BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c25588_g6_i1 len=748 path=[5341:0-490 5832:491-521 6720:522-658
6857:659-667 36597:668-682 6881:683-747]

Length=748
                                                                      Score     E

ref|XP_011091064.1|  PREDICTED: putative late blight resistance p...  72.0    6e-11   
gb|AAV88068.1|  NBS-LRR protein                                       71.6    6e-11   Ipomoea batatas [batate]
ref|XP_011101340.1|  PREDICTED: putative late blight resistance p...  69.7    3e-10   
gb|AAT40487.1|  putative disease resistance protein                   68.9    7e-10   Solanum demissum
ref|XP_004248174.1|  PREDICTED: putative late blight resistance p...  68.2    1e-09   
ref|XP_011091063.1|  PREDICTED: putative late blight resistance p...  67.4    2e-09   
ref|XP_009788847.1|  PREDICTED: putative late blight resistance p...  67.0    2e-09   
ref|XP_006356446.1|  PREDICTED: putative late blight resistance p...  67.0    2e-09   
ref|XP_009766276.1|  PREDICTED: putative late blight resistance p...  67.0    3e-09   
gb|AAV88066.1|  NBS-LRR protein                                       66.2    4e-09   Ipomoea batatas [batate]
gb|AAT39932.2|  NB-ARC domain containing protein                      66.2    4e-09   Solanum demissum
ref|XP_011071973.1|  PREDICTED: putative late blight resistance p...  65.9    6e-09   
gb|EYU17765.1|  hypothetical protein MIMGU_mgv1a022339mg              65.5    7e-09   
ref|XP_009763530.1|  PREDICTED: putative late blight resistance p...  65.5    8e-09   
ref|XP_009800104.1|  PREDICTED: putative late blight resistance p...  65.1    1e-08   
gb|EYU30149.1|  hypothetical protein MIMGU_mgv1a018270mg              64.7    1e-08   
gb|AAT39951.2|  Disease resistance protein, putative                  65.1    1e-08   Solanum demissum
ref|XP_009617045.1|  PREDICTED: putative late blight resistance p...  63.9    2e-08   
ref|XP_009617046.1|  PREDICTED: putative late blight resistance p...  63.9    2e-08   
ref|XP_009617047.1|  PREDICTED: putative late blight resistance p...  63.9    2e-08   
ref|XP_009758685.1|  PREDICTED: late blight resistance protein R1...  63.9    2e-08   
ref|XP_009587753.1|  PREDICTED: putative late blight resistance p...  63.9    3e-08   
ref|XP_009588135.1|  PREDICTED: putative late blight resistance p...  63.9    3e-08   
gb|AAT40519.2|  hypothetical protein SDM1_22t00007                    63.9    3e-08   Solanum demissum
ref|XP_009799885.1|  PREDICTED: LOW QUALITY PROTEIN: putative lat...  63.9    3e-08   
ref|XP_011088087.1|  PREDICTED: putative late blight resistance p...  63.5    3e-08   
ref|XP_009790395.1|  PREDICTED: putative late blight resistance p...  63.5    3e-08   
ref|XP_009790398.1|  PREDICTED: putative late blight resistance p...  63.5    3e-08   
ref|XP_010320671.1|  PREDICTED: uncharacterized protein LOC101257665  63.5    4e-08   
ref|XP_006366838.1|  PREDICTED: putative late blight resistance p...  62.8    6e-08   
ref|XP_011071841.1|  PREDICTED: putative late blight resistance p...  62.8    7e-08   
ref|XP_010320562.1|  PREDICTED: LOW QUALITY PROTEIN: putative lat...  62.4    9e-08   
ref|XP_004239116.1|  PREDICTED: putative late blight resistance p...  62.0    1e-07   
gb|AAF76312.1|AF220603_4  Prf                                         62.0    1e-07   Solanum lycopersicum
gb|AAF76308.1|  Prf                                                   62.0    1e-07   Solanum pimpinellifolium [currant tomato]
ref|XP_011070550.1|  PREDICTED: putative late blight resistance p...  62.0    1e-07   
gb|AAC49408.1|  PRF                                                   62.0    1e-07   Solanum lycopersicum
ref|XP_010320926.1|  PREDICTED: putative late blight resistance p...  62.0    1e-07   
ref|XP_009618258.1|  PREDICTED: late blight resistance protein R1...  61.6    2e-07   
ref|XP_010324491.1|  PREDICTED: putative late blight resistance p...  61.2    2e-07   
ref|XP_011071971.1|  PREDICTED: putative late blight resistance p...  60.8    3e-07   
ref|XP_006348601.1|  PREDICTED: putative late blight resistance p...  60.5    4e-07   
ref|XP_009794750.1|  PREDICTED: putative late blight resistance p...  60.1    4e-07   
ref|XP_009606087.1|  PREDICTED: putative late blight resistance p...  59.7    6e-07   
ref|XP_009606086.1|  PREDICTED: putative late blight resistance p...  59.7    6e-07   
ref|XP_011087335.1|  PREDICTED: putative late blight resistance p...  59.7    6e-07   
sp|Q6L400.1|R1B16_SOLDE  RecName: Full=Putative late blight resis...  59.7    6e-07   Solanum demissum
ref|XP_011072119.1|  PREDICTED: putative late blight resistance p...  59.7    6e-07   
ref|XP_009606267.1|  PREDICTED: putative late blight resistance p...  58.9    1e-06   
ref|XP_006345283.1|  PREDICTED: uncharacterized protein LOC102590501  58.9    1e-06   
emb|CDP05538.1|  unnamed protein product                              58.5    2e-06   
ref|XP_009798058.1|  PREDICTED: LOW QUALITY PROTEIN: late blight ...  58.5    2e-06   
ref|XP_009764457.1|  PREDICTED: putative late blight resistance p...  58.2    2e-06   
ref|XP_009803439.1|  PREDICTED: putative late blight resistance p...  58.5    2e-06   
ref|XP_009608834.1|  PREDICTED: late blight resistance protein R1...  58.5    2e-06   
ref|XP_009803436.1|  PREDICTED: putative late blight resistance p...  58.5    2e-06   
ref|XP_004231117.1|  PREDICTED: putative late blight resistance p...  58.2    2e-06   
ref|XP_004240523.1|  PREDICTED: putative late blight resistance p...  58.2    2e-06   
ref|XP_009764259.1|  PREDICTED: late blight resistance protein R1...  58.2    2e-06   
ref|XP_009595789.1|  PREDICTED: putative late blight resistance p...  58.2    2e-06   
emb|CDP05499.1|  unnamed protein product                              58.2    2e-06   
ref|XP_011087138.1|  PREDICTED: putative late blight resistance p...  57.8    2e-06   
ref|NP_001234273.1|  JJH-R-like protein                               55.8    3e-06   
ref|XP_009779957.1|  PREDICTED: LOW QUALITY PROTEIN: late blight ...  57.8    3e-06   
ref|XP_004243044.2|  PREDICTED: putative late blight resistance p...  57.8    3e-06   
ref|XP_011072173.1|  PREDICTED: putative late blight resistance p...  57.4    3e-06   
ref|XP_011075746.1|  PREDICTED: putative late blight resistance p...  57.4    4e-06   
ref|XP_009597655.1|  PREDICTED: putative late blight resistance p...  57.4    4e-06   
ref|XP_006367614.1|  PREDICTED: putative late blight resistance p...  57.4    4e-06   
ref|XP_009597654.1|  PREDICTED: putative late blight resistance p...  57.4    4e-06   
ref|XP_009776932.1|  PREDICTED: putative late blight resistance p...  54.7    4e-06   
ref|XP_011088007.1|  PREDICTED: putative late blight resistance p...  57.0    5e-06   
ref|XP_006348816.1|  PREDICTED: putative late blight resistance p...  57.0    5e-06   
gb|AAU93588.1|  late blight resistance protein, identical             57.0    5e-06   Solanum demissum
ref|XP_009757156.1|  PREDICTED: putative late blight resistance p...  57.0    5e-06   
ref|XP_006356447.1|  PREDICTED: uncharacterized protein LOC102594363  57.0    6e-06   
emb|CDP04724.1|  unnamed protein product                              56.6    6e-06   
emb|CDP16515.1|  unnamed protein product                              56.6    7e-06   
ref|XP_009767436.1|  PREDICTED: putative late blight resistance p...  56.6    7e-06   
ref|XP_009762970.1|  PREDICTED: putative late blight resistance p...  56.6    7e-06   
sp|Q6L439.2|R1A4_SOLDE  RecName: Full=Putative late blight resist...  56.6    8e-06   Solanum demissum
gb|AGX27493.1|  NBS-LRR class resistance protein Fy1-Ry1              56.2    8e-06   
gb|AGX27496.1|  NBS-LRR class resistance protein Fy1-Ry1              56.2    8e-06   
gb|AGX27494.1|  NBS-LRR class resistance protein Fy1-Ry1              56.2    8e-06   
gb|AGX27495.1|  NBS-LRR class resistance protein Fy1-Ry1              56.2    8e-06   
gb|AGX27492.1|  NBS-LRR class resistance protein Fy1-Ry1              56.2    8e-06   
gb|ABO92985.1|  putative disease resistance protein                   56.2    9e-06   Solanum tuberosum [potatoes]
gb|EYU31598.1|  hypothetical protein MIMGU_mgv1a018432mg              56.2    9e-06   
ref|XP_009591230.1|  PREDICTED: putative late blight resistance p...  56.2    9e-06   
emb|CDP11974.1|  unnamed protein product                              56.2    9e-06   
ref|XP_011087329.1|  PREDICTED: putative late blight resistance p...  56.2    9e-06   
gb|AGW28124.1|  NBS-LRR class resistance protein Fy1-Ry1              56.2    1e-05   
ref|XP_011077109.1|  PREDICTED: putative late blight resistance p...  56.2    1e-05   
ref|XP_009786264.1|  PREDICTED: putative late blight resistance p...  56.2    1e-05   
gb|AAC32253.1|  disease resistance gene homolog Mi-copy1              56.2    1e-05   Solanum lycopersicum
ref|NP_001234622.1|  plant resistance protein                         56.2    1e-05   
ref|XP_009786258.1|  PREDICTED: putative late blight resistance p...  55.8    1e-05   
sp|Q60CZ8.1|R1A10_SOLDE  RecName: Full=Putative late blight resis...  55.8    1e-05   Solanum demissum
gb|ABO93000.1|  putative disease resistance protein                   55.8    1e-05   Solanum tuberosum [potatoes]
ref|XP_006349899.1|  PREDICTED: putative late blight resistance p...  55.5    1e-05   
ref|XP_009761980.1|  PREDICTED: putative late blight resistance p...  55.8    1e-05   
gb|ABI96216.1|  NBS-LRR resistance protein-like protein               55.8    1e-05   Solanum lycopersicum
ref|XP_011075662.1|  PREDICTED: putative late blight resistance p...  55.8    1e-05   
ref|XP_009761982.1|  PREDICTED: putative late blight resistance p...  55.8    1e-05   
ref|XP_009791056.1|  PREDICTED: putative late blight resistance p...  55.8    1e-05   
ref|XP_009791054.1|  PREDICTED: putative late blight resistance p...  55.8    1e-05   
ref|XP_009773003.1|  PREDICTED: protein CHUP1, chloroplastic-like     55.1    1e-05   
gb|ADH94052.1|  putative disease resistance protein R1                55.1    1e-05   
ref|XP_006364072.1|  PREDICTED: putative late blight resistance p...  55.5    1e-05   
ref|XP_009787864.1|  PREDICTED: LOW QUALITY PROTEIN: late blight ...  55.8    2e-05   
emb|CDP00737.1|  unnamed protein product                              55.5    2e-05   
ref|XP_004240498.1|  PREDICTED: putative late blight resistance p...  55.5    2e-05   
ref|XP_004248175.2|  PREDICTED: putative late blight resistance p...  55.5    2e-05   
gb|ADH94054.1|  putative disease resistance protein R1                55.1    2e-05   
ref|XP_009772163.1|  PREDICTED: putative late blight resistance p...  55.5    2e-05   
ref|XP_009772161.1|  PREDICTED: putative late blight resistance p...  55.5    2e-05   
ref|XP_009772162.1|  PREDICTED: putative late blight resistance p...  55.5    2e-05   
gb|EYU17693.1|  hypothetical protein MIMGU_mgv1a001245mg              55.5    2e-05   
gb|ABO93011.1|  putative disease resistance protein                   55.5    2e-05   Solanum tuberosum [potatoes]
gb|ADH94053.1|  putative disease resistance protein R1                55.1    2e-05   
gb|EYU21105.1|  hypothetical protein MIMGU_mgv1a021133mg              55.5    2e-05   
ref|XP_011075016.1|  PREDICTED: putative late blight resistance p...  55.5    2e-05   
ref|XP_011089745.1|  PREDICTED: putative late blight resistance p...  55.1    2e-05   
ref|XP_009763533.1|  PREDICTED: putative late blight resistance p...  55.1    2e-05   
emb|CDP16510.1|  unnamed protein product                              55.1    2e-05   
ref|XP_006364074.1|  PREDICTED: putative late blight resistance p...  55.1    2e-05   
gb|EYU21847.1|  hypothetical protein MIMGU_mgv1a017843mg              55.1    3e-05   
emb|CDP16512.1|  unnamed protein product                              55.1    3e-05   
ref|XP_009770726.1|  PREDICTED: putative late blight resistance p...  54.7    3e-05   
ref|XP_009602415.1|  PREDICTED: putative late blight resistance p...  54.7    3e-05   
ref|XP_006367619.1|  PREDICTED: putative late blight resistance p...  51.2    3e-05   
ref|XP_009602420.1|  PREDICTED: putative late blight resistance p...  54.7    3e-05   
emb|CDP18682.1|  unnamed protein product                              54.7    3e-05   
ref|XP_009764213.1|  PREDICTED: putative late blight resistance p...  52.4    3e-05   
ref|XP_009791923.1|  PREDICTED: putative late blight resistance p...  54.3    3e-05   
ref|XP_010320901.1|  PREDICTED: putative late blight resistance p...  54.7    3e-05   
ref|XP_010320900.1|  PREDICTED: putative late blight resistance p...  54.7    3e-05   
ref|XP_006351974.1|  PREDICTED: putative late blight resistance p...  54.3    4e-05   
ref|XP_011102162.1|  PREDICTED: putative late blight resistance p...  54.3    4e-05   
gb|EYU21846.1|  hypothetical protein MIMGU_mgv1a022576mg              53.9    4e-05   
ref|XP_011093987.1|  PREDICTED: putative late blight resistance p...  54.3    4e-05   
gb|EYU21842.1|  hypothetical protein MIMGU_mgv1a020462mg              54.3    4e-05   
ref|XP_004252073.2|  PREDICTED: putative late blight resistance p...  54.3    4e-05   
ref|XP_006367617.1|  PREDICTED: putative late blight resistance p...  53.9    5e-05   
ref|XP_004231569.2|  PREDICTED: putative late blight resistance p...  53.9    5e-05   
ref|XP_006345448.1|  PREDICTED: putative late blight resistance p...  53.9    5e-05   
ref|XP_009794266.1|  PREDICTED: late blight resistance protein R1...  53.9    6e-05   
emb|CDP07957.1|  unnamed protein product                              53.9    6e-05   
gb|EYU19036.1|  hypothetical protein MIMGU_mgv1a021264mg              53.5    7e-05   
ref|XP_009602419.1|  PREDICTED: putative late blight resistance p...  53.5    7e-05   
ref|XP_009794525.1|  PREDICTED: putative late blight resistance p...  53.5    7e-05   
ref|XP_006355133.1|  PREDICTED: putative late blight resistance p...  53.5    7e-05   
ref|XP_004243493.1|  PREDICTED: putative late blight resistance p...  53.5    7e-05   
sp|Q8W1E0.1|R1A_SOLDE  RecName: Full=Late blight resistance prote...  53.5    7e-05   Solanum demissum
gb|AEW70444.1|  disease resistance protein R1                         53.1    8e-05   
gb|AEW70440.1|  disease resistance protein R1                         53.1    8e-05   
gb|ABI96211.1|  NBS-LRR resistance protein-like protein               53.5    8e-05   Solanum sp. VFNT
ref|XP_009608832.1|  PREDICTED: late blight resistance protein R1...  53.5    8e-05   
ref|XP_004240499.1|  PREDICTED: putative late blight resistance p...  53.5    8e-05   
ref|XP_011072191.1|  PREDICTED: putative late blight resistance p...  53.5    8e-05   
ref|XP_009622529.1|  PREDICTED: putative late blight resistance p...  53.1    9e-05   
emb|CDP05514.1|  unnamed protein product                              53.1    9e-05   
ref|XP_009763421.1|  PREDICTED: putative late blight resistance p...  53.5    9e-05   
gb|AAX73296.1|  late blight resistance protein                        52.8    9e-05   Solanum tuberosum [potatoes]
ref|XP_010320780.1|  PREDICTED: putative late blight resistance p...  53.1    9e-05   
ref|XP_004238960.1|  PREDICTED: putative late blight resistance p...  53.1    9e-05   
emb|CDP12547.1|  unnamed protein product                              53.1    9e-05   
ref|XP_009799903.1|  PREDICTED: putative late blight resistance p...  53.1    9e-05   
ref|XP_009763450.1|  PREDICTED: putative late blight resistance p...  53.1    1e-04   
ref|XP_009763443.1|  PREDICTED: putative late blight resistance p...  53.1    1e-04   
gb|AAT66777.2|  Late blight resistance protein, putative              53.1    1e-04   Solanum demissum
ref|XP_009763456.1|  PREDICTED: putative late blight resistance p...  53.1    1e-04   
gb|AAT39283.2|  Late blight resistance protein, putative              52.8    1e-04   Solanum demissum
ref|XP_011077106.1|  PREDICTED: putative late blight resistance p...  53.1    1e-04   
gb|AAT39961.1|  Putative late blight resistance protein, identical    53.1    1e-04   Solanum demissum
ref|XP_009788590.1|  PREDICTED: putative late blight resistance p...  53.1    1e-04   
gb|AAT38775.2|  NB-ARC domain containing protein                      52.8    1e-04   Solanum demissum
ref|XP_009788587.1|  PREDICTED: putative late blight resistance p...  53.1    1e-04   
ref|XP_011087330.1|  PREDICTED: putative late blight resistance p...  53.1    1e-04   
emb|CDP15268.1|  unnamed protein product                              53.1    1e-04   
ref|XP_011093989.1|  PREDICTED: putative late blight resistance p...  52.8    1e-04   
gb|ABI96212.1|  NBS-LRR resistance protein-like protein               53.1    1e-04   Solanum sp. VFNT
emb|CDP05558.1|  unnamed protein product                              53.1    1e-04   
emb|CDP16115.1|  unnamed protein product                              52.8    1e-04   
gb|EYU21831.1|  hypothetical protein MIMGU_mgv1a0261622mg             52.8    1e-04   
gb|ABO92983.1|  putative disease resistance protein                   52.8    1e-04   Solanum tuberosum [potatoes]
emb|CDP12770.1|  unnamed protein product                              52.8    1e-04   
sp|Q6L440.2|R1A3_SOLDE  RecName: Full=Putative late blight resist...  52.8    1e-04   Solanum demissum
gb|AAZ95005.1|  late blight resistance protein Rpi-blb2               52.8    1e-04   Solanum bulbocastanum [ornamental nightshade]
ref|XP_011087334.1|  PREDICTED: putative late blight resistance p...  52.8    2e-04   
ref|XP_009799971.1|  PREDICTED: LOW QUALITY PROTEIN: putative lat...  52.8    2e-04   
ref|XP_011072192.1|  PREDICTED: putative late blight resistance p...  52.8    2e-04   
ref|XP_009614428.1|  PREDICTED: putative late blight resistance p...  52.8    2e-04   
gb|EYU31596.1|  hypothetical protein MIMGU_mgv1a025161mg              52.4    2e-04   
ref|XP_009628574.1|  PREDICTED: putative late blight resistance p...  52.4    2e-04   
ref|XP_011087136.1|  PREDICTED: putative late blight resistance p...  52.4    2e-04   
ref|XP_009628577.1|  PREDICTED: putative late blight resistance p...  52.4    2e-04   
ref|XP_004239390.2|  PREDICTED: putative late blight resistance p...  52.4    2e-04   
sp|Q6L3N7.1|R1C3_SOLDE  RecName: Full=Putative late blight resist...  52.4    2e-04   Solanum demissum
gb|EYU40389.1|  hypothetical protein MIMGU_mgv1a001268mg              52.4    2e-04   
ref|XP_004233876.2|  PREDICTED: putative late blight resistance p...  52.4    2e-04   
ref|XP_011077138.1|  PREDICTED: putative late blight resistance p...  52.4    2e-04   
emb|CDP19728.1|  unnamed protein product                              52.4    2e-04   
gb|ABE68835.1|  root-knot nematode resistance protein                 52.4    2e-04   Capsicum annuum
ref|XP_009777477.1|  PREDICTED: putative late blight resistance p...  52.4    2e-04   
ref|XP_009622842.1|  PREDICTED: putative late blight resistance p...  52.4    2e-04   
gb|EYU24542.1|  hypothetical protein MIMGU_mgv1a020452mg              52.4    2e-04   
ref|XP_009777479.1|  PREDICTED: putative late blight resistance p...  52.4    2e-04   
emb|CDP19132.1|  unnamed protein product                              52.4    2e-04   
sp|Q6L3L0.1|R1B23_SOLDE  RecName: Full=Putative late blight resis...  52.4    2e-04   Solanum demissum
gb|EYU21791.1|  hypothetical protein MIMGU_mgv1a001064mg              52.0    2e-04   
gb|ABO93013.1|  putative disease resistance protein                   52.0    2e-04   Solanum tuberosum [potatoes]
emb|CDP17920.1|  unnamed protein product                              52.0    2e-04   
sp|Q6L3X3.1|R1B8_SOLDE  RecName: Full=Putative late blight resist...  52.0    2e-04   Solanum demissum
ref|XP_009783244.1|  PREDICTED: late blight resistance protein R1...  52.0    2e-04   
gb|EYU19026.1|  hypothetical protein MIMGU_mgv1a020094mg              52.0    2e-04   
ref|XP_006361239.1|  PREDICTED: putative late blight resistance p...  52.0    3e-04   
ref|XP_009783246.1|  PREDICTED: late blight resistance protein R1...  52.0    3e-04   
ref|XP_009785700.1|  PREDICTED: putative late blight resistance p...  51.6    3e-04   
ref|XP_010321921.1|  PREDICTED: putative late blight resistance p...  52.0    3e-04   
ref|XP_009762701.1|  PREDICTED: putative late blight resistance p...  52.0    3e-04   
ref|XP_004238957.1|  PREDICTED: putative late blight resistance p...  51.6    3e-04   
ref|XP_004248476.2|  PREDICTED: putative late blight resistance p...  51.6    3e-04   
ref|XP_009608261.1|  PREDICTED: putative late blight resistance p...  52.0    3e-04   
ref|XP_010327076.1|  PREDICTED: putative late blight resistance p...  51.6    3e-04   
ref|XP_006361240.1|  PREDICTED: putative late blight resistance p...  51.6    3e-04   
ref|XP_011101277.1|  PREDICTED: putative late blight resistance p...  51.6    3e-04   
emb|CDP20176.1|  unnamed protein product                              51.6    3e-04   
ref|XP_006362840.1|  PREDICTED: putative late blight resistance p...  51.6    3e-04   
gb|EYU31597.1|  hypothetical protein MIMGU_mgv1a001843mg              51.6    3e-04   
ref|XP_010327078.1|  PREDICTED: putative late blight resistance p...  51.6    3e-04   
gb|AAT39281.2|  Integrase core domain containing protein              51.6    3e-04   Solanum demissum
gb|AAT38780.1|  Putative late blight resistance protein, identical    51.6    3e-04   Solanum demissum
ref|XP_011072136.1|  PREDICTED: putative late blight resistance p...  51.6    4e-04   
sp|Q6L3Y2.1|R1B11_SOLDE  RecName: Full=Putative late blight resis...  51.6    4e-04   Solanum demissum
gb|AAC97933.1|  disease resistance protein                            51.6    4e-04   Solanum lycopersicum
ref|XP_006366307.1|  PREDICTED: putative late blight resistance p...  51.6    4e-04   
gb|AAC32252.1|  disease resistance gene homolog Mi-copy2              51.6    4e-04   Solanum lycopersicum
ref|XP_009611917.1|  PREDICTED: putative late blight resistance p...  51.6    4e-04   
ref|XP_009603186.1|  PREDICTED: putative late blight resistance p...  50.1    4e-04   
emb|CDP13440.1|  unnamed protein product                              51.2    4e-04   
ref|XP_009762697.1|  PREDICTED: putative late blight resistance p...  51.2    4e-04   
ref|XP_009761168.1|  PREDICTED: uncharacterized protein LOC104213363  50.4    4e-04   
gb|AAT66772.2|  NB-ARC domain containing protein                      51.6    4e-04   Solanum demissum
ref|XP_009764018.1|  PREDICTED: putative late blight resistance p...  51.2    4e-04   
ref|XP_011072146.1|  PREDICTED: putative late blight resistance p...  51.2    4e-04   
ref|XP_009762700.1|  PREDICTED: putative late blight resistance p...  51.2    4e-04   
ref|XP_009611920.1|  PREDICTED: putative late blight resistance p...  51.6    4e-04   
ref|XP_009604792.1|  PREDICTED: putative late blight resistance p...  51.2    4e-04   
ref|XP_011072139.1|  PREDICTED: putative late blight resistance p...  51.2    4e-04   
ref|XP_009604795.1|  PREDICTED: putative late blight resistance p...  51.2    4e-04   
ref|XP_009777083.1|  PREDICTED: putative late blight resistance p...  51.2    5e-04   
gb|EYU21830.1|  hypothetical protein MIMGU_mgv1a001060mg              51.2    5e-04   
ref|XP_009764014.1|  PREDICTED: putative late blight resistance p...  50.8    5e-04   
ref|XP_009764013.1|  PREDICTED: putative late blight resistance p...  50.8    5e-04   
emb|CDP18675.1|  unnamed protein product                              51.2    5e-04   
ref|XP_009777084.1|  PREDICTED: putative late blight resistance p...  50.8    5e-04   
ref|XP_011072133.1|  PREDICTED: putative late blight resistance p...  50.8    5e-04   
gb|ABO93012.1|  putative disease resistance protein                   51.2    5e-04   Solanum tuberosum [potatoes]
ref|XP_006363255.1|  PREDICTED: putative late blight resistance p...  50.8    5e-04   
gb|ABI34369.1|  Late blight resistance protein, putative              50.1    6e-04   Solanum demissum
ref|XP_009603168.1|  PREDICTED: putative late blight resistance p...  50.8    6e-04   
ref|XP_004252037.1|  PREDICTED: putative late blight resistance p...  50.8    6e-04   
ref|XP_009758245.1|  PREDICTED: putative late blight resistance p...  50.8    6e-04   
ref|XP_010320570.1|  PREDICTED: LOW QUALITY PROTEIN: putative lat...  50.8    6e-04   
ref|XP_009758244.1|  PREDICTED: putative late blight resistance p...  50.8    6e-04   
ref|XP_009603185.1|  PREDICTED: putative late blight resistance p...  49.7    6e-04   
ref|XP_009588746.1|  PREDICTED: putative late blight resistance p...  50.8    7e-04   
ref|XP_006362985.1|  PREDICTED: putative late blight resistance p...  50.4    7e-04   
ref|XP_009599921.1|  PREDICTED: putative late blight resistance p...  50.8    7e-04   
ref|XP_006360433.1|  PREDICTED: putative late blight resistance p...  50.1    7e-04   
gb|EYU17661.1|  hypothetical protein MIMGU_mgv1a025742mg              50.4    7e-04   
gb|EYU21848.1|  hypothetical protein MIMGU_mgv1a023991mg              50.4    7e-04   
ref|XP_009588743.1|  PREDICTED: putative late blight resistance p...  50.8    7e-04   
emb|CDP17943.1|  unnamed protein product                              50.4    7e-04   
ref|XP_009596161.1|  PREDICTED: LOW QUALITY PROTEIN: putative lat...  50.4    7e-04   
ref|XP_009763120.1|  PREDICTED: putative late blight resistance p...  50.4    7e-04   
gb|EPS69440.1|  hypothetical protein M569_05326                       50.1    8e-04   
ref|XP_009763119.1|  PREDICTED: putative late blight resistance p...  50.4    8e-04   
ref|XP_009763464.1|  PREDICTED: putative late blight resistance p...  50.4    8e-04   
ref|XP_011070551.1|  PREDICTED: putative late blight resistance p...  50.4    8e-04   
ref|XP_009599922.1|  PREDICTED: putative late blight resistance p...  50.4    8e-04   
ref|XP_009765695.1|  PREDICTED: putative late blight resistance p...  50.4    8e-04   
ref|XP_006348578.1|  PREDICTED: putative late blight resistance p...  50.4    9e-04   
ref|NP_001234063.1|  root-knot nematode resistance protein            50.4    9e-04   
ref|XP_004237148.1|  PREDICTED: putative late blight resistance p...  50.4    0.001   
ref|XP_009765696.1|  PREDICTED: putative late blight resistance p...  50.4    0.001   
ref|XP_011072163.1|  PREDICTED: putative late blight resistance p...  50.1    0.001   
ref|XP_009758242.1|  PREDICTED: putative late blight resistance p...  50.1    0.001   



>ref|XP_011091064.1| PREDICTED: putative late blight resistance protein homolog R1B-16 
[Sesamum indicum]
Length=856

 Score = 72.0 bits (175),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 38/80 (48%), Positives = 49/80 (61%), Gaps = 0/80 (0%)
 Frame = -2

Query  747  LLLEDKTLEQWMVDDESFPNLEHLVLRFCYCLEEIPKAIEYISRLRSIELQWCTPSVCYS  568
            LLLE   L +W  D   FP L HLV+R C  LEEIP+AI  I  L  IEL  C+PSV  S
Sbjct  776  LLLEKLKLVRWKADKTHFPRLRHLVIRECSALEEIPRAIGDIPTLEIIELDECSPSVVAS  835

Query  567  TKRIQDFRHEMADDLFELKI  508
             ++IQ+ + E  +D  E++I
Sbjct  836  ARQIQEDQSENGNDGLEVRI  855



>gb|AAV88068.1| NBS-LRR protein [Ipomoea batatas]
Length=849

 Score = 71.6 bits (174),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 38/77 (49%), Positives = 48/77 (62%), Gaps = 2/77 (3%)
 Frame = -2

Query  717  WMVDDESFPNLEHLVLRFCYCLEEIPKAIEYISRLRSIELQWCTPSVCYSTKRIQDFRHE  538
            WM++  SF  LE LVLRFC CLE+IP+ + YI  L+SIEL+ C P V  S   IQ+ RH 
Sbjct  775  WMINKYSFQCLERLVLRFCCCLEKIPRNMNYIITLKSIELEECGPFVAVSALLIQELRHS  834

Query  537  MADDLFELKIIGEESIP  487
             +D  FE  +I    IP
Sbjct  835  FSDINFE--VISYNMIP  849



>ref|XP_011101340.1| PREDICTED: putative late blight resistance protein homolog R1A-4 
[Sesamum indicum]
Length=908

 Score = 69.7 bits (169),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 38/91 (42%), Positives = 54/91 (59%), Gaps = 4/91 (4%)
 Frame = -2

Query  747  LLLEDKTLEQWMVDDESFPNLEHLVLRFCYCLEEIPKAIEYISRLRSIELQWCTPSVCYS  568
            LL+ED  LE W VD ESFP+LE L+L+ CY L+E+P  I  +  L  +EL  C PS+  S
Sbjct  817  LLIEDTDLEYWYVDYESFPSLERLILQHCYKLKEMPSEIGELPNLEKMELVDCHPSLVAS  876

Query  567  TKRIQDFRHEMADDLFELKIIGEESIPADDE  475
             KRI + +    +D+ ++ I       ADD+
Sbjct  877  AKRIAEEQQSAGNDVLQVSIKSS----ADDQ  903



>gb|AAT40487.1| putative disease resistance protein [Solanum demissum]
Length=2607

 Score = 68.9 bits (167),  Expect = 7e-10, Method: Compositional matrix adjust.
 Identities = 36/81 (44%), Positives = 51/81 (63%), Gaps = 1/81 (1%)
 Frame = -2

Query  747   LLLEDKTLEQWMVDDESFPNLEHLVLRFCYCLEEIPKAIEYISRLRSIELQWCTPSVCYS  568
             L L+     QW + ++SFP+LE LVL  C  LE+IP  +E +  L+SIE+ WC+ SV  S
Sbjct  2433  LKLDSLNFAQWSISEDSFPSLERLVLTNCKRLEKIPSHLEDVVSLKSIEVNWCSWSVANS  2492

Query  567   TKRIQDFRHE-MADDLFELKI  508
              + IQ  +HE MA+D F + I
Sbjct  2493  AEEIQTTQHEDMANDAFTVTI  2513



>ref|XP_004248174.1| PREDICTED: putative late blight resistance protein homolog R1B-12 
[Solanum lycopersicum]
Length=889

 Score = 68.2 bits (165),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 36/80 (45%), Positives = 47/80 (59%), Gaps = 0/80 (0%)
 Frame = -2

Query  747  LLLEDKTLEQWMVDDESFPNLEHLVLRFCYCLEEIPKAIEYISRLRSIELQWCTPSVCYS  568
            LLL+   L  W+VD   FP LE LVL+ CYCL EIP  +  I  L+ IEL  C+ S   S
Sbjct  802  LLLDGTDLIHWIVDSIQFPKLESLVLKNCYCLSEIPDDVAEIPTLQFIELYHCSSSADVS  861

Query  567  TKRIQDFRHEMADDLFELKI  508
              RIQ+ +H M +D   ++I
Sbjct  862  ANRIQEEQHSMGNDDLVVRI  881



>ref|XP_011091063.1| PREDICTED: putative late blight resistance protein homolog R1B-16 
[Sesamum indicum]
Length=730

 Score = 67.4 bits (163),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 37/81 (46%), Positives = 47/81 (58%), Gaps = 1/81 (1%)
 Frame = -2

Query  747  LLLED-KTLEQWMVDDESFPNLEHLVLRFCYCLEEIPKAIEYISRLRSIELQWCTPSVCY  571
            LLLE  K L  W  D+   P L HL++R C  LEEIP  I  I  L  IEL  C+PSV  
Sbjct  649  LLLEKLKNLVHWQADETHLPRLRHLLIRGCSALEEIPSGIGEIPTLEIIELDECSPSVVA  708

Query  570  STKRIQDFRHEMADDLFELKI  508
            S K+IQ+ + E  +D  E++I
Sbjct  709  SAKQIQEDQREYGNDGLEVRI  729



>ref|XP_009788847.1| PREDICTED: putative late blight resistance protein homolog R1B-16 
[Nicotiana sylvestris]
Length=900

 Score = 67.0 bits (162),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 35/81 (43%), Positives = 53/81 (65%), Gaps = 1/81 (1%)
 Frame = -2

Query  747  LLLEDKTLEQWMVDDESFPNLEHLVLRFCYCLEEIPKAIEYISRLRSIELQWCTPSVCYS  568
            L L+D  + QW V D++FP+LE LVL+ C  L+EIP    Y   ++SIE+ WC+ SV  S
Sbjct  820  LKLDDVVISQWDVSDDAFPSLEKLVLQRCKKLKEIPSCFGYNCSIQSIEVSWCSLSVTES  879

Query  567  TKRIQDFR-HEMADDLFELKI  508
             K+IQD + ++M +  F++ I
Sbjct  880  AKQIQDTQVNDMGNGGFKIFI  900



>ref|XP_006356446.1| PREDICTED: putative late blight resistance protein homolog R1B-14-like 
[Solanum tuberosum]
Length=1645

 Score = 67.0 bits (162),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 34/79 (43%), Positives = 50/79 (63%), Gaps = 1/79 (1%)
 Frame = -2

Query  741   LEDKTLEQWMVDDESFPNLEHLVLRFCYCLEEIPKAIEYISRLRSIELQWCTPSVCYSTK  562
             LE+  + QW V +++FP LE LVL  C  L++IP   +    L+SIE+ WC+  V  S K
Sbjct  1556  LENLNIAQWSVSEDAFPILERLVLTKCKRLKKIPSHFDDAVSLKSIEVNWCSLGVANSAK  1615

Query  561   RIQDFRH-EMADDLFELKI  508
              IQ F+H E+A+D F++ I
Sbjct  1616  EIQAFQHDEIANDAFKVTI  1634



>ref|XP_009766276.1| PREDICTED: putative late blight resistance protein homolog R1A-4 
isoform X1 [Nicotiana sylvestris]
Length=1810

 Score = 67.0 bits (162),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 35/81 (43%), Positives = 53/81 (65%), Gaps = 1/81 (1%)
 Frame = -2

Query  747   LLLEDKTLEQWMVDDESFPNLEHLVLRFCYCLEEIPKAIEYISRLRSIELQWCTPSVCYS  568
             L L+D  + QW V D++FP+LE LVL+ C  L+EIP    Y   ++SIE+ WC+ SV  S
Sbjct  1730  LKLDDVVISQWDVSDDAFPSLEKLVLQRCKKLKEIPSCFGYNCSIQSIEVSWCSLSVTES  1789

Query  567   TKRIQDFR-HEMADDLFELKI  508
              K+IQD + ++M +  F++ I
Sbjct  1790  AKQIQDTQVNDMGNGGFKIFI  1810



>gb|AAV88066.1| NBS-LRR protein [Ipomoea batatas]
Length=846

 Score = 66.2 bits (160),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 37/68 (54%), Positives = 44/68 (65%), Gaps = 0/68 (0%)
 Frame = -2

Query  747  LLLEDKTLEQWMVDDESFPNLEHLVLRFCYCLEEIPKAIEYISRLRSIELQWCTPSVCYS  568
            LLL+   LEQW V + SF  L+HLVLRFCY L+ IPK +     L SIELQ C  S+  S
Sbjct  717  LLLDGIKLEQWRVGEYSFEYLKHLVLRFCYRLKNIPKVMVDTFTLESIELQSCCHSLITS  776

Query  567  TKRIQDFR  544
             KRIQ+ R
Sbjct  777  AKRIQEHR  784



>gb|AAT39932.2| NB-ARC domain containing protein [Solanum demissum]
 gb|AAT39950.2| NB-ARC domain containing protein [Solanum demissum]
Length=884

 Score = 66.2 bits (160),  Expect = 4e-09, Method: Composition-based stats.
 Identities = 35/81 (43%), Positives = 49/81 (60%), Gaps = 1/81 (1%)
 Frame = -2

Query  747  LLLEDKTLEQWMVDDESFPNLEHLVLRFCYCLEEIPKAIEYISRLRSIELQWCTPSVCYS  568
            L L+     QW + ++SFP+LE LVL  C  LE+IP   E +  L+SIE+ WC+ SV  S
Sbjct  793  LKLDSFNFAQWSISEDSFPSLERLVLTNCKRLEKIPSHFEDVVSLKSIEVNWCSWSVANS  852

Query  567  TKRIQDF-RHEMADDLFELKI  508
             + IQ   R +MA+D F + I
Sbjct  853  AEEIQTTQREDMANDAFTVTI  873



>ref|XP_011071973.1| PREDICTED: putative late blight resistance protein homolog R1A-10 
[Sesamum indicum]
Length=872

 Score = 65.9 bits (159),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 31/78 (40%), Positives = 50/78 (64%), Gaps = 0/78 (0%)
 Frame = -2

Query  747  LLLEDKTLEQWMVDDESFPNLEHLVLRFCYCLEEIPKAIEYISRLRSIELQWCTPSVCYS  568
            LLLED  +  W  + +    LE LV+R CY L+EIP  I+YI+ L+ +E+  C+PSV  S
Sbjct  782  LLLEDMDIANWRANGQILHRLERLVVRHCYNLQEIPYGIDYITTLQLVEVVDCSPSVVDS  841

Query  567  TKRIQDFRHEMADDLFEL  514
              RI++ + ++++D F+ 
Sbjct  842  AMRIKEMQEDLSNDDFKF  859



>gb|EYU17765.1| hypothetical protein MIMGU_mgv1a022339mg [Erythranthe guttata]
Length=839

 Score = 65.5 bits (158),  Expect = 7e-09, Method: Compositional matrix adjust.
 Identities = 32/80 (40%), Positives = 48/80 (60%), Gaps = 0/80 (0%)
 Frame = -2

Query  747  LLLEDKTLEQWMVDDESFPNLEHLVLRFCYCLEEIPKAIEYISRLRSIELQWCTPSVCYS  568
            LL+ED  +++W   +E FP LE L++R CY LE+IP  I  I  L  I++  C P+V  S
Sbjct  748  LLMEDLDIQKWEAGNEHFPMLERLIIRHCYKLEKIPPEIGDIPLLEMIQVDDCNPAVVTS  807

Query  567  TKRIQDFRHEMADDLFELKI  508
             + IQD +    +D F ++I
Sbjct  808  ARGIQDKKASWGNDKFRIQI  827



>ref|XP_009763530.1| PREDICTED: putative late blight resistance protein homolog R1B-12 
isoform X1 [Nicotiana sylvestris]
 ref|XP_009763531.1| PREDICTED: putative late blight resistance protein homolog R1B-12 
isoform X1 [Nicotiana sylvestris]
Length=1734

 Score = 65.5 bits (158),  Expect = 8e-09, Method: Compositional matrix adjust.
 Identities = 33/79 (42%), Positives = 48/79 (61%), Gaps = 1/79 (1%)
 Frame = -2

Query  741   LEDKTLEQWMVDDESFPNLEHLVLRFCYCLEEIPKAIEYISRLRSIELQWCTPSVCYSTK  562
             L+D  + QW V +++FP LEH VL+ C  L+EIP   +Y   LR IE+ WC+ SV  S  
Sbjct  1645  LDDLNITQWSVSEDAFPMLEHFVLKKCKQLKEIPSQFDYAISLRRIEVNWCSWSVANSAM  1704

Query  561   RIQDFRHE-MADDLFELKI  508
              IQ  + E +++D F + I
Sbjct  1705  EIQRTQQEDLSNDAFTVTI  1723



>ref|XP_009800104.1| PREDICTED: putative late blight resistance protein homolog R1B-16 
isoform X1 [Nicotiana sylvestris]
 ref|XP_009800105.1| PREDICTED: putative late blight resistance protein homolog R1B-16 
isoform X1 [Nicotiana sylvestris]
 ref|XP_009800106.1| PREDICTED: putative late blight resistance protein homolog R1B-16 
isoform X2 [Nicotiana sylvestris]
Length=1741

 Score = 65.1 bits (157),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 35/79 (44%), Positives = 48/79 (61%), Gaps = 1/79 (1%)
 Frame = -2

Query  741   LEDKTLEQWMVDDESFPNLEHLVLRFCYCLEEIPKAIEYISRLRSIELQWCTPSVCYSTK  562
             L+D  + QW V D++FP L+ LVL  C  LE+IP   +    LRSIE+ WC  SV  S +
Sbjct  1648  LDDINIAQWSVSDDAFPKLKCLVLTKCKRLEKIPSHFDDSVSLRSIEVNWCNLSVAESAQ  1707

Query  561   RIQDFRH-EMADDLFELKI  508
              IQ  +H EMA+  F ++I
Sbjct  1708  EIQTTQHEEMANGAFTVRI  1726



>gb|EYU30149.1| hypothetical protein MIMGU_mgv1a018270mg, partial [Erythranthe 
guttata]
Length=727

 Score = 64.7 bits (156),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 32/73 (44%), Positives = 43/73 (59%), Gaps = 0/73 (0%)
 Frame = -2

Query  726  LEQWMVDDESFPNLEHLVLRFCYCLEEIPKAIEYISRLRSIELQWCTPSVCYSTKRIQDF  547
            +E W    + FP L+HLVLR C CLEEIP  +  I  L+ IE+  C  SV  S KRIQ+ 
Sbjct  630  IEIWEATSDHFPRLQHLVLRLCGCLEEIPFGVGGIPTLQMIEIYSCAHSVVSSAKRIQEE  689

Query  546  RHEMADDLFELKI  508
            +    +D  E++I
Sbjct  690  QQSYGNDDLEVRI  702



>gb|AAT39951.2| Disease resistance protein, putative [Solanum demissum]
Length=2544

 Score = 65.1 bits (157),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 35/81 (43%), Positives = 48/81 (59%), Gaps = 1/81 (1%)
 Frame = -2

Query  747   LLLEDKTLEQWMVDDESFPNLEHLVLRFCYCLEEIPKAIEYISRLRSIELQWCTPSVCYS  568
             L L+     QW + ++SFP+LE LVL  C  LE+IP   E +  L+SIE+ WC+ SV  S
Sbjct  2453  LKLDSLNFAQWSISEDSFPSLERLVLTNCKRLEKIPSHFEDVVSLKSIEVNWCSWSVANS  2512

Query  567   TKRIQDF-RHEMADDLFELKI  508
                IQ   R +MA+D F + I
Sbjct  2513  AGEIQTTQREDMANDAFTVTI  2533



>ref|XP_009617045.1| PREDICTED: putative late blight resistance protein homolog R1A-3 
isoform X1 [Nicotiana tomentosiformis]
Length=898

 Score = 63.9 bits (154),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 35/80 (44%), Positives = 47/80 (59%), Gaps = 0/80 (0%)
 Frame = -2

Query  747  LLLEDKTLEQWMVDDESFPNLEHLVLRFCYCLEEIPKAIEYISRLRSIELQWCTPSVCYS  568
            LL++   L+ W     +FP L+ LVL+ C  LEEIPK I  I  L SIEL  C  SV  S
Sbjct  799  LLIDRTNLKHWDAGSVNFPKLKRLVLKRCLYLEEIPKDIGEICTLESIELHNCRSSVAKS  858

Query  567  TKRIQDFRHEMADDLFELKI  508
             K IQ+ +  MA+D+  ++I
Sbjct  859  VKEIQEEQESMANDILSVRI  878



>ref|XP_009617046.1| PREDICTED: putative late blight resistance protein homolog R1A-3 
isoform X2 [Nicotiana tomentosiformis]
Length=885

 Score = 63.9 bits (154),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 35/80 (44%), Positives = 47/80 (59%), Gaps = 0/80 (0%)
 Frame = -2

Query  747  LLLEDKTLEQWMVDDESFPNLEHLVLRFCYCLEEIPKAIEYISRLRSIELQWCTPSVCYS  568
            LL++   L+ W     +FP L+ LVL+ C  LEEIPK I  I  L SIEL  C  SV  S
Sbjct  799  LLIDRTNLKHWDAGSVNFPKLKRLVLKRCLYLEEIPKDIGEICTLESIELHNCRSSVAKS  858

Query  567  TKRIQDFRHEMADDLFELKI  508
             K IQ+ +  MA+D+  ++I
Sbjct  859  VKEIQEEQESMANDILSVRI  878



>ref|XP_009617047.1| PREDICTED: putative late blight resistance protein homolog R1A-3 
isoform X3 [Nicotiana tomentosiformis]
Length=882

 Score = 63.9 bits (154),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 35/80 (44%), Positives = 47/80 (59%), Gaps = 0/80 (0%)
 Frame = -2

Query  747  LLLEDKTLEQWMVDDESFPNLEHLVLRFCYCLEEIPKAIEYISRLRSIELQWCTPSVCYS  568
            LL++   L+ W     +FP L+ LVL+ C  LEEIPK I  I  L SIEL  C  SV  S
Sbjct  783  LLIDRTNLKHWDAGSVNFPKLKRLVLKRCLYLEEIPKDIGEICTLESIELHNCRSSVAKS  842

Query  567  TKRIQDFRHEMADDLFELKI  508
             K IQ+ +  MA+D+  ++I
Sbjct  843  VKEIQEEQESMANDILSVRI  862



>ref|XP_009758685.1| PREDICTED: late blight resistance protein R1-A-like [Nicotiana 
sylvestris]
Length=1249

 Score = 63.9 bits (154),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 31/58 (53%), Positives = 39/58 (67%), Gaps = 0/58 (0%)
 Frame = -2

Query  729   TLEQWMVDDESFPNLEHLVLRFCYCLEEIPKAIEYISRLRSIELQWCTPSVCYSTKRI  556
             +L +W V D++FPNLEHLVLR CY LEEIP     IS L+SI ++ C  SV  S + I
Sbjct  1171  SLREWTVHDDAFPNLEHLVLRHCYSLEEIPSCFRDISSLKSIVVRICNDSVDKSARDI  1228



>ref|XP_009587753.1| PREDICTED: putative late blight resistance protein homolog R1A-4 
isoform X1 [Nicotiana tomentosiformis]
 ref|XP_009587821.1| PREDICTED: putative late blight resistance protein homolog R1A-4 
isoform X1 [Nicotiana tomentosiformis]
 ref|XP_009587887.1| PREDICTED: putative late blight resistance protein homolog R1A-4 
isoform X1 [Nicotiana tomentosiformis]
 ref|XP_009587951.1| PREDICTED: putative late blight resistance protein homolog R1A-4 
isoform X1 [Nicotiana tomentosiformis]
 ref|XP_009588013.1| PREDICTED: putative late blight resistance protein homolog R1A-4 
isoform X1 [Nicotiana tomentosiformis]
 ref|XP_009588066.1| PREDICTED: putative late blight resistance protein homolog R1A-4 
isoform X1 [Nicotiana tomentosiformis]
Length=1260

 Score = 63.9 bits (154),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 31/58 (53%), Positives = 39/58 (67%), Gaps = 0/58 (0%)
 Frame = -2

Query  729   TLEQWMVDDESFPNLEHLVLRFCYCLEEIPKAIEYISRLRSIELQWCTPSVCYSTKRI  556
             +L +W V D++FPNLEHLVLR CY LEEIP     IS L+SI ++ C  SV  S + I
Sbjct  1172  SLREWTVPDDAFPNLEHLVLRHCYSLEEIPSCFRDISSLKSIVVRICNDSVDKSARDI  1229



>ref|XP_009588135.1| PREDICTED: putative late blight resistance protein homolog R1B-23 
isoform X2 [Nicotiana tomentosiformis]
 ref|XP_009588199.1| PREDICTED: putative late blight resistance protein homolog R1B-23 
isoform X2 [Nicotiana tomentosiformis]
Length=1201

 Score = 63.9 bits (154),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 31/58 (53%), Positives = 39/58 (67%), Gaps = 0/58 (0%)
 Frame = -2

Query  729   TLEQWMVDDESFPNLEHLVLRFCYCLEEIPKAIEYISRLRSIELQWCTPSVCYSTKRI  556
             +L +W V D++FPNLEHLVLR CY LEEIP     IS L+SI ++ C  SV  S + I
Sbjct  1113  SLREWTVPDDAFPNLEHLVLRHCYSLEEIPSCFRDISSLKSIVVRICNDSVDKSARDI  1170



>gb|AAT40519.2| hypothetical protein SDM1_22t00007 [Solanum demissum]
Length=937

 Score = 63.9 bits (154),  Expect = 3e-08, Method: Composition-based stats.
 Identities = 33/79 (42%), Positives = 47/79 (59%), Gaps = 1/79 (1%)
 Frame = -2

Query  741  LEDKTLEQWMVDDESFPNLEHLVLRFCYCLEEIPKAIEYISRLRSIELQWCTPSVCYSTK  562
            L+     QW + ++SFP+LE LVL  C   E+IP   E +  L+SIE+ WC+ SV  S +
Sbjct  848  LDSLNFAQWSISEDSFPSLERLVLTNCKRHEKIPSYFEDVVSLKSIEVNWCSWSVANSAE  907

Query  561  RIQDFRHE-MADDLFELKI  508
             IQ  + E MA+D F + I
Sbjct  908  EIQTTQRENMANDAFTVTI  926



>ref|XP_009799885.1| PREDICTED: LOW QUALITY PROTEIN: putative late blight resistance 
protein homolog R1B-16 [Nicotiana sylvestris]
Length=1826

 Score = 63.9 bits (154),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 35/81 (43%), Positives = 48/81 (59%), Gaps = 1/81 (1%)
 Frame = -2

Query  747   LLLEDKTLEQWMVDDESFPNLEHLVLRFCYCLEEIPKAIEYISRLRSIELQWCTPSVCYS  568
             L L++  + QW V  ++FP LEHLVL  C  LE+IP   +    L+SIE+ WC  SV  S
Sbjct  1735  LKLDNLKVAQWSVSYDAFPKLEHLVLTKCKHLEKIPSHFDDAVSLKSIEVNWCNWSVANS  1794

Query  567   TKRIQDF-RHEMADDLFELKI  508
              + IQ   R +MA+D F + I
Sbjct  1795  AQEIQTTQREDMANDSFTVTI  1815



>ref|XP_011088087.1| PREDICTED: putative late blight resistance protein homolog R1B-16 
[Sesamum indicum]
Length=853

 Score = 63.5 bits (153),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 32/68 (47%), Positives = 43/68 (63%), Gaps = 0/68 (0%)
 Frame = -2

Query  726  LEQWMVDDESFPNLEHLVLRFCYCLEEIPKAIEYISRLRSIELQWCTPSVCYSTKRIQDF  547
            L  W+VDD +FP L+HLV+R C  LEEIP AI  I  L+ IE+   +PSV  S + IQ  
Sbjct  776  LVNWVVDDTNFPRLDHLVIRGCRHLEEIPLAIGDIPTLKVIEVDNSSPSVLASAREIQQA  835

Query  546  RHEMADDL  523
            + +  +DL
Sbjct  836  QLDSGNDL  843



>ref|XP_009790395.1| PREDICTED: putative late blight resistance protein homolog R1A-4 
isoform X1 [Nicotiana sylvestris]
 ref|XP_009790397.1| PREDICTED: putative late blight resistance protein homolog R1A-4 
isoform X2 [Nicotiana sylvestris]
 ref|XP_009790399.1| PREDICTED: putative late blight resistance protein homolog R1A-4 
isoform X1 [Nicotiana sylvestris]
 ref|XP_009790400.1| PREDICTED: putative late blight resistance protein homolog R1A-4 
isoform X1 [Nicotiana sylvestris]
 ref|XP_009790401.1| PREDICTED: putative late blight resistance protein homolog R1A-4 
isoform X1 [Nicotiana sylvestris]
 ref|XP_009790402.1| PREDICTED: putative late blight resistance protein homolog R1A-4 
isoform X1 [Nicotiana sylvestris]
Length=1807

 Score = 63.5 bits (153),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 35/81 (43%), Positives = 48/81 (59%), Gaps = 1/81 (1%)
 Frame = -2

Query  747   LLLEDKTLEQWMVDDESFPNLEHLVLRFCYCLEEIPKAIEYISRLRSIELQWCTPSVCYS  568
             L L++  + QW V  ++FP LEHLVL  C  LE+IP   +    L+SIE+ WC  SV  S
Sbjct  1716  LKLDNLKVAQWSVSYDAFPKLEHLVLTKCKHLEKIPSHFDDAVSLKSIEVNWCNWSVANS  1775

Query  567   TKRIQDF-RHEMADDLFELKI  508
              + IQ   R +MA+D F + I
Sbjct  1776  AQEIQTTQREDMANDSFTVTI  1796



>ref|XP_009790398.1| PREDICTED: putative late blight resistance protein homolog R1A-4 
isoform X3 [Nicotiana sylvestris]
Length=1807

 Score = 63.5 bits (153),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 35/81 (43%), Positives = 48/81 (59%), Gaps = 1/81 (1%)
 Frame = -2

Query  747   LLLEDKTLEQWMVDDESFPNLEHLVLRFCYCLEEIPKAIEYISRLRSIELQWCTPSVCYS  568
             L L++  + QW V  ++FP LEHLVL  C  LE+IP   +    L+SIE+ WC  SV  S
Sbjct  1716  LKLDNLKVAQWSVSYDAFPKLEHLVLTKCKHLEKIPSHFDDAVSLKSIEVNWCNWSVANS  1775

Query  567   TKRIQDF-RHEMADDLFELKI  508
              + IQ   R +MA+D F + I
Sbjct  1776  AQEIQTTQREDMANDSFTVTI  1796



>ref|XP_010320671.1| PREDICTED: uncharacterized protein LOC101257665 [Solanum lycopersicum]
Length=2437

 Score = 63.5 bits (153),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 34/81 (42%), Positives = 48/81 (59%), Gaps = 1/81 (1%)
 Frame = -2

Query  747   LLLEDKTLEQWMVDDESFPNLEHLVLRFCYCLEEIPKAIEYISRLRSIELQWCTPSVCYS  568
             L L+     +W + ++SFP+LE LVL  C  LE IP   E +  L+SIE+ WC+ SV  S
Sbjct  2348  LKLDSLNFAKWSISEDSFPSLERLVLTNCKRLENIPSHFEDVVSLKSIEVNWCSWSVANS  2407

Query  567   TKRIQDF-RHEMADDLFELKI  508
              + IQ   R +MA+D F + I
Sbjct  2408  AEEIQTTQREDMANDAFTVTI  2428



>ref|XP_006366838.1| PREDICTED: putative late blight resistance protein homolog R1B-16-like 
[Solanum tuberosum]
Length=889

 Score = 62.8 bits (151),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 34/80 (43%), Positives = 46/80 (58%), Gaps = 0/80 (0%)
 Frame = -2

Query  747  LLLEDKTLEQWMVDDESFPNLEHLVLRFCYCLEEIPKAIEYISRLRSIELQWCTPSVCYS  568
            LL++   L++W     +FP L+HLVL+ C  LEEIPK I  I  L SIEL  C  S   S
Sbjct  802  LLIDRTNLKRWKAGSVNFPKLQHLVLKRCIYLEEIPKDIGEIYTLESIELLNCRTSAAKS  861

Query  567  TKRIQDFRHEMADDLFELKI  508
             K IQ+ +  M +D   ++I
Sbjct  862  VKEIQEEQESMGNDCLSVRI  881



>ref|XP_011071841.1| PREDICTED: putative late blight resistance protein homolog R1A-10 
[Sesamum indicum]
Length=1095

 Score = 62.8 bits (151),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 38/96 (40%), Positives = 57/96 (59%), Gaps = 2/96 (2%)
 Frame = -2

Query  747   LLLEDKTLEQWMVDDESFPNLEHLVLRFCYCLEEIPKAIEYISRLRSIELQWCTPSVCYS  568
             LLLE+  L QW  ++  FP L+ L++R C+ L EIP AI  I+ L+ IEL  C PS   S
Sbjct  1000  LLLEELDLVQWRTNEAHFPCLQSLIIRSCFRLREIPSAIGDITTLQMIELVDCHPSAVTS  1059

Query  567   TKRIQDFRHEMADDLFELKIIGEESIPADDEWQAKI  460
              K+IQ+ +  MA++  +LK+  E      D + ++I
Sbjct  1060  AKQIQEEQESMANE--DLKVCIELKRRFKDRFSSRI  1093



>ref|XP_010320562.1| PREDICTED: LOW QUALITY PROTEIN: putative late blight resistance 
protein homolog R1A-4 [Solanum lycopersicum]
Length=1687

 Score = 62.4 bits (150),  Expect = 9e-08, Method: Compositional matrix adjust.
 Identities = 35/81 (43%), Positives = 47/81 (58%), Gaps = 1/81 (1%)
 Frame = -2

Query  747   LLLEDKTLEQWMVDDESFPNLEHLVLRFCYCLEEIPKAIEYISRLRSIELQWCTPSVCYS  568
             L L++  + QW + +++FP LEHLVL  C  LEEIP        L+SIE+  C  SV  S
Sbjct  1596  LNLDNINISQWSLSNDAFPKLEHLVLTKCKQLEEIPSHFGDAVTLKSIEVNRCGRSVSNS  1655

Query  567   TKRIQDFRHE-MADDLFELKI  508
                IQ  +HE MA+D F + I
Sbjct  1656  ALEIQTAQHEDMANDAFTVTI  1676



>ref|XP_004239116.1| PREDICTED: putative late blight resistance protein homolog R1A-4 
isoform X1 [Solanum lycopersicum]
 ref|XP_010320925.1| PREDICTED: putative late blight resistance protein homolog R1A-4 
isoform X1 [Solanum lycopersicum]
Length=1825

 Score = 62.0 bits (149),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 33/81 (41%), Positives = 48/81 (59%), Gaps = 1/81 (1%)
 Frame = -2

Query  747   LLLEDKTLEQWMVDDESFPNLEHLVLRFCYCLEEIPKAIEYISRLRSIELQWCTPSVCYS  568
             L L++  + QW + D++FP LEHLVL  C  LE+IP   E    L  +E+ WC  +V  S
Sbjct  1732  LKLDNLKVVQWSISDDAFPKLEHLVLTKCKHLEKIPSRFEDAVCLNRVEVNWCNWNVANS  1791

Query  567   TKRIQDFRHE-MADDLFELKI  508
              + IQ  +HE +A+D F + I
Sbjct  1792  AQDIQTMQHEVIANDSFTVTI  1812



>gb|AAF76312.1|AF220603_4 Prf [Solanum lycopersicum]
Length=1825

 Score = 62.0 bits (149),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 33/81 (41%), Positives = 48/81 (59%), Gaps = 1/81 (1%)
 Frame = -2

Query  747   LLLEDKTLEQWMVDDESFPNLEHLVLRFCYCLEEIPKAIEYISRLRSIELQWCTPSVCYS  568
             L L++  + QW + D++FP LEHLVL  C  LE+IP   E    L  +E+ WC  +V  S
Sbjct  1732  LKLDNLKVVQWSISDDAFPKLEHLVLTKCKHLEKIPSRFEDAVCLNRVEVNWCNWNVANS  1791

Query  567   TKRIQDFRHE-MADDLFELKI  508
              + IQ  +HE +A+D F + I
Sbjct  1792  AQDIQTMQHEVIANDSFTVTI  1812



>gb|AAF76308.1| Prf [Solanum pimpinellifolium]
Length=1824

 Score = 62.0 bits (149),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 33/81 (41%), Positives = 48/81 (59%), Gaps = 1/81 (1%)
 Frame = -2

Query  747   LLLEDKTLEQWMVDDESFPNLEHLVLRFCYCLEEIPKAIEYISRLRSIELQWCTPSVCYS  568
             L L++  + QW + D++FP LEHLVL  C  LE+IP   E    L  +E+ WC  +V  S
Sbjct  1731  LKLDNLKVVQWSISDDAFPKLEHLVLTKCKHLEKIPSRFEDAVCLNRVEVNWCNWNVANS  1790

Query  567   TKRIQDFRHE-MADDLFELKI  508
              + IQ  +HE +A+D F + I
Sbjct  1791  AQDIQTMQHEVIANDSFTVTI  1811



>ref|XP_011070550.1| PREDICTED: putative late blight resistance protein homolog R1A-10 
[Sesamum indicum]
Length=910

 Score = 62.0 bits (149),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 34/80 (43%), Positives = 45/80 (56%), Gaps = 0/80 (0%)
 Frame = -2

Query  747  LLLEDKTLEQWMVDDESFPNLEHLVLRFCYCLEEIPKAIEYISRLRSIELQWCTPSVCYS  568
            LLLE+  LE W      +P+L+HLVLR C  L EIP  I  I  L+ IEL  C  S   S
Sbjct  828  LLLENNELEIWKATSTHYPSLQHLVLRLCDALIEIPCGIGEIPTLQIIELYSCGHSAVRS  887

Query  567  TKRIQDFRHEMADDLFELKI  508
             KRI + +  + +D  E++I
Sbjct  888  AKRIHEEQQSIGNDDLEVRI  907



>gb|AAC49408.1| PRF [Solanum lycopersicum]
Length=1824

 Score = 62.0 bits (149),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 33/81 (41%), Positives = 48/81 (59%), Gaps = 1/81 (1%)
 Frame = -2

Query  747   LLLEDKTLEQWMVDDESFPNLEHLVLRFCYCLEEIPKAIEYISRLRSIELQWCTPSVCYS  568
             L L++  + QW + D++FP LEHLVL  C  LE+IP   E    L  +E+ WC  +V  S
Sbjct  1731  LKLDNLKVVQWSISDDAFPKLEHLVLTKCKHLEKIPSRFEDAVCLNRVEVNWCNWNVANS  1790

Query  567   TKRIQDFRHE-MADDLFELKI  508
              + IQ  +HE +A+D F + I
Sbjct  1791  AQDIQTMQHEVIANDSFTVTI  1811



>ref|XP_010320926.1| PREDICTED: putative late blight resistance protein homolog R1B-23 
isoform X2 [Solanum lycopersicum]
Length=1785

 Score = 62.0 bits (149),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 33/81 (41%), Positives = 48/81 (59%), Gaps = 1/81 (1%)
 Frame = -2

Query  747   LLLEDKTLEQWMVDDESFPNLEHLVLRFCYCLEEIPKAIEYISRLRSIELQWCTPSVCYS  568
             L L++  + QW + D++FP LEHLVL  C  LE+IP   E    L  +E+ WC  +V  S
Sbjct  1692  LKLDNLKVVQWSISDDAFPKLEHLVLTKCKHLEKIPSRFEDAVCLNRVEVNWCNWNVANS  1751

Query  567   TKRIQDFRHE-MADDLFELKI  508
              + IQ  +HE +A+D F + I
Sbjct  1752  AQDIQTMQHEVIANDSFTVTI  1772



>ref|XP_009618258.1| PREDICTED: late blight resistance protein R1-A-like isoform X1 
[Nicotiana tomentosiformis]
 ref|XP_009618266.1| PREDICTED: late blight resistance protein R1-A-like isoform X1 
[Nicotiana tomentosiformis]
 ref|XP_009618270.1| PREDICTED: late blight resistance protein R1-A-like isoform X2 
[Nicotiana tomentosiformis]
Length=1741

 Score = 61.6 bits (148),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 34/79 (43%), Positives = 47/79 (59%), Gaps = 1/79 (1%)
 Frame = -2

Query  741   LEDKTLEQWMVDDESFPNLEHLVLRFCYCLEEIPKAIEYISRLRSIELQWCTPSVCYSTK  562
             L+D  + QW V D++FP L+ LVL  C  LE+IP   +    LRSIE+ WC   V  S +
Sbjct  1648  LDDINIAQWSVSDDAFPKLKCLVLIKCKRLEKIPSHFDDSVSLRSIEVNWCNWFVANSAQ  1707

Query  561   RIQDFRH-EMADDLFELKI  508
              IQ  +H EMA+  F ++I
Sbjct  1708  EIQTTQHEEMANGAFTVRI  1726



>ref|XP_010324491.1| PREDICTED: putative late blight resistance protein homolog R1A-3 
[Solanum lycopersicum]
Length=875

 Score = 61.2 bits (147),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 29/78 (37%), Positives = 48/78 (62%), Gaps = 0/78 (0%)
 Frame = -2

Query  747  LLLEDKTLEQWMVDDESFPNLEHLVLRFCYCLEEIPKAIEYISRLRSIELQWCTPSVCYS  568
            LL+E+K L+ W   D+SFP LE ++++ C  L+EIPK       L+ IEL  CTPS+   
Sbjct  792  LLVENKGLKNWNASDDSFPCLERVIIKNCRFLQEIPKGFSDSMTLKRIELWGCTPSLVNF  851

Query  567  TKRIQDFRHEMADDLFEL  514
             K IQ+ +  + +++ ++
Sbjct  852  AKEIQEEQEILGNNILQV  869



>ref|XP_011071971.1| PREDICTED: putative late blight resistance protein homolog R1A-10 
[Sesamum indicum]
Length=872

 Score = 60.8 bits (146),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 31/75 (41%), Positives = 44/75 (59%), Gaps = 0/75 (0%)
 Frame = -2

Query  747  LLLEDKTLEQWMVDDESFPNLEHLVLRFCYCLEEIPKAIEYISRLRSIELQWCTPSVCYS  568
            LLLE   L+ W   D++FP+LE L++R CY LE+IP  I  I  LR I+L  C+P+   S
Sbjct  789  LLLEALQLQIWTASDDNFPSLERLIIRHCYELEKIPPEIAEIGPLRLIQLVDCSPTAVAS  848

Query  567  TKRIQDFRHEMADDL  523
             + I+  +     DL
Sbjct  849  AQEIKKDKQRTKKDL  863



>ref|XP_006348601.1| PREDICTED: putative late blight resistance protein homolog R1B-16-like 
[Solanum tuberosum]
Length=1733

 Score = 60.5 bits (145),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 33/81 (41%), Positives = 46/81 (57%), Gaps = 1/81 (1%)
 Frame = -2

Query  747   LLLEDKTLEQWMVDDESFPNLEHLVLRFCYCLEEIPKAIEYISRLRSIELQWCTPSVCYS  568
             L+L++    QW + D++FP LE+L L  C  LEEIP        ++SIE+  C  SV  S
Sbjct  1642  LILDNINFSQWSISDDAFPELENLSLTKCERLEEIPSHFGEAVSIKSIEVNRCGSSVANS  1701

Query  567   TKRIQDFRH-EMADDLFELKI  508
                IQ  +H EMA+D F + I
Sbjct  1702  ALEIQTTQHEEMANDAFTVTI  1722



>ref|XP_009794750.1| PREDICTED: putative late blight resistance protein homolog R1A-10 
[Nicotiana sylvestris]
Length=745

 Score = 60.1 bits (144),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 35/91 (38%), Positives = 49/91 (54%), Gaps = 2/91 (2%)
 Frame = -2

Query  747  LLLEDKTLEQWMVDDESFPNLEHLVLRFCYCLEEIPKAIEYISRLRSIELQWCTPSVCYS  568
            LL+ +  L+ W     +FP L+ LVL+ C+ LEEIPK    I  L SIEL  C  S   S
Sbjct  479  LLINETYLKHWDAGSVNFPKLQRLVLKRCFDLEEIPKDFGEICTLESIELHKCKTSAAAS  538

Query  567  TKRIQDFRHEMADDLFELKIIGEESIPADDE  475
             K IQ+ +  M +D   L ++  +S PA  +
Sbjct  539  AKNIQEEQESMGNDC--LSVLINDSGPAQAQ  567



>ref|XP_009606087.1| PREDICTED: putative late blight resistance protein homolog R1B-16 
isoform X2 [Nicotiana tomentosiformis]
Length=975

 Score = 59.7 bits (143),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 31/80 (39%), Positives = 47/80 (59%), Gaps = 0/80 (0%)
 Frame = -2

Query  747  LLLEDKTLEQWMVDDESFPNLEHLVLRFCYCLEEIPKAIEYISRLRSIELQWCTPSVCYS  568
            LL+E   LEQW   ++ FP LEHLVL+ C  L+ IP+ + +I  L+ IEL   + S   S
Sbjct  875  LLIEMSDLEQWSASNDHFPCLEHLVLKGCLHLDSIPRDLGFIPTLQIIELDNSSQSAVLS  934

Query  567  TKRIQDFRHEMADDLFELKI  508
             K IQ+ +    +D  +++I
Sbjct  935  AKEIQEEQQSCGNDALQVRI  954



>ref|XP_009606086.1| PREDICTED: putative late blight resistance protein homolog R1B-16 
isoform X1 [Nicotiana tomentosiformis]
Length=990

 Score = 59.7 bits (143),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 31/80 (39%), Positives = 47/80 (59%), Gaps = 0/80 (0%)
 Frame = -2

Query  747  LLLEDKTLEQWMVDDESFPNLEHLVLRFCYCLEEIPKAIEYISRLRSIELQWCTPSVCYS  568
            LL+E   LEQW   ++ FP LEHLVL+ C  L+ IP+ + +I  L+ IEL   + S   S
Sbjct  890  LLIEMSDLEQWSASNDHFPCLEHLVLKGCLHLDSIPRDLGFIPTLQIIELDNSSQSAVLS  949

Query  567  TKRIQDFRHEMADDLFELKI  508
             K IQ+ +    +D  +++I
Sbjct  950  AKEIQEEQQSCGNDALQVRI  969



>ref|XP_011087335.1| PREDICTED: putative late blight resistance protein homolog R1A-3 
[Sesamum indicum]
Length=794

 Score = 59.7 bits (143),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 30/79 (38%), Positives = 44/79 (56%), Gaps = 0/79 (0%)
 Frame = -2

Query  747  LLLEDKTLEQWMVDDESFPNLEHLVLRFCYCLEEIPKAIEYISRLRSIELQWCTPSVCYS  568
            L++E   LE W  ++  FP LEHLV+R C  L+ IP  I  I  L+ IE+  C PS+  S
Sbjct  709  LIMEKLNLEYWAANNICFPRLEHLVIRHCSHLDRIPHGIGGIPTLKLIEVYECNPSLVDS  768

Query  567  TKRIQDFRHEMADDLFELK  511
             + IQ  +    +D  E++
Sbjct  769  ARMIQKEQESYGNDGLEVR  787



>sp|Q6L400.1|R1B16_SOLDE RecName: Full=Putative late blight resistance protein homolog 
R1B-16 [Solanum demissum]
 gb|AAT38773.1| Putative late blight resistance protein, identical [Solanum demissum]
Length=1284

 Score = 59.7 bits (143),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 39/90 (43%), Positives = 51/90 (57%), Gaps = 1/90 (1%)
 Frame = -2

Query  747   LLLEDKTLEQWMVDDESFPNLEHLVLRFCYCLEEIPKAIEYISRLRSIELQWCTPSVCYS  568
             L LE   L +W+V D++FPNLE LVL  C  L EIP     I  L+ IE++ C  SV  S
Sbjct  1165  LKLEYLALMKWIVADDAFPNLEQLVLHECRHLMEIPSCFMDIPSLKYIEVENCNESVVKS  1224

Query  567   TKRIQDFRHE-MADDLFELKIIGEESIPAD  481
                IQ+ + E   +  F+L +IG ESI  D
Sbjct  1225  AMNIQETQVEDYQNTNFKLVLIGIESISTD  1254



>ref|XP_011072119.1| PREDICTED: putative late blight resistance protein homolog R1B-14 
[Sesamum indicum]
Length=996

 Score = 59.7 bits (143),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 37/96 (39%), Positives = 55/96 (57%), Gaps = 2/96 (2%)
 Frame = -2

Query  747  LLLEDKTLEQWMVDDESFPNLEHLVLRFCYCLEEIPKAIEYISRLRSIELQWCTPSVCYS  568
            LLLE+  L QW   +  FP L+ L++R C+ L EIP AI  I+ L+ IEL  C PS    
Sbjct  901  LLLEELDLVQWRTKEAPFPRLQSLIIRSCFRLREIPSAIGDITTLQMIELVDCHPSAVTW  960

Query  567  TKRIQDFRHEMADDLFELKIIGEESIPADDEWQAKI  460
             K+IQ+ +  MA++  +LK+  E      D + ++I
Sbjct  961  AKQIQEEQESMANE--DLKVCIELKRRIKDRFSSRI  994



>ref|XP_009606267.1| PREDICTED: putative late blight resistance protein homolog R1A-3 
[Nicotiana tomentosiformis]
Length=927

 Score = 58.9 bits (141),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 30/81 (37%), Positives = 48/81 (59%), Gaps = 0/81 (0%)
 Frame = -2

Query  747  LLLEDKTLEQWMVDDESFPNLEHLVLRFCYCLEEIPKAIEYISRLRSIELQWCTPSVCYS  568
            LL++  +L  W   D++FP LE LVLR CY L E+P    YI+ L+ IEL  C P +  S
Sbjct  840  LLIDSTSLNYWKATDDNFPALECLVLRSCYFLAEMPIEFAYINSLQLIELYNCMPKLEAS  899

Query  567  TKRIQDFRHEMADDLFELKII  505
              +IQ  + ++ +   +++I+
Sbjct  900  AAQIQQEQEDIGNKPLDIRIL  920



>ref|XP_006345283.1| PREDICTED: uncharacterized protein LOC102590501 [Solanum tuberosum]
Length=2691

 Score = 58.9 bits (141),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 30/79 (38%), Positives = 45/79 (57%), Gaps = 0/79 (0%)
 Frame = -2

Query  747   LLLEDKTLEQWMVDDESFPNLEHLVLRFCYCLEEIPKAIEYISRLRSIELQWCTPSVCYS  568
             LL+E   L+ W   ++ FP LEHLV+R C+ LEEIP     I  L+ IELQ C+  +  S
Sbjct  1788  LLIEGTNLKCWKATNDHFPALEHLVIRHCFHLEEIPIEFADIYSLQLIELQNCSAKLVAS  1847

Query  567   TKRIQDFRHEMADDLFELK  511
               RIQ+ +  +     +++
Sbjct  1848  AGRIQEEQESLGSKAVDVR  1866


 Score = 57.8 bits (138),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 31/79 (39%), Positives = 45/79 (57%), Gaps = 0/79 (0%)
 Frame = -2

Query  747   LLLEDKTLEQWMVDDESFPNLEHLVLRFCYCLEEIPKAIEYISRLRSIELQWCTPSVCYS  568
             LL+E   L+ W   ++ FP LEHLV+R C+ LEEIP     I  L+ IELQ CT  +  S
Sbjct  2595  LLIEGTNLKCWKATNDHFPALEHLVIRHCFHLEEIPIEFADIYSLQLIELQNCTAKLVAS  2654

Query  567   TKRIQDFRHEMADDLFELK  511
             T  IQ+ +  +     +++
Sbjct  2655  TVLIQEEQESLGSKAVDVR  2673



>emb|CDP05538.1| unnamed protein product [Coffea canephora]
Length=1220

 Score = 58.5 bits (140),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 29/74 (39%), Positives = 43/74 (58%), Gaps = 1/74 (1%)
 Frame = -2

Query  729   TLEQWMVDDESFPNLEHLVLRFCYCLEEIPKAIEYISRLRSIELQWCTPSVCYSTKRIQD  550
              +++W V  E FP LE L +R CY L+EIP +I  I  L  +E+ WC  +   S K I +
Sbjct  1146  NIQEWNVSSEPFPRLEQLTIRDCYSLQEIPSSIGDIPTLEKLEVHWCFDAAS-SAKHILE  1204

Query  549   FRHEMADDLFELKI  508
              + +M +DL E+ I
Sbjct  1205  EQRDMGNDLLEVII  1218



>ref|XP_009798058.1| PREDICTED: LOW QUALITY PROTEIN: late blight resistance protein 
R1-A-like [Nicotiana sylvestris]
Length=1265

 Score = 58.5 bits (140),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 28/69 (41%), Positives = 46/69 (67%), Gaps = 0/69 (0%)
 Frame = -2

Query  744   LLEDKTLEQWMVDDESFPNLEHLVLRFCYCLEEIPKAIEYISRLRSIELQWCTPSVCYST  565
             L++  +L++W V D++FPNLE LVLR C+ ++E P     I  L+SIE+++C  SV  S 
Sbjct  1185  LIDCNSLKEWTVSDDAFPNLERLVLRRCWNIKETPSCFGDILSLKSIEVKYCNESVVKSA  1244

Query  564   KRIQDFRHE  538
             + I++ + E
Sbjct  1245  RVIRETQVE  1253



>ref|XP_009764457.1| PREDICTED: putative late blight resistance protein homolog R1A-10 
[Nicotiana sylvestris]
Length=487

 Score = 58.2 bits (139),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 33/79 (42%), Positives = 43/79 (54%), Gaps = 0/79 (0%)
 Frame = -2

Query  744  LLEDKTLEQWMVDDESFPNLEHLVLRFCYCLEEIPKAIEYISRLRSIELQWCTPSVCYST  565
            L     L+ W     +FP L+ LVL+ C  LEEIPK I  I  L SIEL  C  SV  S 
Sbjct  362  LTATTNLKHWDAGSVNFPMLKRLVLKRCLYLEEIPKDIGEICTLESIELHNCRSSVAKSV  421

Query  564  KRIQDFRHEMADDLFELKI  508
            K IQ+ +  MA+D   +++
Sbjct  422  KEIQEEQESMANDNLSVRV  440



>ref|XP_009803439.1| PREDICTED: putative late blight resistance protein homolog R1A-3 
isoform X2 [Nicotiana sylvestris]
Length=1224

 Score = 58.5 bits (140),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 29/66 (44%), Positives = 41/66 (62%), Gaps = 0/66 (0%)
 Frame = -2

Query  747   LLLEDKTLEQWMVDDESFPNLEHLVLRFCYCLEEIPKAIEYISRLRSIELQWCTPSVCYS  568
             L L D  + +W   +ESFP LE LV++ CY LEEIP +   I  L+ I+L WC+ S+  S
Sbjct  1142  LKLVDLGIVRWNASEESFPQLETLVIKVCYDLEEIPLSFADIPTLKQIKLMWCSKSLVAS  1201

Query  567   TKRIQD  550
               RI++
Sbjct  1202  AVRIKE  1207



>ref|XP_009608834.1| PREDICTED: late blight resistance protein R1-A-like isoform X1 
[Nicotiana tomentosiformis]
Length=1272

 Score = 58.5 bits (140),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 28/69 (41%), Positives = 47/69 (68%), Gaps = 0/69 (0%)
 Frame = -2

Query  744   LLEDKTLEQWMVDDESFPNLEHLVLRFCYCLEEIPKAIEYISRLRSIELQWCTPSVCYST  565
             L++  +L++W V D++FPNLE LVLR C+ ++E P     I  L+SIE+++C+ SV  S 
Sbjct  1192  LIDCSSLKEWTVSDDAFPNLERLVLRRCWNIKETPSCFGDILSLKSIEVKYCSESVVKSA  1251

Query  564   KRIQDFRHE  538
             + I++ + E
Sbjct  1252  RIIRETQVE  1260



>ref|XP_009803436.1| PREDICTED: putative late blight resistance protein homolog R1A-3 
isoform X1 [Nicotiana sylvestris]
 ref|XP_009803438.1| PREDICTED: putative late blight resistance protein homolog R1A-3 
isoform X1 [Nicotiana sylvestris]
Length=1256

 Score = 58.5 bits (140),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 29/66 (44%), Positives = 41/66 (62%), Gaps = 0/66 (0%)
 Frame = -2

Query  747   LLLEDKTLEQWMVDDESFPNLEHLVLRFCYCLEEIPKAIEYISRLRSIELQWCTPSVCYS  568
             L L D  + +W   +ESFP LE LV++ CY LEEIP +   I  L+ I+L WC+ S+  S
Sbjct  1174  LKLVDLGIVRWNASEESFPQLETLVIKVCYDLEEIPLSFADIPTLKQIKLMWCSKSLVAS  1233

Query  567   TKRIQD  550
               RI++
Sbjct  1234  AVRIKE  1239



>ref|XP_004231117.1| PREDICTED: putative late blight resistance protein homolog R1A-10 
[Solanum lycopersicum]
Length=880

 Score = 58.2 bits (139),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 35/96 (36%), Positives = 51/96 (53%), Gaps = 2/96 (2%)
 Frame = -2

Query  747  LLLEDKTLEQWMVDDESFPNLEHLVLRFCYCLEEIPKAIEYISRLRSIELQWCTPSVCYS  568
            LLL +  L  W     +FPNL+ LVLR C CLEEIP  I  I  L  IEL  C+ S   S
Sbjct  782  LLLAEPRLLNWEAGSVNFPNLQKLVLRKCICLEEIPIDIGEICTLEMIELICCSSSAQNS  841

Query  567  TKRIQDFRHEMADDLFELKIIGEESIPAD--DEWQA  466
               I++ +  M +   ++++  ++  P+   D W+A
Sbjct  842  ANEIREEQESMGNSCLDIRVYVDDDEPSSLFDFWRA  877



>ref|XP_004240523.1| PREDICTED: putative late blight resistance protein homolog R1A-3 
[Solanum lycopersicum]
 gb|ABI96217.1| NBS-LRR resistance protein-like protein [Solanum lycopersicum]
Length=1249

 Score = 58.2 bits (139),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 34/81 (42%), Positives = 52/81 (64%), Gaps = 2/81 (2%)
 Frame = -2

Query  729   TLEQWMVDDESFPNLEHLVLRFCYCLEEIPKAIEYISRLRSIELQWCTPSVCYSTKRIQD  550
             TL +W V +ESFPNLE L L+ C  LEEIP +   I  L+ I++   +P + YS  +I++
Sbjct  1168  TLSKWEVGEESFPNLEKLKLQGCGKLEEIPPSFGDIYSLKFIKIV-KSPQLEYSALKIKE  1226

Query  549   FRHEMADDLFELKIIGEESIP  487
             +  EM     EL+I+G+++IP
Sbjct  1227  YAEEMRGG-SELQILGQKNIP  1246



>ref|XP_009764259.1| PREDICTED: late blight resistance protein R1-A-like [Nicotiana 
sylvestris]
Length=1267

 Score = 58.2 bits (139),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 29/61 (48%), Positives = 41/61 (67%), Gaps = 0/61 (0%)
 Frame = -2

Query  732   KTLEQWMVDDESFPNLEHLVLRFCYCLEEIPKAIEYISRLRSIELQWCTPSVCYSTKRIQ  553
             ++LE+W V D++FPNLE L LR    L+EIP   E IS L+SIE++ C  SV  S + I+
Sbjct  1191  RSLEEWTVSDDAFPNLERLFLRGLENLKEIPSCFEDISSLKSIEVKECNESVVKSARDIR  1250

Query  552   D  550
             +
Sbjct  1251  E  1251



>ref|XP_009595789.1| PREDICTED: putative late blight resistance protein homolog R1A-4 
[Nicotiana tomentosiformis]
Length=1776

 Score = 58.2 bits (139),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 31/81 (38%), Positives = 50/81 (62%), Gaps = 1/81 (1%)
 Frame = -2

Query  747   LLLEDKTLEQWMVDDESFPNLEHLVLRFCYCLEEIPKAIEYISRLRSIELQWCTPSVCYS  568
             L LE+ +  +W + +++F NLE LVL  C CL EIP    Y + L++IE++ C  SV  S
Sbjct  1695  LKLENISFARWSISEDAFSNLEKLVLHSCDCLVEIPSEFGYFTCLQTIEVKSCQESVANS  1754

Query  567   TKRIQDFR-HEMADDLFELKI  508
              K +++ +  EM ++ F+L I
Sbjct  1755  AKNVEEIQVEEMQNNGFKLFI  1775



>emb|CDP05499.1| unnamed protein product [Coffea canephora]
Length=866

 Score = 58.2 bits (139),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 31/80 (39%), Positives = 45/80 (56%), Gaps = 0/80 (0%)
 Frame = -2

Query  747  LLLEDKTLEQWMVDDESFPNLEHLVLRFCYCLEEIPKAIEYISRLRSIELQWCTPSVCYS  568
            L L +  L+QW     SFP L+ LVL  C  L+EIP +   I  L +IEL + + SV  S
Sbjct  780  LKLSNTDLQQWSASSSSFPCLQQLVLDGCPNLQEIPSSFRSIDTLEAIELYYSSQSVADS  839

Query  567  TKRIQDFRHEMADDLFELKI  508
             ++IQD +  M +D  ++ I
Sbjct  840  ARQIQDSQRYMGNDGLKVLI  859



>ref|XP_011087138.1| PREDICTED: putative late blight resistance protein homolog R1A-10 
[Sesamum indicum]
Length=821

 Score = 57.8 bits (138),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 31/65 (48%), Positives = 40/65 (62%), Gaps = 0/65 (0%)
 Frame = -2

Query  747  LLLEDKTLEQWMVDDESFPNLEHLVLRFCYCLEEIPKAIEYISRLRSIELQWCTPSVCYS  568
            LL+ED  LE W  +   FP LE L +  CY L+EIP++IE   RL  IE+   TPS+  S
Sbjct  734  LLIEDTDLEYWRANGYRFPRLERLFIHHCYKLKEIPQSIEENFRLEVIEIVDGTPSLVAS  793

Query  567  TKRIQ  553
             K+IQ
Sbjct  794  AKQIQ  798



>ref|NP_001234273.1| JJH-R-like protein [Solanum lycopersicum]
 gb|ABA41595.1| JJH-R-like protein [Solanum lycopersicum]
Length=195

 Score = 55.8 bits (133),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 30/71 (42%), Positives = 44/71 (62%), Gaps = 0/71 (0%)
 Frame = -2

Query  747  LLLEDKTLEQWMVDDESFPNLEHLVLRFCYCLEEIPKAIEYISRLRSIELQWCTPSVCYS  568
            L LE+ +  +W V D++FP LEHLVL  C  LE IP    Y+S L+SIE++ C  S+  S
Sbjct  74   LKLENLSFSEWDVSDDAFPYLEHLVLIRCPYLEVIPSCFGYMSSLKSIEVKSCKESLADS  133

Query  567  TKRIQDFRHEM  535
               I++ + E+
Sbjct  134  AMVIKEMQVEV  144



>ref|XP_009779957.1| PREDICTED: LOW QUALITY PROTEIN: late blight resistance protein 
R1-A-like, partial [Nicotiana sylvestris]
Length=1109

 Score = 57.8 bits (138),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 31/63 (49%), Positives = 41/63 (65%), Gaps = 0/63 (0%)
 Frame = -2

Query  726   LEQWMVDDESFPNLEHLVLRFCYCLEEIPKAIEYISRLRSIELQWCTPSVCYSTKRIQDF  547
             LE+W+V +++FPNLE LVLR C  L+EIP     IS L+SIE+Q C   V  S   IQ+ 
Sbjct  1035  LEEWIVAEDAFPNLERLVLRECKKLKEIPSCFGVISSLKSIEVQECNDCVDKSASIIQEM  1094

Query  546   RHE  538
             + E
Sbjct  1095  QVE  1097



>ref|XP_004243044.2| PREDICTED: putative late blight resistance protein homolog R1B-16 
[Solanum lycopersicum]
Length=889

 Score = 57.8 bits (138),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 31/80 (39%), Positives = 44/80 (55%), Gaps = 0/80 (0%)
 Frame = -2

Query  747  LLLEDKTLEQWMVDDESFPNLEHLVLRFCYCLEEIPKAIEYISRLRSIELQWCTPSVCYS  568
            LL++   ++ W     +FP L+ LVL+ C  LEEIPK I  +  L SIEL  C  S   S
Sbjct  802  LLIDRTNVKSWKAGSVNFPKLQRLVLKRCIYLEEIPKDIGEVYTLESIELLNCRTSAAKS  861

Query  567  TKRIQDFRHEMADDLFELKI  508
             K IQ+ +  M +D   ++I
Sbjct  862  VKEIQEEQESMGNDCLSVRI  881



>ref|XP_011072173.1| PREDICTED: putative late blight resistance protein homolog R1A-10 
[Sesamum indicum]
Length=869

 Score = 57.4 bits (137),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 31/75 (41%), Positives = 41/75 (55%), Gaps = 0/75 (0%)
 Frame = -2

Query  747  LLLEDKTLEQWMVDDESFPNLEHLVLRFCYCLEEIPKAIEYISRLRSIELQWCTPSVCYS  568
            L + D  L  W  DD  FP+LE L LR  + LEEIP  I +I  LRSI L  C+  V  S
Sbjct  781  LFISDSDLVSWRADDFHFPHLESLFLRLMHKLEEIPSGIGHIETLRSIHLNKCSELVVNS  840

Query  567  TKRIQDFRHEMADDL  523
             K+I + +    ++L
Sbjct  841  AKQILEEQSSYGNEL  855



>ref|XP_011075746.1| PREDICTED: putative late blight resistance protein homolog R1A-10 
[Sesamum indicum]
Length=967

 Score = 57.4 bits (137),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 33/80 (41%), Positives = 48/80 (60%), Gaps = 2/80 (3%)
 Frame = -2

Query  747  LLLEDKTLEQWMVDDESFPNLEHLVLRFCYCLEEIPKAIEYISRLRSIELQWCTPSVCYS  568
            LLLE+  L QW+ ++  FP L+ LV+R CY L+EIP  I  I  L  IEL  C  S   S
Sbjct  872  LLLEEVDLVQWVANETHFPRLQRLVIRSCYKLKEIPSGIGEIPTLELIELVDCHHSAVTS  931

Query  567  TKRIQDFRHEMADDLFELKI  508
             ++IQ+ +  + ++  ELK+
Sbjct  932  AEKIQEEQEGLGNE--ELKV  949



>ref|XP_009597655.1| PREDICTED: putative late blight resistance protein homolog R1A-10 
isoform X2 [Nicotiana tomentosiformis]
Length=884

 Score = 57.4 bits (137),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 31/74 (42%), Positives = 41/74 (55%), Gaps = 0/74 (0%)
 Frame = -2

Query  747  LLLEDKTLEQWMVDDESFPNLEHLVLRFCYCLEEIPKAIEYISRLRSIELQWCTPSVCYS  568
            LL+    L+ W     +FP LE LVL+ CY LEEIP+ +  I  L SIEL  C+ S   S
Sbjct  799  LLISAINLKHWEASSVNFPRLERLVLKRCYYLEEIPQDLGEICTLASIELHECSISAAKS  858

Query  567  TKRIQDFRHEMADD  526
               IQ+ +  M +D
Sbjct  859  VNEIQEEQESMGND  872



>ref|XP_006367614.1| PREDICTED: putative late blight resistance protein homolog R1B-23-like 
isoform X1 [Solanum tuberosum]
Length=1024

 Score = 57.4 bits (137),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 33/66 (50%), Positives = 41/66 (62%), Gaps = 0/66 (0%)
 Frame = -2

Query  747  LLLEDKTLEQWMVDDESFPNLEHLVLRFCYCLEEIPKAIEYISRLRSIELQWCTPSVCYS  568
            L LED +L +W+V D++FPNLE LVLR    LEEIP     I  L+ IEL+ C  SV  S
Sbjct  927  LKLEDLSLMKWIVADDAFPNLEQLVLRGWRHLEEIPSCFMDILSLKYIELENCNESVVKS  986

Query  567  TKRIQD  550
               IQ+
Sbjct  987  AMNIQE  992



>ref|XP_009597654.1| PREDICTED: putative late blight resistance protein homolog R1A-10 
isoform X1 [Nicotiana tomentosiformis]
Length=884

 Score = 57.4 bits (137),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 31/74 (42%), Positives = 41/74 (55%), Gaps = 0/74 (0%)
 Frame = -2

Query  747  LLLEDKTLEQWMVDDESFPNLEHLVLRFCYCLEEIPKAIEYISRLRSIELQWCTPSVCYS  568
            LL+    L+ W     +FP LE LVL+ CY LEEIP+ +  I  L SIEL  C+ S   S
Sbjct  799  LLISAINLKHWEASSVNFPRLERLVLKRCYYLEEIPQDLGEICTLASIELHECSISAAKS  858

Query  567  TKRIQDFRHEMADD  526
               IQ+ +  M +D
Sbjct  859  VNEIQEEQESMGND  872



>ref|XP_009776932.1| PREDICTED: putative late blight resistance protein homolog R1A-3 
[Nicotiana sylvestris]
Length=159

 Score = 54.7 bits (130),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 36/95 (38%), Positives = 49/95 (52%), Gaps = 1/95 (1%)
 Frame = -2

Query  747  LLLEDKTLEQWMVDDESFPNLEHLVLRFCYCLEEIPKAIEYISRLRSIELQWCTPSVCYS  568
            LLL +  L +W     +FP L+ LVLR C  LEEIP  I  I  L +IEL  C+ S   S
Sbjct  62   LLLAEPRLVKWEAGSVNFPTLQKLVLRKCIRLEEIPIDIGEICTLEAIELICCSASAQNS  121

Query  567  TKRIQDFRHEMADDLFELKI-IGEESIPADDEWQA  466
               IQD +  M +   +++    +ES    D W+A
Sbjct  122  ATEIQDEQESMGNSCLDVRAYANDESSSLFDFWRA  156



>ref|XP_011088007.1| PREDICTED: putative late blight resistance protein homolog R1B-14 
[Sesamum indicum]
Length=903

 Score = 57.0 bits (136),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 30/80 (38%), Positives = 41/80 (51%), Gaps = 0/80 (0%)
 Frame = -2

Query  747  LLLEDKTLEQWMVDDESFPNLEHLVLRFCYCLEEIPKAIEYISRLRSIELQWCTPSVCYS  568
            LL+    LE W  D   FPNL+ LVLR C  L+EIP  I     L  IEL  C  S   S
Sbjct  821  LLIGSTNLEIWDADGTHFPNLQQLVLRHCKFLKEIPYGISEAPLLEKIELHCCKDSAVIS  880

Query  567  TKRIQDFRHEMADDLFELKI  508
             + +Q+ +  + +D  ++ I
Sbjct  881  ARHLQEEQQSLGNDGLKIHI  900



>ref|XP_006348816.1| PREDICTED: putative late blight resistance protein homolog R1B-23-like 
[Solanum tuberosum]
Length=1437

 Score = 57.0 bits (136),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 30/70 (43%), Positives = 44/70 (63%), Gaps = 0/70 (0%)
 Frame = -2

Query  747   LLLEDKTLEQWMVDDESFPNLEHLVLRFCYCLEEIPKAIEYISRLRSIELQWCTPSVCYS  568
             L LE+ +  +W V D++FP LEHLVL+ C  LEEIP    Y+  L+SIE++ C  S+  S
Sbjct  1339  LKLENLSFSEWDVSDDAFPCLEHLVLKRCRYLEEIPSCFGYMPSLKSIEVESCKESLADS  1398

Query  567   TKRIQDFRHE  538
                I++ + E
Sbjct  1399  AMVIKEMQVE  1408



>gb|AAU93588.1| late blight resistance protein, identical [Solanum demissum]
 gb|ABO92999.1| late blight resistance protein R1 [Solanum tuberosum]
Length=1313

 Score = 57.0 bits (136),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 46/128 (36%), Positives = 70/128 (55%), Gaps = 14/128 (11%)
 Frame = -2

Query  747   LLLEDKTLEQWMVDDESFPNLEHLVLRFCYCLEEIPKAIEYISRLRSIELQWCTPSVCYS  568
             L LE  +L +W+V D++FPNLE LVLR C  L EIP     I  L+ I +++C  SV  S
Sbjct  1181  LKLEYLSLVKWIVADDAFPNLEQLVLRGCQDLMEIPSCFMDILSLKYIGVEYCNESVVKS  1240

Query  567   TKRIQDFRHE-MADDLFELKII-----------GEESIPADDEWQAKIKIIGE-DSEES*  427
                IQ+ + E   +  F+L +I           G ES+ + DE + K+ + G+ D++E  
Sbjct  1241  ALNIQETQVEDYQNTNFKLVLIEIHLFCLFDMKGIESV-SSDEKEKKLTVTGDVDADEVQ  1299

Query  426   YLNDKLAK  403
              + +KL K
Sbjct  1300  LVVEKLRK  1307



>ref|XP_009757156.1| PREDICTED: putative late blight resistance protein homolog R1B-16 
[Nicotiana sylvestris]
Length=886

 Score = 57.0 bits (136),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 34/75 (45%), Positives = 44/75 (59%), Gaps = 3/75 (4%)
 Frame = -2

Query  747  LLLEDKTLEQWMVDDESFPNLEHLVLRFCYCLEEIPKAIEYISRLRSIELQWCTPSVCYS  568
            LL+E   L+ W   ++SFP LE LV+R C  LE+IP    YI  L+ IEL  CTP +  S
Sbjct  784  LLIEYNDLKYWSSPNDSFPVLERLVIRHCSELEDIPIDFAYIDSLQQIELTDCTPELEAS  843

Query  567  TKRIQDFRHEMADDL  523
              RIQ   HE  ++L
Sbjct  844  AARIQ---HEQKENL  855



>ref|XP_006356447.1| PREDICTED: uncharacterized protein LOC102594363 [Solanum tuberosum]
Length=2035

 Score = 57.0 bits (136),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 33/81 (41%), Positives = 49/81 (60%), Gaps = 2/81 (2%)
 Frame = -2

Query  747   LLLEDKTLEQWMVDDESFPNLEHLVLRFCYCLEEIPKAIEYISRLRSIELQWCTPSVCYS  568
             L L++  + +W V D++FP LEHLVL  C  LE+IP     ++ L +IE+ WC+ SV  S
Sbjct  1945  LKLDNLNIAEWSVMDDAFPKLEHLVLTKCKKLEKIPCHFGDVASL-NIEVNWCSWSVANS  2003

Query  567   TKRIQDFRHE-MADDLFELKI  508
              +  Q  +HE MA+  F + I
Sbjct  2004  AQEFQTTQHEDMANYAFRVTI  2024



>emb|CDP04724.1| unnamed protein product [Coffea canephora]
Length=613

 Score = 56.6 bits (135),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 34/81 (42%), Positives = 46/81 (57%), Gaps = 2/81 (2%)
 Frame = -2

Query  747  LLLEDKTLEQWMVDDESFPNLEHLVLRFCYCLEEIPKAIEYISRLRSIELQWCTPSVCYS  568
            L L    L+QW+    SFP LE LVL  C  LEEIP ++E I  L  IE+     SV  S
Sbjct  527  LKLSHTDLQQWIASSSSFPCLEQLVLNGCLDLEEIPSSLEEIYTLEIIEVYHSCQSVADS  586

Query  567  TKRIQDFRHEMADDLFELKII  505
             +R+Q+ +  M +D  ELK++
Sbjct  587  ARRLQEIQSYMGND--ELKVL  605



>emb|CDP16515.1| unnamed protein product [Coffea canephora]
Length=815

 Score = 56.6 bits (135),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 31/85 (36%), Positives = 50/85 (59%), Gaps = 3/85 (4%)
 Frame = -2

Query  747  LLLEDKTLEQWMVDDESFPNLEHLVLRFCYCLEEIPKAIEYISRLRSIELQWCTPSVCYS  568
            L L+   + +W    +  P LEHL+LR C  L+E+P      S L  IE+Q+CT S+  S
Sbjct  730  LKLDSLNIAEWNACSDHLPQLEHLILRSCRELKEVPSGFGDSSTLEMIEVQFCTSSLEES  789

Query  567  TKRIQDFRHEMADDLFELKIIGEES  493
             K++Q+ +H+M +   ELK++ + S
Sbjct  790  VKQLQEEQHDMGN---ELKVLVDRS  811



>ref|XP_009767436.1| PREDICTED: putative late blight resistance protein homolog R1B-16 
[Nicotiana sylvestris]
Length=930

 Score = 56.6 bits (135),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 31/80 (39%), Positives = 45/80 (56%), Gaps = 0/80 (0%)
 Frame = -2

Query  747  LLLEDKTLEQWMVDDESFPNLEHLVLRFCYCLEEIPKAIEYISRLRSIELQWCTPSVCYS  568
            LL+E   LE W   ++ FP LEHLVL+ C  L+ IP  +  I  L+ IEL+  + S   S
Sbjct  839  LLIEMSDLEHWSASNDHFPCLEHLVLKGCLHLDSIPHELGDIPTLQIIELENSSQSALLS  898

Query  567  TKRIQDFRHEMADDLFELKI  508
             K IQ+ +    +D  E++I
Sbjct  899  AKEIQEEQQSYGNDALEVRI  918



>ref|XP_009762970.1| PREDICTED: putative late blight resistance protein homolog R1B-23 
[Nicotiana sylvestris]
Length=1777

 Score = 56.6 bits (135),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 32/81 (40%), Positives = 48/81 (59%), Gaps = 1/81 (1%)
 Frame = -2

Query  747   LLLEDKTLEQWMVDDESFPNLEHLVLRFCYCLEEIPKAIEYISRLRSIELQWCTPSVCYS  568
             L LE+ +   W V +++F NLE LVL  C CL EIP    Y + L+SIE++ C  SV  S
Sbjct  1696  LKLENISFACWSVSEDAFSNLEQLVLHSCDCLVEIPTEFGYFTCLQSIEVKSCQESVANS  1755

Query  567   TKRIQDFR-HEMADDLFELKI  508
              + +++ +  EM ++ F L I
Sbjct  1756  ARNVEEIQVEEMQNNGFTLFI  1776



>sp|Q6L439.2|R1A4_SOLDE RecName: Full=Putative late blight resistance protein homolog 
R1A-4 [Solanum demissum]
 gb|AAT39943.2| Late blight resistance protein, putative [Solanum demissum]
 gb|ABO92984.1| putative disease resistance protein [Solanum tuberosum]
Length=1244

 Score = 56.6 bits (135),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 33/70 (47%), Positives = 43/70 (61%), Gaps = 0/70 (0%)
 Frame = -2

Query  747   LLLEDKTLEQWMVDDESFPNLEHLVLRFCYCLEEIPKAIEYISRLRSIELQWCTPSVCYS  568
             L LED +L +W+V D++FPNLE LVLR C  L EIP     I  L+ IE++ C  SV  S
Sbjct  1159  LKLEDVSLMKWIVADDAFPNLEQLVLRGCQDLMEIPSCFMDILSLQYIEVEDCNESVVKS  1218

Query  567   TKRIQDFRHE  538
                IQ+ + E
Sbjct  1219  AMNIQETQVE  1228



>gb|AGX27493.1| NBS-LRR class resistance protein Fy1-Ry1 [Sesamum indicum]
Length=701

 Score = 56.2 bits (134),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 31/79 (39%), Positives = 43/79 (54%), Gaps = 0/79 (0%)
 Frame = -2

Query  747  LLLEDKTLEQWMVDDESFPNLEHLVLRFCYCLEEIPKAIEYISRLRSIELQWCTPSVCYS  568
            L++E   L  W  DD  FP LEHLV+R C  L EIP  I  I  L+ IE+  C  SV  S
Sbjct  619  LIMEKLNLVFWTADDICFPRLEHLVIRHCAHLNEIPSGIGDIPTLQVIEVHECKRSVLDS  678

Query  567  TKRIQDFRHEMADDLFELK  511
             + IQ+ +    ++  E++
Sbjct  679  ARMIQEEQESWGNEYLEVR  697



>gb|AGX27496.1| NBS-LRR class resistance protein Fy1-Ry1 [Sesamum indicum]
Length=701

 Score = 56.2 bits (134),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 31/79 (39%), Positives = 43/79 (54%), Gaps = 0/79 (0%)
 Frame = -2

Query  747  LLLEDKTLEQWMVDDESFPNLEHLVLRFCYCLEEIPKAIEYISRLRSIELQWCTPSVCYS  568
            L++E   L  W  DD  FP LEHLV+R C  L EIP  I  I  L+ IE+  C  SV  S
Sbjct  619  LIMEKLNLVFWTADDICFPRLEHLVIRHCAHLNEIPSGIGDIPTLQVIEVHECKRSVLDS  678

Query  567  TKRIQDFRHEMADDLFELK  511
             + IQ+ +    ++  E++
Sbjct  679  ARMIQEEQESWGNEYLEVR  697



>gb|AGX27494.1| NBS-LRR class resistance protein Fy1-Ry1 [Sesamum indicum]
Length=701

 Score = 56.2 bits (134),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 31/79 (39%), Positives = 43/79 (54%), Gaps = 0/79 (0%)
 Frame = -2

Query  747  LLLEDKTLEQWMVDDESFPNLEHLVLRFCYCLEEIPKAIEYISRLRSIELQWCTPSVCYS  568
            L++E   L  W  DD  FP LEHLV+R C  L EIP  I  I  L+ IE+  C  SV  S
Sbjct  619  LIMEKLNLVFWTADDICFPRLEHLVIRHCAHLNEIPSGIGDIPTLQVIEVHECKRSVLDS  678

Query  567  TKRIQDFRHEMADDLFELK  511
             + IQ+ +    ++  E++
Sbjct  679  ARMIQEEQESWGNEYLEVR  697



>gb|AGX27495.1| NBS-LRR class resistance protein Fy1-Ry1 [Sesamum indicum]
 gb|AGX27497.1| NBS-LRR class resistance protein Fy1-Ry1 [Sesamum indicum]
 gb|AGX27498.1| NBS-LRR class resistance protein Fy1-Ry1 [Sesamum indicum]
Length=701

 Score = 56.2 bits (134),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 31/79 (39%), Positives = 43/79 (54%), Gaps = 0/79 (0%)
 Frame = -2

Query  747  LLLEDKTLEQWMVDDESFPNLEHLVLRFCYCLEEIPKAIEYISRLRSIELQWCTPSVCYS  568
            L++E   L  W  DD  FP LEHLV+R C  L EIP  I  I  L+ IE+  C  SV  S
Sbjct  619  LIMEKLNLVFWTADDICFPRLEHLVIRHCAHLNEIPSGIGDIPTLQVIEVHECKRSVLDS  678

Query  567  TKRIQDFRHEMADDLFELK  511
             + IQ+ +    ++  E++
Sbjct  679  ARMIQEEQESWGNEYLEVR  697



>gb|AGX27492.1| NBS-LRR class resistance protein Fy1-Ry1 [Sesamum indicum]
Length=700

 Score = 56.2 bits (134),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 31/79 (39%), Positives = 43/79 (54%), Gaps = 0/79 (0%)
 Frame = -2

Query  747  LLLEDKTLEQWMVDDESFPNLEHLVLRFCYCLEEIPKAIEYISRLRSIELQWCTPSVCYS  568
            L++E   L  W  DD  FP LEHLV+R C  L EIP  I  I  L+ IE+  C  SV  S
Sbjct  618  LIMEKLNLVFWTADDICFPRLEHLVIRHCAHLNEIPSGIGDIPTLQVIEVHECKRSVLDS  677

Query  567  TKRIQDFRHEMADDLFELK  511
             + IQ+ +    ++  E++
Sbjct  678  ARMIQEEQESWGNEYLEVR  696



>gb|ABO92985.1| putative disease resistance protein [Solanum tuberosum]
Length=1264

 Score = 56.2 bits (134),  Expect = 9e-06, Method: Compositional matrix adjust.
 Identities = 33/70 (47%), Positives = 43/70 (61%), Gaps = 0/70 (0%)
 Frame = -2

Query  747   LLLEDKTLEQWMVDDESFPNLEHLVLRFCYCLEEIPKAIEYISRLRSIELQWCTPSVCYS  568
             L LED +L +W+V D++FPNLE LVLR C  L EIP     I  L+ IE++ C  SV  S
Sbjct  1148  LKLEDVSLMKWIVADDAFPNLEQLVLRGCQDLMEIPSCFMDILSLQYIEVEDCNESVVKS  1207

Query  567   TKRIQDFRHE  538
                IQ+ + E
Sbjct  1208  AMNIQETQVE  1217



>gb|EYU31598.1| hypothetical protein MIMGU_mgv1a018432mg [Erythranthe guttata]
Length=852

 Score = 56.2 bits (134),  Expect = 9e-06, Method: Compositional matrix adjust.
 Identities = 29/59 (49%), Positives = 35/59 (59%), Gaps = 0/59 (0%)
 Frame = -2

Query  732  KTLEQWMVDDESFPNLEHLVLRFCYCLEEIPKAIEYISRLRSIELQWCTPSVCYSTKRI  556
            + LE W  D   FP LEHL L+F   L+EIP  I  IS L+SI+L WC+ S   S K I
Sbjct  763  RDLEWWTTDSNHFPRLEHLHLQFLRKLKEIPSCIGEISTLQSIQLIWCSKSAVKSAKEI  821



>ref|XP_009591230.1| PREDICTED: putative late blight resistance protein homolog R1A-10 
[Nicotiana tomentosiformis]
 ref|XP_009591231.1| PREDICTED: putative late blight resistance protein homolog R1A-10 
[Nicotiana tomentosiformis]
Length=900

 Score = 56.2 bits (134),  Expect = 9e-06, Method: Compositional matrix adjust.
 Identities = 31/74 (42%), Positives = 42/74 (57%), Gaps = 0/74 (0%)
 Frame = -2

Query  747  LLLEDKTLEQWMVDDESFPNLEHLVLRFCYCLEEIPKAIEYISRLRSIELQWCTPSVCYS  568
            LL+    LEQW     +FP L+ LVL+ C  L++IP+ I  I  L SIEL  C+ S   S
Sbjct  817  LLIHKTDLEQWKAGSVNFPELQCLVLKECISLKKIPQDIGEIYTLESIELHNCSTSAENS  876

Query  567  TKRIQDFRHEMADD  526
             K+IQ  +  M +D
Sbjct  877  VKKIQKEQKSMGND  890



>emb|CDP11974.1| unnamed protein product [Coffea canephora]
Length=1481

 Score = 56.2 bits (134),  Expect = 9e-06, Method: Compositional matrix adjust.
 Identities = 29/84 (35%), Positives = 47/84 (56%), Gaps = 0/84 (0%)
 Frame = -2

Query  747   LLLEDKTLEQWMVDDESFPNLEHLVLRFCYCLEEIPKAIEYISRLRSIELQWCTPSVCYS  568
             L L++  + QW   ++  P L HLVL+ C  LEE+P ++  I  L  IE+ WC+ S   S
Sbjct  1397  LKLDNLWIAQWKASNDHLPCLRHLVLQRCKKLEEVPSSLGDIRTLERIEVHWCSQSAAVS  1456

Query  567   TKRIQDFRHEMADDLFELKIIGEE  496
              K I+D + ++ ++   + I G E
Sbjct  1457  VKEIEDEQRDIGNEELMVLISGME  1480



>ref|XP_011087329.1| PREDICTED: putative late blight resistance protein homolog R1B-16 
[Sesamum indicum]
Length=789

 Score = 56.2 bits (134),  Expect = 9e-06, Method: Compositional matrix adjust.
 Identities = 31/79 (39%), Positives = 43/79 (54%), Gaps = 0/79 (0%)
 Frame = -2

Query  747  LLLEDKTLEQWMVDDESFPNLEHLVLRFCYCLEEIPKAIEYISRLRSIELQWCTPSVCYS  568
            L++E   L  W  DD  FP LEHLV+R C  L EIP  I  I  L+ IE+  C  SV  S
Sbjct  707  LIMEKLNLVFWTADDICFPRLEHLVIRHCAHLNEIPSGIGDIPTLQVIEVHECKRSVLDS  766

Query  567  TKRIQDFRHEMADDLFELK  511
             + IQ+ +    ++  E++
Sbjct  767  ARMIQEEQESWGNEYLEVR  785



>gb|AGW28124.1| NBS-LRR class resistance protein Fy1-Ry1 [Sesamum indicum]
Length=701

 Score = 56.2 bits (134),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 31/79 (39%), Positives = 43/79 (54%), Gaps = 0/79 (0%)
 Frame = -2

Query  747  LLLEDKTLEQWMVDDESFPNLEHLVLRFCYCLEEIPKAIEYISRLRSIELQWCTPSVCYS  568
            L++E   L  W  DD  FP LEHLV+R C  L EIP  I  I  L+ IE+  C  SV  S
Sbjct  619  LIMEKLNLVFWTADDICFPRLEHLVIRHCAHLNEIPSGIGDIPTLQVIEVHECRRSVLDS  678

Query  567  TKRIQDFRHEMADDLFELK  511
             + IQ+ +    ++  E++
Sbjct  679  ARMIQEEQESWGNEYLEVR  697



>ref|XP_011077109.1| PREDICTED: putative late blight resistance protein homolog R1B-14 
[Sesamum indicum]
Length=760

 Score = 56.2 bits (134),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 28/89 (31%), Positives = 49/89 (55%), Gaps = 0/89 (0%)
 Frame = -2

Query  747  LLLEDKTLEQWMVDDESFPNLEHLVLRFCYCLEEIPKAIEYISRLRSIELQWCTPSVCYS  568
            LLL+   L+ W+ +   FPNL+ LVL  C+CL+EIP     I  L  I++     S+  S
Sbjct  670  LLLDKSDLQHWITESSHFPNLKCLVLYRCWCLKEIPDGFGEIPTLELIKVDDGNISLVDS  729

Query  567  TKRIQDFRHEMADDLFELKIIGEESIPAD  481
             ++IQ+ +    +D F++++    ++  D
Sbjct  730  ARQIQEVQQGWGNDAFQVRVGRYNTLTGD  758



>ref|XP_009786264.1| PREDICTED: putative late blight resistance protein homolog R1A-10 
isoform X2 [Nicotiana sylvestris]
Length=884

 Score = 56.2 bits (134),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 30/74 (41%), Positives = 41/74 (55%), Gaps = 0/74 (0%)
 Frame = -2

Query  747  LLLEDKTLEQWMVDDESFPNLEHLVLRFCYCLEEIPKAIEYISRLRSIELQWCTPSVCYS  568
            LL+    L+ W     +FP LE LVL+ CY LEEIP+ +  I  L SIEL  C+ S   S
Sbjct  799  LLISTINLKHWEASSVNFPRLERLVLKRCYYLEEIPQDLGEICTLASIELHECSISAAKS  858

Query  567  TKRIQDFRHEMADD  526
               IQ+ +  M ++
Sbjct  859  VNEIQEEQASMGNN  872



>gb|AAC32253.1| disease resistance gene homolog Mi-copy1 [Solanum lycopersicum]
Length=1204

 Score = 56.2 bits (134),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 32/81 (40%), Positives = 53/81 (65%), Gaps = 2/81 (2%)
 Frame = -2

Query  729   TLEQWMVDDESFPNLEHLVLRFCYCLEEIPKAIEYISRLRSIELQWCTPSVCYSTKRIQD  550
             ++ +W V +ESFPNLE L LR C+ LEEIP +   I  L+SI++   +P +  S  +I++
Sbjct  1123  SISKWEVGEESFPNLEKLKLRGCHKLEEIPPSFGDIYSLKSIKI-VKSPQLEDSALKIKE  1181

Query  549   FRHEMADDLFELKIIGEESIP  487
             +  +M     EL+I+G+++IP
Sbjct  1182  YAEDMRGG-DELQILGQKNIP  1201



>ref|NP_001234622.1| plant resistance protein [Solanum lycopersicum]
 gb|AAC67237.1| plant resistance protein [Solanum lycopersicum]
Length=1255

 Score = 56.2 bits (134),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 32/81 (40%), Positives = 53/81 (65%), Gaps = 2/81 (2%)
 Frame = -2

Query  729   TLEQWMVDDESFPNLEHLVLRFCYCLEEIPKAIEYISRLRSIELQWCTPSVCYSTKRIQD  550
             ++ +W V +ESFPNLE L LR C+ LEEIP +   I  L+SI++   +P +  S  +I++
Sbjct  1174  SISKWEVGEESFPNLEKLKLRGCHKLEEIPPSFGDIYSLKSIKI-VKSPQLEDSALKIKE  1232

Query  549   FRHEMADDLFELKIIGEESIP  487
             +  +M     EL+I+G+++IP
Sbjct  1233  YAEDMRGG-DELQILGQKNIP  1252



>ref|XP_009786258.1| PREDICTED: putative late blight resistance protein homolog R1A-10 
isoform X1 [Nicotiana sylvestris]
 ref|XP_009786259.1| PREDICTED: putative late blight resistance protein homolog R1A-10 
isoform X1 [Nicotiana sylvestris]
 ref|XP_009786260.1| PREDICTED: putative late blight resistance protein homolog R1A-10 
isoform X1 [Nicotiana sylvestris]
 ref|XP_009786261.1| PREDICTED: putative late blight resistance protein homolog R1A-10 
isoform X1 [Nicotiana sylvestris]
 ref|XP_009786262.1| PREDICTED: putative late blight resistance protein homolog R1A-10 
isoform X1 [Nicotiana sylvestris]
 ref|XP_009786263.1| PREDICTED: putative late blight resistance protein homolog R1A-10 
isoform X1 [Nicotiana sylvestris]
Length=884

 Score = 55.8 bits (133),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 30/74 (41%), Positives = 41/74 (55%), Gaps = 0/74 (0%)
 Frame = -2

Query  747  LLLEDKTLEQWMVDDESFPNLEHLVLRFCYCLEEIPKAIEYISRLRSIELQWCTPSVCYS  568
            LL+    L+ W     +FP LE LVL+ CY LEEIP+ +  I  L SIEL  C+ S   S
Sbjct  799  LLISTINLKHWEASSVNFPRLERLVLKRCYYLEEIPQDLGEICTLASIELHECSISAAKS  858

Query  567  TKRIQDFRHEMADD  526
               IQ+ +  M ++
Sbjct  859  VNEIQEEQASMGNN  872



>sp|Q60CZ8.1|R1A10_SOLDE RecName: Full=Putative late blight resistance protein homolog 
R1A-10 [Solanum demissum]
 sp|Q6L438.2|R1A6_SOLDE RecName: Full=Putative late blight resistance protein homolog 
R1A-6 [Solanum demissum]
 gb|AAU93589.1| Putative late blight resistance protein, identical [Solanum demissum]
 gb|AAT39944.2| Putative late blight resistance protein, identical [Solanum demissum]
Length=1306

 Score = 55.8 bits (133),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 33/70 (47%), Positives = 43/70 (61%), Gaps = 0/70 (0%)
 Frame = -2

Query  747   LLLEDKTLEQWMVDDESFPNLEHLVLRFCYCLEEIPKAIEYISRLRSIELQWCTPSVCYS  568
             L LED +L +W+V D++FPNLE LVLR C  L EIP     I  L+ IE++ C  SV  S
Sbjct  1162  LKLEDVSLMKWIVADDAFPNLEQLVLRGCQDLMEIPSCFMDILSLQYIEVEDCNESVVKS  1221

Query  567   TKRIQDFRHE  538
                IQ+ + E
Sbjct  1222  AMNIQETQVE  1231



>gb|ABO93000.1| putative disease resistance protein [Solanum tuberosum]
Length=1305

 Score = 55.8 bits (133),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 33/70 (47%), Positives = 43/70 (61%), Gaps = 0/70 (0%)
 Frame = -2

Query  747   LLLEDKTLEQWMVDDESFPNLEHLVLRFCYCLEEIPKAIEYISRLRSIELQWCTPSVCYS  568
             L LED +L +W+V D++FPNLE LVLR C  L EIP     I  L+ IE++ C  SV  S
Sbjct  1162  LKLEDVSLMKWIVADDAFPNLEQLVLRGCQDLMEIPSCFMDILSLQYIEVEDCNESVVKS  1221

Query  567   TKRIQDFRHE  538
                IQ+ + E
Sbjct  1222  AMNIQETQVE  1231



>ref|XP_006349899.1| PREDICTED: putative late blight resistance protein homolog R1A-10-like 
[Solanum tuberosum]
Length=413

 Score = 55.5 bits (132),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 34/87 (39%), Positives = 52/87 (60%), Gaps = 2/87 (2%)
 Frame = -2

Query  726  LEQWMVDDESFPNLEHLVLRFCYCLEEIPKAIEYISRLRSIELQWCTPSVCYSTKRIQDF  547
             E+W V D++FPNLEHLVLR C  L+EIP     IS L+SI ++ C  +V  S   I++ 
Sbjct  327  FEEWFVADDAFPNLEHLVLRDCKFLKEIPSWFGEISSLKSIAVRNCNENVDKSASDIRET  386

Query  546  RHE-MADDLFELKIIGEESIPADDEWQ  469
            + E   +  FE+  I  E+  +D +++
Sbjct  387  QVEDYQNSKFEV-FITRENNKSDSDYE  412



>ref|XP_009761980.1| PREDICTED: putative late blight resistance protein homolog R1A-10 
isoform X1 [Nicotiana sylvestris]
Length=766

 Score = 55.8 bits (133),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 28/72 (39%), Positives = 41/72 (57%), Gaps = 0/72 (0%)
 Frame = -2

Query  726  LEQWMVDDESFPNLEHLVLRFCYCLEEIPKAIEYISRLRSIELQWCTPSVCYSTKRIQDF  547
            L  W    ES P LE+LVLR CY L+EIP  I  I  L+ IEL +C+ S   S + I D 
Sbjct  689  LVHWHATSESLPVLEYLVLRHCYKLKEIPTEIGDIPTLKLIELHYCSQSAVTSAEEILDE  748

Query  546  RHEMADDLFELK  511
            +  + +++  ++
Sbjct  749  QQSLGNEVLAVR  760



>gb|ABI96216.1| NBS-LRR resistance protein-like protein [Solanum lycopersicum]
Length=1244

 Score = 55.8 bits (133),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 34/81 (42%), Positives = 50/81 (62%), Gaps = 2/81 (2%)
 Frame = -2

Query  729   TLEQWMVDDESFPNLEHLVLRFCYCLEEIPKAIEYISRLRSIELQWCTPSVCYSTKRIQD  550
             TL  W V +ESFPNLE L LR C  LEEIP +   I  L+ I++   +P +  S  +I++
Sbjct  1163  TLSNWEVGEESFPNLEKLKLRGCGELEEIPPSFGDIYSLKIIKI-VNSPQLEDSALKIKE  1221

Query  549   FRHEMADDLFELKIIGEESIP  487
             +  EM     EL+I+G+++IP
Sbjct  1222  YAEEMRGG-GELQILGQKNIP  1241



>ref|XP_011075662.1| PREDICTED: putative late blight resistance protein homolog R1A-10 
[Sesamum indicum]
Length=738

 Score = 55.8 bits (133),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 33/80 (41%), Positives = 48/80 (60%), Gaps = 2/80 (3%)
 Frame = -2

Query  747  LLLEDKTLEQWMVDDESFPNLEHLVLRFCYCLEEIPKAIEYISRLRSIELQWCTPSVCYS  568
            LLLE+  L QW+ ++  FP L+ LV+R CY L+EIP  I  I  L  IEL  C  S   S
Sbjct  643  LLLEEVDLVQWVANETHFPCLQRLVIRSCYKLKEIPSGIGEIPTLELIELVDCHHSAVTS  702

Query  567  TKRIQDFRHEMADDLFELKI  508
             ++IQ+ +  + ++  ELK+
Sbjct  703  AEKIQEEQEGLGNE--ELKV  720



>ref|XP_009761982.1| PREDICTED: putative late blight resistance protein homolog R1A-10 
isoform X2 [Nicotiana sylvestris]
Length=741

 Score = 55.8 bits (133),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 28/72 (39%), Positives = 41/72 (57%), Gaps = 0/72 (0%)
 Frame = -2

Query  726  LEQWMVDDESFPNLEHLVLRFCYCLEEIPKAIEYISRLRSIELQWCTPSVCYSTKRIQDF  547
            L  W    ES P LE+LVLR CY L+EIP  I  I  L+ IEL +C+ S   S + I D 
Sbjct  664  LVHWHATSESLPVLEYLVLRHCYKLKEIPTEIGDIPTLKLIELHYCSQSAVTSAEEILDE  723

Query  546  RHEMADDLFELK  511
            +  + +++  ++
Sbjct  724  QQSLGNEVLAVR  735



>ref|XP_009791056.1| PREDICTED: putative late blight resistance protein homolog R1B-16 
isoform X2 [Nicotiana sylvestris]
Length=1101

 Score = 55.8 bits (133),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 28/64 (44%), Positives = 42/64 (66%), Gaps = 0/64 (0%)
 Frame = -2

Query  747   LLLEDKTLEQWMVDDESFPNLEHLVLRFCYCLEEIPKAIEYISRLRSIELQWCTPSVCYS  568
             L L+D  +  W+V+D++FPNL+HL+L  C  L+EIP     IS L+SI+++ C  SV  S
Sbjct  1007  LELDDLRIGGWIVEDDAFPNLQHLILLECKSLKEIPSCFGDISSLKSIKVEECNESVNKS  1066

Query  567   TKRI  556
              + I
Sbjct  1067  ARDI  1070



>ref|XP_009791054.1| PREDICTED: putative late blight resistance protein homolog R1A-10 
isoform X1 [Nicotiana sylvestris]
 ref|XP_009791055.1| PREDICTED: putative late blight resistance protein homolog R1A-10 
isoform X1 [Nicotiana sylvestris]
Length=1135

 Score = 55.8 bits (133),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 28/64 (44%), Positives = 42/64 (66%), Gaps = 0/64 (0%)
 Frame = -2

Query  747   LLLEDKTLEQWMVDDESFPNLEHLVLRFCYCLEEIPKAIEYISRLRSIELQWCTPSVCYS  568
             L L+D  +  W+V+D++FPNL+HL+L  C  L+EIP     IS L+SI+++ C  SV  S
Sbjct  1041  LELDDLRIGGWIVEDDAFPNLQHLILLECKSLKEIPSCFGDISSLKSIKVEECNESVNKS  1100

Query  567   TKRI  556
              + I
Sbjct  1101  ARDI  1104



>ref|XP_009773003.1| PREDICTED: protein CHUP1, chloroplastic-like [Nicotiana sylvestris]
Length=358

 Score = 55.1 bits (131),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 28/70 (40%), Positives = 40/70 (57%), Gaps = 0/70 (0%)
 Frame = -2

Query  729  TLEQWMVDDESFPNLEHLVLRFCYCLEEIPKAIEYISRLRSIELQWCTPSVCYSTKRIQD  550
             L QW    +S PNLE LV+R CY L+EIP  I  I  L+ IEL  C+ +V  S + I +
Sbjct  44   NLVQWKATSDSLPNLECLVIRHCYKLKEIPAEIGDIPTLKLIELHHCSQAVVTSAEEILE  103

Query  549  FRHEMADDLF  520
             +  M +++ 
Sbjct  104  EQQSMGNEVL  113



>gb|ADH94052.1| putative disease resistance protein R1 [Solanum stoloniferum]
Length=324

 Score = 55.1 bits (131),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 35/82 (43%), Positives = 50/82 (61%), Gaps = 1/82 (1%)
 Frame = -2

Query  747  LLLEDKTLEQWMVDDESFPNLEHLVLRFCYCLEEIPKAIEYISRLRSIELQWCTPSVCYS  568
            L LE  +L +W+V D++FPNLE LVLR C  L EIP     I  L+ IE+++C  SV  S
Sbjct  242  LKLEYLSLVKWIVADDAFPNLEQLVLRGCQDLMEIPSCFMDILSLKYIEVEYCNESVVKS  301

Query  567  TKRIQDFRHEMADDL-FELKII  505
               IQ+ + E   ++ F+L +I
Sbjct  302  ALNIQETQVEDNQNINFKLVLI  323



>ref|XP_006364072.1| PREDICTED: putative late blight resistance protein homolog R1A-10-like 
[Solanum tuberosum]
Length=584

 Score = 55.5 bits (132),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 30/71 (42%), Positives = 40/71 (56%), Gaps = 0/71 (0%)
 Frame = -2

Query  738  EDKTLEQWMVDDESFPNLEHLVLRFCYCLEEIPKAIEYISRLRSIELQWCTPSVCYSTKR  559
            E+  L QW      FPNLEHLVL  CY LE++P     I  L+ IEL  C  SV  S ++
Sbjct  503  ENMNLMQWEATSYHFPNLEHLVLTDCYLLEQMPFDFAEIQTLQLIELHKCKCSVLVSAEQ  562

Query  558  IQDFRHEMADD  526
            IQ+ +  + +D
Sbjct  563  IQEEQQSLGND  573



>ref|XP_009787864.1| PREDICTED: LOW QUALITY PROTEIN: late blight resistance protein 
R1-A-like [Nicotiana sylvestris]
Length=1261

 Score = 55.8 bits (133),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 32/64 (50%), Positives = 41/64 (64%), Gaps = 1/64 (2%)
 Frame = -2

Query  726   LEQW-MVDDESFPNLEHLVLRFCYCLEEIPKAIEYISRLRSIELQWCTPSVCYSTKRIQD  550
              E+W + DDE+FP LE LVLR C  LEEIP A   IS L+ IE++ C  SV  S + I+D
Sbjct  1179  FEEWDVADDEAFPKLEXLVLRECEYLEEIPSAFGEISSLKYIEVRKCYESVDKSARDIRD  1238

Query  549   FRHE  538
              + E
Sbjct  1239  IKVE  1242



>emb|CDP00737.1| unnamed protein product [Coffea canephora]
Length=1006

 Score = 55.5 bits (132),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 28/65 (43%), Positives = 38/65 (58%), Gaps = 0/65 (0%)
 Frame = -2

Query  747  LLLEDKTLEQWMVDDESFPNLEHLVLRFCYCLEEIPKAIEYISRLRSIELQWCTPSVCYS  568
             L++   LE W    ++FP LEHLVLR C  L+ IP  IE I+ L+  EL +C+ S   S
Sbjct  930  FLIDSTNLENWEASSDNFPCLEHLVLRGCKFLKGIPDGIEEINTLQRFELHYCSESAEIS  989

Query  567  TKRIQ  553
             K I+
Sbjct  990  AKGIE  994



>ref|XP_004240498.1| PREDICTED: putative late blight resistance protein homolog R1A-3 
[Solanum lycopersicum]
 gb|ABI96214.1| NBS-LRR resistance protein-like protein [Solanum lycopersicum]
Length=1251

 Score = 55.5 bits (132),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 34/81 (42%), Positives = 51/81 (63%), Gaps = 2/81 (2%)
 Frame = -2

Query  729   TLEQWMVDDESFPNLEHLVLRFCYCLEEIPKAIEYISRLRSIELQWCTPSVCYSTKRIQD  550
             TL +W V +ESFPNLE L LR C  LEEIP +   I  L+ I++   +P +  S  +I++
Sbjct  1170  TLSKWEVGEESFPNLEKLKLRGCGELEEIPPSFGDIYSLKFIKI-VKSPQLEDSALKIKE  1228

Query  549   FRHEMADDLFELKIIGEESIP  487
             +  EM     EL+I+G+++IP
Sbjct  1229  YAEEMRGG-GELQILGQKNIP  1248



>ref|XP_004248175.2| PREDICTED: putative late blight resistance protein homolog R1B-14 
[Solanum lycopersicum]
Length=887

 Score = 55.5 bits (132),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 28/76 (37%), Positives = 42/76 (55%), Gaps = 2/76 (3%)
 Frame = -2

Query  729  TLEQWMVDDESFPNLEHLVLRFCYCLEEIPKAIEYISRLRSIELQWCTPSVCYSTKRIQD  550
             LE W      FP L+ + L+ C  L EIP  +  +S L++IEL W TP+   S + IQ 
Sbjct  807  NLEHWNASGHHFPRLQQVFLKHCSSLNEIPFGLVEVSSLQNIELFWPTPAAAASARIIQQ  866

Query  549  FRHE--MADDLFELKI  508
             + E  + D++F+L I
Sbjct  867  EKQEGDIKDNVFKLVI  882



>gb|ADH94054.1| putative disease resistance protein R1 [Solanum stoloniferum]
Length=324

 Score = 55.1 bits (131),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 35/82 (43%), Positives = 50/82 (61%), Gaps = 1/82 (1%)
 Frame = -2

Query  747  LLLEDKTLEQWMVDDESFPNLEHLVLRFCYCLEEIPKAIEYISRLRSIELQWCTPSVCYS  568
            L LE  +L +W+V D++FPNLE LVLR C  L EIP     I  L+ IE+++C  SV  S
Sbjct  242  LKLEYLSLVKWIVADDAFPNLEQLVLRGCQDLMEIPSCFMDILSLKYIEVEYCNESVVKS  301

Query  567  TKRIQDFRHEMADDL-FELKII  505
               IQ+ + E + +  F+L +I
Sbjct  302  ALNIQETQVEDSQNTNFKLVLI  323



>ref|XP_009772163.1| PREDICTED: putative late blight resistance protein homolog R1B-8 
isoform X3 [Nicotiana sylvestris]
 ref|XP_009772164.1| PREDICTED: putative late blight resistance protein homolog R1B-8 
isoform X3 [Nicotiana sylvestris]
Length=1547

 Score = 55.5 bits (132),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 34/79 (43%), Positives = 47/79 (59%), Gaps = 2/79 (3%)
 Frame = -2

Query  747   LLLEDKTLEQWMVDDESFPNLEHLVLRFCYCLEEIPKAIEYISRLRSIELQWCTPSVCYS  568
             L L+   L +W V +ESFP LE L LR C  LEEIP +   I  L+SIEL+W +P +  S
Sbjct  1466  LTLQRVNLAKWEVREESFPALEKLRLRDCRKLEEIPSSFGDICSLKSIELKW-SPQLEES  1524

Query  567   TKRI-QDFRHEMADDLFEL  514
              ++I QD    M +D  ++
Sbjct  1525  ARKIKQDVEDTMGEDRIQV  1543



>ref|XP_009772161.1| PREDICTED: putative late blight resistance protein homolog R1B-8 
isoform X1 [Nicotiana sylvestris]
Length=1599

 Score = 55.5 bits (132),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 34/79 (43%), Positives = 47/79 (59%), Gaps = 2/79 (3%)
 Frame = -2

Query  747   LLLEDKTLEQWMVDDESFPNLEHLVLRFCYCLEEIPKAIEYISRLRSIELQWCTPSVCYS  568
             L L+   L +W V +ESFP LE L LR C  LEEIP +   I  L+SIEL+W +P +  S
Sbjct  1518  LTLQRVNLAKWEVREESFPALEKLRLRDCRKLEEIPSSFGDICSLKSIELKW-SPQLEES  1576

Query  567   TKRI-QDFRHEMADDLFEL  514
              ++I QD    M +D  ++
Sbjct  1577  ARKIKQDVEDTMGEDRIQV  1595



>ref|XP_009772162.1| PREDICTED: putative late blight resistance protein homolog R1B-8 
isoform X2 [Nicotiana sylvestris]
Length=1598

 Score = 55.5 bits (132),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 34/79 (43%), Positives = 47/79 (59%), Gaps = 2/79 (3%)
 Frame = -2

Query  747   LLLEDKTLEQWMVDDESFPNLEHLVLRFCYCLEEIPKAIEYISRLRSIELQWCTPSVCYS  568
             L L+   L +W V +ESFP LE L LR C  LEEIP +   I  L+SIEL+W +P +  S
Sbjct  1517  LTLQRVNLAKWEVREESFPALEKLRLRDCRKLEEIPSSFGDICSLKSIELKW-SPQLEES  1575

Query  567   TKRI-QDFRHEMADDLFEL  514
              ++I QD    M +D  ++
Sbjct  1576  ARKIKQDVEDTMGEDRIQV  1594



>gb|EYU17693.1| hypothetical protein MIMGU_mgv1a001245mg [Erythranthe guttata]
Length=855

 Score = 55.5 bits (132),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 28/66 (42%), Positives = 39/66 (59%), Gaps = 2/66 (3%)
 Frame = -2

Query  747  LLLEDKTLEQWMVDDESFPNLEHLVLRFCYCLEEIPKAIEYISRLRSIELQWCTPSVCYS  568
            LL+ED  L QW V   SFP L+ L ++ CY L E+P  +E+   LR I+L  C P V   
Sbjct  769  LLIEDADLAQWSVGSGSFPKLKSLTMKHCYKLRELP--VEFAKSLRKIDLIECNPLVLTC  826

Query  567  TKRIQD  550
             K+I++
Sbjct  827  AKKIKE  832



>gb|ABO93011.1| putative disease resistance protein [Solanum tuberosum]
Length=1294

 Score = 55.5 bits (132),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 43/122 (35%), Positives = 69/122 (57%), Gaps = 14/122 (11%)
 Frame = -2

Query  729   TLEQWMVDDESFPNLEHLVLRFCYCLEEIPKAIEYISRLRSIELQWCTPSVCYSTKRIQD  550
             +L++W+V D++FPNLE LVL  C  L+EIP  +  I  L+ IE++ C  SV  S   IQ+
Sbjct  1153  SLKKWIVADDAFPNLEQLVLCGCQDLKEIPSCLMDILSLKYIEVENCNESVVKSAMNIQE  1212

Query  549   FRHE-MADDLFELKII-----------GEESIPADDEWQAKIKIIGE-DSEES*YLNDKL  409
              + E   +  F+L +I           G ES+ + DE + K+ + G+ D++E   + +KL
Sbjct  1213  TQVEDYQNTNFKLVLIKIHLFCLFDMKGIESV-SSDEKEKKLTVTGDVDADEGQLVVEKL  1271

Query  408   AK  403
              K
Sbjct  1272  RK  1273



>gb|ADH94053.1| putative disease resistance protein R1 [Solanum stoloniferum]
Length=324

 Score = 55.1 bits (131),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 32/70 (46%), Positives = 43/70 (61%), Gaps = 0/70 (0%)
 Frame = -2

Query  747  LLLEDKTLEQWMVDDESFPNLEHLVLRFCYCLEEIPKAIEYISRLRSIELQWCTPSVCYS  568
            L LE  +L +W+V D++FPNLE LVLR C  L EIP     I  L+ IE+++C  SV  S
Sbjct  242  LKLEYLSLVKWIVADDAFPNLEQLVLRGCQDLMEIPSCFMDILSLKYIEVEYCNESVVKS  301

Query  567  TKRIQDFRHE  538
               IQ+ + E
Sbjct  302  ALNIQETQVE  311



>gb|EYU21105.1| hypothetical protein MIMGU_mgv1a021133mg [Erythranthe guttata]
Length=913

 Score = 55.5 bits (132),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 27/81 (33%), Positives = 46/81 (57%), Gaps = 0/81 (0%)
 Frame = -2

Query  747  LLLEDKTLEQWMVDDESFPNLEHLVLRFCYCLEEIPKAIEYISRLRSIELQWCTPSVCYS  568
            L++E+  L  W+ +   FPNL+ LV+R C  L EIP  I  I+ L  IE++     +  S
Sbjct  832  LMIEESDLRNWITESSHFPNLKWLVIRRCRYLREIPDGIGEIATLELIEVEMRNKYLVES  891

Query  567  TKRIQDFRHEMADDLFELKII  505
             KRIQ+ +  + +D  +++ +
Sbjct  892  AKRIQEEQESLGNDALQVRFV  912



>ref|XP_011075016.1| PREDICTED: putative late blight resistance protein homolog R1C-3 
[Sesamum indicum]
Length=860

 Score = 55.5 bits (132),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 28/81 (35%), Positives = 47/81 (58%), Gaps = 0/81 (0%)
 Frame = -2

Query  747  LLLEDKTLEQWMVDDESFPNLEHLVLRFCYCLEEIPKAIEYISRLRSIELQWCTPSVCYS  568
            LL++   L  W  DD  FP LE LV+++C+ L+EIP AI  I  L+ +E+  C  S   S
Sbjct  779  LLMKGLKLVNWTADDTHFPRLEELVIQYCFELKEIPLAIGDIPTLKVMEVLRCGDSAKAS  838

Query  567  TKRIQDFRHEMADDLFELKII  505
             + I + + +  +D  +++I+
Sbjct  839  AREIMEAQVDNGNDELQVRIL  859



>ref|XP_011089745.1| PREDICTED: putative late blight resistance protein homolog R1A-10 
[Sesamum indicum]
Length=894

 Score = 55.1 bits (131),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 29/81 (36%), Positives = 47/81 (58%), Gaps = 0/81 (0%)
 Frame = -2

Query  747  LLLEDKTLEQWMVDDESFPNLEHLVLRFCYCLEEIPKAIEYISRLRSIELQWCTPSVCYS  568
            LL+E+     W  D   FP+L+ LVLR C+ L EIP+ I  I+ L+ IE+Q C+  +  S
Sbjct  795  LLVENSDPMSWDADASHFPSLQQLVLRECHRLTEIPQGIGDITTLQMIEVQDCSFYIVRS  854

Query  567  TKRIQDFRHEMADDLFELKII  505
             ++I   +  + +D   ++II
Sbjct  855  ARKIHQQQQILGNDELGIRII  875



>ref|XP_009763533.1| PREDICTED: putative late blight resistance protein homolog R1B-12 
[Nicotiana sylvestris]
 ref|XP_009763534.1| PREDICTED: putative late blight resistance protein homolog R1B-12 
[Nicotiana sylvestris]
 ref|XP_009763535.1| PREDICTED: putative late blight resistance protein homolog R1B-12 
[Nicotiana sylvestris]
 ref|XP_009763536.1| PREDICTED: putative late blight resistance protein homolog R1B-12 
[Nicotiana sylvestris]
 ref|XP_009763537.1| PREDICTED: putative late blight resistance protein homolog R1B-12 
[Nicotiana sylvestris]
 ref|XP_009763538.1| PREDICTED: putative late blight resistance protein homolog R1B-12 
[Nicotiana sylvestris]
 ref|XP_009763539.1| PREDICTED: putative late blight resistance protein homolog R1B-12 
[Nicotiana sylvestris]
 ref|XP_009763540.1| PREDICTED: putative late blight resistance protein homolog R1B-12 
[Nicotiana sylvestris]
Length=1747

 Score = 55.1 bits (131),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 31/80 (39%), Positives = 46/80 (58%), Gaps = 5/80 (6%)
 Frame = -2

Query  741   LEDKTLEQWMVDDESFPNLEHLVLRFCYCLEEIPKAIEYISRLRSIELQWCT-PSVCYST  565
             L+D  + +W V +++FP LEHLVL  C  L+EIP   +    LR IE+ WC+ P+   S 
Sbjct  1660  LDDLNIARWSVSEDAFPMLEHLVLTKCKKLKEIPSQFDNAISLRRIEVNWCSWPN---SA  1716

Query  564   KRIQDFRHE-MADDLFELKI  508
             + IQ   HE M +D   + +
Sbjct  1717  QEIQRTHHEDMTNDALTIAV  1736



>emb|CDP16510.1| unnamed protein product [Coffea canephora]
Length=1418

 Score = 55.1 bits (131),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 28/75 (37%), Positives = 41/75 (55%), Gaps = 0/75 (0%)
 Frame = -2

Query  747   LLLEDKTLEQWMVDDESFPNLEHLVLRFCYCLEEIPKAIEYISRLRSIELQWCTPSVCYS  568
             L L+   L +W    +  P L+HL+LR C  L+E+P     I  L  IE+Q CT SV  S
Sbjct  1333  LKLDSLNLAEWNASSDHLPQLQHLILRSCRQLKEVPSGFGEICTLEMIEVQLCTRSVGKS  1392

Query  567   TKRIQDFRHEMADDL  523
              +R+Q    +M ++L
Sbjct  1393  VRRLQTESLDMGNEL  1407



>ref|XP_006364074.1| PREDICTED: putative late blight resistance protein homolog R1A-4-like 
[Solanum tuberosum]
Length=761

 Score = 55.1 bits (131),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 30/71 (42%), Positives = 39/71 (55%), Gaps = 0/71 (0%)
 Frame = -2

Query  738  EDKTLEQWMVDDESFPNLEHLVLRFCYCLEEIPKAIEYISRLRSIELQWCTPSVCYSTKR  559
            E   LEQW      FP+LEHLVL  C+ LE+IP     I  L+ IEL  C  SV  S ++
Sbjct  672  EHMHLEQWEATSYHFPSLEHLVLTHCHSLEQIPFDFAEIQTLQLIELHNCMRSVLVSAEQ  731

Query  558  IQDFRHEMADD  526
            IQ+ +    +D
Sbjct  732  IQEEQQSFGND  742



>gb|EYU21847.1| hypothetical protein MIMGU_mgv1a017843mg, partial [Erythranthe 
guttata]
Length=857

 Score = 55.1 bits (131),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 30/81 (37%), Positives = 45/81 (56%), Gaps = 0/81 (0%)
 Frame = -2

Query  732  KTLEQWMVDDESFPNLEHLVLRFCYCLEEIPKAIEYISRLRSIELQWCTPSVCYSTKRIQ  553
            + LE W  D   FP LEHL LR+ + L+EIP  I  IS L+SIEL  C+     S K+I 
Sbjct  773  RDLEWWTTDSSHFPRLEHLHLRYLHKLKEIPSCIGEISTLQSIELISCSKLAVISAKQIL  832

Query  552  DFRHEMADDLFELKIIGEESI  490
              + +  ++ F +++    S+
Sbjct  833  KEQEDFGNEDFRVQVFDTMSL  853



>emb|CDP16512.1| unnamed protein product [Coffea canephora]
Length=907

 Score = 55.1 bits (131),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 31/85 (36%), Positives = 48/85 (56%), Gaps = 3/85 (4%)
 Frame = -2

Query  747  LLLEDKTLEQWMVDDESFPNLEHLVLRFCYCLEEIPKAIEYISRLRSIELQWCTPSVCYS  568
            L L+  ++ +W    +  P L+HL+LR C  L+E+P      S L  IE+Q CT SV  S
Sbjct  808  LKLDTLSIAEWKSSSDHLPQLQHLILRNCRQLKEVPSGFGDSSSLEMIEVQLCTRSVEES  867

Query  567  TKRIQDFRHEMADDLFELKIIGEES  493
             + +Q  +HEM +   ELK++ + S
Sbjct  868  VRLLQKEQHEMGN---ELKVLVDRS  889



>ref|XP_009770726.1| PREDICTED: putative late blight resistance protein homolog R1A-10 
[Nicotiana sylvestris]
 ref|XP_009770727.1| PREDICTED: putative late blight resistance protein homolog R1A-10 
[Nicotiana sylvestris]
 ref|XP_009770728.1| PREDICTED: putative late blight resistance protein homolog R1A-10 
[Nicotiana sylvestris]
 ref|XP_009770729.1| PREDICTED: putative late blight resistance protein homolog R1A-10 
[Nicotiana sylvestris]
Length=914

 Score = 54.7 bits (130),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 32/80 (40%), Positives = 45/80 (56%), Gaps = 0/80 (0%)
 Frame = -2

Query  747  LLLEDKTLEQWMVDDESFPNLEHLVLRFCYCLEEIPKAIEYISRLRSIELQWCTPSVCYS  568
            LL+E   L+ W   D++FP LE L+ R C  LEEIP    YI  L+ IEL  CT  +  S
Sbjct  817  LLIEHCDLKYWKATDDNFPVLERLLFRHCRSLEEIPIVFAYIDSLQLIELTNCTTELEAS  876

Query  567  TKRIQDFRHEMADDLFELKI  508
              RIQ+ + E+     +++I
Sbjct  877  AVRIQEEQEELGIKPVDVRI  896



>ref|XP_009602415.1| PREDICTED: putative late blight resistance protein homolog R1B-16 
isoform X1 [Nicotiana tomentosiformis]
 ref|XP_009602416.1| PREDICTED: putative late blight resistance protein homolog R1B-16 
isoform X1 [Nicotiana tomentosiformis]
 ref|XP_009602417.1| PREDICTED: putative late blight resistance protein homolog R1B-16 
isoform X1 [Nicotiana tomentosiformis]
 ref|XP_009602418.1| PREDICTED: putative late blight resistance protein homolog R1B-16 
isoform X1 [Nicotiana tomentosiformis]
Length=935

 Score = 54.7 bits (130),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 33/75 (44%), Positives = 44/75 (59%), Gaps = 3/75 (4%)
 Frame = -2

Query  747  LLLEDKTLEQWMVDDESFPNLEHLVLRFCYCLEEIPKAIEYISRLRSIELQWCTPSVCYS  568
            LL+E   L+ W   +++FP LE LV+R C  LE+IP    YI  L+ IEL  CTP +  S
Sbjct  825  LLIEYNDLKYWNSPNDNFPVLERLVIRDCSELEDIPIDFAYIDSLQQIELTDCTPELEAS  884

Query  567  TKRIQDFRHEMADDL  523
              RIQ   HE  ++L
Sbjct  885  AARIQ---HEQEENL  896



>ref|XP_006367619.1| PREDICTED: putative late blight resistance protein homolog R1C-3-like 
[Solanum tuberosum]
Length=93

 Score = 51.2 bits (121),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 28/61 (46%), Positives = 37/61 (61%), Gaps = 0/61 (0%)
 Frame = -2

Query  720  QWMVDDESFPNLEHLVLRFCYCLEEIPKAIEYISRLRSIELQWCTPSVCYSTKRIQDFRH  541
            +W+V D++FPNLE LVLR C  L EIP     I  L+ IE++ C  SV  S   IQ+ + 
Sbjct  2    KWIVADDAFPNLEQLVLRGCRDLMEIPSCFMDILPLQYIEVENCNESVVKSAMNIQETQV  61

Query  540  E  538
            E
Sbjct  62   E  62



>ref|XP_009602420.1| PREDICTED: putative late blight resistance protein homolog R1B-16 
isoform X3 [Nicotiana tomentosiformis]
Length=916

 Score = 54.7 bits (130),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 33/75 (44%), Positives = 44/75 (59%), Gaps = 3/75 (4%)
 Frame = -2

Query  747  LLLEDKTLEQWMVDDESFPNLEHLVLRFCYCLEEIPKAIEYISRLRSIELQWCTPSVCYS  568
            LL+E   L+ W   +++FP LE LV+R C  LE+IP    YI  L+ IEL  CTP +  S
Sbjct  825  LLIEYNDLKYWNSPNDNFPVLERLVIRDCSELEDIPIDFAYIDSLQQIELTDCTPELEAS  884

Query  567  TKRIQDFRHEMADDL  523
              RIQ   HE  ++L
Sbjct  885  AARIQ---HEQEENL  896



>emb|CDP18682.1| unnamed protein product [Coffea canephora]
Length=1077

 Score = 54.7 bits (130),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 29/79 (37%), Positives = 42/79 (53%), Gaps = 2/79 (3%)
 Frame = -2

Query  732   KTLEQWMVDDESFPNLEHLVLRFCYCLEEIPKAIEYISRLRSIELQWCTPSVCYSTKRIQ  553
             +    W    ++FP LE LV+  C  LEE+P  +     L  IE+ WC  SV  S K+IQ
Sbjct  979   RDFRSWTASSDNFPRLEKLVVHNCQMLEEVPSCLGECPTLEMIEVTWCRESVASSVKQIQ  1038

Query  552   DFRHEMADDLFELKIIGEE  496
               + +M ++   LKI+ EE
Sbjct  1039  QAQKDMGNEF--LKILIEE  1055



>ref|XP_009764213.1| PREDICTED: putative late blight resistance protein homolog R1A-3 
[Nicotiana sylvestris]
 ref|XP_009764214.1| PREDICTED: putative late blight resistance protein homolog R1A-3 
[Nicotiana sylvestris]
 ref|XP_009764215.1| PREDICTED: putative late blight resistance protein homolog R1A-3 
[Nicotiana sylvestris]
 ref|XP_009764216.1| PREDICTED: putative late blight resistance protein homolog R1A-3 
[Nicotiana sylvestris]
 ref|XP_009764217.1| PREDICTED: putative late blight resistance protein homolog R1A-3 
[Nicotiana sylvestris]
Length=173

 Score = 52.4 bits (124),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 32/90 (36%), Positives = 51/90 (57%), Gaps = 3/90 (3%)
 Frame = -2

Query  747  LLLEDKTLEQWMVDDESFPNLEHLVLRFCYCLEEIPKAIEYISRLRSIELQWCTPSVCYS  568
            LLLE   L  W   D+ FP LE +++R C+ ++EIP+       L+ IEL  C+ S+  S
Sbjct  44   LLLEWLYLHYWRATDDYFPRLERIIIRSCFFIKEIPEGFADSMTLQLIELHQCSSSLVNS  103

Query  567  TKRIQDFRHE-MADDLFELKIIGEESIPAD  481
             KRIQ  + E + +D+  LK+   ++I  +
Sbjct  104  AKRIQKEQLENLGNDM--LKVYAYDTISEN  131



>ref|XP_009791923.1| PREDICTED: putative late blight resistance protein homolog R1B-12 
[Nicotiana sylvestris]
Length=695

 Score = 54.3 bits (129),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 28/81 (35%), Positives = 51/81 (63%), Gaps = 1/81 (1%)
 Frame = -2

Query  747  LLLEDKTLEQWMVDDESFPNLEHLVLRFCYCLEEIPKAIEYISRLRSIELQWCTPSVCYS  568
            L L+D  + +W   D+SFPNLE +++R+C+ LEEIP++      ++ IE++ C  SV  +
Sbjct  613  LKLKDLPISEWTASDDSFPNLEKVLVRWCWNLEEIPESFGSKCTMQMIEVRSCRYSVVNA  672

Query  567  TKRIQDFR-HEMADDLFELKI  508
              +I++ +  EM +  F++ I
Sbjct  673  ALKIKEIQTEEMGNSQFKVII  693



>ref|XP_010320901.1| PREDICTED: putative late blight resistance protein homolog R1B-23 
isoform X2 [Solanum lycopersicum]
Length=1493

 Score = 54.7 bits (130),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 30/70 (43%), Positives = 43/70 (61%), Gaps = 0/70 (0%)
 Frame = -2

Query  747   LLLEDKTLEQWMVDDESFPNLEHLVLRFCYCLEEIPKAIEYISRLRSIELQWCTPSVCYS  568
             L LE+ +  +W V D++FP LEHLVL  C  LE IP    Y+S L+SIE++ C  S+  S
Sbjct  1395  LKLENLSFSEWDVSDDAFPYLEHLVLIRCPYLEVIPSCFGYMSSLKSIEVKSCKESLADS  1454

Query  567   TKRIQDFRHE  538
                I++ + E
Sbjct  1455  AMVIKEMQVE  1464



>ref|XP_010320900.1| PREDICTED: putative late blight resistance protein homolog R1B-23 
isoform X1 [Solanum lycopersicum]
Length=1495

 Score = 54.7 bits (130),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 30/70 (43%), Positives = 43/70 (61%), Gaps = 0/70 (0%)
 Frame = -2

Query  747   LLLEDKTLEQWMVDDESFPNLEHLVLRFCYCLEEIPKAIEYISRLRSIELQWCTPSVCYS  568
             L LE+ +  +W V D++FP LEHLVL  C  LE IP    Y+S L+SIE++ C  S+  S
Sbjct  1395  LKLENLSFSEWDVSDDAFPYLEHLVLIRCPYLEVIPSCFGYMSSLKSIEVKSCKESLADS  1454

Query  567   TKRIQDFRHE  538
                I++ + E
Sbjct  1455  AMVIKEMQVE  1464



>ref|XP_006351974.1| PREDICTED: putative late blight resistance protein homolog R1B-16-like 
[Solanum tuberosum]
Length=926

 Score = 54.3 bits (129),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 28/80 (35%), Positives = 46/80 (58%), Gaps = 0/80 (0%)
 Frame = -2

Query  747  LLLEDKTLEQWMVDDESFPNLEHLVLRFCYCLEEIPKAIEYISRLRSIELQWCTPSVCYS  568
            LL+E   ++ W   ++ FP LEHLVL+ C  L+ IP  +  I  L+ IEL+  + S   S
Sbjct  834  LLIEISDIKHWSASNDHFPVLEHLVLKSCLHLDSIPHDLGDIPTLQIIELENSSQSAVLS  893

Query  567  TKRIQDFRHEMADDLFELKI  508
             K IQ+ +  M ++  E+++
Sbjct  894  AKEIQEEQQSMGNETLEVRM  913



>ref|XP_011102162.1| PREDICTED: putative late blight resistance protein homolog R1A-10 
[Sesamum indicum]
Length=997

 Score = 54.3 bits (129),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 34/66 (52%), Positives = 39/66 (59%), Gaps = 1/66 (2%)
 Frame = -2

Query  747  LLLEDKTLEQWMVDDESFPNLEHLVLRFCYCLEEIPKAIEYISRLRSIELQWCTPSVCYS  568
            LL+ED  LE W V    FP+LE L+LR CY L+EI K I  I  L  IEL  C PS+  S
Sbjct  910  LLIEDTDLEDWYVKS-WFPSLERLILRHCYKLKEISKEIGDIVCLEMIELDDCNPSLVAS  968

Query  567  TKRIQD  550
            TK   D
Sbjct  969  TKHWAD  974



>gb|EYU21846.1| hypothetical protein MIMGU_mgv1a022576mg, partial [Erythranthe 
guttata]
Length=348

 Score = 53.9 bits (128),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 30/68 (44%), Positives = 39/68 (57%), Gaps = 0/68 (0%)
 Frame = -2

Query  732  KTLEQWMVDDESFPNLEHLVLRFCYCLEEIPKAIEYISRLRSIELQWCTPSVCYSTKRIQ  553
            + LE W  D   FP LEHL L++   LEEIP  I  IS L SI L+ C+ +   S KRI 
Sbjct  251  RDLECWTTDSTHFPRLEHLDLQYLDKLEEIPSCIGEISSLESIYLEICSDAAVISAKRIL  310

Query  552  DFRHEMAD  529
            D + E+ +
Sbjct  311  DEQEELGN  318



>ref|XP_011093987.1| PREDICTED: putative late blight resistance protein homolog R1B-14 
[Sesamum indicum]
Length=821

 Score = 54.3 bits (129),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 28/80 (35%), Positives = 45/80 (56%), Gaps = 0/80 (0%)
 Frame = -2

Query  747  LLLEDKTLEQWMVDDESFPNLEHLVLRFCYCLEEIPKAIEYISRLRSIELQWCTPSVCYS  568
            L++E   ++ W  DD  FP LEHL++R C  L EIP  I  I  L+ IE++   P +  S
Sbjct  735  LIMEHLHMDFWAADDICFPRLEHLIIRHCAWLPEIPYGIGDIPTLKVIEVRQYLPPLLDS  794

Query  567  TKRIQDFRHEMADDLFELKI  508
             + IQ  + +  +D  E+++
Sbjct  795  VRMIQKKQEKNGNDGLEVRL  814



>gb|EYU21842.1| hypothetical protein MIMGU_mgv1a020462mg, partial [Erythranthe 
guttata]
Length=846

 Score = 54.3 bits (129),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 30/74 (41%), Positives = 40/74 (54%), Gaps = 0/74 (0%)
 Frame = -2

Query  726  LEQWMVDDESFPNLEHLVLRFCYCLEEIPKAIEYISRLRSIELQWCTPSVCYSTKRIQDF  547
            LE W  D   FP LE LVL F     EIP AI  I  L+SI+L  CT S   S KRI + 
Sbjct  752  LEWWTTDSSHFPRLERLVLHFLDNFVEIPSAIGEIPTLQSIQLNNCTDSAVISAKRILED  811

Query  546  RHEMADDLFELKII  505
            + E+ +   ++ ++
Sbjct  812  QEELQNLGLQVHVV  825



>ref|XP_004252073.2| PREDICTED: putative late blight resistance protein homolog R1B-16 
[Solanum lycopersicum]
Length=917

 Score = 54.3 bits (129),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 28/66 (42%), Positives = 39/66 (59%), Gaps = 0/66 (0%)
 Frame = -2

Query  747  LLLEDKTLEQWMVDDESFPNLEHLVLRFCYCLEEIPKAIEYISRLRSIELQWCTPSVCYS  568
            LL+E   L +W   ++ FP LEHLV++ C+ L +IP     I  L+ IELQ C   +  S
Sbjct  821  LLIEGTNLTRWKATNDHFPALEHLVIKHCFHLVKIPIEFADIYSLQLIELQNCKAKLMAS  880

Query  567  TKRIQD  550
            T RIQ+
Sbjct  881  TVRIQE  886



>ref|XP_006367617.1| PREDICTED: putative late blight resistance protein homolog R1C-3-like 
[Solanum tuberosum]
Length=632

 Score = 53.9 bits (128),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 36/82 (44%), Positives = 47/82 (57%), Gaps = 1/82 (1%)
 Frame = -2

Query  747  LLLEDKTLEQWMVDDESFPNLEHLVLRFCYCLEEIPKAIEYISRLRSIELQWCTPSVCYS  568
            L LE   L +W+V D++FPNLE LVLR C  L EIP     I  L+ IE+  C  SV  S
Sbjct  547  LKLEYVCLMKWIVADDAFPNLEQLVLRGCKYLMEIPSCFMNILSLKYIEVHSCNESVVKS  606

Query  567  TKRIQDFRHEMADDL-FELKII  505
             K I++ + E   +  F+L II
Sbjct  607  AKDIEETQVEDNQNTNFKLVII  628



>ref|XP_004231569.2| PREDICTED: putative late blight resistance protein homolog R1A-3 
[Solanum lycopersicum]
Length=929

 Score = 53.9 bits (128),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 30/81 (37%), Positives = 45/81 (56%), Gaps = 0/81 (0%)
 Frame = -2

Query  747  LLLEDKTLEQWMVDDESFPNLEHLVLRFCYCLEEIPKAIEYISRLRSIELQWCTPSVCYS  568
            LL++   LE W   +++FP LE LVL  C  L+EIP     I+  + IEL  C P +  S
Sbjct  818  LLIQANYLESWKATNDNFPVLERLVLGSCSYLKEIPIEFADINTSQLIELDSCPPILAES  877

Query  567  TKRIQDFRHEMADDLFELKII  505
              RIQ  + ++ +D  ++ II
Sbjct  878  AARIQQEQEDLGNDPIDVHII  898



>ref|XP_006345448.1| PREDICTED: putative late blight resistance protein homolog R1A-10-like 
[Solanum tuberosum]
Length=888

 Score = 53.9 bits (128),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 35/101 (35%), Positives = 51/101 (50%), Gaps = 2/101 (2%)
 Frame = -2

Query  747  LLLEDKTLEQWMVDDESFPNLEHLVLRFCYCLEEIPKAIEYISRLRSIELQWCTPSVCYS  568
            LLL +  L  W     +FPNL+ LVLR C  LEEIP  I  I  L  IEL  C+ S   S
Sbjct  786  LLLSEPRLVNWEAGSVNFPNLQKLVLRKCIRLEEIPLDIGEICTLEMIELICCSSSAQNS  845

Query  567  TKRIQDFRHEMADDLFELKIIG--EESIPADDEWQAKIKII  451
               I++ +  M +   ++++    +ES    D W+A +  +
Sbjct  846  ANEIREEQESMGNSCLDIRVYADDDESSSLFDFWRAVMSYV  886



>ref|XP_009794266.1| PREDICTED: late blight resistance protein R1-A-like [Nicotiana 
sylvestris]
 ref|XP_009794270.1| PREDICTED: late blight resistance protein R1-A-like [Nicotiana 
sylvestris]
 ref|XP_009794280.1| PREDICTED: late blight resistance protein R1-A-like [Nicotiana 
sylvestris]
Length=1273

 Score = 53.9 bits (128),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 33/75 (44%), Positives = 46/75 (61%), Gaps = 1/75 (1%)
 Frame = -2

Query  729   TLEQWMVDDESFPNLEHLVLRFCYCLEEIPKAIEYISRLRSIELQWCTPSVCYSTKRIQD  550
             +LE+W V D++FPNLE L LR    L+EIP   E I  L+SIE+  C  SV  S + IQ+
Sbjct  1198  SLEEWTVFDDAFPNLERLFLRGLENLKEIPSCFEDICSLKSIEVWDCNESVVKSARVIQE  1257

Query  549   FR-HEMADDLFELKI  508
              +  +  +D F+L I
Sbjct  1258  IQVDDYQNDDFKLVI  1272



>emb|CDP07957.1| unnamed protein product [Coffea canephora]
Length=1275

 Score = 53.9 bits (128),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 32/89 (36%), Positives = 47/89 (53%), Gaps = 2/89 (2%)
 Frame = -2

Query  747   LLLEDKTLEQWMVDDESFPNLEHLVLRFCYCLEEIPKAIEYISRLRSIELQWCTPSVCYS  568
             L LE   +  W   ++  P LE LV++ C+ L EIP  +  I  L+ IELQ CT S   S
Sbjct  1184  LKLESLDIAHWNASEDHLPCLETLVVKKCHALTEIPLCLGDIPTLQRIELQNCTRSAWIS  1243

Query  567   TKRIQDFRHEMADDLFE--LKIIGEESIP  487
              + +++ + EM +D FE   K  G   +P
Sbjct  1244  ARTVKEKQKEMGNDQFEFTFKFEGSWRVP  1272



>gb|EYU19036.1| hypothetical protein MIMGU_mgv1a021264mg, partial [Erythranthe 
guttata]
Length=768

 Score = 53.5 bits (127),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 28/73 (38%), Positives = 40/73 (55%), Gaps = 0/73 (0%)
 Frame = -2

Query  726  LEQWMVDDESFPNLEHLVLRFCYCLEEIPKAIEYISRLRSIELQWCTPSVCYSTKRIQDF  547
            LE W  D   FP+LE LVL +   L+EIP  I  I  L SIEL +C+ S   S K I D 
Sbjct  674  LEWWTTDSNHFPSLEQLVLEYMDKLKEIPSCIGEIPTLGSIELNYCSKSAVISAKEILDE  733

Query  546  RHEMADDLFELKI  508
            + ++ +    +++
Sbjct  734  QEDLGNVGLRVRV  746



>ref|XP_009602419.1| PREDICTED: putative late blight resistance protein homolog R1B-16 
isoform X2 [Nicotiana tomentosiformis]
Length=929

 Score = 53.5 bits (127),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 33/75 (44%), Positives = 44/75 (59%), Gaps = 3/75 (4%)
 Frame = -2

Query  747  LLLEDKTLEQWMVDDESFPNLEHLVLRFCYCLEEIPKAIEYISRLRSIELQWCTPSVCYS  568
            LL+E   L+ W   +++FP LE LV+R C  LE+IP    YI  L+ IEL  CTP +  S
Sbjct  825  LLIEYNDLKYWNSPNDNFPVLERLVIRDCSELEDIPIDFAYIDSLQQIELTDCTPELEAS  884

Query  567  TKRIQDFRHEMADDL  523
              RIQ   HE  ++L
Sbjct  885  AARIQ---HEQEENL  896



>ref|XP_009794525.1| PREDICTED: putative late blight resistance protein homolog R1A-10 
isoform X1 [Nicotiana sylvestris]
 ref|XP_009794533.1| PREDICTED: putative late blight resistance protein homolog R1A-10 
isoform X1 [Nicotiana sylvestris]
 ref|XP_009794540.1| PREDICTED: putative late blight resistance protein homolog R1A-10 
isoform X1 [Nicotiana sylvestris]
 ref|XP_009794546.1| PREDICTED: putative late blight resistance protein homolog R1A-10 
isoform X2 [Nicotiana sylvestris]
 ref|XP_009794554.1| PREDICTED: putative late blight resistance protein homolog R1A-10 
isoform X1 [Nicotiana sylvestris]
 ref|XP_009794561.1| PREDICTED: putative late blight resistance protein homolog R1A-10 
isoform X1 [Nicotiana sylvestris]
Length=893

 Score = 53.5 bits (127),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 30/74 (41%), Positives = 41/74 (55%), Gaps = 0/74 (0%)
 Frame = -2

Query  747  LLLEDKTLEQWMVDDESFPNLEHLVLRFCYCLEEIPKAIEYISRLRSIELQWCTPSVCYS  568
            LL+ +  L+QW     +FP L+ LVL+ C  L+ IP+ I  I  L SIEL  C+ S   S
Sbjct  810  LLIYETNLKQWKAGSVNFPELQCLVLKECRSLKTIPQDIGEIYTLESIELHNCSTSAEKS  869

Query  567  TKRIQDFRHEMADD  526
             K IQ  +  M +D
Sbjct  870  VKNIQKEQKSMGND  883



>ref|XP_006355133.1| PREDICTED: putative late blight resistance protein homolog R1C-3-like 
isoform X1 [Solanum tuberosum]
 ref|XP_006355134.1| PREDICTED: putative late blight resistance protein homolog R1C-3-like 
isoform X2 [Solanum tuberosum]
Length=1190

 Score = 53.5 bits (127),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 31/75 (41%), Positives = 43/75 (57%), Gaps = 1/75 (1%)
 Frame = -2

Query  729   TLEQWMVDDESFPNLEHLVLRFCYCLEEIPKAIEYISRLRSIELQWCTPSVCYSTKRIQD  550
             + ++W V D++FP LEH+VL  C  L EIP     +S L+ IE+  C  SV  S + IQ 
Sbjct  1113  SFKEWTVYDDAFPKLEHMVLHCCQLLVEIPSWFAEVSSLKYIEVDNCNGSVVESARIIQR  1172

Query  549   FR-HEMADDLFELKI  508
              +  E A+D  EL I
Sbjct  1173  TKVEEYANDDLELVI  1187



>ref|XP_004243493.1| PREDICTED: putative late blight resistance protein homolog R1B-16 
isoform X1 [Solanum lycopersicum]
Length=858

 Score = 53.5 bits (127),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 28/81 (35%), Positives = 48/81 (59%), Gaps = 0/81 (0%)
 Frame = -2

Query  747  LLLEDKTLEQWMVDDESFPNLEHLVLRFCYCLEEIPKAIEYISRLRSIELQWCTPSVCYS  568
            L +    LE+W    ++FP LE L L + + LEEIP++I  I  L+SIE++ C  +V  S
Sbjct  776  LAVRHGNLERWEATSDNFPMLEELYLSWLHLLEEIPESIGEIMTLKSIEIRGCNSAVITS  835

Query  567  TKRIQDFRHEMADDLFELKII  505
             K+I++ +    +  F+L+ +
Sbjct  836  AKQIRENQEIYGNYEFQLRFV  856



>sp|Q8W1E0.1|R1A_SOLDE RecName: Full=Late blight resistance protein R1-A; Short=Protein 
R1 [Solanum demissum]
 gb|AAL39063.1|AF447489_1 late blight resistance protein [Solanum demissum]
Length=1293

 Score = 53.5 bits (127),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 31/70 (44%), Positives = 42/70 (60%), Gaps = 0/70 (0%)
 Frame = -2

Query  747   LLLEDKTLEQWMVDDESFPNLEHLVLRFCYCLEEIPKAIEYISRLRSIELQWCTPSVCYS  568
             L LE  +L +W+V D++FPNLE LVLR C  L EIP     I  L+ I +++C  SV  S
Sbjct  1181  LKLEYLSLVKWIVADDAFPNLEQLVLRGCQDLMEIPSCFMDILSLKYIGVEYCNESVVKS  1240

Query  567   TKRIQDFRHE  538
                IQ+ + E
Sbjct  1241  ALNIQETQVE  1250



>gb|AEW70444.1| disease resistance protein R1 [Solanum tuberosum]
Length=356

 Score = 53.1 bits (126),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 31/70 (44%), Positives = 42/70 (60%), Gaps = 0/70 (0%)
 Frame = -2

Query  747  LLLEDKTLEQWMVDDESFPNLEHLVLRFCYCLEEIPKAIEYISRLRSIELQWCTPSVCYS  568
            L LE  +L +W+V D++FPNLE LVLR C  L EIP     I  L+ I +++C  SV  S
Sbjct  244  LKLEYLSLVKWIVADDAFPNLEQLVLRGCQDLMEIPSCFMDILSLKYIGVEYCNESVVKS  303

Query  567  TKRIQDFRHE  538
               IQ+ + E
Sbjct  304  ALNIQETQVE  313



>gb|AEW70440.1| disease resistance protein R1 [Solanum tuberosum]
 gb|AEW70441.1| disease resistance protein R1 [Solanum tuberosum]
 gb|AEW70442.1| disease resistance protein R1 [Solanum tuberosum]
 gb|AEW70443.1| disease resistance protein R1 [Solanum tuberosum]
Length=356

 Score = 53.1 bits (126),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 31/70 (44%), Positives = 42/70 (60%), Gaps = 0/70 (0%)
 Frame = -2

Query  747  LLLEDKTLEQWMVDDESFPNLEHLVLRFCYCLEEIPKAIEYISRLRSIELQWCTPSVCYS  568
            L LE  +L +W+V D++FPNLE LVLR C  L EIP     I  L+ I +++C  SV  S
Sbjct  244  LKLEYLSLVKWIVADDAFPNLEQLVLRGCQDLMEIPSCFMDILSLKYIGVEYCNESVVKS  303

Query  567  TKRIQDFRHE  538
               IQ+ + E
Sbjct  304  ALNIQETQVE  313



>gb|ABI96211.1| NBS-LRR resistance protein-like protein [Solanum sp. VFNT]
Length=1252

 Score = 53.5 bits (127),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 33/81 (41%), Positives = 51/81 (63%), Gaps = 2/81 (2%)
 Frame = -2

Query  729   TLEQWMVDDESFPNLEHLVLRFCYCLEEIPKAIEYISRLRSIELQWCTPSVCYSTKRIQD  550
             TL +W V +ESFPNLE L L+ C  LEEIP +   I  L+ I++   +P +  S  +I++
Sbjct  1171  TLSKWEVGEESFPNLEKLKLQECGKLEEIPPSFGDIYSLKFIKI-VKSPQLEDSALKIKE  1229

Query  549   FRHEMADDLFELKIIGEESIP  487
             +  EM     EL+I+G+++IP
Sbjct  1230  YAEEMRGG-SELQILGQKNIP  1249



>ref|XP_009608832.1| PREDICTED: late blight resistance protein R1-A-like [Nicotiana 
tomentosiformis]
 ref|XP_009608833.1| PREDICTED: late blight resistance protein R1-A-like [Nicotiana 
tomentosiformis]
Length=1261

 Score = 53.5 bits (127),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 26/61 (43%), Positives = 41/61 (67%), Gaps = 0/61 (0%)
 Frame = -2

Query  732   KTLEQWMVDDESFPNLEHLVLRFCYCLEEIPKAIEYISRLRSIELQWCTPSVCYSTKRIQ  553
             ++LE+W V D++FP+LE L LR    L++IP   E IS L+SIE++ C  SV  + + I+
Sbjct  1185  RSLEEWAVSDDAFPSLERLFLRGLENLKKIPSCFEDISSLKSIEVRECNESVVNAARDIR  1244

Query  552   D  550
             +
Sbjct  1245  E  1245



>ref|XP_004240499.1| PREDICTED: putative late blight resistance protein homolog R1A-3 
[Solanum lycopersicum]
 ref|XP_010321826.1| PREDICTED: putative late blight resistance protein homolog R1A-3 
[Solanum lycopersicum]
 gb|ABI96215.1| NBS-LRR resistance protein-like protein [Solanum lycopersicum]
Length=1251

 Score = 53.5 bits (127),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 32/81 (40%), Positives = 51/81 (63%), Gaps = 2/81 (2%)
 Frame = -2

Query  729   TLEQWMVDDESFPNLEHLVLRFCYCLEEIPKAIEYISRLRSIELQWCTPSVCYSTKRIQD  550
             TL +W V +ESFPNLE L L+ C  LEEIP +   I  L+ I++   +P +  S  +I++
Sbjct  1170  TLSKWEVGEESFPNLEKLKLQGCRKLEEIPPSFGDIYSLKVIKI-VKSPQLEDSALKIKE  1228

Query  549   FRHEMADDLFELKIIGEESIP  487
             +  +M     EL+I+G+++IP
Sbjct  1229  YAEDMRGG-SELQILGQKNIP  1248



>ref|XP_011072191.1| PREDICTED: putative late blight resistance protein homolog R1B-16 
[Sesamum indicum]
Length=884

 Score = 53.5 bits (127),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 24/80 (30%), Positives = 50/80 (63%), Gaps = 0/80 (0%)
 Frame = -2

Query  747  LLLEDKTLEQWMVDDESFPNLEHLVLRFCYCLEEIPKAIEYISRLRSIELQWCTPSVCYS  568
            LL++   L  W+ ++  FP LEHL++R C+ L+ IP  I  I+ L+ I++  C+ S   S
Sbjct  799  LLMDRMELVWWIAENTHFPCLEHLIIRSCHNLQAIPSGIGDIATLKMIDIDDCSSSAVTS  858

Query  567  TKRIQDFRHEMADDLFELKI  508
             ++I + + +M +++ ++++
Sbjct  859  VEQILEEQRDMENNVLQVRV  878



>ref|XP_009622529.1| PREDICTED: putative late blight resistance protein homolog R1A-4, 
partial [Nicotiana tomentosiformis]
Length=727

 Score = 53.1 bits (126),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 34/75 (45%), Positives = 44/75 (59%), Gaps = 2/75 (3%)
 Frame = -2

Query  747  LLLEDKTLEQWMVDDESFPNLEHLVLRFCYCLEEIPKAIEYISRLRSIELQWCTPSVCYS  568
            L L+   L +W V +ESFP LE L LR C  LEEIP +   I  L+SIEL+W +P +  S
Sbjct  646  LTLQRVNLAKWEVREESFPALEKLRLRDCRKLEEIPPSFGDICSLKSIELKW-SPQLEES  704

Query  567  TKRI-QDFRHEMADD  526
              +I QD    M +D
Sbjct  705  ALKIKQDVEDTMGED  719



>emb|CDP05514.1| unnamed protein product [Coffea canephora]
Length=875

 Score = 53.1 bits (126),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 31/83 (37%), Positives = 45/83 (54%), Gaps = 2/83 (2%)
 Frame = -2

Query  747  LLLEDKTLEQWMVDDESFPNLEHLVLRFCYCLEEIPKAIEYISRLRSIELQWCTPSVCYS  568
            L L    L++W+    SFP L HLVL  C  LEEIP +I  I  L+ IE+   + +   S
Sbjct  789  LKLSHTNLQRWIASSSSFPCLGHLVLHRCLVLEEIPPSIGDIQTLQMIEVSHSSLAAADS  848

Query  567  TKRIQDFRHEMADDLFELKIIGE  499
              +IQ+ +  M +  FELK+  +
Sbjct  849  VWQIQESQKSMGN--FELKVFTQ  869



>ref|XP_009763421.1| PREDICTED: putative late blight resistance protein homolog R1B-12 
isoform X1 [Nicotiana sylvestris]
 ref|XP_009763428.1| PREDICTED: putative late blight resistance protein homolog R1B-12 
isoform X1 [Nicotiana sylvestris]
 ref|XP_009763437.1| PREDICTED: putative late blight resistance protein homolog R1B-12 
isoform X1 [Nicotiana sylvestris]
Length=1810

 Score = 53.5 bits (127),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 34/79 (43%), Positives = 46/79 (58%), Gaps = 2/79 (3%)
 Frame = -2

Query  747   LLLEDKTLEQWMVDDESFPNLEHLVLRFCYCLEEIPKAIEYISRLRSIELQWCTPSVCYS  568
             L L+   L +W V +ESFP LE L LR C  LEEIP +   I  L+SIEL+W +P +  S
Sbjct  1728  LTLQRVNLAKWEVREESFPALEKLRLRDCRKLEEIPPSFGDICSLKSIELKW-SPQLEES  1786

Query  567   TKRI-QDFRHEMADDLFEL  514
               +I QD    M +D  ++
Sbjct  1787  ALKIKQDVEDTMGEDRIQV  1805



>gb|AAX73296.1| late blight resistance protein [Solanum tuberosum]
Length=348

 Score = 52.8 bits (125),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 30/66 (45%), Positives = 40/66 (61%), Gaps = 0/66 (0%)
 Frame = -2

Query  747  LLLEDKTLEQWMVDDESFPNLEHLVLRFCYCLEEIPKAIEYISRLRSIELQWCTPSVCYS  568
            L LE  +L +W+V D++FPNLE LVLR C  L EIP     I  L+ I +++C  SV  S
Sbjct  237  LKLEYLSLVKWIVADDAFPNLEQLVLRGCQDLMEIPSCFMDILSLKYIGVEYCNESVVKS  296

Query  567  TKRIQD  550
               IQ+
Sbjct  297  ALNIQE  302



>ref|XP_010320780.1| PREDICTED: putative late blight resistance protein homolog R1B-17 
isoform X1 [Solanum lycopersicum]
 ref|XP_010320781.1| PREDICTED: putative late blight resistance protein homolog R1B-17 
isoform X1 [Solanum lycopersicum]
Length=721

 Score = 53.1 bits (126),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 33/74 (45%), Positives = 46/74 (62%), Gaps = 1/74 (1%)
 Frame = -2

Query  726  LEQWMVDDESFPNLEHLVLRFCYCLEEIPKAIEYISRLRSIELQWCTPSVCYSTKRI-QD  550
            + +W   +ESFP LE+LV++ C  LEEIP+A  YI RLR I++  C+ SV  S +RI QD
Sbjct  644  MTKWSCIEESFPCLEYLVIKSCPKLEEIPEAFVYIPRLRLIKVINCSESVRDSAQRIKQD  703

Query  549  FRHEMADDLFELKI  508
                  D+  +L I
Sbjct  704  VEDIEGDERLQLHI  717



>ref|XP_004238960.1| PREDICTED: putative late blight resistance protein homolog R1B-17 
isoform X2 [Solanum lycopersicum]
Length=701

 Score = 53.1 bits (126),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 33/74 (45%), Positives = 46/74 (62%), Gaps = 1/74 (1%)
 Frame = -2

Query  726  LEQWMVDDESFPNLEHLVLRFCYCLEEIPKAIEYISRLRSIELQWCTPSVCYSTKRI-QD  550
            + +W   +ESFP LE+LV++ C  LEEIP+A  YI RLR I++  C+ SV  S +RI QD
Sbjct  624  MTKWSCIEESFPCLEYLVIKSCPKLEEIPEAFVYIPRLRLIKVINCSESVRDSAQRIKQD  683

Query  549  FRHEMADDLFELKI  508
                  D+  +L I
Sbjct  684  VEDIEGDERLQLHI  697



>emb|CDP12547.1| unnamed protein product [Coffea canephora]
Length=1233

 Score = 53.1 bits (126),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 29/78 (37%), Positives = 47/78 (60%), Gaps = 0/78 (0%)
 Frame = -2

Query  747   LLLEDKTLEQWMVDDESFPNLEHLVLRFCYCLEEIPKAIEYISRLRSIELQWCTPSVCYS  568
             L + +   E+W V  E FP+LE+LVL  C  L+EIP +   IS LR I+++ C+P+V  S
Sbjct  1153  LRIYNSEFERWAVPAEPFPSLENLVLIDCTKLQEIPSSFAEISTLRMIKVRGCSPNVEKS  1212

Query  567   TKRIQDFRHEMADDLFEL  514
              + I + + +M +   +L
Sbjct  1213  AQTIFEEQKDMGNGDLQL  1230



>ref|XP_009799903.1| PREDICTED: putative late blight resistance protein homolog R1B-16 
[Nicotiana sylvestris]
Length=670

 Score = 53.1 bits (126),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 30/79 (38%), Positives = 46/79 (58%), Gaps = 1/79 (1%)
 Frame = -2

Query  747  LLLEDKTLEQWMVDDESFPNLEHLVLRFCYCLEEIPKAIEYISRLRSIELQWCTPSVCYS  568
            L +E  +++ W +  +SFP LE LVLR+C  LEEIP +   +  L+ IE   C PS   S
Sbjct  586  LKIEHSSIKHWNMSVDSFPCLEQLVLRWCDKLEEIPSSFGCMPSLQRIEAHCCCPSATKS  645

Query  567  TKRIQDF-RHEMADDLFEL  514
              +I++  R +M +  F+L
Sbjct  646  AVKIRNMQRDDMKNSDFKL  664



>ref|XP_009763450.1| PREDICTED: putative late blight resistance protein homolog R1B-12 
isoform X3 [Nicotiana sylvestris]
Length=1740

 Score = 53.1 bits (126),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 34/79 (43%), Positives = 46/79 (58%), Gaps = 2/79 (3%)
 Frame = -2

Query  747   LLLEDKTLEQWMVDDESFPNLEHLVLRFCYCLEEIPKAIEYISRLRSIELQWCTPSVCYS  568
             L L+   L +W V +ESFP LE L LR C  LEEIP +   I  L+SIEL+W +P +  S
Sbjct  1658  LTLQRVNLAKWEVREESFPALEKLRLRDCRKLEEIPPSFGDICSLKSIELKW-SPQLEES  1716

Query  567   TKRI-QDFRHEMADDLFEL  514
               +I QD    M +D  ++
Sbjct  1717  ALKIKQDVEDTMGEDRIQV  1735



>ref|XP_009763443.1| PREDICTED: putative late blight resistance protein homolog R1B-12 
isoform X2 [Nicotiana sylvestris]
Length=1742

 Score = 53.1 bits (126),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 34/79 (43%), Positives = 46/79 (58%), Gaps = 2/79 (3%)
 Frame = -2

Query  747   LLLEDKTLEQWMVDDESFPNLEHLVLRFCYCLEEIPKAIEYISRLRSIELQWCTPSVCYS  568
             L L+   L +W V +ESFP LE L LR C  LEEIP +   I  L+SIEL+W +P +  S
Sbjct  1660  LTLQRVNLAKWEVREESFPALEKLRLRDCRKLEEIPPSFGDICSLKSIELKW-SPQLEES  1718

Query  567   TKRI-QDFRHEMADDLFEL  514
               +I QD    M +D  ++
Sbjct  1719  ALKIKQDVEDTMGEDRIQV  1737



>gb|AAT66777.2| Late blight resistance protein, putative [Solanum demissum]
Length=748

 Score = 53.1 bits (126),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 27/59 (46%), Positives = 36/59 (61%), Gaps = 0/59 (0%)
 Frame = -2

Query  729  TLEQWMVDDESFPNLEHLVLRFCYCLEEIPKAIEYISRLRSIELQWCTPSVCYSTKRIQ  553
            +L++W V D++F NLEH+VLR C  L EIP     I  L+ IE+  C  SV  S + IQ
Sbjct  671  SLKEWTVQDDAFSNLEHMVLRCCQLLVEIPSWFAEIYSLKYIEVDNCNGSVVESARIIQ  729



>ref|XP_009763456.1| PREDICTED: putative late blight resistance protein homolog R1B-23 
isoform X4 [Nicotiana sylvestris]
Length=1606

 Score = 53.1 bits (126),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 34/79 (43%), Positives = 46/79 (58%), Gaps = 2/79 (3%)
 Frame = -2

Query  747   LLLEDKTLEQWMVDDESFPNLEHLVLRFCYCLEEIPKAIEYISRLRSIELQWCTPSVCYS  568
             L L+   L +W V +ESFP LE L LR C  LEEIP +   I  L+SIEL+W +P +  S
Sbjct  1524  LTLQRVNLAKWEVREESFPALEKLRLRDCRKLEEIPPSFGDICSLKSIELKW-SPQLEES  1582

Query  567   TKRI-QDFRHEMADDLFEL  514
               +I QD    M +D  ++
Sbjct  1583  ALKIKQDVEDTMGEDRIQV  1601



>gb|AAT39283.2| Late blight resistance protein, putative [Solanum demissum]
Length=435

 Score = 52.8 bits (125),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 31/70 (44%), Positives = 42/70 (60%), Gaps = 0/70 (0%)
 Frame = -2

Query  747  LLLEDKTLEQWMVDDESFPNLEHLVLRFCYCLEEIPKAIEYISRLRSIELQWCTPSVCYS  568
            L LE  +L +W+V D++FPNLE LVLR C  L EIP     I  L+ I+++ C  SV  S
Sbjct  350  LKLEYVSLMKWIVADDAFPNLEQLVLRGCRYLMEIPSCFMDILSLQYIKVENCNESVVKS  409

Query  567  TKRIQDFRHE  538
               IQ+ + E
Sbjct  410  AMTIQEIQVE  419



>ref|XP_011077106.1| PREDICTED: putative late blight resistance protein homolog R1B-14 
[Sesamum indicum]
 ref|XP_011077107.1| PREDICTED: putative late blight resistance protein homolog R1B-14 
[Sesamum indicum]
Length=897

 Score = 53.1 bits (126),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 29/80 (36%), Positives = 43/80 (54%), Gaps = 0/80 (0%)
 Frame = -2

Query  747  LLLEDKTLEQWMVDDESFPNLEHLVLRFCYCLEEIPKAIEYISRLRSIELQWCTPSVCYS  568
            L +E + L+ W+ D   FPNLE LVL  C  L EIP  I  I  L  IE+     S+  S
Sbjct  816  LQIESENLKHWVTDSSHFPNLERLVLHDCGELGEIPDGIGEIPTLELIEVPHWPKSLVDS  875

Query  567  TKRIQDFRHEMADDLFELKI  508
              RI++ + E  +D  ++++
Sbjct  876  AMRIKEEQQESGNDFLQVRV  895



>gb|AAT39961.1| Putative late blight resistance protein, identical [Solanum demissum]
Length=1203

 Score = 53.1 bits (126),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 27/59 (46%), Positives = 36/59 (61%), Gaps = 0/59 (0%)
 Frame = -2

Query  729   TLEQWMVDDESFPNLEHLVLRFCYCLEEIPKAIEYISRLRSIELQWCTPSVCYSTKRIQ  553
             +L++W V D++F NLEH+VLR C  L EIP     I  L+ IE+  C  SV  S + IQ
Sbjct  1126  SLKEWTVQDDAFSNLEHMVLRCCQLLVEIPSWFAEIYSLKYIEVDNCNGSVVESARIIQ  1184



>ref|XP_009788590.1| PREDICTED: putative late blight resistance protein homolog R1A-4 
isoform X2 [Nicotiana sylvestris]
Length=1675

 Score = 53.1 bits (126),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 30/74 (41%), Positives = 40/74 (54%), Gaps = 0/74 (0%)
 Frame = -2

Query  747   LLLEDKTLEQWMVDDESFPNLEHLVLRFCYCLEEIPKAIEYISRLRSIELQWCTPSVCYS  568
             L L++  + QW V D++FP +EHLVL  C  LEEIP        L+ IE+  C  SV  S
Sbjct  1595  LNLDNINISQWSVYDDAFPMIEHLVLTKCERLEEIPSHFGDAISLKRIEVNRCCWSVANS  1654

Query  567   TKRIQDFRHEMADD  526
                IQ   H+M  +
Sbjct  1655  ALEIQTTHHDMMGN  1668



>gb|AAT38775.2| NB-ARC domain containing protein [Solanum demissum]
Length=551

 Score = 52.8 bits (125),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 45/130 (35%), Positives = 68/130 (52%), Gaps = 18/130 (14%)
 Frame = -2

Query  747  LLLEDKTLEQWMVDDESFPNLEHLVLRFCYCLEEIPKAIEYISRLRSIELQWCTPSVCYS  568
            L LE  +L +W+V D++FPNLE LVLR C  L EIP     I  L+ I+++ C  SV  S
Sbjct  419  LKLEYLSLMKWIVADDAFPNLEQLVLRGCRDLMEIPSCFMDILSLQYIKVENCNESVVKS  478

Query  567  TKRIQDFRHEMADD--------------LFELKIIGEESIPADDEWQAKIKIIGE-DSEE  433
               IQ+ + E   +              LF++K  G ES+  D + +  + + G+ D++E
Sbjct  479  AMNIQETQVEYYQNTNFKLVLIKIHLFCLFDMK--GIESVSTDIK-EKILTVTGDVDADE  535

Query  432  S*YLNDKLAK  403
               L +KL K
Sbjct  536  VQLLVEKLRK  545



>ref|XP_009788587.1| PREDICTED: putative late blight resistance protein homolog R1B-23 
isoform X1 [Nicotiana sylvestris]
 ref|XP_009788588.1| PREDICTED: putative late blight resistance protein homolog R1B-23 
isoform X1 [Nicotiana sylvestris]
 ref|XP_009788589.1| PREDICTED: putative late blight resistance protein homolog R1B-23 
isoform X1 [Nicotiana sylvestris]
Length=1721

 Score = 53.1 bits (126),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 30/74 (41%), Positives = 40/74 (54%), Gaps = 0/74 (0%)
 Frame = -2

Query  747   LLLEDKTLEQWMVDDESFPNLEHLVLRFCYCLEEIPKAIEYISRLRSIELQWCTPSVCYS  568
             L L++  + QW V D++FP +EHLVL  C  LEEIP        L+ IE+  C  SV  S
Sbjct  1641  LNLDNINISQWSVYDDAFPMIEHLVLTKCERLEEIPSHFGDAISLKRIEVNRCCWSVANS  1700

Query  567   TKRIQDFRHEMADD  526
                IQ   H+M  +
Sbjct  1701  ALEIQTTHHDMMGN  1714



>ref|XP_011087330.1| PREDICTED: putative late blight resistance protein homolog R1B-17 
[Sesamum indicum]
 ref|XP_011087331.1| PREDICTED: putative late blight resistance protein homolog R1B-17 
[Sesamum indicum]
 ref|XP_011087332.1| PREDICTED: putative late blight resistance protein homolog R1B-17 
[Sesamum indicum]
Length=837

 Score = 53.1 bits (126),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 28/51 (55%), Positives = 32/51 (63%), Gaps = 0/51 (0%)
 Frame = -2

Query  747  LLLEDKTLEQWMVDDESFPNLEHLVLRFCYCLEEIPKAIEYISRLRSIELQ  595
            LLLED  L  W+ D   FP LEHLV+R C  LEEIP  I  I+ L  IE+Q
Sbjct  757  LLLEDLDLVNWIADYSHFPRLEHLVIRGCSDLEEIPPGIGEITTLEIIEVQ  807



>emb|CDP15268.1| unnamed protein product [Coffea canephora]
Length=1484

 Score = 53.1 bits (126),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 30/85 (35%), Positives = 45/85 (53%), Gaps = 3/85 (4%)
 Frame = -2

Query  747   LLLEDKTLEQWMVDDESFPNLEHLVLRFCYCLEEIPKAIEYISRLRSIELQWCTPSVCYS  568
             L L+   + QW    +  P L+HL+LR C  L+E+P        L  IE+Q CT +V  S
Sbjct  1399  LKLDSLNVAQWNASSDHLPQLQHLILRSCRQLKEVPSGFAESCTLEMIEVQLCTHTVEES  1458

Query  567   TKRIQDFRHEMADDLFELKIIGEES  493
              K +QD +  M    +ELK++ + S
Sbjct  1459  VKSLQDGQLGMG---YELKVLIDHS  1480



>ref|XP_011093989.1| PREDICTED: putative late blight resistance protein homolog R1B-14 
[Sesamum indicum]
Length=701

 Score = 52.8 bits (125),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 28/80 (35%), Positives = 44/80 (55%), Gaps = 0/80 (0%)
 Frame = -2

Query  747  LLLEDKTLEQWMVDDESFPNLEHLVLRFCYCLEEIPKAIEYISRLRSIELQWCTPSVCYS  568
            L++    L+ W  DD  FP LEHL++R C  L EIP  I  I  L+ IE++   P +  S
Sbjct  615  LMMASLHLDFWAADDICFPRLEHLIIRRCSGLPEIPYGIGDIPTLKVIEVREYLPPLLDS  674

Query  567  TKRIQDFRHEMADDLFELKI  508
             + IQ  + +  +D  E+++
Sbjct  675  VRMIQKKQEKNGNDGLEVRL  694



>gb|ABI96212.1| NBS-LRR resistance protein-like protein [Solanum sp. VFNT]
Length=1248

 Score = 53.1 bits (126),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 32/81 (40%), Positives = 50/81 (62%), Gaps = 2/81 (2%)
 Frame = -2

Query  729   TLEQWMVDDESFPNLEHLVLRFCYCLEEIPKAIEYISRLRSIELQWCTPSVCYSTKRIQD  550
             TL +W V +ESFPNLE L L+ C  LEEIP +   I  L+ I++   +P +  S  +I++
Sbjct  1167  TLSKWEVGEESFPNLEKLKLQVCRKLEEIPPSFGDIYSLKFIKIVR-SPQLEDSALKIKE  1225

Query  549   FRHEMADDLFELKIIGEESIP  487
             +  +M     EL+I+G+ +IP
Sbjct  1226  YAEDMRGG-NELQILGQSNIP  1245



>emb|CDP05558.1| unnamed protein product [Coffea canephora]
Length=888

 Score = 53.1 bits (126),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 30/83 (36%), Positives = 42/83 (51%), Gaps = 3/83 (4%)
 Frame = -2

Query  747  LLLEDKTLEQWMVDDESFPNLEHLVLRFCYCLEEIPKAIEYISRLRSIELQWCTPSVCYS  568
            L L    L  W      FP LE +VL+ C  LEEIP     +S L+++EL W TP+   S
Sbjct  801  LQLGRSDLVHWHASSHHFPRLERVVLKHCTHLEEIPCGFGEVSALQNMELYWPTPAAAAS  860

Query  567  TKRIQDFRHE---MADDLFELKI  508
             + IQ  + +   M +  F+L I
Sbjct  861  ARLIQHQKQQDQRMVNSAFKLLI  883



>emb|CDP16115.1| unnamed protein product [Coffea canephora]
Length=809

 Score = 52.8 bits (125),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 29/63 (46%), Positives = 39/63 (62%), Gaps = 1/63 (2%)
 Frame = -2

Query  741  LEDKTLEQWM-VDDESFPNLEHLVLRFCYCLEEIPKAIEYISRLRSIELQWCTPSVCYST  565
            L +  +E+W+ V  ESFP L  LVLR CY LEEIP     +S L+ IE+++C+  V  S 
Sbjct  730  LYNLNIEKWINVSTESFPCLHRLVLRHCYRLEEIPPCFGDVSTLKMIEVRFCSERVTNSA  789

Query  564  KRI  556
            K I
Sbjct  790  KSI  792



>gb|EYU21831.1| hypothetical protein MIMGU_mgv1a0261622mg, partial [Erythranthe 
guttata]
Length=817

 Score = 52.8 bits (125),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 28/59 (47%), Positives = 34/59 (58%), Gaps = 0/59 (0%)
 Frame = -2

Query  732  KTLEQWMVDDESFPNLEHLVLRFCYCLEEIPKAIEYISRLRSIELQWCTPSVCYSTKRI  556
            + LE W  D   FP LEHL L     L+EIP  I  IS L+SI+L WC+ S   S K+I
Sbjct  750  RDLEWWTTDSNHFPRLEHLHLEDLDKLKEIPSCIGEISTLQSIQLIWCSKSAVSSAKKI  808



>gb|ABO92983.1| putative disease resistance protein [Solanum tuberosum]
Length=760

 Score = 52.8 bits (125),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 34/75 (45%), Positives = 44/75 (59%), Gaps = 1/75 (1%)
 Frame = -2

Query  726  LEQWMVDDESFPNLEHLVLRFCYCLEEIPKAIEYISRLRSIELQWCTPSVCYSTKRIQDF  547
            L +W+V D++FPNLE LVLR C  L EIP     I  L+ IEL  C  SV  S K I++ 
Sbjct  622  LMKWIVADDAFPNLEQLVLRGCKDLMEIPFCFMDILSLKYIELDNCNKSVVKSAKDIEEA  681

Query  546  RHEMADDL-FELKII  505
            + E   +  F+L II
Sbjct  682  QVEDNQNTNFKLVII  696



>emb|CDP12770.1| unnamed protein product [Coffea canephora]
Length=811

 Score = 52.8 bits (125),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 24/71 (34%), Positives = 40/71 (56%), Gaps = 0/71 (0%)
 Frame = -2

Query  720  QWMVDDESFPNLEHLVLRFCYCLEEIPKAIEYISRLRSIELQWCTPSVCYSTKRIQDFRH  541
             W    ++FP L+ LV+  C  LEE+P  +     L  IE++WC  SV  S K+IQ  + 
Sbjct  735  SWTASSDNFPRLQKLVVHNCENLEEVPSCLGECPTLEMIEVKWCRTSVANSVKQIQQEQI  794

Query  540  EMADDLFELKI  508
            +M +++ ++ I
Sbjct  795  DMGNEVLKISI  805



>sp|Q6L440.2|R1A3_SOLDE RecName: Full=Putative late blight resistance protein homolog 
R1A-3 [Solanum demissum]
 gb|AAT39942.2| Late blight resistance protein, putative [Solanum demissum]
Length=775

 Score = 52.8 bits (125),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 34/75 (45%), Positives = 44/75 (59%), Gaps = 1/75 (1%)
 Frame = -2

Query  726  LEQWMVDDESFPNLEHLVLRFCYCLEEIPKAIEYISRLRSIELQWCTPSVCYSTKRIQDF  547
            L +W+V D++FPNLE LVLR C  L EIP     I  L+ IEL  C  SV  S K I++ 
Sbjct  637  LMKWIVADDAFPNLEQLVLRGCKDLMEIPFCFMDILSLKYIELDNCNKSVVKSAKDIEEA  696

Query  546  RHEMADDL-FELKII  505
            + E   +  F+L II
Sbjct  697  QVEDNQNTNFKLVII  711



>gb|AAZ95005.1| late blight resistance protein Rpi-blb2 [Solanum bulbocastanum]
Length=1267

 Score = 52.8 bits (125),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 34/87 (39%), Positives = 51/87 (59%), Gaps = 2/87 (2%)
 Frame = -2

Query  747   LLLEDKTLEQWMVDDESFPNLEHLVLRFCYCLEEIPKAIEYISRLRSIELQWCTPSVCYS  568
             L+L    L +W V +ESFP LE L L  C+ LEEIP +   I  L+ IEL   +P +  S
Sbjct  1180  LMLSQVILSKWEVGEESFPTLEKLELSDCHNLEEIPSSFGDIYSLKIIELVR-SPQLENS  1238

Query  567   TKRIQDFRHEMADDLFELKIIGEESIP  487
               +I+++  +M     EL+I+G++ IP
Sbjct  1239  ALKIKEYAEDMRGG-DELQILGQKDIP  1264



>ref|XP_011087334.1| PREDICTED: putative late blight resistance protein homolog R1B-16 
[Sesamum indicum]
Length=821

 Score = 52.8 bits (125),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 27/66 (41%), Positives = 38/66 (58%), Gaps = 0/66 (0%)
 Frame = -2

Query  747  LLLEDKTLEQWMVDDESFPNLEHLVLRFCYCLEEIPKAIEYISRLRSIELQWCTPSVCYS  568
            LL+E+  L  W+ D+  F  L+HL ++ C  LE IP  I  I  L+ IE+  C PSV  S
Sbjct  748  LLMENLNLVNWVADESHFRRLQHLFIQHCSDLEAIPLVIRDIPTLQVIEVHNCRPSVMNS  807

Query  567  TKRIQD  550
             + IQ+
Sbjct  808  ARMIQE  813



>ref|XP_009799971.1| PREDICTED: LOW QUALITY PROTEIN: putative late blight resistance 
protein homolog R1A-3 [Nicotiana sylvestris]
Length=1241

 Score = 52.8 bits (125),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 31/74 (42%), Positives = 46/74 (62%), Gaps = 2/74 (3%)
 Frame = -2

Query  729   TLEQWMVDDESFPNLEHLVLRFCYCLEEIPKAIEYISRLRSIELQWCTPSVCYSTKRIQD  550
             +  +W V +E+FP LE L LR+C  L+EIP+++  I+ L+SI L+   P +  S  RI+D
Sbjct  1166  SFSEWHVGEETFPVLEELQLRYCTELKEIPESVGDITSLKSITLE-SNPQLEDSALRIKD  1224

Query  549   FRHEM-ADDLFELK  511
             +  EM   D  ELK
Sbjct  1225  YISEMTGADKLELK  1238



>ref|XP_011072192.1| PREDICTED: putative late blight resistance protein homolog R1B-16 
[Sesamum indicum]
Length=881

 Score = 52.8 bits (125),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 24/80 (30%), Positives = 49/80 (61%), Gaps = 0/80 (0%)
 Frame = -2

Query  747  LLLEDKTLEQWMVDDESFPNLEHLVLRFCYCLEEIPKAIEYISRLRSIELQWCTPSVCYS  568
            LL+E   L +W+ ++  FP LEHL++  C+ L+ IP  I  I  L+ I++  C+ S   S
Sbjct  799  LLIEKMRLVRWIAENTHFPCLEHLIISACHDLQAIPSGIGDIPTLKMIDIDDCSSSAVTS  858

Query  567  TKRIQDFRHEMADDLFELKI  508
             ++I + + +M +++ ++++
Sbjct  859  VEQILEEQRDMENNVLQVRV  878



>ref|XP_009614428.1| PREDICTED: putative late blight resistance protein homolog R1A-3 
[Nicotiana tomentosiformis]
 ref|XP_009614429.1| PREDICTED: putative late blight resistance protein homolog R1A-3 
[Nicotiana tomentosiformis]
 ref|XP_009614430.1| PREDICTED: putative late blight resistance protein homolog R1A-3 
[Nicotiana tomentosiformis]
Length=1164

 Score = 52.8 bits (125),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 31/81 (38%), Positives = 48/81 (59%), Gaps = 2/81 (2%)
 Frame = -2

Query  747   LLLEDKTLEQWMVDDESFPNLEHLVLRFCYCLEEIPKAIEYISRLRSIELQWCTPSVCYS  568
             L L    + +W   DES  NLE L++  C+ L+EIP AI  IS ++ IE++ C  S+  S
Sbjct  1078  LKLRSLKITEWNASDESLQNLERLLVESCFHLQEIPSAIGEISSIKMIEVKRCGESLEKS  1137

Query  567   TKRIQDFRHEMADDLFELKII  505
              ++IQ+ + E  D   E+K+I
Sbjct  1138  VRQIQEEQKEEYDK--EIKVI  1156



>gb|EYU31596.1| hypothetical protein MIMGU_mgv1a025161mg [Erythranthe guttata]
Length=754

 Score = 52.4 bits (124),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 30/64 (47%), Positives = 35/64 (55%), Gaps = 4/64 (6%)
 Frame = -2

Query  726  LEQWMVDDESFPNLEHLVLRFCYCLEEIPKAIEYISRLRSIELQWCTPSVCYSTKRI---  556
            LE W      FP LEHL L+    L+EIP  I  IS L+SI+L WC+ S   S K I   
Sbjct  679  LEWWTTGSNHFPRLEHLHLQLLDKLKEIPSCIGEISTLQSIQLIWCSKSAVISAKEILKE  738

Query  555  -QDF  547
             QDF
Sbjct  739  QQDF  742



>ref|XP_009628574.1| PREDICTED: putative late blight resistance protein homolog R1A-10 
isoform X1 [Nicotiana tomentosiformis]
 ref|XP_009628576.1| PREDICTED: putative late blight resistance protein homolog R1A-10 
isoform X1 [Nicotiana tomentosiformis]
Length=855

 Score = 52.4 bits (124),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 30/74 (41%), Positives = 39/74 (53%), Gaps = 0/74 (0%)
 Frame = -2

Query  747  LLLEDKTLEQWMVDDESFPNLEHLVLRFCYCLEEIPKAIEYISRLRSIELQWCTPSVCYS  568
            LL+    L  W     +FP L+ LVLR C  LEEIPK    I  L SIEL  C+ S   S
Sbjct  770  LLISVTFLRHWEAGSVNFPKLQRLVLRSCIGLEEIPKDFGEIYSLESIELYDCSMSAAKS  829

Query  567  TKRIQDFRHEMADD  526
             + +Q+ +  M +D
Sbjct  830  VEELQEEQKSMGND  843



>ref|XP_011087136.1| PREDICTED: putative late blight resistance protein homolog R1A-10 
[Sesamum indicum]
Length=877

 Score = 52.4 bits (124),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 33/77 (43%), Positives = 42/77 (55%), Gaps = 2/77 (3%)
 Frame = -2

Query  738  EDKTLEQWMVDDESFPNLEHLVLRFCYCLEEIPKAIEYISRLRSIELQWCTPSVCYSTKR  559
            ED  LE W      FP LE L++R CY L+ IP  I+ IS L  IEL  C PS+  S KR
Sbjct  795  EDIDLEYWY--RGLFPWLERLIIRDCYKLKRIPLGIKKISSLEMIELVDCNPSLVSSAKR  852

Query  558  IQDFRHEMADDLFELKI  508
            I + +    DD  ++ I
Sbjct  853  IAEEQKSNGDDYLQICI  869



>ref|XP_009628577.1| PREDICTED: putative late blight resistance protein homolog R1A-10 
isoform X2 [Nicotiana tomentosiformis]
Length=854

 Score = 52.4 bits (124),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 30/74 (41%), Positives = 39/74 (53%), Gaps = 0/74 (0%)
 Frame = -2

Query  747  LLLEDKTLEQWMVDDESFPNLEHLVLRFCYCLEEIPKAIEYISRLRSIELQWCTPSVCYS  568
            LL+    L  W     +FP L+ LVLR C  LEEIPK    I  L SIEL  C+ S   S
Sbjct  770  LLISVTFLRHWEAGSVNFPKLQRLVLRSCIGLEEIPKDFGEIYSLESIELYDCSMSAAKS  829

Query  567  TKRIQDFRHEMADD  526
             + +Q+ +  M +D
Sbjct  830  VEELQEEQKSMGND  843



>ref|XP_004239390.2| PREDICTED: putative late blight resistance protein homolog R1C-3 
[Solanum lycopersicum]
Length=1193

 Score = 52.4 bits (124),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 30/79 (38%), Positives = 41/79 (52%), Gaps = 0/79 (0%)
 Frame = -2

Query  729   TLEQWMVDDESFPNLEHLVLRFCYCLEEIPKAIEYISRLRSIELQWCTPSVCYSTKRIQD  550
             +  +W V D++F NL+H+ LR C  L EIP     I  L+ IE+  C  SV  S + IQ+
Sbjct  1109  SFREWTVSDDAFSNLQHMFLRCCQSLVEIPSWFAEIHSLKYIEVDNCNGSVVESARTIQN  1168

Query  549   FRHEMADDLFELKIIGEES  493
              + E  D   EL I    S
Sbjct  1169  TKVEDYDVDLELVIKTHNS  1187



>sp|Q6L3N7.1|R1C3_SOLDE RecName: Full=Putative late blight resistance protein homolog 
R1C-3 [Solanum demissum]
 gb|AAT38759.1| Putative late blight resistance protein, identical [Solanum demissum]
Length=1292

 Score = 52.4 bits (124),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 28/60 (47%), Positives = 37/60 (62%), Gaps = 0/60 (0%)
 Frame = -2

Query  729   TLEQWMVDDESFPNLEHLVLRFCYCLEEIPKAIEYISRLRSIELQWCTPSVCYSTKRIQD  550
             +L +W+V D++FPNLE LVLR C  L EIP     I  L+ IE++ C  SV  S   IQ+
Sbjct  1152  SLLKWIVADDAFPNLEQLVLRGCRHLMEIPSCFMDILSLQYIEVENCNESVVKSAMNIQE  1211



>gb|EYU40389.1| hypothetical protein MIMGU_mgv1a001268mg [Erythranthe guttata]
Length=849

 Score = 52.4 bits (124),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 32/80 (40%), Positives = 43/80 (54%), Gaps = 1/80 (1%)
 Frame = -2

Query  717  WMVDDESFPNLEHLVLRFCYCLEEIPKAIEYISRLRSIELQWCTPSVCYSTKRIQDFRHE  538
            W+ +   FP LE LVLR CY L EIP +I  I  L  I++  C  S+  S KRIQ+    
Sbjct  763  WITESSHFPTLEVLVLRKCYTLSEIPYSICEIQTLEQIKVDCCNSSIGESAKRIQEEVQS  822

Query  537  MADDLFELKIIGEESIPADD  478
              ++L E+  I  +  PA D
Sbjct  823  FGNEL-EVLTITSQLEPALD  841



>ref|XP_004233876.2| PREDICTED: putative late blight resistance protein homolog R1C-3 
[Solanum lycopersicum]
Length=745

 Score = 52.4 bits (124),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 30/81 (37%), Positives = 48/81 (59%), Gaps = 1/81 (1%)
 Frame = -2

Query  747  LLLEDKTLEQWMVDDESFPNLEHLVLRFCYCLEEIPKAIEYISRLRSIELQWCTPSVCYS  568
            L LE  +++ W +  +SFP LE LVLR+C  LEEIP +   +  L+ IE + C PS   S
Sbjct  662  LKLEHSSIKHWNMFVDSFPCLEQLVLRWCGKLEEIPASFGSMPSLQKIEARACCPSARKS  721

Query  567  TKRIQDFRHEMADDLFELKII  505
              +I++ + +   +L + K+I
Sbjct  722  AVKIRNMQRDDMKNL-DFKVI  741



>ref|XP_011077138.1| PREDICTED: putative late blight resistance protein homolog R1B-14 
[Sesamum indicum]
Length=875

 Score = 52.4 bits (124),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 27/77 (35%), Positives = 42/77 (55%), Gaps = 0/77 (0%)
 Frame = -2

Query  729  TLEQWMVDDESFPNLEHLVLRFCYCLEEIPKAIEYISRLRSIELQWCTPSVCYSTKRIQD  550
             L+ W+ D   FP+LEHL L  C  L EIP  +  I  L+ IE+     S+  S K+I++
Sbjct  799  NLQHWVTDSSHFPSLEHLQLFSCQRLGEIPDVLGEIPTLKIIEVNRSDRSLVKSAKQIKE  858

Query  549  FRHEMADDLFELKIIGE  499
             +    +D  E++I+ E
Sbjct  859  EQQSFGNDYLEVRIVRE  875



>emb|CDP19728.1| unnamed protein product [Coffea canephora]
Length=1099

 Score = 52.4 bits (124),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 29/85 (34%), Positives = 48/85 (56%), Gaps = 3/85 (4%)
 Frame = -2

Query  747   LLLEDKTLEQWMVDDESFPNLEHLVLRFCYCLEEIPKAIEYISRLRSIELQWCTPSVCYS  568
             L L+   L +W    +  P L+HL+L+ C+ L+E+P        L  IE+Q CT S+  S
Sbjct  1014  LKLDSLNLSEWNASSDHLPQLQHLILQSCWQLKEVPPGFGDSFTLEIIEVQMCTSSLEES  1073

Query  567   TKRIQDFRHEMADDLFELKIIGEES  493
              KR+++ + EM +   ELK++ + S
Sbjct  1074  VKRLEEEQQEMGN---ELKVLVDHS  1095



>gb|ABE68835.1| root-knot nematode resistance protein [Capsicum annuum]
Length=1257

 Score = 52.4 bits (124),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 33/81 (41%), Positives = 49/81 (60%), Gaps = 2/81 (2%)
 Frame = -2

Query  729   TLEQWMVDDESFPNLEHLVLRFCYCLEEIPKAIEYISRLRSIELQWCTPSVCYSTKRIQD  550
             TL +W V +ESFPNLE L L+ C  LEEIP +   I  L+ I++   +P +  S  +I+ 
Sbjct  1176  TLSKWEVGEESFPNLEKLKLQECGKLEEIPPSFGDIYSLKFIKI-VKSPQLEDSALKIKK  1234

Query  549   FRHEMADDLFELKIIGEESIP  487
             +  +M     EL+I+G+E IP
Sbjct  1235  YAEDMRGG-NELQILGQEDIP  1254



>ref|XP_009777477.1| PREDICTED: putative late blight resistance protein homolog R1A-3 
isoform X1 [Nicotiana sylvestris]
 ref|XP_009777478.1| PREDICTED: putative late blight resistance protein homolog R1A-3 
isoform X1 [Nicotiana sylvestris]
Length=1254

 Score = 52.4 bits (124),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 29/68 (43%), Positives = 41/68 (60%), Gaps = 2/68 (3%)
 Frame = -2

Query  747   LLLEDKTLEQWMVDDESFPNLEHLVLRFCYCLEEIPKAIEYISRLRSIELQWC--TPSVC  574
             L LE+  + +W   +ESFP LE LV++ C  LEEIP +  YI  L+ I+L WC    S+ 
Sbjct  1162  LKLEELYVSKWDASEESFPQLETLVIKQCEYLEEIPLSFAYIQTLKQIKLIWCNNNKSLV  1221

Query  573   YSTKRIQD  550
              S  RI++
Sbjct  1222  ASAVRIKE  1229



>ref|XP_009622842.1| PREDICTED: putative late blight resistance protein homolog R1B-16 
[Nicotiana tomentosiformis]
 ref|XP_009622843.1| PREDICTED: putative late blight resistance protein homolog R1B-16 
[Nicotiana tomentosiformis]
Length=880

 Score = 52.4 bits (124),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 25/73 (34%), Positives = 42/73 (58%), Gaps = 0/73 (0%)
 Frame = -2

Query  726  LEQWMVDDESFPNLEHLVLRFCYCLEEIPKAIEYISRLRSIELQWCTPSVCYSTKRIQDF  547
            L  W    +S P LE+LVL FC  LEEIP+ I  I  L+ I+L +C+ +   S + IQ+ 
Sbjct  799  LVHWQATSDSLPVLEYLVLMFCSQLEEIPRVIGDIPTLKLIDLHYCSQAAVTSAEEIQEE  858

Query  546  RHEMADDLFELKI  508
            +  + +++  + +
Sbjct  859  QKSIGNEVLVVTV  871



>gb|EYU24542.1| hypothetical protein MIMGU_mgv1a020452mg [Erythranthe guttata]
Length=871

 Score = 52.4 bits (124),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 28/81 (35%), Positives = 47/81 (58%), Gaps = 0/81 (0%)
 Frame = -2

Query  747  LLLEDKTLEQWMVDDESFPNLEHLVLRFCYCLEEIPKAIEYISRLRSIELQWCTPSVCYS  568
            LL+E   L  W+ + + FP+L+ L+LR C  L EIP AI  I  L+ IE++  + S+  S
Sbjct  779  LLIESSDLRHWITESDHFPSLKWLLLRHCEHLREIPDAIGEIPTLQLIEVKGGSASLFES  838

Query  567  TKRIQDFRHEMADDLFELKII  505
             K IQ+ +    ++  +++ I
Sbjct  839  AKGIQEEQQSWGNEALQVRCI  859



>ref|XP_009777479.1| PREDICTED: putative late blight resistance protein homolog R1A-3 
isoform X2 [Nicotiana sylvestris]
Length=1143

 Score = 52.4 bits (124),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 29/68 (43%), Positives = 41/68 (60%), Gaps = 2/68 (3%)
 Frame = -2

Query  747   LLLEDKTLEQWMVDDESFPNLEHLVLRFCYCLEEIPKAIEYISRLRSIELQWC--TPSVC  574
             L LE+  + +W   +ESFP LE LV++ C  LEEIP +  YI  L+ I+L WC    S+ 
Sbjct  1051  LKLEELYVSKWDASEESFPQLETLVIKQCEYLEEIPLSFAYIQTLKQIKLIWCNNNKSLV  1110

Query  573   YSTKRIQD  550
              S  RI++
Sbjct  1111  ASAVRIKE  1118



>emb|CDP19132.1| unnamed protein product [Coffea canephora]
Length=1249

 Score = 52.4 bits (124),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 28/65 (43%), Positives = 37/65 (57%), Gaps = 0/65 (0%)
 Frame = -2

Query  747   LLLEDKTLEQWMVDDESFPNLEHLVLRFCYCLEEIPKAIEYISRLRSIELQWCTPSVCYS  568
             L L+   L QW    ++FP LE LVL+ C  LEEIP +   I+ L  IE+QWC+ S   S
Sbjct  1165  LKLDTLKLVQWNASSDNFPCLEQLVLQKCKQLEEIPSSFGDIATLEKIEVQWCSISASKS  1224

Query  567   TKRIQ  553
                I+
Sbjct  1225  ATDIE  1229



>sp|Q6L3L0.1|R1B23_SOLDE RecName: Full=Putative late blight resistance protein homolog 
R1B-23 [Solanum demissum]
 gb|AAT39284.1| Putative late blight resistance protein, identical [Solanum demissum]
Length=1262

 Score = 52.4 bits (124),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 28/60 (47%), Positives = 37/60 (62%), Gaps = 0/60 (0%)
 Frame = -2

Query  729   TLEQWMVDDESFPNLEHLVLRFCYCLEEIPKAIEYISRLRSIELQWCTPSVCYSTKRIQD  550
             +L +W+V D++FPNLE LVLR C  L EIP     I  L+ IE++ C  SV  S   IQ+
Sbjct  1122  SLLKWIVADDAFPNLEQLVLRRCRHLMEIPSCFMDILSLQYIEVENCNESVVKSAMNIQE  1181



>gb|EYU21791.1| hypothetical protein MIMGU_mgv1a001064mg [Erythranthe guttata]
Length=898

 Score = 52.0 bits (123),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 30/70 (43%), Positives = 37/70 (53%), Gaps = 0/70 (0%)
 Frame = -2

Query  738  EDKTLEQWMVDDESFPNLEHLVLRFCYCLEEIPKAIEYISRLRSIELQWCTPSVCYSTKR  559
            ED  LE W  D   FP LE L L   Y L+EIP  I  I  L SIEL +C+ S   S K 
Sbjct  813  EDSDLEWWTTDSTHFPRLEQLKLWDLYKLKEIPSCIGEIPTLGSIELIYCSKSAVISAKE  872

Query  558  IQDFRHEMAD  529
            I D + ++ +
Sbjct  873  ILDEQEDLGN  882



>gb|ABO93013.1| putative disease resistance protein [Solanum tuberosum]
Length=1320

 Score = 52.0 bits (123),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 28/60 (47%), Positives = 37/60 (62%), Gaps = 0/60 (0%)
 Frame = -2

Query  729   TLEQWMVDDESFPNLEHLVLRFCYCLEEIPKAIEYISRLRSIELQWCTPSVCYSTKRIQD  550
             +L +W+V D++FPNLE LVLR C  L EIP     I  L+ IE++ C  SV  S   IQ+
Sbjct  1180  SLLKWIVADDAFPNLEQLVLRGCRHLMEIPSYFMDILSLQYIEVENCNESVVKSAMNIQE  1239



>emb|CDP17920.1| unnamed protein product [Coffea canephora]
Length=1489

 Score = 52.0 bits (123),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 27/66 (41%), Positives = 38/66 (58%), Gaps = 0/66 (0%)
 Frame = -2

Query  747   LLLEDKTLEQWMVDDESFPNLEHLVLRFCYCLEEIPKAIEYISRLRSIELQWCTPSVCYS  568
             L L++  + QW     +FP LE LVL+ C  LEEIP+    I  LR IE+ WC  S   S
Sbjct  1408  LSLDNLNIAQWNASCHNFPKLERLVLQNCKDLEEIPEDFGMIGSLRMIEVHWCGKSAEES  1467

Query  567   TKRIQD  550
              ++I++
Sbjct  1468  AEQIKE  1473



>sp|Q6L3X3.1|R1B8_SOLDE RecName: Full=Putative late blight resistance protein homolog 
R1B-8 [Solanum demissum]
 gb|AAT38800.1| Putative late blight resistance protein, identical [Solanum demissum]
Length=1202

 Score = 52.0 bits (123),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 34/82 (41%), Positives = 49/82 (60%), Gaps = 1/82 (1%)
 Frame = -2

Query  747   LLLEDKTLEQWMVDDESFPNLEHLVLRFCYCLEEIPKAIEYISRLRSIELQWCTPSVCYS  568
             L LE  +L +W+V D+ FPNLE LVLR C  L EIP     I  L+ I++   + SV  S
Sbjct  1092  LKLEYVSLMKWIVADDVFPNLEQLVLRGCRHLMEIPSCFMDILSLKYIKVDEYSESVVQS  1151

Query  567   TKRIQDFR-HEMADDLFELKII  505
              ++IQ+ +  E  ++ F+L II
Sbjct  1152  ARKIQETQIEEYQNNNFKLVII  1173



>ref|XP_009783244.1| PREDICTED: late blight resistance protein R1-A-like isoform X1 
[Nicotiana sylvestris]
 ref|XP_009783245.1| PREDICTED: late blight resistance protein R1-A-like isoform X1 
[Nicotiana sylvestris]
Length=1272

 Score = 52.0 bits (123),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 30/64 (47%), Positives = 41/64 (64%), Gaps = 1/64 (2%)
 Frame = -2

Query  726   LEQW-MVDDESFPNLEHLVLRFCYCLEEIPKAIEYISRLRSIELQWCTPSVCYSTKRIQD  550
              E+W + DDE+FP LE LVLR C  L+EIP A   IS L+ IE++ C  SV  S + I++
Sbjct  1175  FEEWDVTDDEAFPKLERLVLRECEYLKEIPSAFGEISSLKYIEVRKCPESVDKSARDIRE  1234

Query  549   FRHE  538
              + E
Sbjct  1235  IQVE  1238



>gb|EYU19026.1| hypothetical protein MIMGU_mgv1a020094mg [Erythranthe guttata]
Length=770

 Score = 52.0 bits (123),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 30/78 (38%), Positives = 40/78 (51%), Gaps = 3/78 (4%)
 Frame = -2

Query  726  LEQWMVDDESFPNLEHLVLRFCYCLEEIPKAIEYISRLRSIELQWCTPSVCYSTKRIQDF  547
            LE W  D  SFP LEHLVL+    L EIP  I  I  L+SIEL  C      S K I D 
Sbjct  681  LEWWTTDSSSFPRLEHLVLQQLDKLNEIPSGIGEIPTLQSIELNLCHDDAVISAKSIFDE  740

Query  546  RHEMADDLFELKIIGEES  493
            + ++      ++++  +S
Sbjct  741  QEDLG---LRVRVVARDS  755



>ref|XP_006361239.1| PREDICTED: putative late blight resistance protein homolog R1B-12-like 
isoform X1 [Solanum tuberosum]
Length=992

 Score = 52.0 bits (123),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 25/66 (38%), Positives = 41/66 (62%), Gaps = 0/66 (0%)
 Frame = -2

Query  747  LLLEDKTLEQWMVDDESFPNLEHLVLRFCYCLEEIPKAIEYISRLRSIELQWCTPSVCYS  568
            LL+E K LE W  +D+SFP LE ++++ C  L++IP+       L+ IEL+ C+ S+   
Sbjct  891  LLIEKKGLEYWTAEDDSFPCLERVIIKNCPSLQKIPQGFADSMTLQLIELRGCSTSLVNF  950

Query  567  TKRIQD  550
             + IQ+
Sbjct  951  AREIQE  956



>ref|XP_009783246.1| PREDICTED: late blight resistance protein R1-A-like isoform X2 
[Nicotiana sylvestris]
Length=1220

 Score = 52.0 bits (123),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 30/64 (47%), Positives = 41/64 (64%), Gaps = 1/64 (2%)
 Frame = -2

Query  726   LEQW-MVDDESFPNLEHLVLRFCYCLEEIPKAIEYISRLRSIELQWCTPSVCYSTKRIQD  550
              E+W + DDE+FP LE LVLR C  L+EIP A   IS L+ IE++ C  SV  S + I++
Sbjct  1123  FEEWDVTDDEAFPKLERLVLRECEYLKEIPSAFGEISSLKYIEVRKCPESVDKSARDIRE  1182

Query  549   FRHE  538
              + E
Sbjct  1183  IQVE  1186



>ref|XP_009785700.1| PREDICTED: putative late blight resistance protein homolog R1B-11 
[Nicotiana sylvestris]
Length=433

 Score = 51.6 bits (122),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 26/74 (35%), Positives = 44/74 (59%), Gaps = 0/74 (0%)
 Frame = -2

Query  729  TLEQWMVDDESFPNLEHLVLRFCYCLEEIPKAIEYISRLRSIELQWCTPSVCYSTKRIQD  550
             LE+W    ++FP LE L+L     LEEIP++I  I  L+ I+++WC+ +   S  +IQ+
Sbjct  351  NLERWEATSDNFPMLEQLLLSGLKKLEEIPQSIGEIMTLKFIKIEWCSSAADTSAMKIQE  410

Query  549  FRHEMADDLFELKI  508
             +    +D  E++I
Sbjct  411  EQTNCGNDSLEVQI  424



>ref|XP_010321921.1| PREDICTED: putative late blight resistance protein homolog R1A-3 
[Solanum lycopersicum]
Length=1026

 Score = 52.0 bits (123),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 32/81 (40%), Positives = 50/81 (62%), Gaps = 2/81 (2%)
 Frame = -2

Query  729   TLEQWMVDDESFPNLEHLVLRFCYCLEEIPKAIEYISRLRSIELQWCTPSVCYSTKRIQD  550
             TL +W V +ESFPNLE L L+ C   EEIP +   I  L+ I++   +P +  S  +I++
Sbjct  945   TLSKWEVGEESFPNLEKLKLQECGKFEEIPPSFGDIYSLKFIKIV-KSPQLEDSALKIKE  1003

Query  549   FRHEMADDLFELKIIGEESIP  487
             +  EM     EL+I+G+++IP
Sbjct  1004  YAEEMRGG-SELQILGQKNIP  1023



>ref|XP_009762701.1| PREDICTED: putative late blight resistance protein homolog R1A-10 
[Nicotiana sylvestris]
Length=983

 Score = 52.0 bits (123),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 30/88 (34%), Positives = 49/88 (56%), Gaps = 5/88 (6%)
 Frame = -2

Query  747  LLLEDKTLEQWMVDD--ESFPNLEHLVLRFCYCLEEIPKAIEYISRLRSIELQWCTPSVC  574
            +LLE   L+ W   D  ++FP LE +V+R C  L++IPK       L+ IEL  C+PS+ 
Sbjct  791  VLLEKLDLKYWRAADIDDNFPCLERVVIRNCSYLKQIPKVFADSGTLQRIELWGCSPSLV  850

Query  573  YSTKRIQDFRHEMADDL---FELKIIGE  499
               K+IQ+   ++ +++   +    IGE
Sbjct  851  TFAKKIQENHEDLGNNMLKVYAFDTIGE  878



>ref|XP_004238957.1| PREDICTED: putative late blight resistance protein homolog R1A-10 
[Solanum lycopersicum]
Length=747

 Score = 51.6 bits (122),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 31/65 (48%), Positives = 39/65 (60%), Gaps = 0/65 (0%)
 Frame = -2

Query  747  LLLEDKTLEQWMVDDESFPNLEHLVLRFCYCLEEIPKAIEYISRLRSIELQWCTPSVCYS  568
            L LE   + QW   D SFP LE LV++ C  LEEIP +   IS LR I+L  C+ SV  S
Sbjct  663  LKLELVDMNQWEASDTSFPMLEKLVIKDCEQLEEIPSSFADISTLRLIKLINCSESVRES  722

Query  567  TKRIQ  553
             +RI+
Sbjct  723  AQRIK  727



>ref|XP_004248476.2| PREDICTED: putative late blight resistance protein homolog R1B-14 
isoform X2 [Solanum lycopersicum]
Length=869

 Score = 51.6 bits (122),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 31/80 (39%), Positives = 42/80 (53%), Gaps = 0/80 (0%)
 Frame = -2

Query  747  LLLEDKTLEQWMVDDESFPNLEHLVLRFCYCLEEIPKAIEYISRLRSIELQWCTPSVCYS  568
            LLL+   L  W      FP LE+LVL+ C CL EIP  +  I  L  IEL  C+ S   S
Sbjct  782  LLLDGTDLIHWKASSIQFPKLENLVLKNCGCLYEIPDDVAEIPTLLFIELYHCSSSADDS  841

Query  567  TKRIQDFRHEMADDLFELKI  508
              RI++ +  M +D   ++I
Sbjct  842  ANRIREEQISMGNDDLVVRI  861



>ref|XP_009608261.1| PREDICTED: putative late blight resistance protein homolog R1A-3 
isoform X1 [Nicotiana tomentosiformis]
Length=1228

 Score = 52.0 bits (123),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 30/66 (45%), Positives = 40/66 (61%), Gaps = 0/66 (0%)
 Frame = -2

Query  747   LLLEDKTLEQWMVDDESFPNLEHLVLRFCYCLEEIPKAIEYISRLRSIELQWCTPSVCYS  568
             L LE+  L +W V DE+F  LE LVL  C  LEEIP   E + +L+ IE+  C+ SV  S
Sbjct  1148  LKLENLKLSEWSVSDEAFCCLERLVLVRCLHLEEIPSCFEDLEKLQYIEVNSCSESVANS  1207

Query  567   TKRIQD  550
              + I+D
Sbjct  1208  ARDIRD  1213



>ref|XP_010327076.1| PREDICTED: putative late blight resistance protein homolog R1B-14 
isoform X1 [Solanum lycopersicum]
 ref|XP_010327077.1| PREDICTED: putative late blight resistance protein homolog R1B-14 
isoform X1 [Solanum lycopersicum]
Length=879

 Score = 51.6 bits (122),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 31/80 (39%), Positives = 42/80 (53%), Gaps = 0/80 (0%)
 Frame = -2

Query  747  LLLEDKTLEQWMVDDESFPNLEHLVLRFCYCLEEIPKAIEYISRLRSIELQWCTPSVCYS  568
            LLL+   L  W      FP LE+LVL+ C CL EIP  +  I  L  IEL  C+ S   S
Sbjct  782  LLLDGTDLIHWKASSIQFPKLENLVLKNCGCLYEIPDDVAEIPTLLFIELYHCSSSADDS  841

Query  567  TKRIQDFRHEMADDLFELKI  508
              RI++ +  M +D   ++I
Sbjct  842  ANRIREEQISMGNDDLVVRI  861



>ref|XP_006361240.1| PREDICTED: putative late blight resistance protein homolog R1B-12-like 
isoform X2 [Solanum tuberosum]
Length=859

 Score = 51.6 bits (122),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 25/66 (38%), Positives = 41/66 (62%), Gaps = 0/66 (0%)
 Frame = -2

Query  747  LLLEDKTLEQWMVDDESFPNLEHLVLRFCYCLEEIPKAIEYISRLRSIELQWCTPSVCYS  568
            LL+E K LE W  +D+SFP LE ++++ C  L++IP+       L+ IEL+ C+ S+   
Sbjct  758  LLIEKKGLEYWTAEDDSFPCLERVIIKNCPSLQKIPQGFADSMTLQLIELRGCSTSLVNF  817

Query  567  TKRIQD  550
             + IQ+
Sbjct  818  AREIQE  823



>ref|XP_011101277.1| PREDICTED: putative late blight resistance protein homolog R1A-10 
[Sesamum indicum]
 ref|XP_011101278.1| PREDICTED: putative late blight resistance protein homolog R1A-10 
[Sesamum indicum]
 ref|XP_011101279.1| PREDICTED: putative late blight resistance protein homolog R1A-10 
[Sesamum indicum]
 ref|XP_011101280.1| PREDICTED: putative late blight resistance protein homolog R1A-10 
[Sesamum indicum]
 ref|XP_011101281.1| PREDICTED: putative late blight resistance protein homolog R1A-10 
[Sesamum indicum]
Length=879

 Score = 51.6 bits (122),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 28/70 (40%), Positives = 36/70 (51%), Gaps = 0/70 (0%)
 Frame = -2

Query  747  LLLEDKTLEQWMVDDESFPNLEHLVLRFCYCLEEIPKAIEYISRLRSIELQWCTPSVCYS  568
             LLED  L  W   + SF ++ HL++R CY LEEIP  I     L  +EL    PSV  S
Sbjct  789  FLLEDTDLRHWRKGEGSFISIRHLIIRHCYKLEEIPLEIGIYPALERVELVDVKPSVVAS  848

Query  567  TKRIQDFRHE  538
              +I   R +
Sbjct  849  ADKILQLRTQ  858



>emb|CDP20176.1| unnamed protein product [Coffea canephora]
Length=894

 Score = 51.6 bits (122),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 25/57 (44%), Positives = 36/57 (63%), Gaps = 0/57 (0%)
 Frame = -2

Query  747  LLLEDKTLEQWMVDDESFPNLEHLVLRFCYCLEEIPKAIEYISRLRSIELQWCTPSV  577
            L +     E+W V DE FP+LE+LVL  C  L+EIP +   IS L+ I+++ C PS+
Sbjct  821  LAMHHSEFERWAVPDEPFPSLENLVLTDCTKLKEIPSSFADISTLKMIKIRGCCPSI  877



>ref|XP_006362840.1| PREDICTED: putative late blight resistance protein homolog R1B-17-like 
[Solanum tuberosum]
Length=876

 Score = 51.6 bits (122),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 32/76 (42%), Positives = 42/76 (55%), Gaps = 6/76 (8%)
 Frame = -2

Query  747  LLLEDKTLEQWM---VDDESFPNLEHLVLRFCYCLEEIPKAIEYISRLRSIELQWCTPSV  577
            LL+E + L  W     D   FP L+HLVLRFCY L+EIP  I  I  L+ I+L  C+P  
Sbjct  790  LLVESRDLVVWKQASTDSYPFPVLQHLVLRFCYKLKEIPYEIGDIPSLQVIKLHSCSP--  847

Query  576  CYSTKRIQDFRHEMAD  529
             Y+T+  +    E  D
Sbjct  848  -YATRLARMIEKEQID  862



>gb|EYU31597.1| hypothetical protein MIMGU_mgv1a001843mg [Erythranthe guttata]
Length=751

 Score = 51.6 bits (122),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 27/75 (36%), Positives = 41/75 (55%), Gaps = 0/75 (0%)
 Frame = -2

Query  726  LEQWMVDDESFPNLEHLVLRFCYCLEEIPKAIEYISRLRSIELQWCTPSVCYSTKRIQDF  547
            LE+W  +   FP LE L LR    LEEIP  I  I  L+SI +Q+C+ +   S +RI D 
Sbjct  655  LERWTTESAHFPRLEQLDLRHLDRLEEIPSDIGEIPTLQSIRVQYCSKATVISARRILDE  714

Query  546  RHEMADDLFELKIIG  502
            + E  +    ++++ 
Sbjct  715  QEEFDNVGLRVRVVA  729



>ref|XP_010327078.1| PREDICTED: putative late blight resistance protein homolog R1B-14 
isoform X3 [Solanum lycopersicum]
Length=869

 Score = 51.6 bits (122),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 31/80 (39%), Positives = 42/80 (53%), Gaps = 0/80 (0%)
 Frame = -2

Query  747  LLLEDKTLEQWMVDDESFPNLEHLVLRFCYCLEEIPKAIEYISRLRSIELQWCTPSVCYS  568
            LLL+   L  W      FP LE+LVL+ C CL EIP  +  I  L  IEL  C+ S   S
Sbjct  782  LLLDGTDLIHWKASSIQFPKLENLVLKNCGCLYEIPDDVAEIPTLLFIELYHCSSSADDS  841

Query  567  TKRIQDFRHEMADDLFELKI  508
              RI++ +  M +D   ++I
Sbjct  842  ANRIREEQISMGNDDLVVRI  861



>gb|AAT39281.2| Integrase core domain containing protein [Solanum demissum]
Length=1760

 Score = 51.6 bits (122),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 38/98 (39%), Positives = 50/98 (51%), Gaps = 11/98 (11%)
 Frame = -2

Query  747   LLLEDKTLEQWMVDDESFPNLEHLVLRFCYCLEEIPKAIEYISRLRSIELQWCTPSVCYS  568
             L LE  +L +W+V D++FPNLE LVLR C  L EIP     I  L+ IE+  C  SV  S
Sbjct  1605  LKLECLSLMKWIVADDAFPNLEQLVLRECRDLMEIPSCFMDILSLQYIEVVNCNESVVKS  1664

Query  567   TKRIQDFRHE-----------MADDLFELKIIGEESIP  487
                IQ+ + E           +    FEL +  +E IP
Sbjct  1665  AMNIQETQVEDYQNTNFKLVLIEKKTFELNLSRDEDIP  1702



>gb|AAT38780.1| Putative late blight resistance protein, identical [Solanum demissum]
Length=797

 Score = 51.6 bits (122),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 32/76 (42%), Positives = 43/76 (57%), Gaps = 1/76 (1%)
 Frame = -2

Query  729  TLEQWMVDDESFPNLEHLVLRFCYCLEEIPKAIEYISRLRSIELQWCTPSVCYSTKRIQD  550
            +L +W+V D++FPNLE LV   C  L EIP     I  L+ IE+  C  SV  S K IQ+
Sbjct  660  SLMKWIVADDAFPNLEQLVSLGCQNLMEIPSCFTDILSLKYIEVDICNKSVVKSAKYIQE  719

Query  549  FRHEMADDL-FELKII  505
             + E   +  F+L II
Sbjct  720  TQVEYNQNTNFKLVII  735



>ref|XP_011072136.1| PREDICTED: putative late blight resistance protein homolog R1A-10 
[Sesamum indicum]
Length=877

 Score = 51.6 bits (122),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 27/70 (39%), Positives = 40/70 (57%), Gaps = 0/70 (0%)
 Frame = -2

Query  717  WMVDDESFPNLEHLVLRFCYCLEEIPKAIEYISRLRSIELQWCTPSVCYSTKRIQDFRHE  538
            W  ++ +FPNLE LVL F + LEE+P  I  I  LRSI L+ C  SV  S  +I + +  
Sbjct  800  WRAENVNFPNLESLVLSFMWKLEEMPSVIGDIPTLRSIHLESCNNSVVDSAMQILEEQQS  859

Query  537  MADDLFELKI  508
              ++  +L +
Sbjct  860  YGNESLQLYV  869



>sp|Q6L3Y2.1|R1B11_SOLDE RecName: Full=Putative late blight resistance protein homolog 
R1B-11 [Solanum demissum]
 gb|AAT38806.1| Putative late blight resistance protein, identical [Solanum demissum]
Length=1252

 Score = 51.6 bits (122),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 34/82 (41%), Positives = 46/82 (56%), Gaps = 1/82 (1%)
 Frame = -2

Query  747   LLLEDKTLEQWMVDDESFPNLEHLVLRFCYCLEEIPKAIEYISRLRSIELQWCTPSVCYS  568
             L L+  +L +W+V D++FPNLE LV   C  L EIP     I  L+ IE+  C  SV  S
Sbjct  1109  LKLDYVSLMKWIVADDAFPNLEQLVSLGCQNLMEIPSCFTDILSLKYIEVDICNKSVVKS  1168

Query  567   TKRIQDFRHEMADDL-FELKII  505
              K IQ+ + E   +  F+L II
Sbjct  1169  AKYIQETQVEYNQNTNFKLVII  1190



>gb|AAC97933.1| disease resistance protein [Solanum lycopersicum]
Length=1257

 Score = 51.6 bits (122),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 32/81 (40%), Positives = 50/81 (62%), Gaps = 2/81 (2%)
 Frame = -2

Query  729   TLEQWMVDDESFPNLEHLVLRFCYCLEEIPKAIEYISRLRSIELQWCTPSVCYSTKRIQD  550
             TL +W V +ESFPNLE L L+ C  LEEIP +   I  L+ I++   +P +  S  +I+ 
Sbjct  1176  TLSKWEVGEESFPNLEKLKLQECGKLEEIPPSFGDIYSLKFIKI-VKSPQLEDSALKIKK  1234

Query  549   FRHEMADDLFELKIIGEESIP  487
             +  +M     EL+I+G+++IP
Sbjct  1235  YAEDMRGG-NELQILGQKNIP  1254



>ref|XP_006366307.1| PREDICTED: putative late blight resistance protein homolog R1B-14-like 
isoform X1 [Solanum tuberosum]
 ref|XP_006366308.1| PREDICTED: putative late blight resistance protein homolog R1B-14-like 
isoform X2 [Solanum tuberosum]
Length=887

 Score = 51.6 bits (122),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 25/76 (33%), Positives = 41/76 (54%), Gaps = 2/76 (3%)
 Frame = -2

Query  729  TLEQWMVDDESFPNLEHLVLRFCYCLEEIPKAIEYISRLRSIELQWCTPSVCYSTKRIQD  550
             LE W      FP L+ + L+ C  L EIP  +  +  L+++EL W TP+   S + IQ 
Sbjct  807  NLEHWNASGHHFPRLQQVFLKHCSSLNEIPFGLVEVPSLQNMELFWPTPAAAASARFIQQ  866

Query  549  FRH--EMADDLFELKI  508
             +   ++ D++F+L I
Sbjct  867  EKQKGDIKDNVFKLVI  882



>gb|AAC32252.1| disease resistance gene homolog Mi-copy2 [Solanum lycopersicum]
Length=1206

 Score = 51.6 bits (122),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 32/81 (40%), Positives = 50/81 (62%), Gaps = 2/81 (2%)
 Frame = -2

Query  729   TLEQWMVDDESFPNLEHLVLRFCYCLEEIPKAIEYISRLRSIELQWCTPSVCYSTKRIQD  550
             TL +W V +ESFPNLE L L+ C  LEEIP +   I  L+ I++   +P +  S  +I+ 
Sbjct  1125  TLSKWEVGEESFPNLEKLKLQECGKLEEIPPSFGDIYSLKFIKI-VKSPQLEDSALKIKK  1183

Query  549   FRHEMADDLFELKIIGEESIP  487
             +  +M     EL+I+G+++IP
Sbjct  1184  YAEDMRGG-NELQILGQKNIP  1203



>ref|XP_009611917.1| PREDICTED: putative late blight resistance protein homolog R1B-23 
isoform X1 [Nicotiana tomentosiformis]
 ref|XP_009611918.1| PREDICTED: putative late blight resistance protein homolog R1B-23 
isoform X1 [Nicotiana tomentosiformis]
 ref|XP_009611919.1| PREDICTED: putative late blight resistance protein homolog R1B-23 
isoform X1 [Nicotiana tomentosiformis]
Length=1727

 Score = 51.6 bits (122),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 31/81 (38%), Positives = 44/81 (54%), Gaps = 1/81 (1%)
 Frame = -2

Query  747   LLLEDKTLEQWMVDDESFPNLEHLVLRFCYCLEEIPKAIEYISRLRSIELQWCTPSVCYS  568
             L L++  + QW V D++FP +EHLVL  C  LEEIP        L+SIE+  C  SV  S
Sbjct  1643  LNLDNINISQWSVYDDAFPMIEHLVLTKCERLEEIPSHFGDAISLKSIEVNRCCWSVAKS  1702

Query  567   TKRIQDFRHE-MADDLFELKI  508
                I+   H+ M ++   + I
Sbjct  1703  AVEIRTTHHDTMGNNALTVTI  1723



>ref|XP_009603186.1| PREDICTED: putative late blight resistance protein homolog R1A-3 
isoform X2 [Nicotiana tomentosiformis]
Length=191

 Score = 50.1 bits (118),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 25/84 (30%), Positives = 44/84 (52%), Gaps = 0/84 (0%)
 Frame = -2

Query  747  LLLEDKTLEQWMVDDESFPNLEHLVLRFCYCLEEIPKAIEYISRLRSIELQWCTPSVCYS  568
            L +  K L  W    ES P LE L+L++CY LE+IP  I  I  ++ IEL  C+ +   S
Sbjct  107  LQINRKNLVLWEASSESLPRLEFLILKYCYKLEDIPTEIGDIPTIKLIELHNCSQAAATS  166

Query  567  TKRIQDFRHEMADDLFELKIIGEE  496
             + + + +  + +++  ++    E
Sbjct  167  AEEMGEEQQSLGNEVLVVRAYNTE  190



>emb|CDP13440.1| unnamed protein product [Coffea canephora]
Length=735

 Score = 51.2 bits (121),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 26/66 (39%), Positives = 37/66 (56%), Gaps = 0/66 (0%)
 Frame = -2

Query  747  LLLEDKTLEQWMVDDESFPNLEHLVLRFCYCLEEIPKAIEYISRLRSIELQWCTPSVCYS  568
            L L+   + +W    E  PNLEHL LR C  LEE+P     I  L+ IE+Q+C  S   S
Sbjct  659  LKLDSLNIARWTASAEPLPNLEHLALRNCKDLEEVPFEFADIPNLQKIEVQFCGQSTEES  718

Query  567  TKRIQD  550
             ++I++
Sbjct  719  VRKIEE  724



>ref|XP_009762697.1| PREDICTED: putative late blight resistance protein homolog R1B-16 
isoform X1 [Nicotiana sylvestris]
 ref|XP_009762698.1| PREDICTED: putative late blight resistance protein homolog R1B-16 
isoform X1 [Nicotiana sylvestris]
 ref|XP_009762699.1| PREDICTED: putative late blight resistance protein homolog R1B-16 
isoform X2 [Nicotiana sylvestris]
Length=900

 Score = 51.2 bits (121),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 24/55 (44%), Positives = 33/55 (60%), Gaps = 0/55 (0%)
 Frame = -2

Query  717  WMVDDESFPNLEHLVLRFCYCLEEIPKAIEYISRLRSIELQWCTPSVCYSTKRIQ  553
            W   D+ FP LEH++++ C  L+EIP+       L+ I LQ C+PSV  S  RIQ
Sbjct  821  WRATDDYFPCLEHVIIKNCRHLKEIPQGFADSMTLKLIMLQGCSPSVVTSADRIQ  875



>ref|XP_009761168.1| PREDICTED: uncharacterized protein LOC104213363 [Nicotiana sylvestris]
Length=235

 Score = 50.4 bits (119),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 25/84 (30%), Positives = 44/84 (52%), Gaps = 0/84 (0%)
 Frame = -2

Query  747  LLLEDKTLEQWMVDDESFPNLEHLVLRFCYCLEEIPKAIEYISRLRSIELQWCTPSVCYS  568
            L + +  L  W    ES P LE L+L++CY LE+IP  I  I  L+  EL  C+ +   S
Sbjct  151  LQINETNLVHWEASSESLPRLEFLILKYCYKLEDIPTEIGDIPTLKLTELHNCSQAAAPS  210

Query  567  TKRIQDFRHEMADDLFELKIIGEE  496
            ++ I + +  + +++  ++    E
Sbjct  211  SEEIGEEQQSLGNEVLVVRAYNTE  234



>gb|AAT66772.2| NB-ARC domain containing protein [Solanum demissum]
Length=1281

 Score = 51.6 bits (122),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 32/80 (40%), Positives = 44/80 (55%), Gaps = 1/80 (1%)
 Frame = -2

Query  744   LLEDKTLEQWMVDDESFPNLEHLVLRFCYCLEEIPKAIEYISRLRSIELQWCTPSVCYST  565
             L+   +L++W V D++F  LEH+VLR C  L EI      IS L+ IE+  C  SV  S 
Sbjct  1199  LVNCSSLKEWTVQDDAFSKLEHIVLRCCQLLVEISSWFAEISSLKYIEVDNCNGSVVESA  1258

Query  564   KRIQDFR-HEMADDLFELKI  508
             + IQ  +  E  +D  EL I
Sbjct  1259  RTIQTTKVEEYVNDDLELVI  1278



>ref|XP_009764018.1| PREDICTED: putative late blight resistance protein homolog R1A-10 
[Nicotiana sylvestris]
 ref|XP_009764019.1| PREDICTED: putative late blight resistance protein homolog R1A-10 
[Nicotiana sylvestris]
 ref|XP_009764020.1| PREDICTED: putative late blight resistance protein homolog R1A-10 
[Nicotiana sylvestris]
Length=855

 Score = 51.2 bits (121),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 30/80 (38%), Positives = 41/80 (51%), Gaps = 0/80 (0%)
 Frame = -2

Query  747  LLLEDKTLEQWMVDDESFPNLEHLVLRFCYCLEEIPKAIEYISRLRSIELQWCTPSVCYS  568
            LL+    L  W     +FP L+ +VLR C  LEEIPK    I  L SIEL  C+ S   S
Sbjct  771  LLISVTFLRHWEAGSVNFPKLQRVVLRSCIGLEEIPKDFGEIYSLESIELYDCSMSAAKS  830

Query  567  TKRIQDFRHEMADDLFELKI  508
             + +Q+ +  M +D   + I
Sbjct  831  VEELQEEQESMGNDCLSVVI  850



>ref|XP_011072146.1| PREDICTED: putative late blight resistance protein homolog R1B-16 
[Sesamum indicum]
Length=881

 Score = 51.2 bits (121),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 31/76 (41%), Positives = 43/76 (57%), Gaps = 0/76 (0%)
 Frame = -2

Query  726  LEQWMVDDESFPNLEHLVLRFCYCLEEIPKAIEYISRLRSIELQWCTPSVCYSTKRIQDF  547
            LE+W  ++  FPNLE L L     LEEIP  +  I+ L SI L  CT SV    K+I + 
Sbjct  798  LERWRAENIHFPNLEILSLDDMQKLEEIPTILGDITTLHSIYLTHCTDSVINLAKQIVEE  857

Query  546  RHEMADDLFELKIIGE  499
            +H   +++ +L I GE
Sbjct  858  QHSYGNEILQLYIDGE  873



>ref|XP_009762700.1| PREDICTED: putative late blight resistance protein homolog R1B-16 
isoform X3 [Nicotiana sylvestris]
Length=890

 Score = 51.2 bits (121),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 24/55 (44%), Positives = 33/55 (60%), Gaps = 0/55 (0%)
 Frame = -2

Query  717  WMVDDESFPNLEHLVLRFCYCLEEIPKAIEYISRLRSIELQWCTPSVCYSTKRIQ  553
            W   D+ FP LEH++++ C  L+EIP+       L+ I LQ C+PSV  S  RIQ
Sbjct  811  WRATDDYFPCLEHVIIKNCRHLKEIPQGFADSMTLKLIMLQGCSPSVVTSADRIQ  865



>ref|XP_009611920.1| PREDICTED: putative late blight resistance protein homolog R1A-4 
isoform X2 [Nicotiana tomentosiformis]
Length=1665

 Score = 51.6 bits (122),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 31/81 (38%), Positives = 44/81 (54%), Gaps = 1/81 (1%)
 Frame = -2

Query  747   LLLEDKTLEQWMVDDESFPNLEHLVLRFCYCLEEIPKAIEYISRLRSIELQWCTPSVCYS  568
             L L++  + QW V D++FP +EHLVL  C  LEEIP        L+SIE+  C  SV  S
Sbjct  1581  LNLDNINISQWSVYDDAFPMIEHLVLTKCERLEEIPSHFGDAISLKSIEVNRCCWSVAKS  1640

Query  567   TKRIQDFRHE-MADDLFELKI  508
                I+   H+ M ++   + I
Sbjct  1641  AVEIRTTHHDTMGNNALTVTI  1661



>ref|XP_009604792.1| PREDICTED: putative late blight resistance protein homolog R1A-10 
isoform X1 [Nicotiana tomentosiformis]
 ref|XP_009604793.1| PREDICTED: putative late blight resistance protein homolog R1A-10 
isoform X1 [Nicotiana tomentosiformis]
Length=875

 Score = 51.2 bits (121),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 24/72 (33%), Positives = 42/72 (58%), Gaps = 0/72 (0%)
 Frame = -2

Query  726  LEQWMVDDESFPNLEHLVLRFCYCLEEIPKAIEYISRLRSIELQWCTPSVCYSTKRIQDF  547
            L  W    +S P+LE+L+LR CY L+EIP  I  I  L+ +EL +C+ S   S + I + 
Sbjct  798  LVHWHATSDSLPSLEYLILRHCYKLKEIPTEIGDIPTLKLVELHYCSQSAVTSAEEILEE  857

Query  546  RHEMADDLFELK  511
            +  + +++  ++
Sbjct  858  QQCLGNEILAVR  869



>ref|XP_011072139.1| PREDICTED: putative late blight resistance protein homolog R1A-4 
[Sesamum indicum]
Length=825

 Score = 51.2 bits (121),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 29/71 (41%), Positives = 39/71 (55%), Gaps = 0/71 (0%)
 Frame = -2

Query  726  LEQWMVDDESFPNLEHLVLRFCYCLEEIPKAIEYISRLRSIELQWCTPSVCYSTKRIQDF  547
            LE+W  +   FPNLE L L F  CLEEIP  I  I  L SI L+ C+ S   S K+I + 
Sbjct  744  LERWRAESLHFPNLERLHLEFMQCLEEIPWGIGDIPTLLSIHLEDCSDSSVNSAKQILEE  803

Query  546  RHEMADDLFEL  514
            +    ++  +L
Sbjct  804  QQSFGNETLQL  814



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1284566944336