BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c25593_g1_i1 len=918 path=[1275:0-90 954:91-108 972:109-112
1386:113-149 4254:150-168 1441:169-172 1274:173-199 1471:200-210
1482:211-237 4319:238-246 1517:247-249 946:250-331 1601:332-338
364:339-382 4351:383-385 4354:386-395 746:396-430 622:431-439
1100:440-477 4384:478-478 1738:479-493 708:494-496 872:497-537
1023:538-551 1037:552-588 4441:589-591 4444:592-592 4445:593-597
3158:598-640 1893:641-669 3071:670-675 1928:676-917]

Length=918
                                                                      Score     E

ref|XP_006339619.1|  PREDICTED: probable polygalacturonase-like         310   1e-98   
ref|XP_009762711.1|  PREDICTED: probable polygalacturonase isofor...    307   2e-97   
emb|CDP20376.1|  unnamed protein product                                307   2e-97   
ref|XP_009762710.1|  PREDICTED: probable polygalacturonase isofor...    307   2e-97   
gb|KDO86269.1|  hypothetical protein CISIN_1g0090751mg                  299   3e-97   
ref|XP_004229920.2|  PREDICTED: probable polygalacturonase              306   4e-97   
ref|XP_009767883.1|  PREDICTED: probable polygalacturonase              305   8e-97   
ref|XP_006491165.1|  PREDICTED: probable polygalacturonase-like         302   2e-95   
ref|XP_006444979.1|  hypothetical protein CICLE_v10019597mg             303   4e-95   
ref|XP_009599786.1|  PREDICTED: probable polygalacturonase isofor...    301   5e-95   
ref|XP_009599780.1|  PREDICTED: probable polygalacturonase isofor...    300   1e-94   
ref|XP_003528838.1|  PREDICTED: probable polygalacturonase              300   1e-94   
gb|KHN26934.1|  Putative polygalacturonase                              300   2e-94   
ref|XP_006345582.1|  PREDICTED: probable polygalacturonase-like i...    300   2e-94   
ref|XP_006345581.1|  PREDICTED: probable polygalacturonase-like i...    300   2e-94   
ref|XP_004240097.1|  PREDICTED: probable polygalacturonase              299   3e-94   
ref|XP_009624373.1|  PREDICTED: probable polygalacturonase              298   7e-94   
ref|XP_011092828.1|  PREDICTED: probable polygalacturonase              298   1e-93   
ref|XP_007144550.1|  hypothetical protein PHAVU_007G165300g             296   3e-93   
gb|KDP28587.1|  hypothetical protein JCGZ_14358                         295   7e-93   
gb|KHG15710.1|  hypothetical protein F383_10492                         295   8e-93   
ref|XP_006386609.1|  hypothetical protein POPTR_0002s16390g             291   1e-92   
gb|KHG15709.1|  hypothetical protein F383_10492                         295   1e-92   
ref|XP_011023291.1|  PREDICTED: probable polygalacturonase isofor...    295   1e-92   
ref|XP_011023292.1|  PREDICTED: probable polygalacturonase isofor...    295   1e-92   
ref|XP_007051731.1|  Polygalacturonase, putative isoform 1              295   1e-92   
ref|XP_003624048.1|  Polygalacturonase                                  295   2e-92   
ref|XP_007051732.1|  Polygalacturonase, putative isoform 2              294   2e-92   
ref|XP_002511903.1|  polygalacturonase, putative                        294   2e-92   Ricinus communis
ref|XP_003548644.2|  PREDICTED: probable polygalacturonase-like i...    295   2e-92   
gb|KHN46704.1|  Putative polygalacturonase                              294   2e-92   
ref|XP_006598941.1|  PREDICTED: probable polygalacturonase-like i...    294   3e-92   
ref|XP_011029346.1|  PREDICTED: probable polygalacturonase              294   3e-92   
ref|XP_002301370.1|  polygalacturonase-like family protein              293   5e-92   Populus trichocarpa [western balsam poplar]
ref|XP_002303605.2|  hypothetical protein POPTR_0003s13160g             293   5e-92   Populus trichocarpa [western balsam poplar]
ref|XP_011022627.1|  PREDICTED: probable polygalacturonase              293   6e-92   
gb|ABG34276.1|  polygalacturonase                                       285   6e-92   Eucalyptus globulus subsp. globulus
gb|AAP33475.1|  polygalacturonase-like protein                          293   7e-92   Fragaria x ananassa
ref|XP_002299511.1|  hypothetical protein POPTR_0001s09790g             293   7e-92   Populus trichocarpa [western balsam poplar]
ref|XP_004306749.1|  PREDICTED: probable polygalacturonase-like         293   8e-92   
gb|AFK43011.1|  unknown                                                 292   1e-91   
ref|XP_002278930.1|  PREDICTED: probable polygalacturonase              290   1e-90   Vitis vinifera
ref|XP_003533597.1|  PREDICTED: probable polygalacturonase-like         289   2e-90   
ref|XP_003552411.1|  PREDICTED: probable polygalacturonase              289   2e-90   
emb|CDP12065.1|  unnamed protein product                                288   2e-90   
gb|ABG34275.1|  polygalacturonase                                       281   3e-90   Eucalyptus globulus subsp. globulus
ref|XP_010053221.1|  PREDICTED: probable polygalacturonase              288   5e-90   
ref|XP_008232996.1|  PREDICTED: LOW QUALITY PROTEIN: probable pol...    288   6e-90   
gb|KHN26935.1|  Putative polygalacturonase                              284   8e-90   
gb|EYU35105.1|  hypothetical protein MIMGU_mgv1a005694mg                287   9e-90   
ref|XP_004295492.1|  PREDICTED: probable polygalacturonase-like         288   9e-90   
ref|XP_007219266.1|  hypothetical protein PRUPE_ppa018224mg             286   1e-89   
ref|XP_004503680.1|  PREDICTED: probable polygalacturonase-like i...    286   1e-89   
ref|XP_002509850.1|  polygalacturonase, putative                        287   2e-89   Ricinus communis
ref|XP_004492778.1|  PREDICTED: probable polygalacturonase-like         286   2e-89   
ref|XP_003633958.1|  PREDICTED: probable polygalacturonase              286   2e-89   
ref|XP_007139799.1|  hypothetical protein PHAVU_008G059700g             286   2e-89   
ref|XP_004503678.1|  PREDICTED: probable polygalacturonase-like i...    287   2e-89   
sp|A7PZL3.1|PGLR_VITVI  RecName: Full=Probable polygalacturonase;...    286   2e-89   Vitis vinifera
gb|ABG34277.1|  polygalacturonase                                       278   2e-89   Eucalyptus globulus subsp. globulus
ref|XP_010523769.1|  PREDICTED: probable polygalacturonase isofor...    286   3e-89   
ref|XP_003529926.1|  PREDICTED: probable polygalacturonase-like         286   8e-89   
ref|XP_010089056.1|  putative polygalacturonase                         283   3e-88   
ref|XP_010523770.1|  PREDICTED: probable polygalacturonase isofor...    283   3e-88   
ref|XP_007040335.1|  Pectin lyase-like superfamily protein isoform 1    283   4e-88   
ref|XP_010055091.1|  PREDICTED: probable polygalacturonase isofor...    283   5e-88   
ref|XP_008343414.1|  PREDICTED: probable polygalacturonase              283   6e-88   
ref|XP_010055092.1|  PREDICTED: probable polygalacturonase isofor...    283   7e-88   
ref|XP_010469084.1|  PREDICTED: probable polygalacturonase              282   1e-87   
gb|KEH21119.1|  polygalacturonase/glycoside hydrolase family protein    280   3e-87   
ref|XP_002876618.1|  glycoside hydrolase family 28 protein              281   3e-87   
ref|XP_004298828.1|  PREDICTED: probable polygalacturonase-like         281   5e-87   
ref|NP_191708.1|  polygalacturonase-like protein                        280   6e-87   Arabidopsis thaliana [mouse-ear cress]
gb|KHN16795.1|  Putative polygalacturonase                              278   7e-87   
ref|XP_006291035.1|  hypothetical protein CARUB_v10017147mg             280   7e-87   
ref|XP_009349812.1|  PREDICTED: probable polygalacturonase              280   7e-87   
ref|XP_006402475.1|  hypothetical protein EUTSA_v10005939mg             280   8e-87   
ref|XP_010055093.1|  PREDICTED: probable polygalacturonase              280   9e-87   
ref|XP_006439488.1|  hypothetical protein CICLE_v10019941mg             280   9e-87   
ref|XP_009116814.1|  PREDICTED: probable polygalacturonase              279   1e-86   
ref|XP_010413390.1|  PREDICTED: probable polygalacturonase              279   1e-86   
gb|AFK37962.1|  unknown                                                 278   2e-86   
emb|CDY65355.1|  BnaC08g49000D                                          278   3e-86   
gb|KDO76318.1|  hypothetical protein CISIN_1g011659mg                   278   3e-86   
ref|XP_003532926.1|  PREDICTED: probable polygalacturonase-like i...    278   5e-86   
gb|KDP25392.1|  hypothetical protein JCGZ_20548                         278   6e-86   
ref|XP_006584731.1|  PREDICTED: probable polygalacturonase-like i...    278   7e-86   
ref|XP_009604283.1|  PREDICTED: probable polygalacturonase              278   7e-86   
ref|XP_008238946.1|  PREDICTED: probable polygalacturonase              278   7e-86   
ref|XP_007160099.1|  hypothetical protein PHAVU_002G292300g             277   7e-86   
gb|KHM99951.1|  Putative polygalacturonase                              276   7e-86   
emb|CDY48913.1|  BnaA09g39240D                                          277   1e-85   
ref|XP_009793070.1|  PREDICTED: probable polygalacturonase              277   1e-85   
ref|XP_009345122.1|  PREDICTED: probable polygalacturonase              277   1e-85   
ref|XP_003622464.1|  Polygalacturonase-like protein                     277   1e-85   
gb|KHG23155.1|  putative polygalacturonase                              276   1e-85   
ref|XP_006476506.1|  PREDICTED: probable polygalacturonase-like         276   2e-85   
gb|EYU23462.1|  hypothetical protein MIMGU_mgv1a006147mg                275   2e-85   
ref|XP_006580552.1|  PREDICTED: probable polygalacturonase-like i...    276   2e-85   
ref|XP_010255225.1|  PREDICTED: probable polygalacturonase isofor...    275   3e-85   
ref|XP_004510753.1|  PREDICTED: probable polygalacturonase-like         276   3e-85   
ref|XP_003525377.2|  PREDICTED: probable polygalacturonase-like i...    275   5e-85   
ref|XP_006343936.1|  PREDICTED: probable polygalacturonase-like         275   5e-85   
gb|AFK44529.1|  unknown                                                 275   6e-85   
ref|XP_010255224.1|  PREDICTED: probable polygalacturonase isofor...    275   7e-85   
ref|XP_010255223.1|  PREDICTED: probable polygalacturonase isofor...    275   8e-85   
ref|XP_007209970.1|  hypothetical protein PRUPE_ppa004996mg             275   8e-85   
gb|EPS72197.1|  hypothetical protein M569_02558                         272   5e-84   
ref|XP_010530415.1|  PREDICTED: probable polygalacturonase              271   5e-84   
ref|XP_004245570.1|  PREDICTED: probable polygalacturonase              272   1e-83   
ref|XP_008438007.1|  PREDICTED: probable polygalacturonase              272   1e-83   
ref|XP_010276903.1|  PREDICTED: probable polygalacturonase isofor...    270   2e-83   
ref|XP_004133855.1|  PREDICTED: probable polygalacturonase-like         271   4e-83   
ref|XP_004172137.1|  PREDICTED: probable polygalacturonase-like         271   4e-83   
ref|XP_010276902.1|  PREDICTED: probable polygalacturonase isofor...    270   4e-83   
ref|XP_010276899.1|  PREDICTED: probable polygalacturonase isofor...    269   1e-82   
ref|XP_010436419.1|  PREDICTED: probable polygalacturonase              265   1e-82   
emb|CDY70893.1|  BnaCnng70190D                                          264   3e-82   
emb|CDY69255.1|  BnaAnng29830D                                          265   4e-82   
ref|XP_010676424.1|  PREDICTED: probable polygalacturonase              268   4e-82   
ref|XP_006413548.1|  hypothetical protein EUTSA_v10025011mg             268   4e-82   
ref|XP_002869777.1|  glycoside hydrolase family 28 protein              268   5e-82   
gb|EMS49882.1|  putative polygalacturonase                              264   7e-82   
ref|NP_194081.1|  putative polygalacturonase                            267   1e-81   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008780530.1|  PREDICTED: probable polygalacturonase              258   1e-81   
ref|XP_010448699.1|  PREDICTED: probable polygalacturonase              266   1e-81   
ref|XP_010089055.1|  putative polygalacturonase                         266   1e-81   
ref|XP_006283603.1|  hypothetical protein CARUB_v10004660mg             266   2e-81   
ref|XP_009137356.1|  PREDICTED: probable polygalacturonase              266   2e-81   
ref|XP_010439166.1|  PREDICTED: probable polygalacturonase              266   3e-81   
ref|XP_003592201.1|  Polygalacturonase-like protein                     265   3e-81   
gb|AES62452.2|  pectin lyase superfamily protein                        265   3e-81   
ref|XP_009137085.1|  PREDICTED: probable polygalacturonase              265   4e-81   
ref|XP_010230291.1|  PREDICTED: probable polygalacturonase              263   4e-81   
ref|XP_009607671.1|  PREDICTED: probable polygalacturonase              265   5e-81   
dbj|BAK02492.1|  predicted protein                                      260   2e-80   
gb|KFK28901.1|  hypothetical protein AALP_AA7G062800                    263   2e-80   
gb|EPS71449.1|  hypothetical protein M569_03308                         261   3e-80   
ref|XP_003592202.1|  hypothetical protein MTR_1g100060                  262   7e-80   
emb|CDY44105.1|  BnaA01g13130D                                          261   8e-80   
ref|XP_002273177.2|  PREDICTED: probable polygalacturonase              261   1e-79   Vitis vinifera
ref|XP_009772512.1|  PREDICTED: probable polygalacturonase              261   1e-79   
ref|XP_007038809.1|  Pectin lyase-like superfamily protein isoform 2    261   1e-79   
ref|XP_009383010.1|  PREDICTED: probable polygalacturonase              258   1e-79   
ref|XP_007038808.1|  Pectin lyase-like superfamily protein isoform 1    261   1e-79   
gb|AES62453.2|  pectin lyase superfamily protein                        261   2e-79   
ref|NP_001048813.1|  Os03g0124900                                       260   2e-79   Oryza sativa Japonica Group [Japonica rice]
ref|XP_007151453.1|  hypothetical protein PHAVU_004G047800g             260   3e-79   
ref|XP_006589526.1|  PREDICTED: probable polygalacturonase-like i...    259   4e-79   
gb|KHN21786.1|  Putative polygalacturonase                              258   4e-79   
ref|XP_003535597.1|  PREDICTED: probable polygalacturonase-like i...    259   6e-79   
ref|XP_010276919.1|  PREDICTED: probable polygalacturonase              262   1e-78   
gb|KHN21785.1|  Putative polygalacturonase                              258   1e-78   
ref|XP_003536450.1|  PREDICTED: probable polygalacturonase-like         258   2e-78   
ref|XP_006422033.1|  hypothetical protein CICLE_v10004864mg             258   3e-78   
ref|XP_003535598.1|  PREDICTED: probable polygalacturonase-like         257   3e-78   
gb|KHN21784.1|  Putative polygalacturonase                              257   4e-78   
ref|XP_003624874.1|  hypothetical protein MTR_7g088550                  256   8e-78   
ref|XP_003592200.1|  Polygalacturonase-like protein                     256   9e-78   
ref|XP_004985902.1|  PREDICTED: probable polygalacturonase-like         255   1e-77   
gb|KHG19694.1|  putative polygalacturonase                              255   2e-77   
ref|XP_006650993.1|  PREDICTED: probable polygalacturonase-like         258   3e-77   
ref|XP_009363435.1|  PREDICTED: probable polygalacturonase              254   5e-77   
ref|XP_006362679.1|  PREDICTED: probable polygalacturonase-like         256   5e-77   
ref|NP_001151102.1|  glycoside hydrolase, family 28 precursor           253   1e-76   Zea mays [maize]
ref|XP_009382256.1|  PREDICTED: probable polygalacturonase isofor...    253   1e-76   
ref|XP_002468601.1|  hypothetical protein SORBIDRAFT_01g048880          253   1e-76   Sorghum bicolor [broomcorn]
ref|XP_010024977.1|  PREDICTED: probable polygalacturonase              252   2e-76   
gb|KCW90638.1|  hypothetical protein EUGRSUZ_A02742                     252   2e-76   
ref|XP_006292567.1|  hypothetical protein CARUB_v10018803mg             252   2e-76   
ref|XP_010941157.1|  PREDICTED: probable polygalacturonase              252   3e-76   
ref|XP_004496830.1|  PREDICTED: probable polygalacturonase-like         252   3e-76   
ref|XP_007151452.1|  hypothetical protein PHAVU_004G047700g             251   4e-76   
ref|XP_008794781.1|  PREDICTED: probable polygalacturonase isofor...    251   6e-76   
ref|XP_008810120.1|  PREDICTED: probable polygalacturonase isofor...    250   7e-76   
ref|XP_008794778.1|  PREDICTED: probable polygalacturonase isofor...    251   7e-76   
ref|XP_008794779.1|  PREDICTED: probable polygalacturonase isofor...    251   7e-76   
ref|XP_008794777.1|  PREDICTED: probable polygalacturonase isofor...    251   9e-76   
ref|XP_004496829.1|  PREDICTED: probable polygalacturonase-like         251   1e-75   
gb|AFW04075.1|  polygalacturonase                                       250   2e-75   
ref|XP_004234221.1|  PREDICTED: probable polygalacturonase              250   2e-75   
ref|XP_009393955.1|  PREDICTED: probable polygalacturonase              241   3e-75   
gb|KGN49922.1|  hypothetical protein Csa_5G140480                       250   3e-75   
ref|XP_004160401.1|  PREDICTED: LOW QUALITY PROTEIN: probable pol...    250   3e-75   
ref|XP_009382257.1|  PREDICTED: probable polygalacturonase isofor...    250   3e-75   
ref|XP_004145976.1|  PREDICTED: probable polygalacturonase-like         249   3e-75   
ref|XP_011035342.1|  PREDICTED: probable polygalacturonase              249   3e-75   
ref|XP_008810119.1|  PREDICTED: probable polygalacturonase isofor...    250   4e-75   
ref|XP_002513653.1|  polygalacturonase, putative                        249   4e-75   Ricinus communis
ref|XP_002273669.1|  PREDICTED: probable polygalacturonase              249   4e-75   Vitis vinifera
ref|NP_190464.1|  pectin lyase-like superfamily protein                 249   4e-75   Arabidopsis thaliana [mouse-ear cress]
gb|AFK49026.1|  unknown                                                 246   5e-75   
ref|XP_008437531.1|  PREDICTED: probable polygalacturonase              249   6e-75   
ref|XP_010933983.1|  PREDICTED: probable polygalacturonase isofor...    249   7e-75   
ref|XP_011046019.1|  PREDICTED: probable polygalacturonase              248   7e-75   
ref|XP_002305262.1|  glycoside hydrolase family 28 family protein       248   8e-75   Populus trichocarpa [western balsam poplar]
ref|XP_010933982.1|  PREDICTED: probable polygalacturonase isofor...    249   1e-74   
ref|XP_010426397.1|  PREDICTED: probable polygalacturonase              248   1e-74   
ref|XP_010450744.1|  PREDICTED: probable polygalacturonase              248   1e-74   
gb|KDP22229.1|  hypothetical protein JCGZ_26060                         248   1e-74   
ref|XP_010503541.1|  PREDICTED: probable polygalacturonase              247   2e-74   
ref|XP_002875935.1|  predicted protein                                  247   2e-74   
ref|XP_004513187.1|  PREDICTED: probable polygalacturonase-like         247   2e-74   
gb|KHN42438.1|  Putative polygalacturonase                              247   3e-74   
ref|XP_003533980.1|  PREDICTED: probable polygalacturonase-like         247   4e-74   
ref|XP_007152185.1|  hypothetical protein PHAVU_004G108800g             246   7e-74   
ref|NP_001240215.1|  uncharacterized protein LOC100785005 precursor     246   7e-74   
ref|XP_006372397.1|  glycoside hydrolase family 28 family protein       245   8e-74   
ref|XP_003592197.1|  Endo-polygalacturonase-like protein                246   1e-73   
ref|XP_010105745.1|  putative polygalacturonase                         244   2e-73   
ref|XP_010519488.1|  PREDICTED: probable polygalacturonase isofor...    244   2e-73   
ref|XP_006829063.1|  hypothetical protein AMTR_s00001p00258260          245   2e-73   
gb|KDP22228.1|  hypothetical protein JCGZ_26059                         244   3e-73   
ref|XP_010519487.1|  PREDICTED: probable polygalacturonase isofor...    244   4e-73   
ref|XP_010519492.1|  PREDICTED: probable polygalacturonase              243   1e-72   
ref|XP_010550764.1|  PREDICTED: probable polygalacturonase              243   1e-72   
ref|XP_010317519.1|  PREDICTED: probable polygalacturonase              242   2e-72   
ref|XP_010934935.1|  PREDICTED: probable polygalacturonase              242   3e-72   
ref|XP_004298190.1|  PREDICTED: probable polygalacturonase-like         241   3e-72   
ref|XP_009395434.1|  PREDICTED: probable polygalacturonase isofor...    242   4e-72   
ref|XP_009395433.1|  PREDICTED: probable polygalacturonase isofor...    242   4e-72   
ref|XP_008796910.1|  PREDICTED: probable polygalacturonase              241   6e-72   
ref|XP_009375527.1|  PREDICTED: probable polygalacturonase              241   6e-72   
ref|XP_009368731.1|  PREDICTED: probable polygalacturonase              241   8e-72   
ref|XP_008380132.1|  PREDICTED: probable polygalacturonase              241   9e-72   
ref|XP_004496831.1|  PREDICTED: probable polygalacturonase-like         241   1e-71   
ref|XP_008376628.1|  PREDICTED: probable polygalacturonase              240   1e-71   
ref|XP_002273143.3|  PREDICTED: probable polygalacturonase              239   2e-71   Vitis vinifera
ref|XP_009377556.1|  PREDICTED: probable polygalacturonase              238   6e-71   
ref|XP_002878707.1|  glycoside hydrolase family 28 protein              238   9e-71   
gb|AAC63679.1|  putative polygalacturonase                              237   2e-70   Arabidopsis thaliana [mouse-ear cress]
emb|CDY39678.1|  BnaA04g13950D                                          237   2e-70   
gb|AGZ62594.1|  pollen-specific polygalacturonase                       237   2e-70   
gb|EMT02659.1|  hypothetical protein F775_52404                         237   2e-70   
ref|NP_179968.2|  pectin lyase-like protein                             237   2e-70   Arabidopsis thaliana [mouse-ear cress]
gb|ABK28510.1|  unknown                                                 237   2e-70   Arabidopsis thaliana [mouse-ear cress]
emb|CDY05885.1|  BnaC08g20620D                                          236   2e-70   
ref|XP_009140503.1|  PREDICTED: probable polygalacturonase              236   4e-70   
ref|XP_008229768.1|  PREDICTED: probable polygalacturonase              236   4e-70   
ref|XP_009149779.1|  PREDICTED: probable polygalacturonase              236   5e-70   
emb|CDY20264.1|  BnaC04g36920D                                          236   6e-70   
ref|XP_010472382.1|  PREDICTED: probable polygalacturonase              236   7e-70   
gb|EYU25143.1|  hypothetical protein MIMGU_mgv1a005601mg                236   7e-70   
gb|KFK32698.1|  hypothetical protein AALP_AA6G277200                    235   1e-69   
ref|XP_008234837.1|  PREDICTED: probable polygalacturonase              234   3e-69   
ref|XP_006656549.1|  PREDICTED: probable polygalacturonase-like         234   4e-69   
emb|CDY08095.1|  BnaA06g16310D                                          234   4e-69   
ref|XP_006404874.1|  hypothetical protein EUTSA_v10000145mg             233   7e-69   
ref|XP_010429342.1|  PREDICTED: probable polygalacturonase              233   8e-69   
ref|XP_006295548.1|  hypothetical protein CARUB_v10024654mg             233   8e-69   
ref|XP_010417129.1|  PREDICTED: probable polygalacturonase              233   9e-69   
gb|KDP22227.1|  hypothetical protein JCGZ_26058                         233   1e-68   
ref|XP_010112958.1|  putative polygalacturonase                         232   1e-68   
ref|XP_008234902.1|  PREDICTED: probable polygalacturonase              232   2e-68   
dbj|BAD67712.1|  putative polygalacturonase                             231   6e-68   Oryza sativa Japonica Group [Japonica rice]
ref|XP_011076107.1|  PREDICTED: probable polygalacturonase              231   8e-68   
ref|XP_010671628.1|  PREDICTED: probable polygalacturonase              229   4e-67   
ref|XP_002437680.1|  hypothetical protein SORBIDRAFT_10g000660          228   1e-66   Sorghum bicolor [broomcorn]
gb|ACG41831.1|  glycoside hydrolase, family 28                          226   2e-66   Zea mays [maize]
ref|XP_010024966.1|  PREDICTED: probable polygalacturonase              226   3e-66   
gb|AFW75224.1|  glycoside hydrolase, family 28                          226   4e-66   
ref|NP_001151164.1|  glycoside hydrolase, family 28 precursor           226   5e-66   Zea mays [maize]
ref|XP_007215325.1|  hypothetical protein PRUPE_ppa005185mg             225   9e-66   
gb|ABR18040.1|  unknown                                                 224   2e-65   Picea sitchensis
ref|XP_009149760.1|  PREDICTED: probable polygalacturonase              223   3e-65   
gb|EMT00190.1|  Putative polygalacturonase                              221   5e-65   
ref|XP_010541188.1|  PREDICTED: LOW QUALITY PROTEIN: probable pol...    223   8e-65   
emb|CDY05907.1|  BnaC08g20840D                                          221   8e-65   
emb|CDY08113.1|  BnaA06g16130D                                          221   1e-64   
gb|KFK34205.1|  hypothetical protein AALP_AA5G114700                    231   2e-64   
gb|KFK34204.1|  hypothetical protein AALP_AA5G114700                    231   2e-64   
ref|XP_004964293.1|  PREDICTED: probable polygalacturonase-like i...    221   3e-64   
ref|XP_004964294.1|  PREDICTED: probable polygalacturonase-like i...    221   4e-64   
gb|KHN09300.1|  Putative polygalacturonase                              218   4e-64   
ref|XP_006404169.1|  hypothetical protein EUTSA_v10010343mg             220   4e-64   
dbj|BAJ90091.1|  predicted protein                                      221   5e-64   
ref|XP_004964295.1|  PREDICTED: probable polygalacturonase-like i...    221   6e-64   
ref|XP_008366373.1|  PREDICTED: LOW QUALITY PROTEIN: probable pol...    217   9e-64   
ref|XP_010228132.1|  PREDICTED: probable polygalacturonase isofor...    218   7e-63   
ref|XP_010228133.1|  PREDICTED: probable polygalacturonase isofor...    218   7e-63   
gb|AFK36744.1|  unknown                                                 208   8e-63   
ref|XP_006404198.1|  hypothetical protein EUTSA_v10011050mg             216   1e-62   
ref|XP_007143467.1|  hypothetical protein PHAVU_007G074300g             214   8e-62   
ref|XP_010436421.1|  PREDICTED: probable polygalacturonase              206   3e-59   
gb|EYU25144.1|  hypothetical protein MIMGU_mgv1a023393mg                205   1e-58   
emb|CBI34379.3|  unnamed protein product                                204   3e-58   
ref|XP_007217591.1|  hypothetical protein PRUPE_ppa018901mg             202   8e-58   
ref|XP_007219377.1|  hypothetical protein PRUPE_ppa020086mg             200   4e-56   
ref|XP_002513652.1|  Exopolygalacturonase precursor, putative           193   7e-54   
gb|KFK27673.1|  hypothetical protein AALP_AA8G413900                    191   1e-53   
gb|ABG34278.1|  polygalacturonase                                       187   6e-53   
gb|KCW46748.1|  hypothetical protein EUGRSUZ_K00562                     184   1e-50   
ref|XP_010035373.1|  PREDICTED: probable polygalacturonase              184   3e-50   
ref|XP_003626072.1|  Polygalacturonase                                  179   2e-48   
gb|KEH24447.1|  polygalacturonase/glycoside hydrolase family protein    179   2e-48   
gb|AIU50444.1|  pectin lyase-like superfamily protein                   176   5e-48   
ref|XP_002875934.1|  hypothetical protein ARALYDRAFT_906150             176   2e-47   
emb|CDX67875.1|  BnaA07g19150D                                          176   2e-47   
ref|XP_009104364.1|  PREDICTED: probable polygalacturonase              176   3e-47   
ref|XP_008227776.1|  PREDICTED: probable polygalacturonase              174   2e-46   
emb|CDY25090.1|  BnaC06g18320D                                          172   3e-46   
ref|XP_002535132.1|  Polygalacturonase precursor, putative              173   4e-46   
ref|XP_002876663.1|  glycoside hydrolase family 28 protein              172   5e-46   
emb|CDY11403.1|  BnaA09g39690D                                          172   7e-46   
ref|XP_002875985.1|  glycoside hydrolase family 28 protein              172   8e-46   
gb|AIU50402.1|  pectin lyase-like superfamily protein                   170   9e-46   
ref|XP_009116889.1|  PREDICTED: probable polygalacturonase              172   9e-46   
ref|XP_010241442.1|  PREDICTED: probable polygalacturonase isofor...    170   1e-45   
ref|XP_006291055.1|  hypothetical protein CARUB_v10017170mg             171   2e-45   
ref|NP_567126.1|  pectin lyase-like superfamily protein                 171   2e-45   
ref|XP_010245458.1|  PREDICTED: probable polygalacturonase isofor...    171   2e-45   
emb|CAB71871.1|  putative protein                                       171   2e-45   
ref|XP_010241441.1|  PREDICTED: probable polygalacturonase isofor...    171   2e-45   
ref|NP_194113.1|  glycoside hydrolase family 28 protein / polygal...    170   3e-45   
ref|XP_010091430.1|  putative polygalacturonase                         170   3e-45   
ref|XP_010245459.1|  PREDICTED: probable polygalacturonase isofor...    170   3e-45   
ref|XP_007221479.1|  hypothetical protein PRUPE_ppa005310mg             170   3e-45   
ref|XP_007163248.1|  hypothetical protein PHAVU_001G218400g             170   3e-45   
ref|XP_009363066.1|  PREDICTED: probable polygalacturonase isofor...    170   4e-45   
gb|KDP28345.1|  hypothetical protein JCGZ_14116                         170   4e-45   
ref|XP_010544930.1|  PREDICTED: probable polygalacturonase              165   5e-45   
ref|XP_009363065.1|  PREDICTED: probable polygalacturonase isofor...    170   6e-45   
ref|XP_002273855.2|  PREDICTED: probable polygalacturonase              169   6e-45   
ref|XP_010433858.1|  PREDICTED: probable polygalacturonase              169   6e-45   
ref|XP_010448653.1|  PREDICTED: probable polygalacturonase              169   7e-45   
ref|XP_002881510.1|  predicted protein                                  160   8e-45   
ref|XP_010523877.1|  PREDICTED: probable polygalacturonase isofor...    169   9e-45   
ref|XP_007040496.1|  Pectin lyase-like superfamily protein              168   1e-44   
ref|XP_010439131.1|  PREDICTED: probable polygalacturonase              168   1e-44   
ref|XP_010523874.1|  PREDICTED: probable polygalacturonase isofor...    169   1e-44   
ref|XP_011040145.1|  PREDICTED: probable polygalacturonase              168   2e-44   
gb|KDO36047.1|  hypothetical protein CISIN_1g038330mg                   162   2e-44   
ref|XP_004494475.1|  PREDICTED: probable polygalacturonase-like i...    168   2e-44   
ref|XP_004494474.1|  PREDICTED: probable polygalacturonase-like i...    168   2e-44   
gb|AIU50400.1|  pectin lyase-like superfamily protein                   166   2e-44   
gb|ACC91250.1|  glycoside hydrolase family 28 protein                   167   3e-44   
ref|XP_006283738.1|  hypothetical protein CARUB_v10004811mg             167   4e-44   
ref|XP_002867688.1|  glycoside hydrolase family 28 protein              167   4e-44   
ref|XP_003575492.1|  PREDICTED: probable polygalacturonase              167   4e-44   
gb|EPS69236.1|  hypothetical protein M569_05533                         159   4e-44   
emb|CDX76617.1|  BnaC08g32030D                                          167   5e-44   
ref|XP_004487815.1|  PREDICTED: probable polygalacturonase-like         167   6e-44   
ref|XP_002320934.2|  hypothetical protein POPTR_0014s10770g             166   7e-44   
ref|XP_011005969.1|  PREDICTED: probable polygalacturonase              166   8e-44   
ref|XP_004955888.1|  PREDICTED: probable polygalacturonase-like i...    167   8e-44   
gb|KHG21610.1|  putative polygalacturonase                              166   8e-44   
ref|XP_002877654.1|  hypothetical protein ARALYDRAFT_323502             171   1e-43   
ref|XP_010413306.1|  PREDICTED: probable polygalacturonase              166   1e-43   
ref|XP_008381624.1|  PREDICTED: probable polygalacturonase              166   2e-43   
ref|XP_006413510.1|  hypothetical protein EUTSA_v10025189mg             165   2e-43   
gb|AIU50411.1|  pectin lyase-like superfamily protein                   164   2e-43   
gb|AIN44009.1|  polygalacturonase-like protein                          165   2e-43   
ref|XP_002967047.1|  hypothetical protein SELMODRAFT_408393             166   2e-43   
ref|XP_002960960.1|  hypothetical protein SELMODRAFT_33152              163   3e-43   
gb|KHG14610.1|  putative polygalacturonase                              164   3e-43   
gb|AIU50399.1|  pectin lyase-like superfamily protein                   163   4e-43   
tpg|DAA52311.1|  TPA: hypothetical protein ZEAMMB73_541408              159   4e-43   
ref|XP_004288344.1|  PREDICTED: probable polygalacturonase-like         164   5e-43   
ref|XP_010512598.1|  PREDICTED: probable polygalacturonase isofor...    164   5e-43   
ref|XP_010544928.1|  PREDICTED: probable polygalacturonase              164   5e-43   
gb|KHG27846.1|  putative polygalacturonase                              163   6e-43   
ref|XP_009404468.1|  PREDICTED: probable polygalacturonase              164   6e-43   
ref|XP_007223360.1|  hypothetical protein PRUPE_ppa005599mg             164   6e-43   
gb|KDP27854.1|  hypothetical protein JCGZ_18934                         164   6e-43   
ref|XP_010649560.1|  PREDICTED: probable polygalacturonase              160   7e-43   
ref|XP_010652214.1|  PREDICTED: probable polygalacturonase              164   7e-43   
gb|EMS62063.1|  putative polygalacturonase                              164   7e-43   
ref|XP_008351179.1|  PREDICTED: probable polygalacturonase              159   8e-43   
ref|NP_001183080.1|  hypothetical protein precursor                     164   8e-43   
gb|EMT30389.1|  Putative polygalacturonase                              163   9e-43   
ref|XP_010512597.1|  PREDICTED: probable polygalacturonase isofor...    165   9e-43   
gb|AIU50397.1|  pectin lyase-like superfamily protein                   162   9e-43   
ref|XP_006386685.1|  hypothetical protein POPTR_0002s18800g             163   1e-42   
emb|CBI36899.3|  unnamed protein product                                164   1e-42   
ref|XP_010055855.1|  PREDICTED: probable polygalacturonase              163   1e-42   
ref|XP_006604763.1|  PREDICTED: probable polygalacturonase-like i...    163   1e-42   
ref|XP_003554577.1|  PREDICTED: probable polygalacturonase-like i...    163   1e-42   
gb|AIU50413.1|  pectin lyase-like superfamily protein                   162   1e-42   
ref|XP_008386709.1|  PREDICTED: probable polygalacturonase              163   1e-42   
gb|AIU50405.1|  pectin lyase-like superfamily protein                   162   1e-42   
ref|XP_006664631.1|  PREDICTED: probable polygalacturonase-like         162   2e-42   
ref|XP_011073737.1|  PREDICTED: probable polygalacturonase              162   2e-42   
emb|CDX94222.1|  BnaC07g38560D                                          162   2e-42   
gb|AIU50441.1|  pectin lyase-like superfamily protein                   161   2e-42   
gb|EAY85246.1|  hypothetical protein OsI_06620                          162   2e-42   
ref|XP_003563034.1|  PREDICTED: probable polygalacturonase              162   2e-42   
ref|XP_004298894.1|  PREDICTED: probable polygalacturonase-like         162   2e-42   
ref|XP_004499965.1|  PREDICTED: probable polygalacturonase-like         162   2e-42   
ref|XP_006837459.1|  hypothetical protein AMTR_s00107p00122980          162   3e-42   
gb|KHN43408.1|  Putative polygalacturonase                              163   3e-42   
ref|XP_006840361.1|  hypothetical protein AMTR_s00045p00118570          162   3e-42   
ref|XP_006576263.1|  PREDICTED: uncharacterized protein LOC100817...    162   4e-42   
ref|XP_010913844.1|  PREDICTED: probable polygalacturonase isofor...    159   4e-42   
ref|NP_199002.1|  pectin lyase-like superfamily protein                 161   4e-42   
ref|XP_008223260.1|  PREDICTED: probable polygalacturonase              161   5e-42   
ref|NP_001241086.1|  uncharacterized protein LOC100817309 precursor     161   6e-42   
ref|XP_006576262.1|  PREDICTED: uncharacterized protein LOC100817...    161   6e-42   
ref|XP_006419481.1|  hypothetical protein CICLE_v10004942mg             161   6e-42   
ref|XP_008337461.1|  PREDICTED: probable polygalacturonase              152   6e-42   
emb|CDP12145.1|  unnamed protein product                                161   6e-42   
ref|XP_007146299.1|  hypothetical protein PHAVU_006G028800g             161   7e-42   
ref|XP_006283728.1|  hypothetical protein CARUB_v10004799mg             161   7e-42   
ref|XP_009137393.1|  PREDICTED: probable polygalacturonase              160   8e-42   
ref|XP_002509949.1|  Polygalacturonase precursor, putative              160   8e-42   
ref|XP_006657587.1|  PREDICTED: probable polygalacturonase-like i...    160   9e-42   
gb|KDO76503.1|  hypothetical protein CISIN_1g0134022mg                  157   9e-42   
ref|XP_002868572.1|  glycoside hydrolase family 28 protein              160   1e-41   
emb|CDY47619.1|  BnaA01g13460D                                          160   1e-41   
gb|KHN14175.1|  Putative polygalacturonase                              161   1e-41   
ref|XP_007138953.1|  hypothetical protein PHAVU_009G252200g             160   1e-41   
ref|XP_002307030.2|  hypothetical protein POPTR_0005s06430g             161   1e-41   
ref|XP_009793676.1|  PREDICTED: probable polygalacturonase              160   1e-41   
ref|XP_009378739.1|  PREDICTED: probable polygalacturonase isofor...    160   1e-41   
gb|KDO71782.1|  hypothetical protein CISIN_1g012788mg                   160   1e-41   
gb|KHM99685.1|  Putative polygalacturonase                              160   1e-41   
ref|XP_006586032.1|  PREDICTED: probable polygalacturonase-like         160   1e-41   
gb|KFK32989.1|  hypothetical protein AALP_AA6G314900                    160   1e-41   
ref|XP_009378738.1|  PREDICTED: probable polygalacturonase isofor...    160   1e-41   
ref|XP_010913831.1|  PREDICTED: probable polygalacturonase isofor...    160   1e-41   
gb|KEH43186.1|  polygalacturonase/glycoside hydrolase family protein    159   2e-41   
ref|XP_009346610.1|  PREDICTED: probable polygalacturonase isofor...    160   2e-41   
ref|XP_009346609.1|  PREDICTED: probable polygalacturonase isofor...    160   2e-41   
ref|XP_010271039.1|  PREDICTED: probable polygalacturonase isofor...    160   2e-41   
ref|XP_006657586.1|  PREDICTED: probable polygalacturonase-like i...    160   2e-41   
ref|XP_010271038.1|  PREDICTED: probable polygalacturonase isofor...    160   2e-41   
ref|XP_011031186.1|  PREDICTED: probable polygalacturonase              160   2e-41   
ref|XP_004245522.1|  PREDICTED: probable polygalacturonase isofor...    160   2e-41   
ref|XP_008390608.1|  PREDICTED: probable polygalacturonase              160   2e-41   
ref|XP_010541559.1|  PREDICTED: probable polygalacturonase isofor...    159   2e-41   
ref|NP_001059282.1|  Os07g0245200                                       159   2e-41   
ref|XP_009137402.1|  PREDICTED: probable polygalacturonase              159   2e-41   
gb|AIU50435.1|  pectin lyase-like superfamily protein                   159   2e-41   
ref|XP_010325363.1|  PREDICTED: probable polygalacturonase isofor...    160   2e-41   
ref|XP_004173333.1|  PREDICTED: probable polygalacturonase-like         157   2e-41   
ref|XP_006343870.1|  PREDICTED: probable polygalacturonase-like         159   2e-41   
ref|XP_011011881.1|  PREDICTED: probable polygalacturonase isofor...    159   2e-41   
ref|XP_010527633.1|  PREDICTED: probable polygalacturonase              153   2e-41   
ref|XP_010541551.1|  PREDICTED: probable polygalacturonase isofor...    159   2e-41   
ref|XP_002463589.1|  hypothetical protein SORBIDRAFT_01g002550          159   3e-41   
gb|KEH33635.1|  polygalacturonase/glycoside hydrolase family protein    159   3e-41   
ref|XP_011011880.1|  PREDICTED: probable polygalacturonase isofor...    159   3e-41   
ref|XP_004240577.1|  PREDICTED: probable polygalacturonase              159   3e-41   
gb|AIU50401.1|  pectin lyase-like superfamily protein                   158   3e-41   
gb|AIU50437.1|  pectin lyase-like superfamily protein                   158   3e-41   
ref|XP_002304552.2|  glycoside hydrolase family 28 family protein       159   3e-41   
ref|XP_002273305.1|  PREDICTED: probable polygalacturonase              159   3e-41   
ref|XP_011022514.1|  PREDICTED: probable polygalacturonase              159   3e-41   
gb|KDO76502.1|  hypothetical protein CISIN_1g0134022mg                  156   3e-41   
emb|CDY10970.1|  BnaA03g46290D                                          159   3e-41   
gb|EEE66877.1|  hypothetical protein OsJ_23693                          160   4e-41   
gb|AIU50409.1|  pectin lyase-like superfamily protein                   158   4e-41   
gb|KDO76501.1|  hypothetical protein CISIN_1g0134022mg                  156   4e-41   
emb|CDY03516.1|  BnaC01g15660D                                          159   4e-41   
gb|AES61557.2|  polygalacturonase/glycoside hydrolase family protein    159   5e-41   
ref|XP_010259446.1|  PREDICTED: probable polygalacturonase              159   5e-41   
emb|CDY13383.1|  BnaC06g13740D                                          158   5e-41   
ref|XP_008390626.1|  PREDICTED: probable polygalacturonase              160   5e-41   
ref|XP_009603675.1|  PREDICTED: probable polygalacturonase              158   5e-41   
ref|NP_001046468.1|  Os02g0256100                                       158   5e-41   
emb|CBI22951.3|  unnamed protein product                                159   5e-41   
ref|XP_002459610.1|  hypothetical protein SORBIDRAFT_02g007470          159   5e-41   
ref|XP_006405300.1|  hypothetical protein EUTSA_v10027765mg             158   6e-41   
gb|KHN20382.1|  Putative polygalacturonase                              157   6e-41   
ref|XP_010261531.1|  PREDICTED: probable polygalacturonase              158   7e-41   
ref|XP_008460889.1|  PREDICTED: probable polygalacturonase              159   7e-41   
ref|XP_009624502.1|  PREDICTED: probable polygalacturonase              160   7e-41   
ref|XP_011007067.1|  PREDICTED: probable polygalacturonase              158   8e-41   
ref|XP_006650856.1|  PREDICTED: probable polygalacturonase-like i...    158   9e-41   
ref|XP_006380233.1|  glycoside hydrolase family 28 family protein       158   9e-41   
ref|XP_003557344.1|  PREDICTED: probable polygalacturonase              158   9e-41   
ref|XP_003591306.1|  Polygalacturonase-like protein                     159   1e-40   
ref|XP_006444619.1|  hypothetical protein CICLE_v10020035mg             158   1e-40   
gb|AIU50434.1|  pectin lyase-like superfamily protein                   154   1e-40   
ref|XP_009767931.1|  PREDICTED: probable polygalacturonase              158   1e-40   
gb|KHN30667.1|  Putative polygalacturonase                              158   1e-40   
ref|XP_010909275.1|  PREDICTED: probable polygalacturonase isofor...    157   1e-40   
gb|KDP25309.1|  hypothetical protein JCGZ_20465                         157   1e-40   
ref|XP_007035679.1|  Pectin lyase-like superfamily protein              159   1e-40   
ref|XP_003520745.2|  PREDICTED: probable polygalacturonase-like         158   1e-40   
ref|XP_008788175.1|  PREDICTED: probable polygalacturonase              158   1e-40   
gb|KEH37171.1|  polygalacturonase/glycoside hydrolase family protein    156   1e-40   
ref|XP_007051305.1|  Pectin lyase-like superfamily protein isoform 4    155   1e-40   
emb|CDX67513.1|  BnaA07g15530D                                          157   1e-40   
ref|XP_006476397.1|  PREDICTED: probable polygalacturonase-like         157   1e-40   
ref|NP_001151479.1|  polygalacturonase precursor                        158   1e-40   
ref|XP_009413832.1|  PREDICTED: probable polygalacturonase              157   1e-40   
gb|KHG12205.1|  putative polygalacturonase                              157   1e-40   
emb|CAN76963.1|  hypothetical protein VITISV_043959                     157   1e-40   
ref|XP_007141479.1|  hypothetical protein PHAVU_008G199400g             157   2e-40   
gb|AIU50426.1|  pectin lyase-like superfamily protein                   156   2e-40   
ref|XP_006588584.1|  PREDICTED: probable polygalacturonase-like         157   2e-40   
ref|XP_002274138.2|  PREDICTED: probable polygalacturonase              158   2e-40   
ref|XP_008661941.1|  PREDICTED: polygalacturonase isoform X1            157   2e-40   
ref|XP_010659126.1|  PREDICTED: probable polygalacturonase              157   2e-40   
gb|ACN28107.1|  unknown                                                 157   2e-40   
ref|XP_010468984.1|  PREDICTED: probable polygalacturonase              157   2e-40   
gb|AIU50407.1|  pectin lyase-like superfamily protein                   156   2e-40   
ref|XP_010909269.1|  PREDICTED: probable polygalacturonase isofor...    157   2e-40   
ref|XP_009125202.1|  PREDICTED: probable polygalacturonase              157   2e-40   
gb|AIU50447.1|  pectin lyase-like superfamily protein                   156   2e-40   



>ref|XP_006339619.1| PREDICTED: probable polygalacturonase-like [Solanum tuberosum]
Length=476

 Score =   310 bits (794),  Expect = 1e-98, Method: Compositional matrix adjust.
 Identities = 140/198 (71%), Positives = 169/198 (85%), Gaps = 0/198 (0%)
 Frame = +2

Query  2    VAVKSGWDQYGIKYGKPTKQLIIKRLTCISPYSAAIALGSEMSGGIEDVRASDITAVHTE  181
            VAVKSGWD+YGIKYGKPT  LIIKRLTCISPYSAAIALGSEMSGGI+DVR  DITA+ TE
Sbjct  261  VAVKSGWDEYGIKYGKPTSHLIIKRLTCISPYSAAIALGSEMSGGIQDVRIQDITAIQTE  320

Query  182  SGVRIKSAIGRGGYVKNIYVKGLRAHTMKWVFLMSGDYGDHPDNHFDPKAFPVVAGINFR  361
            SG+RIK+ +GRGGYVK+IYVKG++ HTMKWVF M+G+YG H D H+DPKA P + GIN+R
Sbjct  321  SGIRIKTGVGRGGYVKDIYVKGMKLHTMKWVFWMTGNYGSHADTHWDPKALPEIKGINYR  380

Query  362  DVVADNVTMAGKMEGISGHPYTGVCMANVTIGMAKNGKKPAWNCSNIQGVASGVVPPPCP  541
            DVVA+NV+MAG+++GISG P+TG+CM+NVTIG+AK  K+  W C+NI+G++S V PPPC 
Sbjct  381  DVVAENVSMAGQLDGISGDPFTGICMSNVTIGLAKKSKQNPWACTNIEGISSSVQPPPCK  440

Query  542  LLHIQGPVKPGMCDLPPK  595
            LL  QGP K GMCD P +
Sbjct  441  LLADQGPKKSGMCDFPTE  458



>ref|XP_009762711.1| PREDICTED: probable polygalacturonase isoform X2 [Nicotiana sylvestris]
Length=479

 Score =   307 bits (787),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 138/198 (70%), Positives = 167/198 (84%), Gaps = 0/198 (0%)
 Frame = +2

Query  2    VAVKSGWDQYGIKYGKPTKQLIIKRLTCISPYSAAIALGSEMSGGIEDVRASDITAVHTE  181
            VAVKSGWD+YGIKYG PT QL+I+RLTCISPYSAAIALGSEMSGGI+DVRA DITA++TE
Sbjct  264  VAVKSGWDEYGIKYGMPTSQLVIRRLTCISPYSAAIALGSEMSGGIQDVRAEDITAINTE  323

Query  182  SGVRIKSAIGRGGYVKNIYVKGLRAHTMKWVFLMSGDYGDHPDNHFDPKAFPVVAGINFR  361
            SGVRIK+A+GRGG+VK++YVKG+  HTMKWVF M+G+YG H D H+DP A P + GIN+R
Sbjct  324  SGVRIKTAVGRGGFVKDVYVKGMTLHTMKWVFWMTGNYGSHADTHWDPNALPEIKGINYR  383

Query  362  DVVADNVTMAGKMEGISGHPYTGVCMANVTIGMAKNGKKPAWNCSNIQGVASGVVPPPCP  541
            DVVA+NV+MA ++EGISG P+TG+CM+NVTI MAK  KK  W C++I+G+ SGV PPPC 
Sbjct  384  DVVAENVSMAARLEGISGDPFTGICMSNVTISMAKKAKKYPWTCTDIEGITSGVQPPPCQ  443

Query  542  LLHIQGPVKPGMCDLPPK  595
            LL  QGP K  MCD P +
Sbjct  444  LLPDQGPEKSEMCDFPTE  461



>emb|CDP20376.1| unnamed protein product [Coffea canephora]
Length=484

 Score =   307 bits (787),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 138/199 (69%), Positives = 169/199 (85%), Gaps = 0/199 (0%)
 Frame = +2

Query  2    VAVKSGWDQYGIKYGKPTKQLIIKRLTCISPYSAAIALGSEMSGGIEDVRASDITAVHTE  181
            +AVKSGWD+YGI YG PTKQL+I+RLTCISPYSAAIALGSEMSGGI+DVRA DI A++TE
Sbjct  269  IAVKSGWDEYGISYGMPTKQLLIRRLTCISPYSAAIALGSEMSGGIQDVRAQDIVAINTE  328

Query  182  SGVRIKSAIGRGGYVKNIYVKGLRAHTMKWVFLMSGDYGDHPDNHFDPKAFPVVAGINFR  361
            SGVRIK+A+GRGG+VK+IYVKG++  TMKWVF M+G+YG H DNH+DP A P + GIN+R
Sbjct  329  SGVRIKTAVGRGGFVKDIYVKGMKLQTMKWVFWMTGNYGSHADNHYDPHALPAIQGINYR  388

Query  362  DVVADNVTMAGKMEGISGHPYTGVCMANVTIGMAKNGKKPAWNCSNIQGVASGVVPPPCP  541
            DVVAD+V MA ++EGISG P+TG+C+ANVTIGMA+  KK  W C++++G+ASGVVPPPC 
Sbjct  389  DVVADDVKMAARLEGISGDPFTGICIANVTIGMAQKAKKYPWTCADVEGIASGVVPPPCA  448

Query  542  LLHIQGPVKPGMCDLPPKK  598
             L  QGP K GMCD P + 
Sbjct  449  SLPDQGPEKVGMCDFPQEN  467



>ref|XP_009762710.1| PREDICTED: probable polygalacturonase isoform X1 [Nicotiana sylvestris]
Length=486

 Score =   307 bits (786),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 138/198 (70%), Positives = 167/198 (84%), Gaps = 0/198 (0%)
 Frame = +2

Query  2    VAVKSGWDQYGIKYGKPTKQLIIKRLTCISPYSAAIALGSEMSGGIEDVRASDITAVHTE  181
            VAVKSGWD+YGIKYG PT QL+I+RLTCISPYSAAIALGSEMSGGI+DVRA DITA++TE
Sbjct  271  VAVKSGWDEYGIKYGMPTSQLVIRRLTCISPYSAAIALGSEMSGGIQDVRAEDITAINTE  330

Query  182  SGVRIKSAIGRGGYVKNIYVKGLRAHTMKWVFLMSGDYGDHPDNHFDPKAFPVVAGINFR  361
            SGVRIK+A+GRGG+VK++YVKG+  HTMKWVF M+G+YG H D H+DP A P + GIN+R
Sbjct  331  SGVRIKTAVGRGGFVKDVYVKGMTLHTMKWVFWMTGNYGSHADTHWDPNALPEIKGINYR  390

Query  362  DVVADNVTMAGKMEGISGHPYTGVCMANVTIGMAKNGKKPAWNCSNIQGVASGVVPPPCP  541
            DVVA+NV+MA ++EGISG P+TG+CM+NVTI MAK  KK  W C++I+G+ SGV PPPC 
Sbjct  391  DVVAENVSMAARLEGISGDPFTGICMSNVTISMAKKAKKYPWTCTDIEGITSGVQPPPCQ  450

Query  542  LLHIQGPVKPGMCDLPPK  595
            LL  QGP K  MCD P +
Sbjct  451  LLPDQGPEKSEMCDFPTE  468



>gb|KDO86269.1| hypothetical protein CISIN_1g0090751mg, partial [Citrus sinensis]
Length=259

 Score =   299 bits (766),  Expect = 3e-97, Method: Compositional matrix adjust.
 Identities = 137/198 (69%), Positives = 164/198 (83%), Gaps = 0/198 (0%)
 Frame = +2

Query  2    VAVKSGWDQYGIKYGKPTKQLIIKRLTCISPYSAAIALGSEMSGGIEDVRASDITAVHTE  181
            VAVKSGWD+YGI YG PTKQL+I+RLTCISPYSA IALGSEMSGGI+DVRA DI A++TE
Sbjct  43   VAVKSGWDEYGIAYGMPTKQLVIRRLTCISPYSATIALGSEMSGGIQDVRAEDIKAINTE  102

Query  182  SGVRIKSAIGRGGYVKNIYVKGLRAHTMKWVFLMSGDYGDHPDNHFDPKAFPVVAGINFR  361
            SGVRIK+A+GRGGYVK+IYV+G+  HTMKW F M+G+YG H DNH+DPKA PV+ GIN+R
Sbjct  103  SGVRIKTAVGRGGYVKDIYVRGMTMHTMKWAFWMTGNYGSHADNHYDPKALPVIQGINYR  162

Query  362  DVVADNVTMAGKMEGISGHPYTGVCMANVTIGMAKNGKKPAWNCSNIQGVASGVVPPPCP  541
            D+VADNV+MA ++EGISG P+TG+C+AN TIGMA   KK  W C++I G+ SGV PPPC 
Sbjct  163  DIVADNVSMAARLEGISGDPFTGICIANATIGMAAKHKKVPWTCADIGGMTSGVTPPPCE  222

Query  542  LLHIQGPVKPGMCDLPPK  595
            LL  QGP K   CD P +
Sbjct  223  LLPDQGPEKIRACDFPTE  240



>ref|XP_004229920.2| PREDICTED: probable polygalacturonase [Solanum lycopersicum]
Length=476

 Score =   306 bits (784),  Expect = 4e-97, Method: Compositional matrix adjust.
 Identities = 139/198 (70%), Positives = 168/198 (85%), Gaps = 0/198 (0%)
 Frame = +2

Query  2    VAVKSGWDQYGIKYGKPTKQLIIKRLTCISPYSAAIALGSEMSGGIEDVRASDITAVHTE  181
            VAVKSGWD+YGIKYG+PT  LIIKRLTCISPYSAAIALGSEMSGGI+DVR  DITA+ TE
Sbjct  261  VAVKSGWDEYGIKYGRPTSHLIIKRLTCISPYSAAIALGSEMSGGIQDVRIQDITAIQTE  320

Query  182  SGVRIKSAIGRGGYVKNIYVKGLRAHTMKWVFLMSGDYGDHPDNHFDPKAFPVVAGINFR  361
            SG+RIK+ +G+GGYVK+IYVKG++ HTMKWVF M+G+YG H D H+DPKA P + GIN+R
Sbjct  321  SGIRIKTGVGQGGYVKDIYVKGMKLHTMKWVFWMTGNYGSHADTHWDPKALPEIKGINYR  380

Query  362  DVVADNVTMAGKMEGISGHPYTGVCMANVTIGMAKNGKKPAWNCSNIQGVASGVVPPPCP  541
            DVVA+NV+MAG+++GISG P+TG+CM+NVTIG+AK  KK  W C+NI G++S V PPPC 
Sbjct  381  DVVAENVSMAGQLDGISGDPFTGICMSNVTIGLAKKSKKNPWACTNIGGISSSVQPPPCK  440

Query  542  LLHIQGPVKPGMCDLPPK  595
            LL  QGP K GMCD P +
Sbjct  441  LLADQGPKKSGMCDFPTE  458



>ref|XP_009767883.1| PREDICTED: probable polygalacturonase [Nicotiana sylvestris]
Length=476

 Score =   305 bits (782),  Expect = 8e-97, Method: Compositional matrix adjust.
 Identities = 136/198 (69%), Positives = 168/198 (85%), Gaps = 0/198 (0%)
 Frame = +2

Query  2    VAVKSGWDQYGIKYGKPTKQLIIKRLTCISPYSAAIALGSEMSGGIEDVRASDITAVHTE  181
            VAVKSGWD++GIKYG PT  LII+RLTCISPYSAAIALGSEMSGGI+DVR  DITA++TE
Sbjct  261  VAVKSGWDEFGIKYGMPTSHLIIRRLTCISPYSAAIALGSEMSGGIQDVRVQDITAINTE  320

Query  182  SGVRIKSAIGRGGYVKNIYVKGLRAHTMKWVFLMSGDYGDHPDNHFDPKAFPVVAGINFR  361
            SGVRIK+A+GRGG+VK++YVKG++ HTMKWVF M+G+YG H D H+DPKA P + GIN+R
Sbjct  321  SGVRIKTAVGRGGFVKDVYVKGMKLHTMKWVFWMTGNYGSHADTHWDPKALPEIKGINYR  380

Query  362  DVVADNVTMAGKMEGISGHPYTGVCMANVTIGMAKNGKKPAWNCSNIQGVASGVVPPPCP  541
            DVVA+NV+MA ++EG+SG P+TG+CM+NVTIG+AK  KK  W C+NI+G++S V PPPC 
Sbjct  381  DVVAENVSMAAQLEGMSGDPFTGICMSNVTIGLAKKAKKYPWTCTNIEGISSNVQPPPCQ  440

Query  542  LLHIQGPVKPGMCDLPPK  595
            LL  QGP K  MCD P +
Sbjct  441  LLAYQGPKKSRMCDFPTE  458



>ref|XP_006491165.1| PREDICTED: probable polygalacturonase-like [Citrus sinensis]
Length=481

 Score =   302 bits (773),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 137/198 (69%), Positives = 164/198 (83%), Gaps = 0/198 (0%)
 Frame = +2

Query  2    VAVKSGWDQYGIKYGKPTKQLIIKRLTCISPYSAAIALGSEMSGGIEDVRASDITAVHTE  181
            VAVKSGWD+YGI YG PTKQL+I+RLTCISPYSA IALGSEMSGGI+DVRA DI A++TE
Sbjct  265  VAVKSGWDEYGIAYGMPTKQLVIRRLTCISPYSATIALGSEMSGGIQDVRAEDIKAINTE  324

Query  182  SGVRIKSAIGRGGYVKNIYVKGLRAHTMKWVFLMSGDYGDHPDNHFDPKAFPVVAGINFR  361
            SGVRIK+A+GRGGYVK+IYV+G+  HTMKW F M+G+YG H DNH+DPKA PV+ GIN+R
Sbjct  325  SGVRIKTAVGRGGYVKDIYVRGMTMHTMKWAFWMTGNYGSHADNHYDPKALPVIQGINYR  384

Query  362  DVVADNVTMAGKMEGISGHPYTGVCMANVTIGMAKNGKKPAWNCSNIQGVASGVVPPPCP  541
            D+VADNV+MA ++EGISG P+TG+C+AN TIGMA   KK  W C++I G+ SGV PPPC 
Sbjct  385  DIVADNVSMAARLEGISGDPFTGICIANATIGMAAKHKKVPWTCADIGGMTSGVTPPPCE  444

Query  542  LLHIQGPVKPGMCDLPPK  595
            LL  QGP K   CD P +
Sbjct  445  LLPDQGPEKIRACDFPTE  462



>ref|XP_006444979.1| hypothetical protein CICLE_v10019597mg [Citrus clementina]
 gb|ESR58219.1| hypothetical protein CICLE_v10019597mg [Citrus clementina]
Length=544

 Score =   303 bits (776),  Expect = 4e-95, Method: Compositional matrix adjust.
 Identities = 137/198 (69%), Positives = 164/198 (83%), Gaps = 0/198 (0%)
 Frame = +2

Query  2    VAVKSGWDQYGIKYGKPTKQLIIKRLTCISPYSAAIALGSEMSGGIEDVRASDITAVHTE  181
            VAVKSGWD+YGI YG PTKQL+I+RLTCISPYSA IALGSEMSGGI+DVRA DI A++TE
Sbjct  328  VAVKSGWDEYGIAYGMPTKQLVIRRLTCISPYSATIALGSEMSGGIQDVRAEDIKAINTE  387

Query  182  SGVRIKSAIGRGGYVKNIYVKGLRAHTMKWVFLMSGDYGDHPDNHFDPKAFPVVAGINFR  361
            SGVRIK+A+GRGGYVK+IYV+G+  HTMKW F M+G+YG H DNH+DPKA PV+ GIN+R
Sbjct  388  SGVRIKTAVGRGGYVKDIYVRGMTMHTMKWAFWMTGNYGSHADNHYDPKALPVIQGINYR  447

Query  362  DVVADNVTMAGKMEGISGHPYTGVCMANVTIGMAKNGKKPAWNCSNIQGVASGVVPPPCP  541
            D+VADNV+MA ++EGISG P+TG+C+AN TIGMA   KK  W C++I G+ SGV PPPC 
Sbjct  448  DIVADNVSMAARLEGISGDPFTGICIANATIGMAAKHKKVPWTCADIGGMTSGVTPPPCE  507

Query  542  LLHIQGPVKPGMCDLPPK  595
            LL  QGP K   CD P +
Sbjct  508  LLPDQGPEKIRACDFPTE  525



>ref|XP_009599786.1| PREDICTED: probable polygalacturonase isoform X2 [Nicotiana tomentosiformis]
Length=474

 Score =   301 bits (770),  Expect = 5e-95, Method: Compositional matrix adjust.
 Identities = 136/198 (69%), Positives = 165/198 (83%), Gaps = 0/198 (0%)
 Frame = +2

Query  2    VAVKSGWDQYGIKYGKPTKQLIIKRLTCISPYSAAIALGSEMSGGIEDVRASDITAVHTE  181
            VAVKSGWD+YGIKYG PT QLII+RLTCISPYSAAIALGSEMSGGI+DVRA DITA++TE
Sbjct  259  VAVKSGWDEYGIKYGMPTSQLIIRRLTCISPYSAAIALGSEMSGGIQDVRAEDITAINTE  318

Query  182  SGVRIKSAIGRGGYVKNIYVKGLRAHTMKWVFLMSGDYGDHPDNHFDPKAFPVVAGINFR  361
            SGVRIK+A+GRGG+VK++YVKG+  HTMKWVF M+G+YG H D H+DP A P +  IN+R
Sbjct  319  SGVRIKTAVGRGGFVKDVYVKGMTLHTMKWVFWMTGNYGSHADTHWDPNALPEIKRINYR  378

Query  362  DVVADNVTMAGKMEGISGHPYTGVCMANVTIGMAKNGKKPAWNCSNIQGVASGVVPPPCP  541
            DVVA+NV+MA ++EGISG P+TG+CM+NVTI MAK  KK  W C++I+G+ SGV P PC 
Sbjct  379  DVVAENVSMAARLEGISGDPFTGICMSNVTISMAKKAKKYPWTCTDIEGITSGVQPTPCQ  438

Query  542  LLHIQGPVKPGMCDLPPK  595
            LL  QGP K  MC+ P +
Sbjct  439  LLPDQGPEKSEMCNFPTE  456



>ref|XP_009599780.1| PREDICTED: probable polygalacturonase isoform X1 [Nicotiana tomentosiformis]
Length=486

 Score =   300 bits (769),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 136/198 (69%), Positives = 165/198 (83%), Gaps = 0/198 (0%)
 Frame = +2

Query  2    VAVKSGWDQYGIKYGKPTKQLIIKRLTCISPYSAAIALGSEMSGGIEDVRASDITAVHTE  181
            VAVKSGWD+YGIKYG PT QLII+RLTCISPYSAAIALGSEMSGGI+DVRA DITA++TE
Sbjct  271  VAVKSGWDEYGIKYGMPTSQLIIRRLTCISPYSAAIALGSEMSGGIQDVRAEDITAINTE  330

Query  182  SGVRIKSAIGRGGYVKNIYVKGLRAHTMKWVFLMSGDYGDHPDNHFDPKAFPVVAGINFR  361
            SGVRIK+A+GRGG+VK++YVKG+  HTMKWVF M+G+YG H D H+DP A P +  IN+R
Sbjct  331  SGVRIKTAVGRGGFVKDVYVKGMTLHTMKWVFWMTGNYGSHADTHWDPNALPEIKRINYR  390

Query  362  DVVADNVTMAGKMEGISGHPYTGVCMANVTIGMAKNGKKPAWNCSNIQGVASGVVPPPCP  541
            DVVA+NV+MA ++EGISG P+TG+CM+NVTI MAK  KK  W C++I+G+ SGV P PC 
Sbjct  391  DVVAENVSMAARLEGISGDPFTGICMSNVTISMAKKAKKYPWTCTDIEGITSGVQPTPCQ  450

Query  542  LLHIQGPVKPGMCDLPPK  595
            LL  QGP K  MC+ P +
Sbjct  451  LLPDQGPEKSEMCNFPTE  468



>ref|XP_003528838.1| PREDICTED: probable polygalacturonase [Glycine max]
Length=482

 Score =   300 bits (768),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 138/196 (70%), Positives = 163/196 (83%), Gaps = 0/196 (0%)
 Frame = +2

Query  2    VAVKSGWDQYGIKYGKPTKQLIIKRLTCISPYSAAIALGSEMSGGIEDVRASDITAVHTE  181
            VAVKSGWD+YGIK+G PTKQL+I+RLTCISP SAAIALGSEMSGGI+DVRA DITA+HTE
Sbjct  266  VAVKSGWDEYGIKFGWPTKQLVIRRLTCISPQSAAIALGSEMSGGIQDVRAEDITAIHTE  325

Query  182  SGVRIKSAIGRGGYVKNIYVKGLRAHTMKWVFLMSGDYGDHPDNHFDPKAFPVVAGINFR  361
            SGVRIK+A+GRGGYVK+IYVK +  HTMKWVF M+G+YG H D+H+DPKA P + GIN+R
Sbjct  326  SGVRIKTAVGRGGYVKDIYVKRMTMHTMKWVFWMTGNYGSHADSHYDPKALPEINGINYR  385

Query  362  DVVADNVTMAGKMEGISGHPYTGVCMANVTIGMAKNGKKPAWNCSNIQGVASGVVPPPCP  541
            DVVADNVTMA ++EGIS  P+TG+C+ANVTIGMA   KK  W C++I+G+ SGV P PC 
Sbjct  386  DVVADNVTMAARLEGISNDPFTGICIANVTIGMAAKAKKQPWTCTDIEGITSGVTPKPCN  445

Query  542  LLHIQGPVKPGMCDLP  589
             L  QGP K   CD P
Sbjct  446  SLPDQGPEKIKACDFP  461



>gb|KHN26934.1| Putative polygalacturonase [Glycine soja]
Length=482

 Score =   300 bits (767),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 138/196 (70%), Positives = 163/196 (83%), Gaps = 0/196 (0%)
 Frame = +2

Query  2    VAVKSGWDQYGIKYGKPTKQLIIKRLTCISPYSAAIALGSEMSGGIEDVRASDITAVHTE  181
            VAVKSGWD+YGIK+G PTKQL+I+RLTCISP SAAIALGSEMSGGI+DVRA DITA+HTE
Sbjct  266  VAVKSGWDEYGIKFGWPTKQLVIRRLTCISPQSAAIALGSEMSGGIQDVRAEDITAIHTE  325

Query  182  SGVRIKSAIGRGGYVKNIYVKGLRAHTMKWVFLMSGDYGDHPDNHFDPKAFPVVAGINFR  361
            SGVRIK+A+GRGGYVK+IYVK +  HTMKWVF M+G+YG H D+H+DPKA P + GIN+R
Sbjct  326  SGVRIKTAVGRGGYVKDIYVKRMTMHTMKWVFWMTGNYGSHADSHYDPKALPEINGINYR  385

Query  362  DVVADNVTMAGKMEGISGHPYTGVCMANVTIGMAKNGKKPAWNCSNIQGVASGVVPPPCP  541
            DVVADNVTMA ++EGIS  P+TG+C+ANVTIGMA   KK  W C++I+G+ SGV P PC 
Sbjct  386  DVVADNVTMAARLEGISNDPFTGICIANVTIGMAAKAKKQPWTCTDIEGITSGVTPKPCN  445

Query  542  LLHIQGPVKPGMCDLP  589
             L  QGP K   CD P
Sbjct  446  SLPDQGPEKIKACDFP  461



>ref|XP_006345582.1| PREDICTED: probable polygalacturonase-like isoform X2 [Solanum 
tuberosum]
 ref|XP_006345583.1| PREDICTED: probable polygalacturonase-like isoform X3 [Solanum 
tuberosum]
Length=477

 Score =   300 bits (767),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 135/199 (68%), Positives = 164/199 (82%), Gaps = 0/199 (0%)
 Frame = +2

Query  2    VAVKSGWDQYGIKYGKPTKQLIIKRLTCISPYSAAIALGSEMSGGIEDVRASDITAVHTE  181
            VAVKSGWD+YGI YG PT QLII+RLTCISPYSAAIALGSEMSGGI+DVRA DITA++TE
Sbjct  262  VAVKSGWDEYGINYGMPTSQLIIRRLTCISPYSAAIALGSEMSGGIQDVRAEDITAINTE  321

Query  182  SGVRIKSAIGRGGYVKNIYVKGLRAHTMKWVFLMSGDYGDHPDNHFDPKAFPVVAGINFR  361
            SGVRIK+ +GRGG+VK++YVKG+  HTMKWVF M+G+YG H D H+DP A P + GIN+R
Sbjct  322  SGVRIKTGVGRGGFVKDVYVKGMTLHTMKWVFWMTGNYGQHADTHWDPNALPEIKGINYR  381

Query  362  DVVADNVTMAGKMEGISGHPYTGVCMANVTIGMAKNGKKPAWNCSNIQGVASGVVPPPCP  541
            DVVA+NV+MA ++EGISG P+TG+C++NVTI MAK  KK  W C++I+G+ SGV PPPC 
Sbjct  382  DVVAENVSMAARLEGISGDPFTGICISNVTISMAKKAKKYPWTCTDIEGITSGVQPPPCQ  441

Query  542  LLHIQGPVKPGMCDLPPKK  598
            LL  QGP K  MC  P + 
Sbjct  442  LLPDQGPEKTEMCSFPTEN  460



>ref|XP_006345581.1| PREDICTED: probable polygalacturonase-like isoform X1 [Solanum 
tuberosum]
Length=481

 Score =   300 bits (767),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 135/199 (68%), Positives = 164/199 (82%), Gaps = 0/199 (0%)
 Frame = +2

Query  2    VAVKSGWDQYGIKYGKPTKQLIIKRLTCISPYSAAIALGSEMSGGIEDVRASDITAVHTE  181
            VAVKSGWD+YGI YG PT QLII+RLTCISPYSAAIALGSEMSGGI+DVRA DITA++TE
Sbjct  266  VAVKSGWDEYGINYGMPTSQLIIRRLTCISPYSAAIALGSEMSGGIQDVRAEDITAINTE  325

Query  182  SGVRIKSAIGRGGYVKNIYVKGLRAHTMKWVFLMSGDYGDHPDNHFDPKAFPVVAGINFR  361
            SGVRIK+ +GRGG+VK++YVKG+  HTMKWVF M+G+YG H D H+DP A P + GIN+R
Sbjct  326  SGVRIKTGVGRGGFVKDVYVKGMTLHTMKWVFWMTGNYGQHADTHWDPNALPEIKGINYR  385

Query  362  DVVADNVTMAGKMEGISGHPYTGVCMANVTIGMAKNGKKPAWNCSNIQGVASGVVPPPCP  541
            DVVA+NV+MA ++EGISG P+TG+C++NVTI MAK  KK  W C++I+G+ SGV PPPC 
Sbjct  386  DVVAENVSMAARLEGISGDPFTGICISNVTISMAKKAKKYPWTCTDIEGITSGVQPPPCQ  445

Query  542  LLHIQGPVKPGMCDLPPKK  598
            LL  QGP K  MC  P + 
Sbjct  446  LLPDQGPEKTEMCSFPTEN  464



>ref|XP_004240097.1| PREDICTED: probable polygalacturonase [Solanum lycopersicum]
Length=486

 Score =   299 bits (766),  Expect = 3e-94, Method: Compositional matrix adjust.
 Identities = 134/199 (67%), Positives = 164/199 (82%), Gaps = 0/199 (0%)
 Frame = +2

Query  2    VAVKSGWDQYGIKYGKPTKQLIIKRLTCISPYSAAIALGSEMSGGIEDVRASDITAVHTE  181
            VAVKSGWD+YGI YG PT QLII+RLTCISPYSAAIALGSEMSGGI+DVRA DITA++TE
Sbjct  271  VAVKSGWDEYGINYGMPTSQLIIRRLTCISPYSAAIALGSEMSGGIQDVRAEDITAINTE  330

Query  182  SGVRIKSAIGRGGYVKNIYVKGLRAHTMKWVFLMSGDYGDHPDNHFDPKAFPVVAGINFR  361
            SGVRIK+ +GRGG+V+++YVKG+  HTMKWVF M+G+YG H D H+DP A P + GIN+R
Sbjct  331  SGVRIKTGVGRGGFVRDVYVKGMTLHTMKWVFWMTGNYGQHADTHWDPNALPEIKGINYR  390

Query  362  DVVADNVTMAGKMEGISGHPYTGVCMANVTIGMAKNGKKPAWNCSNIQGVASGVVPPPCP  541
            DVVA+NV+MA ++EGISG P+TG+C++NVTI MAK  KK  W C++I+G+ SGV PPPC 
Sbjct  391  DVVAENVSMAARLEGISGDPFTGICISNVTISMAKKAKKYPWTCTDIEGITSGVQPPPCQ  450

Query  542  LLHIQGPVKPGMCDLPPKK  598
            LL  QGP K  MC  P + 
Sbjct  451  LLPDQGPEKTEMCSFPTEN  469



>ref|XP_009624373.1| PREDICTED: probable polygalacturonase [Nicotiana tomentosiformis]
Length=470

 Score =   298 bits (762),  Expect = 7e-94, Method: Compositional matrix adjust.
 Identities = 135/199 (68%), Positives = 167/199 (84%), Gaps = 1/199 (1%)
 Frame = +2

Query  2    VAVKSGWDQYGIKYGKPTKQLIIKRLTCISPYSAAIALGSEMSGGIEDVRASDITAVHTE  181
            VAVKSGWD+YGIKYG PT  LII+RLTCISPYSAAIALGSEMSGGI+DVR  DI A++TE
Sbjct  254  VAVKSGWDEYGIKYGMPTSHLIIRRLTCISPYSAAIALGSEMSGGIQDVRVQDIIAINTE  313

Query  182  SGVRIKSAIGRGGYVKNIYVKGLRAHTMKWVFLMSGDYGDHPDNHFDPKAFPVVAGINFR  361
            SGVRIK+A+GRGG+VK++YVKG++ HT+KWVF M+G+YG H D H+DPKA P + GIN+R
Sbjct  314  SGVRIKTAVGRGGFVKDVYVKGMKLHTIKWVFWMTGNYGSHADTHWDPKALPEIKGINYR  373

Query  362  DVVADNVTMAGKMEGISGHPYTGVCMANVTIGMAKNGKKPAWNCSNIQGVASGVVPPPCP  541
            DVVA+NV+MA ++EG+SG P+TG+CM+NVTIG+AK  KK  W C+NI+G++S V PPPC 
Sbjct  374  DVVAENVSMAAQLEGLSGDPFTGICMSNVTIGLAKKAKKYPWTCTNIEGISSSVQPPPCQ  433

Query  542  LLHIQGPVKP-GMCDLPPK  595
            LL  QGP K   MCD P +
Sbjct  434  LLADQGPKKSRRMCDFPTE  452



>ref|XP_011092828.1| PREDICTED: probable polygalacturonase [Sesamum indicum]
Length=505

 Score =   298 bits (763),  Expect = 1e-93, Method: Compositional matrix adjust.
 Identities = 133/196 (68%), Positives = 164/196 (84%), Gaps = 0/196 (0%)
 Frame = +2

Query  2    VAVKSGWDQYGIKYGKPTKQLIIKRLTCISPYSAAIALGSEMSGGIEDVRASDITAVHTE  181
            +AVKSGWD+YGI YG PTK LII+RL C+SPYSAAIALGSEMSGGI+DVRA +ITA++TE
Sbjct  289  IAVKSGWDEYGISYGMPTKHLIIRRLVCVSPYSAAIALGSEMSGGIQDVRAQEITAINTE  348

Query  182  SGVRIKSAIGRGGYVKNIYVKGLRAHTMKWVFLMSGDYGDHPDNHFDPKAFPVVAGINFR  361
            SGVRIK+A+GRGGYVK+IYVKG+  HTMKWVF ++G+YG H DNH+DP A P + GIN+R
Sbjct  349  SGVRIKTAVGRGGYVKDIYVKGMNLHTMKWVFWITGNYGSHADNHYDPNALPEIKGINYR  408

Query  362  DVVADNVTMAGKMEGISGHPYTGVCMANVTIGMAKNGKKPAWNCSNIQGVASGVVPPPCP  541
            D+VA+NV+MAG++EGISG P+TG+CM+NVTI MA   KK  W+C  ++G+ SGVVP PC 
Sbjct  409  DIVAENVSMAGRLEGISGDPFTGICMSNVTIAMAAKAKKYPWSCVEVEGITSGVVPRPCD  468

Query  542  LLHIQGPVKPGMCDLP  589
            LL  QG  + GMCD P
Sbjct  469  LLPDQGEQELGMCDFP  484



>ref|XP_007144550.1| hypothetical protein PHAVU_007G165300g [Phaseolus vulgaris]
 gb|ESW16544.1| hypothetical protein PHAVU_007G165300g [Phaseolus vulgaris]
Length=474

 Score =   296 bits (759),  Expect = 3e-93, Method: Compositional matrix adjust.
 Identities = 136/196 (69%), Positives = 160/196 (82%), Gaps = 0/196 (0%)
 Frame = +2

Query  2    VAVKSGWDQYGIKYGKPTKQLIIKRLTCISPYSAAIALGSEMSGGIEDVRASDITAVHTE  181
            VAVKSGWD+YGIK+G PTKQL+I+RLTCISP SAAIALGSEMSGGI+DVRA DITA+HTE
Sbjct  258  VAVKSGWDEYGIKFGWPTKQLVIRRLTCISPESAAIALGSEMSGGIQDVRAEDITAIHTE  317

Query  182  SGVRIKSAIGRGGYVKNIYVKGLRAHTMKWVFLMSGDYGDHPDNHFDPKAFPVVAGINFR  361
            SGVRIK+A+GRGGYVK+IYVKG+  HTMKWVF M+G YG H D+H+DPKA P + GIN+R
Sbjct  318  SGVRIKTAVGRGGYVKDIYVKGMTMHTMKWVFWMTGSYGSHADSHYDPKALPEIKGINYR  377

Query  362  DVVADNVTMAGKMEGISGHPYTGVCMANVTIGMAKNGKKPAWNCSNIQGVASGVVPPPCP  541
            DVVADNVTMA ++EGIS  P+TG+C+ANVTI MA   KK  W C++I+G+ SGV P PC 
Sbjct  378  DVVADNVTMAARLEGISNDPFTGICIANVTINMAAKAKKQPWTCTDIEGITSGVTPKPCN  437

Query  542  LLHIQGPVKPGMCDLP  589
             L  QG      CD P
Sbjct  438  SLPDQGQDNIKACDFP  453



>gb|KDP28587.1| hypothetical protein JCGZ_14358 [Jatropha curcas]
Length=479

 Score =   295 bits (756),  Expect = 7e-93, Method: Compositional matrix adjust.
 Identities = 135/198 (68%), Positives = 161/198 (81%), Gaps = 0/198 (0%)
 Frame = +2

Query  2    VAVKSGWDQYGIKYGKPTKQLIIKRLTCISPYSAAIALGSEMSGGIEDVRASDITAVHTE  181
            VAVKSGWD+YGI +G PTKQLII+RLTCISPYSA IALGSEMSGGI+DVRA DITA+HTE
Sbjct  265  VAVKSGWDEYGIAFGMPTKQLIIRRLTCISPYSATIALGSEMSGGIQDVRAEDITAIHTE  324

Query  182  SGVRIKSAIGRGGYVKNIYVKGLRAHTMKWVFLMSGDYGDHPDNHFDPKAFPVVAGINFR  361
            SGVRIK+A+GRGG+VK+IYVK +  HTMKWVF M+G+YG H D ++DP A PV+ GIN+R
Sbjct  325  SGVRIKTAVGRGGFVKDIYVKRMTMHTMKWVFWMTGNYGSHADKNYDPNALPVIQGINYR  384

Query  362  DVVADNVTMAGKMEGISGHPYTGVCMANVTIGMAKNGKKPAWNCSNIQGVASGVVPPPCP  541
            D+VADNVTMA ++EGISG P+  +C++NVTIGMA   KK  W C+ I G+ SGV P PC 
Sbjct  385  DMVADNVTMAARLEGISGDPFKEICISNVTIGMAAKAKKVPWTCTEIAGITSGVSPRPCD  444

Query  542  LLHIQGPVKPGMCDLPPK  595
            LL  QGP K   CD PP+
Sbjct  445  LLPDQGPEKLTECDFPPE  462



>gb|KHG15710.1| hypothetical protein F383_10492 [Gossypium arboreum]
Length=481

 Score =   295 bits (756),  Expect = 8e-93, Method: Compositional matrix adjust.
 Identities = 132/198 (67%), Positives = 162/198 (82%), Gaps = 0/198 (0%)
 Frame = +2

Query  2    VAVKSGWDQYGIKYGKPTKQLIIKRLTCISPYSAAIALGSEMSGGIEDVRASDITAVHTE  181
            +AVKSGWD+YGI +G PTKQL+I+RLTCISPYSAAIALGSEMSGGIEDVRA DITA+HTE
Sbjct  265  IAVKSGWDEYGISFGMPTKQLVIRRLTCISPYSAAIALGSEMSGGIEDVRAEDITAIHTE  324

Query  182  SGVRIKSAIGRGGYVKNIYVKGLRAHTMKWVFLMSGDYGDHPDNHFDPKAFPVVAGINFR  361
            SGVRIK+A GRGG+VK+IYVKG+  HTMKWVF M+G+Y  H DNH+DP A PV+ GIN+R
Sbjct  325  SGVRIKTARGRGGFVKDIYVKGMTLHTMKWVFWMTGNYKAHADNHYDPNALPVIQGINYR  384

Query  362  DVVADNVTMAGKMEGISGHPYTGVCMANVTIGMAKNGKKPAWNCSNIQGVASGVVPPPCP  541
            D++ADNV+MA ++EGI G P+T +C++NVTIGMA   KK  W C++++G+ SGV P PC 
Sbjct  385  DIMADNVSMAARLEGIEGDPFTQICISNVTIGMAAKAKKVPWTCTDVEGITSGVSPRPCD  444

Query  542  LLHIQGPVKPGMCDLPPK  595
             L  QGP K   CD P +
Sbjct  445  QLPDQGPEKITACDFPAE  462



>ref|XP_006386609.1| hypothetical protein POPTR_0002s16390g [Populus trichocarpa]
 gb|ERP64406.1| hypothetical protein POPTR_0002s16390g [Populus trichocarpa]
Length=357

 Score =   291 bits (745),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 133/199 (67%), Positives = 162/199 (81%), Gaps = 0/199 (0%)
 Frame = +2

Query  2    VAVKSGWDQYGIKYGKPTKQLIIKRLTCISPYSAAIALGSEMSGGIEDVRASDITAVHTE  181
            VAVKSGWD+YGI +G PTKQL+I+RLTCISPYSA IALGSEMSGGIEDVRA DITA+HTE
Sbjct  141  VAVKSGWDEYGIAFGMPTKQLVIRRLTCISPYSATIALGSEMSGGIEDVRAEDITAIHTE  200

Query  182  SGVRIKSAIGRGGYVKNIYVKGLRAHTMKWVFLMSGDYGDHPDNHFDPKAFPVVAGINFR  361
            SGVRIK+A+GRGGYVK+IYVK +  HTMKWVF M+G+YG H D ++DP A P++ GIN+R
Sbjct  201  SGVRIKTAVGRGGYVKDIYVKRMTMHTMKWVFWMTGNYGSHADKNYDPNALPLIQGINYR  260

Query  362  DVVADNVTMAGKMEGISGHPYTGVCMANVTIGMAKNGKKPAWNCSNIQGVASGVVPPPCP  541
            D+VADNVTMA ++EGI+G P+  +C++NVTIG+A   KK  W C+ I+G+ SGV P PC 
Sbjct  261  DMVADNVTMAARLEGIAGDPFKEICISNVTIGLAPKAKKVPWTCTEIEGMTSGVSPRPCD  320

Query  542  LLHIQGPVKPGMCDLPPKK  598
            LL  QGP K   CD PP+ 
Sbjct  321  LLPDQGPEKITSCDFPPEN  339



>gb|KHG15709.1| hypothetical protein F383_10492 [Gossypium arboreum]
Length=482

 Score =   295 bits (755),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 132/198 (67%), Positives = 162/198 (82%), Gaps = 0/198 (0%)
 Frame = +2

Query  2    VAVKSGWDQYGIKYGKPTKQLIIKRLTCISPYSAAIALGSEMSGGIEDVRASDITAVHTE  181
            +AVKSGWD+YGI +G PTKQL+I+RLTCISPYSAAIALGSEMSGGIEDVRA DITA+HTE
Sbjct  266  IAVKSGWDEYGISFGMPTKQLVIRRLTCISPYSAAIALGSEMSGGIEDVRAEDITAIHTE  325

Query  182  SGVRIKSAIGRGGYVKNIYVKGLRAHTMKWVFLMSGDYGDHPDNHFDPKAFPVVAGINFR  361
            SGVRIK+A GRGG+VK+IYVKG+  HTMKWVF M+G+Y  H DNH+DP A PV+ GIN+R
Sbjct  326  SGVRIKTARGRGGFVKDIYVKGMTLHTMKWVFWMTGNYKAHADNHYDPNALPVIQGINYR  385

Query  362  DVVADNVTMAGKMEGISGHPYTGVCMANVTIGMAKNGKKPAWNCSNIQGVASGVVPPPCP  541
            D++ADNV+MA ++EGI G P+T +C++NVTIGMA   KK  W C++++G+ SGV P PC 
Sbjct  386  DIMADNVSMAARLEGIEGDPFTQICISNVTIGMAAKAKKVPWTCTDVEGITSGVSPRPCD  445

Query  542  LLHIQGPVKPGMCDLPPK  595
             L  QGP K   CD P +
Sbjct  446  QLPDQGPEKITACDFPAE  463



>ref|XP_011023291.1| PREDICTED: probable polygalacturonase isoform X1 [Populus euphratica]
Length=473

 Score =   295 bits (754),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 133/199 (67%), Positives = 163/199 (82%), Gaps = 0/199 (0%)
 Frame = +2

Query  2    VAVKSGWDQYGIKYGKPTKQLIIKRLTCISPYSAAIALGSEMSGGIEDVRASDITAVHTE  181
            VAVKSGWD+YGI +G PTKQL+I+RLTCISPYSA IALGSEMSGGIEDVRA D+TA+HTE
Sbjct  257  VAVKSGWDEYGIAFGMPTKQLVIRRLTCISPYSATIALGSEMSGGIEDVRAEDLTAIHTE  316

Query  182  SGVRIKSAIGRGGYVKNIYVKGLRAHTMKWVFLMSGDYGDHPDNHFDPKAFPVVAGINFR  361
            SGVRIK+A+GRGGYVK+IYVK +  HTMKWVF M+G+YG H D ++DP A P++ GIN+R
Sbjct  317  SGVRIKTAVGRGGYVKDIYVKRMTMHTMKWVFWMTGNYGSHADKNYDPNALPLIQGINYR  376

Query  362  DVVADNVTMAGKMEGISGHPYTGVCMANVTIGMAKNGKKPAWNCSNIQGVASGVVPPPCP  541
            D+VADNVTMA ++EGI+G P+  +C++NVTIG+A   KK  W C+ I+G+ SGV P PC 
Sbjct  377  DMVADNVTMAARLEGIAGDPFKEICISNVTIGLAPKAKKVPWTCTEIEGMTSGVSPRPCD  436

Query  542  LLHIQGPVKPGMCDLPPKK  598
            LL  QGP K   CD PP+K
Sbjct  437  LLPDQGPEKITSCDFPPEK  455



>ref|XP_011023292.1| PREDICTED: probable polygalacturonase isoform X2 [Populus euphratica]
Length=470

 Score =   295 bits (754),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 133/199 (67%), Positives = 163/199 (82%), Gaps = 0/199 (0%)
 Frame = +2

Query  2    VAVKSGWDQYGIKYGKPTKQLIIKRLTCISPYSAAIALGSEMSGGIEDVRASDITAVHTE  181
            VAVKSGWD+YGI +G PTKQL+I+RLTCISPYSA IALGSEMSGGIEDVRA D+TA+HTE
Sbjct  254  VAVKSGWDEYGIAFGMPTKQLVIRRLTCISPYSATIALGSEMSGGIEDVRAEDLTAIHTE  313

Query  182  SGVRIKSAIGRGGYVKNIYVKGLRAHTMKWVFLMSGDYGDHPDNHFDPKAFPVVAGINFR  361
            SGVRIK+A+GRGGYVK+IYVK +  HTMKWVF M+G+YG H D ++DP A P++ GIN+R
Sbjct  314  SGVRIKTAVGRGGYVKDIYVKRMTMHTMKWVFWMTGNYGSHADKNYDPNALPLIQGINYR  373

Query  362  DVVADNVTMAGKMEGISGHPYTGVCMANVTIGMAKNGKKPAWNCSNIQGVASGVVPPPCP  541
            D+VADNVTMA ++EGI+G P+  +C++NVTIG+A   KK  W C+ I+G+ SGV P PC 
Sbjct  374  DMVADNVTMAARLEGIAGDPFKEICISNVTIGLAPKAKKVPWTCTEIEGMTSGVSPRPCD  433

Query  542  LLHIQGPVKPGMCDLPPKK  598
            LL  QGP K   CD PP+K
Sbjct  434  LLPDQGPEKITSCDFPPEK  452



>ref|XP_007051731.1| Polygalacturonase, putative isoform 1 [Theobroma cacao]
 gb|EOX95888.1| Polygalacturonase, putative isoform 1 [Theobroma cacao]
Length=484

 Score =   295 bits (755),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 134/198 (68%), Positives = 162/198 (82%), Gaps = 0/198 (0%)
 Frame = +2

Query  2    VAVKSGWDQYGIKYGKPTKQLIIKRLTCISPYSAAIALGSEMSGGIEDVRASDITAVHTE  181
            +AVKSGWD+YGI +G PTKQL+I+RLTCISPYSAAIALGSEMSGGI+DVRA DITAVHTE
Sbjct  268  IAVKSGWDEYGISFGMPTKQLVIRRLTCISPYSAAIALGSEMSGGIQDVRAEDITAVHTE  327

Query  182  SGVRIKSAIGRGGYVKNIYVKGLRAHTMKWVFLMSGDYGDHPDNHFDPKAFPVVAGINFR  361
            SGVRIK+A GRGG+VK+IYVK +  HTMKWVF M+G+Y  H DNH+DP A PV+ GIN+R
Sbjct  328  SGVRIKTARGRGGFVKDIYVKRMTLHTMKWVFWMTGNYKAHADNHYDPNALPVIQGINYR  387

Query  362  DVVADNVTMAGKMEGISGHPYTGVCMANVTIGMAKNGKKPAWNCSNIQGVASGVVPPPCP  541
            DVVADN +MA ++EGI G P+T +C++NVTIG+A   KK  W C++I+G+ SGV P PC 
Sbjct  388  DVVADNASMAARLEGIEGDPFTQICISNVTIGLAAKAKKVPWTCTDIEGITSGVSPRPCG  447

Query  542  LLHIQGPVKPGMCDLPPK  595
            LL  QGP K   CD PP+
Sbjct  448  LLPDQGPGKITACDFPPE  465



>ref|XP_003624048.1| Polygalacturonase [Medicago truncatula]
 gb|AES80266.1| polygalacturonase/glycoside hydrolase family protein [Medicago 
truncatula]
Length=483

 Score =   295 bits (754),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 133/198 (67%), Positives = 160/198 (81%), Gaps = 0/198 (0%)
 Frame = +2

Query  2    VAVKSGWDQYGIKYGKPTKQLIIKRLTCISPYSAAIALGSEMSGGIEDVRASDITAVHTE  181
            VAVKSGWD+YGIK+G PTKQL+I+RLTCISP+SA IALGSEMSGGI+DVRA DITA+ TE
Sbjct  266  VAVKSGWDEYGIKFGWPTKQLVIRRLTCISPFSATIALGSEMSGGIQDVRAEDITAIRTE  325

Query  182  SGVRIKSAIGRGGYVKNIYVKGLRAHTMKWVFLMSGDYGDHPDNHFDPKAFPVVAGINFR  361
            SGVRIK+A+GRGGYVK+IYVK    HTMKW F M+GDY  H D HFDP A P +A IN+R
Sbjct  326  SGVRIKTAVGRGGYVKDIYVKRFTMHTMKWAFKMTGDYNSHADTHFDPNALPEIANINYR  385

Query  362  DVVADNVTMAGKMEGISGHPYTGVCMANVTIGMAKNGKKPAWNCSNIQGVASGVVPPPCP  541
            DVVA+NVT+A + +GIS  P+ G+C+ANVT+GMA   KK +W C++I+G+ SGV PPPC 
Sbjct  386  DVVAENVTIAARFQGISNDPFKGICIANVTLGMAVKAKKRSWTCTDIEGMTSGVTPPPCD  445

Query  542  LLHIQGPVKPGMCDLPPK  595
            LL  QGP K G CD P +
Sbjct  446  LLPDQGPEKIGACDFPAE  463



>ref|XP_007051732.1| Polygalacturonase, putative isoform 2 [Theobroma cacao]
 gb|EOX95889.1| Polygalacturonase, putative isoform 2 [Theobroma cacao]
Length=481

 Score =   294 bits (753),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 134/198 (68%), Positives = 162/198 (82%), Gaps = 0/198 (0%)
 Frame = +2

Query  2    VAVKSGWDQYGIKYGKPTKQLIIKRLTCISPYSAAIALGSEMSGGIEDVRASDITAVHTE  181
            +AVKSGWD+YGI +G PTKQL+I+RLTCISPYSAAIALGSEMSGGI+DVRA DITAVHTE
Sbjct  265  IAVKSGWDEYGISFGMPTKQLVIRRLTCISPYSAAIALGSEMSGGIQDVRAEDITAVHTE  324

Query  182  SGVRIKSAIGRGGYVKNIYVKGLRAHTMKWVFLMSGDYGDHPDNHFDPKAFPVVAGINFR  361
            SGVRIK+A GRGG+VK+IYVK +  HTMKWVF M+G+Y  H DNH+DP A PV+ GIN+R
Sbjct  325  SGVRIKTARGRGGFVKDIYVKRMTLHTMKWVFWMTGNYKAHADNHYDPNALPVIQGINYR  384

Query  362  DVVADNVTMAGKMEGISGHPYTGVCMANVTIGMAKNGKKPAWNCSNIQGVASGVVPPPCP  541
            DVVADN +MA ++EGI G P+T +C++NVTIG+A   KK  W C++I+G+ SGV P PC 
Sbjct  385  DVVADNASMAARLEGIEGDPFTQICISNVTIGLAAKAKKVPWTCTDIEGITSGVSPRPCG  444

Query  542  LLHIQGPVKPGMCDLPPK  595
            LL  QGP K   CD PP+
Sbjct  445  LLPDQGPGKITACDFPPE  462



>ref|XP_002511903.1| polygalacturonase, putative [Ricinus communis]
 gb|EEF50572.1| polygalacturonase, putative [Ricinus communis]
Length=472

 Score =   294 bits (752),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 132/199 (66%), Positives = 162/199 (81%), Gaps = 0/199 (0%)
 Frame = +2

Query  2    VAVKSGWDQYGIKYGKPTKQLIIKRLTCISPYSAAIALGSEMSGGIEDVRASDITAVHTE  181
            VAVKSGWD+YGI +G PTKQL+I+RLTCISPYSA IALGSEMSGGI+DVRA DITA+HTE
Sbjct  256  VAVKSGWDEYGIAFGMPTKQLVIRRLTCISPYSATIALGSEMSGGIQDVRAEDITAIHTE  315

Query  182  SGVRIKSAIGRGGYVKNIYVKGLRAHTMKWVFLMSGDYGDHPDNHFDPKAFPVVAGINFR  361
            SGVRIK+A+GRGGYVK+IYVK +  HTMKW F M+G+YG H D ++DP A PV+ GIN+R
Sbjct  316  SGVRIKTAVGRGGYVKDIYVKRMTMHTMKWAFWMTGNYGSHADKNYDPNALPVIEGINYR  375

Query  362  DVVADNVTMAGKMEGISGHPYTGVCMANVTIGMAKNGKKPAWNCSNIQGVASGVVPPPCP  541
            D+VADNV+MA ++EGISG P+  +C++NVTIGMA   KK  W C++I+G+ +GV P PC 
Sbjct  376  DMVADNVSMAARLEGISGDPFKQICISNVTIGMAAKAKKIPWTCTDIEGITTGVSPRPCD  435

Query  542  LLHIQGPVKPGMCDLPPKK  598
            LL  QGP K   CD PP+ 
Sbjct  436  LLPDQGPEKLTACDFPPEN  454



>ref|XP_003548644.2| PREDICTED: probable polygalacturonase-like isoform X1 [Glycine 
max]
Length=491

 Score =   295 bits (754),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 135/198 (68%), Positives = 162/198 (82%), Gaps = 0/198 (0%)
 Frame = +2

Query  2    VAVKSGWDQYGIKYGKPTKQLIIKRLTCISPYSAAIALGSEMSGGIEDVRASDITAVHTE  181
            VAVKSGWD+YGIK+G PTKQL+I+RLTCISP SAAIALGSEMSGGI+DVRA DITA+HTE
Sbjct  278  VAVKSGWDEYGIKFGWPTKQLVIRRLTCISPESAAIALGSEMSGGIQDVRAEDITAIHTE  337

Query  182  SGVRIKSAIGRGGYVKNIYVKGLRAHTMKWVFLMSGDYGDHPDNHFDPKAFPVVAGINFR  361
            SGVRIK+A+GRGGYVK+IYVK +  HTMKWVF M+G+YG H D+H+DP A P + GIN+R
Sbjct  338  SGVRIKTAVGRGGYVKDIYVKRMTMHTMKWVFWMTGNYGSHADSHYDPNALPEINGINYR  397

Query  362  DVVADNVTMAGKMEGISGHPYTGVCMANVTIGMAKNGKKPAWNCSNIQGVASGVVPPPCP  541
            DVVADNVT+A ++EGIS  P+TG+C+ANVTI MA   KK  W C++I+G+ SGV P PC 
Sbjct  398  DVVADNVTIAARLEGISNDPFTGICIANVTINMAAKAKKQPWACTDIEGITSGVTPKPCN  457

Query  542  LLHIQGPVKPGMCDLPPK  595
             L  QGP K   CD P +
Sbjct  458  SLPDQGPEKIKACDFPQE  475



>gb|KHN46704.1| Putative polygalacturonase [Glycine soja]
Length=477

 Score =   294 bits (752),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 135/198 (68%), Positives = 162/198 (82%), Gaps = 0/198 (0%)
 Frame = +2

Query  2    VAVKSGWDQYGIKYGKPTKQLIIKRLTCISPYSAAIALGSEMSGGIEDVRASDITAVHTE  181
            VAVKSGWD+YGIK+G PTKQL+I+RLTCISP SAAIALGSEMSGGI+DVRA DITA+HTE
Sbjct  264  VAVKSGWDEYGIKFGWPTKQLVIRRLTCISPESAAIALGSEMSGGIQDVRAEDITAIHTE  323

Query  182  SGVRIKSAIGRGGYVKNIYVKGLRAHTMKWVFLMSGDYGDHPDNHFDPKAFPVVAGINFR  361
            SGVRIK+A+GRGGYVK+IYVK +  HTMKWVF M+G+YG H D+H+DP A P + GIN+R
Sbjct  324  SGVRIKTAVGRGGYVKDIYVKRMTMHTMKWVFWMTGNYGSHADSHYDPNALPEINGINYR  383

Query  362  DVVADNVTMAGKMEGISGHPYTGVCMANVTIGMAKNGKKPAWNCSNIQGVASGVVPPPCP  541
            DVVADNVT+A ++EGIS  P+TG+C+ANVTI MA   KK  W C++I+G+ SGV P PC 
Sbjct  384  DVVADNVTIAARLEGISNDPFTGICIANVTINMAAKAKKQPWACTDIEGITSGVTPKPCN  443

Query  542  LLHIQGPVKPGMCDLPPK  595
             L  QGP K   CD P +
Sbjct  444  SLPDQGPEKIKACDFPQE  461



>ref|XP_006598941.1| PREDICTED: probable polygalacturonase-like isoform X2 [Glycine 
max]
Length=489

 Score =   294 bits (753),  Expect = 3e-92, Method: Compositional matrix adjust.
 Identities = 135/198 (68%), Positives = 162/198 (82%), Gaps = 0/198 (0%)
 Frame = +2

Query  2    VAVKSGWDQYGIKYGKPTKQLIIKRLTCISPYSAAIALGSEMSGGIEDVRASDITAVHTE  181
            VAVKSGWD+YGIK+G PTKQL+I+RLTCISP SAAIALGSEMSGGI+DVRA DITA+HTE
Sbjct  276  VAVKSGWDEYGIKFGWPTKQLVIRRLTCISPESAAIALGSEMSGGIQDVRAEDITAIHTE  335

Query  182  SGVRIKSAIGRGGYVKNIYVKGLRAHTMKWVFLMSGDYGDHPDNHFDPKAFPVVAGINFR  361
            SGVRIK+A+GRGGYVK+IYVK +  HTMKWVF M+G+YG H D+H+DP A P + GIN+R
Sbjct  336  SGVRIKTAVGRGGYVKDIYVKRMTMHTMKWVFWMTGNYGSHADSHYDPNALPEINGINYR  395

Query  362  DVVADNVTMAGKMEGISGHPYTGVCMANVTIGMAKNGKKPAWNCSNIQGVASGVVPPPCP  541
            DVVADNVT+A ++EGIS  P+TG+C+ANVTI MA   KK  W C++I+G+ SGV P PC 
Sbjct  396  DVVADNVTIAARLEGISNDPFTGICIANVTINMAAKAKKQPWACTDIEGITSGVTPKPCN  455

Query  542  LLHIQGPVKPGMCDLPPK  595
             L  QGP K   CD P +
Sbjct  456  SLPDQGPEKIKACDFPQE  473



>ref|XP_011029346.1| PREDICTED: probable polygalacturonase [Populus euphratica]
Length=481

 Score =   294 bits (752),  Expect = 3e-92, Method: Compositional matrix adjust.
 Identities = 133/196 (68%), Positives = 164/196 (84%), Gaps = 0/196 (0%)
 Frame = +2

Query  2    VAVKSGWDQYGIKYGKPTKQLIIKRLTCISPYSAAIALGSEMSGGIEDVRASDITAVHTE  181
            VAVKSGWD+YGI +G PTKQL+I+RLTCISP SA IALGSEMSGGIEDVRA DITA+ +E
Sbjct  264  VAVKSGWDEYGISFGMPTKQLVIRRLTCISPTSAVIALGSEMSGGIEDVRAEDITAIDSE  323

Query  182  SGVRIKSAIGRGGYVKNIYVKGLRAHTMKWVFLMSGDYGDHPDNHFDPKAFPVVAGINFR  361
            SGVRIK+A+GRGGYVK+IYV+G+   TMKWVF M+G+YG HPD+++DP A PV+  IN+R
Sbjct  324  SGVRIKTAVGRGGYVKDIYVRGMTLKTMKWVFWMTGNYGSHPDDNYDPNAIPVIQNINYR  383

Query  362  DVVADNVTMAGKMEGISGHPYTGVCMANVTIGMAKNGKKPAWNCSNIQGVASGVVPPPCP  541
            DVVA+NVTMA K+EGI+G P+TG+C++NVTIG+A+N KK  WNC+++ G+ S V P PC 
Sbjct  384  DVVAENVTMAAKLEGIAGDPFTGICISNVTIGLAQNSKKLQWNCTDVAGITSEVNPKPCA  443

Query  542  LLHIQGPVKPGMCDLP  589
            LL  QGP K G CD P
Sbjct  444  LLADQGPGKIGGCDFP  459



>ref|XP_002301370.1| polygalacturonase-like family protein [Populus trichocarpa]
 gb|EEE80643.1| polygalacturonase-like family protein [Populus trichocarpa]
Length=470

 Score =   293 bits (750),  Expect = 5e-92, Method: Compositional matrix adjust.
 Identities = 133/199 (67%), Positives = 162/199 (81%), Gaps = 0/199 (0%)
 Frame = +2

Query  2    VAVKSGWDQYGIKYGKPTKQLIIKRLTCISPYSAAIALGSEMSGGIEDVRASDITAVHTE  181
            VAVKSGWD+YGI +G PTKQL+I+RLTCISPYSA IALGSEMSGGIEDVRA DITA+HTE
Sbjct  254  VAVKSGWDEYGIAFGMPTKQLVIRRLTCISPYSATIALGSEMSGGIEDVRAEDITAIHTE  313

Query  182  SGVRIKSAIGRGGYVKNIYVKGLRAHTMKWVFLMSGDYGDHPDNHFDPKAFPVVAGINFR  361
            SGVRIK+A+GRGGYVK+IYVK +  HTMKWVF M+G+YG H D ++DP A P++ GIN+R
Sbjct  314  SGVRIKTAVGRGGYVKDIYVKRMTMHTMKWVFWMTGNYGSHADKNYDPNALPLIQGINYR  373

Query  362  DVVADNVTMAGKMEGISGHPYTGVCMANVTIGMAKNGKKPAWNCSNIQGVASGVVPPPCP  541
            D+VADNVTMA ++EGI+G P+  +C++NVTIG+A   KK  W C+ I+G+ SGV P PC 
Sbjct  374  DMVADNVTMAARLEGIAGDPFKEICISNVTIGLAPKAKKVPWTCTEIEGMTSGVSPRPCD  433

Query  542  LLHIQGPVKPGMCDLPPKK  598
            LL  QGP K   CD PP+ 
Sbjct  434  LLPDQGPEKITSCDFPPEN  452



>ref|XP_002303605.2| hypothetical protein POPTR_0003s13160g [Populus trichocarpa]
 gb|EEE78584.2| hypothetical protein POPTR_0003s13160g [Populus trichocarpa]
Length=479

 Score =   293 bits (750),  Expect = 5e-92, Method: Compositional matrix adjust.
 Identities = 132/196 (67%), Positives = 164/196 (84%), Gaps = 0/196 (0%)
 Frame = +2

Query  2    VAVKSGWDQYGIKYGKPTKQLIIKRLTCISPYSAAIALGSEMSGGIEDVRASDITAVHTE  181
            VAVKSGWD+YGI +G PTKQ++I+RLTCISP SA IALGSEMSGGIEDVRA DITA+ +E
Sbjct  264  VAVKSGWDEYGIAFGMPTKQVVIRRLTCISPTSAVIALGSEMSGGIEDVRAEDITAIDSE  323

Query  182  SGVRIKSAIGRGGYVKNIYVKGLRAHTMKWVFLMSGDYGDHPDNHFDPKAFPVVAGINFR  361
            SGVRIK+A+GRGGYVK+IYV+G+   TMKWVF M+G+YG HPDN++DP A PV+  IN+R
Sbjct  324  SGVRIKTAVGRGGYVKDIYVRGMTLKTMKWVFWMTGNYGSHPDNNYDPNAIPVIQNINYR  383

Query  362  DVVADNVTMAGKMEGISGHPYTGVCMANVTIGMAKNGKKPAWNCSNIQGVASGVVPPPCP  541
            DVVA+NVTMA ++EGI+G P+TG+C++NVTIG+A+N KK  WNCS++ G+ S V P PC 
Sbjct  384  DVVAENVTMAARLEGIAGDPFTGICISNVTIGLARNRKKLQWNCSDVAGITSEVTPKPCD  443

Query  542  LLHIQGPVKPGMCDLP  589
            LL  QGP K G C+ P
Sbjct  444  LLSDQGPGKIGACNYP  459



>ref|XP_011022627.1| PREDICTED: probable polygalacturonase [Populus euphratica]
Length=479

 Score =   293 bits (750),  Expect = 6e-92, Method: Compositional matrix adjust.
 Identities = 132/196 (67%), Positives = 164/196 (84%), Gaps = 0/196 (0%)
 Frame = +2

Query  2    VAVKSGWDQYGIKYGKPTKQLIIKRLTCISPYSAAIALGSEMSGGIEDVRASDITAVHTE  181
            VAVKSGWD+YGI +G PTKQ++I+RLTCISP SA IALGSEMSGGIEDVRA DITA+ +E
Sbjct  264  VAVKSGWDEYGIAFGMPTKQVVIRRLTCISPTSAVIALGSEMSGGIEDVRAEDITAIDSE  323

Query  182  SGVRIKSAIGRGGYVKNIYVKGLRAHTMKWVFLMSGDYGDHPDNHFDPKAFPVVAGINFR  361
            SGVRIK+A+GRGGYVK+IYV+G+   TMKWVF M+G+YG HPDN++DP A PV+  IN+R
Sbjct  324  SGVRIKTAVGRGGYVKDIYVRGMTLKTMKWVFWMTGNYGSHPDNNYDPNAIPVIQNINYR  383

Query  362  DVVADNVTMAGKMEGISGHPYTGVCMANVTIGMAKNGKKPAWNCSNIQGVASGVVPPPCP  541
            DVVA+NVTMA ++EGI+G P+TG+C++NVTIG+A+N KK  WNCS++ G+ S V P PC 
Sbjct  384  DVVAENVTMAARLEGIAGDPFTGICISNVTIGLARNRKKLQWNCSDVAGITSEVTPKPCD  443

Query  542  LLHIQGPVKPGMCDLP  589
            LL  QGP K G C+ P
Sbjct  444  LLSDQGPGKIGACNYP  459



>gb|ABG34276.1| polygalacturonase [Eucalyptus globulus subsp. globulus]
Length=241

 Score =   285 bits (729),  Expect = 6e-92, Method: Compositional matrix adjust.
 Identities = 130/199 (65%), Positives = 163/199 (82%), Gaps = 0/199 (0%)
 Frame = +2

Query  2    VAVKSGWDQYGIKYGKPTKQLIIKRLTCISPYSAAIALGSEMSGGIEDVRASDITAVHTE  181
            VAVKSGWD+YGI YG PTKQL+I+RLTCISP SA IALGSEMSGGIEDVRA DI A+++E
Sbjct  25   VAVKSGWDEYGIAYGMPTKQLVIRRLTCISPTSAVIALGSEMSGGIEDVRAEDILAINSE  84

Query  182  SGVRIKSAIGRGGYVKNIYVKGLRAHTMKWVFLMSGDYGDHPDNHFDPKAFPVVAGINFR  361
            SGVRIK+AIGRGGYVK+IYVKG+   TMKWVF M+G+YG H DN++DP A P++  IN+R
Sbjct  85   SGVRIKTAIGRGGYVKDIYVKGMTMRTMKWVFWMTGNYGSHADNNYDPNALPLIQNINYR  144

Query  362  DVVADNVTMAGKMEGISGHPYTGVCMANVTIGMAKNGKKPAWNCSNIQGVASGVVPPPCP  541
            D+VA+NVTMA ++EGI+G P+TG+C++NVTIG+A+  KK  WNC++I G++S VVP PC 
Sbjct  145  DMVAENVTMAARLEGIAGDPFTGICISNVTIGLAQKPKKLQWNCTDISGISSSVVPQPCN  204

Query  542  LLHIQGPVKPGMCDLPPKK  598
             L  QGP K   C+ P  +
Sbjct  205  ALPNQGPEKLPACNFPEDR  223



>gb|AAP33475.1| polygalacturonase-like protein [Fragaria x ananassa]
Length=474

 Score =   293 bits (749),  Expect = 7e-92, Method: Compositional matrix adjust.
 Identities = 131/196 (67%), Positives = 160/196 (82%), Gaps = 0/196 (0%)
 Frame = +2

Query  2    VAVKSGWDQYGIKYGKPTKQLIIKRLTCISPYSAAIALGSEMSGGIEDVRASDITAVHTE  181
            VAVKSGWD+YGI +G PTKQL+I+RLTCISPYSA IALGSEMSGGI+DVRA DI A++TE
Sbjct  259  VAVKSGWDEYGISFGMPTKQLVIRRLTCISPYSATIALGSEMSGGIQDVRAEDIVAINTE  318

Query  182  SGVRIKSAIGRGGYVKNIYVKGLRAHTMKWVFLMSGDYGDHPDNHFDPKAFPVVAGINFR  361
            S VRIK+A+GRG YVK+IYV+ +  HTMKW F M+G+YG H D ++D  AFP + GIN+R
Sbjct  319  SAVRIKTAVGRGAYVKDIYVRRMTLHTMKWAFWMTGNYGSHADGNYDKNAFPEITGINYR  378

Query  362  DVVADNVTMAGKMEGISGHPYTGVCMANVTIGMAKNGKKPAWNCSNIQGVASGVVPPPCP  541
            DVVA+NVTMA ++EGI+ HP+TG+CM+NVTIG+AK  KK  W C++IQG+ SGV P PC 
Sbjct  379  DVVAENVTMAARLEGIADHPFTGICMSNVTIGLAKKAKKQPWTCTDIQGITSGVTPTPCG  438

Query  542  LLHIQGPVKPGMCDLP  589
            LL  QG  KPG CD P
Sbjct  439  LLPDQGTDKPGGCDFP  454



>ref|XP_002299511.1| hypothetical protein POPTR_0001s09790g [Populus trichocarpa]
 gb|EEE84316.1| hypothetical protein POPTR_0001s09790g [Populus trichocarpa]
Length=481

 Score =   293 bits (749),  Expect = 7e-92, Method: Compositional matrix adjust.
 Identities = 133/196 (68%), Positives = 164/196 (84%), Gaps = 0/196 (0%)
 Frame = +2

Query  2    VAVKSGWDQYGIKYGKPTKQLIIKRLTCISPYSAAIALGSEMSGGIEDVRASDITAVHTE  181
            VAVKSGWD+YGI +G PTKQL+I+RLTCISP SA IALGSEMSGGIEDVRA DITA+ +E
Sbjct  264  VAVKSGWDEYGISFGMPTKQLVIRRLTCISPTSAVIALGSEMSGGIEDVRAEDITAIDSE  323

Query  182  SGVRIKSAIGRGGYVKNIYVKGLRAHTMKWVFLMSGDYGDHPDNHFDPKAFPVVAGINFR  361
            SGVRIK+A+GRGGYVK+IYV+G+   TMKWVF M+G+YG HPDN++DP A PV+  IN+R
Sbjct  324  SGVRIKTAVGRGGYVKDIYVRGMTLKTMKWVFWMTGNYGSHPDNNYDPNAIPVIQNINYR  383

Query  362  DVVADNVTMAGKMEGISGHPYTGVCMANVTIGMAKNGKKPAWNCSNIQGVASGVVPPPCP  541
            DVVA+NVTMA K+EGI+G P+TG+C++NVTIG+A+N KK  WNC+++ G+ S V P PC 
Sbjct  384  DVVAENVTMAAKLEGIAGDPFTGICISNVTIGLAQNSKKLQWNCTDVAGITSEVNPKPCA  443

Query  542  LLHIQGPVKPGMCDLP  589
            LL  QGP K G C+ P
Sbjct  444  LLPDQGPGKIGGCNFP  459



>ref|XP_004306749.1| PREDICTED: probable polygalacturonase-like [Fragaria vesca subsp. 
vesca]
Length=474

 Score =   293 bits (749),  Expect = 8e-92, Method: Compositional matrix adjust.
 Identities = 131/196 (67%), Positives = 160/196 (82%), Gaps = 0/196 (0%)
 Frame = +2

Query  2    VAVKSGWDQYGIKYGKPTKQLIIKRLTCISPYSAAIALGSEMSGGIEDVRASDITAVHTE  181
            VAVKSGWD+YGI +G PTKQL+I+RLTCISPYSA IALGSEMSGGI+DVRA DI A++TE
Sbjct  259  VAVKSGWDEYGISFGMPTKQLVIRRLTCISPYSATIALGSEMSGGIQDVRAEDIVAINTE  318

Query  182  SGVRIKSAIGRGGYVKNIYVKGLRAHTMKWVFLMSGDYGDHPDNHFDPKAFPVVAGINFR  361
            S VRIK+A+GRG YVK+IYV+ +  HTMKW F M+G+YG H D ++D  AFP + GIN+R
Sbjct  319  SAVRIKTAVGRGAYVKDIYVRRMTLHTMKWAFWMTGNYGSHADGNYDKNAFPEITGINYR  378

Query  362  DVVADNVTMAGKMEGISGHPYTGVCMANVTIGMAKNGKKPAWNCSNIQGVASGVVPPPCP  541
            DVVA+NVTMA ++EGI+ HP+TG+CM+NVTIG+AK  KK  W C++IQG+ SGV P PC 
Sbjct  379  DVVAENVTMAARLEGIADHPFTGICMSNVTIGLAKKAKKQPWTCTDIQGITSGVTPTPCG  438

Query  542  LLHIQGPVKPGMCDLP  589
            LL  QG  KPG CD P
Sbjct  439  LLPDQGTDKPGGCDFP  454



>gb|AFK43011.1| unknown [Medicago truncatula]
Length=483

 Score =   292 bits (748),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 132/198 (67%), Positives = 159/198 (80%), Gaps = 0/198 (0%)
 Frame = +2

Query  2    VAVKSGWDQYGIKYGKPTKQLIIKRLTCISPYSAAIALGSEMSGGIEDVRASDITAVHTE  181
            VAVKSGWD+YGIK+G PTKQL+I+RLTCISP+SA IALGSEMSGGI+DVRA DITA+ TE
Sbjct  266  VAVKSGWDEYGIKFGWPTKQLVIRRLTCISPFSATIALGSEMSGGIQDVRAEDITAIRTE  325

Query  182  SGVRIKSAIGRGGYVKNIYVKGLRAHTMKWVFLMSGDYGDHPDNHFDPKAFPVVAGINFR  361
            SGVRIK+A+GRGGYVK+IYVK    HTMKW F M+GDY  H D HFDP A P +A IN+R
Sbjct  326  SGVRIKTAVGRGGYVKDIYVKRFTMHTMKWAFKMTGDYNSHADTHFDPNALPEIANINYR  385

Query  362  DVVADNVTMAGKMEGISGHPYTGVCMANVTIGMAKNGKKPAWNCSNIQGVASGVVPPPCP  541
            DVVA+NVT+A + +GI   P+ G+C+ANVT+GMA   KK +W C++I+G+ SGV PPPC 
Sbjct  386  DVVAENVTIAARFQGIFNDPFKGICIANVTLGMAVKAKKRSWTCTDIEGMTSGVTPPPCD  445

Query  542  LLHIQGPVKPGMCDLPPK  595
            LL  QGP K G CD P +
Sbjct  446  LLPDQGPEKIGACDFPAE  463



>ref|XP_002278930.1| PREDICTED: probable polygalacturonase [Vitis vinifera]
Length=480

 Score =   290 bits (741),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 131/196 (67%), Positives = 161/196 (82%), Gaps = 0/196 (0%)
 Frame = +2

Query  2    VAVKSGWDQYGIKYGKPTKQLIIKRLTCISPYSAAIALGSEMSGGIEDVRASDITAVHTE  181
            +AVKSGWD+YGI YG PTKQL+I+RLTCISP+SA IALGSEMSGGIEDVRA DI A+ TE
Sbjct  264  IAVKSGWDEYGIAYGMPTKQLVIRRLTCISPFSATIALGSEMSGGIEDVRAEDILAIDTE  323

Query  182  SGVRIKSAIGRGGYVKNIYVKGLRAHTMKWVFLMSGDYGDHPDNHFDPKAFPVVAGINFR  361
            SGVRIK+A+GRGGYVK+IYV+ +   TMKW F M+G+YG H DN++DP A P + GIN+R
Sbjct  324  SGVRIKTAVGRGGYVKDIYVRSMIMKTMKWAFWMTGNYGSHADNNYDPNALPAIQGINYR  383

Query  362  DVVADNVTMAGKMEGISGHPYTGVCMANVTIGMAKNGKKPAWNCSNIQGVASGVVPPPCP  541
            D+VA+NVTMAG++EGISG P+TG+C++NVTIG+AK  KK  W C++I G+ SGVVP PC 
Sbjct  384  DMVAENVTMAGRLEGISGDPFTGICISNVTIGLAKKAKKAPWTCTDIAGITSGVVPQPCD  443

Query  542  LLHIQGPVKPGMCDLP  589
            LL  QGP K   C+ P
Sbjct  444  LLPDQGPEKIVACNFP  459



>ref|XP_003533597.1| PREDICTED: probable polygalacturonase-like [Glycine max]
 gb|KHN29325.1| Putative polygalacturonase [Glycine soja]
Length=484

 Score =   289 bits (740),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 131/196 (67%), Positives = 158/196 (81%), Gaps = 0/196 (0%)
 Frame = +2

Query  2    VAVKSGWDQYGIKYGKPTKQLIIKRLTCISPYSAAIALGSEMSGGIEDVRASDITAVHTE  181
            VAVKSGWD+YGIK+G PTKQL+I+RLTCISPYSA IALGSEMSGGI+DVRA DITA+ TE
Sbjct  266  VAVKSGWDEYGIKFGWPTKQLMIRRLTCISPYSATIALGSEMSGGIQDVRAEDITAIQTE  325

Query  182  SGVRIKSAIGRGGYVKNIYVKGLRAHTMKWVFLMSGDYGDHPDNHFDPKAFPVVAGINFR  361
            SGVRIK+A+GRGGYVK+IYVK +  HTMKW F M+GDY  H D+H+DP A P +  IN+R
Sbjct  326  SGVRIKTAVGRGGYVKDIYVKRMTLHTMKWAFKMTGDYNSHADSHYDPNALPEIKNINYR  385

Query  362  DVVADNVTMAGKMEGISGHPYTGVCMANVTIGMAKNGKKPAWNCSNIQGVASGVVPPPCP  541
            DVVA+NVT+A + +GIS  P+TG+C+ANVT+ MA   KK  W C++I+G+ SGV PPPC 
Sbjct  386  DVVAENVTIAARFQGISNDPFTGICIANVTLRMAAKAKKQPWTCTDIEGMTSGVTPPPCG  445

Query  542  LLHIQGPVKPGMCDLP  589
            LL  QGP K   CD P
Sbjct  446  LLPDQGPEKITACDFP  461



>ref|XP_003552411.1| PREDICTED: probable polygalacturonase [Glycine max]
 gb|KHM99339.1| Putative polygalacturonase [Glycine soja]
Length=484

 Score =   289 bits (740),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 131/196 (67%), Positives = 157/196 (80%), Gaps = 0/196 (0%)
 Frame = +2

Query  2    VAVKSGWDQYGIKYGKPTKQLIIKRLTCISPYSAAIALGSEMSGGIEDVRASDITAVHTE  181
            VAVKSGWD+YGIK+G PTKQL+I+RLTCISPYSA IALGSEMSGGI+DVRA DITA+ TE
Sbjct  266  VAVKSGWDEYGIKFGWPTKQLVIRRLTCISPYSATIALGSEMSGGIQDVRAEDITAIQTE  325

Query  182  SGVRIKSAIGRGGYVKNIYVKGLRAHTMKWVFLMSGDYGDHPDNHFDPKAFPVVAGINFR  361
            SGVRIK+A+GRGGYVK+IYVK +  HTMKW F M+GDY  H D H+DP A P +  IN+R
Sbjct  326  SGVRIKTAVGRGGYVKDIYVKRMTLHTMKWAFKMTGDYNSHADGHYDPNALPEIKNINYR  385

Query  362  DVVADNVTMAGKMEGISGHPYTGVCMANVTIGMAKNGKKPAWNCSNIQGVASGVVPPPCP  541
            DVVA+NVT+A + +GIS  P+TG+C+ANVT+ MA   KK  W C++I+G+ SGV PPPC 
Sbjct  386  DVVAENVTIAARFQGISNDPFTGICIANVTLRMAAKAKKQPWTCTDIEGMTSGVTPPPCG  445

Query  542  LLHIQGPVKPGMCDLP  589
            LL  QGP K   CD P
Sbjct  446  LLPDQGPEKITACDFP  461



>emb|CDP12065.1| unnamed protein product [Coffea canephora]
Length=468

 Score =   288 bits (738),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 132/198 (67%), Positives = 161/198 (81%), Gaps = 0/198 (0%)
 Frame = +2

Query  2    VAVKSGWDQYGIKYGKPTKQLIIKRLTCISPYSAAIALGSEMSGGIEDVRASDITAVHTE  181
            VAVKSGWD+YGI +G PTKQL IKRLTCISP SA IALGSEMSGGIEDVRA DI A++TE
Sbjct  266  VAVKSGWDEYGIAFGMPTKQLFIKRLTCISPSSATIALGSEMSGGIEDVRAEDIVAINTE  325

Query  182  SGVRIKSAIGRGGYVKNIYVKGLRAHTMKWVFLMSGDYGDHPDNHFDPKAFPVVAGINFR  361
            SGVRIK+A+GRGGYVK+IYVKG+   TMK+VF M+G+YG HPDN++DP A P V  IN+R
Sbjct  326  SGVRIKTAVGRGGYVKDIYVKGMTLKTMKYVFWMTGNYGSHPDNNYDPNALPAVENINYR  385

Query  362  DVVADNVTMAGKMEGISGHPYTGVCMANVTIGMAKNGKKPAWNCSNIQGVASGVVPPPCP  541
            D+VA+NVTMAG++EGI G P+TG+C++NVTI +A+N KK  WNC++I G++SGV P PC 
Sbjct  386  DIVAENVTMAGRLEGIPGDPFTGICISNVTIELAQNAKKLPWNCTDISGISSGVTPQPCD  445

Query  542  LLHIQGPVKPGMCDLPPK  595
            LL  QG      CD P +
Sbjct  446  LLTQQGEEYSPSCDFPTE  463



>gb|ABG34275.1| polygalacturonase [Eucalyptus globulus subsp. globulus]
Length=238

 Score =   281 bits (718),  Expect = 3e-90, Method: Compositional matrix adjust.
 Identities = 127/198 (64%), Positives = 159/198 (80%), Gaps = 4/198 (2%)
 Frame = +2

Query  2    VAVKSGWDQYGIKYGKPTKQLIIKRLTCISPYSAAIALGSEMSGGIEDVRASDITAVHTE  181
            VAVKSGWD+YGI YG PTKQL+I+RLTCISPYSA IALGSEMSGGIEDVRA DITA++TE
Sbjct  26   VAVKSGWDEYGISYGMPTKQLVIRRLTCISPYSAMIALGSEMSGGIEDVRAEDITAINTE  85

Query  182  SGVRIKSAIGRGGYVKNIYVKGLRAHTMKWVFLMSGDYGDHPDNHFDPKAFPVVAGINFR  361
            SG+RIK+A+GRGGYVK+IYV+G++ HTMKW F M G+YG HPD H+DPKA P++ GIN+R
Sbjct  86   SGIRIKTAMGRGGYVKDIYVRGMKMHTMKWAFWMDGNYGSHPDPHYDPKARPIITGINYR  145

Query  362  DVVADNVTMAGKMEGISGHPYTGVCMANVTIGMAKNGKKPAWNCSNIQGVASGVVPPPCP  541
            D+VA+NVTM  +++GI G+P+TG+C++N TI MA   KK  W CS+I G+ SGV P PC 
Sbjct  146  DIVAENVTMVAQLKGIPGNPFTGICISNATITMAPESKKEPWTCSDIHGITSGVTPQPCG  205

Query  542  LLHIQGPVKPGMCDLPPK  595
            +L    P +   C  P +
Sbjct  206  ML----PAETTTCHFPER  219



>ref|XP_010053221.1| PREDICTED: probable polygalacturonase [Eucalyptus grandis]
 gb|KCW77483.1| hypothetical protein EUGRSUZ_D01821 [Eucalyptus grandis]
Length=482

 Score =   288 bits (737),  Expect = 5e-90, Method: Compositional matrix adjust.
 Identities = 131/199 (66%), Positives = 164/199 (82%), Gaps = 0/199 (0%)
 Frame = +2

Query  2    VAVKSGWDQYGIKYGKPTKQLIIKRLTCISPYSAAIALGSEMSGGIEDVRASDITAVHTE  181
            VAVKSGWD+YGI YG PTKQL+I+RLTCISP SA IALGSEMSGGIEDVRA DI A+++E
Sbjct  266  VAVKSGWDEYGIAYGMPTKQLVIRRLTCISPTSAVIALGSEMSGGIEDVRAEDILAINSE  325

Query  182  SGVRIKSAIGRGGYVKNIYVKGLRAHTMKWVFLMSGDYGDHPDNHFDPKAFPVVAGINFR  361
            SGVRIK+AIGRGGYVK+IYVKG+   TMKWVF M+G+YG H DN++DP A P++  IN+R
Sbjct  326  SGVRIKTAIGRGGYVKDIYVKGMTMRTMKWVFWMTGNYGSHADNNYDPNALPLIQNINYR  385

Query  362  DVVADNVTMAGKMEGISGHPYTGVCMANVTIGMAKNGKKPAWNCSNIQGVASGVVPPPCP  541
            D+VA+NVTMA ++EGI+G P+TG+C++NVTIG+A+  KK  WNC++I G++S VVPPPC 
Sbjct  386  DMVAENVTMAARLEGIAGDPFTGICISNVTIGLAQKPKKLQWNCTDISGISSSVVPPPCN  445

Query  542  LLHIQGPVKPGMCDLPPKK  598
             L  QGP K   C+ P  +
Sbjct  446  ALPNQGPEKLPACNFPEDR  464



>ref|XP_008232996.1| PREDICTED: LOW QUALITY PROTEIN: probable polygalacturonase [Prunus 
mume]
Length=476

 Score =   288 bits (736),  Expect = 6e-90, Method: Compositional matrix adjust.
 Identities = 128/196 (65%), Positives = 159/196 (81%), Gaps = 0/196 (0%)
 Frame = +2

Query  2    VAVKSGWDQYGIKYGKPTKQLIIKRLTCISPYSAAIALGSEMSGGIEDVRASDITAVHTE  181
            VAVKSGWD+YGI +G+PTKQL+I+RLTCISPYSA IALGSEMSGGI+DVRA DI A+HTE
Sbjct  260  VAVKSGWDEYGIAFGRPTKQLVIRRLTCISPYSATIALGSEMSGGIQDVRAEDIVAIHTE  319

Query  182  SGVRIKSAIGRGGYVKNIYVKGLRAHTMKWVFLMSGDYGDHPDNHFDPKAFPVVAGINFR  361
            SG+RIK+A+GRGGYVK+IYV+ +  HTMKWVF M+GDYG H D  +D  A P + GIN+R
Sbjct  320  SGIRIKTAVGRGGYVKDIYVRRMTMHTMKWVFKMNGDYGSHADGKYDKNAIPEIKGINYR  379

Query  362  DVVADNVTMAGKMEGISGHPYTGVCMANVTIGMAKNGKKPAWNCSNIQGVASGVVPPPCP  541
            D+VADNVT+A ++EGI+ HP+TG+C++NVTIG+A   KK  W C+NI+G+ SGV P PC 
Sbjct  380  DMVADNVTIAARLEGIADHPFTGICISNVTIGLAAKAKKQPWTCTNIEGITSGVTPSPCD  439

Query  542  LLHIQGPVKPGMCDLP  589
            LL  QG  K   C+ P
Sbjct  440  LLPDQGHDKATACEFP  455



>gb|KHN26935.1| Putative polygalacturonase [Glycine soja]
Length=378

 Score =   284 bits (727),  Expect = 8e-90, Method: Compositional matrix adjust.
 Identities = 131/199 (66%), Positives = 161/199 (81%), Gaps = 1/199 (1%)
 Frame = +2

Query  2    VAVKSGWDQYGIKYGKPTKQLIIKRLTCISPYSAAIALGSEMSGGIEDVRASDITAVHTE  181
            VAVKSGWD++GIK+G PTKQL+I+RLTCISP SAAIALGSEMSGGI+DVRA DITA+HTE
Sbjct  161  VAVKSGWDEFGIKFGWPTKQLVIRRLTCISPQSAAIALGSEMSGGIQDVRAEDITAIHTE  220

Query  182  SGVRIKSAIGRGGYVKNIYVKGLRAHTMKWVFLMSGDYGDHPDN-HFDPKAFPVVAGINF  358
            SGVRIK++IGRGGYVK+IYV+ +  HTMKW F M+G+YG + +N H+DPKA P + GIN+
Sbjct  221  SGVRIKTSIGRGGYVKDIYVRRMTMHTMKWAFWMTGNYGSYANNSHYDPKALPEIKGINY  280

Query  359  RDVVADNVTMAGKMEGISGHPYTGVCMANVTIGMAKNGKKPAWNCSNIQGVASGVVPPPC  538
            RDVVADNVTMA  +EGIS  P+TG+C+ANVTI MA    +  W C++I+G+ SGV P PC
Sbjct  281  RDVVADNVTMAATLEGISNSPFTGICIANVTISMADKANEKPWTCTDIEGITSGVTPKPC  340

Query  539  PLLHIQGPVKPGMCDLPPK  595
              L  +GP K   CD PP+
Sbjct  341  NSLLDKGPEKIKTCDFPPE  359



>gb|EYU35105.1| hypothetical protein MIMGU_mgv1a005694mg [Erythranthe guttata]
Length=474

 Score =   287 bits (735),  Expect = 9e-90, Method: Compositional matrix adjust.
 Identities = 131/197 (66%), Positives = 159/197 (81%), Gaps = 1/197 (1%)
 Frame = +2

Query  2    VAVKSGWDQYGIKYGKPTKQLIIKRLTCISPYSAAIALGSEMSGGIEDVRASDITAVHTE  181
            +AVKSGWD+YGI YG PTK LII+RLTCISPYSAAIALGSEMSGGI+DVRA DITA+ TE
Sbjct  257  IAVKSGWDEYGINYGMPTKHLIIRRLTCISPYSAAIALGSEMSGGIQDVRADDITAIQTE  316

Query  182  SGVRIKSAIGRGGYVKNIYVKGLRAHTMKWVFLMSGDYGDHPDNHFDPKAFPVVAGINFR  361
            S VRIK+ +GRGGYVK+I+VK ++ HTMKWVF ++G+YG H D HFDP A P + GIN+R
Sbjct  317  SAVRIKTGVGRGGYVKDIFVKNMKLHTMKWVFWITGNYGSHADTHFDPNALPEIKGINYR  376

Query  362  DVVADNVTMAGKMEGISGHPYTGVCMANVTIGMAKNGKKPAWNCSNIQGVASGVVPPPCP  541
            D+VA+NVTMA ++EGISG P+TG+C+ N TIG++K  KK  W CS+++GV   VVPPPC 
Sbjct  377  DIVAENVTMAARLEGISGDPFTGICIYNATIGLSKKPKKYQWTCSDVEGVTGAVVPPPCA  436

Query  542  LL-HIQGPVKPGMCDLP  589
            LL   Q   K GMCD P
Sbjct  437  LLPPTQVDEKFGMCDFP  453



>ref|XP_004295492.1| PREDICTED: probable polygalacturonase-like [Fragaria vesca subsp. 
vesca]
Length=508

 Score =   288 bits (738),  Expect = 9e-90, Method: Compositional matrix adjust.
 Identities = 133/196 (68%), Positives = 159/196 (81%), Gaps = 2/196 (1%)
 Frame = +2

Query  2    VAVKSGWDQYGIKYGKPTKQLIIKRLTCISPYSAAIALGSEMSGGIEDVRASDITAVHTE  181
            VAVKSGWDQYG+ +G PTKQL+I+RLTC+SPYSAAIALGSEMSGGIEDVRA DI AV TE
Sbjct  261  VAVKSGWDQYGVSFGMPTKQLVIRRLTCVSPYSAAIALGSEMSGGIEDVRAEDIVAVETE  320

Query  182  SGVRIKSAIGRGGYVKNIYVKGLRAHTMKWVFLMSGDYGDHPDNHFDPKAFPVVAGINFR  361
            SGVRIK+A+GRGGYV+++YV+ +  HTMKW F MSGDYG H D  +D  AFP + GI +R
Sbjct  321  SGVRIKTAVGRGGYVRDVYVRRMEMHTMKWAFKMSGDYGSHADEGYDKNAFPEIKGIYYR  380

Query  362  DVVADNVTMAGKMEGISGHPYTGVCMANVTIGMAKNGKKPAWNCSNIQGVASGVVPPPCP  541
            DVVADNVTMA ++EGI GHP+TG+CM+NVT+ +A   KK  W+CS+++GVASGV P PC 
Sbjct  381  DVVADNVTMAARLEGIEGHPFTGICMSNVTVVLAAKAKKQPWSCSDVKGVASGVTPMPCD  440

Query  542  LLHIQGPVKPGMCDLP  589
            LL  QG V  G CD P
Sbjct  441  LL--QGDVVNGGCDFP  454



>ref|XP_007219266.1| hypothetical protein PRUPE_ppa018224mg, partial [Prunus persica]
 gb|EMJ20465.1| hypothetical protein PRUPE_ppa018224mg, partial [Prunus persica]
Length=463

 Score =   286 bits (733),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 127/196 (65%), Positives = 159/196 (81%), Gaps = 0/196 (0%)
 Frame = +2

Query  2    VAVKSGWDQYGIKYGKPTKQLIIKRLTCISPYSAAIALGSEMSGGIEDVRASDITAVHTE  181
            VAVKSGWD+YGI +G+PTKQL+I+RLTCISPYSA IALGSEMSGGI+DVRA DI A+HTE
Sbjct  260  VAVKSGWDEYGIAFGRPTKQLVIRRLTCISPYSATIALGSEMSGGIQDVRAEDIVAIHTE  319

Query  182  SGVRIKSAIGRGGYVKNIYVKGLRAHTMKWVFLMSGDYGDHPDNHFDPKAFPVVAGINFR  361
            SG+RIK+A+GRGGYVK+IYV+ +  HTMKWVF M+GDYG H D+ +D  A P + GIN+R
Sbjct  320  SGIRIKTAVGRGGYVKDIYVRRMTMHTMKWVFKMNGDYGSHADDKYDKNAIPEIKGINYR  379

Query  362  DVVADNVTMAGKMEGISGHPYTGVCMANVTIGMAKNGKKPAWNCSNIQGVASGVVPPPCP  541
            D+VADNVT+A ++EGI+ HP+TG+C++NVTIG+A   KK  W C+NI+G+ SGV P  C 
Sbjct  380  DMVADNVTIAARLEGIADHPFTGICISNVTIGLAAKAKKQPWTCTNIEGITSGVTPRSCD  439

Query  542  LLHIQGPVKPGMCDLP  589
            LL  QG  K   C+ P
Sbjct  440  LLPDQGHDKATACEFP  455



>ref|XP_004503680.1| PREDICTED: probable polygalacturonase-like isoform X3 [Cicer 
arietinum]
Length=470

 Score =   286 bits (733),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 132/196 (67%), Positives = 159/196 (81%), Gaps = 0/196 (0%)
 Frame = +2

Query  2    VAVKSGWDQYGIKYGKPTKQLIIKRLTCISPYSAAIALGSEMSGGIEDVRASDITAVHTE  181
            VAVKSGWD+YGI YG PTKQL+I+RLTCISP SA IALGSEMSGGIEDVRA DI A+++E
Sbjct  254  VAVKSGWDEYGIAYGMPTKQLVIRRLTCISPTSAVIALGSEMSGGIEDVRAEDIVAINSE  313

Query  182  SGVRIKSAIGRGGYVKNIYVKGLRAHTMKWVFLMSGDYGDHPDNHFDPKAFPVVAGINFR  361
            SGVRIK+A+GRGGYVK+IYV+ +   TMKW F M+GDYG H DN++DP A PVV  +N+R
Sbjct  314  SGVRIKTAVGRGGYVKDIYVRRMTMKTMKWAFWMTGDYGSHADNNYDPNALPVVQNVNYR  373

Query  362  DVVADNVTMAGKMEGISGHPYTGVCMANVTIGMAKNGKKPAWNCSNIQGVASGVVPPPCP  541
            D+VADNVTMA K+EGIS  P+TG+C++NVTIG+AK  KK  WNC++I G++SGV P PC 
Sbjct  374  DMVADNVTMAAKLEGISNAPFTGICISNVTIGLAKKAKKVPWNCTDIAGISSGVTPSPCD  433

Query  542  LLHIQGPVKPGMCDLP  589
            LL  QG  K G C  P
Sbjct  434  LLPDQGVQKIGACTFP  449



>ref|XP_002509850.1| polygalacturonase, putative [Ricinus communis]
 gb|EEF51237.1| polygalacturonase, putative [Ricinus communis]
Length=480

 Score =   287 bits (734),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 128/196 (65%), Positives = 163/196 (83%), Gaps = 0/196 (0%)
 Frame = +2

Query  2    VAVKSGWDQYGIKYGKPTKQLIIKRLTCISPYSAAIALGSEMSGGIEDVRASDITAVHTE  181
            VAVKSGWD+YGI +G PTKQL+I+RLTCISP SAAIALGSEMSGGI+DVRA DIT ++TE
Sbjct  264  VAVKSGWDEYGISFGMPTKQLVIRRLTCISPTSAAIALGSEMSGGIQDVRAEDITCINTE  323

Query  182  SGVRIKSAIGRGGYVKNIYVKGLRAHTMKWVFLMSGDYGDHPDNHFDPKAFPVVAGINFR  361
            SGVRIK+++GRGGYVK+IYV+ +  HTMKWVF M+G+YG HPDN++DP A PV+  IN+R
Sbjct  324  SGVRIKTSVGRGGYVKDIYVRKMTMHTMKWVFWMTGNYGSHPDNNYDPNAIPVIENINYR  383

Query  362  DVVADNVTMAGKMEGISGHPYTGVCMANVTIGMAKNGKKPAWNCSNIQGVASGVVPPPCP  541
            D+VA+NVTMA ++EGI+G P+TG+C++NVTIG+A+  KK  WNC++I G++SGV P PC 
Sbjct  384  DIVAENVTMAARLEGIAGDPFTGICISNVTIGLAQKPKKLQWNCTDIAGISSGVTPKPCS  443

Query  542  LLHIQGPVKPGMCDLP  589
            LL  Q   K   C+ P
Sbjct  444  LLPEQEKEKIADCNFP  459



>ref|XP_004492778.1| PREDICTED: probable polygalacturonase-like [Cicer arietinum]
Length=483

 Score =   286 bits (733),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 129/198 (65%), Positives = 158/198 (80%), Gaps = 0/198 (0%)
 Frame = +2

Query  2    VAVKSGWDQYGIKYGKPTKQLIIKRLTCISPYSAAIALGSEMSGGIEDVRASDITAVHTE  181
            VAVKSGWD+YGIK+G PTKQL+I+RLTCISPYSA IALGSEMSGGI+DVRA DITA+ TE
Sbjct  264  VAVKSGWDEYGIKFGMPTKQLVIRRLTCISPYSATIALGSEMSGGIQDVRAEDITAIRTE  323

Query  182  SGVRIKSAIGRGGYVKNIYVKGLRAHTMKWVFLMSGDYGDHPDNHFDPKAFPVVAGINFR  361
            SGVRIK+A+GRGGYVK+IYVK +  +TMKW F M+GDY  H D H+DP A P ++ IN+R
Sbjct  324  SGVRIKTAVGRGGYVKDIYVKRMNMYTMKWAFKMTGDYNSHADTHYDPNALPEISNINYR  383

Query  362  DVVADNVTMAGKMEGISGHPYTGVCMANVTIGMAKNGKKPAWNCSNIQGVASGVVPPPCP  541
            D+VA+NVT+A + EGIS  P+ G+C+ANVT+GMA   KK  W C++I+G+ SGV PPPC 
Sbjct  384  DIVAENVTIAARFEGISNDPFKGICIANVTLGMAVKAKKQPWTCTDIEGMTSGVTPPPCA  443

Query  542  LLHIQGPVKPGMCDLPPK  595
            LL  QG  K   CD P +
Sbjct  444  LLPDQGIEKITACDFPKE  461



>ref|XP_003633958.1| PREDICTED: probable polygalacturonase [Vitis vinifera]
Length=479

 Score =   286 bits (733),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 126/198 (64%), Positives = 162/198 (82%), Gaps = 0/198 (0%)
 Frame = +2

Query  2    VAVKSGWDQYGIKYGKPTKQLIIKRLTCISPYSAAIALGSEMSGGIEDVRASDITAVHTE  181
            VAVKSGWD+YGI YG PTKQL+I+RLTCISPYSA IALGSEMSGGI+DVRA DI A+++E
Sbjct  262  VAVKSGWDEYGIAYGMPTKQLVIRRLTCISPYSAVIALGSEMSGGIQDVRAEDIVAINSE  321

Query  182  SGVRIKSAIGRGGYVKNIYVKGLRAHTMKWVFLMSGDYGDHPDNHFDPKAFPVVAGINFR  361
            SG+RIK+ IGRGGYVK+IYV+G+   TMKW F M+G+YG H DNH+DPKAFPV+ GIN+R
Sbjct  322  SGIRIKTGIGRGGYVKDIYVRGMTMKTMKWAFWMTGNYGSHADNHYDPKAFPVIQGINYR  381

Query  362  DVVADNVTMAGKMEGISGHPYTGVCMANVTIGMAKNGKKPAWNCSNIQGVASGVVPPPCP  541
            D+VA+NV+MA ++EGI   P+TG+C++NVTI +A   KK  W C++++G++SGV P PC 
Sbjct  382  DMVAENVSMAARLEGIPSDPFTGICISNVTIHLAAKAKKVPWTCTDVEGISSGVTPTPCS  441

Query  542  LLHIQGPVKPGMCDLPPK  595
             L  QGP K  +C+ P +
Sbjct  442  TLPDQGPEKTSLCNFPAE  459



>ref|XP_007139799.1| hypothetical protein PHAVU_008G059700g [Phaseolus vulgaris]
 gb|ESW11793.1| hypothetical protein PHAVU_008G059700g [Phaseolus vulgaris]
Length=486

 Score =   286 bits (733),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 131/196 (67%), Positives = 156/196 (80%), Gaps = 0/196 (0%)
 Frame = +2

Query  2    VAVKSGWDQYGIKYGKPTKQLIIKRLTCISPYSAAIALGSEMSGGIEDVRASDITAVHTE  181
            VAVKSGWD+YGIK+G PTK L+I+RLTCISP+SA IALGSEMSGGI+DVRA DITA+ TE
Sbjct  264  VAVKSGWDEYGIKFGWPTKHLVIRRLTCISPFSATIALGSEMSGGIQDVRAEDITAIQTE  323

Query  182  SGVRIKSAIGRGGYVKNIYVKGLRAHTMKWVFLMSGDYGDHPDNHFDPKAFPVVAGINFR  361
            SGVRIK+A GRGGYVK+IYVK +  HTMKW F M+GDY  H D+H+DP A P +  IN+R
Sbjct  324  SGVRIKTAAGRGGYVKDIYVKRMTLHTMKWAFKMTGDYNSHADSHYDPNALPEIKNINYR  383

Query  362  DVVADNVTMAGKMEGISGHPYTGVCMANVTIGMAKNGKKPAWNCSNIQGVASGVVPPPCP  541
            DVVADNVT+A + +GIS  P+TG+C+ANVT+ MA   KK  W C++I+GV SGV PPPC 
Sbjct  384  DVVADNVTIAARFQGISNDPFTGICIANVTLRMAVKAKKQPWTCTDIEGVTSGVNPPPCG  443

Query  542  LLHIQGPVKPGMCDLP  589
            LL  QGP K   CD P
Sbjct  444  LLPDQGPEKITACDFP  459



>ref|XP_004503678.1| PREDICTED: probable polygalacturonase-like isoform X1 [Cicer 
arietinum]
 ref|XP_004503679.1| PREDICTED: probable polygalacturonase-like isoform X2 [Cicer 
arietinum]
Length=500

 Score =   287 bits (734),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 132/196 (67%), Positives = 159/196 (81%), Gaps = 0/196 (0%)
 Frame = +2

Query  2    VAVKSGWDQYGIKYGKPTKQLIIKRLTCISPYSAAIALGSEMSGGIEDVRASDITAVHTE  181
            VAVKSGWD+YGI YG PTKQL+I+RLTCISP SA IALGSEMSGGIEDVRA DI A+++E
Sbjct  284  VAVKSGWDEYGIAYGMPTKQLVIRRLTCISPTSAVIALGSEMSGGIEDVRAEDIVAINSE  343

Query  182  SGVRIKSAIGRGGYVKNIYVKGLRAHTMKWVFLMSGDYGDHPDNHFDPKAFPVVAGINFR  361
            SGVRIK+A+GRGGYVK+IYV+ +   TMKW F M+GDYG H DN++DP A PVV  +N+R
Sbjct  344  SGVRIKTAVGRGGYVKDIYVRRMTMKTMKWAFWMTGDYGSHADNNYDPNALPVVQNVNYR  403

Query  362  DVVADNVTMAGKMEGISGHPYTGVCMANVTIGMAKNGKKPAWNCSNIQGVASGVVPPPCP  541
            D+VADNVTMA K+EGIS  P+TG+C++NVTIG+AK  KK  WNC++I G++SGV P PC 
Sbjct  404  DMVADNVTMAAKLEGISNAPFTGICISNVTIGLAKKAKKVPWNCTDIAGISSGVTPSPCD  463

Query  542  LLHIQGPVKPGMCDLP  589
            LL  QG  K G C  P
Sbjct  464  LLPDQGVQKIGACTFP  479



>sp|A7PZL3.1|PGLR_VITVI RecName: Full=Probable polygalacturonase; Short=PG; AltName: 
Full=Pectinase [Vitis vinifera]
Length=491

 Score =   286 bits (733),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 126/198 (64%), Positives = 162/198 (82%), Gaps = 0/198 (0%)
 Frame = +2

Query  2    VAVKSGWDQYGIKYGKPTKQLIIKRLTCISPYSAAIALGSEMSGGIEDVRASDITAVHTE  181
            VAVKSGWD+YGI YG PTKQL+I+RLTCISPYSA IALGSEMSGGI+DVRA DI A+++E
Sbjct  274  VAVKSGWDEYGIAYGMPTKQLVIRRLTCISPYSAVIALGSEMSGGIQDVRAEDIVAINSE  333

Query  182  SGVRIKSAIGRGGYVKNIYVKGLRAHTMKWVFLMSGDYGDHPDNHFDPKAFPVVAGINFR  361
            SG+RIK+ IGRGGYVK+IYV+G+   TMKW F M+G+YG H DNH+DPKAFPV+ GIN+R
Sbjct  334  SGIRIKTGIGRGGYVKDIYVRGMTMKTMKWAFWMTGNYGSHADNHYDPKAFPVIQGINYR  393

Query  362  DVVADNVTMAGKMEGISGHPYTGVCMANVTIGMAKNGKKPAWNCSNIQGVASGVVPPPCP  541
            D+VA+NV+MA ++EGI   P+TG+C++NVTI +A   KK  W C++++G++SGV P PC 
Sbjct  394  DMVAENVSMAARLEGIPSDPFTGICISNVTIHLAAKAKKVPWTCTDVEGISSGVTPTPCS  453

Query  542  LLHIQGPVKPGMCDLPPK  595
             L  QGP K  +C+ P +
Sbjct  454  TLPDQGPEKTSLCNFPAE  471



>gb|ABG34277.1| polygalacturonase [Eucalyptus globulus subsp. globulus]
Length=242

 Score =   278 bits (712),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 125/196 (64%), Positives = 153/196 (78%), Gaps = 0/196 (0%)
 Frame = +2

Query  2    VAVKSGWDQYGIKYGKPTKQLIIKRLTCISPYSAAIALGSEMSGGIEDVRASDITAVHTE  181
            VAVKSGWD+YGI +G PT+QLII+RLTCISPYSA IALGSEMSGGI DVRA DI A++TE
Sbjct  26   VAVKSGWDEYGIAFGMPTQQLIIRRLTCISPYSATIALGSEMSGGIRDVRAEDIVAINTE  85

Query  182  SGVRIKSAIGRGGYVKNIYVKGLRAHTMKWVFLMSGDYGDHPDNHFDPKAFPVVAGINFR  361
            SG+RIK+A+GRG Y+K+IYVK +  HTMKW F M GDY  HPDN +DP A PV+  IN+R
Sbjct  86   SGIRIKTAVGRGAYIKDIYVKKMTMHTMKWAFKMDGDYKSHPDNKYDPNALPVIQNINYR  145

Query  362  DVVADNVTMAGKMEGISGHPYTGVCMANVTIGMAKNGKKPAWNCSNIQGVASGVVPPPCP  541
            D+VA+NV++A +  GI+G  +TG+CMANVT+GM    KK  W C+++QG+ SGV PPPC 
Sbjct  146  DMVAENVSVAARFNGIAGDKFTGICMANVTLGMTAKHKKYPWTCTDVQGMTSGVTPPPCD  205

Query  542  LLHIQGPVKPGMCDLP  589
             L  QGP K   CD P
Sbjct  206  SLPDQGPEKISACDFP  221



>ref|XP_010523769.1| PREDICTED: probable polygalacturonase isoform X1 [Tarenaya hassleriana]
Length=472

 Score =   286 bits (731),  Expect = 3e-89, Method: Compositional matrix adjust.
 Identities = 130/196 (66%), Positives = 159/196 (81%), Gaps = 0/196 (0%)
 Frame = +2

Query  2    VAVKSGWDQYGIKYGKPTKQLIIKRLTCISPYSAAIALGSEMSGGIEDVRASDITAVHTE  181
            VAVKSGWD+YGI +G P  QL I+RLTCISPYSAAIALGSEMSGGI+DVRA DITA HTE
Sbjct  258  VAVKSGWDEYGIAFGMPPSQLGIRRLTCISPYSAAIALGSEMSGGIQDVRAEDITAFHTE  317

Query  182  SGVRIKSAIGRGGYVKNIYVKGLRAHTMKWVFLMSGDYGDHPDNHFDPKAFPVVAGINFR  361
            SGVRIK+A+GRGG+VK+IYVKG+  HTMKW+F M+G+Y  H D+H+DP A PV++GIN+R
Sbjct  318  SGVRIKTAVGRGGFVKDIYVKGMNLHTMKWIFWMTGNYKAHADSHYDPHALPVISGINYR  377

Query  362  DVVADNVTMAGKMEGISGHPYTGVCMANVTIGMAKNGKKPAWNCSNIQGVASGVVPPPCP  541
            DVVA+NV+MAG++EGISG P+T +C++N TI MA   KK  W CS++QG+ +GV P PC 
Sbjct  378  DVVAENVSMAGRLEGISGDPFTEICISNATISMAAKHKKAMWMCSDVQGITTGVEPQPCD  437

Query  542  LLHIQGPVKPGMCDLP  589
            LL  QG  K   CD P
Sbjct  438  LLTGQGSEKINGCDFP  453



>ref|XP_003529926.1| PREDICTED: probable polygalacturonase-like [Glycine max]
Length=498

 Score =   286 bits (731),  Expect = 8e-89, Method: Compositional matrix adjust.
 Identities = 131/199 (66%), Positives = 161/199 (81%), Gaps = 1/199 (1%)
 Frame = +2

Query  2    VAVKSGWDQYGIKYGKPTKQLIIKRLTCISPYSAAIALGSEMSGGIEDVRASDITAVHTE  181
            VAVKSGWD++GIK+G PTKQL+I+RLTCISP SAAIALGSEMSGGI+DVRA DITA+HTE
Sbjct  281  VAVKSGWDEFGIKFGWPTKQLVIRRLTCISPQSAAIALGSEMSGGIQDVRAEDITAIHTE  340

Query  182  SGVRIKSAIGRGGYVKNIYVKGLRAHTMKWVFLMSGDYGDHPDN-HFDPKAFPVVAGINF  358
            SGVRIK++IGRGGYVK+IYV+ +  HTMKW F M+G+YG + +N H+DPKA P + GIN+
Sbjct  341  SGVRIKTSIGRGGYVKDIYVRRMTMHTMKWAFWMTGNYGSYANNSHYDPKALPEIKGINY  400

Query  359  RDVVADNVTMAGKMEGISGHPYTGVCMANVTIGMAKNGKKPAWNCSNIQGVASGVVPPPC  538
            RDVVADNVTMA  +EGIS  P+TG+C+ANVTI MA    +  W C++I+G+ SGV P PC
Sbjct  401  RDVVADNVTMAATLEGISNSPFTGICIANVTISMADKANEKPWTCTDIEGITSGVTPKPC  460

Query  539  PLLHIQGPVKPGMCDLPPK  595
              L  +GP K   CD PP+
Sbjct  461  NSLLDKGPEKIKTCDFPPE  479



>ref|XP_010089056.1| putative polygalacturonase [Morus notabilis]
 gb|EXB37303.1| putative polygalacturonase [Morus notabilis]
Length=466

 Score =   283 bits (724),  Expect = 3e-88, Method: Compositional matrix adjust.
 Identities = 124/196 (63%), Positives = 160/196 (82%), Gaps = 0/196 (0%)
 Frame = +2

Query  2    VAVKSGWDQYGIKYGKPTKQLIIKRLTCISPYSAAIALGSEMSGGIEDVRASDITAVHTE  181
            +AVKSGWD+YGI +G PTKQL+I+RLTCISP+SA IALGSEMSGGI+DVRA DI A+++E
Sbjct  250  IAVKSGWDEYGIAFGMPTKQLVIRRLTCISPFSAVIALGSEMSGGIQDVRAEDIVAINSE  309

Query  182  SGVRIKSAIGRGGYVKNIYVKGLRAHTMKWVFLMSGDYGDHPDNHFDPKAFPVVAGINFR  361
            SGVRIK+A+GRGG+VK+IYV+G    TMKW F M+G+YG HPD+ +D  A P++  IN+R
Sbjct  310  SGVRIKTAVGRGGFVKDIYVRGFTMKTMKWAFWMTGNYGSHPDDKYDSNALPLIQNINYR  369

Query  362  DVVADNVTMAGKMEGISGHPYTGVCMANVTIGMAKNGKKPAWNCSNIQGVASGVVPPPCP  541
            DVVA+NV+MA ++EGI G P+TG+C++NVTIG+AK  KK  WNC+++ G++SGVVP PCP
Sbjct  370  DVVAENVSMAARLEGIPGDPFTGICLSNVTIGLAKKPKKLQWNCTDVSGISSGVVPQPCP  429

Query  542  LLHIQGPVKPGMCDLP  589
            LL  QGP     C  P
Sbjct  430  LLADQGPDAATTCAFP  445



>ref|XP_010523770.1| PREDICTED: probable polygalacturonase isoform X2 [Tarenaya hassleriana]
Length=472

 Score =   283 bits (724),  Expect = 3e-88, Method: Compositional matrix adjust.
 Identities = 129/196 (66%), Positives = 158/196 (81%), Gaps = 0/196 (0%)
 Frame = +2

Query  2    VAVKSGWDQYGIKYGKPTKQLIIKRLTCISPYSAAIALGSEMSGGIEDVRASDITAVHTE  181
            VAVKSGWD+YGI +G P  QL I+RLTCISPYSAAIALGSEMSGGI+DVRA DITA HTE
Sbjct  258  VAVKSGWDEYGIAFGMPPSQLGIRRLTCISPYSAAIALGSEMSGGIQDVRAEDITAFHTE  317

Query  182  SGVRIKSAIGRGGYVKNIYVKGLRAHTMKWVFLMSGDYGDHPDNHFDPKAFPVVAGINFR  361
            SGVRIK+A+GRGG+VK+IYVKG+   TMKW+F M+G+Y  H D+H+DP A PV++GIN+R
Sbjct  318  SGVRIKTAVGRGGFVKDIYVKGMNLQTMKWIFWMTGNYKAHADSHYDPHALPVISGINYR  377

Query  362  DVVADNVTMAGKMEGISGHPYTGVCMANVTIGMAKNGKKPAWNCSNIQGVASGVVPPPCP  541
            DVVA+NV+MAG++EGISG P+T +C++N TI MA   KK  W CS++QG+ +GV P PC 
Sbjct  378  DVVAENVSMAGRLEGISGDPFTEICISNATISMAAKHKKAMWMCSDVQGITTGVEPQPCD  437

Query  542  LLHIQGPVKPGMCDLP  589
            LL  QG  K   CD P
Sbjct  438  LLTGQGSEKINGCDFP  453



>ref|XP_007040335.1| Pectin lyase-like superfamily protein isoform 1 [Theobroma cacao]
 ref|XP_007040336.1| Pectin lyase-like superfamily protein isoform 1 [Theobroma cacao]
 gb|EOY24836.1| Pectin lyase-like superfamily protein isoform 1 [Theobroma cacao]
 gb|EOY24837.1| Pectin lyase-like superfamily protein isoform 1 [Theobroma cacao]
Length=467

 Score =   283 bits (723),  Expect = 4e-88, Method: Compositional matrix adjust.
 Identities = 130/196 (66%), Positives = 157/196 (80%), Gaps = 2/196 (1%)
 Frame = +2

Query  2    VAVKSGWDQYGIKYGKPTKQLIIKRLTCISPYSAAIALGSEMSGGIEDVRASDITAVHTE  181
            VAVKSGWD+YGIK+  PTKQL+I+RLTCISP+SA IALGSEMSGGIEDVRA DIT +++E
Sbjct  265  VAVKSGWDEYGIKFAMPTKQLVIRRLTCISPFSAVIALGSEMSGGIEDVRAEDITGINSE  324

Query  182  SGVRIKSAIGRGGYVKNIYVKGLRAHTMKWVFLMSGDYGDHPDNHFDPKAFPVVAGINFR  361
            S VRIK+A+GRG YVK+IYV+G+   TMK VF M+G+YG HPDN +DP A PV+  INFR
Sbjct  325  SAVRIKTAVGRGNYVKDIYVRGMTMKTMKMVFWMAGNYGSHPDNDYDPNAIPVIQNINFR  384

Query  362  DVVADNVTMAGKMEGISGHPYTGVCMANVTIGMAKNGKKPAWNCSNIQGVASGVVPPPCP  541
            DVVA+NVTMA ++EGI GHP+TG+C++N TIG+ K  KK  WNC+ I GV+S V PPPC 
Sbjct  385  DVVAENVTMAARLEGIPGHPFTGICISNATIGLTKKPKKIQWNCTEIAGVSSDVTPPPCN  444

Query  542  LLHIQGPVKPGMCDLP  589
            LL  QGP     CD P
Sbjct  445  LLTDQGPAN--ACDFP  458



>ref|XP_010055091.1| PREDICTED: probable polygalacturonase isoform X1 [Eucalyptus 
grandis]
 gb|KCW71568.1| hypothetical protein EUGRSUZ_E00104 [Eucalyptus grandis]
Length=481

 Score =   283 bits (723),  Expect = 5e-88, Method: Compositional matrix adjust.
 Identities = 128/198 (65%), Positives = 159/198 (80%), Gaps = 4/198 (2%)
 Frame = +2

Query  2    VAVKSGWDQYGIKYGKPTKQLIIKRLTCISPYSAAIALGSEMSGGIEDVRASDITAVHTE  181
            VAVKSGWD+YGI YG PTKQL+I+RLTCISPYSA IALGSEMSGGIEDVRA DITA++TE
Sbjct  269  VAVKSGWDEYGISYGMPTKQLVIRRLTCISPYSAMIALGSEMSGGIEDVRAEDITAINTE  328

Query  182  SGVRIKSAIGRGGYVKNIYVKGLRAHTMKWVFLMSGDYGDHPDNHFDPKAFPVVAGINFR  361
            SGVRIK+A+GRGGYVK+IYV+G++ HTMKW F M G+YG HPD H+DPKA P++ GIN+R
Sbjct  329  SGVRIKTAMGRGGYVKDIYVRGMKMHTMKWAFWMDGNYGSHPDPHYDPKARPIITGINYR  388

Query  362  DVVADNVTMAGKMEGISGHPYTGVCMANVTIGMAKNGKKPAWNCSNIQGVASGVVPPPCP  541
            D+VA+NVTM  +++GI G+P+TG+C++N TI MA   KK  W CS+I G+ SGV P PC 
Sbjct  389  DIVAENVTMVAQLKGIPGNPFTGICISNATITMAPESKKEPWTCSDIHGITSGVTPQPCG  448

Query  542  LLHIQGPVKPGMCDLPPK  595
            +L    P +   C  P +
Sbjct  449  ML----PAETTTCHFPER  462



>ref|XP_008343414.1| PREDICTED: probable polygalacturonase [Malus domestica]
 ref|XP_008354013.1| PREDICTED: probable polygalacturonase [Malus domestica]
Length=483

 Score =   283 bits (723),  Expect = 6e-88, Method: Compositional matrix adjust.
 Identities = 125/196 (64%), Positives = 155/196 (79%), Gaps = 0/196 (0%)
 Frame = +2

Query  2    VAVKSGWDQYGIKYGKPTKQLIIKRLTCISPYSAAIALGSEMSGGIEDVRASDITAVHTE  181
            VAVKSGWD+YGI +G PTKQL+++RLTCISPYSA IALGSEMSGGI+DVRA DI A+HTE
Sbjct  267  VAVKSGWDEYGIAFGMPTKQLVVRRLTCISPYSATIALGSEMSGGIQDVRAEDIVAIHTE  326

Query  182  SGVRIKSAIGRGGYVKNIYVKGLRAHTMKWVFLMSGDYGDHPDNHFDPKAFPVVAGINFR  361
            SGVRIK+A+GRGGYVK+IY +    HTMKW F M+G+YG H D+ +D  A P +  IN+R
Sbjct  327  SGVRIKTAVGRGGYVKDIYARRFTMHTMKWAFWMTGNYGSHADDKYDKNALPEIKNINYR  386

Query  362  DVVADNVTMAGKMEGISGHPYTGVCMANVTIGMAKNGKKPAWNCSNIQGVASGVVPPPCP  541
            D+VADNVTMA ++EGI+ HP+TG+C++NVTIG+A   KK  W C++I+G+ SGV P PC 
Sbjct  387  DMVADNVTMAARLEGIADHPFTGICISNVTIGLAVKAKKQPWTCTDIEGITSGVTPRPCD  446

Query  542  LLHIQGPVKPGMCDLP  589
            LL  QG  K   CD P
Sbjct  447  LLPDQGAEKAKXCDFP  462



>ref|XP_010055092.1| PREDICTED: probable polygalacturonase isoform X2 [Eucalyptus 
grandis]
Length=479

 Score =   283 bits (723),  Expect = 7e-88, Method: Compositional matrix adjust.
 Identities = 128/198 (65%), Positives = 159/198 (80%), Gaps = 4/198 (2%)
 Frame = +2

Query  2    VAVKSGWDQYGIKYGKPTKQLIIKRLTCISPYSAAIALGSEMSGGIEDVRASDITAVHTE  181
            VAVKSGWD+YGI YG PTKQL+I+RLTCISPYSA IALGSEMSGGIEDVRA DITA++TE
Sbjct  267  VAVKSGWDEYGISYGMPTKQLVIRRLTCISPYSAMIALGSEMSGGIEDVRAEDITAINTE  326

Query  182  SGVRIKSAIGRGGYVKNIYVKGLRAHTMKWVFLMSGDYGDHPDNHFDPKAFPVVAGINFR  361
            SGVRIK+A+GRGGYVK+IYV+G++ HTMKW F M G+YG HPD H+DPKA P++ GIN+R
Sbjct  327  SGVRIKTAMGRGGYVKDIYVRGMKMHTMKWAFWMDGNYGSHPDPHYDPKARPIITGINYR  386

Query  362  DVVADNVTMAGKMEGISGHPYTGVCMANVTIGMAKNGKKPAWNCSNIQGVASGVVPPPCP  541
            D+VA+NVTM  +++GI G+P+TG+C++N TI MA   KK  W CS+I G+ SGV P PC 
Sbjct  387  DIVAENVTMVAQLKGIPGNPFTGICISNATITMAPESKKEPWTCSDIHGITSGVTPQPCG  446

Query  542  LLHIQGPVKPGMCDLPPK  595
            +L    P +   C  P +
Sbjct  447  ML----PAETTTCHFPER  460



>ref|XP_010469084.1| PREDICTED: probable polygalacturonase [Camelina sativa]
Length=476

 Score =   282 bits (721),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 131/202 (65%), Positives = 158/202 (78%), Gaps = 6/202 (3%)
 Frame = +2

Query  2    VAVKSGWDQYGIKYGKPTKQLIIKRLTCISPYSAAIALGSEMSGGIEDVRASDITAVHTE  181
            +AVKSGWD+YGI +G PTK L+I+RLTCISPYSAAIALGSEMSGGIEDVRA DITA  TE
Sbjct  256  IAVKSGWDEYGISFGMPTKHLVIRRLTCISPYSAAIALGSEMSGGIEDVRAEDITAYQTE  315

Query  182  SGVRIKSAIGRGGYVKNIYVKGLRAHTMKWVFLMSGDYGDHPDNHFDPKAFPVVAGINFR  361
            SGVRIK+A+GRG +VKNIYVKG+  HTMKWVF M+G+Y  H D+H+DP A P + GIN+R
Sbjct  316  SGVRIKTAVGRGAFVKNIYVKGMSLHTMKWVFWMTGNYKAHADSHYDPHALPEITGINYR  375

Query  362  DVVADNVTMAGKMEGISGHPYTGVCMANVTIGMAKNGKKPAWNCSNIQGVASGVVPPPCP  541
            D+VA+NV+MAG++EGISG P+TG+C++N TI MA   KK  W CS+++GV SGV P PC 
Sbjct  376  DIVAENVSMAGRLEGISGDPFTGICISNATISMAAKHKKVIWMCSDVEGVTSGVDPKPCD  435

Query  542  LLHIQGPVKP------GMCDLP  589
            LL  Q   K       G CD P
Sbjct  436  LLDGQESEKKKRMTSDGGCDFP  457



>gb|KEH21119.1| polygalacturonase/glycoside hydrolase family protein [Medicago 
truncatula]
Length=470

 Score =   280 bits (717),  Expect = 3e-87, Method: Compositional matrix adjust.
 Identities = 132/196 (67%), Positives = 158/196 (81%), Gaps = 0/196 (0%)
 Frame = +2

Query  2    VAVKSGWDQYGIKYGKPTKQLIIKRLTCISPYSAAIALGSEMSGGIEDVRASDITAVHTE  181
            VAVKSGWD+YGI YG PTKQL+I+RLTCISP SA IALGSEMSGGI+DVRA DI A+++E
Sbjct  255  VAVKSGWDEYGIAYGMPTKQLVIRRLTCISPTSAVIALGSEMSGGIQDVRAEDIVAINSE  314

Query  182  SGVRIKSAIGRGGYVKNIYVKGLRAHTMKWVFLMSGDYGDHPDNHFDPKAFPVVAGINFR  361
            SGVRIK+A+GRGGYVK+IYV+ +   TMKW F M+GDYG H DN++DP A PVV  IN+R
Sbjct  315  SGVRIKTAVGRGGYVKDIYVRRMTMKTMKWAFWMTGDYGSHADNNYDPNAIPVVQNINYR  374

Query  362  DVVADNVTMAGKMEGISGHPYTGVCMANVTIGMAKNGKKPAWNCSNIQGVASGVVPPPCP  541
            D+VA+NVTMA K+EGIS  P+TG+C++NVTIG+AK  KK  WNC+ I GV+SGV P PC 
Sbjct  375  DMVAENVTMAAKLEGISNAPFTGICISNVTIGLAKKAKKLPWNCTYIAGVSSGVTPAPCG  434

Query  542  LLHIQGPVKPGMCDLP  589
            LL  QG  K G C  P
Sbjct  435  LLPDQGVEKIGPCAFP  450



>ref|XP_002876618.1| glycoside hydrolase family 28 protein [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH52877.1| glycoside hydrolase family 28 protein [Arabidopsis lyrata subsp. 
lyrata]
Length=475

 Score =   281 bits (718),  Expect = 3e-87, Method: Compositional matrix adjust.
 Identities = 129/201 (64%), Positives = 158/201 (79%), Gaps = 5/201 (2%)
 Frame = +2

Query  2    VAVKSGWDQYGIKYGKPTKQLIIKRLTCISPYSAAIALGSEMSGGIEDVRASDITAVHTE  181
            +AVKSGWD+YGI +G PTK L+I+RLTCISPYSAAIALGSEMSGGIEDVRA DITA  TE
Sbjct  256  IAVKSGWDEYGISFGMPTKHLVIRRLTCISPYSAAIALGSEMSGGIEDVRAEDITAYQTE  315

Query  182  SGVRIKSAIGRGGYVKNIYVKGLRAHTMKWVFLMSGDYGDHPDNHFDPKAFPVVAGINFR  361
            SGVRIK+A+GRG +VKNIYVKG+  HTMKWVF M+G+Y  H D+H+DP A P + GIN+R
Sbjct  316  SGVRIKTAVGRGAFVKNIYVKGMNLHTMKWVFWMTGNYKAHADSHYDPHALPEITGINYR  375

Query  362  DVVADNVTMAGKMEGISGHPYTGVCMANVTIGMAKNGKKPAWNCSNIQGVASGVVPPPCP  541
            D+VA+NV+MAG++EGISG P+TG+C++N TI MA   KK  W CS+++GV SGV P PC 
Sbjct  376  DIVAENVSMAGRLEGISGDPFTGICISNATISMAAKHKKAIWMCSDVEGVTSGVDPKPCD  435

Query  542  LL-----HIQGPVKPGMCDLP  589
            LL       +  +  G CD P
Sbjct  436  LLDGQESETKKKMIDGGCDFP  456



>ref|XP_004298828.1| PREDICTED: probable polygalacturonase-like [Fragaria vesca subsp. 
vesca]
Length=503

 Score =   281 bits (719),  Expect = 5e-87, Method: Compositional matrix adjust.
 Identities = 126/199 (63%), Positives = 163/199 (82%), Gaps = 0/199 (0%)
 Frame = +2

Query  2    VAVKSGWDQYGIKYGKPTKQLIIKRLTCISPYSAAIALGSEMSGGIEDVRASDITAVHTE  181
            +AVKSGWD+YGI +G PTK L+I+RLTCISP+SA IALGSEMSGGI+DVRA DI A++TE
Sbjct  287  IAVKSGWDEYGIAFGMPTKALVIRRLTCISPFSAVIALGSEMSGGIQDVRAEDIFAINTE  346

Query  182  SGVRIKSAIGRGGYVKNIYVKGLRAHTMKWVFLMSGDYGDHPDNHFDPKAFPVVAGINFR  361
            S VRIK+A+GRGG+VK+IYV+ +  HTMK+VF ++GDYG H DN +DP A PV+  IN+ 
Sbjct  347  SAVRIKTAVGRGGFVKDIYVRRMTMHTMKYVFWIAGDYGSHADNGYDPNALPVIQNINYH  406

Query  362  DVVADNVTMAGKMEGISGHPYTGVCMANVTIGMAKNGKKPAWNCSNIQGVASGVVPPPCP  541
            D+VA+NVTMAGK+ G++G P+TG+C++NVTI MAK GKK  WNC+++ G++SGVVP PC 
Sbjct  407  DMVAENVTMAGKLGGLTGDPFTGICISNVTITMAKKGKKVPWNCTDVAGISSGVVPQPCE  466

Query  542  LLHIQGPVKPGMCDLPPKK  598
            LL  QGP K G C+ P + 
Sbjct  467  LLADQGPEKIGACNFPEES  485



>ref|NP_191708.1| polygalacturonase-like protein [Arabidopsis thaliana]
 ref|NP_974473.1| polygalacturonase-like protein [Arabidopsis thaliana]
 ref|NP_001190154.1| polygalacturonase-like protein [Arabidopsis thaliana]
 emb|CAB71079.1| putative protein [Arabidopsis thaliana]
 gb|AEE80211.1| polygalacturonase-like protein [Arabidopsis thaliana]
 gb|AEE80212.1| polygalacturonase-like protein [Arabidopsis thaliana]
 gb|AEE80213.1| polygalacturonase-like protein [Arabidopsis thaliana]
Length=476

 Score =   280 bits (716),  Expect = 6e-87, Method: Compositional matrix adjust.
 Identities = 130/202 (64%), Positives = 158/202 (78%), Gaps = 6/202 (3%)
 Frame = +2

Query  2    VAVKSGWDQYGIKYGKPTKQLIIKRLTCISPYSAAIALGSEMSGGIEDVRASDITAVHTE  181
            +AVKSGWD+YGI +G PTK L+I+RLTCISPYSAAIALGSEMSGGIEDVRA DITA  TE
Sbjct  256  IAVKSGWDEYGISFGMPTKHLVIRRLTCISPYSAAIALGSEMSGGIEDVRAEDITAYQTE  315

Query  182  SGVRIKSAIGRGGYVKNIYVKGLRAHTMKWVFLMSGDYGDHPDNHFDPKAFPVVAGINFR  361
            SGVRIK+A+GRG +VKNIYVKG+  HTMKWVF M+G+Y  H D+H+DP A P + GIN+R
Sbjct  316  SGVRIKTAVGRGAFVKNIYVKGMNLHTMKWVFWMTGNYKAHADSHYDPHALPEITGINYR  375

Query  362  DVVADNVTMAGKMEGISGHPYTGVCMANVTIGMAKNGKKPAWNCSNIQGVASGVVPPPCP  541
            D+VA+NV+MAG++EGISG P+TG+C++N TI MA   KK  W CS+++GV SGV P PC 
Sbjct  376  DIVAENVSMAGRLEGISGDPFTGICISNATISMAAKHKKAIWMCSDVEGVTSGVDPKPCD  435

Query  542  LLHIQGP------VKPGMCDLP  589
            LL  Q        +  G CD P
Sbjct  436  LLDGQESETTKKKMIDGGCDFP  457



>gb|KHN16795.1| Putative polygalacturonase [Glycine soja]
Length=434

 Score =   278 bits (712),  Expect = 7e-87, Method: Compositional matrix adjust.
 Identities = 125/198 (63%), Positives = 160/198 (81%), Gaps = 0/198 (0%)
 Frame = +2

Query  2    VAVKSGWDQYGIKYGKPTKQLIIKRLTCISPYSAAIALGSEMSGGIEDVRASDITAVHTE  181
            VAVKSGWD+YGI YG PTKQL+I+RLTCISP+SAAIALGSEMSGGI+D+RA DI A++TE
Sbjct  219  VAVKSGWDEYGIAYGMPTKQLVIRRLTCISPFSAAIALGSEMSGGIQDMRAEDIVAINTE  278

Query  182  SGVRIKSAIGRGGYVKNIYVKGLRAHTMKWVFLMSGDYGDHPDNHFDPKAFPVVAGINFR  361
            SGVRIK+A+GRGGYVK+I+V+ +   TMKW F M+G+YG H D+++DP A PV+  IN+R
Sbjct  279  SGVRIKTAVGRGGYVKDIFVRRMTMKTMKWAFWMTGNYGSHADDNYDPNALPVIQNINYR  338

Query  362  DVVADNVTMAGKMEGISGHPYTGVCMANVTIGMAKNGKKPAWNCSNIQGVASGVVPPPCP  541
            D+VA+NVTMA ++EGISG P+TG+C++NVTI +AK  KK  W C++I G++S V P PC 
Sbjct  339  DMVAENVTMAARLEGISGDPFTGICISNVTIQLAKKAKKVPWTCTDIAGISSDVTPAPCD  398

Query  542  LLHIQGPVKPGMCDLPPK  595
            LL  QG  K G C  P +
Sbjct  399  LLPDQGEEKIGACTFPEE  416



>ref|XP_006291035.1| hypothetical protein CARUB_v10017147mg [Capsella rubella]
 gb|EOA23933.1| hypothetical protein CARUB_v10017147mg [Capsella rubella]
Length=475

 Score =   280 bits (716),  Expect = 7e-87, Method: Compositional matrix adjust.
 Identities = 129/201 (64%), Positives = 158/201 (79%), Gaps = 5/201 (2%)
 Frame = +2

Query  2    VAVKSGWDQYGIKYGKPTKQLIIKRLTCISPYSAAIALGSEMSGGIEDVRASDITAVHTE  181
            +AVKSGWD+YGI +G PTK L+I+RLTCISPYSAAIALGSEMSGGIEDVRA +ITA  TE
Sbjct  256  IAVKSGWDEYGISFGMPTKHLVIRRLTCISPYSAAIALGSEMSGGIEDVRAEEITAYQTE  315

Query  182  SGVRIKSAIGRGGYVKNIYVKGLRAHTMKWVFLMSGDYGDHPDNHFDPKAFPVVAGINFR  361
            SGVRIK+A+GRG +VKN+YVKG+  HTMKWVF M+G+Y  H D+H+DP A P + GIN+R
Sbjct  316  SGVRIKTAVGRGAFVKNVYVKGMSLHTMKWVFWMTGNYKAHADSHYDPHALPEITGINYR  375

Query  362  DVVADNVTMAGKMEGISGHPYTGVCMANVTIGMAKNGKKPAWNCSNIQGVASGVVPPPCP  541
            D+VA+NV+MAG++EGISG P+TG+C++N TI MA   KK  W CS+++GV SGV P PC 
Sbjct  376  DIVAENVSMAGRLEGISGDPFTGICISNATISMAAKHKKAIWMCSDVEGVTSGVDPKPCD  435

Query  542  LLHIQGPVKP-----GMCDLP  589
            LL  Q   K      G CD P
Sbjct  436  LLDGQESEKKKRMSDGGCDFP  456



>ref|XP_009349812.1| PREDICTED: probable polygalacturonase [Pyrus x bretschneideri]
Length=483

 Score =   280 bits (716),  Expect = 7e-87, Method: Compositional matrix adjust.
 Identities = 124/196 (63%), Positives = 154/196 (79%), Gaps = 0/196 (0%)
 Frame = +2

Query  2    VAVKSGWDQYGIKYGKPTKQLIIKRLTCISPYSAAIALGSEMSGGIEDVRASDITAVHTE  181
            VAVKSGWD+YGI +G PTKQL+++RLTCISPYSA IALGSEMSGGI+DVRA DI A+HTE
Sbjct  267  VAVKSGWDEYGIAFGMPTKQLVVRRLTCISPYSATIALGSEMSGGIQDVRAEDIVAIHTE  326

Query  182  SGVRIKSAIGRGGYVKNIYVKGLRAHTMKWVFLMSGDYGDHPDNHFDPKAFPVVAGINFR  361
            SGVRIK+A+GRGGYVK+IY +    HTMKW F M+G+YG H D+ +D  A P +  IN+ 
Sbjct  327  SGVRIKTAVGRGGYVKDIYARRFTMHTMKWAFWMTGNYGSHADDKYDKNALPEIKNINYM  386

Query  362  DVVADNVTMAGKMEGISGHPYTGVCMANVTIGMAKNGKKPAWNCSNIQGVASGVVPPPCP  541
            D+VADNVTMA ++EGI+ HP+TG+C++NVTIG+A   KK  W C++I+G+ SGV P PC 
Sbjct  387  DMVADNVTMAARLEGIADHPFTGICISNVTIGLAVKAKKQPWTCTDIEGITSGVTPRPCD  446

Query  542  LLHIQGPVKPGMCDLP  589
            LL  QG  K   CD P
Sbjct  447  LLPDQGAEKAKACDFP  462



>ref|XP_006402475.1| hypothetical protein EUTSA_v10005939mg [Eutrema salsugineum]
 gb|ESQ43928.1| hypothetical protein EUTSA_v10005939mg [Eutrema salsugineum]
Length=475

 Score =   280 bits (715),  Expect = 8e-87, Method: Compositional matrix adjust.
 Identities = 129/200 (65%), Positives = 158/200 (79%), Gaps = 4/200 (2%)
 Frame = +2

Query  2    VAVKSGWDQYGIKYGKPTKQLIIKRLTCISPYSAAIALGSEMSGGIEDVRASDITAVHTE  181
            +AVKSGWD+YGI +G PTK L+I+RLTCISPYSAAIALGSEMSGGIEDVRA +ITA  TE
Sbjct  257  IAVKSGWDEYGIAFGMPTKHLLIRRLTCISPYSAAIALGSEMSGGIEDVRAEEITAYQTE  316

Query  182  SGVRIKSAIGRGGYVKNIYVKGLRAHTMKWVFLMSGDYGDHPDNHFDPKAFPVVAGINFR  361
            SGVRIK+A+GRG +VKNIYV+G+  HTMKWVF M+G+Y  H D+H+DP A P + GIN+R
Sbjct  317  SGVRIKTAVGRGAFVKNIYVRGMSLHTMKWVFWMTGNYKAHADSHYDPHALPEITGINYR  376

Query  362  DVVADNVTMAGKMEGISGHPYTGVCMANVTIGMAKNGKKPAWNCSNIQGVASGVVPPPCP  541
            D+VA+NV+MAG++EGISG P+TG+C++N TI MA   KK  W CS+++GV SGV P PC 
Sbjct  377  DIVAENVSMAGRLEGISGDPFTGICISNATISMAAKHKKAIWMCSDVEGVTSGVDPKPCD  436

Query  542  LLHIQGPVKP----GMCDLP  589
            LL  Q   K     G CD P
Sbjct  437  LLDGQQSEKKKKTDGGCDFP  456



>ref|XP_010055093.1| PREDICTED: probable polygalacturonase [Eucalyptus grandis]
 gb|KCW71569.1| hypothetical protein EUGRSUZ_E00105 [Eucalyptus grandis]
Length=472

 Score =   280 bits (715),  Expect = 9e-87, Method: Compositional matrix adjust.
 Identities = 125/196 (64%), Positives = 153/196 (78%), Gaps = 0/196 (0%)
 Frame = +2

Query  2    VAVKSGWDQYGIKYGKPTKQLIIKRLTCISPYSAAIALGSEMSGGIEDVRASDITAVHTE  181
            VAVKSGWD+YGI +G PT+QLII+RLTCISPYSA IALGSEMSGGI DVRA DI A++TE
Sbjct  256  VAVKSGWDEYGIAFGMPTQQLIIRRLTCISPYSATIALGSEMSGGIRDVRAEDIVAINTE  315

Query  182  SGVRIKSAIGRGGYVKNIYVKGLRAHTMKWVFLMSGDYGDHPDNHFDPKAFPVVAGINFR  361
            SG+RIK+A+GRG Y+K+IYVK +  HTMKW F M GDY  HPDN +DP A PV+  IN+R
Sbjct  316  SGIRIKTAVGRGAYIKDIYVKKMTMHTMKWAFKMDGDYKSHPDNKYDPNALPVIQNINYR  375

Query  362  DVVADNVTMAGKMEGISGHPYTGVCMANVTIGMAKNGKKPAWNCSNIQGVASGVVPPPCP  541
            D+VA+NV++A +  GI+G  +TG+CMANVT+GM    KK  W C+++QG+ SGV PPPC 
Sbjct  376  DMVAENVSVAARFNGIAGDKFTGICMANVTLGMTAKHKKYPWTCTDVQGMTSGVTPPPCD  435

Query  542  LLHIQGPVKPGMCDLP  589
             L  QGP K   CD P
Sbjct  436  SLPDQGPEKISACDFP  451



>ref|XP_006439488.1| hypothetical protein CICLE_v10019941mg [Citrus clementina]
 gb|ESR52728.1| hypothetical protein CICLE_v10019941mg [Citrus clementina]
Length=480

 Score =   280 bits (715),  Expect = 9e-87, Method: Compositional matrix adjust.
 Identities = 124/199 (62%), Positives = 158/199 (79%), Gaps = 0/199 (0%)
 Frame = +2

Query  2    VAVKSGWDQYGIKYGKPTKQLIIKRLTCISPYSAAIALGSEMSGGIEDVRASDITAVHTE  181
            VAVKSGWDQYGI YG PTKQLII+RLTCISP+SA IALGSEMSGGI+DVRA DITA+ +E
Sbjct  264  VAVKSGWDQYGIAYGMPTKQLIIRRLTCISPFSAVIALGSEMSGGIQDVRAEDITAIDSE  323

Query  182  SGVRIKSAIGRGGYVKNIYVKGLRAHTMKWVFLMSGDYGDHPDNHFDPKAFPVVAGINFR  361
            SGVRIK+A+GRGG+VK++YV+ +   TMKW F ++G YG HPDN++DP A PV+  IN+R
Sbjct  324  SGVRIKTAVGRGGFVKDVYVRRMTMKTMKWAFWITGSYGSHPDNNYDPHALPVIQNINYR  383

Query  362  DVVADNVTMAGKMEGISGHPYTGVCMANVTIGMAKNGKKPAWNCSNIQGVASGVVPPPCP  541
            D+VA+NVTMA ++EGI+G P+TG+C++NVTI +    KK  WNC++I G++SGV P PC 
Sbjct  384  DMVAENVTMAARLEGIAGDPFTGICISNVTIELTNKPKKLQWNCTDITGISSGVTPKPCE  443

Query  542  LLHIQGPVKPGMCDLPPKK  598
            LL    P K   C+ P  +
Sbjct  444  LLPDHEPAKTTECNFPDNR  462



>ref|XP_009116814.1| PREDICTED: probable polygalacturonase [Brassica rapa]
Length=470

 Score =   279 bits (714),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 126/196 (64%), Positives = 157/196 (80%), Gaps = 0/196 (0%)
 Frame = +2

Query  2    VAVKSGWDQYGIKYGKPTKQLIIKRLTCISPYSAAIALGSEMSGGIEDVRASDITAVHTE  181
            VAVKSGWD+YGI +G PTK LII+RLTCISPYSAAIALGSEMSGGIEDVRA +ITA  TE
Sbjct  256  VAVKSGWDEYGISFGMPTKHLIIRRLTCISPYSAAIALGSEMSGGIEDVRAEEITAYQTE  315

Query  182  SGVRIKSAIGRGGYVKNIYVKGLRAHTMKWVFLMSGDYGDHPDNHFDPKAFPVVAGINFR  361
            SGVRIK+A+GRG +V+N+YV+G+R HTMKWVF M+G+Y  H D+H+DP A P + GIN+R
Sbjct  316  SGVRIKTAVGRGAFVRNVYVRGMRLHTMKWVFWMTGNYKAHADSHYDPHALPEITGINYR  375

Query  362  DVVADNVTMAGKMEGISGHPYTGVCMANVTIGMAKNGKKPAWNCSNIQGVASGVVPPPCP  541
            D+VA+NV+MAG++EGISG P+ G+C++N TI MA   KK  W CS+++GV SGV P PC 
Sbjct  376  DIVAENVSMAGRLEGISGDPFKGICISNATISMAVKHKKVMWMCSDVEGVTSGVDPKPCD  435

Query  542  LLHIQGPVKPGMCDLP  589
            LL  +     G C+ P
Sbjct  436  LLDGKQEKMDGGCEFP  451



>ref|XP_010413390.1| PREDICTED: probable polygalacturonase [Camelina sativa]
 ref|XP_010413391.1| PREDICTED: probable polygalacturonase [Camelina sativa]
 ref|XP_010413392.1| PREDICTED: probable polygalacturonase [Camelina sativa]
Length=476

 Score =   279 bits (714),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 130/202 (64%), Positives = 158/202 (78%), Gaps = 6/202 (3%)
 Frame = +2

Query  2    VAVKSGWDQYGIKYGKPTKQLIIKRLTCISPYSAAIALGSEMSGGIEDVRASDITAVHTE  181
            +AVKSGWD+YGI +G PTK L+I+RLTCISPYSAAIALGSEMSGGIEDVRA DITA  TE
Sbjct  256  IAVKSGWDEYGISFGMPTKHLLIRRLTCISPYSAAIALGSEMSGGIEDVRAEDITAYQTE  315

Query  182  SGVRIKSAIGRGGYVKNIYVKGLRAHTMKWVFLMSGDYGDHPDNHFDPKAFPVVAGINFR  361
            SGVRIK+A+GRG +VKNIYVKG+  HTMKWVF M+G+Y  H D+++DP A P + GIN+R
Sbjct  316  SGVRIKTAVGRGAFVKNIYVKGMSLHTMKWVFWMTGNYKAHADSNYDPHALPEITGINYR  375

Query  362  DVVADNVTMAGKMEGISGHPYTGVCMANVTIGMAKNGKKPAWNCSNIQGVASGVVPPPCP  541
            D+VA+NV+MAG++EGISG P+TG+C++N TI MA   KK  W CS+++GV SGV P PC 
Sbjct  376  DIVAENVSMAGRLEGISGDPFTGICISNATISMAAKHKKAIWMCSDVEGVTSGVDPKPCD  435

Query  542  LLHIQGPVKP------GMCDLP  589
            LL  Q   K       G CD P
Sbjct  436  LLDGQESEKKKRMTTGGGCDFP  457



>gb|AFK37962.1| unknown [Lotus japonicus]
Length=469

 Score =   278 bits (712),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 126/196 (64%), Positives = 157/196 (80%), Gaps = 0/196 (0%)
 Frame = +2

Query  2    VAVKSGWDQYGIKYGKPTKQLIIKRLTCISPYSAAIALGSEMSGGIEDVRASDITAVHTE  181
            VAVKSGWD+YGI YG PTK L+I+RLTCISP SA IALGSEMSGGIEDVRA DI A+++E
Sbjct  254  VAVKSGWDEYGISYGMPTKHLVIRRLTCISPTSAVIALGSEMSGGIEDVRAEDILAINSE  313

Query  182  SGVRIKSAIGRGGYVKNIYVKGLRAHTMKWVFLMSGDYGDHPDNHFDPKAFPVVAGINFR  361
            SGVRIK+A+GRGGYV++IYV+ +   TMKWVF M+GDYG H DN++DP A PV+  IN+R
Sbjct  314  SGVRIKTAVGRGGYVRDIYVRRMTMKTMKWVFWMTGDYGSHADNNYDPNAIPVIENINYR  373

Query  362  DVVADNVTMAGKMEGISGHPYTGVCMANVTIGMAKNGKKPAWNCSNIQGVASGVVPPPCP  541
            D+VA+NVTMA ++EGISG P+TG+C++NVTI +AK  KK  W C+++ G++SGV P PC 
Sbjct  374  DMVAENVTMAARLEGISGAPFTGICISNVTIELAKKAKKVPWTCTDVSGISSGVTPEPCE  433

Query  542  LLHIQGPVKPGMCDLP  589
            LL  Q   K G C  P
Sbjct  434  LLPGQAEEKFGACSFP  449



>emb|CDY65355.1| BnaC08g49000D [Brassica napus]
Length=472

 Score =   278 bits (711),  Expect = 3e-86, Method: Compositional matrix adjust.
 Identities = 127/197 (64%), Positives = 157/197 (80%), Gaps = 1/197 (1%)
 Frame = +2

Query  2    VAVKSGWDQYGIKYGKPTKQLIIKRLTCISPYSAAIALGSEMSGGIEDVRASDITAVHTE  181
            VAVKSGWD+YGI +G PTK LII+RLTC+SPYSAAIALGSEMSGGIEDVRA DITA  TE
Sbjct  256  VAVKSGWDEYGIAFGMPTKHLIIRRLTCVSPYSAAIALGSEMSGGIEDVRAEDITAYQTE  315

Query  182  SGVRIKSAIGRGGYVKNIYVKGLRAHTMKWVFLMSGDYGDHPDNHFDPKAFPVVAGINFR  361
            SGVRIK+A+GRG +V+N+YV+G+  HTMKWVF M+G+Y  H D+H+DP A P + GIN+R
Sbjct  316  SGVRIKTAVGRGAFVRNVYVRGMSLHTMKWVFWMTGNYKAHADSHYDPHALPEITGINYR  375

Query  362  DVVADNVTMAGKMEGISGHPYTGVCMANVTIGMAKNGKKPAWNCSNIQGVASGVVPPPCP  541
            D+VA+NV+MAG++EGISG P+TG+C++N TI MA   KK  W CS+++GV SGV P PC 
Sbjct  376  DIVAENVSMAGRLEGISGDPFTGICISNATISMAVKHKKAIWMCSDVEGVTSGVDPKPCD  435

Query  542  LLH-IQGPVKPGMCDLP  589
            LL   Q     G C+ P
Sbjct  436  LLDGKQSEKMDGGCEFP  452



>gb|KDO76318.1| hypothetical protein CISIN_1g011659mg [Citrus sinensis]
Length=480

 Score =   278 bits (711),  Expect = 3e-86, Method: Compositional matrix adjust.
 Identities = 123/199 (62%), Positives = 158/199 (79%), Gaps = 0/199 (0%)
 Frame = +2

Query  2    VAVKSGWDQYGIKYGKPTKQLIIKRLTCISPYSAAIALGSEMSGGIEDVRASDITAVHTE  181
            VAVKSGWDQYGI YG PTKQLII+RLTCISP+SA IALGSEMSGGI+DVRA DITA+ +E
Sbjct  264  VAVKSGWDQYGIAYGMPTKQLIIRRLTCISPFSAVIALGSEMSGGIQDVRAEDITAIDSE  323

Query  182  SGVRIKSAIGRGGYVKNIYVKGLRAHTMKWVFLMSGDYGDHPDNHFDPKAFPVVAGINFR  361
            SGVRIK+A+GRGG+VK++YV+ +   TMKW F ++G YG HPDN++DP A PV+  IN+R
Sbjct  324  SGVRIKTAVGRGGFVKDVYVRRMTMKTMKWAFWITGSYGSHPDNNYDPHALPVIQNINYR  383

Query  362  DVVADNVTMAGKMEGISGHPYTGVCMANVTIGMAKNGKKPAWNCSNIQGVASGVVPPPCP  541
            D+VA+NVTMA ++EGI+G P+TG+C++NVTI +    KK  WNC++I G++SGV P PC 
Sbjct  384  DMVAENVTMAARLEGIAGDPFTGICISNVTIELTNKPKKLQWNCTDITGISSGVTPKPCE  443

Query  542  LLHIQGPVKPGMCDLPPKK  598
            LL    P +   C+ P  +
Sbjct  444  LLPDHEPAQTTECNFPDNR  462



>ref|XP_003532926.1| PREDICTED: probable polygalacturonase-like isoform X1 [Glycine 
max]
Length=494

 Score =   278 bits (711),  Expect = 5e-86, Method: Compositional matrix adjust.
 Identities = 125/198 (63%), Positives = 160/198 (81%), Gaps = 0/198 (0%)
 Frame = +2

Query  2    VAVKSGWDQYGIKYGKPTKQLIIKRLTCISPYSAAIALGSEMSGGIEDVRASDITAVHTE  181
            VAVKSGWD+YGI YG PTKQL+I+RLTCISP+SAAIALGSEMSGGI+D+RA DI A++TE
Sbjct  279  VAVKSGWDEYGIAYGMPTKQLVIRRLTCISPFSAAIALGSEMSGGIQDMRAEDIVAINTE  338

Query  182  SGVRIKSAIGRGGYVKNIYVKGLRAHTMKWVFLMSGDYGDHPDNHFDPKAFPVVAGINFR  361
            SGVRIK+A+GRGGYVK+I+V+ +   TMKW F M+G+YG H D+++DP A PV+  IN+R
Sbjct  339  SGVRIKTAVGRGGYVKDIFVRRMTMKTMKWAFWMTGNYGSHADDNYDPNALPVIQNINYR  398

Query  362  DVVADNVTMAGKMEGISGHPYTGVCMANVTIGMAKNGKKPAWNCSNIQGVASGVVPPPCP  541
            D+VA+NVTMA ++EGISG P+TG+C++NVTI +AK  KK  W C++I G++S V P PC 
Sbjct  399  DMVAENVTMAARLEGISGDPFTGICISNVTIQLAKKAKKVPWTCTDIAGISSDVTPAPCD  458

Query  542  LLHIQGPVKPGMCDLPPK  595
            LL  QG  K G C  P +
Sbjct  459  LLPDQGEEKIGACTFPEE  476



>gb|KDP25392.1| hypothetical protein JCGZ_20548 [Jatropha curcas]
Length=480

 Score =   278 bits (710),  Expect = 6e-86, Method: Compositional matrix adjust.
 Identities = 127/196 (65%), Positives = 158/196 (81%), Gaps = 0/196 (0%)
 Frame = +2

Query  2    VAVKSGWDQYGIKYGKPTKQLIIKRLTCISPYSAAIALGSEMSGGIEDVRASDITAVHTE  181
            VAVKSGWD+YGI +G PTKQL+I+RLTCISP SAAIALGSEMSGGI+DVRA DITA+ TE
Sbjct  264  VAVKSGWDEYGIAFGMPTKQLVIRRLTCISPTSAAIALGSEMSGGIQDVRAEDITAIDTE  323

Query  182  SGVRIKSAIGRGGYVKNIYVKGLRAHTMKWVFLMSGDYGDHPDNHFDPKAFPVVAGINFR  361
            SGVRIK++IGRGGYVK IYV+ +   TMKWVF M+G+YG HPDN++DP A PV+  IN+R
Sbjct  324  SGVRIKTSIGRGGYVKEIYVRRMTMKTMKWVFWMTGNYGSHPDNNYDPNAIPVIENINYR  383

Query  362  DVVADNVTMAGKMEGISGHPYTGVCMANVTIGMAKNGKKPAWNCSNIQGVASGVVPPPCP  541
            D+VA+NVTMA ++EGI+G P+TG+C++NVTI + +  KK  WNC+ I G++SGV P PC 
Sbjct  384  DMVAENVTMAARLEGIAGDPFTGICISNVTIKLTEKPKKLQWNCTEIAGISSGVTPKPCD  443

Query  542  LLHIQGPVKPGMCDLP  589
            LL    P K   C+ P
Sbjct  444  LLPDSEPGKVTPCNFP  459



>ref|XP_006584731.1| PREDICTED: probable polygalacturonase-like isoform X2 [Glycine 
max]
Length=506

 Score =   278 bits (711),  Expect = 7e-86, Method: Compositional matrix adjust.
 Identities = 125/198 (63%), Positives = 160/198 (81%), Gaps = 0/198 (0%)
 Frame = +2

Query  2    VAVKSGWDQYGIKYGKPTKQLIIKRLTCISPYSAAIALGSEMSGGIEDVRASDITAVHTE  181
            VAVKSGWD+YGI YG PTKQL+I+RLTCISP+SAAIALGSEMSGGI+D+RA DI A++TE
Sbjct  291  VAVKSGWDEYGIAYGMPTKQLVIRRLTCISPFSAAIALGSEMSGGIQDMRAEDIVAINTE  350

Query  182  SGVRIKSAIGRGGYVKNIYVKGLRAHTMKWVFLMSGDYGDHPDNHFDPKAFPVVAGINFR  361
            SGVRIK+A+GRGGYVK+I+V+ +   TMKW F M+G+YG H D+++DP A PV+  IN+R
Sbjct  351  SGVRIKTAVGRGGYVKDIFVRRMTMKTMKWAFWMTGNYGSHADDNYDPNALPVIQNINYR  410

Query  362  DVVADNVTMAGKMEGISGHPYTGVCMANVTIGMAKNGKKPAWNCSNIQGVASGVVPPPCP  541
            D+VA+NVTMA ++EGISG P+TG+C++NVTI +AK  KK  W C++I G++S V P PC 
Sbjct  411  DMVAENVTMAARLEGISGDPFTGICISNVTIQLAKKAKKVPWTCTDIAGISSDVTPAPCD  470

Query  542  LLHIQGPVKPGMCDLPPK  595
            LL  QG  K G C  P +
Sbjct  471  LLPDQGEEKIGACTFPEE  488



>ref|XP_009604283.1| PREDICTED: probable polygalacturonase [Nicotiana tomentosiformis]
Length=482

 Score =   278 bits (710),  Expect = 7e-86, Method: Compositional matrix adjust.
 Identities = 127/199 (64%), Positives = 160/199 (80%), Gaps = 0/199 (0%)
 Frame = +2

Query  2    VAVKSGWDQYGIKYGKPTKQLIIKRLTCISPYSAAIALGSEMSGGIEDVRASDITAVHTE  181
            +AVKSGWD+YG+ +G PTKQL I+R+TCISP SA IALGSEMSGGI+DVRA DI A+ TE
Sbjct  266  IAVKSGWDEYGVAFGMPTKQLAIRRITCISPTSATIALGSEMSGGIQDVRAEDIVAIDTE  325

Query  182  SGVRIKSAIGRGGYVKNIYVKGLRAHTMKWVFLMSGDYGDHPDNHFDPKAFPVVAGINFR  361
            SGVRIK+A+GRGGYVK+IYVKG+   TMK+VF M+GDYG HPDN++DP A PV+  IN+R
Sbjct  326  SGVRIKTAVGRGGYVKDIYVKGVTMKTMKYVFWMTGDYGSHPDNNYDPNALPVIDNINYR  385

Query  362  DVVADNVTMAGKMEGISGHPYTGVCMANVTIGMAKNGKKPAWNCSNIQGVASGVVPPPCP  541
            D+VA+NVT+A K+ GISG P+TG+C++NVTI +A   KK AWNC++I G++SGVVP PC 
Sbjct  386  DMVAENVTIAAKLSGISGDPFTGICISNVTIELAPKAKKLAWNCTDISGISSGVVPQPCE  445

Query  542  LLHIQGPVKPGMCDLPPKK  598
            LL  QG      C+ P + 
Sbjct  446  LLPDQGTENVAPCNFPTEN  464



>ref|XP_008238946.1| PREDICTED: probable polygalacturonase [Prunus mume]
Length=482

 Score =   278 bits (710),  Expect = 7e-86, Method: Compositional matrix adjust.
 Identities = 124/199 (62%), Positives = 159/199 (80%), Gaps = 0/199 (0%)
 Frame = +2

Query  2    VAVKSGWDQYGIKYGKPTKQLIIKRLTCISPYSAAIALGSEMSGGIEDVRASDITAVHTE  181
            +AVKSGWDQYGI +G PTKQL+I+RLTCISP+SA IALGSEMSGGI+DVRA DI A+ +E
Sbjct  266  IAVKSGWDQYGIAFGMPTKQLVIRRLTCISPFSAVIALGSEMSGGIQDVRAEDILAIDSE  325

Query  182  SGVRIKSAIGRGGYVKNIYVKGLRAHTMKWVFLMSGDYGDHPDNHFDPKAFPVVAGINFR  361
            SGVRIK+A+GRGG+VK+IYV+G+   TMKW F M+G+YG H DN +DP A PV+  IN+ 
Sbjct  326  SGVRIKTAVGRGGFVKDIYVRGMTMKTMKWAFWMTGNYGSHADNGYDPNALPVIQNINYH  385

Query  362  DVVADNVTMAGKMEGISGHPYTGVCMANVTIGMAKNGKKPAWNCSNIQGVASGVVPPPCP  541
            D+VA+NVTMA K+EGI G P+TG+C++NVTI +AK  KK  WNC+++ G++SGVVP  C 
Sbjct  386  DMVAENVTMAAKLEGIPGDPFTGICISNVTITLAKKAKKLPWNCTDVAGISSGVVPQACG  445

Query  542  LLHIQGPVKPGMCDLPPKK  598
            LL  QGP     C+ P ++
Sbjct  446  LLVDQGPRNVAACNFPEER  464



>ref|XP_007160099.1| hypothetical protein PHAVU_002G292300g [Phaseolus vulgaris]
 gb|ESW32093.1| hypothetical protein PHAVU_002G292300g [Phaseolus vulgaris]
Length=469

 Score =   277 bits (708),  Expect = 7e-86, Method: Compositional matrix adjust.
 Identities = 125/199 (63%), Positives = 157/199 (79%), Gaps = 0/199 (0%)
 Frame = +2

Query  2    VAVKSGWDQYGIKYGKPTKQLIIKRLTCISPYSAAIALGSEMSGGIEDVRASDITAVHTE  181
            VAVKSGWD+YGI YG PTKQL+I+RLTCISP+SA IALGSEMSGGI+DVRA DI A++TE
Sbjct  254  VAVKSGWDEYGIAYGMPTKQLVIRRLTCISPFSAVIALGSEMSGGIQDVRAEDIVAINTE  313

Query  182  SGVRIKSAIGRGGYVKNIYVKGLRAHTMKWVFLMSGDYGDHPDNHFDPKAFPVVAGINFR  361
            SGVRIK+A+GRGGYVK+IYV+ +   TMKW F M+G+YG H D+ +DP A PV+  IN+R
Sbjct  314  SGVRIKTAVGRGGYVKDIYVRRMTMKTMKWAFWMTGNYGSHADDKYDPNALPVIQNINYR  373

Query  362  DVVADNVTMAGKMEGISGHPYTGVCMANVTIGMAKNGKKPAWNCSNIQGVASGVVPPPCP  541
            D+VA+NVTMA ++EGISG P+TG+C++NVTI +AK  KK  W C++I G++S V P PC 
Sbjct  374  DMVAENVTMAARLEGISGDPFTGICISNVTIQLAKKAKKVPWTCTDIDGISSDVTPAPCN  433

Query  542  LLHIQGPVKPGMCDLPPKK  598
            LL  QG    G C  P + 
Sbjct  434  LLPEQGEENIGACTFPEES  452



>gb|KHM99951.1| Putative polygalacturonase [Glycine soja]
Length=434

 Score =   276 bits (705),  Expect = 7e-86, Method: Compositional matrix adjust.
 Identities = 124/198 (63%), Positives = 159/198 (80%), Gaps = 0/198 (0%)
 Frame = +2

Query  2    VAVKSGWDQYGIKYGKPTKQLIIKRLTCISPYSAAIALGSEMSGGIEDVRASDITAVHTE  181
            VAVKSGWD+YGI YG PTKQL+I+RLTCISP+SA IALGSEMSGGI+DVRA DI A+++E
Sbjct  219  VAVKSGWDEYGIAYGMPTKQLVIRRLTCISPFSAVIALGSEMSGGIQDVRAEDIVAINSE  278

Query  182  SGVRIKSAIGRGGYVKNIYVKGLRAHTMKWVFLMSGDYGDHPDNHFDPKAFPVVAGINFR  361
            SGVRIK+A+GRGGYVK+I+V+ +   TMKW F M+G+YG H D+++DP A PV+  IN+R
Sbjct  279  SGVRIKTAVGRGGYVKDIFVRRMTMKTMKWAFWMTGNYGSHADDNYDPNALPVIQNINYR  338

Query  362  DVVADNVTMAGKMEGISGHPYTGVCMANVTIGMAKNGKKPAWNCSNIQGVASGVVPPPCP  541
            D+VA+NVTMA ++EGISG P+TG+C++NVTI +AK  KK  W C++I G++S V P PC 
Sbjct  339  DMVAENVTMAARLEGISGDPFTGICISNVTIQLAKKAKKVPWTCTDIAGISSDVTPAPCG  398

Query  542  LLHIQGPVKPGMCDLPPK  595
            LL  QG  K G C  P +
Sbjct  399  LLPDQGEEKIGACTFPEE  416



>emb|CDY48913.1| BnaA09g39240D [Brassica napus]
Length=471

 Score =   277 bits (708),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 127/197 (64%), Positives = 158/197 (80%), Gaps = 1/197 (1%)
 Frame = +2

Query  2    VAVKSGWDQYGIKYGKPTKQLIIKRLTCISPYSAAIALGSEMSGGIEDVRASDITAVHTE  181
            VAVKSGWD+YGI +G PTK LII+RLTCISPYSAAIALGSEMSGGIEDVRA +ITA  TE
Sbjct  256  VAVKSGWDEYGISFGMPTKHLIIRRLTCISPYSAAIALGSEMSGGIEDVRAEEITAYQTE  315

Query  182  SGVRIKSAIGRGGYVKNIYVKGLRAHTMKWVFLMSGDYGDHPDNHFDPKAFPVVAGINFR  361
            SGVRIK+A+GRG +V+N+YV+G+R HTMKWVF M+G+Y  H D+H+DP A P + GIN+R
Sbjct  316  SGVRIKTAVGRGAFVRNVYVRGMRLHTMKWVFWMTGNYKAHADSHYDPHALPEITGINYR  375

Query  362  DVVADNVTMAGKMEGISGHPYTGVCMANVTIGMAKNGKKPAWNCSNIQGVASGVVPPPCP  541
            D+VA+NV+MAG++EGISG P+ G+C++N TI MA   KK  W CS+++GV SGV P PC 
Sbjct  376  DIVAENVSMAGRLEGISGDPFKGICISNATISMAVKHKKVMWMCSDVEGVTSGVDPKPCD  435

Query  542  LLHIQGPVK-PGMCDLP  589
            LL  +   K  G C+ P
Sbjct  436  LLDGKQEKKMDGGCEFP  452



>ref|XP_009793070.1| PREDICTED: probable polygalacturonase [Nicotiana sylvestris]
Length=482

 Score =   277 bits (708),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 126/199 (63%), Positives = 160/199 (80%), Gaps = 0/199 (0%)
 Frame = +2

Query  2    VAVKSGWDQYGIKYGKPTKQLIIKRLTCISPYSAAIALGSEMSGGIEDVRASDITAVHTE  181
            +AVKSGWD+YG+ +G PTKQL I+R+TCISP SA IALGSEMSGGI+DVRA DI A+ TE
Sbjct  266  IAVKSGWDEYGVAFGMPTKQLAIRRITCISPTSATIALGSEMSGGIQDVRAEDIVAIDTE  325

Query  182  SGVRIKSAIGRGGYVKNIYVKGLRAHTMKWVFLMSGDYGDHPDNHFDPKAFPVVAGINFR  361
            SGVRIK+A+GRGGYVK++YVKG+   TMK+VF M+GDYG HPDN++DP A PV+  IN+R
Sbjct  326  SGVRIKTAVGRGGYVKDVYVKGVTMKTMKYVFWMTGDYGSHPDNNYDPNALPVIDNINYR  385

Query  362  DVVADNVTMAGKMEGISGHPYTGVCMANVTIGMAKNGKKPAWNCSNIQGVASGVVPPPCP  541
            D+VA+NVT+A K+ GISG P+TG+C++NVTI +A   KK AWNC++I G++SGVVP PC 
Sbjct  386  DMVAENVTIAAKLAGISGDPFTGICISNVTIELAPKAKKLAWNCTDISGISSGVVPQPCE  445

Query  542  LLHIQGPVKPGMCDLPPKK  598
            LL  QG      C+ P + 
Sbjct  446  LLPDQGTENVSPCNFPTEN  464



>ref|XP_009345122.1| PREDICTED: probable polygalacturonase [Pyrus x bretschneideri]
Length=485

 Score =   277 bits (708),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 124/198 (63%), Positives = 159/198 (80%), Gaps = 0/198 (0%)
 Frame = +2

Query  2    VAVKSGWDQYGIKYGKPTKQLIIKRLTCISPYSAAIALGSEMSGGIEDVRASDITAVHTE  181
            +AVKSGWD+YGI +G PTKQL+I+RLTCISP+SA IALGSEMSGGI+DVRA DI A+++E
Sbjct  269  IAVKSGWDEYGIAFGMPTKQLVIRRLTCISPFSAVIALGSEMSGGIQDVRAEDIFAINSE  328

Query  182  SGVRIKSAIGRGGYVKNIYVKGLRAHTMKWVFLMSGDYGDHPDNHFDPKAFPVVAGINFR  361
            SGVRIK+A+GRGG+VK+IYV+G+   TMKW F M+G+YG H DN +DP A PV+  IN+ 
Sbjct  329  SGVRIKTAVGRGGFVKDIYVRGMTMKTMKWAFWMTGNYGSHADNGYDPNALPVIQNINYH  388

Query  362  DVVADNVTMAGKMEGISGHPYTGVCMANVTIGMAKNGKKPAWNCSNIQGVASGVVPPPCP  541
            D+VA+NVTMA K+EGI G P+TG+C++NVTI +AK  KK  WNC++I G++SGVVP PC 
Sbjct  389  DMVAENVTMAAKLEGIPGDPFTGICISNVTITLAKKAKKLPWNCTDIAGISSGVVPQPCQ  448

Query  542  LLHIQGPVKPGMCDLPPK  595
             L  QGP     C+ P +
Sbjct  449  ALADQGPGNVTACNFPEE  466



>ref|XP_003622464.1| Polygalacturonase-like protein [Medicago truncatula]
 gb|KEH18815.1| polygalacturonase/glycoside hydrolase family protein [Medicago 
truncatula]
Length=479

 Score =   277 bits (708),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 126/196 (64%), Positives = 156/196 (80%), Gaps = 0/196 (0%)
 Frame = +2

Query  2    VAVKSGWDQYGIKYGKPTKQLIIKRLTCISPYSAAIALGSEMSGGIEDVRASDITAVHTE  181
            VAVKSGWD+YGIK+G PTKQL+I+RLTCISPYSA IALGSEMSGGI+DVRA DITAVHTE
Sbjct  266  VAVKSGWDEYGIKFGWPTKQLVIRRLTCISPYSATIALGSEMSGGIQDVRAEDITAVHTE  325

Query  182  SGVRIKSAIGRGGYVKNIYVKGLRAHTMKWVFLMSGDYGDHPDNHFDPKAFPVVAGINFR  361
            SG+RIK+A+GRGGYVK+IYVK +  HTMKW F ++G+YG H D +++  A P +  I++R
Sbjct  326  SGIRIKTAVGRGGYVKDIYVKKMTMHTMKWAFWITGNYGSHADKNYNHSALPEIKNIHYR  385

Query  362  DVVADNVTMAGKMEGISGHPYTGVCMANVTIGMAKNGKKPAWNCSNIQGVASGVVPPPCP  541
            D+VADNV+MAG +EGIS  P+TG+C++NVTI MA   KK  W C++I+G+ SGV P PC 
Sbjct  386  DMVADNVSMAGNLEGISNDPFTGICISNVTITMAAKAKKQPWTCNDIEGITSGVTPKPCD  445

Query  542  LLHIQGPVKPGMCDLP  589
            LL  QG      CD P
Sbjct  446  LLPEQGKENIRDCDFP  461



>gb|KHG23155.1| putative polygalacturonase [Gossypium arboreum]
Length=449

 Score =   276 bits (705),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 127/196 (65%), Positives = 156/196 (80%), Gaps = 2/196 (1%)
 Frame = +2

Query  2    VAVKSGWDQYGIKYGKPTKQLIIKRLTCISPYSAAIALGSEMSGGIEDVRASDITAVHTE  181
            VAVKSGWD+YGIK+G PTKQL+I+RLTCISP+SA IALGSEMSGGIEDVRA DIT +++E
Sbjct  247  VAVKSGWDEYGIKFGMPTKQLVIRRLTCISPFSAVIALGSEMSGGIEDVRAEDITGINSE  306

Query  182  SGVRIKSAIGRGGYVKNIYVKGLRAHTMKWVFLMSGDYGDHPDNHFDPKAFPVVAGINFR  361
            S VRIK+A+GRG YVK+IYV+ +   TMK VF M+G+YG HPDN +DP A PV+  INFR
Sbjct  307  SAVRIKTAVGRGNYVKDIYVRRMTMKTMKMVFWMAGNYGSHPDNDYDPNAIPVIQNINFR  366

Query  362  DVVADNVTMAGKMEGISGHPYTGVCMANVTIGMAKNGKKPAWNCSNIQGVASGVVPPPCP  541
            DVVA+NVTMA ++EGI GHP++G+C++N TIG+ K  KK  WNC+ I GV+S V P PC 
Sbjct  367  DVVAENVTMAARLEGIPGHPFSGICISNTTIGLTKKPKKIQWNCTEIAGVSSNVRPQPCN  426

Query  542  LLHIQGPVKPGMCDLP  589
            LL  QGP     C+ P
Sbjct  427  LLTDQGP--DNACNFP  440



>ref|XP_006476506.1| PREDICTED: probable polygalacturonase-like [Citrus sinensis]
Length=480

 Score =   276 bits (707),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 123/199 (62%), Positives = 157/199 (79%), Gaps = 0/199 (0%)
 Frame = +2

Query  2    VAVKSGWDQYGIKYGKPTKQLIIKRLTCISPYSAAIALGSEMSGGIEDVRASDITAVHTE  181
            VAVKSGWDQYGI YG PTKQLII+RLTCISP+SA IALGSEMSGGI+DVRA DITA+ +E
Sbjct  264  VAVKSGWDQYGIAYGMPTKQLIIRRLTCISPFSAVIALGSEMSGGIQDVRAEDITAIDSE  323

Query  182  SGVRIKSAIGRGGYVKNIYVKGLRAHTMKWVFLMSGDYGDHPDNHFDPKAFPVVAGINFR  361
            SGVRIK+A+GRGG+VK+IYV+ +   TMKW F ++G YG HPDN++DP A P +  IN+R
Sbjct  324  SGVRIKTAVGRGGFVKDIYVRRMTMKTMKWAFWITGSYGSHPDNNYDPHALPEIQNINYR  383

Query  362  DVVADNVTMAGKMEGISGHPYTGVCMANVTIGMAKNGKKPAWNCSNIQGVASGVVPPPCP  541
            D+VA+NVTMA ++EGI+G P+TG+C++NVTI +    KK  WNC++I G++SGV P PC 
Sbjct  384  DMVAENVTMAARLEGIAGDPFTGICISNVTIELTNKPKKLQWNCTDITGISSGVTPKPCE  443

Query  542  LLHIQGPVKPGMCDLPPKK  598
            LL    P +   C+ P  +
Sbjct  444  LLPDHEPAQTTECNFPDNR  462



>gb|EYU23462.1| hypothetical protein MIMGU_mgv1a006147mg [Erythranthe guttata]
Length=455

 Score =   275 bits (704),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 123/199 (62%), Positives = 161/199 (81%), Gaps = 4/199 (2%)
 Frame = +2

Query  2    VAVKSGWDQYGIKYGKPTKQLIIKRLTCISPYSAAIALGSEMSGGIEDVRASDITAVHTE  181
            +AVKSGWDQYGI +  PTK+L+I+RLTCISP+SA IALGSEMSGGIEDVRA +I A+ +E
Sbjct  231  IAVKSGWDQYGISFAMPTKRLVIRRLTCISPFSAVIALGSEMSGGIEDVRAEEILAIDSE  290

Query  182  SGVRIKSAIGRGGYVKNIYVKGLRAHTMKWVFLMSGDYGDHPDNHFDPKAFPVVAGINFR  361
            SG+RIK+A+GRGGYVK+IYV+G+   TMKW F M+G+YG HPDN++DP A P+++ IN+R
Sbjct  291  SGIRIKTAVGRGGYVKDIYVRGMTMKTMKWAFWMTGNYGSHPDNNYDPNALPLISNINYR  350

Query  362  DVVADNVTMAGKMEGISGHPYTGVCMANVTIGMAKNGKKPAWNCSNIQGVASGVVPPPCP  541
            D+VA+NVTMA K+EGISG P+TG+C++NVTI +AK  KK  WNC++++GV+SGVVP PC 
Sbjct  351  DMVAENVTMAAKLEGISGDPFTGICISNVTIELAKKPKKVIWNCTDVEGVSSGVVPLPCS  410

Query  542  LLHIQGPVKPGMCDLPPKK  598
                Q P     C+ P + 
Sbjct  411  ----QLPEVSAECNFPAES  425



>ref|XP_006580552.1| PREDICTED: probable polygalacturonase-like isoform X2 [Glycine 
max]
Length=469

 Score =   276 bits (705),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 124/198 (63%), Positives = 159/198 (80%), Gaps = 0/198 (0%)
 Frame = +2

Query  2    VAVKSGWDQYGIKYGKPTKQLIIKRLTCISPYSAAIALGSEMSGGIEDVRASDITAVHTE  181
            VAVKSGWD+YGI YG PTKQL+I+RLTCISP+SA IALGSEMSGGI+DVRA DI A+++E
Sbjct  254  VAVKSGWDEYGIAYGMPTKQLVIRRLTCISPFSAVIALGSEMSGGIQDVRAEDIVAINSE  313

Query  182  SGVRIKSAIGRGGYVKNIYVKGLRAHTMKWVFLMSGDYGDHPDNHFDPKAFPVVAGINFR  361
            SGVRIK+A+GRGGYVK+I+V+ +   TMKW F M+G+YG H D+++DP A PV+  IN+R
Sbjct  314  SGVRIKTAVGRGGYVKDIFVRRMTMKTMKWAFWMTGNYGSHADDNYDPNALPVIQNINYR  373

Query  362  DVVADNVTMAGKMEGISGHPYTGVCMANVTIGMAKNGKKPAWNCSNIQGVASGVVPPPCP  541
            D+VA+NVTMA ++EGISG P+TG+C++NVTI +AK  KK  W C++I G++S V P PC 
Sbjct  374  DMVAENVTMAARLEGISGDPFTGICISNVTIQLAKKAKKVPWTCTDIAGISSDVTPAPCG  433

Query  542  LLHIQGPVKPGMCDLPPK  595
            LL  QG  K G C  P +
Sbjct  434  LLPDQGEEKIGACTFPEE  451



>ref|XP_010255225.1| PREDICTED: probable polygalacturonase isoform X3 [Nelumbo nucifera]
Length=468

 Score =   275 bits (704),  Expect = 3e-85, Method: Compositional matrix adjust.
 Identities = 125/196 (64%), Positives = 156/196 (80%), Gaps = 0/196 (0%)
 Frame = +2

Query  2    VAVKSGWDQYGIKYGKPTKQLIIKRLTCISPYSAAIALGSEMSGGIEDVRASDITAVHTE  181
            VAVKSGWD+YGI +G PTK L+I+RLTCISP SA IALGSEMSGGIEDVRA DI A+++E
Sbjct  252  VAVKSGWDEYGIAFGMPTKGLVIRRLTCISPDSAVIALGSEMSGGIEDVRAEDILAINSE  311

Query  182  SGVRIKSAIGRGGYVKNIYVKGLRAHTMKWVFLMSGDYGDHPDNHFDPKAFPVVAGINFR  361
            SGVRIK+A+GRGGYVK++YV+G+   TMKW F M+G+YG HPDN +DP A PV+ GIN+R
Sbjct  312  SGVRIKTAVGRGGYVKDVYVRGMTMKTMKWAFWMTGNYGSHPDNKYDPNALPVINGINYR  371

Query  362  DVVADNVTMAGKMEGISGHPYTGVCMANVTIGMAKNGKKPAWNCSNIQGVASGVVPPPCP  541
            D+VA+NVTMA ++EGI+G  +TG+C++NVTIG+A   KK  W CS+I+G+ SGV P PC 
Sbjct  372  DMVAENVTMAARLEGIAGDQFTGICISNVTIGLAHKAKKVPWTCSDIEGITSGVTPAPCA  431

Query  542  LLHIQGPVKPGMCDLP  589
            LL  Q P     C  P
Sbjct  432  LLPDQAPQGLTSCAFP  447



>ref|XP_004510753.1| PREDICTED: probable polygalacturonase-like [Cicer arietinum]
Length=481

 Score =   276 bits (705),  Expect = 3e-85, Method: Compositional matrix adjust.
 Identities = 125/196 (64%), Positives = 156/196 (80%), Gaps = 0/196 (0%)
 Frame = +2

Query  2    VAVKSGWDQYGIKYGKPTKQLIIKRLTCISPYSAAIALGSEMSGGIEDVRASDITAVHTE  181
            VAVKSGWD+YGIK+G PTKQL+I+RLTCISPYSA IALGSEMSGGI+DVRA DITAVHTE
Sbjct  268  VAVKSGWDEYGIKFGWPTKQLVIRRLTCISPYSATIALGSEMSGGIQDVRAEDITAVHTE  327

Query  182  SGVRIKSAIGRGGYVKNIYVKGLRAHTMKWVFLMSGDYGDHPDNHFDPKAFPVVAGINFR  361
            SG+RIK+A+GRGGYVK+IYV+ +  HTMKW F ++G+YG H D ++DP A P +  IN+R
Sbjct  328  SGIRIKTAVGRGGYVKDIYVQRMTMHTMKWAFWITGNYGSHADKNYDPNALPEIRNINYR  387

Query  362  DVVADNVTMAGKMEGISGHPYTGVCMANVTIGMAKNGKKPAWNCSNIQGVASGVVPPPCP  541
            D+ A+NV+MA ++EGIS  P+TG+C++NVTI MA   KK  W C++I+G+ SGV P PC 
Sbjct  388  DMKAENVSMAARLEGISNDPFTGICISNVTISMAAKAKKQPWTCNDIEGITSGVSPKPCG  447

Query  542  LLHIQGPVKPGMCDLP  589
            LL  QG  K   C  P
Sbjct  448  LLPDQGIKKIKACHFP  463



>ref|XP_003525377.2| PREDICTED: probable polygalacturonase-like isoform X1 [Glycine 
max]
Length=492

 Score =   275 bits (704),  Expect = 5e-85, Method: Compositional matrix adjust.
 Identities = 124/198 (63%), Positives = 159/198 (80%), Gaps = 0/198 (0%)
 Frame = +2

Query  2    VAVKSGWDQYGIKYGKPTKQLIIKRLTCISPYSAAIALGSEMSGGIEDVRASDITAVHTE  181
            VAVKSGWD+YGI YG PTKQL+I+RLTCISP+SA IALGSEMSGGI+DVRA DI A+++E
Sbjct  277  VAVKSGWDEYGIAYGMPTKQLVIRRLTCISPFSAVIALGSEMSGGIQDVRAEDIVAINSE  336

Query  182  SGVRIKSAIGRGGYVKNIYVKGLRAHTMKWVFLMSGDYGDHPDNHFDPKAFPVVAGINFR  361
            SGVRIK+A+GRGGYVK+I+V+ +   TMKW F M+G+YG H D+++DP A PV+  IN+R
Sbjct  337  SGVRIKTAVGRGGYVKDIFVRRMTMKTMKWAFWMTGNYGSHADDNYDPNALPVIQNINYR  396

Query  362  DVVADNVTMAGKMEGISGHPYTGVCMANVTIGMAKNGKKPAWNCSNIQGVASGVVPPPCP  541
            D+VA+NVTMA ++EGISG P+TG+C++NVTI +AK  KK  W C++I G++S V P PC 
Sbjct  397  DMVAENVTMAARLEGISGDPFTGICISNVTIQLAKKAKKVPWTCTDIAGISSDVTPAPCG  456

Query  542  LLHIQGPVKPGMCDLPPK  595
            LL  QG  K G C  P +
Sbjct  457  LLPDQGEEKIGACTFPEE  474



>ref|XP_006343936.1| PREDICTED: probable polygalacturonase-like [Solanum tuberosum]
Length=483

 Score =   275 bits (703),  Expect = 5e-85, Method: Compositional matrix adjust.
 Identities = 126/199 (63%), Positives = 159/199 (80%), Gaps = 0/199 (0%)
 Frame = +2

Query  2    VAVKSGWDQYGIKYGKPTKQLIIKRLTCISPYSAAIALGSEMSGGIEDVRASDITAVHTE  181
            +AVKSGWD+YGI +G PTKQL I+R+TCISP SA IALGSEMSGGI+DVRA DI A++TE
Sbjct  266  IAVKSGWDEYGIAFGMPTKQLAIRRITCISPTSATIALGSEMSGGIQDVRAEDIVAINTE  325

Query  182  SGVRIKSAIGRGGYVKNIYVKGLRAHTMKWVFLMSGDYGDHPDNHFDPKAFPVVAGINFR  361
            S VRIK+A+GRGGYVK+IYV+G+   TMK+VF M+GDYG HPDN++DP A PV+  IN+R
Sbjct  326  SAVRIKTAVGRGGYVKDIYVRGVTMKTMKYVFWMTGDYGSHPDNNYDPNALPVIENINYR  385

Query  362  DVVADNVTMAGKMEGISGHPYTGVCMANVTIGMAKNGKKPAWNCSNIQGVASGVVPPPCP  541
            D+VA+NVT+A K+ GISG P+TG+C++NVTI MA   KK  WNC++I G++SGVVP PC 
Sbjct  386  DMVAENVTIAAKLAGISGDPFTGICISNVTIEMAPKAKKLFWNCTDISGISSGVVPQPCD  445

Query  542  LLHIQGPVKPGMCDLPPKK  598
            LL  QG      C+ P + 
Sbjct  446  LLPDQGTEYASPCNFPTES  464



>gb|AFK44529.1| unknown [Lotus japonicus]
Length=469

 Score =   275 bits (702),  Expect = 6e-85, Method: Compositional matrix adjust.
 Identities = 125/196 (64%), Positives = 156/196 (80%), Gaps = 0/196 (0%)
 Frame = +2

Query  2    VAVKSGWDQYGIKYGKPTKQLIIKRLTCISPYSAAIALGSEMSGGIEDVRASDITAVHTE  181
            VAVKSGWD+YGI YG PTK L+I+RLTCISP SA IALGSEMSGGIEDVRA DI A+++E
Sbjct  254  VAVKSGWDEYGISYGMPTKHLVIRRLTCISPTSAVIALGSEMSGGIEDVRAEDILAINSE  313

Query  182  SGVRIKSAIGRGGYVKNIYVKGLRAHTMKWVFLMSGDYGDHPDNHFDPKAFPVVAGINFR  361
            SGVRIK+A+GRGGYV++IYV+ +   TMKWVF M+GDYG H DN++DP A PV+  IN+R
Sbjct  314  SGVRIKTAVGRGGYVRDIYVRRMTMKTMKWVFWMTGDYGSHADNNYDPNAIPVIENINYR  373

Query  362  DVVADNVTMAGKMEGISGHPYTGVCMANVTIGMAKNGKKPAWNCSNIQGVASGVVPPPCP  541
            D+VA+NVTMA ++ GISG P+TG+C++NVTI +AK  KK  W C+++ G++SGV P PC 
Sbjct  374  DMVAENVTMAARLGGISGAPFTGICISNVTIELAKKAKKVPWTCTDVSGISSGVTPEPCE  433

Query  542  LLHIQGPVKPGMCDLP  589
            LL  Q   K G C  P
Sbjct  434  LLPGQAEEKFGACSFP  449



>ref|XP_010255224.1| PREDICTED: probable polygalacturonase isoform X2 [Nelumbo nucifera]
Length=489

 Score =   275 bits (703),  Expect = 7e-85, Method: Compositional matrix adjust.
 Identities = 125/196 (64%), Positives = 156/196 (80%), Gaps = 0/196 (0%)
 Frame = +2

Query  2    VAVKSGWDQYGIKYGKPTKQLIIKRLTCISPYSAAIALGSEMSGGIEDVRASDITAVHTE  181
            VAVKSGWD+YGI +G PTK L+I+RLTCISP SA IALGSEMSGGIEDVRA DI A+++E
Sbjct  273  VAVKSGWDEYGIAFGMPTKGLVIRRLTCISPDSAVIALGSEMSGGIEDVRAEDILAINSE  332

Query  182  SGVRIKSAIGRGGYVKNIYVKGLRAHTMKWVFLMSGDYGDHPDNHFDPKAFPVVAGINFR  361
            SGVRIK+A+GRGGYVK++YV+G+   TMKW F M+G+YG HPDN +DP A PV+ GIN+R
Sbjct  333  SGVRIKTAVGRGGYVKDVYVRGMTMKTMKWAFWMTGNYGSHPDNKYDPNALPVINGINYR  392

Query  362  DVVADNVTMAGKMEGISGHPYTGVCMANVTIGMAKNGKKPAWNCSNIQGVASGVVPPPCP  541
            D+VA+NVTMA ++EGI+G  +TG+C++NVTIG+A   KK  W CS+I+G+ SGV P PC 
Sbjct  393  DMVAENVTMAARLEGIAGDQFTGICISNVTIGLAHKAKKVPWTCSDIEGITSGVTPAPCA  452

Query  542  LLHIQGPVKPGMCDLP  589
            LL  Q P     C  P
Sbjct  453  LLPDQAPQGLTSCAFP  468



>ref|XP_010255223.1| PREDICTED: probable polygalacturonase isoform X1 [Nelumbo nucifera]
Length=508

 Score =   275 bits (704),  Expect = 8e-85, Method: Compositional matrix adjust.
 Identities = 125/196 (64%), Positives = 156/196 (80%), Gaps = 0/196 (0%)
 Frame = +2

Query  2    VAVKSGWDQYGIKYGKPTKQLIIKRLTCISPYSAAIALGSEMSGGIEDVRASDITAVHTE  181
            VAVKSGWD+YGI +G PTK L+I+RLTCISP SA IALGSEMSGGIEDVRA DI A+++E
Sbjct  292  VAVKSGWDEYGIAFGMPTKGLVIRRLTCISPDSAVIALGSEMSGGIEDVRAEDILAINSE  351

Query  182  SGVRIKSAIGRGGYVKNIYVKGLRAHTMKWVFLMSGDYGDHPDNHFDPKAFPVVAGINFR  361
            SGVRIK+A+GRGGYVK++YV+G+   TMKW F M+G+YG HPDN +DP A PV+ GIN+R
Sbjct  352  SGVRIKTAVGRGGYVKDVYVRGMTMKTMKWAFWMTGNYGSHPDNKYDPNALPVINGINYR  411

Query  362  DVVADNVTMAGKMEGISGHPYTGVCMANVTIGMAKNGKKPAWNCSNIQGVASGVVPPPCP  541
            D+VA+NVTMA ++EGI+G  +TG+C++NVTIG+A   KK  W CS+I+G+ SGV P PC 
Sbjct  412  DMVAENVTMAARLEGIAGDQFTGICISNVTIGLAHKAKKVPWTCSDIEGITSGVTPAPCA  471

Query  542  LLHIQGPVKPGMCDLP  589
            LL  Q P     C  P
Sbjct  472  LLPDQAPQGLTSCAFP  487



>ref|XP_007209970.1| hypothetical protein PRUPE_ppa004996mg [Prunus persica]
 gb|EMJ11169.1| hypothetical protein PRUPE_ppa004996mg [Prunus persica]
Length=482

 Score =   275 bits (702),  Expect = 8e-85, Method: Compositional matrix adjust.
 Identities = 123/198 (62%), Positives = 158/198 (80%), Gaps = 0/198 (0%)
 Frame = +2

Query  2    VAVKSGWDQYGIKYGKPTKQLIIKRLTCISPYSAAIALGSEMSGGIEDVRASDITAVHTE  181
            +AVKSGWDQYGI +G PTKQL+I+RLTCISP+SA IALGSEMSGGI+DVRA +I A+ +E
Sbjct  266  IAVKSGWDQYGIAFGMPTKQLVIRRLTCISPFSAVIALGSEMSGGIQDVRAENILAIDSE  325

Query  182  SGVRIKSAIGRGGYVKNIYVKGLRAHTMKWVFLMSGDYGDHPDNHFDPKAFPVVAGINFR  361
            SGVRIK+A+GRGG+VK+IYV+G+   TMKW F M+G+YG H DN +DP A PV+  IN+ 
Sbjct  326  SGVRIKTAVGRGGFVKDIYVRGVTMKTMKWAFWMTGNYGSHADNGYDPNALPVIQNINYH  385

Query  362  DVVADNVTMAGKMEGISGHPYTGVCMANVTIGMAKNGKKPAWNCSNIQGVASGVVPPPCP  541
            D+VA+NVTMA K+EGI G P+TG+C++NVTI +AK  KK  WNC+++ G++SGVVP  C 
Sbjct  386  DMVAENVTMAAKLEGIPGDPFTGICISNVTITLAKKAKKLPWNCTDVAGISSGVVPQACG  445

Query  542  LLHIQGPVKPGMCDLPPK  595
            LL  QGP     C+ P +
Sbjct  446  LLVDQGPSNVAACNFPEE  463



>gb|EPS72197.1| hypothetical protein M569_02558, partial [Genlisea aurea]
Length=458

 Score =   272 bits (695),  Expect = 5e-84, Method: Compositional matrix adjust.
 Identities = 124/200 (62%), Positives = 160/200 (80%), Gaps = 3/200 (2%)
 Frame = +2

Query  2    VAVKSGWDQYGIKYGKPTKQLIIKRLTCISPYSAAIALGSEMSGGIEDVRASDITAVHTE  181
            VAVKSGWD+YGI YG PTK L I+RLTC+SPYSAAIA+GSEMSGGIEDVRA DITAV TE
Sbjct  250  VAVKSGWDEYGISYGMPTKHLTIRRLTCVSPYSAAIAIGSEMSGGIEDVRAQDITAVGTE  309

Query  182  SGVRIKSAIGRGGYVKNIYVKGLRAHTMKWVFLMSGDYGDHPDNHFDPKAFPVVAGINFR  361
            SG+RIK+ +GRGG+V++++VKG+  HTMKWVF ++G+YG H D ++DP A P + GIN+R
Sbjct  310  SGIRIKTGVGRGGFVRDVFVKGMDLHTMKWVFWITGNYGSHADGNYDPNALPEIRGINYR  369

Query  362  DVVADNVTMAGKMEGISGHPYTGVCMANVTIGMAKNGKKPAWNCSNIQGVASGVVPPPCP  541
            DVVA+NV+MAG++EGI+G P+T +CM+NVTI MA   KK  W+C+++QGV+S V PPPC 
Sbjct  370  DVVAENVSMAGRLEGIAGDPFTEICMSNVTISMAAKAKKYPWSCTDVQGVSSSVDPPPCD  429

Query  542  LLHIQGPVKPGMCDLPPKKT  601
            LL  Q       C+ P + +
Sbjct  430  LLPGQADED---CNFPSEDS  446



>ref|XP_010530415.1| PREDICTED: probable polygalacturonase, partial [Tarenaya hassleriana]
Length=445

 Score =   271 bits (694),  Expect = 5e-84, Method: Compositional matrix adjust.
 Identities = 124/198 (63%), Positives = 160/198 (81%), Gaps = 0/198 (0%)
 Frame = +2

Query  2    VAVKSGWDQYGIKYGKPTKQLIIKRLTCISPYSAAIALGSEMSGGIEDVRASDITAVHTE  181
            +AVKSGWD+YGIKYG PTKQL+I+RLTCISP SA IALGSEMSGGIEDVRA DI A+++E
Sbjct  229  IAVKSGWDEYGIKYGMPTKQLLIRRLTCISPDSAVIALGSEMSGGIEDVRAEDIVAINSE  288

Query  182  SGVRIKSAIGRGGYVKNIYVKGLRAHTMKWVFLMSGDYGDHPDNHFDPKAFPVVAGINFR  361
            SGVRIK+AIGRGGYVK+IYV+G+  +TMK+VF M+G+YG HPD H+DP+A PV+  IN++
Sbjct  289  SGVRIKTAIGRGGYVKDIYVRGMTMNTMKYVFWMTGNYGSHPDEHYDPEALPVIENINYQ  348

Query  362  DVVADNVTMAGKMEGISGHPYTGVCMANVTIGMAKNGKKPAWNCSNIQGVASGVVPPPCP  541
            D+VA+NVTM  ++ GI G  ++G+C++NVTIG+A   KK  WNC+++ G ASGV PPPC 
Sbjct  349  DMVAENVTMPAQLSGIPGDQFSGICISNVTIGLATKPKKVLWNCTDVSGFASGVTPPPCE  408

Query  542  LLHIQGPVKPGMCDLPPK  595
            LL  + P     C+ P +
Sbjct  409  LLPEKQPGTMIPCNFPAE  426



>ref|XP_004245570.1| PREDICTED: probable polygalacturonase [Solanum lycopersicum]
Length=483

 Score =   272 bits (695),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 124/199 (62%), Positives = 159/199 (80%), Gaps = 0/199 (0%)
 Frame = +2

Query  2    VAVKSGWDQYGIKYGKPTKQLIIKRLTCISPYSAAIALGSEMSGGIEDVRASDITAVHTE  181
            +AVKSGWD+YG+ +G PTKQL I+R+TCISP SA IALGSEMSGGI+DVRA DI A++TE
Sbjct  266  IAVKSGWDEYGVAFGMPTKQLAIRRITCISPTSATIALGSEMSGGIQDVRAEDIVAINTE  325

Query  182  SGVRIKSAIGRGGYVKNIYVKGLRAHTMKWVFLMSGDYGDHPDNHFDPKAFPVVAGINFR  361
            S VRIK+A+GRGGYVK+IYV+G+   TMK+VF M+GDYG HPD+++DP A PV+  IN+R
Sbjct  326  SAVRIKTAVGRGGYVKDIYVRGVTMKTMKYVFWMTGDYGSHPDDNYDPNALPVIENINYR  385

Query  362  DVVADNVTMAGKMEGISGHPYTGVCMANVTIGMAKNGKKPAWNCSNIQGVASGVVPPPCP  541
            D+VA+NVT+A K+ GISG P+TG+C++NVTI MA   KK  WNC++I G++SGVVP PC 
Sbjct  386  DMVAENVTIAAKLAGISGDPFTGICISNVTIEMAPKAKKLFWNCTDISGISSGVVPQPCD  445

Query  542  LLHIQGPVKPGMCDLPPKK  598
            LL  QG      C+ P + 
Sbjct  446  LLPDQGMEYASPCNFPTES  464



>ref|XP_008438007.1| PREDICTED: probable polygalacturonase [Cucumis melo]
Length=493

 Score =   272 bits (695),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 121/196 (62%), Positives = 154/196 (79%), Gaps = 0/196 (0%)
 Frame = +2

Query  2    VAVKSGWDQYGIKYGKPTKQLIIKRLTCISPYSAAIALGSEMSGGIEDVRASDITAVHTE  181
            VAVKSGWD+YGI++G PTKQL+++RLTCISP SA IALGSEMSGGI+DVRA DI A+++E
Sbjct  277  VAVKSGWDEYGIRFGLPTKQLVVRRLTCISPTSAVIALGSEMSGGIQDVRAEDIVAINSE  336

Query  182  SGVRIKSAIGRGGYVKNIYVKGLRAHTMKWVFLMSGDYGDHPDNHFDPKAFPVVAGINFR  361
            SGVRIK+ IGRGGYVK+IYV+ +  HTMKW F M+GDYG H D ++DP A PV+ GIN+R
Sbjct  337  SGVRIKTGIGRGGYVKDIYVRRMTMHTMKWAFWMTGDYGSHADKNYDPHALPVIQGINYR  396

Query  362  DVVADNVTMAGKMEGISGHPYTGVCMANVTIGMAKNGKKPAWNCSNIQGVASGVVPPPCP  541
            D+V +N TMA ++EGISG  +T +C++NVTIG+A   KK  W C++++G+ S V PPPC 
Sbjct  397  DMVVENATMAARLEGISGDTFTDICISNVTIGLAPKAKKQPWTCTDVEGITSQVTPPPCD  456

Query  542  LLHIQGPVKPGMCDLP  589
            LL  QG  K   C  P
Sbjct  457  LLPDQGEEKITTCKFP  472



>ref|XP_010276903.1| PREDICTED: probable polygalacturonase isoform X3 [Nelumbo nucifera]
Length=434

 Score =   270 bits (689),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 122/185 (66%), Positives = 152/185 (82%), Gaps = 0/185 (0%)
 Frame = +2

Query  2    VAVKSGWDQYGIKYGKPTKQLIIKRLTCISPYSAAIALGSEMSGGIEDVRASDITAVHTE  181
            +AVKSGWDQYGI +G PTK L+I+RLTCISP SA IALGSEMSGGIEDVRA DI A++TE
Sbjct  216  IAVKSGWDQYGIAFGMPTKGLMIRRLTCISPDSAVIALGSEMSGGIEDVRAEDILAINTE  275

Query  182  SGVRIKSAIGRGGYVKNIYVKGLRAHTMKWVFLMSGDYGDHPDNHFDPKAFPVVAGINFR  361
            SGVRIK+++GRGGYVK+IYV+ +   TMKWVF M+G+YG HPD +FDP A P + GIN+ 
Sbjct  276  SGVRIKTSVGRGGYVKDIYVRRMTMKTMKWVFWMTGNYGSHPDGNFDPNALPAIQGINYG  335

Query  362  DVVADNVTMAGKMEGISGHPYTGVCMANVTIGMAKNGKKPAWNCSNIQGVASGVVPPPCP  541
            D+VA+NVTMA ++EGI+G P+TG+C++NVTIG+A   KK  WNC+NI+G+ S V P PC 
Sbjct  336  DMVAENVTMAARLEGIAGDPFTGICISNVTIGLAATAKKVQWNCTNIEGITSDVTPQPCE  395

Query  542  LLHIQ  556
            LL  Q
Sbjct  396  LLPDQ  400



>ref|XP_004133855.1| PREDICTED: probable polygalacturonase-like [Cucumis sativus]
 gb|KGN56496.1| hypothetical protein Csa_3G121720 [Cucumis sativus]
Length=493

 Score =   271 bits (692),  Expect = 4e-83, Method: Compositional matrix adjust.
 Identities = 122/196 (62%), Positives = 152/196 (78%), Gaps = 0/196 (0%)
 Frame = +2

Query  2    VAVKSGWDQYGIKYGKPTKQLIIKRLTCISPYSAAIALGSEMSGGIEDVRASDITAVHTE  181
            VAVKSGWD+YGI +G PTKQL+++RLTCISP SA IALGSEMSGGIEDVRA DI A+ +E
Sbjct  277  VAVKSGWDEYGISFGLPTKQLVVRRLTCISPTSAVIALGSEMSGGIEDVRAEDIVAIDSE  336

Query  182  SGVRIKSAIGRGGYVKNIYVKGLRAHTMKWVFLMSGDYGDHPDNHFDPKAFPVVAGINFR  361
            SGVRIK+ IGRGGYVK+IYV+ +  HTMKW F M+GDYG H D ++DP A PV+ GIN++
Sbjct  337  SGVRIKTGIGRGGYVKDIYVRRMTMHTMKWAFWMTGDYGSHADKNYDPHALPVIQGINYK  396

Query  362  DVVADNVTMAGKMEGISGHPYTGVCMANVTIGMAKNGKKPAWNCSNIQGVASGVVPPPCP  541
            D+V +N TMA ++EGISG  +T +C++NVTIG+A   KK  W C++I+G+ S V PPPC 
Sbjct  397  DMVVENATMAARLEGISGDTFTDICISNVTIGLAPKAKKQPWTCTDIEGITSQVTPPPCD  456

Query  542  LLHIQGPVKPGMCDLP  589
            LL  QG  K   C  P
Sbjct  457  LLPDQGEEKITTCKFP  472



>ref|XP_004172137.1| PREDICTED: probable polygalacturonase-like [Cucumis sativus]
Length=493

 Score =   271 bits (692),  Expect = 4e-83, Method: Compositional matrix adjust.
 Identities = 122/196 (62%), Positives = 152/196 (78%), Gaps = 0/196 (0%)
 Frame = +2

Query  2    VAVKSGWDQYGIKYGKPTKQLIIKRLTCISPYSAAIALGSEMSGGIEDVRASDITAVHTE  181
            VAVKSGWD+YGI +G PTKQL+++RLTCISP SA IALGSEMSGGIEDVRA DI A+ +E
Sbjct  277  VAVKSGWDEYGISFGLPTKQLVVRRLTCISPTSAVIALGSEMSGGIEDVRAEDIVAIDSE  336

Query  182  SGVRIKSAIGRGGYVKNIYVKGLRAHTMKWVFLMSGDYGDHPDNHFDPKAFPVVAGINFR  361
            SGVRIK+ IGRGGYVK+IYV+ +  HTMKW F M+GDYG H D ++DP A PV+ GIN++
Sbjct  337  SGVRIKTGIGRGGYVKDIYVRRMTMHTMKWAFWMTGDYGSHADKNYDPHALPVIQGINYK  396

Query  362  DVVADNVTMAGKMEGISGHPYTGVCMANVTIGMAKNGKKPAWNCSNIQGVASGVVPPPCP  541
            D+V +N TMA ++EGISG  +T +C++NVTIG+A   KK  W C++I+G+ S V PPPC 
Sbjct  397  DMVVENATMAARLEGISGDTFTDICISNVTIGLAPKAKKQPWTCTDIEGITSQVTPPPCD  456

Query  542  LLHIQGPVKPGMCDLP  589
            LL  QG  K   C  P
Sbjct  457  LLPDQGEEKITTCKFP  472



>ref|XP_010276902.1| PREDICTED: probable polygalacturonase isoform X2 [Nelumbo nucifera]
Length=482

 Score =   270 bits (691),  Expect = 4e-83, Method: Compositional matrix adjust.
 Identities = 122/186 (66%), Positives = 152/186 (82%), Gaps = 0/186 (0%)
 Frame = +2

Query  2    VAVKSGWDQYGIKYGKPTKQLIIKRLTCISPYSAAIALGSEMSGGIEDVRASDITAVHTE  181
            +AVKSGWDQYGI +G PTK L+I+RLTCISP SA IALGSEMSGGIEDVRA DI A++TE
Sbjct  264  IAVKSGWDQYGIAFGMPTKGLMIRRLTCISPDSAVIALGSEMSGGIEDVRAEDILAINTE  323

Query  182  SGVRIKSAIGRGGYVKNIYVKGLRAHTMKWVFLMSGDYGDHPDNHFDPKAFPVVAGINFR  361
            SGVRIK+++GRGGYVK+IYV+ +   TMKWVF M+G+YG HPD +FDP A P + GIN+ 
Sbjct  324  SGVRIKTSVGRGGYVKDIYVRRMTMKTMKWVFWMTGNYGSHPDGNFDPNALPAIQGINYG  383

Query  362  DVVADNVTMAGKMEGISGHPYTGVCMANVTIGMAKNGKKPAWNCSNIQGVASGVVPPPCP  541
            D+VA+NVTMA ++EGI+G P+TG+C++NVTIG+A   KK  WNC+NI+G+ S V P PC 
Sbjct  384  DMVAENVTMAARLEGIAGDPFTGICISNVTIGLAATAKKVQWNCTNIEGITSDVTPQPCE  443

Query  542  LLHIQG  559
            LL  Q 
Sbjct  444  LLPDQA  449



>ref|XP_010276899.1| PREDICTED: probable polygalacturonase isoform X1 [Nelumbo nucifera]
Length=483

 Score =   269 bits (688),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 122/186 (66%), Positives = 152/186 (82%), Gaps = 0/186 (0%)
 Frame = +2

Query  2    VAVKSGWDQYGIKYGKPTKQLIIKRLTCISPYSAAIALGSEMSGGIEDVRASDITAVHTE  181
            +AVKSGWDQYGI +G PTK L+I+RLTCISP SA IALGSEMSGGIEDVRA DI A++TE
Sbjct  265  IAVKSGWDQYGIAFGMPTKGLMIRRLTCISPDSAVIALGSEMSGGIEDVRAEDILAINTE  324

Query  182  SGVRIKSAIGRGGYVKNIYVKGLRAHTMKWVFLMSGDYGDHPDNHFDPKAFPVVAGINFR  361
            SGVRIK+++GRGGYVK+IYV+ +   TMKWVF M+G+YG HPD +FDP A P + GIN+ 
Sbjct  325  SGVRIKTSVGRGGYVKDIYVRRMTMKTMKWVFWMTGNYGSHPDGNFDPNALPAIQGINYG  384

Query  362  DVVADNVTMAGKMEGISGHPYTGVCMANVTIGMAKNGKKPAWNCSNIQGVASGVVPPPCP  541
            D+VA+NVTMA ++EGI+G P+TG+C++NVTIG+A   KK  WNC+NI+G+ S V P PC 
Sbjct  385  DMVAENVTMAARLEGIAGDPFTGICISNVTIGLAATAKKVQWNCTNIEGITSDVTPQPCE  444

Query  542  LLHIQG  559
            LL  Q 
Sbjct  445  LLPDQA  450



>ref|XP_010436419.1| PREDICTED: probable polygalacturonase, partial [Camelina sativa]
Length=358

 Score =   265 bits (677),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 123/196 (63%), Positives = 154/196 (79%), Gaps = 0/196 (0%)
 Frame = +2

Query  2    VAVKSGWDQYGIKYGKPTKQLIIKRLTCISPYSAAIALGSEMSGGIEDVRASDITAVHTE  181
            +AVKSGWDQYGI YG PTKQL+I+RLTCISP SA IALGSEMSGGIEDVRA DI A+ +E
Sbjct  142  IAVKSGWDQYGIAYGMPTKQLLIRRLTCISPDSAVIALGSEMSGGIEDVRAEDIVAIDSE  201

Query  182  SGVRIKSAIGRGGYVKNIYVKGLRAHTMKWVFLMSGDYGDHPDNHFDPKAFPVVAGINFR  361
            SG+RIK+AIGRGGYVK++YV+G+   TMK+VF M+G YG HPD H+DPKA PV+  IN++
Sbjct  202  SGIRIKTAIGRGGYVKDVYVRGMTMKTMKYVFWMTGSYGSHPDEHYDPKALPVIQNINYQ  261

Query  362  DVVADNVTMAGKMEGISGHPYTGVCMANVTIGMAKNGKKPAWNCSNIQGVASGVVPPPCP  541
            D+VA+NVTM  ++ GISG  +TG+C++NVTI ++K  KK  WNC++I G  SGV P PC 
Sbjct  262  DMVAENVTMPAQLAGISGDQFTGICISNVTITLSKKPKKVLWNCTDISGSTSGVTPAPCQ  321

Query  542  LLHIQGPVKPGMCDLP  589
            LL  + P     C+ P
Sbjct  322  LLPEKQPGTIVPCNFP  337



>emb|CDY70893.1| BnaCnng70190D, partial [Brassica napus]
Length=358

 Score =   264 bits (675),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 120/196 (61%), Positives = 155/196 (79%), Gaps = 0/196 (0%)
 Frame = +2

Query  2    VAVKSGWDQYGIKYGKPTKQLIIKRLTCISPYSAAIALGSEMSGGIEDVRASDITAVHTE  181
            +AVKSGWDQYGI YG PTKQL+I+RLTCISP SA IALGSEMSGGIEDVRA DI A+++E
Sbjct  142  IAVKSGWDQYGINYGMPTKQLLIRRLTCISPDSAVIALGSEMSGGIEDVRAEDIVAINSE  201

Query  182  SGVRIKSAIGRGGYVKNIYVKGLRAHTMKWVFLMSGDYGDHPDNHFDPKAFPVVAGINFR  361
            SG+RIK+A+GRGGYVK++YV+G+   TMK+VF M+G YG HPD H+DPKA PV+  IN++
Sbjct  202  SGIRIKTAVGRGGYVKDVYVRGMTMKTMKYVFWMTGSYGSHPDEHYDPKALPVIQNINYQ  261

Query  362  DVVADNVTMAGKMEGISGHPYTGVCMANVTIGMAKNGKKPAWNCSNIQGVASGVVPPPCP  541
            D+VA+NVTM  ++ GI+G  +TG+C++NVTI ++K  KK  WNC+++ G  SGV P PC 
Sbjct  262  DMVAENVTMPAQLAGITGDEFTGICISNVTITLSKKPKKVLWNCTDVSGYTSGVTPEPCQ  321

Query  542  LLHIQGPVKPGMCDLP  589
            LL  + P     C+ P
Sbjct  322  LLPEKQPGTVVPCNFP  337



>emb|CDY69255.1| BnaAnng29830D, partial [Brassica napus]
Length=376

 Score =   265 bits (676),  Expect = 4e-82, Method: Compositional matrix adjust.
 Identities = 120/196 (61%), Positives = 155/196 (79%), Gaps = 0/196 (0%)
 Frame = +2

Query  2    VAVKSGWDQYGIKYGKPTKQLIIKRLTCISPYSAAIALGSEMSGGIEDVRASDITAVHTE  181
            +AVKSGWDQYGI YG PTKQL+I+RLTCISP SA IALGSEMSGGIEDVRA DI A+++E
Sbjct  160  IAVKSGWDQYGINYGMPTKQLLIRRLTCISPDSAVIALGSEMSGGIEDVRAEDIVAINSE  219

Query  182  SGVRIKSAIGRGGYVKNIYVKGLRAHTMKWVFLMSGDYGDHPDNHFDPKAFPVVAGINFR  361
            SG+RIK+A+GRGGYVK++YV+G+   TMK+VF M+G YG HPD H+DPKA PV+  IN++
Sbjct  220  SGIRIKTAVGRGGYVKDVYVRGMTMKTMKYVFWMTGSYGSHPDEHYDPKALPVIQNINYQ  279

Query  362  DVVADNVTMAGKMEGISGHPYTGVCMANVTIGMAKNGKKPAWNCSNIQGVASGVVPPPCP  541
            D+VA+NVTM  ++ GI+G  +TG+C++NVTI ++K  KK  WNC+++ G  SGV P PC 
Sbjct  280  DMVAENVTMPAQLAGITGDEFTGICISNVTITLSKKPKKVLWNCTDVSGYTSGVTPEPCQ  339

Query  542  LLHIQGPVKPGMCDLP  589
            LL  + P     C+ P
Sbjct  340  LLPEKQPGTVVPCNFP  355



>ref|XP_010676424.1| PREDICTED: probable polygalacturonase [Beta vulgaris subsp. vulgaris]
Length=485

 Score =   268 bits (685),  Expect = 4e-82, Method: Compositional matrix adjust.
 Identities = 120/199 (60%), Positives = 153/199 (77%), Gaps = 0/199 (0%)
 Frame = +2

Query  2    VAVKSGWDQYGIKYGKPTKQLIIKRLTCISPYSAAIALGSEMSGGIEDVRASDITAVHTE  181
            VAVKSGWD+YGI YG PT+QL+I+RLTCISP SA IALGSEMSGGI+DVRA DI A+++E
Sbjct  269  VAVKSGWDEYGISYGMPTQQLVIRRLTCISPTSAVIALGSEMSGGIQDVRAEDILAINSE  328

Query  182  SGVRIKSAIGRGGYVKNIYVKGLRAHTMKWVFLMSGDYGDHPDNHFDPKAFPVVAGINFR  361
            SGVRIK+ +GRGG+VK+IYVKG   HTMKW F M+G+YG HPD+ +DPKA P +  IN+R
Sbjct  329  SGVRIKTGVGRGGFVKDIYVKGFTMHTMKWAFWMTGNYGSHPDDKYDPKAIPTIQNINYR  388

Query  362  DVVADNVTMAGKMEGISGHPYTGVCMANVTIGMAKNGKKPAWNCSNIQGVASGVVPPPCP  541
            D+VAD+V MA ++EGISG P+T +C++NVTI +A   KK  W C+++ G++S V P PC 
Sbjct  389  DMVADDVKMAARLEGISGDPFTEICISNVTISLAAKPKKVQWACTDVAGISSDVTPKPCD  448

Query  542  LLHIQGPVKPGMCDLPPKK  598
             L  QGP     C  P  +
Sbjct  449  SLADQGPDHKIQCQFPEDR  467



>ref|XP_006413548.1| hypothetical protein EUTSA_v10025011mg [Eutrema salsugineum]
 gb|ESQ55001.1| hypothetical protein EUTSA_v10025011mg [Eutrema salsugineum]
Length=493

 Score =   268 bits (685),  Expect = 4e-82, Method: Compositional matrix adjust.
 Identities = 122/196 (62%), Positives = 155/196 (79%), Gaps = 0/196 (0%)
 Frame = +2

Query  2    VAVKSGWDQYGIKYGKPTKQLIIKRLTCISPYSAAIALGSEMSGGIEDVRASDITAVHTE  181
            +AVKSGWDQYGI YG PTKQL+I+RLTCISP SA IALGSEMSGGIEDVRA DI A+++E
Sbjct  277  IAVKSGWDQYGISYGMPTKQLLIRRLTCISPDSAVIALGSEMSGGIEDVRAEDIVAINSE  336

Query  182  SGVRIKSAIGRGGYVKNIYVKGLRAHTMKWVFLMSGDYGDHPDNHFDPKAFPVVAGINFR  361
            SG+RIK+AIGRGGYVK++YV+G+   TMK+VF M+G YG HPD H+DPKA PV+  IN++
Sbjct  337  SGIRIKTAIGRGGYVKDVYVRGMTMKTMKYVFWMTGSYGSHPDEHYDPKALPVIQNINYQ  396

Query  362  DVVADNVTMAGKMEGISGHPYTGVCMANVTIGMAKNGKKPAWNCSNIQGVASGVVPPPCP  541
            D+VA+NVTM  ++ GISG  +TG+C++NVTI ++K  KK  WNC+++ G  SGV P PC 
Sbjct  397  DMVAENVTMPAQLAGISGDQFTGICISNVTITLSKKPKKVLWNCTDVSGFTSGVTPEPCQ  456

Query  542  LLHIQGPVKPGMCDLP  589
            LL  + P     C+ P
Sbjct  457  LLPEKQPGTVVPCNFP  472



>ref|XP_002869777.1| glycoside hydrolase family 28 protein [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH46036.1| glycoside hydrolase family 28 protein [Arabidopsis lyrata subsp. 
lyrata]
Length=494

 Score =   268 bits (685),  Expect = 5e-82, Method: Compositional matrix adjust.
 Identities = 122/196 (62%), Positives = 156/196 (80%), Gaps = 0/196 (0%)
 Frame = +2

Query  2    VAVKSGWDQYGIKYGKPTKQLIIKRLTCISPYSAAIALGSEMSGGIEDVRASDITAVHTE  181
            +AVKSGWDQYGI YG PTKQL+I+RLTCISP SA IALGSEMSGGIEDVRA DI A+++E
Sbjct  278  IAVKSGWDQYGINYGMPTKQLLIRRLTCISPDSAVIALGSEMSGGIEDVRAEDIVAINSE  337

Query  182  SGVRIKSAIGRGGYVKNIYVKGLRAHTMKWVFLMSGDYGDHPDNHFDPKAFPVVAGINFR  361
            SG+RIK+AIGRGGYVK++YV+G+  +TMK+VF M+G YG HPD H+DPKA PV+  IN++
Sbjct  338  SGIRIKTAIGRGGYVKDVYVRGMTMNTMKYVFWMTGSYGSHPDEHYDPKALPVIQNINYQ  397

Query  362  DVVADNVTMAGKMEGISGHPYTGVCMANVTIGMAKNGKKPAWNCSNIQGVASGVVPPPCP  541
            D+VA+NVTM  ++ GISG  +TG+C++NVTI ++K  KK  WNC+++ G  SGV P PC 
Sbjct  398  DMVAENVTMPAQLAGISGDQFTGICISNVTITLSKKPKKVLWNCTDVSGYTSGVTPQPCQ  457

Query  542  LLHIQGPVKPGMCDLP  589
            LL  + P     C+ P
Sbjct  458  LLPEKQPGTVVPCNFP  473



>gb|EMS49882.1| putative polygalacturonase [Triticum urartu]
Length=391

 Score =   264 bits (675),  Expect = 7e-82, Method: Compositional matrix adjust.
 Identities = 122/199 (61%), Positives = 155/199 (78%), Gaps = 4/199 (2%)
 Frame = +2

Query  2    VAVKSGWDQYGIKYGKPTKQLIIKRLTCISPYSAAIALGSEMSGGIEDVRASDITAVHTE  181
            +AVKSGWD+YGIK+  P++ ++++RLTCISP SA IALGSEMSGGI+DVR  D TA+ TE
Sbjct  184  IAVKSGWDEYGIKFNMPSQHIVVRRLTCISPTSAMIALGSEMSGGIQDVRVEDNTAIDTE  243

Query  182  SGVRIKSAIGRGGYVKNIYVKGLRAHTMKWVFLMSGDYGDHPDNHFDPKAFPVVAGINFR  361
            S VRIKS +GRGG+V++++V+ L  HTMKWVF M+G+YG HPDN  DPKA P V GIN+R
Sbjct  244  SAVRIKSGVGRGGFVRDVFVRRLSLHTMKWVFWMTGNYGQHPDNSSDPKALPEVTGINYR  303

Query  362  DVVADNVTMAGKMEGISGHPYTGVCMANVTIGMAKNGKKPAWNCSNIQGVASGVVPPPCP  541
            DV A+NVTMAG+MEGI   PYTG+CM+N+T  +A   KK  WNC+++QGVASGV P PCP
Sbjct  304  DVFAENVTMAGRMEGIPNDPYTGICMSNITAQLAPKAKKLQWNCTDVQGVASGVSPEPCP  363

Query  542  LLHIQGPVKPGMCDLPPKK  598
             L  +G  KP  C  P ++
Sbjct  364  ELGAEG--KP--CTFPEEE  378



>ref|NP_194081.1| putative polygalacturonase [Arabidopsis thaliana]
 emb|CAA20471.1| putative protein [Arabidopsis thaliana]
 emb|CAB79305.1| putative protein [Arabidopsis thaliana]
 gb|AAN13048.1| unknown protein [Arabidopsis thaliana]
 dbj|BAD95012.1| hypothetical protein [Arabidopsis thaliana]
 gb|AEE84768.1| putative polygalacturonase [Arabidopsis thaliana]
Length=495

 Score =   267 bits (682),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 122/196 (62%), Positives = 156/196 (80%), Gaps = 0/196 (0%)
 Frame = +2

Query  2    VAVKSGWDQYGIKYGKPTKQLIIKRLTCISPYSAAIALGSEMSGGIEDVRASDITAVHTE  181
            +AVKSGWDQYGI YG PTKQL+I+RLTCISP SA IALGSEMSGGIEDVRA DI A+++E
Sbjct  279  IAVKSGWDQYGINYGMPTKQLLIRRLTCISPDSAVIALGSEMSGGIEDVRAEDIVAINSE  338

Query  182  SGVRIKSAIGRGGYVKNIYVKGLRAHTMKWVFLMSGDYGDHPDNHFDPKAFPVVAGINFR  361
            SG+RIK+AIGRGGYVK++YV+G+   TMK+VF M+G YG HPD+H+DPKA PV+  IN++
Sbjct  339  SGIRIKTAIGRGGYVKDVYVRGMTMMTMKYVFWMTGSYGSHPDDHYDPKALPVIQNINYQ  398

Query  362  DVVADNVTMAGKMEGISGHPYTGVCMANVTIGMAKNGKKPAWNCSNIQGVASGVVPPPCP  541
            D+VA+NVTM  ++ GISG  +TG+C++NVTI ++K  KK  WNC+++ G  SGV P PC 
Sbjct  399  DMVAENVTMPAQLAGISGDQFTGICISNVTITLSKKPKKVLWNCTDVSGYTSGVTPQPCQ  458

Query  542  LLHIQGPVKPGMCDLP  589
            LL  + P     C+ P
Sbjct  459  LLPEKQPGTVVPCNFP  474



>ref|XP_008780530.1| PREDICTED: probable polygalacturonase, partial [Phoenix dactylifera]
Length=213

 Score =   258 bits (658),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 116/186 (62%), Positives = 153/186 (82%), Gaps = 0/186 (0%)
 Frame = +2

Query  2    VAVKSGWDQYGIKYGKPTKQLIIKRLTCISPYSAAIALGSEMSGGIEDVRASDITAVHTE  181
            +A+KSGWD+YGI +  PT+ + I+RLTCISP+SA IALGSEMSGGI+DVRA +ITA++TE
Sbjct  27   IAIKSGWDEYGIAFNMPTQHVNIRRLTCISPFSATIALGSEMSGGIQDVRAENITAINTE  86

Query  182  SGVRIKSAIGRGGYVKNIYVKGLRAHTMKWVFLMSGDYGDHPDNHFDPKAFPVVAGINFR  361
            SGVRIK+A+GRGG+VK+I+V+G+  +TMK+VF MSG+YG HPD+ +DP A PVV  I + 
Sbjct  87   SGVRIKTAVGRGGFVKDIFVRGMTLNTMKYVFWMSGNYGQHPDDKYDPNAIPVVRNIRYS  146

Query  362  DVVADNVTMAGKMEGISGHPYTGVCMANVTIGMAKNGKKPAWNCSNIQGVASGVVPPPCP  541
            +VVA+NVT+AG +EGI G P+TG+C++NVTI +A + KK  WNC+ I+GVAS V P PC 
Sbjct  147  NVVAENVTIAGHLEGIPGAPFTGICLSNVTIDVAHSKKKLKWNCTEIEGVASAVTPTPCA  206

Query  542  LLHIQG  559
            LL  QG
Sbjct  207  LLRDQG  212



>ref|XP_010448699.1| PREDICTED: probable polygalacturonase [Camelina sativa]
Length=490

 Score =   266 bits (681),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 123/196 (63%), Positives = 154/196 (79%), Gaps = 0/196 (0%)
 Frame = +2

Query  2    VAVKSGWDQYGIKYGKPTKQLIIKRLTCISPYSAAIALGSEMSGGIEDVRASDITAVHTE  181
            +AVKSGWDQYGI YG PTKQL+I+RLTCISP SA IALGSEMSGGIEDVRA DI A+ +E
Sbjct  281  IAVKSGWDQYGIAYGMPTKQLLIRRLTCISPDSAVIALGSEMSGGIEDVRAEDIVAIDSE  340

Query  182  SGVRIKSAIGRGGYVKNIYVKGLRAHTMKWVFLMSGDYGDHPDNHFDPKAFPVVAGINFR  361
            SG+RIK+AIGRGGYVK++YV+G+   TMK+VF M+G YG HPD H+DPKA PV+  IN++
Sbjct  341  SGIRIKTAIGRGGYVKDVYVRGMTMKTMKYVFWMTGSYGSHPDEHYDPKALPVIQNINYQ  400

Query  362  DVVADNVTMAGKMEGISGHPYTGVCMANVTIGMAKNGKKPAWNCSNIQGVASGVVPPPCP  541
            D+VA+NVTM  ++ GISG  +TG+C++NVTI ++K  KK  WNC++I G  SGV P PC 
Sbjct  401  DMVAENVTMPAQLAGISGDQFTGICISNVTITLSKKPKKVLWNCTDISGYTSGVTPAPCQ  460

Query  542  LLHIQGPVKPGMCDLP  589
            LL  + P     C+ P
Sbjct  461  LLPEKQPGTIVPCNFP  476



>ref|XP_010089055.1| putative polygalacturonase [Morus notabilis]
 gb|EXB37302.1| putative polygalacturonase [Morus notabilis]
Length=471

 Score =   266 bits (679),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 122/196 (62%), Positives = 153/196 (78%), Gaps = 0/196 (0%)
 Frame = +2

Query  2    VAVKSGWDQYGIKYGKPTKQLIIKRLTCISPYSAAIALGSEMSGGIEDVRASDITAVHTE  181
            VAVKSG DQYGI +G PTK L+I+RLTCISP SA IALGSEMSGG++DVRA +I A+ +E
Sbjct  255  VAVKSGLDQYGIAFGMPTKHLVIRRLTCISPTSAVIALGSEMSGGVQDVRAENIVAISSE  314

Query  182  SGVRIKSAIGRGGYVKNIYVKGLRAHTMKWVFLMSGDYGDHPDNHFDPKAFPVVAGINFR  361
            SGVRIK+  GRGG+VK+IYVKG+  HTM+WVF M+G+YG H DN +DP A PV+  IN+R
Sbjct  315  SGVRIKTGKGRGGFVKDIYVKGMTMHTMRWVFWMTGNYGSHADNGYDPNALPVIQNINYR  374

Query  362  DVVADNVTMAGKMEGISGHPYTGVCMANVTIGMAKNGKKPAWNCSNIQGVASGVVPPPCP  541
            D+VA+NVTMA  +EGI G P+TG+C++NVTI +A+  KK  WNC++I G++SGVVP  C 
Sbjct  375  DMVAENVTMASWLEGIPGDPFTGICISNVTIALAETAKKLQWNCTDIAGISSGVVPHTCE  434

Query  542  LLHIQGPVKPGMCDLP  589
            LL  Q   K   CD P
Sbjct  435  LLANQSLEKWTTCDFP  450



>ref|XP_006283603.1| hypothetical protein CARUB_v10004660mg [Capsella rubella]
 gb|ACC91278.1| glycoside hydrolase family 28 protein [Capsella rubella]
 gb|EOA16501.1| hypothetical protein CARUB_v10004660mg [Capsella rubella]
Length=494

 Score =   266 bits (680),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 122/196 (62%), Positives = 154/196 (79%), Gaps = 0/196 (0%)
 Frame = +2

Query  2    VAVKSGWDQYGIKYGKPTKQLIIKRLTCISPYSAAIALGSEMSGGIEDVRASDITAVHTE  181
            +AVKSGWDQYGI YG PTKQL+I+RLTCISP SA IALGSEMSGGIEDVRA DI A+ +E
Sbjct  278  IAVKSGWDQYGIAYGMPTKQLLIRRLTCISPDSAVIALGSEMSGGIEDVRAEDIVAIDSE  337

Query  182  SGVRIKSAIGRGGYVKNIYVKGLRAHTMKWVFLMSGDYGDHPDNHFDPKAFPVVAGINFR  361
            SG+RIK+AIGRGGYVK++YV+G+   TMK+VF M+G YG HPD H+DPKA PV+  IN++
Sbjct  338  SGIRIKTAIGRGGYVKDVYVRGMTMKTMKYVFWMTGSYGSHPDEHYDPKALPVIQNINYQ  397

Query  362  DVVADNVTMAGKMEGISGHPYTGVCMANVTIGMAKNGKKPAWNCSNIQGVASGVVPPPCP  541
            D+VA+NVTM  ++ GISG  +TG+C++NVTI ++K  KK  WNC+++ G  SGV P PC 
Sbjct  398  DMVAENVTMPAQLAGISGDQFTGICISNVTITLSKKPKKVLWNCTDVSGYTSGVTPAPCQ  457

Query  542  LLHIQGPVKPGMCDLP  589
            LL  + P     C+ P
Sbjct  458  LLPEKQPGTVVPCNFP  473



>ref|XP_009137356.1| PREDICTED: probable polygalacturonase [Brassica rapa]
Length=493

 Score =   266 bits (680),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 120/196 (61%), Positives = 155/196 (79%), Gaps = 0/196 (0%)
 Frame = +2

Query  2    VAVKSGWDQYGIKYGKPTKQLIIKRLTCISPYSAAIALGSEMSGGIEDVRASDITAVHTE  181
            +AVKSGWDQYGI YG PTKQL+I+RLTCISP SA IALGSEMSGGIEDVRA DI A+++E
Sbjct  277  IAVKSGWDQYGINYGMPTKQLLIRRLTCISPDSAVIALGSEMSGGIEDVRAEDIVAINSE  336

Query  182  SGVRIKSAIGRGGYVKNIYVKGLRAHTMKWVFLMSGDYGDHPDNHFDPKAFPVVAGINFR  361
            SG+RIK+A+GRGGYVK++YV+G+   TMK+VF M+G YG HPD H+DPKA PV+  IN++
Sbjct  337  SGIRIKTAVGRGGYVKDVYVRGMTMKTMKYVFWMTGSYGSHPDEHYDPKALPVIQNINYQ  396

Query  362  DVVADNVTMAGKMEGISGHPYTGVCMANVTIGMAKNGKKPAWNCSNIQGVASGVVPPPCP  541
            D+VA+NVTM  ++ GI+G  +TG+C++NVTI ++K  KK  WNC+++ G  SGV P PC 
Sbjct  397  DMVAENVTMPAQLAGITGDEFTGICISNVTITLSKKPKKVLWNCTDVSGYTSGVTPEPCQ  456

Query  542  LLHIQGPVKPGMCDLP  589
            LL  + P     C+ P
Sbjct  457  LLPEKQPGTVVPCNFP  472



>ref|XP_010439166.1| PREDICTED: probable polygalacturonase [Camelina sativa]
Length=497

 Score =   266 bits (679),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 122/196 (62%), Positives = 154/196 (79%), Gaps = 0/196 (0%)
 Frame = +2

Query  2    VAVKSGWDQYGIKYGKPTKQLIIKRLTCISPYSAAIALGSEMSGGIEDVRASDITAVHTE  181
            +AVKSGWDQYGI YG PTKQL+I+RLTCISP SA IALGSEMSGGIEDVRA DI A+ +E
Sbjct  281  IAVKSGWDQYGIAYGMPTKQLLIRRLTCISPDSAVIALGSEMSGGIEDVRAEDIVAIDSE  340

Query  182  SGVRIKSAIGRGGYVKNIYVKGLRAHTMKWVFLMSGDYGDHPDNHFDPKAFPVVAGINFR  361
            SG+RIK+AIGRGGYVK++YV+G+   TMK+VF M+G YG HPD H+DPKA PV+  IN++
Sbjct  341  SGIRIKTAIGRGGYVKDVYVRGMTMKTMKYVFWMTGSYGSHPDEHYDPKALPVIQNINYQ  400

Query  362  DVVADNVTMAGKMEGISGHPYTGVCMANVTIGMAKNGKKPAWNCSNIQGVASGVVPPPCP  541
            D+VA+NVTM  ++ GISG  +TG+C++NVTI ++K  KK  WNC+++ G  SGV P PC 
Sbjct  401  DMVAENVTMPAQLAGISGDQFTGICISNVTITLSKKPKKVLWNCTDVSGYTSGVTPAPCQ  460

Query  542  LLHIQGPVKPGMCDLP  589
            LL  + P     C+ P
Sbjct  461  LLPEKQPGTVVPCNFP  476



>ref|XP_003592201.1| Polygalacturonase-like protein [Medicago truncatula]
Length=478

 Score =   265 bits (678),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 122/199 (61%), Positives = 156/199 (78%), Gaps = 4/199 (2%)
 Frame = +2

Query  2    VAVKSGWDQYGIKYGKPTKQLIIKRLTCISPYSAAIALGSEMSGGIEDVRASDITAVHTE  181
            +A+KSGWD+YGIK G P++Q+II+RLTCISP SA +ALGSEMSGGI+DVR  D+TA++TE
Sbjct  266  IAIKSGWDEYGIKVGMPSQQIIIRRLTCISPDSAMVALGSEMSGGIQDVRIEDVTAINTE  325

Query  182  SGVRIKSAIGRGGYVKNIYVKGLRAHTMKWVFLMSGDYGDHPDNHFDPKAFPVVAGINFR  361
            S +RIKSA+GRG +VK+I+VKG+  +TMK+VF M+G YGDHPDN FDP A P ++GIN+R
Sbjct  326  SAIRIKSAVGRGAFVKDIFVKGMDLNTMKYVFWMTGSYGDHPDNGFDPNALPKISGINYR  385

Query  362  DVVADNVTMAGKMEGISGHPYTGVCMANVTIGMAKNGKKPAWNCSNIQGVASGVVPPPCP  541
            DV A NVT+AGK+EGIS  P+TG+C++NVTI M+ + KK  WNC++I GV S VVP PC 
Sbjct  386  DVTAKNVTIAGKLEGISNDPFTGICVSNVTIEMSAHKKKLPWNCTDISGVTSNVVPKPCE  445

Query  542  LLHIQGPVKPGMCDLPPKK  598
            LL      K   C  P  K
Sbjct  446  LLQ----EKEIECPFPTDK  460



>gb|AES62452.2| pectin lyase superfamily protein [Medicago truncatula]
Length=473

 Score =   265 bits (677),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 122/199 (61%), Positives = 156/199 (78%), Gaps = 4/199 (2%)
 Frame = +2

Query  2    VAVKSGWDQYGIKYGKPTKQLIIKRLTCISPYSAAIALGSEMSGGIEDVRASDITAVHTE  181
            +A+KSGWD+YGIK G P++Q+II+RLTCISP SA +ALGSEMSGGI+DVR  D+TA++TE
Sbjct  261  IAIKSGWDEYGIKVGMPSQQIIIRRLTCISPDSAMVALGSEMSGGIQDVRIEDVTAINTE  320

Query  182  SGVRIKSAIGRGGYVKNIYVKGLRAHTMKWVFLMSGDYGDHPDNHFDPKAFPVVAGINFR  361
            S +RIKSA+GRG +VK+I+VKG+  +TMK+VF M+G YGDHPDN FDP A P ++GIN+R
Sbjct  321  SAIRIKSAVGRGAFVKDIFVKGMDLNTMKYVFWMTGSYGDHPDNGFDPNALPKISGINYR  380

Query  362  DVVADNVTMAGKMEGISGHPYTGVCMANVTIGMAKNGKKPAWNCSNIQGVASGVVPPPCP  541
            DV A NVT+AGK+EGIS  P+TG+C++NVTI M+ + KK  WNC++I GV S VVP PC 
Sbjct  381  DVTAKNVTIAGKLEGISNDPFTGICVSNVTIEMSAHKKKLPWNCTDISGVTSNVVPKPCE  440

Query  542  LLHIQGPVKPGMCDLPPKK  598
            LL      K   C  P  K
Sbjct  441  LLQ----EKEIECPFPTDK  455



>ref|XP_009137085.1| PREDICTED: probable polygalacturonase [Brassica rapa]
Length=493

 Score =   265 bits (678),  Expect = 4e-81, Method: Compositional matrix adjust.
 Identities = 120/196 (61%), Positives = 154/196 (79%), Gaps = 0/196 (0%)
 Frame = +2

Query  2    VAVKSGWDQYGIKYGKPTKQLIIKRLTCISPYSAAIALGSEMSGGIEDVRASDITAVHTE  181
            +AVKSGWDQYGI YG PTKQL+I+RLTCISP SA IALGSEMSGGIEDVRA DI A+++E
Sbjct  277  IAVKSGWDQYGINYGMPTKQLLIRRLTCISPDSAVIALGSEMSGGIEDVRAEDIIAINSE  336

Query  182  SGVRIKSAIGRGGYVKNIYVKGLRAHTMKWVFLMSGDYGDHPDNHFDPKAFPVVAGINFR  361
            SG+RIK+AIGRGGYVK++YV+G+   TMK+VF M+G YG HPD H+DP A PV+  IN++
Sbjct  337  SGIRIKTAIGRGGYVKDVYVRGMTMQTMKYVFWMTGSYGSHPDEHYDPNALPVIQNINYQ  396

Query  362  DVVADNVTMAGKMEGISGHPYTGVCMANVTIGMAKNGKKPAWNCSNIQGVASGVVPPPCP  541
            D+VA+NVTM  ++ GI+G  +TG+C++NVTI ++K  KK  WNC+++ G  SGV P PC 
Sbjct  397  DMVAENVTMPAQLAGITGDQFTGICISNVTITLSKKPKKVLWNCTDVSGYTSGVTPEPCQ  456

Query  542  LLHIQGPVKPGMCDLP  589
            LL  + P     C+ P
Sbjct  457  LLPEKQPGTVVPCNFP  472



>ref|XP_010230291.1| PREDICTED: probable polygalacturonase, partial [Brachypodium 
distachyon]
Length=433

 Score =   263 bits (673),  Expect = 4e-81, Method: Compositional matrix adjust.
 Identities = 123/199 (62%), Positives = 157/199 (79%), Gaps = 4/199 (2%)
 Frame = +2

Query  2    VAVKSGWDQYGIKYGKPTKQLIIKRLTCISPYSAAIALGSEMSGGIEDVRASDITAVHTE  181
            +AVKSGWD+YGIK+  P++ ++++RLTCISP SA IALGSEMSGGI+DVRA D  A++TE
Sbjct  226  IAVKSGWDEYGIKFNMPSQHIVVRRLTCISPTSAMIALGSEMSGGIQDVRAEDNIAINTE  285

Query  182  SGVRIKSAIGRGGYVKNIYVKGLRAHTMKWVFLMSGDYGDHPDNHFDPKAFPVVAGINFR  361
            S VRIKS +GRGG+VK+++V+GL  HTMKWVF M+G+YG HPDN  +PKA P V GIN+R
Sbjct  286  SAVRIKSGVGRGGFVKDVFVRGLSLHTMKWVFWMTGNYGQHPDNSSNPKALPEVTGINYR  345

Query  362  DVVADNVTMAGKMEGISGHPYTGVCMANVTIGMAKNGKKPAWNCSNIQGVASGVVPPPCP  541
            DV A+NVTMAG+MEGI   PYTG+CM+NVT  +A + KK  WNC++++GVASGV P PCP
Sbjct  346  DVFAENVTMAGRMEGIPNDPYTGICMSNVTAQLAPDAKKLQWNCTDVKGVASGVSPKPCP  405

Query  542  LLHIQGPVKPGMCDLPPKK  598
             L   G  KP  C  P ++
Sbjct  406  ELGAVG--KP--CTFPEEE  420



>ref|XP_009607671.1| PREDICTED: probable polygalacturonase [Nicotiana tomentosiformis]
Length=472

 Score =   265 bits (676),  Expect = 5e-81, Method: Compositional matrix adjust.
 Identities = 120/185 (65%), Positives = 153/185 (83%), Gaps = 0/185 (0%)
 Frame = +2

Query  2    VAVKSGWDQYGIKYGKPTKQLIIKRLTCISPYSAAIALGSEMSGGIEDVRASDITAVHTE  181
            +AVKSGWD+YGI +G PT+ LII+RLTCISP SA IALGSEMSGGI+DVRA +ITA+ +E
Sbjct  261  IAVKSGWDEYGIAFGMPTQHLIIRRLTCISPDSAVIALGSEMSGGIQDVRAENITAISSE  320

Query  182  SGVRIKSAIGRGGYVKNIYVKGLRAHTMKWVFLMSGDYGDHPDNHFDPKAFPVVAGINFR  361
            SGVRIK+AIGRG YVK+++VKG+   TMK+ F M+GDYG HPD+HFDPKA PV+ GINFR
Sbjct  321  SGVRIKTAIGRGAYVKDVFVKGMTLQTMKYTFWMTGDYGSHPDDHFDPKALPVIQGINFR  380

Query  362  DVVADNVTMAGKMEGISGHPYTGVCMANVTIGMAKNGKKPAWNCSNIQGVASGVVPPPCP  541
            DVV+ NVT+AGK+ GI    ++G+C++NV+I ++++ KK  WNCS+IQGV+S V P PC 
Sbjct  381  DVVSKNVTIAGKLVGIKNDTFSGICISNVSIELSEHAKKQPWNCSDIQGVSSQVSPQPCA  440

Query  542  LLHIQ  556
            LL  Q
Sbjct  441  LLPDQ  445



>dbj|BAK02492.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=378

 Score =   260 bits (664),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 120/199 (60%), Positives = 154/199 (77%), Gaps = 4/199 (2%)
 Frame = +2

Query  2    VAVKSGWDQYGIKYGKPTKQLIIKRLTCISPYSAAIALGSEMSGGIEDVRASDITAVHTE  181
            +AVKSGWD+YGI++  P++ ++++RLTCISP SA IALGSEMSGGI+DVR  D  A++TE
Sbjct  171  IAVKSGWDEYGIRFNMPSQHIVVRRLTCISPTSAMIALGSEMSGGIQDVRVEDNIAINTE  230

Query  182  SGVRIKSAIGRGGYVKNIYVKGLRAHTMKWVFLMSGDYGDHPDNHFDPKAFPVVAGINFR  361
            S VRIKS +GRGG+V++++V+ L  HTMKWVF M+G+YG HPDN  DPKA P V GIN+R
Sbjct  231  SAVRIKSGVGRGGFVRDVFVRRLSLHTMKWVFWMTGNYGQHPDNSSDPKALPEVTGINYR  290

Query  362  DVVADNVTMAGKMEGISGHPYTGVCMANVTIGMAKNGKKPAWNCSNIQGVASGVVPPPCP  541
            DV A+NVTMAG+MEGI   PYTG+CM+NVT  +A   KK  WNC+++QGVA GV P PCP
Sbjct  291  DVFAENVTMAGRMEGIPNDPYTGICMSNVTAQLAPKAKKLQWNCTDVQGVAYGVSPEPCP  350

Query  542  LLHIQGPVKPGMCDLPPKK  598
             L  +G  KP  C  P ++
Sbjct  351  ELGAEG--KP--CTFPDEE  365



>gb|KFK28901.1| hypothetical protein AALP_AA7G062800 [Arabis alpina]
Length=494

 Score =   263 bits (673),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 119/196 (61%), Positives = 154/196 (79%), Gaps = 0/196 (0%)
 Frame = +2

Query  2    VAVKSGWDQYGIKYGKPTKQLIIKRLTCISPYSAAIALGSEMSGGIEDVRASDITAVHTE  181
            +AVKSGWDQYGI YG PTKQL+I+RLTCISP SA IALGSEMSGGIEDVRA DI A+++E
Sbjct  278  IAVKSGWDQYGINYGMPTKQLLIRRLTCISPDSAVIALGSEMSGGIEDVRAEDIVAINSE  337

Query  182  SGVRIKSAIGRGGYVKNIYVKGLRAHTMKWVFLMSGDYGDHPDNHFDPKAFPVVAGINFR  361
            S +RIK+AIGRGGYVK++YV+G+  +TMK+VF M+G YG HPD H+DP A PV+  IN++
Sbjct  338  SAIRIKTAIGRGGYVKDVYVRGMTMNTMKYVFWMTGSYGSHPDEHYDPNALPVIQNINYQ  397

Query  362  DVVADNVTMAGKMEGISGHPYTGVCMANVTIGMAKNGKKPAWNCSNIQGVASGVVPPPCP  541
            D+VA+NVTM  ++ GI+G  +TG+C++NVTI ++K  KK  WNC+++ G  SGV P PC 
Sbjct  398  DMVAENVTMPAQLAGITGDQFTGICISNVTITLSKKPKKVLWNCTDVSGFTSGVTPQPCQ  457

Query  542  LLHIQGPVKPGMCDLP  589
            LL  + P     C+ P
Sbjct  458  LLPEKEPGTIVPCNFP  473



>gb|EPS71449.1| hypothetical protein M569_03308, partial [Genlisea aurea]
Length=445

 Score =   261 bits (668),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 120/196 (61%), Positives = 155/196 (79%), Gaps = 1/196 (1%)
 Frame = +2

Query  2    VAVKSGWDQYGIKYGKPTKQLIIKRLTCISPYSAAIALGSEMSGGIEDVRASDITAVHTE  181
            VAVKSGWD+YGI  G PTK L+I+RLTCISP SA IALGSEMSGGIEDVRA DITA+++E
Sbjct  241  VAVKSGWDEYGIAVGLPTKGLLIRRLTCISPTSAVIALGSEMSGGIEDVRAEDITAINSE  300

Query  182  SGVRIKSAIGRGGYVKNIYVKGLRAHTMKWVFLMSGDYGDHPDNHFDPKAFPVVAGINFR  361
            SG+RIK+ +GRGGYVK+I+V+ +   TMKWVF M+G+YG HPD+ +DP A P++  IN+R
Sbjct  301  SGIRIKTGVGRGGYVKDIFVRRMTMRTMKWVFWMTGNYGSHPDDKYDPNALPLIKNINYR  360

Query  362  DVVADNVTMAGKMEGISGHPYTGVCMANVTIGMAKNGKKPAWNCSNIQGVASGVVPPPCP  541
            D+VA+NVTMAG + GI+G  +  +C+ANVTI +AKN K  AWNC++++G++ GVVP PC 
Sbjct  361  DMVAENVTMAGWLTGIAGDTFRDICIANVTIELAKNSKL-AWNCTDVEGISMGVVPQPCD  419

Query  542  LLHIQGPVKPGMCDLP  589
             L  + P   G CD P
Sbjct  420  ALPEKEPEDDGSCDFP  435



>ref|XP_003592202.1| hypothetical protein MTR_1g100060 [Medicago truncatula]
Length=487

 Score =   262 bits (669),  Expect = 7e-80, Method: Compositional matrix adjust.
 Identities = 117/182 (64%), Positives = 152/182 (84%), Gaps = 0/182 (0%)
 Frame = +2

Query  2    VAVKSGWDQYGIKYGKPTKQLIIKRLTCISPYSAAIALGSEMSGGIEDVRASDITAVHTE  181
            +A+KSGWD+YGIK GKP++ +I++RLTCISP SA +ALGSEMSGGI+DVR  D+TA++TE
Sbjct  275  IAIKSGWDEYGIKVGKPSQNIIVRRLTCISPKSALVALGSEMSGGIQDVRIEDVTAINTE  334

Query  182  SGVRIKSAIGRGGYVKNIYVKGLRAHTMKWVFLMSGDYGDHPDNHFDPKAFPVVAGINFR  361
            S VRIKSA+GRG +VK+I+VKG+  +T+K+VF M+G YGDHPDN FDP A P ++GIN+R
Sbjct  335  SAVRIKSAVGRGAFVKDIFVKGMDLNTLKYVFWMTGSYGDHPDNGFDPNALPKISGINYR  394

Query  362  DVVADNVTMAGKMEGISGHPYTGVCMANVTIGMAKNGKKPAWNCSNIQGVASGVVPPPCP  541
            DV A NVT+AGK+EGIS  P+TG+C++NVTI M+ + KK  WNC++I GV S VVP PC 
Sbjct  395  DVTAKNVTIAGKVEGISNDPFTGICVSNVTIEMSAHKKKLPWNCTDISGVTSNVVPKPCE  454

Query  542  LL  547
            LL
Sbjct  455  LL  456



>emb|CDY44105.1| BnaA01g13130D [Brassica napus]
Length=452

 Score =   261 bits (666),  Expect = 8e-80, Method: Compositional matrix adjust.
 Identities = 118/196 (60%), Positives = 153/196 (78%), Gaps = 0/196 (0%)
 Frame = +2

Query  2    VAVKSGWDQYGIKYGKPTKQLIIKRLTCISPYSAAIALGSEMSGGIEDVRASDITAVHTE  181
            +AVKSGWDQYGI YG PTKQL+I+RLTCISP SA IALGSEMSGGIEDVRA DI A+++E
Sbjct  236  IAVKSGWDQYGINYGMPTKQLLIRRLTCISPDSAVIALGSEMSGGIEDVRAEDIVAINSE  295

Query  182  SGVRIKSAIGRGGYVKNIYVKGLRAHTMKWVFLMSGDYGDHPDNHFDPKAFPVVAGINFR  361
            SG+RIK+AIGRGGYVK++YV+G+   TMK+VF M+G YG HPD H+D  A P++  IN++
Sbjct  296  SGIRIKTAIGRGGYVKDVYVRGMTMQTMKYVFWMTGSYGSHPDEHYDLNALPLIQNINYQ  355

Query  362  DVVADNVTMAGKMEGISGHPYTGVCMANVTIGMAKNGKKPAWNCSNIQGVASGVVPPPCP  541
            D+VA+NVTM  ++ GI+G  +TG+C++NVTI ++K  KK  WNC+++ G  SGV P PC 
Sbjct  356  DMVAENVTMPAQLAGITGDQFTGICISNVTITLSKKPKKVLWNCTDVSGYTSGVTPEPCQ  415

Query  542  LLHIQGPVKPGMCDLP  589
            LL  + P     C+ P
Sbjct  416  LLPEKQPGTVVPCNFP  431



>ref|XP_002273177.2| PREDICTED: probable polygalacturonase [Vitis vinifera]
Length=465

 Score =   261 bits (666),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 117/183 (64%), Positives = 152/183 (83%), Gaps = 0/183 (0%)
 Frame = +2

Query  2    VAVKSGWDQYGIKYGKPTKQLIIKRLTCISPYSAAIALGSEMSGGIEDVRASDITAVHTE  181
            +AVKSGWDQYGIK+G PT+ LII+RLTCISP SA IALGSEMSGGI++VRA +ITA+ +E
Sbjct  256  IAVKSGWDQYGIKFGMPTEDLIIRRLTCISPDSAVIALGSEMSGGIKNVRAENITAIDSE  315

Query  182  SGVRIKSAIGRGGYVKNIYVKGLRAHTMKWVFLMSGDYGDHPDNHFDPKAFPVVAGINFR  361
            SGVRIKS +GRGGYVK+IY +G+   TMK+VF M+GDYG HPD+ +DPKA P +  IN+R
Sbjct  316  SGVRIKSGVGRGGYVKDIYARGMTMKTMKYVFWMTGDYGQHPDDGWDPKALPKIENINYR  375

Query  362  DVVADNVTMAGKMEGISGHPYTGVCMANVTIGMAKNGKKPAWNCSNIQGVASGVVPPPCP  541
            D+VA+NVT + +++GISG P+TG+C++NV IG+ +  KK  WNC+N++GV+S V PP C 
Sbjct  376  DMVAENVTYSARLDGISGDPFTGICISNVKIGLTEKPKKLQWNCTNVEGVSSQVTPPSCD  435

Query  542  LLH  550
            LLH
Sbjct  436  LLH  438



>ref|XP_009772512.1| PREDICTED: probable polygalacturonase [Nicotiana sylvestris]
Length=473

 Score =   261 bits (667),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 118/185 (64%), Positives = 152/185 (82%), Gaps = 0/185 (0%)
 Frame = +2

Query  2    VAVKSGWDQYGIKYGKPTKQLIIKRLTCISPYSAAIALGSEMSGGIEDVRASDITAVHTE  181
            +AVKSGWD+YGI +G PT+ LII+RLTCISP SA IALGSEMSGGI+DVRA +ITA+ +E
Sbjct  262  IAVKSGWDEYGIAFGMPTQHLIIRRLTCISPDSAVIALGSEMSGGIQDVRAENITAISSE  321

Query  182  SGVRIKSAIGRGGYVKNIYVKGLRAHTMKWVFLMSGDYGDHPDNHFDPKAFPVVAGINFR  361
            SGVRIK+AIGRG YVK+++VKG+   TMK+ F M+GDYG HPD+HFDPKA PV+ GINFR
Sbjct  322  SGVRIKTAIGRGAYVKDVFVKGMSLQTMKYTFWMTGDYGSHPDDHFDPKALPVIQGINFR  381

Query  362  DVVADNVTMAGKMEGISGHPYTGVCMANVTIGMAKNGKKPAWNCSNIQGVASGVVPPPCP  541
            DV++ NVT+AGK+ GI    ++G+C++NV+I ++++ KK  WNCS+IQGV+S V P  C 
Sbjct  382  DVISKNVTIAGKLVGIKDDTFSGICISNVSIELSEHAKKQPWNCSDIQGVSSQVSPQACA  441

Query  542  LLHIQ  556
            LL  Q
Sbjct  442  LLPDQ  446



>ref|XP_007038809.1| Pectin lyase-like superfamily protein isoform 2 [Theobroma cacao]
 gb|EOY23310.1| Pectin lyase-like superfamily protein isoform 2 [Theobroma cacao]
Length=473

 Score =   261 bits (667),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 121/199 (61%), Positives = 150/199 (75%), Gaps = 4/199 (2%)
 Frame = +2

Query  2    VAVKSGWDQYGIKYGKPTKQLIIKRLTCISPYSAAIALGSEMSGGIEDVRASDITAVHTE  181
            +AVKSGWDQYGIK+  PTK L+I+R TCISP SA IALGSEMSGGIEDVRA DITA++T+
Sbjct  262  IAVKSGWDQYGIKFNMPTKHLVIRRFTCISPDSATIALGSEMSGGIEDVRAEDITAINTQ  321

Query  182  SGVRIKSAIGRGGYVKNIYVKGLRAHTMKWVFLMSGDYGDHPDNHFDPKAFPVVAGINFR  361
            SGVRIK+A+GRG YVK+IY + +  +TMK+VF M+G YG HPD  FDP AFPV+ GIN+R
Sbjct  322  SGVRIKTAVGRGAYVKDIYARRMTLNTMKYVFWMTGSYGSHPDPGFDPNAFPVIKGINYR  381

Query  362  DVVADNVTMAGKMEGISGHPYTGVCMANVTIGMAKNGKKPAWNCSNIQGVASGVVPPPCP  541
            DVVADNVT + ++EGI   P+T +C++NV I +    K+  WNC+N+QGV S V P PC 
Sbjct  382  DVVADNVTYSARLEGIEKDPFTDICISNVNIKLTNKPKELQWNCTNVQGVTSRVTPEPCN  441

Query  542  LLHIQGPVKPGMCDLPPKK  598
            LL    PVK   C  P  +
Sbjct  442  LL----PVKEIDCPFPEDR  456



>ref|XP_009383010.1| PREDICTED: probable polygalacturonase [Musa acuminata subsp. 
malaccensis]
Length=360

 Score =   258 bits (658),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 120/196 (61%), Positives = 154/196 (79%), Gaps = 2/196 (1%)
 Frame = +2

Query  2    VAVKSGWDQYGIKYGKPTKQLIIKRLTCISPYSAAIALGSEMSGGIEDVRASDITAVHTE  181
            VA+KSGWD+YGI +  P+K ++I+RLTCISP SA IALGSEMSGGI+DVRA DITA+H+E
Sbjct  146  VAIKSGWDEYGIAFNMPSKHIVIRRLTCISPSSAVIALGSEMSGGIQDVRAEDITAIHSE  205

Query  182  SGVRIKSAIGRGGYVKNIYVKGLRAHTMKWVFLMSGDYGDHPDNHFDPKAFPVVAGINFR  361
            SGVRIK+AIGRG YVK+I+V+ +  HTMKWVF M+G YG HPD+ FDPKA PVV  I++ 
Sbjct  206  SGVRIKTAIGRGAYVKDIFVRRMDLHTMKWVFWMTGTYGQHPDDKFDPKAIPVVQNISYS  265

Query  362  DVVADNVTMAGKMEGISGHPYTGVCMANVTIGMAKNGKKPAWNCSNIQGVASGVVPPPCP  541
            +VVA+NVTMA K+EGI G P+TG+C+ NVT  + K+ KKP WNC++++GV+S V P PC 
Sbjct  266  NVVAENVTMAAKLEGIPGAPFTGICIYNVTAEVRKS-KKPIWNCTDVEGVSSHVTPTPCA  324

Query  542  LLHIQGPVKPGMCDLP  589
            L+  + P     C  P
Sbjct  325  LIP-ESPDSITHCPFP  339



>ref|XP_007038808.1| Pectin lyase-like superfamily protein isoform 1 [Theobroma cacao]
 gb|EOY23309.1| Pectin lyase-like superfamily protein isoform 1 [Theobroma cacao]
Length=469

 Score =   261 bits (666),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 121/199 (61%), Positives = 150/199 (75%), Gaps = 4/199 (2%)
 Frame = +2

Query  2    VAVKSGWDQYGIKYGKPTKQLIIKRLTCISPYSAAIALGSEMSGGIEDVRASDITAVHTE  181
            +AVKSGWDQYGIK+  PTK L+I+R TCISP SA IALGSEMSGGIEDVRA DITA++T+
Sbjct  258  IAVKSGWDQYGIKFNMPTKHLVIRRFTCISPDSATIALGSEMSGGIEDVRAEDITAINTQ  317

Query  182  SGVRIKSAIGRGGYVKNIYVKGLRAHTMKWVFLMSGDYGDHPDNHFDPKAFPVVAGINFR  361
            SGVRIK+A+GRG YVK+IY + +  +TMK+VF M+G YG HPD  FDP AFPV+ GIN+R
Sbjct  318  SGVRIKTAVGRGAYVKDIYARRMTLNTMKYVFWMTGSYGSHPDPGFDPNAFPVIKGINYR  377

Query  362  DVVADNVTMAGKMEGISGHPYTGVCMANVTIGMAKNGKKPAWNCSNIQGVASGVVPPPCP  541
            DVVADNVT + ++EGI   P+T +C++NV I +    K+  WNC+N+QGV S V P PC 
Sbjct  378  DVVADNVTYSARLEGIEKDPFTDICISNVNIKLTNKPKELQWNCTNVQGVTSRVTPEPCN  437

Query  542  LLHIQGPVKPGMCDLPPKK  598
            LL    PVK   C  P  +
Sbjct  438  LL----PVKEIDCPFPEDR  452



>gb|AES62453.2| pectin lyase superfamily protein [Medicago truncatula]
Length=516

 Score =   261 bits (668),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 117/182 (64%), Positives = 152/182 (84%), Gaps = 0/182 (0%)
 Frame = +2

Query  2    VAVKSGWDQYGIKYGKPTKQLIIKRLTCISPYSAAIALGSEMSGGIEDVRASDITAVHTE  181
            +A+KSGWD+YGIK GKP++ +I++RLTCISP SA +ALGSEMSGGI+DVR  D+TA++TE
Sbjct  304  IAIKSGWDEYGIKVGKPSQNIIVRRLTCISPKSALVALGSEMSGGIQDVRIEDVTAINTE  363

Query  182  SGVRIKSAIGRGGYVKNIYVKGLRAHTMKWVFLMSGDYGDHPDNHFDPKAFPVVAGINFR  361
            S VRIKSA+GRG +VK+I+VKG+  +T+K+VF M+G YGDHPDN FDP A P ++GIN+R
Sbjct  364  SAVRIKSAVGRGAFVKDIFVKGMDLNTLKYVFWMTGSYGDHPDNGFDPNALPKISGINYR  423

Query  362  DVVADNVTMAGKMEGISGHPYTGVCMANVTIGMAKNGKKPAWNCSNIQGVASGVVPPPCP  541
            DV A NVT+AGK+EGIS  P+TG+C++NVTI M+ + KK  WNC++I GV S VVP PC 
Sbjct  424  DVTAKNVTIAGKVEGISNDPFTGICVSNVTIEMSAHKKKLPWNCTDISGVTSNVVPKPCE  483

Query  542  LL  547
            LL
Sbjct  484  LL  485



>ref|NP_001048813.1| Os03g0124900 [Oryza sativa Japonica Group]
 gb|ABF93740.1| polygalacturonase, putative, expressed [Oryza sativa Japonica 
Group]
 dbj|BAF10727.1| Os03g0124900 [Oryza sativa Japonica Group]
 gb|EAZ25422.1| hypothetical protein OsJ_09236 [Oryza sativa Japonica Group]
Length=458

 Score =   260 bits (664),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 124/199 (62%), Positives = 152/199 (76%), Gaps = 4/199 (2%)
 Frame = +2

Query  2    VAVKSGWDQYGIKYGKPTKQLIIKRLTCISPYSAAIALGSEMSGGIEDVRASDITAVHTE  181
            +AVKSGWDQYGIK+  P++ ++I+RLTCISP SA IALGSEMSGGI DVRA D  A+ TE
Sbjct  251  IAVKSGWDQYGIKFNMPSQHILIRRLTCISPTSAMIALGSEMSGGIRDVRAVDNVAIDTE  310

Query  182  SGVRIKSAIGRGGYVKNIYVKGLRAHTMKWVFLMSGDYGDHPDNHFDPKAFPVVAGINFR  361
            S VRIKS +GRGGYVK+++V+GL  HTMKWVF M+G+YG HPDN  DP A P V GIN+ 
Sbjct  311  SAVRIKSGVGRGGYVKDVFVRGLSLHTMKWVFWMTGNYGQHPDNSSDPNALPEVTGINYS  370

Query  362  DVVADNVTMAGKMEGISGHPYTGVCMANVTIGMAKNGKKPAWNCSNIQGVASGVVPPPCP  541
            DV A+NVTMAG+MEGI   PYTG+CM+NVT  +A + KK  WNC++++GVAS V P PCP
Sbjct  371  DVFAENVTMAGRMEGIPNDPYTGICMSNVTAQLAPDAKKLQWNCTDVKGVASDVSPVPCP  430

Query  542  LLHIQGPVKPGMCDLPPKK  598
             L   G  KP  C  P ++
Sbjct  431  ELGAAG--KP--CAFPEEE  445



>ref|XP_007151453.1| hypothetical protein PHAVU_004G047800g [Phaseolus vulgaris]
 gb|ESW23447.1| hypothetical protein PHAVU_004G047800g [Phaseolus vulgaris]
Length=476

 Score =   260 bits (664),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 111/182 (61%), Positives = 151/182 (83%), Gaps = 0/182 (0%)
 Frame = +2

Query  2    VAVKSGWDQYGIKYGKPTKQLIIKRLTCISPYSAAIALGSEMSGGIEDVRASDITAVHTE  181
            +AVKSGWD+YGIK+G+PT+ L+I+R+TCISP SA +ALGSEMSGGIEDVR  D+TA++TE
Sbjct  268  IAVKSGWDEYGIKFGRPTQHLVIRRVTCISPDSAMVALGSEMSGGIEDVRVDDLTAINTE  327

Query  182  SGVRIKSAIGRGGYVKNIYVKGLRAHTMKWVFLMSGDYGDHPDNHFDPKAFPVVAGINFR  361
            S +RIK+A+GRGG+VKNI+V+GL  +TMK+VF M+G YG+HPD +FDPKA P + GIN++
Sbjct  328  SAIRIKTAVGRGGFVKNIFVRGLNLNTMKYVFWMTGSYGEHPDPNFDPKALPTITGINYK  387

Query  362  DVVADNVTMAGKMEGISGHPYTGVCMANVTIGMAKNGKKPAWNCSNIQGVASGVVPPPCP  541
            D+VA NVT + K+EGIS  P+TG+C++NV++ ++   KK  WNC+N+ GV + V P PC 
Sbjct  388  DIVAKNVTYSAKLEGISNDPFTGICISNVSVQVSAQQKKLQWNCTNVAGVTNNVTPTPCA  447

Query  542  LL  547
            LL
Sbjct  448  LL  449



>ref|XP_006589526.1| PREDICTED: probable polygalacturonase-like isoform X2 [Glycine 
max]
Length=458

 Score =   259 bits (662),  Expect = 4e-79, Method: Compositional matrix adjust.
 Identities = 120/196 (61%), Positives = 156/196 (80%), Gaps = 3/196 (2%)
 Frame = +2

Query  2    VAVKSGWDQYGIKYGKPTKQLIIKRLTCISPYSAAIALGSEMSGGIEDVRASDITAVHTE  181
            +AVKSGWD+YGI++G PT+ LII+R+TC+SP SA IALGSEMSGGI DVRA D+TA++TE
Sbjct  251  IAVKSGWDEYGIRFGMPTQHLIIRRITCVSPDSAMIALGSEMSGGIYDVRAEDLTAINTE  310

Query  182  SGVRIKSAIGRGGYVKNIYVKGLRAHTMKWVFLMSGDYGDHPDNHFDPKAFPVVAGINFR  361
            + VRIK+AIGRGGYVKNI+VKG+  +TMK+VF ++G YGDHPD  +DPKA P + GIN+R
Sbjct  311  AAVRIKTAIGRGGYVKNIFVKGMNLNTMKYVFWITGTYGDHPDPGYDPKALPYITGINYR  370

Query  362  DVVADNVTMAGKMEGISGHPYTGVCMANVTIGMAKNGKKPAWNCSNIQGVASGVVPPPCP  541
            DVVA NVT + ++EGIS  P+TG+C++NV+I +++  KK  WNCSNI GV S V P PC 
Sbjct  371  DVVATNVTKSARLEGISNDPFTGICISNVSIQVSEQQKKLQWNCSNISGVTSNVTPYPCA  430

Query  542  LLHIQGPVKPGMCDLP  589
            LL  +G ++   C  P
Sbjct  431  LLPEKGQLE---CPFP  443



>gb|KHN21786.1| Putative polygalacturonase, partial [Glycine soja]
Length=434

 Score =   258 bits (660),  Expect = 4e-79, Method: Compositional matrix adjust.
 Identities = 120/196 (61%), Positives = 156/196 (80%), Gaps = 3/196 (2%)
 Frame = +2

Query  2    VAVKSGWDQYGIKYGKPTKQLIIKRLTCISPYSAAIALGSEMSGGIEDVRASDITAVHTE  181
            +AVKSGWD+YGI++G PT+ LII+R+TC+SP SA IALGSEMSGGI DVRA D+TA++TE
Sbjct  227  IAVKSGWDEYGIRFGMPTQHLIIRRITCVSPDSAMIALGSEMSGGIYDVRAEDLTAINTE  286

Query  182  SGVRIKSAIGRGGYVKNIYVKGLRAHTMKWVFLMSGDYGDHPDNHFDPKAFPVVAGINFR  361
            + VRIK+AIGRGGYVKNI+VKG+  +TMK+VF ++G YGDHPD  +DPKA P + GIN+R
Sbjct  287  AAVRIKTAIGRGGYVKNIFVKGMNLNTMKYVFWITGTYGDHPDPGYDPKALPYITGINYR  346

Query  362  DVVADNVTMAGKMEGISGHPYTGVCMANVTIGMAKNGKKPAWNCSNIQGVASGVVPPPCP  541
            DVVA NVT + ++EGIS  P+TG+C++NV+I +++  KK  WNCSNI GV S V P PC 
Sbjct  347  DVVATNVTKSARLEGISNDPFTGICISNVSIQVSEQQKKLQWNCSNISGVTSNVTPYPCA  406

Query  542  LLHIQGPVKPGMCDLP  589
            LL  +G ++   C  P
Sbjct  407  LLPEKGQLE---CPFP  419



>ref|XP_003535597.1| PREDICTED: probable polygalacturonase-like isoform X1 [Glycine 
max]
Length=466

 Score =   259 bits (662),  Expect = 6e-79, Method: Compositional matrix adjust.
 Identities = 120/196 (61%), Positives = 156/196 (80%), Gaps = 3/196 (2%)
 Frame = +2

Query  2    VAVKSGWDQYGIKYGKPTKQLIIKRLTCISPYSAAIALGSEMSGGIEDVRASDITAVHTE  181
            +AVKSGWD+YGI++G PT+ LII+R+TC+SP SA IALGSEMSGGI DVRA D+TA++TE
Sbjct  259  IAVKSGWDEYGIRFGMPTQHLIIRRITCVSPDSAMIALGSEMSGGIYDVRAEDLTAINTE  318

Query  182  SGVRIKSAIGRGGYVKNIYVKGLRAHTMKWVFLMSGDYGDHPDNHFDPKAFPVVAGINFR  361
            + VRIK+AIGRGGYVKNI+VKG+  +TMK+VF ++G YGDHPD  +DPKA P + GIN+R
Sbjct  319  AAVRIKTAIGRGGYVKNIFVKGMNLNTMKYVFWITGTYGDHPDPGYDPKALPYITGINYR  378

Query  362  DVVADNVTMAGKMEGISGHPYTGVCMANVTIGMAKNGKKPAWNCSNIQGVASGVVPPPCP  541
            DVVA NVT + ++EGIS  P+TG+C++NV+I +++  KK  WNCSNI GV S V P PC 
Sbjct  379  DVVATNVTKSARLEGISNDPFTGICISNVSIQVSEQQKKLQWNCSNISGVTSNVTPYPCA  438

Query  542  LLHIQGPVKPGMCDLP  589
            LL  +G ++   C  P
Sbjct  439  LLPEKGQLE---CPFP  451



>ref|XP_010276919.1| PREDICTED: probable polygalacturonase [Nelumbo nucifera]
Length=607

 Score =   262 bits (670),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 121/199 (61%), Positives = 153/199 (77%), Gaps = 0/199 (0%)
 Frame = +2

Query  2    VAVKSGWDQYGIKYGKPTKQLIIKRLTCISPYSAAIALGSEMSGGIEDVRASDITAVHTE  181
            +AVKSGWD+YGI +G PT+ LII+RLTCISP SA IALGSEMSGGI+DVRA DI A+++E
Sbjct  253  IAVKSGWDEYGIAFGMPTQHLIIRRLTCISPTSAVIALGSEMSGGIQDVRAEDIVAINSE  312

Query  182  SGVRIKSAIGRGGYVKNIYVKGLRAHTMKWVFLMSGDYGDHPDNHFDPKAFPVVAGINFR  361
            SGVRIK+A GRG YVK+IYV+ +  +TMK+VF M+G YG HPD  +DPKA P V GIN+ 
Sbjct  313  SGVRIKTAPGRGAYVKDIYVRRMNMNTMKYVFWMTGSYGQHPDEKYDPKALPDVHGINWM  372

Query  362  DVVADNVTMAGKMEGISGHPYTGVCMANVTIGMAKNGKKPAWNCSNIQGVASGVVPPPCP  541
            D+ A+NVT+  K+EGI+G P+TG+C++NVTIG++   KK  WNC++IQGVA  V PPPC 
Sbjct  373  DMTAENVTIPAKLEGINGDPFTGICISNVTIGLSPKPKKVQWNCTDIQGVARDVTPPPCD  432

Query  542  LLHIQGPVKPGMCDLPPKK  598
            LL  QG      C  P  +
Sbjct  433  LLSDQGSTGSKSCSFPTDR  451



>gb|KHN21785.1| Putative polygalacturonase [Glycine soja]
Length=456

 Score =   258 bits (658),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 121/199 (61%), Positives = 153/199 (77%), Gaps = 3/199 (2%)
 Frame = +2

Query  2    VAVKSGWDQYGIKYGKPTKQLIIKRLTCISPYSAAIALGSEMSGGIEDVRASDITAVHTE  181
            VAVKSGWD+YGIK+GKPT+ L+I+RLTCISP SA IALGSEMSGGI+DVR  DITA++T+
Sbjct  244  VAVKSGWDEYGIKFGKPTQHLVIRRLTCISPDSAMIALGSEMSGGIQDVRVEDITAINTQ  303

Query  182  SGVRIKSAIGRGGYVKNIYVKGLRAHTMKWVFLMSGDYGDHPDNHFDPKAFPVVAGINFR  361
            S VRIK+A+GRGGYVK+I+VKG+   TMK+VF M+G YG HPD  FDPKA P + GIN+R
Sbjct  304  SAVRIKTAVGRGGYVKDIFVKGMTLSTMKYVFWMTGSYGSHPDPAFDPKALPNITGINYR  363

Query  362  DVVADNVTMAGKMEGISGHPYTGVCMANVTIGMAKNGKKPAWNCSNIQGVASGVVPPPCP  541
            DVVA NVT + K+EGIS  P+TG+C++NV+I +++  KK  WNC+++ GV S V P  C 
Sbjct  364  DVVATNVTYSAKLEGISNDPFTGICISNVSIQVSEQKKKLQWNCTDVAGVTSNVTPNTCQ  423

Query  542  LLHIQGPVKPGMCDLPPKK  598
            LL  +G      C  P  K
Sbjct  424  LLPEKGKFD---CPFPNDK  439



>ref|XP_003536450.1| PREDICTED: probable polygalacturonase-like [Glycine max]
Length=476

 Score =   258 bits (658),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 121/199 (61%), Positives = 153/199 (77%), Gaps = 3/199 (2%)
 Frame = +2

Query  2    VAVKSGWDQYGIKYGKPTKQLIIKRLTCISPYSAAIALGSEMSGGIEDVRASDITAVHTE  181
            VAVKSGWD+YGIK+GKPT+ L+I+RLTCISP SA IALGSEMSGGI+DVR  DITA++T+
Sbjct  264  VAVKSGWDEYGIKFGKPTQHLVIRRLTCISPDSAMIALGSEMSGGIQDVRVEDITAINTQ  323

Query  182  SGVRIKSAIGRGGYVKNIYVKGLRAHTMKWVFLMSGDYGDHPDNHFDPKAFPVVAGINFR  361
            S VRIK+A+GRGGYVK+I+VKG+   TMK+VF M+G YG HPD  FDPKA P + GIN+R
Sbjct  324  SAVRIKTAVGRGGYVKDIFVKGMTLSTMKYVFWMTGSYGSHPDPAFDPKALPNITGINYR  383

Query  362  DVVADNVTMAGKMEGISGHPYTGVCMANVTIGMAKNGKKPAWNCSNIQGVASGVVPPPCP  541
            DVVA NVT + K+EGIS  P+TG+C++NV+I +++  KK  WNC+++ GV S V P  C 
Sbjct  384  DVVATNVTYSAKLEGISNDPFTGICISNVSIQVSEQKKKLQWNCTDVAGVTSNVTPNTCQ  443

Query  542  LLHIQGPVKPGMCDLPPKK  598
            LL  +G      C  P  K
Sbjct  444  LLPEKGKFD---CPFPNDK  459



>ref|XP_006422033.1| hypothetical protein CICLE_v10004864mg [Citrus clementina]
 ref|XP_006490634.1| PREDICTED: probable polygalacturonase-like [Citrus sinensis]
 gb|ESR35273.1| hypothetical protein CICLE_v10004864mg [Citrus clementina]
 gb|KDO56791.1| hypothetical protein CISIN_1g011615mg [Citrus sinensis]
Length=481

 Score =   258 bits (658),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 123/199 (62%), Positives = 151/199 (76%), Gaps = 3/199 (2%)
 Frame = +2

Query  2    VAVKSGWDQYGIKYGKPTKQLIIKRLTCISPYSAAIALGSEMSGGIEDVRASDITAVHTE  181
            VAVKSGWD+YGIK G PT+ LII+RL CISP SAAIALGSEMSGGI+DVRA DITA++T+
Sbjct  268  VAVKSGWDEYGIKVGMPTQHLIIRRLICISPDSAAIALGSEMSGGIKDVRAEDITAINTQ  327

Query  182  SGVRIKSAIGRGGYVKNIYVKGLRAHTMKWVFLMSGDYGDHPDNHFDPKAFPVVAGINFR  361
            SGVRIK+A+GRG YVK IYV+ +   TMK+VF M+GDYG HPD  FDPKA P V GIN+R
Sbjct  328  SGVRIKTAVGRGAYVKEIYVRRMTMKTMKYVFWMTGDYGSHPDPGFDPKALPTVTGINYR  387

Query  362  DVVADNVTMAGKMEGISGHPYTGVCMANVTIGMAKNGKKPAWNCSNIQGVASGVVPPPCP  541
            D+VADNVT + K++GI   P+TG+C++NVTI + +  K+  WNC+NIQG+ S V P  C 
Sbjct  388  DMVADNVTQSAKLDGIRNDPFTGICISNVTIKLTEKPKELQWNCTNIQGITSRVTPQACE  447

Query  542  LLHIQGPVKPGMCDLPPKK  598
            LL  + P     C  P  K
Sbjct  448  LLPKKEPTD---CFFPDDK  463



>ref|XP_003535598.1| PREDICTED: probable polygalacturonase-like [Glycine max]
Length=475

 Score =   257 bits (657),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 121/199 (61%), Positives = 153/199 (77%), Gaps = 3/199 (2%)
 Frame = +2

Query  2    VAVKSGWDQYGIKYGKPTKQLIIKRLTCISPYSAAIALGSEMSGGIEDVRASDITAVHTE  181
            VAVKSGWD+YGIK+GKPT+ L+I+RLTCISP SA IALGSEMSGGI+DVR  DITA++T+
Sbjct  263  VAVKSGWDEYGIKFGKPTQHLVIRRLTCISPDSAMIALGSEMSGGIQDVRVEDITAINTQ  322

Query  182  SGVRIKSAIGRGGYVKNIYVKGLRAHTMKWVFLMSGDYGDHPDNHFDPKAFPVVAGINFR  361
            S VRIK+A+GRGGYVK+I+VKG+   TMK+VF M+G YG HPD  FDPKA P + GIN+R
Sbjct  323  SAVRIKTAVGRGGYVKDIFVKGMTLSTMKYVFWMTGSYGSHPDPAFDPKALPNITGINYR  382

Query  362  DVVADNVTMAGKMEGISGHPYTGVCMANVTIGMAKNGKKPAWNCSNIQGVASGVVPPPCP  541
            DVVA NVT + K+EGIS  P+TG+C++NV+I +++  KK  WNC+++ GV S V P  C 
Sbjct  383  DVVATNVTYSAKLEGISNDPFTGICISNVSIQVSEQKKKLQWNCTDVAGVTSNVTPNTCQ  442

Query  542  LLHIQGPVKPGMCDLPPKK  598
            LL  +G      C  P  K
Sbjct  443  LLPEKGKFD---CPFPNDK  458



>gb|KHN21784.1| Putative polygalacturonase [Glycine soja]
Length=472

 Score =   257 bits (656),  Expect = 4e-78, Method: Compositional matrix adjust.
 Identities = 121/199 (61%), Positives = 153/199 (77%), Gaps = 3/199 (2%)
 Frame = +2

Query  2    VAVKSGWDQYGIKYGKPTKQLIIKRLTCISPYSAAIALGSEMSGGIEDVRASDITAVHTE  181
            VAVKSGWD+YGIK+GKPT+ L+I+RLTCISP SA IALGSEMSGGI+DVR  DITA++T+
Sbjct  260  VAVKSGWDEYGIKFGKPTQHLVIRRLTCISPDSAMIALGSEMSGGIQDVRVEDITAINTQ  319

Query  182  SGVRIKSAIGRGGYVKNIYVKGLRAHTMKWVFLMSGDYGDHPDNHFDPKAFPVVAGINFR  361
            S VRIK+A+GRGGYVK+I+VKG+   TMK+VF M+G YG HPD  FDPKA P + GIN+R
Sbjct  320  SAVRIKTAVGRGGYVKDIFVKGMTLSTMKYVFWMTGSYGSHPDPAFDPKALPNITGINYR  379

Query  362  DVVADNVTMAGKMEGISGHPYTGVCMANVTIGMAKNGKKPAWNCSNIQGVASGVVPPPCP  541
            DVVA NVT + K+EGIS  P+TG+C++NV+I +++  KK  WNC+++ GV S V P  C 
Sbjct  380  DVVATNVTYSAKLEGISNDPFTGICISNVSIQVSEQKKKLQWNCTDVAGVTSNVTPNTCQ  439

Query  542  LLHIQGPVKPGMCDLPPKK  598
            LL  +G      C  P  K
Sbjct  440  LLPEKGKFD---CPFPNDK  455



>ref|XP_003624874.1| hypothetical protein MTR_7g088550 [Medicago truncatula]
 gb|AES81092.1| pectin lyase superfamily protein [Medicago truncatula]
Length=476

 Score =   256 bits (655),  Expect = 8e-78, Method: Compositional matrix adjust.
 Identities = 120/185 (65%), Positives = 156/185 (84%), Gaps = 3/185 (2%)
 Frame = +2

Query  2    VAVKSGWDQYGIKYGKPTKQLIIKRLTCISPYSAAIALGSEMSGGIEDVRASDITAVHTE  181
            +A+KSGWDQYGIK+GKP+KQ+II+RLTCISP SA IALGSEMSGGIE+VR  D+TA++TE
Sbjct  261  IAIKSGWDQYGIKFGKPSKQIIIRRLTCISPDSAMIALGSEMSGGIENVRVEDVTAINTE  320

Query  182  SGVRIKSAIGRGGYVKNIYVKGLRAHT-MKWVFLMSGDYGDHPDNHFDPKAFPVVAGINF  358
            S VRIKSA+GRGGYVK+I+VKG++ +T +++VF ++G YGDHPDN FDPKA P + GI F
Sbjct  321  SAVRIKSAVGRGGYVKDIFVKGVKLNTILRYVFWLTGSYGDHPDNGFDPKALPKITGIIF  380

Query  359  RDVVADNVTMAGKMEGISGHPYTGVCMANVTIGMAKNGKKPA--WNCSNIQGVASGVVPP  532
            RDV+A NVT+AG++EGIS  P+TG+C++NVTI +++  KK    WNC+++ GV S VVP 
Sbjct  381  RDVIAKNVTVAGQLEGISNDPFTGICISNVTIELSELKKKKKLPWNCTDVSGVTSNVVPK  440

Query  533  PCPLL  547
            PC LL
Sbjct  441  PCDLL  445



>ref|XP_003592200.1| Polygalacturonase-like protein [Medicago truncatula]
 gb|AES62451.1| pectin lyase superfamily protein [Medicago truncatula]
Length=481

 Score =   256 bits (655),  Expect = 9e-78, Method: Compositional matrix adjust.
 Identities = 114/182 (63%), Positives = 147/182 (81%), Gaps = 0/182 (0%)
 Frame = +2

Query  2    VAVKSGWDQYGIKYGKPTKQLIIKRLTCISPYSAAIALGSEMSGGIEDVRASDITAVHTE  181
            +A+KSGWD+YGIK+GKP++Q+II+RLTCISP SA +ALGSEMSGGI+DVR  D+TA+ TE
Sbjct  267  IAIKSGWDEYGIKFGKPSQQIIIRRLTCISPKSAMVALGSEMSGGIQDVRVEDVTAIKTE  326

Query  182  SGVRIKSAIGRGGYVKNIYVKGLRAHTMKWVFLMSGDYGDHPDNHFDPKAFPVVAGINFR  361
            S VRIK+AIGRG YVK+I+VKG+   TMK+VF M+G Y  HPDN FDP A P ++ IN+R
Sbjct  327  SAVRIKTAIGRGAYVKDIFVKGMNLDTMKYVFWMTGSYKSHPDNGFDPNALPKISEINYR  386

Query  362  DVVADNVTMAGKMEGISGHPYTGVCMANVTIGMAKNGKKPAWNCSNIQGVASGVVPPPCP  541
            DV A NVT+AGK++GIS  P+TG+C++N TI M+ + KK  WNC+++ GV S V P PC 
Sbjct  387  DVTAKNVTIAGKLDGISNDPFTGICVSNATIEMSAHKKKLPWNCTDVSGVTSNVSPTPCE  446

Query  542  LL  547
            LL
Sbjct  447  LL  448



>ref|XP_004985902.1| PREDICTED: probable polygalacturonase-like [Setaria italica]
Length=456

 Score =   255 bits (652),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 120/199 (60%), Positives = 152/199 (76%), Gaps = 4/199 (2%)
 Frame = +2

Query  2    VAVKSGWDQYGIKYGKPTKQLIIKRLTCISPYSAAIALGSEMSGGIEDVRASDITAVHTE  181
            +AVKSGWD+YGIK+  P++ +II+RLTCISP SA IALGSEMSGGI DVRA D  A++TE
Sbjct  249  IAVKSGWDEYGIKFNMPSQHIIIRRLTCISPTSAMIALGSEMSGGIRDVRAEDNIAINTE  308

Query  182  SGVRIKSAIGRGGYVKNIYVKGLRAHTMKWVFLMSGDYGDHPDNHFDPKAFPVVAGINFR  361
            S VR+KS +GRGG+VK+I+V+GL  HTMKWVF M+G+YG HPDN  DP A P V GIN+ 
Sbjct  309  SAVRVKSGVGRGGFVKDIFVRGLSLHTMKWVFWMTGNYGQHPDNSSDPNAMPEVTGINYS  368

Query  362  DVVADNVTMAGKMEGISGHPYTGVCMANVTIGMAKNGKKPAWNCSNIQGVASGVVPPPCP  541
            DV A+NVTMAG+MEGI   PYTG+C++NVT  +A + KK  WNC++++GV   V P PCP
Sbjct  369  DVFAENVTMAGRMEGIPNDPYTGICISNVTARLAPDAKKLQWNCTDVKGVTYDVTPKPCP  428

Query  542  LLHIQGPVKPGMCDLPPKK  598
             L  +G  KP  C  P ++
Sbjct  429  ELGAEG--KP--CAFPEEE  443



>gb|KHG19694.1| putative polygalacturonase [Gossypium arboreum]
Length=474

 Score =   255 bits (652),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 112/182 (62%), Positives = 144/182 (79%), Gaps = 0/182 (0%)
 Frame = +2

Query  2    VAVKSGWDQYGIKYGKPTKQLIIKRLTCISPYSAAIALGSEMSGGIEDVRASDITAVHTE  181
            +AVKSGWD+YGIK+  PTKQL+I+R  CISP SA IALGSEMSGGIEDVR  D+TA++TE
Sbjct  263  IAVKSGWDEYGIKFNMPTKQLVIRRFACISPSSATIALGSEMSGGIEDVRVEDVTAINTE  322

Query  182  SGVRIKSAIGRGGYVKNIYVKGLRAHTMKWVFLMSGDYGDHPDNHFDPKAFPVVAGINFR  361
            SGVRIK+ +GRG YVK++YV+ +  +TMK+VF M+GDYG HPD  FD  AFPV+ GIN+R
Sbjct  323  SGVRIKTGVGRGAYVKDVYVRNMTLNTMKYVFWMTGDYGSHPDAEFDQNAFPVIKGINYR  382

Query  362  DVVADNVTMAGKMEGISGHPYTGVCMANVTIGMAKNGKKPAWNCSNIQGVASGVVPPPCP  541
            D+VADNVT + +++GI  HP+T +C++NV I +A   K   WNCS++QGV + V P PC 
Sbjct  383  DIVADNVTQSAQLDGIGKHPFTDICISNVNIKLAAKPKGVQWNCSDVQGVTNRVSPEPCN  442

Query  542  LL  547
            LL
Sbjct  443  LL  444



>ref|XP_006650993.1| PREDICTED: probable polygalacturonase-like [Oryza brachyantha]
Length=587

 Score =   258 bits (659),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 122/196 (62%), Positives = 151/196 (77%), Gaps = 4/196 (2%)
 Frame = +2

Query  2    VAVKSGWDQYGIKYGKPTKQLIIKRLTCISPYSAAIALGSEMSGGIEDVRASDITAVHTE  181
            +AVKSGWDQYGIK+ KP++ ++I+RLTCISP SA IALGSEMSGGI+DVRA D  A+ TE
Sbjct  380  IAVKSGWDQYGIKFNKPSQHILIRRLTCISPTSAMIALGSEMSGGIQDVRAVDNVAIDTE  439

Query  182  SGVRIKSAIGRGGYVKNIYVKGLRAHTMKWVFLMSGDYGDHPDNHFDPKAFPVVAGINFR  361
            S VRIKS +GRGG+VK+++V+GL  HTMKWVF M+G+YG HPDN  DP A P V GIN+ 
Sbjct  440  SAVRIKSGVGRGGFVKDVFVRGLSLHTMKWVFWMTGNYGQHPDNSSDPNALPEVTGINYS  499

Query  362  DVVADNVTMAGKMEGISGHPYTGVCMANVTIGMAKNGKKPAWNCSNIQGVASGVVPPPCP  541
            DV A+NVTMAG+MEGI   PYTG+C++NVT  +A + KK  WNC++++GV S V P PCP
Sbjct  500  DVFAENVTMAGRMEGIPNDPYTGICISNVTAQLAPDAKKLQWNCTDVKGVTSDVSPKPCP  559

Query  542  LLHIQGPVKPGMCDLP  589
             L   G  KP  C  P
Sbjct  560  ELGAAG--KP--CAFP  571



>ref|XP_009363435.1| PREDICTED: probable polygalacturonase [Pyrus x bretschneideri]
Length=473

 Score =   254 bits (649),  Expect = 5e-77, Method: Compositional matrix adjust.
 Identities = 116/198 (59%), Positives = 151/198 (76%), Gaps = 0/198 (0%)
 Frame = +2

Query  2    VAVKSGWDQYGIKYGKPTKQLIIKRLTCISPYSAAIALGSEMSGGIEDVRASDITAVHTE  181
            +AVKSGWD+YGI +  PTKQL+I+RLTCISP+SA IALGSEMSGGIE VRA  I A+++E
Sbjct  256  IAVKSGWDEYGIAFRMPTKQLVIRRLTCISPFSAVIALGSEMSGGIEVVRAEYIVAINSE  315

Query  182  SGVRIKSAIGRGGYVKNIYVKGLRAHTMKWVFLMSGDYGDHPDNHFDPKAFPVVAGINFR  361
            SGVRIK+A+GRGG+VK+IYV+G+   TMKW F M+G+YG H DN +DP A PV+  IN  
Sbjct  316  SGVRIKTAVGRGGFVKDIYVRGMTMKTMKWAFWMTGNYGSHADNGYDPHALPVIQNINHH  375

Query  362  DVVADNVTMAGKMEGISGHPYTGVCMANVTIGMAKNGKKPAWNCSNIQGVASGVVPPPCP  541
            ++ A+NVTMA ++EGI G P+TG+C +NVTI +AKN KK  WNC+++  ++S VVP PC 
Sbjct  376  EMAAENVTMAAELEGIPGDPFTGICKSNVTITLAKNVKKLPWNCTDVARISSRVVPQPCE  435

Query  542  LLHIQGPVKPGMCDLPPK  595
             L  Q P     C+ P +
Sbjct  436  ALADQVPGSVAACNFPEE  453



>ref|XP_006362679.1| PREDICTED: probable polygalacturonase-like [Solanum tuberosum]
Length=527

 Score =   256 bits (653),  Expect = 5e-77, Method: Compositional matrix adjust.
 Identities = 118/196 (60%), Positives = 152/196 (78%), Gaps = 4/196 (2%)
 Frame = +2

Query  2    VAVKSGWDQYGIKYGKPTKQLIIKRLTCISPYSAAIALGSEMSGGIEDVRASDITAVHTE  181
            +AVKSGWD+YGI +GKPTK LII+ LTCISP SA IALGSEMSGGI+DVRA +I A+ +E
Sbjct  315  IAVKSGWDEYGIAFGKPTKHLIIRNLTCISPDSAVIALGSEMSGGIQDVRAENIAAISSE  374

Query  182  SGVRIKSAIGRGGYVKNIYVKGLRAHTMKWVFLMSGDYGDHPDNHFDPKAFPVVAGINFR  361
            SG+RIK+AIGRG YVK+++V+G+   TMK+ F ++GDYG HPD+H+DPKA PV+ GIN +
Sbjct  375  SGLRIKTAIGRGAYVKDVFVRGMTLQTMKYTFWITGDYGSHPDDHYDPKALPVIQGINVK  434

Query  362  DVVADNVTMAGKMEGISGHPYTGVCMANVTIGMAKNGKKPAWNCSNIQGVASGVVPPPCP  541
            DVVA NVT+AGK+ GI G  + G+C++NV I +++  K+  WNCSNI+GV+S V P PC 
Sbjct  435  DVVAKNVTIAGKLAGIDGDTFNGICISNVAIELSEQAKQLEWNCSNIKGVSSQVSPQPCA  494

Query  542  LLHIQGPVKPGMCDLP  589
            LL    P K   C  P
Sbjct  495  LL----PDKNIYCPFP  506



>ref|NP_001151102.1| glycoside hydrolase, family 28 precursor [Zea mays]
 gb|ACG41634.1| glycoside hydrolase, family 28 [Zea mays]
 gb|ACL53776.1| unknown [Zea mays]
 tpg|DAA43050.1| TPA: glycoside hydrolase, family 28 [Zea mays]
Length=463

 Score =   253 bits (646),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 118/199 (59%), Positives = 152/199 (76%), Gaps = 4/199 (2%)
 Frame = +2

Query  2    VAVKSGWDQYGIKYGKPTKQLIIKRLTCISPYSAAIALGSEMSGGIEDVRASDITAVHTE  181
            VAVKSGWD+YGI++  P++ ++I+RLTC+SP SA IALGSEMSGGI DVRA D  A++TE
Sbjct  256  VAVKSGWDEYGIRFNMPSQHIVIRRLTCVSPTSAMIALGSEMSGGIRDVRAEDSVAINTE  315

Query  182  SGVRIKSAIGRGGYVKNIYVKGLRAHTMKWVFLMSGDYGDHPDNHFDPKAFPVVAGINFR  361
            S VR+KS  GRGG+V++I+V+GL  HTMKWVF M+G+YG HPDN  DP A P V GIN+ 
Sbjct  316  SAVRVKSGAGRGGFVRDIFVRGLSLHTMKWVFWMTGNYGQHPDNTSDPNAMPEVTGINYS  375

Query  362  DVVADNVTMAGKMEGISGHPYTGVCMANVTIGMAKNGKKPAWNCSNIQGVASGVVPPPCP  541
            DV A+NVTMAG+MEGI   PYTG+C++NVT  +A + K+  WNC+N++GV S V P PCP
Sbjct  376  DVFAENVTMAGRMEGIPKDPYTGICISNVTARLAPDAKELQWNCTNVKGVTSHVSPKPCP  435

Query  542  LLHIQGPVKPGMCDLPPKK  598
             L  +G  KP  C  P ++
Sbjct  436  ELAAEG--KP--CAFPEEE  450



>ref|XP_009382256.1| PREDICTED: probable polygalacturonase isoform X1 [Musa acuminata 
subsp. malaccensis]
Length=486

 Score =   253 bits (647),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 117/196 (60%), Positives = 154/196 (79%), Gaps = 2/196 (1%)
 Frame = +2

Query  2    VAVKSGWDQYGIKYGKPTKQLIIKRLTCISPYSAAIALGSEMSGGIEDVRASDITAVHTE  181
            +A+KSGWD+YGI +   +K ++I+RLTCISP SA IALGSEMSGGI+DVRA DITA+H+E
Sbjct  272  IAIKSGWDEYGIAFNMSSKHIVIRRLTCISPTSAVIALGSEMSGGIQDVRAEDITAIHSE  331

Query  182  SGVRIKSAIGRGGYVKNIYVKGLRAHTMKWVFLMSGDYGDHPDNHFDPKAFPVVAGINFR  361
            SGVRIK+AIGRG YVK+I+V+ +  HTMKWVF M+G YG HPD+ FDPKA PVV  I++ 
Sbjct  332  SGVRIKTAIGRGAYVKDIFVRRMNLHTMKWVFWMTGTYGQHPDDKFDPKAIPVVQNISYS  391

Query  362  DVVADNVTMAGKMEGISGHPYTGVCMANVTIGMAKNGKKPAWNCSNIQGVASGVVPPPCP  541
            +VVA+NVTMA K+EGI G P+TG+C+ NVT  + ++ KKP WNC++++GV+S V P PC 
Sbjct  392  NVVAENVTMAAKLEGIPGAPFTGICIYNVTAEVVRS-KKPIWNCTDVEGVSSHVTPTPCA  450

Query  542  LLHIQGPVKPGMCDLP  589
            L+  + P +   C  P
Sbjct  451  LIP-ESPDRITHCPFP  465



>ref|XP_002468601.1| hypothetical protein SORBIDRAFT_01g048880 [Sorghum bicolor]
 gb|EER95599.1| hypothetical protein SORBIDRAFT_01g048880 [Sorghum bicolor]
Length=463

 Score =   253 bits (645),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 120/196 (61%), Positives = 148/196 (76%), Gaps = 4/196 (2%)
 Frame = +2

Query  2    VAVKSGWDQYGIKYGKPTKQLIIKRLTCISPYSAAIALGSEMSGGIEDVRASDITAVHTE  181
            VAVKSGWD+YGIK+  P++ ++I+RLTCISP SA IALGSEMSGGI DVRA D  A++TE
Sbjct  256  VAVKSGWDEYGIKFNMPSQHIVIRRLTCISPTSAMIALGSEMSGGIRDVRAEDNIAINTE  315

Query  182  SGVRIKSAIGRGGYVKNIYVKGLRAHTMKWVFLMSGDYGDHPDNHFDPKAFPVVAGINFR  361
            S VRIKS  GRGG+VK+I+V+GL  HTMKWVF M+G+YG HPDN  +P A P V GIN+ 
Sbjct  316  SAVRIKSGAGRGGFVKDIFVRGLSLHTMKWVFWMTGNYGQHPDNTSNPNAMPEVTGINYS  375

Query  362  DVVADNVTMAGKMEGISGHPYTGVCMANVTIGMAKNGKKPAWNCSNIQGVASGVVPPPCP  541
            DV A+NVT AG+MEGI   PYTG+C++NVT  +A N  +  WNC+N++GV S V P PCP
Sbjct  376  DVFAENVTTAGRMEGIPNDPYTGICISNVTASLAPNATELQWNCTNVKGVTSNVSPKPCP  435

Query  542  LLHIQGPVKPGMCDLP  589
             L  +G  KP  C  P
Sbjct  436  ELGAEG--KP--CAFP  447



>ref|XP_010024977.1| PREDICTED: probable polygalacturonase [Eucalyptus grandis]
Length=462

 Score =   252 bits (644),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 119/199 (60%), Positives = 154/199 (77%), Gaps = 2/199 (1%)
 Frame = +2

Query  2    VAVKSGWDQYGIKYGKPTKQLIIKRLTCISPYSAAIALGSEMSGGIEDVRASDITAVHTE  181
            +A+KSGWDQYGIK+GKPT+ + I+RLTCISP SAAIALGSEMSGGI+DVRA  I A++T+
Sbjct  247  IAIKSGWDQYGIKFGKPTEHVSIRRLTCISPDSAAIALGSEMSGGIQDVRAETIVAINTQ  306

Query  182  SGVRIKSAIGRGGYVKNIYVKGLRAHTMKWVFLMSGDYGDHPDNHFDPKAFPVVAGINFR  361
            SGVRIK+A GRGGYVK+I+VKG+   TMK+ F M+G Y  HPD  +DPKA PV+ GIN+R
Sbjct  307  SGVRIKTAPGRGGYVKDIFVKGMIMKTMKYAFWMTGSYNSHPDTGYDPKALPVIQGINYR  366

Query  362  DVVADNVTMAGKMEGISGHPYTGVCMANVTIGMAKNGKKPAWNCSNIQGVASGVVPPPCP  541
            D+VA+NVT + K++GI G P+TG+C++NV I ++KN KK  WNC++I+GV S V P  C 
Sbjct  367  DMVAENVTYSAKLDGIKGDPFTGICISNVQIELSKNPKKLQWNCTDIEGVTSNVTPVACD  426

Query  542  LLHIQGPVKPGMCDLPPKK  598
            LL  + P     C  P +K
Sbjct  427  LLPKKEPAID--CPFPTEK  443



>gb|KCW90638.1| hypothetical protein EUGRSUZ_A02742 [Eucalyptus grandis]
Length=464

 Score =   252 bits (644),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 119/199 (60%), Positives = 154/199 (77%), Gaps = 2/199 (1%)
 Frame = +2

Query  2    VAVKSGWDQYGIKYGKPTKQLIIKRLTCISPYSAAIALGSEMSGGIEDVRASDITAVHTE  181
            +A+KSGWDQYGIK+GKPT+ + I+RLTCISP SAAIALGSEMSGGI+DVRA  I A++T+
Sbjct  249  IAIKSGWDQYGIKFGKPTEHVSIRRLTCISPDSAAIALGSEMSGGIQDVRAETIVAINTQ  308

Query  182  SGVRIKSAIGRGGYVKNIYVKGLRAHTMKWVFLMSGDYGDHPDNHFDPKAFPVVAGINFR  361
            SGVRIK+A GRGGYVK+I+VKG+   TMK+ F M+G Y  HPD  +DPKA PV+ GIN+R
Sbjct  309  SGVRIKTAPGRGGYVKDIFVKGMIMKTMKYAFWMTGSYNSHPDTGYDPKALPVIQGINYR  368

Query  362  DVVADNVTMAGKMEGISGHPYTGVCMANVTIGMAKNGKKPAWNCSNIQGVASGVVPPPCP  541
            D+VA+NVT + K++GI G P+TG+C++NV I ++KN KK  WNC++I+GV S V P  C 
Sbjct  369  DMVAENVTYSAKLDGIKGDPFTGICISNVQIELSKNPKKLQWNCTDIEGVTSNVTPVACD  428

Query  542  LLHIQGPVKPGMCDLPPKK  598
            LL  + P     C  P +K
Sbjct  429  LLPKKEPAID--CPFPTEK  445



>ref|XP_006292567.1| hypothetical protein CARUB_v10018803mg [Capsella rubella]
 gb|EOA25465.1| hypothetical protein CARUB_v10018803mg [Capsella rubella]
Length=471

 Score =   252 bits (644),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 116/190 (61%), Positives = 146/190 (77%), Gaps = 1/190 (1%)
 Frame = +2

Query  2    VAVKSGWDQYGIKYGKPTKQLIIKRLTCISPYSAAIALGSEMSGGIEDVRASDITAVHTE  181
            +AVKSGWDQYGIK+G PTKQL I+RLTCISP SA +ALGSEMSGGI+DVR  ++T  +TE
Sbjct  258  IAVKSGWDQYGIKFGMPTKQLSIRRLTCISPKSAGVALGSEMSGGIKDVRIEEVTLTNTE  317

Query  182  SGVRIKSAIGRGGYVKNIYVKGLRAHTMKWVFLMSGDYGDHPDNHFDPKAFPVVAGINFR  361
            S +RIK+A GRGGYVKNI+ + +   TMK+VF MSGDY  HPD  +DPKAFP V  IN+R
Sbjct  318  SAIRIKTAAGRGGYVKNIFARRITMKTMKYVFWMSGDYNQHPDEGYDPKAFPEVTNINYR  377

Query  362  DVVADNVTMAGKMEGISGHPYTGVCMANVTIGMAKNGKKPAWNCSNIQGVASGVVPPPCP  541
            D+ A+NVTM+G ++GI   P+ G+C++NVTI +A N KK  WNC+N+ GV S V P PC 
Sbjct  378  DMKAENVTMSGSLDGIDKDPFKGICISNVTIALADNAKKVQWNCTNVAGVTSRVKPEPCS  437

Query  542  LL-HIQGPVK  568
            LL   + P+K
Sbjct  438  LLPEKKAPMK  447



>ref|XP_010941157.1| PREDICTED: probable polygalacturonase [Elaeis guineensis]
Length=486

 Score =   252 bits (644),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 114/186 (61%), Positives = 150/186 (81%), Gaps = 0/186 (0%)
 Frame = +2

Query  2    VAVKSGWDQYGIKYGKPTKQLIIKRLTCISPYSAAIALGSEMSGGIEDVRASDITAVHTE  181
            VA+KSGWD+YGI +G P++ +II+RLTCISP SA IALGSEMSGGI+DVRA DITA+ +E
Sbjct  274  VAIKSGWDEYGIAFGMPSQHIIIRRLTCISPTSAVIALGSEMSGGIQDVRAEDITAIDSE  333

Query  182  SGVRIKSAIGRGGYVKNIYVKGLRAHTMKWVFLMSGDYGDHPDNHFDPKAFPVVAGINFR  361
            SGVRIK+AIGRG YVK+I+V+G+  +TMKWVF M+G Y  HPDN +DP A PVV GI++ 
Sbjct  334  SGVRIKTAIGRGAYVKDIFVRGMNLNTMKWVFWMTGAYKSHPDNKYDPNAIPVVKGISYS  393

Query  362  DVVADNVTMAGKMEGISGHPYTGVCMANVTIGMAKNGKKPAWNCSNIQGVASGVVPPPCP  541
            DVVA +VT A ++EGIS  P+TG+C++NVT+ +A   KK +W C++++GV+SGV P PC 
Sbjct  394  DVVATDVTQAARLEGISNAPFTGICISNVTVHLAAKAKKQSWTCTDVEGVSSGVSPTPCA  453

Query  542  LLHIQG  559
             L  +G
Sbjct  454  SLPDRG  459



>ref|XP_004496830.1| PREDICTED: probable polygalacturonase-like [Cicer arietinum]
Length=469

 Score =   252 bits (643),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 118/183 (64%), Positives = 145/183 (79%), Gaps = 1/183 (1%)
 Frame = +2

Query  2    VAVKSGWDQYGIKYGKPTKQLIIKRLTCISPYSAAIALGSEMSGGIEDVRASDITAVHTE  181
            +A+KSGWD+YGIK G PT+ +II+RLTCISP SA IALGSEMSGGI+DVRA DITA+ TE
Sbjct  260  IAIKSGWDEYGIKVGMPTQHVIIRRLTCISPDSATIALGSEMSGGIQDVRAEDITAISTE  319

Query  182  SGVRIKSAIGRGGYVKNIYVKGLRAHTMKWVFLMSGDYGDHPDNHFDPKAFPVVAGINFR  361
            S VRIKSA+GRGG+V++I+VKG+  +TMK+VF M+G YG H D  FDPKA P V  IN+ 
Sbjct  320  SAVRIKSAVGRGGFVRDIFVKGMNLNTMKYVFWMTGAYGQHADEGFDPKALPNVTNINYS  379

Query  362  DVVADNVTMAGKMEGISGHPYTGVCMANVTIGMAKNGKKPAWNCSNIQGV-ASGVVPPPC  538
            D+VA NVT AGK+EGIS  PYTG+C++N  I MA N KK  WNC+++ GV +S V P PC
Sbjct  380  DIVAKNVTFAGKLEGISNDPYTGICISNTNIEMAANKKKLPWNCTDVSGVTSSDVTPQPC  439

Query  539  PLL  547
             LL
Sbjct  440  ALL  442



>ref|XP_007151452.1| hypothetical protein PHAVU_004G047700g [Phaseolus vulgaris]
 gb|ESW23446.1| hypothetical protein PHAVU_004G047700g [Phaseolus vulgaris]
Length=455

 Score =   251 bits (641),  Expect = 4e-76, Method: Compositional matrix adjust.
 Identities = 109/183 (60%), Positives = 145/183 (79%), Gaps = 0/183 (0%)
 Frame = +2

Query  2    VAVKSGWDQYGIKYGKPTKQLIIKRLTCISPYSAAIALGSEMSGGIEDVRASDITAVHTE  181
            ++ KSGWD YG+K+GKPTK +II+R+TCISP SA +ALGSEMSGGIED+R  D+TA+ T+
Sbjct  267  ISPKSGWDNYGVKFGKPTKNIIIRRITCISPDSAMVALGSEMSGGIEDIRVEDLTAIDTQ  326

Query  182  SGVRIKSAIGRGGYVKNIYVKGLRAHTMKWVFLMSGDYGDHPDNHFDPKAFPVVAGINFR  361
            S VRIK+A+GRG YVKNIYV+ L  +TMK+VF M+G YG HPD  FDPKA PV++GIN++
Sbjct  327  SAVRIKTAVGRGAYVKNIYVRNLNLNTMKYVFWMTGSYGSHPDPEFDPKALPVISGINYK  386

Query  362  DVVADNVTMAGKMEGISGHPYTGVCMANVTIGMAKNGKKPAWNCSNIQGVASGVVPPPCP  541
            D+VA NVT A ++EGI   P+TG+C++NVT+ ++K   K  WNC++I GV++ V P PC 
Sbjct  387  DIVAKNVTYAARLEGIPNDPFTGICISNVTMELSKEQHKLQWNCTDISGVSNNVTPTPCE  446

Query  542  LLH  550
             L 
Sbjct  447  ELQ  449



>ref|XP_008794781.1| PREDICTED: probable polygalacturonase isoform X4 [Phoenix dactylifera]
Length=477

 Score =   251 bits (642),  Expect = 6e-76, Method: Compositional matrix adjust.
 Identities = 113/186 (61%), Positives = 148/186 (80%), Gaps = 0/186 (0%)
 Frame = +2

Query  2    VAVKSGWDQYGIKYGKPTKQLIIKRLTCISPYSAAIALGSEMSGGIEDVRASDITAVHTE  181
            VA+KSGWD+YGI  G P++ +II+RLTCISP SA IALGSEMSGGI+DVRA DITA+ +E
Sbjct  265  VAIKSGWDEYGIAVGMPSQHIIIRRLTCISPTSAVIALGSEMSGGIQDVRAEDITAIDSE  324

Query  182  SGVRIKSAIGRGGYVKNIYVKGLRAHTMKWVFLMSGDYGDHPDNHFDPKAFPVVAGINFR  361
            SGVRIK+A+GRG YVK+I+V+G+  +TMKWVF M+G Y  HPDN +DP A PVV GI++ 
Sbjct  325  SGVRIKTAVGRGAYVKDIFVRGMNLNTMKWVFWMTGSYKSHPDNKYDPNAIPVVKGISYS  384

Query  362  DVVADNVTMAGKMEGISGHPYTGVCMANVTIGMAKNGKKPAWNCSNIQGVASGVVPPPCP  541
            DVVA +VT A ++EGIS  P+TG+C++NVT+ +A   KK +W C++++GV+ GV P PC 
Sbjct  385  DVVATDVTQAARLEGISNAPFTGICISNVTVQLAAKAKKQSWTCTDVEGVSKGVSPTPCA  444

Query  542  LLHIQG  559
             L  QG
Sbjct  445  SLPDQG  450



>ref|XP_008810120.1| PREDICTED: probable polygalacturonase isoform X2 [Phoenix dactylifera]
Length=441

 Score =   250 bits (639),  Expect = 7e-76, Method: Compositional matrix adjust.
 Identities = 111/186 (60%), Positives = 154/186 (83%), Gaps = 1/186 (1%)
 Frame = +2

Query  2    VAVKSGWDQYGIKYGKPTKQLIIKRLTCISPYSAAIALGSEMSGGIEDVRASDITAVHTE  181
            +A+KSGWD+YGI +  PT+ +II+RL+CISP SA IALGSEMSGG++D+RA DITA++TE
Sbjct  227  IAIKSGWDEYGIAFNMPTQHVIIRRLSCISPSSATIALGSEMSGGVQDIRAEDITAINTE  286

Query  182  SGVRIKSAIGRGGYVKNIYVKGLRAHTMKWVFLMSGDYGDHPDNHFDPKAFPVVAGINFR  361
            SGVRIK+AIGRGGY+K+I+V+ +  + MK+VF M+G+YG HPD+++DP A P+V  IN+ 
Sbjct  287  SGVRIKTAIGRGGYIKDIFVRRMTLNAMKYVFWMTGNYGQHPDDNYDPNAIPLVQNINYS  346

Query  362  DVVADNVTMAGKMEGISGHPYTGVCMANVTIGMAKNGKKPAWNCSNIQGVASGVVPPPCP  541
            DVVA+NVT+AGK+EGI   P+TG+C++NVT+ + K+ KK  WNC++++GV+S VVP PC 
Sbjct  347  DVVAENVTIAGKLEGIPKAPFTGICLSNVTVDVVKS-KKLKWNCTDVEGVSSAVVPTPCD  405

Query  542  LLHIQG  559
             L  QG
Sbjct  406  SLRDQG  411



>ref|XP_008794778.1| PREDICTED: probable polygalacturonase isoform X2 [Phoenix dactylifera]
Length=486

 Score =   251 bits (642),  Expect = 7e-76, Method: Compositional matrix adjust.
 Identities = 113/186 (61%), Positives = 148/186 (80%), Gaps = 0/186 (0%)
 Frame = +2

Query  2    VAVKSGWDQYGIKYGKPTKQLIIKRLTCISPYSAAIALGSEMSGGIEDVRASDITAVHTE  181
            VA+KSGWD+YGI  G P++ +II+RLTCISP SA IALGSEMSGGI+DVRA DITA+ +E
Sbjct  274  VAIKSGWDEYGIAVGMPSQHIIIRRLTCISPTSAVIALGSEMSGGIQDVRAEDITAIDSE  333

Query  182  SGVRIKSAIGRGGYVKNIYVKGLRAHTMKWVFLMSGDYGDHPDNHFDPKAFPVVAGINFR  361
            SGVRIK+A+GRG YVK+I+V+G+  +TMKWVF M+G Y  HPDN +DP A PVV GI++ 
Sbjct  334  SGVRIKTAVGRGAYVKDIFVRGMNLNTMKWVFWMTGSYKSHPDNKYDPNAIPVVKGISYS  393

Query  362  DVVADNVTMAGKMEGISGHPYTGVCMANVTIGMAKNGKKPAWNCSNIQGVASGVVPPPCP  541
            DVVA +VT A ++EGIS  P+TG+C++NVT+ +A   KK +W C++++GV+ GV P PC 
Sbjct  394  DVVATDVTQAARLEGISNAPFTGICISNVTVQLAAKAKKQSWTCTDVEGVSKGVSPTPCA  453

Query  542  LLHIQG  559
             L  QG
Sbjct  454  SLPDQG  459



>ref|XP_008794779.1| PREDICTED: probable polygalacturonase isoform X3 [Phoenix dactylifera]
Length=486

 Score =   251 bits (642),  Expect = 7e-76, Method: Compositional matrix adjust.
 Identities = 113/186 (61%), Positives = 148/186 (80%), Gaps = 0/186 (0%)
 Frame = +2

Query  2    VAVKSGWDQYGIKYGKPTKQLIIKRLTCISPYSAAIALGSEMSGGIEDVRASDITAVHTE  181
            VA+KSGWD+YGI  G P++ +II+RLTCISP SA IALGSEMSGGI+DVRA DITA+ +E
Sbjct  274  VAIKSGWDEYGIAVGMPSQHIIIRRLTCISPTSAVIALGSEMSGGIQDVRAEDITAIDSE  333

Query  182  SGVRIKSAIGRGGYVKNIYVKGLRAHTMKWVFLMSGDYGDHPDNHFDPKAFPVVAGINFR  361
            SGVRIK+A+GRG YVK+I+V+G+  +TMKWVF M+G Y  HPDN +DP A PVV GI++ 
Sbjct  334  SGVRIKTAVGRGAYVKDIFVRGMNLNTMKWVFWMTGSYKSHPDNKYDPNAIPVVKGISYS  393

Query  362  DVVADNVTMAGKMEGISGHPYTGVCMANVTIGMAKNGKKPAWNCSNIQGVASGVVPPPCP  541
            DVVA +VT A ++EGIS  P+TG+C++NVT+ +A   KK +W C++++GV+ GV P PC 
Sbjct  394  DVVATDVTQAARLEGISNAPFTGICISNVTVQLAAKAKKQSWTCTDVEGVSKGVSPTPCA  453

Query  542  LLHIQG  559
             L  QG
Sbjct  454  SLPDQG  459



>ref|XP_008794777.1| PREDICTED: probable polygalacturonase isoform X1 [Phoenix dactylifera]
Length=495

 Score =   251 bits (642),  Expect = 9e-76, Method: Compositional matrix adjust.
 Identities = 113/186 (61%), Positives = 148/186 (80%), Gaps = 0/186 (0%)
 Frame = +2

Query  2    VAVKSGWDQYGIKYGKPTKQLIIKRLTCISPYSAAIALGSEMSGGIEDVRASDITAVHTE  181
            VA+KSGWD+YGI  G P++ +II+RLTCISP SA IALGSEMSGGI+DVRA DITA+ +E
Sbjct  283  VAIKSGWDEYGIAVGMPSQHIIIRRLTCISPTSAVIALGSEMSGGIQDVRAEDITAIDSE  342

Query  182  SGVRIKSAIGRGGYVKNIYVKGLRAHTMKWVFLMSGDYGDHPDNHFDPKAFPVVAGINFR  361
            SGVRIK+A+GRG YVK+I+V+G+  +TMKWVF M+G Y  HPDN +DP A PVV GI++ 
Sbjct  343  SGVRIKTAVGRGAYVKDIFVRGMNLNTMKWVFWMTGSYKSHPDNKYDPNAIPVVKGISYS  402

Query  362  DVVADNVTMAGKMEGISGHPYTGVCMANVTIGMAKNGKKPAWNCSNIQGVASGVVPPPCP  541
            DVVA +VT A ++EGIS  P+TG+C++NVT+ +A   KK +W C++++GV+ GV P PC 
Sbjct  403  DVVATDVTQAARLEGISNAPFTGICISNVTVQLAAKAKKQSWTCTDVEGVSKGVSPTPCA  462

Query  542  LLHIQG  559
             L  QG
Sbjct  463  SLPDQG  468



>ref|XP_004496829.1| PREDICTED: probable polygalacturonase-like [Cicer arietinum]
Length=475

 Score =   251 bits (640),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 120/200 (60%), Positives = 151/200 (76%), Gaps = 4/200 (2%)
 Frame = +2

Query  2    VAVKSGWDQYGIKYGKPTKQLIIKRLTCISPYSAAIALGSEMSGGIEDVRASDITAVHTE  181
            +A+KSGWD+YGIK G PT+ +II+RLTCISP SA IALGSEMSGGI+DVRA DITA+ TE
Sbjct  260  IAIKSGWDEYGIKVGMPTQHVIIRRLTCISPDSATIALGSEMSGGIQDVRAEDITAISTE  319

Query  182  SGVRIKSAIGRGGYVKNIYVKGLRAHTMKWVFLMSGDYGDHPDNHFDPKAFPVVAGINFR  361
            S VRIKSA+GRGG+V++I+VKG+  +TMK+VF M+G YG H D  FDPKA P V  IN+ 
Sbjct  320  SAVRIKSAVGRGGFVRDIFVKGMNLNTMKYVFWMTGAYGQHADEGFDPKALPNVTNINYS  379

Query  362  DVVADNVTMAGKMEGISGHPYTGVCMANVTIGMAKNGKKPAWNCSNIQGV-ASGVVPPPC  538
            +++A NVT AGK+EGIS  PYTG+C++N  I MA N KK  WNC+++ GV +S V P PC
Sbjct  380  NIIAKNVTFAGKLEGISNDPYTGICVSNTNIEMAANKKKLPWNCTDVSGVTSSDVTPQPC  439

Query  539  PLLHIQGPVKPGMCDLPPKK  598
             LL  +G  +   C  P  K
Sbjct  440  ALLPQKGKFE---CAYPSDK  456



>gb|AFW04075.1| polygalacturonase [Litchi chinensis]
Length=481

 Score =   250 bits (639),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 117/199 (59%), Positives = 150/199 (75%), Gaps = 3/199 (2%)
 Frame = +2

Query  2    VAVKSGWDQYGIKYGKPTKQLIIKRLTCISPYSAAIALGSEMSGGIEDVRASDITAVHTE  181
            +AVKSGWDQYGIK G PT++L+I+R+TCISP SA IALGSEMSGGI DVRA DITA+ T+
Sbjct  267  IAVKSGWDQYGIKVGMPTQRLVIRRVTCISPDSATIALGSEMSGGIRDVRAEDITAIDTQ  326

Query  182  SGVRIKSAIGRGGYVKNIYVKGLRAHTMKWVFLMSGDYGDHPDNHFDPKAFPVVAGINFR  361
            SGVRIK+ +GRGGYVK+IYV+ +   TMK+VF M+G YG HPD  FDPKA P + GIN+R
Sbjct  327  SGVRIKTGVGRGGYVKDIYVRRMTMKTMKYVFWMTGSYGQHPDPGFDPKALPDIHGINYR  386

Query  362  DVVADNVTMAGKMEGISGHPYTGVCMANVTIGMAKNGKKPAWNCSNIQGVASGVVPPPCP  541
            D+VA+NVT + +++GI   P+ G+C+ NVTI + K  K+  WNC+++QGV S V PP C 
Sbjct  387  DMVAENVTYSARLDGIPNDPFKGICIFNVTITLTKKPKELQWNCTDVQGVTSRVTPPACS  446

Query  542  LLHIQGPVKPGMCDLPPKK  598
            LL  + PV    C  P  +
Sbjct  447  LLPEKKPVD---CPFPADR  462



>ref|XP_004234221.1| PREDICTED: probable polygalacturonase [Solanum lycopersicum]
Length=467

 Score =   250 bits (638),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 116/196 (59%), Positives = 150/196 (77%), Gaps = 4/196 (2%)
 Frame = +2

Query  2    VAVKSGWDQYGIKYGKPTKQLIIKRLTCISPYSAAIALGSEMSGGIEDVRASDITAVHTE  181
            +AVKSGWD+YGI +G PTK LII+ LTCISP SA IALGSEMSGGI+DVRA +I A+ +E
Sbjct  255  IAVKSGWDEYGIAFGMPTKHLIIRNLTCISPDSAVIALGSEMSGGIQDVRAENIGAISSE  314

Query  182  SGVRIKSAIGRGGYVKNIYVKGLRAHTMKWVFLMSGDYGDHPDNHFDPKAFPVVAGINFR  361
            SG+RIK+AIGRG Y+K+++V+G+   TMK+ F ++GDYG HPD H+DPKA PV+ GIN +
Sbjct  315  SGLRIKTAIGRGAYIKDVFVRGMTLQTMKYTFWITGDYGAHPDEHYDPKALPVIQGINVK  374

Query  362  DVVADNVTMAGKMEGISGHPYTGVCMANVTIGMAKNGKKPAWNCSNIQGVASGVVPPPCP  541
            DVVA NVT+AGK+ GI G  + G+C++NV I +++  K+  WNCSNI+GV+S V P PC 
Sbjct  375  DVVAKNVTIAGKLVGIDGDTFNGICISNVAIELSEQAKQLQWNCSNIEGVSSQVTPQPCA  434

Query  542  LLHIQGPVKPGMCDLP  589
            LL    P K   C  P
Sbjct  435  LL----PDKNIECPFP  446



>ref|XP_009393955.1| PREDICTED: probable polygalacturonase, partial [Musa acuminata 
subsp. malaccensis]
Length=214

 Score =   241 bits (616),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 107/184 (58%), Positives = 148/184 (80%), Gaps = 1/184 (1%)
 Frame = +2

Query  8    VKSGWDQYGIKYGKPTKQLIIKRLTCISPYSAAIALGSEMSGGIEDVRASDITAVHTESG  187
            +KSGWD+YGI YG P++ ++I+RLTC+SP SA IALGSEMSGGI DVRA DITA+++ESG
Sbjct  1    IKSGWDEYGISYGMPSQHIVIRRLTCVSPTSAVIALGSEMSGGIRDVRAEDITALNSESG  60

Query  188  VRIKSAIGRGGYVKNIYVKGLRAHTMKWVFLMSGDYGDHPDNHFDPKAFPVVAGINFRDV  367
            +RIK+A+GRG YVK+++V+ +  +TMKWVF M+G Y  HPD+ +DP A P+V GI++ +V
Sbjct  61   IRIKTAVGRGAYVKDVFVRRMNLNTMKWVFWMTGSYKSHPDDKYDPNAIPMVDGISYSEV  120

Query  368  VADNVTMAGKMEGISGHPYTGVCMANVTIGMAKNGKKPAWNCSNIQGVASGVVPPPCPLL  547
            VA NVTMAG++EGI   P+TG+C++NVT+ +AK+ K P W C++++GV+SGV P  C  L
Sbjct  121  VAYNVTMAGRLEGIPSAPFTGICVSNVTVQLAKSMKTP-WYCADVEGVSSGVTPAACASL  179

Query  548  HIQG  559
              QG
Sbjct  180  ADQG  183



>gb|KGN49922.1| hypothetical protein Csa_5G140480 [Cucumis sativus]
Length=482

 Score =   250 bits (638),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 114/199 (57%), Positives = 151/199 (76%), Gaps = 2/199 (1%)
 Frame = +2

Query  2    VAVKSGWDQYGIKYGKPTKQLIIKRLTCISPYSAAIALGSEMSGGIEDVRASDITAVHTE  181
            +AVKSGWDQYGIK+G PT+ L+IKRLTCISP SA +ALGSEMSGGI +VR  + T ++T+
Sbjct  267  IAVKSGWDQYGIKFGMPTEDLVIKRLTCISPDSAGVALGSEMSGGIRNVRIENFTGINTQ  326

Query  182  SGVRIKSAIGRGGYVKNIYVKGLRAHTMKWVFLMSGDYGDHPDNHFDPKAFPVVAGINFR  361
            S VRIK+A GRGG+VK+I+V+G+   TMK+VF M+G+Y  HPD+ FDP A P +  IN+R
Sbjct  327  SAVRIKTARGRGGFVKDIFVRGMYLSTMKYVFWMTGNYKSHPDDKFDPAALPEITNINYR  386

Query  362  DVVADNVTMAGKMEGISGHPYTGVCMANVTIGMAKNGKKPAWNCSNIQGVASGVVPPPCP  541
            DVVA+NVT + ++EGISG P+T +C++NV IG+    KK  WNC++++G +S VVPPPC 
Sbjct  387  DVVAENVTYSARLEGISGDPFTNICISNVKIGLTATPKKLQWNCTDVEGFSSDVVPPPCA  446

Query  542  LLHIQGPVKPGMCDLPPKK  598
             L   G  K G CD P  +
Sbjct  447  PLAKAG--KSGGCDFPEDQ  463



>ref|XP_004160401.1| PREDICTED: LOW QUALITY PROTEIN: probable polygalacturonase-like 
[Cucumis sativus]
Length=480

 Score =   250 bits (638),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 114/199 (57%), Positives = 151/199 (76%), Gaps = 2/199 (1%)
 Frame = +2

Query  2    VAVKSGWDQYGIKYGKPTKQLIIKRLTCISPYSAAIALGSEMSGGIEDVRASDITAVHTE  181
            +AVKSGWDQYGIK+G PT+ L+IKRLTCISP SA +ALGSEMSGGI +VR  + T ++T+
Sbjct  265  IAVKSGWDQYGIKFGMPTEDLVIKRLTCISPDSAGVALGSEMSGGIRNVRIENFTGINTQ  324

Query  182  SGVRIKSAIGRGGYVKNIYVKGLRAHTMKWVFLMSGDYGDHPDNHFDPKAFPVVAGINFR  361
            S VRIK+A GRGG+VK+I+V+G+   TMK+VF M+G+Y  HPD+ FDP A P +  IN+R
Sbjct  325  SAVRIKTARGRGGFVKDIFVRGMYLSTMKYVFWMTGNYKSHPDDKFDPAALPEITNINYR  384

Query  362  DVVADNVTMAGKMEGISGHPYTGVCMANVTIGMAKNGKKPAWNCSNIQGVASGVVPPPCP  541
            DVVA+NVT + ++EGISG P+T +C++NV IG+    KK  WNC++++G +S VVPPPC 
Sbjct  385  DVVAENVTYSARLEGISGDPFTNICISNVKIGLTATPKKLQWNCTDVEGFSSDVVPPPCA  444

Query  542  LLHIQGPVKPGMCDLPPKK  598
             L   G  K G CD P  +
Sbjct  445  PLAKAG--KSGGCDFPEDQ  461



>ref|XP_009382257.1| PREDICTED: probable polygalacturonase isoform X2 [Musa acuminata 
subsp. malaccensis]
Length=486

 Score =   250 bits (638),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 117/196 (60%), Positives = 151/196 (77%), Gaps = 2/196 (1%)
 Frame = +2

Query  2    VAVKSGWDQYGIKYGKPTKQLIIKRLTCISPYSAAIALGSEMSGGIEDVRASDITAVHTE  181
            +A+KSGWD+YGI +   +K ++I+RLTCISP SA IALGSEMSGGI+DVRA DITA+H+E
Sbjct  272  IAIKSGWDEYGIAFNMSSKHIVIRRLTCISPTSAVIALGSEMSGGIQDVRAEDITAIHSE  331

Query  182  SGVRIKSAIGRGGYVKNIYVKGLRAHTMKWVFLMSGDYGDHPDNHFDPKAFPVVAGINFR  361
            SGVRIK+ IGRG YVK+I+V+ +  HTMKWVF M+G YG HPD+ FDPKA PVV  I + 
Sbjct  332  SGVRIKTTIGRGAYVKDIFVRRMNLHTMKWVFWMTGTYGQHPDDKFDPKAIPVVRNIIYS  391

Query  362  DVVADNVTMAGKMEGISGHPYTGVCMANVTIGMAKNGKKPAWNCSNIQGVASGVVPPPCP  541
            DVVA+NVTMA K+EGI G P+TG+C+ NVT  + K+ KKP WNC++++GV+S V P PC 
Sbjct  392  DVVAENVTMAAKLEGIPGAPFTGICIYNVTAEVVKS-KKPIWNCTDVEGVSSHVTPTPCA  450

Query  542  LLHIQGPVKPGMCDLP  589
             +  + P +   C  P
Sbjct  451  QIP-EYPDRITHCPFP  465



>ref|XP_004145976.1| PREDICTED: probable polygalacturonase-like [Cucumis sativus]
Length=480

 Score =   249 bits (637),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 114/199 (57%), Positives = 151/199 (76%), Gaps = 2/199 (1%)
 Frame = +2

Query  2    VAVKSGWDQYGIKYGKPTKQLIIKRLTCISPYSAAIALGSEMSGGIEDVRASDITAVHTE  181
            +AVKSGWDQYGIK+G PT+ L+IKRLTCISP SA +ALGSEMSGGI +VR  + T ++T+
Sbjct  265  IAVKSGWDQYGIKFGMPTEDLVIKRLTCISPDSAGVALGSEMSGGIRNVRIENFTGINTQ  324

Query  182  SGVRIKSAIGRGGYVKNIYVKGLRAHTMKWVFLMSGDYGDHPDNHFDPKAFPVVAGINFR  361
            S VRIK+A GRGG+VK+I+V+G+   TMK+VF M+G+Y  HPD+ FDP A P +  IN+R
Sbjct  325  SAVRIKTARGRGGFVKDIFVRGMYLSTMKYVFWMTGNYKSHPDDKFDPAALPEITNINYR  384

Query  362  DVVADNVTMAGKMEGISGHPYTGVCMANVTIGMAKNGKKPAWNCSNIQGVASGVVPPPCP  541
            DVVA+NVT + ++EGISG P+T +C++NV IG+    KK  WNC++++G +S VVPPPC 
Sbjct  385  DVVAENVTYSARLEGISGDPFTNICISNVKIGLTATPKKLQWNCTDVEGFSSDVVPPPCA  444

Query  542  LLHIQGPVKPGMCDLPPKK  598
             L   G  K G CD P  +
Sbjct  445  PLAKAG--KSGGCDFPEDQ  461



>ref|XP_011035342.1| PREDICTED: probable polygalacturonase [Populus euphratica]
Length=475

 Score =   249 bits (637),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 118/200 (59%), Positives = 152/200 (76%), Gaps = 5/200 (3%)
 Frame = +2

Query  2    VAVKSGWDQYGIKYGKPTKQLIIKRLTCISPYSAAIALGSEMSGGIEDVRASDITAVHTE  181
            +AVKSG DQYGIK G P KQL+I+R+TCISP SAAIALGSEMSGGIEDVR  DITA++TE
Sbjct  265  IAVKSGLDQYGIKVGMPMKQLVIRRITCISPKSAAIALGSEMSGGIEDVRVEDITAINTE  324

Query  182  SGVRIKSAIGRGGYVKNIYVKGLRAHTMKWVFLMSGDYGDHPDNHFDPKAFPVVAGINFR  361
            S VR+K+A+GRGGYVK+I+V+ +   TMK+VF M G Y  H D  +DPKA P +  INFR
Sbjct  325  SAVRVKTAVGRGGYVKDIFVRRMTLKTMKYVFWMIGSYSSHADEGYDPKALPEITNINFR  384

Query  362  DVVADNVTMAGKMEGI-SGHPYTGVCMANVTIGMAKNGKKPAWNCSNIQGVASGVVPPPC  538
            D+VADNVT+ GK+EG+  G+P+TG+C++NVT+ +A+  K+PAWNC+++ GV+S V P PC
Sbjct  385  DIVADNVTIPGKLEGLGEGNPFTGICISNVTMTLAEKHKEPAWNCTDVSGVSSNVTPMPC  444

Query  539  PLLHIQGPVKPGMCDLPPKK  598
              L    P K   C  P  +
Sbjct  445  AAL----PKKSMDCPFPEDQ  460



>ref|XP_008810119.1| PREDICTED: probable polygalacturonase isoform X1 [Phoenix dactylifera]
Length=493

 Score =   250 bits (638),  Expect = 4e-75, Method: Compositional matrix adjust.
 Identities = 111/186 (60%), Positives = 154/186 (83%), Gaps = 1/186 (1%)
 Frame = +2

Query  2    VAVKSGWDQYGIKYGKPTKQLIIKRLTCISPYSAAIALGSEMSGGIEDVRASDITAVHTE  181
            +A+KSGWD+YGI +  PT+ +II+RL+CISP SA IALGSEMSGG++D+RA DITA++TE
Sbjct  279  IAIKSGWDEYGIAFNMPTQHVIIRRLSCISPSSATIALGSEMSGGVQDIRAEDITAINTE  338

Query  182  SGVRIKSAIGRGGYVKNIYVKGLRAHTMKWVFLMSGDYGDHPDNHFDPKAFPVVAGINFR  361
            SGVRIK+AIGRGGY+K+I+V+ +  + MK+VF M+G+YG HPD+++DP A P+V  IN+ 
Sbjct  339  SGVRIKTAIGRGGYIKDIFVRRMTLNAMKYVFWMTGNYGQHPDDNYDPNAIPLVQNINYS  398

Query  362  DVVADNVTMAGKMEGISGHPYTGVCMANVTIGMAKNGKKPAWNCSNIQGVASGVVPPPCP  541
            DVVA+NVT+AGK+EGI   P+TG+C++NVT+ + K+ KK  WNC++++GV+S VVP PC 
Sbjct  399  DVVAENVTIAGKLEGIPKAPFTGICLSNVTVDVVKS-KKLKWNCTDVEGVSSAVVPTPCD  457

Query  542  LLHIQG  559
             L  QG
Sbjct  458  SLRDQG  463



>ref|XP_002513653.1| polygalacturonase, putative [Ricinus communis]
 gb|EEF49056.1| polygalacturonase, putative [Ricinus communis]
Length=473

 Score =   249 bits (636),  Expect = 4e-75, Method: Compositional matrix adjust.
 Identities = 114/199 (57%), Positives = 150/199 (75%), Gaps = 4/199 (2%)
 Frame = +2

Query  2    VAVKSGWDQYGIKYGKPTKQLIIKRLTCISPYSAAIALGSEMSGGIEDVRASDITAVHTE  181
            +AVKSGWDQYGIK+G PTK+L+I+RLTCISP SA IALGSEMSGGI+DVRA DITA++T+
Sbjct  264  IAVKSGWDQYGIKFGMPTKKLVIRRLTCISPDSATIALGSEMSGGIQDVRAEDITAINTQ  323

Query  182  SGVRIKSAIGRGGYVKNIYVKGLRAHTMKWVFLMSGDYGDHPDNHFDPKAFPVVAGINFR  361
            SG+RIK+A GRG YVK+I+V+ +   TMK+VF M+G YG HPD  +DP A P++  IN+R
Sbjct  324  SGIRIKTAAGRGAYVKDIFVRRMNFKTMKYVFWMTGSYGSHPDKGYDPNALPIITRINYR  383

Query  362  DVVADNVTMAGKMEGISGHPYTGVCMANVTIGMAKNGKKPAWNCSNIQGVASGVVPPPCP  541
            D+VA+NVT + ++EGI   P+TG+C++N  I + K  +K  WNC++I+GV S V P PC 
Sbjct  384  DIVAENVTYSARLEGIEKDPFTGICISNANITLTKKPEKLQWNCTDIEGVTSNVNPRPCS  443

Query  542  LLHIQGPVKPGMCDLPPKK  598
            LL    P K   C  P  +
Sbjct  444  LL----PGKRLECPFPKDR  458



>ref|XP_002273669.1| PREDICTED: probable polygalacturonase [Vitis vinifera]
Length=478

 Score =   249 bits (636),  Expect = 4e-75, Method: Compositional matrix adjust.
 Identities = 113/182 (62%), Positives = 148/182 (81%), Gaps = 0/182 (0%)
 Frame = +2

Query  2    VAVKSGWDQYGIKYGKPTKQLIIKRLTCISPYSAAIALGSEMSGGIEDVRASDITAVHTE  181
            +AVKSGWDQYG K+G PTK L+I+RLTCISP SA IALGSEMSGGI++V A DITA+ T+
Sbjct  263  IAVKSGWDQYGYKFGMPTKDLLIRRLTCISPDSATIALGSEMSGGIKNVWAEDITAIDTQ  322

Query  182  SGVRIKSAIGRGGYVKNIYVKGLRAHTMKWVFLMSGDYGDHPDNHFDPKAFPVVAGINFR  361
            SG+RIK+ IGRGGYVK+IYV+ +   TMK+VF ++GDYG HPD+ +DPKA PV+  IN+R
Sbjct  323  SGIRIKTGIGRGGYVKDIYVRRMTVKTMKYVFWITGDYGSHPDDGWDPKALPVIKNINYR  382

Query  362  DVVADNVTMAGKMEGISGHPYTGVCMANVTIGMAKNGKKPAWNCSNIQGVASGVVPPPCP  541
            D+VA+NVT + +++GISG P+TG+C++NVTIG+ +  K+  WNC+N+ GV S V P  C 
Sbjct  383  DMVAENVTYSARLDGISGDPFTGICISNVTIGLTEKPKELQWNCTNVAGVTSQVTPRSCD  442

Query  542  LL  547
            LL
Sbjct  443  LL  444



>ref|NP_190464.1| pectin lyase-like superfamily protein [Arabidopsis thaliana]
 emb|CAB62015.1| endo-polygalacturonase-like protein [Arabidopsis thaliana]
 gb|AAY78763.1| glycoside hydrolase family 28 protein [Arabidopsis thaliana]
 gb|AEE78476.1| pectin lyase-like superfamily protein [Arabidopsis thaliana]
Length=469

 Score =   249 bits (636),  Expect = 4e-75, Method: Compositional matrix adjust.
 Identities = 110/182 (60%), Positives = 141/182 (77%), Gaps = 0/182 (0%)
 Frame = +2

Query  2    VAVKSGWDQYGIKYGKPTKQLIIKRLTCISPYSAAIALGSEMSGGIEDVRASDITAVHTE  181
            +AVKSGWDQYGIK+G PT+QL I+RLTCISP SA +ALGSEMSGGI+DVR  D+T  +TE
Sbjct  257  IAVKSGWDQYGIKFGMPTQQLSIRRLTCISPKSAGVALGSEMSGGIKDVRIEDVTLTNTE  316

Query  182  SGVRIKSAIGRGGYVKNIYVKGLRAHTMKWVFLMSGDYGDHPDNHFDPKAFPVVAGINFR  361
            S +RIK+A+GRG YVK+IY + +   TMK+VF MSG+YG HPD  FDPKA P +  IN+R
Sbjct  317  SAIRIKTAVGRGAYVKDIYARRITMKTMKYVFWMSGNYGSHPDEGFDPKALPEITNINYR  376

Query  362  DVVADNVTMAGKMEGISGHPYTGVCMANVTIGMAKNGKKPAWNCSNIQGVASGVVPPPCP  541
            D+ A+NVTM+  ++GI   P+TG+C++NVTI +A   KK  WNC+++ GV S V P PC 
Sbjct  377  DMTAENVTMSASLDGIDKDPFTGICISNVTIALAAKAKKMQWNCTDVAGVTSRVTPEPCS  436

Query  542  LL  547
            LL
Sbjct  437  LL  438



>gb|AFK49026.1| unknown [Lotus japonicus]
Length=388

 Score =   246 bits (629),  Expect = 5e-75, Method: Compositional matrix adjust.
 Identities = 111/183 (61%), Positives = 143/183 (78%), Gaps = 2/183 (1%)
 Frame = +2

Query  2    VAVKSGWDQYGIKYGKPTKQLIIKRLTCISPYSAAIALGSEMSGGIEDVRASDITAVHTE  181
            +AVKSGWD+YGIK G P++ +II+RLTCISP SA IALGSEMSGGI+D+RA D+TA++T+
Sbjct  202  IAVKSGWDEYGIKVGMPSQHIIIRRLTCISPDSAMIALGSEMSGGIQDIRAEDLTAINTQ  261

Query  182  SGVRIKSAIGRGGYVKNIYVKGLRAHTMKWVFLMSGDYGDHPDNHFDPKAFPVVAGINFR  361
            S VRIK+A+GRG YV+NI+V+G+   TMK+VF M+G YG HPD  FDPKA P + GIN+R
Sbjct  262  SAVRIKTAVGRGAYVRNIFVEGMNLFTMKYVFWMTGSYGSHPDTGFDPKALPTITGINYR  321

Query  362  DVVADNVTMAGKMEGISGHPYTGVCMANVTIGMAKNGKKPAWNCSNIQGVASGVVPPPCP  541
            DV+A NV    K+EGI+  P+TG+C++N  I   K GKK AWNC+++ GV S V P PC 
Sbjct  322  DVIAKNVAYPAKLEGIANDPFTGICISNANI--EKVGKKLAWNCTDVHGVTSNVSPEPCA  379

Query  542  LLH  550
            LL 
Sbjct  380  LLQ  382



>ref|XP_008437531.1| PREDICTED: probable polygalacturonase [Cucumis melo]
Length=480

 Score =   249 bits (635),  Expect = 6e-75, Method: Compositional matrix adjust.
 Identities = 113/199 (57%), Positives = 151/199 (76%), Gaps = 2/199 (1%)
 Frame = +2

Query  2    VAVKSGWDQYGIKYGKPTKQLIIKRLTCISPYSAAIALGSEMSGGIEDVRASDITAVHTE  181
            +AVKSGWDQYGIK+G PT+ L+I+RLTCISP SA IALGSEMSGGI +VR  ++T ++T+
Sbjct  265  IAVKSGWDQYGIKFGMPTEDLVIRRLTCISPDSAGIALGSEMSGGIRNVRIENVTGINTQ  324

Query  182  SGVRIKSAIGRGGYVKNIYVKGLRAHTMKWVFLMSGDYGDHPDNHFDPKAFPVVAGINFR  361
            S VRIK+A GRGG+VK+I+V+G+   TMK+VF M+G+Y  HPD  FDP A P +  IN+R
Sbjct  325  SAVRIKTARGRGGFVKDIFVRGMYLSTMKYVFWMTGNYKSHPDEKFDPAALPEITNINYR  384

Query  362  DVVADNVTMAGKMEGISGHPYTGVCMANVTIGMAKNGKKPAWNCSNIQGVASGVVPPPCP  541
            DVVA+NVT + ++EGISG P+T +C++NV IG+    KK  WNC++++G++S VVPPPC 
Sbjct  385  DVVAENVTYSARLEGISGDPFTNICISNVKIGLTAKPKKLQWNCTDVEGISSDVVPPPCA  444

Query  542  LLHIQGPVKPGMCDLPPKK  598
             L      K G CD P  +
Sbjct  445  PL--AKAAKSGGCDFPADQ  461



>ref|XP_010933983.1| PREDICTED: probable polygalacturonase isoform X2 [Elaeis guineensis]
Length=492

 Score =   249 bits (636),  Expect = 7e-75, Method: Compositional matrix adjust.
 Identities = 112/186 (60%), Positives = 153/186 (82%), Gaps = 1/186 (1%)
 Frame = +2

Query  2    VAVKSGWDQYGIKYGKPTKQLIIKRLTCISPYSAAIALGSEMSGGIEDVRASDITAVHTE  181
            +A+KSGWD+YGI +  PT+ +II+RLTCISP SA IALGSEMSGGIEDVRA DI A++TE
Sbjct  278  IAIKSGWDEYGIAFNMPTRHVIIRRLTCISPTSATIALGSEMSGGIEDVRAEDIMAINTE  337

Query  182  SGVRIKSAIGRGGYVKNIYVKGLRAHTMKWVFLMSGDYGDHPDNHFDPKAFPVVAGINFR  361
            SGVRIK+AIGRGGYVK+I+V+ +  +TMK+VF M+G+YG HPD+ +DP A P++  IN+R
Sbjct  338  SGVRIKTAIGRGGYVKDIFVRRMTLNTMKYVFWMAGNYGQHPDDKYDPNAIPIIHNINYR  397

Query  362  DVVADNVTMAGKMEGISGHPYTGVCMANVTIGMAKNGKKPAWNCSNIQGVASGVVPPPCP  541
            DVVA++VT+AGK+EG+   P+TG+C++NVT+ + K+ KK  WNC++++GV+S V+P PC 
Sbjct  398  DVVAEDVTIAGKLEGLPKAPFTGICLSNVTVDVVKS-KKLKWNCTDVEGVSSAVMPTPCD  456

Query  542  LLHIQG  559
             L   G
Sbjct  457  SLRDLG  462



>ref|XP_011046019.1| PREDICTED: probable polygalacturonase [Populus euphratica]
Length=452

 Score =   248 bits (633),  Expect = 7e-75, Method: Compositional matrix adjust.
 Identities = 111/199 (56%), Positives = 151/199 (76%), Gaps = 4/199 (2%)
 Frame = +2

Query  2    VAVKSGWDQYGIKYGKPTKQLIIKRLTCISPYSAAIALGSEMSGGIEDVRASDITAVHTE  181
            +AVKSGWD+YGIK+G+PT+ L+I+R +CISP SAAIALGSEMSGGI+DVRA DITA+ T+
Sbjct  243  IAVKSGWDEYGIKFGRPTQHLVIRRFSCISPDSAAIALGSEMSGGIQDVRAEDITALSTQ  302

Query  182  SGVRIKSAIGRGGYVKNIYVKGLRAHTMKWVFLMSGDYGDHPDNHFDPKAFPVVAGINFR  361
            SGVRIK+A+GRG YVK+I+V+ +   TMK+ F M+G YG HPD  +DPKA P + GI+++
Sbjct  303  SGVRIKTAVGRGAYVKDIFVRRMILKTMKYAFWMTGSYGSHPDTGYDPKALPEIKGISYK  362

Query  362  DVVADNVTMAGKMEGISGHPYTGVCMANVTIGMAKNGKKPAWNCSNIQGVASGVVPPPCP  541
            D+VA+NVT + ++EGI   P+TG+C++NV I + +  K+  WNC++IQGV+S V P PC 
Sbjct  363  DIVAENVTYSARLEGIENDPFTGICISNVNISLTQKPKELQWNCTDIQGVSSKVTPQPCA  422

Query  542  LLHIQGPVKPGMCDLPPKK  598
             L    P K   C  P  +
Sbjct  423  AL----PEKSIECPFPEDR  437



>ref|XP_002305262.1| glycoside hydrolase family 28 family protein [Populus trichocarpa]
 gb|EEE85773.1| glycoside hydrolase family 28 family protein [Populus trichocarpa]
Length=437

 Score =   248 bits (632),  Expect = 8e-75, Method: Compositional matrix adjust.
 Identities = 118/200 (59%), Positives = 151/200 (76%), Gaps = 5/200 (3%)
 Frame = +2

Query  2    VAVKSGWDQYGIKYGKPTKQLIIKRLTCISPYSAAIALGSEMSGGIEDVRASDITAVHTE  181
            +AVKSG DQYGIK G P KQL+I+R+TCISP SAAIALGSEMSGGIEDVR  DITA++TE
Sbjct  227  IAVKSGLDQYGIKVGMPMKQLVIRRITCISPKSAAIALGSEMSGGIEDVRIEDITAINTE  286

Query  182  SGVRIKSAIGRGGYVKNIYVKGLRAHTMKWVFLMSGDYGDHPDNHFDPKAFPVVAGINFR  361
            S VR+K+A+GRGGYVK+I+V+ +   TMK+VF M G Y  H D  +DPKA P +  INFR
Sbjct  287  SAVRVKTAVGRGGYVKDIFVRRMTLKTMKYVFWMIGSYSSHADEGYDPKALPEITNINFR  346

Query  362  DVVADNVTMAGKMEGI-SGHPYTGVCMANVTIGMAKNGKKPAWNCSNIQGVASGVVPPPC  538
            D+ ADNVT+ GK+EG+  G+P+TG+C++NVT+ +A+  K+PAWNC+++ GV+S V P PC
Sbjct  347  DIAADNVTIPGKLEGLGEGNPFTGICISNVTMTLAEKHKEPAWNCTDVSGVSSNVTPMPC  406

Query  539  PLLHIQGPVKPGMCDLPPKK  598
              L    P K   C  P  K
Sbjct  407  AAL----PKKSMDCPFPEDK  422



>ref|XP_010933982.1| PREDICTED: probable polygalacturonase isoform X1 [Elaeis guineensis]
Length=501

 Score =   249 bits (635),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 112/186 (60%), Positives = 153/186 (82%), Gaps = 1/186 (1%)
 Frame = +2

Query  2    VAVKSGWDQYGIKYGKPTKQLIIKRLTCISPYSAAIALGSEMSGGIEDVRASDITAVHTE  181
            +A+KSGWD+YGI +  PT+ +II+RLTCISP SA IALGSEMSGGIEDVRA DI A++TE
Sbjct  287  IAIKSGWDEYGIAFNMPTRHVIIRRLTCISPTSATIALGSEMSGGIEDVRAEDIMAINTE  346

Query  182  SGVRIKSAIGRGGYVKNIYVKGLRAHTMKWVFLMSGDYGDHPDNHFDPKAFPVVAGINFR  361
            SGVRIK+AIGRGGYVK+I+V+ +  +TMK+VF M+G+YG HPD+ +DP A P++  IN+R
Sbjct  347  SGVRIKTAIGRGGYVKDIFVRRMTLNTMKYVFWMAGNYGQHPDDKYDPNAIPIIHNINYR  406

Query  362  DVVADNVTMAGKMEGISGHPYTGVCMANVTIGMAKNGKKPAWNCSNIQGVASGVVPPPCP  541
            DVVA++VT+AGK+EG+   P+TG+C++NVT+ + K+ KK  WNC++++GV+S V+P PC 
Sbjct  407  DVVAEDVTIAGKLEGLPKAPFTGICLSNVTVDVVKS-KKLKWNCTDVEGVSSAVMPTPCD  465

Query  542  LLHIQG  559
             L   G
Sbjct  466  SLRDLG  471



>ref|XP_010426397.1| PREDICTED: probable polygalacturonase [Camelina sativa]
Length=464

 Score =   248 bits (632),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 114/196 (58%), Positives = 145/196 (74%), Gaps = 4/196 (2%)
 Frame = +2

Query  2    VAVKSGWDQYGIKYGKPTKQLIIKRLTCISPYSAAIALGSEMSGGIEDVRASDITAVHTE  181
            +AVKSGWDQYGIK+G PT+QL I+RLTCISP SA +ALGSEMSGGI+DVR  D+T  +TE
Sbjct  257  IAVKSGWDQYGIKFGMPTRQLSIRRLTCISPKSAGVALGSEMSGGIKDVRIEDVTLTNTE  316

Query  182  SGVRIKSAIGRGGYVKNIYVKGLRAHTMKWVFLMSGDYGDHPDNHFDPKAFPVVAGINFR  361
            S +RIK+A GRGGYVK+I+ + +   TMK+VF M+GDY  HPD  +DPKAFP V  IN+R
Sbjct  317  SAIRIKTAAGRGGYVKDIFARRITMKTMKFVFWMNGDYNSHPDEGYDPKAFPEVTNINYR  376

Query  362  DVVADNVTMAGKMEGISGHPYTGVCMANVTIGMAKNGKKPAWNCSNIQGVASGVVPPPCP  541
            D+ A+NVTM+  ++GI   P+ G+C++NVT+ +A N KK  WNC+N+ GV S V P PC 
Sbjct  377  DMTAENVTMSASLDGIDKDPFKGICISNVTMALADNAKKVQWNCTNVAGVTSRVKPEPCS  436

Query  542  LLHIQGPVKPGMCDLP  589
            LL    P K   C  P
Sbjct  437  LL----PEKNQDCVFP  448



>ref|XP_010450744.1| PREDICTED: probable polygalacturonase [Camelina sativa]
Length=459

 Score =   248 bits (632),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 114/196 (58%), Positives = 145/196 (74%), Gaps = 4/196 (2%)
 Frame = +2

Query  2    VAVKSGWDQYGIKYGKPTKQLIIKRLTCISPYSAAIALGSEMSGGIEDVRASDITAVHTE  181
            +AVKSGWDQYGIK+G PTKQL I+RLTCISP SA +ALGSEMSGGI+DVR  D+T  +TE
Sbjct  252  IAVKSGWDQYGIKFGMPTKQLSIRRLTCISPKSAGVALGSEMSGGIKDVRIEDVTLTNTE  311

Query  182  SGVRIKSAIGRGGYVKNIYVKGLRAHTMKWVFLMSGDYGDHPDNHFDPKAFPVVAGINFR  361
            S +RIK+A GRGGYVK+++ + +   TMK+VF M+GDY  HPD  +DPKAFP V  IN+R
Sbjct  312  SAIRIKTAAGRGGYVKDVFARRITMKTMKFVFWMNGDYNQHPDEGYDPKAFPEVTNINYR  371

Query  362  DVVADNVTMAGKMEGISGHPYTGVCMANVTIGMAKNGKKPAWNCSNIQGVASGVVPPPCP  541
            D+ A+NVTM+  ++GI   P+ G+C++NVT+ +A N KK  WNC+N+ GV S V P PC 
Sbjct  372  DMTAENVTMSASLDGIDKDPFKGICISNVTMELAANAKKVQWNCTNVAGVTSRVKPEPCS  431

Query  542  LLHIQGPVKPGMCDLP  589
            LL    P K   C  P
Sbjct  432  LL----PEKNQDCVFP  443



>gb|KDP22229.1| hypothetical protein JCGZ_26060 [Jatropha curcas]
Length=467

 Score =   248 bits (632),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 118/196 (60%), Positives = 147/196 (75%), Gaps = 4/196 (2%)
 Frame = +2

Query  2    VAVKSGWDQYGIKYGKPTKQLIIKRLTCISPYSAAIALGSEMSGGIEDVRASDITAVHTE  181
            +AVKSGWDQYGIK+G PTKQLII++LTCISP SAAIALGSEMSGGI+DVRA DITA++TE
Sbjct  259  IAVKSGWDQYGIKFGMPTKQLIIRKLTCISPDSAAIALGSEMSGGIQDVRAEDITAINTE  318

Query  182  SGVRIKSAIGRGGYVKNIYVKGLRAHTMKWVFLMSGDYGDHPDNHFDPKAFPVVAGINFR  361
            SGVRIK+AIGRGG+VK+I+V+ +   TMK+VF M+G YG HPD  +DPKA P V  IN+ 
Sbjct  319  SGVRIKTAIGRGGFVKDIFVRNMNFQTMKYVFWMTGSYGSHPDKGYDPKALPNVTQINYG  378

Query  362  DVVADNVTMAGKMEGISGHPYTGVCMANVTIGMAKNGKKPAWNCSNIQGVASGVVPPPCP  541
            D+VA NVT + ++EGI   P+TG+C++N  I + +  KK  W C+ I+GV S V P  C 
Sbjct  379  DIVAKNVTYSARLEGIENDPFTGICISNAEITLREKPKKQQWKCTGIEGVTSNVTPKACD  438

Query  542  LLHIQGPVKPGMCDLP  589
            LL    P K   C  P
Sbjct  439  LL----PEKKIDCPFP  450



>ref|XP_010503541.1| PREDICTED: probable polygalacturonase [Camelina sativa]
Length=464

 Score =   247 bits (631),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 114/197 (58%), Positives = 146/197 (74%), Gaps = 0/197 (0%)
 Frame = +2

Query  2    VAVKSGWDQYGIKYGKPTKQLIIKRLTCISPYSAAIALGSEMSGGIEDVRASDITAVHTE  181
            +AVKSGWDQYGIK+G PTKQL I+RLTCISP SA +ALGSEMSGGI+DVR  D+T ++TE
Sbjct  257  IAVKSGWDQYGIKFGMPTKQLSIRRLTCISPKSAGVALGSEMSGGIKDVRIEDVTLINTE  316

Query  182  SGVRIKSAIGRGGYVKNIYVKGLRAHTMKWVFLMSGDYGDHPDNHFDPKAFPVVAGINFR  361
            S +RIK+A GRGGYVK+I+ + +   TMK+VF M+GDY  HPD  +DPKAFP V  IN+R
Sbjct  317  SAIRIKTAAGRGGYVKDIFARRITMKTMKYVFWMNGDYNQHPDKGYDPKAFPEVTNINYR  376

Query  362  DVVADNVTMAGKMEGISGHPYTGVCMANVTIGMAKNGKKPAWNCSNIQGVASGVVPPPCP  541
            D+ A+NVTM+  ++GI   P+  +C++NVT+ +A N KK  WNC+N+ GV S V P PC 
Sbjct  377  DMTAENVTMSASLDGIDKDPFKDICISNVTMELAANAKKVQWNCTNVAGVTSRVKPQPCS  436

Query  542  LLHIQGPVKPGMCDLPP  592
            LL  +       CDL P
Sbjct  437  LLPEKNEDCVFPCDLIP  453



>ref|XP_002875935.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH52194.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
Length=469

 Score =   247 bits (631),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 113/197 (57%), Positives = 144/197 (73%), Gaps = 1/197 (1%)
 Frame = +2

Query  2    VAVKSGWDQYGIKYGKPTKQLIIKRLTCISPYSAAIALGSEMSGGIEDVRASDITAVHTE  181
            +AVKSGWDQYGIK+G PT+QL I+RLTCISP SA +ALGSEMSGGI+DVR  D+T  +TE
Sbjct  257  IAVKSGWDQYGIKFGMPTQQLSIRRLTCISPKSAGVALGSEMSGGIKDVRIEDVTLTNTE  316

Query  182  SGVRIKSAIGRGGYVKNIYVKGLRAHTMKWVFLMSGDYGDHPDNHFDPKAFPVVAGINFR  361
            S +RIK+A GRG YVK+I+ + +   TMK+VF MSG+Y  HPD  FDPKA P V  IN+R
Sbjct  317  SAIRIKTAAGRGAYVKDIFARRITMKTMKYVFWMSGNYNSHPDEGFDPKALPEVTNINYR  376

Query  362  DVVADNVTMAGKMEGISGHPYTGVCMANVTIGMAKNGKKPAWNCSNIQGVASGVVPPPCP  541
            D+ A+NVTM+  ++GI   P+TG+C++NVTI +A   KK  WNC+++ GV S V P PC 
Sbjct  377  DMTAENVTMSASLDGIHKDPFTGICISNVTIALADKAKKVQWNCTDVAGVTSRVTPEPCS  436

Query  542  LL-HIQGPVKPGMCDLP  589
            LL   + P K   C  P
Sbjct  437  LLPEKKAPAKNEDCAFP  453



>ref|XP_004513187.1| PREDICTED: probable polygalacturonase-like [Cicer arietinum]
Length=479

 Score =   247 bits (631),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 114/194 (59%), Positives = 153/194 (79%), Gaps = 6/194 (3%)
 Frame = +2

Query  2    VAVKSGWDQYGIKYGKPTKQLIIKRLTCISPYSAAIALGSEMSGGIEDVRASDITAVHTE  181
            VA+KSGWDQYGIK+G P++ +II+RL C+SP SA IALGSEMSGGI+D+R  D+TA++T+
Sbjct  266  VAIKSGWDQYGIKFGMPSQHIIIRRLKCVSPDSAMIALGSEMSGGIQDIRVEDLTAINTQ  325

Query  182  SGVRIKSAIGRGGYVKNIYVKGLRAHTMKWVFLMSGDYGDHPDNHFDPKAFPVVAGINFR  361
            S VRIKSAIGRGG+VK+I+V+G+  +TMK+VF M+G YG HPD  FDPKA P+++GIN+ 
Sbjct  326  SAVRIKSAIGRGGFVKDIFVRGMNLNTMKYVFWMTGSYGSHPDPSFDPKALPIISGINYS  385

Query  362  DVVADNVTMAGKMEGISGHPYTGVCMANVTIGMAKNGKKPAWNCSNIQGVASGVVPPPCP  541
            +VVA+NVT + ++EGI+G P++G+C++NVTI     G K  WNCS+++GV S V P PC 
Sbjct  386  NVVANNVTYSARLEGINGDPFSGICISNVTIHNV--GNKLQWNCSDVEGVTSNVYPKPCE  443

Query  542  LLHIQGPVKPGMCD  583
            LL    P K G  D
Sbjct  444  LL----PEKEGKFD  453



>gb|KHN42438.1| Putative polygalacturonase, partial [Glycine soja]
Length=462

 Score =   247 bits (630),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 113/199 (57%), Positives = 154/199 (77%), Gaps = 5/199 (3%)
 Frame = +2

Query  2    VAVKSGWDQYGIKYGKPTKQLIIKRLTCISPYSAAIALGSEMSGGIEDVRASDITAVHTE  181
            VA+KSGWD+ GIK+G P++ +II+RL C+SP SA IALGSEMSGGI DVRA ++TA++T+
Sbjct  250  VAIKSGWDESGIKFGMPSQHIIIRRLECVSPDSAMIALGSEMSGGIRDVRAEELTALNTQ  309

Query  182  SGVRIKSAIGRGGYVKNIYVKGLRAHTMKWVFLMSGDYGDHPDNHFDPKAFPVVAGINFR  361
            S VRIK+A+GRG YV++I+VKG+  +TMK+VF M+G YG HP+  FDPKA P + GIN+R
Sbjct  310  SAVRIKTAVGRGAYVRDIFVKGMNLNTMKYVFWMTGSYGSHPNTDFDPKALPNITGINYR  369

Query  362  DVVADNVTMAGKMEGISGHPYTGVCMANVTIGMAKNGKKPAWNCSNIQGVASGVVPPPCP  541
            DV+ADNVT + ++EGI+  P+TG+C++NVTI   K  KKP WNC++I+GV S V P PC 
Sbjct  370  DVIADNVTYSARLEGIANDPFTGICISNVTIHSGK--KKPQWNCTDIEGVTSNVYPKPCE  427

Query  542  LLHIQGPVKPGMCDLPPKK  598
            LL ++  ++   C  P  K
Sbjct  428  LLPLKEKIE---CPYPDDK  443



>ref|XP_003533980.1| PREDICTED: probable polygalacturonase-like [Glycine max]
Length=476

 Score =   247 bits (630),  Expect = 4e-74, Method: Compositional matrix adjust.
 Identities = 113/199 (57%), Positives = 154/199 (77%), Gaps = 5/199 (3%)
 Frame = +2

Query  2    VAVKSGWDQYGIKYGKPTKQLIIKRLTCISPYSAAIALGSEMSGGIEDVRASDITAVHTE  181
            VA+KSGWD+ GIK+G P++ +II+RL C+SP SA IALGSEMSGGI DVRA ++TA++T+
Sbjct  264  VAIKSGWDESGIKFGMPSQHIIIRRLECVSPDSAMIALGSEMSGGIRDVRAEELTALNTQ  323

Query  182  SGVRIKSAIGRGGYVKNIYVKGLRAHTMKWVFLMSGDYGDHPDNHFDPKAFPVVAGINFR  361
            S VRIK+A+GRG YV++I+VKG+  +TMK+VF M+G YG HP+  FDPKA P + GIN+R
Sbjct  324  SAVRIKTAVGRGAYVRDIFVKGMNLNTMKYVFWMTGSYGSHPNTDFDPKALPNITGINYR  383

Query  362  DVVADNVTMAGKMEGISGHPYTGVCMANVTIGMAKNGKKPAWNCSNIQGVASGVVPPPCP  541
            DV+ADNVT + ++EGI+  P+TG+C++NVTI   K  KKP WNC++I+GV S V P PC 
Sbjct  384  DVIADNVTYSARLEGIANDPFTGICISNVTIHSGK--KKPQWNCTDIEGVTSNVYPKPCE  441

Query  542  LLHIQGPVKPGMCDLPPKK  598
            LL ++  ++   C  P  K
Sbjct  442  LLPLKEKIE---CPYPDDK  457



>ref|XP_007152185.1| hypothetical protein PHAVU_004G108800g [Phaseolus vulgaris]
 gb|ESW24179.1| hypothetical protein PHAVU_004G108800g [Phaseolus vulgaris]
Length=477

 Score =   246 bits (628),  Expect = 7e-74, Method: Compositional matrix adjust.
 Identities = 111/182 (61%), Positives = 146/182 (80%), Gaps = 2/182 (1%)
 Frame = +2

Query  2    VAVKSGWDQYGIKYGKPTKQLIIKRLTCISPYSAAIALGSEMSGGIEDVRASDITAVHTE  181
            +A+KSGWD+YGIK+G P+K +II+RL C+SP SA IALGSEMSGGI+DVRA D+TA++TE
Sbjct  264  IAIKSGWDEYGIKFGMPSKHIIIRRLECVSPDSAMIALGSEMSGGIQDVRAEDLTAINTE  323

Query  182  SGVRIKSAIGRGGYVKNIYVKGLRAHTMKWVFLMSGDYGDHPDNHFDPKAFPVVAGINFR  361
            S VRIK+A+GRG YV++I+VKG+  +TMK+VF M+G YG HPD  FDPKA P + GIN+R
Sbjct  324  SAVRIKTAVGRGAYVRDIFVKGMNLNTMKYVFWMTGSYGSHPDPGFDPKALPNITGINYR  383

Query  362  DVVADNVTMAGKMEGISGHPYTGVCMANVTIGMAKNGKKPAWNCSNIQGVASGVVPPPCP  541
            DV ADNVT + +++GI+  P+TG+C++NVTI      KK  WNC++I+GV S V P PC 
Sbjct  384  DVFADNVTYSARLDGIANDPFTGICISNVTI--HSGDKKLQWNCTDIEGVTSNVYPKPCE  441

Query  542  LL  547
            LL
Sbjct  442  LL  443



>ref|NP_001240215.1| uncharacterized protein LOC100785005 precursor [Glycine max]
 gb|ACU17976.1| unknown [Glycine max]
Length=477

 Score =   246 bits (628),  Expect = 7e-74, Method: Compositional matrix adjust.
 Identities = 109/185 (59%), Positives = 149/185 (81%), Gaps = 2/185 (1%)
 Frame = +2

Query  2    VAVKSGWDQYGIKYGKPTKQLIIKRLTCISPYSAAIALGSEMSGGIEDVRASDITAVHTE  181
            VA+KSGWD+YGIK+G P++ +II+RL C+SP SA IALGSEMSGGI+DVRA D+TA++T+
Sbjct  264  VAIKSGWDEYGIKFGMPSQHIIIRRLECVSPDSAMIALGSEMSGGIQDVRAEDLTAINTQ  323

Query  182  SGVRIKSAIGRGGYVKNIYVKGLRAHTMKWVFLMSGDYGDHPDNHFDPKAFPVVAGINFR  361
            S VRIK+A+GRG YV++I++KG+  +TMK+VF M+G Y  HPDN FDPK  P + GIN+R
Sbjct  324  SAVRIKTAVGRGAYVRDIFIKGMNLNTMKYVFWMTGSYSSHPDNGFDPKTLPNITGINYR  383

Query  362  DVVADNVTMAGKMEGISGHPYTGVCMANVTIGMAKNGKKPAWNCSNIQGVASGVVPPPCP  541
            DV+A+NVT + ++EGI+  P+TG+C++NVTI   K  KK  WNC++I+GV S V P PC 
Sbjct  384  DVIAENVTYSARLEGIANDPFTGICISNVTIHSGK--KKLQWNCTDIEGVTSNVYPKPCE  441

Query  542  LLHIQ  556
            LL ++
Sbjct  442  LLPLK  446



>ref|XP_006372397.1| glycoside hydrolase family 28 family protein [Populus trichocarpa]
 gb|ERP50194.1| glycoside hydrolase family 28 family protein [Populus trichocarpa]
Length=452

 Score =   245 bits (626),  Expect = 8e-74, Method: Compositional matrix adjust.
 Identities = 106/182 (58%), Positives = 144/182 (79%), Gaps = 0/182 (0%)
 Frame = +2

Query  2    VAVKSGWDQYGIKYGKPTKQLIIKRLTCISPYSAAIALGSEMSGGIEDVRASDITAVHTE  181
            +AVKSGWD+YGIK+G+PT+ L+I+R TCISP SA IALGSEMSGGI+DVRA DITA+ T+
Sbjct  243  IAVKSGWDEYGIKFGRPTQHLVIRRFTCISPDSATIALGSEMSGGIQDVRAEDITALSTQ  302

Query  182  SGVRIKSAIGRGGYVKNIYVKGLRAHTMKWVFLMSGDYGDHPDNHFDPKAFPVVAGINFR  361
            SGVRIK+A+GRG YVK+I+V+ +    MK+ F M+G YG HPD  +DPKA P + GI+++
Sbjct  303  SGVRIKTAVGRGAYVKDIFVRRMTLKAMKYAFWMTGSYGSHPDTGYDPKALPEIKGISYK  362

Query  362  DVVADNVTMAGKMEGISGHPYTGVCMANVTIGMAKNGKKPAWNCSNIQGVASGVVPPPCP  541
            D+VA+NVT + ++EGI   P+TG+C++NV I + +  K+  WNC++IQGV+S V P PC 
Sbjct  363  DIVAENVTYSARLEGIENDPFTGICISNVNISLTQKPKELQWNCTDIQGVSSKVTPQPCA  422

Query  542  LL  547
             L
Sbjct  423  AL  424



>ref|XP_003592197.1| Endo-polygalacturonase-like protein [Medicago truncatula]
 gb|AES62448.1| pectin lyase superfamily protein [Medicago truncatula]
Length=475

 Score =   246 bits (627),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 112/199 (56%), Positives = 152/199 (76%), Gaps = 4/199 (2%)
 Frame = +2

Query  2    VAVKSGWDQYGIKYGKPTKQLIIKRLTCISPYSAAIALGSEMSGGIEDVRASDITAVHTE  181
            +A+KSG D YGIK GKP++++I++RLTCISP SA +ALGSEMSGGI+D+R  DITA++TE
Sbjct  266  IAIKSGLDGYGIKVGKPSQKIIVRRLTCISPKSAMVALGSEMSGGIQDIRIEDITAINTE  325

Query  182  SGVRIKSAIGRGGYVKNIYVKGLRAHTMKWVFLMSGDYGDHPDNHFDPKAFPVVAGINFR  361
            S VRIK+A+GRG YVK+I+VKG+  +TMK+VF M+G Y  H +N FDPKA P ++GIN+R
Sbjct  326  SAVRIKTAVGRGAYVKDIFVKGMNLNTMKYVFWMTGAYKSHAENGFDPKALPKISGINYR  385

Query  362  DVVADNVTMAGKMEGISGHPYTGVCMANVTIGMAKNGKKPAWNCSNIQGVASGVVPPPCP  541
            D++A NVT+AG+++GIS  P+TG+C++NVTI M+       WNC+++ GVAS  VP PC 
Sbjct  386  DIIAKNVTIAGQLDGISNDPFTGICISNVTIEMSAQKNNLPWNCTDVSGVASNAVPKPCD  445

Query  542  LLHIQGPVKPGMCDLPPKK  598
            +L    P K   C  P  K
Sbjct  446  ML----PEKKIECPFPTDK  460



>ref|XP_010105745.1| putative polygalacturonase [Morus notabilis]
 gb|EXC05965.1| putative polygalacturonase [Morus notabilis]
Length=459

 Score =   244 bits (624),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 116/196 (59%), Positives = 147/196 (75%), Gaps = 4/196 (2%)
 Frame = +2

Query  2    VAVKSGWDQYGIKYGKPTKQLIIKRLTCISPYSAAIALGSEMSGGIEDVRASDITAVHTE  181
            VAVKSGW QYGIK GKPTKQL+I+RLTCISP SA IALGSEMSGGI+DVR  DITA+ T+
Sbjct  249  VAVKSGWGQYGIKLGKPTKQLVIRRLTCISPDSATIALGSEMSGGIQDVRIEDITALSTQ  308

Query  182  SGVRIKSAIGRGGYVKNIYVKGLRAHTMKWVFLMSGDYGDHPDNHFDPKAFPVVAGINFR  361
            SG+RIK+  GRGGYVK+I+ + +   TMK+ F M+G+YG HPD  FDPKA PV+  IN+R
Sbjct  309  SGIRIKTGRGRGGYVKDIFARRMTLKTMKYAFWMTGNYGSHPDPGFDPKALPVIDRINYR  368

Query  362  DVVADNVTMAGKMEGISGHPYTGVCMANVTIGMAKNGKKPAWNCSNIQGVASGVVPPPCP  541
            DVVA+NVT + +++GI+G  + G+C++N TI + +  KK  WNC+N++GV S V P  C 
Sbjct  369  DVVAENVTYSARLDGIAGDTFKGICISNATITLTETPKKLQWNCTNVEGVTSNVTPKACD  428

Query  542  LLHIQGPVKPGMCDLP  589
            LL    P K G  D P
Sbjct  429  LL----PEKQGKFDCP  440



>ref|XP_010519488.1| PREDICTED: probable polygalacturonase isoform X2 [Tarenaya hassleriana]
 ref|XP_010519489.1| PREDICTED: probable polygalacturonase isoform X2 [Tarenaya hassleriana]
 ref|XP_010519491.1| PREDICTED: probable polygalacturonase isoform X2 [Tarenaya hassleriana]
Length=468

 Score =   244 bits (624),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 114/199 (57%), Positives = 147/199 (74%), Gaps = 2/199 (1%)
 Frame = +2

Query  2    VAVKSGWDQYGIKYGKPTKQLIIKRLTCISPYSAAIALGSEMSGGIEDVRASDITAVHTE  181
            +AVKSGWDQYGIK G PT+QL I+RLTCISP SA +ALGSEMSGGI DVR  D T ++T+
Sbjct  259  IAVKSGWDQYGIKVGIPTQQLSIRRLTCISPDSAGVALGSEMSGGIRDVRIEDSTMINTQ  318

Query  182  SGVRIKSAIGRGGYVKNIYVKGLRAHTMKWVFLMSGDYGDHPDNHFDPKAFPVVAGINFR  361
            SG+RIK+AIGRGGYVK+I+ + +   TMK+VF MSG Y  HPD HFDPKA P +  IN+R
Sbjct  319  SGIRIKTAIGRGGYVKDIFARRIMMKTMKYVFWMSGAYNQHPDEHFDPKALPEITNINYR  378

Query  362  DVVADNVTMAGKMEGISGHPYTGVCMANVTIGMAKNGKKPAWNCSNIQGVASGVVPPPCP  541
            D++ADNVT++ +++GI    +TG+C++NV I ++ N KK  WNC+++ GV S V PP C 
Sbjct  379  DMMADNVTISARLDGIEKDQFTGICISNVNISLSPNPKKLQWNCTDVAGVTSRVSPPACS  438

Query  542  LLHIQGPVKPGMCDLPPKK  598
            LL  +G   P  C  P  K
Sbjct  439  LLPEKG--SPVDCKFPTDK  455



>ref|XP_006829063.1| hypothetical protein AMTR_s00001p00258260 [Amborella trichopoda]
 gb|ERM96479.1| hypothetical protein AMTR_s00001p00258260 [Amborella trichopoda]
Length=487

 Score =   245 bits (625),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 116/201 (58%), Positives = 153/201 (76%), Gaps = 5/201 (2%)
 Frame = +2

Query  2    VAVKSGWDQYGIKYGKPTKQLIIKRLTCISPYSAAIALGSEMSGGIEDVRASDITAVHTE  181
            +A+KSGWD+YGI +G P++ +II+RL C+SP+SA IALGSEMSGGI+DVRA DI AV++E
Sbjct  264  IAIKSGWDEYGIAFGMPSQHIIIRRLFCVSPFSAVIALGSEMSGGIQDVRAQDIQAVNSE  323

Query  182  SGVRIKSAIGRGGYVKNIYVKGLRAHTMKWVFLMSGDYGDHPDNHFDPKAFPVVAGINFR  361
            + VRIK++ GRGG+VK+IYVKG+    MKWVF M+G YG HPDN +DP AFPVV+GIN+R
Sbjct  324  AAVRIKTSPGRGGFVKDIYVKGMNLENMKWVFTMTGSYGSHPDNKWDPNAFPVVSGINYR  383

Query  362  DVVADNVTMAGKMEGISGHPYTGVCMANVTIGMAKNGKKPA--WNCSNIQGVASGVVPPP  535
            DV+++NVT+AGK+EGI   P+  +C++NVTIGM+   KK    WNC+ + G +SGV P P
Sbjct  384  DVISENVTIAGKLEGIPKAPFGDICISNVTIGMSPKSKKKKLPWNCTYVSGTSSGVTPTP  443

Query  536  CPLLHIQGPVKPGMCDLPPKK  598
            C LL   G    G C  P  +
Sbjct  444  CSLLPESG---YGDCPFPTDR  461



>gb|KDP22228.1| hypothetical protein JCGZ_26059 [Jatropha curcas]
Length=470

 Score =   244 bits (623),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 114/196 (58%), Positives = 145/196 (74%), Gaps = 4/196 (2%)
 Frame = +2

Query  2    VAVKSGWDQYGIKYGKPTKQLIIKRLTCISPYSAAIALGSEMSGGIEDVRASDITAVHTE  181
            +AVKSGWDQYGIK+G PT+QLII+RLTCISP SA IALGSEMSGGI+DVRA DITA++T+
Sbjct  255  IAVKSGWDQYGIKFGVPTRQLIIRRLTCISPDSATIALGSEMSGGIQDVRAEDITAINTQ  314

Query  182  SGVRIKSAIGRGGYVKNIYVKGLRAHTMKWVFLMSGDYGDHPDNHFDPKAFPVVAGINFR  361
            SGVRIK+AIGRGG+VK+++V+ +   TMK+VF M+G YG HPD  +DPKA P +  IN+ 
Sbjct  315  SGVRIKTAIGRGGFVKDVFVRKMNFQTMKYVFWMTGSYGSHPDEGYDPKALPNITQINYN  374

Query  362  DVVADNVTMAGKMEGISGHPYTGVCMANVTIGMAKNGKKPAWNCSNIQGVASGVVPPPCP  541
            DVVA NVT   +++GI   P+TG+C++N  I + +  KK  WNC++I GV S V    C 
Sbjct  375  DVVAKNVTYTARLDGIKNDPFTGICISNADITLTEKPKKLQWNCTDIAGVTSNVTTKACD  434

Query  542  LLHIQGPVKPGMCDLP  589
            LL    P K   C  P
Sbjct  435  LL----PEKKIDCPFP  446



>ref|XP_010519487.1| PREDICTED: probable polygalacturonase isoform X1 [Tarenaya hassleriana]
Length=475

 Score =   244 bits (623),  Expect = 4e-73, Method: Compositional matrix adjust.
 Identities = 114/199 (57%), Positives = 147/199 (74%), Gaps = 2/199 (1%)
 Frame = +2

Query  2    VAVKSGWDQYGIKYGKPTKQLIIKRLTCISPYSAAIALGSEMSGGIEDVRASDITAVHTE  181
            +AVKSGWDQYGIK G PT+QL I+RLTCISP SA +ALGSEMSGGI DVR  D T ++T+
Sbjct  266  IAVKSGWDQYGIKVGIPTQQLSIRRLTCISPDSAGVALGSEMSGGIRDVRIEDSTMINTQ  325

Query  182  SGVRIKSAIGRGGYVKNIYVKGLRAHTMKWVFLMSGDYGDHPDNHFDPKAFPVVAGINFR  361
            SG+RIK+AIGRGGYVK+I+ + +   TMK+VF MSG Y  HPD HFDPKA P +  IN+R
Sbjct  326  SGIRIKTAIGRGGYVKDIFARRIMMKTMKYVFWMSGAYNQHPDEHFDPKALPEITNINYR  385

Query  362  DVVADNVTMAGKMEGISGHPYTGVCMANVTIGMAKNGKKPAWNCSNIQGVASGVVPPPCP  541
            D++ADNVT++ +++GI    +TG+C++NV I ++ N KK  WNC+++ GV S V PP C 
Sbjct  386  DMMADNVTISARLDGIEKDQFTGICISNVNISLSPNPKKLQWNCTDVAGVTSRVSPPACS  445

Query  542  LLHIQGPVKPGMCDLPPKK  598
            LL  +G   P  C  P  K
Sbjct  446  LLPEKG--SPVDCKFPTDK  462



>ref|XP_010519492.1| PREDICTED: probable polygalacturonase [Tarenaya hassleriana]
Length=468

 Score =   243 bits (619),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 113/186 (61%), Positives = 139/186 (75%), Gaps = 0/186 (0%)
 Frame = +2

Query  2    VAVKSGWDQYGIKYGKPTKQLIIKRLTCISPYSAAIALGSEMSGGIEDVRASDITAVHTE  181
            +AVKSGWDQYGIK G PT+QL I+RLTCISP SA +ALGSEMSGGI DVR  D+T ++TE
Sbjct  259  IAVKSGWDQYGIKVGMPTQQLSIRRLTCISPDSAGVALGSEMSGGIRDVRIEDVTLINTE  318

Query  182  SGVRIKSAIGRGGYVKNIYVKGLRAHTMKWVFLMSGDYGDHPDNHFDPKAFPVVAGINFR  361
            S VRIK+AIGRG YVK+IY + +   TMK+VF  SG Y  HPD+H+DPKA P V  INFR
Sbjct  319  SAVRIKTAIGRGAYVKDIYAQRITMKTMKYVFWTSGSYNSHPDDHWDPKAIPEVTNINFR  378

Query  362  DVVADNVTMAGKMEGISGHPYTGVCMANVTIGMAKNGKKPAWNCSNIQGVASGVVPPPCP  541
            D+ A+NVTM G + GI   P+TG+C++NV I ++   KK  WNC+N+ GV S V P PC 
Sbjct  379  DMTAENVTMPGNLAGIEKDPFTGICISNVNITLSPKPKKVQWNCTNVAGVTSRVTPEPCS  438

Query  542  LLHIQG  559
            LL  +G
Sbjct  439  LLPGKG  444



>ref|XP_010550764.1| PREDICTED: probable polygalacturonase [Tarenaya hassleriana]
Length=477

 Score =   243 bits (620),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 112/199 (56%), Positives = 148/199 (74%), Gaps = 2/199 (1%)
 Frame = +2

Query  2    VAVKSGWDQYGIKYGKPTKQLIIKRLTCISPYSAAIALGSEMSGGIEDVRASDITAVHTE  181
            +AVKSGWDQYGI+ G PT+QL I+RLTCISP SA +ALGSEMSGGI+DVR  D T ++T+
Sbjct  268  IAVKSGWDQYGIQVGIPTQQLSIRRLTCISPDSAGVALGSEMSGGIKDVRIEDSTMINTQ  327

Query  182  SGVRIKSAIGRGGYVKNIYVKGLRAHTMKWVFLMSGDYGDHPDNHFDPKAFPVVAGINFR  361
            S +RIK+A+GRGGYVK+I+ + +   TMK+VF MSG Y  HPD+ FDPKA PVV  IN+R
Sbjct  328  SAIRIKTAVGRGGYVKDIFARKITMKTMKYVFWMSGAYNQHPDDKFDPKALPVVTNINYR  387

Query  362  DVVADNVTMAGKMEGISGHPYTGVCMANVTIGMAKNGKKPAWNCSNIQGVASGVVPPPCP  541
            D+ A+NVTMA +++GI   P+TG+C++NV + +A   K   WNC+++ GV++ V PP C 
Sbjct  388  DMTAENVTMAARLDGIEKDPFTGICISNVKMTLAPKAKDLQWNCTDVAGVSNRVEPPVCS  447

Query  542  LLHIQGPVKPGMCDLPPKK  598
            LL  +G   P  CD P  K
Sbjct  448  LLPEKG--SPMDCDFPADK  464



>ref|XP_010317519.1| PREDICTED: probable polygalacturonase, partial [Solanum lycopersicum]
Length=464

 Score =   242 bits (617),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 114/196 (58%), Positives = 148/196 (76%), Gaps = 4/196 (2%)
 Frame = +2

Query  2    VAVKSGWDQYGIKYGKPTKQLIIKRLTCISPYSAAIALGSEMSGGIEDVRASDITAVHTE  181
            +AVKSG+D+YGI +G PTK LII+ LTCISP SA IALGSEMSGGI+DVRA +I A+ +E
Sbjct  252  IAVKSGYDEYGIAFGMPTKHLIIRNLTCISPSSAVIALGSEMSGGIQDVRAENIGAIGSE  311

Query  182  SGVRIKSAIGRGGYVKNIYVKGLRAHTMKWVFLMSGDYGDHPDNHFDPKAFPVVAGINFR  361
            SG+RIK+AIGRG YVK+++V+G+   TMK+ F ++GDYG HPD+H+D KA PV+ GIN +
Sbjct  312  SGLRIKTAIGRGAYVKDVFVRGMTLQTMKYTFWITGDYGAHPDDHYDRKAIPVIQGINIK  371

Query  362  DVVADNVTMAGKMEGISGHPYTGVCMANVTIGMAKNGKKPAWNCSNIQGVASGVVPPPCP  541
            D VA NVT+AGK+ GI G  + G+C++NV I M++   +  WNCSNI+GV+S V P PC 
Sbjct  372  DTVAKNVTIAGKLAGIDGDTFNGICLSNVAIEMSQQANQLPWNCSNIKGVSSQVTPQPCA  431

Query  542  LLHIQGPVKPGMCDLP  589
            LL    P K   C  P
Sbjct  432  LL----PHKKIDCPFP  443



>ref|XP_010934935.1| PREDICTED: probable polygalacturonase [Elaeis guineensis]
Length=469

 Score =   242 bits (617),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 105/186 (56%), Positives = 143/186 (77%), Gaps = 0/186 (0%)
 Frame = +2

Query  2    VAVKSGWDQYGIKYGKPTKQLIIKRLTCISPYSAAIALGSEMSGGIEDVRASDITAVHTE  181
            VA+KSGWD+YGI  G P++ +II+RLTCISP SA IALGSEMSGGI+DVRA DITA+ +E
Sbjct  269  VAIKSGWDEYGIAVGMPSQHIIIQRLTCISPTSAVIALGSEMSGGIQDVRAEDITAIDSE  328

Query  182  SGVRIKSAIGRGGYVKNIYVKGLRAHTMKWVFLMSGDYGDHPDNHFDPKAFPVVAGINFR  361
            SG+RIK+A+GRGGYVK+I+V+G+  +TMKWVF M G+Y  HPDN +DP A PV+ GI++ 
Sbjct  329  SGIRIKTAVGRGGYVKDIFVRGMNLNTMKWVFRMDGNYKSHPDNKYDPHAIPVIKGISYS  388

Query  362  DVVADNVTMAGKMEGISGHPYTGVCMANVTIGMAKNGKKPAWNCSNIQGVASGVVPPPCP  541
            +++A NV     + GI   P+TG+C++NVT+ +A   +K  W C++++GV+SGV P PC 
Sbjct  389  NIIAKNVKQVASLHGIPNAPFTGICISNVTVQLAAKARKQTWTCTDVEGVSSGVTPAPCA  448

Query  542  LLHIQG  559
                QG
Sbjct  449  SFRDQG  454



>ref|XP_004298190.1| PREDICTED: probable polygalacturonase-like [Fragaria vesca subsp. 
vesca]
Length=462

 Score =   241 bits (616),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 109/199 (55%), Positives = 144/199 (72%), Gaps = 2/199 (1%)
 Frame = +2

Query  2    VAVKSGWDQYGIKYGKPTKQLIIKRLTCISPYSAAIALGSEMSGGIEDVRASDITAVHTE  181
            +AVKSGWD YGIK+G P + L+I+RLTCISP SA +ALGSEMSGGI DVR  D+TA++TE
Sbjct  250  IAVKSGWDNYGIKFGMPMEHLVIRRLTCISPKSATVALGSEMSGGIRDVRVEDVTAINTE  309

Query  182  SGVRIKSAIGRGGYVKNIYVKGLRAHTMKWVFLMSGDYGDHPDNHFDPKAFPVVAGINFR  361
            S +RIK+A+GRG YVK+I+V+ +   TMK+VF M+G YG HP   FDP A PV+  IN+R
Sbjct  310  SSIRIKTAVGRGAYVKDIFVRRMTLSTMKYVFWMTGAYGSHPSEGFDPNALPVIQNINYR  369

Query  362  DVVADNVTMAGKMEGISGHPYTGVCMANVTIGMAKNGKKPAWNCSNIQGVASGVVPPPCP  541
            D+VA NVT  G+++GI+  P+ G+C++N TI +    KK  WNC++++G+ S V P PC 
Sbjct  370  DIVAKNVTHPGQLDGIANDPFKGICISNATITLTAKPKKVLWNCTDVEGITSNVTPKPCA  429

Query  542  LLHIQGPVKPGMCDLPPKK  598
            LL  Q   KP  C  P  K
Sbjct  430  LLPEQQ--KPINCAFPEDK  446



>ref|XP_009395434.1| PREDICTED: probable polygalacturonase isoform X2 [Musa acuminata 
subsp. malaccensis]
Length=491

 Score =   242 bits (618),  Expect = 4e-72, Method: Compositional matrix adjust.
 Identities = 111/186 (60%), Positives = 147/186 (79%), Gaps = 1/186 (1%)
 Frame = +2

Query  2    VAVKSGWDQYGIKYGKPTKQLIIKRLTCISPYSAAIALGSEMSGGIEDVRASDITAVHTE  181
            VA+KSGWD+YGI YG P++ ++I+RLTCISP SA IALGSEMSGGI+DVRA DITA+++E
Sbjct  276  VAIKSGWDEYGIAYGMPSQHIVIRRLTCISPTSAVIALGSEMSGGIQDVRAEDITAINSE  335

Query  182  SGVRIKSAIGRGGYVKNIYVKGLRAHTMKWVFLMSGDYGDHPDNHFDPKAFPVVAGINFR  361
            SGVRIK+A+GRG YVK++YV+ +   TMKWVF M+G+Y  HPD+ FDP A PVV GI++ 
Sbjct  336  SGVRIKTAVGRGAYVKDVYVRRMYLSTMKWVFWMTGNYKSHPDDKFDPNAIPVVDGISYS  395

Query  362  DVVADNVTMAGKMEGISGHPYTGVCMANVTIGMAKNGKKPAWNCSNIQGVASGVVPPPCP  541
            +V A NVTMA ++EGI   P+TG+C++NVT+ + K  K P W C++++GV+SGV P  C 
Sbjct  396  EVTAYNVTMAARLEGIPNAPFTGICISNVTVELRKARKLP-WYCADVEGVSSGVSPAACA  454

Query  542  LLHIQG  559
             L  QG
Sbjct  455  SLADQG  460



>ref|XP_009395433.1| PREDICTED: probable polygalacturonase isoform X1 [Musa acuminata 
subsp. malaccensis]
Length=497

 Score =   242 bits (618),  Expect = 4e-72, Method: Compositional matrix adjust.
 Identities = 111/186 (60%), Positives = 147/186 (79%), Gaps = 1/186 (1%)
 Frame = +2

Query  2    VAVKSGWDQYGIKYGKPTKQLIIKRLTCISPYSAAIALGSEMSGGIEDVRASDITAVHTE  181
            VA+KSGWD+YGI YG P++ ++I+RLTCISP SA IALGSEMSGGI+DVRA DITA+++E
Sbjct  282  VAIKSGWDEYGIAYGMPSQHIVIRRLTCISPTSAVIALGSEMSGGIQDVRAEDITAINSE  341

Query  182  SGVRIKSAIGRGGYVKNIYVKGLRAHTMKWVFLMSGDYGDHPDNHFDPKAFPVVAGINFR  361
            SGVRIK+A+GRG YVK++YV+ +   TMKWVF M+G+Y  HPD+ FDP A PVV GI++ 
Sbjct  342  SGVRIKTAVGRGAYVKDVYVRRMYLSTMKWVFWMTGNYKSHPDDKFDPNAIPVVDGISYS  401

Query  362  DVVADNVTMAGKMEGISGHPYTGVCMANVTIGMAKNGKKPAWNCSNIQGVASGVVPPPCP  541
            +V A NVTMA ++EGI   P+TG+C++NVT+ + K  K P W C++++GV+SGV P  C 
Sbjct  402  EVTAYNVTMAARLEGIPNAPFTGICISNVTVELRKARKLP-WYCADVEGVSSGVSPAACA  460

Query  542  LLHIQG  559
             L  QG
Sbjct  461  SLADQG  466



>ref|XP_008796910.1| PREDICTED: probable polygalacturonase [Phoenix dactylifera]
Length=466

 Score =   241 bits (614),  Expect = 6e-72, Method: Compositional matrix adjust.
 Identities = 112/199 (56%), Positives = 147/199 (74%), Gaps = 3/199 (2%)
 Frame = +2

Query  2    VAVKSGWDQYGIKYGKPTKQLIIKRLTCISPYSAAIALGSEMSGGIEDVRASDITAVHTE  181
            VA+KSGWD+YGI  G P++ + I+RLTCISP SA IALGSEMSGGI+DVRA DITA+ +E
Sbjct  268  VAIKSGWDEYGIAVGMPSQHITIRRLTCISPTSAVIALGSEMSGGIQDVRAEDITAIDSE  327

Query  182  SGVRIKSAIGRGGYVKNIYVKGLRAHTMKWVFLMSGDYGDHPDNHFDPKAFPVVAGINFR  361
            SGVRIK+A+GRG YVK+I+V+G+  +TMKWVF M G+Y  HPDN +DPKA PVV  I++ 
Sbjct  328  SGVRIKTAVGRGAYVKDIFVRGMNLNTMKWVFRMDGNYKSHPDNKYDPKAIPVVKDISYS  387

Query  362  DVVADNVTMAGKMEGISGHPYTGVCMANVTIGMAKNGKKPAWNCSNIQGVASGVVPPPCP  541
            ++VA NV    K+ GI   P+TG+C++NVT+ +A   KK  W CS+++GV+SGV P PC 
Sbjct  388  NIVAKNVKQVAKLHGIPNAPFTGICISNVTVQLAAKAKKQRWTCSDVEGVSSGVTPAPCA  447

Query  542  LLHIQGPVKPGMCDLPPKK  598
             L  +   KP  C  P  +
Sbjct  448  SLQ-RAVAKP--CPFPADR  463



>ref|XP_009375527.1| PREDICTED: probable polygalacturonase [Pyrus x bretschneideri]
Length=471

 Score =   241 bits (614),  Expect = 6e-72, Method: Compositional matrix adjust.
 Identities = 109/185 (59%), Positives = 143/185 (77%), Gaps = 0/185 (0%)
 Frame = +2

Query  2    VAVKSGWDQYGIKYGKPTKQLIIKRLTCISPYSAAIALGSEMSGGIEDVRASDITAVHTE  181
            +AVKSG+D+YGIK G PT+ L+I+RLTCISP SA IALGSEMSGGI DVR  DITA+ TE
Sbjct  257  IAVKSGFDEYGIKVGIPTEHLVIRRLTCISPSSATIALGSEMSGGIRDVRGEDITAIDTE  316

Query  182  SGVRIKSAIGRGGYVKNIYVKGLRAHTMKWVFLMSGDYGDHPDNHFDPKAFPVVAGINFR  361
            S VRIK+A+GRGGYVK+IYV+ +   TMK+VF M+G YG HPD  FDPKA P +  IN++
Sbjct  317  SSVRIKTAVGRGGYVKDIYVRRMTLKTMKYVFWMTGSYGSHPDPCFDPKALPEITNINYK  376

Query  362  DVVADNVTMAGKMEGISGHPYTGVCMANVTIGMAKNGKKPAWNCSNIQGVASGVVPPPCP  541
             VVA+NVT++ +++GI   P+ G+C++NVTI +A+  KK  WNC++++G+ S V P  C 
Sbjct  377  QVVAENVTISARLDGIHDDPFKGICISNVTITLAEKAKKLQWNCTDVEGITSNVTPKACD  436

Query  542  LLHIQ  556
            LL  Q
Sbjct  437  LLPEQ  441



>ref|XP_009368731.1| PREDICTED: probable polygalacturonase [Pyrus x bretschneideri]
Length=472

 Score =   241 bits (614),  Expect = 8e-72, Method: Compositional matrix adjust.
 Identities = 109/188 (58%), Positives = 141/188 (75%), Gaps = 0/188 (0%)
 Frame = +2

Query  2    VAVKSGWDQYGIKYGKPTKQLIIKRLTCISPYSAAIALGSEMSGGIEDVRASDITAVHTE  181
            +AVKSGWD+YGIK G PT+ L+I+RLTCISP SA IALGSEMSGGI DVRA DITA+ T+
Sbjct  258  IAVKSGWDKYGIKVGIPTEHLVIRRLTCISPDSATIALGSEMSGGIHDVRAEDITAIDTQ  317

Query  182  SGVRIKSAIGRGGYVKNIYVKGLRAHTMKWVFLMSGDYGDHPDNHFDPKAFPVVAGINFR  361
            S VRIK+A+GRG YVK+IYV+ +   TMK+ F M+G YG HPD  FDPKA P +  IN++
Sbjct  318  SSVRIKTAVGRGAYVKDIYVRRMTLKTMKYAFWMTGSYGSHPDPSFDPKALPEITNINYK  377

Query  362  DVVADNVTMAGKMEGISGHPYTGVCMANVTIGMAKNGKKPAWNCSNIQGVASGVVPPPCP  541
             VVA+NVT + +++GI   P+ G+C++NVTI + +  KK  WNC+N++G+ S V P  C 
Sbjct  378  QVVAENVTYSARLDGIPNDPFKGICISNVTITLTEKPKKLQWNCTNVEGITSNVTPKACD  437

Query  542  LLHIQGPV  565
            LL  Q  V
Sbjct  438  LLSEQKEV  445



>ref|XP_008380132.1| PREDICTED: probable polygalacturonase [Malus domestica]
Length=474

 Score =   241 bits (614),  Expect = 9e-72, Method: Compositional matrix adjust.
 Identities = 109/185 (59%), Positives = 143/185 (77%), Gaps = 0/185 (0%)
 Frame = +2

Query  2    VAVKSGWDQYGIKYGKPTKQLIIKRLTCISPYSAAIALGSEMSGGIEDVRASDITAVHTE  181
            +AVKSG+D+YGIK G PT+ L+I+RLTCISP SA IALGSEMSGGI DVRA DITA+ TE
Sbjct  257  IAVKSGFDEYGIKVGIPTEHLVIRRLTCISPSSATIALGSEMSGGIRDVRAEDITAIDTE  316

Query  182  SGVRIKSAIGRGGYVKNIYVKGLRAHTMKWVFLMSGDYGDHPDNHFDPKAFPVVAGINFR  361
            S VRIK+A+GRGGYVK+IYV+ +   TMK+VF M+G YG HPD  FDPKA P +  IN++
Sbjct  317  SSVRIKTAVGRGGYVKDIYVRRMTLKTMKYVFWMTGSYGSHPDPGFDPKALPEITNINYK  376

Query  362  DVVADNVTMAGKMEGISGHPYTGVCMANVTIGMAKNGKKPAWNCSNIQGVASGVVPPPCP  541
             VVA+NVT++ +++GI   P+ G+C++NVTI +A+  KK  WNC++++G+ S   P  C 
Sbjct  377  QVVAENVTISARLDGIHDDPFKGICISNVTITLAEKAKKLQWNCTDVEGITSNXTPKACD  436

Query  542  LLHIQ  556
            LL  Q
Sbjct  437  LLPEQ  441



>ref|XP_004496831.1| PREDICTED: probable polygalacturonase-like [Cicer arietinum]
Length=481

 Score =   241 bits (614),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 115/200 (58%), Positives = 147/200 (74%), Gaps = 4/200 (2%)
 Frame = +2

Query  2    VAVKSGWDQYGIKYGKPTKQLIIKRLTCISPYSAAIALGSEMSGGIEDVRASDITAVHTE  181
            +A+KSGWD+YGIK G PT+ +II+RLTCISP SA IALGSEMSGGI+DVRA DITA+ TE
Sbjct  266  IAIKSGWDEYGIKVGMPTQHVIIRRLTCISPDSATIALGSEMSGGIQDVRAEDITAISTE  325

Query  182  SGVRIKSAIGRGGYVKNIYVKGLRAHTMKWVFLMSGDYGDHPDNHFDPKAFPVVAGINFR  361
            S VRIKSA+GRGG+V++I+VKG+  +TMK+VF M+G Y  H D  FDPKA P V  IN+ 
Sbjct  326  SAVRIKSAVGRGGFVRDIFVKGMNLNTMKYVFWMTGSYSSHADEGFDPKALPNVTNINYS  385

Query  362  DVVADNVTMAGKMEGISGHPYTGVCMANVTIGMAKNGKKPAWNCSNIQGV-ASGVVPPPC  538
            +++A  VT A ++EGIS  PYTG+C++N  I MA   KK  WNC+++ GV +S V P PC
Sbjct  386  NIIAKKVTYAAQLEGISNDPYTGICISNTNIEMAAKKKKLPWNCTDVSGVTSSDVTPQPC  445

Query  539  PLLHIQGPVKPGMCDLPPKK  598
             LL  +G  +   C  P  K
Sbjct  446  ALLPQKGKFE---CAYPSDK  462



>ref|XP_008376628.1| PREDICTED: probable polygalacturonase [Malus domestica]
Length=475

 Score =   240 bits (613),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 107/182 (59%), Positives = 140/182 (77%), Gaps = 0/182 (0%)
 Frame = +2

Query  2    VAVKSGWDQYGIKYGKPTKQLIIKRLTCISPYSAAIALGSEMSGGIEDVRASDITAVHTE  181
            +AVKSGWD+YGIK G PT+ L+I+RLTCISP SA IALGSEMSGGI DVRA DITA+ T+
Sbjct  258  IAVKSGWDEYGIKVGIPTEHLVIRRLTCISPDSATIALGSEMSGGIRDVRAEDITAIDTQ  317

Query  182  SGVRIKSAIGRGGYVKNIYVKGLRAHTMKWVFLMSGDYGDHPDNHFDPKAFPVVAGINFR  361
            S VRIK+A+GRG YVK+IYV+ +   TMK+VF M+G YG HPD  FDPKA P +  IN++
Sbjct  318  SSVRIKTAVGRGAYVKDIYVRRMTLKTMKYVFWMTGSYGSHPDPSFDPKALPEITNINYK  377

Query  362  DVVADNVTMAGKMEGISGHPYTGVCMANVTIGMAKNGKKPAWNCSNIQGVASGVVPPPCP  541
             VVA+NVT + +++G+   P+ G+C++NVTI + +  KK  WNC+N++G+ S V P  C 
Sbjct  378  QVVAENVTYSARLDGVPNDPFKGICISNVTITLTEKPKKLQWNCTNVEGITSNVTPKACD  437

Query  542  LL  547
            LL
Sbjct  438  LL  439



>ref|XP_002273143.3| PREDICTED: probable polygalacturonase, partial [Vitis vinifera]
Length=434

 Score =   239 bits (609),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 109/200 (55%), Positives = 154/200 (77%), Gaps = 4/200 (2%)
 Frame = +2

Query  2    VAVKSGWDQYGIKYGKPTKQLIIKRLTCISPYSAAIALGSEMSGGIEDVRASDITAVHTE  181
            +AVKSGWDQYGIKYG PT+ ++I+RLTCISP SA IALGSEMSGGI++VRA DITA++++
Sbjct  218  IAVKSGWDQYGIKYGVPTRDIVIRRLTCISPDSAVIALGSEMSGGIKNVRAEDITAINSQ  277

Query  182  SGVRIKSAIGRGGYVKNIYVKGLRAHTMKWVFLMSGDYGDHPDNHFDPKAFPVVAGINFR  361
            SGVRIK+ +GRGGYV++IY + +   TMK+VF M+ DYG HPD+ +D KA P +  IN+R
Sbjct  278  SGVRIKTGVGRGGYVQDIYARKMTMKTMKYVFWMTSDYGSHPDDEWDRKAIPKIENINYR  337

Query  362  DVVADNVTMAGKMEGISGHPYTGVCMANVTIGMAKNGKKPAWNCSNIQGVASGVVPPPCP  541
            +VVA+NVT + +++GI+G  +TG+C+++VTI + +  K+  WNC+N++GV S V P  C 
Sbjct  338  EVVAENVTYSARLDGIAGDKFTGICISDVTIRLTQKPKQLQWNCTNVEGVTSQVTPQSCD  397

Query  542  LL-HIQGPVKPGMCDLPPKK  598
            LL   +GP++   C  P  +
Sbjct  398  LLPPSKGPLQ---CTFPENQ  414



>ref|XP_009377556.1| PREDICTED: probable polygalacturonase [Pyrus x bretschneideri]
 ref|XP_009377601.1| PREDICTED: probable polygalacturonase [Pyrus x bretschneideri]
Length=471

 Score =   238 bits (608),  Expect = 6e-71, Method: Compositional matrix adjust.
 Identities = 108/185 (58%), Positives = 142/185 (77%), Gaps = 0/185 (0%)
 Frame = +2

Query  2    VAVKSGWDQYGIKYGKPTKQLIIKRLTCISPYSAAIALGSEMSGGIEDVRASDITAVHTE  181
            +AVKSG+D+YGIK G PT+ L+I+RLTCISP SA IALGSEMSGGI DVR  DITA+  E
Sbjct  257  IAVKSGFDEYGIKVGIPTEHLVIRRLTCISPSSATIALGSEMSGGIRDVRGEDITAIDAE  316

Query  182  SGVRIKSAIGRGGYVKNIYVKGLRAHTMKWVFLMSGDYGDHPDNHFDPKAFPVVAGINFR  361
            S VRIK+A+GRGGYVK+IYV+ +   TMK+VF M+G YG HPD  FDPKA P +  IN++
Sbjct  317  SSVRIKTAVGRGGYVKDIYVRRMTLKTMKYVFWMTGSYGSHPDPGFDPKALPEITNINYK  376

Query  362  DVVADNVTMAGKMEGISGHPYTGVCMANVTIGMAKNGKKPAWNCSNIQGVASGVVPPPCP  541
             VVA+NVT++ +++GI   P+ G+C++NVTI +A+  KK  WNC++++G+ S V P  C 
Sbjct  377  QVVAENVTISARLDGIHDDPFKGICISNVTITLAEKAKKLQWNCTDVEGITSNVTPKACD  436

Query  542  LLHIQ  556
            LL  Q
Sbjct  437  LLPEQ  441



>ref|XP_002878707.1| glycoside hydrolase family 28 protein [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH54966.1| glycoside hydrolase family 28 protein [Arabidopsis lyrata subsp. 
lyrata]
Length=477

 Score =   238 bits (607),  Expect = 9e-71, Method: Compositional matrix adjust.
 Identities = 113/199 (57%), Positives = 141/199 (71%), Gaps = 2/199 (1%)
 Frame = +2

Query  2    VAVKSGWDQYGIKYGKPTKQLIIKRLTCISPYSAAIALGSEMSGGIEDVRASDITAVHTE  181
            +AVKSGWDQ+GIK G PTKQL I+RLTCISP SA IALGSEMSGGI+DVR  DIT + T+
Sbjct  268  IAVKSGWDQFGIKVGMPTKQLSIRRLTCISPDSAGIALGSEMSGGIKDVRIEDITLLQTQ  327

Query  182  SGVRIKSAIGRGGYVKNIYVKGLRAHTMKWVFLMSGDYGDHPDNHFDPKAFPVVAGINFR  361
            S +RIK+A+GRGGYVK+I+ +     TMK+VF MSG Y  HP + FDPKA P +  IN+R
Sbjct  328  SAIRIKTAVGRGGYVKDIFARRFTMKTMKYVFWMSGAYNQHPASGFDPKAMPEITNINYR  387

Query  362  DVVADNVTMAGKMEGISGHPYTGVCMANVTIGMAKNGKKPAWNCSNIQGVASGVVPPPCP  541
            D+ ADNVT   +++G    P+T +CM+N+ I +A   KK  WNC+NI GV+S V P PC 
Sbjct  388  DMTADNVTQPARLDGFKNDPFTKICMSNIKIDLAAEPKKLLWNCTNISGVSSKVTPKPCS  447

Query  542  LLHIQGPVKPGMCDLPPKK  598
            LL  +G   P  C  P  K
Sbjct  448  LLPEKG--APVDCAFPVDK  464



>gb|AAC63679.1| putative polygalacturonase [Arabidopsis thaliana]
Length=466

 Score =   237 bits (605),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 112/199 (56%), Positives = 142/199 (71%), Gaps = 2/199 (1%)
 Frame = +2

Query  2    VAVKSGWDQYGIKYGKPTKQLIIKRLTCISPYSAAIALGSEMSGGIEDVRASDITAVHTE  181
            +AVKSGWDQ+GIK G PT+QL I+RLTCISP SA IALGSEMSGGI+DVR  DIT + T+
Sbjct  257  IAVKSGWDQFGIKVGMPTQQLSIRRLTCISPDSAGIALGSEMSGGIKDVRIEDITLLQTQ  316

Query  182  SGVRIKSAIGRGGYVKNIYVKGLRAHTMKWVFLMSGDYGDHPDNHFDPKAFPVVAGINFR  361
            S +RIK+A+GRGGYVK+I+ +     TMK+VF MSG Y  HP + FDPKA PV+  IN+R
Sbjct  317  SAIRIKTAVGRGGYVKDIFARRFTMKTMKYVFWMSGAYNQHPASGFDPKAMPVITNINYR  376

Query  362  DVVADNVTMAGKMEGISGHPYTGVCMANVTIGMAKNGKKPAWNCSNIQGVASGVVPPPCP  541
            D+ ADNVT   +++G    P+T +CM+N+ I +A   KK  WNC++I GV+S V P PC 
Sbjct  377  DMTADNVTQPARLDGFKNDPFTKICMSNIKIDLAAEPKKLLWNCTSISGVSSKVTPKPCS  436

Query  542  LLHIQGPVKPGMCDLPPKK  598
            LL  +G   P  C  P  K
Sbjct  437  LLPEKG--APVDCAFPVDK  453



>emb|CDY39678.1| BnaA04g13950D [Brassica napus]
Length=478

 Score =   237 bits (605),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 111/199 (56%), Positives = 140/199 (70%), Gaps = 3/199 (2%)
 Frame = +2

Query  2    VAVKSGWDQYGIKYGKPTKQLIIKRLTCISPYSAAIALGSEMSGGIEDVRASDITAVHTE  181
            +AVKSGWDQ+GIK G PT+QL I+RLTCISP SA IALGSEMSGGI+DVR  DIT + T+
Sbjct  270  IAVKSGWDQFGIKVGMPTQQLSIRRLTCISPDSAGIALGSEMSGGIKDVRMEDITLLQTQ  329

Query  182  SGVRIKSAIGRGGYVKNIYVKGLRAHTMKWVFLMSGDYGDHPDNHFDPKAFPVVAGINFR  361
            S +RIK+A+GRGGYVK+I+ +     TMK+VF MSG Y  HP + FDPKA P +  IN+R
Sbjct  330  SAIRIKTAVGRGGYVKDIFARRFTMKTMKYVFWMSGAYNQHPASGFDPKAMPEITNINYR  389

Query  362  DVVADNVTMAGKMEGISGHPYTGVCMANVTIGMAKNGKKPAWNCSNIQGVASGVVPPPCP  541
            D+ ADNVT   +++G +  P+T +CM+N+ I +A   KK  WNC+ I GV+S V P PC 
Sbjct  390  DMTADNVTQPARLDGFTNDPFTKICMSNINIALAAEPKKLLWNCTAISGVSSKVTPKPCS  449

Query  542  LLHIQGPVKPGMCDLPPKK  598
            LL    PV    C  P  K
Sbjct  450  LLPENAPVD---CAFPVDK  465



>gb|AGZ62594.1| pollen-specific polygalacturonase [Brassica rapa subsp. chinensis]
Length=478

 Score =   237 bits (605),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 111/199 (56%), Positives = 140/199 (70%), Gaps = 3/199 (2%)
 Frame = +2

Query  2    VAVKSGWDQYGIKYGKPTKQLIIKRLTCISPYSAAIALGSEMSGGIEDVRASDITAVHTE  181
            +AVKSGWDQ+GIK G PT+QL I+RLTCISP SA IALGSEMSGGI+DVR  DIT + T+
Sbjct  270  IAVKSGWDQFGIKVGMPTQQLSIRRLTCISPDSAGIALGSEMSGGIKDVRMEDITLLQTQ  329

Query  182  SGVRIKSAIGRGGYVKNIYVKGLRAHTMKWVFLMSGDYGDHPDNHFDPKAFPVVAGINFR  361
            S +RIK+A+GRGGYVK+I+ +     TMK+VF MSG Y  HP + FDPKA P +  IN+R
Sbjct  330  SAIRIKTAVGRGGYVKDIFARRFTMKTMKYVFWMSGAYNQHPASGFDPKAMPEITNINYR  389

Query  362  DVVADNVTMAGKMEGISGHPYTGVCMANVTIGMAKNGKKPAWNCSNIQGVASGVVPPPCP  541
            D+ ADNVT   +++G +  P+T +CM+N+ I +A   KK  WNC+ I GV+S V P PC 
Sbjct  390  DMAADNVTQPARLDGFTNDPFTKICMSNINIALAAEPKKLLWNCTAISGVSSKVTPKPCS  449

Query  542  LLHIQGPVKPGMCDLPPKK  598
            LL    PV    C  P  K
Sbjct  450  LLPENAPVD---CAFPVDK  465



>gb|EMT02659.1| hypothetical protein F775_52404 [Aegilops tauschii]
Length=467

 Score =   237 bits (604),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 114/199 (57%), Positives = 145/199 (73%), Gaps = 16/199 (8%)
 Frame = +2

Query  2    VAVKSGWDQYGIKYGKPTKQLIIKRLTCISPYSAAIALGSEMSGGIEDVRASDITAVHTE  181
            +AVKSGWD+YGI++  P++ ++++RLTCISP SA IALGSEMSGGI+DVR  D  A++TE
Sbjct  272  IAVKSGWDEYGIRFNMPSQHIVVRRLTCISPTSAMIALGSEMSGGIQDVRVEDNIAINTE  331

Query  182  SGVRIKSAIGRGGYVKNIYVKGLRAHTMKWVFLMSGDYGDHPDNHFDPKAFPVVAGINFR  361
            S VRIKS +GRGG+V++            WVF M+G+YG HPDN  DPKA P V GIN+R
Sbjct  332  SAVRIKSGVGRGGFVRD------------WVFWMTGNYGQHPDNSSDPKALPEVTGINYR  379

Query  362  DVVADNVTMAGKMEGISGHPYTGVCMANVTIGMAKNGKKPAWNCSNIQGVASGVVPPPCP  541
            DV A+NVTMAG+MEGI   PYTG+CM+NVT  +A   KK  WNC+++QGVA GV P PCP
Sbjct  380  DVFAENVTMAGRMEGIPNDPYTGICMSNVTAQLAPKAKKLQWNCTDVQGVAYGVSPEPCP  439

Query  542  LLHIQGPVKPGMCDLPPKK  598
             L  +G  KP  C  P ++
Sbjct  440  ELGAEG--KP--CTFPEEE  454



>ref|NP_179968.2| pectin lyase-like protein [Arabidopsis thaliana]
 gb|ABE65854.1| glycoside hydrolase family 28 protein/polygalacturonase family 
protein [Arabidopsis thaliana]
 gb|AEC07500.1| pectin lyase-like protein [Arabidopsis thaliana]
Length=477

 Score =   237 bits (605),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 112/199 (56%), Positives = 142/199 (71%), Gaps = 2/199 (1%)
 Frame = +2

Query  2    VAVKSGWDQYGIKYGKPTKQLIIKRLTCISPYSAAIALGSEMSGGIEDVRASDITAVHTE  181
            +AVKSGWDQ+GIK G PT+QL I+RLTCISP SA IALGSEMSGGI+DVR  DIT + T+
Sbjct  268  IAVKSGWDQFGIKVGMPTQQLSIRRLTCISPDSAGIALGSEMSGGIKDVRIEDITLLQTQ  327

Query  182  SGVRIKSAIGRGGYVKNIYVKGLRAHTMKWVFLMSGDYGDHPDNHFDPKAFPVVAGINFR  361
            S +RIK+A+GRGGYVK+I+ +     TMK+VF MSG Y  HP + FDPKA PV+  IN+R
Sbjct  328  SAIRIKTAVGRGGYVKDIFARRFTMKTMKYVFWMSGAYNQHPASGFDPKAMPVITNINYR  387

Query  362  DVVADNVTMAGKMEGISGHPYTGVCMANVTIGMAKNGKKPAWNCSNIQGVASGVVPPPCP  541
            D+ ADNVT   +++G    P+T +CM+N+ I +A   KK  WNC++I GV+S V P PC 
Sbjct  388  DMTADNVTQPARLDGFKNDPFTKICMSNIKIDLAAEPKKLLWNCTSISGVSSKVTPKPCS  447

Query  542  LLHIQGPVKPGMCDLPPKK  598
            LL  +G   P  C  P  K
Sbjct  448  LLPEKG--APVDCAFPVDK  464



>gb|ABK28510.1| unknown [Arabidopsis thaliana]
Length=478

 Score =   237 bits (605),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 112/199 (56%), Positives = 142/199 (71%), Gaps = 2/199 (1%)
 Frame = +2

Query  2    VAVKSGWDQYGIKYGKPTKQLIIKRLTCISPYSAAIALGSEMSGGIEDVRASDITAVHTE  181
            +AVKSGWDQ+GIK G PT+QL I+RLTCISP SA IALGSEMSGGI+DVR  DIT + T+
Sbjct  268  IAVKSGWDQFGIKVGMPTQQLSIRRLTCISPDSAGIALGSEMSGGIKDVRIEDITLLQTQ  327

Query  182  SGVRIKSAIGRGGYVKNIYVKGLRAHTMKWVFLMSGDYGDHPDNHFDPKAFPVVAGINFR  361
            S +RIK+A+GRGGYVK+I+ +     TMK+VF MSG Y  HP + FDPKA PV+  IN+R
Sbjct  328  SAIRIKTAVGRGGYVKDIFARRFTMKTMKYVFWMSGAYNQHPASGFDPKAMPVITNINYR  387

Query  362  DVVADNVTMAGKMEGISGHPYTGVCMANVTIGMAKNGKKPAWNCSNIQGVASGVVPPPCP  541
            D+ ADNVT   +++G    P+T +CM+N+ I +A   KK  WNC++I GV+S V P PC 
Sbjct  388  DMTADNVTQPARLDGFKNDPFTKICMSNIKIDLAAEPKKLLWNCTSISGVSSKVTPKPCS  447

Query  542  LLHIQGPVKPGMCDLPPKK  598
            LL  +G   P  C  P  K
Sbjct  448  LLPEKG--APVDCAFPVDK  464



>emb|CDY05885.1| BnaC08g20620D [Brassica napus]
Length=464

 Score =   236 bits (603),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 112/196 (57%), Positives = 141/196 (72%), Gaps = 4/196 (2%)
 Frame = +2

Query  2    VAVKSGWDQYGIKYGKPTKQLIIKRLTCISPYSAAIALGSEMSGGIEDVRASDITAVHTE  181
            +AVKSGWDQYGIK+G PT+QL I+RLTCISP SA +ALGSEMSGGI+DVR  D+T ++TE
Sbjct  257  IAVKSGWDQYGIKFGMPTQQLSIRRLTCISPKSAGVALGSEMSGGIKDVRIEDVTLINTE  316

Query  182  SGVRIKSAIGRGGYVKNIYVKGLRAHTMKWVFLMSGDYGDHPDNHFDPKAFPVVAGINFR  361
            S VRIK+A GRG YVK+IY +     TMK+VF MSG+Y  HPD  +DPKA P V+ INF 
Sbjct  317  SSVRIKTAAGRGVYVKDIYARRFTMKTMKYVFWMSGNYNQHPDEGYDPKALPEVSNINFS  376

Query  362  DVVADNVTMAGKMEGISGHPYTGVCMANVTIGMAKNGKKPAWNCSNIQGVASGVVPPPCP  541
            D+ A+NVTM+  + GI   P+TG+C++NV I ++   K+  WNC+N+ GV S V P PC 
Sbjct  377  DMTAENVTMSASLAGIDKDPFTGICISNVNITLSAKPKEVQWNCTNMAGVTSRVKPEPCS  436

Query  542  LLHIQGPVKPGMCDLP  589
            LL    P K   C  P
Sbjct  437  LL----PEKNMDCKFP  448



>ref|XP_009140503.1| PREDICTED: probable polygalacturonase [Brassica rapa]
Length=478

 Score =   236 bits (603),  Expect = 4e-70, Method: Compositional matrix adjust.
 Identities = 111/199 (56%), Positives = 140/199 (70%), Gaps = 3/199 (2%)
 Frame = +2

Query  2    VAVKSGWDQYGIKYGKPTKQLIIKRLTCISPYSAAIALGSEMSGGIEDVRASDITAVHTE  181
            +AVKSGWDQ+GIK G PT+QL I+RLTCISP SA IALGSEMSGGI+DVR  DIT + T+
Sbjct  270  IAVKSGWDQFGIKVGMPTQQLSIRRLTCISPDSAGIALGSEMSGGIKDVRMEDITLLQTQ  329

Query  182  SGVRIKSAIGRGGYVKNIYVKGLRAHTMKWVFLMSGDYGDHPDNHFDPKAFPVVAGINFR  361
            S +RIK+A+GRGGYVK+I+ +     TMK+VF MSG Y  HP + FDPKA P +  IN+R
Sbjct  330  SAIRIKTAVGRGGYVKDIFARRFTMKTMKYVFWMSGAYNQHPASGFDPKAMPEITNINYR  389

Query  362  DVVADNVTMAGKMEGISGHPYTGVCMANVTIGMAKNGKKPAWNCSNIQGVASGVVPPPCP  541
            D+ ADNVT   +++G +  P+T +CM+N+ I +A   KK  WNC+ I GV+S V P PC 
Sbjct  390  DMTADNVTQPARLDGFTNDPFTKICMSNINIVLAAEPKKLLWNCTAISGVSSKVTPKPCS  449

Query  542  LLHIQGPVKPGMCDLPPKK  598
            LL    PV    C  P  K
Sbjct  450  LLPENAPVD---CAFPVDK  465



>ref|XP_008229768.1| PREDICTED: probable polygalacturonase [Prunus mume]
Length=474

 Score =   236 bits (602),  Expect = 4e-70, Method: Compositional matrix adjust.
 Identities = 112/196 (57%), Positives = 143/196 (73%), Gaps = 4/196 (2%)
 Frame = +2

Query  2    VAVKSGWDQYGIKYGKPTKQLIIKRLTCISPYSAAIALGSEMSGGIEDVRASDITAVHTE  181
            +AVKSGWDQYGIK G PT+ L+I+RLTCISP SA IALGSEMSGGI DVRA DITA+ T+
Sbjct  260  IAVKSGWDQYGIKVGIPTEHLVIRRLTCISPDSATIALGSEMSGGIRDVRAEDITALSTQ  319

Query  182  SGVRIKSAIGRGGYVKNIYVKGLRAHTMKWVFLMSGDYGDHPDNHFDPKAFPVVAGINFR  361
            SGVRIK+A GRG YVK+I+++ +   TMK+VF M+G Y  HPD  FDPKA P++  IN++
Sbjct  320  SGVRIKTARGRGAYVKDIFLRRMTLKTMKYVFWMTGSYRSHPDPSFDPKALPLIQNINYK  379

Query  362  DVVADNVTMAGKMEGISGHPYTGVCMANVTIGMAKNGKKPAWNCSNIQGVASGVVPPPCP  541
             V A+NVT + ++EGI   P+ G+C++NVTI + +  KK  WNC++I GV S V P  C 
Sbjct  380  QVEAENVTYSARLEGIPNDPFKGICISNVTITLTEKPKKLQWNCTDIAGVTSNVTPKACD  439

Query  542  LLHIQGPVKPGMCDLP  589
            LL    P K  + D P
Sbjct  440  LL----PEKKEVVDCP  451



>ref|XP_009149779.1| PREDICTED: probable polygalacturonase [Brassica rapa]
Length=469

 Score =   236 bits (601),  Expect = 5e-70, Method: Compositional matrix adjust.
 Identities = 107/182 (59%), Positives = 137/182 (75%), Gaps = 0/182 (0%)
 Frame = +2

Query  2    VAVKSGWDQYGIKYGKPTKQLIIKRLTCISPYSAAIALGSEMSGGIEDVRASDITAVHTE  181
            +AVKSGWDQYGIK+G PT+QL I+RLTCISP SA +ALGSEMSGGI+DVR  D+T ++TE
Sbjct  257  IAVKSGWDQYGIKFGMPTQQLSIRRLTCISPKSAGVALGSEMSGGIKDVRIEDVTLINTE  316

Query  182  SGVRIKSAIGRGGYVKNIYVKGLRAHTMKWVFLMSGDYGDHPDNHFDPKAFPVVAGINFR  361
            S VRIK+A GRG YVK+IY +     TMK+VF MSG+Y  HPD  +DPKA P V+ INF 
Sbjct  317  SSVRIKTAAGRGAYVKDIYARRFTMKTMKYVFWMSGNYNQHPDEGYDPKALPEVSNINFS  376

Query  362  DVVADNVTMAGKMEGISGHPYTGVCMANVTIGMAKNGKKPAWNCSNIQGVASGVVPPPCP  541
            D+ A+NVTM+  + GI   P+TG+C++NV I ++   K+  WNC+++ GV S V P PC 
Sbjct  377  DMTAENVTMSASLAGIDKDPFTGICISNVNITLSAKPKEVQWNCTDVAGVTSRVKPEPCS  436

Query  542  LL  547
            LL
Sbjct  437  LL  438



>emb|CDY20264.1| BnaC04g36920D [Brassica napus]
Length=478

 Score =   236 bits (602),  Expect = 6e-70, Method: Compositional matrix adjust.
 Identities = 110/199 (55%), Positives = 140/199 (70%), Gaps = 3/199 (2%)
 Frame = +2

Query  2    VAVKSGWDQYGIKYGKPTKQLIIKRLTCISPYSAAIALGSEMSGGIEDVRASDITAVHTE  181
            +AVKSGWDQ+GIK G PT+QL I+RLTCISP SA IALGSEMSGGI+DVR  DIT + T+
Sbjct  270  IAVKSGWDQFGIKVGMPTQQLSIRRLTCISPDSAGIALGSEMSGGIKDVRMEDITLLQTQ  329

Query  182  SGVRIKSAIGRGGYVKNIYVKGLRAHTMKWVFLMSGDYGDHPDNHFDPKAFPVVAGINFR  361
            S +RIK+A+GRGGYVK+I+ +     TMK+VF MSG Y  HP + +DPKA P +  IN+R
Sbjct  330  SAIRIKTAVGRGGYVKDIFARRFTMKTMKYVFWMSGAYNQHPASGYDPKAMPEITNINYR  389

Query  362  DVVADNVTMAGKMEGISGHPYTGVCMANVTIGMAKNGKKPAWNCSNIQGVASGVVPPPCP  541
            D+ ADNVT   +++G +  P+T +CM+N+ I +A   KK  WNC+ I GV+S V P PC 
Sbjct  390  DMTADNVTQPARLDGFTNDPFTKICMSNINIALAAEPKKLLWNCTAISGVSSKVTPKPCS  449

Query  542  LLHIQGPVKPGMCDLPPKK  598
            LL    PV    C  P  K
Sbjct  450  LLPENAPVD---CAFPVDK  465



>ref|XP_010472382.1| PREDICTED: probable polygalacturonase [Camelina sativa]
Length=508

 Score =   236 bits (603),  Expect = 7e-70, Method: Compositional matrix adjust.
 Identities = 111/199 (56%), Positives = 142/199 (71%), Gaps = 2/199 (1%)
 Frame = +2

Query  2    VAVKSGWDQYGIKYGKPTKQLIIKRLTCISPYSAAIALGSEMSGGIEDVRASDITAVHTE  181
            +AVKSGWDQ+GIK GKPT+QL I+RLTCISP SA IALGSEMSGGI+DVR  DIT + T+
Sbjct  268  IAVKSGWDQFGIKVGKPTQQLSIRRLTCISPDSAGIALGSEMSGGIKDVRIEDITLLQTQ  327

Query  182  SGVRIKSAIGRGGYVKNIYVKGLRAHTMKWVFLMSGDYGDHPDNHFDPKAFPVVAGINFR  361
            S +RIK+A+GRGGYVK+I+ +     TM++VF MSG Y  HP + FDPKA P +  IN+ 
Sbjct  328  SAIRIKTAVGRGGYVKDIFARKFTMKTMQYVFWMSGAYNQHPVSGFDPKAMPQITNINYS  387

Query  362  DVVADNVTMAGKMEGISGHPYTGVCMANVTIGMAKNGKKPAWNCSNIQGVASGVVPPPCP  541
            D+ ADNVT   +++G+   P+T +CM+N+ I +A   KK  WNC+NI GV+S V P PC 
Sbjct  388  DMTADNVTQPARLDGLKNDPFTKICMSNINIALAPKPKKLLWNCTNISGVSSKVTPKPCS  447

Query  542  LLHIQGPVKPGMCDLPPKK  598
            LL  +G   P  C  P  K
Sbjct  448  LLPERG--APVHCAFPVDK  464



>gb|EYU25143.1| hypothetical protein MIMGU_mgv1a005601mg [Erythranthe guttata]
Length=477

 Score =   236 bits (601),  Expect = 7e-70, Method: Compositional matrix adjust.
 Identities = 115/209 (55%), Positives = 147/209 (70%), Gaps = 17/209 (8%)
 Frame = +2

Query  2    VAVKSGWDQYGIKYGKPTKQLIIKRLTCISPYSAAIALGSEMSGGIEDVRASDITAVHTE  181
            +AVKSGWDQYGIK+G PT+ L IKR TCISP SA IALGSEMSGGI+DVRA D+ A++++
Sbjct  257  IAVKSGWDQYGIKFGMPTQHLSIKRFTCISPDSAVIALGSEMSGGIQDVRAEDVHAINSQ  316

Query  182  SGVRIKSAIGRGGYVKNIYVKGLRAHTMKWVFLMSGDYGDHPDNHFDPKAFPVVAGINFR  361
            +GVRIK+A GRG YVK+I+V+ LR  TM++VF M+G YG HPD+ +DPKA PVV  INF+
Sbjct  317  AGVRIKTAPGRGAYVKDIFVRNLRMETMQYVFWMTGAYGSHPDDGYDPKALPVVNNINFK  376

Query  362  DVVADNVTMAGKMEGISGHPYTGVCMANVTIGMA-------------KNGKKPAWNCSNI  502
            D+V  NV+M G + GI GHP+TG+C++N+T  +A                KK  WNC++I
Sbjct  377  DMVGKNVSMVGNLAGIEGHPFTGLCLSNITAELAVKKKKKNIHPIFSSEKKKLPWNCTDI  436

Query  503  QGVASGVVPPPCPLLHIQGPVKPGMCDLP  589
             GV+S V P  C LL    P K   C  P
Sbjct  437  SGVSSQVTPKACDLL----PEKKVDCAYP  461



>gb|KFK32698.1| hypothetical protein AALP_AA6G277200 [Arabis alpina]
Length=477

 Score =   235 bits (600),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 110/199 (55%), Positives = 141/199 (71%), Gaps = 2/199 (1%)
 Frame = +2

Query  2    VAVKSGWDQYGIKYGKPTKQLIIKRLTCISPYSAAIALGSEMSGGIEDVRASDITAVHTE  181
            +AVKSGWDQ+GIK G PT+QL I+RLTCISP SA IALGSEMSGGI+DVR  DIT + T+
Sbjct  268  IAVKSGWDQFGIKVGMPTQQLSIRRLTCISPDSAGIALGSEMSGGIKDVRMEDITLLQTQ  327

Query  182  SGVRIKSAIGRGGYVKNIYVKGLRAHTMKWVFLMSGDYGDHPDNHFDPKAFPVVAGINFR  361
            S +RIK+A+GRGGYVK+I+ +     TMK+VF MSG Y  HP + FD KA P +  IN+R
Sbjct  328  SAIRIKTAVGRGGYVKDIFARRFTMKTMKYVFWMSGAYNQHPASGFDAKAMPEITNINYR  387

Query  362  DVVADNVTMAGKMEGISGHPYTGVCMANVTIGMAKNGKKPAWNCSNIQGVASGVVPPPCP  541
            D+ ADNVT   +++G++  P+T +CM+N+ I +A   K+  WNC+NI GV+S V P PC 
Sbjct  388  DMTADNVTQPARLDGLNNDPFTKICMSNINIALAPKPKELLWNCTNISGVSSKVTPKPCS  447

Query  542  LLHIQGPVKPGMCDLPPKK  598
            LL   G   P  C  P  K
Sbjct  448  LLSENG--APVDCAFPVDK  464



>ref|XP_008234837.1| PREDICTED: probable polygalacturonase [Prunus mume]
Length=474

 Score =   234 bits (597),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 112/196 (57%), Positives = 142/196 (72%), Gaps = 4/196 (2%)
 Frame = +2

Query  2    VAVKSGWDQYGIKYGKPTKQLIIKRLTCISPYSAAIALGSEMSGGIEDVRASDITAVHTE  181
            +AVKSGWDQYGIK G PT+ L+I+RLTCISP SA IALGSEMSGGI DVR  DITA+ T+
Sbjct  260  IAVKSGWDQYGIKVGIPTEHLVIRRLTCISPDSATIALGSEMSGGIRDVRVEDITALSTQ  319

Query  182  SGVRIKSAIGRGGYVKNIYVKGLRAHTMKWVFLMSGDYGDHPDNHFDPKAFPVVAGINFR  361
            S VRIK+A GRGGYVK+I+V+ +   TMK+VF M+G YG HPD  FDPKA P++  IN++
Sbjct  320  SSVRIKTAQGRGGYVKDIFVRRMTLKTMKYVFWMTGSYGSHPDPGFDPKALPLIQNINYK  379

Query  362  DVVADNVTMAGKMEGISGHPYTGVCMANVTIGMAKNGKKPAWNCSNIQGVASGVVPPPCP  541
             V A+NVT + ++EGI    + G+C++NVTI + +  KK  WNC++I GV S V P  C 
Sbjct  380  QVEAENVTYSARLEGIPNDHFKGICISNVTITLTEKPKKLQWNCTDIAGVTSNVTPKACD  439

Query  542  LLHIQGPVKPGMCDLP  589
            LL    P K  + D P
Sbjct  440  LL----PEKKEVADCP  451



>ref|XP_006656549.1| PREDICTED: probable polygalacturonase-like [Oryza brachyantha]
Length=479

 Score =   234 bits (596),  Expect = 4e-69, Method: Compositional matrix adjust.
 Identities = 109/196 (56%), Positives = 148/196 (76%), Gaps = 4/196 (2%)
 Frame = +2

Query  2    VAVKSGWDQYGIKYGKPTKQLIIKRLTCISPYSAAIALGSEMSGGIEDVRASDITAVHTE  181
            VA+KSGWD+YGI YG P++ ++++RLTC+SP SA IALGSEMSGGI DVRA DITAV++E
Sbjct  267  VAIKSGWDEYGIAYGMPSQHIVVRRLTCVSPTSAVIALGSEMSGGINDVRAEDITAVNSE  326

Query  182  SGVRIKSAIGRGGYVKNIYVKGLRAHTMKWVFLMSGDYGDHPDNHFDPKAFPVVAGINFR  361
            SGVRIK+A+GRG YV++++V+ +   TMKWVF M+G+Y  HPD+ +DP A PVV  I+++
Sbjct  327  SGVRIKTAVGRGAYVRDVFVRRMSLDTMKWVFWMTGNYKSHPDDKYDPNAIPVVENISYQ  386

Query  362  DVVADNVTMAGKMEGISGHPYTGVCMANVTIGMAKNGKKPAWNCSNIQGVASGVVPPPCP  541
            DVVA  V  A ++EGI G P+  +C+ANVT  +AK+ K P W C++++GV++GV P PC 
Sbjct  387  DVVATAVNTAARLEGIQGAPFRDICIANVTATLAKSRKYP-WTCTDVEGVSAGVTPSPCQ  445

Query  542  LLHIQGPVKPGMCDLP  589
             L  QG    G C  P
Sbjct  446  PL--QGS-HDGACPFP  458



>emb|CDY08095.1| BnaA06g16310D [Brassica napus]
Length=495

 Score =   234 bits (597),  Expect = 4e-69, Method: Compositional matrix adjust.
 Identities = 106/182 (58%), Positives = 136/182 (75%), Gaps = 0/182 (0%)
 Frame = +2

Query  2    VAVKSGWDQYGIKYGKPTKQLIIKRLTCISPYSAAIALGSEMSGGIEDVRASDITAVHTE  181
            +AVKSGWDQYGIK+G PT+QL I+RLTCISP SA +ALGSEMSGGI+DVR  D+T ++TE
Sbjct  283  IAVKSGWDQYGIKFGMPTQQLSIRRLTCISPKSAGVALGSEMSGGIKDVRIEDVTLINTE  342

Query  182  SGVRIKSAIGRGGYVKNIYVKGLRAHTMKWVFLMSGDYGDHPDNHFDPKAFPVVAGINFR  361
            S VRIK+A GRG YVK+IY +     TMK+VF MSG+Y  HPD  +DPKA P V+ INF 
Sbjct  343  SSVRIKTAAGRGAYVKDIYARRFTMKTMKYVFWMSGNYNQHPDEGYDPKALPEVSNINFS  402

Query  362  DVVADNVTMAGKMEGISGHPYTGVCMANVTIGMAKNGKKPAWNCSNIQGVASGVVPPPCP  541
            D+ A+NVTM+  + GI   P+TG+C++NV I ++   K+  WNC+++ GV   V P PC 
Sbjct  403  DMTAENVTMSASLAGIDKDPFTGICISNVNITLSAKPKEVQWNCTDVAGVTRRVKPEPCS  462

Query  542  LL  547
            LL
Sbjct  463  LL  464



>ref|XP_006404874.1| hypothetical protein EUTSA_v10000145mg [Eutrema salsugineum]
 gb|ESQ46327.1| hypothetical protein EUTSA_v10000145mg [Eutrema salsugineum]
Length=491

 Score =   233 bits (595),  Expect = 7e-69, Method: Compositional matrix adjust.
 Identities = 109/199 (55%), Positives = 141/199 (71%), Gaps = 2/199 (1%)
 Frame = +2

Query  2    VAVKSGWDQYGIKYGKPTKQLIIKRLTCISPYSAAIALGSEMSGGIEDVRASDITAVHTE  181
            +AVKSGWDQ+GIK   PT+QL I+RLTCISP SA IALGSEMSGGI+DVR  DIT + T+
Sbjct  282  IAVKSGWDQFGIKVAMPTQQLSIRRLTCISPDSAGIALGSEMSGGIKDVRIEDITLLQTQ  341

Query  182  SGVRIKSAIGRGGYVKNIYVKGLRAHTMKWVFLMSGDYGDHPDNHFDPKAFPVVAGINFR  361
            S +RIK+A+GRGGYVK+I+ +     TMK+VF MSG Y  HP + +DPKA P +  IN+R
Sbjct  342  SAIRIKTAVGRGGYVKDIFARRFTMKTMKYVFWMSGAYNQHPVSGYDPKAMPEITNINYR  401

Query  362  DVVADNVTMAGKMEGISGHPYTGVCMANVTIGMAKNGKKPAWNCSNIQGVASGVVPPPCP  541
            D+ ADNVT   +++G+   P+T +CM+N+ I +A   KK  WNC++I GV+S V P PC 
Sbjct  402  DMTADNVTQPARLDGLKNDPFTKICMSNINIALAAEPKKLLWNCTDISGVSSKVTPKPCS  461

Query  542  LLHIQGPVKPGMCDLPPKK  598
            LL  +G   P  C  P  K
Sbjct  462  LLPEKG--APVDCAFPVDK  478



>ref|XP_010429342.1| PREDICTED: probable polygalacturonase [Camelina sativa]
Length=475

 Score =   233 bits (594),  Expect = 8e-69, Method: Compositional matrix adjust.
 Identities = 105/182 (58%), Positives = 136/182 (75%), Gaps = 0/182 (0%)
 Frame = +2

Query  2    VAVKSGWDQYGIKYGKPTKQLIIKRLTCISPYSAAIALGSEMSGGIEDVRASDITAVHTE  181
            +AVKSGWDQ+GIK GKPT+QL I+RLTCISP SA IALGSEMSGGI+DVR  DIT + T+
Sbjct  268  IAVKSGWDQFGIKVGKPTQQLSIRRLTCISPDSAGIALGSEMSGGIKDVRIEDITLLQTQ  327

Query  182  SGVRIKSAIGRGGYVKNIYVKGLRAHTMKWVFLMSGDYGDHPDNHFDPKAFPVVAGINFR  361
            S +RIK+A+GRGGYVK+I+ +     TM++VF MSG Y  HP + FDPKA P +  IN+ 
Sbjct  328  SAIRIKTAVGRGGYVKDIFARKFTMKTMQYVFWMSGAYNQHPVSGFDPKAMPQITNINYS  387

Query  362  DVVADNVTMAGKMEGISGHPYTGVCMANVTIGMAKNGKKPAWNCSNIQGVASGVVPPPCP  541
            D+ ADNVT   K++G+   P+T +CM+N+ + +A   KK  WNC++I GV+S V P PC 
Sbjct  388  DMTADNVTQPAKLDGLKNDPFTKICMSNINMTLAPEPKKLLWNCTDISGVSSKVTPKPCS  447

Query  542  LL  547
            LL
Sbjct  448  LL  449



>ref|XP_006295548.1| hypothetical protein CARUB_v10024654mg [Capsella rubella]
 gb|EOA28446.1| hypothetical protein CARUB_v10024654mg [Capsella rubella]
Length=477

 Score =   233 bits (594),  Expect = 8e-69, Method: Compositional matrix adjust.
 Identities = 109/199 (55%), Positives = 141/199 (71%), Gaps = 2/199 (1%)
 Frame = +2

Query  2    VAVKSGWDQYGIKYGKPTKQLIIKRLTCISPYSAAIALGSEMSGGIEDVRASDITAVHTE  181
            +AVKSGWDQ+GIK G PT+QL I+RLTCISP SA IALGSEMSGGI+DVR  DIT + T+
Sbjct  268  IAVKSGWDQFGIKVGMPTQQLSIRRLTCISPDSAGIALGSEMSGGIKDVRIEDITLLQTQ  327

Query  182  SGVRIKSAIGRGGYVKNIYVKGLRAHTMKWVFLMSGDYGDHPDNHFDPKAFPVVAGINFR  361
            S +RIK+A+GRGGYVK+I+ +     TMK++F MSG Y  HP + F+PKA P +  IN+R
Sbjct  328  SAIRIKTAVGRGGYVKDIFTRRFTMKTMKYIFWMSGAYNQHPVSGFNPKAMPQITNINYR  387

Query  362  DVVADNVTMAGKMEGISGHPYTGVCMANVTIGMAKNGKKPAWNCSNIQGVASGVVPPPCP  541
            D+ ADNVT   +++G+   P+T +CM+N+ I +A   KK  WNC++I GV+S V P PC 
Sbjct  388  DMTADNVTQPARLDGLKNDPFTKICMSNIKIALAPEPKKLLWNCTDISGVSSKVTPKPCS  447

Query  542  LLHIQGPVKPGMCDLPPKK  598
            LL   G   P  C  P  K
Sbjct  448  LLPENG--APVDCAFPVDK  464



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1924132229272