BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c25593_g1_i3 len=780 path=[3496:0-155 3652:156-178 1386:179-215
4254:216-234 1270:235-238 1274:239-265 3258:266-276 1482:277-303
4319:304-312 3746:313-397 1601:398-404 364:405-448 4351:449-451
577:452-496 622:497-505 1100:506-543 4384:544-544 690:545-562
708:563-565 872:566-606 1794:607-609 1797:610-620 1037:621-657
148:658-779]

Length=780
                                                                      Score     E

ref|XP_009762711.1|  PREDICTED: probable polygalacturonase isofor...    343   3e-112   
ref|XP_009762710.1|  PREDICTED: probable polygalacturonase isofor...    343   5e-112   
emb|CDP20376.1|  unnamed protein product                                341   3e-111   
ref|XP_009767883.1|  PREDICTED: probable polygalacturonase              340   4e-111   
ref|XP_006339619.1|  PREDICTED: probable polygalacturonase-like         338   2e-110   
gb|KDO86269.1|  hypothetical protein CISIN_1g0090751mg                  329   1e-109   
ref|XP_009599786.1|  PREDICTED: probable polygalacturonase isofor...    336   2e-109   
ref|XP_006345581.1|  PREDICTED: probable polygalacturonase-like i...    335   4e-109   
ref|XP_009599780.1|  PREDICTED: probable polygalacturonase isofor...    335   4e-109   
ref|XP_006345582.1|  PREDICTED: probable polygalacturonase-like i...    335   5e-109   
ref|XP_004229920.2|  PREDICTED: probable polygalacturonase              335   6e-109   
ref|XP_003528838.1|  PREDICTED: probable polygalacturonase              334   1e-108   
gb|KHN26934.1|  Putative polygalacturonase                              334   1e-108   
ref|XP_007144550.1|  hypothetical protein PHAVU_007G165300g             333   2e-108   
ref|XP_009624373.1|  PREDICTED: probable polygalacturonase              333   3e-108   
ref|XP_004240097.1|  PREDICTED: probable polygalacturonase              333   4e-108   
ref|XP_006491165.1|  PREDICTED: probable polygalacturonase-like         332   6e-108   
ref|XP_003548644.2|  PREDICTED: probable polygalacturonase-like i...    332   8e-108   
ref|XP_006598941.1|  PREDICTED: probable polygalacturonase-like i...    332   8e-108   
gb|KHN46704.1|  Putative polygalacturonase                              332   1e-107   
ref|XP_006444979.1|  hypothetical protein CICLE_v10019597mg             333   1e-107   
ref|XP_011092828.1|  PREDICTED: probable polygalacturonase              332   2e-107   
ref|XP_006386609.1|  hypothetical protein POPTR_0002s16390g             323   8e-106   
gb|AAP33475.1|  polygalacturonase-like protein                          327   8e-106   Fragaria x ananassa
ref|XP_004306749.1|  PREDICTED: probable polygalacturonase-like         327   8e-106   
gb|KHG15709.1|  hypothetical protein F383_10492                         326   2e-105   
ref|XP_002278930.1|  PREDICTED: probable polygalacturonase              326   2e-105   Vitis vinifera
gb|KHG15710.1|  hypothetical protein F383_10492                         326   2e-105   
gb|KDP28587.1|  hypothetical protein JCGZ_14358                         326   2e-105   
ref|XP_003552411.1|  PREDICTED: probable polygalacturonase              325   3e-105   
ref|XP_002301370.1|  polygalacturonase-like family protein              325   5e-105   Populus trichocarpa [western balsam poplar]
gb|ABG34276.1|  polygalacturonase                                       316   6e-105   Eucalyptus globulus subsp. globulus
ref|XP_003533597.1|  PREDICTED: probable polygalacturonase-like         323   2e-104   
ref|XP_011022627.1|  PREDICTED: probable polygalacturonase              323   2e-104   
ref|XP_011029346.1|  PREDICTED: probable polygalacturonase              323   3e-104   
ref|XP_002303605.2|  hypothetical protein POPTR_0003s13160g             322   4e-104   Populus trichocarpa [western balsam poplar]
ref|XP_007139799.1|  hypothetical protein PHAVU_008G059700g             322   5e-104   
ref|XP_003624048.1|  Polygalacturonase                                  322   5e-104   
ref|XP_011023292.1|  PREDICTED: probable polygalacturonase isofor...    322   5e-104   
ref|XP_011023291.1|  PREDICTED: probable polygalacturonase isofor...    322   6e-104   
gb|AFK43011.1|  unknown                                                 322   9e-104   
ref|XP_004503680.1|  PREDICTED: probable polygalacturonase-like i...    320   2e-103   
ref|XP_002299511.1|  hypothetical protein POPTR_0001s09790g             321   2e-103   Populus trichocarpa [western balsam poplar]
emb|CDP12065.1|  unnamed protein product                                320   2e-103   
ref|XP_010053221.1|  PREDICTED: probable polygalacturonase              320   5e-103   
ref|XP_004492778.1|  PREDICTED: probable polygalacturonase-like         320   5e-103   
ref|XP_007051731.1|  Polygalacturonase, putative isoform 1              319   9e-103   
ref|XP_007051732.1|  Polygalacturonase, putative isoform 2              319   9e-103   
ref|XP_007219266.1|  hypothetical protein PRUPE_ppa018224mg             318   1e-102   
ref|XP_008232996.1|  PREDICTED: LOW QUALITY PROTEIN: probable pol...    318   1e-102   
ref|XP_004133855.1|  PREDICTED: probable polygalacturonase-like         319   1e-102   
ref|XP_003633958.1|  PREDICTED: probable polygalacturonase              318   2e-102   
sp|A7PZL3.1|PGLR_VITVI  RecName: Full=Probable polygalacturonase;...    319   2e-102   Vitis vinifera
ref|XP_004172137.1|  PREDICTED: probable polygalacturonase-like         319   2e-102   
ref|XP_008343414.1|  PREDICTED: probable polygalacturonase              318   2e-102   
gb|AFK37962.1|  unknown                                                 317   7e-102   
ref|XP_008438007.1|  PREDICTED: probable polygalacturonase              317   1e-101   
gb|KEH21119.1|  polygalacturonase/glycoside hydrolase family protein    316   1e-101   
gb|KHN26935.1|  Putative polygalacturonase                              313   1e-101   
gb|ABG34277.1|  polygalacturonase                                       308   1e-101   Eucalyptus globulus subsp. globulus
ref|XP_007040335.1|  Pectin lyase-like superfamily protein isoform 1    315   3e-101   
gb|KHN16795.1|  Putative polygalacturonase                              313   3e-101   
gb|ABG34275.1|  polygalacturonase                                       306   4e-101   Eucalyptus globulus subsp. globulus
ref|XP_004295492.1|  PREDICTED: probable polygalacturonase-like         316   4e-101   
ref|XP_009349812.1|  PREDICTED: probable polygalacturonase              315   4e-101   
ref|XP_004503678.1|  PREDICTED: probable polygalacturonase-like i...    315   7e-101   
ref|XP_003529926.1|  PREDICTED: probable polygalacturonase-like         315   7e-101   
gb|EYU35105.1|  hypothetical protein MIMGU_mgv1a005694mg                313   9e-101   
ref|XP_002509850.1|  polygalacturonase, putative                        314   9e-101   Ricinus communis
ref|XP_007160099.1|  hypothetical protein PHAVU_002G292300g             313   2e-100   
gb|AFK44529.1|  unknown                                                 313   2e-100   
ref|XP_006584731.1|  PREDICTED: probable polygalacturonase-like i...    313   4e-100   
ref|XP_003532926.1|  PREDICTED: probable polygalacturonase-like i...    313   4e-100   
gb|KHM99951.1|  Putative polygalacturonase                              310   5e-100   
ref|XP_003622464.1|  Polygalacturonase-like protein                     311   7e-100   
ref|XP_006580552.1|  PREDICTED: probable polygalacturonase-like i...    311   1e-99    
ref|XP_010055091.1|  PREDICTED: probable polygalacturonase isofor...    311   2e-99    
ref|XP_010055092.1|  PREDICTED: probable polygalacturonase isofor...    310   2e-99    
ref|XP_009345122.1|  PREDICTED: probable polygalacturonase              310   2e-99    
ref|XP_010055093.1|  PREDICTED: probable polygalacturonase              310   2e-99    
ref|XP_010523769.1|  PREDICTED: probable polygalacturonase isofor...    310   3e-99    
ref|XP_003525377.2|  PREDICTED: probable polygalacturonase-like i...    310   3e-99    
ref|XP_010413390.1|  PREDICTED: probable polygalacturonase              310   3e-99    
ref|XP_004510753.1|  PREDICTED: probable polygalacturonase-like         310   5e-99    
gb|EPS72197.1|  hypothetical protein M569_02558                         308   6e-99    
gb|KHG23155.1|  putative polygalacturonase                              307   1e-98    
ref|XP_008238946.1|  PREDICTED: probable polygalacturonase              308   1e-98    
ref|XP_004298828.1|  PREDICTED: probable polygalacturonase-like         309   2e-98    
ref|XP_010469084.1|  PREDICTED: probable polygalacturonase              308   2e-98    
ref|XP_010523770.1|  PREDICTED: probable polygalacturonase isofor...    307   3e-98    
ref|XP_010089055.1|  putative polygalacturonase                         307   3e-98    
ref|XP_007209970.1|  hypothetical protein PRUPE_ppa004996mg             307   4e-98    
ref|XP_002876618.1|  glycoside hydrolase family 28 protein              306   5e-98    
ref|XP_006291035.1|  hypothetical protein CARUB_v10017147mg             306   6e-98    
gb|KDP25392.1|  hypothetical protein JCGZ_20548                         306   6e-98    
ref|XP_009116814.1|  PREDICTED: probable polygalacturonase              306   6e-98    
ref|NP_191708.1|  polygalacturonase-like protein                        306   6e-98    Arabidopsis thaliana [mouse-ear cress]
ref|XP_006402475.1|  hypothetical protein EUTSA_v10005939mg             306   6e-98    
ref|XP_009604283.1|  PREDICTED: probable polygalacturonase              305   2e-97    
emb|CDY65355.1|  BnaC08g49000D                                          305   3e-97    
ref|XP_010089056.1|  putative polygalacturonase                         304   3e-97    
ref|XP_009793070.1|  PREDICTED: probable polygalacturonase              305   4e-97    
ref|XP_002511903.1|  polygalacturonase, putative                        304   6e-97    Ricinus communis
emb|CDY48913.1|  BnaA09g39240D                                          304   6e-97    
ref|XP_010530415.1|  PREDICTED: probable polygalacturonase              303   7e-97    
ref|XP_010255225.1|  PREDICTED: probable polygalacturonase isofor...    302   3e-96    
ref|XP_006439488.1|  hypothetical protein CICLE_v10019941mg             302   4e-96    
ref|XP_010255224.1|  PREDICTED: probable polygalacturonase isofor...    302   5e-96    
ref|XP_010255223.1|  PREDICTED: probable polygalacturonase isofor...    302   9e-96    
ref|XP_006343936.1|  PREDICTED: probable polygalacturonase-like         300   2e-95    
gb|KDO76318.1|  hypothetical protein CISIN_1g011659mg                   300   2e-95    
gb|EYU23462.1|  hypothetical protein MIMGU_mgv1a006147mg                298   9e-95    
ref|XP_006476506.1|  PREDICTED: probable polygalacturonase-like         298   1e-94    
ref|XP_010676424.1|  PREDICTED: probable polygalacturonase              298   1e-94    
ref|XP_004245570.1|  PREDICTED: probable polygalacturonase              298   1e-94    
gb|AES62452.2|  pectin lyase superfamily protein                        293   1e-92    
ref|XP_003592201.1|  Polygalacturonase-like protein                     293   1e-92    
ref|XP_010436419.1|  PREDICTED: probable polygalacturonase              288   2e-92    
gb|EPS71449.1|  hypothetical protein M569_03308                         290   6e-92    
emb|CDY70893.1|  BnaCnng70190D                                          287   7e-92    
ref|XP_010448699.1|  PREDICTED: probable polygalacturonase              291   1e-91    
emb|CDY69255.1|  BnaAnng29830D                                          287   1e-91    
ref|XP_010941157.1|  PREDICTED: probable polygalacturonase              290   2e-91    
ref|XP_006283603.1|  hypothetical protein CARUB_v10004660mg             290   2e-91    
ref|XP_007038809.1|  Pectin lyase-like superfamily protein isoform 2    290   2e-91    
ref|XP_007038808.1|  Pectin lyase-like superfamily protein isoform 1    289   2e-91    
ref|XP_009363435.1|  PREDICTED: probable polygalacturonase              289   2e-91    
ref|XP_010439166.1|  PREDICTED: probable polygalacturonase              290   2e-91    
ref|XP_010276903.1|  PREDICTED: probable polygalacturonase isofor...    288   4e-91    
ref|XP_006413548.1|  hypothetical protein EUTSA_v10025011mg             290   4e-91    
ref|XP_002869777.1|  glycoside hydrolase family 28 protein              289   6e-91    
ref|XP_006422033.1|  hypothetical protein CICLE_v10004864mg             288   6e-91    
ref|XP_009137356.1|  PREDICTED: probable polygalacturonase              289   7e-91    
ref|XP_009607671.1|  PREDICTED: probable polygalacturonase              288   1e-90    
ref|XP_010276902.1|  PREDICTED: probable polygalacturonase isofor...    288   1e-90    
ref|XP_010276899.1|  PREDICTED: probable polygalacturonase isofor...    288   1e-90    
ref|XP_008794778.1|  PREDICTED: probable polygalacturonase isofor...    288   2e-90    
ref|XP_008794781.1|  PREDICTED: probable polygalacturonase isofor...    287   2e-90    
ref|XP_009137085.1|  PREDICTED: probable polygalacturonase              288   2e-90    
ref|XP_008794777.1|  PREDICTED: probable polygalacturonase isofor...    288   2e-90    
ref|XP_008794779.1|  PREDICTED: probable polygalacturonase isofor...    287   2e-90    
ref|NP_194081.1|  putative polygalacturonase                            287   2e-90    Arabidopsis thaliana [mouse-ear cress]
ref|XP_010276919.1|  PREDICTED: probable polygalacturonase              290   3e-90    
ref|XP_009772512.1|  PREDICTED: probable polygalacturonase              285   8e-90    
gb|KFK28901.1|  hypothetical protein AALP_AA7G062800                    286   1e-89    
ref|XP_008810120.1|  PREDICTED: probable polygalacturonase isofor...    284   1e-89    
ref|XP_009395433.1|  PREDICTED: probable polygalacturonase isofor...    286   1e-89    
ref|XP_008780530.1|  PREDICTED: probable polygalacturonase              276   1e-89    
ref|XP_009395434.1|  PREDICTED: probable polygalacturonase isofor...    285   2e-89    
ref|XP_003592200.1|  Polygalacturonase-like protein                     284   3e-89    
ref|XP_009383010.1|  PREDICTED: probable polygalacturonase              280   4e-89    
ref|XP_008810119.1|  PREDICTED: probable polygalacturonase isofor...    284   4e-89    
emb|CDY44105.1|  BnaA01g13130D                                          283   4e-89    
gb|AFW04075.1|  polygalacturonase                                       284   5e-89    
gb|KHN42438.1|  Putative polygalacturonase                              283   6e-89    
ref|XP_003533980.1|  PREDICTED: probable polygalacturonase-like         283   9e-89    
ref|XP_004496830.1|  PREDICTED: probable polygalacturonase-like         282   1e-88    
ref|XP_004496829.1|  PREDICTED: probable polygalacturonase-like         283   1e-88    
ref|XP_003592197.1|  Endo-polygalacturonase-like protein                282   1e-88    
gb|KDP22229.1|  hypothetical protein JCGZ_26060                         282   1e-88    
ref|XP_011035342.1|  PREDICTED: probable polygalacturonase              282   2e-88    
ref|XP_007152185.1|  hypothetical protein PHAVU_004G108800g             282   2e-88    
ref|XP_007151452.1|  hypothetical protein PHAVU_004G047700g             281   3e-88    
ref|XP_007151453.1|  hypothetical protein PHAVU_004G047800g             281   4e-88    
ref|XP_008796910.1|  PREDICTED: probable polygalacturonase              281   5e-88    
gb|EMS49882.1|  putative polygalacturonase                              278   6e-88    
ref|XP_002305262.1|  glycoside hydrolase family 28 family protein       279   7e-88    Populus trichocarpa [western balsam poplar]
gb|KHG19694.1|  putative polygalacturonase                              280   8e-88    
gb|KHN21785.1|  Putative polygalacturonase                              280   8e-88    
gb|KHN21786.1|  Putative polygalacturonase                              279   1e-87    
ref|XP_003536450.1|  PREDICTED: probable polygalacturonase-like         280   2e-87    
gb|KHN21784.1|  Putative polygalacturonase                              279   2e-87    
ref|XP_010934935.1|  PREDICTED: probable polygalacturonase              279   2e-87    
ref|XP_006589526.1|  PREDICTED: probable polygalacturonase-like i...    279   2e-87    
ref|XP_003535598.1|  PREDICTED: probable polygalacturonase-like         279   2e-87    
ref|XP_003535597.1|  PREDICTED: probable polygalacturonase-like i...    279   2e-87    
ref|XP_010024977.1|  PREDICTED: probable polygalacturonase              278   4e-87    
ref|XP_002513653.1|  polygalacturonase, putative                        278   4e-87    Ricinus communis
ref|XP_009382256.1|  PREDICTED: probable polygalacturonase isofor...    279   4e-87    
ref|NP_001240215.1|  uncharacterized protein LOC100785005 precursor     278   5e-87    
ref|XP_008380132.1|  PREDICTED: probable polygalacturonase              278   5e-87    
gb|KCW90638.1|  hypothetical protein EUGRSUZ_A02742                     278   6e-87    
ref|XP_009375527.1|  PREDICTED: probable polygalacturonase              278   8e-87    
ref|XP_003624874.1|  hypothetical protein MTR_7g088550                  278   9e-87    
ref|XP_003592202.1|  hypothetical protein MTR_1g100060                  278   1e-86    
ref|XP_004496831.1|  PREDICTED: probable polygalacturonase-like         277   1e-86    
ref|XP_009377556.1|  PREDICTED: probable polygalacturonase              276   2e-86    
ref|XP_002273669.1|  PREDICTED: probable polygalacturonase              276   4e-86    Vitis vinifera
ref|XP_010230291.1|  PREDICTED: probable polygalacturonase              275   5e-86    
gb|AES62453.2|  pectin lyase superfamily protein                        276   7e-86    
ref|XP_002273177.2|  PREDICTED: probable polygalacturonase              275   7e-86    Vitis vinifera
ref|XP_010933983.1|  PREDICTED: probable polygalacturonase isofor...    275   9e-86    
ref|XP_010933982.1|  PREDICTED: probable polygalacturonase isofor...    276   1e-85    
ref|XP_009382257.1|  PREDICTED: probable polygalacturonase isofor...    275   1e-85    
ref|XP_009368731.1|  PREDICTED: probable polygalacturonase              275   1e-85    
dbj|BAK02492.1|  predicted protein                                      271   2e-85    
ref|XP_006829063.1|  hypothetical protein AMTR_s00001p00258260          275   2e-85    
ref|XP_008376628.1|  PREDICTED: probable polygalacturonase              274   3e-85    
ref|XP_006656549.1|  PREDICTED: probable polygalacturonase-like         274   3e-85    
ref|NP_001048813.1|  Os03g0124900                                       273   3e-85    Oryza sativa Japonica Group [Japonica rice]
gb|AFK49026.1|  unknown                                                 271   3e-85    
ref|XP_008437531.1|  PREDICTED: probable polygalacturonase              273   5e-85    
ref|XP_011046019.1|  PREDICTED: probable polygalacturonase              273   5e-85    
ref|XP_011076107.1|  PREDICTED: probable polygalacturonase              272   2e-84    
ref|XP_004513187.1|  PREDICTED: probable polygalacturonase-like         272   2e-84    
ref|NP_190464.1|  pectin lyase-like superfamily protein                 271   3e-84    Arabidopsis thaliana [mouse-ear cress]
ref|XP_004234221.1|  PREDICTED: probable polygalacturonase              271   4e-84    
ref|XP_002468601.1|  hypothetical protein SORBIDRAFT_01g048880          270   4e-84    Sorghum bicolor [broomcorn]
ref|XP_006372397.1|  glycoside hydrolase family 28 family protein       270   4e-84    
ref|XP_010317519.1|  PREDICTED: probable polygalacturonase              270   1e-83    
ref|XP_002875935.1|  predicted protein                                  270   1e-83    
dbj|BAD67712.1|  putative polygalacturonase                             270   1e-83    Oryza sativa Japonica Group [Japonica rice]
ref|XP_004298190.1|  PREDICTED: probable polygalacturonase-like         268   2e-83    
gb|KDP22228.1|  hypothetical protein JCGZ_26059                         268   4e-83    
ref|XP_004160401.1|  PREDICTED: LOW QUALITY PROTEIN: probable pol...    268   4e-83    
ref|XP_004985902.1|  PREDICTED: probable polygalacturonase-like         268   4e-83    
ref|XP_004145976.1|  PREDICTED: probable polygalacturonase-like         268   4e-83    
ref|XP_002437680.1|  hypothetical protein SORBIDRAFT_10g000660          269   4e-83    Sorghum bicolor [broomcorn]
gb|KGN49922.1|  hypothetical protein Csa_5G140480                       268   5e-83    
ref|XP_006362679.1|  PREDICTED: probable polygalacturonase-like         269   8e-83    
ref|NP_001151102.1|  glycoside hydrolase, family 28 precursor           267   9e-83    Zea mays [maize]
gb|ACG41831.1|  glycoside hydrolase, family 28                          266   1e-82    Zea mays [maize]
gb|EYU25143.1|  hypothetical protein MIMGU_mgv1a005601mg                267   1e-82    
ref|XP_006292567.1|  hypothetical protein CARUB_v10018803mg             266   2e-82    
ref|NP_001151164.1|  glycoside hydrolase, family 28 precursor           266   4e-82    Zea mays [maize]
gb|AFW75224.1|  glycoside hydrolase, family 28                          266   4e-82    
ref|XP_008229768.1|  PREDICTED: probable polygalacturonase              265   6e-82    
ref|XP_002273143.3|  PREDICTED: probable polygalacturonase              264   7e-82    Vitis vinifera
ref|XP_010426397.1|  PREDICTED: probable polygalacturonase              264   1e-81    
ref|XP_004964293.1|  PREDICTED: probable polygalacturonase-like i...    265   1e-81    
ref|XP_004964294.1|  PREDICTED: probable polygalacturonase-like i...    265   1e-81    
ref|XP_010105745.1|  putative polygalacturonase                         263   2e-81    
ref|XP_008234902.1|  PREDICTED: probable polygalacturonase              263   3e-81    
ref|XP_008234837.1|  PREDICTED: probable polygalacturonase              263   3e-81    
ref|XP_004964295.1|  PREDICTED: probable polygalacturonase-like i...    264   3e-81    
ref|XP_010450744.1|  PREDICTED: probable polygalacturonase              262   6e-81    
ref|XP_006650993.1|  PREDICTED: probable polygalacturonase-like         265   2e-80    
ref|XP_010503541.1|  PREDICTED: probable polygalacturonase              261   2e-80    
ref|XP_010519492.1|  PREDICTED: probable polygalacturonase              261   2e-80    
gb|EMT00190.1|  Putative polygalacturonase                              258   3e-80    
ref|XP_002878707.1|  glycoside hydrolase family 28 protein              259   2e-79    
ref|NP_179968.2|  pectin lyase-like protein                             258   3e-79    Arabidopsis thaliana [mouse-ear cress]
gb|AAC63679.1|  putative polygalacturonase                              258   4e-79    Arabidopsis thaliana [mouse-ear cress]
emb|CDY05885.1|  BnaC08g20620D                                          258   4e-79    
gb|ABK28510.1|  unknown                                                 258   4e-79    Arabidopsis thaliana [mouse-ear cress]
ref|XP_010519488.1|  PREDICTED: probable polygalacturonase isofor...    257   7e-79    
ref|XP_010519487.1|  PREDICTED: probable polygalacturonase isofor...    257   7e-79    
gb|KDP22227.1|  hypothetical protein JCGZ_26058                         257   8e-79    
emb|CDY39678.1|  BnaA04g13950D                                          257   9e-79    
gb|AGZ62594.1|  pollen-specific polygalacturonase                       257   1e-78    
ref|XP_010112958.1|  putative polygalacturonase                         256   1e-78    
dbj|BAJ90091.1|  predicted protein                                      257   1e-78    
ref|XP_009149779.1|  PREDICTED: probable polygalacturonase              256   1e-78    
ref|XP_010228133.1|  PREDICTED: probable polygalacturonase isofor...    257   2e-78    
ref|XP_010228132.1|  PREDICTED: probable polygalacturonase isofor...    257   2e-78    
ref|XP_010671628.1|  PREDICTED: probable polygalacturonase              256   2e-78    
ref|XP_009140503.1|  PREDICTED: probable polygalacturonase              256   3e-78    
emb|CDY20264.1|  BnaC04g36920D                                          256   3e-78    
ref|XP_010550764.1|  PREDICTED: probable polygalacturonase              255   4e-78    
gb|KFK32698.1|  hypothetical protein AALP_AA6G277200                    255   4e-78    
gb|KHN09300.1|  Putative polygalacturonase                              253   7e-78    
emb|CDY08095.1|  BnaA06g16310D                                          255   1e-77    
ref|XP_006295548.1|  hypothetical protein CARUB_v10024654mg             254   1e-77    
ref|XP_006404874.1|  hypothetical protein EUTSA_v10000145mg             254   2e-77    
ref|XP_007215325.1|  hypothetical protein PRUPE_ppa005185mg             254   2e-77    
ref|XP_009393955.1|  PREDICTED: probable polygalacturonase              245   2e-77    
ref|XP_010024966.1|  PREDICTED: probable polygalacturonase              251   7e-77    
ref|XP_010472382.1|  PREDICTED: probable polygalacturonase              253   7e-77    
ref|XP_010541188.1|  PREDICTED: LOW QUALITY PROTEIN: probable pol...    251   1e-76    
gb|ABR18040.1|  unknown                                                 251   2e-76    Picea sitchensis
gb|EMT02659.1|  hypothetical protein F775_52404                         248   2e-75    
ref|XP_010417129.1|  PREDICTED: probable polygalacturonase              248   2e-75    
ref|XP_009149760.1|  PREDICTED: probable polygalacturonase              246   8e-75    
ref|XP_010429342.1|  PREDICTED: probable polygalacturonase              247   8e-75    
emb|CDY05907.1|  BnaC08g20840D                                          244   2e-74    
ref|XP_008366373.1|  PREDICTED: LOW QUALITY PROTEIN: probable pol...    243   2e-74    
emb|CDY08113.1|  BnaA06g16130D                                          244   3e-74    
ref|XP_007217591.1|  hypothetical protein PRUPE_ppa018901mg             239   5e-73    
emb|CBI34379.3|  unnamed protein product                                240   8e-73    
ref|XP_006404169.1|  hypothetical protein EUTSA_v10010343mg             241   1e-72    
ref|XP_010436421.1|  PREDICTED: probable polygalacturonase              238   3e-72    
ref|XP_007219377.1|  hypothetical protein PRUPE_ppa020086mg             240   7e-72    
ref|XP_007143467.1|  hypothetical protein PHAVU_007G074300g             237   2e-71    
gb|KFK34205.1|  hypothetical protein AALP_AA5G114700                    248   2e-71    
gb|KFK34204.1|  hypothetical protein AALP_AA5G114700                    248   3e-71    
gb|EYU25144.1|  hypothetical protein MIMGU_mgv1a023393mg                229   2e-68    
gb|AFK36744.1|  unknown                                                 211   9e-65    
gb|ABG34278.1|  polygalacturonase                                       211   5e-63    
gb|KFK27673.1|  hypothetical protein AALP_AA8G413900                    214   5e-63    
gb|KCW46748.1|  hypothetical protein EUGRSUZ_K00562                     209   1e-60    
ref|XP_010035373.1|  PREDICTED: probable polygalacturonase              209   2e-60    
ref|XP_006404198.1|  hypothetical protein EUTSA_v10011050mg             207   7e-60    
emb|CDX67875.1|  BnaA07g19150D                                          206   2e-59    
ref|XP_009104364.1|  PREDICTED: probable polygalacturonase              206   3e-59    
ref|XP_008227776.1|  PREDICTED: probable polygalacturonase              206   4e-59    
gb|KEH24447.1|  polygalacturonase/glycoside hydrolase family protein    204   2e-58    
ref|XP_003626072.1|  Polygalacturonase                                  204   2e-58    
emb|CDY25090.1|  BnaC06g18320D                                          203   3e-58    
ref|XP_010413306.1|  PREDICTED: probable polygalacturonase              201   2e-57    
emb|CDY11403.1|  BnaA09g39690D                                          200   4e-57    
ref|XP_009116889.1|  PREDICTED: probable polygalacturonase              200   4e-57    
ref|XP_002876663.1|  glycoside hydrolase family 28 protein              200   6e-57    
ref|XP_010241442.1|  PREDICTED: probable polygalacturonase isofor...    197   8e-57    
ref|XP_002875985.1|  glycoside hydrolase family 28 protein              199   8e-57    
ref|XP_007221479.1|  hypothetical protein PRUPE_ppa005310mg             199   1e-56    
ref|NP_567126.1|  pectin lyase-like superfamily protein                 199   2e-56    
emb|CAB71871.1|  putative protein                                       198   2e-56    
ref|XP_010512598.1|  PREDICTED: probable polygalacturonase isofor...    198   3e-56    
ref|XP_010241441.1|  PREDICTED: probable polygalacturonase isofor...    198   3e-56    
emb|CDX76617.1|  BnaC08g32030D                                          197   5e-56    
ref|XP_006291055.1|  hypothetical protein CARUB_v10017170mg             197   5e-56    
ref|XP_009363066.1|  PREDICTED: probable polygalacturonase isofor...    197   5e-56    
ref|XP_007163248.1|  hypothetical protein PHAVU_001G218400g             197   6e-56    
ref|XP_009363065.1|  PREDICTED: probable polygalacturonase isofor...    197   6e-56    
ref|XP_010512597.1|  PREDICTED: probable polygalacturonase isofor...    199   1e-55    
ref|XP_008381624.1|  PREDICTED: probable polygalacturonase              196   3e-55    
ref|XP_006604763.1|  PREDICTED: probable polygalacturonase-like i...    195   5e-55    
ref|XP_003554577.1|  PREDICTED: probable polygalacturonase-like i...    195   5e-55    
ref|XP_002273855.2|  PREDICTED: probable polygalacturonase              194   7e-55    
ref|XP_004494474.1|  PREDICTED: probable polygalacturonase-like i...    194   8e-55    
ref|XP_004494475.1|  PREDICTED: probable polygalacturonase-like i...    194   9e-55    
gb|KHN43408.1|  Putative polygalacturonase                              195   3e-54    
ref|NP_001241086.1|  uncharacterized protein LOC100817309 precursor     192   3e-54    
ref|XP_006576262.1|  PREDICTED: uncharacterized protein LOC100817...    192   3e-54    
ref|XP_006576263.1|  PREDICTED: uncharacterized protein LOC100817...    192   3e-54    
ref|XP_004955888.1|  PREDICTED: probable polygalacturonase-like i...    192   5e-54    
ref|XP_010544930.1|  PREDICTED: probable polygalacturonase              186   5e-54    
gb|KHN14175.1|  Putative polygalacturonase                              192   6e-54    
ref|NP_001183080.1|  hypothetical protein precursor                     192   8e-54    
ref|XP_002535132.1|  Polygalacturonase precursor, putative              191   1e-53    
ref|XP_011040145.1|  PREDICTED: probable polygalacturonase              190   3e-53    
gb|AIU50444.1|  pectin lyase-like superfamily protein                   189   3e-53    
ref|XP_006840361.1|  hypothetical protein AMTR_s00045p00118570          190   3e-53    
ref|XP_009387922.1|  PREDICTED: probable polygalacturonase              189   4e-53    
gb|KDP28345.1|  hypothetical protein JCGZ_14116                         190   4e-53    
ref|XP_010523877.1|  PREDICTED: probable polygalacturonase isofor...    189   6e-53    
ref|XP_006657587.1|  PREDICTED: probable polygalacturonase-like i...    188   8e-53    
ref|XP_010523874.1|  PREDICTED: probable polygalacturonase isofor...    189   9e-53    
ref|NP_001059282.1|  Os07g0245200                                       188   1e-52    
ref|XP_004288344.1|  PREDICTED: probable polygalacturonase-like         188   2e-52    
gb|ACC91250.1|  glycoside hydrolase family 28 protein                   187   2e-52    
ref|XP_007040496.1|  Pectin lyase-like superfamily protein              187   2e-52    
ref|XP_010091430.1|  putative polygalacturonase                         187   2e-52    
gb|EEE66877.1|  hypothetical protein OsJ_23693                          188   2e-52    
ref|XP_002960960.1|  hypothetical protein SELMODRAFT_33152              186   3e-52    
ref|XP_002967047.1|  hypothetical protein SELMODRAFT_408393             188   3e-52    
ref|XP_006657586.1|  PREDICTED: probable polygalacturonase-like i...    187   3e-52    
ref|XP_002320934.2|  hypothetical protein POPTR_0014s10770g             187   4e-52    
ref|XP_011005969.1|  PREDICTED: probable polygalacturonase              187   5e-52    
ref|XP_004499965.1|  PREDICTED: probable polygalacturonase-like         186   5e-52    
ref|XP_002459610.1|  hypothetical protein SORBIDRAFT_02g007470          187   6e-52    
ref|NP_194113.1|  glycoside hydrolase family 28 protein / polygal...    186   6e-52    
ref|XP_010544928.1|  PREDICTED: probable polygalacturonase              186   7e-52    
gb|KEH43186.1|  polygalacturonase/glycoside hydrolase family protein    185   9e-52    
ref|XP_002867688.1|  glycoside hydrolase family 28 protein              186   1e-51    
ref|XP_010271039.1|  PREDICTED: probable polygalacturonase isofor...    186   1e-51    
ref|XP_010271038.1|  PREDICTED: probable polygalacturonase isofor...    186   1e-51    
ref|XP_007146299.1|  hypothetical protein PHAVU_006G028800g             185   2e-51    
ref|XP_006283738.1|  hypothetical protein CARUB_v10004811mg             185   2e-51    
ref|XP_010468984.1|  PREDICTED: probable polygalacturonase              185   2e-51    
ref|XP_009404468.1|  PREDICTED: probable polygalacturonase              184   2e-51    
gb|EEC81792.1|  hypothetical protein OsI_25505                          186   2e-51    
ref|XP_003535296.2|  PREDICTED: probable polygalacturonase-like         184   3e-51    
gb|AES61557.2|  polygalacturonase/glycoside hydrolase family protein    186   3e-51    
emb|CDP12145.1|  unnamed protein product                                184   4e-51    
ref|XP_010448653.1|  PREDICTED: probable polygalacturonase              184   4e-51    
gb|KFK35396.1|  hypothetical protein AALP_AA5G279500                    184   5e-51    
ref|XP_011073737.1|  PREDICTED: probable polygalacturonase              184   6e-51    
gb|KFK35395.1|  hypothetical protein AALP_AA5G279500                    184   6e-51    
gb|AIU50411.1|  pectin lyase-like superfamily protein                   182   6e-51    
gb|AIU50405.1|  pectin lyase-like superfamily protein                   182   6e-51    
ref|XP_010676306.1|  PREDICTED: probable polygalacturonase              183   7e-51    
ref|XP_010439131.1|  PREDICTED: probable polygalacturonase              183   7e-51    
gb|AIU50400.1|  pectin lyase-like superfamily protein                   182   7e-51    
gb|KDO76503.1|  hypothetical protein CISIN_1g0134022mg                  179   8e-51    
ref|XP_002509949.1|  Polygalacturonase precursor, putative              183   9e-51    
gb|AIU50402.1|  pectin lyase-like superfamily protein                   182   1e-50    
ref|XP_010055855.1|  PREDICTED: probable polygalacturonase              183   1e-50    
ref|XP_010913844.1|  PREDICTED: probable polygalacturonase isofor...    181   1e-50    
gb|AIU50399.1|  pectin lyase-like superfamily protein                   182   1e-50    
ref|XP_010433858.1|  PREDICTED: probable polygalacturonase              182   1e-50    
gb|AIU50397.1|  pectin lyase-like superfamily protein                   182   1e-50    
ref|XP_009603675.1|  PREDICTED: probable polygalacturonase              182   1e-50    
ref|XP_006386685.1|  hypothetical protein POPTR_0002s18800g             182   1e-50    
ref|XP_009767931.1|  PREDICTED: probable polygalacturonase              182   2e-50    
ref|XP_003591306.1|  Polygalacturonase-like protein                     185   2e-50    
ref|XP_010914786.1|  PREDICTED: probable polygalacturonase              182   2e-50    
gb|KDO76502.1|  hypothetical protein CISIN_1g0134022mg                  179   2e-50    
ref|XP_008807914.1|  PREDICTED: probable polygalacturonase              182   2e-50    
gb|EPS61079.1|  hypothetical protein M569_13719                         181   3e-50    
ref|XP_010925748.1|  PREDICTED: probable polygalacturonase              182   3e-50    
ref|XP_003563034.1|  PREDICTED: probable polygalacturonase              182   3e-50    
gb|KHM99685.1|  Putative polygalacturonase                              181   3e-50    
gb|AIU50435.1|  pectin lyase-like superfamily protein                   181   3e-50    
gb|KDO76501.1|  hypothetical protein CISIN_1g0134022mg                  179   3e-50    
ref|XP_003519731.2|  PREDICTED: probable polygalacturonase-like i...    182   3e-50    
gb|KDP25309.1|  hypothetical protein JCGZ_20465                         181   4e-50    
ref|XP_007145093.1|  hypothetical protein PHAVU_007G209200g             182   4e-50    
ref|XP_003557344.1|  PREDICTED: probable polygalacturonase              182   4e-50    
ref|XP_006586032.1|  PREDICTED: probable polygalacturonase-like         181   4e-50    
ref|XP_002513652.1|  Exopolygalacturonase precursor, putative           181   5e-50    
gb|KHG27846.1|  putative polygalacturonase                              180   5e-50    
gb|KHN00242.1|  Putative polygalacturonase                              181   5e-50    
ref|XP_009412155.1|  PREDICTED: probable polygalacturonase              181   6e-50    
gb|KEH33635.1|  polygalacturonase/glycoside hydrolase family protein    181   7e-50    
ref|XP_010913831.1|  PREDICTED: probable polygalacturonase isofor...    181   8e-50    
ref|XP_007141479.1|  hypothetical protein PHAVU_008G199400g             180   1e-49    
gb|AIN44009.1|  polygalacturonase-like protein                          180   1e-49    
ref|XP_011022514.1|  PREDICTED: probable polygalacturonase              180   2e-49    
ref|XP_009413832.1|  PREDICTED: probable polygalacturonase              179   2e-49    
ref|XP_010909275.1|  PREDICTED: probable polygalacturonase isofor...    179   2e-49    
ref|XP_002307030.2|  hypothetical protein POPTR_0005s06430g             180   2e-49    
ref|XP_002304552.2|  glycoside hydrolase family 28 family protein       179   3e-49    
ref|XP_009378739.1|  PREDICTED: probable polygalacturonase isofor...    179   3e-49    
gb|AIU50437.1|  pectin lyase-like superfamily protein                   178   3e-49    
ref|XP_010652214.1|  PREDICTED: probable polygalacturonase              179   4e-49    
ref|XP_010909269.1|  PREDICTED: probable polygalacturonase isofor...    179   4e-49    
ref|XP_009378738.1|  PREDICTED: probable polygalacturonase isofor...    179   4e-49    
ref|XP_006439367.1|  hypothetical protein CICLE_v10020162mg             179   4e-49    
ref|XP_008788175.1|  PREDICTED: probable polygalacturonase              179   4e-49    
ref|XP_011031186.1|  PREDICTED: probable polygalacturonase              179   4e-49    
ref|XP_011022938.1|  PREDICTED: probable polygalacturonase              179   4e-49    
gb|AIU50407.1|  pectin lyase-like superfamily protein                   177   5e-49    
ref|XP_001755533.1|  predicted protein                                  177   5e-49    
ref|XP_008790157.1|  PREDICTED: probable polygalacturonase              178   6e-49    
emb|CBI36899.3|  unnamed protein product                                179   6e-49    
ref|XP_010541559.1|  PREDICTED: probable polygalacturonase isofor...    178   6e-49    
gb|AIU50413.1|  pectin lyase-like superfamily protein                   177   6e-49    
ref|XP_006476397.1|  PREDICTED: probable polygalacturonase-like         178   8e-49    
ref|XP_003551949.1|  PREDICTED: probable polygalacturonase-like         177   8e-49    
ref|XP_002310517.2|  glycoside hydrolase family 28 family protein       178   8e-49    
gb|AIU50409.1|  pectin lyase-like superfamily protein                   177   9e-49    
gb|KFK28938.1|  hypothetical protein AALP_AA7G068200                    177   9e-49    
gb|KHN28527.1|  Putative polygalacturonase                              178   1e-48    
gb|AIU50408.1|  pectin lyase-like superfamily protein                   177   1e-48    
ref|XP_010261531.1|  PREDICTED: probable polygalacturonase              177   1e-48    
ref|XP_004298894.1|  PREDICTED: probable polygalacturonase-like         177   1e-48    
ref|XP_010659126.1|  PREDICTED: probable polygalacturonase              177   1e-48    
gb|KHG21610.1|  putative polygalacturonase                              177   1e-48    
gb|EAY85246.1|  hypothetical protein OsI_06620                          177   1e-48    
emb|CDX94222.1|  BnaC07g38560D                                          177   1e-48    
ref|XP_006413510.1|  hypothetical protein EUTSA_v10025189mg             177   1e-48    
ref|XP_009346610.1|  PREDICTED: probable polygalacturonase isofor...    177   1e-48    
ref|XP_009346609.1|  PREDICTED: probable polygalacturonase isofor...    177   1e-48    
ref|XP_006837459.1|  hypothetical protein AMTR_s00107p00122980          177   1e-48    
ref|XP_002526639.1|  polygalacturonase, putative                        177   2e-48    
gb|AIU50426.1|  pectin lyase-like superfamily protein                   176   2e-48    
ref|XP_010259446.1|  PREDICTED: probable polygalacturonase              177   2e-48    
gb|KDP27854.1|  hypothetical protein JCGZ_18934                         177   2e-48    
gb|AIU50433.1|  pectin lyase-like superfamily protein                   176   2e-48    
ref|XP_010679489.1|  PREDICTED: probable polygalacturonase isofor...    177   2e-48    
ref|XP_009784614.1|  PREDICTED: probable polygalacturonase isofor...    176   2e-48    
ref|XP_010679488.1|  PREDICTED: probable polygalacturonase isofor...    177   3e-48    
ref|XP_009784607.1|  PREDICTED: probable polygalacturonase isofor...    177   3e-48    
ref|XP_008351179.1|  PREDICTED: probable polygalacturonase              171   3e-48    
emb|CAN76963.1|  hypothetical protein VITISV_043959                     177   3e-48    
gb|AIU50430.1|  pectin lyase-like superfamily protein                   176   3e-48    
tpg|DAA52311.1|  TPA: hypothetical protein ZEAMMB73_541408              171   3e-48    
ref|XP_008386709.1|  PREDICTED: probable polygalacturonase              176   3e-48    
ref|XP_006402409.1|  hypothetical protein EUTSA_v10005945mg             177   4e-48    
gb|AIU50401.1|  pectin lyase-like superfamily protein                   175   4e-48    
ref|XP_002274138.2|  PREDICTED: probable polygalacturonase              177   4e-48    
ref|XP_006444619.1|  hypothetical protein CICLE_v10020035mg             176   5e-48    
gb|AIU50442.1|  pectin lyase-like superfamily protein                   175   5e-48    
gb|KDO50316.1|  hypothetical protein CISIN_1g020062mg                   173   5e-48    
ref|XP_004173333.1|  PREDICTED: probable polygalacturonase-like         173   6e-48    
ref|XP_006650856.1|  PREDICTED: probable polygalacturonase-like i...    176   6e-48    
ref|XP_009137393.1|  PREDICTED: probable polygalacturonase              176   6e-48    
emb|CBI37530.3|  unnamed protein product                                177   6e-48    
ref|XP_009396562.1|  PREDICTED: probable polygalacturonase              175   7e-48    
ref|XP_009137402.1|  PREDICTED: probable polygalacturonase              175   8e-48    
ref|XP_007051305.1|  Pectin lyase-like superfamily protein isoform 4    173   8e-48    
ref|XP_004245522.1|  PREDICTED: probable polygalacturonase isofor...    176   8e-48    
ref|XP_009793676.1|  PREDICTED: probable polygalacturonase              176   8e-48    
gb|AIU50441.1|  pectin lyase-like superfamily protein                   174   8e-48    
ref|XP_002463589.1|  hypothetical protein SORBIDRAFT_01g002550          175   9e-48    
emb|CDY47619.1|  BnaA01g13460D                                          175   9e-48    
ref|XP_010325363.1|  PREDICTED: probable polygalacturonase isofor...    176   1e-47    
ref|XP_003545367.1|  PREDICTED: probable polygalacturonase              175   1e-47    
gb|AIU50416.1|  pectin lyase-like superfamily protein                   174   1e-47    
gb|AIU50422.1|  pectin lyase-like superfamily protein                   174   1e-47    
ref|XP_006343870.1|  PREDICTED: probable polygalacturonase-like         174   1e-47    
ref|XP_008345224.1|  PREDICTED: probable polygalacturonase isofor...    174   1e-47    
gb|AIU50448.1|  pectin lyase-like superfamily protein                   173   2e-47    
ref|XP_007209143.1|  hypothetical protein PRUPE_ppa005818mg             174   2e-47    
ref|XP_006432212.1|  hypothetical protein CICLE_v10003286mg             175   2e-47    
ref|XP_006464997.1|  PREDICTED: probable polygalacturonase-like i...    175   2e-47    
gb|KHN12010.1|  Putative polygalacturonase                              174   2e-47    
ref|XP_004951285.1|  PREDICTED: probable polygalacturonase-like         174   2e-47    
ref|XP_008460889.1|  PREDICTED: probable polygalacturonase              175   2e-47    
gb|AIU50404.1|  pectin lyase-like superfamily protein                   173   2e-47    
emb|CDY03516.1|  BnaC01g15660D                                          174   2e-47    
ref|XP_010924850.1|  PREDICTED: probable polygalacturonase              174   2e-47    
emb|CDY10970.1|  BnaA03g46290D                                          174   2e-47    
ref|XP_008810829.1|  PREDICTED: probable polygalacturonase              174   3e-47    
ref|XP_008345223.1|  PREDICTED: probable polygalacturonase isofor...    174   3e-47    
ref|XP_008223260.1|  PREDICTED: probable polygalacturonase              174   3e-47    
ref|NP_001046468.1|  Os02g0256100                                       174   3e-47    
ref|XP_001775589.1|  predicted protein                                  174   3e-47    
gb|AIU50439.1|  pectin lyase-like superfamily protein                   173   3e-47    



>ref|XP_009762711.1| PREDICTED: probable polygalacturonase isoform X2 [Nicotiana sylvestris]
Length=479

 Score =   343 bits (880),  Expect = 3e-112, Method: Compositional matrix adjust.
 Identities = 158/222 (71%), Positives = 185/222 (83%), Gaps = 1/222 (0%)
 Frame = +2

Query  2    INPDSCTKVRIEDNYIVSGDDCVAIKSGIDEYGIKYGMPTKQLIIRRLTCISPTSGAIAM  181
            INPDSCT VR+EDNYIVSGDDCVA+KSG DEYGIKYGMPT QL+IRRLTCISP S AIA+
Sbjct  242  INPDSCTNVRLEDNYIVSGDDCVAVKSGWDEYGIKYGMPTSQLVIRRLTCISPYSAAIAL  301

Query  182  GSEMSGGIEDVRASDITALDTESGVRIKTALGRGGYVKNIYVKGLRAHTMKLLFQMTGKY  361
            GSEMSGGI+DVRA DITA++TESGVRIKTA+GRGG+VK++YVKG+  HTMK +F MTG Y
Sbjct  302  GSEMSGGIQDVRAEDITAINTESGVRIKTAVGRGGFVKDVYVKGMTLHTMKWVFWMTGNY  361

Query  362  GSHADKNFDPKAIPVVAGINFRDVVADNVTTAGTMEGIPGHPFTGICMANVTIGMAKNGK  541
            GSHAD ++DP A+P + GIN+RDVVA+NV+ A  +EGI G PFTGICM+NVTI MAK  K
Sbjct  362  GSHADTHWDPNALPEIKGINYRDVVAENVSMAARLEGISGDPFTGICMSNVTISMAKKAK  421

Query  542  KQPPWVCANIQGVASGVVPPPCNLLHSQGPVKPGMCDLPAKN  667
            K  PW C +I+G+ SGV PPPC LL  QGP K  MCD P ++
Sbjct  422  KY-PWTCTDIEGITSGVQPPPCQLLPDQGPEKSEMCDFPTES  462



>ref|XP_009762710.1| PREDICTED: probable polygalacturonase isoform X1 [Nicotiana sylvestris]
Length=486

 Score =   343 bits (879),  Expect = 5e-112, Method: Compositional matrix adjust.
 Identities = 158/222 (71%), Positives = 185/222 (83%), Gaps = 1/222 (0%)
 Frame = +2

Query  2    INPDSCTKVRIEDNYIVSGDDCVAIKSGIDEYGIKYGMPTKQLIIRRLTCISPTSGAIAM  181
            INPDSCT VR+EDNYIVSGDDCVA+KSG DEYGIKYGMPT QL+IRRLTCISP S AIA+
Sbjct  249  INPDSCTNVRLEDNYIVSGDDCVAVKSGWDEYGIKYGMPTSQLVIRRLTCISPYSAAIAL  308

Query  182  GSEMSGGIEDVRASDITALDTESGVRIKTALGRGGYVKNIYVKGLRAHTMKLLFQMTGKY  361
            GSEMSGGI+DVRA DITA++TESGVRIKTA+GRGG+VK++YVKG+  HTMK +F MTG Y
Sbjct  309  GSEMSGGIQDVRAEDITAINTESGVRIKTAVGRGGFVKDVYVKGMTLHTMKWVFWMTGNY  368

Query  362  GSHADKNFDPKAIPVVAGINFRDVVADNVTTAGTMEGIPGHPFTGICMANVTIGMAKNGK  541
            GSHAD ++DP A+P + GIN+RDVVA+NV+ A  +EGI G PFTGICM+NVTI MAK  K
Sbjct  369  GSHADTHWDPNALPEIKGINYRDVVAENVSMAARLEGISGDPFTGICMSNVTISMAKKAK  428

Query  542  KQPPWVCANIQGVASGVVPPPCNLLHSQGPVKPGMCDLPAKN  667
            K  PW C +I+G+ SGV PPPC LL  QGP K  MCD P ++
Sbjct  429  KY-PWTCTDIEGITSGVQPPPCQLLPDQGPEKSEMCDFPTES  469



>emb|CDP20376.1| unnamed protein product [Coffea canephora]
Length=484

 Score =   341 bits (874),  Expect = 3e-111, Method: Compositional matrix adjust.
 Identities = 158/222 (71%), Positives = 186/222 (84%), Gaps = 1/222 (0%)
 Frame = +2

Query  2    INPDSCTKVRIEDNYIVSGDDCVAIKSGIDEYGIKYGMPTKQLIIRRLTCISPTSGAIAM  181
            INPDSCT  RIED+YIVSGDDC+A+KSG DEYGI YGMPTKQL+IRRLTCISP S AIA+
Sbjct  247  INPDSCTNTRIEDSYIVSGDDCIAVKSGWDEYGISYGMPTKQLLIRRLTCISPYSAAIAL  306

Query  182  GSEMSGGIEDVRASDITALDTESGVRIKTALGRGGYVKNIYVKGLRAHTMKLLFQMTGKY  361
            GSEMSGGI+DVRA DI A++TESGVRIKTA+GRGG+VK+IYVKG++  TMK +F MTG Y
Sbjct  307  GSEMSGGIQDVRAQDIVAINTESGVRIKTAVGRGGFVKDIYVKGMKLQTMKWVFWMTGNY  366

Query  362  GSHADKNFDPKAIPVVAGINFRDVVADNVTTAGTMEGIPGHPFTGICMANVTIGMAKNGK  541
            GSHAD ++DP A+P + GIN+RDVVAD+V  A  +EGI G PFTGIC+ANVTIGMA+  K
Sbjct  367  GSHADNHYDPHALPAIQGINYRDVVADDVKMAARLEGISGDPFTGICIANVTIGMAQKAK  426

Query  542  KQPPWVCANIQGVASGVVPPPCNLLHSQGPVKPGMCDLPAKN  667
            K  PW CA+++G+ASGVVPPPC  L  QGP K GMCD P +N
Sbjct  427  KY-PWTCADVEGIASGVVPPPCASLPDQGPEKVGMCDFPQEN  467



>ref|XP_009767883.1| PREDICTED: probable polygalacturonase [Nicotiana sylvestris]
Length=476

 Score =   340 bits (872),  Expect = 4e-111, Method: Compositional matrix adjust.
 Identities = 155/222 (70%), Positives = 185/222 (83%), Gaps = 1/222 (0%)
 Frame = +2

Query  2    INPDSCTKVRIEDNYIVSGDDCVAIKSGIDEYGIKYGMPTKQLIIRRLTCISPTSGAIAM  181
            I+PDSCT  R+EDNYIVSGDDCVA+KSG DE+GIKYGMPT  LIIRRLTCISP S AIA+
Sbjct  239  IDPDSCTNTRLEDNYIVSGDDCVAVKSGWDEFGIKYGMPTSHLIIRRLTCISPYSAAIAL  298

Query  182  GSEMSGGIEDVRASDITALDTESGVRIKTALGRGGYVKNIYVKGLRAHTMKLLFQMTGKY  361
            GSEMSGGI+DVR  DITA++TESGVRIKTA+GRGG+VK++YVKG++ HTMK +F MTG Y
Sbjct  299  GSEMSGGIQDVRVQDITAINTESGVRIKTAVGRGGFVKDVYVKGMKLHTMKWVFWMTGNY  358

Query  362  GSHADKNFDPKAIPVVAGINFRDVVADNVTTAGTMEGIPGHPFTGICMANVTIGMAKNGK  541
            GSHAD ++DPKA+P + GIN+RDVVA+NV+ A  +EG+ G PFTGICM+NVTIG+AK  K
Sbjct  359  GSHADTHWDPKALPEIKGINYRDVVAENVSMAAQLEGMSGDPFTGICMSNVTIGLAKKAK  418

Query  542  KQPPWVCANIQGVASGVVPPPCNLLHSQGPVKPGMCDLPAKN  667
            K  PW C NI+G++S V PPPC LL  QGP K  MCD P +N
Sbjct  419  KY-PWTCTNIEGISSNVQPPPCQLLAYQGPKKSRMCDFPTEN  459



>ref|XP_006339619.1| PREDICTED: probable polygalacturonase-like [Solanum tuberosum]
Length=476

 Score =   338 bits (868),  Expect = 2e-110, Method: Compositional matrix adjust.
 Identities = 155/222 (70%), Positives = 185/222 (83%), Gaps = 1/222 (0%)
 Frame = +2

Query  2    INPDSCTKVRIEDNYIVSGDDCVAIKSGIDEYGIKYGMPTKQLIIRRLTCISPTSGAIAM  181
            INPDSCT +++EDNYIVSGDDCVA+KSG DEYGIKYG PT  LII+RLTCISP S AIA+
Sbjct  239  INPDSCTNIKLEDNYIVSGDDCVAVKSGWDEYGIKYGKPTSHLIIKRLTCISPYSAAIAL  298

Query  182  GSEMSGGIEDVRASDITALDTESGVRIKTALGRGGYVKNIYVKGLRAHTMKLLFQMTGKY  361
            GSEMSGGI+DVR  DITA+ TESG+RIKT +GRGGYVK+IYVKG++ HTMK +F MTG Y
Sbjct  299  GSEMSGGIQDVRIQDITAIQTESGIRIKTGVGRGGYVKDIYVKGMKLHTMKWVFWMTGNY  358

Query  362  GSHADKNFDPKAIPVVAGINFRDVVADNVTTAGTMEGIPGHPFTGICMANVTIGMAKNGK  541
            GSHAD ++DPKA+P + GIN+RDVVA+NV+ AG ++GI G PFTGICM+NVTIG+AK   
Sbjct  359  GSHADTHWDPKALPEIKGINYRDVVAENVSMAGQLDGISGDPFTGICMSNVTIGLAKK-S  417

Query  542  KQPPWVCANIQGVASGVVPPPCNLLHSQGPVKPGMCDLPAKN  667
            KQ PW C NI+G++S V PPPC LL  QGP K GMCD P ++
Sbjct  418  KQNPWACTNIEGISSSVQPPPCKLLADQGPKKSGMCDFPTES  459



>gb|KDO86269.1| hypothetical protein CISIN_1g0090751mg, partial [Citrus sinensis]
Length=259

 Score =   329 bits (843),  Expect = 1e-109, Method: Compositional matrix adjust.
 Identities = 157/222 (71%), Positives = 180/222 (81%), Gaps = 1/222 (0%)
 Frame = +2

Query  2    INPDSCTKVRIEDNYIVSGDDCVAIKSGIDEYGIKYGMPTKQLIIRRLTCISPTSGAIAM  181
            INPDSCT  RIED YIVSGDDCVA+KSG DEYGI YGMPTKQL+IRRLTCISP S  IA+
Sbjct  21   INPDSCTNTRIEDCYIVSGDDCVAVKSGWDEYGIAYGMPTKQLVIRRLTCISPYSATIAL  80

Query  182  GSEMSGGIEDVRASDITALDTESGVRIKTALGRGGYVKNIYVKGLRAHTMKLLFQMTGKY  361
            GSEMSGGI+DVRA DI A++TESGVRIKTA+GRGGYVK+IYV+G+  HTMK  F MTG Y
Sbjct  81   GSEMSGGIQDVRAEDIKAINTESGVRIKTAVGRGGYVKDIYVRGMTMHTMKWAFWMTGNY  140

Query  362  GSHADKNFDPKAIPVVAGINFRDVVADNVTTAGTMEGIPGHPFTGICMANVTIGMAKNGK  541
            GSHAD ++DPKA+PV+ GIN+RD+VADNV+ A  +EGI G PFTGIC+AN TIGMA   K
Sbjct  141  GSHADNHYDPKALPVIQGINYRDIVADNVSMAARLEGISGDPFTGICIANATIGMAAKHK  200

Query  542  KQPPWVCANIQGVASGVVPPPCNLLHSQGPVKPGMCDLPAKN  667
            K  PW CA+I G+ SGV PPPC LL  QGP K   CD P ++
Sbjct  201  KV-PWTCADIGGMTSGVTPPPCELLPDQGPEKIRACDFPTES  241



>ref|XP_009599786.1| PREDICTED: probable polygalacturonase isoform X2 [Nicotiana tomentosiformis]
Length=474

 Score =   336 bits (861),  Expect = 2e-109, Method: Compositional matrix adjust.
 Identities = 155/222 (70%), Positives = 183/222 (82%), Gaps = 1/222 (0%)
 Frame = +2

Query  2    INPDSCTKVRIEDNYIVSGDDCVAIKSGIDEYGIKYGMPTKQLIIRRLTCISPTSGAIAM  181
            INPDSCT +R+EDNYIVSGDDCVA+KSG DEYGIKYGMPT QLIIRRLTCISP S AIA+
Sbjct  237  INPDSCTNIRLEDNYIVSGDDCVAVKSGWDEYGIKYGMPTSQLIIRRLTCISPYSAAIAL  296

Query  182  GSEMSGGIEDVRASDITALDTESGVRIKTALGRGGYVKNIYVKGLRAHTMKLLFQMTGKY  361
            GSEMSGGI+DVRA DITA++TESGVRIKTA+GRGG+VK++YVKG+  HTMK +F MTG Y
Sbjct  297  GSEMSGGIQDVRAEDITAINTESGVRIKTAVGRGGFVKDVYVKGMTLHTMKWVFWMTGNY  356

Query  362  GSHADKNFDPKAIPVVAGINFRDVVADNVTTAGTMEGIPGHPFTGICMANVTIGMAKNGK  541
            GSHAD ++DP A+P +  IN+RDVVA+NV+ A  +EGI G PFTGICM+NVTI MAK  K
Sbjct  357  GSHADTHWDPNALPEIKRINYRDVVAENVSMAARLEGISGDPFTGICMSNVTISMAKKAK  416

Query  542  KQPPWVCANIQGVASGVVPPPCNLLHSQGPVKPGMCDLPAKN  667
            K  PW C +I+G+ SGV P PC LL  QGP K  MC+ P ++
Sbjct  417  KY-PWTCTDIEGITSGVQPTPCQLLPDQGPEKSEMCNFPTES  457



>ref|XP_006345581.1| PREDICTED: probable polygalacturonase-like isoform X1 [Solanum 
tuberosum]
Length=481

 Score =   335 bits (860),  Expect = 4e-109, Method: Compositional matrix adjust.
 Identities = 155/222 (70%), Positives = 181/222 (82%), Gaps = 1/222 (0%)
 Frame = +2

Query  2    INPDSCTKVRIEDNYIVSGDDCVAIKSGIDEYGIKYGMPTKQLIIRRLTCISPTSGAIAM  181
            INPDSCT +RIEDNYIVSGDDCVA+KSG DEYGI YGMPT QLIIRRLTCISP S AIA+
Sbjct  244  INPDSCTNMRIEDNYIVSGDDCVAVKSGWDEYGINYGMPTSQLIIRRLTCISPYSAAIAL  303

Query  182  GSEMSGGIEDVRASDITALDTESGVRIKTALGRGGYVKNIYVKGLRAHTMKLLFQMTGKY  361
            GSEMSGGI+DVRA DITA++TESGVRIKT +GRGG+VK++YVKG+  HTMK +F MTG Y
Sbjct  304  GSEMSGGIQDVRAEDITAINTESGVRIKTGVGRGGFVKDVYVKGMTLHTMKWVFWMTGNY  363

Query  362  GSHADKNFDPKAIPVVAGINFRDVVADNVTTAGTMEGIPGHPFTGICMANVTIGMAKNGK  541
            G HAD ++DP A+P + GIN+RDVVA+NV+ A  +EGI G PFTGIC++NVTI MAK  K
Sbjct  364  GQHADTHWDPNALPEIKGINYRDVVAENVSMAARLEGISGDPFTGICISNVTISMAKKAK  423

Query  542  KQPPWVCANIQGVASGVVPPPCNLLHSQGPVKPGMCDLPAKN  667
            K  PW C +I+G+ SGV PPPC LL  QGP K  MC  P +N
Sbjct  424  KY-PWTCTDIEGITSGVQPPPCQLLPDQGPEKTEMCSFPTEN  464



>ref|XP_009599780.1| PREDICTED: probable polygalacturonase isoform X1 [Nicotiana tomentosiformis]
Length=486

 Score =   335 bits (860),  Expect = 4e-109, Method: Compositional matrix adjust.
 Identities = 155/222 (70%), Positives = 183/222 (82%), Gaps = 1/222 (0%)
 Frame = +2

Query  2    INPDSCTKVRIEDNYIVSGDDCVAIKSGIDEYGIKYGMPTKQLIIRRLTCISPTSGAIAM  181
            INPDSCT +R+EDNYIVSGDDCVA+KSG DEYGIKYGMPT QLIIRRLTCISP S AIA+
Sbjct  249  INPDSCTNIRLEDNYIVSGDDCVAVKSGWDEYGIKYGMPTSQLIIRRLTCISPYSAAIAL  308

Query  182  GSEMSGGIEDVRASDITALDTESGVRIKTALGRGGYVKNIYVKGLRAHTMKLLFQMTGKY  361
            GSEMSGGI+DVRA DITA++TESGVRIKTA+GRGG+VK++YVKG+  HTMK +F MTG Y
Sbjct  309  GSEMSGGIQDVRAEDITAINTESGVRIKTAVGRGGFVKDVYVKGMTLHTMKWVFWMTGNY  368

Query  362  GSHADKNFDPKAIPVVAGINFRDVVADNVTTAGTMEGIPGHPFTGICMANVTIGMAKNGK  541
            GSHAD ++DP A+P +  IN+RDVVA+NV+ A  +EGI G PFTGICM+NVTI MAK  K
Sbjct  369  GSHADTHWDPNALPEIKRINYRDVVAENVSMAARLEGISGDPFTGICMSNVTISMAKKAK  428

Query  542  KQPPWVCANIQGVASGVVPPPCNLLHSQGPVKPGMCDLPAKN  667
            K  PW C +I+G+ SGV P PC LL  QGP K  MC+ P ++
Sbjct  429  KY-PWTCTDIEGITSGVQPTPCQLLPDQGPEKSEMCNFPTES  469



>ref|XP_006345582.1| PREDICTED: probable polygalacturonase-like isoform X2 [Solanum 
tuberosum]
 ref|XP_006345583.1| PREDICTED: probable polygalacturonase-like isoform X3 [Solanum 
tuberosum]
Length=477

 Score =   335 bits (859),  Expect = 5e-109, Method: Compositional matrix adjust.
 Identities = 155/222 (70%), Positives = 181/222 (82%), Gaps = 1/222 (0%)
 Frame = +2

Query  2    INPDSCTKVRIEDNYIVSGDDCVAIKSGIDEYGIKYGMPTKQLIIRRLTCISPTSGAIAM  181
            INPDSCT +RIEDNYIVSGDDCVA+KSG DEYGI YGMPT QLIIRRLTCISP S AIA+
Sbjct  240  INPDSCTNMRIEDNYIVSGDDCVAVKSGWDEYGINYGMPTSQLIIRRLTCISPYSAAIAL  299

Query  182  GSEMSGGIEDVRASDITALDTESGVRIKTALGRGGYVKNIYVKGLRAHTMKLLFQMTGKY  361
            GSEMSGGI+DVRA DITA++TESGVRIKT +GRGG+VK++YVKG+  HTMK +F MTG Y
Sbjct  300  GSEMSGGIQDVRAEDITAINTESGVRIKTGVGRGGFVKDVYVKGMTLHTMKWVFWMTGNY  359

Query  362  GSHADKNFDPKAIPVVAGINFRDVVADNVTTAGTMEGIPGHPFTGICMANVTIGMAKNGK  541
            G HAD ++DP A+P + GIN+RDVVA+NV+ A  +EGI G PFTGIC++NVTI MAK  K
Sbjct  360  GQHADTHWDPNALPEIKGINYRDVVAENVSMAARLEGISGDPFTGICISNVTISMAKKAK  419

Query  542  KQPPWVCANIQGVASGVVPPPCNLLHSQGPVKPGMCDLPAKN  667
            K  PW C +I+G+ SGV PPPC LL  QGP K  MC  P +N
Sbjct  420  KY-PWTCTDIEGITSGVQPPPCQLLPDQGPEKTEMCSFPTEN  460



>ref|XP_004229920.2| PREDICTED: probable polygalacturonase [Solanum lycopersicum]
Length=476

 Score =   335 bits (858),  Expect = 6e-109, Method: Compositional matrix adjust.
 Identities = 154/222 (69%), Positives = 184/222 (83%), Gaps = 1/222 (0%)
 Frame = +2

Query  2    INPDSCTKVRIEDNYIVSGDDCVAIKSGIDEYGIKYGMPTKQLIIRRLTCISPTSGAIAM  181
            I+PDSCT +R+EDNYIVSGDDCVA+KSG DEYGIKYG PT  LII+RLTCISP S AIA+
Sbjct  239  IDPDSCTNIRLEDNYIVSGDDCVAVKSGWDEYGIKYGRPTSHLIIKRLTCISPYSAAIAL  298

Query  182  GSEMSGGIEDVRASDITALDTESGVRIKTALGRGGYVKNIYVKGLRAHTMKLLFQMTGKY  361
            GSEMSGGI+DVR  DITA+ TESG+RIKT +G+GGYVK+IYVKG++ HTMK +F MTG Y
Sbjct  299  GSEMSGGIQDVRIQDITAIQTESGIRIKTGVGQGGYVKDIYVKGMKLHTMKWVFWMTGNY  358

Query  362  GSHADKNFDPKAIPVVAGINFRDVVADNVTTAGTMEGIPGHPFTGICMANVTIGMAKNGK  541
            GSHAD ++DPKA+P + GIN+RDVVA+NV+ AG ++GI G PFTGICM+NVTIG+AK  K
Sbjct  359  GSHADTHWDPKALPEIKGINYRDVVAENVSMAGQLDGISGDPFTGICMSNVTIGLAKKSK  418

Query  542  KQPPWVCANIQGVASGVVPPPCNLLHSQGPVKPGMCDLPAKN  667
            K  PW C NI G++S V PPPC LL  QGP K GMCD P ++
Sbjct  419  KN-PWACTNIGGISSSVQPPPCKLLADQGPKKSGMCDFPTES  459



>ref|XP_003528838.1| PREDICTED: probable polygalacturonase [Glycine max]
Length=482

 Score =   334 bits (857),  Expect = 1e-108, Method: Compositional matrix adjust.
 Identities = 159/222 (72%), Positives = 179/222 (81%), Gaps = 1/222 (0%)
 Frame = +2

Query  2    INPDSCTKVRIEDNYIVSGDDCVAIKSGIDEYGIKYGMPTKQLIIRRLTCISPTSGAIAM  181
            INPDSCT  RIED YIVSGDDCVA+KSG DEYGIK+G PTKQL+IRRLTCISP S AIA+
Sbjct  244  INPDSCTNTRIEDCYIVSGDDCVAVKSGWDEYGIKFGWPTKQLVIRRLTCISPQSAAIAL  303

Query  182  GSEMSGGIEDVRASDITALDTESGVRIKTALGRGGYVKNIYVKGLRAHTMKLLFQMTGKY  361
            GSEMSGGI+DVRA DITA+ TESGVRIKTA+GRGGYVK+IYVK +  HTMK +F MTG Y
Sbjct  304  GSEMSGGIQDVRAEDITAIHTESGVRIKTAVGRGGYVKDIYVKRMTMHTMKWVFWMTGNY  363

Query  362  GSHADKNFDPKAIPVVAGINFRDVVADNVTTAGTMEGIPGHPFTGICMANVTIGMAKNGK  541
            GSHAD ++DPKA+P + GIN+RDVVADNVT A  +EGI   PFTGIC+ANVTIGMA   K
Sbjct  364  GSHADSHYDPKALPEINGINYRDVVADNVTMAARLEGISNDPFTGICIANVTIGMAAKAK  423

Query  542  KQPPWVCANIQGVASGVVPPPCNLLHSQGPVKPGMCDLPAKN  667
            KQ PW C +I+G+ SGV P PCN L  QGP K   CD P  N
Sbjct  424  KQ-PWTCTDIEGITSGVTPKPCNSLPDQGPEKIKACDFPQGN  464



>gb|KHN26934.1| Putative polygalacturonase [Glycine soja]
Length=482

 Score =   334 bits (856),  Expect = 1e-108, Method: Compositional matrix adjust.
 Identities = 159/222 (72%), Positives = 179/222 (81%), Gaps = 1/222 (0%)
 Frame = +2

Query  2    INPDSCTKVRIEDNYIVSGDDCVAIKSGIDEYGIKYGMPTKQLIIRRLTCISPTSGAIAM  181
            INPDSCT  RIED YIVSGDDCVA+KSG DEYGIK+G PTKQL+IRRLTCISP S AIA+
Sbjct  244  INPDSCTNTRIEDCYIVSGDDCVAVKSGWDEYGIKFGWPTKQLVIRRLTCISPQSAAIAL  303

Query  182  GSEMSGGIEDVRASDITALDTESGVRIKTALGRGGYVKNIYVKGLRAHTMKLLFQMTGKY  361
            GSEMSGGI+DVRA DITA+ TESGVRIKTA+GRGGYVK+IYVK +  HTMK +F MTG Y
Sbjct  304  GSEMSGGIQDVRAEDITAIHTESGVRIKTAVGRGGYVKDIYVKRMTMHTMKWVFWMTGNY  363

Query  362  GSHADKNFDPKAIPVVAGINFRDVVADNVTTAGTMEGIPGHPFTGICMANVTIGMAKNGK  541
            GSHAD ++DPKA+P + GIN+RDVVADNVT A  +EGI   PFTGIC+ANVTIGMA   K
Sbjct  364  GSHADSHYDPKALPEINGINYRDVVADNVTMAARLEGISNDPFTGICIANVTIGMAAKAK  423

Query  542  KQPPWVCANIQGVASGVVPPPCNLLHSQGPVKPGMCDLPAKN  667
            KQ PW C +I+G+ SGV P PCN L  QGP K   CD P  N
Sbjct  424  KQ-PWTCTDIEGITSGVTPKPCNSLPDQGPEKIKACDFPQGN  464



>ref|XP_007144550.1| hypothetical protein PHAVU_007G165300g [Phaseolus vulgaris]
 gb|ESW16544.1| hypothetical protein PHAVU_007G165300g [Phaseolus vulgaris]
Length=474

 Score =   333 bits (855),  Expect = 2e-108, Method: Compositional matrix adjust.
 Identities = 158/222 (71%), Positives = 178/222 (80%), Gaps = 1/222 (0%)
 Frame = +2

Query  2    INPDSCTKVRIEDNYIVSGDDCVAIKSGIDEYGIKYGMPTKQLIIRRLTCISPTSGAIAM  181
            INPDSCT  RIED YIVSGDDCVA+KSG DEYGIK+G PTKQL+IRRLTCISP S AIA+
Sbjct  236  INPDSCTNTRIEDCYIVSGDDCVAVKSGWDEYGIKFGWPTKQLVIRRLTCISPESAAIAL  295

Query  182  GSEMSGGIEDVRASDITALDTESGVRIKTALGRGGYVKNIYVKGLRAHTMKLLFQMTGKY  361
            GSEMSGGI+DVRA DITA+ TESGVRIKTA+GRGGYVK+IYVKG+  HTMK +F MTG Y
Sbjct  296  GSEMSGGIQDVRAEDITAIHTESGVRIKTAVGRGGYVKDIYVKGMTMHTMKWVFWMTGSY  355

Query  362  GSHADKNFDPKAIPVVAGINFRDVVADNVTTAGTMEGIPGHPFTGICMANVTIGMAKNGK  541
            GSHAD ++DPKA+P + GIN+RDVVADNVT A  +EGI   PFTGIC+ANVTI MA   K
Sbjct  356  GSHADSHYDPKALPEIKGINYRDVVADNVTMAARLEGISNDPFTGICIANVTINMAAKAK  415

Query  542  KQPPWVCANIQGVASGVVPPPCNLLHSQGPVKPGMCDLPAKN  667
            KQ PW C +I+G+ SGV P PCN L  QG      CD PA N
Sbjct  416  KQ-PWTCTDIEGITSGVTPKPCNSLPDQGQDNIKACDFPADN  456



>ref|XP_009624373.1| PREDICTED: probable polygalacturonase [Nicotiana tomentosiformis]
Length=470

 Score =   333 bits (853),  Expect = 3e-108, Method: Compositional matrix adjust.
 Identities = 153/223 (69%), Positives = 185/223 (83%), Gaps = 2/223 (1%)
 Frame = +2

Query  2    INPDSCTKVRIEDNYIVSGDDCVAIKSGIDEYGIKYGMPTKQLIIRRLTCISPTSGAIAM  181
            I+PDSCT +R+EDNYIVSGDDCVA+KSG DEYGIKYGMPT  LIIRRLTCISP S AIA+
Sbjct  232  IDPDSCTNIRLEDNYIVSGDDCVAVKSGWDEYGIKYGMPTSHLIIRRLTCISPYSAAIAL  291

Query  182  GSEMSGGIEDVRASDITALDTESGVRIKTALGRGGYVKNIYVKGLRAHTMKLLFQMTGKY  361
            GSEMSGGI+DVR  DI A++TESGVRIKTA+GRGG+VK++YVKG++ HT+K +F MTG Y
Sbjct  292  GSEMSGGIQDVRVQDIIAINTESGVRIKTAVGRGGFVKDVYVKGMKLHTIKWVFWMTGNY  351

Query  362  GSHADKNFDPKAIPVVAGINFRDVVADNVTTAGTMEGIPGHPFTGICMANVTIGMAKNGK  541
            GSHAD ++DPKA+P + GIN+RDVVA+NV+ A  +EG+ G PFTGICM+NVTIG+AK  K
Sbjct  352  GSHADTHWDPKALPEIKGINYRDVVAENVSMAAQLEGLSGDPFTGICMSNVTIGLAKKAK  411

Query  542  KQPPWVCANIQGVASGVVPPPCNLLHSQGPVKP-GMCDLPAKN  667
            K  PW C NI+G++S V PPPC LL  QGP K   MCD P ++
Sbjct  412  KY-PWTCTNIEGISSSVQPPPCQLLADQGPKKSRRMCDFPTES  453



>ref|XP_004240097.1| PREDICTED: probable polygalacturonase [Solanum lycopersicum]
Length=486

 Score =   333 bits (853),  Expect = 4e-108, Method: Compositional matrix adjust.
 Identities = 153/222 (69%), Positives = 181/222 (82%), Gaps = 1/222 (0%)
 Frame = +2

Query  2    INPDSCTKVRIEDNYIVSGDDCVAIKSGIDEYGIKYGMPTKQLIIRRLTCISPTSGAIAM  181
            INPDSCT ++IEDNYIVSGDDCVA+KSG DEYGI YGMPT QLIIRRLTCISP S AIA+
Sbjct  249  INPDSCTNMKIEDNYIVSGDDCVAVKSGWDEYGINYGMPTSQLIIRRLTCISPYSAAIAL  308

Query  182  GSEMSGGIEDVRASDITALDTESGVRIKTALGRGGYVKNIYVKGLRAHTMKLLFQMTGKY  361
            GSEMSGGI+DVRA DITA++TESGVRIKT +GRGG+V+++YVKG+  HTMK +F MTG Y
Sbjct  309  GSEMSGGIQDVRAEDITAINTESGVRIKTGVGRGGFVRDVYVKGMTLHTMKWVFWMTGNY  368

Query  362  GSHADKNFDPKAIPVVAGINFRDVVADNVTTAGTMEGIPGHPFTGICMANVTIGMAKNGK  541
            G HAD ++DP A+P + GIN+RDVVA+NV+ A  +EGI G PFTGIC++NVTI MAK  K
Sbjct  369  GQHADTHWDPNALPEIKGINYRDVVAENVSMAARLEGISGDPFTGICISNVTISMAKKAK  428

Query  542  KQPPWVCANIQGVASGVVPPPCNLLHSQGPVKPGMCDLPAKN  667
            K  PW C +I+G+ SGV PPPC LL  QGP K  MC  P +N
Sbjct  429  KY-PWTCTDIEGITSGVQPPPCQLLPDQGPEKTEMCSFPTEN  469



>ref|XP_006491165.1| PREDICTED: probable polygalacturonase-like [Citrus sinensis]
Length=481

 Score =   332 bits (852),  Expect = 6e-108, Method: Compositional matrix adjust.
 Identities = 157/222 (71%), Positives = 180/222 (81%), Gaps = 1/222 (0%)
 Frame = +2

Query  2    INPDSCTKVRIEDNYIVSGDDCVAIKSGIDEYGIKYGMPTKQLIIRRLTCISPTSGAIAM  181
            INPDSCT  RIED YIVSGDDCVA+KSG DEYGI YGMPTKQL+IRRLTCISP S  IA+
Sbjct  243  INPDSCTNTRIEDCYIVSGDDCVAVKSGWDEYGIAYGMPTKQLVIRRLTCISPYSATIAL  302

Query  182  GSEMSGGIEDVRASDITALDTESGVRIKTALGRGGYVKNIYVKGLRAHTMKLLFQMTGKY  361
            GSEMSGGI+DVRA DI A++TESGVRIKTA+GRGGYVK+IYV+G+  HTMK  F MTG Y
Sbjct  303  GSEMSGGIQDVRAEDIKAINTESGVRIKTAVGRGGYVKDIYVRGMTMHTMKWAFWMTGNY  362

Query  362  GSHADKNFDPKAIPVVAGINFRDVVADNVTTAGTMEGIPGHPFTGICMANVTIGMAKNGK  541
            GSHAD ++DPKA+PV+ GIN+RD+VADNV+ A  +EGI G PFTGIC+AN TIGMA   K
Sbjct  363  GSHADNHYDPKALPVIQGINYRDIVADNVSMAARLEGISGDPFTGICIANATIGMAAKHK  422

Query  542  KQPPWVCANIQGVASGVVPPPCNLLHSQGPVKPGMCDLPAKN  667
            K  PW CA+I G+ SGV PPPC LL  QGP K   CD P ++
Sbjct  423  KV-PWTCADIGGMTSGVTPPPCELLPDQGPEKIRACDFPTES  463



>ref|XP_003548644.2| PREDICTED: probable polygalacturonase-like isoform X1 [Glycine 
max]
Length=491

 Score =   332 bits (852),  Expect = 8e-108, Method: Compositional matrix adjust.
 Identities = 157/222 (71%), Positives = 178/222 (80%), Gaps = 1/222 (0%)
 Frame = +2

Query  2    INPDSCTKVRIEDNYIVSGDDCVAIKSGIDEYGIKYGMPTKQLIIRRLTCISPTSGAIAM  181
            INPDSCT  RIED YIVSGDDCVA+KSG DEYGIK+G PTKQL+IRRLTCISP S AIA+
Sbjct  256  INPDSCTNTRIEDCYIVSGDDCVAVKSGWDEYGIKFGWPTKQLVIRRLTCISPESAAIAL  315

Query  182  GSEMSGGIEDVRASDITALDTESGVRIKTALGRGGYVKNIYVKGLRAHTMKLLFQMTGKY  361
            GSEMSGGI+DVRA DITA+ TESGVRIKTA+GRGGYVK+IYVK +  HTMK +F MTG Y
Sbjct  316  GSEMSGGIQDVRAEDITAIHTESGVRIKTAVGRGGYVKDIYVKRMTMHTMKWVFWMTGNY  375

Query  362  GSHADKNFDPKAIPVVAGINFRDVVADNVTTAGTMEGIPGHPFTGICMANVTIGMAKNGK  541
            GSHAD ++DP A+P + GIN+RDVVADNVT A  +EGI   PFTGIC+ANVTI MA   K
Sbjct  376  GSHADSHYDPNALPEINGINYRDVVADNVTIAARLEGISNDPFTGICIANVTINMAAKAK  435

Query  542  KQPPWVCANIQGVASGVVPPPCNLLHSQGPVKPGMCDLPAKN  667
            KQ PW C +I+G+ SGV P PCN L  QGP K   CD P +N
Sbjct  436  KQ-PWACTDIEGITSGVTPKPCNSLPDQGPEKIKACDFPQEN  476



>ref|XP_006598941.1| PREDICTED: probable polygalacturonase-like isoform X2 [Glycine 
max]
Length=489

 Score =   332 bits (852),  Expect = 8e-108, Method: Compositional matrix adjust.
 Identities = 157/222 (71%), Positives = 178/222 (80%), Gaps = 1/222 (0%)
 Frame = +2

Query  2    INPDSCTKVRIEDNYIVSGDDCVAIKSGIDEYGIKYGMPTKQLIIRRLTCISPTSGAIAM  181
            INPDSCT  RIED YIVSGDDCVA+KSG DEYGIK+G PTKQL+IRRLTCISP S AIA+
Sbjct  254  INPDSCTNTRIEDCYIVSGDDCVAVKSGWDEYGIKFGWPTKQLVIRRLTCISPESAAIAL  313

Query  182  GSEMSGGIEDVRASDITALDTESGVRIKTALGRGGYVKNIYVKGLRAHTMKLLFQMTGKY  361
            GSEMSGGI+DVRA DITA+ TESGVRIKTA+GRGGYVK+IYVK +  HTMK +F MTG Y
Sbjct  314  GSEMSGGIQDVRAEDITAIHTESGVRIKTAVGRGGYVKDIYVKRMTMHTMKWVFWMTGNY  373

Query  362  GSHADKNFDPKAIPVVAGINFRDVVADNVTTAGTMEGIPGHPFTGICMANVTIGMAKNGK  541
            GSHAD ++DP A+P + GIN+RDVVADNVT A  +EGI   PFTGIC+ANVTI MA   K
Sbjct  374  GSHADSHYDPNALPEINGINYRDVVADNVTIAARLEGISNDPFTGICIANVTINMAAKAK  433

Query  542  KQPPWVCANIQGVASGVVPPPCNLLHSQGPVKPGMCDLPAKN  667
            KQ PW C +I+G+ SGV P PCN L  QGP K   CD P +N
Sbjct  434  KQ-PWACTDIEGITSGVTPKPCNSLPDQGPEKIKACDFPQEN  474



>gb|KHN46704.1| Putative polygalacturonase [Glycine soja]
Length=477

 Score =   332 bits (850),  Expect = 1e-107, Method: Compositional matrix adjust.
 Identities = 157/222 (71%), Positives = 178/222 (80%), Gaps = 1/222 (0%)
 Frame = +2

Query  2    INPDSCTKVRIEDNYIVSGDDCVAIKSGIDEYGIKYGMPTKQLIIRRLTCISPTSGAIAM  181
            INPDSCT  RIED YIVSGDDCVA+KSG DEYGIK+G PTKQL+IRRLTCISP S AIA+
Sbjct  242  INPDSCTNTRIEDCYIVSGDDCVAVKSGWDEYGIKFGWPTKQLVIRRLTCISPESAAIAL  301

Query  182  GSEMSGGIEDVRASDITALDTESGVRIKTALGRGGYVKNIYVKGLRAHTMKLLFQMTGKY  361
            GSEMSGGI+DVRA DITA+ TESGVRIKTA+GRGGYVK+IYVK +  HTMK +F MTG Y
Sbjct  302  GSEMSGGIQDVRAEDITAIHTESGVRIKTAVGRGGYVKDIYVKRMTMHTMKWVFWMTGNY  361

Query  362  GSHADKNFDPKAIPVVAGINFRDVVADNVTTAGTMEGIPGHPFTGICMANVTIGMAKNGK  541
            GSHAD ++DP A+P + GIN+RDVVADNVT A  +EGI   PFTGIC+ANVTI MA   K
Sbjct  362  GSHADSHYDPNALPEINGINYRDVVADNVTIAARLEGISNDPFTGICIANVTINMAAKAK  421

Query  542  KQPPWVCANIQGVASGVVPPPCNLLHSQGPVKPGMCDLPAKN  667
            KQ PW C +I+G+ SGV P PCN L  QGP K   CD P +N
Sbjct  422  KQ-PWACTDIEGITSGVTPKPCNSLPDQGPEKIKACDFPQEN  462



>ref|XP_006444979.1| hypothetical protein CICLE_v10019597mg [Citrus clementina]
 gb|ESR58219.1| hypothetical protein CICLE_v10019597mg [Citrus clementina]
Length=544

 Score =   333 bits (855),  Expect = 1e-107, Method: Compositional matrix adjust.
 Identities = 157/222 (71%), Positives = 180/222 (81%), Gaps = 1/222 (0%)
 Frame = +2

Query  2    INPDSCTKVRIEDNYIVSGDDCVAIKSGIDEYGIKYGMPTKQLIIRRLTCISPTSGAIAM  181
            INPDSCT  RIED YIVSGDDCVA+KSG DEYGI YGMPTKQL+IRRLTCISP S  IA+
Sbjct  306  INPDSCTNTRIEDCYIVSGDDCVAVKSGWDEYGIAYGMPTKQLVIRRLTCISPYSATIAL  365

Query  182  GSEMSGGIEDVRASDITALDTESGVRIKTALGRGGYVKNIYVKGLRAHTMKLLFQMTGKY  361
            GSEMSGGI+DVRA DI A++TESGVRIKTA+GRGGYVK+IYV+G+  HTMK  F MTG Y
Sbjct  366  GSEMSGGIQDVRAEDIKAINTESGVRIKTAVGRGGYVKDIYVRGMTMHTMKWAFWMTGNY  425

Query  362  GSHADKNFDPKAIPVVAGINFRDVVADNVTTAGTMEGIPGHPFTGICMANVTIGMAKNGK  541
            GSHAD ++DPKA+PV+ GIN+RD+VADNV+ A  +EGI G PFTGIC+AN TIGMA   K
Sbjct  426  GSHADNHYDPKALPVIQGINYRDIVADNVSMAARLEGISGDPFTGICIANATIGMAAKHK  485

Query  542  KQPPWVCANIQGVASGVVPPPCNLLHSQGPVKPGMCDLPAKN  667
            K  PW CA+I G+ SGV PPPC LL  QGP K   CD P ++
Sbjct  486  K-VPWTCADIGGMTSGVTPPPCELLPDQGPEKIRACDFPTES  526



>ref|XP_011092828.1| PREDICTED: probable polygalacturonase [Sesamum indicum]
Length=505

 Score =   332 bits (851),  Expect = 2e-107, Method: Compositional matrix adjust.
 Identities = 152/220 (69%), Positives = 181/220 (82%), Gaps = 1/220 (0%)
 Frame = +2

Query  2    INPDSCTKVRIEDNYIVSGDDCVAIKSGIDEYGIKYGMPTKQLIIRRLTCISPTSGAIAM  181
            INPDSCT  RIEDNYIVSGDDC+A+KSG DEYGI YGMPTK LIIRRL C+SP S AIA+
Sbjct  267  INPDSCTNTRIEDNYIVSGDDCIAVKSGWDEYGISYGMPTKHLIIRRLVCVSPYSAAIAL  326

Query  182  GSEMSGGIEDVRASDITALDTESGVRIKTALGRGGYVKNIYVKGLRAHTMKLLFQMTGKY  361
            GSEMSGGI+DVRA +ITA++TESGVRIKTA+GRGGYVK+IYVKG+  HTMK +F +TG Y
Sbjct  327  GSEMSGGIQDVRAQEITAINTESGVRIKTAVGRGGYVKDIYVKGMNLHTMKWVFWITGNY  386

Query  362  GSHADKNFDPKAIPVVAGINFRDVVADNVTTAGTMEGIPGHPFTGICMANVTIGMAKNGK  541
            GSHAD ++DP A+P + GIN+RD+VA+NV+ AG +EGI G PFTGICM+NVTI MA   K
Sbjct  387  GSHADNHYDPNALPEIKGINYRDIVAENVSMAGRLEGISGDPFTGICMSNVTIAMAAKAK  446

Query  542  KQPPWVCANIQGVASGVVPPPCNLLHSQGPVKPGMCDLPA  661
            K  PW C  ++G+ SGVVP PC+LL  QG  + GMCD P+
Sbjct  447  KY-PWSCVEVEGITSGVVPRPCDLLPDQGEQELGMCDFPS  485



>ref|XP_006386609.1| hypothetical protein POPTR_0002s16390g [Populus trichocarpa]
 gb|ERP64406.1| hypothetical protein POPTR_0002s16390g [Populus trichocarpa]
Length=357

 Score =   323 bits (827),  Expect = 8e-106, Method: Compositional matrix adjust.
 Identities = 154/222 (69%), Positives = 178/222 (80%), Gaps = 1/222 (0%)
 Frame = +2

Query  2    INPDSCTKVRIEDNYIVSGDDCVAIKSGIDEYGIKYGMPTKQLIIRRLTCISPTSGAIAM  181
            INPDSCT  +IED YIVSGDDCVA+KSG DEYGI +GMPTKQL+IRRLTCISP S  IA+
Sbjct  119  INPDSCTNTKIEDCYIVSGDDCVAVKSGWDEYGIAFGMPTKQLVIRRLTCISPYSATIAL  178

Query  182  GSEMSGGIEDVRASDITALDTESGVRIKTALGRGGYVKNIYVKGLRAHTMKLLFQMTGKY  361
            GSEMSGGIEDVRA DITA+ TESGVRIKTA+GRGGYVK+IYVK +  HTMK +F MTG Y
Sbjct  179  GSEMSGGIEDVRAEDITAIHTESGVRIKTAVGRGGYVKDIYVKRMTMHTMKWVFWMTGNY  238

Query  362  GSHADKNFDPKAIPVVAGINFRDVVADNVTTAGTMEGIPGHPFTGICMANVTIGMAKNGK  541
            GSHADKN+DP A+P++ GIN+RD+VADNVT A  +EGI G PF  IC++NVTIG+A   K
Sbjct  239  GSHADKNYDPNALPLIQGINYRDMVADNVTMAARLEGIAGDPFKEICISNVTIGLAPKAK  298

Query  542  KQPPWVCANIQGVASGVVPPPCNLLHSQGPVKPGMCDLPAKN  667
            K  PW C  I+G+ SGV P PC+LL  QGP K   CD P +N
Sbjct  299  KV-PWTCTEIEGMTSGVSPRPCDLLPDQGPEKITSCDFPPEN  339



>gb|AAP33475.1| polygalacturonase-like protein [Fragaria x ananassa]
Length=474

 Score =   327 bits (837),  Expect = 8e-106, Method: Compositional matrix adjust.
 Identities = 153/222 (69%), Positives = 175/222 (79%), Gaps = 1/222 (0%)
 Frame = +2

Query  2    INPDSCTKVRIEDNYIVSGDDCVAIKSGIDEYGIKYGMPTKQLIIRRLTCISPTSGAIAM  181
            INPDSCT  +IED YIVSGDDCVA+KSG DEYGI +GMPTKQL+IRRLTCISP S  IA+
Sbjct  237  INPDSCTNTKIEDCYIVSGDDCVAVKSGWDEYGISFGMPTKQLVIRRLTCISPYSATIAL  296

Query  182  GSEMSGGIEDVRASDITALDTESGVRIKTALGRGGYVKNIYVKGLRAHTMKLLFQMTGKY  361
            GSEMSGGI+DVRA DI A++TES VRIKTA+GRG YVK+IYV+ +  HTMK  F MTG Y
Sbjct  297  GSEMSGGIQDVRAEDIVAINTESAVRIKTAVGRGAYVKDIYVRRMTLHTMKWAFWMTGNY  356

Query  362  GSHADKNFDPKAIPVVAGINFRDVVADNVTTAGTMEGIPGHPFTGICMANVTIGMAKNGK  541
            GSHAD N+D  A P + GIN+RDVVA+NVT A  +EGI  HPFTGICM+NVTIG+AK  K
Sbjct  357  GSHADGNYDKNAFPEITGINYRDVVAENVTMAARLEGIADHPFTGICMSNVTIGLAKKAK  416

Query  542  KQPPWVCANIQGVASGVVPPPCNLLHSQGPVKPGMCDLPAKN  667
            KQ PW C +IQG+ SGV P PC LL  QG  KPG CD P  +
Sbjct  417  KQ-PWTCTDIQGITSGVTPTPCGLLPDQGTDKPGGCDFPTDD  457



>ref|XP_004306749.1| PREDICTED: probable polygalacturonase-like [Fragaria vesca subsp. 
vesca]
Length=474

 Score =   327 bits (837),  Expect = 8e-106, Method: Compositional matrix adjust.
 Identities = 153/222 (69%), Positives = 175/222 (79%), Gaps = 1/222 (0%)
 Frame = +2

Query  2    INPDSCTKVRIEDNYIVSGDDCVAIKSGIDEYGIKYGMPTKQLIIRRLTCISPTSGAIAM  181
            INPDSCT  +IED YIVSGDDCVA+KSG DEYGI +GMPTKQL+IRRLTCISP S  IA+
Sbjct  237  INPDSCTNTKIEDCYIVSGDDCVAVKSGWDEYGISFGMPTKQLVIRRLTCISPYSATIAL  296

Query  182  GSEMSGGIEDVRASDITALDTESGVRIKTALGRGGYVKNIYVKGLRAHTMKLLFQMTGKY  361
            GSEMSGGI+DVRA DI A++TES VRIKTA+GRG YVK+IYV+ +  HTMK  F MTG Y
Sbjct  297  GSEMSGGIQDVRAEDIVAINTESAVRIKTAVGRGAYVKDIYVRRMTLHTMKWAFWMTGNY  356

Query  362  GSHADKNFDPKAIPVVAGINFRDVVADNVTTAGTMEGIPGHPFTGICMANVTIGMAKNGK  541
            GSHAD N+D  A P + GIN+RDVVA+NVT A  +EGI  HPFTGICM+NVTIG+AK  K
Sbjct  357  GSHADGNYDKNAFPEITGINYRDVVAENVTMAARLEGIADHPFTGICMSNVTIGLAKKAK  416

Query  542  KQPPWVCANIQGVASGVVPPPCNLLHSQGPVKPGMCDLPAKN  667
            KQ PW C +IQG+ SGV P PC LL  QG  KPG CD P  +
Sbjct  417  KQ-PWTCTDIQGITSGVTPTPCGLLPDQGTDKPGGCDFPTDD  457



>gb|KHG15709.1| hypothetical protein F383_10492 [Gossypium arboreum]
Length=482

 Score =   326 bits (836),  Expect = 2e-105, Method: Compositional matrix adjust.
 Identities = 151/221 (68%), Positives = 180/221 (81%), Gaps = 1/221 (0%)
 Frame = +2

Query  2    INPDSCTKVRIEDNYIVSGDDCVAIKSGIDEYGIKYGMPTKQLIIRRLTCISPTSGAIAM  181
            INPDSCT VRIED+YIVSGDDC+A+KSG DEYGI +GMPTKQL+IRRLTCISP S AIA+
Sbjct  244  INPDSCTNVRIEDSYIVSGDDCIAVKSGWDEYGISFGMPTKQLVIRRLTCISPYSAAIAL  303

Query  182  GSEMSGGIEDVRASDITALDTESGVRIKTALGRGGYVKNIYVKGLRAHTMKLLFQMTGKY  361
            GSEMSGGIEDVRA DITA+ TESGVRIKTA GRGG+VK+IYVKG+  HTMK +F MTG Y
Sbjct  304  GSEMSGGIEDVRAEDITAIHTESGVRIKTARGRGGFVKDIYVKGMTLHTMKWVFWMTGNY  363

Query  362  GSHADKNFDPKAIPVVAGINFRDVVADNVTTAGTMEGIPGHPFTGICMANVTIGMAKNGK  541
             +HAD ++DP A+PV+ GIN+RD++ADNV+ A  +EGI G PFT IC++NVTIGMA   K
Sbjct  364  KAHADNHYDPNALPVIQGINYRDIMADNVSMAARLEGIEGDPFTQICISNVTIGMAAKAK  423

Query  542  KQPPWVCANIQGVASGVVPPPCNLLHSQGPVKPGMCDLPAK  664
            K  PW C +++G+ SGV P PC+ L  QGP K   CD PA+
Sbjct  424  K-VPWTCTDVEGITSGVSPRPCDQLPDQGPEKITACDFPAE  463



>ref|XP_002278930.1| PREDICTED: probable polygalacturonase [Vitis vinifera]
Length=480

 Score =   326 bits (836),  Expect = 2e-105, Method: Compositional matrix adjust.
 Identities = 154/222 (69%), Positives = 178/222 (80%), Gaps = 1/222 (0%)
 Frame = +2

Query  2    INPDSCTKVRIEDNYIVSGDDCVAIKSGIDEYGIKYGMPTKQLIIRRLTCISPTSGAIAM  181
            INPDSCT  RIED YIVSGDDC+A+KSG DEYGI YGMPTKQL+IRRLTCISP S  IA+
Sbjct  242  INPDSCTNTRIEDCYIVSGDDCIAVKSGWDEYGIAYGMPTKQLVIRRLTCISPFSATIAL  301

Query  182  GSEMSGGIEDVRASDITALDTESGVRIKTALGRGGYVKNIYVKGLRAHTMKLLFQMTGKY  361
            GSEMSGGIEDVRA DI A+DTESGVRIKTA+GRGGYVK+IYV+ +   TMK  F MTG Y
Sbjct  302  GSEMSGGIEDVRAEDILAIDTESGVRIKTAVGRGGYVKDIYVRSMIMKTMKWAFWMTGNY  361

Query  362  GSHADKNFDPKAIPVVAGINFRDVVADNVTTAGTMEGIPGHPFTGICMANVTIGMAKNGK  541
            GSHAD N+DP A+P + GIN+RD+VA+NVT AG +EGI G PFTGIC++NVTIG+AK  K
Sbjct  362  GSHADNNYDPNALPAIQGINYRDMVAENVTMAGRLEGISGDPFTGICISNVTIGLAKKAK  421

Query  542  KQPPWVCANIQGVASGVVPPPCNLLHSQGPVKPGMCDLPAKN  667
            K  PW C +I G+ SGVVP PC+LL  QGP K   C+ P  +
Sbjct  422  KA-PWTCTDIAGITSGVVPQPCDLLPDQGPEKIVACNFPTDS  462



>gb|KHG15710.1| hypothetical protein F383_10492 [Gossypium arboreum]
Length=481

 Score =   326 bits (835),  Expect = 2e-105, Method: Compositional matrix adjust.
 Identities = 151/221 (68%), Positives = 180/221 (81%), Gaps = 1/221 (0%)
 Frame = +2

Query  2    INPDSCTKVRIEDNYIVSGDDCVAIKSGIDEYGIKYGMPTKQLIIRRLTCISPTSGAIAM  181
            INPDSCT VRIED+YIVSGDDC+A+KSG DEYGI +GMPTKQL+IRRLTCISP S AIA+
Sbjct  243  INPDSCTNVRIEDSYIVSGDDCIAVKSGWDEYGISFGMPTKQLVIRRLTCISPYSAAIAL  302

Query  182  GSEMSGGIEDVRASDITALDTESGVRIKTALGRGGYVKNIYVKGLRAHTMKLLFQMTGKY  361
            GSEMSGGIEDVRA DITA+ TESGVRIKTA GRGG+VK+IYVKG+  HTMK +F MTG Y
Sbjct  303  GSEMSGGIEDVRAEDITAIHTESGVRIKTARGRGGFVKDIYVKGMTLHTMKWVFWMTGNY  362

Query  362  GSHADKNFDPKAIPVVAGINFRDVVADNVTTAGTMEGIPGHPFTGICMANVTIGMAKNGK  541
             +HAD ++DP A+PV+ GIN+RD++ADNV+ A  +EGI G PFT IC++NVTIGMA   K
Sbjct  363  KAHADNHYDPNALPVIQGINYRDIMADNVSMAARLEGIEGDPFTQICISNVTIGMAAKAK  422

Query  542  KQPPWVCANIQGVASGVVPPPCNLLHSQGPVKPGMCDLPAK  664
            K  PW C +++G+ SGV P PC+ L  QGP K   CD PA+
Sbjct  423  K-VPWTCTDVEGITSGVSPRPCDQLPDQGPEKITACDFPAE  462



>gb|KDP28587.1| hypothetical protein JCGZ_14358 [Jatropha curcas]
Length=479

 Score =   326 bits (835),  Expect = 2e-105, Method: Compositional matrix adjust.
 Identities = 155/222 (70%), Positives = 177/222 (80%), Gaps = 1/222 (0%)
 Frame = +2

Query  2    INPDSCTKVRIEDNYIVSGDDCVAIKSGIDEYGIKYGMPTKQLIIRRLTCISPTSGAIAM  181
            INPDSCT  +IED YIVSGDDCVA+KSG DEYGI +GMPTKQLIIRRLTCISP S  IA+
Sbjct  243  INPDSCTNTKIEDCYIVSGDDCVAVKSGWDEYGIAFGMPTKQLIIRRLTCISPYSATIAL  302

Query  182  GSEMSGGIEDVRASDITALDTESGVRIKTALGRGGYVKNIYVKGLRAHTMKLLFQMTGKY  361
            GSEMSGGI+DVRA DITA+ TESGVRIKTA+GRGG+VK+IYVK +  HTMK +F MTG Y
Sbjct  303  GSEMSGGIQDVRAEDITAIHTESGVRIKTAVGRGGFVKDIYVKRMTMHTMKWVFWMTGNY  362

Query  362  GSHADKNFDPKAIPVVAGINFRDVVADNVTTAGTMEGIPGHPFTGICMANVTIGMAKNGK  541
            GSHADKN+DP A+PV+ GIN+RD+VADNVT A  +EGI G PF  IC++NVTIGMA   K
Sbjct  363  GSHADKNYDPNALPVIQGINYRDMVADNVTMAARLEGISGDPFKEICISNVTIGMAAKAK  422

Query  542  KQPPWVCANIQGVASGVVPPPCNLLHSQGPVKPGMCDLPAKN  667
            K  PW C  I G+ SGV P PC+LL  QGP K   CD P +N
Sbjct  423  KV-PWTCTEIAGITSGVSPRPCDLLPDQGPEKLTECDFPPEN  463



>ref|XP_003552411.1| PREDICTED: probable polygalacturonase [Glycine max]
 gb|KHM99339.1| Putative polygalacturonase [Glycine soja]
Length=484

 Score =   325 bits (834),  Expect = 3e-105, Method: Compositional matrix adjust.
 Identities = 154/222 (69%), Positives = 176/222 (79%), Gaps = 1/222 (0%)
 Frame = +2

Query  2    INPDSCTKVRIEDNYIVSGDDCVAIKSGIDEYGIKYGMPTKQLIIRRLTCISPTSGAIAM  181
            INPDSCT VRIED YIVSGDDCVA+KSG DEYGIK+G PTKQL+IRRLTCISP S  IA+
Sbjct  244  INPDSCTNVRIEDCYIVSGDDCVAVKSGWDEYGIKFGWPTKQLVIRRLTCISPYSATIAL  303

Query  182  GSEMSGGIEDVRASDITALDTESGVRIKTALGRGGYVKNIYVKGLRAHTMKLLFQMTGKY  361
            GSEMSGGI+DVRA DITA+ TESGVRIKTA+GRGGYVK+IYVK +  HTMK  F+MTG Y
Sbjct  304  GSEMSGGIQDVRAEDITAIQTESGVRIKTAVGRGGYVKDIYVKRMTLHTMKWAFKMTGDY  363

Query  362  GSHADKNFDPKAIPVVAGINFRDVVADNVTTAGTMEGIPGHPFTGICMANVTIGMAKNGK  541
             SHAD ++DP A+P +  IN+RDVVA+NVT A   +GI   PFTGIC+ANVT+ MA   K
Sbjct  364  NSHADGHYDPNALPEIKNINYRDVVAENVTIAARFQGISNDPFTGICIANVTLRMAAKAK  423

Query  542  KQPPWVCANIQGVASGVVPPPCNLLHSQGPVKPGMCDLPAKN  667
            KQ PW C +I+G+ SGV PPPC LL  QGP K   CD PA N
Sbjct  424  KQ-PWTCTDIEGMTSGVTPPPCGLLPDQGPEKITACDFPADN  464



>ref|XP_002301370.1| polygalacturonase-like family protein [Populus trichocarpa]
 gb|EEE80643.1| polygalacturonase-like family protein [Populus trichocarpa]
Length=470

 Score =   325 bits (832),  Expect = 5e-105, Method: Compositional matrix adjust.
 Identities = 154/222 (69%), Positives = 178/222 (80%), Gaps = 1/222 (0%)
 Frame = +2

Query  2    INPDSCTKVRIEDNYIVSGDDCVAIKSGIDEYGIKYGMPTKQLIIRRLTCISPTSGAIAM  181
            INPDSCT  +IED YIVSGDDCVA+KSG DEYGI +GMPTKQL+IRRLTCISP S  IA+
Sbjct  232  INPDSCTNTKIEDCYIVSGDDCVAVKSGWDEYGIAFGMPTKQLVIRRLTCISPYSATIAL  291

Query  182  GSEMSGGIEDVRASDITALDTESGVRIKTALGRGGYVKNIYVKGLRAHTMKLLFQMTGKY  361
            GSEMSGGIEDVRA DITA+ TESGVRIKTA+GRGGYVK+IYVK +  HTMK +F MTG Y
Sbjct  292  GSEMSGGIEDVRAEDITAIHTESGVRIKTAVGRGGYVKDIYVKRMTMHTMKWVFWMTGNY  351

Query  362  GSHADKNFDPKAIPVVAGINFRDVVADNVTTAGTMEGIPGHPFTGICMANVTIGMAKNGK  541
            GSHADKN+DP A+P++ GIN+RD+VADNVT A  +EGI G PF  IC++NVTIG+A   K
Sbjct  352  GSHADKNYDPNALPLIQGINYRDMVADNVTMAARLEGIAGDPFKEICISNVTIGLAPKAK  411

Query  542  KQPPWVCANIQGVASGVVPPPCNLLHSQGPVKPGMCDLPAKN  667
            K  PW C  I+G+ SGV P PC+LL  QGP K   CD P +N
Sbjct  412  KV-PWTCTEIEGMTSGVSPRPCDLLPDQGPEKITSCDFPPEN  452



>gb|ABG34276.1| polygalacturonase [Eucalyptus globulus subsp. globulus]
Length=241

 Score =   316 bits (810),  Expect = 6e-105, Method: Compositional matrix adjust.
 Identities = 150/219 (68%), Positives = 178/219 (81%), Gaps = 1/219 (0%)
 Frame = +2

Query  2    INPDSCTKVRIEDNYIVSGDDCVAIKSGIDEYGIKYGMPTKQLIIRRLTCISPTSGAIAM  181
            INPDSCT  +IED YIVSGDDCVA+KSG DEYGI YGMPTKQL+IRRLTCISPTS  IA+
Sbjct  3    INPDSCTNTKIEDCYIVSGDDCVAVKSGWDEYGIAYGMPTKQLVIRRLTCISPTSAVIAL  62

Query  182  GSEMSGGIEDVRASDITALDTESGVRIKTALGRGGYVKNIYVKGLRAHTMKLLFQMTGKY  361
            GSEMSGGIEDVRA DI A+++ESGVRIKTA+GRGGYVK+IYVKG+   TMK +F MTG Y
Sbjct  63   GSEMSGGIEDVRAEDILAINSESGVRIKTAIGRGGYVKDIYVKGMTMRTMKWVFWMTGNY  122

Query  362  GSHADKNFDPKAIPVVAGINFRDVVADNVTTAGTMEGIPGHPFTGICMANVTIGMAKNGK  541
            GSHAD N+DP A+P++  IN+RD+VA+NVT A  +EGI G PFTGIC++NVTIG+A+  K
Sbjct  123  GSHADNNYDPNALPLIQNINYRDMVAENVTMAARLEGIAGDPFTGICISNVTIGLAQKPK  182

Query  542  KQPPWVCANIQGVASGVVPPPCNLLHSQGPVKPGMCDLP  658
            K   W C +I G++S VVP PCN L +QGP K   C+ P
Sbjct  183  KL-QWNCTDISGISSSVVPQPCNALPNQGPEKLPACNFP  220



>ref|XP_003533597.1| PREDICTED: probable polygalacturonase-like [Glycine max]
 gb|KHN29325.1| Putative polygalacturonase [Glycine soja]
Length=484

 Score =   323 bits (829),  Expect = 2e-104, Method: Compositional matrix adjust.
 Identities = 153/220 (70%), Positives = 175/220 (80%), Gaps = 1/220 (0%)
 Frame = +2

Query  2    INPDSCTKVRIEDNYIVSGDDCVAIKSGIDEYGIKYGMPTKQLIIRRLTCISPTSGAIAM  181
            INPDSCT VRIED YIVSGDDCVA+KSG DEYGIK+G PTKQL+IRRLTCISP S  IA+
Sbjct  244  INPDSCTNVRIEDCYIVSGDDCVAVKSGWDEYGIKFGWPTKQLMIRRLTCISPYSATIAL  303

Query  182  GSEMSGGIEDVRASDITALDTESGVRIKTALGRGGYVKNIYVKGLRAHTMKLLFQMTGKY  361
            GSEMSGGI+DVRA DITA+ TESGVRIKTA+GRGGYVK+IYVK +  HTMK  F+MTG Y
Sbjct  304  GSEMSGGIQDVRAEDITAIQTESGVRIKTAVGRGGYVKDIYVKRMTLHTMKWAFKMTGDY  363

Query  362  GSHADKNFDPKAIPVVAGINFRDVVADNVTTAGTMEGIPGHPFTGICMANVTIGMAKNGK  541
             SHAD ++DP A+P +  IN+RDVVA+NVT A   +GI   PFTGIC+ANVT+ MA   K
Sbjct  364  NSHADSHYDPNALPEIKNINYRDVVAENVTIAARFQGISNDPFTGICIANVTLRMAAKAK  423

Query  542  KQPPWVCANIQGVASGVVPPPCNLLHSQGPVKPGMCDLPA  661
            KQ PW C +I+G+ SGV PPPC LL  QGP K   CD PA
Sbjct  424  KQ-PWTCTDIEGMTSGVTPPPCGLLPDQGPEKITACDFPA  462



>ref|XP_011022627.1| PREDICTED: probable polygalacturonase [Populus euphratica]
Length=479

 Score =   323 bits (828),  Expect = 2e-104, Method: Compositional matrix adjust.
 Identities = 151/222 (68%), Positives = 181/222 (82%), Gaps = 1/222 (0%)
 Frame = +2

Query  2    INPDSCTKVRIEDNYIVSGDDCVAIKSGIDEYGIKYGMPTKQLIIRRLTCISPTSGAIAM  181
            INPDSCT  RI+D YIVSGDDCVA+KSG DEYGI +GMPTKQ++IRRLTCISPTS  IA+
Sbjct  242  INPDSCTNTRIQDCYIVSGDDCVAVKSGWDEYGIAFGMPTKQVVIRRLTCISPTSAVIAL  301

Query  182  GSEMSGGIEDVRASDITALDTESGVRIKTALGRGGYVKNIYVKGLRAHTMKLLFQMTGKY  361
            GSEMSGGIEDVRA DITA+D+ESGVRIKTA+GRGGYVK+IYV+G+   TMK +F MTG Y
Sbjct  302  GSEMSGGIEDVRAEDITAIDSESGVRIKTAVGRGGYVKDIYVRGMTLKTMKWVFWMTGNY  361

Query  362  GSHADKNFDPKAIPVVAGINFRDVVADNVTTAGTMEGIPGHPFTGICMANVTIGMAKNGK  541
            GSH D N+DP AIPV+  IN+RDVVA+NVT A  +EGI G PFTGIC++NVTIG+A+N +
Sbjct  362  GSHPDNNYDPNAIPVIQNINYRDVVAENVTMAARLEGIAGDPFTGICISNVTIGLARN-R  420

Query  542  KQPPWVCANIQGVASGVVPPPCNLLHSQGPVKPGMCDLPAKN  667
            K+  W C+++ G+ S V P PC+LL  QGP K G C+ P  N
Sbjct  421  KKLQWNCSDVAGITSEVTPKPCDLLSDQGPGKIGACNYPEDN  462



>ref|XP_011029346.1| PREDICTED: probable polygalacturonase [Populus euphratica]
Length=481

 Score =   323 bits (828),  Expect = 3e-104, Method: Compositional matrix adjust.
 Identities = 153/219 (70%), Positives = 177/219 (81%), Gaps = 1/219 (0%)
 Frame = +2

Query  2    INPDSCTKVRIEDNYIVSGDDCVAIKSGIDEYGIKYGMPTKQLIIRRLTCISPTSGAIAM  181
            INPDSCT  RIED Y+VSGDDCVA+KSG DEYGI +GMPTKQL+IRRLTCISPTS  IA+
Sbjct  242  INPDSCTNTRIEDCYVVSGDDCVAVKSGWDEYGISFGMPTKQLVIRRLTCISPTSAVIAL  301

Query  182  GSEMSGGIEDVRASDITALDTESGVRIKTALGRGGYVKNIYVKGLRAHTMKLLFQMTGKY  361
            GSEMSGGIEDVRA DITA+D+ESGVRIKTA+GRGGYVK+IYV+G+   TMK +F MTG Y
Sbjct  302  GSEMSGGIEDVRAEDITAIDSESGVRIKTAVGRGGYVKDIYVRGMTLKTMKWVFWMTGNY  361

Query  362  GSHADKNFDPKAIPVVAGINFRDVVADNVTTAGTMEGIPGHPFTGICMANVTIGMAKNGK  541
            GSH D N+DP AIPV+  IN+RDVVA+NVT A  +EGI G PFTGIC++NVTIG+A+N K
Sbjct  362  GSHPDDNYDPNAIPVIQNINYRDVVAENVTMAAKLEGIAGDPFTGICISNVTIGLAQNSK  421

Query  542  KQPPWVCANIQGVASGVVPPPCNLLHSQGPVKPGMCDLP  658
            K   W C ++ G+ S V P PC LL  QGP K G CD P
Sbjct  422  KL-QWNCTDVAGITSEVNPKPCALLADQGPGKIGGCDFP  459



>ref|XP_002303605.2| hypothetical protein POPTR_0003s13160g [Populus trichocarpa]
 gb|EEE78584.2| hypothetical protein POPTR_0003s13160g [Populus trichocarpa]
Length=479

 Score =   322 bits (826),  Expect = 4e-104, Method: Compositional matrix adjust.
 Identities = 150/222 (68%), Positives = 181/222 (82%), Gaps = 1/222 (0%)
 Frame = +2

Query  2    INPDSCTKVRIEDNYIVSGDDCVAIKSGIDEYGIKYGMPTKQLIIRRLTCISPTSGAIAM  181
            INPDSCT  +I+D YIVSGDDCVA+KSG DEYGI +GMPTKQ++IRRLTCISPTS  IA+
Sbjct  242  INPDSCTNTKIQDCYIVSGDDCVAVKSGWDEYGIAFGMPTKQVVIRRLTCISPTSAVIAL  301

Query  182  GSEMSGGIEDVRASDITALDTESGVRIKTALGRGGYVKNIYVKGLRAHTMKLLFQMTGKY  361
            GSEMSGGIEDVRA DITA+D+ESGVRIKTA+GRGGYVK+IYV+G+   TMK +F MTG Y
Sbjct  302  GSEMSGGIEDVRAEDITAIDSESGVRIKTAVGRGGYVKDIYVRGMTLKTMKWVFWMTGNY  361

Query  362  GSHADKNFDPKAIPVVAGINFRDVVADNVTTAGTMEGIPGHPFTGICMANVTIGMAKNGK  541
            GSH D N+DP AIPV+  IN+RDVVA+NVT A  +EGI G PFTGIC++NVTIG+A+N +
Sbjct  362  GSHPDNNYDPNAIPVIQNINYRDVVAENVTMAARLEGIAGDPFTGICISNVTIGLARN-R  420

Query  542  KQPPWVCANIQGVASGVVPPPCNLLHSQGPVKPGMCDLPAKN  667
            K+  W C+++ G+ S V P PC+LL  QGP K G C+ P  N
Sbjct  421  KKLQWNCSDVAGITSEVTPKPCDLLSDQGPGKIGACNYPEDN  462



>ref|XP_007139799.1| hypothetical protein PHAVU_008G059700g [Phaseolus vulgaris]
 gb|ESW11793.1| hypothetical protein PHAVU_008G059700g [Phaseolus vulgaris]
Length=486

 Score =   322 bits (826),  Expect = 5e-104, Method: Compositional matrix adjust.
 Identities = 154/220 (70%), Positives = 173/220 (79%), Gaps = 1/220 (0%)
 Frame = +2

Query  2    INPDSCTKVRIEDNYIVSGDDCVAIKSGIDEYGIKYGMPTKQLIIRRLTCISPTSGAIAM  181
            INPDSCT VRIED YIVSGDDCVA+KSG DEYGIK+G PTK L+IRRLTCISP S  IA+
Sbjct  242  INPDSCTNVRIEDCYIVSGDDCVAVKSGWDEYGIKFGWPTKHLVIRRLTCISPFSATIAL  301

Query  182  GSEMSGGIEDVRASDITALDTESGVRIKTALGRGGYVKNIYVKGLRAHTMKLLFQMTGKY  361
            GSEMSGGI+DVRA DITA+ TESGVRIKTA GRGGYVK+IYVK +  HTMK  F+MTG Y
Sbjct  302  GSEMSGGIQDVRAEDITAIQTESGVRIKTAAGRGGYVKDIYVKRMTLHTMKWAFKMTGDY  361

Query  362  GSHADKNFDPKAIPVVAGINFRDVVADNVTTAGTMEGIPGHPFTGICMANVTIGMAKNGK  541
             SHAD ++DP A+P +  IN+RDVVADNVT A   +GI   PFTGIC+ANVT+ MA   K
Sbjct  362  NSHADSHYDPNALPEIKNINYRDVVADNVTIAARFQGISNDPFTGICIANVTLRMAVKAK  421

Query  542  KQPPWVCANIQGVASGVVPPPCNLLHSQGPVKPGMCDLPA  661
            KQ PW C +I+GV SGV PPPC LL  QGP K   CD PA
Sbjct  422  KQ-PWTCTDIEGVTSGVNPPPCGLLPDQGPEKITACDFPA  460



>ref|XP_003624048.1| Polygalacturonase [Medicago truncatula]
 gb|AES80266.1| polygalacturonase/glycoside hydrolase family protein [Medicago 
truncatula]
Length=483

 Score =   322 bits (826),  Expect = 5e-104, Method: Compositional matrix adjust.
 Identities = 152/222 (68%), Positives = 177/222 (80%), Gaps = 1/222 (0%)
 Frame = +2

Query  2    INPDSCTKVRIEDNYIVSGDDCVAIKSGIDEYGIKYGMPTKQLIIRRLTCISPTSGAIAM  181
            INPDSCT  +IED YIVSGDDCVA+KSG DEYGIK+G PTKQL+IRRLTCISP S  IA+
Sbjct  244  INPDSCTNTKIEDCYIVSGDDCVAVKSGWDEYGIKFGWPTKQLVIRRLTCISPFSATIAL  303

Query  182  GSEMSGGIEDVRASDITALDTESGVRIKTALGRGGYVKNIYVKGLRAHTMKLLFQMTGKY  361
            GSEMSGGI+DVRA DITA+ TESGVRIKTA+GRGGYVK+IYVK    HTMK  F+MTG Y
Sbjct  304  GSEMSGGIQDVRAEDITAIRTESGVRIKTAVGRGGYVKDIYVKRFTMHTMKWAFKMTGDY  363

Query  362  GSHADKNFDPKAIPVVAGINFRDVVADNVTTAGTMEGIPGHPFTGICMANVTIGMAKNGK  541
             SHAD +FDP A+P +A IN+RDVVA+NVT A   +GI   PF GIC+ANVT+GMA   K
Sbjct  364  NSHADTHFDPNALPEIANINYRDVVAENVTIAARFQGISNDPFKGICIANVTLGMAVKAK  423

Query  542  KQPPWVCANIQGVASGVVPPPCNLLHSQGPVKPGMCDLPAKN  667
            K+  W C +I+G+ SGV PPPC+LL  QGP K G CD PA++
Sbjct  424  KR-SWTCTDIEGMTSGVTPPPCDLLPDQGPEKIGACDFPAES  464



>ref|XP_011023292.1| PREDICTED: probable polygalacturonase isoform X2 [Populus euphratica]
Length=470

 Score =   322 bits (825),  Expect = 5e-104, Method: Compositional matrix adjust.
 Identities = 152/219 (69%), Positives = 176/219 (80%), Gaps = 1/219 (0%)
 Frame = +2

Query  2    INPDSCTKVRIEDNYIVSGDDCVAIKSGIDEYGIKYGMPTKQLIIRRLTCISPTSGAIAM  181
            INPDSCT  +IED YIVSGDDCVA+KSG DEYGI +GMPTKQL+IRRLTCISP S  IA+
Sbjct  232  INPDSCTNTKIEDCYIVSGDDCVAVKSGWDEYGIAFGMPTKQLVIRRLTCISPYSATIAL  291

Query  182  GSEMSGGIEDVRASDITALDTESGVRIKTALGRGGYVKNIYVKGLRAHTMKLLFQMTGKY  361
            GSEMSGGIEDVRA D+TA+ TESGVRIKTA+GRGGYVK+IYVK +  HTMK +F MTG Y
Sbjct  292  GSEMSGGIEDVRAEDLTAIHTESGVRIKTAVGRGGYVKDIYVKRMTMHTMKWVFWMTGNY  351

Query  362  GSHADKNFDPKAIPVVAGINFRDVVADNVTTAGTMEGIPGHPFTGICMANVTIGMAKNGK  541
            GSHADKN+DP A+P++ GIN+RD+VADNVT A  +EGI G PF  IC++NVTIG+A   K
Sbjct  352  GSHADKNYDPNALPLIQGINYRDMVADNVTMAARLEGIAGDPFKEICISNVTIGLAPKAK  411

Query  542  KQPPWVCANIQGVASGVVPPPCNLLHSQGPVKPGMCDLP  658
            K  PW C  I+G+ SGV P PC+LL  QGP K   CD P
Sbjct  412  KV-PWTCTEIEGMTSGVSPRPCDLLPDQGPEKITSCDFP  449



>ref|XP_011023291.1| PREDICTED: probable polygalacturonase isoform X1 [Populus euphratica]
Length=473

 Score =   322 bits (824),  Expect = 6e-104, Method: Compositional matrix adjust.
 Identities = 152/219 (69%), Positives = 176/219 (80%), Gaps = 1/219 (0%)
 Frame = +2

Query  2    INPDSCTKVRIEDNYIVSGDDCVAIKSGIDEYGIKYGMPTKQLIIRRLTCISPTSGAIAM  181
            INPDSCT  +IED YIVSGDDCVA+KSG DEYGI +GMPTKQL+IRRLTCISP S  IA+
Sbjct  235  INPDSCTNTKIEDCYIVSGDDCVAVKSGWDEYGIAFGMPTKQLVIRRLTCISPYSATIAL  294

Query  182  GSEMSGGIEDVRASDITALDTESGVRIKTALGRGGYVKNIYVKGLRAHTMKLLFQMTGKY  361
            GSEMSGGIEDVRA D+TA+ TESGVRIKTA+GRGGYVK+IYVK +  HTMK +F MTG Y
Sbjct  295  GSEMSGGIEDVRAEDLTAIHTESGVRIKTAVGRGGYVKDIYVKRMTMHTMKWVFWMTGNY  354

Query  362  GSHADKNFDPKAIPVVAGINFRDVVADNVTTAGTMEGIPGHPFTGICMANVTIGMAKNGK  541
            GSHADKN+DP A+P++ GIN+RD+VADNVT A  +EGI G PF  IC++NVTIG+A   K
Sbjct  355  GSHADKNYDPNALPLIQGINYRDMVADNVTMAARLEGIAGDPFKEICISNVTIGLAPKAK  414

Query  542  KQPPWVCANIQGVASGVVPPPCNLLHSQGPVKPGMCDLP  658
            K  PW C  I+G+ SGV P PC+LL  QGP K   CD P
Sbjct  415  KV-PWTCTEIEGMTSGVSPRPCDLLPDQGPEKITSCDFP  452



>gb|AFK43011.1| unknown [Medicago truncatula]
Length=483

 Score =   322 bits (824),  Expect = 9e-104, Method: Compositional matrix adjust.
 Identities = 152/222 (68%), Positives = 177/222 (80%), Gaps = 1/222 (0%)
 Frame = +2

Query  2    INPDSCTKVRIEDNYIVSGDDCVAIKSGIDEYGIKYGMPTKQLIIRRLTCISPTSGAIAM  181
            INPDSCT  +IED YIVSGDDCVA+KSG DEYGIK+G PTKQL+IRRLTCISP S  IA+
Sbjct  244  INPDSCTNTKIEDCYIVSGDDCVAVKSGWDEYGIKFGWPTKQLVIRRLTCISPFSATIAL  303

Query  182  GSEMSGGIEDVRASDITALDTESGVRIKTALGRGGYVKNIYVKGLRAHTMKLLFQMTGKY  361
            GSEMSGGI+DVRA DITA+ TESGVRIKTA+GRGGYVK+IYVK    HTMK  F+MTG Y
Sbjct  304  GSEMSGGIQDVRAEDITAIRTESGVRIKTAVGRGGYVKDIYVKRFTMHTMKWAFKMTGDY  363

Query  362  GSHADKNFDPKAIPVVAGINFRDVVADNVTTAGTMEGIPGHPFTGICMANVTIGMAKNGK  541
             SHAD +FDP A+P +A IN+RDVVA+NVT A   +GI   PF GIC+ANVT+GMA   K
Sbjct  364  NSHADTHFDPNALPEIANINYRDVVAENVTIAARFQGIFNDPFKGICIANVTLGMAVKAK  423

Query  542  KQPPWVCANIQGVASGVVPPPCNLLHSQGPVKPGMCDLPAKN  667
            K+  W C +I+G+ SGV PPPC+LL  QGP K G CD PA++
Sbjct  424  KR-SWTCTDIEGMTSGVTPPPCDLLPDQGPEKIGACDFPAES  464



>ref|XP_004503680.1| PREDICTED: probable polygalacturonase-like isoform X3 [Cicer 
arietinum]
Length=470

 Score =   320 bits (821),  Expect = 2e-103, Method: Compositional matrix adjust.
 Identities = 153/222 (69%), Positives = 176/222 (79%), Gaps = 1/222 (0%)
 Frame = +2

Query  2    INPDSCTKVRIEDNYIVSGDDCVAIKSGIDEYGIKYGMPTKQLIIRRLTCISPTSGAIAM  181
            INPDSCT  RIED YIVSGDDCVA+KSG DEYGI YGMPTKQL+IRRLTCISPTS  IA+
Sbjct  232  INPDSCTNTRIEDCYIVSGDDCVAVKSGWDEYGIAYGMPTKQLVIRRLTCISPTSAVIAL  291

Query  182  GSEMSGGIEDVRASDITALDTESGVRIKTALGRGGYVKNIYVKGLRAHTMKLLFQMTGKY  361
            GSEMSGGIEDVRA DI A+++ESGVRIKTA+GRGGYVK+IYV+ +   TMK  F MTG Y
Sbjct  292  GSEMSGGIEDVRAEDIVAINSESGVRIKTAVGRGGYVKDIYVRRMTMKTMKWAFWMTGDY  351

Query  362  GSHADKNFDPKAIPVVAGINFRDVVADNVTTAGTMEGIPGHPFTGICMANVTIGMAKNGK  541
            GSHAD N+DP A+PVV  +N+RD+VADNVT A  +EGI   PFTGIC++NVTIG+AK  K
Sbjct  352  GSHADNNYDPNALPVVQNVNYRDMVADNVTMAAKLEGISNAPFTGICISNVTIGLAKKAK  411

Query  542  KQPPWVCANIQGVASGVVPPPCNLLHSQGPVKPGMCDLPAKN  667
            K  PW C +I G++SGV P PC+LL  QG  K G C  P  N
Sbjct  412  KV-PWNCTDIAGISSGVTPSPCDLLPDQGVQKIGACTFPEDN  452



>ref|XP_002299511.1| hypothetical protein POPTR_0001s09790g [Populus trichocarpa]
 gb|EEE84316.1| hypothetical protein POPTR_0001s09790g [Populus trichocarpa]
Length=481

 Score =   321 bits (822),  Expect = 2e-103, Method: Compositional matrix adjust.
 Identities = 153/219 (70%), Positives = 177/219 (81%), Gaps = 1/219 (0%)
 Frame = +2

Query  2    INPDSCTKVRIEDNYIVSGDDCVAIKSGIDEYGIKYGMPTKQLIIRRLTCISPTSGAIAM  181
            INPDSCT  RIED YIVSGDDCVA+KSG DEYGI +GMPTKQL+IRRLTCISPTS  IA+
Sbjct  242  INPDSCTNTRIEDCYIVSGDDCVAVKSGWDEYGISFGMPTKQLVIRRLTCISPTSAVIAL  301

Query  182  GSEMSGGIEDVRASDITALDTESGVRIKTALGRGGYVKNIYVKGLRAHTMKLLFQMTGKY  361
            GSEMSGGIEDVRA DITA+D+ESGVRIKTA+GRGGYVK+IYV+G+   TMK +F MTG Y
Sbjct  302  GSEMSGGIEDVRAEDITAIDSESGVRIKTAVGRGGYVKDIYVRGMTLKTMKWVFWMTGNY  361

Query  362  GSHADKNFDPKAIPVVAGINFRDVVADNVTTAGTMEGIPGHPFTGICMANVTIGMAKNGK  541
            GSH D N+DP AIPV+  IN+RDVVA+NVT A  +EGI G PFTGIC++NVTIG+A+N K
Sbjct  362  GSHPDNNYDPNAIPVIQNINYRDVVAENVTMAAKLEGIAGDPFTGICISNVTIGLAQNSK  421

Query  542  KQPPWVCANIQGVASGVVPPPCNLLHSQGPVKPGMCDLP  658
            K   W C ++ G+ S V P PC LL  QGP K G C+ P
Sbjct  422  KL-QWNCTDVAGITSEVNPKPCALLPDQGPGKIGGCNFP  459



>emb|CDP12065.1| unnamed protein product [Coffea canephora]
Length=468

 Score =   320 bits (821),  Expect = 2e-103, Method: Compositional matrix adjust.
 Identities = 150/222 (68%), Positives = 178/222 (80%), Gaps = 1/222 (0%)
 Frame = +2

Query  2    INPDSCTKVRIEDNYIVSGDDCVAIKSGIDEYGIKYGMPTKQLIIRRLTCISPTSGAIAM  181
            INPDSCT V+I D YIVSGDDCVA+KSG DEYGI +GMPTKQL I+RLTCISP+S  IA+
Sbjct  244  INPDSCTNVQIRDCYIVSGDDCVAVKSGWDEYGIAFGMPTKQLFIKRLTCISPSSATIAL  303

Query  182  GSEMSGGIEDVRASDITALDTESGVRIKTALGRGGYVKNIYVKGLRAHTMKLLFQMTGKY  361
            GSEMSGGIEDVRA DI A++TESGVRIKTA+GRGGYVK+IYVKG+   TMK +F MTG Y
Sbjct  304  GSEMSGGIEDVRAEDIVAINTESGVRIKTAVGRGGYVKDIYVKGMTLKTMKYVFWMTGNY  363

Query  362  GSHADKNFDPKAIPVVAGINFRDVVADNVTTAGTMEGIPGHPFTGICMANVTIGMAKNGK  541
            GSH D N+DP A+P V  IN+RD+VA+NVT AG +EGIPG PFTGIC++NVTI +A+N K
Sbjct  364  GSHPDNNYDPNALPAVENINYRDIVAENVTMAGRLEGIPGDPFTGICISNVTIELAQNAK  423

Query  542  KQPPWVCANIQGVASGVVPPPCNLLHSQGPVKPGMCDLPAKN  667
            K  PW C +I G++SGV P PC+LL  QG      CD P ++
Sbjct  424  KL-PWNCTDISGISSGVTPQPCDLLTQQGEEYSPSCDFPTEH  464



>ref|XP_010053221.1| PREDICTED: probable polygalacturonase [Eucalyptus grandis]
 gb|KCW77483.1| hypothetical protein EUGRSUZ_D01821 [Eucalyptus grandis]
Length=482

 Score =   320 bits (820),  Expect = 5e-103, Method: Compositional matrix adjust.
 Identities = 151/219 (69%), Positives = 179/219 (82%), Gaps = 1/219 (0%)
 Frame = +2

Query  2    INPDSCTKVRIEDNYIVSGDDCVAIKSGIDEYGIKYGMPTKQLIIRRLTCISPTSGAIAM  181
            INPDSCT  +IED YIVSGDDCVA+KSG DEYGI YGMPTKQL+IRRLTCISPTS  IA+
Sbjct  244  INPDSCTNTKIEDCYIVSGDDCVAVKSGWDEYGIAYGMPTKQLVIRRLTCISPTSAVIAL  303

Query  182  GSEMSGGIEDVRASDITALDTESGVRIKTALGRGGYVKNIYVKGLRAHTMKLLFQMTGKY  361
            GSEMSGGIEDVRA DI A+++ESGVRIKTA+GRGGYVK+IYVKG+   TMK +F MTG Y
Sbjct  304  GSEMSGGIEDVRAEDILAINSESGVRIKTAIGRGGYVKDIYVKGMTMRTMKWVFWMTGNY  363

Query  362  GSHADKNFDPKAIPVVAGINFRDVVADNVTTAGTMEGIPGHPFTGICMANVTIGMAKNGK  541
            GSHAD N+DP A+P++  IN+RD+VA+NVT A  +EGI G PFTGIC++NVTIG+A+  K
Sbjct  364  GSHADNNYDPNALPLIQNINYRDMVAENVTMAARLEGIAGDPFTGICISNVTIGLAQKPK  423

Query  542  KQPPWVCANIQGVASGVVPPPCNLLHSQGPVKPGMCDLP  658
            K   W C +I G++S VVPPPCN L +QGP K   C+ P
Sbjct  424  KL-QWNCTDISGISSSVVPPPCNALPNQGPEKLPACNFP  461



>ref|XP_004492778.1| PREDICTED: probable polygalacturonase-like [Cicer arietinum]
Length=483

 Score =   320 bits (819),  Expect = 5e-103, Method: Compositional matrix adjust.
 Identities = 151/222 (68%), Positives = 176/222 (79%), Gaps = 1/222 (0%)
 Frame = +2

Query  2    INPDSCTKVRIEDNYIVSGDDCVAIKSGIDEYGIKYGMPTKQLIIRRLTCISPTSGAIAM  181
            INPDSCT  RIED YIVSGDDCVA+KSG DEYGIK+GMPTKQL+IRRLTCISP S  IA+
Sbjct  242  INPDSCTNTRIEDCYIVSGDDCVAVKSGWDEYGIKFGMPTKQLVIRRLTCISPYSATIAL  301

Query  182  GSEMSGGIEDVRASDITALDTESGVRIKTALGRGGYVKNIYVKGLRAHTMKLLFQMTGKY  361
            GSEMSGGI+DVRA DITA+ TESGVRIKTA+GRGGYVK+IYVK +  +TMK  F+MTG Y
Sbjct  302  GSEMSGGIQDVRAEDITAIRTESGVRIKTAVGRGGYVKDIYVKRMNMYTMKWAFKMTGDY  361

Query  362  GSHADKNFDPKAIPVVAGINFRDVVADNVTTAGTMEGIPGHPFTGICMANVTIGMAKNGK  541
             SHAD ++DP A+P ++ IN+RD+VA+NVT A   EGI   PF GIC+ANVT+GMA   K
Sbjct  362  NSHADTHYDPNALPEISNINYRDIVAENVTIAARFEGISNDPFKGICIANVTLGMAVKAK  421

Query  542  KQPPWVCANIQGVASGVVPPPCNLLHSQGPVKPGMCDLPAKN  667
            KQ PW C +I+G+ SGV PPPC LL  QG  K   CD P +N
Sbjct  422  KQ-PWTCTDIEGMTSGVTPPPCALLPDQGIEKITACDFPKEN  462



>ref|XP_007051731.1| Polygalacturonase, putative isoform 1 [Theobroma cacao]
 gb|EOX95888.1| Polygalacturonase, putative isoform 1 [Theobroma cacao]
Length=484

 Score =   319 bits (818),  Expect = 9e-103, Method: Compositional matrix adjust.
 Identities = 150/219 (68%), Positives = 176/219 (80%), Gaps = 1/219 (0%)
 Frame = +2

Query  2    INPDSCTKVRIEDNYIVSGDDCVAIKSGIDEYGIKYGMPTKQLIIRRLTCISPTSGAIAM  181
            INPDSCT VRIED+YIVSGDDC+A+KSG DEYGI +GMPTKQL+IRRLTCISP S AIA+
Sbjct  246  INPDSCTNVRIEDSYIVSGDDCIAVKSGWDEYGISFGMPTKQLVIRRLTCISPYSAAIAL  305

Query  182  GSEMSGGIEDVRASDITALDTESGVRIKTALGRGGYVKNIYVKGLRAHTMKLLFQMTGKY  361
            GSEMSGGI+DVRA DITA+ TESGVRIKTA GRGG+VK+IYVK +  HTMK +F MTG Y
Sbjct  306  GSEMSGGIQDVRAEDITAVHTESGVRIKTARGRGGFVKDIYVKRMTLHTMKWVFWMTGNY  365

Query  362  GSHADKNFDPKAIPVVAGINFRDVVADNVTTAGTMEGIPGHPFTGICMANVTIGMAKNGK  541
             +HAD ++DP A+PV+ GIN+RDVVADN + A  +EGI G PFT IC++NVTIG+A   K
Sbjct  366  KAHADNHYDPNALPVIQGINYRDVVADNASMAARLEGIEGDPFTQICISNVTIGLAAKAK  425

Query  542  KQPPWVCANIQGVASGVVPPPCNLLHSQGPVKPGMCDLP  658
            K  PW C +I+G+ SGV P PC LL  QGP K   CD P
Sbjct  426  KV-PWTCTDIEGITSGVSPRPCGLLPDQGPGKITACDFP  463



>ref|XP_007051732.1| Polygalacturonase, putative isoform 2 [Theobroma cacao]
 gb|EOX95889.1| Polygalacturonase, putative isoform 2 [Theobroma cacao]
Length=481

 Score =   319 bits (817),  Expect = 9e-103, Method: Compositional matrix adjust.
 Identities = 150/219 (68%), Positives = 176/219 (80%), Gaps = 1/219 (0%)
 Frame = +2

Query  2    INPDSCTKVRIEDNYIVSGDDCVAIKSGIDEYGIKYGMPTKQLIIRRLTCISPTSGAIAM  181
            INPDSCT VRIED+YIVSGDDC+A+KSG DEYGI +GMPTKQL+IRRLTCISP S AIA+
Sbjct  243  INPDSCTNVRIEDSYIVSGDDCIAVKSGWDEYGISFGMPTKQLVIRRLTCISPYSAAIAL  302

Query  182  GSEMSGGIEDVRASDITALDTESGVRIKTALGRGGYVKNIYVKGLRAHTMKLLFQMTGKY  361
            GSEMSGGI+DVRA DITA+ TESGVRIKTA GRGG+VK+IYVK +  HTMK +F MTG Y
Sbjct  303  GSEMSGGIQDVRAEDITAVHTESGVRIKTARGRGGFVKDIYVKRMTLHTMKWVFWMTGNY  362

Query  362  GSHADKNFDPKAIPVVAGINFRDVVADNVTTAGTMEGIPGHPFTGICMANVTIGMAKNGK  541
             +HAD ++DP A+PV+ GIN+RDVVADN + A  +EGI G PFT IC++NVTIG+A   K
Sbjct  363  KAHADNHYDPNALPVIQGINYRDVVADNASMAARLEGIEGDPFTQICISNVTIGLAAKAK  422

Query  542  KQPPWVCANIQGVASGVVPPPCNLLHSQGPVKPGMCDLP  658
            K  PW C +I+G+ SGV P PC LL  QGP K   CD P
Sbjct  423  KV-PWTCTDIEGITSGVSPRPCGLLPDQGPGKITACDFP  460



>ref|XP_007219266.1| hypothetical protein PRUPE_ppa018224mg, partial [Prunus persica]
 gb|EMJ20465.1| hypothetical protein PRUPE_ppa018224mg, partial [Prunus persica]
Length=463

 Score =   318 bits (815),  Expect = 1e-102, Method: Compositional matrix adjust.
 Identities = 149/222 (67%), Positives = 174/222 (78%), Gaps = 1/222 (0%)
 Frame = +2

Query  2    INPDSCTKVRIEDNYIVSGDDCVAIKSGIDEYGIKYGMPTKQLIIRRLTCISPTSGAIAM  181
            INPDSCT  RIED YIVSGDDCVA+KSG DEYGI +G PTKQL+IRRLTCISP S  IA+
Sbjct  238  INPDSCTNTRIEDCYIVSGDDCVAVKSGWDEYGIAFGRPTKQLVIRRLTCISPYSATIAL  297

Query  182  GSEMSGGIEDVRASDITALDTESGVRIKTALGRGGYVKNIYVKGLRAHTMKLLFQMTGKY  361
            GSEMSGGI+DVRA DI A+ TESG+RIKTA+GRGGYVK+IYV+ +  HTMK +F+M G Y
Sbjct  298  GSEMSGGIQDVRAEDIVAIHTESGIRIKTAVGRGGYVKDIYVRRMTMHTMKWVFKMNGDY  357

Query  362  GSHADKNFDPKAIPVVAGINFRDVVADNVTTAGTMEGIPGHPFTGICMANVTIGMAKNGK  541
            GSHAD  +D  AIP + GIN+RD+VADNVT A  +EGI  HPFTGIC++NVTIG+A   K
Sbjct  358  GSHADDKYDKNAIPEIKGINYRDMVADNVTIAARLEGIADHPFTGICISNVTIGLAAKAK  417

Query  542  KQPPWVCANIQGVASGVVPPPCNLLHSQGPVKPGMCDLPAKN  667
            KQ PW C NI+G+ SGV P  C+LL  QG  K   C+ PA N
Sbjct  418  KQ-PWTCTNIEGITSGVTPRSCDLLPDQGHDKATACEFPADN  458



>ref|XP_008232996.1| PREDICTED: LOW QUALITY PROTEIN: probable polygalacturonase [Prunus 
mume]
Length=476

 Score =   318 bits (816),  Expect = 1e-102, Method: Compositional matrix adjust.
 Identities = 149/222 (67%), Positives = 175/222 (79%), Gaps = 1/222 (0%)
 Frame = +2

Query  2    INPDSCTKVRIEDNYIVSGDDCVAIKSGIDEYGIKYGMPTKQLIIRRLTCISPTSGAIAM  181
            INPDSCT  RIED YIVSGDDCVA+KSG DEYGI +G PTKQL+IRRLTCISP S  IA+
Sbjct  238  INPDSCTNTRIEDCYIVSGDDCVAVKSGWDEYGIAFGRPTKQLVIRRLTCISPYSATIAL  297

Query  182  GSEMSGGIEDVRASDITALDTESGVRIKTALGRGGYVKNIYVKGLRAHTMKLLFQMTGKY  361
            GSEMSGGI+DVRA DI A+ TESG+RIKTA+GRGGYVK+IYV+ +  HTMK +F+M G Y
Sbjct  298  GSEMSGGIQDVRAEDIVAIHTESGIRIKTAVGRGGYVKDIYVRRMTMHTMKWVFKMNGDY  357

Query  362  GSHADKNFDPKAIPVVAGINFRDVVADNVTTAGTMEGIPGHPFTGICMANVTIGMAKNGK  541
            GSHAD  +D  AIP + GIN+RD+VADNVT A  +EGI  HPFTGIC++NVTIG+A   K
Sbjct  358  GSHADGKYDKNAIPEIKGINYRDMVADNVTIAARLEGIADHPFTGICISNVTIGLAAKAK  417

Query  542  KQPPWVCANIQGVASGVVPPPCNLLHSQGPVKPGMCDLPAKN  667
            KQ PW C NI+G+ SGV P PC+LL  QG  K   C+ PA +
Sbjct  418  KQ-PWTCTNIEGITSGVTPSPCDLLPDQGHDKATACEFPADD  458



>ref|XP_004133855.1| PREDICTED: probable polygalacturonase-like [Cucumis sativus]
 gb|KGN56496.1| hypothetical protein Csa_3G121720 [Cucumis sativus]
Length=493

 Score =   319 bits (817),  Expect = 1e-102, Method: Compositional matrix adjust.
 Identities = 148/222 (67%), Positives = 175/222 (79%), Gaps = 1/222 (0%)
 Frame = +2

Query  2    INPDSCTKVRIEDNYIVSGDDCVAIKSGIDEYGIKYGMPTKQLIIRRLTCISPTSGAIAM  181
            INPDSCT VRIED YIVSGDDCVA+KSG DEYGI +G+PTKQL++RRLTCISPTS  IA+
Sbjct  255  INPDSCTNVRIEDCYIVSGDDCVAVKSGWDEYGISFGLPTKQLVVRRLTCISPTSAVIAL  314

Query  182  GSEMSGGIEDVRASDITALDTESGVRIKTALGRGGYVKNIYVKGLRAHTMKLLFQMTGKY  361
            GSEMSGGIEDVRA DI A+D+ESGVRIKT +GRGGYVK+IYV+ +  HTMK  F MTG Y
Sbjct  315  GSEMSGGIEDVRAEDIVAIDSESGVRIKTGIGRGGYVKDIYVRRMTMHTMKWAFWMTGDY  374

Query  362  GSHADKNFDPKAIPVVAGINFRDVVADNVTTAGTMEGIPGHPFTGICMANVTIGMAKNGK  541
            GSHADKN+DP A+PV+ GIN++D+V +N T A  +EGI G  FT IC++NVTIG+A   K
Sbjct  375  GSHADKNYDPHALPVIQGINYKDMVVENATMAARLEGISGDTFTDICISNVTIGLAPKAK  434

Query  542  KQPPWVCANIQGVASGVVPPPCNLLHSQGPVKPGMCDLPAKN  667
            KQ PW C +I+G+ S V PPPC+LL  QG  K   C  P  N
Sbjct  435  KQ-PWTCTDIEGITSQVTPPPCDLLPDQGEEKITTCKFPEDN  475



>ref|XP_003633958.1| PREDICTED: probable polygalacturonase [Vitis vinifera]
Length=479

 Score =   318 bits (816),  Expect = 2e-102, Method: Compositional matrix adjust.
 Identities = 146/222 (66%), Positives = 179/222 (81%), Gaps = 1/222 (0%)
 Frame = +2

Query  2    INPDSCTKVRIEDNYIVSGDDCVAIKSGIDEYGIKYGMPTKQLIIRRLTCISPTSGAIAM  181
            INPDSCT  RIED YIVSGDDCVA+KSG DEYGI YGMPTKQL+IRRLTCISP S  IA+
Sbjct  240  INPDSCTNTRIEDCYIVSGDDCVAVKSGWDEYGIAYGMPTKQLVIRRLTCISPYSAVIAL  299

Query  182  GSEMSGGIEDVRASDITALDTESGVRIKTALGRGGYVKNIYVKGLRAHTMKLLFQMTGKY  361
            GSEMSGGI+DVRA DI A+++ESG+RIKT +GRGGYVK+IYV+G+   TMK  F MTG Y
Sbjct  300  GSEMSGGIQDVRAEDIVAINSESGIRIKTGIGRGGYVKDIYVRGMTMKTMKWAFWMTGNY  359

Query  362  GSHADKNFDPKAIPVVAGINFRDVVADNVTTAGTMEGIPGHPFTGICMANVTIGMAKNGK  541
            GSHAD ++DPKA PV+ GIN+RD+VA+NV+ A  +EGIP  PFTGIC++NVTI +A   K
Sbjct  360  GSHADNHYDPKAFPVIQGINYRDMVAENVSMAARLEGIPSDPFTGICISNVTIHLAAKAK  419

Query  542  KQPPWVCANIQGVASGVVPPPCNLLHSQGPVKPGMCDLPAKN  667
            K  PW C +++G++SGV P PC+ L  QGP K  +C+ PA++
Sbjct  420  KV-PWTCTDVEGISSGVTPTPCSTLPDQGPEKTSLCNFPAES  460



>sp|A7PZL3.1|PGLR_VITVI RecName: Full=Probable polygalacturonase; Short=PG; AltName: 
Full=Pectinase [Vitis vinifera]
Length=491

 Score =   319 bits (817),  Expect = 2e-102, Method: Compositional matrix adjust.
 Identities = 146/222 (66%), Positives = 179/222 (81%), Gaps = 1/222 (0%)
 Frame = +2

Query  2    INPDSCTKVRIEDNYIVSGDDCVAIKSGIDEYGIKYGMPTKQLIIRRLTCISPTSGAIAM  181
            INPDSCT  RIED YIVSGDDCVA+KSG DEYGI YGMPTKQL+IRRLTCISP S  IA+
Sbjct  252  INPDSCTNTRIEDCYIVSGDDCVAVKSGWDEYGIAYGMPTKQLVIRRLTCISPYSAVIAL  311

Query  182  GSEMSGGIEDVRASDITALDTESGVRIKTALGRGGYVKNIYVKGLRAHTMKLLFQMTGKY  361
            GSEMSGGI+DVRA DI A+++ESG+RIKT +GRGGYVK+IYV+G+   TMK  F MTG Y
Sbjct  312  GSEMSGGIQDVRAEDIVAINSESGIRIKTGIGRGGYVKDIYVRGMTMKTMKWAFWMTGNY  371

Query  362  GSHADKNFDPKAIPVVAGINFRDVVADNVTTAGTMEGIPGHPFTGICMANVTIGMAKNGK  541
            GSHAD ++DPKA PV+ GIN+RD+VA+NV+ A  +EGIP  PFTGIC++NVTI +A   K
Sbjct  372  GSHADNHYDPKAFPVIQGINYRDMVAENVSMAARLEGIPSDPFTGICISNVTIHLAAKAK  431

Query  542  KQPPWVCANIQGVASGVVPPPCNLLHSQGPVKPGMCDLPAKN  667
            K  PW C +++G++SGV P PC+ L  QGP K  +C+ PA++
Sbjct  432  KV-PWTCTDVEGISSGVTPTPCSTLPDQGPEKTSLCNFPAES  472



>ref|XP_004172137.1| PREDICTED: probable polygalacturonase-like [Cucumis sativus]
Length=493

 Score =   319 bits (817),  Expect = 2e-102, Method: Compositional matrix adjust.
 Identities = 148/222 (67%), Positives = 175/222 (79%), Gaps = 1/222 (0%)
 Frame = +2

Query  2    INPDSCTKVRIEDNYIVSGDDCVAIKSGIDEYGIKYGMPTKQLIIRRLTCISPTSGAIAM  181
            INPDSCT VRIED YIVSGDDCVA+KSG DEYGI +G+PTKQL++RRLTCISPTS  IA+
Sbjct  255  INPDSCTNVRIEDCYIVSGDDCVAVKSGWDEYGISFGLPTKQLVVRRLTCISPTSAVIAL  314

Query  182  GSEMSGGIEDVRASDITALDTESGVRIKTALGRGGYVKNIYVKGLRAHTMKLLFQMTGKY  361
            GSEMSGGIEDVRA DI A+D+ESGVRIKT +GRGGYVK+IYV+ +  HTMK  F MTG Y
Sbjct  315  GSEMSGGIEDVRAEDIVAIDSESGVRIKTGIGRGGYVKDIYVRRMTMHTMKWAFWMTGDY  374

Query  362  GSHADKNFDPKAIPVVAGINFRDVVADNVTTAGTMEGIPGHPFTGICMANVTIGMAKNGK  541
            GSHADKN+DP A+PV+ GIN++D+V +N T A  +EGI G  FT IC++NVTIG+A   K
Sbjct  375  GSHADKNYDPHALPVIQGINYKDMVVENATMAARLEGISGDTFTDICISNVTIGLAPKAK  434

Query  542  KQPPWVCANIQGVASGVVPPPCNLLHSQGPVKPGMCDLPAKN  667
            KQ PW C +I+G+ S V PPPC+LL  QG  K   C  P  N
Sbjct  435  KQ-PWTCTDIEGITSQVTPPPCDLLPDQGEEKITTCKFPEDN  475



>ref|XP_008343414.1| PREDICTED: probable polygalacturonase [Malus domestica]
 ref|XP_008354013.1| PREDICTED: probable polygalacturonase [Malus domestica]
Length=483

 Score =   318 bits (815),  Expect = 2e-102, Method: Compositional matrix adjust.
 Identities = 148/222 (67%), Positives = 172/222 (77%), Gaps = 1/222 (0%)
 Frame = +2

Query  2    INPDSCTKVRIEDNYIVSGDDCVAIKSGIDEYGIKYGMPTKQLIIRRLTCISPTSGAIAM  181
            INPDSCT  RIED YIVSGDDCVA+KSG DEYGI +GMPTKQL++RRLTCISP S  IA+
Sbjct  245  INPDSCTNTRIEDCYIVSGDDCVAVKSGWDEYGIAFGMPTKQLVVRRLTCISPYSATIAL  304

Query  182  GSEMSGGIEDVRASDITALDTESGVRIKTALGRGGYVKNIYVKGLRAHTMKLLFQMTGKY  361
            GSEMSGGI+DVRA DI A+ TESGVRIKTA+GRGGYVK+IY +    HTMK  F MTG Y
Sbjct  305  GSEMSGGIQDVRAEDIVAIHTESGVRIKTAVGRGGYVKDIYARRFTMHTMKWAFWMTGNY  364

Query  362  GSHADKNFDPKAIPVVAGINFRDVVADNVTTAGTMEGIPGHPFTGICMANVTIGMAKNGK  541
            GSHAD  +D  A+P +  IN+RD+VADNVT A  +EGI  HPFTGIC++NVTIG+A   K
Sbjct  365  GSHADDKYDKNALPEIKNINYRDMVADNVTMAARLEGIADHPFTGICISNVTIGLAVKAK  424

Query  542  KQPPWVCANIQGVASGVVPPPCNLLHSQGPVKPGMCDLPAKN  667
            KQ PW C +I+G+ SGV P PC+LL  QG  K   CD PA +
Sbjct  425  KQ-PWTCTDIEGITSGVTPRPCDLLPDQGAEKAKXCDFPADD  465



>gb|AFK37962.1| unknown [Lotus japonicus]
Length=469

 Score =   317 bits (811),  Expect = 7e-102, Method: Compositional matrix adjust.
 Identities = 149/222 (67%), Positives = 174/222 (78%), Gaps = 1/222 (0%)
 Frame = +2

Query  2    INPDSCTKVRIEDNYIVSGDDCVAIKSGIDEYGIKYGMPTKQLIIRRLTCISPTSGAIAM  181
            INPDSCT  RIED YIVSGDDCVA+KSG DEYGI YGMPTK L+IRRLTCISPTS  IA+
Sbjct  232  INPDSCTNTRIEDCYIVSGDDCVAVKSGWDEYGISYGMPTKHLVIRRLTCISPTSAVIAL  291

Query  182  GSEMSGGIEDVRASDITALDTESGVRIKTALGRGGYVKNIYVKGLRAHTMKLLFQMTGKY  361
            GSEMSGGIEDVRA DI A+++ESGVRIKTA+GRGGYV++IYV+ +   TMK +F MTG Y
Sbjct  292  GSEMSGGIEDVRAEDILAINSESGVRIKTAVGRGGYVRDIYVRRMTMKTMKWVFWMTGDY  351

Query  362  GSHADKNFDPKAIPVVAGINFRDVVADNVTTAGTMEGIPGHPFTGICMANVTIGMAKNGK  541
            GSHAD N+DP AIPV+  IN+RD+VA+NVT A  +EGI G PFTGIC++NVTI +AK  K
Sbjct  352  GSHADNNYDPNAIPVIENINYRDMVAENVTMAARLEGISGAPFTGICISNVTIELAKKAK  411

Query  542  KQPPWVCANIQGVASGVVPPPCNLLHSQGPVKPGMCDLPAKN  667
            K  PW C ++ G++SGV P PC LL  Q   K G C  P  N
Sbjct  412  KV-PWTCTDVSGISSGVTPEPCELLPGQAEEKFGACSFPEDN  452



>ref|XP_008438007.1| PREDICTED: probable polygalacturonase [Cucumis melo]
Length=493

 Score =   317 bits (812),  Expect = 1e-101, Method: Compositional matrix adjust.
 Identities = 146/222 (66%), Positives = 176/222 (79%), Gaps = 1/222 (0%)
 Frame = +2

Query  2    INPDSCTKVRIEDNYIVSGDDCVAIKSGIDEYGIKYGMPTKQLIIRRLTCISPTSGAIAM  181
            INPDSCT VRIED YIVSGDDCVA+KSG DEYGI++G+PTKQL++RRLTCISPTS  IA+
Sbjct  255  INPDSCTNVRIEDCYIVSGDDCVAVKSGWDEYGIRFGLPTKQLVVRRLTCISPTSAVIAL  314

Query  182  GSEMSGGIEDVRASDITALDTESGVRIKTALGRGGYVKNIYVKGLRAHTMKLLFQMTGKY  361
            GSEMSGGI+DVRA DI A+++ESGVRIKT +GRGGYVK+IYV+ +  HTMK  F MTG Y
Sbjct  315  GSEMSGGIQDVRAEDIVAINSESGVRIKTGIGRGGYVKDIYVRRMTMHTMKWAFWMTGDY  374

Query  362  GSHADKNFDPKAIPVVAGINFRDVVADNVTTAGTMEGIPGHPFTGICMANVTIGMAKNGK  541
            GSHADKN+DP A+PV+ GIN+RD+V +N T A  +EGI G  FT IC++NVTIG+A   K
Sbjct  375  GSHADKNYDPHALPVIQGINYRDMVVENATMAARLEGISGDTFTDICISNVTIGLAPKAK  434

Query  542  KQPPWVCANIQGVASGVVPPPCNLLHSQGPVKPGMCDLPAKN  667
            KQ PW C +++G+ S V PPPC+LL  QG  K   C  P  N
Sbjct  435  KQ-PWTCTDVEGITSQVTPPPCDLLPDQGEEKITTCKFPEDN  475



>gb|KEH21119.1| polygalacturonase/glycoside hydrolase family protein [Medicago 
truncatula]
Length=470

 Score =   316 bits (809),  Expect = 1e-101, Method: Compositional matrix adjust.
 Identities = 154/222 (69%), Positives = 174/222 (78%), Gaps = 1/222 (0%)
 Frame = +2

Query  2    INPDSCTKVRIEDNYIVSGDDCVAIKSGIDEYGIKYGMPTKQLIIRRLTCISPTSGAIAM  181
            INPDSCT  RIED YIVSGDDCVA+KSG DEYGI YGMPTKQL+IRRLTCISPTS  IA+
Sbjct  233  INPDSCTNTRIEDCYIVSGDDCVAVKSGWDEYGIAYGMPTKQLVIRRLTCISPTSAVIAL  292

Query  182  GSEMSGGIEDVRASDITALDTESGVRIKTALGRGGYVKNIYVKGLRAHTMKLLFQMTGKY  361
            GSEMSGGI+DVRA DI A+++ESGVRIKTA+GRGGYVK+IYV+ +   TMK  F MTG Y
Sbjct  293  GSEMSGGIQDVRAEDIVAINSESGVRIKTAVGRGGYVKDIYVRRMTMKTMKWAFWMTGDY  352

Query  362  GSHADKNFDPKAIPVVAGINFRDVVADNVTTAGTMEGIPGHPFTGICMANVTIGMAKNGK  541
            GSHAD N+DP AIPVV  IN+RD+VA+NVT A  +EGI   PFTGIC++NVTIG+AK  K
Sbjct  353  GSHADNNYDPNAIPVVQNINYRDMVAENVTMAAKLEGISNAPFTGICISNVTIGLAKKAK  412

Query  542  KQPPWVCANIQGVASGVVPPPCNLLHSQGPVKPGMCDLPAKN  667
            K  PW C  I GV+SGV P PC LL  QG  K G C  P  N
Sbjct  413  KL-PWNCTYIAGVSSGVTPAPCGLLPDQGVEKIGPCAFPEDN  453



>gb|KHN26935.1| Putative polygalacturonase [Glycine soja]
Length=378

 Score =   313 bits (801),  Expect = 1e-101, Method: Compositional matrix adjust.
 Identities = 149/220 (68%), Positives = 176/220 (80%), Gaps = 2/220 (1%)
 Frame = +2

Query  2    INPDSCTKVRIEDNYIVSGDDCVAIKSGIDEYGIKYGMPTKQLIIRRLTCISPTSGAIAM  181
            INPDSCT  RIED YIVSGDDCVA+KSG DE+GIK+G PTKQL+IRRLTCISP S AIA+
Sbjct  139  INPDSCTNTRIEDCYIVSGDDCVAVKSGWDEFGIKFGWPTKQLVIRRLTCISPQSAAIAL  198

Query  182  GSEMSGGIEDVRASDITALDTESGVRIKTALGRGGYVKNIYVKGLRAHTMKLLFQMTGKY  361
            GSEMSGGI+DVRA DITA+ TESGVRIKT++GRGGYVK+IYV+ +  HTMK  F MTG Y
Sbjct  199  GSEMSGGIQDVRAEDITAIHTESGVRIKTSIGRGGYVKDIYVRRMTMHTMKWAFWMTGNY  258

Query  362  GSHADK-NFDPKAIPVVAGINFRDVVADNVTTAGTMEGIPGHPFTGICMANVTIGMAKNG  538
            GS+A+  ++DPKA+P + GIN+RDVVADNVT A T+EGI   PFTGIC+ANVTI MA   
Sbjct  259  GSYANNSHYDPKALPEIKGINYRDVVADNVTMAATLEGISNSPFTGICIANVTISMADKA  318

Query  539  KKQPPWVCANIQGVASGVVPPPCNLLHSQGPVKPGMCDLP  658
             ++ PW C +I+G+ SGV P PCN L  +GP K   CD P
Sbjct  319  NEK-PWTCTDIEGITSGVTPKPCNSLLDKGPEKIKTCDFP  357



>gb|ABG34277.1| polygalacturonase [Eucalyptus globulus subsp. globulus]
Length=242

 Score =   308 bits (788),  Expect = 1e-101, Method: Compositional matrix adjust.
 Identities = 145/222 (65%), Positives = 170/222 (77%), Gaps = 1/222 (0%)
 Frame = +2

Query  2    INPDSCTKVRIEDNYIVSGDDCVAIKSGIDEYGIKYGMPTKQLIIRRLTCISPTSGAIAM  181
            INPDSCT VRIED YIVSGDDCVA+KSG DEYGI +GMPT+QLIIRRLTCISP S  IA+
Sbjct  4    INPDSCTNVRIEDCYIVSGDDCVAVKSGWDEYGIAFGMPTQQLIIRRLTCISPYSATIAL  63

Query  182  GSEMSGGIEDVRASDITALDTESGVRIKTALGRGGYVKNIYVKGLRAHTMKLLFQMTGKY  361
            GSEMSGGI DVRA DI A++TESG+RIKTA+GRG Y+K+IYVK +  HTMK  F+M G Y
Sbjct  64   GSEMSGGIRDVRAEDIVAINTESGIRIKTAVGRGAYIKDIYVKKMTMHTMKWAFKMDGDY  123

Query  362  GSHADKNFDPKAIPVVAGINFRDVVADNVTTAGTMEGIPGHPFTGICMANVTIGMAKNGK  541
             SH D  +DP A+PV+  IN+RD+VA+NV+ A    GI G  FTGICMANVT+GM    K
Sbjct  124  KSHPDNKYDPNALPVIQNINYRDMVAENVSVAARFNGIAGDKFTGICMANVTLGMTAKHK  183

Query  542  KQPPWVCANIQGVASGVVPPPCNLLHSQGPVKPGMCDLPAKN  667
            K  PW C ++QG+ SGV PPPC+ L  QGP K   CD PA +
Sbjct  184  KY-PWTCTDVQGMTSGVTPPPCDSLPDQGPEKISACDFPANS  224



>ref|XP_007040335.1| Pectin lyase-like superfamily protein isoform 1 [Theobroma cacao]
 ref|XP_007040336.1| Pectin lyase-like superfamily protein isoform 1 [Theobroma cacao]
 gb|EOY24836.1| Pectin lyase-like superfamily protein isoform 1 [Theobroma cacao]
 gb|EOY24837.1| Pectin lyase-like superfamily protein isoform 1 [Theobroma cacao]
Length=467

 Score =   315 bits (806),  Expect = 3e-101, Method: Compositional matrix adjust.
 Identities = 150/219 (68%), Positives = 172/219 (79%), Gaps = 3/219 (1%)
 Frame = +2

Query  2    INPDSCTKVRIEDNYIVSGDDCVAIKSGIDEYGIKYGMPTKQLIIRRLTCISPTSGAIAM  181
            INPDSCT  RIED YIVSGDDCVA+KSG DEYGIK+ MPTKQL+IRRLTCISP S  IA+
Sbjct  243  INPDSCTNTRIEDCYIVSGDDCVAVKSGWDEYGIKFAMPTKQLVIRRLTCISPFSAVIAL  302

Query  182  GSEMSGGIEDVRASDITALDTESGVRIKTALGRGGYVKNIYVKGLRAHTMKLLFQMTGKY  361
            GSEMSGGIEDVRA DIT +++ES VRIKTA+GRG YVK+IYV+G+   TMK++F M G Y
Sbjct  303  GSEMSGGIEDVRAEDITGINSESAVRIKTAVGRGNYVKDIYVRGMTMKTMKMVFWMAGNY  362

Query  362  GSHADKNFDPKAIPVVAGINFRDVVADNVTTAGTMEGIPGHPFTGICMANVTIGMAKNGK  541
            GSH D ++DP AIPV+  INFRDVVA+NVT A  +EGIPGHPFTGIC++N TIG+ K  K
Sbjct  363  GSHPDNDYDPNAIPVIQNINFRDVVAENVTMAARLEGIPGHPFTGICISNATIGLTKKPK  422

Query  542  KQPPWVCANIQGVASGVVPPPCNLLHSQGPVKPGMCDLP  658
            K   W C  I GV+S V PPPCNLL  QGP     CD P
Sbjct  423  KI-QWNCTEIAGVSSDVTPPPCNLLTDQGPAN--ACDFP  458



>gb|KHN16795.1| Putative polygalacturonase [Glycine soja]
Length=434

 Score =   313 bits (803),  Expect = 3e-101, Method: Compositional matrix adjust.
 Identities = 148/222 (67%), Positives = 176/222 (79%), Gaps = 1/222 (0%)
 Frame = +2

Query  2    INPDSCTKVRIEDNYIVSGDDCVAIKSGIDEYGIKYGMPTKQLIIRRLTCISPTSGAIAM  181
            INPDSCT  RIED YIVSGDDCVA+KSG DEYGI YGMPTKQL+IRRLTCISP S AIA+
Sbjct  197  INPDSCTDTRIEDCYIVSGDDCVAVKSGWDEYGIAYGMPTKQLVIRRLTCISPFSAAIAL  256

Query  182  GSEMSGGIEDVRASDITALDTESGVRIKTALGRGGYVKNIYVKGLRAHTMKLLFQMTGKY  361
            GSEMSGGI+D+RA DI A++TESGVRIKTA+GRGGYVK+I+V+ +   TMK  F MTG Y
Sbjct  257  GSEMSGGIQDMRAEDIVAINTESGVRIKTAVGRGGYVKDIFVRRMTMKTMKWAFWMTGNY  316

Query  362  GSHADKNFDPKAIPVVAGINFRDVVADNVTTAGTMEGIPGHPFTGICMANVTIGMAKNGK  541
            GSHAD N+DP A+PV+  IN+RD+VA+NVT A  +EGI G PFTGIC++NVTI +AK  K
Sbjct  317  GSHADDNYDPNALPVIQNINYRDMVAENVTMAARLEGISGDPFTGICISNVTIQLAKKAK  376

Query  542  KQPPWVCANIQGVASGVVPPPCNLLHSQGPVKPGMCDLPAKN  667
            K  PW C +I G++S V P PC+LL  QG  K G C  P ++
Sbjct  377  KV-PWTCTDIAGISSDVTPAPCDLLPDQGEEKIGACTFPEES  417



>gb|ABG34275.1| polygalacturonase [Eucalyptus globulus subsp. globulus]
Length=238

 Score =   306 bits (785),  Expect = 4e-101, Method: Compositional matrix adjust.
 Identities = 142/222 (64%), Positives = 176/222 (79%), Gaps = 5/222 (2%)
 Frame = +2

Query  2    INPDSCTKVRIEDNYIVSGDDCVAIKSGIDEYGIKYGMPTKQLIIRRLTCISPTSGAIAM  181
            ++PDSCT  RIED +IVSGDDCVA+KSG DEYGI YGMPTKQL+IRRLTCISP S  IA+
Sbjct  4    VDPDSCTNTRIEDVHIVSGDDCVAVKSGWDEYGISYGMPTKQLVIRRLTCISPYSAMIAL  63

Query  182  GSEMSGGIEDVRASDITALDTESGVRIKTALGRGGYVKNIYVKGLRAHTMKLLFQMTGKY  361
            GSEMSGGIEDVRA DITA++TESG+RIKTA+GRGGYVK+IYV+G++ HTMK  F M G Y
Sbjct  64   GSEMSGGIEDVRAEDITAINTESGIRIKTAMGRGGYVKDIYVRGMKMHTMKWAFWMDGNY  123

Query  362  GSHADKNFDPKAIPVVAGINFRDVVADNVTTAGTMEGIPGHPFTGICMANVTIGMAKNGK  541
            GSH D ++DPKA P++ GIN+RD+VA+NVT    ++GIPG+PFTGIC++N TI MA   K
Sbjct  124  GSHPDPHYDPKARPIITGINYRDIVAENVTMVAQLKGIPGNPFTGICISNATITMAPESK  183

Query  542  KQPPWVCANIQGVASGVVPPPCNLLHSQGPVKPGMCDLPAKN  667
            K+ PW C++I G+ SGV P PC +L    P +   C  P ++
Sbjct  184  KE-PWTCSDIHGITSGVTPQPCGML----PAETTTCHFPERS  220



>ref|XP_004295492.1| PREDICTED: probable polygalacturonase-like [Fragaria vesca subsp. 
vesca]
Length=508

 Score =   316 bits (809),  Expect = 4e-101, Method: Compositional matrix adjust.
 Identities = 147/219 (67%), Positives = 179/219 (82%), Gaps = 3/219 (1%)
 Frame = +2

Query  2    INPDSCTKVRIEDNYIVSGDDCVAIKSGIDEYGIKYGMPTKQLIIRRLTCISPTSGAIAM  181
            +NPDSCT V+IED YIVSGDDCVA+KSG D+YG+ +GMPTKQL+IRRLTC+SP S AIA+
Sbjct  239  VNPDSCTNVKIEDCYIVSGDDCVAVKSGWDQYGVSFGMPTKQLVIRRLTCVSPYSAAIAL  298

Query  182  GSEMSGGIEDVRASDITALDTESGVRIKTALGRGGYVKNIYVKGLRAHTMKLLFQMTGKY  361
            GSEMSGGIEDVRA DI A++TESGVRIKTA+GRGGYV+++YV+ +  HTMK  F+M+G Y
Sbjct  299  GSEMSGGIEDVRAEDIVAVETESGVRIKTAVGRGGYVRDVYVRRMEMHTMKWAFKMSGDY  358

Query  362  GSHADKNFDPKAIPVVAGINFRDVVADNVTTAGTMEGIPGHPFTGICMANVTIGMAKNGK  541
            GSHAD+ +D  A P + GI +RDVVADNVT A  +EGI GHPFTGICM+NVT+ +A   K
Sbjct  359  GSHADEGYDKNAFPEIKGIYYRDVVADNVTMAARLEGIEGHPFTGICMSNVTVVLAAKAK  418

Query  542  KQPPWVCANIQGVASGVVPPPCNLLHSQGPVKPGMCDLP  658
            KQ PW C++++GVASGV P PC+LL  QG V  G CD P
Sbjct  419  KQ-PWSCSDVKGVASGVTPMPCDLL--QGDVVNGGCDFP  454



>ref|XP_009349812.1| PREDICTED: probable polygalacturonase [Pyrus x bretschneideri]
Length=483

 Score =   315 bits (806),  Expect = 4e-101, Method: Compositional matrix adjust.
 Identities = 147/222 (66%), Positives = 171/222 (77%), Gaps = 1/222 (0%)
 Frame = +2

Query  2    INPDSCTKVRIEDNYIVSGDDCVAIKSGIDEYGIKYGMPTKQLIIRRLTCISPTSGAIAM  181
            INPDSCT  RIED YIVSGDDCVA+KSG DEYGI +GMPTKQL++RRLTCISP S  IA+
Sbjct  245  INPDSCTNTRIEDCYIVSGDDCVAVKSGWDEYGIAFGMPTKQLVVRRLTCISPYSATIAL  304

Query  182  GSEMSGGIEDVRASDITALDTESGVRIKTALGRGGYVKNIYVKGLRAHTMKLLFQMTGKY  361
            GSEMSGGI+DVRA DI A+ TESGVRIKTA+GRGGYVK+IY +    HTMK  F MTG Y
Sbjct  305  GSEMSGGIQDVRAEDIVAIHTESGVRIKTAVGRGGYVKDIYARRFTMHTMKWAFWMTGNY  364

Query  362  GSHADKNFDPKAIPVVAGINFRDVVADNVTTAGTMEGIPGHPFTGICMANVTIGMAKNGK  541
            GSHAD  +D  A+P +  IN+ D+VADNVT A  +EGI  HPFTGIC++NVTIG+A   K
Sbjct  365  GSHADDKYDKNALPEIKNINYMDMVADNVTMAARLEGIADHPFTGICISNVTIGLAVKAK  424

Query  542  KQPPWVCANIQGVASGVVPPPCNLLHSQGPVKPGMCDLPAKN  667
            KQ PW C +I+G+ SGV P PC+LL  QG  K   CD PA +
Sbjct  425  KQ-PWTCTDIEGITSGVTPRPCDLLPDQGAEKAKACDFPADD  465



>ref|XP_004503678.1| PREDICTED: probable polygalacturonase-like isoform X1 [Cicer 
arietinum]
 ref|XP_004503679.1| PREDICTED: probable polygalacturonase-like isoform X2 [Cicer 
arietinum]
Length=500

 Score =   315 bits (806),  Expect = 7e-101, Method: Compositional matrix adjust.
 Identities = 150/222 (68%), Positives = 174/222 (78%), Gaps = 1/222 (0%)
 Frame = +2

Query  2    INPDSCTKVRIEDNYIVSGDDCVAIKSGIDEYGIKYGMPTKQLIIRRLTCISPTSGAIAM  181
             + DSCT  RIED YIVSGDDCVA+KSG DEYGI YGMPTKQL+IRRLTCISPTS  IA+
Sbjct  262  FDADSCTNTRIEDCYIVSGDDCVAVKSGWDEYGIAYGMPTKQLVIRRLTCISPTSAVIAL  321

Query  182  GSEMSGGIEDVRASDITALDTESGVRIKTALGRGGYVKNIYVKGLRAHTMKLLFQMTGKY  361
            GSEMSGGIEDVRA DI A+++ESGVRIKTA+GRGGYVK+IYV+ +   TMK  F MTG Y
Sbjct  322  GSEMSGGIEDVRAEDIVAINSESGVRIKTAVGRGGYVKDIYVRRMTMKTMKWAFWMTGDY  381

Query  362  GSHADKNFDPKAIPVVAGINFRDVVADNVTTAGTMEGIPGHPFTGICMANVTIGMAKNGK  541
            GSHAD N+DP A+PVV  +N+RD+VADNVT A  +EGI   PFTGIC++NVTIG+AK  K
Sbjct  382  GSHADNNYDPNALPVVQNVNYRDMVADNVTMAAKLEGISNAPFTGICISNVTIGLAKKAK  441

Query  542  KQPPWVCANIQGVASGVVPPPCNLLHSQGPVKPGMCDLPAKN  667
            K  PW C +I G++SGV P PC+LL  QG  K G C  P  N
Sbjct  442  K-VPWNCTDIAGISSGVTPSPCDLLPDQGVQKIGACTFPEDN  482



>ref|XP_003529926.1| PREDICTED: probable polygalacturonase-like [Glycine max]
Length=498

 Score =   315 bits (806),  Expect = 7e-101, Method: Compositional matrix adjust.
 Identities = 149/220 (68%), Positives = 176/220 (80%), Gaps = 2/220 (1%)
 Frame = +2

Query  2    INPDSCTKVRIEDNYIVSGDDCVAIKSGIDEYGIKYGMPTKQLIIRRLTCISPTSGAIAM  181
            INPDSCT  RIED YIVSGDDCVA+KSG DE+GIK+G PTKQL+IRRLTCISP S AIA+
Sbjct  259  INPDSCTNTRIEDCYIVSGDDCVAVKSGWDEFGIKFGWPTKQLVIRRLTCISPQSAAIAL  318

Query  182  GSEMSGGIEDVRASDITALDTESGVRIKTALGRGGYVKNIYVKGLRAHTMKLLFQMTGKY  361
            GSEMSGGI+DVRA DITA+ TESGVRIKT++GRGGYVK+IYV+ +  HTMK  F MTG Y
Sbjct  319  GSEMSGGIQDVRAEDITAIHTESGVRIKTSIGRGGYVKDIYVRRMTMHTMKWAFWMTGNY  378

Query  362  GSHADK-NFDPKAIPVVAGINFRDVVADNVTTAGTMEGIPGHPFTGICMANVTIGMAKNG  538
            GS+A+  ++DPKA+P + GIN+RDVVADNVT A T+EGI   PFTGIC+ANVTI MA   
Sbjct  379  GSYANNSHYDPKALPEIKGINYRDVVADNVTMAATLEGISNSPFTGICIANVTISMADKA  438

Query  539  KKQPPWVCANIQGVASGVVPPPCNLLHSQGPVKPGMCDLP  658
             ++ PW C +I+G+ SGV P PCN L  +GP K   CD P
Sbjct  439  NEK-PWTCTDIEGITSGVTPKPCNSLLDKGPEKIKTCDFP  477



>gb|EYU35105.1| hypothetical protein MIMGU_mgv1a005694mg [Erythranthe guttata]
Length=474

 Score =   313 bits (803),  Expect = 9e-101, Method: Compositional matrix adjust.
 Identities = 148/221 (67%), Positives = 176/221 (80%), Gaps = 2/221 (1%)
 Frame = +2

Query  2    INPDSCTKVRIEDNYIVSGDDCVAIKSGIDEYGIKYGMPTKQLIIRRLTCISPTSGAIAM  181
            INPDSCT  RIED YIVSGDDC+A+KSG DEYGI YGMPTK LIIRRLTCISP S AIA+
Sbjct  235  INPDSCTNTRIEDTYIVSGDDCIAVKSGWDEYGINYGMPTKHLIIRRLTCISPYSAAIAL  294

Query  182  GSEMSGGIEDVRASDITALDTESGVRIKTALGRGGYVKNIYVKGLRAHTMKLLFQMTGKY  361
            GSEMSGGI+DVRA DITA+ TES VRIKT +GRGGYVK+I+VK ++ HTMK +F +TG Y
Sbjct  295  GSEMSGGIQDVRADDITAIQTESAVRIKTGVGRGGYVKDIFVKNMKLHTMKWVFWITGNY  354

Query  362  GSHADKNFDPKAIPVVAGINFRDVVADNVTTAGTMEGIPGHPFTGICMANVTIGMAKNGK  541
            GSHAD +FDP A+P + GIN+RD+VA+NVT A  +EGI G PFTGIC+ N TIG++K  K
Sbjct  355  GSHADTHFDPNALPEIKGINYRDIVAENVTMAARLEGISGDPFTGICIYNATIGLSKKPK  414

Query  542  KQPPWVCANIQGVASGVVPPPCNLL-HSQGPVKPGMCDLPA  661
            K   W C++++GV   VVPPPC LL  +Q   K GMCD P+
Sbjct  415  KY-QWTCSDVEGVTGAVVPPPCALLPPTQVDEKFGMCDFPS  454



>ref|XP_002509850.1| polygalacturonase, putative [Ricinus communis]
 gb|EEF51237.1| polygalacturonase, putative [Ricinus communis]
Length=480

 Score =   314 bits (804),  Expect = 9e-101, Method: Compositional matrix adjust.
 Identities = 148/219 (68%), Positives = 176/219 (80%), Gaps = 1/219 (0%)
 Frame = +2

Query  2    INPDSCTKVRIEDNYIVSGDDCVAIKSGIDEYGIKYGMPTKQLIIRRLTCISPTSGAIAM  181
            INPDSCT  RIED YIVSGDDCVA+KSG DEYGI +GMPTKQL+IRRLTCISPTS AIA+
Sbjct  242  INPDSCTNTRIEDCYIVSGDDCVAVKSGWDEYGISFGMPTKQLVIRRLTCISPTSAAIAL  301

Query  182  GSEMSGGIEDVRASDITALDTESGVRIKTALGRGGYVKNIYVKGLRAHTMKLLFQMTGKY  361
            GSEMSGGI+DVRA DIT ++TESGVRIKT++GRGGYVK+IYV+ +  HTMK +F MTG Y
Sbjct  302  GSEMSGGIQDVRAEDITCINTESGVRIKTSVGRGGYVKDIYVRKMTMHTMKWVFWMTGNY  361

Query  362  GSHADKNFDPKAIPVVAGINFRDVVADNVTTAGTMEGIPGHPFTGICMANVTIGMAKNGK  541
            GSH D N+DP AIPV+  IN+RD+VA+NVT A  +EGI G PFTGIC++NVTIG+A+  K
Sbjct  362  GSHPDNNYDPNAIPVIENINYRDIVAENVTMAARLEGIAGDPFTGICISNVTIGLAQKPK  421

Query  542  KQPPWVCANIQGVASGVVPPPCNLLHSQGPVKPGMCDLP  658
            K   W C +I G++SGV P PC+LL  Q   K   C+ P
Sbjct  422  KL-QWNCTDIAGISSGVTPKPCSLLPEQEKEKIADCNFP  459



>ref|XP_007160099.1| hypothetical protein PHAVU_002G292300g [Phaseolus vulgaris]
 gb|ESW32093.1| hypothetical protein PHAVU_002G292300g [Phaseolus vulgaris]
Length=469

 Score =   313 bits (801),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 148/222 (67%), Positives = 173/222 (78%), Gaps = 1/222 (0%)
 Frame = +2

Query  2    INPDSCTKVRIEDNYIVSGDDCVAIKSGIDEYGIKYGMPTKQLIIRRLTCISPTSGAIAM  181
            INPDSCT  RIED YIVSGDDCVA+KSG DEYGI YGMPTKQL+IRRLTCISP S  IA+
Sbjct  232  INPDSCTNTRIEDCYIVSGDDCVAVKSGWDEYGIAYGMPTKQLVIRRLTCISPFSAVIAL  291

Query  182  GSEMSGGIEDVRASDITALDTESGVRIKTALGRGGYVKNIYVKGLRAHTMKLLFQMTGKY  361
            GSEMSGGI+DVRA DI A++TESGVRIKTA+GRGGYVK+IYV+ +   TMK  F MTG Y
Sbjct  292  GSEMSGGIQDVRAEDIVAINTESGVRIKTAVGRGGYVKDIYVRRMTMKTMKWAFWMTGNY  351

Query  362  GSHADKNFDPKAIPVVAGINFRDVVADNVTTAGTMEGIPGHPFTGICMANVTIGMAKNGK  541
            GSHAD  +DP A+PV+  IN+RD+VA+NVT A  +EGI G PFTGIC++NVTI +AK  K
Sbjct  352  GSHADDKYDPNALPVIQNINYRDMVAENVTMAARLEGISGDPFTGICISNVTIQLAKKAK  411

Query  542  KQPPWVCANIQGVASGVVPPPCNLLHSQGPVKPGMCDLPAKN  667
            K  PW C +I G++S V P PCNLL  QG    G C  P ++
Sbjct  412  KV-PWTCTDIDGISSDVTPAPCNLLPEQGEENIGACTFPEES  452



>gb|AFK44529.1| unknown [Lotus japonicus]
Length=469

 Score =   313 bits (801),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 148/222 (67%), Positives = 173/222 (78%), Gaps = 1/222 (0%)
 Frame = +2

Query  2    INPDSCTKVRIEDNYIVSGDDCVAIKSGIDEYGIKYGMPTKQLIIRRLTCISPTSGAIAM  181
            INPDSCT  RIED YIVSGDDCVA+KSG DEYGI YGMPTK L+IRRLTCISPTS  IA+
Sbjct  232  INPDSCTNTRIEDCYIVSGDDCVAVKSGWDEYGISYGMPTKHLVIRRLTCISPTSAVIAL  291

Query  182  GSEMSGGIEDVRASDITALDTESGVRIKTALGRGGYVKNIYVKGLRAHTMKLLFQMTGKY  361
            GSEMSGGIEDVRA DI A+++ESGVRIKTA+GRGGYV++IYV+ +   TMK +F MTG Y
Sbjct  292  GSEMSGGIEDVRAEDILAINSESGVRIKTAVGRGGYVRDIYVRRMTMKTMKWVFWMTGDY  351

Query  362  GSHADKNFDPKAIPVVAGINFRDVVADNVTTAGTMEGIPGHPFTGICMANVTIGMAKNGK  541
            GSHAD N+DP AIPV+  IN+RD+VA+NVT A  + GI G PFTGIC++NVTI +AK  K
Sbjct  352  GSHADNNYDPNAIPVIENINYRDMVAENVTMAARLGGISGAPFTGICISNVTIELAKKAK  411

Query  542  KQPPWVCANIQGVASGVVPPPCNLLHSQGPVKPGMCDLPAKN  667
            K  PW C ++ G++SGV P PC LL  Q   K G C  P  N
Sbjct  412  KV-PWTCTDVSGISSGVTPEPCELLPGQAEEKFGACSFPEDN  452



>ref|XP_006584731.1| PREDICTED: probable polygalacturonase-like isoform X2 [Glycine 
max]
Length=506

 Score =   313 bits (802),  Expect = 4e-100, Method: Compositional matrix adjust.
 Identities = 148/222 (67%), Positives = 176/222 (79%), Gaps = 1/222 (0%)
 Frame = +2

Query  2    INPDSCTKVRIEDNYIVSGDDCVAIKSGIDEYGIKYGMPTKQLIIRRLTCISPTSGAIAM  181
            INPDSCT  RIED YIVSGDDCVA+KSG DEYGI YGMPTKQL+IRRLTCISP S AIA+
Sbjct  269  INPDSCTDTRIEDCYIVSGDDCVAVKSGWDEYGIAYGMPTKQLVIRRLTCISPFSAAIAL  328

Query  182  GSEMSGGIEDVRASDITALDTESGVRIKTALGRGGYVKNIYVKGLRAHTMKLLFQMTGKY  361
            GSEMSGGI+D+RA DI A++TESGVRIKTA+GRGGYVK+I+V+ +   TMK  F MTG Y
Sbjct  329  GSEMSGGIQDMRAEDIVAINTESGVRIKTAVGRGGYVKDIFVRRMTMKTMKWAFWMTGNY  388

Query  362  GSHADKNFDPKAIPVVAGINFRDVVADNVTTAGTMEGIPGHPFTGICMANVTIGMAKNGK  541
            GSHAD N+DP A+PV+  IN+RD+VA+NVT A  +EGI G PFTGIC++NVTI +AK  K
Sbjct  389  GSHADDNYDPNALPVIQNINYRDMVAENVTMAARLEGISGDPFTGICISNVTIQLAKKAK  448

Query  542  KQPPWVCANIQGVASGVVPPPCNLLHSQGPVKPGMCDLPAKN  667
            K  PW C +I G++S V P PC+LL  QG  K G C  P ++
Sbjct  449  KV-PWTCTDIAGISSDVTPAPCDLLPDQGEEKIGACTFPEES  489



>ref|XP_003532926.1| PREDICTED: probable polygalacturonase-like isoform X1 [Glycine 
max]
Length=494

 Score =   313 bits (801),  Expect = 4e-100, Method: Compositional matrix adjust.
 Identities = 148/222 (67%), Positives = 176/222 (79%), Gaps = 1/222 (0%)
 Frame = +2

Query  2    INPDSCTKVRIEDNYIVSGDDCVAIKSGIDEYGIKYGMPTKQLIIRRLTCISPTSGAIAM  181
            INPDSCT  RIED YIVSGDDCVA+KSG DEYGI YGMPTKQL+IRRLTCISP S AIA+
Sbjct  257  INPDSCTDTRIEDCYIVSGDDCVAVKSGWDEYGIAYGMPTKQLVIRRLTCISPFSAAIAL  316

Query  182  GSEMSGGIEDVRASDITALDTESGVRIKTALGRGGYVKNIYVKGLRAHTMKLLFQMTGKY  361
            GSEMSGGI+D+RA DI A++TESGVRIKTA+GRGGYVK+I+V+ +   TMK  F MTG Y
Sbjct  317  GSEMSGGIQDMRAEDIVAINTESGVRIKTAVGRGGYVKDIFVRRMTMKTMKWAFWMTGNY  376

Query  362  GSHADKNFDPKAIPVVAGINFRDVVADNVTTAGTMEGIPGHPFTGICMANVTIGMAKNGK  541
            GSHAD N+DP A+PV+  IN+RD+VA+NVT A  +EGI G PFTGIC++NVTI +AK  K
Sbjct  377  GSHADDNYDPNALPVIQNINYRDMVAENVTMAARLEGISGDPFTGICISNVTIQLAKKAK  436

Query  542  KQPPWVCANIQGVASGVVPPPCNLLHSQGPVKPGMCDLPAKN  667
            K  PW C +I G++S V P PC+LL  QG  K G C  P ++
Sbjct  437  KV-PWTCTDIAGISSDVTPAPCDLLPDQGEEKIGACTFPEES  477



>gb|KHM99951.1| Putative polygalacturonase [Glycine soja]
Length=434

 Score =   310 bits (795),  Expect = 5e-100, Method: Compositional matrix adjust.
 Identities = 147/222 (66%), Positives = 174/222 (78%), Gaps = 1/222 (0%)
 Frame = +2

Query  2    INPDSCTKVRIEDNYIVSGDDCVAIKSGIDEYGIKYGMPTKQLIIRRLTCISPTSGAIAM  181
            INPDSCT  RIED YIVSGDDCVA+KSG DEYGI YGMPTKQL+IRRLTCISP S  IA+
Sbjct  197  INPDSCTNTRIEDCYIVSGDDCVAVKSGWDEYGIAYGMPTKQLVIRRLTCISPFSAVIAL  256

Query  182  GSEMSGGIEDVRASDITALDTESGVRIKTALGRGGYVKNIYVKGLRAHTMKLLFQMTGKY  361
            GSEMSGGI+DVRA DI A+++ESGVRIKTA+GRGGYVK+I+V+ +   TMK  F MTG Y
Sbjct  257  GSEMSGGIQDVRAEDIVAINSESGVRIKTAVGRGGYVKDIFVRRMTMKTMKWAFWMTGNY  316

Query  362  GSHADKNFDPKAIPVVAGINFRDVVADNVTTAGTMEGIPGHPFTGICMANVTIGMAKNGK  541
            GSHAD N+DP A+PV+  IN+RD+VA+NVT A  +EGI G PFTGIC++NVTI +AK  K
Sbjct  317  GSHADDNYDPNALPVIQNINYRDMVAENVTMAARLEGISGDPFTGICISNVTIQLAKKAK  376

Query  542  KQPPWVCANIQGVASGVVPPPCNLLHSQGPVKPGMCDLPAKN  667
            K  PW C +I G++S V P PC LL  QG  K G C  P ++
Sbjct  377  KV-PWTCTDIAGISSDVTPAPCGLLPDQGEEKIGACTFPEES  417



>ref|XP_003622464.1| Polygalacturonase-like protein [Medicago truncatula]
 gb|KEH18815.1| polygalacturonase/glycoside hydrolase family protein [Medicago 
truncatula]
Length=479

 Score =   311 bits (798),  Expect = 7e-100, Method: Compositional matrix adjust.
 Identities = 146/220 (66%), Positives = 174/220 (79%), Gaps = 1/220 (0%)
 Frame = +2

Query  2    INPDSCTKVRIEDNYIVSGDDCVAIKSGIDEYGIKYGMPTKQLIIRRLTCISPTSGAIAM  181
            INPDSCT  +IED YIVSGDDCVA+KSG DEYGIK+G PTKQL+IRRLTCISP S  IA+
Sbjct  244  INPDSCTNTKIEDCYIVSGDDCVAVKSGWDEYGIKFGWPTKQLVIRRLTCISPYSATIAL  303

Query  182  GSEMSGGIEDVRASDITALDTESGVRIKTALGRGGYVKNIYVKGLRAHTMKLLFQMTGKY  361
            GSEMSGGI+DVRA DITA+ TESG+RIKTA+GRGGYVK+IYVK +  HTMK  F +TG Y
Sbjct  304  GSEMSGGIQDVRAEDITAVHTESGIRIKTAVGRGGYVKDIYVKKMTMHTMKWAFWITGNY  363

Query  362  GSHADKNFDPKAIPVVAGINFRDVVADNVTTAGTMEGIPGHPFTGICMANVTIGMAKNGK  541
            GSHADKN++  A+P +  I++RD+VADNV+ AG +EGI   PFTGIC++NVTI MA   K
Sbjct  364  GSHADKNYNHSALPEIKNIHYRDMVADNVSMAGNLEGISNDPFTGICISNVTITMAAKAK  423

Query  542  KQPPWVCANIQGVASGVVPPPCNLLHSQGPVKPGMCDLPA  661
            KQ PW C +I+G+ SGV P PC+LL  QG      CD P+
Sbjct  424  KQ-PWTCNDIEGITSGVTPKPCDLLPEQGKENIRDCDFPS  462



>ref|XP_006580552.1| PREDICTED: probable polygalacturonase-like isoform X2 [Glycine 
max]
Length=469

 Score =   311 bits (796),  Expect = 1e-99, Method: Compositional matrix adjust.
 Identities = 147/222 (66%), Positives = 174/222 (78%), Gaps = 1/222 (0%)
 Frame = +2

Query  2    INPDSCTKVRIEDNYIVSGDDCVAIKSGIDEYGIKYGMPTKQLIIRRLTCISPTSGAIAM  181
            INPDSCT  RIED YIVSGDDCVA+KSG DEYGI YGMPTKQL+IRRLTCISP S  IA+
Sbjct  232  INPDSCTNTRIEDCYIVSGDDCVAVKSGWDEYGIAYGMPTKQLVIRRLTCISPFSAVIAL  291

Query  182  GSEMSGGIEDVRASDITALDTESGVRIKTALGRGGYVKNIYVKGLRAHTMKLLFQMTGKY  361
            GSEMSGGI+DVRA DI A+++ESGVRIKTA+GRGGYVK+I+V+ +   TMK  F MTG Y
Sbjct  292  GSEMSGGIQDVRAEDIVAINSESGVRIKTAVGRGGYVKDIFVRRMTMKTMKWAFWMTGNY  351

Query  362  GSHADKNFDPKAIPVVAGINFRDVVADNVTTAGTMEGIPGHPFTGICMANVTIGMAKNGK  541
            GSHAD N+DP A+PV+  IN+RD+VA+NVT A  +EGI G PFTGIC++NVTI +AK  K
Sbjct  352  GSHADDNYDPNALPVIQNINYRDMVAENVTMAARLEGISGDPFTGICISNVTIQLAKKAK  411

Query  542  KQPPWVCANIQGVASGVVPPPCNLLHSQGPVKPGMCDLPAKN  667
            K  PW C +I G++S V P PC LL  QG  K G C  P ++
Sbjct  412  KV-PWTCTDIAGISSDVTPAPCGLLPDQGEEKIGACTFPEES  452



>ref|XP_010055091.1| PREDICTED: probable polygalacturonase isoform X1 [Eucalyptus 
grandis]
 gb|KCW71568.1| hypothetical protein EUGRSUZ_E00104 [Eucalyptus grandis]
Length=481

 Score =   311 bits (796),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 144/222 (65%), Positives = 176/222 (79%), Gaps = 5/222 (2%)
 Frame = +2

Query  2    INPDSCTKVRIEDNYIVSGDDCVAIKSGIDEYGIKYGMPTKQLIIRRLTCISPTSGAIAM  181
            I+PDSCT  RIED +IVSGDDCVA+KSG DEYGI YGMPTKQL+IRRLTCISP S  IA+
Sbjct  247  IDPDSCTNTRIEDVHIVSGDDCVAVKSGWDEYGISYGMPTKQLVIRRLTCISPYSAMIAL  306

Query  182  GSEMSGGIEDVRASDITALDTESGVRIKTALGRGGYVKNIYVKGLRAHTMKLLFQMTGKY  361
            GSEMSGGIEDVRA DITA++TESGVRIKTA+GRGGYVK+IYV+G++ HTMK  F M G Y
Sbjct  307  GSEMSGGIEDVRAEDITAINTESGVRIKTAMGRGGYVKDIYVRGMKMHTMKWAFWMDGNY  366

Query  362  GSHADKNFDPKAIPVVAGINFRDVVADNVTTAGTMEGIPGHPFTGICMANVTIGMAKNGK  541
            GSH D ++DPKA P++ GIN+RD+VA+NVT    ++GIPG+PFTGIC++N TI MA   K
Sbjct  367  GSHPDPHYDPKARPIITGINYRDIVAENVTMVAQLKGIPGNPFTGICISNATITMAPESK  426

Query  542  KQPPWVCANIQGVASGVVPPPCNLLHSQGPVKPGMCDLPAKN  667
            K+ PW C++I G+ SGV P PC +L    P +   C  P ++
Sbjct  427  KE-PWTCSDIHGITSGVTPQPCGML----PAETTTCHFPERS  463



>ref|XP_010055092.1| PREDICTED: probable polygalacturonase isoform X2 [Eucalyptus 
grandis]
Length=479

 Score =   310 bits (795),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 144/222 (65%), Positives = 176/222 (79%), Gaps = 5/222 (2%)
 Frame = +2

Query  2    INPDSCTKVRIEDNYIVSGDDCVAIKSGIDEYGIKYGMPTKQLIIRRLTCISPTSGAIAM  181
            I+PDSCT  RIED +IVSGDDCVA+KSG DEYGI YGMPTKQL+IRRLTCISP S  IA+
Sbjct  245  IDPDSCTNTRIEDVHIVSGDDCVAVKSGWDEYGISYGMPTKQLVIRRLTCISPYSAMIAL  304

Query  182  GSEMSGGIEDVRASDITALDTESGVRIKTALGRGGYVKNIYVKGLRAHTMKLLFQMTGKY  361
            GSEMSGGIEDVRA DITA++TESGVRIKTA+GRGGYVK+IYV+G++ HTMK  F M G Y
Sbjct  305  GSEMSGGIEDVRAEDITAINTESGVRIKTAMGRGGYVKDIYVRGMKMHTMKWAFWMDGNY  364

Query  362  GSHADKNFDPKAIPVVAGINFRDVVADNVTTAGTMEGIPGHPFTGICMANVTIGMAKNGK  541
            GSH D ++DPKA P++ GIN+RD+VA+NVT    ++GIPG+PFTGIC++N TI MA   K
Sbjct  365  GSHPDPHYDPKARPIITGINYRDIVAENVTMVAQLKGIPGNPFTGICISNATITMAPESK  424

Query  542  KQPPWVCANIQGVASGVVPPPCNLLHSQGPVKPGMCDLPAKN  667
            K+ PW C++I G+ SGV P PC +L    P +   C  P ++
Sbjct  425  KE-PWTCSDIHGITSGVTPQPCGML----PAETTTCHFPERS  461



>ref|XP_009345122.1| PREDICTED: probable polygalacturonase [Pyrus x bretschneideri]
Length=485

 Score =   310 bits (795),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 145/222 (65%), Positives = 175/222 (79%), Gaps = 1/222 (0%)
 Frame = +2

Query  2    INPDSCTKVRIEDNYIVSGDDCVAIKSGIDEYGIKYGMPTKQLIIRRLTCISPTSGAIAM  181
            INPDSCT  RIED YIVSGDDC+A+KSG DEYGI +GMPTKQL+IRRLTCISP S  IA+
Sbjct  247  INPDSCTNTRIEDCYIVSGDDCIAVKSGWDEYGIAFGMPTKQLVIRRLTCISPFSAVIAL  306

Query  182  GSEMSGGIEDVRASDITALDTESGVRIKTALGRGGYVKNIYVKGLRAHTMKLLFQMTGKY  361
            GSEMSGGI+DVRA DI A+++ESGVRIKTA+GRGG+VK+IYV+G+   TMK  F MTG Y
Sbjct  307  GSEMSGGIQDVRAEDIFAINSESGVRIKTAVGRGGFVKDIYVRGMTMKTMKWAFWMTGNY  366

Query  362  GSHADKNFDPKAIPVVAGINFRDVVADNVTTAGTMEGIPGHPFTGICMANVTIGMAKNGK  541
            GSHAD  +DP A+PV+  IN+ D+VA+NVT A  +EGIPG PFTGIC++NVTI +AK  K
Sbjct  367  GSHADNGYDPNALPVIQNINYHDMVAENVTMAAKLEGIPGDPFTGICISNVTITLAKKAK  426

Query  542  KQPPWVCANIQGVASGVVPPPCNLLHSQGPVKPGMCDLPAKN  667
            K  PW C +I G++SGVVP PC  L  QGP     C+ P ++
Sbjct  427  KL-PWNCTDIAGISSGVVPQPCQALADQGPGNVTACNFPEES  467



>ref|XP_010055093.1| PREDICTED: probable polygalacturonase [Eucalyptus grandis]
 gb|KCW71569.1| hypothetical protein EUGRSUZ_E00105 [Eucalyptus grandis]
Length=472

 Score =   310 bits (794),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 145/222 (65%), Positives = 170/222 (77%), Gaps = 1/222 (0%)
 Frame = +2

Query  2    INPDSCTKVRIEDNYIVSGDDCVAIKSGIDEYGIKYGMPTKQLIIRRLTCISPTSGAIAM  181
            INPDSCT VRIED YIVSGDDCVA+KSG DEYGI +GMPT+QLIIRRLTCISP S  IA+
Sbjct  234  INPDSCTNVRIEDCYIVSGDDCVAVKSGWDEYGIAFGMPTQQLIIRRLTCISPYSATIAL  293

Query  182  GSEMSGGIEDVRASDITALDTESGVRIKTALGRGGYVKNIYVKGLRAHTMKLLFQMTGKY  361
            GSEMSGGI DVRA DI A++TESG+RIKTA+GRG Y+K+IYVK +  HTMK  F+M G Y
Sbjct  294  GSEMSGGIRDVRAEDIVAINTESGIRIKTAVGRGAYIKDIYVKKMTMHTMKWAFKMDGDY  353

Query  362  GSHADKNFDPKAIPVVAGINFRDVVADNVTTAGTMEGIPGHPFTGICMANVTIGMAKNGK  541
             SH D  +DP A+PV+  IN+RD+VA+NV+ A    GI G  FTGICMANVT+GM    K
Sbjct  354  KSHPDNKYDPNALPVIQNINYRDMVAENVSVAARFNGIAGDKFTGICMANVTLGMTAKHK  413

Query  542  KQPPWVCANIQGVASGVVPPPCNLLHSQGPVKPGMCDLPAKN  667
            K  PW C ++QG+ SGV PPPC+ L  QGP K   CD PA +
Sbjct  414  KY-PWTCTDVQGMTSGVTPPPCDSLPDQGPEKISACDFPANS  454



>ref|XP_010523769.1| PREDICTED: probable polygalacturonase isoform X1 [Tarenaya hassleriana]
Length=472

 Score =   310 bits (794),  Expect = 3e-99, Method: Compositional matrix adjust.
 Identities = 146/219 (67%), Positives = 174/219 (79%), Gaps = 1/219 (0%)
 Frame = +2

Query  2    INPDSCTKVRIEDNYIVSGDDCVAIKSGIDEYGIKYGMPTKQLIIRRLTCISPTSGAIAM  181
            INPDSCT  RIED YIVSGDDCVA+KSG DEYGI +GMP  QL IRRLTCISP S AIA+
Sbjct  236  INPDSCTNTRIEDCYIVSGDDCVAVKSGWDEYGIAFGMPPSQLGIRRLTCISPYSAAIAL  295

Query  182  GSEMSGGIEDVRASDITALDTESGVRIKTALGRGGYVKNIYVKGLRAHTMKLLFQMTGKY  361
            GSEMSGGI+DVRA DITA  TESGVRIKTA+GRGG+VK+IYVKG+  HTMK +F MTG Y
Sbjct  296  GSEMSGGIQDVRAEDITAFHTESGVRIKTAVGRGGFVKDIYVKGMNLHTMKWIFWMTGNY  355

Query  362  GSHADKNFDPKAIPVVAGINFRDVVADNVTTAGTMEGIPGHPFTGICMANVTIGMAKNGK  541
             +HAD ++DP A+PV++GIN+RDVVA+NV+ AG +EGI G PFT IC++N TI MA   K
Sbjct  356  KAHADSHYDPHALPVISGINYRDVVAENVSMAGRLEGISGDPFTEICISNATISMAAKHK  415

Query  542  KQPPWVCANIQGVASGVVPPPCNLLHSQGPVKPGMCDLP  658
            K   W+C+++QG+ +GV P PC+LL  QG  K   CD P
Sbjct  416  K-AMWMCSDVQGITTGVEPQPCDLLTGQGSEKINGCDFP  453



>ref|XP_003525377.2| PREDICTED: probable polygalacturonase-like isoform X1 [Glycine 
max]
Length=492

 Score =   310 bits (795),  Expect = 3e-99, Method: Compositional matrix adjust.
 Identities = 147/222 (66%), Positives = 174/222 (78%), Gaps = 1/222 (0%)
 Frame = +2

Query  2    INPDSCTKVRIEDNYIVSGDDCVAIKSGIDEYGIKYGMPTKQLIIRRLTCISPTSGAIAM  181
            INPDSCT  RIED YIVSGDDCVA+KSG DEYGI YGMPTKQL+IRRLTCISP S  IA+
Sbjct  255  INPDSCTNTRIEDCYIVSGDDCVAVKSGWDEYGIAYGMPTKQLVIRRLTCISPFSAVIAL  314

Query  182  GSEMSGGIEDVRASDITALDTESGVRIKTALGRGGYVKNIYVKGLRAHTMKLLFQMTGKY  361
            GSEMSGGI+DVRA DI A+++ESGVRIKTA+GRGGYVK+I+V+ +   TMK  F MTG Y
Sbjct  315  GSEMSGGIQDVRAEDIVAINSESGVRIKTAVGRGGYVKDIFVRRMTMKTMKWAFWMTGNY  374

Query  362  GSHADKNFDPKAIPVVAGINFRDVVADNVTTAGTMEGIPGHPFTGICMANVTIGMAKNGK  541
            GSHAD N+DP A+PV+  IN+RD+VA+NVT A  +EGI G PFTGIC++NVTI +AK  K
Sbjct  375  GSHADDNYDPNALPVIQNINYRDMVAENVTMAARLEGISGDPFTGICISNVTIQLAKKAK  434

Query  542  KQPPWVCANIQGVASGVVPPPCNLLHSQGPVKPGMCDLPAKN  667
            K  PW C +I G++S V P PC LL  QG  K G C  P ++
Sbjct  435  KV-PWTCTDIAGISSDVTPAPCGLLPDQGEEKIGACTFPEES  475



>ref|XP_010413390.1| PREDICTED: probable polygalacturonase [Camelina sativa]
 ref|XP_010413391.1| PREDICTED: probable polygalacturonase [Camelina sativa]
 ref|XP_010413392.1| PREDICTED: probable polygalacturonase [Camelina sativa]
Length=476

 Score =   310 bits (794),  Expect = 3e-99, Method: Compositional matrix adjust.
 Identities = 147/225 (65%), Positives = 174/225 (77%), Gaps = 7/225 (3%)
 Frame = +2

Query  2    INPDSCTKVRIEDNYIVSGDDCVAIKSGIDEYGIKYGMPTKQLIIRRLTCISPTSGAIAM  181
            INPDSCT  RIED YI+SGDDC+A+KSG DEYGI +GMPTK L+IRRLTCISP S AIA+
Sbjct  234  INPDSCTNTRIEDCYIISGDDCIAVKSGWDEYGISFGMPTKHLLIRRLTCISPYSAAIAL  293

Query  182  GSEMSGGIEDVRASDITALDTESGVRIKTALGRGGYVKNIYVKGLRAHTMKLLFQMTGKY  361
            GSEMSGGIEDVRA DITA  TESGVRIKTA+GRG +VKNIYVKG+  HTMK +F MTG Y
Sbjct  294  GSEMSGGIEDVRAEDITAYQTESGVRIKTAVGRGAFVKNIYVKGMSLHTMKWVFWMTGNY  353

Query  362  GSHADKNFDPKAIPVVAGINFRDVVADNVTTAGTMEGIPGHPFTGICMANVTIGMAKNGK  541
             +HAD N+DP A+P + GIN+RD+VA+NV+ AG +EGI G PFTGIC++N TI MA   K
Sbjct  354  KAHADSNYDPHALPEITGINYRDIVAENVSMAGRLEGISGDPFTGICISNATISMAAKHK  413

Query  542  KQPPWVCANIQGVASGVVPPPCNLLHSQGPVKP------GMCDLP  658
            K   W+C++++GV SGV P PC+LL  Q   K       G CD P
Sbjct  414  K-AIWMCSDVEGVTSGVDPKPCDLLDGQESEKKKRMTTGGGCDFP  457



>ref|XP_004510753.1| PREDICTED: probable polygalacturonase-like [Cicer arietinum]
Length=481

 Score =   310 bits (793),  Expect = 5e-99, Method: Compositional matrix adjust.
 Identities = 145/220 (66%), Positives = 173/220 (79%), Gaps = 1/220 (0%)
 Frame = +2

Query  2    INPDSCTKVRIEDNYIVSGDDCVAIKSGIDEYGIKYGMPTKQLIIRRLTCISPTSGAIAM  181
            INPDSCT ++IED YIVSGDDCVA+KSG DEYGIK+G PTKQL+IRRLTCISP S  IA+
Sbjct  246  INPDSCTNIKIEDCYIVSGDDCVAVKSGWDEYGIKFGWPTKQLVIRRLTCISPYSATIAL  305

Query  182  GSEMSGGIEDVRASDITALDTESGVRIKTALGRGGYVKNIYVKGLRAHTMKLLFQMTGKY  361
            GSEMSGGI+DVRA DITA+ TESG+RIKTA+GRGGYVK+IYV+ +  HTMK  F +TG Y
Sbjct  306  GSEMSGGIQDVRAEDITAVHTESGIRIKTAVGRGGYVKDIYVQRMTMHTMKWAFWITGNY  365

Query  362  GSHADKNFDPKAIPVVAGINFRDVVADNVTTAGTMEGIPGHPFTGICMANVTIGMAKNGK  541
            GSHADKN+DP A+P +  IN+RD+ A+NV+ A  +EGI   PFTGIC++NVTI MA   K
Sbjct  366  GSHADKNYDPNALPEIRNINYRDMKAENVSMAARLEGISNDPFTGICISNVTISMAAKAK  425

Query  542  KQPPWVCANIQGVASGVVPPPCNLLHSQGPVKPGMCDLPA  661
            KQ PW C +I+G+ SGV P PC LL  QG  K   C  P+
Sbjct  426  KQ-PWTCNDIEGITSGVSPKPCGLLPDQGIKKIKACHFPS  464



>gb|EPS72197.1| hypothetical protein M569_02558, partial [Genlisea aurea]
Length=458

 Score =   308 bits (790),  Expect = 6e-99, Method: Compositional matrix adjust.
 Identities = 145/222 (65%), Positives = 176/222 (79%), Gaps = 4/222 (2%)
 Frame = +2

Query  2    INPDSCTKVRIEDNYIVSGDDCVAIKSGIDEYGIKYGMPTKQLIIRRLTCISPTSGAIAM  181
            INPDSC   RIEDNY+VSGDDCVA+KSG DEYGI YGMPTK L IRRLTC+SP S AIA+
Sbjct  228  INPDSCINTRIEDNYVVSGDDCVAVKSGWDEYGISYGMPTKHLTIRRLTCVSPYSAAIAI  287

Query  182  GSEMSGGIEDVRASDITALDTESGVRIKTALGRGGYVKNIYVKGLRAHTMKLLFQMTGKY  361
            GSEMSGGIEDVRA DITA+ TESG+RIKT +GRGG+V++++VKG+  HTMK +F +TG Y
Sbjct  288  GSEMSGGIEDVRAQDITAVGTESGIRIKTGVGRGGFVRDVFVKGMDLHTMKWVFWITGNY  347

Query  362  GSHADKNFDPKAIPVVAGINFRDVVADNVTTAGTMEGIPGHPFTGICMANVTIGMAKNGK  541
            GSHAD N+DP A+P + GIN+RDVVA+NV+ AG +EGI G PFT ICM+NVTI MA   K
Sbjct  348  GSHADGNYDPNALPEIRGINYRDVVAENVSMAGRLEGIAGDPFTEICMSNVTISMAAKAK  407

Query  542  KQPPWVCANIQGVASGVVPPPCNLLHSQGPVKPGMCDLPAKN  667
            K  PW C ++QGV+S V PPPC+LL  Q       C+ P+++
Sbjct  408  KY-PWSCTDVQGVSSSVDPPPCDLLPGQADED---CNFPSED  445



>gb|KHG23155.1| putative polygalacturonase [Gossypium arboreum]
Length=449

 Score =   307 bits (787),  Expect = 1e-98, Method: Compositional matrix adjust.
 Identities = 147/219 (67%), Positives = 171/219 (78%), Gaps = 3/219 (1%)
 Frame = +2

Query  2    INPDSCTKVRIEDNYIVSGDDCVAIKSGIDEYGIKYGMPTKQLIIRRLTCISPTSGAIAM  181
            INPDSCT  RIED YIVSGDDCVA+KSG DEYGIK+GMPTKQL+IRRLTCISP S  IA+
Sbjct  225  INPDSCTNTRIEDCYIVSGDDCVAVKSGWDEYGIKFGMPTKQLVIRRLTCISPFSAVIAL  284

Query  182  GSEMSGGIEDVRASDITALDTESGVRIKTALGRGGYVKNIYVKGLRAHTMKLLFQMTGKY  361
            GSEMSGGIEDVRA DIT +++ES VRIKTA+GRG YVK+IYV+ +   TMK++F M G Y
Sbjct  285  GSEMSGGIEDVRAEDITGINSESAVRIKTAVGRGNYVKDIYVRRMTMKTMKMVFWMAGNY  344

Query  362  GSHADKNFDPKAIPVVAGINFRDVVADNVTTAGTMEGIPGHPFTGICMANVTIGMAKNGK  541
            GSH D ++DP AIPV+  INFRDVVA+NVT A  +EGIPGHPF+GIC++N TIG+ K  K
Sbjct  345  GSHPDNDYDPNAIPVIQNINFRDVVAENVTMAARLEGIPGHPFSGICISNTTIGLTKKPK  404

Query  542  KQPPWVCANIQGVASGVVPPPCNLLHSQGPVKPGMCDLP  658
            K   W C  I GV+S V P PCNLL  QGP     C+ P
Sbjct  405  K-IQWNCTEIAGVSSNVRPQPCNLLTDQGP--DNACNFP  440



>ref|XP_008238946.1| PREDICTED: probable polygalacturonase [Prunus mume]
Length=482

 Score =   308 bits (790),  Expect = 1e-98, Method: Compositional matrix adjust.
 Identities = 143/221 (65%), Positives = 174/221 (79%), Gaps = 1/221 (0%)
 Frame = +2

Query  2    INPDSCTKVRIEDNYIVSGDDCVAIKSGIDEYGIKYGMPTKQLIIRRLTCISPTSGAIAM  181
            INPDSCT  +IED YIVSGDDC+A+KSG D+YGI +GMPTKQL+IRRLTCISP S  IA+
Sbjct  244  INPDSCTNTKIEDCYIVSGDDCIAVKSGWDQYGIAFGMPTKQLVIRRLTCISPFSAVIAL  303

Query  182  GSEMSGGIEDVRASDITALDTESGVRIKTALGRGGYVKNIYVKGLRAHTMKLLFQMTGKY  361
            GSEMSGGI+DVRA DI A+D+ESGVRIKTA+GRGG+VK+IYV+G+   TMK  F MTG Y
Sbjct  304  GSEMSGGIQDVRAEDILAIDSESGVRIKTAVGRGGFVKDIYVRGMTMKTMKWAFWMTGNY  363

Query  362  GSHADKNFDPKAIPVVAGINFRDVVADNVTTAGTMEGIPGHPFTGICMANVTIGMAKNGK  541
            GSHAD  +DP A+PV+  IN+ D+VA+NVT A  +EGIPG PFTGIC++NVTI +AK  K
Sbjct  364  GSHADNGYDPNALPVIQNINYHDMVAENVTMAAKLEGIPGDPFTGICISNVTITLAKKAK  423

Query  542  KQPPWVCANIQGVASGVVPPPCNLLHSQGPVKPGMCDLPAK  664
            K  PW C ++ G++SGVVP  C LL  QGP     C+ P +
Sbjct  424  KL-PWNCTDVAGISSGVVPQACGLLVDQGPRNVAACNFPEE  463



>ref|XP_004298828.1| PREDICTED: probable polygalacturonase-like [Fragaria vesca subsp. 
vesca]
Length=503

 Score =   309 bits (791),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 144/222 (65%), Positives = 176/222 (79%), Gaps = 1/222 (0%)
 Frame = +2

Query  2    INPDSCTKVRIEDNYIVSGDDCVAIKSGIDEYGIKYGMPTKQLIIRRLTCISPTSGAIAM  181
            INPDSCT  RIED YIVSGDDC+A+KSG DEYGI +GMPTK L+IRRLTCISP S  IA+
Sbjct  265  INPDSCTNTRIEDCYIVSGDDCIAVKSGWDEYGIAFGMPTKALVIRRLTCISPFSAVIAL  324

Query  182  GSEMSGGIEDVRASDITALDTESGVRIKTALGRGGYVKNIYVKGLRAHTMKLLFQMTGKY  361
            GSEMSGGI+DVRA DI A++TES VRIKTA+GRGG+VK+IYV+ +  HTMK +F + G Y
Sbjct  325  GSEMSGGIQDVRAEDIFAINTESAVRIKTAVGRGGFVKDIYVRRMTMHTMKYVFWIAGDY  384

Query  362  GSHADKNFDPKAIPVVAGINFRDVVADNVTTAGTMEGIPGHPFTGICMANVTIGMAKNGK  541
            GSHAD  +DP A+PV+  IN+ D+VA+NVT AG + G+ G PFTGIC++NVTI MAK GK
Sbjct  385  GSHADNGYDPNALPVIQNINYHDMVAENVTMAGKLGGLTGDPFTGICISNVTITMAKKGK  444

Query  542  KQPPWVCANIQGVASGVVPPPCNLLHSQGPVKPGMCDLPAKN  667
            K  PW C ++ G++SGVVP PC LL  QGP K G C+ P ++
Sbjct  445  K-VPWNCTDVAGISSGVVPQPCELLADQGPEKIGACNFPEES  485



>ref|XP_010469084.1| PREDICTED: probable polygalacturonase [Camelina sativa]
Length=476

 Score =   308 bits (788),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 146/225 (65%), Positives = 174/225 (77%), Gaps = 7/225 (3%)
 Frame = +2

Query  2    INPDSCTKVRIEDNYIVSGDDCVAIKSGIDEYGIKYGMPTKQLIIRRLTCISPTSGAIAM  181
            INPDSCT  RIED YI+SGDDC+A+KSG DEYGI +GMPTK L+IRRLTCISP S AIA+
Sbjct  234  INPDSCTNTRIEDCYIISGDDCIAVKSGWDEYGISFGMPTKHLVIRRLTCISPYSAAIAL  293

Query  182  GSEMSGGIEDVRASDITALDTESGVRIKTALGRGGYVKNIYVKGLRAHTMKLLFQMTGKY  361
            GSEMSGGIEDVRA DITA  TESGVRIKTA+GRG +VKNIYVKG+  HTMK +F MTG Y
Sbjct  294  GSEMSGGIEDVRAEDITAYQTESGVRIKTAVGRGAFVKNIYVKGMSLHTMKWVFWMTGNY  353

Query  362  GSHADKNFDPKAIPVVAGINFRDVVADNVTTAGTMEGIPGHPFTGICMANVTIGMAKNGK  541
             +HAD ++DP A+P + GIN+RD+VA+NV+ AG +EGI G PFTGIC++N TI MA   K
Sbjct  354  KAHADSHYDPHALPEITGINYRDIVAENVSMAGRLEGISGDPFTGICISNATISMAAKHK  413

Query  542  KQPPWVCANIQGVASGVVPPPCNLLHSQGPVKP------GMCDLP  658
            K   W+C++++GV SGV P PC+LL  Q   K       G CD P
Sbjct  414  K-VIWMCSDVEGVTSGVDPKPCDLLDGQESEKKKRMTSDGGCDFP  457



>ref|XP_010523770.1| PREDICTED: probable polygalacturonase isoform X2 [Tarenaya hassleriana]
Length=472

 Score =   307 bits (787),  Expect = 3e-98, Method: Compositional matrix adjust.
 Identities = 145/219 (66%), Positives = 173/219 (79%), Gaps = 1/219 (0%)
 Frame = +2

Query  2    INPDSCTKVRIEDNYIVSGDDCVAIKSGIDEYGIKYGMPTKQLIIRRLTCISPTSGAIAM  181
            INPDSCT  RIED YIVSGDDCVA+KSG DEYGI +GMP  QL IRRLTCISP S AIA+
Sbjct  236  INPDSCTNTRIEDCYIVSGDDCVAVKSGWDEYGIAFGMPPSQLGIRRLTCISPYSAAIAL  295

Query  182  GSEMSGGIEDVRASDITALDTESGVRIKTALGRGGYVKNIYVKGLRAHTMKLLFQMTGKY  361
            GSEMSGGI+DVRA DITA  TESGVRIKTA+GRGG+VK+IYVKG+   TMK +F MTG Y
Sbjct  296  GSEMSGGIQDVRAEDITAFHTESGVRIKTAVGRGGFVKDIYVKGMNLQTMKWIFWMTGNY  355

Query  362  GSHADKNFDPKAIPVVAGINFRDVVADNVTTAGTMEGIPGHPFTGICMANVTIGMAKNGK  541
             +HAD ++DP A+PV++GIN+RDVVA+NV+ AG +EGI G PFT IC++N TI MA   K
Sbjct  356  KAHADSHYDPHALPVISGINYRDVVAENVSMAGRLEGISGDPFTEICISNATISMAAKHK  415

Query  542  KQPPWVCANIQGVASGVVPPPCNLLHSQGPVKPGMCDLP  658
            K   W+C+++QG+ +GV P PC+LL  QG  K   CD P
Sbjct  416  K-AMWMCSDVQGITTGVEPQPCDLLTGQGSEKINGCDFP  453



>ref|XP_010089055.1| putative polygalacturonase [Morus notabilis]
 gb|EXB37302.1| putative polygalacturonase [Morus notabilis]
Length=471

 Score =   307 bits (786),  Expect = 3e-98, Method: Compositional matrix adjust.
 Identities = 142/219 (65%), Positives = 173/219 (79%), Gaps = 1/219 (0%)
 Frame = +2

Query  2    INPDSCTKVRIEDNYIVSGDDCVAIKSGIDEYGIKYGMPTKQLIIRRLTCISPTSGAIAM  181
            INPDSCT  RIED YIVSGDDCVA+KSG+D+YGI +GMPTK L+IRRLTCISPTS  IA+
Sbjct  233  INPDSCTNTRIEDCYIVSGDDCVAVKSGLDQYGIAFGMPTKHLVIRRLTCISPTSAVIAL  292

Query  182  GSEMSGGIEDVRASDITALDTESGVRIKTALGRGGYVKNIYVKGLRAHTMKLLFQMTGKY  361
            GSEMSGG++DVRA +I A+ +ESGVRIKT  GRGG+VK+IYVKG+  HTM+ +F MTG Y
Sbjct  293  GSEMSGGVQDVRAENIVAISSESGVRIKTGKGRGGFVKDIYVKGMTMHTMRWVFWMTGNY  352

Query  362  GSHADKNFDPKAIPVVAGINFRDVVADNVTTAGTMEGIPGHPFTGICMANVTIGMAKNGK  541
            GSHAD  +DP A+PV+  IN+RD+VA+NVT A  +EGIPG PFTGIC++NVTI +A+  K
Sbjct  353  GSHADNGYDPNALPVIQNINYRDMVAENVTMASWLEGIPGDPFTGICISNVTIALAETAK  412

Query  542  KQPPWVCANIQGVASGVVPPPCNLLHSQGPVKPGMCDLP  658
            K   W C +I G++SGVVP  C LL +Q   K   CD P
Sbjct  413  KL-QWNCTDIAGISSGVVPHTCELLANQSLEKWTTCDFP  450



>ref|XP_007209970.1| hypothetical protein PRUPE_ppa004996mg [Prunus persica]
 gb|EMJ11169.1| hypothetical protein PRUPE_ppa004996mg [Prunus persica]
Length=482

 Score =   307 bits (786),  Expect = 4e-98, Method: Compositional matrix adjust.
 Identities = 142/222 (64%), Positives = 175/222 (79%), Gaps = 1/222 (0%)
 Frame = +2

Query  2    INPDSCTKVRIEDNYIVSGDDCVAIKSGIDEYGIKYGMPTKQLIIRRLTCISPTSGAIAM  181
            INPDSCT  +IED YIVSGDDC+A+KSG D+YGI +GMPTKQL+IRRLTCISP S  IA+
Sbjct  244  INPDSCTNTKIEDCYIVSGDDCIAVKSGWDQYGIAFGMPTKQLVIRRLTCISPFSAVIAL  303

Query  182  GSEMSGGIEDVRASDITALDTESGVRIKTALGRGGYVKNIYVKGLRAHTMKLLFQMTGKY  361
            GSEMSGGI+DVRA +I A+D+ESGVRIKTA+GRGG+VK+IYV+G+   TMK  F MTG Y
Sbjct  304  GSEMSGGIQDVRAENILAIDSESGVRIKTAVGRGGFVKDIYVRGVTMKTMKWAFWMTGNY  363

Query  362  GSHADKNFDPKAIPVVAGINFRDVVADNVTTAGTMEGIPGHPFTGICMANVTIGMAKNGK  541
            GSHAD  +DP A+PV+  IN+ D+VA+NVT A  +EGIPG PFTGIC++NVTI +AK  K
Sbjct  364  GSHADNGYDPNALPVIQNINYHDMVAENVTMAAKLEGIPGDPFTGICISNVTITLAKKAK  423

Query  542  KQPPWVCANIQGVASGVVPPPCNLLHSQGPVKPGMCDLPAKN  667
            K  PW C ++ G++SGVVP  C LL  QGP     C+ P ++
Sbjct  424  KL-PWNCTDVAGISSGVVPQACGLLVDQGPSNVAACNFPEES  464



>ref|XP_002876618.1| glycoside hydrolase family 28 protein [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH52877.1| glycoside hydrolase family 28 protein [Arabidopsis lyrata subsp. 
lyrata]
Length=475

 Score =   306 bits (785),  Expect = 5e-98, Method: Compositional matrix adjust.
 Identities = 146/224 (65%), Positives = 174/224 (78%), Gaps = 6/224 (3%)
 Frame = +2

Query  2    INPDSCTKVRIEDNYIVSGDDCVAIKSGIDEYGIKYGMPTKQLIIRRLTCISPTSGAIAM  181
            INPDSCT  RIED YI+SGDDC+A+KSG DEYGI +GMPTK L+IRRLTCISP S AIA+
Sbjct  234  INPDSCTNTRIEDCYIISGDDCIAVKSGWDEYGISFGMPTKHLVIRRLTCISPYSAAIAL  293

Query  182  GSEMSGGIEDVRASDITALDTESGVRIKTALGRGGYVKNIYVKGLRAHTMKLLFQMTGKY  361
            GSEMSGGIEDVRA DITA  TESGVRIKTA+GRG +VKNIYVKG+  HTMK +F MTG Y
Sbjct  294  GSEMSGGIEDVRAEDITAYQTESGVRIKTAVGRGAFVKNIYVKGMNLHTMKWVFWMTGNY  353

Query  362  GSHADKNFDPKAIPVVAGINFRDVVADNVTTAGTMEGIPGHPFTGICMANVTIGMAKNGK  541
             +HAD ++DP A+P + GIN+RD+VA+NV+ AG +EGI G PFTGIC++N TI MA   K
Sbjct  354  KAHADSHYDPHALPEITGINYRDIVAENVSMAGRLEGISGDPFTGICISNATISMAAKHK  413

Query  542  KQPPWVCANIQGVASGVVPPPCNLLHSQ-GPVKPGM----CDLP  658
            K   W+C++++GV SGV P PC+LL  Q    K  M    CD P
Sbjct  414  K-AIWMCSDVEGVTSGVDPKPCDLLDGQESETKKKMIDGGCDFP  456



>ref|XP_006291035.1| hypothetical protein CARUB_v10017147mg [Capsella rubella]
 gb|EOA23933.1| hypothetical protein CARUB_v10017147mg [Capsella rubella]
Length=475

 Score =   306 bits (785),  Expect = 6e-98, Method: Compositional matrix adjust.
 Identities = 144/224 (64%), Positives = 174/224 (78%), Gaps = 6/224 (3%)
 Frame = +2

Query  2    INPDSCTKVRIEDNYIVSGDDCVAIKSGIDEYGIKYGMPTKQLIIRRLTCISPTSGAIAM  181
            INPDSCT  RIED YI+SGDDC+A+KSG DEYGI +GMPTK L+IRRLTCISP S AIA+
Sbjct  234  INPDSCTNTRIEDCYIISGDDCIAVKSGWDEYGISFGMPTKHLVIRRLTCISPYSAAIAL  293

Query  182  GSEMSGGIEDVRASDITALDTESGVRIKTALGRGGYVKNIYVKGLRAHTMKLLFQMTGKY  361
            GSEMSGGIEDVRA +ITA  TESGVRIKTA+GRG +VKN+YVKG+  HTMK +F MTG Y
Sbjct  294  GSEMSGGIEDVRAEEITAYQTESGVRIKTAVGRGAFVKNVYVKGMSLHTMKWVFWMTGNY  353

Query  362  GSHADKNFDPKAIPVVAGINFRDVVADNVTTAGTMEGIPGHPFTGICMANVTIGMAKNGK  541
             +HAD ++DP A+P + GIN+RD+VA+NV+ AG +EGI G PFTGIC++N TI MA   K
Sbjct  354  KAHADSHYDPHALPEITGINYRDIVAENVSMAGRLEGISGDPFTGICISNATISMAAKHK  413

Query  542  KQPPWVCANIQGVASGVVPPPCNLLHSQGPVKP-----GMCDLP  658
            K   W+C++++GV SGV P PC+LL  Q   K      G CD P
Sbjct  414  K-AIWMCSDVEGVTSGVDPKPCDLLDGQESEKKKRMSDGGCDFP  456



>gb|KDP25392.1| hypothetical protein JCGZ_20548 [Jatropha curcas]
Length=480

 Score =   306 bits (785),  Expect = 6e-98, Method: Compositional matrix adjust.
 Identities = 147/219 (67%), Positives = 172/219 (79%), Gaps = 1/219 (0%)
 Frame = +2

Query  2    INPDSCTKVRIEDNYIVSGDDCVAIKSGIDEYGIKYGMPTKQLIIRRLTCISPTSGAIAM  181
            INPDSCT  RIED YIVSGDDCVA+KSG DEYGI +GMPTKQL+IRRLTCISPTS AIA+
Sbjct  242  INPDSCTNTRIEDCYIVSGDDCVAVKSGWDEYGIAFGMPTKQLVIRRLTCISPTSAAIAL  301

Query  182  GSEMSGGIEDVRASDITALDTESGVRIKTALGRGGYVKNIYVKGLRAHTMKLLFQMTGKY  361
            GSEMSGGI+DVRA DITA+DTESGVRIKT++GRGGYVK IYV+ +   TMK +F MTG Y
Sbjct  302  GSEMSGGIQDVRAEDITAIDTESGVRIKTSIGRGGYVKEIYVRRMTMKTMKWVFWMTGNY  361

Query  362  GSHADKNFDPKAIPVVAGINFRDVVADNVTTAGTMEGIPGHPFTGICMANVTIGMAKNGK  541
            GSH D N+DP AIPV+  IN+RD+VA+NVT A  +EGI G PFTGIC++NVTI + +  K
Sbjct  362  GSHPDNNYDPNAIPVIENINYRDMVAENVTMAARLEGIAGDPFTGICISNVTIKLTEKPK  421

Query  542  KQPPWVCANIQGVASGVVPPPCNLLHSQGPVKPGMCDLP  658
            K   W C  I G++SGV P PC+LL    P K   C+ P
Sbjct  422  KL-QWNCTEIAGISSGVTPKPCDLLPDSEPGKVTPCNFP  459



>ref|XP_009116814.1| PREDICTED: probable polygalacturonase [Brassica rapa]
Length=470

 Score =   306 bits (784),  Expect = 6e-98, Method: Compositional matrix adjust.
 Identities = 141/220 (64%), Positives = 174/220 (79%), Gaps = 1/220 (0%)
 Frame = +2

Query  2    INPDSCTKVRIEDNYIVSGDDCVAIKSGIDEYGIKYGMPTKQLIIRRLTCISPTSGAIAM  181
            INPDSCT  RIED YI+SGDDCVA+KSG DEYGI +GMPTK LIIRRLTCISP S AIA+
Sbjct  234  INPDSCTNTRIEDCYIISGDDCVAVKSGWDEYGISFGMPTKHLIIRRLTCISPYSAAIAL  293

Query  182  GSEMSGGIEDVRASDITALDTESGVRIKTALGRGGYVKNIYVKGLRAHTMKLLFQMTGKY  361
            GSEMSGGIEDVRA +ITA  TESGVRIKTA+GRG +V+N+YV+G+R HTMK +F MTG Y
Sbjct  294  GSEMSGGIEDVRAEEITAYQTESGVRIKTAVGRGAFVRNVYVRGMRLHTMKWVFWMTGNY  353

Query  362  GSHADKNFDPKAIPVVAGINFRDVVADNVTTAGTMEGIPGHPFTGICMANVTIGMAKNGK  541
             +HAD ++DP A+P + GIN+RD+VA+NV+ AG +EGI G PF GIC++N TI MA   K
Sbjct  354  KAHADSHYDPHALPEITGINYRDIVAENVSMAGRLEGISGDPFKGICISNATISMAVKHK  413

Query  542  KQPPWVCANIQGVASGVVPPPCNLLHSQGPVKPGMCDLPA  661
            K   W+C++++GV SGV P PC+LL  +     G C+ P+
Sbjct  414  K-VMWMCSDVEGVTSGVDPKPCDLLDGKQEKMDGGCEFPS  452



>ref|NP_191708.1| polygalacturonase-like protein [Arabidopsis thaliana]
 ref|NP_974473.1| polygalacturonase-like protein [Arabidopsis thaliana]
 ref|NP_001190154.1| polygalacturonase-like protein [Arabidopsis thaliana]
 emb|CAB71079.1| putative protein [Arabidopsis thaliana]
 gb|AEE80211.1| polygalacturonase-like protein [Arabidopsis thaliana]
 gb|AEE80212.1| polygalacturonase-like protein [Arabidopsis thaliana]
 gb|AEE80213.1| polygalacturonase-like protein [Arabidopsis thaliana]
Length=476

 Score =   306 bits (785),  Expect = 6e-98, Method: Compositional matrix adjust.
 Identities = 145/225 (64%), Positives = 174/225 (77%), Gaps = 7/225 (3%)
 Frame = +2

Query  2    INPDSCTKVRIEDNYIVSGDDCVAIKSGIDEYGIKYGMPTKQLIIRRLTCISPTSGAIAM  181
            INPDSCT  RIED YI+SGDDC+A+KSG DEYGI +GMPTK L+IRRLTCISP S AIA+
Sbjct  234  INPDSCTNTRIEDCYIISGDDCIAVKSGWDEYGISFGMPTKHLVIRRLTCISPYSAAIAL  293

Query  182  GSEMSGGIEDVRASDITALDTESGVRIKTALGRGGYVKNIYVKGLRAHTMKLLFQMTGKY  361
            GSEMSGGIEDVRA DITA  TESGVRIKTA+GRG +VKNIYVKG+  HTMK +F MTG Y
Sbjct  294  GSEMSGGIEDVRAEDITAYQTESGVRIKTAVGRGAFVKNIYVKGMNLHTMKWVFWMTGNY  353

Query  362  GSHADKNFDPKAIPVVAGINFRDVVADNVTTAGTMEGIPGHPFTGICMANVTIGMAKNGK  541
             +HAD ++DP A+P + GIN+RD+VA+NV+ AG +EGI G PFTGIC++N TI MA   K
Sbjct  354  KAHADSHYDPHALPEITGINYRDIVAENVSMAGRLEGISGDPFTGICISNATISMAAKHK  413

Query  542  KQPPWVCANIQGVASGVVPPPCNLLHSQGP------VKPGMCDLP  658
            K   W+C++++GV SGV P PC+LL  Q        +  G CD P
Sbjct  414  K-AIWMCSDVEGVTSGVDPKPCDLLDGQESETTKKKMIDGGCDFP  457



>ref|XP_006402475.1| hypothetical protein EUTSA_v10005939mg [Eutrema salsugineum]
 gb|ESQ43928.1| hypothetical protein EUTSA_v10005939mg [Eutrema salsugineum]
Length=475

 Score =   306 bits (785),  Expect = 6e-98, Method: Compositional matrix adjust.
 Identities = 144/223 (65%), Positives = 174/223 (78%), Gaps = 5/223 (2%)
 Frame = +2

Query  2    INPDSCTKVRIEDNYIVSGDDCVAIKSGIDEYGIKYGMPTKQLIIRRLTCISPTSGAIAM  181
            INPDSCT  RIED YI+SGDDC+A+KSG DEYGI +GMPTK L+IRRLTCISP S AIA+
Sbjct  235  INPDSCTNTRIEDCYIISGDDCIAVKSGWDEYGIAFGMPTKHLLIRRLTCISPYSAAIAL  294

Query  182  GSEMSGGIEDVRASDITALDTESGVRIKTALGRGGYVKNIYVKGLRAHTMKLLFQMTGKY  361
            GSEMSGGIEDVRA +ITA  TESGVRIKTA+GRG +VKNIYV+G+  HTMK +F MTG Y
Sbjct  295  GSEMSGGIEDVRAEEITAYQTESGVRIKTAVGRGAFVKNIYVRGMSLHTMKWVFWMTGNY  354

Query  362  GSHADKNFDPKAIPVVAGINFRDVVADNVTTAGTMEGIPGHPFTGICMANVTIGMAKNGK  541
             +HAD ++DP A+P + GIN+RD+VA+NV+ AG +EGI G PFTGIC++N TI MA   K
Sbjct  355  KAHADSHYDPHALPEITGINYRDIVAENVSMAGRLEGISGDPFTGICISNATISMAAKHK  414

Query  542  KQPPWVCANIQGVASGVVPPPCNLLHSQGPVKP----GMCDLP  658
            K   W+C++++GV SGV P PC+LL  Q   K     G CD P
Sbjct  415  K-AIWMCSDVEGVTSGVDPKPCDLLDGQQSEKKKKTDGGCDFP  456



>ref|XP_009604283.1| PREDICTED: probable polygalacturonase [Nicotiana tomentosiformis]
Length=482

 Score =   305 bits (782),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 145/222 (65%), Positives = 172/222 (77%), Gaps = 1/222 (0%)
 Frame = +2

Query  2    INPDSCTKVRIEDNYIVSGDDCVAIKSGIDEYGIKYGMPTKQLIIRRLTCISPTSGAIAM  181
            INPDSC   RIED YIVSGDDC+A+KSG DEYG+ +GMPTKQL IRR+TCISPTS  IA+
Sbjct  244  INPDSCINTRIEDCYIVSGDDCIAVKSGWDEYGVAFGMPTKQLAIRRITCISPTSATIAL  303

Query  182  GSEMSGGIEDVRASDITALDTESGVRIKTALGRGGYVKNIYVKGLRAHTMKLLFQMTGKY  361
            GSEMSGGI+DVRA DI A+DTESGVRIKTA+GRGGYVK+IYVKG+   TMK +F MTG Y
Sbjct  304  GSEMSGGIQDVRAEDIVAIDTESGVRIKTAVGRGGYVKDIYVKGVTMKTMKYVFWMTGDY  363

Query  362  GSHADKNFDPKAIPVVAGINFRDVVADNVTTAGTMEGIPGHPFTGICMANVTIGMAKNGK  541
            GSH D N+DP A+PV+  IN+RD+VA+NVT A  + GI G PFTGIC++NVTI +A   K
Sbjct  364  GSHPDNNYDPNALPVIDNINYRDMVAENVTIAAKLSGISGDPFTGICISNVTIELAPKAK  423

Query  542  KQPPWVCANIQGVASGVVPPPCNLLHSQGPVKPGMCDLPAKN  667
            K   W C +I G++SGVVP PC LL  QG      C+ P +N
Sbjct  424  KL-AWNCTDISGISSGVVPQPCELLPDQGTENVAPCNFPTEN  464



>emb|CDY65355.1| BnaC08g49000D [Brassica napus]
Length=472

 Score =   305 bits (780),  Expect = 3e-97, Method: Compositional matrix adjust.
 Identities = 142/221 (64%), Positives = 174/221 (79%), Gaps = 2/221 (1%)
 Frame = +2

Query  2    INPDSCTKVRIEDNYIVSGDDCVAIKSGIDEYGIKYGMPTKQLIIRRLTCISPTSGAIAM  181
            INPDSCT  RIED YI+SGDDCVA+KSG DEYGI +GMPTK LIIRRLTC+SP S AIA+
Sbjct  234  INPDSCTNTRIEDCYIISGDDCVAVKSGWDEYGIAFGMPTKHLIIRRLTCVSPYSAAIAL  293

Query  182  GSEMSGGIEDVRASDITALDTESGVRIKTALGRGGYVKNIYVKGLRAHTMKLLFQMTGKY  361
            GSEMSGGIEDVRA DITA  TESGVRIKTA+GRG +V+N+YV+G+  HTMK +F MTG Y
Sbjct  294  GSEMSGGIEDVRAEDITAYQTESGVRIKTAVGRGAFVRNVYVRGMSLHTMKWVFWMTGNY  353

Query  362  GSHADKNFDPKAIPVVAGINFRDVVADNVTTAGTMEGIPGHPFTGICMANVTIGMAKNGK  541
             +HAD ++DP A+P + GIN+RD+VA+NV+ AG +EGI G PFTGIC++N TI MA   K
Sbjct  354  KAHADSHYDPHALPEITGINYRDIVAENVSMAGRLEGISGDPFTGICISNATISMAVKHK  413

Query  542  KQPPWVCANIQGVASGVVPPPCNLLH-SQGPVKPGMCDLPA  661
            K   W+C++++GV SGV P PC+LL   Q     G C+ P+
Sbjct  414  K-AIWMCSDVEGVTSGVDPKPCDLLDGKQSEKMDGGCEFPS  453



>ref|XP_010089056.1| putative polygalacturonase [Morus notabilis]
 gb|EXB37303.1| putative polygalacturonase [Morus notabilis]
Length=466

 Score =   304 bits (779),  Expect = 3e-97, Method: Compositional matrix adjust.
 Identities = 143/219 (65%), Positives = 171/219 (78%), Gaps = 1/219 (0%)
 Frame = +2

Query  2    INPDSCTKVRIEDNYIVSGDDCVAIKSGIDEYGIKYGMPTKQLIIRRLTCISPTSGAIAM  181
            INPDSCT  RIED YIVSGDDC+A+KSG DEYGI +GMPTKQL+IRRLTCISP S  IA+
Sbjct  228  INPDSCTNTRIEDCYIVSGDDCIAVKSGWDEYGIAFGMPTKQLVIRRLTCISPFSAVIAL  287

Query  182  GSEMSGGIEDVRASDITALDTESGVRIKTALGRGGYVKNIYVKGLRAHTMKLLFQMTGKY  361
            GSEMSGGI+DVRA DI A+++ESGVRIKTA+GRGG+VK+IYV+G    TMK  F MTG Y
Sbjct  288  GSEMSGGIQDVRAEDIVAINSESGVRIKTAVGRGGFVKDIYVRGFTMKTMKWAFWMTGNY  347

Query  362  GSHADKNFDPKAIPVVAGINFRDVVADNVTTAGTMEGIPGHPFTGICMANVTIGMAKNGK  541
            GSH D  +D  A+P++  IN+RDVVA+NV+ A  +EGIPG PFTGIC++NVTIG+AK  K
Sbjct  348  GSHPDDKYDSNALPLIQNINYRDVVAENVSMAARLEGIPGDPFTGICLSNVTIGLAKKPK  407

Query  542  KQPPWVCANIQGVASGVVPPPCNLLHSQGPVKPGMCDLP  658
            K   W C ++ G++SGVVP PC LL  QGP     C  P
Sbjct  408  KL-QWNCTDVSGISSGVVPQPCPLLADQGPDAATTCAFP  445



>ref|XP_009793070.1| PREDICTED: probable polygalacturonase [Nicotiana sylvestris]
Length=482

 Score =   305 bits (780),  Expect = 4e-97, Method: Compositional matrix adjust.
 Identities = 144/222 (65%), Positives = 172/222 (77%), Gaps = 1/222 (0%)
 Frame = +2

Query  2    INPDSCTKVRIEDNYIVSGDDCVAIKSGIDEYGIKYGMPTKQLIIRRLTCISPTSGAIAM  181
            INPDSC   RIED YIVSGDDC+A+KSG DEYG+ +GMPTKQL IRR+TCISPTS  IA+
Sbjct  244  INPDSCINTRIEDCYIVSGDDCIAVKSGWDEYGVAFGMPTKQLAIRRITCISPTSATIAL  303

Query  182  GSEMSGGIEDVRASDITALDTESGVRIKTALGRGGYVKNIYVKGLRAHTMKLLFQMTGKY  361
            GSEMSGGI+DVRA DI A+DTESGVRIKTA+GRGGYVK++YVKG+   TMK +F MTG Y
Sbjct  304  GSEMSGGIQDVRAEDIVAIDTESGVRIKTAVGRGGYVKDVYVKGVTMKTMKYVFWMTGDY  363

Query  362  GSHADKNFDPKAIPVVAGINFRDVVADNVTTAGTMEGIPGHPFTGICMANVTIGMAKNGK  541
            GSH D N+DP A+PV+  IN+RD+VA+NVT A  + GI G PFTGIC++NVTI +A   K
Sbjct  364  GSHPDNNYDPNALPVIDNINYRDMVAENVTIAAKLAGISGDPFTGICISNVTIELAPKAK  423

Query  542  KQPPWVCANIQGVASGVVPPPCNLLHSQGPVKPGMCDLPAKN  667
            K   W C +I G++SGVVP PC LL  QG      C+ P +N
Sbjct  424  KL-AWNCTDISGISSGVVPQPCELLPDQGTENVSPCNFPTEN  464



>ref|XP_002511903.1| polygalacturonase, putative [Ricinus communis]
 gb|EEF50572.1| polygalacturonase, putative [Ricinus communis]
Length=472

 Score =   304 bits (778),  Expect = 6e-97, Method: Compositional matrix adjust.
 Identities = 143/210 (68%), Positives = 168/210 (80%), Gaps = 1/210 (0%)
 Frame = +2

Query  38   DNYIVSGDDCVAIKSGIDEYGIKYGMPTKQLIIRRLTCISPTSGAIAMGSEMSGGIEDVR  217
            D YI+SGDDCVA+KSG DEYGI +GMPTKQL+IRRLTCISP S  IA+GSEMSGGI+DVR
Sbjct  246  DCYIISGDDCVAVKSGWDEYGIAFGMPTKQLVIRRLTCISPYSATIALGSEMSGGIQDVR  305

Query  218  ASDITALDTESGVRIKTALGRGGYVKNIYVKGLRAHTMKLLFQMTGKYGSHADKNFDPKA  397
            A DITA+ TESGVRIKTA+GRGGYVK+IYVK +  HTMK  F MTG YGSHADKN+DP A
Sbjct  306  AEDITAIHTESGVRIKTAVGRGGYVKDIYVKRMTMHTMKWAFWMTGNYGSHADKNYDPNA  365

Query  398  IPVVAGINFRDVVADNVTTAGTMEGIPGHPFTGICMANVTIGMAKNGKKQPPWVCANIQG  577
            +PV+ GIN+RD+VADNV+ A  +EGI G PF  IC++NVTIGMA   KK  PW C +I+G
Sbjct  366  LPVIEGINYRDMVADNVSMAARLEGISGDPFKQICISNVTIGMAAKAKKI-PWTCTDIEG  424

Query  578  VASGVVPPPCNLLHSQGPVKPGMCDLPAKN  667
            + +GV P PC+LL  QGP K   CD P +N
Sbjct  425  ITTGVSPRPCDLLPDQGPEKLTACDFPPEN  454



>emb|CDY48913.1| BnaA09g39240D [Brassica napus]
Length=471

 Score =   304 bits (778),  Expect = 6e-97, Method: Compositional matrix adjust.
 Identities = 142/221 (64%), Positives = 175/221 (79%), Gaps = 2/221 (1%)
 Frame = +2

Query  2    INPDSCTKVRIEDNYIVSGDDCVAIKSGIDEYGIKYGMPTKQLIIRRLTCISPTSGAIAM  181
            INPDSCT  RIED YI+SGDDCVA+KSG DEYGI +GMPTK LIIRRLTCISP S AIA+
Sbjct  234  INPDSCTNTRIEDCYIISGDDCVAVKSGWDEYGISFGMPTKHLIIRRLTCISPYSAAIAL  293

Query  182  GSEMSGGIEDVRASDITALDTESGVRIKTALGRGGYVKNIYVKGLRAHTMKLLFQMTGKY  361
            GSEMSGGIEDVRA +ITA  TESGVRIKTA+GRG +V+N+YV+G+R HTMK +F MTG Y
Sbjct  294  GSEMSGGIEDVRAEEITAYQTESGVRIKTAVGRGAFVRNVYVRGMRLHTMKWVFWMTGNY  353

Query  362  GSHADKNFDPKAIPVVAGINFRDVVADNVTTAGTMEGIPGHPFTGICMANVTIGMAKNGK  541
             +HAD ++DP A+P + GIN+RD+VA+NV+ AG +EGI G PF GIC++N TI MA   K
Sbjct  354  KAHADSHYDPHALPEITGINYRDIVAENVSMAGRLEGISGDPFKGICISNATISMAVKHK  413

Query  542  KQPPWVCANIQGVASGVVPPPCNLLHSQGPVK-PGMCDLPA  661
            K   W+C++++GV SGV P PC+LL  +   K  G C+ P+
Sbjct  414  K-VMWMCSDVEGVTSGVDPKPCDLLDGKQEKKMDGGCEFPS  453



>ref|XP_010530415.1| PREDICTED: probable polygalacturonase, partial [Tarenaya hassleriana]
Length=445

 Score =   303 bits (775),  Expect = 7e-97, Method: Compositional matrix adjust.
 Identities = 143/221 (65%), Positives = 176/221 (80%), Gaps = 1/221 (0%)
 Frame = +2

Query  2    INPDSCTKVRIEDNYIVSGDDCVAIKSGIDEYGIKYGMPTKQLIIRRLTCISPTSGAIAM  181
            INPDSCT  RIED YIVSGDDC+A+KSG DEYGIKYGMPTKQL+IRRLTCISP S  IA+
Sbjct  207  INPDSCTNTRIEDCYIVSGDDCIAVKSGWDEYGIKYGMPTKQLLIRRLTCISPDSAVIAL  266

Query  182  GSEMSGGIEDVRASDITALDTESGVRIKTALGRGGYVKNIYVKGLRAHTMKLLFQMTGKY  361
            GSEMSGGIEDVRA DI A+++ESGVRIKTA+GRGGYVK+IYV+G+  +TMK +F MTG Y
Sbjct  267  GSEMSGGIEDVRAEDIVAINSESGVRIKTAIGRGGYVKDIYVRGMTMNTMKYVFWMTGNY  326

Query  362  GSHADKNFDPKAIPVVAGINFRDVVADNVTTAGTMEGIPGHPFTGICMANVTIGMAKNGK  541
            GSH D+++DP+A+PV+  IN++D+VA+NVT    + GIPG  F+GIC++NVTIG+A   K
Sbjct  327  GSHPDEHYDPEALPVIENINYQDMVAENVTMPAQLSGIPGDQFSGICISNVTIGLATKPK  386

Query  542  KQPPWVCANIQGVASGVVPPPCNLLHSQGPVKPGMCDLPAK  664
            K   W C ++ G ASGV PPPC LL  + P     C+ PA+
Sbjct  387  KV-LWNCTDVSGFASGVTPPPCELLPEKQPGTMIPCNFPAE  426



>ref|XP_010255225.1| PREDICTED: probable polygalacturonase isoform X3 [Nelumbo nucifera]
Length=468

 Score =   302 bits (773),  Expect = 3e-96, Method: Compositional matrix adjust.
 Identities = 144/222 (65%), Positives = 171/222 (77%), Gaps = 1/222 (0%)
 Frame = +2

Query  2    INPDSCTKVRIEDNYIVSGDDCVAIKSGIDEYGIKYGMPTKQLIIRRLTCISPTSGAIAM  181
            INPDS T VRIED YIVSGDDCVA+KSG DEYGI +GMPTK L+IRRLTCISP S  IA+
Sbjct  230  INPDSSTNVRIEDCYIVSGDDCVAVKSGWDEYGIAFGMPTKGLVIRRLTCISPDSAVIAL  289

Query  182  GSEMSGGIEDVRASDITALDTESGVRIKTALGRGGYVKNIYVKGLRAHTMKLLFQMTGKY  361
            GSEMSGGIEDVRA DI A+++ESGVRIKTA+GRGGYVK++YV+G+   TMK  F MTG Y
Sbjct  290  GSEMSGGIEDVRAEDILAINSESGVRIKTAVGRGGYVKDVYVRGMTMKTMKWAFWMTGNY  349

Query  362  GSHADKNFDPKAIPVVAGINFRDVVADNVTTAGTMEGIPGHPFTGICMANVTIGMAKNGK  541
            GSH D  +DP A+PV+ GIN+RD+VA+NVT A  +EGI G  FTGIC++NVTIG+A   K
Sbjct  350  GSHPDNKYDPNALPVINGINYRDMVAENVTMAARLEGIAGDQFTGICISNVTIGLAHKAK  409

Query  542  KQPPWVCANIQGVASGVVPPPCNLLHSQGPVKPGMCDLPAKN  667
            K  PW C++I+G+ SGV P PC LL  Q P     C  P  +
Sbjct  410  KV-PWTCSDIEGITSGVTPAPCALLPDQAPQGLTSCAFPTDS  450



>ref|XP_006439488.1| hypothetical protein CICLE_v10019941mg [Citrus clementina]
 gb|ESR52728.1| hypothetical protein CICLE_v10019941mg [Citrus clementina]
Length=480

 Score =   302 bits (773),  Expect = 4e-96, Method: Compositional matrix adjust.
 Identities = 142/219 (65%), Positives = 170/219 (78%), Gaps = 1/219 (0%)
 Frame = +2

Query  2    INPDSCTKVRIEDNYIVSGDDCVAIKSGIDEYGIKYGMPTKQLIIRRLTCISPTSGAIAM  181
            INPDSCT  RIED YIVSGDDCVA+KSG D+YGI YGMPTKQLIIRRLTCISP S  IA+
Sbjct  242  INPDSCTNTRIEDCYIVSGDDCVAVKSGWDQYGIAYGMPTKQLIIRRLTCISPFSAVIAL  301

Query  182  GSEMSGGIEDVRASDITALDTESGVRIKTALGRGGYVKNIYVKGLRAHTMKLLFQMTGKY  361
            GSEMSGGI+DVRA DITA+D+ESGVRIKTA+GRGG+VK++YV+ +   TMK  F +TG Y
Sbjct  302  GSEMSGGIQDVRAEDITAIDSESGVRIKTAVGRGGFVKDVYVRRMTMKTMKWAFWITGSY  361

Query  362  GSHADKNFDPKAIPVVAGINFRDVVADNVTTAGTMEGIPGHPFTGICMANVTIGMAKNGK  541
            GSH D N+DP A+PV+  IN+RD+VA+NVT A  +EGI G PFTGIC++NVTI +  N  
Sbjct  362  GSHPDNNYDPHALPVIQNINYRDMVAENVTMAARLEGIAGDPFTGICISNVTIELT-NKP  420

Query  542  KQPPWVCANIQGVASGVVPPPCNLLHSQGPVKPGMCDLP  658
            K+  W C +I G++SGV P PC LL    P K   C+ P
Sbjct  421  KKLQWNCTDITGISSGVTPKPCELLPDHEPAKTTECNFP  459



>ref|XP_010255224.1| PREDICTED: probable polygalacturonase isoform X2 [Nelumbo nucifera]
Length=489

 Score =   302 bits (773),  Expect = 5e-96, Method: Compositional matrix adjust.
 Identities = 144/222 (65%), Positives = 171/222 (77%), Gaps = 1/222 (0%)
 Frame = +2

Query  2    INPDSCTKVRIEDNYIVSGDDCVAIKSGIDEYGIKYGMPTKQLIIRRLTCISPTSGAIAM  181
            INPDS T VRIED YIVSGDDCVA+KSG DEYGI +GMPTK L+IRRLTCISP S  IA+
Sbjct  251  INPDSSTNVRIEDCYIVSGDDCVAVKSGWDEYGIAFGMPTKGLVIRRLTCISPDSAVIAL  310

Query  182  GSEMSGGIEDVRASDITALDTESGVRIKTALGRGGYVKNIYVKGLRAHTMKLLFQMTGKY  361
            GSEMSGGIEDVRA DI A+++ESGVRIKTA+GRGGYVK++YV+G+   TMK  F MTG Y
Sbjct  311  GSEMSGGIEDVRAEDILAINSESGVRIKTAVGRGGYVKDVYVRGMTMKTMKWAFWMTGNY  370

Query  362  GSHADKNFDPKAIPVVAGINFRDVVADNVTTAGTMEGIPGHPFTGICMANVTIGMAKNGK  541
            GSH D  +DP A+PV+ GIN+RD+VA+NVT A  +EGI G  FTGIC++NVTIG+A   K
Sbjct  371  GSHPDNKYDPNALPVINGINYRDMVAENVTMAARLEGIAGDQFTGICISNVTIGLAHKAK  430

Query  542  KQPPWVCANIQGVASGVVPPPCNLLHSQGPVKPGMCDLPAKN  667
            K  PW C++I+G+ SGV P PC LL  Q P     C  P  +
Sbjct  431  K-VPWTCSDIEGITSGVTPAPCALLPDQAPQGLTSCAFPTDS  471



>ref|XP_010255223.1| PREDICTED: probable polygalacturonase isoform X1 [Nelumbo nucifera]
Length=508

 Score =   302 bits (773),  Expect = 9e-96, Method: Compositional matrix adjust.
 Identities = 144/222 (65%), Positives = 171/222 (77%), Gaps = 1/222 (0%)
 Frame = +2

Query  2    INPDSCTKVRIEDNYIVSGDDCVAIKSGIDEYGIKYGMPTKQLIIRRLTCISPTSGAIAM  181
            INPDS T VRIED YIVSGDDCVA+KSG DEYGI +GMPTK L+IRRLTCISP S  IA+
Sbjct  270  INPDSSTNVRIEDCYIVSGDDCVAVKSGWDEYGIAFGMPTKGLVIRRLTCISPDSAVIAL  329

Query  182  GSEMSGGIEDVRASDITALDTESGVRIKTALGRGGYVKNIYVKGLRAHTMKLLFQMTGKY  361
            GSEMSGGIEDVRA DI A+++ESGVRIKTA+GRGGYVK++YV+G+   TMK  F MTG Y
Sbjct  330  GSEMSGGIEDVRAEDILAINSESGVRIKTAVGRGGYVKDVYVRGMTMKTMKWAFWMTGNY  389

Query  362  GSHADKNFDPKAIPVVAGINFRDVVADNVTTAGTMEGIPGHPFTGICMANVTIGMAKNGK  541
            GSH D  +DP A+PV+ GIN+RD+VA+NVT A  +EGI G  FTGIC++NVTIG+A   K
Sbjct  390  GSHPDNKYDPNALPVINGINYRDMVAENVTMAARLEGIAGDQFTGICISNVTIGLAHKAK  449

Query  542  KQPPWVCANIQGVASGVVPPPCNLLHSQGPVKPGMCDLPAKN  667
            K  PW C++I+G+ SGV P PC LL  Q P     C  P  +
Sbjct  450  KV-PWTCSDIEGITSGVTPAPCALLPDQAPQGLTSCAFPTDS  490



>ref|XP_006343936.1| PREDICTED: probable polygalacturonase-like [Solanum tuberosum]
Length=483

 Score =   300 bits (769),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 143/222 (64%), Positives = 172/222 (77%), Gaps = 1/222 (0%)
 Frame = +2

Query  2    INPDSCTKVRIEDNYIVSGDDCVAIKSGIDEYGIKYGMPTKQLIIRRLTCISPTSGAIAM  181
            INPDSC   RIED YIVSGDDC+A+KSG DEYGI +GMPTKQL IRR+TCISPTS  IA+
Sbjct  244  INPDSCINTRIEDCYIVSGDDCIAVKSGWDEYGIAFGMPTKQLAIRRITCISPTSATIAL  303

Query  182  GSEMSGGIEDVRASDITALDTESGVRIKTALGRGGYVKNIYVKGLRAHTMKLLFQMTGKY  361
            GSEMSGGI+DVRA DI A++TES VRIKTA+GRGGYVK+IYV+G+   TMK +F MTG Y
Sbjct  304  GSEMSGGIQDVRAEDIVAINTESAVRIKTAVGRGGYVKDIYVRGVTMKTMKYVFWMTGDY  363

Query  362  GSHADKNFDPKAIPVVAGINFRDVVADNVTTAGTMEGIPGHPFTGICMANVTIGMAKNGK  541
            GSH D N+DP A+PV+  IN+RD+VA+NVT A  + GI G PFTGIC++NVTI MA   K
Sbjct  364  GSHPDNNYDPNALPVIENINYRDMVAENVTIAAKLAGISGDPFTGICISNVTIEMAPKAK  423

Query  542  KQPPWVCANIQGVASGVVPPPCNLLHSQGPVKPGMCDLPAKN  667
            K   W C +I G++SGVVP PC+LL  QG      C+ P ++
Sbjct  424  KL-FWNCTDISGISSGVVPQPCDLLPDQGTEYASPCNFPTES  464



>gb|KDO76318.1| hypothetical protein CISIN_1g011659mg [Citrus sinensis]
Length=480

 Score =   300 bits (768),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 141/219 (64%), Positives = 170/219 (78%), Gaps = 1/219 (0%)
 Frame = +2

Query  2    INPDSCTKVRIEDNYIVSGDDCVAIKSGIDEYGIKYGMPTKQLIIRRLTCISPTSGAIAM  181
            INPDSCT  RIED YIVSGDDCVA+KSG D+YGI YGMPTKQLIIRRLTCISP S  IA+
Sbjct  242  INPDSCTNTRIEDCYIVSGDDCVAVKSGWDQYGIAYGMPTKQLIIRRLTCISPFSAVIAL  301

Query  182  GSEMSGGIEDVRASDITALDTESGVRIKTALGRGGYVKNIYVKGLRAHTMKLLFQMTGKY  361
            GSEMSGGI+DVRA DITA+D+ESGVRIKTA+GRGG+VK++YV+ +   TMK  F +TG Y
Sbjct  302  GSEMSGGIQDVRAEDITAIDSESGVRIKTAVGRGGFVKDVYVRRMTMKTMKWAFWITGSY  361

Query  362  GSHADKNFDPKAIPVVAGINFRDVVADNVTTAGTMEGIPGHPFTGICMANVTIGMAKNGK  541
            GSH D N+DP A+PV+  IN+RD+VA+NVT A  +EGI G PFTGIC++NVTI +  N  
Sbjct  362  GSHPDNNYDPHALPVIQNINYRDMVAENVTMAARLEGIAGDPFTGICISNVTIELT-NKP  420

Query  542  KQPPWVCANIQGVASGVVPPPCNLLHSQGPVKPGMCDLP  658
            K+  W C +I G++SGV P PC LL    P +   C+ P
Sbjct  421  KKLQWNCTDITGISSGVTPKPCELLPDHEPAQTTECNFP  459



>gb|EYU23462.1| hypothetical protein MIMGU_mgv1a006147mg [Erythranthe guttata]
Length=455

 Score =   298 bits (762),  Expect = 9e-95, Method: Compositional matrix adjust.
 Identities = 141/222 (64%), Positives = 175/222 (79%), Gaps = 5/222 (2%)
 Frame = +2

Query  2    INPDSCTKVRIEDNYIVSGDDCVAIKSGIDEYGIKYGMPTKQLIIRRLTCISPTSGAIAM  181
            INPDSCT  RIED YIVSGDDC+A+KSG D+YGI + MPTK+L+IRRLTCISP S  IA+
Sbjct  209  INPDSCTNTRIEDCYIVSGDDCIAVKSGWDQYGISFAMPTKRLVIRRLTCISPFSAVIAL  268

Query  182  GSEMSGGIEDVRASDITALDTESGVRIKTALGRGGYVKNIYVKGLRAHTMKLLFQMTGKY  361
            GSEMSGGIEDVRA +I A+D+ESG+RIKTA+GRGGYVK+IYV+G+   TMK  F MTG Y
Sbjct  269  GSEMSGGIEDVRAEEILAIDSESGIRIKTAVGRGGYVKDIYVRGMTMKTMKWAFWMTGNY  328

Query  362  GSHADKNFDPKAIPVVAGINFRDVVADNVTTAGTMEGIPGHPFTGICMANVTIGMAKNGK  541
            GSH D N+DP A+P+++ IN+RD+VA+NVT A  +EGI G PFTGIC++NVTI +AK  K
Sbjct  329  GSHPDNNYDPNALPLISNINYRDMVAENVTMAAKLEGISGDPFTGICISNVTIELAKKPK  388

Query  542  KQPPWVCANIQGVASGVVPPPCNLLHSQGPVKPGMCDLPAKN  667
            K   W C +++GV+SGVVP PC    SQ P     C+ PA++
Sbjct  389  KV-IWNCTDVEGVSSGVVPLPC----SQLPEVSAECNFPAES  425



>ref|XP_006476506.1| PREDICTED: probable polygalacturonase-like [Citrus sinensis]
Length=480

 Score =   298 bits (764),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 141/219 (64%), Positives = 169/219 (77%), Gaps = 1/219 (0%)
 Frame = +2

Query  2    INPDSCTKVRIEDNYIVSGDDCVAIKSGIDEYGIKYGMPTKQLIIRRLTCISPTSGAIAM  181
            INPDSCT  RIED YIVSGDDCVA+KSG D+YGI YGMPTKQLIIRRLTCISP S  IA+
Sbjct  242  INPDSCTNTRIEDCYIVSGDDCVAVKSGWDQYGIAYGMPTKQLIIRRLTCISPFSAVIAL  301

Query  182  GSEMSGGIEDVRASDITALDTESGVRIKTALGRGGYVKNIYVKGLRAHTMKLLFQMTGKY  361
            GSEMSGGI+DVRA DITA+D+ESGVRIKTA+GRGG+VK+IYV+ +   TMK  F +TG Y
Sbjct  302  GSEMSGGIQDVRAEDITAIDSESGVRIKTAVGRGGFVKDIYVRRMTMKTMKWAFWITGSY  361

Query  362  GSHADKNFDPKAIPVVAGINFRDVVADNVTTAGTMEGIPGHPFTGICMANVTIGMAKNGK  541
            GSH D N+DP A+P +  IN+RD+VA+NVT A  +EGI G PFTGIC++NVTI +  N  
Sbjct  362  GSHPDNNYDPHALPEIQNINYRDMVAENVTMAARLEGIAGDPFTGICISNVTIELT-NKP  420

Query  542  KQPPWVCANIQGVASGVVPPPCNLLHSQGPVKPGMCDLP  658
            K+  W C +I G++SGV P PC LL    P +   C+ P
Sbjct  421  KKLQWNCTDITGISSGVTPKPCELLPDHEPAQTTECNFP  459



>ref|XP_010676424.1| PREDICTED: probable polygalacturonase [Beta vulgaris subsp. vulgaris]
Length=485

 Score =   298 bits (764),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 141/219 (64%), Positives = 166/219 (76%), Gaps = 1/219 (0%)
 Frame = +2

Query  2    INPDSCTKVRIEDNYIVSGDDCVAIKSGIDEYGIKYGMPTKQLIIRRLTCISPTSGAIAM  181
            INPDSCT  RIED YIVSGDDCVA+KSG DEYGI YGMPT+QL+IRRLTCISPTS  IA+
Sbjct  247  INPDSCTNTRIEDCYIVSGDDCVAVKSGWDEYGISYGMPTQQLVIRRLTCISPTSAVIAL  306

Query  182  GSEMSGGIEDVRASDITALDTESGVRIKTALGRGGYVKNIYVKGLRAHTMKLLFQMTGKY  361
            GSEMSGGI+DVRA DI A+++ESGVRIKT +GRGG+VK+IYVKG   HTMK  F MTG Y
Sbjct  307  GSEMSGGIQDVRAEDILAINSESGVRIKTGVGRGGFVKDIYVKGFTMHTMKWAFWMTGNY  366

Query  362  GSHADKNFDPKAIPVVAGINFRDVVADNVTTAGTMEGIPGHPFTGICMANVTIGMAKNGK  541
            GSH D  +DPKAIP +  IN+RD+VAD+V  A  +EGI G PFT IC++NVTI +A   K
Sbjct  367  GSHPDDKYDPKAIPTIQNINYRDMVADDVKMAARLEGISGDPFTEICISNVTISLAAKPK  426

Query  542  KQPPWVCANIQGVASGVVPPPCNLLHSQGPVKPGMCDLP  658
            K   W C ++ G++S V P PC+ L  QGP     C  P
Sbjct  427  K-VQWACTDVAGISSDVTPKPCDSLADQGPDHKIQCQFP  464



>ref|XP_004245570.1| PREDICTED: probable polygalacturonase [Solanum lycopersicum]
Length=483

 Score =   298 bits (763),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 141/222 (64%), Positives = 172/222 (77%), Gaps = 1/222 (0%)
 Frame = +2

Query  2    INPDSCTKVRIEDNYIVSGDDCVAIKSGIDEYGIKYGMPTKQLIIRRLTCISPTSGAIAM  181
            INPDSC   RIED YI+SGDDC+A+KSG DEYG+ +GMPTKQL IRR+TCISPTS  IA+
Sbjct  244  INPDSCINTRIEDCYIISGDDCIAVKSGWDEYGVAFGMPTKQLAIRRITCISPTSATIAL  303

Query  182  GSEMSGGIEDVRASDITALDTESGVRIKTALGRGGYVKNIYVKGLRAHTMKLLFQMTGKY  361
            GSEMSGGI+DVRA DI A++TES VRIKTA+GRGGYVK+IYV+G+   TMK +F MTG Y
Sbjct  304  GSEMSGGIQDVRAEDIVAINTESAVRIKTAVGRGGYVKDIYVRGVTMKTMKYVFWMTGDY  363

Query  362  GSHADKNFDPKAIPVVAGINFRDVVADNVTTAGTMEGIPGHPFTGICMANVTIGMAKNGK  541
            GSH D N+DP A+PV+  IN+RD+VA+NVT A  + GI G PFTGIC++NVTI MA   K
Sbjct  364  GSHPDDNYDPNALPVIENINYRDMVAENVTIAAKLAGISGDPFTGICISNVTIEMAPKAK  423

Query  542  KQPPWVCANIQGVASGVVPPPCNLLHSQGPVKPGMCDLPAKN  667
            K   W C +I G++SGVVP PC+LL  QG      C+ P ++
Sbjct  424  KL-FWNCTDISGISSGVVPQPCDLLPDQGMEYASPCNFPTES  464



>gb|AES62452.2| pectin lyase superfamily protein [Medicago truncatula]
Length=473

 Score =   293 bits (749),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 135/208 (65%), Positives = 167/208 (80%), Gaps = 1/208 (0%)
 Frame = +2

Query  2    INPDSCTKVRIEDNYIVSGDDCVAIKSGIDEYGIKYGMPTKQLIIRRLTCISPTSGAIAM  181
            INPDSCT VRIEDN+IVSGDDC+AIKSG DEYGIK GMP++Q+IIRRLTCISP S  +A+
Sbjct  239  INPDSCTNVRIEDNFIVSGDDCIAIKSGWDEYGIKVGMPSQQIIIRRLTCISPDSAMVAL  298

Query  182  GSEMSGGIEDVRASDITALDTESGVRIKTALGRGGYVKNIYVKGLRAHTMKLLFQMTGKY  361
            GSEMSGGI+DVR  D+TA++TES +RIK+A+GRG +VK+I+VKG+  +TMK +F MTG Y
Sbjct  299  GSEMSGGIQDVRIEDVTAINTESAIRIKSAVGRGAFVKDIFVKGMDLNTMKYVFWMTGSY  358

Query  362  GSHADKNFDPKAIPVVAGINFRDVVADNVTTAGTMEGIPGHPFTGICMANVTIGMAKNGK  541
            G H D  FDP A+P ++GIN+RDV A NVT AG +EGI   PFTGIC++NVTI M+ + K
Sbjct  359  GDHPDNGFDPNALPKISGINYRDVTAKNVTIAGKLEGISNDPFTGICVSNVTIEMSAH-K  417

Query  542  KQPPWVCANIQGVASGVVPPPCNLLHSQ  625
            K+ PW C +I GV S VVP PC LL  +
Sbjct  418  KKLPWNCTDISGVTSNVVPKPCELLQEK  445



>ref|XP_003592201.1| Polygalacturonase-like protein [Medicago truncatula]
Length=478

 Score =   293 bits (749),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 135/208 (65%), Positives = 167/208 (80%), Gaps = 1/208 (0%)
 Frame = +2

Query  2    INPDSCTKVRIEDNYIVSGDDCVAIKSGIDEYGIKYGMPTKQLIIRRLTCISPTSGAIAM  181
            INPDSCT VRIEDN+IVSGDDC+AIKSG DEYGIK GMP++Q+IIRRLTCISP S  +A+
Sbjct  244  INPDSCTNVRIEDNFIVSGDDCIAIKSGWDEYGIKVGMPSQQIIIRRLTCISPDSAMVAL  303

Query  182  GSEMSGGIEDVRASDITALDTESGVRIKTALGRGGYVKNIYVKGLRAHTMKLLFQMTGKY  361
            GSEMSGGI+DVR  D+TA++TES +RIK+A+GRG +VK+I+VKG+  +TMK +F MTG Y
Sbjct  304  GSEMSGGIQDVRIEDVTAINTESAIRIKSAVGRGAFVKDIFVKGMDLNTMKYVFWMTGSY  363

Query  362  GSHADKNFDPKAIPVVAGINFRDVVADNVTTAGTMEGIPGHPFTGICMANVTIGMAKNGK  541
            G H D  FDP A+P ++GIN+RDV A NVT AG +EGI   PFTGIC++NVTI M+ + K
Sbjct  364  GDHPDNGFDPNALPKISGINYRDVTAKNVTIAGKLEGISNDPFTGICVSNVTIEMSAH-K  422

Query  542  KQPPWVCANIQGVASGVVPPPCNLLHSQ  625
            K+ PW C +I GV S VVP PC LL  +
Sbjct  423  KKLPWNCTDISGVTSNVVPKPCELLQEK  450



>ref|XP_010436419.1| PREDICTED: probable polygalacturonase, partial [Camelina sativa]
Length=358

 Score =   288 bits (738),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 138/219 (63%), Positives = 169/219 (77%), Gaps = 1/219 (0%)
 Frame = +2

Query  2    INPDSCTKVRIEDNYIVSGDDCVAIKSGIDEYGIKYGMPTKQLIIRRLTCISPTSGAIAM  181
            INPDSCT  RIED YIVSGDDC+A+KSG D+YGI YGMPTKQL+IRRLTCISP S  IA+
Sbjct  120  INPDSCTNTRIEDCYIVSGDDCIAVKSGWDQYGIAYGMPTKQLLIRRLTCISPDSAVIAL  179

Query  182  GSEMSGGIEDVRASDITALDTESGVRIKTALGRGGYVKNIYVKGLRAHTMKLLFQMTGKY  361
            GSEMSGGIEDVRA DI A+D+ESG+RIKTA+GRGGYVK++YV+G+   TMK +F MTG Y
Sbjct  180  GSEMSGGIEDVRAEDIVAIDSESGIRIKTAIGRGGYVKDVYVRGMTMKTMKYVFWMTGSY  239

Query  362  GSHADKNFDPKAIPVVAGINFRDVVADNVTTAGTMEGIPGHPFTGICMANVTIGMAKNGK  541
            GSH D+++DPKA+PV+  IN++D+VA+NVT    + GI G  FTGIC++NVTI ++K  K
Sbjct  240  GSHPDEHYDPKALPVIQNINYQDMVAENVTMPAQLAGISGDQFTGICISNVTITLSKKPK  299

Query  542  KQPPWVCANIQGVASGVVPPPCNLLHSQGPVKPGMCDLP  658
            K   W C +I G  SGV P PC LL  + P     C+ P
Sbjct  300  KV-LWNCTDISGSTSGVTPAPCQLLPEKQPGTIVPCNFP  337



>gb|EPS71449.1| hypothetical protein M569_03308, partial [Genlisea aurea]
Length=445

 Score =   290 bits (742),  Expect = 6e-92, Method: Compositional matrix adjust.
 Identities = 137/219 (63%), Positives = 168/219 (77%), Gaps = 2/219 (1%)
 Frame = +2

Query  2    INPDSCTKVRIEDNYIVSGDDCVAIKSGIDEYGIKYGMPTKQLIIRRLTCISPTSGAIAM  181
            INPDSCT  RIED YIVSGDDCVA+KSG DEYGI  G+PTK L+IRRLTCISPTS  IA+
Sbjct  219  INPDSCTDTRIEDCYIVSGDDCVAVKSGWDEYGIAVGLPTKGLLIRRLTCISPTSAVIAL  278

Query  182  GSEMSGGIEDVRASDITALDTESGVRIKTALGRGGYVKNIYVKGLRAHTMKLLFQMTGKY  361
            GSEMSGGIEDVRA DITA+++ESG+RIKT +GRGGYVK+I+V+ +   TMK +F MTG Y
Sbjct  279  GSEMSGGIEDVRAEDITAINSESGIRIKTGVGRGGYVKDIFVRRMTMRTMKWVFWMTGNY  338

Query  362  GSHADKNFDPKAIPVVAGINFRDVVADNVTTAGTMEGIPGHPFTGICMANVTIGMAKNGK  541
            GSH D  +DP A+P++  IN+RD+VA+NVT AG + GI G  F  IC+ANVTI +AKN K
Sbjct  339  GSHPDDKYDPNALPLIKNINYRDMVAENVTMAGWLTGIAGDTFRDICIANVTIELAKNSK  398

Query  542  KQPPWVCANIQGVASGVVPPPCNLLHSQGPVKPGMCDLP  658
                W C +++G++ GVVP PC+ L  + P   G CD P
Sbjct  399  LA--WNCTDVEGISMGVVPQPCDALPEKEPEDDGSCDFP  435



>emb|CDY70893.1| BnaCnng70190D, partial [Brassica napus]
Length=358

 Score =   287 bits (734),  Expect = 7e-92, Method: Compositional matrix adjust.
 Identities = 136/219 (62%), Positives = 169/219 (77%), Gaps = 1/219 (0%)
 Frame = +2

Query  2    INPDSCTKVRIEDNYIVSGDDCVAIKSGIDEYGIKYGMPTKQLIIRRLTCISPTSGAIAM  181
            INPDSCT  RIED YIVSGDDC+A+KSG D+YGI YGMPTKQL+IRRLTCISP S  IA+
Sbjct  120  INPDSCTNTRIEDCYIVSGDDCIAVKSGWDQYGINYGMPTKQLLIRRLTCISPDSAVIAL  179

Query  182  GSEMSGGIEDVRASDITALDTESGVRIKTALGRGGYVKNIYVKGLRAHTMKLLFQMTGKY  361
            GSEMSGGIEDVRA DI A+++ESG+RIKTA+GRGGYVK++YV+G+   TMK +F MTG Y
Sbjct  180  GSEMSGGIEDVRAEDIVAINSESGIRIKTAVGRGGYVKDVYVRGMTMKTMKYVFWMTGSY  239

Query  362  GSHADKNFDPKAIPVVAGINFRDVVADNVTTAGTMEGIPGHPFTGICMANVTIGMAKNGK  541
            GSH D+++DPKA+PV+  IN++D+VA+NVT    + GI G  FTGIC++NVTI ++K  K
Sbjct  240  GSHPDEHYDPKALPVIQNINYQDMVAENVTMPAQLAGITGDEFTGICISNVTITLSKKPK  299

Query  542  KQPPWVCANIQGVASGVVPPPCNLLHSQGPVKPGMCDLP  658
            K   W C ++ G  SGV P PC LL  + P     C+ P
Sbjct  300  KV-LWNCTDVSGYTSGVTPEPCQLLPEKQPGTVVPCNFP  337



>ref|XP_010448699.1| PREDICTED: probable polygalacturonase [Camelina sativa]
Length=490

 Score =   291 bits (744),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 138/219 (63%), Positives = 169/219 (77%), Gaps = 1/219 (0%)
 Frame = +2

Query  2    INPDSCTKVRIEDNYIVSGDDCVAIKSGIDEYGIKYGMPTKQLIIRRLTCISPTSGAIAM  181
            INPDSCT  RIED YIVSGDDC+A+KSG D+YGI YGMPTKQL+IRRLTCISP S  IA+
Sbjct  259  INPDSCTNTRIEDCYIVSGDDCIAVKSGWDQYGIAYGMPTKQLLIRRLTCISPDSAVIAL  318

Query  182  GSEMSGGIEDVRASDITALDTESGVRIKTALGRGGYVKNIYVKGLRAHTMKLLFQMTGKY  361
            GSEMSGGIEDVRA DI A+D+ESG+RIKTA+GRGGYVK++YV+G+   TMK +F MTG Y
Sbjct  319  GSEMSGGIEDVRAEDIVAIDSESGIRIKTAIGRGGYVKDVYVRGMTMKTMKYVFWMTGSY  378

Query  362  GSHADKNFDPKAIPVVAGINFRDVVADNVTTAGTMEGIPGHPFTGICMANVTIGMAKNGK  541
            GSH D+++DPKA+PV+  IN++D+VA+NVT    + GI G  FTGIC++NVTI ++K  K
Sbjct  379  GSHPDEHYDPKALPVIQNINYQDMVAENVTMPAQLAGISGDQFTGICISNVTITLSKKPK  438

Query  542  KQPPWVCANIQGVASGVVPPPCNLLHSQGPVKPGMCDLP  658
            K   W C +I G  SGV P PC LL  + P     C+ P
Sbjct  439  KV-LWNCTDISGYTSGVTPAPCQLLPEKQPGTIVPCNFP  476



>emb|CDY69255.1| BnaAnng29830D, partial [Brassica napus]
Length=376

 Score =   287 bits (735),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 136/219 (62%), Positives = 169/219 (77%), Gaps = 1/219 (0%)
 Frame = +2

Query  2    INPDSCTKVRIEDNYIVSGDDCVAIKSGIDEYGIKYGMPTKQLIIRRLTCISPTSGAIAM  181
            INPDSCT  RIED YIVSGDDC+A+KSG D+YGI YGMPTKQL+IRRLTCISP S  IA+
Sbjct  138  INPDSCTNTRIEDCYIVSGDDCIAVKSGWDQYGINYGMPTKQLLIRRLTCISPDSAVIAL  197

Query  182  GSEMSGGIEDVRASDITALDTESGVRIKTALGRGGYVKNIYVKGLRAHTMKLLFQMTGKY  361
            GSEMSGGIEDVRA DI A+++ESG+RIKTA+GRGGYVK++YV+G+   TMK +F MTG Y
Sbjct  198  GSEMSGGIEDVRAEDIVAINSESGIRIKTAVGRGGYVKDVYVRGMTMKTMKYVFWMTGSY  257

Query  362  GSHADKNFDPKAIPVVAGINFRDVVADNVTTAGTMEGIPGHPFTGICMANVTIGMAKNGK  541
            GSH D+++DPKA+PV+  IN++D+VA+NVT    + GI G  FTGIC++NVTI ++K  K
Sbjct  258  GSHPDEHYDPKALPVIQNINYQDMVAENVTMPAQLAGITGDEFTGICISNVTITLSKKPK  317

Query  542  KQPPWVCANIQGVASGVVPPPCNLLHSQGPVKPGMCDLP  658
            K   W C ++ G  SGV P PC LL  + P     C+ P
Sbjct  318  KV-LWNCTDVSGYTSGVTPEPCQLLPEKQPGTVVPCNFP  355



>ref|XP_010941157.1| PREDICTED: probable polygalacturonase [Elaeis guineensis]
Length=486

 Score =   290 bits (743),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 138/209 (66%), Positives = 167/209 (80%), Gaps = 1/209 (0%)
 Frame = +2

Query  2    INPDSCTKVRIEDNYIVSGDDCVAIKSGIDEYGIKYGMPTKQLIIRRLTCISPTSGAIAM  181
            INPDSCT VRIED YIVSGDDCVAIKSG DEYGI +GMP++ +IIRRLTCISPTS  IA+
Sbjct  252  INPDSCTHVRIEDCYIVSGDDCVAIKSGWDEYGIAFGMPSQHIIIRRLTCISPTSAVIAL  311

Query  182  GSEMSGGIEDVRASDITALDTESGVRIKTALGRGGYVKNIYVKGLRAHTMKLLFQMTGKY  361
            GSEMSGGI+DVRA DITA+D+ESGVRIKTA+GRG YVK+I+V+G+  +TMK +F MTG Y
Sbjct  312  GSEMSGGIQDVRAEDITAIDSESGVRIKTAIGRGAYVKDIFVRGMNLNTMKWVFWMTGAY  371

Query  362  GSHADKNFDPKAIPVVAGINFRDVVADNVTTAGTMEGIPGHPFTGICMANVTIGMAKNGK  541
             SH D  +DP AIPVV GI++ DVVA +VT A  +EGI   PFTGIC++NVT+ +A   K
Sbjct  372  KSHPDNKYDPNAIPVVKGISYSDVVATDVTQAARLEGISNAPFTGICISNVTVHLAAKAK  431

Query  542  KQPPWVCANIQGVASGVVPPPCNLLHSQG  628
            KQ  W C +++GV+SGV P PC  L  +G
Sbjct  432  KQ-SWTCTDVEGVSSGVSPTPCASLPDRG  459



>ref|XP_006283603.1| hypothetical protein CARUB_v10004660mg [Capsella rubella]
 gb|ACC91278.1| glycoside hydrolase family 28 protein [Capsella rubella]
 gb|EOA16501.1| hypothetical protein CARUB_v10004660mg [Capsella rubella]
Length=494

 Score =   290 bits (743),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 137/219 (63%), Positives = 169/219 (77%), Gaps = 1/219 (0%)
 Frame = +2

Query  2    INPDSCTKVRIEDNYIVSGDDCVAIKSGIDEYGIKYGMPTKQLIIRRLTCISPTSGAIAM  181
            INPDSCT  RIED YIVSGDDC+A+KSG D+YGI YGMPTKQL+IRRLTCISP S  IA+
Sbjct  256  INPDSCTNTRIEDCYIVSGDDCIAVKSGWDQYGIAYGMPTKQLLIRRLTCISPDSAVIAL  315

Query  182  GSEMSGGIEDVRASDITALDTESGVRIKTALGRGGYVKNIYVKGLRAHTMKLLFQMTGKY  361
            GSEMSGGIEDVRA DI A+D+ESG+RIKTA+GRGGYVK++YV+G+   TMK +F MTG Y
Sbjct  316  GSEMSGGIEDVRAEDIVAIDSESGIRIKTAIGRGGYVKDVYVRGMTMKTMKYVFWMTGSY  375

Query  362  GSHADKNFDPKAIPVVAGINFRDVVADNVTTAGTMEGIPGHPFTGICMANVTIGMAKNGK  541
            GSH D+++DPKA+PV+  IN++D+VA+NVT    + GI G  FTGIC++NVTI ++K  K
Sbjct  376  GSHPDEHYDPKALPVIQNINYQDMVAENVTMPAQLAGISGDQFTGICISNVTITLSKKPK  435

Query  542  KQPPWVCANIQGVASGVVPPPCNLLHSQGPVKPGMCDLP  658
            K   W C ++ G  SGV P PC LL  + P     C+ P
Sbjct  436  KV-LWNCTDVSGYTSGVTPAPCQLLPEKQPGTVVPCNFP  473



>ref|XP_007038809.1| Pectin lyase-like superfamily protein isoform 2 [Theobroma cacao]
 gb|EOY23310.1| Pectin lyase-like superfamily protein isoform 2 [Theobroma cacao]
Length=473

 Score =   290 bits (741),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 138/219 (63%), Positives = 165/219 (75%), Gaps = 5/219 (2%)
 Frame = +2

Query  2    INPDSCTKVRIEDNYIVSGDDCVAIKSGIDEYGIKYGMPTKQLIIRRLTCISPTSGAIAM  181
            INPDSCT  RIED+++VSGDDC+A+KSG D+YGIK+ MPTK L+IRR TCISP S  IA+
Sbjct  240  INPDSCTNTRIEDSFVVSGDDCIAVKSGWDQYGIKFNMPTKHLVIRRFTCISPDSATIAL  299

Query  182  GSEMSGGIEDVRASDITALDTESGVRIKTALGRGGYVKNIYVKGLRAHTMKLLFQMTGKY  361
            GSEMSGGIEDVRA DITA++T+SGVRIKTA+GRG YVK+IY + +  +TMK +F MTG Y
Sbjct  300  GSEMSGGIEDVRAEDITAINTQSGVRIKTAVGRGAYVKDIYARRMTLNTMKYVFWMTGSY  359

Query  362  GSHADKNFDPKAIPVVAGINFRDVVADNVTTAGTMEGIPGHPFTGICMANVTIGMAKNGK  541
            GSH D  FDP A PV+ GIN+RDVVADNVT +  +EGI   PFT IC++NV I +  N  
Sbjct  360  GSHPDPGFDPNAFPVIKGINYRDVVADNVTYSARLEGIEKDPFTDICISNVNIKLT-NKP  418

Query  542  KQPPWVCANIQGVASGVVPPPCNLLHSQGPVKPGMCDLP  658
            K+  W C N+QGV S V P PCNLL    PVK   C  P
Sbjct  419  KELQWNCTNVQGVTSRVTPEPCNLL----PVKEIDCPFP  453



>ref|XP_007038808.1| Pectin lyase-like superfamily protein isoform 1 [Theobroma cacao]
 gb|EOY23309.1| Pectin lyase-like superfamily protein isoform 1 [Theobroma cacao]
Length=469

 Score =   289 bits (740),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 138/219 (63%), Positives = 165/219 (75%), Gaps = 5/219 (2%)
 Frame = +2

Query  2    INPDSCTKVRIEDNYIVSGDDCVAIKSGIDEYGIKYGMPTKQLIIRRLTCISPTSGAIAM  181
            INPDSCT  RIED+++VSGDDC+A+KSG D+YGIK+ MPTK L+IRR TCISP S  IA+
Sbjct  236  INPDSCTNTRIEDSFVVSGDDCIAVKSGWDQYGIKFNMPTKHLVIRRFTCISPDSATIAL  295

Query  182  GSEMSGGIEDVRASDITALDTESGVRIKTALGRGGYVKNIYVKGLRAHTMKLLFQMTGKY  361
            GSEMSGGIEDVRA DITA++T+SGVRIKTA+GRG YVK+IY + +  +TMK +F MTG Y
Sbjct  296  GSEMSGGIEDVRAEDITAINTQSGVRIKTAVGRGAYVKDIYARRMTLNTMKYVFWMTGSY  355

Query  362  GSHADKNFDPKAIPVVAGINFRDVVADNVTTAGTMEGIPGHPFTGICMANVTIGMAKNGK  541
            GSH D  FDP A PV+ GIN+RDVVADNVT +  +EGI   PFT IC++NV I +  N  
Sbjct  356  GSHPDPGFDPNAFPVIKGINYRDVVADNVTYSARLEGIEKDPFTDICISNVNIKLT-NKP  414

Query  542  KQPPWVCANIQGVASGVVPPPCNLLHSQGPVKPGMCDLP  658
            K+  W C N+QGV S V P PCNLL    PVK   C  P
Sbjct  415  KELQWNCTNVQGVTSRVTPEPCNLL----PVKEIDCPFP  449



>ref|XP_009363435.1| PREDICTED: probable polygalacturonase [Pyrus x bretschneideri]
Length=473

 Score =   289 bits (740),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 138/222 (62%), Positives = 167/222 (75%), Gaps = 1/222 (0%)
 Frame = +2

Query  2    INPDSCTKVRIEDNYIVSGDDCVAIKSGIDEYGIKYGMPTKQLIIRRLTCISPTSGAIAM  181
            INPDSCT  RIED YIVSGDDC+A+KSG DEYGI + MPTKQL+IRRLTCISP S  IA+
Sbjct  234  INPDSCTNTRIEDCYIVSGDDCIAVKSGWDEYGIAFRMPTKQLVIRRLTCISPFSAVIAL  293

Query  182  GSEMSGGIEDVRASDITALDTESGVRIKTALGRGGYVKNIYVKGLRAHTMKLLFQMTGKY  361
            GSEMSGGIE VRA  I A+++ESGVRIKTA+GRGG+VK+IYV+G+   TMK  F MTG Y
Sbjct  294  GSEMSGGIEVVRAEYIVAINSESGVRIKTAVGRGGFVKDIYVRGMTMKTMKWAFWMTGNY  353

Query  362  GSHADKNFDPKAIPVVAGINFRDVVADNVTTAGTMEGIPGHPFTGICMANVTIGMAKNGK  541
            GSHAD  +DP A+PV+  IN  ++ A+NVT A  +EGIPG PFTGIC +NVTI +AKN K
Sbjct  354  GSHADNGYDPHALPVIQNINHHEMAAENVTMAAELEGIPGDPFTGICKSNVTITLAKNVK  413

Query  542  KQPPWVCANIQGVASGVVPPPCNLLHSQGPVKPGMCDLPAKN  667
            K  PW C ++  ++S VVP PC  L  Q P     C+ P ++
Sbjct  414  KL-PWNCTDVARISSRVVPQPCEALADQVPGSVAACNFPEES  454



>ref|XP_010439166.1| PREDICTED: probable polygalacturonase [Camelina sativa]
Length=497

 Score =   290 bits (742),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 137/219 (63%), Positives = 169/219 (77%), Gaps = 1/219 (0%)
 Frame = +2

Query  2    INPDSCTKVRIEDNYIVSGDDCVAIKSGIDEYGIKYGMPTKQLIIRRLTCISPTSGAIAM  181
            INPDSCT  RIED YIVSGDDC+A+KSG D+YGI YGMPTKQL+IRRLTCISP S  IA+
Sbjct  259  INPDSCTNTRIEDCYIVSGDDCIAVKSGWDQYGIAYGMPTKQLLIRRLTCISPDSAVIAL  318

Query  182  GSEMSGGIEDVRASDITALDTESGVRIKTALGRGGYVKNIYVKGLRAHTMKLLFQMTGKY  361
            GSEMSGGIEDVRA DI A+D+ESG+RIKTA+GRGGYVK++YV+G+   TMK +F MTG Y
Sbjct  319  GSEMSGGIEDVRAEDIVAIDSESGIRIKTAIGRGGYVKDVYVRGMTMKTMKYVFWMTGSY  378

Query  362  GSHADKNFDPKAIPVVAGINFRDVVADNVTTAGTMEGIPGHPFTGICMANVTIGMAKNGK  541
            GSH D+++DPKA+PV+  IN++D+VA+NVT    + GI G  FTGIC++NVTI ++K  K
Sbjct  379  GSHPDEHYDPKALPVIQNINYQDMVAENVTMPAQLAGISGDQFTGICISNVTITLSKKPK  438

Query  542  KQPPWVCANIQGVASGVVPPPCNLLHSQGPVKPGMCDLP  658
            K   W C ++ G  SGV P PC LL  + P     C+ P
Sbjct  439  KV-LWNCTDVSGYTSGVTPAPCQLLPEKQPGTVVPCNFP  476



>ref|XP_010276903.1| PREDICTED: probable polygalacturonase isoform X3 [Nelumbo nucifera]
Length=434

 Score =   288 bits (736),  Expect = 4e-91, Method: Compositional matrix adjust.
 Identities = 140/221 (63%), Positives = 166/221 (75%), Gaps = 4/221 (2%)
 Frame = +2

Query  2    INPDSCTKVRIEDNYIVSGDDCVAIKSGIDEYGIKYGMPTKQLIIRRLTCISPTSGAIAM  181
            INPDS T V IED YIVSGDDC+A+KSG D+YGI +GMPTK L+IRRLTCISP S  IA+
Sbjct  194  INPDSSTNVLIEDCYIVSGDDCIAVKSGWDQYGIAFGMPTKGLMIRRLTCISPDSAVIAL  253

Query  182  GSEMSGGIEDVRASDITALDTESGVRIKTALGRGGYVKNIYVKGLRAHTMKLLFQMTGKY  361
            GSEMSGGIEDVRA DI A++TESGVRIKT++GRGGYVK+IYV+ +   TMK +F MTG Y
Sbjct  254  GSEMSGGIEDVRAEDILAINTESGVRIKTSVGRGGYVKDIYVRRMTMKTMKWVFWMTGNY  313

Query  362  GSHADKNFDPKAIPVVAGINFRDVVADNVTTAGTMEGIPGHPFTGICMANVTIGMAKNGK  541
            GSH D NFDP A+P + GIN+ D+VA+NVT A  +EGI G PFTGIC++NVTIG+A   K
Sbjct  314  GSHPDGNFDPNALPAIQGINYGDMVAENVTMAARLEGIAGDPFTGICISNVTIGLAATAK  373

Query  542  KQPPWVCANIQGVASGVVPPPCNLLHSQGPVKPGMCDLPAK  664
            K   W C NI+G+ S V P PC LL  Q       C  P +
Sbjct  374  KV-QWNCTNIEGITSDVTPQPCELLPDQALTN---CAFPTE  410



>ref|XP_006413548.1| hypothetical protein EUTSA_v10025011mg [Eutrema salsugineum]
 gb|ESQ55001.1| hypothetical protein EUTSA_v10025011mg [Eutrema salsugineum]
Length=493

 Score =   290 bits (741),  Expect = 4e-91, Method: Compositional matrix adjust.
 Identities = 136/219 (62%), Positives = 169/219 (77%), Gaps = 1/219 (0%)
 Frame = +2

Query  2    INPDSCTKVRIEDNYIVSGDDCVAIKSGIDEYGIKYGMPTKQLIIRRLTCISPTSGAIAM  181
            INPDSCT  RIED YIVSGDDC+A+KSG D+YGI YGMPTKQL+IRRLTCISP S  IA+
Sbjct  255  INPDSCTNTRIEDCYIVSGDDCIAVKSGWDQYGISYGMPTKQLLIRRLTCISPDSAVIAL  314

Query  182  GSEMSGGIEDVRASDITALDTESGVRIKTALGRGGYVKNIYVKGLRAHTMKLLFQMTGKY  361
            GSEMSGGIEDVRA DI A+++ESG+RIKTA+GRGGYVK++YV+G+   TMK +F MTG Y
Sbjct  315  GSEMSGGIEDVRAEDIVAINSESGIRIKTAIGRGGYVKDVYVRGMTMKTMKYVFWMTGSY  374

Query  362  GSHADKNFDPKAIPVVAGINFRDVVADNVTTAGTMEGIPGHPFTGICMANVTIGMAKNGK  541
            GSH D+++DPKA+PV+  IN++D+VA+NVT    + GI G  FTGIC++NVTI ++K  K
Sbjct  375  GSHPDEHYDPKALPVIQNINYQDMVAENVTMPAQLAGISGDQFTGICISNVTITLSKKPK  434

Query  542  KQPPWVCANIQGVASGVVPPPCNLLHSQGPVKPGMCDLP  658
            K   W C ++ G  SGV P PC LL  + P     C+ P
Sbjct  435  KV-LWNCTDVSGFTSGVTPEPCQLLPEKQPGTVVPCNFP  472



>ref|XP_002869777.1| glycoside hydrolase family 28 protein [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH46036.1| glycoside hydrolase family 28 protein [Arabidopsis lyrata subsp. 
lyrata]
Length=494

 Score =   289 bits (740),  Expect = 6e-91, Method: Compositional matrix adjust.
 Identities = 136/219 (62%), Positives = 170/219 (78%), Gaps = 1/219 (0%)
 Frame = +2

Query  2    INPDSCTKVRIEDNYIVSGDDCVAIKSGIDEYGIKYGMPTKQLIIRRLTCISPTSGAIAM  181
            INPDSCT  RIED YIVSGDDC+A+KSG D+YGI YGMPTKQL+IRRLTCISP S  IA+
Sbjct  256  INPDSCTNTRIEDCYIVSGDDCIAVKSGWDQYGINYGMPTKQLLIRRLTCISPDSAVIAL  315

Query  182  GSEMSGGIEDVRASDITALDTESGVRIKTALGRGGYVKNIYVKGLRAHTMKLLFQMTGKY  361
            GSEMSGGIEDVRA DI A+++ESG+RIKTA+GRGGYVK++YV+G+  +TMK +F MTG Y
Sbjct  316  GSEMSGGIEDVRAEDIVAINSESGIRIKTAIGRGGYVKDVYVRGMTMNTMKYVFWMTGSY  375

Query  362  GSHADKNFDPKAIPVVAGINFRDVVADNVTTAGTMEGIPGHPFTGICMANVTIGMAKNGK  541
            GSH D+++DPKA+PV+  IN++D+VA+NVT    + GI G  FTGIC++NVTI ++K  K
Sbjct  376  GSHPDEHYDPKALPVIQNINYQDMVAENVTMPAQLAGISGDQFTGICISNVTITLSKKPK  435

Query  542  KQPPWVCANIQGVASGVVPPPCNLLHSQGPVKPGMCDLP  658
            K   W C ++ G  SGV P PC LL  + P     C+ P
Sbjct  436  KV-LWNCTDVSGYTSGVTPQPCQLLPEKQPGTVVPCNFP  473



>ref|XP_006422033.1| hypothetical protein CICLE_v10004864mg [Citrus clementina]
 ref|XP_006490634.1| PREDICTED: probable polygalacturonase-like [Citrus sinensis]
 gb|ESR35273.1| hypothetical protein CICLE_v10004864mg [Citrus clementina]
 gb|KDO56791.1| hypothetical protein CISIN_1g011615mg [Citrus sinensis]
Length=481

 Score =   288 bits (738),  Expect = 6e-91, Method: Compositional matrix adjust.
 Identities = 139/210 (66%), Positives = 163/210 (78%), Gaps = 1/210 (0%)
 Frame = +2

Query  2    INPDSCTKVRIEDNYIVSGDDCVAIKSGIDEYGIKYGMPTKQLIIRRLTCISPTSGAIAM  181
            INPDSCT  RIEDNYIVSGDDCVA+KSG DEYGIK GMPT+ LIIRRL CISP S AIA+
Sbjct  246  INPDSCTNTRIEDNYIVSGDDCVAVKSGWDEYGIKVGMPTQHLIIRRLICISPDSAAIAL  305

Query  182  GSEMSGGIEDVRASDITALDTESGVRIKTALGRGGYVKNIYVKGLRAHTMKLLFQMTGKY  361
            GSEMSGGI+DVRA DITA++T+SGVRIKTA+GRG YVK IYV+ +   TMK +F MTG Y
Sbjct  306  GSEMSGGIKDVRAEDITAINTQSGVRIKTAVGRGAYVKEIYVRRMTMKTMKYVFWMTGDY  365

Query  362  GSHADKNFDPKAIPVVAGINFRDVVADNVTTAGTMEGIPGHPFTGICMANVTIGMAKNGK  541
            GSH D  FDPKA+P V GIN+RD+VADNVT +  ++GI   PFTGIC++NVTI + +   
Sbjct  366  GSHPDPGFDPKALPTVTGINYRDMVADNVTQSAKLDGIRNDPFTGICISNVTIKLTEK-P  424

Query  542  KQPPWVCANIQGVASGVVPPPCNLLHSQGP  631
            K+  W C NIQG+ S V P  C LL  + P
Sbjct  425  KELQWNCTNIQGITSRVTPQACELLPKKEP  454



>ref|XP_009137356.1| PREDICTED: probable polygalacturonase [Brassica rapa]
Length=493

 Score =   289 bits (739),  Expect = 7e-91, Method: Compositional matrix adjust.
 Identities = 136/219 (62%), Positives = 169/219 (77%), Gaps = 1/219 (0%)
 Frame = +2

Query  2    INPDSCTKVRIEDNYIVSGDDCVAIKSGIDEYGIKYGMPTKQLIIRRLTCISPTSGAIAM  181
            INPDSCT  RIED YIVSGDDC+A+KSG D+YGI YGMPTKQL+IRRLTCISP S  IA+
Sbjct  255  INPDSCTNTRIEDCYIVSGDDCIAVKSGWDQYGINYGMPTKQLLIRRLTCISPDSAVIAL  314

Query  182  GSEMSGGIEDVRASDITALDTESGVRIKTALGRGGYVKNIYVKGLRAHTMKLLFQMTGKY  361
            GSEMSGGIEDVRA DI A+++ESG+RIKTA+GRGGYVK++YV+G+   TMK +F MTG Y
Sbjct  315  GSEMSGGIEDVRAEDIVAINSESGIRIKTAVGRGGYVKDVYVRGMTMKTMKYVFWMTGSY  374

Query  362  GSHADKNFDPKAIPVVAGINFRDVVADNVTTAGTMEGIPGHPFTGICMANVTIGMAKNGK  541
            GSH D+++DPKA+PV+  IN++D+VA+NVT    + GI G  FTGIC++NVTI ++K  K
Sbjct  375  GSHPDEHYDPKALPVIQNINYQDMVAENVTMPAQLAGITGDEFTGICISNVTITLSKKPK  434

Query  542  KQPPWVCANIQGVASGVVPPPCNLLHSQGPVKPGMCDLP  658
            K   W C ++ G  SGV P PC LL  + P     C+ P
Sbjct  435  KV-LWNCTDVSGYTSGVTPEPCQLLPEKQPGTVVPCNFP  472



>ref|XP_009607671.1| PREDICTED: probable polygalacturonase [Nicotiana tomentosiformis]
Length=472

 Score =   288 bits (736),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 134/208 (64%), Positives = 168/208 (81%), Gaps = 1/208 (0%)
 Frame = +2

Query  2    INPDSCTKVRIEDNYIVSGDDCVAIKSGIDEYGIKYGMPTKQLIIRRLTCISPTSGAIAM  181
            I+PDSC+  +IED +IVSGDDC+A+KSG DEYGI +GMPT+ LIIRRLTCISP S  IA+
Sbjct  239  IDPDSCSNTKIEDCFIVSGDDCIAVKSGWDEYGIAFGMPTQHLIIRRLTCISPDSAVIAL  298

Query  182  GSEMSGGIEDVRASDITALDTESGVRIKTALGRGGYVKNIYVKGLRAHTMKLLFQMTGKY  361
            GSEMSGGI+DVRA +ITA+ +ESGVRIKTA+GRG YVK+++VKG+   TMK  F MTG Y
Sbjct  299  GSEMSGGIQDVRAENITAISSESGVRIKTAIGRGAYVKDVFVKGMTLQTMKYTFWMTGDY  358

Query  362  GSHADKNFDPKAIPVVAGINFRDVVADNVTTAGTMEGIPGHPFTGICMANVTIGMAKNGK  541
            GSH D +FDPKA+PV+ GINFRDVV+ NVT AG + GI    F+GIC++NV+I ++++ K
Sbjct  359  GSHPDDHFDPKALPVIQGINFRDVVSKNVTIAGKLVGIKNDTFSGICISNVSIELSEHAK  418

Query  542  KQPPWVCANIQGVASGVVPPPCNLLHSQ  625
            KQ PW C++IQGV+S V P PC LL  Q
Sbjct  419  KQ-PWNCSDIQGVSSQVSPQPCALLPDQ  445



>ref|XP_010276902.1| PREDICTED: probable polygalacturonase isoform X2 [Nelumbo nucifera]
Length=482

 Score =   288 bits (736),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 140/221 (63%), Positives = 166/221 (75%), Gaps = 4/221 (2%)
 Frame = +2

Query  2    INPDSCTKVRIEDNYIVSGDDCVAIKSGIDEYGIKYGMPTKQLIIRRLTCISPTSGAIAM  181
            INPDS T V IED YIVSGDDC+A+KSG D+YGI +GMPTK L+IRRLTCISP S  IA+
Sbjct  242  INPDSSTNVLIEDCYIVSGDDCIAVKSGWDQYGIAFGMPTKGLMIRRLTCISPDSAVIAL  301

Query  182  GSEMSGGIEDVRASDITALDTESGVRIKTALGRGGYVKNIYVKGLRAHTMKLLFQMTGKY  361
            GSEMSGGIEDVRA DI A++TESGVRIKT++GRGGYVK+IYV+ +   TMK +F MTG Y
Sbjct  302  GSEMSGGIEDVRAEDILAINTESGVRIKTSVGRGGYVKDIYVRRMTMKTMKWVFWMTGNY  361

Query  362  GSHADKNFDPKAIPVVAGINFRDVVADNVTTAGTMEGIPGHPFTGICMANVTIGMAKNGK  541
            GSH D NFDP A+P + GIN+ D+VA+NVT A  +EGI G PFTGIC++NVTIG+A   K
Sbjct  362  GSHPDGNFDPNALPAIQGINYGDMVAENVTMAARLEGIAGDPFTGICISNVTIGLAATAK  421

Query  542  KQPPWVCANIQGVASGVVPPPCNLLHSQGPVKPGMCDLPAK  664
            K   W C NI+G+ S V P PC LL  Q       C  P +
Sbjct  422  KV-QWNCTNIEGITSDVTPQPCELLPDQALTN---CAFPTE  458



>ref|XP_010276899.1| PREDICTED: probable polygalacturonase isoform X1 [Nelumbo nucifera]
Length=483

 Score =   288 bits (736),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 140/221 (63%), Positives = 166/221 (75%), Gaps = 4/221 (2%)
 Frame = +2

Query  2    INPDSCTKVRIEDNYIVSGDDCVAIKSGIDEYGIKYGMPTKQLIIRRLTCISPTSGAIAM  181
            INPDS T V IED YIVSGDDC+A+KSG D+YGI +GMPTK L+IRRLTCISP S  IA+
Sbjct  243  INPDSSTNVLIEDCYIVSGDDCIAVKSGWDQYGIAFGMPTKGLMIRRLTCISPDSAVIAL  302

Query  182  GSEMSGGIEDVRASDITALDTESGVRIKTALGRGGYVKNIYVKGLRAHTMKLLFQMTGKY  361
            GSEMSGGIEDVRA DI A++TESGVRIKT++GRGGYVK+IYV+ +   TMK +F MTG Y
Sbjct  303  GSEMSGGIEDVRAEDILAINTESGVRIKTSVGRGGYVKDIYVRRMTMKTMKWVFWMTGNY  362

Query  362  GSHADKNFDPKAIPVVAGINFRDVVADNVTTAGTMEGIPGHPFTGICMANVTIGMAKNGK  541
            GSH D NFDP A+P + GIN+ D+VA+NVT A  +EGI G PFTGIC++NVTIG+A   K
Sbjct  363  GSHPDGNFDPNALPAIQGINYGDMVAENVTMAARLEGIAGDPFTGICISNVTIGLAATAK  422

Query  542  KQPPWVCANIQGVASGVVPPPCNLLHSQGPVKPGMCDLPAK  664
            K   W C NI+G+ S V P PC LL  Q       C  P +
Sbjct  423  KV-QWNCTNIEGITSDVTPQPCELLPDQALTN---CAFPTE  459



>ref|XP_008794778.1| PREDICTED: probable polygalacturonase isoform X2 [Phoenix dactylifera]
Length=486

 Score =   288 bits (736),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 137/209 (66%), Positives = 165/209 (79%), Gaps = 1/209 (0%)
 Frame = +2

Query  2    INPDSCTKVRIEDNYIVSGDDCVAIKSGIDEYGIKYGMPTKQLIIRRLTCISPTSGAIAM  181
            INPDSC+ VRIED YIVSGDDCVAIKSG DEYGI  GMP++ +IIRRLTCISPTS  IA+
Sbjct  252  INPDSCSHVRIEDCYIVSGDDCVAIKSGWDEYGIAVGMPSQHIIIRRLTCISPTSAVIAL  311

Query  182  GSEMSGGIEDVRASDITALDTESGVRIKTALGRGGYVKNIYVKGLRAHTMKLLFQMTGKY  361
            GSEMSGGI+DVRA DITA+D+ESGVRIKTA+GRG YVK+I+V+G+  +TMK +F MTG Y
Sbjct  312  GSEMSGGIQDVRAEDITAIDSESGVRIKTAVGRGAYVKDIFVRGMNLNTMKWVFWMTGSY  371

Query  362  GSHADKNFDPKAIPVVAGINFRDVVADNVTTAGTMEGIPGHPFTGICMANVTIGMAKNGK  541
             SH D  +DP AIPVV GI++ DVVA +VT A  +EGI   PFTGIC++NVT+ +A   K
Sbjct  372  KSHPDNKYDPNAIPVVKGISYSDVVATDVTQAARLEGISNAPFTGICISNVTVQLAAKAK  431

Query  542  KQPPWVCANIQGVASGVVPPPCNLLHSQG  628
            KQ  W C +++GV+ GV P PC  L  QG
Sbjct  432  KQ-SWTCTDVEGVSKGVSPTPCASLPDQG  459



>ref|XP_008794781.1| PREDICTED: probable polygalacturonase isoform X4 [Phoenix dactylifera]
Length=477

 Score =   287 bits (735),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 137/209 (66%), Positives = 165/209 (79%), Gaps = 1/209 (0%)
 Frame = +2

Query  2    INPDSCTKVRIEDNYIVSGDDCVAIKSGIDEYGIKYGMPTKQLIIRRLTCISPTSGAIAM  181
            INPDSC+ VRIED YIVSGDDCVAIKSG DEYGI  GMP++ +IIRRLTCISPTS  IA+
Sbjct  243  INPDSCSHVRIEDCYIVSGDDCVAIKSGWDEYGIAVGMPSQHIIIRRLTCISPTSAVIAL  302

Query  182  GSEMSGGIEDVRASDITALDTESGVRIKTALGRGGYVKNIYVKGLRAHTMKLLFQMTGKY  361
            GSEMSGGI+DVRA DITA+D+ESGVRIKTA+GRG YVK+I+V+G+  +TMK +F MTG Y
Sbjct  303  GSEMSGGIQDVRAEDITAIDSESGVRIKTAVGRGAYVKDIFVRGMNLNTMKWVFWMTGSY  362

Query  362  GSHADKNFDPKAIPVVAGINFRDVVADNVTTAGTMEGIPGHPFTGICMANVTIGMAKNGK  541
             SH D  +DP AIPVV GI++ DVVA +VT A  +EGI   PFTGIC++NVT+ +A   K
Sbjct  363  KSHPDNKYDPNAIPVVKGISYSDVVATDVTQAARLEGISNAPFTGICISNVTVQLAAKAK  422

Query  542  KQPPWVCANIQGVASGVVPPPCNLLHSQG  628
            KQ  W C +++GV+ GV P PC  L  QG
Sbjct  423  KQ-SWTCTDVEGVSKGVSPTPCASLPDQG  450



>ref|XP_009137085.1| PREDICTED: probable polygalacturonase [Brassica rapa]
Length=493

 Score =   288 bits (736),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 135/222 (61%), Positives = 169/222 (76%), Gaps = 1/222 (0%)
 Frame = +2

Query  2    INPDSCTKVRIEDNYIVSGDDCVAIKSGIDEYGIKYGMPTKQLIIRRLTCISPTSGAIAM  181
            INPDSCT  RIED YIVSGDDC+A+KSG D+YGI YGMPTKQL+IRRLTCISP S  IA+
Sbjct  255  INPDSCTNTRIEDCYIVSGDDCIAVKSGWDQYGINYGMPTKQLLIRRLTCISPDSAVIAL  314

Query  182  GSEMSGGIEDVRASDITALDTESGVRIKTALGRGGYVKNIYVKGLRAHTMKLLFQMTGKY  361
            GSEMSGGIEDVRA DI A+++ESG+RIKTA+GRGGYVK++YV+G+   TMK +F MTG Y
Sbjct  315  GSEMSGGIEDVRAEDIIAINSESGIRIKTAIGRGGYVKDVYVRGMTMQTMKYVFWMTGSY  374

Query  362  GSHADKNFDPKAIPVVAGINFRDVVADNVTTAGTMEGIPGHPFTGICMANVTIGMAKNGK  541
            GSH D+++DP A+PV+  IN++D+VA+NVT    + GI G  FTGIC++NVTI ++K  K
Sbjct  375  GSHPDEHYDPNALPVIQNINYQDMVAENVTMPAQLAGITGDQFTGICISNVTITLSKKPK  434

Query  542  KQPPWVCANIQGVASGVVPPPCNLLHSQGPVKPGMCDLPAKN  667
            K   W C ++ G  SGV P PC LL  + P     C+ P  +
Sbjct  435  KV-LWNCTDVSGYTSGVTPEPCQLLPEKQPGTVVPCNFPESS  475



>ref|XP_008794777.1| PREDICTED: probable polygalacturonase isoform X1 [Phoenix dactylifera]
Length=495

 Score =   288 bits (736),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 137/209 (66%), Positives = 165/209 (79%), Gaps = 1/209 (0%)
 Frame = +2

Query  2    INPDSCTKVRIEDNYIVSGDDCVAIKSGIDEYGIKYGMPTKQLIIRRLTCISPTSGAIAM  181
            INPDSC+ VRIED YIVSGDDCVAIKSG DEYGI  GMP++ +IIRRLTCISPTS  IA+
Sbjct  261  INPDSCSHVRIEDCYIVSGDDCVAIKSGWDEYGIAVGMPSQHIIIRRLTCISPTSAVIAL  320

Query  182  GSEMSGGIEDVRASDITALDTESGVRIKTALGRGGYVKNIYVKGLRAHTMKLLFQMTGKY  361
            GSEMSGGI+DVRA DITA+D+ESGVRIKTA+GRG YVK+I+V+G+  +TMK +F MTG Y
Sbjct  321  GSEMSGGIQDVRAEDITAIDSESGVRIKTAVGRGAYVKDIFVRGMNLNTMKWVFWMTGSY  380

Query  362  GSHADKNFDPKAIPVVAGINFRDVVADNVTTAGTMEGIPGHPFTGICMANVTIGMAKNGK  541
             SH D  +DP AIPVV GI++ DVVA +VT A  +EGI   PFTGIC++NVT+ +A   K
Sbjct  381  KSHPDNKYDPNAIPVVKGISYSDVVATDVTQAARLEGISNAPFTGICISNVTVQLAAKAK  440

Query  542  KQPPWVCANIQGVASGVVPPPCNLLHSQG  628
            KQ  W C +++GV+ GV P PC  L  QG
Sbjct  441  KQ-SWTCTDVEGVSKGVSPTPCASLPDQG  468



>ref|XP_008794779.1| PREDICTED: probable polygalacturonase isoform X3 [Phoenix dactylifera]
Length=486

 Score =   287 bits (735),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 137/209 (66%), Positives = 165/209 (79%), Gaps = 1/209 (0%)
 Frame = +2

Query  2    INPDSCTKVRIEDNYIVSGDDCVAIKSGIDEYGIKYGMPTKQLIIRRLTCISPTSGAIAM  181
            INPDSC+ VRIED YIVSGDDCVAIKSG DEYGI  GMP++ +IIRRLTCISPTS  IA+
Sbjct  252  INPDSCSHVRIEDCYIVSGDDCVAIKSGWDEYGIAVGMPSQHIIIRRLTCISPTSAVIAL  311

Query  182  GSEMSGGIEDVRASDITALDTESGVRIKTALGRGGYVKNIYVKGLRAHTMKLLFQMTGKY  361
            GSEMSGGI+DVRA DITA+D+ESGVRIKTA+GRG YVK+I+V+G+  +TMK +F MTG Y
Sbjct  312  GSEMSGGIQDVRAEDITAIDSESGVRIKTAVGRGAYVKDIFVRGMNLNTMKWVFWMTGSY  371

Query  362  GSHADKNFDPKAIPVVAGINFRDVVADNVTTAGTMEGIPGHPFTGICMANVTIGMAKNGK  541
             SH D  +DP AIPVV GI++ DVVA +VT A  +EGI   PFTGIC++NVT+ +A   K
Sbjct  372  KSHPDNKYDPNAIPVVKGISYSDVVATDVTQAARLEGISNAPFTGICISNVTVQLAAKAK  431

Query  542  KQPPWVCANIQGVASGVVPPPCNLLHSQG  628
            KQ  W C +++GV+ GV P PC  L  QG
Sbjct  432  KQ-SWTCTDVEGVSKGVSPTPCASLPDQG  459



>ref|NP_194081.1| putative polygalacturonase [Arabidopsis thaliana]
 emb|CAA20471.1| putative protein [Arabidopsis thaliana]
 emb|CAB79305.1| putative protein [Arabidopsis thaliana]
 gb|AAN13048.1| unknown protein [Arabidopsis thaliana]
 dbj|BAD95012.1| hypothetical protein [Arabidopsis thaliana]
 gb|AEE84768.1| putative polygalacturonase [Arabidopsis thaliana]
Length=495

 Score =   287 bits (735),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 136/219 (62%), Positives = 168/219 (77%), Gaps = 1/219 (0%)
 Frame = +2

Query  2    INPDSCTKVRIEDNYIVSGDDCVAIKSGIDEYGIKYGMPTKQLIIRRLTCISPTSGAIAM  181
            INPDSCT  RIED YIVSGDDC+A+KSG D+YGI YGMPTKQL+IRRLTCISP S  IA+
Sbjct  257  INPDSCTNTRIEDCYIVSGDDCIAVKSGWDQYGINYGMPTKQLLIRRLTCISPDSAVIAL  316

Query  182  GSEMSGGIEDVRASDITALDTESGVRIKTALGRGGYVKNIYVKGLRAHTMKLLFQMTGKY  361
            GSEMSGGIEDVRA DI A+++ESG+RIKTA+GRGGYVK++YV+G+   TMK +F MTG Y
Sbjct  317  GSEMSGGIEDVRAEDIVAINSESGIRIKTAIGRGGYVKDVYVRGMTMMTMKYVFWMTGSY  376

Query  362  GSHADKNFDPKAIPVVAGINFRDVVADNVTTAGTMEGIPGHPFTGICMANVTIGMAKNGK  541
            GSH D ++DPKA+PV+  IN++D+VA+NVT    + GI G  FTGIC++NVTI ++K  K
Sbjct  377  GSHPDDHYDPKALPVIQNINYQDMVAENVTMPAQLAGISGDQFTGICISNVTITLSKKPK  436

Query  542  KQPPWVCANIQGVASGVVPPPCNLLHSQGPVKPGMCDLP  658
            K   W C ++ G  SGV P PC LL  + P     C+ P
Sbjct  437  KV-LWNCTDVSGYTSGVTPQPCQLLPEKQPGTVVPCNFP  474



>ref|XP_010276919.1| PREDICTED: probable polygalacturonase [Nelumbo nucifera]
Length=607

 Score =   290 bits (743),  Expect = 3e-90, Method: Compositional matrix adjust.
 Identities = 139/220 (63%), Positives = 167/220 (76%), Gaps = 1/220 (0%)
 Frame = +2

Query  2    INPDSCTKVRIEDNYIVSGDDCVAIKSGIDEYGIKYGMPTKQLIIRRLTCISPTSGAIAM  181
            I+PDSC  VRIED YIVSGDDC+A+KSG DEYGI +GMPT+ LIIRRLTCISPTS  IA+
Sbjct  231  IDPDSCNNVRIEDCYIVSGDDCIAVKSGWDEYGIAFGMPTQHLIIRRLTCISPTSAVIAL  290

Query  182  GSEMSGGIEDVRASDITALDTESGVRIKTALGRGGYVKNIYVKGLRAHTMKLLFQMTGKY  361
            GSEMSGGI+DVRA DI A+++ESGVRIKTA GRG YVK+IYV+ +  +TMK +F MTG Y
Sbjct  291  GSEMSGGIQDVRAEDIVAINSESGVRIKTAPGRGAYVKDIYVRRMNMNTMKYVFWMTGSY  350

Query  362  GSHADKNFDPKAIPVVAGINFRDVVADNVTTAGTMEGIPGHPFTGICMANVTIGMAKNGK  541
            G H D+ +DPKA+P V GIN+ D+ A+NVT    +EGI G PFTGIC++NVTIG++   K
Sbjct  351  GQHPDEKYDPKALPDVHGINWMDMTAENVTIPAKLEGINGDPFTGICISNVTIGLSPKPK  410

Query  542  KQPPWVCANIQGVASGVVPPPCNLLHSQGPVKPGMCDLPA  661
            K   W C +IQGVA  V PPPC+LL  QG      C  P 
Sbjct  411  KV-QWNCTDIQGVARDVTPPPCDLLSDQGSTGSKSCSFPT  449



>ref|XP_009772512.1| PREDICTED: probable polygalacturonase [Nicotiana sylvestris]
Length=473

 Score =   285 bits (730),  Expect = 8e-90, Method: Compositional matrix adjust.
 Identities = 133/208 (64%), Positives = 167/208 (80%), Gaps = 1/208 (0%)
 Frame = +2

Query  2    INPDSCTKVRIEDNYIVSGDDCVAIKSGIDEYGIKYGMPTKQLIIRRLTCISPTSGAIAM  181
            I+PDSC+  RIED +IVSGDDC+A+KSG DEYGI +GMPT+ LIIRRLTCISP S  IA+
Sbjct  240  IDPDSCSNTRIEDCFIVSGDDCIAVKSGWDEYGIAFGMPTQHLIIRRLTCISPDSAVIAL  299

Query  182  GSEMSGGIEDVRASDITALDTESGVRIKTALGRGGYVKNIYVKGLRAHTMKLLFQMTGKY  361
            GSEMSGGI+DVRA +ITA+ +ESGVRIKTA+GRG YVK+++VKG+   TMK  F MTG Y
Sbjct  300  GSEMSGGIQDVRAENITAISSESGVRIKTAIGRGAYVKDVFVKGMSLQTMKYTFWMTGDY  359

Query  362  GSHADKNFDPKAIPVVAGINFRDVVADNVTTAGTMEGIPGHPFTGICMANVTIGMAKNGK  541
            GSH D +FDPKA+PV+ GINFRDV++ NVT AG + GI    F+GIC++NV+I ++++ K
Sbjct  360  GSHPDDHFDPKALPVIQGINFRDVISKNVTIAGKLVGIKDDTFSGICISNVSIELSEHAK  419

Query  542  KQPPWVCANIQGVASGVVPPPCNLLHSQ  625
            KQ PW C++IQGV+S V P  C LL  Q
Sbjct  420  KQ-PWNCSDIQGVSSQVSPQACALLPDQ  446



>gb|KFK28901.1| hypothetical protein AALP_AA7G062800 [Arabis alpina]
Length=494

 Score =   286 bits (731),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 134/219 (61%), Positives = 168/219 (77%), Gaps = 1/219 (0%)
 Frame = +2

Query  2    INPDSCTKVRIEDNYIVSGDDCVAIKSGIDEYGIKYGMPTKQLIIRRLTCISPTSGAIAM  181
            INPDSCT  RIED YIVSGDDC+A+KSG D+YGI YGMPTKQL+IRRLTCISP S  IA+
Sbjct  256  INPDSCTNTRIEDCYIVSGDDCIAVKSGWDQYGINYGMPTKQLLIRRLTCISPDSAVIAL  315

Query  182  GSEMSGGIEDVRASDITALDTESGVRIKTALGRGGYVKNIYVKGLRAHTMKLLFQMTGKY  361
            GSEMSGGIEDVRA DI A+++ES +RIKTA+GRGGYVK++YV+G+  +TMK +F MTG Y
Sbjct  316  GSEMSGGIEDVRAEDIVAINSESAIRIKTAIGRGGYVKDVYVRGMTMNTMKYVFWMTGSY  375

Query  362  GSHADKNFDPKAIPVVAGINFRDVVADNVTTAGTMEGIPGHPFTGICMANVTIGMAKNGK  541
            GSH D+++DP A+PV+  IN++D+VA+NVT    + GI G  FTGIC++NVTI ++K  K
Sbjct  376  GSHPDEHYDPNALPVIQNINYQDMVAENVTMPAQLAGITGDQFTGICISNVTITLSKKPK  435

Query  542  KQPPWVCANIQGVASGVVPPPCNLLHSQGPVKPGMCDLP  658
            K   W C ++ G  SGV P PC LL  + P     C+ P
Sbjct  436  KV-LWNCTDVSGFTSGVTPQPCQLLPEKEPGTIVPCNFP  473



>ref|XP_008810120.1| PREDICTED: probable polygalacturonase isoform X2 [Phoenix dactylifera]
Length=441

 Score =   284 bits (727),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 130/209 (62%), Positives = 168/209 (80%), Gaps = 2/209 (1%)
 Frame = +2

Query  2    INPDSCTKVRIEDNYIVSGDDCVAIKSGIDEYGIKYGMPTKQLIIRRLTCISPTSGAIAM  181
            INPDSC+ V IED +IVSGDDC+AIKSG DEYGI + MPT+ +IIRRL+CISP+S  IA+
Sbjct  205  INPDSCSNVFIEDCFIVSGDDCIAIKSGWDEYGIAFNMPTQHVIIRRLSCISPSSATIAL  264

Query  182  GSEMSGGIEDVRASDITALDTESGVRIKTALGRGGYVKNIYVKGLRAHTMKLLFQMTGKY  361
            GSEMSGG++D+RA DITA++TESGVRIKTA+GRGGY+K+I+V+ +  + MK +F MTG Y
Sbjct  265  GSEMSGGVQDIRAEDITAINTESGVRIKTAIGRGGYIKDIFVRRMTLNAMKYVFWMTGNY  324

Query  362  GSHADKNFDPKAIPVVAGINFRDVVADNVTTAGTMEGIPGHPFTGICMANVTIGMAKNGK  541
            G H D N+DP AIP+V  IN+ DVVA+NVT AG +EGIP  PFTGIC++NVT+ + K+ K
Sbjct  325  GQHPDDNYDPNAIPLVQNINYSDVVAENVTIAGKLEGIPKAPFTGICLSNVTVDVVKSKK  384

Query  542  KQPPWVCANIQGVASGVVPPPCNLLHSQG  628
             +  W C +++GV+S VVP PC+ L  QG
Sbjct  385  LK--WNCTDVEGVSSAVVPTPCDSLRDQG  411



>ref|XP_009395433.1| PREDICTED: probable polygalacturonase isoform X1 [Musa acuminata 
subsp. malaccensis]
Length=497

 Score =   286 bits (731),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 135/209 (65%), Positives = 165/209 (79%), Gaps = 2/209 (1%)
 Frame = +2

Query  2    INPDSCTKVRIEDNYIVSGDDCVAIKSGIDEYGIKYGMPTKQLIIRRLTCISPTSGAIAM  181
            INPDSC+ VRIED YIVSGDDCVAIKSG DEYGI YGMP++ ++IRRLTCISPTS  IA+
Sbjct  260  INPDSCSNVRIEDCYIVSGDDCVAIKSGWDEYGIAYGMPSQHIVIRRLTCISPTSAVIAL  319

Query  182  GSEMSGGIEDVRASDITALDTESGVRIKTALGRGGYVKNIYVKGLRAHTMKLLFQMTGKY  361
            GSEMSGGI+DVRA DITA+++ESGVRIKTA+GRG YVK++YV+ +   TMK +F MTG Y
Sbjct  320  GSEMSGGIQDVRAEDITAINSESGVRIKTAVGRGAYVKDVYVRRMYLSTMKWVFWMTGNY  379

Query  362  GSHADKNFDPKAIPVVAGINFRDVVADNVTTAGTMEGIPGHPFTGICMANVTIGMAKNGK  541
             SH D  FDP AIPVV GI++ +V A NVT A  +EGIP  PFTGIC++NVT+ + K   
Sbjct  380  KSHPDDKFDPNAIPVVDGISYSEVTAYNVTMAARLEGIPNAPFTGICISNVTVELRK--A  437

Query  542  KQPPWVCANIQGVASGVVPPPCNLLHSQG  628
            ++ PW CA+++GV+SGV P  C  L  QG
Sbjct  438  RKLPWYCADVEGVSSGVSPAACASLADQG  466



>ref|XP_008780530.1| PREDICTED: probable polygalacturonase, partial [Phoenix dactylifera]
Length=213

 Score =   276 bits (706),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 132/206 (64%), Positives = 163/206 (79%), Gaps = 1/206 (0%)
 Frame = +2

Query  11   DSCTKVRIEDNYIVSGDDCVAIKSGIDEYGIKYGMPTKQLIIRRLTCISPTSGAIAMGSE  190
            DSC+ V IED +IVSGDDC+AIKSG DEYGI + MPT+ + IRRLTCISP S  IA+GSE
Sbjct  8    DSCSHVLIEDCFIVSGDDCIAIKSGWDEYGIAFNMPTQHVNIRRLTCISPFSATIALGSE  67

Query  191  MSGGIEDVRASDITALDTESGVRIKTALGRGGYVKNIYVKGLRAHTMKLLFQMTGKYGSH  370
            MSGGI+DVRA +ITA++TESGVRIKTA+GRGG+VK+I+V+G+  +TMK +F M+G YG H
Sbjct  68   MSGGIQDVRAENITAINTESGVRIKTAVGRGGFVKDIFVRGMTLNTMKYVFWMSGNYGQH  127

Query  371  ADKNFDPKAIPVVAGINFRDVVADNVTTAGTMEGIPGHPFTGICMANVTIGMAKNGKKQP  550
             D  +DP AIPVV  I + +VVA+NVT AG +EGIPG PFTGIC++NVTI +A + KK+ 
Sbjct  128  PDDKYDPNAIPVVRNIRYSNVVAENVTIAGHLEGIPGAPFTGICLSNVTIDVA-HSKKKL  186

Query  551  PWVCANIQGVASGVVPPPCNLLHSQG  628
             W C  I+GVAS V P PC LL  QG
Sbjct  187  KWNCTEIEGVASAVTPTPCALLRDQG  212



>ref|XP_009395434.1| PREDICTED: probable polygalacturonase isoform X2 [Musa acuminata 
subsp. malaccensis]
Length=491

 Score =   285 bits (730),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 135/209 (65%), Positives = 165/209 (79%), Gaps = 2/209 (1%)
 Frame = +2

Query  2    INPDSCTKVRIEDNYIVSGDDCVAIKSGIDEYGIKYGMPTKQLIIRRLTCISPTSGAIAM  181
            INPDSC+ VRIED YIVSGDDCVAIKSG DEYGI YGMP++ ++IRRLTCISPTS  IA+
Sbjct  254  INPDSCSNVRIEDCYIVSGDDCVAIKSGWDEYGIAYGMPSQHIVIRRLTCISPTSAVIAL  313

Query  182  GSEMSGGIEDVRASDITALDTESGVRIKTALGRGGYVKNIYVKGLRAHTMKLLFQMTGKY  361
            GSEMSGGI+DVRA DITA+++ESGVRIKTA+GRG YVK++YV+ +   TMK +F MTG Y
Sbjct  314  GSEMSGGIQDVRAEDITAINSESGVRIKTAVGRGAYVKDVYVRRMYLSTMKWVFWMTGNY  373

Query  362  GSHADKNFDPKAIPVVAGINFRDVVADNVTTAGTMEGIPGHPFTGICMANVTIGMAKNGK  541
             SH D  FDP AIPVV GI++ +V A NVT A  +EGIP  PFTGIC++NVT+ + K   
Sbjct  374  KSHPDDKFDPNAIPVVDGISYSEVTAYNVTMAARLEGIPNAPFTGICISNVTVELRK--A  431

Query  542  KQPPWVCANIQGVASGVVPPPCNLLHSQG  628
            ++ PW CA+++GV+SGV P  C  L  QG
Sbjct  432  RKLPWYCADVEGVSSGVSPAACASLADQG  460



>ref|XP_003592200.1| Polygalacturonase-like protein [Medicago truncatula]
 gb|AES62451.1| pectin lyase superfamily protein [Medicago truncatula]
Length=481

 Score =   284 bits (727),  Expect = 3e-89, Method: Compositional matrix adjust.
 Identities = 132/205 (64%), Positives = 161/205 (79%), Gaps = 1/205 (0%)
 Frame = +2

Query  2    INPDSCTKVRIEDNYIVSGDDCVAIKSGIDEYGIKYGMPTKQLIIRRLTCISPTSGAIAM  181
            I+PDSCT VRIEDNYIVSGDDC+AIKSG DEYGIK+G P++Q+IIRRLTCISP S  +A+
Sbjct  245  IDPDSCTNVRIEDNYIVSGDDCIAIKSGWDEYGIKFGKPSQQIIIRRLTCISPKSAMVAL  304

Query  182  GSEMSGGIEDVRASDITALDTESGVRIKTALGRGGYVKNIYVKGLRAHTMKLLFQMTGKY  361
            GSEMSGGI+DVR  D+TA+ TES VRIKTA+GRG YVK+I+VKG+   TMK +F MTG Y
Sbjct  305  GSEMSGGIQDVRVEDVTAIKTESAVRIKTAIGRGAYVKDIFVKGMNLDTMKYVFWMTGSY  364

Query  362  GSHADKNFDPKAIPVVAGINFRDVVADNVTTAGTMEGIPGHPFTGICMANVTIGMAKNGK  541
             SH D  FDP A+P ++ IN+RDV A NVT AG ++GI   PFTGIC++N TI M+ + K
Sbjct  365  KSHPDNGFDPNALPKISEINYRDVTAKNVTIAGKLDGISNDPFTGICVSNATIEMSAH-K  423

Query  542  KQPPWVCANIQGVASGVVPPPCNLL  616
            K+ PW C ++ GV S V P PC LL
Sbjct  424  KKLPWNCTDVSGVTSNVSPTPCELL  448



>ref|XP_009383010.1| PREDICTED: probable polygalacturonase [Musa acuminata subsp. 
malaccensis]
Length=360

 Score =   280 bits (717),  Expect = 4e-89, Method: Compositional matrix adjust.
 Identities = 136/219 (62%), Positives = 167/219 (76%), Gaps = 3/219 (1%)
 Frame = +2

Query  2    INPDSCTKVRIEDNYIVSGDDCVAIKSGIDEYGIKYGMPTKQLIIRRLTCISPTSGAIAM  181
            INPDS + VRIED YIVSGDDCVAIKSG DEYGI + MP+K ++IRRLTCISP+S  IA+
Sbjct  124  INPDSSSNVRIEDCYIVSGDDCVAIKSGWDEYGIAFNMPSKHIVIRRLTCISPSSAVIAL  183

Query  182  GSEMSGGIEDVRASDITALDTESGVRIKTALGRGGYVKNIYVKGLRAHTMKLLFQMTGKY  361
            GSEMSGGI+DVRA DITA+ +ESGVRIKTA+GRG YVK+I+V+ +  HTMK +F MTG Y
Sbjct  184  GSEMSGGIQDVRAEDITAIHSESGVRIKTAIGRGAYVKDIFVRRMDLHTMKWVFWMTGTY  243

Query  362  GSHADKNFDPKAIPVVAGINFRDVVADNVTTAGTMEGIPGHPFTGICMANVTIGMAKNGK  541
            G H D  FDPKAIPVV  I++ +VVA+NVT A  +EGIPG PFTGIC+ NVT  + K+  
Sbjct  244  GQHPDDKFDPKAIPVVQNISYSNVVAENVTMAAKLEGIPGAPFTGICIYNVTAEVRKS--  301

Query  542  KQPPWVCANIQGVASGVVPPPCNLLHSQGPVKPGMCDLP  658
            K+P W C +++GV+S V P PC L+  + P     C  P
Sbjct  302  KKPIWNCTDVEGVSSHVTPTPCALI-PESPDSITHCPFP  339



>ref|XP_008810119.1| PREDICTED: probable polygalacturonase isoform X1 [Phoenix dactylifera]
Length=493

 Score =   284 bits (727),  Expect = 4e-89, Method: Compositional matrix adjust.
 Identities = 130/209 (62%), Positives = 168/209 (80%), Gaps = 2/209 (1%)
 Frame = +2

Query  2    INPDSCTKVRIEDNYIVSGDDCVAIKSGIDEYGIKYGMPTKQLIIRRLTCISPTSGAIAM  181
            INPDSC+ V IED +IVSGDDC+AIKSG DEYGI + MPT+ +IIRRL+CISP+S  IA+
Sbjct  257  INPDSCSNVFIEDCFIVSGDDCIAIKSGWDEYGIAFNMPTQHVIIRRLSCISPSSATIAL  316

Query  182  GSEMSGGIEDVRASDITALDTESGVRIKTALGRGGYVKNIYVKGLRAHTMKLLFQMTGKY  361
            GSEMSGG++D+RA DITA++TESGVRIKTA+GRGGY+K+I+V+ +  + MK +F MTG Y
Sbjct  317  GSEMSGGVQDIRAEDITAINTESGVRIKTAIGRGGYIKDIFVRRMTLNAMKYVFWMTGNY  376

Query  362  GSHADKNFDPKAIPVVAGINFRDVVADNVTTAGTMEGIPGHPFTGICMANVTIGMAKNGK  541
            G H D N+DP AIP+V  IN+ DVVA+NVT AG +EGIP  PFTGIC++NVT+ + K+ K
Sbjct  377  GQHPDDNYDPNAIPLVQNINYSDVVAENVTIAGKLEGIPKAPFTGICLSNVTVDVVKSKK  436

Query  542  KQPPWVCANIQGVASGVVPPPCNLLHSQG  628
             +  W C +++GV+S VVP PC+ L  QG
Sbjct  437  LK--WNCTDVEGVSSAVVPTPCDSLRDQG  463



>emb|CDY44105.1| BnaA01g13130D [Brassica napus]
Length=452

 Score =   283 bits (724),  Expect = 4e-89, Method: Compositional matrix adjust.
 Identities = 133/222 (60%), Positives = 168/222 (76%), Gaps = 1/222 (0%)
 Frame = +2

Query  2    INPDSCTKVRIEDNYIVSGDDCVAIKSGIDEYGIKYGMPTKQLIIRRLTCISPTSGAIAM  181
            INPDSCT  RIED YIVSGDDC+A+KSG D+YGI YGMPTKQL+IRRLTCISP S  IA+
Sbjct  214  INPDSCTNTRIEDCYIVSGDDCIAVKSGWDQYGINYGMPTKQLLIRRLTCISPDSAVIAL  273

Query  182  GSEMSGGIEDVRASDITALDTESGVRIKTALGRGGYVKNIYVKGLRAHTMKLLFQMTGKY  361
            GSEMSGGIEDVRA DI A+++ESG+RIKTA+GRGGYVK++YV+G+   TMK +F MTG Y
Sbjct  274  GSEMSGGIEDVRAEDIVAINSESGIRIKTAIGRGGYVKDVYVRGMTMQTMKYVFWMTGSY  333

Query  362  GSHADKNFDPKAIPVVAGINFRDVVADNVTTAGTMEGIPGHPFTGICMANVTIGMAKNGK  541
            GSH D+++D  A+P++  IN++D+VA+NVT    + GI G  FTGIC++NVTI ++K  K
Sbjct  334  GSHPDEHYDLNALPLIQNINYQDMVAENVTMPAQLAGITGDQFTGICISNVTITLSKKPK  393

Query  542  KQPPWVCANIQGVASGVVPPPCNLLHSQGPVKPGMCDLPAKN  667
            K   W C ++ G  SGV P PC LL  + P     C+ P  +
Sbjct  394  KV-LWNCTDVSGYTSGVTPEPCQLLPEKQPGTVVPCNFPESS  434



>gb|AFW04075.1| polygalacturonase [Litchi chinensis]
Length=481

 Score =   284 bits (726),  Expect = 5e-89, Method: Compositional matrix adjust.
 Identities = 136/220 (62%), Positives = 168/220 (76%), Gaps = 4/220 (2%)
 Frame = +2

Query  2    INPDSCTKVRIEDNYIVSGDDCVAIKSGIDEYGIKYGMPTKQLIIRRLTCISPTSGAIAM  181
            I+PDSCT +RIED YIVSGDDC+A+KSG D+YGIK GMPT++L+IRR+TCISP S  IA+
Sbjct  245  IDPDSCTDIRIEDCYIVSGDDCIAVKSGWDQYGIKVGMPTQRLVIRRVTCISPDSATIAL  304

Query  182  GSEMSGGIEDVRASDITALDTESGVRIKTALGRGGYVKNIYVKGLRAHTMKLLFQMTGKY  361
            GSEMSGGI DVRA DITA+DT+SGVRIKT +GRGGYVK+IYV+ +   TMK +F MTG Y
Sbjct  305  GSEMSGGIRDVRAEDITAIDTQSGVRIKTGVGRGGYVKDIYVRRMTMKTMKYVFWMTGSY  364

Query  362  GSHADKNFDPKAIPVVAGINFRDVVADNVTTAGTMEGIPGHPFTGICMANVTIGMAKNGK  541
            G H D  FDPKA+P + GIN+RD+VA+NVT +  ++GIP  PF GIC+ NVTI + K   
Sbjct  365  GQHPDPGFDPKALPDIHGINYRDMVAENVTYSARLDGIPNDPFKGICIFNVTITLTKK-P  423

Query  542  KQPPWVCANIQGVASGVVPPPCNLLHSQGPVKPGMCDLPA  661
            K+  W C ++QGV S V PP C+LL  + PV    C  PA
Sbjct  424  KELQWNCTDVQGVTSRVTPPACSLLPEKKPVD---CPFPA  460



>gb|KHN42438.1| Putative polygalacturonase, partial [Glycine soja]
Length=462

 Score =   283 bits (724),  Expect = 6e-89, Method: Compositional matrix adjust.
 Identities = 132/205 (64%), Positives = 164/205 (80%), Gaps = 3/205 (1%)
 Frame = +2

Query  2    INPDSCTKVRIEDNYIVSGDDCVAIKSGIDEYGIKYGMPTKQLIIRRLTCISPTSGAIAM  181
            INPDSC+  RIED YIVSGDDCVAIKSG DE GIK+GMP++ +IIRRL C+SP S  IA+
Sbjct  228  INPDSCSNTRIEDCYIVSGDDCVAIKSGWDESGIKFGMPSQHIIIRRLECVSPDSAMIAL  287

Query  182  GSEMSGGIEDVRASDITALDTESGVRIKTALGRGGYVKNIYVKGLRAHTMKLLFQMTGKY  361
            GSEMSGGI DVRA ++TAL+T+S VRIKTA+GRG YV++I+VKG+  +TMK +F MTG Y
Sbjct  288  GSEMSGGIRDVRAEELTALNTQSAVRIKTAVGRGAYVRDIFVKGMNLNTMKYVFWMTGSY  347

Query  362  GSHADKNFDPKAIPVVAGINFRDVVADNVTTAGTMEGIPGHPFTGICMANVTIGMAKNGK  541
            GSH + +FDPKA+P + GIN+RDV+ADNVT +  +EGI   PFTGIC++NVTI    +GK
Sbjct  348  GSHPNTDFDPKALPNITGINYRDVIADNVTYSARLEGIANDPFTGICISNVTI---HSGK  404

Query  542  KQPPWVCANIQGVASGVVPPPCNLL  616
            K+P W C +I+GV S V P PC LL
Sbjct  405  KKPQWNCTDIEGVTSNVYPKPCELL  429



>ref|XP_003533980.1| PREDICTED: probable polygalacturonase-like [Glycine max]
Length=476

 Score =   283 bits (723),  Expect = 9e-89, Method: Compositional matrix adjust.
 Identities = 132/205 (64%), Positives = 164/205 (80%), Gaps = 3/205 (1%)
 Frame = +2

Query  2    INPDSCTKVRIEDNYIVSGDDCVAIKSGIDEYGIKYGMPTKQLIIRRLTCISPTSGAIAM  181
            INPDSC+  RIED YIVSGDDCVAIKSG DE GIK+GMP++ +IIRRL C+SP S  IA+
Sbjct  242  INPDSCSNTRIEDCYIVSGDDCVAIKSGWDESGIKFGMPSQHIIIRRLECVSPDSAMIAL  301

Query  182  GSEMSGGIEDVRASDITALDTESGVRIKTALGRGGYVKNIYVKGLRAHTMKLLFQMTGKY  361
            GSEMSGGI DVRA ++TAL+T+S VRIKTA+GRG YV++I+VKG+  +TMK +F MTG Y
Sbjct  302  GSEMSGGIRDVRAEELTALNTQSAVRIKTAVGRGAYVRDIFVKGMNLNTMKYVFWMTGSY  361

Query  362  GSHADKNFDPKAIPVVAGINFRDVVADNVTTAGTMEGIPGHPFTGICMANVTIGMAKNGK  541
            GSH + +FDPKA+P + GIN+RDV+ADNVT +  +EGI   PFTGIC++NVTI    +GK
Sbjct  362  GSHPNTDFDPKALPNITGINYRDVIADNVTYSARLEGIANDPFTGICISNVTI---HSGK  418

Query  542  KQPPWVCANIQGVASGVVPPPCNLL  616
            K+P W C +I+GV S V P PC LL
Sbjct  419  KKPQWNCTDIEGVTSNVYPKPCELL  443



>ref|XP_004496830.1| PREDICTED: probable polygalacturonase-like [Cicer arietinum]
Length=469

 Score =   282 bits (722),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 134/206 (65%), Positives = 165/206 (80%), Gaps = 2/206 (1%)
 Frame = +2

Query  2    INPDSCTKVRIEDNYIVSGDDCVAIKSGIDEYGIKYGMPTKQLIIRRLTCISPTSGAIAM  181
            I+PDSC+ V+IEDN+IVSGDDC+AIKSG DEYGIK GMPT+ +IIRRLTCISP S  IA+
Sbjct  238  IDPDSCSNVKIEDNFIVSGDDCIAIKSGWDEYGIKVGMPTQHVIIRRLTCISPDSATIAL  297

Query  182  GSEMSGGIEDVRASDITALDTESGVRIKTALGRGGYVKNIYVKGLRAHTMKLLFQMTGKY  361
            GSEMSGGI+DVRA DITA+ TES VRIK+A+GRGG+V++I+VKG+  +TMK +F MTG Y
Sbjct  298  GSEMSGGIQDVRAEDITAISTESAVRIKSAVGRGGFVRDIFVKGMNLNTMKYVFWMTGAY  357

Query  362  GSHADKNFDPKAIPVVAGINFRDVVADNVTTAGTMEGIPGHPFTGICMANVTIGMAKNGK  541
            G HAD+ FDPKA+P V  IN+ D+VA NVT AG +EGI   P+TGIC++N  I MA N K
Sbjct  358  GQHADEGFDPKALPNVTNINYSDIVAKNVTFAGKLEGISNDPYTGICISNTNIEMAAN-K  416

Query  542  KQPPWVCANIQGV-ASGVVPPPCNLL  616
            K+ PW C ++ GV +S V P PC LL
Sbjct  417  KKLPWNCTDVSGVTSSDVTPQPCALL  442



>ref|XP_004496829.1| PREDICTED: probable polygalacturonase-like [Cicer arietinum]
Length=475

 Score =   283 bits (723),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 135/221 (61%), Positives = 171/221 (77%), Gaps = 5/221 (2%)
 Frame = +2

Query  2    INPDSCTKVRIEDNYIVSGDDCVAIKSGIDEYGIKYGMPTKQLIIRRLTCISPTSGAIAM  181
            I+PDSC+ V+IEDN+IVSGDDC+AIKSG DEYGIK GMPT+ +IIRRLTCISP S  IA+
Sbjct  238  IDPDSCSNVKIEDNFIVSGDDCIAIKSGWDEYGIKVGMPTQHVIIRRLTCISPDSATIAL  297

Query  182  GSEMSGGIEDVRASDITALDTESGVRIKTALGRGGYVKNIYVKGLRAHTMKLLFQMTGKY  361
            GSEMSGGI+DVRA DITA+ TES VRIK+A+GRGG+V++I+VKG+  +TMK +F MTG Y
Sbjct  298  GSEMSGGIQDVRAEDITAISTESAVRIKSAVGRGGFVRDIFVKGMNLNTMKYVFWMTGAY  357

Query  362  GSHADKNFDPKAIPVVAGINFRDVVADNVTTAGTMEGIPGHPFTGICMANVTIGMAKNGK  541
            G HAD+ FDPKA+P V  IN+ +++A NVT AG +EGI   P+TGIC++N  I MA N K
Sbjct  358  GQHADEGFDPKALPNVTNINYSNIIAKNVTFAGKLEGISNDPYTGICVSNTNIEMAAN-K  416

Query  542  KQPPWVCANIQGV-ASGVVPPPCNLLHSQGPVKPGMCDLPA  661
            K+ PW C ++ GV +S V P PC LL  +G  +   C  P+
Sbjct  417  KKLPWNCTDVSGVTSSDVTPQPCALLPQKGKFE---CAYPS  454



>ref|XP_003592197.1| Endo-polygalacturonase-like protein [Medicago truncatula]
 gb|AES62448.1| pectin lyase superfamily protein [Medicago truncatula]
Length=475

 Score =   282 bits (722),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 133/219 (61%), Positives = 169/219 (77%), Gaps = 5/219 (2%)
 Frame = +2

Query  2    INPDSCTKVRIEDNYIVSGDDCVAIKSGIDEYGIKYGMPTKQLIIRRLTCISPTSGAIAM  181
            I+PDSCT V IEDNYIVSGDDC+AIKSG+D YGIK G P++++I+RRLTCISP S  +A+
Sbjct  244  IDPDSCTNVLIEDNYIVSGDDCIAIKSGLDGYGIKVGKPSQKIIVRRLTCISPKSAMVAL  303

Query  182  GSEMSGGIEDVRASDITALDTESGVRIKTALGRGGYVKNIYVKGLRAHTMKLLFQMTGKY  361
            GSEMSGGI+D+R  DITA++TES VRIKTA+GRG YVK+I+VKG+  +TMK +F MTG Y
Sbjct  304  GSEMSGGIQDIRIEDITAINTESAVRIKTAVGRGAYVKDIFVKGMNLNTMKYVFWMTGAY  363

Query  362  GSHADKNFDPKAIPVVAGINFRDVVADNVTTAGTMEGIPGHPFTGICMANVTIGMAKNGK  541
             SHA+  FDPKA+P ++GIN+RD++A NVT AG ++GI   PFTGIC++NVTI M+   K
Sbjct  364  KSHAENGFDPKALPKISGINYRDIIAKNVTIAGQLDGISNDPFTGICISNVTIEMSAQ-K  422

Query  542  KQPPWVCANIQGVASGVVPPPCNLLHSQGPVKPGMCDLP  658
               PW C ++ GVAS  VP PC++L    P K   C  P
Sbjct  423  NNLPWNCTDVSGVASNAVPKPCDML----PEKKIECPFP  457



>gb|KDP22229.1| hypothetical protein JCGZ_26060 [Jatropha curcas]
Length=467

 Score =   282 bits (721),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 138/219 (63%), Positives = 166/219 (76%), Gaps = 5/219 (2%)
 Frame = +2

Query  2    INPDSCTKVRIEDNYIVSGDDCVAIKSGIDEYGIKYGMPTKQLIIRRLTCISPTSGAIAM  181
            INPDSCT  RIED YIVSGDDC+A+KSG D+YGIK+GMPTKQLIIR+LTCISP S AIA+
Sbjct  237  INPDSCTNTRIEDCYIVSGDDCIAVKSGWDQYGIKFGMPTKQLIIRKLTCISPDSAAIAL  296

Query  182  GSEMSGGIEDVRASDITALDTESGVRIKTALGRGGYVKNIYVKGLRAHTMKLLFQMTGKY  361
            GSEMSGGI+DVRA DITA++TESGVRIKTA+GRGG+VK+I+V+ +   TMK +F MTG Y
Sbjct  297  GSEMSGGIQDVRAEDITAINTESGVRIKTAIGRGGFVKDIFVRNMNFQTMKYVFWMTGSY  356

Query  362  GSHADKNFDPKAIPVVAGINFRDVVADNVTTAGTMEGIPGHPFTGICMANVTIGMAKNGK  541
            GSH DK +DPKA+P V  IN+ D+VA NVT +  +EGI   PFTGIC++N  I + +  K
Sbjct  357  GSHPDKGYDPKALPNVTQINYGDIVAKNVTYSARLEGIENDPFTGICISNAEITLREKPK  416

Query  542  KQPPWVCANIQGVASGVVPPPCNLLHSQGPVKPGMCDLP  658
            KQ  W C  I+GV S V P  C+LL    P K   C  P
Sbjct  417  KQ-QWKCTGIEGVTSNVTPKACDLL----PEKKIDCPFP  450



>ref|XP_011035342.1| PREDICTED: probable polygalacturonase [Populus euphratica]
Length=475

 Score =   282 bits (722),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 136/220 (62%), Positives = 169/220 (77%), Gaps = 6/220 (3%)
 Frame = +2

Query  2    INPDSCTKVRIEDNYIVSGDDCVAIKSGIDEYGIKYGMPTKQLIIRRLTCISPTSGAIAM  181
            INPDSCT V IED YIVSGDDC+A+KSG+D+YGIK GMP KQL+IRR+TCISP S AIA+
Sbjct  243  INPDSCTNVIIEDCYIVSGDDCIAVKSGLDQYGIKVGMPMKQLVIRRITCISPKSAAIAL  302

Query  182  GSEMSGGIEDVRASDITALDTESGVRIKTALGRGGYVKNIYVKGLRAHTMKLLFQMTGKY  361
            GSEMSGGIEDVR  DITA++TES VR+KTA+GRGGYVK+I+V+ +   TMK +F M G Y
Sbjct  303  GSEMSGGIEDVRVEDITAINTESAVRVKTAVGRGGYVKDIFVRRMTLKTMKYVFWMIGSY  362

Query  362  GSHADKNFDPKAIPVVAGINFRDVVADNVTTAGTMEGI-PGHPFTGICMANVTIGMAKNG  538
             SHAD+ +DPKA+P +  INFRD+VADNVT  G +EG+  G+PFTGIC++NVT+ +A+  
Sbjct  363  SSHADEGYDPKALPEITNINFRDIVADNVTIPGKLEGLGEGNPFTGICISNVTMTLAEK-  421

Query  539  KKQPPWVCANIQGVASGVVPPPCNLLHSQGPVKPGMCDLP  658
             K+P W C ++ GV+S V P PC  L    P K   C  P
Sbjct  422  HKEPAWNCTDVSGVSSNVTPMPCAAL----PKKSMDCPFP  457



>ref|XP_007152185.1| hypothetical protein PHAVU_004G108800g [Phaseolus vulgaris]
 gb|ESW24179.1| hypothetical protein PHAVU_004G108800g [Phaseolus vulgaris]
Length=477

 Score =   282 bits (722),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 132/205 (64%), Positives = 162/205 (79%), Gaps = 3/205 (1%)
 Frame = +2

Query  2    INPDSCTKVRIEDNYIVSGDDCVAIKSGIDEYGIKYGMPTKQLIIRRLTCISPTSGAIAM  181
            INPDSC+  RIED YIVSGDDC+AIKSG DEYGIK+GMP+K +IIRRL C+SP S  IA+
Sbjct  242  INPDSCSNTRIEDCYIVSGDDCIAIKSGWDEYGIKFGMPSKHIIIRRLECVSPDSAMIAL  301

Query  182  GSEMSGGIEDVRASDITALDTESGVRIKTALGRGGYVKNIYVKGLRAHTMKLLFQMTGKY  361
            GSEMSGGI+DVRA D+TA++TES VRIKTA+GRG YV++I+VKG+  +TMK +F MTG Y
Sbjct  302  GSEMSGGIQDVRAEDLTAINTESAVRIKTAVGRGAYVRDIFVKGMNLNTMKYVFWMTGSY  361

Query  362  GSHADKNFDPKAIPVVAGINFRDVVADNVTTAGTMEGIPGHPFTGICMANVTIGMAKNGK  541
            GSH D  FDPKA+P + GIN+RDV ADNVT +  ++GI   PFTGIC++NVTI    +G 
Sbjct  362  GSHPDPGFDPKALPNITGINYRDVFADNVTYSARLDGIANDPFTGICISNVTI---HSGD  418

Query  542  KQPPWVCANIQGVASGVVPPPCNLL  616
            K+  W C +I+GV S V P PC LL
Sbjct  419  KKLQWNCTDIEGVTSNVYPKPCELL  443



>ref|XP_007151452.1| hypothetical protein PHAVU_004G047700g [Phaseolus vulgaris]
 gb|ESW23446.1| hypothetical protein PHAVU_004G047700g [Phaseolus vulgaris]
Length=455

 Score =   281 bits (718),  Expect = 3e-88, Method: Compositional matrix adjust.
 Identities = 128/208 (62%), Positives = 161/208 (77%), Gaps = 1/208 (0%)
 Frame = +2

Query  2    INPDSCTKVRIEDNYIVSGDDCVAIKSGIDEYGIKYGMPTKQLIIRRLTCISPTSGAIAM  181
            +NPDSCT  RIED YIVSGDDC++ KSG D YG+K+G PTK +IIRR+TCISP S  +A+
Sbjct  245  VNPDSCTNTRIEDCYIVSGDDCISPKSGWDNYGVKFGKPTKNIIIRRITCISPDSAMVAL  304

Query  182  GSEMSGGIEDVRASDITALDTESGVRIKTALGRGGYVKNIYVKGLRAHTMKLLFQMTGKY  361
            GSEMSGGIED+R  D+TA+DT+S VRIKTA+GRG YVKNIYV+ L  +TMK +F MTG Y
Sbjct  305  GSEMSGGIEDIRVEDLTAIDTQSAVRIKTAVGRGAYVKNIYVRNLNLNTMKYVFWMTGSY  364

Query  362  GSHADKNFDPKAIPVVAGINFRDVVADNVTTAGTMEGIPGHPFTGICMANVTIGMAKNGK  541
            GSH D  FDPKA+PV++GIN++D+VA NVT A  +EGIP  PFTGIC++NVT+ ++K   
Sbjct  365  GSHPDPEFDPKALPVISGINYKDIVAKNVTYAARLEGIPNDPFTGICISNVTMELSKEQH  424

Query  542  KQPPWVCANIQGVASGVVPPPCNLLHSQ  625
            K   W C +I GV++ V P PC  L  +
Sbjct  425  KL-QWNCTDISGVSNNVTPTPCEELQQK  451



>ref|XP_007151453.1| hypothetical protein PHAVU_004G047800g [Phaseolus vulgaris]
 gb|ESW23447.1| hypothetical protein PHAVU_004G047800g [Phaseolus vulgaris]
Length=476

 Score =   281 bits (719),  Expect = 4e-88, Method: Compositional matrix adjust.
 Identities = 126/205 (61%), Positives = 162/205 (79%), Gaps = 1/205 (0%)
 Frame = +2

Query  2    INPDSCTKVRIEDNYIVSGDDCVAIKSGIDEYGIKYGMPTKQLIIRRLTCISPTSGAIAM  181
            +NPDSCT +RIED +IVSGDDC+A+KSG DEYGIK+G PT+ L+IRR+TCISP S  +A+
Sbjct  246  VNPDSCTNIRIEDCFIVSGDDCIAVKSGWDEYGIKFGRPTQHLVIRRVTCISPDSAMVAL  305

Query  182  GSEMSGGIEDVRASDITALDTESGVRIKTALGRGGYVKNIYVKGLRAHTMKLLFQMTGKY  361
            GSEMSGGIEDVR  D+TA++TES +RIKTA+GRGG+VKNI+V+GL  +TMK +F MTG Y
Sbjct  306  GSEMSGGIEDVRVDDLTAINTESAIRIKTAVGRGGFVKNIFVRGLNLNTMKYVFWMTGSY  365

Query  362  GSHADKNFDPKAIPVVAGINFRDVVADNVTTAGTMEGIPGHPFTGICMANVTIGMAKNGK  541
            G H D NFDPKA+P + GIN++D+VA NVT +  +EGI   PFTGIC++NV++ ++   K
Sbjct  366  GEHPDPNFDPKALPTITGINYKDIVAKNVTYSAKLEGISNDPFTGICISNVSVQVSAQQK  425

Query  542  KQPPWVCANIQGVASGVVPPPCNLL  616
            K   W C N+ GV + V P PC LL
Sbjct  426  KL-QWNCTNVAGVTNNVTPTPCALL  449



>ref|XP_008796910.1| PREDICTED: probable polygalacturonase [Phoenix dactylifera]
Length=466

 Score =   281 bits (718),  Expect = 5e-88, Method: Compositional matrix adjust.
 Identities = 136/220 (62%), Positives = 168/220 (76%), Gaps = 4/220 (2%)
 Frame = +2

Query  2    INPDSCTKVRIEDNYIVSGDDCVAIKSGIDEYGIKYGMPTKQLIIRRLTCISPTSGAIAM  181
            INPDSC+ VRIED YIVSGDDCVAIKSG DEYGI  GMP++ + IRRLTCISPTS  IA+
Sbjct  246  INPDSCSHVRIEDCYIVSGDDCVAIKSGWDEYGIAVGMPSQHITIRRLTCISPTSAVIAL  305

Query  182  GSEMSGGIEDVRASDITALDTESGVRIKTALGRGGYVKNIYVKGLRAHTMKLLFQMTGKY  361
            GSEMSGGI+DVRA DITA+D+ESGVRIKTA+GRG YVK+I+V+G+  +TMK +F+M G Y
Sbjct  306  GSEMSGGIQDVRAEDITAIDSESGVRIKTAVGRGAYVKDIFVRGMNLNTMKWVFRMDGNY  365

Query  362  GSHADKNFDPKAIPVVAGINFRDVVADNVTTAGTMEGIPGHPFTGICMANVTIGMAKNGK  541
             SH D  +DPKAIPVV  I++ ++VA NV     + GIP  PFTGIC++NVT+ +A   K
Sbjct  366  KSHPDNKYDPKAIPVVKDISYSNIVAKNVKQVAKLHGIPNAPFTGICISNVTVQLAAKAK  425

Query  542  KQPPWVCANIQGVASGVVPPPCNLLHSQGPVKPGMCDLPA  661
            KQ  W C++++GV+SGV P PC  L  +   KP  C  PA
Sbjct  426  KQ-RWTCSDVEGVSSGVTPAPCASLQ-RAVAKP--CPFPA  461



>gb|EMS49882.1| putative polygalacturonase [Triticum urartu]
Length=391

 Score =   278 bits (711),  Expect = 6e-88, Method: Compositional matrix adjust.
 Identities = 133/222 (60%), Positives = 169/222 (76%), Gaps = 5/222 (2%)
 Frame = +2

Query  2    INPDSCTKVRIEDNYIVSGDDCVAIKSGIDEYGIKYGMPTKQLIIRRLTCISPTSGAIAM  181
            I+PDS + V+IED YIVSGDDC+A+KSG DEYGIK+ MP++ +++RRLTCISPTS  IA+
Sbjct  162  IDPDSSSHVKIEDCYIVSGDDCIAVKSGWDEYGIKFNMPSQHIVVRRLTCISPTSAMIAL  221

Query  182  GSEMSGGIEDVRASDITALDTESGVRIKTALGRGGYVKNIYVKGLRAHTMKLLFQMTGKY  361
            GSEMSGGI+DVR  D TA+DTES VRIK+ +GRGG+V++++V+ L  HTMK +F MTG Y
Sbjct  222  GSEMSGGIQDVRVEDNTAIDTESAVRIKSGVGRGGFVRDVFVRRLSLHTMKWVFWMTGNY  281

Query  362  GSHADKNFDPKAIPVVAGINFRDVVADNVTTAGTMEGIPGHPFTGICMANVTIGMAKNGK  541
            G H D + DPKA+P V GIN+RDV A+NVT AG MEGIP  P+TGICM+N+T  +A   K
Sbjct  282  GQHPDNSSDPKALPEVTGINYRDVFAENVTMAGRMEGIPNDPYTGICMSNITAQLAPKAK  341

Query  542  KQPPWVCANIQGVASGVVPPPCNLLHSQGPVKPGMCDLPAKN  667
            K   W C ++QGVASGV P PC  L ++G  KP  C  P + 
Sbjct  342  KL-QWNCTDVQGVASGVSPEPCPELGAEG--KP--CTFPEEE  378



>ref|XP_002305262.1| glycoside hydrolase family 28 family protein [Populus trichocarpa]
 gb|EEE85773.1| glycoside hydrolase family 28 family protein [Populus trichocarpa]
Length=437

 Score =   279 bits (714),  Expect = 7e-88, Method: Compositional matrix adjust.
 Identities = 135/220 (61%), Positives = 168/220 (76%), Gaps = 6/220 (3%)
 Frame = +2

Query  2    INPDSCTKVRIEDNYIVSGDDCVAIKSGIDEYGIKYGMPTKQLIIRRLTCISPTSGAIAM  181
            INPDSCT V IED YIVSGDDC+A+KSG+D+YGIK GMP KQL+IRR+TCISP S AIA+
Sbjct  205  INPDSCTNVIIEDCYIVSGDDCIAVKSGLDQYGIKVGMPMKQLVIRRITCISPKSAAIAL  264

Query  182  GSEMSGGIEDVRASDITALDTESGVRIKTALGRGGYVKNIYVKGLRAHTMKLLFQMTGKY  361
            GSEMSGGIEDVR  DITA++TES VR+KTA+GRGGYVK+I+V+ +   TMK +F M G Y
Sbjct  265  GSEMSGGIEDVRIEDITAINTESAVRVKTAVGRGGYVKDIFVRRMTLKTMKYVFWMIGSY  324

Query  362  GSHADKNFDPKAIPVVAGINFRDVVADNVTTAGTMEGI-PGHPFTGICMANVTIGMAKNG  538
             SHAD+ +DPKA+P +  INFRD+ ADNVT  G +EG+  G+PFTGIC++NVT+ +A+  
Sbjct  325  SSHADEGYDPKALPEITNINFRDIAADNVTIPGKLEGLGEGNPFTGICISNVTMTLAEK-  383

Query  539  KKQPPWVCANIQGVASGVVPPPCNLLHSQGPVKPGMCDLP  658
             K+P W C ++ GV+S V P PC  L    P K   C  P
Sbjct  384  HKEPAWNCTDVSGVSSNVTPMPCAAL----PKKSMDCPFP  419



>gb|KHG19694.1| putative polygalacturonase [Gossypium arboreum]
Length=474

 Score =   280 bits (717),  Expect = 8e-88, Method: Compositional matrix adjust.
 Identities = 128/205 (62%), Positives = 160/205 (78%), Gaps = 1/205 (0%)
 Frame = +2

Query  2    INPDSCTKVRIEDNYIVSGDDCVAIKSGIDEYGIKYGMPTKQLIIRRLTCISPTSGAIAM  181
            I+PDSCT  RIED++IVSGDDC+A+KSG DEYGIK+ MPTKQL+IRR  CISP+S  IA+
Sbjct  241  IDPDSCTNTRIEDSFIVSGDDCIAVKSGWDEYGIKFNMPTKQLVIRRFACISPSSATIAL  300

Query  182  GSEMSGGIEDVRASDITALDTESGVRIKTALGRGGYVKNIYVKGLRAHTMKLLFQMTGKY  361
            GSEMSGGIEDVR  D+TA++TESGVRIKT +GRG YVK++YV+ +  +TMK +F MTG Y
Sbjct  301  GSEMSGGIEDVRVEDVTAINTESGVRIKTGVGRGAYVKDVYVRNMTLNTMKYVFWMTGDY  360

Query  362  GSHADKNFDPKAIPVVAGINFRDVVADNVTTAGTMEGIPGHPFTGICMANVTIGMAKNGK  541
            GSH D  FD  A PV+ GIN+RD+VADNVT +  ++GI  HPFT IC++NV I +A    
Sbjct  361  GSHPDAEFDQNAFPVIKGINYRDIVADNVTQSAQLDGIGKHPFTDICISNVNIKLAAK-P  419

Query  542  KQPPWVCANIQGVASGVVPPPCNLL  616
            K   W C+++QGV + V P PCNLL
Sbjct  420  KGVQWNCSDVQGVTNRVSPEPCNLL  444



>gb|KHN21785.1| Putative polygalacturonase [Glycine soja]
Length=456

 Score =   280 bits (716),  Expect = 8e-88, Method: Compositional matrix adjust.
 Identities = 133/209 (64%), Positives = 163/209 (78%), Gaps = 1/209 (0%)
 Frame = +2

Query  2    INPDSCTKVRIEDNYIVSGDDCVAIKSGIDEYGIKYGMPTKQLIIRRLTCISPTSGAIAM  181
            I+PDSCT  RIED YIVSGDDCVA+KSG DEYGIK+G PT+ L+IRRLTCISP S  IA+
Sbjct  222  IDPDSCTNTRIEDCYIVSGDDCVAVKSGWDEYGIKFGKPTQHLVIRRLTCISPDSAMIAL  281

Query  182  GSEMSGGIEDVRASDITALDTESGVRIKTALGRGGYVKNIYVKGLRAHTMKLLFQMTGKY  361
            GSEMSGGI+DVR  DITA++T+S VRIKTA+GRGGYVK+I+VKG+   TMK +F MTG Y
Sbjct  282  GSEMSGGIQDVRVEDITAINTQSAVRIKTAVGRGGYVKDIFVKGMTLSTMKYVFWMTGSY  341

Query  362  GSHADKNFDPKAIPVVAGINFRDVVADNVTTAGTMEGIPGHPFTGICMANVTIGMAKNGK  541
            GSH D  FDPKA+P + GIN+RDVVA NVT +  +EGI   PFTGIC++NV+I +++  K
Sbjct  342  GSHPDPAFDPKALPNITGINYRDVVATNVTYSAKLEGISNDPFTGICISNVSIQVSEQ-K  400

Query  542  KQPPWVCANIQGVASGVVPPPCNLLHSQG  628
            K+  W C ++ GV S V P  C LL  +G
Sbjct  401  KKLQWNCTDVAGVTSNVTPNTCQLLPEKG  429



>gb|KHN21786.1| Putative polygalacturonase, partial [Glycine soja]
Length=434

 Score =   279 bits (713),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 132/219 (60%), Positives = 168/219 (77%), Gaps = 4/219 (2%)
 Frame = +2

Query  2    INPDSCTKVRIEDNYIVSGDDCVAIKSGIDEYGIKYGMPTKQLIIRRLTCISPTSGAIAM  181
            INPDSC+ +RIED  I SGDDC+A+KSG DEYGI++GMPT+ LIIRR+TC+SP S  IA+
Sbjct  205  INPDSCSNIRIEDCNITSGDDCIAVKSGWDEYGIRFGMPTQHLIIRRITCVSPDSAMIAL  264

Query  182  GSEMSGGIEDVRASDITALDTESGVRIKTALGRGGYVKNIYVKGLRAHTMKLLFQMTGKY  361
            GSEMSGGI DVRA D+TA++TE+ VRIKTA+GRGGYVKNI+VKG+  +TMK +F +TG Y
Sbjct  265  GSEMSGGIYDVRAEDLTAINTEAAVRIKTAIGRGGYVKNIFVKGMNLNTMKYVFWITGTY  324

Query  362  GSHADKNFDPKAIPVVAGINFRDVVADNVTTAGTMEGIPGHPFTGICMANVTIGMAKNGK  541
            G H D  +DPKA+P + GIN+RDVVA NVT +  +EGI   PFTGIC++NV+I +++  K
Sbjct  325  GDHPDPGYDPKALPYITGINYRDVVATNVTKSARLEGISNDPFTGICISNVSIQVSEQQK  384

Query  542  KQPPWVCANIQGVASGVVPPPCNLLHSQGPVKPGMCDLP  658
            K   W C+NI GV S V P PC LL  +G ++   C  P
Sbjct  385  KL-QWNCSNISGVTSNVTPYPCALLPEKGQLE---CPFP  419



>ref|XP_003536450.1| PREDICTED: probable polygalacturonase-like [Glycine max]
Length=476

 Score =   280 bits (715),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 133/209 (64%), Positives = 163/209 (78%), Gaps = 1/209 (0%)
 Frame = +2

Query  2    INPDSCTKVRIEDNYIVSGDDCVAIKSGIDEYGIKYGMPTKQLIIRRLTCISPTSGAIAM  181
            I+PDSCT  RIED YIVSGDDCVA+KSG DEYGIK+G PT+ L+IRRLTCISP S  IA+
Sbjct  242  IDPDSCTNTRIEDCYIVSGDDCVAVKSGWDEYGIKFGKPTQHLVIRRLTCISPDSAMIAL  301

Query  182  GSEMSGGIEDVRASDITALDTESGVRIKTALGRGGYVKNIYVKGLRAHTMKLLFQMTGKY  361
            GSEMSGGI+DVR  DITA++T+S VRIKTA+GRGGYVK+I+VKG+   TMK +F MTG Y
Sbjct  302  GSEMSGGIQDVRVEDITAINTQSAVRIKTAVGRGGYVKDIFVKGMTLSTMKYVFWMTGSY  361

Query  362  GSHADKNFDPKAIPVVAGINFRDVVADNVTTAGTMEGIPGHPFTGICMANVTIGMAKNGK  541
            GSH D  FDPKA+P + GIN+RDVVA NVT +  +EGI   PFTGIC++NV+I +++  K
Sbjct  362  GSHPDPAFDPKALPNITGINYRDVVATNVTYSAKLEGISNDPFTGICISNVSIQVSEQ-K  420

Query  542  KQPPWVCANIQGVASGVVPPPCNLLHSQG  628
            K+  W C ++ GV S V P  C LL  +G
Sbjct  421  KKLQWNCTDVAGVTSNVTPNTCQLLPEKG  449



>gb|KHN21784.1| Putative polygalacturonase [Glycine soja]
Length=472

 Score =   279 bits (714),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 133/209 (64%), Positives = 163/209 (78%), Gaps = 1/209 (0%)
 Frame = +2

Query  2    INPDSCTKVRIEDNYIVSGDDCVAIKSGIDEYGIKYGMPTKQLIIRRLTCISPTSGAIAM  181
            I+PDSCT  RIED YIVSGDDCVA+KSG DEYGIK+G PT+ L+IRRLTCISP S  IA+
Sbjct  238  IDPDSCTNTRIEDCYIVSGDDCVAVKSGWDEYGIKFGKPTQHLVIRRLTCISPDSAMIAL  297

Query  182  GSEMSGGIEDVRASDITALDTESGVRIKTALGRGGYVKNIYVKGLRAHTMKLLFQMTGKY  361
            GSEMSGGI+DVR  DITA++T+S VRIKTA+GRGGYVK+I+VKG+   TMK +F MTG Y
Sbjct  298  GSEMSGGIQDVRVEDITAINTQSAVRIKTAVGRGGYVKDIFVKGMTLSTMKYVFWMTGSY  357

Query  362  GSHADKNFDPKAIPVVAGINFRDVVADNVTTAGTMEGIPGHPFTGICMANVTIGMAKNGK  541
            GSH D  FDPKA+P + GIN+RDVVA NVT +  +EGI   PFTGIC++NV+I +++  K
Sbjct  358  GSHPDPAFDPKALPNITGINYRDVVATNVTYSAKLEGISNDPFTGICISNVSIQVSEQ-K  416

Query  542  KQPPWVCANIQGVASGVVPPPCNLLHSQG  628
            K+  W C ++ GV S V P  C LL  +G
Sbjct  417  KKLQWNCTDVAGVTSNVTPNTCQLLPEKG  445



>ref|XP_010934935.1| PREDICTED: probable polygalacturonase [Elaeis guineensis]
Length=469

 Score =   279 bits (714),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 128/209 (61%), Positives = 164/209 (78%), Gaps = 1/209 (0%)
 Frame = +2

Query  2    INPDSCTKVRIEDNYIVSGDDCVAIKSGIDEYGIKYGMPTKQLIIRRLTCISPTSGAIAM  181
            INPDS + VRIED YIVSGDDCVAIKSG DEYGI  GMP++ +II+RLTCISPTS  IA+
Sbjct  247  INPDSSSHVRIEDCYIVSGDDCVAIKSGWDEYGIAVGMPSQHIIIQRLTCISPTSAVIAL  306

Query  182  GSEMSGGIEDVRASDITALDTESGVRIKTALGRGGYVKNIYVKGLRAHTMKLLFQMTGKY  361
            GSEMSGGI+DVRA DITA+D+ESG+RIKTA+GRGGYVK+I+V+G+  +TMK +F+M G Y
Sbjct  307  GSEMSGGIQDVRAEDITAIDSESGIRIKTAVGRGGYVKDIFVRGMNLNTMKWVFRMDGNY  366

Query  362  GSHADKNFDPKAIPVVAGINFRDVVADNVTTAGTMEGIPGHPFTGICMANVTIGMAKNGK  541
             SH D  +DP AIPV+ GI++ +++A NV    ++ GIP  PFTGIC++NVT+ +A   +
Sbjct  367  KSHPDNKYDPHAIPVIKGISYSNIIAKNVKQVASLHGIPNAPFTGICISNVTVQLAAKAR  426

Query  542  KQPPWVCANIQGVASGVVPPPCNLLHSQG  628
            KQ  W C +++GV+SGV P PC     QG
Sbjct  427  KQ-TWTCTDVEGVSSGVTPAPCASFRDQG  454



>ref|XP_006589526.1| PREDICTED: probable polygalacturonase-like isoform X2 [Glycine 
max]
Length=458

 Score =   279 bits (713),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 132/220 (60%), Positives = 168/220 (76%), Gaps = 4/220 (2%)
 Frame = +2

Query  2    INPDSCTKVRIEDNYIVSGDDCVAIKSGIDEYGIKYGMPTKQLIIRRLTCISPTSGAIAM  181
            INPDSC+ +RIED  I SGDDC+A+KSG DEYGI++GMPT+ LIIRR+TC+SP S  IA+
Sbjct  229  INPDSCSNIRIEDCNITSGDDCIAVKSGWDEYGIRFGMPTQHLIIRRITCVSPDSAMIAL  288

Query  182  GSEMSGGIEDVRASDITALDTESGVRIKTALGRGGYVKNIYVKGLRAHTMKLLFQMTGKY  361
            GSEMSGGI DVRA D+TA++TE+ VRIKTA+GRGGYVKNI+VKG+  +TMK +F +TG Y
Sbjct  289  GSEMSGGIYDVRAEDLTAINTEAAVRIKTAIGRGGYVKNIFVKGMNLNTMKYVFWITGTY  348

Query  362  GSHADKNFDPKAIPVVAGINFRDVVADNVTTAGTMEGIPGHPFTGICMANVTIGMAKNGK  541
            G H D  +DPKA+P + GIN+RDVVA NVT +  +EGI   PFTGIC++NV+I +++  K
Sbjct  349  GDHPDPGYDPKALPYITGINYRDVVATNVTKSARLEGISNDPFTGICISNVSIQVSEQQK  408

Query  542  KQPPWVCANIQGVASGVVPPPCNLLHSQGPVKPGMCDLPA  661
            K   W C+NI GV S V P PC LL  +G ++   C  P 
Sbjct  409  KL-QWNCSNISGVTSNVTPYPCALLPEKGQLE---CPFPT  444



>ref|XP_003535598.1| PREDICTED: probable polygalacturonase-like [Glycine max]
Length=475

 Score =   279 bits (714),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 133/209 (64%), Positives = 163/209 (78%), Gaps = 1/209 (0%)
 Frame = +2

Query  2    INPDSCTKVRIEDNYIVSGDDCVAIKSGIDEYGIKYGMPTKQLIIRRLTCISPTSGAIAM  181
            I+PDSCT  RIED YIVSGDDCVA+KSG DEYGIK+G PT+ L+IRRLTCISP S  IA+
Sbjct  241  IDPDSCTNTRIEDCYIVSGDDCVAVKSGWDEYGIKFGKPTQHLVIRRLTCISPDSAMIAL  300

Query  182  GSEMSGGIEDVRASDITALDTESGVRIKTALGRGGYVKNIYVKGLRAHTMKLLFQMTGKY  361
            GSEMSGGI+DVR  DITA++T+S VRIKTA+GRGGYVK+I+VKG+   TMK +F MTG Y
Sbjct  301  GSEMSGGIQDVRVEDITAINTQSAVRIKTAVGRGGYVKDIFVKGMTLSTMKYVFWMTGSY  360

Query  362  GSHADKNFDPKAIPVVAGINFRDVVADNVTTAGTMEGIPGHPFTGICMANVTIGMAKNGK  541
            GSH D  FDPKA+P + GIN+RDVVA NVT +  +EGI   PFTGIC++NV+I +++  K
Sbjct  361  GSHPDPAFDPKALPNITGINYRDVVATNVTYSAKLEGISNDPFTGICISNVSIQVSEQ-K  419

Query  542  KQPPWVCANIQGVASGVVPPPCNLLHSQG  628
            K+  W C ++ GV S V P  C LL  +G
Sbjct  420  KKLQWNCTDVAGVTSNVTPNTCQLLPEKG  448



>ref|XP_003535597.1| PREDICTED: probable polygalacturonase-like isoform X1 [Glycine 
max]
Length=466

 Score =   279 bits (713),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 132/220 (60%), Positives = 168/220 (76%), Gaps = 4/220 (2%)
 Frame = +2

Query  2    INPDSCTKVRIEDNYIVSGDDCVAIKSGIDEYGIKYGMPTKQLIIRRLTCISPTSGAIAM  181
            INPDSC+ +RIED  I SGDDC+A+KSG DEYGI++GMPT+ LIIRR+TC+SP S  IA+
Sbjct  237  INPDSCSNIRIEDCNITSGDDCIAVKSGWDEYGIRFGMPTQHLIIRRITCVSPDSAMIAL  296

Query  182  GSEMSGGIEDVRASDITALDTESGVRIKTALGRGGYVKNIYVKGLRAHTMKLLFQMTGKY  361
            GSEMSGGI DVRA D+TA++TE+ VRIKTA+GRGGYVKNI+VKG+  +TMK +F +TG Y
Sbjct  297  GSEMSGGIYDVRAEDLTAINTEAAVRIKTAIGRGGYVKNIFVKGMNLNTMKYVFWITGTY  356

Query  362  GSHADKNFDPKAIPVVAGINFRDVVADNVTTAGTMEGIPGHPFTGICMANVTIGMAKNGK  541
            G H D  +DPKA+P + GIN+RDVVA NVT +  +EGI   PFTGIC++NV+I +++  K
Sbjct  357  GDHPDPGYDPKALPYITGINYRDVVATNVTKSARLEGISNDPFTGICISNVSIQVSEQQK  416

Query  542  KQPPWVCANIQGVASGVVPPPCNLLHSQGPVKPGMCDLPA  661
            K   W C+NI GV S V P PC LL  +G ++   C  P 
Sbjct  417  KL-QWNCSNISGVTSNVTPYPCALLPEKGQLE---CPFPT  452



>ref|XP_010024977.1| PREDICTED: probable polygalacturonase [Eucalyptus grandis]
Length=462

 Score =   278 bits (712),  Expect = 4e-87, Method: Compositional matrix adjust.
 Identities = 134/210 (64%), Positives = 165/210 (79%), Gaps = 1/210 (0%)
 Frame = +2

Query  2    INPDSCTKVRIEDNYIVSGDDCVAIKSGIDEYGIKYGMPTKQLIIRRLTCISPTSGAIAM  181
            INPDS + VRIEDNYIVSGDDC+AIKSG D+YGIK+G PT+ + IRRLTCISP S AIA+
Sbjct  225  INPDSSSNVRIEDNYIVSGDDCIAIKSGWDQYGIKFGKPTEHVSIRRLTCISPDSAAIAL  284

Query  182  GSEMSGGIEDVRASDITALDTESGVRIKTALGRGGYVKNIYVKGLRAHTMKLLFQMTGKY  361
            GSEMSGGI+DVRA  I A++T+SGVRIKTA GRGGYVK+I+VKG+   TMK  F MTG Y
Sbjct  285  GSEMSGGIQDVRAETIVAINTQSGVRIKTAPGRGGYVKDIFVKGMIMKTMKYAFWMTGSY  344

Query  362  GSHADKNFDPKAIPVVAGINFRDVVADNVTTAGTMEGIPGHPFTGICMANVTIGMAKNGK  541
             SH D  +DPKA+PV+ GIN+RD+VA+NVT +  ++GI G PFTGIC++NV I ++KN K
Sbjct  345  NSHPDTGYDPKALPVIQGINYRDMVAENVTYSAKLDGIKGDPFTGICISNVQIELSKNPK  404

Query  542  KQPPWVCANIQGVASGVVPPPCNLLHSQGP  631
            K   W C +I+GV S V P  C+LL  + P
Sbjct  405  KL-QWNCTDIEGVTSNVTPVACDLLPKKEP  433



>ref|XP_002513653.1| polygalacturonase, putative [Ricinus communis]
 gb|EEF49056.1| polygalacturonase, putative [Ricinus communis]
Length=473

 Score =   278 bits (712),  Expect = 4e-87, Method: Compositional matrix adjust.
 Identities = 133/219 (61%), Positives = 166/219 (76%), Gaps = 5/219 (2%)
 Frame = +2

Query  2    INPDSCTKVRIEDNYIVSGDDCVAIKSGIDEYGIKYGMPTKQLIIRRLTCISPTSGAIAM  181
            INPDSCT  RIED YIVSGDDC+A+KSG D+YGIK+GMPTK+L+IRRLTCISP S  IA+
Sbjct  242  INPDSCTNTRIEDCYIVSGDDCIAVKSGWDQYGIKFGMPTKKLVIRRLTCISPDSATIAL  301

Query  182  GSEMSGGIEDVRASDITALDTESGVRIKTALGRGGYVKNIYVKGLRAHTMKLLFQMTGKY  361
            GSEMSGGI+DVRA DITA++T+SG+RIKTA GRG YVK+I+V+ +   TMK +F MTG Y
Sbjct  302  GSEMSGGIQDVRAEDITAINTQSGIRIKTAAGRGAYVKDIFVRRMNFKTMKYVFWMTGSY  361

Query  362  GSHADKNFDPKAIPVVAGINFRDVVADNVTTAGTMEGIPGHPFTGICMANVTIGMAKNGK  541
            GSH DK +DP A+P++  IN+RD+VA+NVT +  +EGI   PFTGIC++N  I + K  +
Sbjct  362  GSHPDKGYDPNALPIITRINYRDIVAENVTYSARLEGIEKDPFTGICISNANITLTKKPE  421

Query  542  KQPPWVCANIQGVASGVVPPPCNLLHSQGPVKPGMCDLP  658
            K   W C +I+GV S V P PC+LL    P K   C  P
Sbjct  422  KL-QWNCTDIEGVTSNVNPRPCSLL----PGKRLECPFP  455



>ref|XP_009382256.1| PREDICTED: probable polygalacturonase isoform X1 [Musa acuminata 
subsp. malaccensis]
Length=486

 Score =   279 bits (713),  Expect = 4e-87, Method: Compositional matrix adjust.
 Identities = 134/219 (61%), Positives = 167/219 (76%), Gaps = 3/219 (1%)
 Frame = +2

Query  2    INPDSCTKVRIEDNYIVSGDDCVAIKSGIDEYGIKYGMPTKQLIIRRLTCISPTSGAIAM  181
            INPDS + VRIED YIVSGDDC+AIKSG DEYGI + M +K ++IRRLTCISPTS  IA+
Sbjct  250  INPDSSSNVRIEDCYIVSGDDCIAIKSGWDEYGIAFNMSSKHIVIRRLTCISPTSAVIAL  309

Query  182  GSEMSGGIEDVRASDITALDTESGVRIKTALGRGGYVKNIYVKGLRAHTMKLLFQMTGKY  361
            GSEMSGGI+DVRA DITA+ +ESGVRIKTA+GRG YVK+I+V+ +  HTMK +F MTG Y
Sbjct  310  GSEMSGGIQDVRAEDITAIHSESGVRIKTAIGRGAYVKDIFVRRMNLHTMKWVFWMTGTY  369

Query  362  GSHADKNFDPKAIPVVAGINFRDVVADNVTTAGTMEGIPGHPFTGICMANVTIGMAKNGK  541
            G H D  FDPKAIPVV  I++ +VVA+NVT A  +EGIPG PFTGIC+ NVT  + ++  
Sbjct  370  GQHPDDKFDPKAIPVVQNISYSNVVAENVTMAAKLEGIPGAPFTGICIYNVTAEVVRS--  427

Query  542  KQPPWVCANIQGVASGVVPPPCNLLHSQGPVKPGMCDLP  658
            K+P W C +++GV+S V P PC L+  + P +   C  P
Sbjct  428  KKPIWNCTDVEGVSSHVTPTPCALI-PESPDRITHCPFP  465



>ref|NP_001240215.1| uncharacterized protein LOC100785005 precursor [Glycine max]
 gb|ACU17976.1| unknown [Glycine max]
Length=477

 Score =   278 bits (712),  Expect = 5e-87, Method: Compositional matrix adjust.
 Identities = 128/205 (62%), Positives = 163/205 (80%), Gaps = 3/205 (1%)
 Frame = +2

Query  2    INPDSCTKVRIEDNYIVSGDDCVAIKSGIDEYGIKYGMPTKQLIIRRLTCISPTSGAIAM  181
            I+PDSC+ +RIED YIVSGDDCVAIKSG DEYGIK+GMP++ +IIRRL C+SP S  IA+
Sbjct  242  IDPDSCSNIRIEDCYIVSGDDCVAIKSGWDEYGIKFGMPSQHIIIRRLECVSPDSAMIAL  301

Query  182  GSEMSGGIEDVRASDITALDTESGVRIKTALGRGGYVKNIYVKGLRAHTMKLLFQMTGKY  361
            GSEMSGGI+DVRA D+TA++T+S VRIKTA+GRG YV++I++KG+  +TMK +F MTG Y
Sbjct  302  GSEMSGGIQDVRAEDLTAINTQSAVRIKTAVGRGAYVRDIFIKGMNLNTMKYVFWMTGSY  361

Query  362  GSHADKNFDPKAIPVVAGINFRDVVADNVTTAGTMEGIPGHPFTGICMANVTIGMAKNGK  541
             SH D  FDPK +P + GIN+RDV+A+NVT +  +EGI   PFTGIC++NVTI    +GK
Sbjct  362  SSHPDNGFDPKTLPNITGINYRDVIAENVTYSARLEGIANDPFTGICISNVTI---HSGK  418

Query  542  KQPPWVCANIQGVASGVVPPPCNLL  616
            K+  W C +I+GV S V P PC LL
Sbjct  419  KKLQWNCTDIEGVTSNVYPKPCELL  443



>ref|XP_008380132.1| PREDICTED: probable polygalacturonase [Malus domestica]
Length=474

 Score =   278 bits (711),  Expect = 5e-87, Method: Compositional matrix adjust.
 Identities = 129/208 (62%), Positives = 162/208 (78%), Gaps = 1/208 (0%)
 Frame = +2

Query  2    INPDSCTKVRIEDNYIVSGDDCVAIKSGIDEYGIKYGMPTKQLIIRRLTCISPTSGAIAM  181
            INPDSC+++RIED YIVSGDDC+A+KSG DEYGIK G+PT+ L+IRRLTCISP+S  IA+
Sbjct  235  INPDSCSQIRIEDCYIVSGDDCIAVKSGFDEYGIKVGIPTEHLVIRRLTCISPSSATIAL  294

Query  182  GSEMSGGIEDVRASDITALDTESGVRIKTALGRGGYVKNIYVKGLRAHTMKLLFQMTGKY  361
            GSEMSGGI DVRA DITA+DTES VRIKTA+GRGGYVK+IYV+ +   TMK +F MTG Y
Sbjct  295  GSEMSGGIRDVRAEDITAIDTESSVRIKTAVGRGGYVKDIYVRRMTLKTMKYVFWMTGSY  354

Query  362  GSHADKNFDPKAIPVVAGINFRDVVADNVTTAGTMEGIPGHPFTGICMANVTIGMAKNGK  541
            GSH D  FDPKA+P +  IN++ VVA+NVT +  ++GI   PF GIC++NVTI +A+  K
Sbjct  355  GSHPDPGFDPKALPEITNINYKQVVAENVTISARLDGIHDDPFKGICISNVTITLAEKAK  414

Query  542  KQPPWVCANIQGVASGVVPPPCNLLHSQ  625
            K   W C +++G+ S   P  C+LL  Q
Sbjct  415  KL-QWNCTDVEGITSNXTPKACDLLPEQ  441



>gb|KCW90638.1| hypothetical protein EUGRSUZ_A02742 [Eucalyptus grandis]
Length=464

 Score =   278 bits (711),  Expect = 6e-87, Method: Compositional matrix adjust.
 Identities = 134/210 (64%), Positives = 165/210 (79%), Gaps = 1/210 (0%)
 Frame = +2

Query  2    INPDSCTKVRIEDNYIVSGDDCVAIKSGIDEYGIKYGMPTKQLIIRRLTCISPTSGAIAM  181
            INPDS + VRIEDNYIVSGDDC+AIKSG D+YGIK+G PT+ + IRRLTCISP S AIA+
Sbjct  227  INPDSSSNVRIEDNYIVSGDDCIAIKSGWDQYGIKFGKPTEHVSIRRLTCISPDSAAIAL  286

Query  182  GSEMSGGIEDVRASDITALDTESGVRIKTALGRGGYVKNIYVKGLRAHTMKLLFQMTGKY  361
            GSEMSGGI+DVRA  I A++T+SGVRIKTA GRGGYVK+I+VKG+   TMK  F MTG Y
Sbjct  287  GSEMSGGIQDVRAETIVAINTQSGVRIKTAPGRGGYVKDIFVKGMIMKTMKYAFWMTGSY  346

Query  362  GSHADKNFDPKAIPVVAGINFRDVVADNVTTAGTMEGIPGHPFTGICMANVTIGMAKNGK  541
             SH D  +DPKA+PV+ GIN+RD+VA+NVT +  ++GI G PFTGIC++NV I ++KN K
Sbjct  347  NSHPDTGYDPKALPVIQGINYRDMVAENVTYSAKLDGIKGDPFTGICISNVQIELSKNPK  406

Query  542  KQPPWVCANIQGVASGVVPPPCNLLHSQGP  631
            K   W C +I+GV S V P  C+LL  + P
Sbjct  407  KL-QWNCTDIEGVTSNVTPVACDLLPKKEP  435



>ref|XP_009375527.1| PREDICTED: probable polygalacturonase [Pyrus x bretschneideri]
Length=471

 Score =   278 bits (710),  Expect = 8e-87, Method: Compositional matrix adjust.
 Identities = 129/208 (62%), Positives = 162/208 (78%), Gaps = 1/208 (0%)
 Frame = +2

Query  2    INPDSCTKVRIEDNYIVSGDDCVAIKSGIDEYGIKYGMPTKQLIIRRLTCISPTSGAIAM  181
            INPDSC+++RIED YIVSGDDC+A+KSG DEYGIK G+PT+ L+IRRLTCISP+S  IA+
Sbjct  235  INPDSCSQIRIEDCYIVSGDDCIAVKSGFDEYGIKVGIPTEHLVIRRLTCISPSSATIAL  294

Query  182  GSEMSGGIEDVRASDITALDTESGVRIKTALGRGGYVKNIYVKGLRAHTMKLLFQMTGKY  361
            GSEMSGGI DVR  DITA+DTES VRIKTA+GRGGYVK+IYV+ +   TMK +F MTG Y
Sbjct  295  GSEMSGGIRDVRGEDITAIDTESSVRIKTAVGRGGYVKDIYVRRMTLKTMKYVFWMTGSY  354

Query  362  GSHADKNFDPKAIPVVAGINFRDVVADNVTTAGTMEGIPGHPFTGICMANVTIGMAKNGK  541
            GSH D  FDPKA+P +  IN++ VVA+NVT +  ++GI   PF GIC++NVTI +A+  K
Sbjct  355  GSHPDPCFDPKALPEITNINYKQVVAENVTISARLDGIHDDPFKGICISNVTITLAEKAK  414

Query  542  KQPPWVCANIQGVASGVVPPPCNLLHSQ  625
            K   W C +++G+ S V P  C+LL  Q
Sbjct  415  KL-QWNCTDVEGITSNVTPKACDLLPEQ  441



>ref|XP_003624874.1| hypothetical protein MTR_7g088550 [Medicago truncatula]
 gb|AES81092.1| pectin lyase superfamily protein [Medicago truncatula]
Length=476

 Score =   278 bits (710),  Expect = 9e-87, Method: Compositional matrix adjust.
 Identities = 133/210 (63%), Positives = 169/210 (80%), Gaps = 2/210 (1%)
 Frame = +2

Query  2    INPDSCTKVRIEDNYIVSGDDCVAIKSGIDEYGIKYGMPTKQLIIRRLTCISPTSGAIAM  181
            I+PDS T VRIEDNYIVSGDDC+AIKSG D+YGIK+G P+KQ+IIRRLTCISP S  IA+
Sbjct  239  IDPDSSTNVRIEDNYIVSGDDCIAIKSGWDQYGIKFGKPSKQIIIRRLTCISPDSAMIAL  298

Query  182  GSEMSGGIEDVRASDITALDTESGVRIKTALGRGGYVKNIYVKGLRAHT-MKLLFQMTGK  358
            GSEMSGGIE+VR  D+TA++TES VRIK+A+GRGGYVK+I+VKG++ +T ++ +F +TG 
Sbjct  299  GSEMSGGIENVRVEDVTAINTESAVRIKSAVGRGGYVKDIFVKGVKLNTILRYVFWLTGS  358

Query  359  YGSHADKNFDPKAIPVVAGINFRDVVADNVTTAGTMEGIPGHPFTGICMANVTIGMAK-N  535
            YG H D  FDPKA+P + GI FRDV+A NVT AG +EGI   PFTGIC++NVTI +++  
Sbjct  359  YGDHPDNGFDPKALPKITGIIFRDVIAKNVTVAGQLEGISNDPFTGICISNVTIELSELK  418

Query  536  GKKQPPWVCANIQGVASGVVPPPCNLLHSQ  625
             KK+ PW C ++ GV S VVP PC+LL  +
Sbjct  419  KKKKLPWNCTDVSGVTSNVVPKPCDLLSEK  448



>ref|XP_003592202.1| hypothetical protein MTR_1g100060 [Medicago truncatula]
Length=487

 Score =   278 bits (710),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 130/208 (63%), Positives = 163/208 (78%), Gaps = 1/208 (0%)
 Frame = +2

Query  2    INPDSCTKVRIEDNYIVSGDDCVAIKSGIDEYGIKYGMPTKQLIIRRLTCISPTSGAIAM  181
            I+PDS T V IEDNYIVSGDDC+AIKSG DEYGIK G P++ +I+RRLTCISP S  +A+
Sbjct  253  IDPDSSTNVLIEDNYIVSGDDCIAIKSGWDEYGIKVGKPSQNIIVRRLTCISPKSALVAL  312

Query  182  GSEMSGGIEDVRASDITALDTESGVRIKTALGRGGYVKNIYVKGLRAHTMKLLFQMTGKY  361
            GSEMSGGI+DVR  D+TA++TES VRIK+A+GRG +VK+I+VKG+  +T+K +F MTG Y
Sbjct  313  GSEMSGGIQDVRIEDVTAINTESAVRIKSAVGRGAFVKDIFVKGMDLNTLKYVFWMTGSY  372

Query  362  GSHADKNFDPKAIPVVAGINFRDVVADNVTTAGTMEGIPGHPFTGICMANVTIGMAKNGK  541
            G H D  FDP A+P ++GIN+RDV A NVT AG +EGI   PFTGIC++NVTI M+ + K
Sbjct  373  GDHPDNGFDPNALPKISGINYRDVTAKNVTIAGKVEGISNDPFTGICVSNVTIEMSAH-K  431

Query  542  KQPPWVCANIQGVASGVVPPPCNLLHSQ  625
            K+ PW C +I GV S VVP PC LL  +
Sbjct  432  KKLPWNCTDISGVTSNVVPKPCELLKEK  459



>ref|XP_004496831.1| PREDICTED: probable polygalacturonase-like [Cicer arietinum]
Length=481

 Score =   277 bits (709),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 133/221 (60%), Positives = 168/221 (76%), Gaps = 5/221 (2%)
 Frame = +2

Query  2    INPDSCTKVRIEDNYIVSGDDCVAIKSGIDEYGIKYGMPTKQLIIRRLTCISPTSGAIAM  181
            INPDSC+ V+IEDN+IVSGDDC+AIKSG DEYGIK GMPT+ +IIRRLTCISP S  IA+
Sbjct  244  INPDSCSNVKIEDNFIVSGDDCIAIKSGWDEYGIKVGMPTQHVIIRRLTCISPDSATIAL  303

Query  182  GSEMSGGIEDVRASDITALDTESGVRIKTALGRGGYVKNIYVKGLRAHTMKLLFQMTGKY  361
            GSEMSGGI+DVRA DITA+ TES VRIK+A+GRGG+V++I+VKG+  +TMK +F MTG Y
Sbjct  304  GSEMSGGIQDVRAEDITAISTESAVRIKSAVGRGGFVRDIFVKGMNLNTMKYVFWMTGSY  363

Query  362  GSHADKNFDPKAIPVVAGINFRDVVADNVTTAGTMEGIPGHPFTGICMANVTIGMAKNGK  541
             SHAD+ FDPKA+P V  IN+ +++A  VT A  +EGI   P+TGIC++N  I MA   K
Sbjct  364  SSHADEGFDPKALPNVTNINYSNIIAKKVTYAAQLEGISNDPYTGICISNTNIEMAAK-K  422

Query  542  KQPPWVCANIQGV-ASGVVPPPCNLLHSQGPVKPGMCDLPA  661
            K+ PW C ++ GV +S V P PC LL  +G  +   C  P+
Sbjct  423  KKLPWNCTDVSGVTSSDVTPQPCALLPQKGKFE---CAYPS  460



>ref|XP_009377556.1| PREDICTED: probable polygalacturonase [Pyrus x bretschneideri]
 ref|XP_009377601.1| PREDICTED: probable polygalacturonase [Pyrus x bretschneideri]
Length=471

 Score =   276 bits (707),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 128/208 (62%), Positives = 161/208 (77%), Gaps = 1/208 (0%)
 Frame = +2

Query  2    INPDSCTKVRIEDNYIVSGDDCVAIKSGIDEYGIKYGMPTKQLIIRRLTCISPTSGAIAM  181
            INPDSC+++RIED YIVSGDDC+A+KSG DEYGIK G+PT+ L+IRRLTCISP+S  IA+
Sbjct  235  INPDSCSQIRIEDCYIVSGDDCIAVKSGFDEYGIKVGIPTEHLVIRRLTCISPSSATIAL  294

Query  182  GSEMSGGIEDVRASDITALDTESGVRIKTALGRGGYVKNIYVKGLRAHTMKLLFQMTGKY  361
            GSEMSGGI DVR  DITA+D ES VRIKTA+GRGGYVK+IYV+ +   TMK +F MTG Y
Sbjct  295  GSEMSGGIRDVRGEDITAIDAESSVRIKTAVGRGGYVKDIYVRRMTLKTMKYVFWMTGSY  354

Query  362  GSHADKNFDPKAIPVVAGINFRDVVADNVTTAGTMEGIPGHPFTGICMANVTIGMAKNGK  541
            GSH D  FDPKA+P +  IN++ VVA+NVT +  ++GI   PF GIC++NVTI +A+  K
Sbjct  355  GSHPDPGFDPKALPEITNINYKQVVAENVTISARLDGIHDDPFKGICISNVTITLAEKAK  414

Query  542  KQPPWVCANIQGVASGVVPPPCNLLHSQ  625
            K   W C +++G+ S V P  C+LL  Q
Sbjct  415  KL-QWNCTDVEGITSNVTPKACDLLPEQ  441



>ref|XP_002273669.1| PREDICTED: probable polygalacturonase [Vitis vinifera]
Length=478

 Score =   276 bits (706),  Expect = 4e-86, Method: Compositional matrix adjust.
 Identities = 129/205 (63%), Positives = 163/205 (80%), Gaps = 1/205 (0%)
 Frame = +2

Query  2    INPDSCTKVRIEDNYIVSGDDCVAIKSGIDEYGIKYGMPTKQLIIRRLTCISPTSGAIAM  181
            INPDSC KVRIED +IVSGDDC+A+KSG D+YG K+GMPTK L+IRRLTCISP S  IA+
Sbjct  241  INPDSCKKVRIEDCFIVSGDDCIAVKSGWDQYGYKFGMPTKDLLIRRLTCISPDSATIAL  300

Query  182  GSEMSGGIEDVRASDITALDTESGVRIKTALGRGGYVKNIYVKGLRAHTMKLLFQMTGKY  361
            GSEMSGGI++V A DITA+DT+SG+RIKT +GRGGYVK+IYV+ +   TMK +F +TG Y
Sbjct  301  GSEMSGGIKNVWAEDITAIDTQSGIRIKTGIGRGGYVKDIYVRRMTVKTMKYVFWITGDY  360

Query  362  GSHADKNFDPKAIPVVAGINFRDVVADNVTTAGTMEGIPGHPFTGICMANVTIGMAKNGK  541
            GSH D  +DPKA+PV+  IN+RD+VA+NVT +  ++GI G PFTGIC++NVTIG+ +   
Sbjct  361  GSHPDDGWDPKALPVIKNINYRDMVAENVTYSARLDGISGDPFTGICISNVTIGLTEK-P  419

Query  542  KQPPWVCANIQGVASGVVPPPCNLL  616
            K+  W C N+ GV S V P  C+LL
Sbjct  420  KELQWNCTNVAGVTSQVTPRSCDLL  444



>ref|XP_010230291.1| PREDICTED: probable polygalacturonase, partial [Brachypodium 
distachyon]
Length=433

 Score =   275 bits (702),  Expect = 5e-86, Method: Compositional matrix adjust.
 Identities = 133/221 (60%), Positives = 170/221 (77%), Gaps = 5/221 (2%)
 Frame = +2

Query  2    INPDSCTKVRIEDNYIVSGDDCVAIKSGIDEYGIKYGMPTKQLIIRRLTCISPTSGAIAM  181
            I+PDS + V+IED YIVSGDDC+A+KSG DEYGIK+ MP++ +++RRLTCISPTS  IA+
Sbjct  204  IDPDSSSYVKIEDCYIVSGDDCIAVKSGWDEYGIKFNMPSQHIVVRRLTCISPTSAMIAL  263

Query  182  GSEMSGGIEDVRASDITALDTESGVRIKTALGRGGYVKNIYVKGLRAHTMKLLFQMTGKY  361
            GSEMSGGI+DVRA D  A++TES VRIK+ +GRGG+VK+++V+GL  HTMK +F MTG Y
Sbjct  264  GSEMSGGIQDVRAEDNIAINTESAVRIKSGVGRGGFVKDVFVRGLSLHTMKWVFWMTGNY  323

Query  362  GSHADKNFDPKAIPVVAGINFRDVVADNVTTAGTMEGIPGHPFTGICMANVTIGMAKNGK  541
            G H D + +PKA+P V GIN+RDV A+NVT AG MEGIP  P+TGICM+NVT  +A + K
Sbjct  324  GQHPDNSSNPKALPEVTGINYRDVFAENVTMAGRMEGIPNDPYTGICMSNVTAQLAPDAK  383

Query  542  KQPPWVCANIQGVASGVVPPPCNLLHSQGPVKPGMCDLPAK  664
            K   W C +++GVASGV P PC  L + G  KP  C  P +
Sbjct  384  KL-QWNCTDVKGVASGVSPKPCPELGAVG--KP--CTFPEE  419



>gb|AES62453.2| pectin lyase superfamily protein [Medicago truncatula]
Length=516

 Score =   276 bits (707),  Expect = 7e-86, Method: Compositional matrix adjust.
 Identities = 130/208 (63%), Positives = 163/208 (78%), Gaps = 1/208 (0%)
 Frame = +2

Query  2    INPDSCTKVRIEDNYIVSGDDCVAIKSGIDEYGIKYGMPTKQLIIRRLTCISPTSGAIAM  181
            I+PDS T V IEDNYIVSGDDC+AIKSG DEYGIK G P++ +I+RRLTCISP S  +A+
Sbjct  282  IDPDSSTNVLIEDNYIVSGDDCIAIKSGWDEYGIKVGKPSQNIIVRRLTCISPKSALVAL  341

Query  182  GSEMSGGIEDVRASDITALDTESGVRIKTALGRGGYVKNIYVKGLRAHTMKLLFQMTGKY  361
            GSEMSGGI+DVR  D+TA++TES VRIK+A+GRG +VK+I+VKG+  +T+K +F MTG Y
Sbjct  342  GSEMSGGIQDVRIEDVTAINTESAVRIKSAVGRGAFVKDIFVKGMDLNTLKYVFWMTGSY  401

Query  362  GSHADKNFDPKAIPVVAGINFRDVVADNVTTAGTMEGIPGHPFTGICMANVTIGMAKNGK  541
            G H D  FDP A+P ++GIN+RDV A NVT AG +EGI   PFTGIC++NVTI M+ + K
Sbjct  402  GDHPDNGFDPNALPKISGINYRDVTAKNVTIAGKVEGISNDPFTGICVSNVTIEMSAH-K  460

Query  542  KQPPWVCANIQGVASGVVPPPCNLLHSQ  625
            K+ PW C +I GV S VVP PC LL  +
Sbjct  461  KKLPWNCTDISGVTSNVVPKPCELLKEK  488



>ref|XP_002273177.2| PREDICTED: probable polygalacturonase [Vitis vinifera]
Length=465

 Score =   275 bits (703),  Expect = 7e-86, Method: Compositional matrix adjust.
 Identities = 128/206 (62%), Positives = 163/206 (79%), Gaps = 1/206 (0%)
 Frame = +2

Query  2    INPDSCTKVRIEDNYIVSGDDCVAIKSGIDEYGIKYGMPTKQLIIRRLTCISPTSGAIAM  181
            INPDS   V IED +IVSGDDC+A+KSG D+YGIK+GMPT+ LIIRRLTCISP S  IA+
Sbjct  234  INPDSSKNVLIEDCFIVSGDDCIAVKSGWDQYGIKFGMPTEDLIIRRLTCISPDSAVIAL  293

Query  182  GSEMSGGIEDVRASDITALDTESGVRIKTALGRGGYVKNIYVKGLRAHTMKLLFQMTGKY  361
            GSEMSGGI++VRA +ITA+D+ESGVRIK+ +GRGGYVK+IY +G+   TMK +F MTG Y
Sbjct  294  GSEMSGGIKNVRAENITAIDSESGVRIKSGVGRGGYVKDIYARGMTMKTMKYVFWMTGDY  353

Query  362  GSHADKNFDPKAIPVVAGINFRDVVADNVTTAGTMEGIPGHPFTGICMANVTIGMAKNGK  541
            G H D  +DPKA+P +  IN+RD+VA+NVT +  ++GI G PFTGIC++NV IG+ +  K
Sbjct  354  GQHPDDGWDPKALPKIENINYRDMVAENVTYSARLDGISGDPFTGICISNVKIGLTEKPK  413

Query  542  KQPPWVCANIQGVASGVVPPPCNLLH  619
            K   W C N++GV+S V PP C+LLH
Sbjct  414  KL-QWNCTNVEGVSSQVTPPSCDLLH  438



>ref|XP_010933983.1| PREDICTED: probable polygalacturonase isoform X2 [Elaeis guineensis]
Length=492

 Score =   275 bits (704),  Expect = 9e-86, Method: Compositional matrix adjust.
 Identities = 128/209 (61%), Positives = 165/209 (79%), Gaps = 2/209 (1%)
 Frame = +2

Query  2    INPDSCTKVRIEDNYIVSGDDCVAIKSGIDEYGIKYGMPTKQLIIRRLTCISPTSGAIAM  181
            I+PDS + V IED +IVSGDDC+AIKSG DEYGI + MPT+ +IIRRLTCISPTS  IA+
Sbjct  256  IDPDSSSNVLIEDCFIVSGDDCIAIKSGWDEYGIAFNMPTRHVIIRRLTCISPTSATIAL  315

Query  182  GSEMSGGIEDVRASDITALDTESGVRIKTALGRGGYVKNIYVKGLRAHTMKLLFQMTGKY  361
            GSEMSGGIEDVRA DI A++TESGVRIKTA+GRGGYVK+I+V+ +  +TMK +F M G Y
Sbjct  316  GSEMSGGIEDVRAEDIMAINTESGVRIKTAIGRGGYVKDIFVRRMTLNTMKYVFWMAGNY  375

Query  362  GSHADKNFDPKAIPVVAGINFRDVVADNVTTAGTMEGIPGHPFTGICMANVTIGMAKNGK  541
            G H D  +DP AIP++  IN+RDVVA++VT AG +EG+P  PFTGIC++NVT+ + K+ K
Sbjct  376  GQHPDDKYDPNAIPIIHNINYRDVVAEDVTIAGKLEGLPKAPFTGICLSNVTVDVVKSKK  435

Query  542  KQPPWVCANIQGVASGVVPPPCNLLHSQG  628
             +  W C +++GV+S V+P PC+ L   G
Sbjct  436  LK--WNCTDVEGVSSAVMPTPCDSLRDLG  462



>ref|XP_010933982.1| PREDICTED: probable polygalacturonase isoform X1 [Elaeis guineensis]
Length=501

 Score =   276 bits (705),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 128/209 (61%), Positives = 165/209 (79%), Gaps = 2/209 (1%)
 Frame = +2

Query  2    INPDSCTKVRIEDNYIVSGDDCVAIKSGIDEYGIKYGMPTKQLIIRRLTCISPTSGAIAM  181
            I+PDS + V IED +IVSGDDC+AIKSG DEYGI + MPT+ +IIRRLTCISPTS  IA+
Sbjct  265  IDPDSSSNVLIEDCFIVSGDDCIAIKSGWDEYGIAFNMPTRHVIIRRLTCISPTSATIAL  324

Query  182  GSEMSGGIEDVRASDITALDTESGVRIKTALGRGGYVKNIYVKGLRAHTMKLLFQMTGKY  361
            GSEMSGGIEDVRA DI A++TESGVRIKTA+GRGGYVK+I+V+ +  +TMK +F M G Y
Sbjct  325  GSEMSGGIEDVRAEDIMAINTESGVRIKTAIGRGGYVKDIFVRRMTLNTMKYVFWMAGNY  384

Query  362  GSHADKNFDPKAIPVVAGINFRDVVADNVTTAGTMEGIPGHPFTGICMANVTIGMAKNGK  541
            G H D  +DP AIP++  IN+RDVVA++VT AG +EG+P  PFTGIC++NVT+ + K+ K
Sbjct  385  GQHPDDKYDPNAIPIIHNINYRDVVAEDVTIAGKLEGLPKAPFTGICLSNVTVDVVKSKK  444

Query  542  KQPPWVCANIQGVASGVVPPPCNLLHSQG  628
             +  W C +++GV+S V+P PC+ L   G
Sbjct  445  LK--WNCTDVEGVSSAVMPTPCDSLRDLG  471



>ref|XP_009382257.1| PREDICTED: probable polygalacturonase isoform X2 [Musa acuminata 
subsp. malaccensis]
Length=486

 Score =   275 bits (703),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 134/222 (60%), Positives = 165/222 (74%), Gaps = 3/222 (1%)
 Frame = +2

Query  2    INPDSCTKVRIEDNYIVSGDDCVAIKSGIDEYGIKYGMPTKQLIIRRLTCISPTSGAIAM  181
            INPDS + VRIED YIVSGDDC+AIKSG DEYGI + M +K ++IRRLTCISPTS  IA+
Sbjct  250  INPDSSSNVRIEDCYIVSGDDCIAIKSGWDEYGIAFNMSSKHIVIRRLTCISPTSAVIAL  309

Query  182  GSEMSGGIEDVRASDITALDTESGVRIKTALGRGGYVKNIYVKGLRAHTMKLLFQMTGKY  361
            GSEMSGGI+DVRA DITA+ +ESGVRIKT +GRG YVK+I+V+ +  HTMK +F MTG Y
Sbjct  310  GSEMSGGIQDVRAEDITAIHSESGVRIKTTIGRGAYVKDIFVRRMNLHTMKWVFWMTGTY  369

Query  362  GSHADKNFDPKAIPVVAGINFRDVVADNVTTAGTMEGIPGHPFTGICMANVTIGMAKNGK  541
            G H D  FDPKAIPVV  I + DVVA+NVT A  +EGIPG PFTGIC+ NVT  + K+  
Sbjct  370  GQHPDDKFDPKAIPVVRNIIYSDVVAENVTMAAKLEGIPGAPFTGICIYNVTAEVVKS--  427

Query  542  KQPPWVCANIQGVASGVVPPPCNLLHSQGPVKPGMCDLPAKN  667
            K+P W C +++GV+S V P PC  +  + P +   C  P  +
Sbjct  428  KKPIWNCTDVEGVSSHVTPTPCAQI-PEYPDRITHCPFPEDD  468



>ref|XP_009368731.1| PREDICTED: probable polygalacturonase [Pyrus x bretschneideri]
Length=472

 Score =   275 bits (702),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 128/211 (61%), Positives = 161/211 (76%), Gaps = 1/211 (0%)
 Frame = +2

Query  2    INPDSCTKVRIEDNYIVSGDDCVAIKSGIDEYGIKYGMPTKQLIIRRLTCISPTSGAIAM  181
            I+PDSC++ RIED YIVSGDDC+A+KSG D+YGIK G+PT+ L+IRRLTCISP S  IA+
Sbjct  236  IDPDSCSQTRIEDCYIVSGDDCIAVKSGWDKYGIKVGIPTEHLVIRRLTCISPDSATIAL  295

Query  182  GSEMSGGIEDVRASDITALDTESGVRIKTALGRGGYVKNIYVKGLRAHTMKLLFQMTGKY  361
            GSEMSGGI DVRA DITA+DT+S VRIKTA+GRG YVK+IYV+ +   TMK  F MTG Y
Sbjct  296  GSEMSGGIHDVRAEDITAIDTQSSVRIKTAVGRGAYVKDIYVRRMTLKTMKYAFWMTGSY  355

Query  362  GSHADKNFDPKAIPVVAGINFRDVVADNVTTAGTMEGIPGHPFTGICMANVTIGMAKNGK  541
            GSH D +FDPKA+P +  IN++ VVA+NVT +  ++GIP  PF GIC++NVTI + +  K
Sbjct  356  GSHPDPSFDPKALPEITNINYKQVVAENVTYSARLDGIPNDPFKGICISNVTITLTEKPK  415

Query  542  KQPPWVCANIQGVASGVVPPPCNLLHSQGPV  634
            K   W C N++G+ S V P  C+LL  Q  V
Sbjct  416  KL-QWNCTNVEGITSNVTPKACDLLSEQKEV  445



>dbj|BAK02492.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=378

 Score =   271 bits (694),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 130/221 (59%), Positives = 167/221 (76%), Gaps = 5/221 (2%)
 Frame = +2

Query  2    INPDSCTKVRIEDNYIVSGDDCVAIKSGIDEYGIKYGMPTKQLIIRRLTCISPTSGAIAM  181
            I+PDS + V+IED YIVSGDDC+A+KSG DEYGI++ MP++ +++RRLTCISPTS  IA+
Sbjct  149  IDPDSSSHVKIEDCYIVSGDDCIAVKSGWDEYGIRFNMPSQHIVVRRLTCISPTSAMIAL  208

Query  182  GSEMSGGIEDVRASDITALDTESGVRIKTALGRGGYVKNIYVKGLRAHTMKLLFQMTGKY  361
            GSEMSGGI+DVR  D  A++TES VRIK+ +GRGG+V++++V+ L  HTMK +F MTG Y
Sbjct  209  GSEMSGGIQDVRVEDNIAINTESAVRIKSGVGRGGFVRDVFVRRLSLHTMKWVFWMTGNY  268

Query  362  GSHADKNFDPKAIPVVAGINFRDVVADNVTTAGTMEGIPGHPFTGICMANVTIGMAKNGK  541
            G H D + DPKA+P V GIN+RDV A+NVT AG MEGIP  P+TGICM+NVT  +A   K
Sbjct  269  GQHPDNSSDPKALPEVTGINYRDVFAENVTMAGRMEGIPNDPYTGICMSNVTAQLAPKAK  328

Query  542  KQPPWVCANIQGVASGVVPPPCNLLHSQGPVKPGMCDLPAK  664
            K   W C ++QGVA GV P PC  L ++G  KP  C  P +
Sbjct  329  KL-QWNCTDVQGVAYGVSPEPCPELGAEG--KP--CTFPDE  364



>ref|XP_006829063.1| hypothetical protein AMTR_s00001p00258260 [Amborella trichopoda]
 gb|ERM96479.1| hypothetical protein AMTR_s00001p00258260 [Amborella trichopoda]
Length=487

 Score =   275 bits (702),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 135/220 (61%), Positives = 166/220 (75%), Gaps = 4/220 (2%)
 Frame = +2

Query  2    INPDSCTKVRIEDNYIVSGDDCVAIKSGIDEYGIKYGMPTKQLIIRRLTCISPTSGAIAM  181
            INPDSCT VRIED  IVSGDDC+AIKSG DEYGI +GMP++ +IIRRL C+SP S  IA+
Sbjct  242  INPDSCTHVRIEDCNIVSGDDCIAIKSGWDEYGIAFGMPSQHIIIRRLFCVSPFSAVIAL  301

Query  182  GSEMSGGIEDVRASDITALDTESGVRIKTALGRGGYVKNIYVKGLRAHTMKLLFQMTGKY  361
            GSEMSGGI+DVRA DI A+++E+ VRIKT+ GRGG+VK+IYVKG+    MK +F MTG Y
Sbjct  302  GSEMSGGIQDVRAQDIQAVNSEAAVRIKTSPGRGGFVKDIYVKGMNLENMKWVFTMTGSY  361

Query  362  GSHADKNFDPKAIPVVAGINFRDVVADNVTTAGTMEGIPGHPFTGICMANVTIGMAKNGK  541
            GSH D  +DP A PVV+GIN+RDV+++NVT AG +EGIP  PF  IC++NVTIGM+   K
Sbjct  362  GSHPDNKWDPNAFPVVSGINYRDVISENVTIAGKLEGIPKAPFGDICISNVTIGMSPKSK  421

Query  542  KQP-PWVCANIQGVASGVVPPPCNLLHSQGPVKPGMCDLP  658
            K+  PW C  + G +SGV P PC+LL   G    G C  P
Sbjct  422  KKKLPWNCTYVSGTSSGVTPTPCSLLPESG---YGDCPFP  458



>ref|XP_008376628.1| PREDICTED: probable polygalacturonase [Malus domestica]
Length=475

 Score =   274 bits (700),  Expect = 3e-85, Method: Compositional matrix adjust.
 Identities = 127/211 (60%), Positives = 162/211 (77%), Gaps = 1/211 (0%)
 Frame = +2

Query  2    INPDSCTKVRIEDNYIVSGDDCVAIKSGIDEYGIKYGMPTKQLIIRRLTCISPTSGAIAM  181
            I+PDSC++ RIED YIVSGDDC+A+KSG DEYGIK G+PT+ L+IRRLTCISP S  IA+
Sbjct  236  IDPDSCSQTRIEDCYIVSGDDCIAVKSGWDEYGIKVGIPTEHLVIRRLTCISPDSATIAL  295

Query  182  GSEMSGGIEDVRASDITALDTESGVRIKTALGRGGYVKNIYVKGLRAHTMKLLFQMTGKY  361
            GSEMSGGI DVRA DITA+DT+S VRIKTA+GRG YVK+IYV+ +   TMK +F MTG Y
Sbjct  296  GSEMSGGIRDVRAEDITAIDTQSSVRIKTAVGRGAYVKDIYVRRMTLKTMKYVFWMTGSY  355

Query  362  GSHADKNFDPKAIPVVAGINFRDVVADNVTTAGTMEGIPGHPFTGICMANVTIGMAKNGK  541
            GSH D +FDPKA+P +  IN++ VVA+NVT +  ++G+P  PF GIC++NVTI + +  K
Sbjct  356  GSHPDPSFDPKALPEITNINYKQVVAENVTYSARLDGVPNDPFKGICISNVTITLTEKPK  415

Query  542  KQPPWVCANIQGVASGVVPPPCNLLHSQGPV  634
            K   W C N++G+ S V P  C+LL  +  V
Sbjct  416  KL-QWNCTNVEGITSNVTPKACDLLPEKKEV  445



>ref|XP_006656549.1| PREDICTED: probable polygalacturonase-like [Oryza brachyantha]
Length=479

 Score =   274 bits (700),  Expect = 3e-85, Method: Compositional matrix adjust.
 Identities = 131/219 (60%), Positives = 163/219 (74%), Gaps = 5/219 (2%)
 Frame = +2

Query  2    INPDSCTKVRIEDNYIVSGDDCVAIKSGIDEYGIKYGMPTKQLIIRRLTCISPTSGAIAM  181
            INPDSC+ VRIED YIVSGDDCVAIKSG DEYGI YGMP++ +++RRLTC+SPTS  IA+
Sbjct  245  INPDSCSHVRIEDCYIVSGDDCVAIKSGWDEYGIAYGMPSQHIVVRRLTCVSPTSAVIAL  304

Query  182  GSEMSGGIEDVRASDITALDTESGVRIKTALGRGGYVKNIYVKGLRAHTMKLLFQMTGKY  361
            GSEMSGGI DVRA DITA+++ESGVRIKTA+GRG YV++++V+ +   TMK +F MTG Y
Sbjct  305  GSEMSGGINDVRAEDITAVNSESGVRIKTAVGRGAYVRDVFVRRMSLDTMKWVFWMTGNY  364

Query  362  GSHADKNFDPKAIPVVAGINFRDVVADNVTTAGTMEGIPGHPFTGICMANVTIGMAKNGK  541
             SH D  +DP AIPVV  I+++DVVA  V TA  +EGI G PF  IC+ANVT  +AK+ K
Sbjct  365  KSHPDDKYDPNAIPVVENISYQDVVATAVNTAARLEGIQGAPFRDICIANVTATLAKSRK  424

Query  542  KQPPWVCANIQGVASGVVPPPCNLLHSQGPVKPGMCDLP  658
               PW C +++GV++GV P PC  L        G C  P
Sbjct  425  Y--PWTCTDVEGVSAGVTPSPCQPLQGS---HDGACPFP  458



>ref|NP_001048813.1| Os03g0124900 [Oryza sativa Japonica Group]
 gb|ABF93740.1| polygalacturonase, putative, expressed [Oryza sativa Japonica 
Group]
 dbj|BAF10727.1| Os03g0124900 [Oryza sativa Japonica Group]
 gb|EAZ25422.1| hypothetical protein OsJ_09236 [Oryza sativa Japonica Group]
Length=458

 Score =   273 bits (698),  Expect = 3e-85, Method: Compositional matrix adjust.
 Identities = 133/221 (60%), Positives = 167/221 (76%), Gaps = 5/221 (2%)
 Frame = +2

Query  2    INPDSCTKVRIEDNYIVSGDDCVAIKSGIDEYGIKYGMPTKQLIIRRLTCISPTSGAIAM  181
            I+PDS + V+IED+YIVSGDDC+A+KSG D+YGIK+ MP++ ++IRRLTCISPTS  IA+
Sbjct  229  IDPDSSSHVKIEDSYIVSGDDCIAVKSGWDQYGIKFNMPSQHILIRRLTCISPTSAMIAL  288

Query  182  GSEMSGGIEDVRASDITALDTESGVRIKTALGRGGYVKNIYVKGLRAHTMKLLFQMTGKY  361
            GSEMSGGI DVRA D  A+DTES VRIK+ +GRGGYVK+++V+GL  HTMK +F MTG Y
Sbjct  289  GSEMSGGIRDVRAVDNVAIDTESAVRIKSGVGRGGYVKDVFVRGLSLHTMKWVFWMTGNY  348

Query  362  GSHADKNFDPKAIPVVAGINFRDVVADNVTTAGTMEGIPGHPFTGICMANVTIGMAKNGK  541
            G H D + DP A+P V GIN+ DV A+NVT AG MEGIP  P+TGICM+NVT  +A + K
Sbjct  349  GQHPDNSSDPNALPEVTGINYSDVFAENVTMAGRMEGIPNDPYTGICMSNVTAQLAPDAK  408

Query  542  KQPPWVCANIQGVASGVVPPPCNLLHSQGPVKPGMCDLPAK  664
            K   W C +++GVAS V P PC  L + G  KP  C  P +
Sbjct  409  KL-QWNCTDVKGVASDVSPVPCPELGAAG--KP--CAFPEE  444



>gb|AFK49026.1| unknown [Lotus japonicus]
Length=388

 Score =   271 bits (692),  Expect = 3e-85, Method: Compositional matrix adjust.
 Identities = 127/208 (61%), Positives = 157/208 (75%), Gaps = 3/208 (1%)
 Frame = +2

Query  2    INPDSCTKVRIEDNYIVSGDDCVAIKSGIDEYGIKYGMPTKQLIIRRLTCISPTSGAIAM  181
            I+PDSC+  RIED YIVSGDDC+A+KSG DEYGIK GMP++ +IIRRLTCISP S  IA+
Sbjct  180  IDPDSCSNTRIEDCYIVSGDDCIAVKSGWDEYGIKVGMPSQHIIIRRLTCISPDSAMIAL  239

Query  182  GSEMSGGIEDVRASDITALDTESGVRIKTALGRGGYVKNIYVKGLRAHTMKLLFQMTGKY  361
            GSEMSGGI+D+RA D+TA++T+S VRIKTA+GRG YV+NI+V+G+   TMK +F MTG Y
Sbjct  240  GSEMSGGIQDIRAEDLTAINTQSAVRIKTAVGRGAYVRNIFVEGMNLFTMKYVFWMTGSY  299

Query  362  GSHADKNFDPKAIPVVAGINFRDVVADNVTTAGTMEGIPGHPFTGICMANVTIGMAKNGK  541
            GSH D  FDPKA+P + GIN+RDV+A NV     +EGI   PFTGIC++N  I   K GK
Sbjct  300  GSHPDTGFDPKALPTITGINYRDVIAKNVAYPAKLEGIANDPFTGICISNANI--EKVGK  357

Query  542  KQPPWVCANIQGVASGVVPPPCNLLHSQ  625
            K   W C ++ GV S V P PC LL  +
Sbjct  358  KL-AWNCTDVHGVTSNVSPEPCALLQEK  384



>ref|XP_008437531.1| PREDICTED: probable polygalacturonase [Cucumis melo]
Length=480

 Score =   273 bits (699),  Expect = 5e-85, Method: Compositional matrix adjust.
 Identities = 128/220 (58%), Positives = 166/220 (75%), Gaps = 3/220 (1%)
 Frame = +2

Query  2    INPDSCTKVRIEDNYIVSGDDCVAIKSGIDEYGIKYGMPTKQLIIRRLTCISPTSGAIAM  181
            I+PDSC+ +RIED +IVSGDDC+A+KSG D+YGIK+GMPT+ L+IRRLTCISP S  IA+
Sbjct  243  IDPDSCSNIRIEDCFIVSGDDCIAVKSGWDQYGIKFGMPTEDLVIRRLTCISPDSAGIAL  302

Query  182  GSEMSGGIEDVRASDITALDTESGVRIKTALGRGGYVKNIYVKGLRAHTMKLLFQMTGKY  361
            GSEMSGGI +VR  ++T ++T+S VRIKTA GRGG+VK+I+V+G+   TMK +F MTG Y
Sbjct  303  GSEMSGGIRNVRIENVTGINTQSAVRIKTARGRGGFVKDIFVRGMYLSTMKYVFWMTGNY  362

Query  362  GSHADKNFDPKAIPVVAGINFRDVVADNVTTAGTMEGIPGHPFTGICMANVTIGMAKNGK  541
             SH D+ FDP A+P +  IN+RDVVA+NVT +  +EGI G PFT IC++NV IG+    K
Sbjct  363  KSHPDEKFDPAALPEITNINYRDVVAENVTYSARLEGISGDPFTNICISNVKIGLTAKPK  422

Query  542  KQPPWVCANIQGVASGVVPPPCNLLHSQGPVKPGMCDLPA  661
            K   W C +++G++S VVPPPC  L      K G CD PA
Sbjct  423  KL-QWNCTDVEGISSDVVPPPCAPLAKAA--KSGGCDFPA  459



>ref|XP_011046019.1| PREDICTED: probable polygalacturonase [Populus euphratica]
Length=452

 Score =   273 bits (697),  Expect = 5e-85, Method: Compositional matrix adjust.
 Identities = 129/219 (59%), Positives = 164/219 (75%), Gaps = 5/219 (2%)
 Frame = +2

Query  2    INPDSCTKVRIEDNYIVSGDDCVAIKSGIDEYGIKYGMPTKQLIIRRLTCISPTSGAIAM  181
            INPDS + VRIED+++VSGDDC+A+KSG DEYGIK+G PT+ L+IRR +CISP S AIA+
Sbjct  221  INPDSSSNVRIEDSFVVSGDDCIAVKSGWDEYGIKFGRPTQHLVIRRFSCISPDSAAIAL  280

Query  182  GSEMSGGIEDVRASDITALDTESGVRIKTALGRGGYVKNIYVKGLRAHTMKLLFQMTGKY  361
            GSEMSGGI+DVRA DITAL T+SGVRIKTA+GRG YVK+I+V+ +   TMK  F MTG Y
Sbjct  281  GSEMSGGIQDVRAEDITALSTQSGVRIKTAVGRGAYVKDIFVRRMILKTMKYAFWMTGSY  340

Query  362  GSHADKNFDPKAIPVVAGINFRDVVADNVTTAGTMEGIPGHPFTGICMANVTIGMAKNGK  541
            GSH D  +DPKA+P + GI+++D+VA+NVT +  +EGI   PFTGIC++NV I + +   
Sbjct  341  GSHPDTGYDPKALPEIKGISYKDIVAENVTYSARLEGIENDPFTGICISNVNISLTQK-P  399

Query  542  KQPPWVCANIQGVASGVVPPPCNLLHSQGPVKPGMCDLP  658
            K+  W C +IQGV+S V P PC  L    P K   C  P
Sbjct  400  KELQWNCTDIQGVSSKVTPQPCAAL----PEKSIECPFP  434



>ref|XP_011076107.1| PREDICTED: probable polygalacturonase [Sesamum indicum]
Length=500

 Score =   272 bits (696),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 131/225 (58%), Positives = 164/225 (73%), Gaps = 9/225 (4%)
 Frame = +2

Query  2    INPDSCTKVRIEDNYIVSGDDCVAIKSGIDEYGIKYGMPTKQLIIRRLTCISPTSGAIAM  181
            INPDSC+  RI D+Y+VSGDDC+A+KSG DEYGIK+GMPT+ L IRR TCISP S  IA+
Sbjct  260  INPDSCSNTRIRDSYVVSGDDCIAVKSGWDEYGIKFGMPTQHLSIRRFTCISPDSAVIAL  319

Query  182  GSEMSGGIEDVRASDITALDTESGVRIKTALGRGGYVKNIYVKGLRAHTMKLLFQMTGKY  361
            GSEMSGGI+DVRA +I A++++SGVRIKTA GRG YVK+I+V+    +TMK +F MTG Y
Sbjct  320  GSEMSGGIQDVRAEEIYAINSQSGVRIKTAPGRGAYVKDIFVRNFNMNTMKYVFWMTGAY  379

Query  362  GSHADKNFDPKAIPVVAGINFRDVVADNVTTAGTMEGIPGHPFTGICMANVTIGMAKN--  535
            GSH DK +DPKA+P +  IN+RD+V  NVT  G + GI   PFTGIC++NVTI +  +  
Sbjct  380  GSHPDKGYDPKALPEITNINYRDMVGKNVTIVGDLSGIQNDPFTGICISNVTIELKSSIF  439

Query  536  ---GKKQPPWVCANIQGVASGVVPPPCNLLHSQGPVKPGMCDLPA  661
                KK+ PW C +I GV+S V P PC+LL    P K   C  PA
Sbjct  440  LSEKKKKLPWNCTDIAGVSSRVTPKPCDLL----PEKQVDCAFPA  480



>ref|XP_004513187.1| PREDICTED: probable polygalacturonase-like [Cicer arietinum]
Length=479

 Score =   272 bits (695),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 126/217 (58%), Positives = 170/217 (78%), Gaps = 7/217 (3%)
 Frame = +2

Query  2    INPDSCTKVRIEDNYIVSGDDCVAIKSGIDEYGIKYGMPTKQLIIRRLTCISPTSGAIAM  181
            I+PDSC+ VRIED+ I+SGDDCVAIKSG D+YGIK+GMP++ +IIRRL C+SP S  IA+
Sbjct  244  IDPDSCSNVRIEDSQIISGDDCVAIKSGWDQYGIKFGMPSQHIIIRRLKCVSPDSAMIAL  303

Query  182  GSEMSGGIEDVRASDITALDTESGVRIKTALGRGGYVKNIYVKGLRAHTMKLLFQMTGKY  361
            GSEMSGGI+D+R  D+TA++T+S VRIK+A+GRGG+VK+I+V+G+  +TMK +F MTG Y
Sbjct  304  GSEMSGGIQDIRVEDLTAINTQSAVRIKSAIGRGGFVKDIFVRGMNLNTMKYVFWMTGSY  363

Query  362  GSHADKNFDPKAIPVVAGINFRDVVADNVTTAGTMEGIPGHPFTGICMANVTIGMAKNGK  541
            GSH D +FDPKA+P+++GIN+ +VVA+NVT +  +EGI G PF+GIC++NVTI    N  
Sbjct  364  GSHPDPSFDPKALPIISGINYSNVVANNVTYSARLEGINGDPFSGICISNVTIHNVGNKL  423

Query  542  KQPPWVCANIQGVASGVVPPPCNLLHSQGPVKPGMCD  652
            +   W C++++GV S V P PC LL    P K G  D
Sbjct  424  Q---WNCSDVEGVTSNVYPKPCELL----PEKEGKFD  453



>ref|NP_190464.1| pectin lyase-like superfamily protein [Arabidopsis thaliana]
 emb|CAB62015.1| endo-polygalacturonase-like protein [Arabidopsis thaliana]
 gb|AAY78763.1| glycoside hydrolase family 28 protein [Arabidopsis thaliana]
 gb|AEE78476.1| pectin lyase-like superfamily protein [Arabidopsis thaliana]
Length=469

 Score =   271 bits (692),  Expect = 3e-84, Method: Compositional matrix adjust.
 Identities = 127/221 (57%), Positives = 162/221 (73%), Gaps = 2/221 (1%)
 Frame = +2

Query  2    INPDSCTKVRIEDNYIVSGDDCVAIKSGIDEYGIKYGMPTKQLIIRRLTCISPTSGAIAM  181
            INPDSCT   IED YIVSGDDC+A+KSG D+YGIK+GMPT+QL IRRLTCISP S  +A+
Sbjct  235  INPDSCTNTLIEDCYIVSGDDCIAVKSGWDQYGIKFGMPTQQLSIRRLTCISPKSAGVAL  294

Query  182  GSEMSGGIEDVRASDITALDTESGVRIKTALGRGGYVKNIYVKGLRAHTMKLLFQMTGKY  361
            GSEMSGGI+DVR  D+T  +TES +RIKTA+GRG YVK+IY + +   TMK +F M+G Y
Sbjct  295  GSEMSGGIKDVRIEDVTLTNTESAIRIKTAVGRGAYVKDIYARRITMKTMKYVFWMSGNY  354

Query  362  GSHADKNFDPKAIPVVAGINFRDVVADNVTTAGTMEGIPGHPFTGICMANVTIGMAKNGK  541
            GSH D+ FDPKA+P +  IN+RD+ A+NVT + +++GI   PFTGIC++NVTI +A   K
Sbjct  355  GSHPDEGFDPKALPEITNINYRDMTAENVTMSASLDGIDKDPFTGICISNVTIALAAKAK  414

Query  542  KQPPWVCANIQGVASGVVPPPCNLL-HSQGPVKPGMCDLPA  661
            K   W C ++ GV S V P PC+LL   +   K   C  P+
Sbjct  415  KM-QWNCTDVAGVTSRVTPEPCSLLPEKKAQAKNVDCAFPS  454



>ref|XP_004234221.1| PREDICTED: probable polygalacturonase [Solanum lycopersicum]
Length=467

 Score =   271 bits (692),  Expect = 4e-84, Method: Compositional matrix adjust.
 Identities = 130/219 (59%), Positives = 165/219 (75%), Gaps = 5/219 (2%)
 Frame = +2

Query  2    INPDSCTKVRIEDNYIVSGDDCVAIKSGIDEYGIKYGMPTKQLIIRRLTCISPTSGAIAM  181
            INPDSC+  RIED +IVSGDDC+A+KSG DEYGI +GMPTK LIIR LTCISP S  IA+
Sbjct  233  INPDSCSNTRIEDCFIVSGDDCIAVKSGWDEYGIAFGMPTKHLIIRNLTCISPDSAVIAL  292

Query  182  GSEMSGGIEDVRASDITALDTESGVRIKTALGRGGYVKNIYVKGLRAHTMKLLFQMTGKY  361
            GSEMSGGI+DVRA +I A+ +ESG+RIKTA+GRG Y+K+++V+G+   TMK  F +TG Y
Sbjct  293  GSEMSGGIQDVRAENIGAISSESGLRIKTAIGRGAYIKDVFVRGMTLQTMKYTFWITGDY  352

Query  362  GSHADKNFDPKAIPVVAGINFRDVVADNVTTAGTMEGIPGHPFTGICMANVTIGMAKNGK  541
            G+H D+++DPKA+PV+ GIN +DVVA NVT AG + GI G  F GIC++NV I +++   
Sbjct  353  GAHPDEHYDPKALPVIQGINVKDVVAKNVTIAGKLVGIDGDTFNGICISNVAIELSEQA-  411

Query  542  KQPPWVCANIQGVASGVVPPPCNLLHSQGPVKPGMCDLP  658
            KQ  W C+NI+GV+S V P PC LL    P K   C  P
Sbjct  412  KQLQWNCSNIEGVSSQVTPQPCALL----PDKNIECPFP  446



>ref|XP_002468601.1| hypothetical protein SORBIDRAFT_01g048880 [Sorghum bicolor]
 gb|EER95599.1| hypothetical protein SORBIDRAFT_01g048880 [Sorghum bicolor]
Length=463

 Score =   270 bits (691),  Expect = 4e-84, Method: Compositional matrix adjust.
 Identities = 133/221 (60%), Positives = 164/221 (74%), Gaps = 5/221 (2%)
 Frame = +2

Query  2    INPDSCTKVRIEDNYIVSGDDCVAIKSGIDEYGIKYGMPTKQLIIRRLTCISPTSGAIAM  181
            I+PDS T V+IED YIVSGDDCVA+KSG DEYGIK+ MP++ ++IRRLTCISPTS  IA+
Sbjct  234  IDPDSSTHVKIEDCYIVSGDDCVAVKSGWDEYGIKFNMPSQHIVIRRLTCISPTSAMIAL  293

Query  182  GSEMSGGIEDVRASDITALDTESGVRIKTALGRGGYVKNIYVKGLRAHTMKLLFQMTGKY  361
            GSEMSGGI DVRA D  A++TES VRIK+  GRGG+VK+I+V+GL  HTMK +F MTG Y
Sbjct  294  GSEMSGGIRDVRAEDNIAINTESAVRIKSGAGRGGFVKDIFVRGLSLHTMKWVFWMTGNY  353

Query  362  GSHADKNFDPKAIPVVAGINFRDVVADNVTTAGTMEGIPGHPFTGICMANVTIGMAKNGK  541
            G H D   +P A+P V GIN+ DV A+NVTTAG MEGIP  P+TGIC++NVT  +A N  
Sbjct  354  GQHPDNTSNPNAMPEVTGINYSDVFAENVTTAGRMEGIPNDPYTGICISNVTASLAPNAT  413

Query  542  KQPPWVCANIQGVASGVVPPPCNLLHSQGPVKPGMCDLPAK  664
            +   W C N++GV S V P PC  L ++G  KP  C  P +
Sbjct  414  EL-QWNCTNVKGVTSNVSPKPCPELGAEG--KP--CAFPVE  449



>ref|XP_006372397.1| glycoside hydrolase family 28 family protein [Populus trichocarpa]
 gb|ERP50194.1| glycoside hydrolase family 28 family protein [Populus trichocarpa]
Length=452

 Score =   270 bits (690),  Expect = 4e-84, Method: Compositional matrix adjust.
 Identities = 124/205 (60%), Positives = 158/205 (77%), Gaps = 1/205 (0%)
 Frame = +2

Query  2    INPDSCTKVRIEDNYIVSGDDCVAIKSGIDEYGIKYGMPTKQLIIRRLTCISPTSGAIAM  181
            INPDS + VRIED+++VSGDDC+A+KSG DEYGIK+G PT+ L+IRR TCISP S  IA+
Sbjct  221  INPDSSSNVRIEDSFVVSGDDCIAVKSGWDEYGIKFGRPTQHLVIRRFTCISPDSATIAL  280

Query  182  GSEMSGGIEDVRASDITALDTESGVRIKTALGRGGYVKNIYVKGLRAHTMKLLFQMTGKY  361
            GSEMSGGI+DVRA DITAL T+SGVRIKTA+GRG YVK+I+V+ +    MK  F MTG Y
Sbjct  281  GSEMSGGIQDVRAEDITALSTQSGVRIKTAVGRGAYVKDIFVRRMTLKAMKYAFWMTGSY  340

Query  362  GSHADKNFDPKAIPVVAGINFRDVVADNVTTAGTMEGIPGHPFTGICMANVTIGMAKNGK  541
            GSH D  +DPKA+P + GI+++D+VA+NVT +  +EGI   PFTGIC++NV I + +   
Sbjct  341  GSHPDTGYDPKALPEIKGISYKDIVAENVTYSARLEGIENDPFTGICISNVNISLTQK-P  399

Query  542  KQPPWVCANIQGVASGVVPPPCNLL  616
            K+  W C +IQGV+S V P PC  L
Sbjct  400  KELQWNCTDIQGVSSKVTPQPCAAL  424



>ref|XP_010317519.1| PREDICTED: probable polygalacturonase, partial [Solanum lycopersicum]
Length=464

 Score =   270 bits (689),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 131/219 (60%), Positives = 163/219 (74%), Gaps = 5/219 (2%)
 Frame = +2

Query  2    INPDSCTKVRIEDNYIVSGDDCVAIKSGIDEYGIKYGMPTKQLIIRRLTCISPTSGAIAM  181
            I+PDSC+  RIED YIVSGDDC+A+KSG DEYGI +GMPTK LIIR LTCISP+S  IA+
Sbjct  230  IDPDSCSNTRIEDCYIVSGDDCIAVKSGYDEYGIAFGMPTKHLIIRNLTCISPSSAVIAL  289

Query  182  GSEMSGGIEDVRASDITALDTESGVRIKTALGRGGYVKNIYVKGLRAHTMKLLFQMTGKY  361
            GSEMSGGI+DVRA +I A+ +ESG+RIKTA+GRG YVK+++V+G+   TMK  F +TG Y
Sbjct  290  GSEMSGGIQDVRAENIGAIGSESGLRIKTAIGRGAYVKDVFVRGMTLQTMKYTFWITGDY  349

Query  362  GSHADKNFDPKAIPVVAGINFRDVVADNVTTAGTMEGIPGHPFTGICMANVTIGMAKNGK  541
            G+H D ++D KAIPV+ GIN +D VA NVT AG + GI G  F GIC++NV I M++   
Sbjct  350  GAHPDDHYDRKAIPVIQGINIKDTVAKNVTIAGKLAGIDGDTFNGICLSNVAIEMSQQA-  408

Query  542  KQPPWVCANIQGVASGVVPPPCNLLHSQGPVKPGMCDLP  658
             Q PW C+NI+GV+S V P PC LL    P K   C  P
Sbjct  409  NQLPWNCSNIKGVSSQVTPQPCALL----PHKKIDCPFP  443



>ref|XP_002875935.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH52194.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
Length=469

 Score =   270 bits (689),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 127/221 (57%), Positives = 161/221 (73%), Gaps = 2/221 (1%)
 Frame = +2

Query  2    INPDSCTKVRIEDNYIVSGDDCVAIKSGIDEYGIKYGMPTKQLIIRRLTCISPTSGAIAM  181
            INPDSCT   IED YIVSGDDC+A+KSG D+YGIK+GMPT+QL IRRLTCISP S  +A+
Sbjct  235  INPDSCTNTLIEDCYIVSGDDCIAVKSGWDQYGIKFGMPTQQLSIRRLTCISPKSAGVAL  294

Query  182  GSEMSGGIEDVRASDITALDTESGVRIKTALGRGGYVKNIYVKGLRAHTMKLLFQMTGKY  361
            GSEMSGGI+DVR  D+T  +TES +RIKTA GRG YVK+I+ + +   TMK +F M+G Y
Sbjct  295  GSEMSGGIKDVRIEDVTLTNTESAIRIKTAAGRGAYVKDIFARRITMKTMKYVFWMSGNY  354

Query  362  GSHADKNFDPKAIPVVAGINFRDVVADNVTTAGTMEGIPGHPFTGICMANVTIGMAKNGK  541
             SH D+ FDPKA+P V  IN+RD+ A+NVT + +++GI   PFTGIC++NVTI +A   K
Sbjct  355  NSHPDEGFDPKALPEVTNINYRDMTAENVTMSASLDGIHKDPFTGICISNVTIALADKAK  414

Query  542  KQPPWVCANIQGVASGVVPPPCNLL-HSQGPVKPGMCDLPA  661
            K   W C ++ GV S V P PC+LL   + P K   C  P+
Sbjct  415  KV-QWNCTDVAGVTSRVTPEPCSLLPEKKAPAKNEDCAFPS  454



>dbj|BAD67712.1| putative polygalacturonase [Oryza sativa Japonica Group]
 gb|EAY99340.1| hypothetical protein OsI_21311 [Oryza sativa Indica Group]
 gb|EAZ35554.1| hypothetical protein OsJ_19837 [Oryza sativa Japonica Group]
Length=485

 Score =   270 bits (690),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 133/220 (60%), Positives = 165/220 (75%), Gaps = 6/220 (3%)
 Frame = +2

Query  2    INPDSCTKVRIEDNYIVSGDDCVAIKSGIDEYGIKYGMPTKQLIIRRLTCISPTSGAIAM  181
            INPDSC+ VRIED YIVSGDDCVAIKSG DEYGI YGMP++ +++RRLTC+SPTS  IA+
Sbjct  249  INPDSCSHVRIEDCYIVSGDDCVAIKSGWDEYGIAYGMPSQHIVVRRLTCVSPTSAVIAL  308

Query  182  GSEMSGGIEDVRASDITALDTESGVRIKTALGRGGYVKNIYVKGLRAHTMKLLFQMTGKY  361
            GSEMSGGI DVRA DITA+++ES VRIKTA+GRG YV++++V+G+   TMK +F MTG Y
Sbjct  309  GSEMSGGISDVRAEDITAVNSESAVRIKTAVGRGAYVRDVFVRGMSLDTMKWVFWMTGNY  368

Query  362  GSHADKNFDPKAIPVVAGINFRDVVADNV-TTAGTMEGIPGHPFTGICMANVTIGMAKNG  538
             SH D  +DP AIPVV  I+++DVVA  V   A  +EGI G PF GIC+ANVT  ++K+ 
Sbjct  369  KSHPDDGYDPNAIPVVDNISYQDVVATGVYKEAARLEGIQGAPFRGICIANVTATLSKSR  428

Query  539  KKQPPWVCANIQGVASGVVPPPCNLLHSQGPVKPGMCDLP  658
            K   PW C +I+GV++GV P PC  L  QG    G C  P
Sbjct  429  KY--PWTCTDIEGVSTGVTPAPCQPL--QG-AHDGACPFP  463



>ref|XP_004298190.1| PREDICTED: probable polygalacturonase-like [Fragaria vesca subsp. 
vesca]
Length=462

 Score =   268 bits (686),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 126/219 (58%), Positives = 159/219 (73%), Gaps = 3/219 (1%)
 Frame = +2

Query  2    INPDSCTKVRIEDNYIVSGDDCVAIKSGIDEYGIKYGMPTKQLIIRRLTCISPTSGAIAM  181
            INPDSC++ RIED YIVSGDDC+A+KSG D YGIK+GMP + L+IRRLTCISP S  +A+
Sbjct  228  INPDSCSQTRIEDCYIVSGDDCIAVKSGWDNYGIKFGMPMEHLVIRRLTCISPKSATVAL  287

Query  182  GSEMSGGIEDVRASDITALDTESGVRIKTALGRGGYVKNIYVKGLRAHTMKLLFQMTGKY  361
            GSEMSGGI DVR  D+TA++TES +RIKTA+GRG YVK+I+V+ +   TMK +F MTG Y
Sbjct  288  GSEMSGGIRDVRVEDVTAINTESSIRIKTAVGRGAYVKDIFVRRMTLSTMKYVFWMTGAY  347

Query  362  GSHADKNFDPKAIPVVAGINFRDVVADNVTTAGTMEGIPGHPFTGICMANVTIGMAKNGK  541
            GSH  + FDP A+PV+  IN+RD+VA NVT  G ++GI   PF GIC++N TI +    K
Sbjct  348  GSHPSEGFDPNALPVIQNINYRDIVAKNVTHPGQLDGIANDPFKGICISNATITLTAKPK  407

Query  542  KQPPWVCANIQGVASGVVPPPCNLLHSQGPVKPGMCDLP  658
            K   W C +++G+ S V P PC LL  Q   KP  C  P
Sbjct  408  KV-LWNCTDVEGITSNVTPKPCALLPEQQ--KPINCAFP  443



>gb|KDP22228.1| hypothetical protein JCGZ_26059 [Jatropha curcas]
Length=470

 Score =   268 bits (685),  Expect = 4e-83, Method: Compositional matrix adjust.
 Identities = 129/219 (59%), Positives = 162/219 (74%), Gaps = 5/219 (2%)
 Frame = +2

Query  2    INPDSCTKVRIEDNYIVSGDDCVAIKSGIDEYGIKYGMPTKQLIIRRLTCISPTSGAIAM  181
            I+PDSCT  RIED YIVSGDDC+A+KSG D+YGIK+G+PT+QLIIRRLTCISP S  IA+
Sbjct  233  IDPDSCTNTRIEDCYIVSGDDCIAVKSGWDQYGIKFGVPTRQLIIRRLTCISPDSATIAL  292

Query  182  GSEMSGGIEDVRASDITALDTESGVRIKTALGRGGYVKNIYVKGLRAHTMKLLFQMTGKY  361
            GSEMSGGI+DVRA DITA++T+SGVRIKTA+GRGG+VK+++V+ +   TMK +F MTG Y
Sbjct  293  GSEMSGGIQDVRAEDITAINTQSGVRIKTAIGRGGFVKDVFVRKMNFQTMKYVFWMTGSY  352

Query  362  GSHADKNFDPKAIPVVAGINFRDVVADNVTTAGTMEGIPGHPFTGICMANVTIGMAKNGK  541
            GSH D+ +DPKA+P +  IN+ DVVA NVT    ++GI   PFTGIC++N  I + +  K
Sbjct  353  GSHPDEGYDPKALPNITQINYNDVVAKNVTYTARLDGIKNDPFTGICISNADITLTEKPK  412

Query  542  KQPPWVCANIQGVASGVVPPPCNLLHSQGPVKPGMCDLP  658
            K   W C +I GV S V    C+LL    P K   C  P
Sbjct  413  KL-QWNCTDIAGVTSNVTTKACDLL----PEKKIDCPFP  446



>ref|XP_004160401.1| PREDICTED: LOW QUALITY PROTEIN: probable polygalacturonase-like 
[Cucumis sativus]
Length=480

 Score =   268 bits (686),  Expect = 4e-83, Method: Compositional matrix adjust.
 Identities = 126/219 (58%), Positives = 162/219 (74%), Gaps = 3/219 (1%)
 Frame = +2

Query  2    INPDSCTKVRIEDNYIVSGDDCVAIKSGIDEYGIKYGMPTKQLIIRRLTCISPTSGAIAM  181
            I+PDSC+  RIED +IVSGDDC+A+KSG D+YGIK+GMPT+ L+I+RLTCISP S  +A+
Sbjct  243  IDPDSCSNTRIEDCFIVSGDDCIAVKSGWDQYGIKFGMPTEDLVIKRLTCISPDSAGVAL  302

Query  182  GSEMSGGIEDVRASDITALDTESGVRIKTALGRGGYVKNIYVKGLRAHTMKLLFQMTGKY  361
            GSEMSGGI +VR  + T ++T+S VRIKTA GRGG+VK+I+V+G+   TMK +F MTG Y
Sbjct  303  GSEMSGGIRNVRIENFTGINTQSAVRIKTARGRGGFVKDIFVRGMYLSTMKYVFWMTGNY  362

Query  362  GSHADKNFDPKAIPVVAGINFRDVVADNVTTAGTMEGIPGHPFTGICMANVTIGMAKNGK  541
             SH D  FDP A+P +  IN+RDVVA+NVT +  +EGI G PFT IC++NV IG+    K
Sbjct  363  KSHPDDKFDPAALPEITNINYRDVVAENVTYSARLEGISGDPFTNICISNVKIGLTATPK  422

Query  542  KQPPWVCANIQGVASGVVPPPCNLLHSQGPVKPGMCDLP  658
            K   W C +++G +S VVPPPC  L   G  K G CD P
Sbjct  423  KL-QWNCTDVEGFSSDVVPPPCAPLAKAG--KSGGCDFP  458



>ref|XP_004985902.1| PREDICTED: probable polygalacturonase-like [Setaria italica]
Length=456

 Score =   268 bits (684),  Expect = 4e-83, Method: Compositional matrix adjust.
 Identities = 130/221 (59%), Positives = 165/221 (75%), Gaps = 5/221 (2%)
 Frame = +2

Query  2    INPDSCTKVRIEDNYIVSGDDCVAIKSGIDEYGIKYGMPTKQLIIRRLTCISPTSGAIAM  181
            I+PDS + V+IED YIVSGDDC+A+KSG DEYGIK+ MP++ +IIRRLTCISPTS  IA+
Sbjct  227  IDPDSSSHVKIEDCYIVSGDDCIAVKSGWDEYGIKFNMPSQHIIIRRLTCISPTSAMIAL  286

Query  182  GSEMSGGIEDVRASDITALDTESGVRIKTALGRGGYVKNIYVKGLRAHTMKLLFQMTGKY  361
            GSEMSGGI DVRA D  A++TES VR+K+ +GRGG+VK+I+V+GL  HTMK +F MTG Y
Sbjct  287  GSEMSGGIRDVRAEDNIAINTESAVRVKSGVGRGGFVKDIFVRGLSLHTMKWVFWMTGNY  346

Query  362  GSHADKNFDPKAIPVVAGINFRDVVADNVTTAGTMEGIPGHPFTGICMANVTIGMAKNGK  541
            G H D + DP A+P V GIN+ DV A+NVT AG MEGIP  P+TGIC++NVT  +A + K
Sbjct  347  GQHPDNSSDPNAMPEVTGINYSDVFAENVTMAGRMEGIPNDPYTGICISNVTARLAPDAK  406

Query  542  KQPPWVCANIQGVASGVVPPPCNLLHSQGPVKPGMCDLPAK  664
            K   W C +++GV   V P PC  L ++G  KP  C  P +
Sbjct  407  KL-QWNCTDVKGVTYDVTPKPCPELGAEG--KP--CAFPEE  442



>ref|XP_004145976.1| PREDICTED: probable polygalacturonase-like [Cucumis sativus]
Length=480

 Score =   268 bits (686),  Expect = 4e-83, Method: Compositional matrix adjust.
 Identities = 126/219 (58%), Positives = 162/219 (74%), Gaps = 3/219 (1%)
 Frame = +2

Query  2    INPDSCTKVRIEDNYIVSGDDCVAIKSGIDEYGIKYGMPTKQLIIRRLTCISPTSGAIAM  181
            I+PDSC+  RIED +IVSGDDC+A+KSG D+YGIK+GMPT+ L+I+RLTCISP S  +A+
Sbjct  243  IDPDSCSNTRIEDCFIVSGDDCIAVKSGWDQYGIKFGMPTEDLVIKRLTCISPDSAGVAL  302

Query  182  GSEMSGGIEDVRASDITALDTESGVRIKTALGRGGYVKNIYVKGLRAHTMKLLFQMTGKY  361
            GSEMSGGI +VR  + T ++T+S VRIKTA GRGG+VK+I+V+G+   TMK +F MTG Y
Sbjct  303  GSEMSGGIRNVRIENFTGINTQSAVRIKTARGRGGFVKDIFVRGMYLSTMKYVFWMTGNY  362

Query  362  GSHADKNFDPKAIPVVAGINFRDVVADNVTTAGTMEGIPGHPFTGICMANVTIGMAKNGK  541
             SH D  FDP A+P +  IN+RDVVA+NVT +  +EGI G PFT IC++NV IG+    K
Sbjct  363  KSHPDDKFDPAALPEITNINYRDVVAENVTYSARLEGISGDPFTNICISNVKIGLTATPK  422

Query  542  KQPPWVCANIQGVASGVVPPPCNLLHSQGPVKPGMCDLP  658
            K   W C +++G +S VVPPPC  L   G  K G CD P
Sbjct  423  KL-QWNCTDVEGFSSDVVPPPCAPLAKAG--KSGGCDFP  458



>ref|XP_002437680.1| hypothetical protein SORBIDRAFT_10g000660 [Sorghum bicolor]
 gb|EER89047.1| hypothetical protein SORBIDRAFT_10g000660 [Sorghum bicolor]
Length=495

 Score =   269 bits (687),  Expect = 4e-83, Method: Compositional matrix adjust.
 Identities = 134/220 (61%), Positives = 165/220 (75%), Gaps = 6/220 (3%)
 Frame = +2

Query  2    INPDSCTKVRIEDNYIVSGDDCVAIKSGIDEYGIKYGMPTKQLIIRRLTCISPTSGAIAM  181
            INPDSC+ VRIED YIVSGDDCVAIKSG DEYGI YGMP++ ++IRRLTC+SPTS  IA+
Sbjct  252  INPDSCSHVRIEDCYIVSGDDCVAIKSGWDEYGISYGMPSQHIVIRRLTCVSPTSAVIAL  311

Query  182  GSEMSGGIEDVRASDITALDTESGVRIKTALGRGGYVKNIYVKGLRAHTMKLLFQMTGKY  361
            GSEMSGGI+DVRA DITA+++ESGVRIKTA+GRG YVK+++V+ +   TMK +F MTG Y
Sbjct  312  GSEMSGGIQDVRAEDITAINSESGVRIKTAVGRGAYVKDVFVRRMTLTTMKWVFWMTGNY  371

Query  362  GSHADKNFDPKAIPVVAGINFRDVVADNV-TTAGTMEGIPGHPFTGICMANVTIGMAKNG  538
             SH D  +DP AIPVV  I+++DVVA  V   A  +EGI G PF GIC+ANVT  ++K+ 
Sbjct  372  KSHPDDKYDPNAIPVVDNISYQDVVATGVYKEAARLEGIQGAPFKGICVANVTADLSKSR  431

Query  539  KKQPPWVCANIQGVASGVVPPPCNLLHSQGPVKPGMCDLP  658
            K   PW CA+++GV+  V P PC  L  QG    G C  P
Sbjct  432  KY--PWTCADVEGVSVNVSPAPCQPL--QG-AHDGACPFP  466



>gb|KGN49922.1| hypothetical protein Csa_5G140480 [Cucumis sativus]
Length=482

 Score =   268 bits (686),  Expect = 5e-83, Method: Compositional matrix adjust.
 Identities = 126/219 (58%), Positives = 162/219 (74%), Gaps = 3/219 (1%)
 Frame = +2

Query  2    INPDSCTKVRIEDNYIVSGDDCVAIKSGIDEYGIKYGMPTKQLIIRRLTCISPTSGAIAM  181
            I+PDSC+  RIED +IVSGDDC+A+KSG D+YGIK+GMPT+ L+I+RLTCISP S  +A+
Sbjct  245  IDPDSCSNTRIEDCFIVSGDDCIAVKSGWDQYGIKFGMPTEDLVIKRLTCISPDSAGVAL  304

Query  182  GSEMSGGIEDVRASDITALDTESGVRIKTALGRGGYVKNIYVKGLRAHTMKLLFQMTGKY  361
            GSEMSGGI +VR  + T ++T+S VRIKTA GRGG+VK+I+V+G+   TMK +F MTG Y
Sbjct  305  GSEMSGGIRNVRIENFTGINTQSAVRIKTARGRGGFVKDIFVRGMYLSTMKYVFWMTGNY  364

Query  362  GSHADKNFDPKAIPVVAGINFRDVVADNVTTAGTMEGIPGHPFTGICMANVTIGMAKNGK  541
             SH D  FDP A+P +  IN+RDVVA+NVT +  +EGI G PFT IC++NV IG+    K
Sbjct  365  KSHPDDKFDPAALPEITNINYRDVVAENVTYSARLEGISGDPFTNICISNVKIGLTATPK  424

Query  542  KQPPWVCANIQGVASGVVPPPCNLLHSQGPVKPGMCDLP  658
            K   W C +++G +S VVPPPC  L   G  K G CD P
Sbjct  425  KL-QWNCTDVEGFSSDVVPPPCAPLAKAG--KSGGCDFP  460



>ref|XP_006362679.1| PREDICTED: probable polygalacturonase-like [Solanum tuberosum]
Length=527

 Score =   269 bits (687),  Expect = 8e-83, Method: Compositional matrix adjust.
 Identities = 130/219 (59%), Positives = 163/219 (74%), Gaps = 5/219 (2%)
 Frame = +2

Query  2    INPDSCTKVRIEDNYIVSGDDCVAIKSGIDEYGIKYGMPTKQLIIRRLTCISPTSGAIAM  181
            I+PDSC+  RIED +IVSGDDC+A+KSG DEYGI +G PTK LIIR LTCISP S  IA+
Sbjct  293  IDPDSCSNTRIEDCFIVSGDDCIAVKSGWDEYGIAFGKPTKHLIIRNLTCISPDSAVIAL  352

Query  182  GSEMSGGIEDVRASDITALDTESGVRIKTALGRGGYVKNIYVKGLRAHTMKLLFQMTGKY  361
            GSEMSGGI+DVRA +I A+ +ESG+RIKTA+GRG YVK+++V+G+   TMK  F +TG Y
Sbjct  353  GSEMSGGIQDVRAENIAAISSESGLRIKTAIGRGAYVKDVFVRGMTLQTMKYTFWITGDY  412

Query  362  GSHADKNFDPKAIPVVAGINFRDVVADNVTTAGTMEGIPGHPFTGICMANVTIGMAKNGK  541
            GSH D ++DPKA+PV+ GIN +DVVA NVT AG + GI G  F GIC++NV I +++   
Sbjct  413  GSHPDDHYDPKALPVIQGINVKDVVAKNVTIAGKLAGIDGDTFNGICISNVAIELSEQA-  471

Query  542  KQPPWVCANIQGVASGVVPPPCNLLHSQGPVKPGMCDLP  658
            KQ  W C+NI+GV+S V P PC LL    P K   C  P
Sbjct  472  KQLEWNCSNIKGVSSQVSPQPCALL----PDKNIYCPFP  506



>ref|NP_001151102.1| glycoside hydrolase, family 28 precursor [Zea mays]
 gb|ACG41634.1| glycoside hydrolase, family 28 [Zea mays]
 gb|ACL53776.1| unknown [Zea mays]
 tpg|DAA43050.1| TPA: glycoside hydrolase, family 28 [Zea mays]
Length=463

 Score =   267 bits (682),  Expect = 9e-83, Method: Compositional matrix adjust.
 Identities = 128/222 (58%), Positives = 165/222 (74%), Gaps = 5/222 (2%)
 Frame = +2

Query  2    INPDSCTKVRIEDNYIVSGDDCVAIKSGIDEYGIKYGMPTKQLIIRRLTCISPTSGAIAM  181
            I+PDS ++V+IED YIVSGDDCVA+KSG DEYGI++ MP++ ++IRRLTC+SPTS  IA+
Sbjct  234  IDPDSSSRVKIEDCYIVSGDDCVAVKSGWDEYGIRFNMPSQHIVIRRLTCVSPTSAMIAL  293

Query  182  GSEMSGGIEDVRASDITALDTESGVRIKTALGRGGYVKNIYVKGLRAHTMKLLFQMTGKY  361
            GSEMSGGI DVRA D  A++TES VR+K+  GRGG+V++I+V+GL  HTMK +F MTG Y
Sbjct  294  GSEMSGGIRDVRAEDSVAINTESAVRVKSGAGRGGFVRDIFVRGLSLHTMKWVFWMTGNY  353

Query  362  GSHADKNFDPKAIPVVAGINFRDVVADNVTTAGTMEGIPGHPFTGICMANVTIGMAKNGK  541
            G H D   DP A+P V GIN+ DV A+NVT AG MEGIP  P+TGIC++NVT  +A + K
Sbjct  354  GQHPDNTSDPNAMPEVTGINYSDVFAENVTMAGRMEGIPKDPYTGICISNVTARLAPDAK  413

Query  542  KQPPWVCANIQGVASGVVPPPCNLLHSQGPVKPGMCDLPAKN  667
            +   W C N++GV S V P PC  L ++G  KP  C  P + 
Sbjct  414  EL-QWNCTNVKGVTSHVSPKPCPELAAEG--KP--CAFPEEE  450



>gb|ACG41831.1| glycoside hydrolase, family 28 [Zea mays]
Length=439

 Score =   266 bits (680),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 132/220 (60%), Positives = 166/220 (75%), Gaps = 6/220 (3%)
 Frame = +2

Query  2    INPDSCTKVRIEDNYIVSGDDCVAIKSGIDEYGIKYGMPTKQLIIRRLTCISPTSGAIAM  181
            INPDSC+ VRIED YIVSGDDCVAIKSG DEYGI YGMP++ ++IRRLTC+SPTS  IA+
Sbjct  203  INPDSCSHVRIEDCYIVSGDDCVAIKSGWDEYGISYGMPSQHIVIRRLTCVSPTSAVIAL  262

Query  182  GSEMSGGIEDVRASDITALDTESGVRIKTALGRGGYVKNIYVKGLRAHTMKLLFQMTGKY  361
            GSEMSGGI+DVRA DITA++TES VRIKTA+GRG YV++++ + +   TMK +F MTG Y
Sbjct  263  GSEMSGGIQDVRAEDITAINTESAVRIKTAVGRGAYVRDVFARRMTLTTMKRVFWMTGDY  322

Query  362  GSHADKNFDPKAIPVVAGINFRDVVADNV-TTAGTMEGIPGHPFTGICMANVTIGMAKNG  538
             SH D  +DP A+PVVA I+++DVVA  V   A  ++GI G PF GIC+ANVT  ++K+ 
Sbjct  323  KSHPDDKYDPNAVPVVANISYQDVVATGVYKEAARLQGIQGAPFRGICVANVTADLSKSR  382

Query  539  KKQPPWVCANIQGVASGVVPPPCNLLHSQGPVKPGMCDLP  658
            K   PW CA+I+GV++ V P PC+ L  QG    G C  P
Sbjct  383  KY--PWNCADIEGVSANVSPAPCDPL--QG-AHDGACPFP  417



>gb|EYU25143.1| hypothetical protein MIMGU_mgv1a005601mg [Erythranthe guttata]
Length=477

 Score =   267 bits (682),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 127/231 (55%), Positives = 164/231 (71%), Gaps = 16/231 (7%)
 Frame = +2

Query  2    INPDSCTKVRIEDNYIVSGDDCVAIKSGIDEYGIKYGMPTKQLIIRRLTCISPTSGAIAM  181
            INPDSC   RI D+Y+VSGDDC+A+KSG D+YGIK+GMPT+ L I+R TCISP S  IA+
Sbjct  235  INPDSCINTRIRDSYVVSGDDCIAVKSGWDQYGIKFGMPTQHLSIKRFTCISPDSAVIAL  294

Query  182  GSEMSGGIEDVRASDITALDTESGVRIKTALGRGGYVKNIYVKGLRAHTMKLLFQMTGKY  361
            GSEMSGGI+DVRA D+ A+++++GVRIKTA GRG YVK+I+V+ LR  TM+ +F MTG Y
Sbjct  295  GSEMSGGIQDVRAEDVHAINSQAGVRIKTAPGRGAYVKDIFVRNLRMETMQYVFWMTGAY  354

Query  362  GSHADKNFDPKAIPVVAGINFRDVVADNVTTAGTMEGIPGHPFTGICMANVTIGMA----  529
            GSH D  +DPKA+PVV  INF+D+V  NV+  G + GI GHPFTG+C++N+T  +A    
Sbjct  355  GSHPDDGYDPKALPVVNNINFKDMVGKNVSMVGNLAGIEGHPFTGLCLSNITAELAVKKK  414

Query  530  --------KNGKKQPPWVCANIQGVASGVVPPPCNLLHSQGPVKPGMCDLP  658
                     + KK+ PW C +I GV+S V P  C+LL    P K   C  P
Sbjct  415  KKNIHPIFSSEKKKLPWNCTDISGVSSQVTPKACDLL----PEKKVDCAYP  461



>ref|XP_006292567.1| hypothetical protein CARUB_v10018803mg [Capsella rubella]
 gb|EOA25465.1| hypothetical protein CARUB_v10018803mg [Capsella rubella]
Length=471

 Score =   266 bits (681),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 126/213 (59%), Positives = 158/213 (74%), Gaps = 2/213 (1%)
 Frame = +2

Query  2    INPDSCTKVRIEDNYIVSGDDCVAIKSGIDEYGIKYGMPTKQLIIRRLTCISPTSGAIAM  181
            INPDSC    IED YIVSGDDC+A+KSG D+YGIK+GMPTKQL IRRLTCISP S  +A+
Sbjct  236  INPDSCANTLIEDCYIVSGDDCIAVKSGWDQYGIKFGMPTKQLSIRRLTCISPKSAGVAL  295

Query  182  GSEMSGGIEDVRASDITALDTESGVRIKTALGRGGYVKNIYVKGLRAHTMKLLFQMTGKY  361
            GSEMSGGI+DVR  ++T  +TES +RIKTA GRGGYVKNI+ + +   TMK +F M+G Y
Sbjct  296  GSEMSGGIKDVRIEEVTLTNTESAIRIKTAAGRGGYVKNIFARRITMKTMKYVFWMSGDY  355

Query  362  GSHADKNFDPKAIPVVAGINFRDVVADNVTTAGTMEGIPGHPFTGICMANVTIGMAKNGK  541
              H D+ +DPKA P V  IN+RD+ A+NVT +G+++GI   PF GIC++NVTI +A N K
Sbjct  356  NQHPDEGYDPKAFPEVTNINYRDMKAENVTMSGSLDGIDKDPFKGICISNVTIALADNAK  415

Query  542  KQPPWVCANIQGVASGVVPPPCNLL-HSQGPVK  637
            K   W C N+ GV S V P PC+LL   + P+K
Sbjct  416  KV-QWNCTNVAGVTSRVKPEPCSLLPEKKAPMK  447



>ref|NP_001151164.1| glycoside hydrolase, family 28 precursor [Zea mays]
 gb|ACF87988.1| unknown [Zea mays]
 gb|AFW75223.1| glycoside hydrolase, family 28 [Zea mays]
Length=486

 Score =   266 bits (680),  Expect = 4e-82, Method: Compositional matrix adjust.
 Identities = 132/220 (60%), Positives = 166/220 (75%), Gaps = 6/220 (3%)
 Frame = +2

Query  2    INPDSCTKVRIEDNYIVSGDDCVAIKSGIDEYGIKYGMPTKQLIIRRLTCISPTSGAIAM  181
            INPDSC+ VRIED YIVSGDDCVAIKSG DEYGI YGMP++ ++IRRLTC+SPTS  IA+
Sbjct  250  INPDSCSHVRIEDCYIVSGDDCVAIKSGWDEYGISYGMPSQHIVIRRLTCVSPTSAVIAL  309

Query  182  GSEMSGGIEDVRASDITALDTESGVRIKTALGRGGYVKNIYVKGLRAHTMKLLFQMTGKY  361
            GSEMSGGI+DVRA DITA++TES VRIKTA+GRG YV++++ + +   TMK +F MTG Y
Sbjct  310  GSEMSGGIQDVRAEDITAINTESAVRIKTAVGRGAYVRDVFARRMTLTTMKRVFWMTGDY  369

Query  362  GSHADKNFDPKAIPVVAGINFRDVVADNV-TTAGTMEGIPGHPFTGICMANVTIGMAKNG  538
             SH D  +DP A+PVVA I+++DVVA  V   A  ++GI G PF GIC+ANVT  ++K+ 
Sbjct  370  KSHPDDKYDPNAVPVVANISYQDVVATGVYKEAARLQGIQGAPFRGICVANVTADLSKSR  429

Query  539  KKQPPWVCANIQGVASGVVPPPCNLLHSQGPVKPGMCDLP  658
            K   PW CA+I+GV++ V P PC+ L  QG    G C  P
Sbjct  430  KY--PWNCADIEGVSANVSPAPCDPL--QG-AHDGACPFP  464



>gb|AFW75224.1| glycoside hydrolase, family 28 [Zea mays]
Length=506

 Score =   266 bits (681),  Expect = 4e-82, Method: Compositional matrix adjust.
 Identities = 132/220 (60%), Positives = 166/220 (75%), Gaps = 6/220 (3%)
 Frame = +2

Query  2    INPDSCTKVRIEDNYIVSGDDCVAIKSGIDEYGIKYGMPTKQLIIRRLTCISPTSGAIAM  181
            INPDSC+ VRIED YIVSGDDCVAIKSG DEYGI YGMP++ ++IRRLTC+SPTS  IA+
Sbjct  270  INPDSCSHVRIEDCYIVSGDDCVAIKSGWDEYGISYGMPSQHIVIRRLTCVSPTSAVIAL  329

Query  182  GSEMSGGIEDVRASDITALDTESGVRIKTALGRGGYVKNIYVKGLRAHTMKLLFQMTGKY  361
            GSEMSGGI+DVRA DITA++TES VRIKTA+GRG YV++++ + +   TMK +F MTG Y
Sbjct  330  GSEMSGGIQDVRAEDITAINTESAVRIKTAVGRGAYVRDVFARRMTLTTMKRVFWMTGDY  389

Query  362  GSHADKNFDPKAIPVVAGINFRDVVADNV-TTAGTMEGIPGHPFTGICMANVTIGMAKNG  538
             SH D  +DP A+PVVA I+++DVVA  V   A  ++GI G PF GIC+ANVT  ++K+ 
Sbjct  390  KSHPDDKYDPNAVPVVANISYQDVVATGVYKEAARLQGIQGAPFRGICVANVTADLSKSR  449

Query  539  KKQPPWVCANIQGVASGVVPPPCNLLHSQGPVKPGMCDLP  658
            K   PW CA+I+GV++ V P PC+ L  QG    G C  P
Sbjct  450  KY--PWNCADIEGVSANVSPAPCDPL--QG-AHDGACPFP  484



>ref|XP_008229768.1| PREDICTED: probable polygalacturonase [Prunus mume]
Length=474

 Score =   265 bits (677),  Expect = 6e-82, Method: Compositional matrix adjust.
 Identities = 128/219 (58%), Positives = 162/219 (74%), Gaps = 5/219 (2%)
 Frame = +2

Query  2    INPDSCTKVRIEDNYIVSGDDCVAIKSGIDEYGIKYGMPTKQLIIRRLTCISPTSGAIAM  181
            I+PDSC++ RIED +IVSGDDC+A+KSG D+YGIK G+PT+ L+IRRLTCISP S  IA+
Sbjct  238  IDPDSCSQTRIEDCFIVSGDDCIAVKSGWDQYGIKVGIPTEHLVIRRLTCISPDSATIAL  297

Query  182  GSEMSGGIEDVRASDITALDTESGVRIKTALGRGGYVKNIYVKGLRAHTMKLLFQMTGKY  361
            GSEMSGGI DVRA DITAL T+SGVRIKTA GRG YVK+I+++ +   TMK +F MTG Y
Sbjct  298  GSEMSGGIRDVRAEDITALSTQSGVRIKTARGRGAYVKDIFLRRMTLKTMKYVFWMTGSY  357

Query  362  GSHADKNFDPKAIPVVAGINFRDVVADNVTTAGTMEGIPGHPFTGICMANVTIGMAKNGK  541
             SH D +FDPKA+P++  IN++ V A+NVT +  +EGIP  PF GIC++NVTI + +  K
Sbjct  358  RSHPDPSFDPKALPLIQNINYKQVEAENVTYSARLEGIPNDPFKGICISNVTITLTEKPK  417

Query  542  KQPPWVCANIQGVASGVVPPPCNLLHSQGPVKPGMCDLP  658
            K   W C +I GV S V P  C+LL    P K  + D P
Sbjct  418  KL-QWNCTDIAGVTSNVTPKACDLL----PEKKEVVDCP  451



>ref|XP_002273143.3| PREDICTED: probable polygalacturonase, partial [Vitis vinifera]
Length=434

 Score =   264 bits (674),  Expect = 7e-82, Method: Compositional matrix adjust.
 Identities = 127/220 (58%), Positives = 167/220 (76%), Gaps = 5/220 (2%)
 Frame = +2

Query  2    INPDSCTKVRIEDNYIVSGDDCVAIKSGIDEYGIKYGMPTKQLIIRRLTCISPTSGAIAM  181
            INPDSC  V+IED YIVSGDDC+A+KSG D+YGIKYG+PT+ ++IRRLTCISP S  IA+
Sbjct  196  INPDSCANVKIEDCYIVSGDDCIAVKSGWDQYGIKYGVPTRDIVIRRLTCISPDSAVIAL  255

Query  182  GSEMSGGIEDVRASDITALDTESGVRIKTALGRGGYVKNIYVKGLRAHTMKLLFQMTGKY  361
            GSEMSGGI++VRA DITA++++SGVRIKT +GRGGYV++IY + +   TMK +F MT  Y
Sbjct  256  GSEMSGGIKNVRAEDITAINSQSGVRIKTGVGRGGYVQDIYARKMTMKTMKYVFWMTSDY  315

Query  362  GSHADKNFDPKAIPVVAGINFRDVVADNVTTAGTMEGIPGHPFTGICMANVTIGMAKNGK  541
            GSH D  +D KAIP +  IN+R+VVA+NVT +  ++GI G  FTGIC+++VTI + +   
Sbjct  316  GSHPDDEWDRKAIPKIENINYREVVAENVTYSARLDGIAGDKFTGICISDVTIRLTQK-P  374

Query  542  KQPPWVCANIQGVASGVVPPPCNLL-HSQGPVKPGMCDLP  658
            KQ  W C N++GV S V P  C+LL  S+GP++   C  P
Sbjct  375  KQLQWNCTNVEGVTSQVTPQSCDLLPPSKGPLQ---CTFP  411



>ref|XP_010426397.1| PREDICTED: probable polygalacturonase [Camelina sativa]
Length=464

 Score =   264 bits (675),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 126/220 (57%), Positives = 158/220 (72%), Gaps = 5/220 (2%)
 Frame = +2

Query  2    INPDSCTKVRIEDNYIVSGDDCVAIKSGIDEYGIKYGMPTKQLIIRRLTCISPTSGAIAM  181
            INPDSC    IED YIVSGDDC+A+KSG D+YGIK+GMPT+QL IRRLTCISP S  +A+
Sbjct  235  INPDSCKNTLIEDCYIVSGDDCIAVKSGWDQYGIKFGMPTRQLSIRRLTCISPKSAGVAL  294

Query  182  GSEMSGGIEDVRASDITALDTESGVRIKTALGRGGYVKNIYVKGLRAHTMKLLFQMTGKY  361
            GSEMSGGI+DVR  D+T  +TES +RIKTA GRGGYVK+I+ + +   TMK +F M G Y
Sbjct  295  GSEMSGGIKDVRIEDVTLTNTESAIRIKTAAGRGGYVKDIFARRITMKTMKFVFWMNGDY  354

Query  362  GSHADKNFDPKAIPVVAGINFRDVVADNVTTAGTMEGIPGHPFTGICMANVTIGMAKNGK  541
             SH D+ +DPKA P V  IN+RD+ A+NVT + +++GI   PF GIC++NVT+ +A N K
Sbjct  355  NSHPDEGYDPKAFPEVTNINYRDMTAENVTMSASLDGIDKDPFKGICISNVTMALADNAK  414

Query  542  KQPPWVCANIQGVASGVVPPPCNLLHSQGPVKPGMCDLPA  661
            K   W C N+ GV S V P PC+LL    P K   C  P+
Sbjct  415  KV-QWNCTNVAGVTSRVKPEPCSLL----PEKNQDCVFPS  449



>ref|XP_004964293.1| PREDICTED: probable polygalacturonase-like isoform X1 [Setaria 
italica]
Length=486

 Score =   265 bits (677),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 129/221 (58%), Positives = 164/221 (74%), Gaps = 7/221 (3%)
 Frame = +2

Query  2    INPDSCTKVRIEDNYIVSGDDCVAIKSGIDEYGIKYGMPTKQLIIRRLTCISPTSGAIAM  181
            INPDSC+ VRIED Y+VSGDDCVAIKSG DEYGI YGMP++ +++RRLTC+SPTS  IA+
Sbjct  246  INPDSCSHVRIEDCYVVSGDDCVAIKSGWDEYGIAYGMPSEHIVVRRLTCVSPTSAVIAL  305

Query  182  GSEMSGGIEDVRASDITALDTESGVRIKTALGRGGYVKNIYVKGLRAHTMKLLFQMTGKY  361
            GSEMSGGI DVRA DITA+++ESGVRIKTA+GRG YV++++V+G++   MK +F MTG Y
Sbjct  306  GSEMSGGIRDVRAEDITAINSESGVRIKTAVGRGNYVRDVFVRGMKLDGMKYVFWMTGNY  365

Query  362  GSHADKNFDPKAIPVVAGINFRDVVADNV-TTAGTMEGIPGHPFTGICMANVTIGMAKNG  538
             SH D  FDP AIPVV  I+++DVVA  V  +A  +EGI G PF GIC+ANVT    K+ 
Sbjct  366  KSHPDDGFDPNAIPVVENISYQDVVATGVYKSAARLEGIDGAPFRGICLANVTAEFDKS-  424

Query  539  KKQPPWVCANIQGVASG-VVPPPCNLLHSQGPVKPGMCDLP  658
             ++ PW C +++GV+S  V P PC  L  +     G C  P
Sbjct  425  -RKYPWTCTDVEGVSSADVSPAPCEALQGK---HDGACPFP  461



>ref|XP_004964294.1| PREDICTED: probable polygalacturonase-like isoform X2 [Setaria 
italica]
Length=485

 Score =   265 bits (676),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 129/221 (58%), Positives = 164/221 (74%), Gaps = 7/221 (3%)
 Frame = +2

Query  2    INPDSCTKVRIEDNYIVSGDDCVAIKSGIDEYGIKYGMPTKQLIIRRLTCISPTSGAIAM  181
            INPDSC+ VRIED Y+VSGDDCVAIKSG DEYGI YGMP++ +++RRLTC+SPTS  IA+
Sbjct  245  INPDSCSHVRIEDCYVVSGDDCVAIKSGWDEYGIAYGMPSEHIVVRRLTCVSPTSAVIAL  304

Query  182  GSEMSGGIEDVRASDITALDTESGVRIKTALGRGGYVKNIYVKGLRAHTMKLLFQMTGKY  361
            GSEMSGGI DVRA DITA+++ESGVRIKTA+GRG YV++++V+G++   MK +F MTG Y
Sbjct  305  GSEMSGGIRDVRAEDITAINSESGVRIKTAVGRGNYVRDVFVRGMKLDGMKYVFWMTGNY  364

Query  362  GSHADKNFDPKAIPVVAGINFRDVVADNV-TTAGTMEGIPGHPFTGICMANVTIGMAKNG  538
             SH D  FDP AIPVV  I+++DVVA  V  +A  +EGI G PF GIC+ANVT    K+ 
Sbjct  365  KSHPDDGFDPNAIPVVENISYQDVVATGVYKSAARLEGIDGAPFRGICLANVTAEFDKS-  423

Query  539  KKQPPWVCANIQGVASG-VVPPPCNLLHSQGPVKPGMCDLP  658
             ++ PW C +++GV+S  V P PC  L  +     G C  P
Sbjct  424  -RKYPWTCTDVEGVSSADVSPAPCEALQGK---HDGACPFP  460



>ref|XP_010105745.1| putative polygalacturonase [Morus notabilis]
 gb|EXC05965.1| putative polygalacturonase [Morus notabilis]
Length=459

 Score =   263 bits (672),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 131/219 (60%), Positives = 159/219 (73%), Gaps = 5/219 (2%)
 Frame = +2

Query  2    INPDSCTKVRIEDNYIVSGDDCVAIKSGIDEYGIKYGMPTKQLIIRRLTCISPTSGAIAM  181
            I+PDSCT + IED +IVSGDDCVA+KSG  +YGIK G PTKQL+IRRLTCISP S  IA+
Sbjct  227  IDPDSCTNMLIEDCFIVSGDDCVAVKSGWGQYGIKLGKPTKQLVIRRLTCISPDSATIAL  286

Query  182  GSEMSGGIEDVRASDITALDTESGVRIKTALGRGGYVKNIYVKGLRAHTMKLLFQMTGKY  361
            GSEMSGGI+DVR  DITAL T+SG+RIKT  GRGGYVK+I+ + +   TMK  F MTG Y
Sbjct  287  GSEMSGGIQDVRIEDITALSTQSGIRIKTGRGRGGYVKDIFARRMTLKTMKYAFWMTGNY  346

Query  362  GSHADKNFDPKAIPVVAGINFRDVVADNVTTAGTMEGIPGHPFTGICMANVTIGMAKNGK  541
            GSH D  FDPKA+PV+  IN+RDVVA+NVT +  ++GI G  F GIC++N TI + +  K
Sbjct  347  GSHPDPGFDPKALPVIDRINYRDVVAENVTYSARLDGIAGDTFKGICISNATITLTETPK  406

Query  542  KQPPWVCANIQGVASGVVPPPCNLLHSQGPVKPGMCDLP  658
            K   W C N++GV S V P  C+LL    P K G  D P
Sbjct  407  KL-QWNCTNVEGVTSNVTPKACDLL----PEKQGKFDCP  440



>ref|XP_008234902.1| PREDICTED: probable polygalacturonase [Prunus mume]
Length=474

 Score =   263 bits (673),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 125/205 (61%), Positives = 156/205 (76%), Gaps = 1/205 (0%)
 Frame = +2

Query  2    INPDSCTKVRIEDNYIVSGDDCVAIKSGIDEYGIKYGMPTKQLIIRRLTCISPTSGAIAM  181
            INPDSC++ RIED +IVSGDDC+A+KSG D+YGIK G+PT+ L+IRRLTCISP S  IA+
Sbjct  238  INPDSCSQTRIEDCFIVSGDDCIAVKSGWDQYGIKVGIPTEHLVIRRLTCISPDSATIAL  297

Query  182  GSEMSGGIEDVRASDITALDTESGVRIKTALGRGGYVKNIYVKGLRAHTMKLLFQMTGKY  361
            GSEMSGGI +VRA DITAL T+S VRIKTA GRGGYVK+I+V+ +   TMK +F MTG Y
Sbjct  298  GSEMSGGIRNVRAEDITALSTQSSVRIKTAQGRGGYVKDIFVRRMTLKTMKYVFWMTGSY  357

Query  362  GSHADKNFDPKAIPVVAGINFRDVVADNVTTAGTMEGIPGHPFTGICMANVTIGMAKNGK  541
            GSH D  FDPKA+P++  IN++ V A+NVT +  +EGIP   F GIC++NVTI + +  K
Sbjct  358  GSHPDPGFDPKALPLIQNINYKQVEAENVTYSARLEGIPNDHFKGICISNVTITLTEKPK  417

Query  542  KQPPWVCANIQGVASGVVPPPCNLL  616
            K   W C +I GV S V P  C+LL
Sbjct  418  KL-QWNCTDIAGVTSNVTPKACDLL  441



>ref|XP_008234837.1| PREDICTED: probable polygalacturonase [Prunus mume]
Length=474

 Score =   263 bits (673),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 128/219 (58%), Positives = 160/219 (73%), Gaps = 5/219 (2%)
 Frame = +2

Query  2    INPDSCTKVRIEDNYIVSGDDCVAIKSGIDEYGIKYGMPTKQLIIRRLTCISPTSGAIAM  181
            I+PDSC++ RIED +IVSGDDC+A+KSG D+YGIK G+PT+ L+IRRLTCISP S  IA+
Sbjct  238  IDPDSCSQTRIEDCFIVSGDDCIAVKSGWDQYGIKVGIPTEHLVIRRLTCISPDSATIAL  297

Query  182  GSEMSGGIEDVRASDITALDTESGVRIKTALGRGGYVKNIYVKGLRAHTMKLLFQMTGKY  361
            GSEMSGGI DVR  DITAL T+S VRIKTA GRGGYVK+I+V+ +   TMK +F MTG Y
Sbjct  298  GSEMSGGIRDVRVEDITALSTQSSVRIKTAQGRGGYVKDIFVRRMTLKTMKYVFWMTGSY  357

Query  362  GSHADKNFDPKAIPVVAGINFRDVVADNVTTAGTMEGIPGHPFTGICMANVTIGMAKNGK  541
            GSH D  FDPKA+P++  IN++ V A+NVT +  +EGIP   F GIC++NVTI + +  K
Sbjct  358  GSHPDPGFDPKALPLIQNINYKQVEAENVTYSARLEGIPNDHFKGICISNVTITLTEKPK  417

Query  542  KQPPWVCANIQGVASGVVPPPCNLLHSQGPVKPGMCDLP  658
            K   W C +I GV S V P  C+LL    P K  + D P
Sbjct  418  KL-QWNCTDIAGVTSNVTPKACDLL----PEKKEVADCP  451



>ref|XP_004964295.1| PREDICTED: probable polygalacturonase-like isoform X3 [Setaria 
italica]
Length=507

 Score =   264 bits (675),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 129/221 (58%), Positives = 164/221 (74%), Gaps = 7/221 (3%)
 Frame = +2

Query  2    INPDSCTKVRIEDNYIVSGDDCVAIKSGIDEYGIKYGMPTKQLIIRRLTCISPTSGAIAM  181
            INPDSC+ VRIED Y+VSGDDCVAIKSG DEYGI YGMP++ +++RRLTC+SPTS  IA+
Sbjct  267  INPDSCSHVRIEDCYVVSGDDCVAIKSGWDEYGIAYGMPSEHIVVRRLTCVSPTSAVIAL  326

Query  182  GSEMSGGIEDVRASDITALDTESGVRIKTALGRGGYVKNIYVKGLRAHTMKLLFQMTGKY  361
            GSEMSGGI DVRA DITA+++ESGVRIKTA+GRG YV++++V+G++   MK +F MTG Y
Sbjct  327  GSEMSGGIRDVRAEDITAINSESGVRIKTAVGRGNYVRDVFVRGMKLDGMKYVFWMTGNY  386

Query  362  GSHADKNFDPKAIPVVAGINFRDVVADNV-TTAGTMEGIPGHPFTGICMANVTIGMAKNG  538
             SH D  FDP AIPVV  I+++DVVA  V  +A  +EGI G PF GIC+ANVT    K+ 
Sbjct  387  KSHPDDGFDPNAIPVVENISYQDVVATGVYKSAARLEGIDGAPFRGICLANVTAEFDKS-  445

Query  539  KKQPPWVCANIQGVASG-VVPPPCNLLHSQGPVKPGMCDLP  658
             ++ PW C +++GV+S  V P PC  L  +     G C  P
Sbjct  446  -RKYPWTCTDVEGVSSADVSPAPCEALQGK---HDGACPFP  482



>ref|XP_010450744.1| PREDICTED: probable polygalacturonase [Camelina sativa]
Length=459

 Score =   262 bits (670),  Expect = 6e-81, Method: Compositional matrix adjust.
 Identities = 125/220 (57%), Positives = 158/220 (72%), Gaps = 5/220 (2%)
 Frame = +2

Query  2    INPDSCTKVRIEDNYIVSGDDCVAIKSGIDEYGIKYGMPTKQLIIRRLTCISPTSGAIAM  181
            INPDSCT   IED +IVSGDDC+A+KSG D+YGIK+GMPTKQL IRRLTCISP S  +A+
Sbjct  230  INPDSCTNTLIEDCHIVSGDDCIAVKSGWDQYGIKFGMPTKQLSIRRLTCISPKSAGVAL  289

Query  182  GSEMSGGIEDVRASDITALDTESGVRIKTALGRGGYVKNIYVKGLRAHTMKLLFQMTGKY  361
            GSEMSGGI+DVR  D+T  +TES +RIKTA GRGGYVK+++ + +   TMK +F M G Y
Sbjct  290  GSEMSGGIKDVRIEDVTLTNTESAIRIKTAAGRGGYVKDVFARRITMKTMKFVFWMNGDY  349

Query  362  GSHADKNFDPKAIPVVAGINFRDVVADNVTTAGTMEGIPGHPFTGICMANVTIGMAKNGK  541
              H D+ +DPKA P V  IN+RD+ A+NVT + +++GI   PF GIC++NVT+ +A N K
Sbjct  350  NQHPDEGYDPKAFPEVTNINYRDMTAENVTMSASLDGIDKDPFKGICISNVTMELAANAK  409

Query  542  KQPPWVCANIQGVASGVVPPPCNLLHSQGPVKPGMCDLPA  661
            K   W C N+ GV S V P PC+LL    P K   C  P+
Sbjct  410  KV-QWNCTNVAGVTSRVKPEPCSLL----PEKNQDCVFPS  444



>ref|XP_006650993.1| PREDICTED: probable polygalacturonase-like [Oryza brachyantha]
Length=587

 Score =   265 bits (676),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 129/219 (59%), Positives = 164/219 (75%), Gaps = 5/219 (2%)
 Frame = +2

Query  2    INPDSCTKVRIEDNYIVSGDDCVAIKSGIDEYGIKYGMPTKQLIIRRLTCISPTSGAIAM  181
            I+PDS + V+IED YIVSGDDC+A+KSG D+YGIK+  P++ ++IRRLTCISPTS  IA+
Sbjct  358  IDPDSSSHVKIEDCYIVSGDDCIAVKSGWDQYGIKFNKPSQHILIRRLTCISPTSAMIAL  417

Query  182  GSEMSGGIEDVRASDITALDTESGVRIKTALGRGGYVKNIYVKGLRAHTMKLLFQMTGKY  361
            GSEMSGGI+DVRA D  A+DTES VRIK+ +GRGG+VK+++V+GL  HTMK +F MTG Y
Sbjct  418  GSEMSGGIQDVRAVDNVAIDTESAVRIKSGVGRGGFVKDVFVRGLSLHTMKWVFWMTGNY  477

Query  362  GSHADKNFDPKAIPVVAGINFRDVVADNVTTAGTMEGIPGHPFTGICMANVTIGMAKNGK  541
            G H D + DP A+P V GIN+ DV A+NVT AG MEGIP  P+TGIC++NVT  +A + K
Sbjct  478  GQHPDNSSDPNALPEVTGINYSDVFAENVTMAGRMEGIPNDPYTGICISNVTAQLAPDAK  537

Query  542  KQPPWVCANIQGVASGVVPPPCNLLHSQGPVKPGMCDLP  658
            K   W C +++GV S V P PC  L + G  KP  C  P
Sbjct  538  KL-QWNCTDVKGVTSDVSPKPCPELGAAG--KP--CAFP  571



>ref|XP_010503541.1| PREDICTED: probable polygalacturonase [Camelina sativa]
Length=464

 Score =   261 bits (667),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 125/218 (57%), Positives = 156/218 (72%), Gaps = 1/218 (0%)
 Frame = +2

Query  2    INPDSCTKVRIEDNYIVSGDDCVAIKSGIDEYGIKYGMPTKQLIIRRLTCISPTSGAIAM  181
            INPDSC    IED YIVSGDDC+A+KSG D+YGIK+GMPTKQL IRRLTCISP S  +A+
Sbjct  235  INPDSCKNTLIEDCYIVSGDDCIAVKSGWDQYGIKFGMPTKQLSIRRLTCISPKSAGVAL  294

Query  182  GSEMSGGIEDVRASDITALDTESGVRIKTALGRGGYVKNIYVKGLRAHTMKLLFQMTGKY  361
            GSEMSGGI+DVR  D+T ++TES +RIKTA GRGGYVK+I+ + +   TMK +F M G Y
Sbjct  295  GSEMSGGIKDVRIEDVTLINTESAIRIKTAAGRGGYVKDIFARRITMKTMKYVFWMNGDY  354

Query  362  GSHADKNFDPKAIPVVAGINFRDVVADNVTTAGTMEGIPGHPFTGICMANVTIGMAKNGK  541
              H DK +DPKA P V  IN+RD+ A+NVT + +++GI   PF  IC++NVT+ +A N K
Sbjct  355  NQHPDKGYDPKAFPEVTNINYRDMTAENVTMSASLDGIDKDPFKDICISNVTMELAANAK  414

Query  542  KQPPWVCANIQGVASGVVPPPCNLLHSQGPVKPGMCDL  655
            K   W C N+ GV S V P PC+LL  +       CDL
Sbjct  415  KV-QWNCTNVAGVTSRVKPQPCSLLPEKNEDCVFPCDL  451



>ref|XP_010519492.1| PREDICTED: probable polygalacturonase [Tarenaya hassleriana]
Length=468

 Score =   261 bits (667),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 125/209 (60%), Positives = 153/209 (73%), Gaps = 1/209 (0%)
 Frame = +2

Query  2    INPDSCTKVRIEDNYIVSGDDCVAIKSGIDEYGIKYGMPTKQLIIRRLTCISPTSGAIAM  181
            INPDSCT   IED Y+VSGDDC+A+KSG D+YGIK GMPT+QL IRRLTCISP S  +A+
Sbjct  237  INPDSCTNTLIEDCYVVSGDDCIAVKSGWDQYGIKVGMPTQQLSIRRLTCISPDSAGVAL  296

Query  182  GSEMSGGIEDVRASDITALDTESGVRIKTALGRGGYVKNIYVKGLRAHTMKLLFQMTGKY  361
            GSEMSGGI DVR  D+T ++TES VRIKTA+GRG YVK+IY + +   TMK +F  +G Y
Sbjct  297  GSEMSGGIRDVRIEDVTLINTESAVRIKTAIGRGAYVKDIYAQRITMKTMKYVFWTSGSY  356

Query  362  GSHADKNFDPKAIPVVAGINFRDVVADNVTTAGTMEGIPGHPFTGICMANVTIGMAKNGK  541
             SH D ++DPKAIP V  INFRD+ A+NVT  G + GI   PFTGIC++NV I ++   K
Sbjct  357  NSHPDDHWDPKAIPEVTNINFRDMTAENVTMPGNLAGIEKDPFTGICISNVNITLSPKPK  416

Query  542  KQPPWVCANIQGVASGVVPPPCNLLHSQG  628
            K   W C N+ GV S V P PC+LL  +G
Sbjct  417  KV-QWNCTNVAGVTSRVTPEPCSLLPGKG  444



>gb|EMT00190.1| Putative polygalacturonase [Aegilops tauschii]
Length=398

 Score =   258 bits (660),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 129/220 (59%), Positives = 161/220 (73%), Gaps = 6/220 (3%)
 Frame = +2

Query  2    INPDSCTKVRIEDNYIVSGDDCVAIKSGIDEYGIKYGMPTKQLIIRRLTCISPTSGAIAM  181
            INPDSC++VRIED Y+VSGDDCVAIKSG DEYGI  GMP++ +++RRLTC+SPTS  IA+
Sbjct  154  INPDSCSQVRIEDCYVVSGDDCVAIKSGWDEYGIAVGMPSEHIVVRRLTCVSPTSAVIAL  213

Query  182  GSEMSGGIEDVRASDITALDTESGVRIKTALGRGGYVKNIYVKGLRAHTMKLLFQMTGKY  361
            GSEMSGGI DVRA DITA+ TES VRIKTA+GRG YV+++Y + +R   MK +F MTG Y
Sbjct  214  GSEMSGGIRDVRAEDITAIGTESAVRIKTAVGRGAYVRDVYARRMRLDGMKRVFWMTGDY  273

Query  362  GSHADKNFDPKAIPVVAGINFRDVVADNV-TTAGTMEGIPGHPFTGICMANVTIGMAKNG  538
             SH D  +D  A+PVV  I+++DVVA  V   A  M+GI G PF GICMANVT  M K  
Sbjct  274  KSHPDDGYDKTAVPVVENISYQDVVATGVWKEAARMQGIQGAPFKGICMANVTAEMTK--  331

Query  539  KKQPPWVCANIQGVASGVVPPPCNLLHSQGPVKPGMCDLP  658
            +++  W CA+++GV++GV P PC  L  QG    G C  P
Sbjct  332  ERKVSWNCADVEGVSAGVTPAPCAPL--QG-THAGSCPFP  368



>ref|XP_002878707.1| glycoside hydrolase family 28 protein [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH54966.1| glycoside hydrolase family 28 protein [Arabidopsis lyrata subsp. 
lyrata]
Length=477

 Score =   259 bits (661),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 126/219 (58%), Positives = 153/219 (70%), Gaps = 3/219 (1%)
 Frame = +2

Query  2    INPDSCTKVRIEDNYIVSGDDCVAIKSGIDEYGIKYGMPTKQLIIRRLTCISPTSGAIAM  181
            INPDSCT   IED Y+VSGDDC+A+KSG D++GIK GMPTKQL IRRLTCISP S  IA+
Sbjct  246  INPDSCTNTLIEDCYVVSGDDCIAVKSGWDQFGIKVGMPTKQLSIRRLTCISPDSAGIAL  305

Query  182  GSEMSGGIEDVRASDITALDTESGVRIKTALGRGGYVKNIYVKGLRAHTMKLLFQMTGKY  361
            GSEMSGGI+DVR  DIT L T+S +RIKTA+GRGGYVK+I+ +     TMK +F M+G Y
Sbjct  306  GSEMSGGIKDVRIEDITLLQTQSAIRIKTAVGRGGYVKDIFARRFTMKTMKYVFWMSGAY  365

Query  362  GSHADKNFDPKAIPVVAGINFRDVVADNVTTAGTMEGIPGHPFTGICMANVTIGMAKNGK  541
              H    FDPKA+P +  IN+RD+ ADNVT    ++G    PFT ICM+N+ I +A   K
Sbjct  366  NQHPASGFDPKAMPEITNINYRDMTADNVTQPARLDGFKNDPFTKICMSNIKIDLAAEPK  425

Query  542  KQPPWVCANIQGVASGVVPPPCNLLHSQGPVKPGMCDLP  658
            K   W C NI GV+S V P PC+LL  +G   P  C  P
Sbjct  426  KL-LWNCTNISGVSSKVTPKPCSLLPEKG--APVDCAFP  461



>ref|NP_179968.2| pectin lyase-like protein [Arabidopsis thaliana]
 gb|ABE65854.1| glycoside hydrolase family 28 protein/polygalacturonase family 
protein [Arabidopsis thaliana]
 gb|AEC07500.1| pectin lyase-like protein [Arabidopsis thaliana]
Length=477

 Score =   258 bits (660),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 125/219 (57%), Positives = 154/219 (70%), Gaps = 3/219 (1%)
 Frame = +2

Query  2    INPDSCTKVRIEDNYIVSGDDCVAIKSGIDEYGIKYGMPTKQLIIRRLTCISPTSGAIAM  181
            INPDSCT   IED Y+VSGDDC+A+KSG D++GIK GMPT+QL IRRLTCISP S  IA+
Sbjct  246  INPDSCTNTLIEDCYVVSGDDCIAVKSGWDQFGIKVGMPTQQLSIRRLTCISPDSAGIAL  305

Query  182  GSEMSGGIEDVRASDITALDTESGVRIKTALGRGGYVKNIYVKGLRAHTMKLLFQMTGKY  361
            GSEMSGGI+DVR  DIT L T+S +RIKTA+GRGGYVK+I+ +     TMK +F M+G Y
Sbjct  306  GSEMSGGIKDVRIEDITLLQTQSAIRIKTAVGRGGYVKDIFARRFTMKTMKYVFWMSGAY  365

Query  362  GSHADKNFDPKAIPVVAGINFRDVVADNVTTAGTMEGIPGHPFTGICMANVTIGMAKNGK  541
              H    FDPKA+PV+  IN+RD+ ADNVT    ++G    PFT ICM+N+ I +A   K
Sbjct  366  NQHPASGFDPKAMPVITNINYRDMTADNVTQPARLDGFKNDPFTKICMSNIKIDLAAEPK  425

Query  542  KQPPWVCANIQGVASGVVPPPCNLLHSQGPVKPGMCDLP  658
            K   W C +I GV+S V P PC+LL  +G   P  C  P
Sbjct  426  KL-LWNCTSISGVSSKVTPKPCSLLPEKG--APVDCAFP  461



>gb|AAC63679.1| putative polygalacturonase [Arabidopsis thaliana]
Length=466

 Score =   258 bits (658),  Expect = 4e-79, Method: Compositional matrix adjust.
 Identities = 125/219 (57%), Positives = 154/219 (70%), Gaps = 3/219 (1%)
 Frame = +2

Query  2    INPDSCTKVRIEDNYIVSGDDCVAIKSGIDEYGIKYGMPTKQLIIRRLTCISPTSGAIAM  181
            INPDSCT   IED Y+VSGDDC+A+KSG D++GIK GMPT+QL IRRLTCISP S  IA+
Sbjct  235  INPDSCTNTLIEDCYVVSGDDCIAVKSGWDQFGIKVGMPTQQLSIRRLTCISPDSAGIAL  294

Query  182  GSEMSGGIEDVRASDITALDTESGVRIKTALGRGGYVKNIYVKGLRAHTMKLLFQMTGKY  361
            GSEMSGGI+DVR  DIT L T+S +RIKTA+GRGGYVK+I+ +     TMK +F M+G Y
Sbjct  295  GSEMSGGIKDVRIEDITLLQTQSAIRIKTAVGRGGYVKDIFARRFTMKTMKYVFWMSGAY  354

Query  362  GSHADKNFDPKAIPVVAGINFRDVVADNVTTAGTMEGIPGHPFTGICMANVTIGMAKNGK  541
              H    FDPKA+PV+  IN+RD+ ADNVT    ++G    PFT ICM+N+ I +A   K
Sbjct  355  NQHPASGFDPKAMPVITNINYRDMTADNVTQPARLDGFKNDPFTKICMSNIKIDLAAEPK  414

Query  542  KQPPWVCANIQGVASGVVPPPCNLLHSQGPVKPGMCDLP  658
            K   W C +I GV+S V P PC+LL  +G   P  C  P
Sbjct  415  KL-LWNCTSISGVSSKVTPKPCSLLPEKG--APVDCAFP  450



>emb|CDY05885.1| BnaC08g20620D [Brassica napus]
Length=464

 Score =   258 bits (658),  Expect = 4e-79, Method: Compositional matrix adjust.
 Identities = 125/220 (57%), Positives = 157/220 (71%), Gaps = 5/220 (2%)
 Frame = +2

Query  2    INPDSCTKVRIEDNYIVSGDDCVAIKSGIDEYGIKYGMPTKQLIIRRLTCISPTSGAIAM  181
            INPDSCT   IED YIVSGDDC+A+KSG D+YGIK+GMPT+QL IRRLTCISP S  +A+
Sbjct  235  INPDSCTNTLIEDCYIVSGDDCIAVKSGWDQYGIKFGMPTQQLSIRRLTCISPKSAGVAL  294

Query  182  GSEMSGGIEDVRASDITALDTESGVRIKTALGRGGYVKNIYVKGLRAHTMKLLFQMTGKY  361
            GSEMSGGI+DVR  D+T ++TES VRIKTA GRG YVK+IY +     TMK +F M+G Y
Sbjct  295  GSEMSGGIKDVRIEDVTLINTESSVRIKTAAGRGVYVKDIYARRFTMKTMKYVFWMSGNY  354

Query  362  GSHADKNFDPKAIPVVAGINFRDVVADNVTTAGTMEGIPGHPFTGICMANVTIGMAKNGK  541
              H D+ +DPKA+P V+ INF D+ A+NVT + ++ GI   PFTGIC++NV I ++    
Sbjct  355  NQHPDEGYDPKALPEVSNINFSDMTAENVTMSASLAGIDKDPFTGICISNVNITLSAK-P  413

Query  542  KQPPWVCANIQGVASGVVPPPCNLLHSQGPVKPGMCDLPA  661
            K+  W C N+ GV S V P PC+LL    P K   C  P+
Sbjct  414  KEVQWNCTNMAGVTSRVKPEPCSLL----PEKNMDCKFPS  449



>gb|ABK28510.1| unknown [Arabidopsis thaliana]
Length=478

 Score =   258 bits (659),  Expect = 4e-79, Method: Compositional matrix adjust.
 Identities = 125/219 (57%), Positives = 154/219 (70%), Gaps = 3/219 (1%)
 Frame = +2

Query  2    INPDSCTKVRIEDNYIVSGDDCVAIKSGIDEYGIKYGMPTKQLIIRRLTCISPTSGAIAM  181
            INPDSCT   IED Y+VSGDDC+A+KSG D++GIK GMPT+QL IRRLTCISP S  IA+
Sbjct  246  INPDSCTNTLIEDCYVVSGDDCIAVKSGWDQFGIKVGMPTQQLSIRRLTCISPDSAGIAL  305

Query  182  GSEMSGGIEDVRASDITALDTESGVRIKTALGRGGYVKNIYVKGLRAHTMKLLFQMTGKY  361
            GSEMSGGI+DVR  DIT L T+S +RIKTA+GRGGYVK+I+ +     TMK +F M+G Y
Sbjct  306  GSEMSGGIKDVRIEDITLLQTQSAIRIKTAVGRGGYVKDIFARRFTMKTMKYVFWMSGAY  365

Query  362  GSHADKNFDPKAIPVVAGINFRDVVADNVTTAGTMEGIPGHPFTGICMANVTIGMAKNGK  541
              H    FDPKA+PV+  IN+RD+ ADNVT    ++G    PFT ICM+N+ I +A   K
Sbjct  366  NQHPASGFDPKAMPVITNINYRDMTADNVTQPARLDGFKNDPFTKICMSNIKIDLAAEPK  425

Query  542  KQPPWVCANIQGVASGVVPPPCNLLHSQGPVKPGMCDLP  658
            K   W C +I GV+S V P PC+LL  +G   P  C  P
Sbjct  426  KL-LWNCTSISGVSSKVTPKPCSLLPEKG--APVDCAFP  461



>ref|XP_010519488.1| PREDICTED: probable polygalacturonase isoform X2 [Tarenaya hassleriana]
 ref|XP_010519489.1| PREDICTED: probable polygalacturonase isoform X2 [Tarenaya hassleriana]
 ref|XP_010519491.1| PREDICTED: probable polygalacturonase isoform X2 [Tarenaya hassleriana]
Length=468

 Score =   257 bits (657),  Expect = 7e-79, Method: Compositional matrix adjust.
 Identities = 122/219 (56%), Positives = 160/219 (73%), Gaps = 3/219 (1%)
 Frame = +2

Query  2    INPDSCTKVRIEDNYIVSGDDCVAIKSGIDEYGIKYGMPTKQLIIRRLTCISPTSGAIAM  181
            I+PDSCT   IED Y+VSGDDC+A+KSG D+YGIK G+PT+QL IRRLTCISP S  +A+
Sbjct  237  IDPDSCTNTLIEDCYVVSGDDCIAVKSGWDQYGIKVGIPTQQLSIRRLTCISPDSAGVAL  296

Query  182  GSEMSGGIEDVRASDITALDTESGVRIKTALGRGGYVKNIYVKGLRAHTMKLLFQMTGKY  361
            GSEMSGGI DVR  D T ++T+SG+RIKTA+GRGGYVK+I+ + +   TMK +F M+G Y
Sbjct  297  GSEMSGGIRDVRIEDSTMINTQSGIRIKTAIGRGGYVKDIFARRIMMKTMKYVFWMSGAY  356

Query  362  GSHADKNFDPKAIPVVAGINFRDVVADNVTTAGTMEGIPGHPFTGICMANVTIGMAKNGK  541
              H D++FDPKA+P +  IN+RD++ADNVT +  ++GI    FTGIC++NV I ++ N K
Sbjct  357  NQHPDEHFDPKALPEITNINYRDMMADNVTISARLDGIEKDQFTGICISNVNISLSPNPK  416

Query  542  KQPPWVCANIQGVASGVVPPPCNLLHSQGPVKPGMCDLP  658
            K   W C ++ GV S V PP C+LL  +G   P  C  P
Sbjct  417  KL-QWNCTDVAGVTSRVSPPACSLLPEKG--SPVDCKFP  452



>ref|XP_010519487.1| PREDICTED: probable polygalacturonase isoform X1 [Tarenaya hassleriana]
Length=475

 Score =   257 bits (657),  Expect = 7e-79, Method: Compositional matrix adjust.
 Identities = 122/219 (56%), Positives = 160/219 (73%), Gaps = 3/219 (1%)
 Frame = +2

Query  2    INPDSCTKVRIEDNYIVSGDDCVAIKSGIDEYGIKYGMPTKQLIIRRLTCISPTSGAIAM  181
            I+PDSCT   IED Y+VSGDDC+A+KSG D+YGIK G+PT+QL IRRLTCISP S  +A+
Sbjct  244  IDPDSCTNTLIEDCYVVSGDDCIAVKSGWDQYGIKVGIPTQQLSIRRLTCISPDSAGVAL  303

Query  182  GSEMSGGIEDVRASDITALDTESGVRIKTALGRGGYVKNIYVKGLRAHTMKLLFQMTGKY  361
            GSEMSGGI DVR  D T ++T+SG+RIKTA+GRGGYVK+I+ + +   TMK +F M+G Y
Sbjct  304  GSEMSGGIRDVRIEDSTMINTQSGIRIKTAIGRGGYVKDIFARRIMMKTMKYVFWMSGAY  363

Query  362  GSHADKNFDPKAIPVVAGINFRDVVADNVTTAGTMEGIPGHPFTGICMANVTIGMAKNGK  541
              H D++FDPKA+P +  IN+RD++ADNVT +  ++GI    FTGIC++NV I ++ N K
Sbjct  364  NQHPDEHFDPKALPEITNINYRDMMADNVTISARLDGIEKDQFTGICISNVNISLSPNPK  423

Query  542  KQPPWVCANIQGVASGVVPPPCNLLHSQGPVKPGMCDLP  658
            K   W C ++ GV S V PP C+LL  +G   P  C  P
Sbjct  424  KL-QWNCTDVAGVTSRVSPPACSLLPEKG--SPVDCKFP  459



>gb|KDP22227.1| hypothetical protein JCGZ_26058 [Jatropha curcas]
Length=477

 Score =   257 bits (657),  Expect = 8e-79, Method: Compositional matrix adjust.
 Identities = 117/208 (56%), Positives = 154/208 (74%), Gaps = 1/208 (0%)
 Frame = +2

Query  2    INPDSCTKVRIEDNYIVSGDDCVAIKSGIDEYGIKYGMPTKQLIIRRLTCISPTSGAIAM  181
            INPDSC+   IED YIVSGDDC+AIKSG D+YG+K  MPT+ L++RRLTCISP S  IA+
Sbjct  245  INPDSCSNCLIEDCYIVSGDDCIAIKSGWDQYGLKVAMPTEHLVVRRLTCISPDSATIAL  304

Query  182  GSEMSGGIEDVRASDITALDTESGVRIKTALGRGGYVKNIYVKGLRAHTMKLLFQMTGKY  361
            GSEMSGGI+DVR  D+ A+DT+SGVRIKTA GRGG++K+I+V+ +    MK +F MTG Y
Sbjct  305  GSEMSGGIQDVRVEDVIAVDTQSGVRIKTAAGRGGFIKDIFVRRMTMKNMKYVFWMTGAY  364

Query  362  GSHADKNFDPKAIPVVAGINFRDVVADNVTTAGTMEGIPGHPFTGICMANVTIGMAKNGK  541
             SH D  FDP A+  + GIN+ D+VADNVT    ++G    PF+GIC++N TI ++++  
Sbjct  365  KSHPDDGFDPNALAEITGINYSDIVADNVTITAALDGFSKAPFSGICISNATITLSEDA-  423

Query  542  KQPPWVCANIQGVASGVVPPPCNLLHSQ  625
            K+  W C N++GV+S V P PC+ L  Q
Sbjct  424  KELQWNCTNVKGVSSHVTPKPCDSLPEQ  451



>emb|CDY39678.1| BnaA04g13950D [Brassica napus]
Length=478

 Score =   257 bits (657),  Expect = 9e-79, Method: Compositional matrix adjust.
 Identities = 123/219 (56%), Positives = 151/219 (69%), Gaps = 4/219 (2%)
 Frame = +2

Query  2    INPDSCTKVRIEDNYIVSGDDCVAIKSGIDEYGIKYGMPTKQLIIRRLTCISPTSGAIAM  181
            INPDSCT   IED ++VSGDDC+A+KSG D++GIK GMPT+QL IRRLTCISP S  IA+
Sbjct  248  INPDSCTNTLIEDCFVVSGDDCIAVKSGWDQFGIKVGMPTQQLSIRRLTCISPDSAGIAL  307

Query  182  GSEMSGGIEDVRASDITALDTESGVRIKTALGRGGYVKNIYVKGLRAHTMKLLFQMTGKY  361
            GSEMSGGI+DVR  DIT L T+S +RIKTA+GRGGYVK+I+ +     TMK +F M+G Y
Sbjct  308  GSEMSGGIKDVRMEDITLLQTQSAIRIKTAVGRGGYVKDIFARRFTMKTMKYVFWMSGAY  367

Query  362  GSHADKNFDPKAIPVVAGINFRDVVADNVTTAGTMEGIPGHPFTGICMANVTIGMAKNGK  541
              H    FDPKA+P +  IN+RD+ ADNVT    ++G    PFT ICM+N+ I +A   K
Sbjct  368  NQHPASGFDPKAMPEITNINYRDMTADNVTQPARLDGFTNDPFTKICMSNINIALAAEPK  427

Query  542  KQPPWVCANIQGVASGVVPPPCNLLHSQGPVKPGMCDLP  658
            K   W C  I GV+S V P PC+LL    PV    C  P
Sbjct  428  KL-LWNCTAISGVSSKVTPKPCSLLPENAPVD---CAFP  462



>gb|AGZ62594.1| pollen-specific polygalacturonase [Brassica rapa subsp. chinensis]
Length=478

 Score =   257 bits (656),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 123/219 (56%), Positives = 151/219 (69%), Gaps = 4/219 (2%)
 Frame = +2

Query  2    INPDSCTKVRIEDNYIVSGDDCVAIKSGIDEYGIKYGMPTKQLIIRRLTCISPTSGAIAM  181
            INPDSCT   IED ++VSGDDC+A+KSG D++GIK GMPT+QL IRRLTCISP S  IA+
Sbjct  248  INPDSCTNTLIEDCFVVSGDDCIAVKSGWDQFGIKVGMPTQQLSIRRLTCISPDSAGIAL  307

Query  182  GSEMSGGIEDVRASDITALDTESGVRIKTALGRGGYVKNIYVKGLRAHTMKLLFQMTGKY  361
            GSEMSGGI+DVR  DIT L T+S +RIKTA+GRGGYVK+I+ +     TMK +F M+G Y
Sbjct  308  GSEMSGGIKDVRMEDITLLQTQSAIRIKTAVGRGGYVKDIFARRFTMKTMKYVFWMSGAY  367

Query  362  GSHADKNFDPKAIPVVAGINFRDVVADNVTTAGTMEGIPGHPFTGICMANVTIGMAKNGK  541
              H    FDPKA+P +  IN+RD+ ADNVT    ++G    PFT ICM+N+ I +A   K
Sbjct  368  NQHPASGFDPKAMPEITNINYRDMAADNVTQPARLDGFTNDPFTKICMSNINIALAAEPK  427

Query  542  KQPPWVCANIQGVASGVVPPPCNLLHSQGPVKPGMCDLP  658
            K   W C  I GV+S V P PC+LL    PV    C  P
Sbjct  428  KL-LWNCTAISGVSSKVTPKPCSLLPENAPVD---CAFP  462



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1401487976976