1872),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 367/672 (55%), Positives = 488/672 (73%), Gaps = 14/672 (2%)
 Frame = -1

Query  2017  DEINDSPVEEVRLTVPITDDPTMPCVTFRTWVLGVTSCVILAFLNQFFGYRQNALYVSSV  1838
              E   SP+EEV LTVP TDD ++P  TFR W LG+ SC +LAF+NQFF YR   L V  +
Sbjct  31    SEEEQSPIEEVALTVPTTDDASLPVYTFRMWTLGLLSCALLAFINQFFSYRTEPLTVGVI  90

Query  1837  PAQIVVLPMGKLMAAYLPTKVVQIPGTKWSFSLNPGPFNIKEHVLITIFASSGSDFSYAV  1658
              AQI  LP+G+LMAA LP+  +++ G   SFSLNPGPFN+KEHVLITIFA++G+  +YA+
Sbjct  91    SAQIAALPLGRLMAAALPSAQLRLLGR--SFSLNPGPFNVKEHVLITIFANAGAGGAYAI  148

Query  1657  SIITMMKAFYYRDIHPLAAVLLTFSTQMLGYGLAGIFKKFLIDSPYMWWPSNLVQVSLFR  1478
              I+ ++KAFY R++          S  + GYG AGIF+++L+D   MWWPSNLVQVS+F 
Sbjct  149   GIVNIVKAFYGREL----------SFVITGYGWAGIFRRYLVDPAEMWWPSNLVQVSIFN  198

Query  1477  ALHDVETRPKGGLTRLQFFIIVLVCSFAYYVVPNYLFPSLTALSLLCWIWKNSVTAQQlg  1298
              LH+ ++R KG +TRLQFF+I L CSF YY +P YLF +LT++S +CW W  SV A QLG
Sbjct  199   TLHEKDSRRKGDVTRLQFFLITLACSFLYYSLPGYLFKTLTSISWVCWAWPKSVLAHQLG  258

Query  1297  sglkglgigSFALDWATVAAFQGSPLVTPDFAIINMLIGYVLVAYIAIPVWYWTNLFDAK  1118
             SG+ G+GIG+   DW+TVA++  SPL TP FAI N+++G+++V Y+  P  Y++N++ AK
Sbjct  259   SGMSGMGIGAVGFDWSTVASYLSSPLATPWFAIANVMVGFLIVMYVITPAAYFSNVYSAK  318

Query  1117  KFPLFSSNVFDSNGQVYNISRVLNKKTFGFDQPGYDSYSNIYLSTAFVYTYGLSFATLAA  938
              FP+FSS +F  +G  YNISRV+N++ F  D   Y+SYS + LST FV+TYG+ FA L A
Sbjct  319   TFPIFSSQLFADDGSRYNISRVVNER-FELDVQAYNSYSKLNLSTFFVFTYGVGFAALTA  377

Query  937   TVSHVALFHGRTIWEQTKESVQDKFSDIHTRLMRKNYEPVPQWWFYlllviivgvalvAC  758
             TVSHV LFHG+ +W +   +   +  D+HTRLMRK Y+P PQWWF  LL + +  +++ C
Sbjct  378   TVSHVVLFHGKEMWSRAVAAFHAEKLDVHTRLMRK-YKPCPQWWFLALLALSIFGSIITC  436

Query  757   QRFGGQLQLPVWGVLLAVLLSLIFTLPVGVITATTNQQTGLNVIAELIIGYMYPGRPLAS  578
               F  Q+QLP WGVLLA  L+ +FTLP+GVITATTNQ  GLNVI E IIGYMYPGRP+A+
Sbjct  437   VVFKDQVQLPWWGVLLACGLAFVFTLPIGVITATTNQTPGLNVITEFIIGYMYPGRPVAN  496

Query  577   VTFKMYGlsslsqslmflSDFKLGHYMKIPPKSMFMVQLVGTLISCCVHFGTGWWLLTTV  398
             V FK YG  S+ Q++ FL+DFKLGHYMKIPP+SMF VQ++GT ++  V+ GT WWLLT+V
Sbjct  497   VCFKTYGYISMLQAITFLADFKLGHYMKIPPRSMFTVQIIGTAVAALVNLGTAWWLLTSV  556

Query  397   ENICNPSKLPEGSQWTCPGDDVFYNASIIWGVVSPRRMFGNLGIYQATNYFFLVGFLAPI  218
             +NIC+  KLP+GS WTCP D VF++AS+IWG++ P R+FG+LG YQA N+FFLVG +AP+
Sbjct  557   DNICHTDKLPQGSPWTCPSDRVFFSASVIWGLIGPNRIFGSLGHYQAINWFFLVGAVAPL  616

Query  217   PVWYLGRKYPEKRWVSLINMPILISGAEGIPIVKSVNYVCWFAVGLYFNLYVYRKHKGWW  38
              VW   + +P +RW+  +NMPILI     +P   SVNY  WF VG  FN  +++  K WW
Sbjct  617   LVWLAAKAFPRQRWIRYVNMPILIGATGNMPPATSVNYTSWFVVGFIFNYLIFKHRKKWW  676

Query  37    ARHNYILSAGLD  2
              R+NY+LSA +D
Sbjct  677   TRYNYVLSAAMD  688



>gb|KCW76553.1| hypothetical protein EUGRSUZ_D00943 [Eucalyptus grandis]
Length=559

 Score =   718 bits (1854),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 356/506 (70%), Positives = 429/506 (85%), Gaps = 0/506 (0%)
 Frame = -1

Query  1519  MWWPSNLVQVSLFRALHDVETRPKGGLTRLQFFIIVLVCSFAYYVVPNYLFPSLTALSLL  1340
             MWWP+NLVQVSLFRALH+ E RPKGGL RLQFF+IVL+ SFAYYVVPNYLFPS+TALS +
Sbjct  1     MWWPANLVQVSLFRALHEEEVRPKGGLMRLQFFLIVLISSFAYYVVPNYLFPSITALSFV  60

Query  1339  CWIWKNSVTAQQlgsglkglgigSFALDWATVAAFQGSPLVTPDFAIINMLIGYVLVAYI  1160
             CWIWK+SVTAQQ+GSG +GLGIGSFALDWATVAAF GSPL TP FA+IN+ IG+ L+ Y+
Sbjct  61    CWIWKDSVTAQQIGSGRRGLGIGSFALDWATVAAFIGSPLATPGFALINISIGFFLMLYV  120

Query  1159  AIPVWYWTNLFDAKKFPLFSSNVFDSNGQVYNISRVLNKKTFGFDQPGYDSYSNIYLSTA  980
              IP+ YWTN F+AK+FP+ SS+VFD+NG  YN+  VLN+ TF F+Q GYD YS ++LS  
Sbjct  121   LIPIAYWTNAFEAKRFPIISSHVFDANGGKYNVGLVLNETTFQFNQQGYDDYSKVHLSIF  180

Query  979   FVYTYGLSFATLAATVSHVALFHGRTIWEQTKESVQDKFSDIHTRLMRKNYEPVPQWWFY  800
             F + YGLSFATLAAT+SHVALFHGRTIW+QT+ + +DKF D+HTRLM+KNY+ VPQWWFY
Sbjct  181   FAFAYGLSFATLAATISHVALFHGRTIWQQTQAAFRDKFDDVHTRLMKKNYDAVPQWWFY  240

Query  799   lllviivgvalvACQRFGGQLQLPVWGVLLAVLLSLIFTLPVGVITATTNQQTGLNVIAE  620
              L +I++G+A+VAC+ FGGQLQLP WGV+LA+ + L F LP+GVITATTNQQ GLNVI+E
Sbjct  241   SLWLIMIGLAMVACEGFGGQLQLPYWGVILAIGVVLFFMLPIGVITATTNQQFGLNVISE  300

Query  619   LIIGYMYPGRPLASVTFKMYGlsslsqslmflSDFKLGHYMKIPPKSMFMVQLVGTLISC  440
             LI+GYMYPGRPLA+V FK Y   S+ Q++ FLSDFKLGHYMKIPPKSMF+VQLVGT+++ 
Sbjct  301   LIVGYMYPGRPLANVVFKTYSYVSMVQAITFLSDFKLGHYMKIPPKSMFIVQLVGTVVAS  360

Query  439   CVHFGTGWWLLTTVENICNPSKLPEGSQWTCPGDDVFYNASIIWGVVSPRRMFGNLGIYQ  260
              V+F T WWLLT+V+NIC+PSKLP GS WTCPGDDVFYNASIIWGVV P RMFG LG+Y 
Sbjct  361   SVYFSTAWWLLTSVDNICDPSKLPMGSPWTCPGDDVFYNASIIWGVVGPLRMFGRLGVYA  420

Query  259   ATNYFFLVGFLAPIPVWYLGRKYPEKRWVSLINMPILISGAEGIPIVKSVNYVCWFAVGL  80
               NYFFL G LAP+PVW L R +PEK+W+ LINMPI+ISG+  +P   +VN +CW  VG+
Sbjct  421   KMNYFFLFGILAPVPVWILSRMFPEKKWIRLINMPIIISGSPSMPPGTAVNNICWLTVGI  480

Query  79    YFNLYVYRKHKGWWARHNYILSAGLD  2
             +FN+YVYR++K WW RHNYILSAGLD
Sbjct  481   FFNVYVYRRYKSWWVRHNYILSAGLD  506



>ref|XP_009358688.1| PREDICTED: LOW QUALITY PROTEIN: oligopeptide transporter 7-like 
[Pyrus x bretschneideri]
Length=749

 Score =   726 bits (1873),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 366/681 (54%), Positives = 493/681 (72%), Gaps = 8/681 (1%)
 Frame = -1

Query  2044  GISAVESSADEINDSPVEEVRLTVPITDDPTMPCVTFRTWVLGVTSCVILAFLNQFFGYR  1865
             G S+   S DE N SPVE+V LTVP TDDP++P +TFR WVLG  SCV+L+FLNQFF YR
Sbjct  26    GQSSSFQSTDEEN-SPVEQVALTVPTTDDPSLPVLTFRMWVLGTLSCVLLSFLNQFFWYR  84

Query  1864  QNALYVSSVPAQIVVLPMGKLMAAYLPTKVVQIPGTKWSFSLNPGPFNIKEHVLITIFAS  1685
                L ++++ AQI V+P+G+LMA+ +  +V    G++W F+LNPGPFN+KEHVLITIFA+
Sbjct  85    TEPLTITAISAQIAVVPLGQLMASKITNRVF-FKGSRWEFTLNPGPFNVKEHVLITIFAN  143

Query  1684  SGSDFSYAVSIITMMKAFYYRDIHPLAAVLLTFSTQMLGYGLAGIFKKFLIDSPYMWWPS  1505
             SG+   YA+ I+T +K FY + I    ++L+  +TQ+LG+G AGIF+++L++   MWWP+
Sbjct  144   SGAGTVYAIHIVTAVKVFYKKHITFFVSLLVILTTQVLGFGWAGIFRRYLVEPAAMWWPA  203

Query  1504  NLVQVSLFRALHDVETRPKGGLTRLQFFIIVLVCSFAYYVVPNYLFPSLTALSLLCWIWK  1325
             NLVQVSLFRALH+ E R KGGLTR QFF+I  +CSFAYYV P YLF  LT+LS +CWI+ 
Sbjct  204   NLVQVSLFRALHEKEVRHKGGLTRTQFFLIAFMCSFAYYVFPGYLFQMLTSLSWICWIFP  263

Query  1324  NSVTAQQlgsglkglgigSFALDWATVAAFQGSPLVTPDFAIINMLIGYVLVAYIAIPVW  1145
              +V AQQLGSGL GLGIG+  +DW+T++A+ GSPL +P FA  N+  G+  V YI  P+ 
Sbjct  264   TNVLAQQLGSGLHGLGIGAVGVDWSTISAYLGSPLASPWFATANVAAGFFFVMYILTPLS  323

Query  1144  YWTNLFDAKKFPLFSSNVFDSNGQVYNISRVLNKKTFGFDQPGYDSYSNIYLSTAFVYTY  965
             YW N++ AK FP+FS+++F S+GQ YNI+ +++   F  D   Y+   ++Y+S  F  TY
Sbjct  324   YWFNIYKAKTFPIFSNSMFTSDGQEYNITAIIDSN-FHLDYDAYEQEGHLYISIIFTITY  382

Query  964   GLSFATLAATVSHVALFHGRTIWEQTKESVQDKFSDIHTRLMRKNYEPVPQWWFYlllvi  785
             G+SFA L AT+ HVALFHGR IWEQ+K S ++K  DIHTRLM++ Y  VP+WWF ++L+ 
Sbjct  383   GVSFAALTATIVHVALFHGREIWEQSKASFKEKKMDIHTRLMQR-YNQVPEWWFVVILLA  441

Query  784   ivgvalvACQRFGGQLQLPVWGVLLAVLLSLIFTLPVGVITATTNQQTGLNVIAELIIGY  605
              + + +  CQ +  QLQLP WGVLLA  +++ FTLP+G+ITA TNQ  GLNVI E IIGY
Sbjct  442   NIALTIFTCQYYNDQLQLPWWGVLLACGIAIFFTLPIGIITAITNQGPGLNVITEYIIGY  501

Query  604   MYPGRPLASVTFKMYGlsslsqslmflSDFKLGHYMKIPPKSMFMVQLVGTLISCCVHFG  425
             +YPG P+A++ FK+ G  S+SQ++ FL DFKLGHYMKIPP++MFM Q+VGTLI+  V+  
Sbjct  502   IYPGYPVANMCFKVXGYISMSQAVTFLQDFKLGHYMKIPPRTMFMAQVVGTLIAAIVYLS  561

Query  424   TGWWLLTTVENICNPSKLPEGSQWTCPGDDVFYNASIIWGVVSPRRMFGNLGIYQATNYF  245
             T WWL+ T+ +IC  +     S WTCPGD VFY+AS+IWG++ PRR+FG+LG Y+A N+F
Sbjct  562   TAWWLMETIPDICEDTT----SVWTCPGDTVFYDASVIWGLIGPRRIFGDLGRYEAVNWF  617

Query  244   FLVGFLAPIPVWYLGRKYPEKRWVSLINMPILISGAEGIPIVKSVNYVCWFAVGLYFNLY  65
             FLVG +API VW   + +P + W+ LINMP+L+     +P   +VNY  W  +G      
Sbjct  618   FLVGAIAPIFVWLAVKAFPRQEWIGLINMPVLMGATSSMPPATAVNYTSWIILGFLSGFV  677

Query  64    VYRKHKGWWARHNYILSAGLD  2
             VYR    WW RHNY+LS  LD
Sbjct  678   VYRYRPNWWKRHNYVLSGALD  698



>ref|XP_007156168.1| hypothetical protein PHAVU_003G263900g [Phaseolus vulgaris]
 gb|ESW28162.1| hypothetical protein PHAVU_003G263900g [Phaseolus vulgaris]
Length=748

 Score =   725 bits (1871),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 360/695 (52%), Positives = 495/695 (71%), Gaps = 4/695 (1%)
 Frame = -1

Query  2086  NSSLSRLLH*MENTGISAVESSADEINDSPVEEVRLTVPITDDPTMPCVTFRTWVLGVTS  1907
             N+ L +  H   N  IS  E+S    N SP+E+V LTVP++DDP++P  TFRTW+LG  +
Sbjct  8     NAPLIKRRH-HNNDAISEAENSPAAEN-SPIEQVALTVPVSDDPSLPSFTFRTWILGTLA  65

Query  1906  CVILAFLNQFFGYRQNALYVSSVPAQIVVLPMGKLMAAYLPTKVVQIPGTKWSFSLNPGP  1727
             CV+L+FLNQFFG+++  L V+++ AQI V+P G LMAA + T+ V + GTKW F+LNPG 
Sbjct  66    CVLLSFLNQFFGFQREPLSVTAISAQIAVVPAGHLMAAAV-TRRVFMKGTKWEFTLNPGK  124

Query  1726  FNIKEHVLITIFASSGSDFSYAVSIITMMKAFYYRDIHPLAAVLLTFSTQMLGYGLAGIF  1547
             FN+KEHVLITIFASSG+   YA+  ++ +K FY +++  LAA+L+  ++Q+LG+G AGIF
Sbjct  125   FNVKEHVLITIFASSGAASVYAIRFVSAVKLFYRKELTVLAALLVVITSQVLGFGWAGIF  184

Query  1546  KKFLIDSPYMWWPSNLVQVSLFRALHDVETRPKGGLTRLQFFIIVLVCSFAYYVVPNYLF  1367
             +++L++   MWWP NLVQVSLFRALH+ E R KG LTR QFF+I  +CSFAYYV P YLF
Sbjct  185   RQYLVEPATMWWPQNLVQVSLFRALHEQEERRKGALTRNQFFLIAFLCSFAYYVFPGYLF  244

Query  1366  PSLTALSLLCWIWKNSVTAQQlgsglkglgigSFALDWATVAAFQGSPLVTPDFAIINML  1187
             P LT++S +CW++  SV A QLGSGL GLG+G+   DW+++ ++ GSPL +P FA  N+ 
Sbjct  245   PMLTSISWICWMFPTSVIAHQLGSGLHGLGVGAVGFDWSSICSYLGSPLASPWFATANVA  304

Query  1186  IGYVLVAYIAIPVWYWTNLFDAKKFPLFSSNVFDSNGQVYNISRVLNKKTFGFDQPGYDS  1007
             +G+ +  Y  +P+ Y TNL++A++FP+FS  +F SNGQ YNIS +++   F  D   Y+ 
Sbjct  305   VGFAIFIYAIVPIAYSTNLYNARRFPIFSDELFMSNGQKYNISAIIDSN-FHLDMEAYER  363

Query  1006  YSNIYLSTAFVYTYGLSFATLAATVSHVALFHGRTIWEQTKESVQDKFSDIHTRLMRKNY  827
                +YLST F  +YG+ FA L+AT+ HV LFHG  I   +K + Q+   DIHT++MRKNY
Sbjct  364   EGPLYLSTMFAMSYGIGFACLSATLVHVLLFHGSEILRLSKSAFQENKIDIHTKIMRKNY  423

Query  826   EPVPQWWFYlllviivgvalvACQRFGGQLQLPVWGVLLAVLLSLIFTLPVGVITATTNQ  647
             + VP+WWF  +L+  +   +  C+ F  +LQLP WGV+LA ++++ FTLP+GVI ATTNQ
Sbjct  424   KQVPEWWFLCILLFNIVATIFICEYFNNELQLPWWGVVLACVVAMSFTLPIGVIRATTNQ  483

Query  646   QTGLNVIAELIIGYMYPGRPLASVTFKMYGlsslsqslmflSDFKLGHYMKIPPKSMFMV  467
                LN+I E IIGY+YPG P+A++ FK+YG  S+ Q++ FL DFKLGHYMKIPP+ MF+ 
Sbjct  484   APALNIITEYIIGYIYPGYPVANMLFKVYGNVSMKQAIFFLQDFKLGHYMKIPPREMFLA  543

Query  466   QLVGTLISCCVHFGTGWWLLTTVENICNPSKLPEGSQWTCPGDDVFYNASIIWGVVSPRR  287
             Q+VGTL+S  VH  T WWL+ TV NIC  + LP GS WTCPGD VFY+AS+IWG++ PRR
Sbjct  544   QVVGTLMSGVVHLLTAWWLMNTVPNICERALLPAGSPWTCPGDHVFYDASVIWGLIGPRR  603

Query  286   MFGNLGIYQATNYFFLVGFLAPIPVWYLGRKYPEKRWVSLINMPILISGAEGIPIVKSVN  107
              FG+LG Y A N+FFL G +AP  VW   +  P+K+W+ LI +P+L+     +P   +VN
Sbjct  604   TFGDLGHYSAINWFFLAGAIAPFLVWLAHKALPQKQWIRLITVPVLLGALSDMPPATAVN  663

Query  106   YVCWFAVGLYFNLYVYRKHKGWWARHNYILSAGLD  2
             Y  W  VG      VYR ++GWW+RHNY+LS  LD
Sbjct  664   YTSWVIVGFVSGFVVYRYYRGWWSRHNYVLSGALD  698



>gb|KHG17687.1| Oligopeptide transporter 7 [Gossypium arboreum]
Length=759

 Score =   725 bits (1872),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 359/668 (54%), Positives = 485/668 (73%), Gaps = 5/668 (1%)
 Frame = -1

Query  2005  DSPVEEVRLTVPITDDPTMPCVTFRTWVLGVTSCVILAFLNQFFGYRQNALYVSSVPAQI  1826
             +SPV +V LTVP TDDP++P +TFR WVLG  SC +L+FLNQFF YR   L ++++ AQI
Sbjct  46    NSPVRQVALTVPTTDDPSLPVLTFRMWVLGTISCFLLSFLNQFFWYRTEPLTITAISAQI  105

Query  1825  VVLPMGKLMAAYLPTKVVQIPGTKWSFSLNPGPFNIKEHVLITIFASSGSDFSYAVSIIT  1646
              V+P+G+LMAA + TK V   G++W F+LNPGPFN+KEHVLITIFA+SG+   YA+ ++T
Sbjct  106   AVVPLGQLMAAKI-TKRVFFKGSRWEFTLNPGPFNVKEHVLITIFANSGAGSVYAIHVVT  164

Query  1645  MMKAFYYRDIHPLAAVLLTFSTQMLGYGLAGIFKKFLIDSPYMWWPSNLVQVSLFRALHD  1466
             ++K FY + I    ++++  +TQ+LG+G AGIF+++L++   MWWP+NLVQVSLFRALH+
Sbjct  165   VVKVFYKQHITFFVSLIVILTTQVLGFGWAGIFRRYLVEPAAMWWPANLVQVSLFRALHE  224

Query  1465  VETRPKGGLTRLQFFIIVLVCSFAYYVVPNYLFPSLTALSLLCWIWKNSVTAQQlgsglk  1286
              E R  GG+TR QFF+I  +CSFAYYV P YLF  LT+LS +CWI+  SV AQQLGSGL 
Sbjct  225   KEERANGGVTRTQFFLIAFICSFAYYVFPGYLFQMLTSLSWICWIFPKSVLAQQLGSGLY  284

Query  1285  glgigSFALDWATVAAFQGSPLVTPDFAIINMLIGYVLVAYIAIPVWYWTNLFDAKKFPL  1106
             GLGIG+  LDW+T++++ GSPL +P FA  N+  GY+ V Y+  P+ YW N++ AK FP+
Sbjct  285   GLGIGAIGLDWSTISSYLGSPLASPWFATANVAAGYIFVMYVLTPICYWLNVYSAKTFPI  344

Query  1105  FSSNVFDSNGQVYNISRVLNKKTFGFDQPGYDSYSNIYLSTAFVYTYGLSFATLAATVSH  926
             FS  +F S GQ YNI+ +++   F  D   Y+    +YLST F  TYG+ FA L AT+ H
Sbjct  345   FSDTLFTSTGQEYNITAIIDSN-FHLDVAAYEKEGPLYLSTFFAMTYGVGFAALTATIVH  403

Query  925   VALFHGRTIWEQTKESVQDKFSDIHTRLMRKNYEPVPQWWFYlllviivgvalvACQRFG  746
             V LFHGR IWEQ+K S Q+K  DIHTRLMRK Y+ VP+WWF  +L++ +   + ACQ + 
Sbjct  404   VGLFHGREIWEQSKASFQEKKMDIHTRLMRK-YKQVPEWWFVCILLVNIAATVFACQYYN  462

Query  745   GQLQLPVWGVLLAVLLSLIFTLPVGVITATTNQQTGLNVIAELIIGYMYPGRPLASVTFK  566
              QLQLP WGVLLA  ++++FTLP+G+ITA TNQ  GLN+I E IIGY+YPG P+A++ FK
Sbjct  463   DQLQLPWWGVLLACGIAIVFTLPIGIITAITNQTPGLNIITEYIIGYIYPGYPVANMCFK  522

Query  565   MYGlsslsqslmflSDFKLGHYMKIPPKSMFMVQLVGTLISCCVHFGTGWWLLTTVENIC  386
             +YG  S++Q++ FL DFKLGHYMKIPP++MFM Q+VGTLI+C V+ GT WWL+  + +IC
Sbjct  523   VYGYISMTQAITFLQDFKLGHYMKIPPRTMFMAQIVGTLIACFVYLGTAWWLMENIPDIC  582

Query  385   NPSKLPEGSQWTCPGDDVFYNASIIWGVVSPRRMFGNLGIYQATNYFFLVGFLAPIPVWY  206
             + +     S WTCP D VFY+AS+IWG+++PRR+FG+LG Y+A N+FFL G +AP+ VW 
Sbjct  583   DTTA--SNSVWTCPSDTVFYDASVIWGLIAPRRIFGDLGTYEAVNWFFLAGAVAPLLVWL  640

Query  205   LGRKYPEKRWVSLINMPILISGAEGIPIVKSVNYVCWFAVGLYFNLYVYRKHKGWWARHN  26
               + +P + W+ LINMP+LI     +P   +VNY  W  VG      VYR     W R+N
Sbjct  641   ASKAFPSQEWIRLINMPVLIGATGMMPPATAVNYTTWIIVGFLSGFVVYRYRPDLWQRYN  700

Query  25    YILSAGLD  2
             Y+LS  LD
Sbjct  701   YVLSGALD  708



>ref|XP_003564333.1| PREDICTED: oligopeptide transporter 7-like [Brachypodium distachyon]
Length=772

 Score =   726 bits (1873),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 366/714 (51%), Positives = 508/714 (71%), Gaps = 5/714 (1%)
 Frame = -1

Query  2143  ERVRNWNLRDTRERVSSFKNSSLSRLLH*MENTGISAVESSADEINDSPVEEVRLTVPIT  1964
             ++ +     D  +++ S  +  ++  L  ++    S     A E N SP+E+V LTVP+ 
Sbjct  13    QQAQEDEEEDHHQQLGSHGDDQITSPLL-LQKPPPSPQGLGASEEN-SPIEQVALTVPVG  70

Query  1963  DDPTMPCVTFRTWVLGVTSCVILAFLNQFFGYRQNALYVSSVPAQIVVLPMGKLMAAYLP  1784
             DDPT P +TFR WVLG  SCV+L+FLNQFF YR+  L ++++ AQI V+PMG+LMAA LP
Sbjct  71    DDPTTPVLTFRMWVLGTASCVVLSFLNQFFWYRKEPLTITAISAQIAVVPMGRLMAALLP  130

Query  1783  TKVVQIPGTKWSFSLNPGPFNIKEHVLITIFASSGSDFSYAVSIITMMKAFYYRDIHPLA  1604
             ++     GT + F+LNPGPFN+KEHVLITIFA++G+   YA+ ++T ++ FY +++    
Sbjct  131   SRPF-FSGTSYEFTLNPGPFNVKEHVLITIFANAGAGSVYAIHVVTAVRVFYGKELTFFV  189

Query  1603  AVLLTFSTQMLGYGLAGIFKKFLIDSPYMWWPSNLVQVSLFRALHDVETRPKGGLTRLQF  1424
             ++++  +TQ+LG+G AGIF+++L++   MWWP+NLVQVSLFRALH+ E   KGGLTR QF
Sbjct  190   SLIVVLTTQVLGFGWAGIFRRYLVEPAAMWWPTNLVQVSLFRALHEKEKLSKGGLTRSQF  249

Query  1423  FIIVLVCSFAYYVVPNYLFPSLTALSLLCWIWKNSVTAQQlgsglkglgigSFALDWATV  1244
             F++  VCSFAYYV P YLF  LT+LS +CW++ NSV AQQLGSGLKGLGIG+  LDWA+V
Sbjct  250   FVVAFVCSFAYYVFPGYLFQMLTSLSWICWLYPNSVFAQQLGSGLKGLGIGTIGLDWASV  309

Query  1243  AAFQGSPLVTPDFAIINMLIGYVLVAYIAIPVWYWTNLFDAKKFPLFSSNVFDSNGQVYN  1064
             +++ GSPL +P FA  N+ +G++ + Y+  P+ YW N + A+ FP+FSS +F  +G  YN
Sbjct  310   SSYLGSPLASPWFATANIAVGFLTIMYVFTPIAYWFNFYKARNFPIFSSGLFTESGHKYN  369

Query  1063  ISRVLNKKTFGFDQPGYDSYSNIYLSTAFVYTYGLSFATLAATVSHVALFHGRTIWEQTK  884
             I+ ++++  F FD   Y+    +YLST F  TYG+ FA+L AT+ HV LFHG  I + +K
Sbjct  370   ITTIVDEH-FHFDTEAYEKNGPLYLSTFFSVTYGVGFASLTATIVHVLLFHGSEILQLSK  428

Query  883   ESVQDKFSDIHTRLMRKNYEPVPQWWFYlllviivgvalvACQRFGGQLQLPVWGVLLAV  704
              + Q K  D+HT+LMR+ Y+ VP+WWF  +L+  + + + AC+ +  QLQLP WGVLLA 
Sbjct  429   SAFQGKKLDVHTKLMRR-YKQVPEWWFICILIANIAITVFACEYYIEQLQLPWWGVLLAC  487

Query  703   LLSLIFTLPVGVITATTNQQTGLNVIAELIIGYMYPGRPLASVTFKMYGlsslsqslmfl  524
              ++  FTLPVG+ITATTNQ  GLN+I E IIGY+YPGRP+A++ FK+YG  S++Q+L FL
Sbjct  488   AIAFFFTLPVGIITATTNQTPGLNIITEYIIGYLYPGRPVANMCFKVYGYISMTQALTFL  547

Query  523   SDFKLGHYMKIPPKSMFMVQLVGTLISCCVHFGTGWWLLTTVENICNPSKLPEGSQWTCP  344
              DFKLGHYMKIPP++MFM Q+VGTLI+  V+ GT WWL+ T+ NICN   L  GS WTCP
Sbjct  548   QDFKLGHYMKIPPRTMFMAQVVGTLIAAFVYLGTAWWLMDTIPNICNSELLSSGSPWTCP  607

Query  343   GDDVFYNASIIWGVVSPRRMFGNLGIYQATNYFFLVGFLAPIPVWYLGRKYPEKRWVSLI  164
             GD VFY+AS+IWG++ PRR+FG+LG Y A N+FFL G +AP+ VW+  + +P + W+ LI
Sbjct  608   GDHVFYDASVIWGLIGPRRIFGDLGTYSAINWFFLGGAIAPLLVWFAHKAFPNQTWILLI  667

Query  163   NMPILISGAEGIPIVKSVNYVCWFAVGLYFNLYVYRKHKGWWARHNYILSAGLD  2
             NMP+LI     +P   +VNY+ W  VG      VYR  + WW RHNY+LS  LD
Sbjct  668   NMPVLIGSTSSMPPATAVNYIAWIFVGFMSGYVVYRYRRNWWERHNYLLSGALD  721



>gb|KHG17686.1| Oligopeptide transporter 7 [Gossypium arboreum]
Length=783

 Score =   726 bits (1874),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 359/668 (54%), Positives = 485/668 (73%), Gaps = 5/668 (1%)
 Frame = -1

Query  2005  DSPVEEVRLTVPITDDPTMPCVTFRTWVLGVTSCVILAFLNQFFGYRQNALYVSSVPAQI  1826
             +SPV +V LTVP TDDP++P +TFR WVLG  SC +L+FLNQFF YR   L ++++ AQI
Sbjct  70    NSPVRQVALTVPTTDDPSLPVLTFRMWVLGTISCFLLSFLNQFFWYRTEPLTITAISAQI  129

Query  1825  VVLPMGKLMAAYLPTKVVQIPGTKWSFSLNPGPFNIKEHVLITIFASSGSDFSYAVSIIT  1646
              V+P+G+LMAA + TK V   G++W F+LNPGPFN+KEHVLITIFA+SG+   YA+ ++T
Sbjct  130   AVVPLGQLMAAKI-TKRVFFKGSRWEFTLNPGPFNVKEHVLITIFANSGAGSVYAIHVVT  188

Query  1645  MMKAFYYRDIHPLAAVLLTFSTQMLGYGLAGIFKKFLIDSPYMWWPSNLVQVSLFRALHD  1466
             ++K FY + I    ++++  +TQ+LG+G AGIF+++L++   MWWP+NLVQVSLFRALH+
Sbjct  189   VVKVFYKQHITFFVSLIVILTTQVLGFGWAGIFRRYLVEPAAMWWPANLVQVSLFRALHE  248

Query  1465  VETRPKGGLTRLQFFIIVLVCSFAYYVVPNYLFPSLTALSLLCWIWKNSVTAQQlgsglk  1286
              E R  GG+TR QFF+I  +CSFAYYV P YLF  LT+LS +CWI+  SV AQQLGSGL 
Sbjct  249   KEERANGGVTRTQFFLIAFICSFAYYVFPGYLFQMLTSLSWICWIFPKSVLAQQLGSGLY  308

Query  1285  glgigSFALDWATVAAFQGSPLVTPDFAIINMLIGYVLVAYIAIPVWYWTNLFDAKKFPL  1106
             GLGIG+  LDW+T++++ GSPL +P FA  N+  GY+ V Y+  P+ YW N++ AK FP+
Sbjct  309   GLGIGAIGLDWSTISSYLGSPLASPWFATANVAAGYIFVMYVLTPICYWLNVYSAKTFPI  368

Query  1105  FSSNVFDSNGQVYNISRVLNKKTFGFDQPGYDSYSNIYLSTAFVYTYGLSFATLAATVSH  926
             FS  +F S GQ YNI+ +++   F  D   Y+    +YLST F  TYG+ FA L AT+ H
Sbjct  369   FSDTLFTSTGQEYNITAIIDSN-FHLDVAAYEKEGPLYLSTFFAMTYGVGFAALTATIVH  427

Query  925   VALFHGRTIWEQTKESVQDKFSDIHTRLMRKNYEPVPQWWFYlllviivgvalvACQRFG  746
             V LFHGR IWEQ+K S Q+K  DIHTRLMRK Y+ VP+WWF  +L++ +   + ACQ + 
Sbjct  428   VGLFHGREIWEQSKASFQEKKMDIHTRLMRK-YKQVPEWWFVCILLVNIAATVFACQYYN  486

Query  745   GQLQLPVWGVLLAVLLSLIFTLPVGVITATTNQQTGLNVIAELIIGYMYPGRPLASVTFK  566
              QLQLP WGVLLA  ++++FTLP+G+ITA TNQ  GLN+I E IIGY+YPG P+A++ FK
Sbjct  487   DQLQLPWWGVLLACGIAIVFTLPIGIITAITNQTPGLNIITEYIIGYIYPGYPVANMCFK  546

Query  565   MYGlsslsqslmflSDFKLGHYMKIPPKSMFMVQLVGTLISCCVHFGTGWWLLTTVENIC  386
             +YG  S++Q++ FL DFKLGHYMKIPP++MFM Q+VGTLI+C V+ GT WWL+  + +IC
Sbjct  547   VYGYISMTQAITFLQDFKLGHYMKIPPRTMFMAQIVGTLIACFVYLGTAWWLMENIPDIC  606

Query  385   NPSKLPEGSQWTCPGDDVFYNASIIWGVVSPRRMFGNLGIYQATNYFFLVGFLAPIPVWY  206
             + +     S WTCP D VFY+AS+IWG+++PRR+FG+LG Y+A N+FFL G +AP+ VW 
Sbjct  607   DTTA--SNSVWTCPSDTVFYDASVIWGLIAPRRIFGDLGTYEAVNWFFLAGAVAPLLVWL  664

Query  205   LGRKYPEKRWVSLINMPILISGAEGIPIVKSVNYVCWFAVGLYFNLYVYRKHKGWWARHN  26
               + +P + W+ LINMP+LI     +P   +VNY  W  VG      VYR     W R+N
Sbjct  665   ASKAFPSQEWIRLINMPVLIGATGMMPPATAVNYTTWIIVGFLSGFVVYRYRPDLWQRYN  724

Query  25    YILSAGLD  2
             Y+LS  LD
Sbjct  725   YVLSGALD  732



>ref|XP_004309550.1| PREDICTED: oligopeptide transporter 7-like [Fragaria vesca subsp. 
vesca]
Length=749

 Score =   724 bits (1870),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 357/676 (53%), Positives = 489/676 (72%), Gaps = 7/676 (1%)
 Frame = -1

Query  2029  ESSADEINDSPVEEVRLTVPITDDPTMPCVTFRTWVLGVTSCVILAFLNQFFGYRQNALY  1850
              S  +E  +SPV++V LTVP  DDP++P +TFR WVLG  SCV+L+FLNQFF YR   L 
Sbjct  30    SSPPEEEENSPVKQVALTVPTGDDPSLPVLTFRMWVLGTLSCVLLSFLNQFFWYRTEPLS  89

Query  1849  VSSVPAQIVVLPMGKLMAAYLPTKVVQIPGTKWSFSLNPGPFNIKEHVLITIFASSGSDF  1670
             ++++ AQI V+P+G+LMAA + T+V    GT+W F+LNPGPFN+KEHVLITIFA+SG+  
Sbjct  90    ITAISAQIAVVPLGQLMAANITTRVF-FKGTRWEFTLNPGPFNVKEHVLITIFANSGAGT  148

Query  1669  SYAVSIITMMKAFYYRDIHPLAAVLLTFSTQMLGYGLAGIFKKFLIDSPYMWWPSNLVQV  1490
              YA+ I+T++K FY + I    ++L+  +TQ+LG+G AGIF+++L++   MWWP+NLVQV
Sbjct  149   VYAIHIVTVVKVFYKQHITFFVSLLVILTTQVLGFGWAGIFRRYLVEPAAMWWPANLVQV  208

Query  1489  SLFRALHDVETRPKGGLTRLQFFIIVLVCSFAYYVVPNYLFPSLTALSLLCWIWKNSVTA  1310
             SLFRALH+ E RPKGG+TR QFF+I  +CSFAYYV P YLF  LT+LS +CWI+ +SV A
Sbjct  209   SLFRALHEREERPKGGVTRTQFFLIAFMCSFAYYVFPGYLFTMLTSLSWICWIFPSSVLA  268

Query  1309  QQlgsglkglgigSFALDWATVAAFQGSPLVTPDFAIINMLIGYVLVAYIAIPVWYWTNL  1130
             QQ+GSGL GLG+G+  LDW+T++++ GSPL +P FA  N+  G+V V Y+  P+ YW NL
Sbjct  269   QQIGSGLYGLGLGAVGLDWSTISSYLGSPLASPWFATANVAAGFVFVMYVLTPICYWLNL  328

Query  1129  FDAKKFPLFSSNVFDSNGQVYNISRVLNKKTFGFDQPGYDSYSNIYLSTAFVYTYGLSFA  950
             + AK FP+FS  +F  +GQ Y+I+ +++   F  +   Y+    +Y+ST F  TYG+ FA
Sbjct  329   YKAKTFPIFSDELFTEDGQEYDITAIIDSN-FHLNITAYEEEGPLYISTFFAMTYGVGFA  387

Query  949   TLAATVSHVALFHGRTIWEQTKESVQDKFSDIHTRLMRKNYEPVPQWWFYlllviivgva  770
              L ATV HVALFHGR IWEQ+K S ++K  DIHTRLM++ Y PVP+WWF  +L+  + + 
Sbjct  388   ALTATVVHVALFHGREIWEQSKSSFKEKRMDIHTRLMQR-YNPVPEWWFVAILLTNIALT  446

Query  769   lvACQRFGGQLQLPVWGVLLAVLLSLIFTLPVGVITATTNQQTGLNVIAELIIGYMYPGR  590
             +  C+ +  QLQLP WGVLLA  ++++FTLP+G+ITA TNQ  GLN+I E IIGY+YPG 
Sbjct  447   IFTCEYYNDQLQLPWWGVLLACAIAILFTLPIGIITAITNQTPGLNIITEYIIGYIYPGY  506

Query  589   PLASVTFKMYGlsslsqslmflSDFKLGHYMKIPPKSMFMVQLVGTLISCCVHFGTGWWL  410
             P+A++ FK+YG  S++Q++ FL DFKLGHYMKIPP++MFM Q+VGTLI+  V+  T WWL
Sbjct  507   PVANMCFKVYGYISMTQAITFLQDFKLGHYMKIPPRTMFMAQVVGTLIAAFVYLCTAWWL  566

Query  409   LTTVENICNPSKLPEGSQWTCPGDDVFYNASIIWGVVSPRRMFGNLGIYQATNYFFLVGF  230
             + T+  IC  +     S WTCP D VFY+AS++WG++ PRR+FG+LG Y A N+FFL G 
Sbjct  567   METIPGICTDTT----SVWTCPMDTVFYDASVLWGLIGPRRIFGDLGTYAAVNWFFLAGA  622

Query  229   LAPIPVWYLGRKYPEKRWVSLINMPILISGAEGIPIVKSVNYVCWFAVGLYFNLYVYRKH  50
             +AP+ VW   + +P++ W+ LINMP+LI     +P   +VNY  W  +G      VYR  
Sbjct  623   IAPVLVWLAAKAFPQQEWIRLINMPVLIGATGSMPPATAVNYTSWIILGFLSGFVVYRYR  682

Query  49    KGWWARHNYILSAGLD  2
               WW RHNY+LS  LD
Sbjct  683   PDWWRRHNYVLSGALD  698



>ref|XP_008394097.1| PREDICTED: oligopeptide transporter 7-like [Malus domestica]
Length=735

 Score =   724 bits (1869),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 362/673 (54%), Positives = 485/673 (72%), Gaps = 5/673 (1%)
 Frame = -1

Query  2020  ADEINDSPVEEVRLTVPITDDPTMPCVTFRTWVLGVTSCVILAFLNQFFGYRQNALYVSS  1841
             ADE  +SP+E+V LTVP+TDDP++P VTFRTW LG  +CV+L+FLNQFF YR+  L ++S
Sbjct  29    ADE--NSPIEQVALTVPVTDDPSLPTVTFRTWTLGALACVLLSFLNQFFWYRREPLSLTS  86

Query  1840  VPAQIVVLPMGKLMAAYLPTKVVQIPGTKWSFSLNPGPFNIKEHVLITIFASSGSDFSYA  1661
             + AQI V+P+G LMA+ L T  V   G KW F+LNPGPFN+KEHVLITIFA+SG+   YA
Sbjct  87    ISAQIAVVPLGHLMAS-LITDRVFFKGRKWEFTLNPGPFNVKEHVLITIFANSGAGNVYA  145

Query  1660  VSIITMMKAFYYRDIHPLAAVLLTFSTQMLGYGLAGIFKKFLIDSPYMWWPSNLVQVSLF  1481
             + I++ +K FY +++    A+L+  +TQ+LG+G AG+F+++L++   MWWP NLVQVSLF
Sbjct  146   IHIVSAVKIFYKKNLSFFVALLVVLTTQVLGFGWAGLFRRYLVEPAAMWWPQNLVQVSLF  205

Query  1480  RALHDVETRPKGGLTRLQFFIIVLVCSFAYYVVPNYLFPSLTALSLLCWIWKNSVTAQQl  1301
             RALH+ E RPKGGLTR QFF+I   CSFAYYV+P YLFP LT+LS +CWI+ +S+ A QL
Sbjct  206   RALHEKEERPKGGLTRNQFFLIAFTCSFAYYVLPGYLFPMLTSLSWICWIFPSSILAHQL  265

Query  1300  gsglkglgigSFALDWATVAAFQGSPLVTPDFAIINMLIGYVLVAYIAIPVWYWTNLFDA  1121
             GSGL GLGIG+  LDW++++++ GSPL +P FA  N+  G+ LV Y+  PV YW N+++A
Sbjct  266   GSGLHGLGIGAIGLDWSSISSYLGSPLASPWFATANIAAGFFLVMYVITPVTYWLNVYNA  325

Query  1120  KKFPLFSSNVFDSNGQVYNISRVLNKKTFGFDQPGYDSYSNIYLSTAFVYTYGLSFATLA  941
             K FP+FS ++F S GQ YNIS +++   F  D   Y+    +Y+ST F   YG++FA L 
Sbjct  326   KTFPIFSDDLFTSTGQSYNISAIIDSN-FRLDINAYEGEGPLYMSTFFAIYYGINFACLT  384

Query  940   ATVSHVALFHGRTIWEQTKESVQDKFSDIHTRLMRKNYEPVPQWWFYlllviivgvalvA  761
             AT+ HV LF+GR IW+ +K ++ +   D+HT+LMRK Y+ VP WWF  +L+  +   L  
Sbjct  385   ATIVHVLLFNGRDIWQLSKSAINENKMDVHTKLMRK-YKQVPGWWFMCILLANITATLFT  443

Query  760   CQRFGGQLQLPVWGVLLAVLLSLIFTLPVGVITATTNQQTGLNVIAELIIGYMYPGRPLA  581
             C  +  QLQL  WGVLLA  L+L FTLP+GVI ATTNQ   LNVI E IIGY+YPG P+A
Sbjct  444   CHYYNYQLQLQWWGVLLACGLALFFTLPIGVINATTNQMPALNVITEYIIGYLYPGYPVA  503

Query  580   SVTFKMYGlsslsqslmflSDFKLGHYMKIPPKSMFMVQLVGTLISCCVHFGTGWWLLTT  401
             ++ FK+YG  S+ Q++ FL DFKLGHYMKIPP++MFM Q+VGT+I+  VH GT WWL++T
Sbjct  504   NILFKVYGYISMKQAIAFLEDFKLGHYMKIPPRAMFMAQVVGTVIAAFVHLGTAWWLMST  563

Query  400   VENICNPSKLPEGSQWTCPGDDVFYNASIIWGVVSPRRMFGNLGIYQATNYFFLVGFLAP  221
             V +IC+ + LP  S WTCPGD VFY+AS+IWG+V PRR+FGNLG Y   N+FFL G +AP
Sbjct  564   VPDICDRALLPSDSPWTCPGDHVFYDASVIWGLVGPRRIFGNLGHYSTINWFFLAGAIAP  623

Query  220   IPVWYLGRKYPEKRWVSLINMPILISGAEGIPIVKSVNYVCWFAVGLYFNLYVYRKHKGW  41
             +PVW   + +P K W+ LI MP+L      +P   +VNY  W  +G       YR ++  
Sbjct  624   VPVWLAHKAFPSKHWIKLITMPVLFGATVNMPPATAVNYTSWILIGFASGFIAYRYYRAL  683

Query  40    WARHNYILSAGLD  2
             W+RHNY+LS  LD
Sbjct  684   WSRHNYVLSGALD  696



>ref|XP_010649021.1| PREDICTED: oligopeptide transporter 7-like [Vitis vinifera]
 emb|CBI17364.3| unnamed protein product [Vitis vinifera]
Length=745

 Score =   724 bits (1869),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 359/682 (53%), Positives = 491/682 (72%), Gaps = 6/682 (1%)
 Frame = -1

Query  2038  SAVESSADEIN---DSPVEEVRLTVPITDDPTMPCVTFRTWVLGVTSCVILAFLNQFFGY  1868
             S    ++DE++   +SP+E+V LTVPITDD T+P VTFR W LG  +C +L+FLNQFF Y
Sbjct  17    SHRSHASDELSGAENSPIEQVALTVPITDDRTLPVVTFRMWTLGTLACALLSFLNQFFWY  76

Query  1867  RQNALYVSSVPAQIVVLPMGKLMAAYLPTKVVQIPGTKWSFSLNPGPFNIKEHVLITIFA  1688
             R+  L ++S+ AQI V+P+G LMA  +  +V    G +W F+LNPGPFNIKEHVLITIFA
Sbjct  77    RREPLSITSISAQIAVVPLGHLMATVITNRVF-FKGKRWEFTLNPGPFNIKEHVLITIFA  135

Query  1687  SSGSDFSYAVSIITMMKAFYYRDIHPLAAVLLTFSTQMLGYGLAGIFKKFLIDSPYMWWP  1508
             +SG+   YA+ I++ +K FY +++    ++L+  +TQ+LG+G AGIF+++L++   MWWP
Sbjct  136   NSGAGNVYAIHIVSAVKIFYKQNLTFFVSLLVVITTQVLGFGWAGIFRRYLVEPAAMWWP  195

Query  1507  SNLVQVSLFRALHDVETRPKGGLTRLQFFIIVLVCSFAYYVVPNYLFPSLTALSLLCWIW  1328
              NLVQVSLFRALH+ E R KGGLTR QFF+I  +CSFAYY+ P YLFP LT+LS +CWI+
Sbjct  196   QNLVQVSLFRALHEREKRIKGGLTRNQFFLIAFICSFAYYIFPGYLFPMLTSLSWICWIF  255

Query  1327  KNSVTAQQlgsglkglgigSFALDWATVAAFQGSPLVTPDFAIINMLIGYVLVAYIAIPV  1148
               SV AQQLGSGL GLGIG+   DW++++++ GSPL +P FA  N+ +G+ L+ Y+  PV
Sbjct  256   PTSVLAQQLGSGLHGLGIGAIGFDWSSISSYLGSPLASPWFATANIALGFALIMYVITPV  315

Query  1147  WYWTNLFDAKKFPLFSSNVFDSNGQVYNISRVLNKKTFGFDQPGYDSYSNIYLSTAFVYT  968
              YW N++ AK FP+FS ++F + GQ YNIS +++ K F  D   Y+    +YLST F  +
Sbjct  316   AYWFNIYKAKAFPIFSDDLFIATGQRYNISAIIDSK-FHVDIQAYERQGPLYLSTFFAMS  374

Query  967   YGLSFATLAATVSHVALFHGRTIWEQTKESVQDKFSDIHTRLMRKNYEPVPQWWFYlllv  788
             YG+ FA L ATV HV LFHG+ IW+ +K + Q+   D+HT+LMRK Y+ VP+WWF  +L 
Sbjct  375   YGVGFACLTATVVHVFLFHGKEIWQLSKSAFQENKMDVHTKLMRK-YKQVPEWWFMCILF  433

Query  787   iivgvalvACQRFGGQLQLPVWGVLLAVLLSLIFTLPVGVITATTNQQTGLNVIAELIIG  608
             + +G  +  C+ +  QLQLP WG+LLA  L++ FTLPVG+ITATTNQ   LNVI E IIG
Sbjct  434   VNIGATIFTCEYYNNQLQLPWWGILLACGLAIFFTLPVGIITATTNQTPALNVITEYIIG  493

Query  607   YMYPGRPLASVTFKMYGlsslsqslmflSDFKLGHYMKIPPKSMFMVQLVGTLISCCVHF  428
             Y+YPG P+A++ FK+YG  S+ Q + FL DFKLGHYMKIPP++MFM Q+VGT+I+  VH 
Sbjct  494   YIYPGFPVANICFKVYGYISMKQGIAFLQDFKLGHYMKIPPRTMFMAQIVGTIIAALVHL  553

Query  427   GTGWWLLTTVENICNPSKLPEGSQWTCPGDDVFYNASIIWGVVSPRRMFGNLGIYQATNY  248
             GT WWL+ TV +IC+ + LP GS WTCPGD VFY+AS+IWG++ PRR+FG+LG Y A N+
Sbjct  554   GTAWWLMETVPDICDRALLPAGSPWTCPGDHVFYDASVIWGLIGPRRIFGDLGHYSAINW  613

Query  247   FFLVGFLAPIPVWYLGRKYPEKRWVSLINMPILISGAEGIPIVKSVNYVCWFAVGLYFNL  68
             FFL G +AP+ VW   + +P + W+ LI MP+L+     +P   +VNY  W  +G +   
Sbjct  614   FFLGGAIAPLLVWLAYKAFPNQHWIRLITMPVLLGATVNMPPATAVNYTSWIIIGFFSGF  673

Query  67    YVYRKHKGWWARHNYILSAGLD  2
               YR ++ WW+RHNY+LS  LD
Sbjct  674   IAYRYYRNWWSRHNYVLSGALD  695



>ref|XP_002874647.1| ATOPT7 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH50906.1| ATOPT7 [Arabidopsis lyrata subsp. lyrata]
Length=764

 Score =   725 bits (1871),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 358/668 (54%), Positives = 492/668 (74%), Gaps = 6/668 (1%)
 Frame = -1

Query  2005  DSPVEEVRLTVPITDDPTMPCVTFRTWVLGVTSCVILAFLNQFFGYRQNALYVSSVPAQI  1826
             +SP+ +V LTVP TDDP++P +TFR WVLG  S ++L+FLNQFF YR   L +S++ AQI
Sbjct  52    NSPIRQVALTVPTTDDPSLPVLTFRMWVLGTLSGILLSFLNQFFWYRTEPLTISAISAQI  111

Query  1825  VVLPMGKLMAAYLPTKVVQIPGTKWSFSLNPGPFNIKEHVLITIFASSGSDFSYAVSIIT  1646
              V+P+G+LMAA +  +V    G+KW F+LNPGPFN+KEHVLITIFA++G+   YA+ ++T
Sbjct  112   AVVPLGRLMAAKISDRVF-FQGSKWQFTLNPGPFNVKEHVLITIFANAGAGSVYAIHVVT  170

Query  1645  MMKAFYYRDIHPLAAVLLTFSTQMLGYGLAGIFKKFLIDSPYMWWPSNLVQVSLFRALHD  1466
             ++KAFY ++I    + ++  +TQ+LG+G AGIF+K+L++   MWWP+NLVQVSLFRALH+
Sbjct  171   VVKAFYMKNITFFVSFIVIVTTQVLGFGWAGIFRKYLVEPAAMWWPANLVQVSLFRALHE  230

Query  1465  VETRPKGGLTRLQFFIIVLVCSFAYYVVPNYLFPSLTALSLLCWIWKNSVTAQQlgsglk  1286
              E R KGGLTR QFF+I  VCSFAYYV P YLF  +T+LS +CW + +SV AQQ+GSGL 
Sbjct  231   KEERTKGGLTRTQFFVIAFVCSFAYYVFPGYLFQIMTSLSWVCWFFPSSVMAQQIGSGLH  290

Query  1285  glgigSFALDWATVAAFQGSPLVTPDFAIINMLIGYVLVAYIAIPVWYWTNLFDAKKFPL  1106
             GLG+G+  LDW+T++++ GSPL +P FA  N+ +G+VLV Y+ +P+ YW +++ AK FP+
Sbjct  291   GLGVGAIGLDWSTISSYLGSPLASPWFATANVGVGFVLVIYVLVPICYWLDVYKAKTFPI  350

Query  1105  FSSNVFDSNGQVYNISRVLNKKTFGFDQPGYDSYSNIYLSTAFVYTYGLSFATLAATVSH  926
             FSS++F S G  YNI+ +++   F  D P Y+    +YL T F  +YG+ FA L+AT+ H
Sbjct  351   FSSSLFTSQGSKYNITSIIDSN-FHLDLPSYEREGPLYLCTFFAISYGVGFAALSATIMH  409

Query  925   VALFHGRTIWEQTKESVQDKFSDIHTRLMRKNYEPVPQWWFYlllviivgvalvACQRFG  746
             VALFHGR IWEQ+KES ++K  D+H RLM++ Y+ VP+WWF+ +LV  VG  + AC+ + 
Sbjct  410   VALFHGREIWEQSKESFKEKKLDVHARLMQR-YKQVPEWWFWCILVTNVGATIFACEYYN  468

Query  745   GQLQLPVWGVLLAVLLSLIFTLPVGVITATTNQQTGLNVIAELIIGYMYPGRPLASVTFK  566
              QLQLP WGVLLA  +++IFTLP+G+ITA TNQ  GLN+I E IIGY+YPG P+A++ FK
Sbjct  469   DQLQLPWWGVLLACTVAIIFTLPIGIITAITNQAPGLNIITEYIIGYIYPGYPVANMCFK  528

Query  565   MYGlsslsqslmflSDFKLGHYMKIPPKSMFMVQLVGTLISCCVHFGTGWWLLTTVENIC  386
             +YG  S+ Q++ FL DFKLGHYMKIPP++MFM Q+VGTLISC V+  T WWL+ T+ NIC
Sbjct  529   VYGYISMQQAITFLQDFKLGHYMKIPPRTMFMAQIVGTLISCLVYLTTAWWLMETIPNIC  588

Query  385   NPSKLPEGSQWTCPGDDVFYNASIIWGVVSPRRMFGNLGIYQATNYFFLVGFLAPIPVWY  206
             +       S WTCP D VFY+AS+IWG++ PRR+FG+LG+Y++ N+FFLVG +AP+ VW 
Sbjct  589   DSV---SNSVWTCPSDKVFYDASVIWGLIGPRRIFGDLGLYKSVNWFFLVGAIAPVLVWL  645

Query  205   LGRKYPEKRWVSLINMPILISGAEGIPIVKSVNYVCWFAVGLYFNLYVYRKHKGWWARHN  26
               R +P + W+ LINMP+LIS    +P   +VNY  W   G      V+R     W R+N
Sbjct  646   ASRMFPRQEWIKLINMPVLISATSSMPPATAVNYTTWVLAGFLSGFVVFRYRPNLWQRYN  705

Query  25    YILSAGLD  2
             Y+LS  LD
Sbjct  706   YVLSGALD  713



>ref|XP_008241834.1| PREDICTED: oligopeptide transporter 7-like [Prunus mume]
Length=738

 Score =   724 bits (1868),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 364/694 (52%), Positives = 495/694 (71%), Gaps = 6/694 (1%)
 Frame = -1

Query  2074  SRLLH*MENTGISAVESSADEIN---DSPVEEVRLTVPITDDPTMPCVTFRTWVLGVTSC  1904
             S L+H  +  G ++    ADEI+   +SP+E+V LTVP+TDDP++P VTFRTW LG  +C
Sbjct  9     SPLIHSNKIDGSASRRPPADEISGHENSPIEQVALTVPVTDDPSLPTVTFRTWTLGALAC  68

Query  1903  VILAFLNQFFGYRQNALYVSSVPAQIVVLPMGKLMAAYLPTKVVQIPGTKWSFSLNPGPF  1724
             V+L+FLNQFF YR+  L ++S+ AQI V+P+G+LMA+ L TK V   G KW F+LNPGPF
Sbjct  69    VLLSFLNQFFWYRREPLSLTSISAQIAVVPLGRLMAS-LITKRVFFKGQKWEFTLNPGPF  127

Query  1723  NIKEHVLITIFASSGSDFSYAVSIITMMKAFYYRDIHPLAAVLLTFSTQMLGYGLAGIFK  1544
             N+KEHVLITIFA+SG+   YA+ I++ +K FY +++    A+L+  +TQ+LG+G AG+F+
Sbjct  128   NVKEHVLITIFANSGAGNVYAIHIVSTVKLFYKKNLSFFVALLVVLTTQVLGFGWAGLFR  187

Query  1543  KFLIDSPYMWWPSNLVQVSLFRALHDVETRPKGGLTRLQFFIIVLVCSFAYYVVPNYLFP  1364
             ++L++   MWWP NLVQVSLFRALH+ E RP+GGLTR QFF+I   CSFAYYV+P YLFP
Sbjct  188   RYLVEPAAMWWPQNLVQVSLFRALHEKEKRPRGGLTRNQFFLIAFTCSFAYYVLPGYLFP  247

Query  1363  SLTALSLLCWIWKNSVTAQQlgsglkglgigSFALDWATVAAFQGSPLVTPDFAIINMLI  1184
              LT+LS +CWI+  S+ A QLGSGL GLGIG+  LDW++++++ GSPL +P FA  N+  
Sbjct  248   MLTSLSWICWIFPTSILAHQLGSGLHGLGIGAIGLDWSSISSYLGSPLASPWFATANIAA  307

Query  1183  GYVLVAYIAIPVWYWTNLFDAKKFPLFSSNVFDSNGQVYNISRVLNKKTFGFDQPGYDSY  1004
             G+ LV Y+  P+ YW NL++AK FP+ S  +F S GQ YNIS +++   F  D   Y+  
Sbjct  308   GFFLVLYVITPLAYWFNLYNAKTFPIVSDGLFTSTGQSYNISAIIDPN-FRLDIDAYERE  366

Query  1003  SNIYLSTAFVYTYGLSFATLAATVSHVALFHGRTIWEQTKESVQDKFSDIHTRLMRKNYE  824
               +++ST F   YG++FA L AT+ HV LF+GR IW+ +  + ++K  D+HT+LMRK Y+
Sbjct  367   GALHISTFFAIYYGVNFACLTATIVHVLLFNGRDIWQLSTSAFREKKMDVHTKLMRK-YK  425

Query  823   PVPQWWFYlllviivgvalvACQRFGGQLQLPVWGVLLAVLLSLIFTLPVGVITATTNQQ  644
              VP WWF  +LV  +   +  C  +  QLQL  WGVLLA  L+L FTLP+GVI ATTNQ+
Sbjct  426   QVPGWWFMCILVANIVATIFTCHYYNHQLQLKWWGVLLACGLALFFTLPIGVIAATTNQK  485

Query  643   TGLNVIAELIIGYMYPGRPLASVTFKMYGlsslsqslmflSDFKLGHYMKIPPKSMFMVQ  464
               LNVI E IIGY+YPG P+A+V FK+YG  S+ Q + FL DFKLGHYMKIPP++MFM Q
Sbjct  486   PALNVITEYIIGYLYPGYPVANVCFKVYGYISMKQGIAFLEDFKLGHYMKIPPRAMFMAQ  545

Query  463   LVGTLISCCVHFGTGWWLLTTVENICNPSKLPEGSQWTCPGDDVFYNASIIWGVVSPRRM  284
             +VGT+I+  VH GT WWL+ T+ +IC+ + LP  S WTCPGD VFY+AS+IWG+V PRR+
Sbjct  546   VVGTIIAAFVHLGTAWWLMNTIPDICDRALLPADSPWTCPGDHVFYDASVIWGLVGPRRI  605

Query  283   FGNLGIYQATNYFFLVGFLAPIPVWYLGRKYPEKRWVSLINMPILISGAEGIPIVKSVNY  104
             FG+LG Y A N+FFL G +AP+ VW   + +P K W+ LI MP+L+     +P   +VN+
Sbjct  606   FGDLGHYSAINWFFLAGAIAPVLVWLAHKAFPRKHWIKLITMPVLLGATVNMPPATAVNF  665

Query  103   VCWFAVGLYFNLYVYRKHKGWWARHNYILSAGLD  2
               W  +G       YR ++G W+RHNY+LS  LD
Sbjct  666   TSWVLIGFASGFIAYRYYRGLWSRHNYVLSGALD  699



>gb|AES71704.2| oligopeptide transporter OPT family protein [Medicago truncatula]
Length=737

 Score =   724 bits (1868),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 362/684 (53%), Positives = 491/684 (72%), Gaps = 7/684 (1%)
 Frame = -1

Query  2053  ENTGISAVESSADEINDSPVEEVRLTVPITDDPTMPCVTFRTWVLGVTSCVILAFLNQFF  1874
             +N     +    D   +SP+++V LTVP TDDP++P +TFR WVLG  SCV+L+FLNQFF
Sbjct  10    DNITSPLLSKKNDSEENSPIKQVALTVPTTDDPSLPVLTFRMWVLGTLSCVLLSFLNQFF  69

Query  1873  GYRQNALYVSSVPAQIVVLPMGKLMAAYLPTKVVQIPGTKWSFSLNPGPFNIKEHVLITI  1694
              YR   L ++++ AQI V+P+G+LMA+ + TK V   G  W F+LNPGPFN+KEHVLITI
Sbjct  70    WYRTEPLTITAISAQIAVVPLGQLMASKI-TKRVFFKGKSWEFTLNPGPFNVKEHVLITI  128

Query  1693  FASSGSDFSYAVSIITMMKAFYYRDIHPLAAVLLTFSTQMLGYGLAGIFKKFLIDSPYMW  1514
             FA+SG+   YA+ I+T +K FY++ I    + L+  +TQ+LG+G AGIF+++L++   MW
Sbjct  129   FANSGAGTVYAIHIVTAVKVFYHQHITFCVSFLVIITTQVLGFGWAGIFRRYLVEPAAMW  188

Query  1513  WPSNLVQVSLFRALHDVETRPKGGLTRLQFFIIVLVCSFAYYVVPNYLFPSLTALSLLCW  1334
             WP+NLVQVSLFRALH+ E R KGGLTR QFF+I  +CSFAYYV P YLF  LT+LS +CW
Sbjct  189   WPANLVQVSLFRALHEKEERTKGGLTRSQFFVISFLCSFAYYVFPGYLFQMLTSLSWICW  248

Query  1333  IWKNSVTAQQlgsglkglgigSFALDWATVAAFQGSPLVTPDFAIINMLIGYVLVAYIAI  1154
             ++ +SV AQQLGSGLKGLGIG+  LDW+ ++A+ GSPL +P FA  N+ +G+V V YI  
Sbjct  249   VFPHSVLAQQLGSGLKGLGIGAIGLDWSAISAYLGSPLASPWFATANVAVGFVFVMYILT  308

Query  1153  PVWYWTNLFDAKKFPLFSSNVFDSNGQVYNISRVLNKKTFGFDQPGYDSYSNIYLSTAFV  974
             P+ YW N+++AK FP+FS+ +F S G++YNI+ +++   F  D   Y+    ++LST F 
Sbjct  309   PLCYWFNVYNAKTFPIFSNQLFTSKGEIYNITEIIDSN-FHMDLAAYEKQGRLHLSTFFA  367

Query  973   YTYGLSFATLAATVSHVALFHGRTIWEQTKESVQDKFSDIHTRLMRKNYEPVPQWWFYll  794
              TYG+ FA L AT+ HVALFHGR IWEQ+K S  +K  DIHT+LMR+ Y+ VP+WWF  +
Sbjct  368   MTYGVGFAALTATIVHVALFHGREIWEQSKSSFNEKSMDIHTKLMRR-YKQVPEWWFVCI  426

Query  793   lviivgvalvACQRFGGQLQLPVWGVLLAVLLSLIFTLPVGVITATTNQQTGLNVIAELI  614
             L+  +   + AC+ +  QLQLP WGVLLA  +++ FTLP+G+ITA TNQ  GLN+I E I
Sbjct  427   LIATIATTIFACEYYNEQLQLPWWGVLLACGIAIFFTLPIGIITAITNQSPGLNIITEYI  486

Query  613   IGYMYPGRPLASVTFKMYGlsslsqslmflSDFKLGHYMKIPPKSMFMVQLVGTLISCCV  434
             IGY+YPG P+A++ FK+YG  S++Q++ FL DFKLGHYMKIPP++MFM Q+VGTLI+  V
Sbjct  487   IGYIYPGYPVANMCFKVYGYISMTQAITFLQDFKLGHYMKIPPRTMFMAQVVGTLIAGLV  546

Query  433   HFGTGWWLLTTVENICNPSKLPEGSQWTCPGDDVFYNASIIWGVVSPRRMFGNLGIYQAT  254
             +  T WWL+ ++ +IC  +     S WTCPGD VFY+AS+IWG++ PRR+FGNLG Y+  
Sbjct  547   YLSTAWWLMESIPDICKDTS----SVWTCPGDTVFYDASVIWGLIGPRRIFGNLGTYENI  602

Query  253   NYFFLVGFLAPIPVWYLGRKYPEKRWVSLINMPILISGAEGIPIVKSVNYVCWFAVGLYF  74
             N+FFL G +AP+ VW   R +P++ W+ LINMP+LI     +P   +VNY  W  VG   
Sbjct  603   NWFFLGGAIAPLLVWLATRAFPQQEWIKLINMPVLIGATGMMPPATAVNYTSWIIVGFLS  662

Query  73    NLYVYRKHKGWWARHNYILSAGLD  2
                VYR    WW RHNY+LS  LD
Sbjct  663   GFVVYRYKPEWWQRHNYVLSGALD  686



>ref|XP_003601453.1| Oligopeptide transporter [Medicago truncatula]
Length=741

 Score =   724 bits (1868),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 361/672 (54%), Positives = 488/672 (73%), Gaps = 7/672 (1%)
 Frame = -1

Query  2017  DEINDSPVEEVRLTVPITDDPTMPCVTFRTWVLGVTSCVILAFLNQFFGYRQNALYVSSV  1838
             D   +SP+++V LTVP TDDP++P +TFR WVLG  SCV+L+FLNQFF YR   L ++++
Sbjct  26    DSEENSPIKQVALTVPTTDDPSLPVLTFRMWVLGTLSCVLLSFLNQFFWYRTEPLTITAI  85

Query  1837  PAQIVVLPMGKLMAAYLPTKVVQIPGTKWSFSLNPGPFNIKEHVLITIFASSGSDFSYAV  1658
              AQI V+P+G+LMA+ + TK V   G  W F+LNPGPFN+KEHVLITIFA+SG+   YA+
Sbjct  86    SAQIAVVPLGQLMASKI-TKRVFFKGKSWEFTLNPGPFNVKEHVLITIFANSGAGTVYAI  144

Query  1657  SIITMMKAFYYRDIHPLAAVLLTFSTQMLGYGLAGIFKKFLIDSPYMWWPSNLVQVSLFR  1478
              I+T +K FY++ I    + L+  +TQ+LG+G AGIF+++L++   MWWP+NLVQVSLFR
Sbjct  145   HIVTAVKVFYHQHITFCVSFLVIITTQVLGFGWAGIFRRYLVEPAAMWWPANLVQVSLFR  204

Query  1477  ALHDVETRPKGGLTRLQFFIIVLVCSFAYYVVPNYLFPSLTALSLLCWIWKNSVTAQQlg  1298
             ALH+ E R KGGLTR QFF+I  +CSFAYYV P YLF  LT+LS +CW++ +SV AQQLG
Sbjct  205   ALHEKEERTKGGLTRSQFFVISFLCSFAYYVFPGYLFQMLTSLSWICWVFPHSVLAQQLG  264

Query  1297  sglkglgigSFALDWATVAAFQGSPLVTPDFAIINMLIGYVLVAYIAIPVWYWTNLFDAK  1118
             SGLKGLGIG+  LDW+ ++A+ GSPL +P FA  N+ +G+V V YI  P+ YW N+++AK
Sbjct  265   SGLKGLGIGAIGLDWSAISAYLGSPLASPWFATANVAVGFVFVMYILTPLCYWFNVYNAK  324

Query  1117  KFPLFSSNVFDSNGQVYNISRVLNKKTFGFDQPGYDSYSNIYLSTAFVYTYGLSFATLAA  938
              FP+FS+ +F S G++YNI+ +++   F  D   Y+    ++LST F  TYG+ FA L A
Sbjct  325   TFPIFSNQLFTSKGEIYNITEIIDSN-FHMDLAAYEKQGRLHLSTFFAMTYGVGFAALTA  383

Query  937   TVSHVALFHGRTIWEQTKESVQDKFSDIHTRLMRKNYEPVPQWWFYlllviivgvalvAC  758
             T+ HVALFHGR IWEQ+K S  +K  DIHT+LMR+ Y+ VP+WWF  +L+  +   + AC
Sbjct  384   TIVHVALFHGREIWEQSKSSFNEKSMDIHTKLMRR-YKQVPEWWFVCILIATIATTIFAC  442

Query  757   QRFGGQLQLPVWGVLLAVLLSLIFTLPVGVITATTNQQTGLNVIAELIIGYMYPGRPLAS  578
             + +  QLQLP WGVLLA  +++ FTLP+G+ITA TNQ  GLN+I E IIGY+YPG P+A+
Sbjct  443   EYYNEQLQLPWWGVLLACGIAIFFTLPIGIITAITNQSPGLNIITEYIIGYIYPGYPVAN  502

Query  577   VTFKMYGlsslsqslmflSDFKLGHYMKIPPKSMFMVQLVGTLISCCVHFGTGWWLLTTV  398
             + FK+YG  S++Q++ FL DFKLGHYMKIPP++MFM Q+VGTLI+  V+  T WWL+ ++
Sbjct  503   MCFKVYGYISMTQAITFLQDFKLGHYMKIPPRTMFMAQVVGTLIAGLVYLSTAWWLMESI  562

Query  397   ENICNPSKLPEGSQWTCPGDDVFYNASIIWGVVSPRRMFGNLGIYQATNYFFLVGFLAPI  218
              +IC  +     S WTCPGD VFY+AS+IWG++ PRR+FGNLG Y+  N+FFL G +AP+
Sbjct  563   PDICKDTS----SVWTCPGDTVFYDASVIWGLIGPRRIFGNLGTYENINWFFLGGAIAPL  618

Query  217   PVWYLGRKYPEKRWVSLINMPILISGAEGIPIVKSVNYVCWFAVGLYFNLYVYRKHKGWW  38
              VW   R +P++ W+ LINMP+LI     +P   +VNY  W  VG      VYR    WW
Sbjct  619   LVWLATRAFPQQEWIKLINMPVLIGATGMMPPATAVNYTSWIIVGFLSGFVVYRYKPEWW  678

Query  37    ARHNYILSAGLD  2
              RHNY+LS  LD
Sbjct  679   QRHNYVLSGALD  690



>ref|XP_010267481.1| PREDICTED: oligopeptide transporter 7-like [Nelumbo nucifera]
Length=734

 Score =   723 bits (1865),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 356/680 (52%), Positives = 503/680 (74%), Gaps = 4/680 (1%)
 Frame = -1

Query  2038  SAVESSADEINDSPVEEVRLTVPITDDPTMPCVTFRTWVLGVTSCVILAFLNQFFGYRQN  1859
             S +E  + E  +S +++V LTVP TDD ++P +TFR WVLG+ SCV+L+FLNQFF YR  
Sbjct  8     SEMEMESPESGNSTIKQVALTVPTTDDSSIPVLTFRMWVLGLVSCVLLSFLNQFFWYRTE  67

Query  1858  ALYVSSVPAQIVVLPMGKLMAAYLPTKVVQIPGTKWSFSLNPGPFNIKEHVLITIFASSG  1679
              + ++++ AQI V+P+G LMA+ + TK V   G++W F++NPGPFN+KEHVLITIFA++G
Sbjct  68    PISITALSAQIAVVPLGHLMASTI-TKRVFFKGSRWEFTMNPGPFNVKEHVLITIFANAG  126

Query  1678  SDFSYAVSIITMMKAFYYRDIHPLAAVLLTFSTQMLGYGLAGIFKKFLIDSPYMWWPSNL  1499
             +   YA  I++ +K +Y R +    A+L+  +TQ+LG+G AG+F+++L++   MWWPSNL
Sbjct  127   AGTVYATHILSAIKLYYKRKLTFFPALLIILTTQILGFGWAGMFRRYLVEPAEMWWPSNL  186

Query  1498  VQVSLFRALHDVETRPKGGLTRLQFFIIVLVCSFAYYVVPNYLFPSLTALSLLCWIWKNS  1319
             VQVSLFRALH+ E RP+GG+TR QFF+I L CSFAYY++P Y+FP LT+LS +CWI+  S
Sbjct  187   VQVSLFRALHEKEKRPRGGVTRTQFFLIALTCSFAYYLLPGYIFPMLTSLSWVCWIFPKS  246

Query  1318  VTAQQlgsglkglgigSFALDWATVAAFQGSPLVTPDFAIINMLIGYVLVAYIAIPVWYW  1139
             + AQQ+GSGL+GLGIG+  LDW+TV+++ GSPL +P FA  N+ +G+ ++ YI +P+ YW
Sbjct  247   ILAQQIGSGLEGLGIGAIGLDWSTVSSYLGSPLASPWFATANVAVGFFIIMYIIVPISYW  306

Query  1138  TNLFDAKKFPLFSSNVFDSNGQVYNISRVLNKKTFGFDQPGYDSYSNIYLSTAFVYTYGL  959
              +++ AK FPLFSS +F S GQ YNIS ++N K F  D   Y+    ++LST F +TYG+
Sbjct  307   LDVYKAKTFPLFSSGLFTSKGQKYNISSIVNSK-FHIDLDSYERNGPLHLSTFFAFTYGV  365

Query  958   SFATLAATVSHVALFHGRTIWEQTKESVQDKFS-DIHTRLMRKNYEPVPQWWFYlllvii  782
              FA L AT+ HV LFHG  I E ++ +++DK   D+HTRLM+K Y+ VPQWWF  +LV++
Sbjct  366   GFAALTATIVHVLLFHGSEILELSRSALKDKKRMDVHTRLMKK-YKQVPQWWFMFILVVV  424

Query  781   vgvalvACQRFGGQLQLPVWGVLLAVLLSLIFTLPVGVITATTNQQTGLNVIAELIIGYM  602
             +   + AC+ +  QLQL  WGVLLA L++ +FTLP+GVI ATTNQ  GLN+I E I+GY+
Sbjct  425   MAATIFACEYYNDQLQLRWWGVLLACLVAYVFTLPIGVIAATTNQAPGLNIITEYILGYL  484

Query  601   YPGRPLASVTFKMYGlsslsqslmflSDFKLGHYMKIPPKSMFMVQLVGTLISCCVHFGT  422
             YPGRP+A++ FK+YG  S++Q+L F+ DFKLGHYMKIPP++MFMVQ++GT+I+  V+ GT
Sbjct  485   YPGRPVANICFKVYGYISMTQALTFIQDFKLGHYMKIPPRAMFMVQMIGTVIAGLVYLGT  544

Query  421   GWWLLTTVENICNPSKLPEGSQWTCPGDDVFYNASIIWGVVSPRRMFGNLGIYQATNYFF  242
             GWWL+ T+ N+C+ + LP+ S WTCP D VFY+AS+IWG++ PRR+FG+LG Y A N+FF
Sbjct  545   GWWLMMTIPNLCDTAVLPDNSPWTCPMDRVFYDASVIWGLIGPRRIFGDLGSYAAVNWFF  604

Query  241   LVGFLAPIPVWYLGRKYPEKRWVSLINMPILISGAEGIPIVKSVNYVCWFAVGLYFNLYV  62
             L G +AP+ VW   + +P ++W+ LINMP+LIS    +P   +VN+  W  +G      V
Sbjct  605   LGGAIAPLLVWVAHKAFPNQKWIRLINMPVLISATGMMPPATAVNFTTWIIIGFLSGFVV  664

Query  61    YRKHKGWWARHNYILSAGLD  2
             YR  +  W RHNY+LS  LD
Sbjct  665   YRYRQDLWQRHNYVLSGALD  684



>ref|XP_006425445.1| hypothetical protein CICLE_v10024968mg [Citrus clementina]
 ref|XP_006466961.1| PREDICTED: oligopeptide transporter 7-like [Citrus sinensis]
 gb|ESR38685.1| hypothetical protein CICLE_v10024968mg [Citrus clementina]
Length=751

 Score =   723 bits (1865),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 356/679 (52%), Positives = 482/679 (71%), Gaps = 3/679 (0%)
 Frame = -1

Query  2038  SAVESSADEINDSPVEEVRLTVPITDDPTMPCVTFRTWVLGVTSCVILAFLNQFFGYRQN  1859
             S+ +  + ++ +SP+E+V LTVP TDDP++   TFRT  LG  SC++L+FLNQFF YR+ 
Sbjct  26    SSADDPSVDVENSPIEQVALTVPTTDDPSLQTFTFRTLTLGALSCILLSFLNQFFWYRRE  85

Query  1858  ALYVSSVPAQIVVLPMGKLMAAYLPTKVVQIPGTKWSFSLNPGPFNIKEHVLITIFASSG  1679
              L +SS+ AQI V+P+G LMA  LP KV    G ++ F+ NPGPF++KEHVLITIFA++G
Sbjct  86    PLSISSISAQIAVVPLGYLMAKTLPKKVF-FEGRRFEFTFNPGPFHVKEHVLITIFANAG  144

Query  1678  SDFSYAVSIITMMKAFYYRDIHPLAAVLLTFSTQMLGYGLAGIFKKFLIDSPYMWWPSNL  1499
             +   YA+ I+++++ FY +++  L A+L+  +TQ+LG+G AG+F+++L+D P MWWP NL
Sbjct  145   AGNVYAIHIVSVLQLFYKKELTFLVALLVVITTQVLGFGWAGLFRRYLVDPPTMWWPQNL  204

Query  1498  VQVSLFRALHDVETRPKGGLTRLQFFIIVLVCSFAYYVVPNYLFPSLTALSLLCWIWKNS  1319
             VQVSLFRALH+ E R  GGLTR QFF+I  VCSFAYYV P YLFP L ++S +CWI+ NS
Sbjct  205   VQVSLFRALHEKEKRSAGGLTRNQFFLIAFVCSFAYYVFPGYLFPMLVSVSWICWIYPNS  264

Query  1318  VTAQQlgsglkglgigSFALDWATVAAFQGSPLVTPDFAIINMLIGYVLVAYIAIPVWYW  1139
             V A QLGSGL GLGIG+   DW++++A+ GSPL +P FA  N+  G+ L+ Y+  P+ YW
Sbjct  265   VLAHQLGSGLHGLGIGAIGFDWSSISAYLGSPLASPWFATANIAAGFFLIMYVITPIAYW  324

Query  1138  TNLFDAKKFPLFSSNVFDSNGQVYNISRVLNKKTFGFDQPGYDSYSNIYLSTAFVYTYGL  959
              N+F AK FP+FS  +F S GQ YN+S ++N   F FD   Y+    +Y+ST F  +YG+
Sbjct  325   LNIFKAKTFPIFSDGLFTSTGQNYNVSAIINNN-FLFDTEAYEREGPLYISTFFAMSYGV  383

Query  958   SFATLAATVSHVALFHGRTIWEQTKESVQDKFSDIHTRLMRKNYEPVPQWWFYlllviiv  779
              FA L ATV HV LFHGR IW+ +K + ++K  D+HT+LMRK Y+ VP+WWF  +L+I +
Sbjct  384   GFACLTATVVHVLLFHGREIWQLSKAAFEEKGMDVHTKLMRK-YKQVPEWWFTCILLINI  442

Query  778   gvalvACQRFGGQLQLPVWGVLLAVLLSLIFTLPVGVITATTNQQTGLNVIAELIIGYMY  599
                +  CQ +  QLQLP WGVLLA +L+L FTLPVGVITATTNQ   LNVI E IIGY+Y
Sbjct  443   AATIFTCQYYNNQLQLPWWGVLLACVLALFFTLPVGVITATTNQTPALNVITEYIIGYIY  502

Query  598   PGRPLASVTFKMYGlsslsqslmflSDFKLGHYMKIPPKSMFMVQLVGTLISCCVHFGTG  419
             PG P A++ FK+YG  S+ Q + FL D KLGHYMKIPP++MFM Q+ GT+IS   H GT 
Sbjct  503   PGFPAANICFKVYGYISMKQGITFLQDLKLGHYMKIPPRAMFMAQVFGTIISALAHLGTA  562

Query  418   WWLLTTVENICNPSKLPEGSQWTCPGDDVFYNASIIWGVVSPRRMFGNLGIYQATNYFFL  239
             WWL+ T+ +IC+   LP GS WTCPGD VFY+ASIIWG++ PRR+FG+LG Y + N+FF 
Sbjct  563   WWLMNTIPDICDREMLPSGSPWTCPGDHVFYDASIIWGLIGPRRIFGDLGYYSSVNWFFF  622

Query  238   VGFLAPIPVWYLGRKYPEKRWVSLINMPILISGAEGIPIVKSVNYVCWFAVGLYFNLYVY  59
              G +AP+ VW   + +P + W+  I MP+L+     +P   +VNY  W  +G       Y
Sbjct  623   AGAVAPVLVWIAHKAFPNRPWIRHITMPVLLGATVNMPPATAVNYTSWILIGFASGFIAY  682

Query  58    RKHKGWWARHNYILSAGLD  2
             R ++ WW+RHNY+LS  LD
Sbjct  683   RYYRDWWSRHNYVLSGALD  701



>ref|XP_002991411.1| hypothetical protein SELMODRAFT_269808 [Selaginella moellendorffii]
 gb|EFJ07523.1| hypothetical protein SELMODRAFT_269808 [Selaginella moellendorffii]
Length=728

 Score =   721 bits (1862),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 362/679 (53%), Positives = 503/679 (74%), Gaps = 7/679 (1%)
 Frame = -1

Query  2032  VESSADEINDSPVEEVRLTVPITDDPTMPCVTFRTWVLGVTSCVILAFLNQFFGYRQNAL  1853
             V+  + + + SP+EEVRLTVP TDD ++P +TFRTW LG+ SC+IL+F+N FF YR+  L
Sbjct  3     VQECSQDDDQSPIEEVRLTVPTTDDTSLPALTFRTWTLGILSCLILSFINMFFSYRRQQL  62

Query  1852  YVSSVPAQIVVLPMGKLMAAYLPTKVVQIPGTKWSFSLNPGPFNIKEHVLITIFASSGSD  1673
              VS + AQIV LP+GKLMAA LPT+ + +PG  W FSLNPGPFN+KEHVLITIFA++G+ 
Sbjct  63    SVSGLTAQIVTLPLGKLMAATLPTQKILVPGLNWGFSLNPGPFNVKEHVLITIFANAGAG  122

Query  1672  FSYAVSIITMMKAFYYRDIHP-LAAVLLTFSTQMLGYGLAGIFKKFLIDSPYMWWPSNLV  1496
              +YAV I+T +KAFY R   P    +L+T +TQ++G+G AG+F+KFL++  +MWWP NLV
Sbjct  123   GAYAVHIVTSLKAFYNRQDFPFFVGLLVTLTTQIVGFGFAGMFRKFLVEPAHMWWPQNLV  182

Query  1495  QVSLFRALHDVETRPKGGLTRLQFFIIVLVCSFAYYVVPNYLFPSLTALSLLCWIWKNSV  1316
             QVSLFR LH+ E R KGGLTR+ FF IV + SFAYY++P YLF +L+++S +C+IW  S+
Sbjct  183   QVSLFRTLHEPEKRVKGGLTRINFFTIVFLTSFAYYLLPGYLFATLSSISWVCYIWPKSI  242

Query  1315  TAQQlgsglkglgigSFALDWATVAAFQGSPLVTPDFAIINMLIGYVLVAYIAIPVWYWT  1136
              A QLGSGL G G+G+  LDW+TVA F GSPL +P FAI N ++G+++  Y+  PV YW 
Sbjct  243   IAHQLGSGLAGYGLGAIGLDWSTVAGFLGSPLASPFFAIANTMVGFIVTLYVLAPVAYWG  302

Query  1135  -NLFDAKKFPLFSSNVFDSNGQVYNISRVLNKKTFGFDQPGYDSYSNIYLSTAFVYTYGL  959
              +++ AKKFPL S  +FDS+GQVYN +R+     F  D   Y++YS +++ST FV+TYG+
Sbjct  303   YDMYGAKKFPLLSLQLFDSDGQVYNRTRI-TTSAFDLDTVAYNNYSRLHISTIFVFTYGI  361

Query  958   SFATLAATVSHVALFHGRTIWEQTKESVQDKFSDIHTRLMRKNYEPVPQWWFYlllviiv  779
             SFA L A+V+H  LFHG+TIW +T  +++D   DIH +LMRK Y+ VP WW+  LLV+ +
Sbjct  362   SFAMLTASVTHAILFHGKTIW-RTLRAMEDARPDIHAKLMRK-YKRVPTWWYGSLLVMTI  419

Query  778   gvalvACQRFGGQLQLPVWGVLLAVLLSLIFTLPVGVITATTNQQTGLNVIAELIIGYMY  599
              ++++AC+ +   LQL  WGVL +V LS +F LP+GV+ ATTNQ  GLNVI+E +IGY+Y
Sbjct  420   ALSVIACEVYNNDLQLRWWGVLFSVGLSFLFCLPIGVLLATTNQSPGLNVISEYLIGYIY  479

Query  598   PGRPLASVTFKMYGlsslsqslmflSDFKLGHYMKIPPKSMFMVQLVGTLISCCVHFGTG  419
             P +P+A+V FK YG  ++ Q+   LSDFK+GHYMKIPP+SMF+ Q+VGT+++   + GT 
Sbjct  480   PNKPIANVLFKTYGTITVYQTTSLLSDFKIGHYMKIPPRSMFIAQIVGTMLASMTYLGTA  539

Query  418   WWLLTTVENICNPSKLPEGSQWTCPGDDVFYNASIIWGVVSPRRMFGNLGIYQATNYFFL  239
             WWLL TV NICN  +  +G+ WTCPGD +FY+AS+IWG++ P+R+FG+LG+Y++ N+ FL
Sbjct  540   WWLLETVPNICN--RHIKGNVWTCPGDTIFYDASVIWGLIGPQRIFGDLGLYKSLNWCFL  597

Query  238   VGFLAPIPVWYLGRKYPEKRWVSLINMPILISGAEGIPIVKSVNYVCWFAVGLYFNLYVY  59
             +G +AP+  W L + +P   W+  + +P+LI GA  +P   +VNY  WF VG +FN +++
Sbjct  598   LGAIAPVIHWVLTKVFPTVEWLKYVVVPVLIGGAGAMPYATAVNYWSWFVVGFFFNYFIF  657

Query  58    RKHKGWWARHNYILSAGLD  2
             R  K WW RHNYILSA LD
Sbjct  658   RTRKKWWQRHNYILSAALD  676



>ref|XP_009379386.1| PREDICTED: oligopeptide transporter 7-like [Pyrus x bretschneideri]
Length=735

 Score =   721 bits (1862),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 361/673 (54%), Positives = 483/673 (72%), Gaps = 5/673 (1%)
 Frame = -1

Query  2020  ADEINDSPVEEVRLTVPITDDPTMPCVTFRTWVLGVTSCVILAFLNQFFGYRQNALYVSS  1841
             ADE  +SP+E+V LTVP+TDDP++  VTFRTW LG  +CV+L+FLNQFF YR+  L ++S
Sbjct  29    ADE--NSPIEQVALTVPVTDDPSLSTVTFRTWTLGALACVLLSFLNQFFWYRREPLSLTS  86

Query  1840  VPAQIVVLPMGKLMAAYLPTKVVQIPGTKWSFSLNPGPFNIKEHVLITIFASSGSDFSYA  1661
             + AQI V+P+G LMA+ L T  V   G KW F+ NPGPFN+KEHVLITIFA+SG+   YA
Sbjct  87    ISAQIAVVPLGHLMAS-LITDRVFFKGRKWEFTFNPGPFNVKEHVLITIFANSGAGNVYA  145

Query  1660  VSIITMMKAFYYRDIHPLAAVLLTFSTQMLGYGLAGIFKKFLIDSPYMWWPSNLVQVSLF  1481
             + I++ +K FY +++    A+L+  +TQ+LG+G AG+F+++L++   MWWP NLVQVSLF
Sbjct  146   IHIVSAVKIFYKKNLSFFVALLVVLTTQVLGFGWAGLFRRYLVEPAAMWWPQNLVQVSLF  205

Query  1480  RALHDVETRPKGGLTRLQFFIIVLVCSFAYYVVPNYLFPSLTALSLLCWIWKNSVTAQQl  1301
             RALH+ E RPKGGLTR QFF+I   CSFAYYV+P YLFP LT+LS +CWI+  S+ A QL
Sbjct  206   RALHEKEERPKGGLTRNQFFLIAFTCSFAYYVLPGYLFPMLTSLSWICWIFPTSILAHQL  265

Query  1300  gsglkglgigSFALDWATVAAFQGSPLVTPDFAIINMLIGYVLVAYIAIPVWYWTNLFDA  1121
             GSGL GLGIG+  LDW++++++ GSPL +P FA  N+  G+ LV Y+  PV YW N+++A
Sbjct  266   GSGLHGLGIGAIGLDWSSISSYLGSPLASPWFATANIAAGFFLVMYVITPVTYWLNVYNA  325

Query  1120  KKFPLFSSNVFDSNGQVYNISRVLNKKTFGFDQPGYDSYSNIYLSTAFVYTYGLSFATLA  941
             K FP+FS ++F S GQ YNIS +++   F  D   Y+    +Y+ST F   YG++FA L 
Sbjct  326   KTFPIFSDDLFTSTGQSYNISAIIDSN-FRLDINAYEREGPLYMSTFFAIYYGINFACLT  384

Query  940   ATVSHVALFHGRTIWEQTKESVQDKFSDIHTRLMRKNYEPVPQWWFYlllviivgvalvA  761
             AT+ HV LF+GR IW+ +K ++ +   D+HT+LMRK Y+ VP WWF  +L+  +   L  
Sbjct  385   ATIVHVLLFNGRDIWQLSKSAINENKMDVHTKLMRK-YKQVPGWWFMCILLANITATLFT  443

Query  760   CQRFGGQLQLPVWGVLLAVLLSLIFTLPVGVITATTNQQTGLNVIAELIIGYMYPGRPLA  581
             C  +  QLQL  WGVLLA  L+L FTLP+GVI ATTNQ   LNVI E IIGY+YPG P+A
Sbjct  444   CHYYNYQLQLQWWGVLLACGLALFFTLPIGVINATTNQAPALNVITEYIIGYLYPGYPVA  503

Query  580   SVTFKMYGlsslsqslmflSDFKLGHYMKIPPKSMFMVQLVGTLISCCVHFGTGWWLLTT  401
             ++ FK+YG  S+ Q++ FL DFKLGHYMKIPP++MFM Q+VGT+I+  VH GT WWL++T
Sbjct  504   NILFKVYGYISMKQAIAFLEDFKLGHYMKIPPRAMFMAQVVGTIIAAIVHLGTAWWLMST  563

Query  400   VENICNPSKLPEGSQWTCPGDDVFYNASIIWGVVSPRRMFGNLGIYQATNYFFLVGFLAP  221
             V +IC+ + LP  S WTCPGD VFY+AS+IWG+V PRR+FGNLG Y A N+FFL G +AP
Sbjct  564   VPDICDRALLPSDSPWTCPGDHVFYDASVIWGLVGPRRIFGNLGHYSAINWFFLAGAIAP  623

Query  220   IPVWYLGRKYPEKRWVSLINMPILISGAEGIPIVKSVNYVCWFAVGLYFNLYVYRKHKGW  41
             +PVW   + +P K W+ LI MP+L      +P   +VNY  W  +G       YR ++  
Sbjct  624   VPVWLAHKAFPSKHWIKLITMPVLFGATVNMPPATAVNYTSWILIGFASGFIAYRYYRAL  683

Query  40    WARHNYILSAGLD  2
             W+RHNY+LS  LD
Sbjct  684   WSRHNYVLSGALD  696



>ref|XP_009391956.1| PREDICTED: oligopeptide transporter 7-like [Musa acuminata subsp. 
malaccensis]
 ref|XP_009391957.1| PREDICTED: oligopeptide transporter 7-like [Musa acuminata subsp. 
malaccensis]
 ref|XP_009391958.1| PREDICTED: oligopeptide transporter 7-like [Musa acuminata subsp. 
malaccensis]
 ref|XP_009391959.1| PREDICTED: oligopeptide transporter 7-like [Musa acuminata subsp. 
malaccensis]
Length=761

 Score =   722 bits (1864),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 364/668 (54%), Positives = 482/668 (72%), Gaps = 4/668 (1%)
 Frame = -1

Query  2005  DSPVEEVRLTVPITDDPTMPCVTFRTWVLGVTSCVILAFLNQFFGYRQNALYVSSVPAQI  1826
             +SP+E+V LTVP+ DDP  P +TFR WVLG  SCV+LAFLNQFF YR+  L ++S+ AQI
Sbjct  48    NSPIEQVALTVPVNDDPATPVLTFRMWVLGTASCVLLAFLNQFFWYRKEPLSITSISAQI  107

Query  1825  VVLPMGKLMAAYLPTKVVQIPGTKWSFSLNPGPFNIKEHVLITIFASSGSDFSYAVSIIT  1646
              V+P+G LMA+ +  +V    G++W F+LNPGPFN+KEHVLITIFA+SG+   YA+ I++
Sbjct  108   AVVPLGHLMASTITDRVF-FRGSRWEFTLNPGPFNMKEHVLITIFANSGAGSVYAIHIVS  166

Query  1645  MMKAFYYRDIHPLAAVLLTFSTQMLGYGLAGIFKKFLIDSPYMWWPSNLVQVSLFRALHD  1466
              ++ FY + I    ++L+  +TQ+LG+G AG+F+++L++   MWWP NLVQVSLFRALH+
Sbjct  167   AVRIFYQKHITFFVSLLVVITTQVLGFGWAGMFRRYLVEPAAMWWPQNLVQVSLFRALHE  226

Query  1465  VETRPKGGLTRLQFFIIVLVCSFAYYVVPNYLFPSLTALSLLCWIWKNSVTAQQlgsglk  1286
              E RPKGG+TR QFF++   CSFAYYV+P +LF  LT+LS +CWI+  SV AQQLGSGL 
Sbjct  227   KEGRPKGGMTRNQFFMVAFFCSFAYYVLPGHLFSVLTSLSWMCWIFPRSVLAQQLGSGLH  286

Query  1285  glgigSFALDWATVAAFQGSPLVTPDFAIINMLIGYVLVAYIAIPVWYWTNLFDAKKFPL  1106
             GLGIG+  LDWAT++++  SPL +P FA  N+  G+ L+ Y+  P  YW NL++AK FP+
Sbjct  287   GLGIGAIGLDWATISSYLSSPLASPWFATANVAAGFALIMYVITPAAYWLNLYNAKTFPI  346

Query  1105  FSSNVFDSNGQVYNISRVLNKKTFGFDQPGYDSYSNIYLSTAFVYTYGLSFATLAATVSH  926
             FS  +F S GQ YNIS +++   F  D   Y+    +YLS  F  TYG+ FA+L AT+SH
Sbjct  347   FSDGLFTSTGQSYNISGIIDPN-FHLDIKTYEKNGPLYLSALFAMTYGVGFASLTATISH  405

Query  925   VALFHGRTIWEQTKESVQDKFSDIHTRLMRKNYEPVPQWWFYlllviivgvalvACQRFG  746
             V LFHG  IW+ +K + ++K  DIHTRLM + Y+ VP WWF +LLV  V + + AC+ F 
Sbjct  406   VLLFHGSQIWQMSKSAFKEKM-DIHTRLMSR-YDQVPHWWFIILLVANVALTIFACEYFI  463

Query  745   GQLQLPVWGVLLAVLLSLIFTLPVGVITATTNQQTGLNVIAELIIGYMYPGRPLASVTFK  566
              QLQLP WGVLLA  +++ FTLP G+I ATTNQ  GLNVI E IIGY+YPGRP+A++ FK
Sbjct  464   DQLQLPWWGVLLACFIAVFFTLPFGIIKATTNQTPGLNVITEYIIGYLYPGRPVANMCFK  523

Query  565   MYGlsslsqslmflSDFKLGHYMKIPPKSMFMVQLVGTLISCCVHFGTGWWLLTTVENIC  386
             +YG  S+ Q+L+FL DFKLGHYMKIPP++MFM Q+VGTLI+  V+ GT WWL+ T+ +IC
Sbjct  524   VYGFISMKQALLFLQDFKLGHYMKIPPRTMFMAQVVGTLIAALVYLGTAWWLMETIPDIC  583

Query  385   NPSKLPEGSQWTCPGDDVFYNASIIWGVVSPRRMFGNLGIYQATNYFFLVGFLAPIPVWY  206
             N   LP  S WTCPGD VFY+AS+IWG++ PRR+FG+LG Y   N+FFL G LAP+ VW 
Sbjct  584   NTKLLPSDSPWTCPGDHVFYDASVIWGLIGPRRIFGDLGTYSNINWFFLAGALAPLLVWL  643

Query  205   LGRKYPEKRWVSLINMPILISGAEGIPIVKSVNYVCWFAVGLYFNLYVYRKHKGWWARHN  26
               + +PE+ W+ LINMP+LI     +P   +VNY  W  VG      VYR  + WW RHN
Sbjct  644   AHKAFPEQEWIRLINMPVLIGATGSMPPATAVNYTTWVFVGFLSGYVVYRYRREWWQRHN  703

Query  25    YILSAGLD  2
             Y+LS  LD
Sbjct  704   YVLSGALD  711



>emb|CBI39772.3| unnamed protein product [Vitis vinifera]
Length=624

 Score =   717 bits (1850),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 361/572 (63%), Positives = 464/572 (81%), Gaps = 7/572 (1%)
 Frame = -1

Query  1696  IFASSGSDFSYAVSIITMMKAFYYRDIHPLAAVLLTFSTQMLGYGLAGIFKKFLIDSPYM  1517
             +FA+SGS   YAV I+T++KAFY R + P A  LL  +TQ+LGYG AG+F+K+L+DSPYM
Sbjct  1     MFANSGSGGVYAVGILTIVKAFYKRSLSPGAGYLLVQTTQLLGYGWAGLFRKYLVDSPYM  60

Query  1516  WWPSNLVQVSLFRALHDVETRPKGGLTRLQFFIIVLVCSFAYYVVPNYLFPSLTALSLLC  1337
             WWPSNLVQVSLFRALH+ E R KGGLTRLQFF+IV + SFAYY+VPNYLFPS+  +S++C
Sbjct  61    WWPSNLVQVSLFRALHEKEKRSKGGLTRLQFFLIVFISSFAYYLVPNYLFPSIGTVSIIC  120

Query  1336  WIWKNSVTAQQlgsglkglgigSFALDWATVAAFQGSPLVTPDFAIINMLIGYVLVAYIA  1157
              IWKNS+TAQQ+GSGL G+G+GSF LDWATVA+F GSPL TP FAIIN+L+G+ ++ YI 
Sbjct  121   LIWKNSITAQQIGSGLYGMGLGSFGLDWATVASFLGSPLATPGFAIINILVGFFIIVYIL  180

Query  1156  IPVWYWTNLFDAKKFPLFSSNVFDSNGQVYNISRVLNKKTFGFDQPGYDSYSNIYLSTAF  977
             +P+ Y+ N ++AKKFP+FSS+ FDS GQ YN++R+LN KTF  D   Y++YS +YLS  F
Sbjct  181   LPLTYYNNAYEAKKFPIFSSHTFDSTGQPYNLTRILNPKTFSVDLAEYNAYSKLYLSVFF  240

Query  976   VYTYGLSFATLAATVSHVALFHGRTIWE---QTKESVQDKFSDIHTRLMRKNYEPVPQWW  806
               TYG+SFATLAA+VSHVALF+G TIW+   +T+ +  +KF D+HTRLM+KNY+ VPQWW
Sbjct  241   SVTYGISFATLAASVSHVALFNGSTIWQMWTKTRAAAGEKFGDVHTRLMKKNYKIVPQWW  300

Query  805   FYlllviivgvalvACQRFGGQLQLPVWGVLLAVLLSLIFTLPVGVITATTNQQ----TG  638
             FYL+L++++G++L+AC+ F  QLQLP WG+LL   L+  FTLP+G+ITATTNQ      G
Sbjct  301   FYLILIVVLGLSLLACEGFDKQLQLPWWGILLCCALAFFFTLPIGIITATTNQAWLFYMG  360

Query  637   LNVIAELIIGYMYPGRPLASVTFKMYGlsslsqslmflSDFKLGHYMKIPPKSMFMVQLV  458
             LNVI ELIIG++YPG+PLA+V FK YG  S+SQ+L FLSDFKLGHYMKIPP+SMF+VQLV
Sbjct  361   LNVITELIIGFIYPGKPLANVVFKTYGYISMSQALTFLSDFKLGHYMKIPPRSMFLVQLV  420

Query  457   GTLISCCVHFGTGWWLLTTVENICNPSKLPEGSQWTCPGDDVFYNASIIWGVVSPRRMFG  278
             GT+I+  V+FGT WWLLTTV++IC+   LPEGS WTCPGDDVFYNAS+IWGV+ P RMFG
Sbjct  421   GTVIASSVYFGTAWWLLTTVKHICDRDLLPEGSPWTCPGDDVFYNASVIWGVIGPLRMFG  480

Query  277   NLGIYQATNYFFLVGFLAPIPVWYLGRKYPEKRWVSLINMPILISGAEGIPIVKSVNYVC  98
              LG+Y   N+FFL GFLAP+PVW+L RK+P ++W+ LI+MPI+I     +P  ++V++V 
Sbjct  481   RLGVYPEMNWFFLAGFLAPVPVWFLSRKFPNQKWIRLIHMPIIIGATGNMPPARAVHFVM  540

Query  97    WFAVGLYFNLYVYRKHKGWWARHNYILSAGLD  2
             W  VG++FN YVY ++K WWA+H YILSA LD
Sbjct  541   WGIVGVFFNFYVYNRYKQWWAKHTYILSAALD  572



>ref|NP_001056665.1| Os06g0127700 [Oryza sativa Japonica Group]
 dbj|BAD67748.1| putative isp4 protein [Oryza sativa Japonica Group]
 dbj|BAD67928.1| putative isp4 protein [Oryza sativa Japonica Group]
 dbj|BAF18579.1| Os06g0127700 [Oryza sativa Japonica Group]
 gb|EEC79910.1| hypothetical protein OsI_21457 [Oryza sativa Indica Group]
 gb|EEE65014.1| hypothetical protein OsJ_19965 [Oryza sativa Japonica Group]
Length=760

 Score =   722 bits (1863),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 355/669 (53%), Positives = 484/669 (72%), Gaps = 3/669 (0%)
 Frame = -1

Query  2008  NDSPVEEVRLTVPITDDPTMPCVTFRTWVLGVTSCVILAFLNQFFGYRQNALYVSSVPAQ  1829
              +SPVE+V LTVP+ DDP  P +TFR WVLG  SCV+L+FLN FF YR+  L V+++ AQ
Sbjct  43    ENSPVEQVALTVPVGDDPATPVLTFRIWVLGTASCVVLSFLNTFFWYRKEPLTVTAISAQ  102

Query  1828  IVVLPMGKLMAAYLPTKVVQIPGTKWSFSLNPGPFNIKEHVLITIFASSGSDFSYAVSII  1649
             I V+P+G+LMAA LP +V    G  W F+LNPGPFN+KEHVLITIFA++G+   +A+++I
Sbjct  103   IAVVPLGRLMAAALPERVF-FRGRPWEFTLNPGPFNVKEHVLITIFANAGAGSVFAINVI  161

Query  1648  TMMKAFYYRDIHPLAAVLLTFSTQMLGYGLAGIFKKFLIDSPYMWWPSNLVQVSLFRALH  1469
             T ++ FY + I    ++L+  ++Q+LG+G AGIF+++L++   MWWPSNLVQVSLFRALH
Sbjct  162   TAVRVFYGKRISFFVSLLVVLTSQVLGFGWAGIFRRYLVEPAAMWWPSNLVQVSLFRALH  221

Query  1468  DVETRPKGGLTRLQFFIIVLVCSFAYYVVPNYLFPSLTALSLLCWIWKNSVTAQQlgsgl  1289
             + E R KGG+TR QFF++  VCSFAYY+ P YLF  LT+LS +CWI+  SV AQQLGSGL
Sbjct  222   EKERRSKGGMTRTQFFLVAFVCSFAYYIFPGYLFQMLTSLSWICWIFPKSVLAQQLGSGL  281

Query  1288  kglgigSFALDWATVAAFQGSPLVTPDFAIINMLIGYVLVAYIAIPVWYWTNLFDAKKFP  1109
              GLGIG+  LDW++++++ GSPL +P FA  N+  G+ +  Y+  P+ YW NL+ A+ FP
Sbjct  282   HGLGIGAIGLDWSSISSYLGSPLASPWFATANIAAGFFIYIYVITPIAYWINLYKAQNFP  341

Query  1108  LFSSNVFDSNGQVYNISRVLNKKTFGFDQPGYDSYSNIYLSTAFVYTYGLSFATLAATVS  929
             +FS  +F   GQ YNIS +++ + F FD   Y+    +Y+ST F  +YGL FA L ATV 
Sbjct  342   IFSDGLFTVTGQKYNISTIIDSQ-FHFDTKAYEKNGPLYISTFFSISYGLGFACLTATVV  400

Query  928   HVALFHGRTIWEQTKESVQDKFSDIHTRLMRKNYEPVPQWWFYlllviivgvalvACQRF  749
             HV LFHG  IW+ ++ + QDK  DIHT+LM++ Y+ VP+WWF  +L+  V + +  C+ +
Sbjct  401   HVLLFHGSEIWQLSRSAFQDKKMDIHTKLMKR-YKQVPEWWFISILIASVAITMFTCEYY  459

Query  748   GGQLQLPVWGVLLAVLLSLIFTLPVGVITATTNQQTGLNVIAELIIGYMYPGRPLASVTF  569
               QLQLP WGVLLA  L++ FTLP+G++TATTNQ  GLN+I E I+GY+YPGRP+A++ F
Sbjct  460   IEQLQLPWWGVLLACALAIFFTLPIGIVTATTNQTPGLNIITEYIMGYLYPGRPVANMCF  519

Query  568   KMYGlsslsqslmflSDFKLGHYMKIPPKSMFMVQLVGTLISCCVHFGTGWWLLTTVENI  389
             K+YG     Q+L FL DFKLGHYMKIPP++MFM Q+VGTLI+  V+ GT WWL+ T+ NI
Sbjct  520   KVYGYIGPQQALAFLQDFKLGHYMKIPPRTMFMAQVVGTLIAAFVYLGTAWWLMDTIPNI  579

Query  388   CNPSKLPEGSQWTCPGDDVFYNASIIWGVVSPRRMFGNLGIYQATNYFFLVGFLAPIPVW  209
             CN   LP GS WTCP D +FY+AS+IWG++ PRR+FG+LG Y A N+FFL G +AP+ VW
Sbjct  580   CNTELLPPGSPWTCPYDHLFYDASVIWGLIGPRRIFGDLGTYSAVNWFFLGGAIAPLLVW  639

Query  208   YLGRKYPEKRWVSLINMPILISGAEGIPIVKSVNYVCWFAVGLYFNLYVYRKHKGWWARH  29
             +  + +P ++W+ L+NMP+LI+G   +P   SVNY  W  V       VY+  + WW RH
Sbjct  640   FAHKAFPGQKWILLVNMPVLIAGISQMPPATSVNYTAWIFVAFLSGYVVYKYRRDWWERH  699

Query  28    NYILSAGLD  2
             NY+LS  LD
Sbjct  700   NYLLSGALD  708



>ref|XP_010228050.1| PREDICTED: oligopeptide transporter 7-like isoform X2 [Brachypodium 
distachyon]
Length=731

 Score =   720 bits (1859),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 354/675 (52%), Positives = 487/675 (72%), Gaps = 3/675 (0%)
 Frame = -1

Query  2026  SSADEINDSPVEEVRLTVPITDDPTMPCVTFRTWVLGVTSCVILAFLNQFFGYRQNALYV  1847
             SS  +  +SPVE+V LTVP+ DDP  P +TFRTWVLG  SCV L+FLN FFGYR+  L +
Sbjct  9     SSPSDWENSPVEQVALTVPVGDDPLTPVLTFRTWVLGTASCVALSFLNAFFGYRKEPLEI  68

Query  1846  SSVPAQIVVLPMGKLMAAYLPTKVVQIPGTKWSFSLNPGPFNIKEHVLITIFASSGSDFS  1667
             ++V AQI VLP+G+LMAA LP++     G ++ F+LNPGPFN+KEHVLITIFA++G+   
Sbjct  69    TAVSAQIAVLPLGRLMAALLPSRAF-FSGRRYEFTLNPGPFNMKEHVLITIFANAGAGSV  127

Query  1666  YAVSIITMMKAFYYRDIHPLAAVLLTFSTQMLGYGLAGIFKKFLIDSPYMWWPSNLVQVS  1487
             +A++++T ++ FY   I    ++L+  ++Q++G+G AGIF+++L++   MWWPSNLVQVS
Sbjct  128   FAINVVTALRVFYAMKITFFVSLLIVLTSQVMGFGWAGIFRQYLVEPAAMWWPSNLVQVS  187

Query  1486  LFRALHDVETRPKGGLTRLQFFIIVLVCSFAYYVVPNYLFPSLTALSLLCWIWKNSVTAQ  1307
             LFRALH+ E R KGG+TR QFFI+  VCSFAYY+ P YLF  LT+LS +CWI+ NSV AQ
Sbjct  188   LFRALHEKEQRSKGGMTRNQFFILAFVCSFAYYIFPGYLFQMLTSLSWICWIFPNSVVAQ  247

Query  1306  QlgsglkglgigSFALDWATVAAFQGSPLVTPDFAIINMLIGYVLVAYIAIPVWYWTNLF  1127
             QLGSG+ GLGIG+  LDW++++++ GSPL +P FA  N+  G+V+  YI  PV YW N++
Sbjct  248   QLGSGMHGLGIGAIGLDWSSISSYLGSPLASPWFATANVAAGFVIYMYIITPVTYWFNVY  307

Query  1126  DAKKFPLFSSNVFDSNGQVYNISRVLNKKTFGFDQPGYDSYSNIYLSTAFVYTYGLSFAT  947
              A+ FP+ S  +F   G+ YNIS +++ + F FD   Y+    +Y+ST F  +YGL FA 
Sbjct  308   KAQNFPIISDGLFTGTGRKYNISTIIDSQ-FHFDMNAYEKNGPLYISTFFAVSYGLGFAC  366

Query  946   LAATVSHVALFHGRTIWEQTKESVQDKFSDIHTRLMRKNYEPVPQWWFYlllviivgval  767
             L AT+ HV LFHG  IW+ +K + Q+K  DIHT+LMR+ Y  VP+WWF  +LV  + + +
Sbjct  367   LTATLVHVILFHGSEIWQLSKSAFQEKKVDIHTKLMRR-YRQVPEWWFICILVASIAITM  425

Query  766   vACQRFGGQLQLPVWGVLLAVLLSLIFTLPVGVITATTNQQTGLNVIAELIIGYMYPGRP  587
               C+ +  QLQLP WGVLLA  L++ +TLP+G+ITATTNQ  GLN+I E I+GY+YPGRP
Sbjct  426   FTCESYIEQLQLPWWGVLLACALAIFYTLPIGIITATTNQTPGLNIITEYIMGYVYPGRP  485

Query  586   LASVTFKMYGlsslsqslmflSDFKLGHYMKIPPKSMFMVQLVGTLISCCVHFGTGWWLL  407
             +A++ FK+YG     Q+L FL DFKLGHYMKIPP++MFM Q+VGT+I+  V+ GT WWL+
Sbjct  486   VANMCFKVYGYIGPRQALAFLQDFKLGHYMKIPPRTMFMAQVVGTIIAAFVYLGTAWWLM  545

Query  406   TTVENICNPSKLPEGSQWTCPGDDVFYNASIIWGVVSPRRMFGNLGIYQATNYFFLVGFL  227
              T+ NICN   LP GS WTCP D +FY+AS+IWG++SPRR+FG+LG Y A N+FFL G +
Sbjct  546   DTIPNICNTELLPAGSPWTCPYDHLFYDASVIWGLISPRRIFGDLGTYSAINWFFLGGAV  605

Query  226   APIPVWYLGRKYPEKRWVSLINMPILISGAEGIPIVKSVNYVCWFAVGLYFNLYVYRKHK  47
             AP+ VW   + +P ++W+ L+NMP+L+ G   +P   +VNY  W  +       VY+  +
Sbjct  606   APLLVWLAHKAFPGQKWILLVNMPVLLGGISHMPPATAVNYTAWIFIAFLSGYMVYKYRR  665

Query  46    GWWARHNYILSAGLD  2
              WW RHNY+LS  LD
Sbjct  666   DWWERHNYLLSGALD  680



>ref|XP_004964382.1| PREDICTED: oligopeptide transporter 7-like isoform X1 [Setaria 
italica]
Length=803

 Score =   723 bits (1866),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 370/696 (53%), Positives = 490/696 (70%), Gaps = 31/696 (4%)
 Frame = -1

Query  2005  DSPVEEVRLTVPITDDPTMPCVTFRTWVLGVTSCVILAFLNQFFGYRQNALYVSSVPAQI  1826
             +SP+E+V LTVP+ DDP+ P +TFR WVLG  SC +L+FLNQFF YR+  L ++++ AQI
Sbjct  60    NSPIEQVALTVPVGDDPSTPVLTFRMWVLGTASCALLSFLNQFFWYRKEPLTITAISAQI  119

Query  1825  VVLPMGKLMAAYLPTKVVQIPGTKWSFSLNPGPFNIKEHVLITIFASSGSDFSYAVSIIT  1646
              V+P+G+LMAA LP +   + GT+W FSLNPGPFN+KEHVLITIFA+SG+   YA+ +IT
Sbjct  120   AVVPLGRLMAAALPERAF-LRGTRWEFSLNPGPFNVKEHVLITIFANSGAGTVYAIHVIT  178

Query  1645  MMKAFYYRDIHPLAAVL----------------------------LTFSTQMLGYGLAGI  1550
              ++ FY + I    ++L                            L+F  Q+LG+G AGI
Sbjct  179   AVRVFYGKHITFFVSLLVVLTTQVSEGCTEKAFASLLLRGVRDYSLSFDMQVLGFGWAGI  238

Query  1549  FKKFLIDSPYMWWPSNLVQVSLFRALHDVETRPKGGLTRLQFFIIVLVCSFAYYVVPNYL  1370
             F+++L++   MWWPSNLVQVSLFRALH+ E R KGGLTR QFF++  +CSFAYY+ P YL
Sbjct  239   FRRYLVEPAAMWWPSNLVQVSLFRALHEKEQRVKGGLTRNQFFLVAFICSFAYYIFPGYL  298

Query  1369  FPSLTALSLLCWIWKNSVTAQQlgsglkglgigSFALDWATVAAFQGSPLVTPDFAIINM  1190
             F  LT+LS +CW++ +SV AQQLGSGL+GLGIG+  LDW+TV+++ GSPL +P FA  N+
Sbjct  299   FQMLTSLSWVCWVFPHSVFAQQLGSGLRGLGIGAIGLDWSTVSSYLGSPLASPWFATANV  358

Query  1189  LIGYVLVAYIAIPVWYWTNLFDAKKFPLFSSNVFDSNGQVYNISRVLNKKTFGFDQPGYD  1010
               G+V V YI  P+ YW N + A+ FP+FS  +F + GQ YNIS +++   F FD   Y+
Sbjct  359   AAGFVFVMYIVTPIAYWFNFYKAQNFPIFSDGLFTTTGQKYNISSIVDSH-FHFDTKAYE  417

Query  1009  SYSNIYLSTAFVYTYGLSFATLAATVSHVALFHGRTIWEQTKESVQDKFSDIHTRLMRKN  830
                 +YLST F  TYG+ FA+L AT+ HV LFHG  IW+ +K + Q+K  D+HT+LMR+ 
Sbjct  418   KNGPLYLSTFFAVTYGVGFASLTATIVHVFLFHGSEIWQLSKSAFQEKKMDVHTKLMRR-  476

Query  829   YEPVPQWWFYlllviivgvalvACQRFGGQLQLPVWGVLLAVLLSLIFTLPVGVITATTN  650
             Y+ VP+WWF  +LV  + V + AC+ +  QLQLP WGVLLA  ++  FTLPVG+ITATTN
Sbjct  477   YKQVPEWWFICILVANIAVTIFACEYYIEQLQLPWWGVLLACAIAFFFTLPVGIITATTN  536

Query  649   QQTGLNVIAELIIGYMYPGRPLASVTFKMYGlsslsqslmflSDFKLGHYMKIPPKSMFM  470
             Q  GLN+I E I+GY+YPGRP+A++ FK+YG  S+SQ+L FL DFKLGHYMKIPP++MFM
Sbjct  537   QTPGLNIITEYIMGYLYPGRPVANMCFKVYGYISMSQALTFLQDFKLGHYMKIPPRTMFM  596

Query  469   VQLVGTLISCCVHFGTGWWLLTTVENICNPSKLPEGSQWTCPGDDVFYNASIIWGVVSPR  290
              Q+VGTLI+  V+ GT WWL+ TV NICN   LP  S WTCPGD VFY+AS+IWG++SPR
Sbjct  597   AQVVGTLIAAFVYIGTAWWLMETVPNICNTELLPRDSPWTCPGDHVFYDASVIWGLISPR  656

Query  289   RMFGNLGIYQATNYFFLVGFLAPIPVWYLGRKYPEKRWVSLINMPILISGAEGIPIVKSV  110
             R+FG+LG Y A N+FFL G +AP+ VW   + +P + W+ LINMP+LI     +P   +V
Sbjct  657   RIFGDLGTYSAVNWFFLGGAIAPLLVWLAHKAFPGQSWILLINMPVLIGATGNMPPATAV  716

Query  109   NYVCWFAVGLYFNLYVYRKHKGWWARHNYILSAGLD  2
             NY  W  VG      VYR  + WW RHNY+LS  LD
Sbjct  717   NYTTWILVGFLSGYVVYRYRRDWWERHNYLLSGALD  752



>ref|XP_003557106.2| PREDICTED: oligopeptide transporter 7-like isoform X1 [Brachypodium 
distachyon]
Length=747

 Score =   721 bits (1860),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 354/675 (52%), Positives = 487/675 (72%), Gaps = 3/675 (0%)
 Frame = -1

Query  2026  SSADEINDSPVEEVRLTVPITDDPTMPCVTFRTWVLGVTSCVILAFLNQFFGYRQNALYV  1847
             SS  +  +SPVE+V LTVP+ DDP  P +TFRTWVLG  SCV L+FLN FFGYR+  L +
Sbjct  25    SSPSDWENSPVEQVALTVPVGDDPLTPVLTFRTWVLGTASCVALSFLNAFFGYRKEPLEI  84

Query  1846  SSVPAQIVVLPMGKLMAAYLPTKVVQIPGTKWSFSLNPGPFNIKEHVLITIFASSGSDFS  1667
             ++V AQI VLP+G+LMAA LP++     G ++ F+LNPGPFN+KEHVLITIFA++G+   
Sbjct  85    TAVSAQIAVLPLGRLMAALLPSRAF-FSGRRYEFTLNPGPFNMKEHVLITIFANAGAGSV  143

Query  1666  YAVSIITMMKAFYYRDIHPLAAVLLTFSTQMLGYGLAGIFKKFLIDSPYMWWPSNLVQVS  1487
             +A++++T ++ FY   I    ++L+  ++Q++G+G AGIF+++L++   MWWPSNLVQVS
Sbjct  144   FAINVVTALRVFYAMKITFFVSLLIVLTSQVMGFGWAGIFRQYLVEPAAMWWPSNLVQVS  203

Query  1486  LFRALHDVETRPKGGLTRLQFFIIVLVCSFAYYVVPNYLFPSLTALSLLCWIWKNSVTAQ  1307
             LFRALH+ E R KGG+TR QFFI+  VCSFAYY+ P YLF  LT+LS +CWI+ NSV AQ
Sbjct  204   LFRALHEKEQRSKGGMTRNQFFILAFVCSFAYYIFPGYLFQMLTSLSWICWIFPNSVVAQ  263

Query  1306  QlgsglkglgigSFALDWATVAAFQGSPLVTPDFAIINMLIGYVLVAYIAIPVWYWTNLF  1127
             QLGSG+ GLGIG+  LDW++++++ GSPL +P FA  N+  G+V+  YI  PV YW N++
Sbjct  264   QLGSGMHGLGIGAIGLDWSSISSYLGSPLASPWFATANVAAGFVIYMYIITPVTYWFNVY  323

Query  1126  DAKKFPLFSSNVFDSNGQVYNISRVLNKKTFGFDQPGYDSYSNIYLSTAFVYTYGLSFAT  947
              A+ FP+ S  +F   G+ YNIS +++ + F FD   Y+    +Y+ST F  +YGL FA 
Sbjct  324   KAQNFPIISDGLFTGTGRKYNISTIIDSQ-FHFDMNAYEKNGPLYISTFFAVSYGLGFAC  382

Query  946   LAATVSHVALFHGRTIWEQTKESVQDKFSDIHTRLMRKNYEPVPQWWFYlllviivgval  767
             L AT+ HV LFHG  IW+ +K + Q+K  DIHT+LMR+ Y  VP+WWF  +LV  + + +
Sbjct  383   LTATLVHVILFHGSEIWQLSKSAFQEKKVDIHTKLMRR-YRQVPEWWFICILVASIAITM  441

Query  766   vACQRFGGQLQLPVWGVLLAVLLSLIFTLPVGVITATTNQQTGLNVIAELIIGYMYPGRP  587
               C+ +  QLQLP WGVLLA  L++ +TLP+G+ITATTNQ  GLN+I E I+GY+YPGRP
Sbjct  442   FTCESYIEQLQLPWWGVLLACALAIFYTLPIGIITATTNQTPGLNIITEYIMGYVYPGRP  501

Query  586   LASVTFKMYGlsslsqslmflSDFKLGHYMKIPPKSMFMVQLVGTLISCCVHFGTGWWLL  407
             +A++ FK+YG     Q+L FL DFKLGHYMKIPP++MFM Q+VGT+I+  V+ GT WWL+
Sbjct  502   VANMCFKVYGYIGPRQALAFLQDFKLGHYMKIPPRTMFMAQVVGTIIAAFVYLGTAWWLM  561

Query  406   TTVENICNPSKLPEGSQWTCPGDDVFYNASIIWGVVSPRRMFGNLGIYQATNYFFLVGFL  227
              T+ NICN   LP GS WTCP D +FY+AS+IWG++SPRR+FG+LG Y A N+FFL G +
Sbjct  562   DTIPNICNTELLPAGSPWTCPYDHLFYDASVIWGLISPRRIFGDLGTYSAINWFFLGGAV  621

Query  226   APIPVWYLGRKYPEKRWVSLINMPILISGAEGIPIVKSVNYVCWFAVGLYFNLYVYRKHK  47
             AP+ VW   + +P ++W+ L+NMP+L+ G   +P   +VNY  W  +       VY+  +
Sbjct  622   APLLVWLAHKAFPGQKWILLVNMPVLLGGISHMPPATAVNYTAWIFIAFLSGYMVYKYRR  681

Query  46    GWWARHNYILSAGLD  2
              WW RHNY+LS  LD
Sbjct  682   DWWERHNYLLSGALD  696



>ref|XP_007204095.1| hypothetical protein PRUPE_ppa002122mg [Prunus persica]
 gb|EMJ05294.1| hypothetical protein PRUPE_ppa002122mg [Prunus persica]
Length=713

 Score =   719 bits (1856),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 361/676 (53%), Positives = 485/676 (72%), Gaps = 5/676 (1%)
 Frame = -1

Query  2029  ESSADEINDSPVEEVRLTVPITDDPTMPCVTFRTWVLGVTSCVILAFLNQFFGYRQNALY  1850
             + S DE  +SP+E+V LTVP+TDDP++P VTFRTW LG  +CV+L+FLNQFF YR+  L 
Sbjct  4     DFSGDE--NSPIEQVALTVPVTDDPSLPTVTFRTWTLGALACVLLSFLNQFFWYRREPLS  61

Query  1849  VSSVPAQIVVLPMGKLMAAYLPTKVVQIPGTKWSFSLNPGPFNIKEHVLITIFASSGSDF  1670
             ++S+ AQI V+P+G LMA+ L TK V   G KW F+LNPGPFN+KEHVLITIFA+SG+  
Sbjct  62    LTSISAQIAVVPLGHLMAS-LITKRVFFKGQKWEFTLNPGPFNVKEHVLITIFANSGAGN  120

Query  1669  SYAVSIITMMKAFYYRDIHPLAAVLLTFSTQMLGYGLAGIFKKFLIDSPYMWWPSNLVQV  1490
              YA+ I++ +K FY +++    A+L+  +TQ+LG+G AG+F+++L++   MWWP NLVQV
Sbjct  121   VYAIHIVSTVKLFYKKNLSFFVALLVVLTTQVLGFGWAGLFRRYLVEPAAMWWPQNLVQV  180

Query  1489  SLFRALHDVETRPKGGLTRLQFFIIVLVCSFAYYVVPNYLFPSLTALSLLCWIWKNSVTA  1310
             SLFRALH+ E RPKGGLTR QFF+I   CSFAYYV+P YLFP LT+LS +CWI+  S+ A
Sbjct  181   SLFRALHEKEKRPKGGLTRNQFFLIAFTCSFAYYVLPGYLFPMLTSLSWICWIFPTSILA  240

Query  1309  QQlgsglkglgigSFALDWATVAAFQGSPLVTPDFAIINMLIGYVLVAYIAIPVWYWTNL  1130
              QLGSGL GLGIG+  LDW++++++ GSPL +P FA  N+  G+ LV Y+  PV YW NL
Sbjct  241   HQLGSGLHGLGIGAIGLDWSSISSYLGSPLASPWFATANITAGFFLVLYVITPVAYWLNL  300

Query  1129  FDAKKFPLFSSNVFDSNGQVYNISRVLNKKTFGFDQPGYDSYSNIYLSTAFVYTYGLSFA  950
             ++AK FP+ S  +F S GQ YNIS +++   F  D   Y     +++ST F   YG++FA
Sbjct  301   YNAKTFPIVSDGLFTSTGQSYNISAIIDPN-FRLDIDAYGREGALHISTFFAMYYGVNFA  359

Query  949   TLAATVSHVALFHGRTIWEQTKESVQDKFSDIHTRLMRKNYEPVPQWWFYlllviivgva  770
              L AT+ HV LF+GR IW+ +  ++++K  D+HT+LMRK Y+ VP WWF  +LV  +   
Sbjct  360   CLTATIVHVLLFNGRDIWQLSTSAIREKKMDVHTKLMRK-YKQVPGWWFMCILVANIVAT  418

Query  769   lvACQRFGGQLQLPVWGVLLAVLLSLIFTLPVGVITATTNQQTGLNVIAELIIGYMYPGR  590
             +  C  +  QLQL  WGVLLA  L+L FTLP+GVI ATTNQ+  LNVI E IIGY+YPG 
Sbjct  419   MFTCHYYNDQLQLKWWGVLLACGLALFFTLPIGVIAATTNQKPALNVITEYIIGYLYPGY  478

Query  589   PLASVTFKMYGlsslsqslmflSDFKLGHYMKIPPKSMFMVQLVGTLISCCVHFGTGWWL  410
             P+A+V FK+YG  S+ Q + FL DFKLGHYMKIPP++MFM Q+VGT+I+  VH GT WWL
Sbjct  479   PVANVCFKVYGYISMKQGIAFLEDFKLGHYMKIPPRAMFMAQVVGTIIAAFVHLGTAWWL  538

Query  409   LTTVENICNPSKLPEGSQWTCPGDDVFYNASIIWGVVSPRRMFGNLGIYQATNYFFLVGF  230
             + T+ +IC+ + LP  S WTCPGD VFY+AS+IWG+V PRR+FG+LG Y A N+FFL G 
Sbjct  539   MNTIPDICDRALLPADSPWTCPGDHVFYDASVIWGLVGPRRIFGDLGHYSAINWFFLAGA  598

Query  229   LAPIPVWYLGRKYPEKRWVSLINMPILISGAEGIPIVKSVNYVCWFAVGLYFNLYVYRKH  50
             +AP+ VW   + +P K W+ LI MP+L+     +P   +VN+  W  +G       YR +
Sbjct  599   IAPVLVWLAHKAFPRKHWIKLITMPVLLGATVNMPPATAVNFTSWVLIGFASGFIAYRYY  658

Query  49    KGWWARHNYILSAGLD  2
             +G W+RHNY+LS  LD
Sbjct  659   RGLWSRHNYVLSGALD  674



>gb|KDP25233.1| hypothetical protein JCGZ_20389 [Jatropha curcas]
Length=756

 Score =   721 bits (1860),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 358/669 (54%), Positives = 489/669 (73%), Gaps = 5/669 (1%)
 Frame = -1

Query  2008  NDSPVEEVRLTVPITDDPTMPCVTFRTWVLGVTSCVILAFLNQFFGYRQNALYVSSVPAQ  1829
              +SPV++V LTVP TDDP++P +TFR WVLG  SCV+L+FLNQFF YR   L ++++ AQ
Sbjct  42    ENSPVKQVALTVPTTDDPSLPVLTFRMWVLGTISCVLLSFLNQFFWYRTEPLSITAISAQ  101

Query  1828  IVVLPMGKLMAAYLPTKVVQIPGTKWSFSLNPGPFNIKEHVLITIFASSGSDFSYAVSII  1649
             I V+P+G+LMAA +  +V  + GT+W F+LNPGPFN+KEHVLITIFA+SG+   YA+ I+
Sbjct  102   IAVVPLGQLMAAKITDRVF-LKGTRWEFTLNPGPFNVKEHVLITIFANSGAGSVYAIHIV  160

Query  1648  TMMKAFYYRDIHPLAAVLLTFSTQMLGYGLAGIFKKFLIDSPYMWWPSNLVQVSLFRALH  1469
             T++K FY + I    ++++  +TQ+LG+G AGIF+K+L++   MWWP+NLVQVSLFRALH
Sbjct  161   TVVKMFYKKHITFFVSLIVIITTQVLGFGWAGIFRKYLVEPAAMWWPANLVQVSLFRALH  220

Query  1468  DVETRPKGGLTRLQFFIIVLVCSFAYYVVPNYLFPSLTALSLLCWIWKNSVTAQQlgsgl  1289
             + E R KGG+TR+QFF+I  +CSFAYYV P YLF  LT+LS +CWI+  SV  QQLGSGL
Sbjct  221   EKEERAKGGVTRIQFFVIAFICSFAYYVFPGYLFQMLTSLSWVCWIFPKSVLTQQLGSGL  280

Query  1288  kglgigSFALDWATVAAFQGSPLVTPDFAIINMLIGYVLVAYIAIPVWYWTNLFDAKKFP  1109
              GLGIG+  +DW+T++++ GSPL +P FA  N+  G++ V YI  P+ YW N++ AK FP
Sbjct  281   YGLGIGAIGIDWSTISSYLGSPLASPWFATANVAAGFIFVMYILTPLCYWFNVYKAKTFP  340

Query  1108  LFSSNVFDSNGQVYNISRVLNKKTFGFDQPGYDSYSNIYLSTAFVYTYGLSFATLAATVS  929
             +FS ++F S+GQ YNIS +++   F  D   Y+    +YLST F  TYG+ FA L AT+ 
Sbjct  341   IFSDDLFTSSGQEYNISAIVDSN-FHLDLAAYEKQGPLYLSTFFAMTYGVGFAALTATIV  399

Query  928   HVALFHGRTIWEQTKESVQDKFSDIHTRLMRKNYEPVPQWWFYlllviivgvalvACQRF  749
             HVALFHGR IWEQ+K S Q+K  DIHT+LMRK Y+ VP+ WF  +L+  +   + AC+ +
Sbjct  400   HVALFHGREIWEQSKASFQEKKMDIHTKLMRK-YKQVPESWFVGILLCNIAATIFACEYY  458

Query  748   GGQLQLPVWGVLLAVLLSLIFTLPVGVITATTNQQTGLNVIAELIIGYMYPGRPLASVTF  569
               QLQLP WGVLLA  ++++FTLP+G ITA TNQ  GLNVI E IIGY+YPG P+A++ F
Sbjct  459   NDQLQLPWWGVLLACGIAILFTLPIGTITAITNQTPGLNVITEYIIGYIYPGYPVANMCF  518

Query  568   KMYGlsslsqslmflSDFKLGHYMKIPPKSMFMVQLVGTLISCCVHFGTGWWLLTTVENI  389
             K+YG  S++Q++ FL DFKLGHYMKIPP++MFM Q+VG+LI+C  + GT WWL+ T+ +I
Sbjct  519   KVYGYISMTQAIAFLQDFKLGHYMKIPPRTMFMAQIVGSLIACLTYLGTAWWLMETITDI  578

Query  388   CNPSKLPEGSQWTCPGDDVFYNASIIWGVVSPRRMFGNLGIYQATNYFFLVGFLAPIPVW  209
             C+ +     S WTCP D VFY+AS+IWG++ PRR+FG+LG Y+A N+FFL G +AP+ VW
Sbjct  579   CDTTA--SNSVWTCPSDTVFYDASVIWGLIGPRRIFGDLGTYEAINWFFLAGAVAPVLVW  636

Query  208   YLGRKYPEKRWVSLINMPILISGAEGIPIVKSVNYVCWFAVGLYFNLYVYRKHKGWWARH  29
                + +P++ W++LINMP+LI     +P   +VNY  W  +G      VYR     W R+
Sbjct  637   LAAKAFPKQEWITLINMPVLIGATGMMPPATAVNYTSWIILGFLSGFVVYRYRPDLWQRY  696

Query  28    NYILSAGLD  2
             NY+LS  LD
Sbjct  697   NYVLSGSLD  705



>ref|XP_006655730.1| PREDICTED: oligopeptide transporter 7-like [Oryza brachyantha]
Length=765

 Score =   720 bits (1859),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 362/672 (54%), Positives = 483/672 (72%), Gaps = 7/672 (1%)
 Frame = -1

Query  2005  DSPVEEVRLTVPITDDPTMPCVTFRTWVLGVTSCVILAFLNQFFGYRQNALYVSSVPAQI  1826
             +SP+E+V LTVP+ D+P  P +TFR WVLGV SC +L+FLNQFF YR+  L ++++ AQI
Sbjct  46    NSPIEQVALTVPVGDEPGTPVLTFRMWVLGVVSCAVLSFLNQFFWYRKEPLTITAISAQI  105

Query  1825  VVLPMGKLMAAYLPTKVVQIPGTKWSFSLNPGPFNIKEHVLITIFASSGSDFSYAVSIIT  1646
              V+P+G+LMAA LP +     G  W F+LNPGPFN+KEHVLITIFA+SG+   YA+ +IT
Sbjct  106   AVVPLGRLMAAALPERAF-FRGRPWEFTLNPGPFNVKEHVLITIFANSGAGTVYAIHVIT  164

Query  1645  MMKAFYYRDIHPLAAVLLTFSTQM----LGYGLAGIFKKFLIDSPYMWWPSNLVQVSLFR  1478
              ++ FY + I    ++L+  +TQ+    LG G AGIF+++L++   MWWPSNLVQVSLFR
Sbjct  165   AVRVFYGKHISFFVSLLVVLTTQLVDQVLGSGWAGIFRRYLVEPAAMWWPSNLVQVSLFR  224

Query  1477  ALHDVETRPKGGLTRLQFFIIVLVCSFAYYVVPNYLFPSLTALSLLCWIWKNSVTAQQlg  1298
             ALH+ E R KGGLTR QFF++  +CSFAYY+ P YLF  LT+LS +CW++ +SV AQQLG
Sbjct  225   ALHEKEQRSKGGLTRNQFFLVAFICSFAYYIFPGYLFQMLTSLSWICWVFPHSVLAQQLG  284

Query  1297  sglkglgigSFALDWATVAAFQGSPLVTPDFAIINMLIGYVLVAYIAIPVWYWTNLFDAK  1118
             SGL GLGIG+  LDW+TV+++ GSPL +P FA  N+  G+  + YI  P+ YW N + A+
Sbjct  285   SGLSGLGIGAIGLDWSTVSSYLGSPLASPWFATANVAAGFFFIMYIITPIAYWFNFYKAQ  344

Query  1117  KFPLFSSNVFDSNGQVYNISRVLNKKTFGFDQPGYDSYSNIYLSTAFVYTYGLSFATLAA  938
              FP+FS  +F S GQ YNIS +++   F FD   Y+    +YLST F  TYG+ FA+L A
Sbjct  345   NFPIFSDGLFTSTGQKYNISSIVDSH-FHFDTQAYEKNGPLYLSTFFAVTYGVGFASLTA  403

Query  937   TVSHVALFHGRTIWEQTKESVQDKFSDIHTRLMRKNYEPVPQWWFYlllviivgvalvAC  758
             T+ HV LFHG  IW+ +K + Q+K  DIHT+LMR+ Y+ VP+ WF  +L+  + + +  C
Sbjct  404   TIVHVLLFHGSEIWQLSKSAFQEKRMDIHTKLMRR-YKQVPESWFVCILIANIAITIFTC  462

Query  757   QRFGGQLQLPVWGVLLAVLLSLIFTLPVGVITATTNQQTGLNVIAELIIGYMYPGRPLAS  578
             + +  QLQLP WGVLLA  L+  FTLP+G+ITATTNQ  GLN+I E I+GY+YPGRP+A+
Sbjct  463   EYYIEQLQLPWWGVLLACALAFFFTLPIGIITATTNQTPGLNIITEYIMGYLYPGRPVAN  522

Query  577   VTFKMYGlsslsqslmflSDFKLGHYMKIPPKSMFMVQLVGTLISCCVHFGTGWWLLTTV  398
             + FK+YG  S+SQ+L FL DFKLGHYMKIPP++MFM Q+VGTLI+  V+ GT WWL+ TV
Sbjct  523   MCFKVYGYISMSQALTFLQDFKLGHYMKIPPRTMFMAQVVGTLIAAFVYIGTAWWLMETV  582

Query  397   ENICNPSKLPEGSQWTCPGDDVFYNASIIWGVVSPRRMFGNLGIYQATNYFFLVGFLAPI  218
              NICN   LP  S WTCPGD VFY+AS+IWG++SPRR+FG+LG Y A N+FFL G +AP+
Sbjct  583   PNICNTELLPSDSPWTCPGDHVFYDASVIWGLISPRRIFGDLGTYSAVNWFFLGGAIAPV  642

Query  217   PVWYLGRKYPEKRWVSLINMPILISGAEGIPIVKSVNYVCWFAVGLYFNLYVYRKHKGWW  38
              VW+  + +P + W+ LINMP+LI     +P   +VNY  W  VG      VY+  + WW
Sbjct  643   LVWFAHKAFPNQNWILLINMPVLIGATGQMPPATAVNYTTWILVGFLSGYVVYKYRRDWW  702

Query  37    ARHNYILSAGLD  2
              RHNY+LS  LD
Sbjct  703   ERHNYLLSGALD  714



>ref|XP_004511249.1| PREDICTED: oligopeptide transporter 7-like [Cicer arietinum]
Length=739

 Score =   718 bits (1854),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 362/676 (54%), Positives = 484/676 (72%), Gaps = 4/676 (1%)
 Frame = -1

Query  2029  ESSADEINDSPVEEVRLTVPITDDPTMPCVTFRTWVLGVTSCVILAFLNQFFGYRQNALY  1850
              SS DE  +SP+E+V LTVP+ DDP++P  TFRTW LG  +CV+L+FLNQFFG+R+  L 
Sbjct  18    SSSGDE--NSPIEQVALTVPVNDDPSLPVFTFRTWTLGTLACVLLSFLNQFFGFRREPLS  75

Query  1849  VSSVPAQIVVLPMGKLMAAYLPTKVVQIPGTKWSFSLNPGPFNIKEHVLITIFASSGSDF  1670
             V+++ AQI V+P+G LMA+ + TK V + GTKW F+LNPG FN+KEHVLITIFASSG+  
Sbjct  76    VTAISAQIAVVPLGHLMASTV-TKRVFLKGTKWEFTLNPGKFNVKEHVLITIFASSGAAS  134

Query  1669  SYAVSIITMMKAFYYRDIHPLAAVLLTFSTQMLGYGLAGIFKKFLIDSPYMWWPSNLVQV  1490
              YA+  +T +K FY ++I  L A+L+  +TQ+LG+G AG+F+++L++   MWWP NLVQV
Sbjct  135   VYAIHFVTAVKVFYRKEITVLVALLVVLTTQVLGFGWAGVFRRYLVEPAAMWWPQNLVQV  194

Query  1489  SLFRALHDVETRPKGGLTRLQFFIIVLVCSFAYYVVPNYLFPSLTALSLLCWIWKNSVTA  1310
             SLFRALH+ E R KG LTR QFF+I  VC FAYYV P YLFP LT+LS +CW++ NSV A
Sbjct  195   SLFRALHEKEERQKGELTRNQFFLITFVCGFAYYVFPGYLFPMLTSLSWICWVFPNSVIA  254

Query  1309  QQlgsglkglgigSFALDWATVAAFQGSPLVTPDFAIINMLIGYVLVAYIAIPVWYWTNL  1130
             QQLGSGL GLG+G+   DW+++ ++ GSPL +P FA  N+  G+ +  Y+ +P+ Y  NL
Sbjct  255   QQLGSGLHGLGVGAIGFDWSSICSYLGSPLASPWFATANIAAGFAIFMYVIVPITYCLNL  314

Query  1129  FDAKKFPLFSSNVFDSNGQVYNISRVLNKKTFGFDQPGYDSYSNIYLSTAFVYTYGLSFA  950
             + A++FP+FS  +F SNGQ YNIS +++   F  D   Y     +YLST F  +YG+ FA
Sbjct  315   YHARRFPIFSDGLFKSNGQEYNISAIIDSN-FHLDFEAYQREGPLYLSTMFAMSYGIGFA  373

Query  949   TLAATVSHVALFHGRTIWEQTKESVQDKFSDIHTRLMRKNYEPVPQWWFYlllviivgva  770
              L+AT+ HV LFHG  I E +K + Q K  DIHT++MRK+Y+ VP+WWF  +LV  +   
Sbjct  374   CLSATLVHVLLFHGSDILELSKSAFQGKKIDIHTKIMRKHYKQVPEWWFICILVFSITAT  433

Query  769   lvACQRFGGQLQLPVWGVLLAVLLSLIFTLPVGVITATTNQQTGLNVIAELIIGYMYPGR  590
                C+ +  QLQLP WGV+LA ++++ FTLPVG+I ATTNQ   LNVI E IIGY+YPG 
Sbjct  434   TFVCEYYNDQLQLPWWGVMLACVVAVSFTLPVGIIRATTNQAPALNVITEYIIGYIYPGY  493

Query  589   PLASVTFKMYGlsslsqslmflSDFKLGHYMKIPPKSMFMVQLVGTLISCCVHFGTGWWL  410
             P+A + FK+YG  S+ Q++ FL DFKLGHYMKIPP++MF+ Q++GT+I+  VH  T WWL
Sbjct  494   PVAVMLFKVYGNVSMKQAIYFLQDFKLGHYMKIPPRAMFLAQVLGTVIAGAVHLITAWWL  553

Query  409   LTTVENICNPSKLPEGSQWTCPGDDVFYNASIIWGVVSPRRMFGNLGIYQATNYFFLVGF  230
             L TV++IC+   LP GS WTCPGD VFY+AS+IWG++ PRR+FGNLG Y A N+FFLVG 
Sbjct  554   LDTVQDICHRELLPAGSPWTCPGDHVFYDASVIWGLIGPRRIFGNLGHYSAINWFFLVGA  613

Query  229   LAPIPVWYLGRKYPEKRWVSLINMPILISGAEGIPIVKSVNYVCWFAVGLYFNLYVYRKH  50
             +AP  VW   + +P K+W+ LI MP+L+     +P    VNY  W  VG       YR +
Sbjct  614   IAPFIVWLAHKAFPNKQWIRLITMPVLLGALSEMPPATPVNYTSWVLVGFASGFIAYRYY  673

Query  49    KGWWARHNYILSAGLD  2
             +GWW RHNY+LS  LD
Sbjct  674   RGWWTRHNYLLSGALD  689



>ref|XP_009591882.1| PREDICTED: oligopeptide transporter 7-like [Nicotiana tomentosiformis]
Length=756

 Score =   718 bits (1853),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 361/671 (54%), Positives = 485/671 (72%), Gaps = 3/671 (0%)
 Frame = -1

Query  2014  EINDSPVEEVRLTVPITDDPTMPCVTFRTWVLGVTSCVILAFLNQFFGYRQNALYVSSVP  1835
             E  +SP+E+V LTVPITD+P++P VTFR W+LG  +C++L+FLNQFF +R+  L +SS+ 
Sbjct  39    EEENSPIEQVALTVPITDEPSLPVVTFRMWILGTLACILLSFLNQFFWFRREPLSISSIS  98

Query  1834  AQIVVLPMGKLMAAYLPTKVVQIPGTKWSFSLNPGPFNIKEHVLITIFASSGSDFSYAVS  1655
             AQI V+P+G LMA  +P +V    G K+ F+LNPGPFN+KEHVLITIFA+SG+   YA+ 
Sbjct  99    AQIAVVPLGHLMAFLIPNRVF-FKGRKFEFTLNPGPFNVKEHVLITIFANSGAGNPYAIH  157

Query  1654  IITMMKAFYYRDIHPLAAVLLTFSTQMLGYGLAGIFKKFLIDSPYMWWPSNLVQVSLFRA  1475
             I++ +K FY R +    ++++  +TQ+LG+G AGIF+++L++   MWWP NLVQVSLFRA
Sbjct  158   IVSAVKVFYKRTLTFWVSLIVVLTTQVLGFGWAGIFRRYLVEPAAMWWPHNLVQVSLFRA  217

Query  1474  LHDVETRPKGGLTRLQFFIIVLVCSFAYYVVPNYLFPSLTALSLLCWIWKNSVTAQQlgs  1295
             LH+ E R K  +TR QFF+I  +CSFAYYV P YLFP L++LS LCW++  SV AQQLGS
Sbjct  218   LHEKEERAKNEMTRNQFFLIAFLCSFAYYVFPGYLFPMLSSLSWLCWLFPASVLAQQLGS  277

Query  1294  glkglgigSFALDWATVAAFQGSPLVTPDFAIINMLIGYVLVAYIAIPVWYWTNLFDAKK  1115
             GL GLGIG+  LDW++++++ GSPL +P FA  N+ +GY L+ Y+  P  YW N++ AK 
Sbjct  278   GLHGLGIGAIGLDWSSISSYLGSPLASPWFATANIAVGYFLIMYVVTPFMYWFNVYKAKT  337

Query  1114  FPLFSSNVFDSNGQVYNISRVLNKKTFGFDQPGYDSYSNIYLSTAFVYTYGLSFATLAAT  935
             FP+FS  +F S+GQ YNIS +++   F  D   YD    +YLST F  TY  SFA L+AT
Sbjct  338   FPIFSDGLFTSDGQKYNISAIIDPN-FHIDFNAYDREGRLYLSTFFSMTYAFSFACLSAT  396

Query  934   VSHVALFHGRTIWEQTKESVQDKFSDIHTRLMRKNYEPVPQWWFYlllviivgvalvACQ  755
             V HV LFHGR +W+ +K + Q+K  DIHT+LMRK Y+ VP+WWF  +L++ +   +  C+
Sbjct  397   VVHVFLFHGRDLWQMSKSAFQEKKMDIHTKLMRK-YKQVPEWWFLSILLVNIAATVFICE  455

Query  754   RFGGQLQLPVWGVLLAVLLSLIFTLPVGVITATTNQQTGLNVIAELIIGYMYPGRPLASV  575
              +  QLQLP WGVLLA  L+  FTLPVGVITATTNQ  GLNVI E IIGY+YPG P+A++
Sbjct  456   YYKTQLQLPWWGVLLACSLAFFFTLPVGVITATTNQTPGLNVITEYIIGYLYPGYPVANM  515

Query  574   TFKMYGlsslsqslmflSDFKLGHYMKIPPKSMFMVQLVGTLISCCVHFGTGWWLLTTVE  395
              FK+YG  S+ Q L FL D KLGHYMKIPP++MFM Q+VGTLIS  VH GT WWL+ TV 
Sbjct  516   CFKVYGYISMKQGLTFLQDLKLGHYMKIPPRAMFMAQVVGTLISALVHLGTAWWLMETVP  575

Query  394   NICNPSKLPEGSQWTCPGDDVFYNASIIWGVVSPRRMFGNLGIYQATNYFFLVGFLAPIP  215
             +IC+ + LP GS WTCPGD VFY+AS+IWG++ P+R+FGNLG Y A N+ FL G +AP+ 
Sbjct  576   DICDRALLPPGSPWTCPGDHVFYDASVIWGLIGPQRIFGNLGHYSALNWAFLFGAIAPVI  635

Query  214   VWYLGRKYPEKRWVSLINMPILISGAEGIPIVKSVNYVCWFAVGLYFNLYVYRKHKGWWA  35
             VW   + +P ++W+ LI +P+L++G   +P   SVNY  W  +       VYR ++  W+
Sbjct  636   VWIAHKSFPNQQWIRLITVPVLLAGIINMPPATSVNYNSWIIIAFISGFVVYRYYQKLWS  695

Query  34    RHNYILSAGLD  2
             RHNY+LS  LD
Sbjct  696   RHNYVLSGALD  706



>ref|XP_010553673.1| PREDICTED: oligopeptide transporter 2 [Tarenaya hassleriana]
Length=734

 Score =   717 bits (1851),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 360/682 (53%), Positives = 507/682 (74%), Gaps = 13/682 (2%)
 Frame = -1

Query  2032  VESSADEINDSPVEEVRLTVPITDDPTMPCVTFRTWVLGVTSCVILAFLNQFFGYRQNAL  1853
             ++    + ++SPVEEVRLTVP  DDP++P  TFR W LG+ SCV+L+FLN FFGYR   L
Sbjct  11    IDEEEGDNDESPVEEVRLTVPNHDDPSLPVWTFRMWFLGLFSCVLLSFLNTFFGYRTQPL  70

Query  1852  YVSSVPAQIVVLPMGKLMAAYLPTKVVQIPGTKWSFSLNPGPFNIKEHVLITIFASSGSD  1673
              +S +  Q+V LP+GK+MA  LP K  ++    + FSLNPGPFN+KEHVLI++FA++G+ 
Sbjct  71    MISMISIQVVTLPIGKMMARVLPDKKFRV--GSFEFSLNPGPFNVKEHVLISMFANAGAG  128

Query  1672  F----SYAVSIITMMKAFYYRDIHPLAAVLLTFSTQMLGYGLAGIFKKFLIDSPYMWWPS  1505
             +    +YAV I+ ++KAFY R+I  LA+ LL  +TQ+LGYG AGI ++ L++   MWWPS
Sbjct  129   YGSGTAYAVGIVDIIKAFYKRNISFLASWLLVITTQVLGYGWAGIMRRLLVEPAQMWWPS  188

Query  1504  NLVQVSLFRALHDVETRPKGGLTRLQFFIIVLVCSFAYYVVPNYLFPSLTALSLLCWIWK  1325
             +L+QVSLFRALH+ +T+    ++R +FF+I  +CSFA+Y+ P YLFP+L+A+S +CW++ 
Sbjct  189   SLLQVSLFRALHEKDTQ---RMSRGKFFLIAFLCSFAWYIFPGYLFPTLSAISWVCWVFP  245

Query  1324  NSVTAQQlgsglkglgigSFALDWATVAAFQGSPLVTPDFAIINMLIGYVLVAYIAIPVW  1145
              SVTAQQ+GSG+ GLG+G+FALDW+ +A++ GSPL++P FAI+N+++GYVLV Y+ IP+ 
Sbjct  246   KSVTAQQIGSGMSGLGLGAFALDWSVIASYLGSPLISPFFAIVNVIVGYVLVMYMFIPIA  305

Query  1144  YW-TNLFDAKKFPLFSSNVFDSNGQVYNISRVLNKKTFGFDQPGYDSYSNIYLSTAFVYT  968
             YW  N++DAKKFP+FSS++FDS GQ+YN S ++N + F  D P Y     +YLST F  T
Sbjct  306   YWGVNMYDAKKFPIFSSDLFDSKGQLYNTSAIVNDE-FELDIPSYGREGRVYLSTFFSLT  364

Query  967   YGLSFATLAATVSHVALFHGRTIWEQTKESVQDKFSDIHTRLMRKNYEPVPQWWFYlllv  788
             YG+ FA + +T++HVALF+G+ I +Q + S  DK  DIHTRLMRK Y+ +P WWF+ LL+
Sbjct  365   YGIGFAAIVSTLTHVALFNGKGILQQLRASASDKV-DIHTRLMRK-YKDIPSWWFHSLLI  422

Query  787   iivgvalvACQRFGGQLQLPVWGVLLAVLLSLIFTLPVGVITATTNQQTGLNVIAELIIG  608
               + ++LV C     Q+Q+P WG+LLA ++++ FT+PV +ITATTNQ  GLN+I E ++G
Sbjct  423   GSLALSLVLCIFMKDQVQMPWWGLLLASVMAITFTVPVSIITATTNQTPGLNIITEYLMG  482

Query  607   YMYPGRPLASVTFKMYGlsslsqslmflSDFKLGHYMKIPPKSMFMVQLVGTLISCCVHF  428
              + PGRP+A+V FK YG  S+SQ++ FL+DFKLGHYMKIPP+SMF+VQ +GT+I+  V+ 
Sbjct  483   VLLPGRPIANVCFKTYGYISMSQAITFLNDFKLGHYMKIPPRSMFLVQFIGTIIAGTVNV  542

Query  427   GTGWWLLTTVENICNPSKLPEGSQWTCPGDDVFYNASIIWGVVSPRRMFGNLGIYQATNY  248
                W+LLTTVENIC    LP  S WTCPGD VF++AS+IWG+V PRR+FGNLG Y   N+
Sbjct  543   SVAWYLLTTVENICQKELLPPNSPWTCPGDRVFFDASVIWGLVGPRRIFGNLGNYPELNW  602

Query  247   FFLVGFLAPIPVWYLGRKYPEKRWVSLINMPILISGAEGIPIVKSVNYVCWFAVGLYFNL  68
             FFL G L P+ VW L + +P ++W+S IN+P+L+     +P   SVN+ CW  +G+ FN 
Sbjct  603   FFLFGALGPLIVWILHKAFPNQKWISQINLPVLLGSTAAMPPATSVNFNCWIIIGVIFNY  662

Query  67    YVYRKHKGWWARHNYILSAGLD  2
             +V++  K WW R+NY+LSA LD
Sbjct  663   FVFKYRKSWWQRYNYVLSAALD  684



>gb|KHG27803.1| Oligopeptide transporter 7 -like protein [Gossypium arboreum]
Length=753

 Score =   717 bits (1852),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 355/678 (52%), Positives = 484/678 (71%), Gaps = 3/678 (0%)
 Frame = -1

Query  2035  AVESSADEINDSPVEEVRLTVPITDDPTMPCVTFRTWVLGVTSCVILAFLNQFFGYRQNA  1856
             +V SS D+    P+E+V LTVP  DDP++P +TFRTW+LG  +C++L+FLNQFF YR+  
Sbjct  29    SVPSSPDDPESCPIEQVALTVPTADDPSLPTLTFRTWILGTLACLLLSFLNQFFWYRREP  88

Query  1855  LYVSSVPAQIVVLPMGKLMAAYLPTKVVQIPGTKWSFSLNPGPFNIKEHVLITIFASSGS  1676
             L +SS+ AQI V+P+G L+AA +  +V       + F+LNPGPFN+KEHVL+TIF++SG+
Sbjct  89    LSISSISAQIAVVPLGHLLAATVTDRVF-FKDWNFEFTLNPGPFNVKEHVLVTIFSNSGA  147

Query  1675  DFSYAVSIITMMKAFYYRDIHPLAAVLLTFSTQMLGYGLAGIFKKFLIDSPYMWWPSNLV  1496
                YA+ ++T +K FY + +  L A+L+ F+TQ+LG+G AGIF+++L++   MWWP NLV
Sbjct  148   GNVYAIHLVTAVKIFYKKRMSFLVALLVVFTTQVLGFGWAGIFRRYLVEPAAMWWPQNLV  207

Query  1495  QVSLFRALHDVETRPKGGLTRLQFFIIVLVCSFAYYVVPNYLFPSLTALSLLCWIWKNSV  1316
             QVSLFRALH+ E R KG LTR QFF+I L CSFAYYV+P YLFP+LT+LS +CW++  S+
Sbjct  208   QVSLFRALHEKEERAKGRLTRNQFFLIALTCSFAYYVLPGYLFPTLTSLSWICWVFPTSI  267

Query  1315  TAQQlgsglkglgigSFALDWATVAAFQGSPLVTPDFAIINMLIGYVLVAYIAIPVWYWT  1136
              A QLGSGL GLGIG+   DW++++A+ GSPL +P FA +N+ +G+ L+ YI  P+ YW 
Sbjct  268   LAHQLGSGLHGLGIGAIGFDWSSISAYLGSPLASPWFATVNIAVGFALITYIITPIAYWL  327

Query  1135  NLFDAKKFPLFSSNVFDSNGQVYNISRVLNKKTFGFDQPGYDSYSNIYLSTAFVYTYGLS  956
             NLF+AK FP+FS  +F S GQ YNIS +++   F  D   Y+   ++YLS+ F  +YG+ 
Sbjct  328   NLFNAKHFPIFSDGLFTSTGQSYNISAIIDSN-FHIDMAAYERGGSLYLSSFFAMSYGVG  386

Query  955   FATLAATVSHVALFHGRTIWEQTKESVQDKFSDIHTRLMRKNYEPVPQWWFYlllviivg  776
             FA L ATV HV LFHG  I +++K + Q+   D+HT+LMRK Y+ VP+WWF  +L++ + 
Sbjct  387   FACLTATVVHVILFHGSEILQRSKSAFQETKMDVHTKLMRK-YKQVPEWWFTCILIVNIA  445

Query  775   valvACQRFGGQLQLPVWGVLLAVLLSLIFTLPVGVITATTNQQTGLNVIAELIIGYMYP  596
               +  CQ +  QLQLP WGVLLA  L++ FTLPVGVITATTNQ   LNVI E IIGY+YP
Sbjct  446   ATIFLCQYYNDQLQLPWWGVLLACGLAIFFTLPVGVITATTNQTPALNVITEYIIGYIYP  505

Query  595   GRPLASVTFKMYGlsslsqslmflSDFKLGHYMKIPPKSMFMVQLVGTLISCCVHFGTGW  416
             G P+A++ FK+YG  S+ Q + FL DFKLGHYMKIPP+SMF+ Q+ GT+I+   H  T W
Sbjct  506   GYPVANMCFKVYGYISMKQGITFLQDFKLGHYMKIPPRSMFIAQVGGTIIAALAHLATAW  565

Query  415   WLLTTVENICNPSKLPEGSQWTCPGDDVFYNASIIWGVVSPRRMFGNLGIYQATNYFFLV  236
             WL+ TV +IC+   LP  S WTCPGD VFY+AS+IWG++ PRR+FG+LG Y A N+FFLV
Sbjct  566   WLMDTVPDICDREMLPTDSPWTCPGDHVFYDASVIWGLIGPRRIFGDLGYYSAINWFFLV  625

Query  235   GFLAPIPVWYLGRKYPEKRWVSLINMPILISGAEGIPIVKSVNYVCWFAVGLYFNLYVYR  56
             G +AP+ VW   + +P K W+ LI MP+L      +P   +VNY  W  +        YR
Sbjct  626   GAIAPVLVWLASKAFPNKPWIKLITMPVLFGATVNMPPATAVNYTSWVLIAFASGFVAYR  685

Query  55    KHKGWWARHNYILSAGLD  2
              ++GWW+RHNY+LS  LD
Sbjct  686   YYRGWWSRHNYVLSGALD  703



>ref|XP_002967597.1| hypothetical protein SELMODRAFT_88962 [Selaginella moellendorffii]
 gb|EFJ30944.1| hypothetical protein SELMODRAFT_88962 [Selaginella moellendorffii]
Length=771

 Score =   718 bits (1854),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 356/668 (53%), Positives = 485/668 (73%), Gaps = 3/668 (0%)
 Frame = -1

Query  2005  DSPVEEVRLTVPITDDPTMPCVTFRTWVLGVTSCVILAFLNQFFGYRQNALYVSSVPAQI  1826
              SP+EEV LTV  +DDP++P  TFR W LGV SCV+LAF NQFF YR   L ++++ AQI
Sbjct  55    QSPIEEVALTVDTSDDPSLPVYTFRMWTLGVVSCVLLAFFNQFFAYRTEPLIITAISAQI  114

Query  1825  VVLPMGKLMAAYLPTKVVQIPGTKWSFSLNPGPFNIKEHVLITIFASSGSDFSYAVSIIT  1646
             V LP+GKLMAA LPT+   I G +  FSLNPG FN KEHVLITIFA++G+  +YAV I+T
Sbjct  115   VTLPLGKLMAATLPTRKFSIFGRE--FSLNPGAFNKKEHVLITIFANTGAGSAYAVGIVT  172

Query  1645  MMKAFYYRDIHPLAAVLLTFSTQMLGYGLAGIFKKFLIDSPYMWWPSNLVQVSLFRALHD  1466
             ++KAFY R +     +L+T +TQ++GYG AGIF+K+L+D   MWWPSNLVQVS+FR LH+
Sbjct  173   IVKAFYKRRMEFGVGLLITITTQIIGYGWAGIFRKYLVDPAEMWWPSNLVQVSIFRTLHE  232

Query  1465  VETRPKGGLTRLQFFIIVLVCSFAYYVVPNYLFPSLTALSLLCWIWKNSVTAQQlgsglk  1286
              + R KGGLTRLQFF+I L  SF YY  P+Y F SL++LS +C+ W  SVTAQQ+GSG  
Sbjct  233   KDVRRKGGLTRLQFFLIALTFSFCYYTFPDYWFISLSSLSWVCYAWPKSVTAQQIGSGFY  292

Query  1285  glgigSFALDWATVAAFQGSPLVTPDFAIINMLIGYVLVAYIAIPVWYWTNLFDAKKFPL  1106
             GLG+GS A DWA VA++ GSPL +P FA  N+++G+ L  Y+  P+ YW+NL+ AK+FP+
Sbjct  293   GLGLGSIAFDWAAVASYLGSPLASPWFATANVMVGFSLFMYVVTPLTYWSNLYGAKRFPI  352

Query  1105  FSSNVFDSNGQVYNISRVLNKKTFGFDQPGYDSYSNIYLSTAFVYTYGLSFATLAATVSH  926
             FSS ++  +G  YN +RV+   +   D   Y+SYS ++LS  FV+TYG SFA L AT++H
Sbjct  353   FSSGLYADDGSEYNFTRVIKDHSLQLDYDAYNSYSKLHLSNFFVFTYGASFAALTATLAH  412

Query  925   VALFHGRTIWEQTKESVQDKFSDIHTRLMRKNYEPVPQWWFYlllviivgvalvACQRFG  746
             VA+FHG+ I+  T  ++  +  D+HTRLM + Y+ VPQ+WF  ++   + +A+  C+ F 
Sbjct  413   VAIFHGKEIYSMTTSALTSRKVDVHTRLMMR-YKTVPQFWFLGMMFASMALAIFTCEYFN  471

Query  745   GQLQLPVWGVLLAVLLSLIFTLPVGVITATTNQQTGLNVIAELIIGYMYPGRPLASVTFK  566
               +QL  WG+L A  ++ IFT+P+ +I ATTNQ  GLNVI E +IGY+YP RP+A+V FK
Sbjct  472   STVQLRWWGLLFAFGIAFIFTMPIAIIAATTNQVPGLNVITEYLIGYVYPNRPVANVLFK  531

Query  565   MYGlsslsqslmflSDFKLGHYMKIPPKSMFMVQLVGTLISCCVHFGTGWWLLTTVENIC  386
              YG  S++Q++ FLSDFKLGHYMKIPP+SMF VQ++GT+I+  V+  T WWLL++++ IC
Sbjct  532   TYGYISMTQAVSFLSDFKLGHYMKIPPRSMFTVQVLGTVIAATVNLSTAWWLLSSIKGIC  591

Query  385   NPSKLPEGSQWTCPGDDVFYNASIIWGVVSPRRMFGNLGIYQATNYFFLVGFLAPIPVWY  206
             +PS+LP  S WTCP D VF++AS+IWG++ P RM+G+LG Y   N+FFLVG +AP+ VW 
Sbjct  592   HPSELPRNSPWTCPNDTVFFDASVIWGLIGPMRMWGSLGQYNQMNWFFLVGAVAPVFVWI  651

Query  205   LGRKYPEKRWVSLINMPILISGAEGIPIVKSVNYVCWFAVGLYFNLYVYRKHKGWWARHN  26
               + +P++RW+ L+NMPIL+     IP   +VNY  WF +G  FN  ++R  K WW RHN
Sbjct  652   AIKLFPKQRWLRLVNMPILLGATGAIPPATAVNYWSWFLMGFVFNYLIFRYRKAWWQRHN  711

Query  25    YILSAGLD  2
             Y+LSA LD
Sbjct  712   YVLSAALD  719



>gb|KGN48927.1| hypothetical protein Csa_6G506530 [Cucumis sativus]
Length=755

 Score =   717 bits (1851),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 351/670 (52%), Positives = 484/670 (72%), Gaps = 3/670 (0%)
 Frame = -1

Query  2011  INDSPVEEVRLTVPITDDPTMPCVTFRTWVLGVTSCVILAFLNQFFGYRQNALYVSSVPA  1832
             + +SPVE+V LTVP+TDD ++P  TFRTW+LG+ +C++L+FLNQFF YR+  L V+S+ A
Sbjct  38    VENSPVEQVALTVPVTDDTSLPTFTFRTWILGIIACMLLSFLNQFFYYRKEPLPVTSISA  97

Query  1831  QIVVLPMGKLMAAYLPTKVVQIPGTKWSFSLNPGPFNIKEHVLITIFASSGSDFSYAVSI  1652
             QI V+P+G  +A+ L  KV    G KW F+LNPGPFN KEHVLITIFA+SG+   YA+ +
Sbjct  98    QIAVVPIGHFLASALTNKVF-FEGKKWKFTLNPGPFNQKEHVLITIFANSGASTVYAIHV  156

Query  1651  ITMMKAFYYRDIHPLAAVLLTFSTQMLGYGLAGIFKKFLIDSPYMWWPSNLVQVSLFRAL  1472
             ++ +K FY +++    A+L+  +TQ+LG+G AGIF+++L++   MWWP NLVQVSLFRAL
Sbjct  157   VSAIKIFYKKELTFFLALLVVLTTQVLGFGWAGIFRRYLVEPAAMWWPQNLVQVSLFRAL  216

Query  1471  HDVETRPKGGLTRLQFFIIVLVCSFAYYVVPNYLFPSLTALSLLCWIWKNSVTAQQlgsg  1292
             H+ E RPKG L+R QFF++   CSF YY+ P YLFP LT++S LCW++  S+ AQQLGSG
Sbjct  217   HEKEERPKGKLSRNQFFVVAFTCSFGYYIFPGYLFPMLTSMSWLCWVFPTSIIAQQLGSG  276

Query  1291  lkglgigSFALDWATVAAFQGSPLVTPDFAIINMLIGYVLVAYIAIPVWYWTNLFDAKKF  1112
             L+GLGIG+F  DW+T++A+ GSPL +P FA +N+  G+ +V Y+  P+ YW +LF+AK F
Sbjct  277   LRGLGIGAFGFDWSTISAYLGSPLASPWFATVNVAAGFAIVTYLGTPLAYWLDLFNAKTF  336

Query  1111  PLFSSNVFDSNGQVYNISRVLNKKTFGFDQPGYDSYSNIYLSTAFVYTYGLSFATLAATV  932
             P+FS  +F S GQ YNIS +++   F  D   Y+    +  ST     YG++FA LAAT+
Sbjct  337   PIFSDGLFTSAGQNYNISAIIDPN-FRLDVDAYNREGPLRFSTFLALYYGVNFACLAATI  395

Query  931   SHVALFHGRTIWEQTKESVQDKFSDIHTRLMRKNYEPVPQWWFYlllviivgvalvACQR  752
              HV LFHGR IW  ++ ++Q+K  D+HT+LMRK Y+ VP+ WF  +LV+ + V +  C+ 
Sbjct  396   VHVLLFHGRDIWRLSRSALQEKLMDVHTKLMRK-YDQVPESWFMCILVVNISVTIFICEY  454

Query  751   FGGQLQLPVWGVLLAVLLSLIFTLPVGVITATTNQQTGLNVIAELIIGYMYPGRPLASVT  572
             +  QLQLP WGVL+A  L++ FTLPVGVITA TNQ   LNVI E IIGY+YPG P+A++ 
Sbjct  455   YNNQLQLPWWGVLIACGLAMFFTLPVGVITALTNQAPSLNVITEFIIGYLYPGYPVANMC  514

Query  571   FKMYGlsslsqslmflSDFKLGHYMKIPPKSMFMVQLVGTLISCCVHFGTGWWLLTTVEN  392
             FK+YG  S+ Q++ FL DFKLGHYMKIPP+ MF+ Q+VGT++S   H GT WWL+ T+ N
Sbjct  515   FKVYGYISMKQAITFLQDFKLGHYMKIPPREMFIAQVVGTVVSAVTHLGTAWWLMATIPN  574

Query  391   ICNPSKLPEGSQWTCPGDDVFYNASIIWGVVSPRRMFGNLGIYQATNYFFLVGFLAPIPV  212
             IC+ +KLP GS WTCPGD VFY+AS+IWG+V PRR+FG+ G Y + N+FFL G ++P+ V
Sbjct  575   ICDRAKLPAGSPWTCPGDHVFYDASVIWGLVGPRRIFGDQGQYGSLNWFFLAGAVSPLLV  634

Query  211   WYLGRKYPEKRWVSLINMPILISGAEGIPIVKSVNYVCWFAVGLYFNLYVYRKHKGWWAR  32
             W   + +P+K W+ LI MP+L+     +P   +VNY  W  +G       YR ++GWW+R
Sbjct  635   WLAHKAFPDKNWIKLITMPVLLGAVVNMPPATAVNYTSWIVIGFASGFVAYRHYRGWWSR  694

Query  31    HNYILSAGLD  2
             HNY+LS  LD
Sbjct  695   HNYLLSGALD  704



>ref|XP_007145948.1| hypothetical protein PHAVU_006G000100g [Phaseolus vulgaris]
 gb|ESW17942.1| hypothetical protein PHAVU_006G000100g [Phaseolus vulgaris]
Length=760

 Score =   717 bits (1852),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 358/669 (54%), Positives = 487/669 (73%), Gaps = 8/669 (1%)
 Frame = -1

Query  2005  DSPVEEVRLTVPITDDPTMPCVTFRTWVLGVTSCVILAFLNQFFGYRQNALYVSSVPAQI  1826
             +SP+++V +TV  TDDP++P +TFR WVLG  SCV+L+FLNQFF YR+  L ++++ AQI
Sbjct  48    NSPIKQVAMTVSTTDDPSLPVLTFRMWVLGSLSCVVLSFLNQFFWYRREPLAITAISAQI  107

Query  1825  VVLPMGKLMAAYLPTKVVQIPGTKWSFSLNPGPFNIKEHVLITIFASSGSDFSYAVSIIT  1646
              V+P+G+LMAA + TK V + GT+W F LNPGPFN+KEHVLITIFA+SG+   YA+ I+T
Sbjct  108   AVVPLGQLMAATM-TKRVFLRGTRWEFRLNPGPFNVKEHVLITIFANSGAGNVYAIHIVT  166

Query  1645  MMKAFYYRDIHPLAAVLLTFSTQMLGYGLAGIFKKFLIDSPYMWWPSNLVQVSLFRALHD  1466
              +K FY + I    ++L+  +TQ+LG+G AGIF+++L++   MWWP+NLVQVSLFRALH+
Sbjct  167   AVKIFYRQHISFFVSLLVVITTQVLGFGWAGIFRRYLVEPAAMWWPANLVQVSLFRALHE  226

Query  1465  VETRPKGGLTRLQFFIIVLVCSFAYYVVPNYLFPSLTALSLLCWIWKNSVTAQQlgsglk  1286
              + R KGGLTR QFF++  VCSFAYYV P Y+F  L +LS +CW++ N++ AQQLGSGL 
Sbjct  227   KDERAKGGLTRSQFFVMAFVCSFAYYVFPGYIFQMLVSLSWVCWLFPNNILAQQLGSGLY  286

Query  1285  glgigSFALDWATVAAFQGSPLVTPDFAIINMLIGYVLVAYIAIPVWYWTNLFDAKKFPL  1106
             GLGIG+  LDW+T++++ GSPL +P FA  N+ +G+VLV Y+  P+ YW N++ AK FP+
Sbjct  287   GLGIGAVGLDWSTISSYLGSPLASPWFATANIAVGFVLVIYVLTPLCYWFNVYRAKTFPI  346

Query  1105  FSSNVFDSNGQVYNISRVLNKKTFGFDQPGYDSYSNIYLSTAFVYTYGLSFATLAATVSH  926
             FS+ +F   GQ+YNI+ +++   F  D   Y     +YLST F  TYG+ FA L ATV H
Sbjct  347   FSNKLFTDQGQIYNITAIIDSN-FHLDLAAYQRQDRLYLSTFFAITYGVGFAALTATVMH  405

Query  925   VALFHGRTIWEQTKESVQDKFS-DIHTRLMRKNYEPVPQWWFYlllviivgvalvACQRF  749
             VALFHGR IWEQ+K S ++K S DIHT+LMR+ Y+ VP+WWF  +L+  +   +  C+ +
Sbjct  406   VALFHGREIWEQSKWSFKEKTSVDIHTKLMRR-YKQVPEWWFVCILLATIAATVFTCEYY  464

Query  748   GGQLQLPVWGVLLAVLLSLIFTLPVGVITATTNQQTGLNVIAELIIGYMYPGRPLASVTF  569
               QLQLP WGVLLA  +++ FTLP+G+ITA TNQ  GLNVI E IIGYMYPG P+A++ F
Sbjct  465   KAQLQLPWWGVLLACAIAIFFTLPIGIITAITNQSPGLNVITEYIIGYMYPGYPVANMCF  524

Query  568   KMYGlsslsqslmflSDFKLGHYMKIPPKSMFMVQLVGTLISCCVHFGTGWWLLTTVENI  389
             K+YG  S++Q++ FL DFKLGHYMKIPP++MFM Q+VGTLI+  V+  T WWL+ T+ +I
Sbjct  525   KVYGYISMTQAITFLQDFKLGHYMKIPPRTMFMAQVVGTLIASLVYLLTAWWLMETIPDI  584

Query  388   CNPSKLPEGSQWTCPGDDVFYNASIIWGVVSPRRMFGNLGIYQATNYFFLVGFLAPIPVW  209
             C  S     S WTCP D VFY+AS+IWG++ PRR+FG+LG Y+  N+FFL G +AP+ VW
Sbjct  585   CKDSS----SVWTCPSDTVFYDASVIWGLIGPRRIFGDLGTYENVNWFFLGGAIAPLLVW  640

Query  208   YLGRKYPEKRWVSLINMPILISGAEGIPIVKSVNYVCWFAVGLYFNLYVYRKHKGWWARH  29
              + R +P++ W+ LINMP+LI     +P   +VNY  W  VG      V+R    WW RH
Sbjct  641   LVARSFPQQEWIRLINMPVLIGATGMMPPATAVNYTSWIIVGFLSGFVVFRYKPEWWKRH  700

Query  28    NYILSAGLD  2
             NY+LS  LD
Sbjct  701   NYVLSGALD  709



>emb|CDP01884.1| unnamed protein product [Coffea canephora]
Length=762

 Score =   717 bits (1852),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 361/707 (51%), Positives = 499/707 (71%), Gaps = 11/707 (2%)
 Frame = -1

Query  2122  LRDTRERVSSFKNSSLSRLLH*MENTGISAVESSADEINDSPVEEVRLTVPITDDPTMPC  1943
             L  T +R   +K+ +          T   + E   DE  +SPVE+V LTVP+TDD T+P 
Sbjct  12    LLTTEKRAEPYKDHASG------SGTSSPSCEPFGDE--NSPVEQVALTVPVTDDRTLPV  63

Query  1942  VTFRTWVLGVTSCVILAFLNQFFGYRQNALYVSSVPAQIVVLPMGKLMAAYLPTKVVQIP  1763
             VTFR WVLG  +C++L+FLNQFF +R+  L +SS+ AQI V+P+G LMA+ L ++V    
Sbjct  64    VTFRMWVLGALACIVLSFLNQFFWFRREPLSISSISAQIAVVPLGHLMASALTSRVF-FK  122

Query  1762  GTKWSFSLNPGPFNIKEHVLITIFASSGSDFSYAVSIITMMKAFYYRDIHPLAAVLLTFS  1583
             G KW F+LNPGPFN+KEHVLITIFA+SG+   Y++ I++ +K FY + +    A+++  +
Sbjct  123   GQKWEFTLNPGPFNMKEHVLITIFANSGAANPYSIHIVSAVKVFYRQRLTFWVALVVVIT  182

Query  1582  TQMLGYGLAGIFKKFLIDSPYMWWPSNLVQVSLFRALHDVETRPKGGLTRLQFFIIVLVC  1403
             TQ+LG+G AGI +++L++   MWWP NLVQVSLFRAL + E R KG L+R QFF+I  +C
Sbjct  183   TQVLGFGWAGILRRYLVEPAEMWWPQNLVQVSLFRALDEKEQRIKGRLSRNQFFLIAFIC  242

Query  1402  SFAYYVVPNYLFPSLTALSLLCWIWKNSVTAQQlgsglkglgigSFALDWATVAAFQGSP  1223
             SFAYYV+P YLFP LT+LS +CWI+ NSV AQQLGSGL GLGIG+  LDW++++++ GSP
Sbjct  243   SFAYYVLPGYLFPMLTSLSWICWIFPNSVLAQQLGSGLHGLGIGAIGLDWSSISSYIGSP  302

Query  1222  LVTPDFAIINMLIGYVLVAYIAIPVWYWTNLFDAKKFPLFSSNVFDSNGQVYNISRVLNK  1043
             L +P FA  N+ +GY L+ Y+  P+ YW N++ AK FP++S  +F S GQ YNIS +++ 
Sbjct  303   LASPWFATANLAVGYFLMMYVITPIAYWFNIYKAKTFPIYSDGLFTSKGQNYNISAIIDS  362

Query  1042  KTFGFDQPGYDSYSNIYLSTAFVYTYGLSFATLAATVSHVALFHGRTIWEQTKESVQDKF  863
               F  D   Y++   +Y+ST F  TYG SFA L ATV HV LFHGR +W  +K + Q+K 
Sbjct  363   N-FHIDLTAYENEGRLYISTFFAITYGFSFACLTATVVHVFLFHGRDLWRLSKSAFQEKK  421

Query  862   SDIHTRLMRKNYEPVPQWWFYlllviivgvalvACQRFGGQLQLPVWGVLLAVLLSLIFT  683
              D+HT+LMR  Y+ VP+WWF  +L++ +   +  C+ +  QLQLP W VLLA  L+  FT
Sbjct  422   LDVHTKLMRM-YKQVPEWWFTCILLVNIAATIFICEYYNDQLQLPWWAVLLACGLAFFFT  480

Query  682   LPVGVITATTNQQTGLNVIAELIIGYMYPGRPLASVTFKMYGlsslsqslmflSDFKLGH  503
             LP+GVITATTNQ  GLNVI E IIGY+YPG P+A+++FK+YG  S+ Q+L FL DFKLGH
Sbjct  481   LPIGVITATTNQTPGLNVITEYIIGYLYPGYPVANMSFKVYGYISMKQALAFLQDFKLGH  540

Query  502   YMKIPPKSMFMVQLVGTLISCCVHFGTGWWLLTTVENICNPSKLPEGSQWTCPGDDVFYN  323
             YMKIPP+ MFM Q+ GTL+S  VH GT WWLL TV +IC+ + LP GS WTCPGD VFY+
Sbjct  541   YMKIPPRDMFMAQVAGTLVSALVHLGTAWWLLETVPDICDRAMLPPGSPWTCPGDHVFYD  600

Query  322   ASIIWGVVSPRRMFGNLGIYQATNYFFLVGFLAPIPVWYLGRKYPEKRWVSLINMPILIS  143
             AS+IWG++ P+R+FG+LG Y A N+ F++G +AP  VW + + +P ++W+ LI++P++++
Sbjct  601   ASVIWGLIGPQRIFGDLGYYSAINWAFVLGAVAPAVVWLMHKAFPNQQWIGLISVPVVLA  660

Query  142   GAEGIPIVKSVNYVCWFAVGLYFNLYVYRKHKGWWARHNYILSAGLD  2
             G   +P   +VNY  W  +        YR ++ WW+RHNY+LS  LD
Sbjct  661   GIMNMPPATAVNYNSWVIIAFLSGFIAYRYYRSWWSRHNYVLSGALD  707



>emb|CDP12213.1| unnamed protein product [Coffea canephora]
Length=763

 Score =   717 bits (1851),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 361/668 (54%), Positives = 484/668 (72%), Gaps = 5/668 (1%)
 Frame = -1

Query  2005  DSPVEEVRLTVPITDDPTMPCVTFRTWVLGVTSCVILAFLNQFFGYRQNALYVSSVPAQI  1826
             +SP+ +V LTVP TDDP++P +TFR WVLG  SC++L+FLNQFF YR   L ++++ AQ+
Sbjct  50    NSPIPQVALTVPTTDDPSLPVLTFRMWVLGTLSCILLSFLNQFFWYRTEPLTITAISAQV  109

Query  1825  VVLPMGKLMAAYLPTKVVQIPGTKWSFSLNPGPFNIKEHVLITIFASSGSDFSYAVSIIT  1646
              V+P+G+LMAA LP K     G++W FSLNPGPFN+KEHVLITIFA+SG+   YA+ I+T
Sbjct  110   AVVPLGQLMAAKLP-KGAFFKGSRWEFSLNPGPFNVKEHVLITIFANSGAGTVYAIHIVT  168

Query  1645  MMKAFYYRDIHPLAAVLLTFSTQMLGYGLAGIFKKFLIDSPYMWWPSNLVQVSLFRALHD  1466
             ++KAFY R I    ++++  +TQ+LG+G AGIF+++L++   MWWP+NLVQVSLFRALH+
Sbjct  169   VVKAFYKRHITFFVSLIVVLTTQVLGFGWAGIFRRYLVEPAAMWWPANLVQVSLFRALHE  228

Query  1465  VETRPKGGLTRLQFFIIVLVCSFAYYVVPNYLFPSLTALSLLCWIWKNSVTAQQlgsglk  1286
              E RPKGG+TR QFF+I  + SFAYYV P YLF  LT+LS LCWI+  S+ AQQLGSGL 
Sbjct  229   KEERPKGGVTRTQFFLIAFISSFAYYVFPGYLFQMLTSLSWLCWIFPTSILAQQLGSGLN  288

Query  1285  glgigSFALDWATVAAFQGSPLVTPDFAIINMLIGYVLVAYIAIPVWYWTNLFDAKKFPL  1106
             GLGIG+  LDW+T++++ GSPL +P FA  N+  G+VLV Y+  P+ YW +L+ AK FP+
Sbjct  289   GLGIGAIGLDWSTISSYLGSPLASPWFATANVAAGFVLVMYVLTPLAYWLDLYKAKTFPI  348

Query  1105  FSSNVFDSNGQVYNISRVLNKKTFGFDQPGYDSYSNIYLSTAFVYTYGLSFATLAATVSH  926
             FS  +F++ GQVY+I+ +++   F  D   Y+    +YLST F  TYG+ FA L AT++H
Sbjct  349   FSDELFNARGQVYDIAAIIDSN-FHLDIAAYERQGPLYLSTFFAMTYGIGFAALTATITH  407

Query  925   VALFHGRTIWEQTKESVQDKFSDIHTRLMRKNYEPVPQWWFYlllviivgvalvACQRFG  746
             V LFHG  IWEQ+K S ++K  DIHTRLM K Y  VP+WWF+ +LV  + +A+  C+ + 
Sbjct  408   VCLFHGSEIWEQSKSSFKEKKMDIHTRLMSK-YNQVPEWWFWCILVANIALAIFVCEYYN  466

Query  745   GQLQLPVWGVLLAVLLSLIFTLPVGVITATTNQQTGLNVIAELIIGYMYPGRPLASVTFK  566
              QLQLP WGVLLA L+++ FTLP+G+ITA TNQ  GLN+I E IIGY+YPG P+A++ FK
Sbjct  467   EQLQLPWWGVLLACLIAIFFTLPIGIITAITNQSPGLNIITEYIIGYIYPGYPVANMCFK  526

Query  565   MYGlsslsqslmflSDFKLGHYMKIPPKSMFMVQLVGTLISCCVHFGTGWWLLTTVENIC  386
             +YG  S+SQ++ FL DFKLGHYMK+PP++MFM Q+VGTLI+  V+ GT WWLL T+ +IC
Sbjct  527   VYGYISMSQAITFLQDFKLGHYMKVPPRTMFMAQVVGTLIAAIVYLGTAWWLLETIPDIC  586

Query  385   NPSKLPEGSQWTCPGDDVFYNASIIWGVVSPRRMFGNLGIYQATNYFFLVGFLAPIPVWY  206
               +     S WTCPGD VFY+AS+IWG++ PRR+FG+LG Y   N+FFL G +AP+ VW 
Sbjct  587   ETTS--SQSVWTCPGDRVFYDASVIWGLIGPRRIFGDLGTYAMVNWFFLGGAIAPLLVWL  644

Query  205   LGRKYPEKRWVSLINMPILISGAEGIPIVKSVNYVCWFAVGLYFNLYVYRKHKGWWARHN  26
               R +P + W+ LINMP+LI     +P   +VNY  W  VG       YR     W R N
Sbjct  645   AARAFPNQHWIKLINMPVLIGATGSMPPATAVNYTTWIIVGFLSGYVWYRYRPESWRRFN  704

Query  25    YILSAGLD  2
             Y+LS  LD
Sbjct  705   YVLSGALD  712



>ref|XP_008440830.1| PREDICTED: oligopeptide transporter 7-like [Cucumis melo]
 ref|XP_008440831.1| PREDICTED: oligopeptide transporter 7-like [Cucumis melo]
Length=755

 Score =   717 bits (1850),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 353/670 (53%), Positives = 481/670 (72%), Gaps = 3/670 (0%)
 Frame = -1

Query  2011  INDSPVEEVRLTVPITDDPTMPCVTFRTWVLGVTSCVILAFLNQFFGYRQNALYVSSVPA  1832
             + +SPVE+V LTVP+TDD ++P  TFRTW+LG+ +C +L+FLNQFF YR+  L V+S+ A
Sbjct  38    VENSPVEQVALTVPVTDDTSLPTFTFRTWILGIIACALLSFLNQFFYYRKEPLSVTSISA  97

Query  1831  QIVVLPMGKLMAAYLPTKVVQIPGTKWSFSLNPGPFNIKEHVLITIFASSGSDFSYAVSI  1652
             QI V+P+G L+A+ L  +V    G KW F+LNPGPFN KEHVLITIFA+SG+   YA+ +
Sbjct  98    QIAVVPIGHLLASALTNRVF-FEGKKWKFTLNPGPFNQKEHVLITIFANSGASTVYAIHV  156

Query  1651  ITMMKAFYYRDIHPLAAVLLTFSTQMLGYGLAGIFKKFLIDSPYMWWPSNLVQVSLFRAL  1472
             ++ +K FY +++    A+L+  +TQ+LG+G AGIF+++L++   MWWP NLVQVSLFRAL
Sbjct  157   VSAIKIFYKKELTFFLALLVVLTTQVLGFGWAGIFRRYLVEPAAMWWPQNLVQVSLFRAL  216

Query  1471  HDVETRPKGGLTRLQFFIIVLVCSFAYYVVPNYLFPSLTALSLLCWIWKNSVTAQQlgsg  1292
             H+ E RPKG L+R QFF+I   CS AYYV P YLFP LT++S LCW++  S+ AQQLGSG
Sbjct  217   HEKEERPKGKLSRNQFFVIAFTCSLAYYVFPGYLFPMLTSMSWLCWVFPTSIIAQQLGSG  276

Query  1291  lkglgigSFALDWATVAAFQGSPLVTPDFAIINMLIGYVLVAYIAIPVWYWTNLFDAKKF  1112
             L+GLGIG+F  DW+T++A+ GSPL +P FA  N+  G+ +V Y+  P+ YW +LF+AK F
Sbjct  277   LRGLGIGAFGFDWSTISAYLGSPLASPWFATANIAAGFAIVTYLVTPLAYWLDLFNAKTF  336

Query  1111  PLFSSNVFDSNGQVYNISRVLNKKTFGFDQPGYDSYSNIYLSTAFVYTYGLSFATLAATV  932
             P+FS  +F S GQ YNIS +++   F  D   Y+    +  ST F   YG++FA LAATV
Sbjct  337   PIFSDGLFTSAGQNYNISAIIDPH-FRLDVDAYNREGPLRFSTFFALYYGVNFACLAATV  395

Query  931   SHVALFHGRTIWEQTKESVQDKFSDIHTRLMRKNYEPVPQWWFYlllviivgvalvACQR  752
              HV LFHGR IW  ++ ++Q+K  D+HT+LMRK Y+ VP+ WF  +LV+ +   +  C+ 
Sbjct  396   VHVLLFHGREIWRLSRSALQEKLMDVHTKLMRK-YDQVPESWFMCILVVNISATIFICEY  454

Query  751   FGGQLQLPVWGVLLAVLLSLIFTLPVGVITATTNQQTGLNVIAELIIGYMYPGRPLASVT  572
             +  QLQLP WGVLLA  L++ FTLPVGVI A TNQ   LNVI E IIGY+YPG P+A++ 
Sbjct  455   YNNQLQLPWWGVLLACGLAVFFTLPVGVIAALTNQAPSLNVITEFIIGYLYPGYPVANMC  514

Query  571   FKMYGlsslsqslmflSDFKLGHYMKIPPKSMFMVQLVGTLISCCVHFGTGWWLLTTVEN  392
             FK+YG  S+ Q++ FL DFKLGHYMKIPP+ MF+ Q+VGT++S   H GT WWL+ T+ N
Sbjct  515   FKVYGYISMKQAITFLQDFKLGHYMKIPPREMFIAQVVGTVVSAVTHLGTAWWLMATIPN  574

Query  391   ICNPSKLPEGSQWTCPGDDVFYNASIIWGVVSPRRMFGNLGIYQATNYFFLVGFLAPIPV  212
             IC+ + LP GS WTCPGD VFY+AS+IWG+V PRR+FG+ G Y + N+FFL G ++P+ V
Sbjct  575   ICDRATLPAGSPWTCPGDHVFYDASVIWGLVGPRRIFGDQGKYGSLNWFFLAGAVSPLLV  634

Query  211   WYLGRKYPEKRWVSLINMPILISGAEGIPIVKSVNYVCWFAVGLYFNLYVYRKHKGWWAR  32
             W   + +P+K W+ LI MP+L+     +P   +VNY  W  +G       YR ++GWW+R
Sbjct  635   WLAHKAFPDKNWIKLITMPVLLGAVVNMPPATAVNYTSWIVIGFASGFVAYRHYRGWWSR  694

Query  31    HNYILSAGLD  2
             HNY+LS  LD
Sbjct  695   HNYLLSGALD  704



>ref|XP_002981747.1| hypothetical protein SELMODRAFT_179057 [Selaginella moellendorffii]
 gb|EFJ17229.1| hypothetical protein SELMODRAFT_179057 [Selaginella moellendorffii]
Length=771

 Score =   717 bits (1852),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 355/668 (53%), Positives = 485/668 (73%), Gaps = 3/668 (0%)
 Frame = -1

Query  2005  DSPVEEVRLTVPITDDPTMPCVTFRTWVLGVTSCVILAFLNQFFGYRQNALYVSSVPAQI  1826
              SP+EEV LTV  +DDP++P  TFR W LGV SCV+LAF NQFF YR   L ++++ AQI
Sbjct  55    QSPIEEVALTVDTSDDPSLPVYTFRMWTLGVVSCVLLAFFNQFFAYRTEPLIITAISAQI  114

Query  1825  VVLPMGKLMAAYLPTKVVQIPGTKWSFSLNPGPFNIKEHVLITIFASSGSDFSYAVSIIT  1646
             V LP+GKLMAA LPT+   I G +  FSLNPG FN KEHVLITIFA++G+  +YAV I+T
Sbjct  115   VTLPLGKLMAATLPTRKFSIFGRE--FSLNPGAFNKKEHVLITIFANTGAGSAYAVGIVT  172

Query  1645  MMKAFYYRDIHPLAAVLLTFSTQMLGYGLAGIFKKFLIDSPYMWWPSNLVQVSLFRALHD  1466
             ++KAFY R +     +L+T +TQ++GYG AGIF+K+L+D   MWWPSNLVQVS+FR LH+
Sbjct  173   IVKAFYKRRMDFGVGLLITITTQIIGYGWAGIFRKYLVDPAEMWWPSNLVQVSIFRTLHE  232

Query  1465  VETRPKGGLTRLQFFIIVLVCSFAYYVVPNYLFPSLTALSLLCWIWKNSVTAQQlgsglk  1286
              + R KGGLTRLQFF+I L  SF YY  P+Y F SL++LS +C+ W  SVTAQQ+GSG  
Sbjct  233   KDVRRKGGLTRLQFFLIALTFSFCYYTFPDYWFISLSSLSWVCYAWPKSVTAQQIGSGFY  292

Query  1285  glgigSFALDWATVAAFQGSPLVTPDFAIINMLIGYVLVAYIAIPVWYWTNLFDAKKFPL  1106
             GLG+GS A DWA +A++ GSPL +P FA  N+++G+ L  Y+  P+ YW+NL+ AK+FP+
Sbjct  293   GLGLGSIAFDWAAIASYLGSPLASPWFATANVMVGFSLFMYVVTPLTYWSNLYGAKRFPI  352

Query  1105  FSSNVFDSNGQVYNISRVLNKKTFGFDQPGYDSYSNIYLSTAFVYTYGLSFATLAATVSH  926
             FSS ++  +G  YN +RV+   +   D   Y+SYS ++LS  FV+TYG SFA L AT++H
Sbjct  353   FSSGLYADDGSEYNFTRVIKDHSLQLDYDAYNSYSKLHLSNFFVFTYGASFAALTATLAH  412

Query  925   VALFHGRTIWEQTKESVQDKFSDIHTRLMRKNYEPVPQWWFYlllviivgvalvACQRFG  746
             VA+FHG+ I+  T  ++  +  D+HTRLM + Y+ VPQ+WF  ++   + +A+  C+ F 
Sbjct  413   VAIFHGKEIYSMTTSALTSRKVDVHTRLMMR-YKTVPQFWFLGMMFASMALAIFTCEYFN  471

Query  745   GQLQLPVWGVLLAVLLSLIFTLPVGVITATTNQQTGLNVIAELIIGYMYPGRPLASVTFK  566
               +QL  WG+L A  ++ IFT+P+ +I ATTNQ  GLNVI E +IGY+YP RP+A+V FK
Sbjct  472   STVQLRWWGLLFAFGIAFIFTMPIAIIAATTNQVPGLNVITEYLIGYVYPNRPVANVLFK  531

Query  565   MYGlsslsqslmflSDFKLGHYMKIPPKSMFMVQLVGTLISCCVHFGTGWWLLTTVENIC  386
              YG  S++Q++ FLSDFKLGHYMKIPP+SMF VQ++GT+I+  V+  T WWLL++++ IC
Sbjct  532   TYGYISMTQAVSFLSDFKLGHYMKIPPRSMFTVQVLGTVIAATVNLSTAWWLLSSIKGIC  591

Query  385   NPSKLPEGSQWTCPGDDVFYNASIIWGVVSPRRMFGNLGIYQATNYFFLVGFLAPIPVWY  206
             +PS+LP  S WTCP D VF++AS+IWG++ P RM+G+LG Y   N+FFLVG +AP+ VW 
Sbjct  592   HPSELPRNSPWTCPNDTVFFDASVIWGLIGPMRMWGSLGQYNQMNWFFLVGAVAPVFVWI  651

Query  205   LGRKYPEKRWVSLINMPILISGAEGIPIVKSVNYVCWFAVGLYFNLYVYRKHKGWWARHN  26
               + +P++RW+ L+NMPIL+     IP   +VNY  WF +G  FN  ++R  K WW RHN
Sbjct  652   AIKLFPKQRWLRLVNMPILLGATGAIPPATAVNYWSWFLMGFVFNYLIFRYKKAWWQRHN  711

Query  25    YILSAGLD  2
             Y+LSA LD
Sbjct  712   YVLSAALD  719



>ref|XP_011078837.1| PREDICTED: oligopeptide transporter 7-like isoform X2 [Sesamum 
indicum]
Length=744

 Score =   716 bits (1848),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 360/679 (53%), Positives = 490/679 (72%), Gaps = 3/679 (0%)
 Frame = -1

Query  2038  SAVESSADEINDSPVEEVRLTVPITDDPTMPCVTFRTWVLGVTSCVILAFLNQFFGYRQN  1859
             ++  S+++E  +SPVE+V LTVP TDDPT+P VTFR W LG  +CV+L+FLNQFF YR+ 
Sbjct  19    ASAASTSEEEENSPVEQVALTVPPTDDPTLPVVTFRMWTLGAAACVMLSFLNQFFWYRRE  78

Query  1858  ALYVSSVPAQIVVLPMGKLMAAYLPTKVVQIPGTKWSFSLNPGPFNIKEHVLITIFASSG  1679
              L ++++ AQI V+P+G LMAA LP +V    G KW FS NPG FN+KEHVLITIFA++G
Sbjct  79    PLSITAISAQIAVVPLGHLMAAALPRRVF-FEGQKWEFSFNPGKFNVKEHVLITIFANAG  137

Query  1678  SDFSYAVSIITMMKAFYYRDIHPLAAVLLTFSTQMLGYGLAGIFKKFLIDSPYMWWPSNL  1499
             +   Y++ I++ +K FY + +    A+ +  +TQ+LG+G AG+F+++L++   MWWP NL
Sbjct  138   AANPYSIHIVSAVKIFYGQKLTFWVALGVVLTTQVLGFGWAGLFRRYLVEPASMWWPQNL  197

Query  1498  VQVSLFRALHDVETRPKGGLTRLQFFIIVLVCSFAYYVVPNYLFPSLTALSLLCWIWKNS  1319
             VQVSLFRALH+ E R +G LTR QFF+I  +CSFAYYV P YLFP LT++S LCWI+ +S
Sbjct  198   VQVSLFRALHEKEVRDRGALTRNQFFLIAFLCSFAYYVFPGYLFPKLTSVSWLCWIFSSS  257

Query  1318  VTAQQlgsglkglgigSFALDWATVAAFQGSPLVTPDFAIINMLIGYVLVAYIAIPVWYW  1139
             V  QQLGSGL GLGIG+  LDW++++++ GSPL +P FA  N+ +GY +  Y   P+ YW
Sbjct  258   VLFQQLGSGLHGLGIGAIGLDWSSISSYLGSPLASPWFATANIAVGYFICMYAVTPIMYW  317

Query  1138  TNLFDAKKFPLFSSNVFDSNGQVYNISRVLNKKTFGFDQPGYDSYSNIYLSTAFVYTYGL  959
              N+++AK FP+FS  ++ S GQ YNIS +++   F  D   Y+    +YLST F  TY  
Sbjct  318   LNVYNAKTFPIFSDGLYTSEGQKYNISAIVDPN-FHIDLQSYEREGRLYLSTFFAMTYAF  376

Query  958   SFATLAATVSHVALFHGRTIWEQTKESVQDKFSDIHTRLMRKNYEPVPQWWFYlllviiv  779
             SFA L AT++HV LFHGR +W  +K + ++K  DIHT+LM +NY+ VP+WWF  +L+I +
Sbjct  377   SFACLTATIAHVLLFHGRDLWLLSKSAFKEKKMDIHTKLM-QNYKQVPEWWFMCILLINI  435

Query  778   gvalvACQRFGGQLQLPVWGVLLAVLLSLIFTLPVGVITATTNQQTGLNVIAELIIGYMY  599
                L+ CQ +  QLQLP WGVLLA +L+  FTLPVGVITATTNQ  GLNVI E +IGY+Y
Sbjct  436   AGTLLICQIYYNQLQLPWWGVLLACVLAFCFTLPVGVITATTNQTPGLNVITEYMIGYLY  495

Query  598   PGRPLASVTFKMYGlsslsqslmflSDFKLGHYMKIPPKSMFMVQLVGTLISCCVHFGTG  419
             PG P+A++ FK+YG  S+ Q+L+FL D KLGHYMKIPP++MFM Q+VGTLIS  VH GT 
Sbjct  496   PGYPVANMCFKVYGYISMKQALIFLQDLKLGHYMKIPPRAMFMAQVVGTLISSLVHLGTA  555

Query  418   WWLLTTVENICNPSKLPEGSQWTCPGDDVFYNASIIWGVVSPRRMFGNLGIYQATNYFFL  239
             WWL+ TV NIC+ + LP GS WTCPGD VFY+AS+IWG++ P R+FG+LG Y A N+ FL
Sbjct  556   WWLMDTVPNICDRTALPPGSPWTCPGDHVFYDASVIWGLIGPERIFGDLGYYSAINWSFL  615

Query  238   VGFLAPIPVWYLGRKYPEKRWVSLINMPILISGAEGIPIVKSVNYVCWFAVGLYFNLYVY  59
             VG +AP+ VW   + +P ++W+ LI++P+L+     +P   SVNY  W  +G       Y
Sbjct  616   VGAIAPLLVWLAHKAFPNQQWIRLISVPVLLVSIINMPPATSVNYNSWIIIGFLSGYVAY  675

Query  58    RKHKGWWARHNYILSAGLD  2
             R ++ WW++HNY+LS  LD
Sbjct  676   RYYRDWWSKHNYVLSGALD  694



>ref|XP_004135024.1| PREDICTED: oligopeptide transporter 7-like [Cucumis sativus]
Length=851

 Score =   720 bits (1858),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 351/670 (52%), Positives = 484/670 (72%), Gaps = 3/670 (0%)
 Frame = -1

Query  2011  INDSPVEEVRLTVPITDDPTMPCVTFRTWVLGVTSCVILAFLNQFFGYRQNALYVSSVPA  1832
             + +SPVE+V LTVP+TDD ++P  TFRTW+LG+ +C++L+FLNQFF YR+  L V+S+ A
Sbjct  134   VENSPVEQVALTVPVTDDTSLPTFTFRTWILGIIACMLLSFLNQFFYYRKEPLPVTSISA  193

Query  1831  QIVVLPMGKLMAAYLPTKVVQIPGTKWSFSLNPGPFNIKEHVLITIFASSGSDFSYAVSI  1652
             QI V+P+G  +A+ L  KV    G KW F+LNPGPFN KEHVLITIFA+SG+   YA+ +
Sbjct  194   QIAVVPIGHFLASALTNKVF-FEGKKWKFTLNPGPFNQKEHVLITIFANSGASTVYAIHV  252

Query  1651  ITMMKAFYYRDIHPLAAVLLTFSTQMLGYGLAGIFKKFLIDSPYMWWPSNLVQVSLFRAL  1472
             ++ +K FY +++    A+L+  +TQ+LG+G AGIF+++L++   MWWP NLVQVSLFRAL
Sbjct  253   VSAIKIFYKKELTFFLALLVVLTTQVLGFGWAGIFRRYLVEPAAMWWPQNLVQVSLFRAL  312

Query  1471  HDVETRPKGGLTRLQFFIIVLVCSFAYYVVPNYLFPSLTALSLLCWIWKNSVTAQQlgsg  1292
             H+ E RPKG L+R QFF++   CSF YY+ P YLFP LT++S LCW++  S+ AQQLGSG
Sbjct  313   HEKEERPKGKLSRNQFFVVAFTCSFGYYIFPGYLFPMLTSMSWLCWVFPTSIIAQQLGSG  372

Query  1291  lkglgigSFALDWATVAAFQGSPLVTPDFAIINMLIGYVLVAYIAIPVWYWTNLFDAKKF  1112
             L+GLGIG+F  DW+T++A+ GSPL +P FA +N+  G+ +V Y+  P+ YW +LF+AK F
Sbjct  373   LRGLGIGAFGFDWSTISAYLGSPLASPWFATVNVAAGFAIVTYLGTPLAYWLDLFNAKTF  432

Query  1111  PLFSSNVFDSNGQVYNISRVLNKKTFGFDQPGYDSYSNIYLSTAFVYTYGLSFATLAATV  932
             P+FS  +F S GQ YNIS +++   F  D   Y+    +  ST     YG++FA LAAT+
Sbjct  433   PIFSDGLFTSAGQNYNISAIIDPN-FRLDVDAYNREGPLRFSTFLALYYGVNFACLAATI  491

Query  931   SHVALFHGRTIWEQTKESVQDKFSDIHTRLMRKNYEPVPQWWFYlllviivgvalvACQR  752
              HV LFHGR IW  ++ ++Q+K  D+HT+LMRK Y+ VP+ WF  +LV+ + V +  C+ 
Sbjct  492   VHVLLFHGRDIWRLSRSALQEKLMDVHTKLMRK-YDQVPESWFMCILVVNISVTIFICEY  550

Query  751   FGGQLQLPVWGVLLAVLLSLIFTLPVGVITATTNQQTGLNVIAELIIGYMYPGRPLASVT  572
             +  QLQLP WGVL+A  L++ FTLPVGVITA TNQ   LNVI E IIGY+YPG P+A++ 
Sbjct  551   YNNQLQLPWWGVLIACGLAMFFTLPVGVITALTNQAPSLNVITEFIIGYLYPGYPVANMC  610

Query  571   FKMYGlsslsqslmflSDFKLGHYMKIPPKSMFMVQLVGTLISCCVHFGTGWWLLTTVEN  392
             FK+YG  S+ Q++ FL DFKLGHYMKIPP+ MF+ Q+VGT++S   H GT WWL+ T+ N
Sbjct  611   FKVYGYISMKQAITFLQDFKLGHYMKIPPREMFIAQVVGTVVSAVTHLGTAWWLMATIPN  670

Query  391   ICNPSKLPEGSQWTCPGDDVFYNASIIWGVVSPRRMFGNLGIYQATNYFFLVGFLAPIPV  212
             IC+ +KLP GS WTCPGD VFY+AS+IWG+V PRR+FG+ G Y + N+FFL G ++P+ V
Sbjct  671   ICDRAKLPAGSPWTCPGDHVFYDASVIWGLVGPRRIFGDQGQYGSLNWFFLAGAVSPLLV  730

Query  211   WYLGRKYPEKRWVSLINMPILISGAEGIPIVKSVNYVCWFAVGLYFNLYVYRKHKGWWAR  32
             W   + +P+K W+ LI MP+L+     +P   +VNY  W  +G       YR ++GWW+R
Sbjct  731   WLAHKAFPDKNWIKLITMPVLLGAVVNMPPATAVNYTSWIVIGFASGFVAYRHYRGWWSR  790

Query  31    HNYILSAGLD  2
             HNY+LS  LD
Sbjct  791   HNYLLSGALD  800



>ref|XP_007156166.1| hypothetical protein PHAVU_003G263700g [Phaseolus vulgaris]
 gb|ESW28160.1| hypothetical protein PHAVU_003G263700g [Phaseolus vulgaris]
Length=753

 Score =   716 bits (1848),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 358/700 (51%), Positives = 492/700 (70%), Gaps = 9/700 (1%)
 Frame = -1

Query  2086  NSSLSRLLH*MENTGISAVESSADEINDSPVEEVRLTVPITDDPTMPCVTFRTWVLGVTS  1907
             N+ L +  H   N  IS  E S    N SP+E+V LTVP++DDP++P  TFRTW+LG  +
Sbjct  8     NAPLIKRRH-HNNDAISEAEKSPAAEN-SPIEQVALTVPVSDDPSLPSFTFRTWILGTLA  65

Query  1906  CVILAFLNQFFGYRQNALYVSSVPAQIVVLPMGKLMAAYLPTKVVQIPGTKWSFSLNPGP  1727
             CV+L+FLNQFFG+R+  L V+++ AQI V+P G LMAA + T+ V + GTKW F+LNPG 
Sbjct  66    CVLLSFLNQFFGFRREPLSVTAISAQIAVVPAGHLMAAAV-TRRVFMKGTKWEFTLNPGK  124

Query  1726  FNIKEHVLITIFASSGSDFSYAVSIITMMKAFYYRDIHPLAAVLLTFSTQMLGYGLAGIF  1547
             FN+KEHVLITIFASSG+   YA+  ++ +K FY +D+  L A+L+  ++Q+LG+G AGIF
Sbjct  125   FNVKEHVLITIFASSGAASVYAIYFVSAVKLFYRKDLTILTALLVVITSQVLGFGWAGIF  184

Query  1546  KKFLIDSPYMWWPSNL-----VQVSLFRALHDVETRPKGGLTRLQFFIIVLVCSFAYYVV  1382
             +K+L++   MWWP N      +Q+  FRALH+ E R KGGLTR QFF+I  +CSFAYYV 
Sbjct  185   RKYLVEPAAMWWPQNFFSGLALQLCYFRALHEKEERRKGGLTRNQFFLIAFLCSFAYYVF  244

Query  1381  PNYLFPSLTALSLLCWIWKNSVTAQQlgsglkglgigSFALDWATVAAFQGSPLVTPDFA  1202
             P YLFPSLT++S +CW++  SV A QLGSGL GLG+G+   DW+++ ++ GSPL +P FA
Sbjct  245   PGYLFPSLTSISWICWMFPTSVIAHQLGSGLHGLGVGAIGFDWSSICSYLGSPLASPWFA  304

Query  1201  IINMLIGYVLVAYIAIPVWYWTNLFDAKKFPLFSSNVFDSNGQVYNISRVLNKKTFGFDQ  1022
               N+  G+ +  Y  +P+ Y TNL++A++FP+FS  +F SNGQ YNIS +++   F  D 
Sbjct  305   TANVAAGFAIFIYAIVPIAYSTNLYNARRFPIFSDELFMSNGQKYNISAIIDSN-FHLDM  363

Query  1021  PGYDSYSNIYLSTAFVYTYGLSFATLAATVSHVALFHGRTIWEQTKESVQDKFSDIHTRL  842
               Y+    +YLST F  +YG+ FA ++AT+ HV+LFHG  I   +K + Q+   DIHT++
Sbjct  364   EAYEREGPLYLSTMFAMSYGIGFACISATLVHVSLFHGSEILRLSKSAFQENKIDIHTKI  423

Query  841   MRKNYEPVPQWWFYlllviivgvalvACQRFGGQLQLPVWGVLLAVLLSLIFTLPVGVIT  662
             MRKNY+ VP+WWF  +L+  +   +  C+ F  +LQLP WGV+LA ++++ FTLP+GVI 
Sbjct  424   MRKNYKQVPEWWFLCILLFNIVATIFICEYFNNELQLPWWGVVLACVVAMSFTLPIGVIR  483

Query  661   ATTNQQTGLNVIAELIIGYMYPGRPLASVTFKMYGlsslsqslmflSDFKLGHYMKIPPK  482
             ATTNQ   LN+I E IIGY+YPG P+A++ FK+YG  S+ Q++ FL DFKLGHYMKIPP+
Sbjct  484   ATTNQAPALNIITEYIIGYVYPGYPVANMLFKVYGDVSMQQAVFFLQDFKLGHYMKIPPR  543

Query  481   SMFMVQLVGTLISCCVHFGTGWWLLTTVENICNPSKLPEGSQWTCPGDDVFYNASIIWGV  302
              MF+ Q+VGTL+S  VH  T WWL+ TV NIC  + LP GS WTCPGD VFY+AS+IWG+
Sbjct  544   EMFLAQVVGTLMSGVVHLLTSWWLMNTVPNICERALLPAGSPWTCPGDHVFYDASVIWGL  603

Query  301   VSPRRMFGNLGIYQATNYFFLVGFLAPIPVWYLGRKYPEKRWVSLINMPILISGAEGIPI  122
             + PRR FG+LG Y A N+FFL G +AP  VW   +  P+K+W+ LI +P+L+     +P 
Sbjct  604   IGPRRTFGDLGHYSAINWFFLAGAIAPFLVWLAHKALPQKQWIRLITVPVLLGALSDMPP  663

Query  121   VKSVNYVCWFAVGLYFNLYVYRKHKGWWARHNYILSAGLD  2
               +VNY  W  VG      VYR ++GWW+RHNY+LS  LD
Sbjct  664   ATAVNYTSWVIVGFVSGFVVYRYYRGWWSRHNYVLSGALD  703



>ref|XP_011078828.1| PREDICTED: oligopeptide transporter 7-like isoform X1 [Sesamum 
indicum]
Length=751

 Score =   716 bits (1847),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 360/679 (53%), Positives = 490/679 (72%), Gaps = 3/679 (0%)
 Frame = -1

Query  2038  SAVESSADEINDSPVEEVRLTVPITDDPTMPCVTFRTWVLGVTSCVILAFLNQFFGYRQN  1859
             ++  S+++E  +SPVE+V LTVP TDDPT+P VTFR W LG  +CV+L+FLNQFF YR+ 
Sbjct  26    ASAASTSEEEENSPVEQVALTVPPTDDPTLPVVTFRMWTLGAAACVMLSFLNQFFWYRRE  85

Query  1858  ALYVSSVPAQIVVLPMGKLMAAYLPTKVVQIPGTKWSFSLNPGPFNIKEHVLITIFASSG  1679
              L ++++ AQI V+P+G LMAA LP +V    G KW FS NPG FN+KEHVLITIFA++G
Sbjct  86    PLSITAISAQIAVVPLGHLMAAALPRRVF-FEGQKWEFSFNPGKFNVKEHVLITIFANAG  144

Query  1678  SDFSYAVSIITMMKAFYYRDIHPLAAVLLTFSTQMLGYGLAGIFKKFLIDSPYMWWPSNL  1499
             +   Y++ I++ +K FY + +    A+ +  +TQ+LG+G AG+F+++L++   MWWP NL
Sbjct  145   AANPYSIHIVSAVKIFYGQKLTFWVALGVVLTTQVLGFGWAGLFRRYLVEPASMWWPQNL  204

Query  1498  VQVSLFRALHDVETRPKGGLTRLQFFIIVLVCSFAYYVVPNYLFPSLTALSLLCWIWKNS  1319
             VQVSLFRALH+ E R +G LTR QFF+I  +CSFAYYV P YLFP LT++S LCWI+ +S
Sbjct  205   VQVSLFRALHEKEVRDRGALTRNQFFLIAFLCSFAYYVFPGYLFPKLTSVSWLCWIFSSS  264

Query  1318  VTAQQlgsglkglgigSFALDWATVAAFQGSPLVTPDFAIINMLIGYVLVAYIAIPVWYW  1139
             V  QQLGSGL GLGIG+  LDW++++++ GSPL +P FA  N+ +GY +  Y   P+ YW
Sbjct  265   VLFQQLGSGLHGLGIGAIGLDWSSISSYLGSPLASPWFATANIAVGYFICMYAVTPIMYW  324

Query  1138  TNLFDAKKFPLFSSNVFDSNGQVYNISRVLNKKTFGFDQPGYDSYSNIYLSTAFVYTYGL  959
              N+++AK FP+FS  ++ S GQ YNIS +++   F  D   Y+    +YLST F  TY  
Sbjct  325   LNVYNAKTFPIFSDGLYTSEGQKYNISAIVDPN-FHIDLQSYEREGRLYLSTFFAMTYAF  383

Query  958   SFATLAATVSHVALFHGRTIWEQTKESVQDKFSDIHTRLMRKNYEPVPQWWFYlllviiv  779
             SFA L AT++HV LFHGR +W  +K + ++K  DIHT+LM +NY+ VP+WWF  +L+I +
Sbjct  384   SFACLTATIAHVLLFHGRDLWLLSKSAFKEKKMDIHTKLM-QNYKQVPEWWFMCILLINI  442

Query  778   gvalvACQRFGGQLQLPVWGVLLAVLLSLIFTLPVGVITATTNQQTGLNVIAELIIGYMY  599
                L+ CQ +  QLQLP WGVLLA +L+  FTLPVGVITATTNQ  GLNVI E +IGY+Y
Sbjct  443   AGTLLICQIYYNQLQLPWWGVLLACVLAFCFTLPVGVITATTNQTPGLNVITEYMIGYLY  502

Query  598   PGRPLASVTFKMYGlsslsqslmflSDFKLGHYMKIPPKSMFMVQLVGTLISCCVHFGTG  419
             PG P+A++ FK+YG  S+ Q+L+FL D KLGHYMKIPP++MFM Q+VGTLIS  VH GT 
Sbjct  503   PGYPVANMCFKVYGYISMKQALIFLQDLKLGHYMKIPPRAMFMAQVVGTLISSLVHLGTA  562

Query  418   WWLLTTVENICNPSKLPEGSQWTCPGDDVFYNASIIWGVVSPRRMFGNLGIYQATNYFFL  239
             WWL+ TV NIC+ + LP GS WTCPGD VFY+AS+IWG++ P R+FG+LG Y A N+ FL
Sbjct  563   WWLMDTVPNICDRTALPPGSPWTCPGDHVFYDASVIWGLIGPERIFGDLGYYSAINWSFL  622

Query  238   VGFLAPIPVWYLGRKYPEKRWVSLINMPILISGAEGIPIVKSVNYVCWFAVGLYFNLYVY  59
             VG +AP+ VW   + +P ++W+ LI++P+L+     +P   SVNY  W  +G       Y
Sbjct  623   VGAIAPLLVWLAHKAFPNQQWIRLISVPVLLVSIINMPPATSVNYNSWIIIGFLSGYVAY  682

Query  58    RKHKGWWARHNYILSAGLD  2
             R ++ WW++HNY+LS  LD
Sbjct  683   RYYRDWWSKHNYVLSGALD  701



>ref|XP_006655737.1| PREDICTED: oligopeptide transporter 7-like [Oryza brachyantha]
Length=762

 Score =   716 bits (1848),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 352/675 (52%), Positives = 486/675 (72%), Gaps = 3/675 (0%)
 Frame = -1

Query  2026  SSADEINDSPVEEVRLTVPITDDPTMPCVTFRTWVLGVTSCVILAFLNQFFGYRQNALYV  1847
                +E  +SPVE+V LTVP+ D+P+ P +T RTWVLG  SCV+L+FLN FF YR+  L V
Sbjct  39    EEVEEGENSPVEQVALTVPVGDEPSAPVLTARTWVLGTASCVVLSFLNTFFWYRKEPLTV  98

Query  1846  SSVPAQIVVLPMGKLMAAYLPTKVVQIPGTKWSFSLNPGPFNIKEHVLITIFASSGSDFS  1667
             +++ AQI V+P+G+LMAA LP +     G  W F+LNPGPFN+KEHVLITIFA++G+   
Sbjct  99    TAISAQIAVVPLGRLMAAVLPERAF-FRGRPWEFTLNPGPFNVKEHVLITIFANAGAGSV  157

Query  1666  YAVSIITMMKAFYYRDIHPLAAVLLTFSTQMLGYGLAGIFKKFLIDSPYMWWPSNLVQVS  1487
             +A+++IT ++ FY + I    ++L+  ++Q+LG+G AGIF+++L++   MWWPSNLVQVS
Sbjct  158   FAINVITAVRVFYGKRISFFVSLLVVLTSQVLGFGWAGIFRRYLVEPAAMWWPSNLVQVS  217

Query  1486  LFRALHDVETRPKGGLTRLQFFIIVLVCSFAYYVVPNYLFPSLTALSLLCWIWKNSVTAQ  1307
             LFRALH+ + R KGG+TR QFF++  VCSFAYY+ P YLF  L++LS +CWI+ NSV AQ
Sbjct  218   LFRALHEKKQRSKGGMTRNQFFLVAFVCSFAYYIFPGYLFQMLSSLSWICWIFPNSVIAQ  277

Query  1306  QlgsglkglgigSFALDWATVAAFQGSPLVTPDFAIINMLIGYVLVAYIAIPVWYWTNLF  1127
             QLGSGL GLGIG+   DW++++++ GSPL +P FA  N+  G+ +  YI  P+ YW NL+
Sbjct  278   QLGSGLHGLGIGAVGFDWSSISSYLGSPLASPWFATANIAAGFFIYIYIITPIAYWINLY  337

Query  1126  DAKKFPLFSSNVFDSNGQVYNISRVLNKKTFGFDQPGYDSYSNIYLSTAFVYTYGLSFAT  947
              A+ FP+FS  +F   GQ YNIS +++ + F FD   Y+    +Y+ST F  +YGL FA 
Sbjct  338   KAQNFPIFSDGLFTVTGQKYNISTIMDSQ-FHFDTKAYEKNGPLYISTFFAISYGLGFAC  396

Query  946   LAATVSHVALFHGRTIWEQTKESVQDKFSDIHTRLMRKNYEPVPQWWFYlllviivgval  767
             L AT++HV LFHG  IW+ +K + QDK  DIHT+LM++ Y+ VP+WWF  +LV  V + +
Sbjct  397   LTATIAHVLLFHGSEIWKLSKSAFQDKRMDIHTKLMKR-YKQVPEWWFICILVASVAITM  455

Query  766   vACQRFGGQLQLPVWGVLLAVLLSLIFTLPVGVITATTNQQTGLNVIAELIIGYMYPGRP  587
               C+ +  QLQLP WGVLLA  L++ FTLP+G++TATTNQ  GLN+I E I+GY+Y GRP
Sbjct  456   FTCEYYIEQLQLPWWGVLLACALAIFFTLPIGIVTATTNQTPGLNIITEYIMGYLYTGRP  515

Query  586   LASVTFKMYGlsslsqslmflSDFKLGHYMKIPPKSMFMVQLVGTLISCCVHFGTGWWLL  407
             +A++ FK+YG     Q+L FL DFKLGHYMKIPP++MFM Q+VGTLI+  V+ GT WWL+
Sbjct  516   VANMCFKVYGYIGPRQALTFLQDFKLGHYMKIPPRTMFMAQVVGTLIAAFVYLGTAWWLM  575

Query  406   TTVENICNPSKLPEGSQWTCPGDDVFYNASIIWGVVSPRRMFGNLGIYQATNYFFLVGFL  227
              T+ +ICN   LP GS WTCP D +FY+AS+IWG++ PRR+FG+LG Y A N+FFL G +
Sbjct  576   DTIPDICNTELLPPGSPWTCPYDHLFYDASVIWGLIGPRRIFGDLGTYSAINWFFLGGAI  635

Query  226   APIPVWYLGRKYPEKRWVSLINMPILISGAEGIPIVKSVNYVCWFAVGLYFNLYVYRKHK  47
             AP+ VW+  + +P ++W+ L+NMP+LI+G   +P   SVNY  W  V       VY+  +
Sbjct  636   APLLVWFAHKAFPGQKWILLVNMPVLITGISQMPPATSVNYTAWIFVAFLSGYVVYKYRR  695

Query  46    GWWARHNYILSAGLD  2
              WW RHNY+LS  LD
Sbjct  696   DWWERHNYLLSGALD  710



>ref|XP_009795933.1| PREDICTED: oligopeptide transporter 7-like isoform X1 [Nicotiana 
sylvestris]
Length=755

 Score =   716 bits (1847),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 361/679 (53%), Positives = 488/679 (72%), Gaps = 3/679 (0%)
 Frame = -1

Query  2038  SAVESSADEINDSPVEEVRLTVPITDDPTMPCVTFRTWVLGVTSCVILAFLNQFFGYRQN  1859
             S+ +SS  +  +SP+E+V LTVPITD+ ++P VTFR W+LG  +C++L+FLNQFF +R+ 
Sbjct  30    SSTQSSPFDEGNSPIEQVALTVPITDESSLPVVTFRMWILGTLACILLSFLNQFFWFRRE  89

Query  1858  ALYVSSVPAQIVVLPMGKLMAAYLPTKVVQIPGTKWSFSLNPGPFNIKEHVLITIFASSG  1679
              L +SS+ AQI V+P+G LMA  +P ++    G K+ F+LNPGPFN+KEHVLITIFA+SG
Sbjct  90    PLSISSISAQIAVVPLGHLMAFLIPNRIF-FKGRKFEFTLNPGPFNVKEHVLITIFANSG  148

Query  1678  SDFSYAVSIITMMKAFYYRDIHPLAAVLLTFSTQMLGYGLAGIFKKFLIDSPYMWWPSNL  1499
             +   YA+ I++ +K FY R +    ++++  +TQ+LG+G AGIF+++L++   MWWP NL
Sbjct  149   AGNPYAIHIVSAVKVFYKRTLTFWVSLIVVLTTQVLGFGWAGIFRRYLVEPAAMWWPHNL  208

Query  1498  VQVSLFRALHDVETRPKGGLTRLQFFIIVLVCSFAYYVVPNYLFPSLTALSLLCWIWKNS  1319
             VQVSLFRALH+ E R K  +TR QFF+I  +CSFAYYV P YLFP L++LS LCW++  S
Sbjct  209   VQVSLFRALHEKEERAKNEMTRNQFFLIAFLCSFAYYVFPGYLFPMLSSLSWLCWLFPAS  268

Query  1318  VTAQQlgsglkglgigSFALDWATVAAFQGSPLVTPDFAIINMLIGYVLVAYIAIPVWYW  1139
             V AQQLGSGL GLGIG+  LDW++++++ GSPL +P FA  N+ +GY L+ Y+  P  YW
Sbjct  269   VLAQQLGSGLHGLGIGAIGLDWSSISSYLGSPLASPWFATANIAVGYFLIMYVVTPFMYW  328

Query  1138  TNLFDAKKFPLFSSNVFDSNGQVYNISRVLNKKTFGFDQPGYDSYSNIYLSTAFVYTYGL  959
              N++ AK FP+FS  +F S+GQ YNIS +++   F  D   YD    +YLST F  TY  
Sbjct  329   FNVYKAKTFPIFSDGLFTSDGQKYNISAIIDPN-FHIDFNAYDREGRLYLSTFFSMTYAF  387

Query  958   SFATLAATVSHVALFHGRTIWEQTKESVQDKFSDIHTRLMRKNYEPVPQWWFYlllviiv  779
             SFA L+ATV HV LFHGR +W+ +K + Q+K  DIHT+LMRK Y+ VP+WWF  +L++ +
Sbjct  388   SFACLSATVVHVFLFHGRDLWQLSKSAFQEKKMDIHTKLMRK-YKQVPEWWFLSILLVNI  446

Query  778   gvalvACQRFGGQLQLPVWGVLLAVLLSLIFTLPVGVITATTNQQTGLNVIAELIIGYMY  599
                +  C+ +  QLQLP WGVLLA  L+  FTLPVGVITATTNQ  GLNVI E IIGY+Y
Sbjct  447   AATVFICEYYKTQLQLPWWGVLLACGLAFFFTLPVGVITATTNQTPGLNVITEYIIGYLY  506

Query  598   PGRPLASVTFKMYGlsslsqslmflSDFKLGHYMKIPPKSMFMVQLVGTLISCCVHFGTG  419
             PG P+A++ FK+YG  S+ Q L FL D KLGHYMKIPP++MFM Q+VGTLIS  VH GT 
Sbjct  507   PGYPVANMCFKVYGYISMKQGLTFLQDLKLGHYMKIPPRAMFMAQVVGTLISALVHLGTA  566

Query  418   WWLLTTVENICNPSKLPEGSQWTCPGDDVFYNASIIWGVVSPRRMFGNLGIYQATNYFFL  239
             WWL+ TV +IC+ + LP GS WTCPGD VFY+AS+IWG++ P+R+FGNLG Y A N+ FL
Sbjct  567   WWLMETVPDICDRALLPPGSPWTCPGDHVFYDASVIWGLIGPQRIFGNLGHYSALNWAFL  626

Query  238   VGFLAPIPVWYLGRKYPEKRWVSLINMPILISGAEGIPIVKSVNYVCWFAVGLYFNLYVY  59
              G +AP+ VW   + +P + W+ LI +P+L++G   +P   SVNY  W  +       VY
Sbjct  627   FGAIAPVIVWIAHKSFPNQHWIRLITVPVLLAGIINMPPATSVNYNSWIIIAFISGFVVY  686

Query  58    RKHKGWWARHNYILSAGLD  2
             R ++  W+RHNY+LS  LD
Sbjct  687   RYYQKLWSRHNYVLSGALD  705



>ref|XP_004169608.1| PREDICTED: oligopeptide transporter 7-like, partial [Cucumis 
sativus]
Length=832

 Score =   718 bits (1853),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 351/670 (52%), Positives = 484/670 (72%), Gaps = 3/670 (0%)
 Frame = -1

Query  2011  INDSPVEEVRLTVPITDDPTMPCVTFRTWVLGVTSCVILAFLNQFFGYRQNALYVSSVPA  1832
             + +SPVE+V LTVP+TDD ++P  TFRTW+LG+ +C++L+FLNQFF YR+  L V+S+ A
Sbjct  115   VENSPVEQVALTVPVTDDTSLPTFTFRTWILGIIACMLLSFLNQFFYYRKEPLPVTSISA  174

Query  1831  QIVVLPMGKLMAAYLPTKVVQIPGTKWSFSLNPGPFNIKEHVLITIFASSGSDFSYAVSI  1652
             QI V+P+G  +A+ L  KV    G KW F+LNPGPFN KEHVLITIFA+SG+   YA+ +
Sbjct  175   QIAVVPIGHFLASALTNKVF-FEGKKWKFTLNPGPFNQKEHVLITIFANSGASTVYAIHV  233

Query  1651  ITMMKAFYYRDIHPLAAVLLTFSTQMLGYGLAGIFKKFLIDSPYMWWPSNLVQVSLFRAL  1472
             ++ +K FY +++    A+L+  +TQ+LG+G AGIF+++L++   MWWP NLVQVSLFRAL
Sbjct  234   VSAIKIFYKKELTFFLALLVVLTTQVLGFGWAGIFRRYLVEPAAMWWPQNLVQVSLFRAL  293

Query  1471  HDVETRPKGGLTRLQFFIIVLVCSFAYYVVPNYLFPSLTALSLLCWIWKNSVTAQQlgsg  1292
             H+ E RPKG L+R QFF++   CSF YY+ P YLFP LT++S LCW++  S+ AQQLGSG
Sbjct  294   HEKEERPKGKLSRNQFFVVAFTCSFGYYIFPGYLFPMLTSMSWLCWVFPTSIIAQQLGSG  353

Query  1291  lkglgigSFALDWATVAAFQGSPLVTPDFAIINMLIGYVLVAYIAIPVWYWTNLFDAKKF  1112
             L+GLGIG+F  DW+T++A+ GSPL +P FA +N+  G+ +V Y+  P+ YW +LF+AK F
Sbjct  354   LRGLGIGAFGFDWSTISAYLGSPLASPWFATVNVAAGFAIVTYLGTPLAYWLDLFNAKTF  413

Query  1111  PLFSSNVFDSNGQVYNISRVLNKKTFGFDQPGYDSYSNIYLSTAFVYTYGLSFATLAATV  932
             P+FS  +F S GQ YNIS +++   F  D   Y+    +  ST     YG++FA LAAT+
Sbjct  414   PIFSDGLFTSAGQNYNISAIIDPN-FRLDVDAYNREGPLRFSTFLALYYGVNFACLAATI  472

Query  931   SHVALFHGRTIWEQTKESVQDKFSDIHTRLMRKNYEPVPQWWFYlllviivgvalvACQR  752
              HV LFHGR IW  ++ ++Q+K  D+HT+LMRK Y+ VP+ WF  +LV+ + V +  C+ 
Sbjct  473   VHVLLFHGRDIWRLSRSALQEKLMDVHTKLMRK-YDQVPESWFMCILVVNISVTIFICEY  531

Query  751   FGGQLQLPVWGVLLAVLLSLIFTLPVGVITATTNQQTGLNVIAELIIGYMYPGRPLASVT  572
             +  QLQLP WGVL+A  L++ FTLPVGVITA TNQ   LNVI E IIGY+YPG P+A++ 
Sbjct  532   YNNQLQLPWWGVLIACGLAMFFTLPVGVITALTNQAPSLNVITEFIIGYLYPGYPVANMC  591

Query  571   FKMYGlsslsqslmflSDFKLGHYMKIPPKSMFMVQLVGTLISCCVHFGTGWWLLTTVEN  392
             FK+YG  S+ Q++ FL DFKLGHYMKIPP+ MF+ Q+VGT++S   H GT WWL+ T+ N
Sbjct  592   FKVYGYISMKQAITFLQDFKLGHYMKIPPREMFIAQVVGTVVSAVTHLGTAWWLMATIPN  651

Query  391   ICNPSKLPEGSQWTCPGDDVFYNASIIWGVVSPRRMFGNLGIYQATNYFFLVGFLAPIPV  212
             IC+ +KLP GS WTCPGD VFY+AS+IWG+V PRR+FG+ G Y + N+FFL G ++P+ V
Sbjct  652   ICDRAKLPAGSPWTCPGDHVFYDASVIWGLVGPRRIFGDQGQYGSLNWFFLAGAVSPLLV  711

Query  211   WYLGRKYPEKRWVSLINMPILISGAEGIPIVKSVNYVCWFAVGLYFNLYVYRKHKGWWAR  32
             W   + +P+K W+ LI MP+L+     +P   +VNY  W  +G       YR ++GWW+R
Sbjct  712   WLAHKAFPDKNWIKLITMPVLLGAVVNMPPATAVNYTSWIVIGFASGFVAYRHYRGWWSR  771

Query  31    HNYILSAGLD  2
             HNY+LS  LD
Sbjct  772   HNYLLSGALD  781



>ref|XP_002993852.1| hypothetical protein SELMODRAFT_137672 [Selaginella moellendorffii]
 gb|EFJ05089.1| hypothetical protein SELMODRAFT_137672 [Selaginella moellendorffii]
Length=725

 Score =   714 bits (1843),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 363/679 (53%), Positives = 499/679 (73%), Gaps = 10/679 (1%)
 Frame = -1

Query  2032  VESSADEINDSPVEEVRLTVPITDDPTMPCVTFRTWVLGVTSCVILAFLNQFFGYRQNAL  1853
             V+  + + + SP+EEVRLTVP TDD ++P +TFRTW LG+ SC+IL+F+N FF YR+  L
Sbjct  3     VQECSQDDDQSPIEEVRLTVPTTDDTSLPALTFRTWTLGILSCLILSFINMFFSYRRQQL  62

Query  1852  YVSSVPAQIVVLPMGKLMAAYLPTKVVQIPGTKWSFSLNPGPFNIKEHVLITIFASSGSD  1673
              VS + AQIV LP+GKLMAA LPTK + +PG  W FSLNPGPFN+KEHVLITIFA++G+ 
Sbjct  63    SVSGLTAQIVTLPLGKLMAAMLPTKKILVPGLNWGFSLNPGPFNVKEHVLITIFANAGAG  122

Query  1672  FSYAVSIITMMKAFYYRDIHP-LAAVLLTFSTQMLGYGLAGIFKKFLIDSPYMWWPSNLV  1496
              +YAV I+T +KAFY R   P    +L+T +TQ++G+G AGIF+KFL++  +MWWP NLV
Sbjct  123   GAYAVHIVTSLKAFYNRQDFPFFVGLLVTLTTQIVGFGFAGIFRKFLVEPAHMWWPQNLV  182

Query  1495  QVSLFRALHDVETRPKGGLTRLQFFIIVLVCSFAYYVVPNYLFPSLTALSLLCWIWKNSV  1316
             QVSLFR     E R KGGLTR+ FF IV + SFAYY++P YLF +L+++S +C+IW  S+
Sbjct  183   QVSLFR---QPEKRVKGGLTRINFFTIVFLTSFAYYLLPGYLFATLSSISWVCYIWPKSI  239

Query  1315  TAQQlgsglkglgigSFALDWATVAAFQGSPLVTPDFAIINMLIGYVLVAYIAIPVWYWT  1136
              A QLGSGL G G+G+  LDW+TVA F GSPL +P FAI N ++G+++  Y+  PV YW 
Sbjct  240   IAHQLGSGLAGYGLGAIGLDWSTVAGFLGSPLASPFFAIANTMVGFIVTLYVLAPVAYWG  299

Query  1135  -NLFDAKKFPLFSSNVFDSNGQVYNISRVLNKKTFGFDQPGYDSYSNIYLSTAFVYTYGL  959
              +++ AKKFPL S  +FDS+GQVYN +R+     F  D   Y++YS +++ST FV+TYG+
Sbjct  300   YDMYGAKKFPLLSLQLFDSDGQVYNQTRI-TTSAFDLDTMAYNNYSRLHISTIFVFTYGI  358

Query  958   SFATLAATVSHVALFHGRTIWEQTKESVQDKFSDIHTRLMRKNYEPVPQWWFYlllviiv  779
             SFA L A+V+H  LFHG+TIW +T  +++D   DIH +LMRK Y+ VP WW+  LLV+ +
Sbjct  359   SFAMLTASVTHAILFHGKTIW-RTLRAMEDARPDIHAKLMRK-YKQVPTWWYGSLLVMTI  416

Query  778   gvalvACQRFGGQLQLPVWGVLLAVLLSLIFTLPVGVITATTNQQTGLNVIAELIIGYMY  599
              ++++AC+ +   LQL  WGVL +V LS +F LP+GV+ ATTNQ  GLNVI+E +IGY+Y
Sbjct  417   ALSVIACEVYNNDLQLRWWGVLFSVGLSFLFCLPIGVLLATTNQSPGLNVISEYLIGYIY  476

Query  598   PGRPLASVTFKMYGlsslsqslmflSDFKLGHYMKIPPKSMFMVQLVGTLISCCVHFGTG  419
             P +P+A+V FK YG  ++ Q+   LSDFK+GHYMKIPP+SMF+ Q+VGT ++   + GT 
Sbjct  477   PNKPIANVLFKTYGTITVYQTTSLLSDFKIGHYMKIPPRSMFIAQIVGTTLASMTYLGTA  536

Query  418   WWLLTTVENICNPSKLPEGSQWTCPGDDVFYNASIIWGVVSPRRMFGNLGIYQATNYFFL  239
             WWLL TV NICN  +  +G+ WTCPGD +FY+AS+IWG++ P+R+FGNLG+Y++ N+ FL
Sbjct  537   WWLLETVPNICN--RHIKGNVWTCPGDTIFYDASVIWGLIGPQRIFGNLGLYKSLNWCFL  594

Query  238   VGFLAPIPVWYLGRKYPEKRWVSLINMPILISGAEGIPIVKSVNYVCWFAVGLYFNLYVY  59
             +G +AP+  W L + +P   W+  + +P+LI GA  +P   +VNY  WF VG +FN +++
Sbjct  595   LGAIAPVIHWVLTKVFPTVEWLKYVVVPVLIGGAGAMPYATAVNYWSWFVVGFFFNYFIF  654

Query  58    RKHKGWWARHNYILSAGLD  2
             R  K WW RHNYILSA LD
Sbjct  655   RTRKKWWQRHNYILSAALD  673



>ref|XP_010034698.1| PREDICTED: oligopeptide transporter 7-like [Eucalyptus grandis]
Length=750

 Score =   714 bits (1844),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 358/669 (54%), Positives = 478/669 (71%), Gaps = 3/669 (0%)
 Frame = -1

Query  2008  NDSPVEEVRLTVPITDDPTMPCVTFRTWVLGVTSCVILAFLNQFFGYRQNALYVSSVPAQ  1829
              +SPVE+V LTVP  DD ++  VTFRT+VLG  +C +L+FLNQFF YR+  L V+SV AQ
Sbjct  35    ENSPVEQVALTVPTGDDHSLRAVTFRTFVLGALACSLLSFLNQFFWYRREPLSVTSVSAQ  94

Query  1828  IVVLPMGKLMAAYLPTKVVQIPGTKWSFSLNPGPFNIKEHVLITIFASSGSDFSYAVSII  1649
             I V+P+G LMA  + T+ V   G +W F+LNPGPFN+KEHVLITIFA+SG+   YA+ II
Sbjct  95    IAVVPLGHLMAGVI-TRRVFFEGRRWQFTLNPGPFNVKEHVLITIFANSGASSVYAIHII  153

Query  1648  TMMKAFYYRDIHPLAAVLLTFSTQMLGYGLAGIFKKFLIDSPYMWWPSNLVQVSLFRALH  1469
             +++K FY +++    A+++  +TQ+LG+G AG+F+++L++   MWWP NLVQVSLFRALH
Sbjct  154   SVVKIFYRKEMSFPVALVIVLTTQVLGFGWAGLFRRYLVEPAAMWWPQNLVQVSLFRALH  213

Query  1468  DVETRPKGGLTRLQFFIIVLVCSFAYYVVPNYLFPSLTALSLLCWIWKNSVTAQQlgsgl  1289
             + E RPKGGL R  FF+I  +CSF+YYV P YLFP LT+LS +CW++  SV AQQLGSGL
Sbjct  214   EKEQRPKGGLMRNHFFLIAFICSFSYYVFPGYLFPMLTSLSWICWLFPASVLAQQLGSGL  273

Query  1288  kglgigSFALDWATVAAFQGSPLVTPDFAIINMLIGYVLVAYIAIPVWYWTNLFDAKKFP  1109
              GLGIG+  LDW++++A+ GSPL +P FA  N+ +G+ LV Y+  P+ YW N++ AK F 
Sbjct  274   HGLGIGAVGLDWSSISAYLGSPLASPWFATANIAVGFALVMYVITPIAYWLNIYRAKTFS  333

Query  1108  LFSSNVFDSNGQVYNISRVLNKKTFGFDQPGYDSYSNIYLSTAFVYTYGLSFATLAATVS  929
             LFS ++F S+GQ YNIS ++N+  F  D   Y+    +YL T F   YG+SFA L ATV 
Sbjct  334   LFSDSLFTSSGQEYNISAIINEH-FQLDAEAYEREGPLYLCTVFSVYYGISFACLTATVV  392

Query  928   HVALFHGRTIWEQTKESVQDKFSDIHTRLMRKNYEPVPQWWFYlllviivgvalvACQRF  749
             H  LFHG+ IW  +K +  +K  DIHT+LMR+ Y+ VP+WWF  +L++ +   +  C+ F
Sbjct  393   HGFLFHGKEIWLLSKSAFSEKKMDIHTKLMRR-YKQVPEWWFTCILLVNIVATIFICEYF  451

Query  748   GGQLQLPVWGVLLAVLLSLIFTLPVGVITATTNQQTGLNVIAELIIGYMYPGRPLASVTF  569
               QLQLP WGVLLA  L++ FTLPVGVITATTNQ   LNVI E IIGY+YPG P+A++ F
Sbjct  452   KDQLQLPWWGVLLACALAIFFTLPVGVITATTNQTPALNVITEFIIGYIYPGYPVANILF  511

Query  568   KMYGlsslsqslmflSDFKLGHYMKIPPKSMFMVQLVGTLISCCVHFGTGWWLLTTVENI  389
             K+YG  S+ Q + FL DFKLGHYMKIPP+ MFM Q+VGT+++  VH  T WWL+ TV +I
Sbjct  512   KVYGYISMKQGITFLQDFKLGHYMKIPPREMFMAQVVGTIVAALVHLRTAWWLMDTVPDI  571

Query  388   CNPSKLPEGSQWTCPGDDVFYNASIIWGVVSPRRMFGNLGIYQATNYFFLVGFLAPIPVW  209
             CN + LP GS WTCPGD VF++ S+IWG++ PRR+FG+LG Y A N+FFLVG +AP  VW
Sbjct  572   CNRALLPAGSPWTCPGDTVFFDGSVIWGLIGPRRIFGDLGYYSAINWFFLVGAIAPFIVW  631

Query  208   YLGRKYPEKRWVSLINMPILISGAEGIPIVKSVNYVCWFAVGLYFNLYVYRKHKGWWARH  29
                + +P+K W+ LI MP+L+     +P   +VNY  W   G       YR ++GWW+RH
Sbjct  632   LAHKAFPDKEWIRLITMPVLLGATVSMPPATAVNYTSWIIAGFLSGFVAYRYYRGWWSRH  691

Query  28    NYILSAGLD  2
             NY LS  LD
Sbjct  692   NYALSGALD  700



>gb|EPS60258.1| hypothetical protein M569_14546, partial [Genlisea aurea]
Length=705

 Score =   713 bits (1840),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 353/672 (53%), Positives = 487/672 (72%), Gaps = 6/672 (1%)
 Frame = -1

Query  2017  DEINDSPVEEVRLTVPITDDPTMPCVTFRTWVLGVTSCVILAFLNQFFGYRQNALYVSSV  1838
             +E  +SP++EV LTV  +DD ++P +TFR W LG  SCV+L+FLNQFF YR   L ++++
Sbjct  2     EEEENSPIKEVALTVSTSDDASIPVLTFRMWFLGTVSCVLLSFLNQFFWYRTEPLSITAI  61

Query  1837  PAQIVVLPMGKLMAAYLPTKVVQIPGTKWSFSLNPGPFNIKEHVLITIFASSGSDFSYAV  1658
              AQI V+P+G+LMAA LP +V     T W F+LNPGPFN+KEHVLITIFA+SG+   YA+
Sbjct  62    SAQIAVVPLGRLMAARLPARVF-FRNTGWEFTLNPGPFNVKEHVLITIFANSGAGTVYAI  120

Query  1657  SIITMMKAFYYRDIHPLAAVLLTFSTQMLGYGLAGIFKKFLIDSPYMWWPSNLVQVSLFR  1478
              ++T +K FY + I+   ++++  +TQ+LG+G AGIF+++L++   MWWP+NLVQVSLFR
Sbjct  121   HVVTAVKVFYRKHINFFVSLVVVITTQVLGFGWAGIFRRYLVEPAEMWWPANLVQVSLFR  180

Query  1477  ALHDVETRPKGGLTRLQFFIIVLVCSFAYYVVPNYLFPSLTALSLLCWIWKNSVTAQQlg  1298
             ALH+ E R KGG+TR QFF+I  +CSFAYYV P YLF  LT+LS +CWI+  S+ AQQLG
Sbjct  181   ALHEKEERRKGGVTRTQFFVIAFICSFAYYVFPGYLFQMLTSLSWICWIFPKSILAQQLG  240

Query  1297  sglkglgigSFALDWATVAAFQGSPLVTPDFAIINMLIGYVLVAYIAIPVWYWTNLFDAK  1118
             SGLKGLGIG+  LDW+TV+++ GSPL +P FA  N+ +G+  V Y+  P+ YW N++DAK
Sbjct  241   SGLKGLGIGAVGLDWSTVSSYLGSPLASPWFATANVAVGFFFVMYVVTPLSYWFNVYDAK  300

Query  1117  KFPLFSSNVFDSNGQVYNISRVLNKKTFGFDQPGYDSYSNIYLSTAFVYTYGLSFATLAA  938
             KFP+FS  +F S+G+VYNIS +++   F  D   Y+    ++LST F  TYG+ FA L+A
Sbjct  301   KFPIFSDELFTSSGEVYNISGIIDSN-FHLDMDSYNRQGTLHLSTFFAMTYGVGFAALSA  359

Query  937   TVSHVALFHGRTIWEQTKESVQDKFSDIHTRLMRKNYEPVPQWWFYlllviivgvalvAC  758
             T+ HV LFHGR IWE ++ S ++K  DIHTRLMR+ Y  VP+WWF+ +L++ + + + AC
Sbjct  360   TIVHVILFHGREIWELSRSSFKEKKMDIHTRLMRR-YRQVPEWWFWCILLVNISLTIFAC  418

Query  757   QRFGGQLQLPVWGVLLAVLLSLIFTLPVGVITATTNQQTGLNVIAELIIGYMYPGRPLAS  578
             + +  QLQLP WGVLLA  ++ +FTLP+G+ITA TNQ  GLN+I E IIGY+YPG P+A+
Sbjct  419   EYYKDQLQLPWWGVLLACFIAFVFTLPIGIITAITNQSPGLNIITEYIIGYIYPGYPVAN  478

Query  577   VTFKMYGlsslsqslmflSDFKLGHYMKIPPKSMFMVQLVGTLISCCVHFGTGWWLLTTV  398
             + FK+YG  S++Q++ FL DFKLGHYMKIPP++MFM Q+VGTLI+  V+  T WWL+ T+
Sbjct  479   MCFKVYGYISMTQAITFLQDFKLGHYMKIPPRTMFMAQVVGTLIAGVVYLSTAWWLMETI  538

Query  397   ENICNPSKLPEGSQWTCPGDDVFYNASIIWGVVSPRRMFGNLGIYQATNYFFLVGFLAPI  218
               IC+ +       WTCPGD VFY+AS+IWG++ PR++FG+ G Y A N+FFL+G +AP+
Sbjct  539   PGICDKAA---SDVWTCPGDHVFYDASVIWGLIGPRKIFGDEGTYAAVNWFFLLGAVAPV  595

Query  217   PVWYLGRKYPEKRWVSLINMPILISGAEGIPIVKSVNYVCWFAVGLYFNLYVYRKHKGWW  38
              VW   + +P++ W+ LINMP+LI     +P   +VNY  W AVG      VY      W
Sbjct  596   LVWLGTKAFPDREWIRLINMPVLIGATGSMPPATAVNYTTWIAVGFVSGYVVYNYRPDLW  655

Query  37    ARHNYILSAGLD  2
              RHNY+LS  LD
Sbjct  656   ERHNYVLSGALD  667



>ref|XP_006856596.1| hypothetical protein AMTR_s00046p00213370 [Amborella trichopoda]
 gb|ERN18063.1| hypothetical protein AMTR_s00046p00213370 [Amborella trichopoda]
Length=732

 Score =   713 bits (1841),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 360/681 (53%), Positives = 497/681 (73%), Gaps = 15/681 (2%)
 Frame = -1

Query  2029  ESSADEINDSPVEEVRLTVPITDDPTMPCVTFRTWVLGVTSCVILAFLNQFFGYRQNALY  1850
                 DEI  SP+E+VRLTV  TDDP++P  TFR W LGV SC  ++FLNQFF YR   L 
Sbjct  12    REEEDEI--SPIEQVRLTVTTTDDPSLPVWTFRMWFLGVLSCAAMSFLNQFFAYRTEPLV  69

Query  1849  VSSVPAQIVVLPMGKLMAAYLPTKVVQIPGTKWSFSLNPGPFNIKEHVLITIFASSGSDF  1670
             ++ +  Q+  LP G  +AA LP K  ++ G++  +SLNPGPFN+KEHVLITIFA++G  F
Sbjct  70    ITQISVQVASLPAGHFLAAVLPKKKFRLGGSE--YSLNPGPFNMKEHVLITIFANAGYAF  127

Query  1669  S----YAVSIITMMKAFYYRDIHPLAAVLLTFSTQMLGYGLAGIFKKFLIDSPYMWWPSN  1502
                  YAV I+ ++KAFY R I  +A+ L+  +TQ+LGYG AG+ +K++++  +MWWPS 
Sbjct  128   GSGTPYAVGIVNIIKAFYRRKISFIASWLIIITTQVLGYGWAGLLRKYVVEPAHMWWPST  187

Query  1501  LVQVSLFRALHDVETRPKGGLTRLQFFIIVLVCSFAYYVVPNYLFPSLTALSLLCWIWKN  1322
             LVQVS+FRALH+ + R    L+R +FF+I LVCSF+YYV+P YLF +LT +S +CW    
Sbjct  188   LVQVSVFRALHEKDDR---RLSRAKFFVIALVCSFSYYVLPGYLFSTLTTISWVCWAHPK  244

Query  1321  SVTAQQlgsglkglgigSFALDWATVAAFQGSPLVTPDFAIINMLIGYVLVAYIAIPVWY  1142
             S+TAQQLGSGL GLG+G+F LDWA +AAF  SPL+ P FAI+N+ +GYV++ Y+AIP+ Y
Sbjct  245   SITAQQLGSGLNGLGLGAFPLDWAAIAAFMFSPLIYPFFAIMNIFVGYVVIVYLAIPIAY  304

Query  1141  WT-NLFDAKKFPLFSSNVFDSNGQVYNISRVLNKKTFGFDQPGYDSYSNIYLSTAFVYTY  965
             W  +L+ AKKFP+FSS++F ++GQ YNI+ ++N + F  D+  Y     I+LS  F  TY
Sbjct  305   WGFDLYGAKKFPIFSSDLFTADGQPYNITAIVNGQ-FELDETAYAQQGPIHLSMFFALTY  363

Query  964   GLSFATLAATVSHVALFHGRTIWEQTKESVQDKFSDIHTRLMRKNYEPVPQWWFYlllvi  785
             G  FAT+A+T++HVALF+GR IW++++ S++ K  D+HTRLM KNY  +PQWWFY L+  
Sbjct  364   GFGFATIASTITHVALFYGREIWQRSRASIRSK-PDMHTRLM-KNYADIPQWWFYALMAA  421

Query  784   ivgvalvACQRFGGQLQLPVWGVLLAVLLSLIFTLPVGVITATTNQQTGLNVIAELIIGY  605
              V ++L  C     ++QLP WG+ LA  L+ +FTLP+ +ITATTNQ  GLN+I E I+GY
Sbjct  422   TVAISLFLCIVLKHEVQLPWWGIFLACALAFLFTLPISIITATTNQTPGLNIITEYIMGY  481

Query  604   MYPGRPLASVTFKMYGlsslsqslmflSDFKLGHYMKIPPKSMFMVQLVGTLISCCVHFG  425
             + PG+P+A+V FK+YG  S+SQ++ FL+DFKLGHYMKIPP+SMF+VQ +GT+I+  ++ G
Sbjct  482   ILPGKPIANVCFKVYGYMSMSQAVSFLADFKLGHYMKIPPRSMFLVQFIGTVIAGTINLG  541

Query  424   TGWWLLTTVENICNPSKLPEGSQWTCPGDDVFYNASIIWGVVSPRRMFGNLGIYQATNYF  245
               WWLL ++ENICN + LP+GS WTCPGD VF++AS+IWG+V P+R+FG LG Y A N+F
Sbjct  542   VAWWLLDSIENICNKAALPKGSPWTCPGDRVFFDASVIWGLVGPKRIFGPLGAYPALNWF  601

Query  244   FLVGFLAPIPVWYLGRKYPEKRWVSLINMPILISGAEGIPIVKSVNYVCWFAVGLYFNLY  65
             FL G L P+ VW L + +P + W+ LIN+P+L+     +P   ++NY  W AVG  FN +
Sbjct  602   FLGGALGPVLVWLLHKAFPSQTWIPLINLPVLLGATAYMPAATALNYNAWVAVGTVFNFF  661

Query  64    VYRKHKGWWARHNYILSAGLD  2
             V+R  K WW R+NY+LSAGLD
Sbjct  662   VFRYRKSWWQRYNYVLSAGLD  682



>ref|XP_004287803.1| PREDICTED: oligopeptide transporter 7-like [Fragaria vesca subsp. 
vesca]
Length=747

 Score =   713 bits (1840),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 360/691 (52%), Positives = 489/691 (71%), Gaps = 6/691 (1%)
 Frame = -1

Query  2068  LLH*MENTGISAV--ESSADEINDSPVEEVRLTVPITDDPTMPCVTFRTWVLGVTSCVIL  1895
             LLH   +  +S+   E+ + E N SP+E+V LTVPITDDP++P VTFRTW LG  +C++L
Sbjct  11    LLHNKNHASVSSPSPENFSGEEN-SPIEQVALTVPITDDPSLPAVTFRTWTLGSLACILL  69

Query  1894  AFLNQFFGYRQNALYVSSVPAQIVVLPMGKLMAAYLPTKVVQIPGTKWSFSLNPGPFNIK  1715
             +FLNQFF YR+  L ++S+ AQI V+P+G LMA+ +  +V    G +W F+LNPGPFN+K
Sbjct  70    SFLNQFFWYRREPLSLTSISAQIAVVPLGHLMASVVTDRVF-FKGRRWEFTLNPGPFNVK  128

Query  1714  EHVLITIFASSGSDFSYAVSIITMMKAFYYRDIHPLAAVLLTFSTQMLGYGLAGIFKKFL  1535
             EHVLITIFA+SG+   YA+ I++ +K FY +D+    A+L+  +TQ+LG+G AG+F+++L
Sbjct  129   EHVLITIFANSGAGNVYAIHIVSTIKVFYGKDMSFWVALLVVLTTQVLGFGWAGLFRRYL  188

Query  1534  IDSPYMWWPSNLVQVSLFRALHDVETRPKGGLTRLQFFIIVLVCSFAYYVVPNYLFPSLT  1355
             ++   MWWP NLVQVSLFRALH+ E RP+GGLTR QFF+I   CSFAYYV P YLFP L+
Sbjct  189   VEPAAMWWPHNLVQVSLFRALHEKEERPRGGLTRNQFFLIAFTCSFAYYVFPGYLFPMLS  248

Query  1354  ALSLLCWIWKNSVTAQQlgsglkglgigSFALDWATVAAFQGSPLVTPDFAIINMLIGYV  1175
             ++S +CWI+  SV   QLGSGL GLGIG+  LDW++++++ GSPL +P FA  N+ +G+V
Sbjct  249   SISWVCWIFPASVLVHQLGSGLHGLGIGAIGLDWSSISSYLGSPLASPWFATANVAVGFV  308

Query  1174  LVAYIAIPVWYWTNLFDAKKFPLFSSNVFDSNGQVYNISRVLNKKTFGFDQPGYDSYSNI  995
             LV Y+  PV YW N++ A+ FP+FS  +F S GQ YNIS +++   F  D   Y+    +
Sbjct  309   LVMYVITPVAYWLNVYKARTFPIFSDGLFTSTGQSYNISAIIDPN-FRLDIDAYEREGPL  367

Query  994   YLSTAFVYTYGLSFATLAATVSHVALFHGRTIWEQTKESVQDKFSDIHTRLMRKNYEPVP  815
             ++ST F   YG++FA L ATV HV LF+GR IWE +K + Q+K +D+HT LMR+ Y+ VP
Sbjct  368   HISTFFAINYGVNFACLTATVVHVLLFNGRDIWELSKSAFQEKKADVHTNLMRR-YKQVP  426

Query  814   QWWFYlllviivgvalvACQRFGGQLQLPVWGVLLAVLLSLIFTLPVGVITATTNQQTGL  635
              WWF  +LV  +   +  C  +  QLQL  WGVLLA  L+L FTLPVGVI ATTNQ   L
Sbjct  427   GWWFICILVANIAATMFTCHYYNDQLQLQWWGVLLACGLALFFTLPVGVIYATTNQMPAL  486

Query  634   NVIAELIIGYMYPGRPLASVTFKMYGlsslsqslmflSDFKLGHYMKIPPKSMFMVQLVG  455
             NVI E IIGY+YPG P A++ FK+YG  S+ Q + FL DFKLGHYMKI P++MFM Q+ G
Sbjct  487   NVITEYIIGYLYPGYPAANILFKVYGHISMKQGITFLEDFKLGHYMKIAPRAMFMAQIAG  546

Query  454   TLISCCVHFGTGWWLLTTVENICNPSKLPEGSQWTCPGDDVFYNASIIWGVVSPRRMFGN  275
             T+I+  VH GT WWL++T+ +IC+ + LP  S WTCPGD VFY+AS+IWG+V PRR+FG+
Sbjct  547   TIIAALVHLGTAWWLMSTIPDICDRALLPADSPWTCPGDHVFYDASVIWGLVGPRRIFGD  606

Query  274   LGIYQATNYFFLVGFLAPIPVWYLGRKYPEKRWVSLINMPILISGAEGIPIVKSVNYVCW  95
             LG Y A N+FFL G +AP  VW   + +P K+W+ LI MP+L+     +P   +VN+  W
Sbjct  607   LGYYSAINWFFLAGAIAPALVWLAHKAFPTKQWIRLITMPVLLGTVVNMPPATAVNFTSW  666

Query  94    FAVGLYFNLYVYRKHKGWWARHNYILSAGLD  2
               +G       YR ++ WW+RHNY+LS  LD
Sbjct  667   ILIGFASGFVAYRYYRSWWSRHNYVLSGALD  697



>ref|XP_004143945.1| PREDICTED: oligopeptide transporter 7-like [Cucumis sativus]
 gb|KGN49990.1| hypothetical protein Csa_5G148610 [Cucumis sativus]
Length=757

 Score =   713 bits (1841),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 356/675 (53%), Positives = 492/675 (73%), Gaps = 9/675 (1%)
 Frame = -1

Query  2026  SSADEINDSPVEEVRLTVPITDDPTMPCVTFRTWVLGVTSCVILAFLNQFFGYRQNALYV  1847
             S +DE  +SP+ +V LTVP TDDP++P +TFR W LG  SCV+L+FLNQFF YR+  L +
Sbjct  41    SESDE--NSPIPQVALTVPTTDDPSLPVLTFRMWFLGTLSCVLLSFLNQFFWYRKEPLSI  98

Query  1846  SSVPAQIVVLPMGKLMAAYLPTKVVQIPGTKWSFSLNPGPFNIKEHVLITIFASSGSDFS  1667
             +++ AQI V+P+G+LMA+ +  +V    G +W FSLNPGPFN+KEHVLITIFA+SG+   
Sbjct  99    TAISAQIAVVPLGRLMASKITDRVF-FKGKRWEFSLNPGPFNVKEHVLITIFANSGAGSV  157

Query  1666  YAVSIITMMKAFYYRDIHPLAAVLLTFSTQMLGYGLAGIFKKFLIDSPYMWWPSNLVQVS  1487
             YA+ ++T++K FY + +    ++++  +TQ+LG+G AGIF+K+L++   MWWPSNLVQVS
Sbjct  158   YAIHVVTVVKTFYKQHLTFFVSLIVVVTTQVLGFGWAGIFRKYLVEPAAMWWPSNLVQVS  217

Query  1486  LFRALHDVETRPKGGLTRLQFFIIVLVCSFAYYVVPNYLFPSLTALSLLCWIWKNSVTAQ  1307
             LFRALH+ E R KG L+R QFF+I  +CSFAYYV+P YLF  L +LS +CWI+  S+ AQ
Sbjct  218   LFRALHEKEERIKGSLSRTQFFVIAFICSFAYYVIPGYLFQMLISLSWVCWIFPTSILAQ  277

Query  1306  QlgsglkglgigSFALDWATVAAFQGSPLVTPDFAIINMLIGYVLVAYIAIPVWYWTNLF  1127
             QLGSGL GLG+GS  LDW+T++++ GSPL +P FA  N+ +G+  + YI  P+ YW N++
Sbjct  278   QLGSGLYGLGLGSIGLDWSTISSYLGSPLASPWFATANVAVGFGFIMYILTPICYWFNVY  337

Query  1126  DAKKFPLFSSNVFDSNGQVYNISRVLNKKTFGFDQPGYDSYSNIYLSTAFVYTYGLSFAT  947
              A+ FP+FS  +F   GQ YNIS +++   F  D   Y++   +Y+ST F  TYG+ FA 
Sbjct  338   KAQTFPMFSDGLFTGKGQKYNISSIIDSN-FHLDFAAYETQGRLYISTFFAVTYGVGFAA  396

Query  946   LAATVSHVALFHGRTIWEQTKESVQDKFSDIHTRLMRKNYEPVPQWWFYlllviivgval  767
             L+AT+ HVALFHGR IWEQ+K S ++K  DIHT+LMRK Y+ VP+WWF L+L+  + + +
Sbjct  397   LSATIVHVALFHGREIWEQSKSSFEEKKMDIHTKLMRK-YKQVPEWWFVLILLGNIALTI  455

Query  766   vACQRFGGQLQLPVWGVLLAVLLSLIFTLPVGVITATTNQQTGLNVIAELIIGYMYPGRP  587
              AC+ +  QLQLP WGV+LA  +++ FTLP+G+ITA TNQ  GLN+I E IIGY+YPG P
Sbjct  456   FACEYYNDQLQLPWWGVILACSIAVFFTLPIGIITAITNQAPGLNIITEYIIGYIYPGYP  515

Query  586   LASVTFKMYGlsslsqslmflSDFKLGHYMKIPPKSMFMVQLVGTLISCCVHFGTGWWLL  407
             +A++ FK+YG  S++Q++ FL DFKLGHYMKIPP++MFM Q+VGTLI+  V+ GT WWLL
Sbjct  516   VANMCFKVYGYISMTQAITFLQDFKLGHYMKIPPRTMFMAQVVGTLIASFVYLGTAWWLL  575

Query  406   TTVENICNPSKLPEGSQWTCPGDDVFYNASIIWGVVSPRRMFGNLGIYQATNYFFLVGFL  227
              T+ +IC+ S+    S WTCP D VFY+AS+IWG++ PRR+FG+LG Y + N+FF+VG +
Sbjct  576   ETIPDICSSSQ----SFWTCPSDRVFYDASVIWGLIGPRRIFGDLGFYSSVNWFFVVGAI  631

Query  226   APIPVWYLGRKYPEKRWVSLINMPILISGAEGIPIVKSVNYVCWFAVGLYFNLYVYRKHK  47
             AP+ VW   + +P+  W+ LINMP+LI     +P   +VNY+ W  VG      VYR   
Sbjct  632   APVLVWLAIKAFPQHEWIKLINMPVLIGATGYMPPATAVNYITWILVGFLSGFVVYRYKP  691

Query  46    GWWARHNYILSAGLD  2
              WW RHNY+LS  LD
Sbjct  692   EWWKRHNYVLSGALD  706



>ref|NP_192815.1| oligopeptide transporter 7 [Arabidopsis thaliana]
 sp|O82485.1|OPT7_ARATH RecName: Full=Oligopeptide transporter 7; Short=AtOPT7 [Arabidopsis 
thaliana]
 gb|AAC35527.1| similar to Schizosaccharomyces pombe isp4 protein (GB:D14061) 
[Arabidopsis thaliana]
 emb|CAB81178.1| putative oligopeptide transporter [Arabidopsis thaliana]
 gb|AAK74026.1| AT4g10770/T12H20_7 [Arabidopsis thaliana]
 gb|AAO42765.1| At4g10770/T12H20_7 [Arabidopsis thaliana]
 gb|AEE82927.1| oligopeptide transporter 7 [Arabidopsis thaliana]
Length=766

 Score =   713 bits (1841),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 360/667 (54%), Positives = 492/667 (74%), Gaps = 6/667 (1%)
 Frame = -1

Query  2002  SPVEEVRLTVPITDDPTMPCVTFRTWVLGVTSCVILAFLNQFFGYRQNALYVSSVPAQIV  1823
             SP+ +V LTVP TDDP++P +TFR WVLG  SC++L+FLNQFF YR   L +S++ AQI 
Sbjct  55    SPIRQVALTVPTTDDPSLPVLTFRMWVLGTLSCILLSFLNQFFWYRTEPLTISAISAQIA  114

Query  1822  VLPMGKLMAAYLPTKVVQIPGTKWSFSLNPGPFNIKEHVLITIFASSGSDFSYAVSIITM  1643
             V+P+G+LMAA +  +V    G+KW F+LNPGPFN+KEHVLITIFA++G+   YA+ ++T+
Sbjct  115   VVPLGRLMAAKITDRVF-FQGSKWQFTLNPGPFNVKEHVLITIFANAGAGSVYAIHVVTV  173

Query  1642  MKAFYYRDIHPLAAVLLTFSTQMLGYGLAGIFKKFLIDSPYMWWPSNLVQVSLFRALHDV  1463
             +KAFY ++I    + ++  +TQ+LG+G AGIF+K+L++   MWWP+NLVQVSLFRALH+ 
Sbjct  174   VKAFYMKNITFFVSFIVIVTTQVLGFGWAGIFRKYLVEPAAMWWPANLVQVSLFRALHEK  233

Query  1462  ETRPKGGLTRLQFFIIVLVCSFAYYVVPNYLFPSLTALSLLCWIWKNSVTAQQlgsglkg  1283
             E R KGGLTR QFF+I  VCSFAYYV P YLF  +T+LS +CW + +SV AQQ+GSGL G
Sbjct  234   EERTKGGLTRTQFFVIAFVCSFAYYVFPGYLFQIMTSLSWVCWFFPSSVMAQQIGSGLHG  293

Query  1282  lgigSFALDWATVAAFQGSPLVTPDFAIINMLIGYVLVAYIAIPVWYWTNLFDAKKFPLF  1103
             LG+G+  LDW+T++++ GSPL +P FA  N+ +G+VLV Y+ +P+ YW +++ AK FP+F
Sbjct  294   LGVGAIGLDWSTISSYLGSPLASPWFATANVGVGFVLVIYVLVPICYWLDVYKAKTFPIF  353

Query  1102  SSNVFDSNGQVYNISRVLNKKTFGFDQPGYDSYSNIYLSTAFVYTYGLSFATLAATVSHV  923
             SS++F S G  YNI+ +++   F  D P Y+    +YL T F  +YG+ FA L+AT+ HV
Sbjct  354   SSSLFSSQGSKYNITSIIDSN-FHLDLPAYERQGPLYLCTFFAISYGVGFAALSATIMHV  412

Query  922   ALFHGRTIWEQTKESVQDKFSDIHTRLMRKNYEPVPQWWFYlllviivgvalvACQRFGG  743
             ALFHGR IWEQ+KES ++K  D+H RLM++ Y+ VP+WWF+ +LV  VG  + AC+ +  
Sbjct  413   ALFHGREIWEQSKESFKEKKLDVHARLMQR-YKQVPEWWFWCILVTNVGATIFACEYYND  471

Query  742   QLQLPVWGVLLAVLLSLIFTLPVGVITATTNQQTGLNVIAELIIGYMYPGRPLASVTFKM  563
             QLQLP WGVLLA  +++IFTLP+G+ITA TNQ  GLN+I E IIGY+YPG P+A++ FK+
Sbjct  472   QLQLPWWGVLLACTVAIIFTLPIGIITAITNQAPGLNIITEYIIGYIYPGYPVANMCFKV  531

Query  562   YGlsslsqslmflSDFKLGHYMKIPPKSMFMVQLVGTLISCCVHFGTGWWLLTTVENICN  383
             YG  S+ Q++ FL DFKLGHYMKIPP++MFM Q+VGTLISC V+  T WWL+ T+ NIC+
Sbjct  532   YGYISMQQAITFLQDFKLGHYMKIPPRTMFMAQIVGTLISCFVYLTTAWWLMETIPNICD  591

Query  382   PSKLPEGSQWTCPGDDVFYNASIIWGVVSPRRMFGNLGIYQATNYFFLVGFLAPIPVWYL  203
                    S WTCP D VFY+AS+IWG++ PRR+FG+LG+Y++ N+FFLVG +API VW  
Sbjct  592   SVT---NSVWTCPSDKVFYDASVIWGLIGPRRIFGDLGLYKSVNWFFLVGAIAPILVWLA  648

Query  202   GRKYPEKRWVSLINMPILISGAEGIPIVKSVNYVCWFAVGLYFNLYVYRKHKGWWARHNY  23
              R +P + W+ LINMP+LIS    +P   +VNY  W   G      V+R     W R+NY
Sbjct  649   SRMFPRQEWIKLINMPVLISATSSMPPATAVNYTTWVLAGFLSGFVVFRYRPNLWQRYNY  708

Query  22    ILSAGLD  2
             +LS  LD
Sbjct  709   VLSGALD  715



>ref|XP_003628537.1| Oligopeptide transporter [Medicago truncatula]
 gb|AET03013.1| oligopeptide transporter OPT family protein [Medicago truncatula]
Length=739

 Score =   712 bits (1838),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 353/687 (51%), Positives = 488/687 (71%), Gaps = 2/687 (0%)
 Frame = -1

Query  2062  H*MENTGISAVESSADEINDSPVEEVRLTVPITDDPTMPCVTFRTWVLGVTSCVILAFLN  1883
             H ++   I   +++     +SP+E+V LTVP+TDDP++P  TFRTW LG  +CV+L+FLN
Sbjct  5     HEIKEALIKNSDATRSNGENSPIEQVALTVPVTDDPSLPVFTFRTWTLGTLACVLLSFLN  64

Query  1882  QFFGYRQNALYVSSVPAQIVVLPMGKLMAAYLPTKVVQIPGTKWSFSLNPGPFNIKEHVL  1703
             QFFG+R+  L V+++ AQI V+P+G LMA+ + TK V + G KW F+LNPG FN+KEHVL
Sbjct  65    QFFGFRREPLSVTAISAQIAVVPLGHLMASTI-TKRVFMKGKKWEFTLNPGKFNVKEHVL  123

Query  1702  ITIFASSGSDFSYAVSIITMMKAFYYRDIHPLAAVLLTFSTQMLGYGLAGIFKKFLIDSP  1523
             ITIFASSG+   YA+  ++ +K FY ++I  L A+L+  +TQ+LG+G AG+F+++L++  
Sbjct  124   ITIFASSGAASVYAIHFVSTVKVFYRKEITVLVALLVVLTTQVLGFGWAGVFRRYLVEPA  183

Query  1522  YMWWPSNLVQVSLFRALHDVETRPKGGLTRLQFFIIVLVCSFAYYVVPNYLFPSLTALSL  1343
              MWWP NLVQVSLFRALH+ E R KGGLTR QFF+I  +CSFAYYV+P YLFP LT+LS 
Sbjct  184   GMWWPQNLVQVSLFRALHEKEERQKGGLTRNQFFLITFICSFAYYVLPGYLFPMLTSLSW  243

Query  1342  LCWIWKNSVTAQQlgsglkglgigSFALDWATVAAFQGSPLVTPDFAIINMLIGYVLVAY  1163
             +CW++ NS+ AQQLGSGL GLG+G+   DW+++ ++ GSPL +P FA  N+  G+ +  Y
Sbjct  244   ICWVFPNSIIAQQLGSGLHGLGVGAIGFDWSSICSYLGSPLASPWFATANIAAGFGIFMY  303

Query  1162  IAIPVWYWTNLFDAKKFPLFSSNVFDSNGQVYNISRVLNKKTFGFDQPGYDSYSNIYLST  983
             + +P+ Y  NL+  + FP+FS  +F++NGQ YNIS +++   F  D   Y     +YLST
Sbjct  304   VVVPIAYGLNLYHGRSFPIFSDGLFNTNGQEYNISAIIDSN-FHLDLDAYQREGPLYLST  362

Query  982   AFVYTYGLSFATLAATVSHVALFHGRTIWEQTKESVQDKFSDIHTRLMRKNYEPVPQWWF  803
              F  +YG+ FA L+A + HV LFHG  I + +K + Q K  DIHT++MRK+Y+ VP+WWF
Sbjct  363   MFAMSYGIDFACLSAILVHVLLFHGSDILQLSKSAFQGKEIDIHTKIMRKHYKQVPEWWF  422

Query  802   YlllviivgvalvACQRFGGQLQLPVWGVLLAVLLSLIFTLPVGVITATTNQQTGLNVIA  623
             + +L+  +  +   C+ +  QLQLP WGV+LA +L+L FTLPVGVI ATTNQ   LNVI 
Sbjct  423   FCILLFSITASTFVCEYYNDQLQLPWWGVMLACILALSFTLPVGVIRATTNQAPALNVIT  482

Query  622   ELIIGYMYPGRPLASVTFKMYGlsslsqslmflSDFKLGHYMKIPPKSMFMVQLVGTLIS  443
             E IIGY+YPG P+A + FK+ G  S+ Q++ FL DFKLGHYMKIPP++MF+ Q++GT+I+
Sbjct  483   EYIIGYIYPGYPVAVMLFKVIGNVSMKQAIFFLQDFKLGHYMKIPPRAMFLAQVLGTIIA  542

Query  442   CCVHFGTGWWLLTTVENICNPSKLPEGSQWTCPGDDVFYNASIIWGVVSPRRMFGNLGIY  263
               VH  T WWL+ TV NIC+   LP GS WTCPGD VFY++S++WG++ PRR+FGNLG Y
Sbjct  543   AIVHLLTAWWLIETVPNICHRELLPAGSPWTCPGDHVFYDSSVVWGLIGPRRIFGNLGHY  602

Query  262   QATNYFFLVGFLAPIPVWYLGRKYPEKRWVSLINMPILISGAEGIPIVKSVNYVCWFAVG  83
              A N+FFLVG +AP  VW   +  P+K+W+ LI MP+++     +P    VNY  W  VG
Sbjct  603   SAINWFFLVGAVAPFIVWLAHKALPDKQWIKLITMPVILGALTEMPPATPVNYTSWVLVG  662

Query  82    LYFNLYVYRKHKGWWARHNYILSAGLD  2
                    YR ++GWW RHNY+LS  LD
Sbjct  663   FASGFVAYRYYRGWWTRHNYVLSGALD  689



>ref|NP_001056651.1| Os06g0125500 [Oryza sativa Japonica Group]
 gb|AAO17308.1|AF393848_1 glutathione transporter [Oryza sativa Japonica Group]
 dbj|BAF18565.1| Os06g0125500 [Oryza sativa Japonica Group]
 gb|EAY99477.1| hypothetical protein OsI_21445 [Oryza sativa Indica Group]
 gb|EAZ35667.1| hypothetical protein OsJ_19953 [Oryza sativa Japonica Group]
Length=766

 Score =   713 bits (1841),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 359/711 (50%), Positives = 490/711 (69%), Gaps = 6/711 (1%)
 Frame = -1

Query  2125  NLRDTRERVSSFKNSSLSRLLH*MENTGISAVESSADEINDSPVEEVRLTVPITDDPTMP  1946
             +++  RE      +     +   +     S       E  +SPVE V LTVP++D+P  P
Sbjct  8     SVQQAREEEEELDHHGDPMITSPLLRPSTSGSSPENGEEENSPVELVALTVPVSDEPETP  67

Query  1945  CVTFRTWVLGVTSCVILAFLNQFFGYRQNALYVSSVPAQIVVLPMGKLMAAYLPTKVVQI  1766
              +TFR WVLG  SC +L+FLNQFF YR+  L ++++ AQI V+P+G+LMAA LP      
Sbjct  68    VLTFRMWVLGTASCAVLSFLNQFFWYRKEPLTITAISAQIAVVPLGRLMAATLPEHAF-F  126

Query  1765  PGTKWSFSLNPGPFNIKEHVLITIFASSGSDFSYAVSIITMMKAFYYRDIHPLAAVLLTF  1586
              G  W F+LNPGPFN+KEHVLITIFA+SG+   YA+ +IT ++ FY + +    ++L+  
Sbjct  127   RGRPWEFTLNPGPFNVKEHVLITIFANSGAGTVYAIHVITGVRVFYGKTLSFFISLLVVL  186

Query  1585  STQ---MLGYGLAGIFKKFLIDSPYMWWPSNLVQVSLFRALHDVETRPKGGLTRLQFFII  1415
             +TQ   MLG+G AGIF+++L++   MWWPSNLVQVSLF ALH+ E R KGGLTR QFF++
Sbjct  187   TTQYHQMLGFGWAGIFRRYLVEPASMWWPSNLVQVSLFSALHEKEARRKGGLTRNQFFLV  246

Query  1414  VLVCSFAYYVVPNYLFPSLTALSLLCWIWKNSVTAQQlgsglkglgigSFALDWATVAAF  1235
               VCSFAYY+ P YLF  LT+LS +CW++ +SV AQQLGSGL+GLG+G+  LDW++++++
Sbjct  247   AFVCSFAYYIFPGYLFQMLTSLSWICWVFPSSVLAQQLGSGLRGLGVGAIGLDWSSISSY  306

Query  1234  QGSPLVTPDFAIINMLIGYVLVAYIAIPVWYWTNLFDAKKFPLFSSNVFDSNGQVYNISR  1055
              GSPL +P FA +N+ +G+ +V YI  P+ YW N + A+ FP+FS  +F S GQ YN+S 
Sbjct  307   LGSPLASPWFATVNVGVGFFIVMYIITPIAYWFNFYKAQNFPIFSDGLFTSTGQKYNVSS  366

Query  1054  VLNKKTFGFDQPGYDSYSNIYLSTAFVYTYGLSFATLAATVSHVALFHGRTIWEQTKESV  875
             +++   F FD   Y+    +YLST+ + TYG+ FATLAAT+ H  LFHG  IW  +K + 
Sbjct  367   IVDSH-FHFDTKAYEKNGPLYLSTSLLVTYGVGFATLAATIVHALLFHGSEIWLLSKSAF  425

Query  874   QDKFSDIHTRLMRKNYEPVPQWWFYlllviivgvalvACQRFGGQLQLPVWGVLLAVLLS  695
             Q+K  DIHT+LMR+ Y+ VP+WWF  +L+  +G  + AC+ +  +LQLP WGVL A  ++
Sbjct  426   QEKRMDIHTKLMRR-YKQVPEWWFICILIANIGTTIFACEYYNEELQLPWWGVLFACSIA  484

Query  694   LIFTLPVGVITATTNQQTGLNVIAELIIGYMYPGRPLASVTFKMYGlsslsqslmflSDF  515
               FTLP+G+I ATTNQ  GLNVI E IIGY+YPGRP+A++ FK+YG  S+ Q+L FL DF
Sbjct  485   FFFTLPIGIIKATTNQTPGLNVITEYIIGYLYPGRPVANMCFKVYGYISMKQALAFLEDF  544

Query  514   KLGHYMKIPPKSMFMVQLVGTLISCCVHFGTGWWLLTTVENICNPSKLPEGSQWTCPGDD  335
             KLGHYMKIPP++MFM Q+VGT I+  V+ GT WWL+ T+ NICN   LP  S WTCPGD 
Sbjct  545   KLGHYMKIPPRTMFMAQVVGTSIAAFVYIGTAWWLMETIPNICNTELLPSDSPWTCPGDH  604

Query  334   VFYNASIIWGVVSPRRMFGNLGIYQATNYFFLVGFLAPIPVWYLGRKYPEKRWVSLINMP  155
             VFY+AS+ WG++SPRR+FG+LG Y A N+FFL G +AP+ VW+  + +P + W+ LI  P
Sbjct  605   VFYDASVTWGLISPRRIFGDLGTYSALNWFFLCGAIAPLLVWFAHKTFPGQNWILLIKTP  664

Query  154   ILISGAEGIPIVKSVNYVCWFAVGLYFNLYVYRKHKGWWARHNYILSAGLD  2
             +LI     +P   +VNY  W  VG      VYR  + WW RHNY+LS  LD
Sbjct  665   VLIGATFQMPPATAVNYTTWILVGFLSGYVVYRYRRDWWERHNYLLSGALD  715



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 6947806009864