BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c25586_g2_i6 len=1297 path=[33949:0-274 17522:275-277 41250:278-372
34319:373-403 16393:404-511 34457:512-646 17234:647-696
34640:697-726 34669:727-822 9786:823-951 38004:952-956 31748:957-959
31751:960-994 39424:995-1024 39453:1025-1049 25357:1050-1099
40921:1100-1110 9372:1111-1112 9374:1113-1296]

Length=1297
                                                                      Score     E

ref|XP_009624178.1|  PREDICTED: acyl-coenzyme A thioesterase 13-like  79.3    9e-14   
ref|XP_006350818.1|  PREDICTED: acyl-coenzyme A thioesterase 13-like  79.0    1e-13   
ref|XP_009614740.1|  PREDICTED: acyl-coenzyme A thioesterase 13-like  78.6    1e-13   
ref|XP_009624177.1|  PREDICTED: acyl-coenzyme A thioesterase 13-like  78.6    1e-13   
ref|XP_004241184.1|  PREDICTED: acyl-coenzyme A thioesterase 13-like  78.2    2e-13   
ref|XP_009784389.1|  PREDICTED: acyl-coenzyme A thioesterase 13       77.4    3e-13   
ref|XP_004241183.1|  PREDICTED: acyl-coenzyme A thioesterase 13-like  77.0    5e-13   
ref|XP_004490572.1|  PREDICTED: acyl-coenzyme A thioesterase 13-like  76.3    7e-13   
ref|XP_006350817.1|  PREDICTED: acyl-coenzyme A thioesterase 13-like  75.5    1e-12   
gb|KDP46555.1|  hypothetical protein JCGZ_08527                       75.1    2e-12   
ref|XP_002520431.1|  acyl-CoA thioesterase, putative                  75.1    2e-12   Ricinus communis
ref|XP_007208636.1|  hypothetical protein PRUPE_ppa019870mg           74.7    2e-12   
emb|CDP09147.1|  unnamed protein product                              74.7    3e-12   
ref|XP_008220367.1|  PREDICTED: acyl-coenzyme A thioesterase 13-like  74.7    3e-12   
ref|XP_008373324.1|  PREDICTED: acyl-coenzyme A thioesterase 13-like  74.3    4e-12   
ref|XP_009337318.1|  PREDICTED: acyl-coenzyme A thioesterase 13-like  74.3    4e-12   
gb|KDO66786.1|  hypothetical protein CISIN_1g031440mg                 74.3    4e-12   
ref|XP_006425012.1|  hypothetical protein CICLE_v10029463mg           73.9    4e-12   
gb|KDO66785.1|  hypothetical protein CISIN_1g031440mg                 73.9    5e-12   
gb|KHN46174.1|  Acyl-coenzyme A thioesterase 13                       73.9    5e-12   
ref|NP_001237069.1|  uncharacterized protein LOC100305814             73.9    6e-12   
ref|XP_007142234.1|  hypothetical protein PHAVU_008G263600g           73.6    7e-12   
ref|XP_002313396.1|  thioesterase family protein                      73.2    8e-12   Populus trichocarpa [western balsam poplar]
ref|XP_011032160.1|  PREDICTED: acyl-coenzyme A thioesterase 13       73.2    9e-12   
ref|XP_004294272.1|  PREDICTED: acyl-coenzyme A thioesterase 13-like  73.2    1e-11   
ref|XP_003615571.1|  Acyl-coenzyme A thioesterase                     72.4    2e-11   
gb|KDP46554.1|  hypothetical protein JCGZ_08526                       72.4    2e-11   
gb|KHN40043.1|  Acyl-coenzyme A thioesterase 13                       70.1    2e-11   
gb|AGK44858.1|  acyl-CoA thioesterase                                 71.6    3e-11   
ref|XP_010104688.1|  hypothetical protein L484_022071                 69.7    3e-11   
ref|XP_010521923.1|  PREDICTED: putative esterase C31F10.02           70.9    6e-11   
gb|ABW81107.1|  AcylCoa-1                                             70.5    6e-11   Tarenaya spinosa
ref|XP_007016186.1|  Acyl-CoA thioesterase, putative                  70.1    9e-11   
emb|CDY45458.1|  BnaA05g12430D                                        69.7    1e-10   
ref|XP_010104689.1|  hypothetical protein L484_022072                 69.3    2e-10   
ref|XP_009144361.1|  PREDICTED: acyl-coenzyme A thioesterase 13       69.3    2e-10   
emb|CDY53360.1|  BnaC04g54400D                                        68.9    3e-10   
ref|XP_002881059.1|  thioesterase family protein                      68.6    3e-10   
ref|NP_565683.1|  thioesterase-like protein                           68.6    3e-10   Arabidopsis thaliana [mouse-ear cress]
gb|AAM65417.1|  unknown                                               68.6    4e-10   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010256675.1|  PREDICTED: acyl-coenzyme A thioesterase 13       68.6    4e-10   
gb|KHG20959.1|  Acyl-coenzyme A thioesterase 13                       70.1    5e-10   
ref|XP_006369557.1|  hypothetical protein POPTR_0001s25540g           64.7    1e-09   
ref|XP_007206515.1|  hypothetical protein PRUPE_ppa019295mg           66.6    2e-09   
ref|XP_010418788.1|  PREDICTED: acyl-coenzyme A thioesterase 13-like  66.6    2e-09   
ref|XP_010510468.1|  PREDICTED: acyl-coenzyme A thioesterase 13-like  65.9    3e-09   
ref|XP_009402301.1|  PREDICTED: acyl-coenzyme A thioesterase 13 i...  65.9    3e-09   
ref|XP_002280576.1|  PREDICTED: acyl-coenzyme A thioesterase 13       65.5    4e-09   Vitis vinifera
ref|XP_006410016.1|  hypothetical protein EUTSA_v10017356mg           65.1    5e-09   
ref|XP_010414338.1|  PREDICTED: acyl-coenzyme A thioesterase 13-like  65.1    5e-09   
ref|XP_008355391.1|  PREDICTED: acyl-coenzyme A thioesterase 13-l...  65.1    5e-09   
ref|XP_006295147.1|  hypothetical protein CARUB_v10024222mg           65.1    5e-09   
ref|XP_009374294.1|  PREDICTED: uncharacterized protein LOC103963...  65.5    5e-09   
ref|XP_008363419.1|  PREDICTED: acyl-coenzyme A thioesterase 13-like  64.7    6e-09   
ref|XP_010033034.1|  PREDICTED: acyl-coenzyme A thioesterase 13       64.7    7e-09   
ref|XP_008355379.1|  PREDICTED: uncharacterized protein LOC103419...  65.1    7e-09   
ref|XP_006848099.1|  hypothetical protein AMTR_s00029p00212430        64.7    8e-09   
ref|XP_008220360.1|  PREDICTED: acyl-coenzyme A thioesterase 13-like  64.3    9e-09   
gb|EYU45972.1|  hypothetical protein MIMGU_mgv1a014917mg              64.7    9e-09   
ref|XP_009374292.1|  PREDICTED: uncharacterized protein LOC103963...  65.1    9e-09   
gb|KFK44237.1|  hypothetical protein AALP_AA1G232400                  64.3    1e-08   
ref|XP_009374291.1|  PREDICTED: acyl-coenzyme A thioesterase 13-like  64.3    1e-08   
ref|XP_008785432.1|  PREDICTED: acyl-coenzyme A thioesterase 13 i...  64.3    1e-08   
gb|KHG14017.1|  Acyl-coenzyme A thioesterase 13                       63.9    1e-08   
gb|KFK44236.1|  hypothetical protein AALP_AA1G232400                  63.9    1e-08   
ref|XP_008355407.1|  PREDICTED: acyl-coenzyme A thioesterase 13-like  63.5    2e-08   
ref|XP_010510436.1|  PREDICTED: uncharacterized protein LOC104786686  63.5    2e-08   
ref|XP_011080688.1|  PREDICTED: acyl-coenzyme A thioesterase 13 i...  63.2    2e-08   
gb|EPS64294.1|  hypothetical protein M569_10488                       63.2    2e-08   
ref|XP_011080687.1|  PREDICTED: acyl-coenzyme A thioesterase 13 i...  63.2    2e-08   
ref|XP_011080685.1|  PREDICTED: acyl-coenzyme A thioesterase 13 i...  63.2    2e-08   
ref|XP_010510470.1|  PREDICTED: acyl-coenzyme A thioesterase 13-like  62.8    3e-08   
ref|XP_010414900.1|  PREDICTED: acyl-coenzyme A thioesterase 13-like  62.8    4e-08   
ref|XP_010685620.1|  PREDICTED: acyl-coenzyme A thioesterase 13-like  62.4    4e-08   
ref|XP_010418789.1|  PREDICTED: acyl-coenzyme A thioesterase 13-like  61.2    4e-08   
ref|XP_007206059.1|  hypothetical protein PRUPE_ppa012666mg           62.4    5e-08   
ref|XP_008220341.1|  PREDICTED: acyl-coenzyme A thioesterase 13-like  62.4    5e-08   
ref|XP_009337316.1|  PREDICTED: acyl-coenzyme A thioesterase 13-like  62.0    6e-08   
ref|XP_008220332.1|  PREDICTED: acyl-coenzyme A thioesterase 13-like  62.0    6e-08   
ref|XP_008785433.1|  PREDICTED: acyl-coenzyme A thioesterase 13 i...  62.0    6e-08   
ref|XP_004143143.1|  PREDICTED: acyl-coenzyme A thioesterase 13-like  62.0    7e-08   
ref|XP_009337314.1|  PREDICTED: acyl-coenzyme A thioesterase 13-like  62.0    7e-08   
ref|XP_009346891.1|  PREDICTED: acyl-coenzyme A thioesterase 13-like  61.6    7e-08   
ref|XP_009346893.1|  PREDICTED: acyl-coenzyme A thioesterase 13-like  61.6    7e-08   
ref|XP_010510433.1|  PREDICTED: acyl-coenzyme A thioesterase 13-like  61.6    8e-08   
ref|XP_010923137.1|  PREDICTED: acyl-coenzyme A thioesterase 13       62.0    8e-08   
ref|XP_007208603.1|  hypothetical protein PRUPE_ppa022342mg           61.6    9e-08   
ref|XP_007207558.1|  hypothetical protein PRUPE_ppa016575mg           61.2    1e-07   
ref|XP_010470349.1|  PREDICTED: acyl-coenzyme A thioesterase 13-l...  61.2    1e-07   
ref|XP_010470350.1|  PREDICTED: acyl-coenzyme A thioesterase 13-l...  61.2    1e-07   
ref|XP_008363451.1|  PREDICTED: putative esterase F42H10.6            60.1    1e-07   
ref|XP_009374287.1|  PREDICTED: acyl-coenzyme A thioesterase 13-l...  60.5    2e-07   
ref|XP_009374288.1|  PREDICTED: acyl-coenzyme A thioesterase 13-l...  60.5    2e-07   
ref|XP_004294275.1|  PREDICTED: acyl-coenzyme A thioesterase 13-like  60.5    2e-07   
ref|XP_009346895.1|  PREDICTED: acyl-coenzyme A thioesterase 13-l...  60.5    2e-07   
ref|XP_009374290.1|  PREDICTED: acyl-coenzyme A thioesterase 13-l...  60.1    2e-07   
ref|XP_009337320.1|  PREDICTED: acyl-coenzyme A thioesterase 13-like  60.1    2e-07   
ref|XP_009346896.1|  PREDICTED: acyl-coenzyme A thioesterase 13-l...  60.1    2e-07   
ref|XP_009374289.1|  PREDICTED: acyl-coenzyme A thioesterase 13-l...  60.1    2e-07   
ref|XP_004294281.1|  PREDICTED: acyl-coenzyme A thioesterase 13-like  60.1    3e-07   
ref|XP_008358976.1|  PREDICTED: acyl-coenzyme A thioesterase 13-like  59.7    3e-07   
ref|XP_008464061.1|  PREDICTED: acyl-coenzyme A thioesterase 13       60.1    4e-07   
ref|XP_004980094.1|  PREDICTED: acyl-coenzyme A thioesterase 13-like  59.7    4e-07   
ref|XP_008220351.1|  PREDICTED: acyl-coenzyme A thioesterase 13-like  59.3    5e-07   
ref|XP_009624835.1|  PREDICTED: uncharacterized protein LOC104115...  62.4    6e-07   
ref|XP_009768691.1|  PREDICTED: uncharacterized protein LOC104219...  62.0    6e-07   
ref|XP_009624837.1|  PREDICTED: uncharacterized protein LOC104115...  62.0    6e-07   
ref|XP_009624836.1|  PREDICTED: uncharacterized protein LOC104115...  62.0    6e-07   
ref|XP_009624840.1|  PREDICTED: uncharacterized protein LOC104115...  62.0    6e-07   
ref|XP_009624838.1|  PREDICTED: uncharacterized protein LOC104115...  62.0    6e-07   
ref|XP_009768690.1|  PREDICTED: uncharacterized protein LOC104219...  62.0    6e-07   
ref|XP_009768688.1|  PREDICTED: uncharacterized protein LOC104219...  62.0    6e-07   
ref|XP_009768692.1|  PREDICTED: uncharacterized protein LOC104219...  62.0    6e-07   
ref|XP_009768689.1|  PREDICTED: uncharacterized protein LOC104219...  62.0    6e-07   
ref|XP_006347496.1|  PREDICTED: uncharacterized protein LOC102581...  62.0    7e-07   
ref|XP_006347492.1|  PREDICTED: uncharacterized protein LOC102581...  62.0    7e-07   
gb|AEP25854.1|  putative acyl-CoA thioesterase                        58.5    7e-07   
ref|XP_002451332.1|  hypothetical protein SORBIDRAFT_05g027920        58.9    8e-07   Sorghum bicolor [broomcorn]
gb|ADE77923.1|  unknown                                               56.6    1e-06   
ref|XP_008373325.1|  PREDICTED: acyl-coenzyme A thioesterase 13-like  58.2    1e-06   
ref|XP_008364467.1|  PREDICTED: uncharacterized protein LOC103428147  58.9    1e-06   
gb|ACG31399.1|  thioesterase family protein                           58.2    1e-06   Zea mays [maize]
ref|NP_001046977.1|  Os02g0521700                                     58.2    1e-06   Oryza sativa Japonica Group [Japonica rice]
ref|XP_009337381.1|  PREDICTED: acyl-coenzyme A thioesterase 13-like  58.2    1e-06   
ref|XP_006647247.1|  PREDICTED: acyl-coenzyme A thioesterase 13-like  58.2    1e-06   
ref|XP_008373323.1|  PREDICTED: acyl-coenzyme A thioesterase 13-like  57.8    1e-06   
ref|XP_010318055.1|  PREDICTED: uncharacterized protein LOC101246...  60.8    1e-06   
ref|XP_010318054.1|  PREDICTED: uncharacterized protein LOC101246...  60.8    2e-06   
ref|XP_004235011.1|  PREDICTED: uncharacterized protein LOC101246...  60.8    2e-06   
ref|XP_004294278.1|  PREDICTED: acyl-coenzyme A thioesterase 13-like  57.4    2e-06   
ref|XP_008343809.1|  PREDICTED: uncharacterized protein LOC103406...  60.5    2e-06   
ref|XP_008381459.1|  PREDICTED: uncharacterized protein LOC103444...  60.5    2e-06   
ref|XP_008343808.1|  PREDICTED: uncharacterized protein LOC103406...  60.5    2e-06   
ref|XP_008343807.1|  PREDICTED: uncharacterized protein LOC103406...  60.5    2e-06   
ref|XP_008381442.1|  PREDICTED: uncharacterized protein LOC103444...  60.5    2e-06   
ref|XP_008381451.1|  PREDICTED: uncharacterized protein LOC103444...  60.5    2e-06   
ref|XP_008347262.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...  60.1    2e-06   
ref|XP_004294282.1|  PREDICTED: acyl-coenzyme A thioesterase 13-like  57.0    3e-06   
ref|XP_010685625.1|  PREDICTED: putative esterase C31F10.02           57.0    3e-06   
ref|XP_002519597.1|  conserved hypothetical protein                   59.7    3e-06   Ricinus communis
ref|NP_001105680.1|  thioesterase family protein                      56.2    5e-06   Zea mays [maize]
gb|AFW60053.1|  thioesterase family protein                           56.2    5e-06   
ref|XP_004295735.1|  PREDICTED: acyl-coenzyme A thioesterase 13-like  56.2    5e-06   
gb|EMS54815.1|  hypothetical protein TRIUR3_19304                     56.2    6e-06   
ref|XP_007206721.1|  hypothetical protein PRUPE_ppa024575mg           55.1    6e-06   
ref|XP_011084747.1|  PREDICTED: uncharacterized protein LOC105166925  58.5    7e-06   
ref|XP_009337319.1|  PREDICTED: acyl-coenzyme A thioesterase 13-like  55.5    8e-06   
ref|XP_009361298.1|  PREDICTED: uncharacterized protein LOC103951...  58.5    8e-06   
dbj|BAJ94865.1|  predicted protein                                    55.5    9e-06   
gb|EMT26876.1|  hypothetical protein F775_26175                       55.5    9e-06   
ref|XP_011044713.1|  PREDICTED: uncharacterized protein LOC105139...  58.2    1e-05   
ref|XP_011044715.1|  PREDICTED: uncharacterized protein LOC105139...  58.2    1e-05   
ref|XP_009361296.1|  PREDICTED: uncharacterized protein LOC103951...  58.2    1e-05   
ref|XP_009361297.1|  PREDICTED: uncharacterized protein LOC103951...  58.2    1e-05   
ref|XP_008234670.1|  PREDICTED: uncharacterized protein LOC103333...  58.2    1e-05   
ref|XP_008376808.1|  PREDICTED: kinesin-related protein 8 isoform X2  58.2    1e-05   
ref|XP_008234665.1|  PREDICTED: probable GPI-anchored adhesin-lik...  58.2    1e-05   
ref|XP_008234662.1|  PREDICTED: probable GPI-anchored adhesin-lik...  58.2    1e-05   
ref|XP_008376807.1|  PREDICTED: kinesin-related protein 8 isoform X1  58.2    1e-05   
ref|XP_008234669.1|  PREDICTED: probable GPI-anchored adhesin-lik...  58.2    1e-05   
ref|XP_008234666.1|  PREDICTED: probable GPI-anchored adhesin-lik...  58.2    1e-05   
ref|XP_008234668.1|  PREDICTED: probable GPI-anchored adhesin-lik...  58.2    1e-05   
gb|AAP83395.1|  SEPALLATA3-like MADS-box                              55.5    1e-05   Petunia x hybrida [garden petunia]
ref|XP_009351932.1|  PREDICTED: uncharacterized protein LOC103943...  57.8    1e-05   
ref|XP_009351931.1|  PREDICTED: uncharacterized protein LOC103943...  57.8    1e-05   
ref|XP_007220603.1|  hypothetical protein PRUPE_ppa001350mg           57.8    1e-05   
ref|XP_009351933.1|  PREDICTED: uncharacterized protein LOC103943...  57.8    1e-05   
gb|KDP26829.1|  hypothetical protein JCGZ_17987                       56.2    1e-05   
ref|XP_007043947.1|  K-box region and MADS-box transcription fact...  55.8    1e-05   
ref|XP_007043949.1|  K-box region and MADS-box transcription fact...  56.2    1e-05   
dbj|BAG55316.1|  transcription factor                                 55.5    2e-05   Petunia integrifolia subsp. inflata
sp|Q03489.2|AGL9_PETHY  RecName: Full=Agamous-like MADS-box prote...  55.5    2e-05   Petunia x hybrida [garden petunia]
ref|NP_001289529.1|  agamous-like MADS-box protein AGL9 homolog       55.5    2e-05   
gb|EYU33468.1|  hypothetical protein MIMGU_mgv1a0126181mg             53.5    2e-05   
ref|XP_007043948.1|  K-box region and MADS-box transcription fact...  55.8    2e-05   
ref|XP_004504400.1|  PREDICTED: agamous-like MADS-box protein AGL...  55.5    2e-05   
ref|XP_009600809.1|  PREDICTED: agamous-like MADS-box protein AGL...  55.5    2e-05   
ref|XP_004504399.1|  PREDICTED: agamous-like MADS-box protein AGL...  55.5    2e-05   
gb|ADP09004.1|  SEP3-like protein                                     55.5    2e-05   
ref|XP_007158666.1|  hypothetical protein PHAVU_002G1723001g          53.9    2e-05   
ref|XP_007158665.1|  hypothetical protein PHAVU_002G1723001g          53.9    2e-05   
ref|XP_004504397.1|  PREDICTED: agamous-like MADS-box protein AGL...  55.5    2e-05   
ref|XP_004504398.1|  PREDICTED: agamous-like MADS-box protein AGL...  55.1    2e-05   
gb|ABW21690.1|  SEP3-like protein                                     52.8    3e-05   Viola pubescens
ref|XP_004310096.1|  PREDICTED: agamous-like MADS-box protein AGL...  54.3    3e-05   
dbj|BAJ11578.1|  transcription factor                                 55.1    3e-05   
gb|AEF59026.1|  MADS-2                                                53.9    3e-05   
gb|ADF49576.1|  transcription factor MADS-box 2                       55.1    3e-05   
ref|NP_001289232.1|  agamous-like MADS-box protein AGL9 homolog       55.1    3e-05   
dbj|BAM36705.1|  MADS transcriptional factor SEP3 homolog             55.1    3e-05   
emb|CBI27678.3|  unnamed protein product                              55.1    3e-05   
ref|NP_001268114.1|  MADS-box protein 4                               55.1    3e-05   
ref|XP_010653929.1|  PREDICTED: MADS-box protein 4 isoform X1         55.1    4e-05   
ref|XP_002318464.2|  hypothetical protein POPTR_0012s03030g           56.2    4e-05   Populus trichocarpa [western balsam poplar]
ref|XP_010662921.1|  PREDICTED: uncharacterized protein LOC100252...  56.2    4e-05   
ref|XP_010662923.1|  PREDICTED: uncharacterized protein LOC100252...  56.2    4e-05   
ref|XP_010662919.1|  PREDICTED: uncharacterized protein LOC100252...  56.2    4e-05   
ref|XP_010662922.1|  PREDICTED: uncharacterized protein LOC100252...  56.2    4e-05   
gb|KGN49814.1|  hypothetical protein Csa_5G138460                     56.2    5e-05   
emb|CBI23069.3|  unnamed protein product                              55.8    5e-05   
ref|XP_004145992.1|  PREDICTED: uncharacterized protein LOC101218478  55.8    5e-05   
ref|XP_008437669.1|  PREDICTED: uncharacterized protein LOC103483...  55.8    6e-05   
ref|NP_001242742.1|  uncharacterized protein LOC100805078             53.9    6e-05   
ref|XP_008437668.1|  PREDICTED: uncharacterized protein LOC103483...  55.8    6e-05   
emb|CAL36578.1|  deficiens H200 homologue                             53.9    7e-05   Misopates orontium
ref|XP_004171788.1|  PREDICTED: agamous-like MADS-box protein AGL...  53.1    7e-05   
gb|ADU56818.1|  MADS-box protein AGL2 subfamily                       52.8    7e-05   
ref|XP_002321976.2|  hypothetical protein POPTR_0015s00910g           55.5    8e-05   Populus trichocarpa [western balsam poplar]
ref|XP_002321969.1|  hypothetical protein POPTR_0015s00910g           55.5    8e-05   Populus trichocarpa [western balsam poplar]
gb|EYU33467.1|  hypothetical protein MIMGU_mgv1a0126181mg             51.6    8e-05   
gb|AAP83377.1|  SEPALLATA3-like MADS-box                              53.1    8e-05   Solanum lycopersicum
gb|ADN37686.1|  SEP3                                                  52.4    9e-05   
ref|XP_006579435.1|  PREDICTED: uncharacterized protein LOC100805...  53.5    9e-05   
ref|XP_006585130.1|  PREDICTED: MADS-box transcription factor 1-l...  53.5    9e-05   
ref|XP_006585129.1|  PREDICTED: MADS-box transcription factor 1-l...  53.5    9e-05   
gb|KHN34832.1|  MADS-box transcription factor 1                       53.5    9e-05   
ref|XP_006579436.1|  PREDICTED: uncharacterized protein LOC100805...  53.5    9e-05   
ref|XP_006579434.1|  PREDICTED: uncharacterized protein LOC100805...  53.5    9e-05   
ref|XP_006579433.1|  PREDICTED: uncharacterized protein LOC100805...  53.5    9e-05   
ref|XP_006585132.1|  PREDICTED: MADS-box transcription factor 1-l...  53.5    9e-05   
ref|XP_006585131.1|  PREDICTED: MADS-box transcription factor 1-l...  53.5    9e-05   
gb|AFU81296.1|  SEPALLATA3                                            53.5    1e-04   
sp|Q42464.1|AGL9_SOLLC  RecName: Full=Agamous-like MADS-box prote...  53.1    1e-04   Solanum lycopersicum
ref|XP_007039176.1|  Uncharacterized protein isoform 1                55.1    1e-04   
ref|XP_007039177.1|  Uncharacterized protein isoform 2                55.1    1e-04   
gb|AEQ75503.1|  MADS-domain transcription factor                      52.8    1e-04   
gb|AAX13298.1|  MADS box protein SEP3                                 53.5    1e-04   Lotus japonicus
ref|XP_004168213.1|  PREDICTED: uncharacterized protein LOC101229859  54.7    1e-04   
ref|XP_009372256.1|  PREDICTED: agamous-like MADS-box protein AGL...  53.5    1e-04   
gb|AEN75254.1|  transcription factor MADS3                            53.1    1e-04   
gb|AET04966.2|  MADS-box transcription factor                         53.5    1e-04   
ref|XP_007039178.1|  Uncharacterized protein isoform 3                55.1    1e-04   
emb|CDP05002.1|  unnamed protein product                              54.7    1e-04   
gb|ADU56817.1|  MADS-box protein AGL2 subfamily                       53.1    1e-04   
gb|AAO22982.1|  MADS-box transcription factor CDM44                   53.5    1e-04   Chrysanthemum x morifolium [florist's chrysanthemum]
gb|AAP83366.1|  SEPALLATA3-like MADS-box                              52.8    1e-04   Antirrhinum majus [garden snapdragon]
ref|XP_008222191.1|  PREDICTED: agamous-like MADS-box protein AGL...  53.1    1e-04   
ref|XP_009372255.1|  PREDICTED: agamous-like MADS-box protein AGL...  53.5    1e-04   
ref|XP_007223808.1|  hypothetical protein PRUPE_ppa010679mg           53.1    1e-04   
gb|AAR01779.1|  MADS-box protein                                      53.1    1e-04   Prunus dulcis [sweet almond]
ref|XP_006352168.1|  PREDICTED: agamous-like MADS-box protein AGL...  53.1    1e-04   
ref|NP_001234384.1|  agamous-like MADS-box protein AGL9 homolog       53.1    1e-04   
gb|KGN46460.1|  hypothetical protein Csa_6G095270                     52.0    1e-04   
gb|ABQ59277.2|  sepallata 3-like MADS box protein                     52.4    1e-04   Eustoma exaltatum subsp. russellianum [bluebells]
ref|XP_010091186.1|  hypothetical protein L484_002581                 54.3    1e-04   
ref|XP_003575601.2|  PREDICTED: uncharacterized protein LOC100839238  52.8    2e-04   
ref|NP_001280756.1|  agamous-like MADS-box protein AGL9 homolog       52.8    2e-04   
ref|XP_008459849.1|  PREDICTED: agamous-like MADS-box protein AGL...  52.4    2e-04   
gb|AAP83364.1|  SEPALLATA3-like MADS-box                              52.4    2e-04   Antirrhinum majus [garden snapdragon]
ref|XP_004140534.1|  PREDICTED: agamous-like MADS-box protein AGL...  52.8    2e-04   
ref|XP_003630490.1|  MADS-box transcription factor                    53.5    2e-04   
ref|NP_001284431.1|  agamous-like MADS-box protein AGL9 homolog       52.8    2e-04   
emb|CAA64742.1|  DEFH72                                               52.8    2e-04   Antirrhinum majus [garden snapdragon]
ref|XP_010685104.1|  PREDICTED: uncharacterized protein LOC104899...  51.2    2e-04   
ref|XP_010685105.1|  PREDICTED: uncharacterized protein LOC104899...  51.2    2e-04   
gb|AIC33052.1|  flower development transporter SEP3                   52.4    2e-04   
gb|AHW58034.1|  SEP3                                                  52.4    2e-04   
gb|EYU19683.1|  hypothetical protein MIMGU_mgv1a001342mg              53.9    3e-04   
ref|XP_011043714.1|  PREDICTED: uncharacterized protein LOC105139...  53.5    3e-04   
ref|XP_011043715.1|  PREDICTED: uncharacterized protein LOC105139...  53.5    3e-04   
emb|CAA64743.1|  DEFH200                                              52.0    3e-04   Antirrhinum majus [garden snapdragon]
dbj|BAK09620.1|  MADS-box transcription factor                        52.0    3e-04   
gb|EMT21269.1|  hypothetical protein F775_13511                       51.2    3e-04   
gb|ADU15477.1|  SEP3                                                  51.6    4e-04   
gb|ADD25191.1|  SEP3                                                  51.2    4e-04   Nelumbo nucifera [Indian lotus]
gb|AEO45959.1|  SEPALLATA3-like protein                               51.6    4e-04   
gb|ABD17387.1|  MADS-box protein SEP3                                 51.6    4e-04   Taihangia rupestris
dbj|BAN89460.1|  sepallata 3                                          51.6    5e-04   
gb|ABD19719.1|  SEP3-like MADS-box protein                            51.6    5e-04   Taihangia rupestris
gb|AAT46095.1|  SEPALLATA-like protein                                51.2    5e-04   Akebia trifoliata
ref|XP_004502275.1|  PREDICTED: MADS-box transcription factor 1-l...  51.2    5e-04   
gb|KHG25284.1|  Agamous-like MADS-box protein AGL9                    51.6    5e-04   
ref|XP_010250667.1|  PREDICTED: agamous-like MADS-box protein AGL...  51.2    5e-04   
ref|XP_002514893.1|  mads box protein, putative                       50.4    5e-04   Ricinus communis
ref|XP_010909961.1|  PREDICTED: uncharacterized protein LOC105035...  52.8    5e-04   
ref|XP_010909966.1|  PREDICTED: uncharacterized protein LOC105035...  52.8    5e-04   
ref|XP_004502274.1|  PREDICTED: MADS-box transcription factor 1-l...  51.2    5e-04   
ref|XP_010909964.1|  PREDICTED: uncharacterized protein LOC105035...  52.8    5e-04   
ref|XP_010909965.1|  PREDICTED: uncharacterized protein LOC105035...  52.8    5e-04   
ref|XP_009109826.1|  PREDICTED: agamous-like MADS-box protein AGL...  51.2    5e-04   
ref|XP_006415782.1|  hypothetical protein EUTSA_v10008591mg           50.1    6e-04   
ref|XP_011036099.1|  PREDICTED: agamous-like MADS-box protein AGL...  51.2    6e-04   
ref|XP_010909967.1|  PREDICTED: uncharacterized protein LOC105035...  52.4    6e-04   
ref|XP_011020782.1|  PREDICTED: agamous-like MADS-box protein AGL...  51.2    6e-04   
gb|KDO81856.1|  hypothetical protein CISIN_1g047287mg                 50.4    6e-04   
gb|AES72582.2|  hypothetical protein MTR_3g092250                     52.4    7e-04   
gb|AES72581.2|  hypothetical protein MTR_3g092250                     52.4    7e-04   
gb|AHC54183.1|  sepallata-like MADS box transcription factor 3        49.3    7e-04   
gb|AHC54153.1|  sepallata-like MADS box transcription factor 3        49.3    7e-04   
gb|AHC54185.1|  sepallata-like MADS box transcription factor 3        49.3    7e-04   
ref|XP_006415783.1|  hypothetical protein EUTSA_v10008591mg           51.2    7e-04   
gb|AHC54170.1|  sepallata-like MADS box transcription factor 3        49.3    7e-04   
ref|XP_007163780.1|  hypothetical protein PHAVU_001G263400g           50.8    7e-04   
ref|XP_006437995.1|  hypothetical protein CICLE_v10032507mg           50.8    7e-04   
dbj|BAF34912.1|  MADS-box protein                                     50.8    7e-04   
gb|AHC54158.1|  sepallata-like MADS box transcription factor 3        49.3    7e-04   
gb|AHC54143.1|  sepallata-like MADS box transcription factor 3        49.3    7e-04   
ref|NP_850953.1|  MADs box transcription factor SEPALLATA3            50.8    7e-04   
dbj|BAE71275.1|  hypothetical protein                                 52.4    7e-04   
ref|XP_010478051.1|  PREDICTED: developmental protein SEPALLATA 3...  50.8    7e-04   
ref|XP_010499199.1|  PREDICTED: developmental protein SEPALLATA 3...  50.8    7e-04   
gb|AHC54173.1|  sepallata-like MADS box transcription factor 3        48.9    8e-04   
ref|XP_003602330.1|  hypothetical protein MTR_3g092250                52.4    8e-04   
ref|XP_007163779.1|  hypothetical protein PHAVU_001G263400g           50.8    8e-04   
ref|XP_003602331.1|  hypothetical protein MTR_3g092250                52.4    8e-04   
gb|ABQ85953.1|  MADS-box transcription factor SEP-like 4              50.8    8e-04   
ref|XP_006437994.1|  hypothetical protein CICLE_v10032507mg           50.8    8e-04   
ref|XP_010460483.1|  PREDICTED: developmental protein SEPALLATA 3...  50.8    8e-04   
ref|XP_006437996.1|  hypothetical protein CICLE_v10032507mg           50.8    8e-04   
ref|XP_006437997.1|  hypothetical protein CICLE_v10032507mg           50.8    8e-04   
ref|XP_006484143.1|  PREDICTED: agamous-like MADS-box protein AGL...  50.8    8e-04   
gb|AHC54167.1|  sepallata-like MADS box transcription factor 3        48.9    8e-04   
gb|AHC54166.1|  sepallata-like MADS box transcription factor 3        48.9    8e-04   
gb|AHC54179.1|  sepallata-like MADS box transcription factor 3        48.9    8e-04   
gb|ABF67487.1|  MADS-domain transcription factor                      50.8    9e-04   
gb|AAO49811.1|  SEP3-related MADS-box protein                         50.4    9e-04   
gb|ABE02212.1|  SEP-like                                              50.4    9e-04   
gb|AFL03390.1|  MADS box transcription factor SEP3                    50.1    0.001   
gb|ABI60898.1|  MADS-box transcription factor                         50.4    0.001   
ref|XP_010532442.1|  PREDICTED: developmental protein SEPALLATA 3...  49.7    0.001   



>ref|XP_009624178.1| PREDICTED: acyl-coenzyme A thioesterase 13-like [Nicotiana tomentosiformis]
Length=179

 Score = 79.3 bits (194),  Expect = 9e-14, Method: Compositional matrix adjust.
 Identities = 36/46 (78%), Positives = 42/46 (91%), Gaps = 0/46 (0%)
 Frame = +2

Query  824  DELEIVGRCLGKRGGYSGTSVLVRNKLTGELIAEGRHSLFGRHHDQ  961
            DELEI+GR LG++GGYSGTSVLV+NK TGELIAEGRHSLFG+H  +
Sbjct  133  DELEIIGRVLGQKGGYSGTSVLVKNKATGELIAEGRHSLFGKHASK  178



>ref|XP_006350818.1| PREDICTED: acyl-coenzyme A thioesterase 13-like [Solanum tuberosum]
Length=158

 Score = 79.0 bits (193),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 36/46 (78%), Positives = 42/46 (91%), Gaps = 0/46 (0%)
 Frame = +2

Query  824  DELEIVGRCLGKRGGYSGTSVLVRNKLTGELIAEGRHSLFGRHHDQ  961
            DELEI+GR LG++GGYSGTSVLV+NK TGELIAEGRHSLFG+H  +
Sbjct  112  DELEIIGRVLGQKGGYSGTSVLVKNKTTGELIAEGRHSLFGKHASK  157



>ref|XP_009614740.1| PREDICTED: acyl-coenzyme A thioesterase 13-like [Nicotiana tomentosiformis]
Length=158

 Score = 78.6 bits (192),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 36/46 (78%), Positives = 42/46 (91%), Gaps = 0/46 (0%)
 Frame = +2

Query  824  DELEIVGRCLGKRGGYSGTSVLVRNKLTGELIAEGRHSLFGRHHDQ  961
            DELEI+GR LG++GGYSGTSVLV+NK TGELIAEGRHSLFG+H  +
Sbjct  112  DELEIIGRVLGQKGGYSGTSVLVKNKATGELIAEGRHSLFGKHASK  157



>ref|XP_009624177.1| PREDICTED: acyl-coenzyme A thioesterase 13-like [Nicotiana tomentosiformis]
Length=158

 Score = 78.6 bits (192),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 36/46 (78%), Positives = 42/46 (91%), Gaps = 0/46 (0%)
 Frame = +2

Query  824  DELEIVGRCLGKRGGYSGTSVLVRNKLTGELIAEGRHSLFGRHHDQ  961
            DELEIVGR LG++GGYSGTSVL++NK TGELIAEGRHSLFG+H  +
Sbjct  112  DELEIVGRVLGQKGGYSGTSVLLKNKTTGELIAEGRHSLFGKHASK  157



>ref|XP_004241184.1| PREDICTED: acyl-coenzyme A thioesterase 13-like [Solanum lycopersicum]
Length=158

 Score = 78.2 bits (191),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 35/46 (76%), Positives = 42/46 (91%), Gaps = 0/46 (0%)
 Frame = +2

Query  824  DELEIVGRCLGKRGGYSGTSVLVRNKLTGELIAEGRHSLFGRHHDQ  961
            DELE++GR LG++GGYSGTSVLV+NK TGELIAEGRHSLFG+H  +
Sbjct  112  DELEVIGRVLGQKGGYSGTSVLVKNKTTGELIAEGRHSLFGKHASK  157



>ref|XP_009784389.1| PREDICTED: acyl-coenzyme A thioesterase 13 [Nicotiana sylvestris]
 ref|XP_009784390.1| PREDICTED: acyl-coenzyme A thioesterase 13 [Nicotiana sylvestris]
Length=158

 Score = 77.4 bits (189),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 35/46 (76%), Positives = 42/46 (91%), Gaps = 0/46 (0%)
 Frame = +2

Query  824  DELEIVGRCLGKRGGYSGTSVLVRNKLTGELIAEGRHSLFGRHHDQ  961
            DELEI+GR LG++GGYSGT+VLV+NK TGELIAEGRHSLFG+H  +
Sbjct  112  DELEIIGRVLGRKGGYSGTNVLVKNKATGELIAEGRHSLFGKHASK  157



>ref|XP_004241183.1| PREDICTED: acyl-coenzyme A thioesterase 13-like [Solanum lycopersicum]
Length=158

 Score = 77.0 bits (188),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 35/46 (76%), Positives = 42/46 (91%), Gaps = 0/46 (0%)
 Frame = +2

Query  824  DELEIVGRCLGKRGGYSGTSVLVRNKLTGELIAEGRHSLFGRHHDQ  961
            DELEI+G+ LGK+GGYSGTSVLV+NK TGELIAEGRHSLFG++  +
Sbjct  112  DELEIIGQVLGKKGGYSGTSVLVKNKATGELIAEGRHSLFGKYASK  157



>ref|XP_004490572.1| PREDICTED: acyl-coenzyme A thioesterase 13-like [Cicer arietinum]
Length=161

 Score = 76.3 bits (186),  Expect = 7e-13, Method: Compositional matrix adjust.
 Identities = 36/50 (72%), Positives = 42/50 (84%), Gaps = 0/50 (0%)
 Frame = +2

Query  812  AY*QDELEIVGRCLGKRGGYSGTSVLVRNKLTGELIAEGRHSLFGRHHDQ  961
            A+  DELEI  R LG++GGYSGT VLV+NK TGELIAEGRHSLFGRH+ +
Sbjct  111  AHVNDELEITSRLLGRKGGYSGTIVLVKNKATGELIAEGRHSLFGRHNSK  160



>ref|XP_006350817.1| PREDICTED: acyl-coenzyme A thioesterase 13-like [Solanum tuberosum]
Length=158

 Score = 75.5 bits (184),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 34/46 (74%), Positives = 42/46 (91%), Gaps = 0/46 (0%)
 Frame = +2

Query  824  DELEIVGRCLGKRGGYSGTSVLVRNKLTGELIAEGRHSLFGRHHDQ  961
            DELEI+G+ LGK+GGYSGTSVLV+NK TGELIA+GRHSLFG++  +
Sbjct  112  DELEIIGQVLGKKGGYSGTSVLVKNKATGELIAQGRHSLFGKYASK  157



>gb|KDP46555.1| hypothetical protein JCGZ_08527 [Jatropha curcas]
Length=158

 Score = 75.1 bits (183),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 34/47 (72%), Positives = 41/47 (87%), Gaps = 0/47 (0%)
 Frame = +2

Query  821  QDELEIVGRCLGKRGGYSGTSVLVRNKLTGELIAEGRHSLFGRHHDQ  961
             DELEI  + LG+RGGY+GT VLV+NKLTGELIAEGRHSLFG+H+ +
Sbjct  111  NDELEITSKVLGRRGGYAGTLVLVKNKLTGELIAEGRHSLFGKHNSK  157



>ref|XP_002520431.1| acyl-CoA thioesterase, putative [Ricinus communis]
 gb|EEF41844.1| acyl-CoA thioesterase, putative [Ricinus communis]
Length=159

 Score = 75.1 bits (183),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 33/46 (72%), Positives = 41/46 (89%), Gaps = 0/46 (0%)
 Frame = +2

Query  824  DELEIVGRCLGKRGGYSGTSVLVRNKLTGELIAEGRHSLFGRHHDQ  961
            DELEI G+ LG++GGY+GT+VLV+NK TGELIAEGRHSLFG+H  +
Sbjct  113  DELEITGKVLGRKGGYAGTTVLVKNKATGELIAEGRHSLFGKHTSK  158



>ref|XP_007208636.1| hypothetical protein PRUPE_ppa019870mg [Prunus persica]
 gb|EMJ09835.1| hypothetical protein PRUPE_ppa019870mg [Prunus persica]
Length=158

 Score = 74.7 bits (182),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 35/46 (76%), Positives = 40/46 (87%), Gaps = 0/46 (0%)
 Frame = +2

Query  824  DELEIVGRCLGKRGGYSGTSVLVRNKLTGELIAEGRHSLFGRHHDQ  961
            DELEI  R LG+RGGYSGT VL+RNK+TGE+IAEGRHSLFGRH  +
Sbjct  112  DELEITSRVLGQRGGYSGTIVLMRNKVTGEVIAEGRHSLFGRHASK  157



>emb|CDP09147.1| unnamed protein product [Coffea canephora]
Length=158

 Score = 74.7 bits (182),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 35/46 (76%), Positives = 40/46 (87%), Gaps = 0/46 (0%)
 Frame = +2

Query  824  DELEIVGRCLGKRGGYSGTSVLVRNKLTGELIAEGRHSLFGRHHDQ  961
            DELEIV   LG++GGYSGT V+VRNKLTGELIAEGRHSLFG+H  +
Sbjct  112  DELEIVSTLLGRKGGYSGTLVIVRNKLTGELIAEGRHSLFGKHASK  157



>ref|XP_008220367.1| PREDICTED: acyl-coenzyme A thioesterase 13-like [Prunus mume]
Length=168

 Score = 74.7 bits (182),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 35/46 (76%), Positives = 40/46 (87%), Gaps = 0/46 (0%)
 Frame = +2

Query  824  DELEIVGRCLGKRGGYSGTSVLVRNKLTGELIAEGRHSLFGRHHDQ  961
            DELEI  R LG+RGGYSGT VL+RNK+TGE+IAEGRHSLFGRH  +
Sbjct  122  DELEITSRVLGQRGGYSGTIVLMRNKVTGEVIAEGRHSLFGRHASK  167



>ref|XP_008373324.1| PREDICTED: acyl-coenzyme A thioesterase 13-like [Malus domestica]
 ref|XP_008364466.1| PREDICTED: acyl-coenzyme A thioesterase 13-like [Malus domestica]
 ref|XP_008366247.1| PREDICTED: acyl-coenzyme A thioesterase 13-like [Malus domestica]
Length=158

 Score = 74.3 bits (181),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 35/46 (76%), Positives = 39/46 (85%), Gaps = 0/46 (0%)
 Frame = +2

Query  824  DELEIVGRCLGKRGGYSGTSVLVRNKLTGELIAEGRHSLFGRHHDQ  961
            DELEI  R LG+RGGYSGT VL+RNK TGE+IAEGRHSLFGRH  +
Sbjct  112  DELEITSRVLGQRGGYSGTIVLMRNKATGEVIAEGRHSLFGRHASK  157



>ref|XP_009337318.1| PREDICTED: acyl-coenzyme A thioesterase 13-like [Pyrus x bretschneideri]
 ref|XP_009346892.1| PREDICTED: acyl-coenzyme A thioesterase 13-like [Pyrus x bretschneideri]
Length=158

 Score = 74.3 bits (181),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 35/46 (76%), Positives = 39/46 (85%), Gaps = 0/46 (0%)
 Frame = +2

Query  824  DELEIVGRCLGKRGGYSGTSVLVRNKLTGELIAEGRHSLFGRHHDQ  961
            DELEI  R LG+RGGYSGT VL+RNK TGE+IAEGRHSLFGRH  +
Sbjct  112  DELEITSRVLGQRGGYSGTIVLLRNKATGEVIAEGRHSLFGRHASK  157



>gb|KDO66786.1| hypothetical protein CISIN_1g031440mg [Citrus sinensis]
Length=159

 Score = 74.3 bits (181),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 35/47 (74%), Positives = 39/47 (83%), Gaps = 0/47 (0%)
 Frame = +2

Query  821  QDELEIVGRCLGKRGGYSGTSVLVRNKLTGELIAEGRHSLFGRHHDQ  961
             DELEI GR LG+RGGYSGT VL+RNK TGE+IAEGRHSLFGR   +
Sbjct  112  NDELEITGRVLGQRGGYSGTIVLMRNKATGEVIAEGRHSLFGRQPSK  158



>ref|XP_006425012.1| hypothetical protein CICLE_v10029463mg [Citrus clementina]
 ref|XP_006488475.1| PREDICTED: acyl-coenzyme A thioesterase 13-like [Citrus sinensis]
 gb|ESR38252.1| hypothetical protein CICLE_v10029463mg [Citrus clementina]
Length=159

 Score = 73.9 bits (180),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 35/47 (74%), Positives = 39/47 (83%), Gaps = 0/47 (0%)
 Frame = +2

Query  821  QDELEIVGRCLGKRGGYSGTSVLVRNKLTGELIAEGRHSLFGRHHDQ  961
             DELEI GR LG+RGGYSGT VL+RNK TGE+IAEGRHSLFGR   +
Sbjct  112  NDELEITGRVLGQRGGYSGTIVLMRNKATGEVIAEGRHSLFGRQPSK  158



>gb|KDO66785.1| hypothetical protein CISIN_1g031440mg [Citrus sinensis]
Length=153

 Score = 73.9 bits (180),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 35/47 (74%), Positives = 39/47 (83%), Gaps = 0/47 (0%)
 Frame = +2

Query  821  QDELEIVGRCLGKRGGYSGTSVLVRNKLTGELIAEGRHSLFGRHHDQ  961
             DELEI GR LG+RGGYSGT VL+RNK TGE+IAEGRHSLFGR   +
Sbjct  106  NDELEITGRVLGQRGGYSGTIVLMRNKATGEVIAEGRHSLFGRQPSK  152



>gb|KHN46174.1| Acyl-coenzyme A thioesterase 13 [Glycine soja]
Length=159

 Score = 73.9 bits (180),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 34/46 (74%), Positives = 40/46 (87%), Gaps = 0/46 (0%)
 Frame = +2

Query  824  DELEIVGRCLGKRGGYSGTSVLVRNKLTGELIAEGRHSLFGRHHDQ  961
            DELEI  R LG++GGYSGT VL++NK TGELIAEGRHSLFGRH+ +
Sbjct  113  DELEITSRLLGRKGGYSGTIVLLKNKATGELIAEGRHSLFGRHNSK  158



>ref|NP_001237069.1| uncharacterized protein LOC100305814 [Glycine max]
 gb|ACU13689.1| unknown [Glycine max]
Length=159

 Score = 73.9 bits (180),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 34/46 (74%), Positives = 40/46 (87%), Gaps = 0/46 (0%)
 Frame = +2

Query  824  DELEIVGRCLGKRGGYSGTSVLVRNKLTGELIAEGRHSLFGRHHDQ  961
            DELEI  R LG++GGYSGT VL++NK TGELIAEGRHSLFGRH+ +
Sbjct  113  DELEITSRLLGRKGGYSGTIVLLKNKATGELIAEGRHSLFGRHNSK  158



>ref|XP_007142234.1| hypothetical protein PHAVU_008G263600g [Phaseolus vulgaris]
 gb|ESW14228.1| hypothetical protein PHAVU_008G263600g [Phaseolus vulgaris]
Length=159

 Score = 73.6 bits (179),  Expect = 7e-12, Method: Compositional matrix adjust.
 Identities = 34/46 (74%), Positives = 40/46 (87%), Gaps = 0/46 (0%)
 Frame = +2

Query  824  DELEIVGRCLGKRGGYSGTSVLVRNKLTGELIAEGRHSLFGRHHDQ  961
            DELEI  R LG++GGYSGT VL++NK TGELIAEGRHSLFGRH+ +
Sbjct  113  DELEITSRLLGRKGGYSGTIVLLKNKATGELIAEGRHSLFGRHNSK  158



>ref|XP_002313396.1| thioesterase family protein [Populus trichocarpa]
 gb|EEE87351.1| thioesterase family protein [Populus trichocarpa]
Length=158

 Score = 73.2 bits (178),  Expect = 8e-12, Method: Compositional matrix adjust.
 Identities = 33/47 (70%), Positives = 39/47 (83%), Gaps = 0/47 (0%)
 Frame = +2

Query  821  QDELEIVGRCLGKRGGYSGTSVLVRNKLTGELIAEGRHSLFGRHHDQ  961
             DELEI  R LG+ GGY+GT VLV+NK TGELIAEGRHSLFG+H+ +
Sbjct  111  NDELEITARVLGRNGGYAGTIVLVKNKATGELIAEGRHSLFGKHNSK  157



>ref|XP_011032160.1| PREDICTED: acyl-coenzyme A thioesterase 13 [Populus euphratica]
Length=158

 Score = 73.2 bits (178),  Expect = 9e-12, Method: Compositional matrix adjust.
 Identities = 33/47 (70%), Positives = 39/47 (83%), Gaps = 0/47 (0%)
 Frame = +2

Query  821  QDELEIVGRCLGKRGGYSGTSVLVRNKLTGELIAEGRHSLFGRHHDQ  961
             DELEI  R LG+ GGY+GT VLV+NK TGELIAEGRHSLFG+H+ +
Sbjct  111  NDELEITARVLGRNGGYAGTIVLVKNKATGELIAEGRHSLFGKHNSK  157



>ref|XP_004294272.1| PREDICTED: acyl-coenzyme A thioesterase 13-like [Fragaria vesca 
subsp. vesca]
Length=159

 Score = 73.2 bits (178),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 34/47 (72%), Positives = 39/47 (83%), Gaps = 0/47 (0%)
 Frame = +2

Query  821  QDELEIVGRCLGKRGGYSGTSVLVRNKLTGELIAEGRHSLFGRHHDQ  961
             D+LEI  + LGKRGGYSGT VL+RNK TGE+IAEGRHSLFGRH  +
Sbjct  112  NDDLEISSKVLGKRGGYSGTLVLMRNKATGEVIAEGRHSLFGRHPSK  158



>ref|XP_003615571.1| Acyl-coenzyme A thioesterase [Medicago truncatula]
 gb|AES98529.1| acyl-CoA thioesterase, putative [Medicago truncatula]
 gb|AFK44583.1| unknown [Medicago truncatula]
Length=161

 Score = 72.4 bits (176),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 34/50 (68%), Positives = 41/50 (82%), Gaps = 0/50 (0%)
 Frame = +2

Query  812  AY*QDELEIVGRCLGKRGGYSGTSVLVRNKLTGELIAEGRHSLFGRHHDQ  961
            A+  DELEI  R LG++GGYSGT VL++NK TGE IAEGRHSLFGRH+ +
Sbjct  111  AHVNDELEITSRLLGRKGGYSGTIVLLKNKATGESIAEGRHSLFGRHNSK  160



>gb|KDP46554.1| hypothetical protein JCGZ_08526 [Jatropha curcas]
Length=158

 Score = 72.4 bits (176),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 32/47 (68%), Positives = 40/47 (85%), Gaps = 0/47 (0%)
 Frame = +2

Query  821  QDELEIVGRCLGKRGGYSGTSVLVRNKLTGELIAEGRHSLFGRHHDQ  961
             DELEI  + LG++GGY+GT VLV+NK TGELIAEGRHSLFG+H+ +
Sbjct  111  NDELEITSKALGRKGGYTGTLVLVKNKATGELIAEGRHSLFGKHNSK  157



>gb|KHN40043.1| Acyl-coenzyme A thioesterase 13 [Glycine soja]
Length=65

 Score = 70.1 bits (170),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 33/46 (72%), Positives = 38/46 (83%), Gaps = 0/46 (0%)
 Frame = +2

Query  824  DELEIVGRCLGKRGGYSGTSVLVRNKLTGELIAEGRHSLFGRHHDQ  961
            DELEI  R LG + GYSGT VL++NK TGELIAEGRHSLFGRH+ +
Sbjct  19   DELEITSRLLGSKRGYSGTIVLLKNKATGELIAEGRHSLFGRHNSK  64



>gb|AGK44858.1| acyl-CoA thioesterase [Citrus reticulata]
Length=153

 Score = 71.6 bits (174),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 34/47 (72%), Positives = 38/47 (81%), Gaps = 0/47 (0%)
 Frame = +2

Query  821  QDELEIVGRCLGKRGGYSGTSVLVRNKLTGELIAEGRHSLFGRHHDQ  961
             DELEI GR LG+RGGYSGT VL+RNK TGE+IAEG HSLFGR   +
Sbjct  106  NDELEITGRVLGQRGGYSGTIVLMRNKATGEVIAEGPHSLFGRQPSK  152



>ref|XP_010104688.1| hypothetical protein L484_022071 [Morus notabilis]
 gb|EXC01494.1| hypothetical protein L484_022071 [Morus notabilis]
Length=76

 Score = 69.7 bits (169),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 31/44 (70%), Positives = 39/44 (89%), Gaps = 0/44 (0%)
 Frame = +2

Query  821  QDELEIVGRCLGKRGGYSGTSVLVRNKLTGELIAEGRHSLFGRH  952
            +DELEI  R LG++ GYSGT+VL++NK TGE+IAEGRHSLFG+H
Sbjct  29   KDELEITSRLLGRKEGYSGTTVLMKNKATGEIIAEGRHSLFGKH  72



>ref|XP_010521923.1| PREDICTED: putative esterase C31F10.02 [Tarenaya hassleriana]
Length=157

 Score = 70.9 bits (172),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 33/46 (72%), Positives = 38/46 (83%), Gaps = 0/46 (0%)
 Frame = +2

Query  824  DELEIVGRCLGKRGGYSGTSVLVRNKLTGELIAEGRHSLFGRHHDQ  961
            DELEI  + LG+RGGY GT V+VRNKLTGE+IAEGRHSLFGR   +
Sbjct  111  DELEITSKVLGERGGYKGTIVVVRNKLTGEIIAEGRHSLFGRKPSK  156



>gb|ABW81107.1| AcylCoa-1 [Cleome spinosa]
Length=155

 Score = 70.5 bits (171),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 33/46 (72%), Positives = 38/46 (83%), Gaps = 0/46 (0%)
 Frame = +2

Query  824  DELEIVGRCLGKRGGYSGTSVLVRNKLTGELIAEGRHSLFGRHHDQ  961
            DELEI  + LG+RGGY GT V+VRNKLTGE+IAEGRHSLFGR   +
Sbjct  109  DELEITSKVLGERGGYKGTIVVVRNKLTGEIIAEGRHSLFGRKPSK  154



>ref|XP_007016186.1| Acyl-CoA thioesterase, putative [Theobroma cacao]
 gb|EOY33805.1| Acyl-CoA thioesterase, putative [Theobroma cacao]
Length=158

 Score = 70.1 bits (170),  Expect = 9e-11, Method: Compositional matrix adjust.
 Identities = 34/47 (72%), Positives = 38/47 (81%), Gaps = 0/47 (0%)
 Frame = +2

Query  821  QDELEIVGRCLGKRGGYSGTSVLVRNKLTGELIAEGRHSLFGRHHDQ  961
             DELEI  + LG+RGGYSGT VLVRNK TGELIAEGRHSLFG+   +
Sbjct  111  NDELEITSKVLGRRGGYSGTIVLVRNKETGELIAEGRHSLFGKQASK  157



>emb|CDY45458.1| BnaA05g12430D [Brassica napus]
Length=159

 Score = 69.7 bits (169),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 32/46 (70%), Positives = 38/46 (83%), Gaps = 0/46 (0%)
 Frame = +2

Query  824  DELEIVGRCLGKRGGYSGTSVLVRNKLTGELIAEGRHSLFGRHHDQ  961
            +ELEI  R +G+RGGY GT V+VRNKLTGE+IAEGRHSLFGR   +
Sbjct  113  EELEITSRVMGERGGYKGTIVVVRNKLTGEIIAEGRHSLFGRQPSK  158



>ref|XP_010104689.1| hypothetical protein L484_022072 [Morus notabilis]
 gb|EXC01495.1| hypothetical protein L484_022072 [Morus notabilis]
Length=153

 Score = 69.3 bits (168),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 30/46 (65%), Positives = 40/46 (87%), Gaps = 0/46 (0%)
 Frame = +2

Query  824  DELEIVGRCLGKRGGYSGTSVLVRNKLTGELIAEGRHSLFGRHHDQ  961
            DELEI  R LG++GGYSGT+VL++NK TGE+IAEGRHSLF +++ +
Sbjct  107  DELEITSRLLGQKGGYSGTAVLIKNKATGEIIAEGRHSLFLKYNSK  152



>ref|XP_009144361.1| PREDICTED: acyl-coenzyme A thioesterase 13 [Brassica rapa]
Length=159

 Score = 69.3 bits (168),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 31/46 (67%), Positives = 38/46 (83%), Gaps = 0/46 (0%)
 Frame = +2

Query  824  DELEIVGRCLGKRGGYSGTSVLVRNKLTGELIAEGRHSLFGRHHDQ  961
            +ELEI  R +G+RGGY GT V+VRNK+TGE+IAEGRHSLFGR   +
Sbjct  113  EELEITSRVMGERGGYKGTIVVVRNKMTGEIIAEGRHSLFGRQPSK  158



>emb|CDY53360.1| BnaC04g54400D [Brassica napus]
Length=159

 Score = 68.9 bits (167),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 31/46 (67%), Positives = 38/46 (83%), Gaps = 0/46 (0%)
 Frame = +2

Query  824  DELEIVGRCLGKRGGYSGTSVLVRNKLTGELIAEGRHSLFGRHHDQ  961
            +ELEI  R +G+RGGY GT V+VRNK+TGE+IAEGRHSLFGR   +
Sbjct  113  EELEITSRVMGERGGYKGTIVVVRNKMTGEIIAEGRHSLFGRQPSK  158



>ref|XP_002881059.1| thioesterase family protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH57318.1| thioesterase family protein [Arabidopsis lyrata subsp. lyrata]
Length=152

 Score = 68.6 bits (166),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 31/46 (67%), Positives = 38/46 (83%), Gaps = 0/46 (0%)
 Frame = +2

Query  824  DELEIVGRCLGKRGGYSGTSVLVRNKLTGELIAEGRHSLFGRHHDQ  961
            +ELEI  R LG+RGGY GT V+VRNK+TGE+IAEGRHS+FGR   +
Sbjct  106  EELEITSRLLGERGGYKGTIVVVRNKMTGEIIAEGRHSMFGRQASK  151



>ref|NP_565683.1| thioesterase-like protein [Arabidopsis thaliana]
 gb|AAC95180.2| expressed protein [Arabidopsis thaliana]
 dbj|BAC42617.1| unknown protein [Arabidopsis thaliana]
 gb|AAO39906.1| At2g29590 [Arabidopsis thaliana]
 gb|AEC08276.1| thioesterase-like protein [Arabidopsis thaliana]
Length=158

 Score = 68.6 bits (166),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 31/46 (67%), Positives = 38/46 (83%), Gaps = 0/46 (0%)
 Frame = +2

Query  824  DELEIVGRCLGKRGGYSGTSVLVRNKLTGELIAEGRHSLFGRHHDQ  961
            +ELEI  R LG+RGGY GT V+VRNK+TGE+IAEGRHS+FGR   +
Sbjct  112  EELEITSRLLGERGGYKGTIVVVRNKMTGEIIAEGRHSMFGRQASK  157



>gb|AAM65417.1| unknown [Arabidopsis thaliana]
Length=157

 Score = 68.6 bits (166),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 31/46 (67%), Positives = 38/46 (83%), Gaps = 0/46 (0%)
 Frame = +2

Query  824  DELEIVGRCLGKRGGYSGTSVLVRNKLTGELIAEGRHSLFGRHHDQ  961
            +ELEI  R LG+RGGY GT V+VRNK+TGE+IAEGRHS+FGR   +
Sbjct  111  EELEITSRLLGERGGYKGTIVVVRNKMTGEIIAEGRHSMFGRQASK  156



>ref|XP_010256675.1| PREDICTED: acyl-coenzyme A thioesterase 13 [Nelumbo nucifera]
Length=157

 Score = 68.6 bits (166),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 30/43 (70%), Positives = 37/43 (86%), Gaps = 0/43 (0%)
 Frame = +2

Query  821  QDELEIVGRCLGKRGGYSGTSVLVRNKLTGELIAEGRHSLFGR  949
             DELEI  R LG++GGYSGT +L +NK+TGELIAEGRHSL+G+
Sbjct  110  NDELEITSRALGQKGGYSGTVILFKNKVTGELIAEGRHSLYGK  152



>gb|KHG20959.1| Acyl-coenzyme A thioesterase 13 [Gossypium arboreum]
Length=288

 Score = 70.1 bits (170),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 33/47 (70%), Positives = 37/47 (79%), Gaps = 0/47 (0%)
 Frame = +2

Query  821  QDELEIVGRCLGKRGGYSGTSVLVRNKLTGELIAEGRHSLFGRHHDQ  961
             DELEI  + LG+RG YSGT VLVRNK TGELIAEGRHSLFG+   +
Sbjct  241  NDELEITSKVLGQRGSYSGTIVLVRNKATGELIAEGRHSLFGKKSSK  287



>ref|XP_006369557.1| hypothetical protein POPTR_0001s25540g [Populus trichocarpa]
 gb|ERP66126.1| hypothetical protein POPTR_0001s25540g [Populus trichocarpa]
Length=67

 Score = 64.7 bits (156),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 30/44 (68%), Positives = 34/44 (77%), Gaps = 0/44 (0%)
 Frame = +2

Query  821  QDELEIVGRCLGKRGGYSGTSVLVRNKLTGELIAEGRHSLFGRH  952
            QDELEI  R L +RGGY+ T VLV+NK T ELIAEGRHS  G+H
Sbjct  20   QDELEITARVLARRGGYAATIVLVKNKATAELIAEGRHSSSGKH  63



>ref|XP_007206515.1| hypothetical protein PRUPE_ppa019295mg [Prunus persica]
 gb|EMJ07714.1| hypothetical protein PRUPE_ppa019295mg [Prunus persica]
Length=159

 Score = 66.6 bits (161),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 30/40 (75%), Positives = 36/40 (90%), Gaps = 0/40 (0%)
 Frame = +2

Query  824  DELEIVGRCLGKRGGYSGTSVLVRNKLTGELIAEGRHSLF  943
            DELEI  + LG++GGYSGTSVL+RNK TGE++AEGRHSLF
Sbjct  112  DELEITSKRLGQKGGYSGTSVLMRNKATGEIVAEGRHSLF  151



>ref|XP_010418788.1| PREDICTED: acyl-coenzyme A thioesterase 13-like [Camelina sativa]
Length=168

 Score = 66.6 bits (161),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 31/46 (67%), Positives = 38/46 (83%), Gaps = 0/46 (0%)
 Frame = +2

Query  824  DELEIVGRCLGKRGGYSGTSVLVRNKLTGELIAEGRHSLFGRHHDQ  961
            +ELEI  R LG+RGGY+GT V+VRN+ TGE+IAEGRHSLFGR   +
Sbjct  122  EELEITSRLLGQRGGYTGTLVVVRNQRTGEIIAEGRHSLFGRQASK  167



>ref|XP_010510468.1| PREDICTED: acyl-coenzyme A thioesterase 13-like [Camelina sativa]
Length=160

 Score = 65.9 bits (159),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 31/46 (67%), Positives = 38/46 (83%), Gaps = 0/46 (0%)
 Frame = +2

Query  824  DELEIVGRCLGKRGGYSGTSVLVRNKLTGELIAEGRHSLFGRHHDQ  961
            +ELEI  R LG+RGGY+GT V+VRN+ TGE+IAEGRHSLFGR   +
Sbjct  114  EELEITSRLLGERGGYTGTLVVVRNQRTGEIIAEGRHSLFGRQASK  159



>ref|XP_009402301.1| PREDICTED: acyl-coenzyme A thioesterase 13 isoform X1 [Musa acuminata 
subsp. malaccensis]
Length=158

 Score = 65.9 bits (159),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 29/42 (69%), Positives = 37/42 (88%), Gaps = 0/42 (0%)
 Frame = +2

Query  824  DELEIVGRCLGKRGGYSGTSVLVRNKLTGELIAEGRHSLFGR  949
            DELEI+ + LG +GGYSGT VL++NK TGE++AEGRHSLFG+
Sbjct  112  DELEIISKVLGHKGGYSGTYVLLKNKATGEVVAEGRHSLFGK  153



>ref|XP_002280576.1| PREDICTED: acyl-coenzyme A thioesterase 13 [Vitis vinifera]
 emb|CBI16006.3| unnamed protein product [Vitis vinifera]
Length=158

 Score = 65.5 bits (158),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 28/47 (60%), Positives = 38/47 (81%), Gaps = 0/47 (0%)
 Frame = +2

Query  821  QDELEIVGRCLGKRGGYSGTSVLVRNKLTGELIAEGRHSLFGRHHDQ  961
            +DELEI  + LG++GGY GT VL++NK TGE++AEGRHSLF +H  +
Sbjct  111  EDELEITSKFLGQKGGYFGTLVLLKNKATGEIVAEGRHSLFKKHASK  157



>ref|XP_006410016.1| hypothetical protein EUTSA_v10017356mg [Eutrema salsugineum]
 gb|ESQ51469.1| hypothetical protein EUTSA_v10017356mg [Eutrema salsugineum]
Length=158

 Score = 65.1 bits (157),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 30/46 (65%), Positives = 37/46 (80%), Gaps = 0/46 (0%)
 Frame = +2

Query  824  DELEIVGRCLGKRGGYSGTSVLVRNKLTGELIAEGRHSLFGRHHDQ  961
            +ELEI  R +G+RGGY GT V+VRN+ TGE+IAEGRHSLFGR   +
Sbjct  112  EELEITSRVMGERGGYKGTIVVVRNQKTGEIIAEGRHSLFGRQASK  157



>ref|XP_010414338.1| PREDICTED: acyl-coenzyme A thioesterase 13-like [Camelina sativa]
Length=161

 Score = 65.1 bits (157),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 31/46 (67%), Positives = 37/46 (80%), Gaps = 0/46 (0%)
 Frame = +2

Query  824  DELEIVGRCLGKRGGYSGTSVLVRNKLTGELIAEGRHSLFGRHHDQ  961
            +ELEI  R LG+RGGY GT V+VRN+ TGE+IAEGRHSLFGR   +
Sbjct  115  EELEITSRLLGERGGYKGTLVVVRNQRTGEVIAEGRHSLFGRQASK  160



>ref|XP_008355391.1| PREDICTED: acyl-coenzyme A thioesterase 13-like isoform X3 [Malus 
domestica]
 ref|XP_008363417.1| PREDICTED: acyl-coenzyme A thioesterase 13-like isoform X3 [Malus 
domestica]
Length=165

 Score = 65.1 bits (157),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 31/46 (67%), Positives = 35/46 (76%), Gaps = 0/46 (0%)
 Frame = +2

Query  824  DELEIVGRCLGKRGGYSGTSVLVRNKLTGELIAEGRHSLFGRHHDQ  961
            DELEI  R LG+ G Y GTS+LVRNK TGE+IAEGRHSLF  H  +
Sbjct  119  DELEITSRVLGQLGRYCGTSILVRNKATGEVIAEGRHSLFAIHTSK  164



>ref|XP_006295147.1| hypothetical protein CARUB_v10024222mg [Capsella rubella]
 gb|EOA28045.1| hypothetical protein CARUB_v10024222mg [Capsella rubella]
Length=159

 Score = 65.1 bits (157),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 31/46 (67%), Positives = 36/46 (78%), Gaps = 0/46 (0%)
 Frame = +2

Query  824  DELEIVGRCLGKRGGYSGTSVLVRNKLTGELIAEGRHSLFGRHHDQ  961
            +ELEI  R LG+RG Y GT V+VRNK TGE+IAEGRHSLFGR   +
Sbjct  113  EELEITSRLLGERGPYKGTLVVVRNKRTGEIIAEGRHSLFGRQASK  158



>ref|XP_009374294.1| PREDICTED: uncharacterized protein LOC103963231 isoform X3 [Pyrus 
x bretschneideri]
Length=178

 Score = 65.5 bits (158),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 30/43 (70%), Positives = 34/43 (79%), Gaps = 0/43 (0%)
 Frame = +2

Query  824  DELEIVGRCLGKRGGYSGTSVLVRNKLTGELIAEGRHSLFGRH  952
            DELEI  R LG+R  Y GTS+LVRNK TG++IAEGRHSLF  H
Sbjct  132  DELEITSRVLGQRDRYCGTSILVRNKATGDVIAEGRHSLFAIH  174



>ref|XP_008363419.1| PREDICTED: acyl-coenzyme A thioesterase 13-like [Malus domestica]
Length=155

 Score = 64.7 bits (156),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 30/40 (75%), Positives = 34/40 (85%), Gaps = 0/40 (0%)
 Frame = +2

Query  824  DELEIVGRCLGKRGGYSGTSVLVRNKLTGELIAEGRHSLF  943
            DELEI  + LG+RG YSG S+LVRNK TGE+IAEGRHSLF
Sbjct  109  DELEITSKSLGQRGRYSGVSILVRNKATGEMIAEGRHSLF  148



>ref|XP_010033034.1| PREDICTED: acyl-coenzyme A thioesterase 13 [Eucalyptus grandis]
 gb|KCW52565.1| hypothetical protein EUGRSUZ_J01944 [Eucalyptus grandis]
Length=158

 Score = 64.7 bits (156),  Expect = 7e-09, Method: Compositional matrix adjust.
 Identities = 29/40 (73%), Positives = 34/40 (85%), Gaps = 0/40 (0%)
 Frame = +2

Query  824  DELEIVGRCLGKRGGYSGTSVLVRNKLTGELIAEGRHSLF  943
            DELEI  + LG++GG+S T VLVRNK TGE+IAEGRHSLF
Sbjct  112  DELEITSKVLGQKGGFSATIVLVRNKATGEIIAEGRHSLF  151



>ref|XP_008355379.1| PREDICTED: uncharacterized protein LOC103419030 isoform X1 [Malus 
domestica]
 ref|XP_008363415.1| PREDICTED: uncharacterized protein LOC103427123 isoform X1 [Malus 
domestica]
Length=198

 Score = 65.1 bits (157),  Expect = 7e-09, Method: Compositional matrix adjust.
 Identities = 31/46 (67%), Positives = 35/46 (76%), Gaps = 0/46 (0%)
 Frame = +2

Query  824  DELEIVGRCLGKRGGYSGTSVLVRNKLTGELIAEGRHSLFGRHHDQ  961
            DELEI  R LG+ G Y GTS+LVRNK TGE+IAEGRHSLF  H  +
Sbjct  152  DELEITSRVLGQLGRYCGTSILVRNKATGEVIAEGRHSLFAIHTSK  197



>ref|XP_006848099.1| hypothetical protein AMTR_s00029p00212430 [Amborella trichopoda]
 gb|ERN09680.1| hypothetical protein AMTR_s00029p00212430 [Amborella trichopoda]
Length=158

 Score = 64.7 bits (156),  Expect = 8e-09, Method: Compositional matrix adjust.
 Identities = 29/42 (69%), Positives = 37/42 (88%), Gaps = 0/42 (0%)
 Frame = +2

Query  824  DELEIVGRCLGKRGGYSGTSVLVRNKLTGELIAEGRHSLFGR  949
            DE+EIV R LG +GGYSGT V+++N+ TGE+IA+GRHSLFGR
Sbjct  112  DEVEIVSRILGHKGGYSGTEVILKNRRTGEIIAQGRHSLFGR  153



>ref|XP_008220360.1| PREDICTED: acyl-coenzyme A thioesterase 13-like [Prunus mume]
Length=159

 Score = 64.3 bits (155),  Expect = 9e-09, Method: Compositional matrix adjust.
 Identities = 29/40 (73%), Positives = 35/40 (88%), Gaps = 0/40 (0%)
 Frame = +2

Query  824  DELEIVGRCLGKRGGYSGTSVLVRNKLTGELIAEGRHSLF  943
            DELEI  + LG++GGYSGTSVL+RNK TG ++AEGRHSLF
Sbjct  112  DELEITSKRLGQKGGYSGTSVLMRNKATGAIVAEGRHSLF  151



>gb|EYU45972.1| hypothetical protein MIMGU_mgv1a014917mg [Erythranthe guttata]
Length=174

 Score = 64.7 bits (156),  Expect = 9e-09, Method: Compositional matrix adjust.
 Identities = 28/42 (67%), Positives = 34/42 (81%), Gaps = 0/42 (0%)
 Frame = +2

Query  821  QDELEIVGRCLGKRGGYSGTSVLVRNKLTGELIAEGRHSLFG  946
             DELEI  R LG++G YSG SVL++NK TGE++AEGRHSLF 
Sbjct  127  NDELEITSRLLGRQGAYSGASVLIQNKTTGEVVAEGRHSLFS  168



>ref|XP_009374292.1| PREDICTED: uncharacterized protein LOC103963231 isoform X1 [Pyrus 
x bretschneideri]
Length=211

 Score = 65.1 bits (157),  Expect = 9e-09, Method: Compositional matrix adjust.
 Identities = 30/43 (70%), Positives = 34/43 (79%), Gaps = 0/43 (0%)
 Frame = +2

Query  824  DELEIVGRCLGKRGGYSGTSVLVRNKLTGELIAEGRHSLFGRH  952
            DELEI  R LG+R  Y GTS+LVRNK TG++IAEGRHSLF  H
Sbjct  165  DELEITSRVLGQRDRYCGTSILVRNKATGDVIAEGRHSLFAIH  207



>gb|KFK44237.1| hypothetical protein AALP_AA1G232400 [Arabis alpina]
Length=153

 Score = 64.3 bits (155),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 30/46 (65%), Positives = 36/46 (78%), Gaps = 0/46 (0%)
 Frame = +2

Query  824  DELEIVGRCLGKRGGYSGTSVLVRNKLTGELIAEGRHSLFGRHHDQ  961
            +ELEI  R LG+ G Y GT V+VRNK+TGE+IAEGRHSLFGR   +
Sbjct  107  EELEITSRLLGEIGSYKGTIVVVRNKITGEIIAEGRHSLFGRQASK  152



>ref|XP_009374291.1| PREDICTED: acyl-coenzyme A thioesterase 13-like [Pyrus x bretschneideri]
Length=155

 Score = 64.3 bits (155),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 30/40 (75%), Positives = 34/40 (85%), Gaps = 0/40 (0%)
 Frame = +2

Query  824  DELEIVGRCLGKRGGYSGTSVLVRNKLTGELIAEGRHSLF  943
            DELEI  + LG+RG YSG SVL+RNK TGE+IAEGRHSLF
Sbjct  109  DELEITSKSLGQRGRYSGVSVLMRNKATGEMIAEGRHSLF  148



>ref|XP_008785432.1| PREDICTED: acyl-coenzyme A thioesterase 13 isoform X1 [Phoenix 
dactylifera]
Length=164

 Score = 64.3 bits (155),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 29/42 (69%), Positives = 34/42 (81%), Gaps = 0/42 (0%)
 Frame = +2

Query  821  QDELEIVGRCLGKRGGYSGTSVLVRNKLTGELIAEGRHSLFG  946
            QDELEI    LG +G Y+GT VL+RNK TGE++AEGRHSLFG
Sbjct  117  QDELEITSSVLGHKGAYTGTYVLLRNKTTGEIVAEGRHSLFG  158



>gb|KHG14017.1| Acyl-coenzyme A thioesterase 13 [Gossypium arboreum]
Length=167

 Score = 63.9 bits (154),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 30/46 (65%), Positives = 36/46 (78%), Gaps = 0/46 (0%)
 Frame = +2

Query  824  DELEIVGRCLGKRGGYSGTSVLVRNKLTGELIAEGRHSLFGRHHDQ  961
            DELEI  + LG+RGGY+GT V +RNK TGELIAEGRHSL+G    +
Sbjct  112  DELEITSKALGERGGYAGTLVHIRNKATGELIAEGRHSLYGNESSK  157



>gb|KFK44236.1| hypothetical protein AALP_AA1G232400 [Arabis alpina]
Length=158

 Score = 63.9 bits (154),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 30/43 (70%), Positives = 35/43 (81%), Gaps = 0/43 (0%)
 Frame = +2

Query  824  DELEIVGRCLGKRGGYSGTSVLVRNKLTGELIAEGRHSLFGRH  952
            +ELEI  R LG+ G Y GT V+VRNK+TGE+IAEGRHSLFGR 
Sbjct  107  EELEITSRLLGEIGSYKGTIVVVRNKITGEIIAEGRHSLFGRQ  149



>ref|XP_008355407.1| PREDICTED: acyl-coenzyme A thioesterase 13-like [Malus domestica]
Length=155

 Score = 63.5 bits (153),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 29/40 (73%), Positives = 34/40 (85%), Gaps = 0/40 (0%)
 Frame = +2

Query  824  DELEIVGRCLGKRGGYSGTSVLVRNKLTGELIAEGRHSLF  943
            DELEI  + LG+RG YSG S+L+RNK TGE+IAEGRHSLF
Sbjct  109  DELEITSKSLGQRGRYSGVSILMRNKATGEMIAEGRHSLF  148



>ref|XP_010510436.1| PREDICTED: uncharacterized protein LOC104786686 [Camelina sativa]
Length=163

 Score = 63.5 bits (153),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 31/45 (69%), Positives = 35/45 (78%), Gaps = 0/45 (0%)
 Frame = +2

Query  827  ELEIVGRCLGKRGGYSGTSVLVRNKLTGELIAEGRHSLFGRHHDQ  961
            ELEI  R LG RGGY+GT V+VRN  TGE+IAEGRHSLFGR   +
Sbjct  118  ELEITSRLLGVRGGYTGTLVVVRNNETGEIIAEGRHSLFGRQASK  162



>ref|XP_011080688.1| PREDICTED: acyl-coenzyme A thioesterase 13 isoform X3 [Sesamum 
indicum]
Length=160

 Score = 63.2 bits (152),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 28/41 (68%), Positives = 34/41 (83%), Gaps = 0/41 (0%)
 Frame = +2

Query  821  QDELEIVGRCLGKRGGYSGTSVLVRNKLTGELIAEGRHSLF  943
             DELEI  RCLG+ G Y GT+VL++NK TGE++AEGRHSLF
Sbjct  113  NDELEITSRCLGRVGRYFGTTVLIQNKTTGEVVAEGRHSLF  153



>gb|EPS64294.1| hypothetical protein M569_10488, partial [Genlisea aurea]
Length=156

 Score = 63.2 bits (152),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 29/42 (69%), Positives = 34/42 (81%), Gaps = 0/42 (0%)
 Frame = +2

Query  821  QDELEIVGRCLGKRGGYSGTSVLVRNKLTGELIAEGRHSLFG  946
             DELEI  R LG+ GGY GTSVL+RNK TG+++AEGRHSLF 
Sbjct  115  NDELEISSRRLGRVGGYYGTSVLIRNKTTGQIVAEGRHSLFA  156



>ref|XP_011080687.1| PREDICTED: acyl-coenzyme A thioesterase 13 isoform X2 [Sesamum 
indicum]
Length=165

 Score = 63.2 bits (152),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 28/41 (68%), Positives = 34/41 (83%), Gaps = 0/41 (0%)
 Frame = +2

Query  821  QDELEIVGRCLGKRGGYSGTSVLVRNKLTGELIAEGRHSLF  943
             DELEI  RCLG+ G Y GT+VL++NK TGE++AEGRHSLF
Sbjct  113  NDELEITSRCLGRVGRYFGTTVLIQNKTTGEVVAEGRHSLF  153



>ref|XP_011080685.1| PREDICTED: acyl-coenzyme A thioesterase 13 isoform X1 [Sesamum 
indicum]
Length=167

 Score = 63.2 bits (152),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 28/41 (68%), Positives = 34/41 (83%), Gaps = 0/41 (0%)
 Frame = +2

Query  821  QDELEIVGRCLGKRGGYSGTSVLVRNKLTGELIAEGRHSLF  943
             DELEI  RCLG+ G Y GT+VL++NK TGE++AEGRHSLF
Sbjct  113  NDELEITSRCLGRVGRYFGTTVLIQNKTTGEVVAEGRHSLF  153



>ref|XP_010510470.1| PREDICTED: acyl-coenzyme A thioesterase 13-like [Camelina sativa]
Length=164

 Score = 62.8 bits (151),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 30/46 (65%), Positives = 36/46 (78%), Gaps = 0/46 (0%)
 Frame = +2

Query  824  DELEIVGRCLGKRGGYSGTSVLVRNKLTGELIAEGRHSLFGRHHDQ  961
            +ELE+  R LG+RG Y GT V+VRNK TGE+IAEGRHSLFGR   +
Sbjct  118  EELEVTSRLLGERGRYKGTLVVVRNKRTGEVIAEGRHSLFGRQASK  163



>ref|XP_010414900.1| PREDICTED: acyl-coenzyme A thioesterase 13-like [Camelina sativa]
Length=160

 Score = 62.8 bits (151),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 30/46 (65%), Positives = 36/46 (78%), Gaps = 0/46 (0%)
 Frame = +2

Query  824  DELEIVGRCLGKRGGYSGTSVLVRNKLTGELIAEGRHSLFGRHHDQ  961
            +ELE+  R LG+RG Y GT V+VRNK TGE+IAEGRHSLFGR   +
Sbjct  114  EELEVTSRLLGERGRYKGTLVVVRNKRTGEVIAEGRHSLFGRQASK  159



>ref|XP_010685620.1| PREDICTED: acyl-coenzyme A thioesterase 13-like [Beta vulgaris 
subsp. vulgaris]
Length=158

 Score = 62.4 bits (150),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 28/46 (61%), Positives = 35/46 (76%), Gaps = 0/46 (0%)
 Frame = +2

Query  824  DELEIVGRCLGKRGGYSGTSVLVRNKLTGELIAEGRHSLFGRHHDQ  961
            DELEI  R LG++G   GTSVL++NK TGE IAEGRH+LF +H  +
Sbjct  112  DELEITSRLLGQKGAVFGTSVLLKNKATGETIAEGRHTLFSKHASK  157



>ref|XP_010418789.1| PREDICTED: acyl-coenzyme A thioesterase 13-like [Camelina sativa]
Length=99

 Score = 61.2 bits (147),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 29/46 (63%), Positives = 36/46 (78%), Gaps = 0/46 (0%)
 Frame = +2

Query  824  DELEIVGRCLGKRGGYSGTSVLVRNKLTGELIAEGRHSLFGRHHDQ  961
            +ELE+  R LG+RG Y GT V+VRN+ TGE+IAEGRHSLFGR   +
Sbjct  53   EELEVTSRLLGERGRYKGTLVVVRNQRTGEVIAEGRHSLFGRQASK  98



>ref|XP_007206059.1| hypothetical protein PRUPE_ppa012666mg [Prunus persica]
 gb|EMJ07258.1| hypothetical protein PRUPE_ppa012666mg [Prunus persica]
Length=159

 Score = 62.4 bits (150),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 29/40 (73%), Positives = 35/40 (88%), Gaps = 0/40 (0%)
 Frame = +2

Query  824  DELEIVGRCLGKRGGYSGTSVLVRNKLTGELIAEGRHSLF  943
            DELEI+ + LG+RGGY+GT VLVRNK TGE+IAEGR S+F
Sbjct  112  DELEIISKRLGQRGGYTGTLVLVRNKATGEIIAEGRLSMF  151



>ref|XP_008220341.1| PREDICTED: acyl-coenzyme A thioesterase 13-like [Prunus mume]
Length=167

 Score = 62.4 bits (150),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 29/40 (73%), Positives = 35/40 (88%), Gaps = 0/40 (0%)
 Frame = +2

Query  824  DELEIVGRCLGKRGGYSGTSVLVRNKLTGELIAEGRHSLF  943
            DELEI+ + LG+RGGY+GT VLVRNK TGE+IAEGR S+F
Sbjct  120  DELEIISKRLGQRGGYTGTLVLVRNKATGEIIAEGRLSMF  159



>ref|XP_009337316.1| PREDICTED: acyl-coenzyme A thioesterase 13-like [Pyrus x bretschneideri]
Length=154

 Score = 62.0 bits (149),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 29/41 (71%), Positives = 34/41 (83%), Gaps = 0/41 (0%)
 Frame = +2

Query  821  QDELEIVGRCLGKRGGYSGTSVLVRNKLTGELIAEGRHSLF  943
             DELEI  + LG+RG YSGT VL+RNK +GE+IAEGRHSLF
Sbjct  106  NDELEITSKQLGQRGRYSGTHVLLRNKASGEIIAEGRHSLF  146



>ref|XP_008220332.1| PREDICTED: acyl-coenzyme A thioesterase 13-like [Prunus mume]
Length=173

 Score = 62.0 bits (149),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 33/52 (63%), Positives = 39/52 (75%), Gaps = 1/52 (2%)
 Frame = +2

Query  824  DELEIVGRCLGKRGGYSGTSVLVRNKLTGELIAEGRHSLFGRHHDQDIREVP  979
            DELEI  R LG+ GG SGT V++RNK TGE+IAEGRHSLF R H   I ++P
Sbjct  112  DELEITSRMLGRVGGCSGTIVILRNKTTGEIIAEGRHSLF-RSHVGLIPKLP  162



>ref|XP_008785433.1| PREDICTED: acyl-coenzyme A thioesterase 13 isoform X2 [Phoenix 
dactylifera]
Length=158

 Score = 62.0 bits (149),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 28/41 (68%), Positives = 33/41 (80%), Gaps = 0/41 (0%)
 Frame = +2

Query  824  DELEIVGRCLGKRGGYSGTSVLVRNKLTGELIAEGRHSLFG  946
            DELEI    LG +G Y+GT VL+RNK TGE++AEGRHSLFG
Sbjct  112  DELEITSSVLGHKGAYTGTYVLLRNKTTGEIVAEGRHSLFG  152



>ref|XP_004143143.1| PREDICTED: acyl-coenzyme A thioesterase 13-like [Cucumis sativus]
 ref|XP_004160179.1| PREDICTED: acyl-coenzyme A thioesterase 13-like [Cucumis sativus]
 gb|KGN47106.1| Acyl-CoA thioesterase [Cucumis sativus]
Length=161

 Score = 62.0 bits (149),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 27/41 (66%), Positives = 35/41 (85%), Gaps = 0/41 (0%)
 Frame = +2

Query  824  DELEIVGRCLGKRGGYSGTSVLVRNKLTGELIAEGRHSLFG  946
            DELEIV + LG++G YSGTSV+++NK  GE++AEGRHSLF 
Sbjct  111  DELEIVSKLLGQKGRYSGTSVVIKNKRNGEIVAEGRHSLFS  151



>ref|XP_009337314.1| PREDICTED: acyl-coenzyme A thioesterase 13-like [Pyrus x bretschneideri]
 ref|XP_009337315.1| PREDICTED: acyl-coenzyme A thioesterase 13-like [Pyrus x bretschneideri]
Length=162

 Score = 62.0 bits (149),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 29/41 (71%), Positives = 34/41 (83%), Gaps = 0/41 (0%)
 Frame = +2

Query  821  QDELEIVGRCLGKRGGYSGTSVLVRNKLTGELIAEGRHSLF  943
             DELEI  + LG+RG YSGT VL+RNK +GE+IAEGRHSLF
Sbjct  115  NDELEITSKRLGQRGRYSGTYVLLRNKASGEIIAEGRHSLF  155



>ref|XP_009346891.1| PREDICTED: acyl-coenzyme A thioesterase 13-like [Pyrus x bretschneideri]
Length=163

 Score = 61.6 bits (148),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 29/41 (71%), Positives = 34/41 (83%), Gaps = 0/41 (0%)
 Frame = +2

Query  821  QDELEIVGRCLGKRGGYSGTSVLVRNKLTGELIAEGRHSLF  943
             DELEI  + LG+RG YSGT VL+RNK +GE+IAEGRHSLF
Sbjct  115  NDELEITSKQLGQRGRYSGTHVLLRNKASGEIIAEGRHSLF  155



>ref|XP_009346893.1| PREDICTED: acyl-coenzyme A thioesterase 13-like [Pyrus x bretschneideri]
 ref|XP_009346894.1| PREDICTED: acyl-coenzyme A thioesterase 13-like [Pyrus x bretschneideri]
Length=162

 Score = 61.6 bits (148),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 29/41 (71%), Positives = 34/41 (83%), Gaps = 0/41 (0%)
 Frame = +2

Query  821  QDELEIVGRCLGKRGGYSGTSVLVRNKLTGELIAEGRHSLF  943
             DELEI  + LG+RG YSGT VL+RNK +GE+IAEGRHSLF
Sbjct  115  NDELEITSKRLGQRGRYSGTYVLLRNKASGEIIAEGRHSLF  155



>ref|XP_010510433.1| PREDICTED: acyl-coenzyme A thioesterase 13-like [Camelina sativa]
Length=164

 Score = 61.6 bits (148),  Expect = 8e-08, Method: Compositional matrix adjust.
 Identities = 29/46 (63%), Positives = 36/46 (78%), Gaps = 0/46 (0%)
 Frame = +2

Query  824  DELEIVGRCLGKRGGYSGTSVLVRNKLTGELIAEGRHSLFGRHHDQ  961
            +ELE+  R LG+RG Y GT V+VRN+ TGE+IAEGRHSLFGR   +
Sbjct  118  EELEVTSRLLGERGRYKGTLVVVRNQRTGEVIAEGRHSLFGRQASK  163



>ref|XP_010923137.1| PREDICTED: acyl-coenzyme A thioesterase 13 [Elaeis guineensis]
Length=184

 Score = 62.0 bits (149),  Expect = 8e-08, Method: Compositional matrix adjust.
 Identities = 29/41 (71%), Positives = 33/41 (80%), Gaps = 0/41 (0%)
 Frame = +2

Query  824  DELEIVGRCLGKRGGYSGTSVLVRNKLTGELIAEGRHSLFG  946
            DELEI    LG +GGYSGT VL+RNK TG ++AEGRHSLFG
Sbjct  138  DELEITSSVLGHKGGYSGTYVLLRNKTTGVIVAEGRHSLFG  178



>ref|XP_007208603.1| hypothetical protein PRUPE_ppa022342mg [Prunus persica]
 gb|EMJ09802.1| hypothetical protein PRUPE_ppa022342mg [Prunus persica]
Length=163

 Score = 61.6 bits (148),  Expect = 9e-08, Method: Compositional matrix adjust.
 Identities = 30/43 (70%), Positives = 34/43 (79%), Gaps = 0/43 (0%)
 Frame = +2

Query  824  DELEIVGRCLGKRGGYSGTSVLVRNKLTGELIAEGRHSLFGRH  952
            DELEI  R LG+ GG SGT V++RNK TGE+IAEGRHSLF  H
Sbjct  114  DELEITSRMLGRVGGCSGTIVILRNKTTGEIIAEGRHSLFRSH  156



>ref|XP_007207558.1| hypothetical protein PRUPE_ppa016575mg [Prunus persica]
 gb|EMJ08757.1| hypothetical protein PRUPE_ppa016575mg [Prunus persica]
Length=163

 Score = 61.2 bits (147),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 30/43 (70%), Positives = 34/43 (79%), Gaps = 0/43 (0%)
 Frame = +2

Query  824  DELEIVGRCLGKRGGYSGTSVLVRNKLTGELIAEGRHSLFGRH  952
            DELEI  R LG+ GG SGT V++RNK TGE+IAEGRHSLF  H
Sbjct  114  DELEITSRMLGRVGGCSGTIVILRNKTTGEIIAEGRHSLFRSH  156



>ref|XP_010470349.1| PREDICTED: acyl-coenzyme A thioesterase 13-like isoform X1 [Camelina 
sativa]
Length=157

 Score = 61.2 bits (147),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 29/46 (63%), Positives = 36/46 (78%), Gaps = 0/46 (0%)
 Frame = +2

Query  824  DELEIVGRCLGKRGGYSGTSVLVRNKLTGELIAEGRHSLFGRHHDQ  961
            +ELE+  R LG+RG Y GT V+VRN+ TGE+IAEGRHSLFGR   +
Sbjct  111  EELEVTSRLLGERGRYKGTLVVVRNQRTGEVIAEGRHSLFGRQASK  156



>ref|XP_010470350.1| PREDICTED: acyl-coenzyme A thioesterase 13-like isoform X2 [Camelina 
sativa]
Length=151

 Score = 61.2 bits (147),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 29/46 (63%), Positives = 36/46 (78%), Gaps = 0/46 (0%)
 Frame = +2

Query  824  DELEIVGRCLGKRGGYSGTSVLVRNKLTGELIAEGRHSLFGRHHDQ  961
            +ELE+  R LG+RG Y GT V+VRN+ TGE+IAEGRHSLFGR   +
Sbjct  105  EELEVTSRLLGERGRYKGTLVVVRNQRTGEVIAEGRHSLFGRQASK  150



>ref|XP_008363451.1| PREDICTED: putative esterase F42H10.6, partial [Malus domestica]
Length=99

 Score = 60.1 bits (144),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 29/40 (73%), Positives = 31/40 (78%), Gaps = 0/40 (0%)
 Frame = +2

Query  824  DELEIVGRCLGKRGGYSGTSVLVRNKLTGELIAEGRHSLF  943
            DELEI  R LG+ GGY GT V  RNK TGE+IAEGRHSLF
Sbjct  50   DELEITSRVLGRAGGYCGTIVTFRNKSTGEIIAEGRHSLF  89



>ref|XP_009374287.1| PREDICTED: acyl-coenzyme A thioesterase 13-like isoform X1 [Pyrus 
x bretschneideri]
Length=160

 Score = 60.5 bits (145),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 29/40 (73%), Positives = 31/40 (78%), Gaps = 0/40 (0%)
 Frame = +2

Query  824  DELEIVGRCLGKRGGYSGTSVLVRNKLTGELIAEGRHSLF  943
            DELEI  R LG+ GGY GT V  RNK TGE+IAEGRHSLF
Sbjct  111  DELEITSRVLGRTGGYCGTMVTFRNKSTGEIIAEGRHSLF  150



>ref|XP_009374288.1| PREDICTED: acyl-coenzyme A thioesterase 13-like isoform X2 [Pyrus 
x bretschneideri]
Length=154

 Score = 60.5 bits (145),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 29/40 (73%), Positives = 31/40 (78%), Gaps = 0/40 (0%)
 Frame = +2

Query  824  DELEIVGRCLGKRGGYSGTSVLVRNKLTGELIAEGRHSLF  943
            DELEI  R LG+ GGY GT V  RNK TGE+IAEGRHSLF
Sbjct  105  DELEITSRVLGRTGGYCGTMVTFRNKSTGEIIAEGRHSLF  144



>ref|XP_004294275.1| PREDICTED: acyl-coenzyme A thioesterase 13-like [Fragaria vesca 
subsp. vesca]
Length=157

 Score = 60.5 bits (145),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 27/40 (68%), Positives = 33/40 (83%), Gaps = 0/40 (0%)
 Frame = +2

Query  824  DELEIVGRCLGKRGGYSGTSVLVRNKLTGELIAEGRHSLF  943
            DELEI  + LG+RG YSG  VL+RNK TGE++AEGRHS+F
Sbjct  112  DELEITSKRLGQRGSYSGVVVLLRNKATGEVVAEGRHSMF  151



>ref|XP_009346895.1| PREDICTED: acyl-coenzyme A thioesterase 13-like isoform X1 [Pyrus 
x bretschneideri]
Length=169

 Score = 60.5 bits (145),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 28/40 (70%), Positives = 34/40 (85%), Gaps = 0/40 (0%)
 Frame = +2

Query  824  DELEIVGRCLGKRGGYSGTSVLVRNKLTGELIAEGRHSLF  943
            DELEI  + LGKRGGY+GT V++RNK TGE+IAEGR S+F
Sbjct  122  DELEITSKRLGKRGGYTGTVVVLRNKTTGEIIAEGRLSMF  161



>ref|XP_009374290.1| PREDICTED: acyl-coenzyme A thioesterase 13-like isoform X2 [Pyrus 
x bretschneideri]
Length=154

 Score = 60.1 bits (144),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 29/40 (73%), Positives = 31/40 (78%), Gaps = 0/40 (0%)
 Frame = +2

Query  824  DELEIVGRCLGKRGGYSGTSVLVRNKLTGELIAEGRHSLF  943
            DELEI  R LG+ GGY GT V  RNK TGE+IAEGRHSLF
Sbjct  105  DELEITSRVLGRTGGYCGTIVTFRNKSTGEIIAEGRHSLF  144



>ref|XP_009337320.1| PREDICTED: acyl-coenzyme A thioesterase 13-like [Pyrus x bretschneideri]
Length=169

 Score = 60.1 bits (144),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 28/40 (70%), Positives = 34/40 (85%), Gaps = 0/40 (0%)
 Frame = +2

Query  824  DELEIVGRCLGKRGGYSGTSVLVRNKLTGELIAEGRHSLF  943
            DELEI  + LGKRGGY+GT V++RNK TGE+IAEGR S+F
Sbjct  122  DELEITSKRLGKRGGYTGTVVVLRNKTTGEIIAEGRLSMF  161



>ref|XP_009346896.1| PREDICTED: acyl-coenzyme A thioesterase 13-like isoform X2 [Pyrus 
x bretschneideri]
Length=163

 Score = 60.1 bits (144),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 28/40 (70%), Positives = 34/40 (85%), Gaps = 0/40 (0%)
 Frame = +2

Query  824  DELEIVGRCLGKRGGYSGTSVLVRNKLTGELIAEGRHSLF  943
            DELEI  + LGKRGGY+GT V++RNK TGE+IAEGR S+F
Sbjct  116  DELEITSKRLGKRGGYTGTVVVLRNKTTGEIIAEGRLSMF  155



>ref|XP_009374289.1| PREDICTED: acyl-coenzyme A thioesterase 13-like isoform X1 [Pyrus 
x bretschneideri]
Length=160

 Score = 60.1 bits (144),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 29/40 (73%), Positives = 31/40 (78%), Gaps = 0/40 (0%)
 Frame = +2

Query  824  DELEIVGRCLGKRGGYSGTSVLVRNKLTGELIAEGRHSLF  943
            DELEI  R LG+ GGY GT V  RNK TGE+IAEGRHSLF
Sbjct  111  DELEITSRVLGRTGGYCGTIVTFRNKSTGEIIAEGRHSLF  150



>ref|XP_004294281.1| PREDICTED: acyl-coenzyme A thioesterase 13-like [Fragaria vesca 
subsp. vesca]
Length=159

 Score = 60.1 bits (144),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 29/41 (71%), Positives = 33/41 (80%), Gaps = 0/41 (0%)
 Frame = +2

Query  821  QDELEIVGRCLGKRGGYSGTSVLVRNKLTGELIAEGRHSLF  943
             DELEI  + LG+RG Y GT VL+RNK TGE+IAEGRHSLF
Sbjct  111  NDELEITSKRLGQRGRYLGTMVLMRNKATGEIIAEGRHSLF  151



>ref|XP_008358976.1| PREDICTED: acyl-coenzyme A thioesterase 13-like [Malus domestica]
Length=168

 Score = 59.7 bits (143),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 27/41 (66%), Positives = 34/41 (83%), Gaps = 0/41 (0%)
 Frame = +2

Query  821  QDELEIVGRCLGKRGGYSGTSVLVRNKLTGELIAEGRHSLF  943
             DELEI  + +G+RGGY+GT V++RNK TGE+IAEGRHSL 
Sbjct  120  NDELEITSKRIGRRGGYTGTVVVLRNKTTGEIIAEGRHSLL  160



>ref|XP_008464061.1| PREDICTED: acyl-coenzyme A thioesterase 13 [Cucumis melo]
Length=195

 Score = 60.1 bits (144),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 26/41 (63%), Positives = 34/41 (83%), Gaps = 0/41 (0%)
 Frame = +2

Query  824  DELEIVGRCLGKRGGYSGTSVLVRNKLTGELIAEGRHSLFG  946
            DELEIV + LG++G YSGT V+++NK  GE++AEGRHSLF 
Sbjct  145  DELEIVSKLLGQKGRYSGTRVVIKNKRNGEIVAEGRHSLFS  185



>ref|XP_004980094.1| PREDICTED: acyl-coenzyme A thioesterase 13-like [Setaria italica]
Length=171

 Score = 59.7 bits (143),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 27/42 (64%), Positives = 31/42 (74%), Gaps = 0/42 (0%)
 Frame = +2

Query  824  DELEIVGRCLGKRGGYSGTSVLVRNKLTGELIAEGRHSLFGR  949
            D L I  R LG RG YSGT VLV N  TG+++AEGRHSLFG+
Sbjct  123  DTLRIAARALGHRGAYSGTHVLVANAATGQVVAEGRHSLFGK  164



>ref|XP_008220351.1| PREDICTED: acyl-coenzyme A thioesterase 13-like [Prunus mume]
Length=159

 Score = 59.3 bits (142),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 28/44 (64%), Positives = 32/44 (73%), Gaps = 0/44 (0%)
 Frame = +2

Query  824  DELEIVGRCLGKRGGYSGTSVLVRNKLTGELIAEGRHSLFGRHH  955
            DELEI  R LG+ G YSGT V++RNK TGE+IAEGR S F  H 
Sbjct  112  DELEITSRLLGRIGRYSGTIVILRNKTTGEIIAEGRQSFFSSHP  155



>ref|XP_009624835.1| PREDICTED: uncharacterized protein LOC104115821 isoform X1 [Nicotiana 
tomentosiformis]
Length=861

 Score = 62.4 bits (150),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 26/46 (57%), Positives = 38/46 (83%), Gaps = 2/46 (4%)
 Frame = +3

Query  1008  NISTRDALSDLHGVSLAPSSLLGMATFIPPGQIAALHPFLMHQ*GV  1145
             N+ST+     +HG+++AP+SLLGM T++PPGQI ALHP++MHQ G+
Sbjct  364   NVSTQS--DQVHGMAVAPTSLLGMTTYLPPGQITALHPYVMHQQGI  407



>ref|XP_009768691.1| PREDICTED: uncharacterized protein LOC104219681 isoform X4 [Nicotiana 
sylvestris]
Length=849

 Score = 62.0 bits (149),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 26/46 (57%), Positives = 38/46 (83%), Gaps = 2/46 (4%)
 Frame = +3

Query  1008  NISTRDALSDLHGVSLAPSSLLGMATFIPPGQIAALHPFLMHQ*GV  1145
             N+ST+     +HG+++AP+SLLGM T++PPGQI ALHP++MHQ G+
Sbjct  347   NVSTQS--DQVHGMAVAPTSLLGMTTYLPPGQITALHPYVMHQQGI  390



>ref|XP_009624837.1| PREDICTED: uncharacterized protein LOC104115821 isoform X3 [Nicotiana 
tomentosiformis]
Length=858

 Score = 62.0 bits (149),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 26/46 (57%), Positives = 38/46 (83%), Gaps = 2/46 (4%)
 Frame = +3

Query  1008  NISTRDALSDLHGVSLAPSSLLGMATFIPPGQIAALHPFLMHQ*GV  1145
             N+ST+     +HG+++AP+SLLGM T++PPGQI ALHP++MHQ G+
Sbjct  364   NVSTQS--DQVHGMAVAPTSLLGMTTYLPPGQITALHPYVMHQQGI  407



>ref|XP_009624836.1| PREDICTED: uncharacterized protein LOC104115821 isoform X2 [Nicotiana 
tomentosiformis]
Length=859

 Score = 62.0 bits (149),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 26/46 (57%), Positives = 38/46 (83%), Gaps = 2/46 (4%)
 Frame = +3

Query  1008  NISTRDALSDLHGVSLAPSSLLGMATFIPPGQIAALHPFLMHQ*GV  1145
             N+ST+     +HG+++AP+SLLGM T++PPGQI ALHP++MHQ G+
Sbjct  362   NVSTQS--DQVHGMAVAPTSLLGMTTYLPPGQITALHPYVMHQQGI  405



>ref|XP_009624840.1| PREDICTED: uncharacterized protein LOC104115821 isoform X5 [Nicotiana 
tomentosiformis]
Length=842

 Score = 62.0 bits (149),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 26/46 (57%), Positives = 38/46 (83%), Gaps = 2/46 (4%)
 Frame = +3

Query  1008  NISTRDALSDLHGVSLAPSSLLGMATFIPPGQIAALHPFLMHQ*GV  1145
             N+ST+     +HG+++AP+SLLGM T++PPGQI ALHP++MHQ G+
Sbjct  345   NVSTQS--DQVHGMAVAPTSLLGMTTYLPPGQITALHPYVMHQQGI  388



>ref|XP_009624838.1| PREDICTED: uncharacterized protein LOC104115821 isoform X4 [Nicotiana 
tomentosiformis]
Length=844

 Score = 62.0 bits (149),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 26/46 (57%), Positives = 38/46 (83%), Gaps = 2/46 (4%)
 Frame = +3

Query  1008  NISTRDALSDLHGVSLAPSSLLGMATFIPPGQIAALHPFLMHQ*GV  1145
             N+ST+     +HG+++AP+SLLGM T++PPGQI ALHP++MHQ G+
Sbjct  347   NVSTQS--DQVHGMAVAPTSLLGMTTYLPPGQITALHPYVMHQQGI  390



>ref|XP_009768690.1| PREDICTED: uncharacterized protein LOC104219681 isoform X3 [Nicotiana 
sylvestris]
Length=863

 Score = 62.0 bits (149),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 26/46 (57%), Positives = 38/46 (83%), Gaps = 2/46 (4%)
 Frame = +3

Query  1008  NISTRDALSDLHGVSLAPSSLLGMATFIPPGQIAALHPFLMHQ*GV  1145
             N+ST+     +HG+++AP+SLLGM T++PPGQI ALHP++MHQ G+
Sbjct  364   NVSTQS--DQVHGMAVAPTSLLGMTTYLPPGQITALHPYVMHQQGI  407



>ref|XP_009768688.1| PREDICTED: uncharacterized protein LOC104219681 isoform X1 [Nicotiana 
sylvestris]
Length=866

 Score = 62.0 bits (149),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 26/46 (57%), Positives = 38/46 (83%), Gaps = 2/46 (4%)
 Frame = +3

Query  1008  NISTRDALSDLHGVSLAPSSLLGMATFIPPGQIAALHPFLMHQ*GV  1145
             N+ST+     +HG+++AP+SLLGM T++PPGQI ALHP++MHQ G+
Sbjct  364   NVSTQS--DQVHGMAVAPTSLLGMTTYLPPGQITALHPYVMHQQGI  407



>ref|XP_009768692.1| PREDICTED: uncharacterized protein LOC104219681 isoform X5 [Nicotiana 
sylvestris]
Length=847

 Score = 62.0 bits (149),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 26/46 (57%), Positives = 38/46 (83%), Gaps = 2/46 (4%)
 Frame = +3

Query  1008  NISTRDALSDLHGVSLAPSSLLGMATFIPPGQIAALHPFLMHQ*GV  1145
             N+ST+     +HG+++AP+SLLGM T++PPGQI ALHP++MHQ G+
Sbjct  345   NVSTQS--DQVHGMAVAPTSLLGMTTYLPPGQITALHPYVMHQQGI  388



>ref|XP_009768689.1| PREDICTED: uncharacterized protein LOC104219681 isoform X2 [Nicotiana 
sylvestris]
Length=864

 Score = 62.0 bits (149),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 26/46 (57%), Positives = 38/46 (83%), Gaps = 2/46 (4%)
 Frame = +3

Query  1008  NISTRDALSDLHGVSLAPSSLLGMATFIPPGQIAALHPFLMHQ*GV  1145
             N+ST+     +HG+++AP+SLLGM T++PPGQI ALHP++MHQ G+
Sbjct  362   NVSTQS--DQVHGMAVAPTSLLGMTTYLPPGQITALHPYVMHQQGI  405



>ref|XP_006347496.1| PREDICTED: uncharacterized protein LOC102581741 isoform X5 [Solanum 
tuberosum]
Length=855

 Score = 62.0 bits (149),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 25/36 (69%), Positives = 33/36 (92%), Gaps = 0/36 (0%)
 Frame = +3

Query  1038  LHGVSLAPSSLLGMATFIPPGQIAALHPFLMHQ*GV  1145
             +HG+ +APSSLLGM T++PPGQIAALHP++MHQ G+
Sbjct  372   VHGMPVAPSSLLGMTTYLPPGQIAALHPYVMHQQGI  407



>ref|XP_006347492.1| PREDICTED: uncharacterized protein LOC102581741 isoform X1 [Solanum 
tuberosum]
 ref|XP_006347493.1| PREDICTED: uncharacterized protein LOC102581741 isoform X2 [Solanum 
tuberosum]
 ref|XP_006347494.1| PREDICTED: uncharacterized protein LOC102581741 isoform X3 [Solanum 
tuberosum]
 ref|XP_006347495.1| PREDICTED: uncharacterized protein LOC102581741 isoform X4 [Solanum 
tuberosum]
Length=857

 Score = 62.0 bits (149),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 25/36 (69%), Positives = 33/36 (92%), Gaps = 0/36 (0%)
 Frame = +3

Query  1038  LHGVSLAPSSLLGMATFIPPGQIAALHPFLMHQ*GV  1145
             +HG+ +APSSLLGM T++PPGQIAALHP++MHQ G+
Sbjct  374   VHGMPVAPSSLLGMTTYLPPGQIAALHPYVMHQQGI  409



>gb|AEP25854.1| putative acyl-CoA thioesterase [Cucumis sativus]
Length=148

 Score = 58.5 bits (140),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 26/39 (67%), Positives = 34/39 (87%), Gaps = 0/39 (0%)
 Frame = +2

Query  824  DELEIVGRCLGKRGGYSGTSVLVRNKLTGELIAEGRHSL  940
            DELEIV + LG++G YSGTSV+++NK  GE++AEGRHSL
Sbjct  110  DELEIVSKLLGQKGRYSGTSVVIKNKRNGEIVAEGRHSL  148



>ref|XP_002451332.1| hypothetical protein SORBIDRAFT_05g027920 [Sorghum bicolor]
 gb|EES10320.1| hypothetical protein SORBIDRAFT_05g027920 [Sorghum bicolor]
Length=178

 Score = 58.9 bits (141),  Expect = 8e-07, Method: Compositional matrix adjust.
 Identities = 26/42 (62%), Positives = 31/42 (74%), Gaps = 0/42 (0%)
 Frame = +2

Query  824  DELEIVGRCLGKRGGYSGTSVLVRNKLTGELIAEGRHSLFGR  949
            D L I  R LG +G YSGT VLV N  TG+++AEGRHSLFG+
Sbjct  130  DALRITARALGHKGAYSGTHVLVANAATGQVVAEGRHSLFGK  171



>gb|ADE77923.1| unknown [Picea sitchensis]
Length=59

 Score = 56.6 bits (135),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 26/43 (60%), Positives = 33/43 (77%), Gaps = 0/43 (0%)
 Frame = +2

Query  821  QDELEIVGRCLGKRGGYSGTSVLVRNKLTGELIAEGRHSLFGR  949
             DE+EI  R LG +GG+S T V +RNK TG+L+AEGRHSL+ R
Sbjct  12   NDEIEINARVLGHKGGFSMTHVKLRNKATGKLVAEGRHSLYSR  54



>ref|XP_008373325.1| PREDICTED: acyl-coenzyme A thioesterase 13-like [Malus domestica]
Length=169

 Score = 58.2 bits (139),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 27/40 (68%), Positives = 33/40 (83%), Gaps = 0/40 (0%)
 Frame = +2

Query  824  DELEIVGRCLGKRGGYSGTSVLVRNKLTGELIAEGRHSLF  943
            DELEI  + LG RGGY+GT V++RNK TGE+IAEGR S+F
Sbjct  122  DELEITSKRLGNRGGYTGTVVVLRNKTTGEIIAEGRLSMF  161



>ref|XP_008364467.1| PREDICTED: uncharacterized protein LOC103428147 [Malus domestica]
Length=229

 Score = 58.9 bits (141),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 28/41 (68%), Positives = 33/41 (80%), Gaps = 0/41 (0%)
 Frame = +2

Query  821  QDELEIVGRCLGKRGGYSGTSVLVRNKLTGELIAEGRHSLF  943
             DELEI  + LG+RG Y GT VL+RNK +GE+IAEGRHSLF
Sbjct  181  NDELEITSKRLGQRGRYYGTYVLLRNKASGEIIAEGRHSLF  221



>gb|ACG31399.1| thioesterase family protein [Zea mays]
Length=169

 Score = 58.2 bits (139),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 25/42 (60%), Positives = 31/42 (74%), Gaps = 0/42 (0%)
 Frame = +2

Query  824  DELEIVGRCLGKRGGYSGTSVLVRNKLTGELIAEGRHSLFGR  949
            D L I  R LG +G YSGT V+V N  TG+++AEGRHSLFG+
Sbjct  121  DALRITARALGHKGAYSGTHVIVANAATGQVVAEGRHSLFGK  162



>ref|NP_001046977.1| Os02g0521700 [Oryza sativa Japonica Group]
 dbj|BAD26141.1| unknown protein [Oryza sativa Japonica Group]
 dbj|BAF08891.1| Os02g0521700 [Oryza sativa Japonica Group]
 gb|EAY86075.1| hypothetical protein OsI_07443 [Oryza sativa Indica Group]
 gb|EAZ23252.1| hypothetical protein OsJ_06944 [Oryza sativa Japonica Group]
 dbj|BAG88533.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG91010.1| unnamed protein product [Oryza sativa Japonica Group]
Length=182

 Score = 58.2 bits (139),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 26/42 (62%), Positives = 30/42 (71%), Gaps = 0/42 (0%)
 Frame = +2

Query  824  DELEIVGRCLGKRGGYSGTSVLVRNKLTGELIAEGRHSLFGR  949
            D L I  R LG +G YS T VL+ N  TGE++AEGRHSLFGR
Sbjct  126  DRLRITARALGHKGAYSATHVLISNAATGEVVAEGRHSLFGR  167



>ref|XP_009337381.1| PREDICTED: acyl-coenzyme A thioesterase 13-like [Pyrus x bretschneideri]
Length=192

 Score = 58.2 bits (139),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 27/41 (66%), Positives = 33/41 (80%), Gaps = 0/41 (0%)
 Frame = +2

Query  821  QDELEIVGRCLGKRGGYSGTSVLVRNKLTGELIAEGRHSLF  943
             DELEI  + +G+RGGY GT V++RNK TGE+IAEGRHSL 
Sbjct  144  NDELEITSKRIGRRGGYKGTVVVLRNKTTGEIIAEGRHSLL  184



>ref|XP_006647247.1| PREDICTED: acyl-coenzyme A thioesterase 13-like [Oryza brachyantha]
Length=192

 Score = 58.2 bits (139),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 25/42 (60%), Positives = 31/42 (74%), Gaps = 0/42 (0%)
 Frame = +2

Query  824  DELEIVGRCLGKRGGYSGTSVLVRNKLTGELIAEGRHSLFGR  949
            D L +  R LG +G YSGT VL+ N  TGE++AEGRHSLFG+
Sbjct  135  DRLRVTARALGHKGAYSGTHVLISNAATGEVVAEGRHSLFGK  176



>ref|XP_008373323.1| PREDICTED: acyl-coenzyme A thioesterase 13-like [Malus domestica]
Length=168

 Score = 57.8 bits (138),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 26/40 (65%), Positives = 33/40 (83%), Gaps = 0/40 (0%)
 Frame = +2

Query  824  DELEIVGRCLGKRGGYSGTSVLVRNKLTGELIAEGRHSLF  943
            DELEI  + LG+RGGY+GT +++RNK  GE+IAEGRHSL 
Sbjct  121  DELEITSKRLGRRGGYTGTVIVLRNKXAGEIIAEGRHSLL  160



>ref|XP_010318055.1| PREDICTED: uncharacterized protein LOC101246515 isoform X4 [Solanum 
lycopersicum]
Length=854

 Score = 60.8 bits (146),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 24/36 (67%), Positives = 33/36 (92%), Gaps = 0/36 (0%)
 Frame = +3

Query  1038  LHGVSLAPSSLLGMATFIPPGQIAALHPFLMHQ*GV  1145
             +HG+ +APSS+LGM T++PPGQIAALHP++MHQ G+
Sbjct  374   VHGMPVAPSSVLGMTTYLPPGQIAALHPYVMHQQGI  409



>ref|XP_010318054.1| PREDICTED: uncharacterized protein LOC101246515 isoform X3 [Solanum 
lycopersicum]
Length=855

 Score = 60.8 bits (146),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 24/36 (67%), Positives = 33/36 (92%), Gaps = 0/36 (0%)
 Frame = +3

Query  1038  LHGVSLAPSSLLGMATFIPPGQIAALHPFLMHQ*GV  1145
             +HG+ +APSS+LGM T++PPGQIAALHP++MHQ G+
Sbjct  372   VHGMPVAPSSVLGMTTYLPPGQIAALHPYVMHQQGI  407



>ref|XP_004235011.1| PREDICTED: uncharacterized protein LOC101246515 isoform X1 [Solanum 
lycopersicum]
 ref|XP_010318052.1| PREDICTED: uncharacterized protein LOC101246515 isoform X1 [Solanum 
lycopersicum]
 ref|XP_010318053.1| PREDICTED: uncharacterized protein LOC101246515 isoform X2 [Solanum 
lycopersicum]
Length=857

 Score = 60.8 bits (146),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 24/36 (67%), Positives = 33/36 (92%), Gaps = 0/36 (0%)
 Frame = +3

Query  1038  LHGVSLAPSSLLGMATFIPPGQIAALHPFLMHQ*GV  1145
             +HG+ +APSS+LGM T++PPGQIAALHP++MHQ G+
Sbjct  374   VHGMPVAPSSVLGMTTYLPPGQIAALHPYVMHQQGI  409



>ref|XP_004294278.1| PREDICTED: acyl-coenzyme A thioesterase 13-like [Fragaria vesca 
subsp. vesca]
Length=160

 Score = 57.4 bits (137),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 26/40 (65%), Positives = 31/40 (78%), Gaps = 0/40 (0%)
 Frame = +2

Query  824  DELEIVGRCLGKRGGYSGTSVLVRNKLTGELIAEGRHSLF  943
            DELEI  R LG+RG YS   V ++NK TGE+IAEGRHS+F
Sbjct  113  DELEITSRWLGQRGRYSAILVCLKNKATGEIIAEGRHSMF  152



>ref|XP_008343809.1| PREDICTED: uncharacterized protein LOC103406597 isoform X3 [Malus 
domestica]
Length=845

 Score = 60.5 bits (145),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 25/34 (74%), Positives = 31/34 (91%), Gaps = 0/34 (0%)
 Frame = +3

Query  1044  GVSLAPSSLLGMATFIPPGQIAALHPFLMHQ*GV  1145
             GVS++PSSLLGM +++PPGQ+ ALHPFLMHQ GV
Sbjct  370   GVSISPSSLLGMPSYLPPGQVTALHPFLMHQQGV  403



>ref|XP_008381459.1| PREDICTED: uncharacterized protein LOC103444284 isoform X3 [Malus 
domestica]
Length=845

 Score = 60.5 bits (145),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 25/34 (74%), Positives = 31/34 (91%), Gaps = 0/34 (0%)
 Frame = +3

Query  1044  GVSLAPSSLLGMATFIPPGQIAALHPFLMHQ*GV  1145
             GVS++PSSLLGM +++PPGQ+ ALHPFLMHQ GV
Sbjct  370   GVSISPSSLLGMPSYLPPGQVTALHPFLMHQQGV  403



>ref|XP_008343808.1| PREDICTED: uncharacterized protein LOC103406597 isoform X2 [Malus 
domestica]
Length=846

 Score = 60.5 bits (145),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 25/34 (74%), Positives = 31/34 (91%), Gaps = 0/34 (0%)
 Frame = +3

Query  1044  GVSLAPSSLLGMATFIPPGQIAALHPFLMHQ*GV  1145
             GVS++PSSLLGM +++PPGQ+ ALHPFLMHQ GV
Sbjct  371   GVSISPSSLLGMPSYLPPGQVTALHPFLMHQQGV  404



>ref|XP_008343807.1| PREDICTED: uncharacterized protein LOC103406597 isoform X1 [Malus 
domestica]
Length=847

 Score = 60.5 bits (145),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 25/34 (74%), Positives = 31/34 (91%), Gaps = 0/34 (0%)
 Frame = +3

Query  1044  GVSLAPSSLLGMATFIPPGQIAALHPFLMHQ*GV  1145
             GVS++PSSLLGM +++PPGQ+ ALHPFLMHQ GV
Sbjct  372   GVSISPSSLLGMPSYLPPGQVTALHPFLMHQQGV  405



>ref|XP_008381442.1| PREDICTED: uncharacterized protein LOC103444284 isoform X1 [Malus 
domestica]
Length=847

 Score = 60.5 bits (145),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 25/34 (74%), Positives = 31/34 (91%), Gaps = 0/34 (0%)
 Frame = +3

Query  1044  GVSLAPSSLLGMATFIPPGQIAALHPFLMHQ*GV  1145
             GVS++PSSLLGM +++PPGQ+ ALHPFLMHQ GV
Sbjct  372   GVSISPSSLLGMPSYLPPGQVTALHPFLMHQQGV  405



>ref|XP_008381451.1| PREDICTED: uncharacterized protein LOC103444284 isoform X2 [Malus 
domestica]
Length=846

 Score = 60.5 bits (145),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 25/34 (74%), Positives = 31/34 (91%), Gaps = 0/34 (0%)
 Frame = +3

Query  1044  GVSLAPSSLLGMATFIPPGQIAALHPFLMHQ*GV  1145
             GVS++PSSLLGM +++PPGQ+ ALHPFLMHQ GV
Sbjct  371   GVSISPSSLLGMPSYLPPGQVTALHPFLMHQQGV  404



>ref|XP_008347262.1| PREDICTED: LOW QUALITY PROTEIN: uncharacterized protein LOC103410322 
[Malus domestica]
Length=750

 Score = 60.1 bits (144),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 25/34 (74%), Positives = 31/34 (91%), Gaps = 0/34 (0%)
 Frame = +3

Query  1044  GVSLAPSSLLGMATFIPPGQIAALHPFLMHQ*GV  1145
             GVS++PSSLLGM +++PPGQ+ ALHPFLMHQ GV
Sbjct  275   GVSISPSSLLGMPSYLPPGQVTALHPFLMHQQGV  308



>ref|XP_004294282.1| PREDICTED: acyl-coenzyme A thioesterase 13-like [Fragaria vesca 
subsp. vesca]
Length=159

 Score = 57.0 bits (136),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 25/40 (63%), Positives = 34/40 (85%), Gaps = 0/40 (0%)
 Frame = +2

Query  824  DELEIVGRCLGKRGGYSGTSVLVRNKLTGELIAEGRHSLF  943
            DE+EI  + LG++GGY+G  VL+RNK TG++IAEGRHS+F
Sbjct  112  DEVEITSKRLGQKGGYTGILVLLRNKATGDVIAEGRHSMF  151



>ref|XP_010685625.1| PREDICTED: putative esterase C31F10.02 [Beta vulgaris subsp. 
vulgaris]
Length=158

 Score = 57.0 bits (136),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 25/46 (54%), Positives = 33/46 (72%), Gaps = 0/46 (0%)
 Frame = +2

Query  824  DELEIVGRCLGKRGGYSGTSVLVRNKLTGELIAEGRHSLFGRHHDQ  961
            DELE+  R LGK G  SGTSV+++ K + E++AEGRHSLF R   +
Sbjct  112  DELEVTSRLLGKIGAVSGTSVIIKKKASEEIVAEGRHSLFSRPKSK  157



>ref|XP_002519597.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF42783.1| conserved hypothetical protein [Ricinus communis]
Length=772

 Score = 59.7 bits (143),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 25/34 (74%), Positives = 31/34 (91%), Gaps = 0/34 (0%)
 Frame = +3

Query  1044  GVSLAPSSLLGMATFIPPGQIAALHPFLMHQ*GV  1145
             GV +APSSLLGM T++PPGQ+AALHPFL+HQ G+
Sbjct  367   GVPIAPSSLLGMPTYLPPGQVAALHPFLLHQQGI  400



>ref|NP_001105680.1| thioesterase family protein [Zea mays]
 gb|AAT67463.1| thioesterase family protein [Zea mays]
Length=169

 Score = 56.2 bits (134),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 25/42 (60%), Positives = 30/42 (71%), Gaps = 0/42 (0%)
 Frame = +2

Query  824  DELEIVGRCLGKRGGYSGTSVLVRNKLTGELIAEGRHSLFGR  949
            D L I  R LG +G YSGT V+V N  TG ++AEGRHSLFG+
Sbjct  121  DALRITARALGHKGAYSGTHVIVANAATGLVVAEGRHSLFGK  162



>gb|AFW60053.1| thioesterase family protein [Zea mays]
Length=169

 Score = 56.2 bits (134),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 25/42 (60%), Positives = 30/42 (71%), Gaps = 0/42 (0%)
 Frame = +2

Query  824  DELEIVGRCLGKRGGYSGTSVLVRNKLTGELIAEGRHSLFGR  949
            D L I  R LG +G YSGT V+V N  TG ++AEGRHSLFG+
Sbjct  121  DALRITARALGHKGAYSGTHVIVANAATGLVVAEGRHSLFGK  162



>ref|XP_004295735.1| PREDICTED: acyl-coenzyme A thioesterase 13-like [Fragaria vesca 
subsp. vesca]
Length=165

 Score = 56.2 bits (134),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 26/48 (54%), Positives = 33/48 (69%), Gaps = 0/48 (0%)
 Frame = +2

Query  824  DELEIVGRCLGKRGGYSGTSVLVRNKLTGELIAEGRHSLFGRHHDQDI  967
            DELEI  + LG++G Y    VL+RNK TGE+IAEGRHS+F   H   +
Sbjct  118  DELEITSKRLGQKGAYYRVIVLLRNKATGEIIAEGRHSMFRPQHTPKL  165



>gb|EMS54815.1| hypothetical protein TRIUR3_19304 [Triticum urartu]
Length=186

 Score = 56.2 bits (134),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 25/56 (45%), Positives = 33/56 (59%), Gaps = 0/56 (0%)
 Frame = +2

Query  824  DELEIVGRCLGKRGGYSGTSVLVRNKLTGELIAEGRHSLFGRHHDQDIREVPEVQL  991
            D L I  R LG +G YSGT VL+ N +TG ++AEGRHS+FG      ++      L
Sbjct  127  DRLSITARVLGHKGAYSGTHVLLTNAVTGNVVAEGRHSVFGNLKKAPLKPAATTSL  182



>ref|XP_007206721.1| hypothetical protein PRUPE_ppa024575mg [Prunus persica]
 gb|EMJ07920.1| hypothetical protein PRUPE_ppa024575mg [Prunus persica]
Length=98

 Score = 55.1 bits (131),  Expect = 6e-06, Method: Composition-based stats.
 Identities = 27/41 (66%), Positives = 30/41 (73%), Gaps = 0/41 (0%)
 Frame = +2

Query  821  QDELEIVGRCLGKRGGYSGTSVLVRNKLTGELIAEGRHSLF  943
             DELEI  R LG+ G YSGT V++RNK TGE IAEGR S F
Sbjct  50   HDELEITSRLLGRIGRYSGTIVILRNKTTGETIAEGRQSFF  90



>ref|XP_011084747.1| PREDICTED: uncharacterized protein LOC105166925 [Sesamum indicum]
Length=726

 Score = 58.5 bits (140),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 26/36 (72%), Positives = 32/36 (89%), Gaps = 1/36 (3%)
 Frame = +3

Query  1038  LHGVSLAPSSLLGMATFIPPGQIAALHPFLMHQ*GV  1145
             +HGV+ APS LLGM T+IPPGQ+AALHPF+MHQ G+
Sbjct  380   VHGVAFAPS-LLGMPTYIPPGQVAALHPFVMHQQGL  414



>ref|XP_009337319.1| PREDICTED: acyl-coenzyme A thioesterase 13-like [Pyrus x bretschneideri]
Length=168

 Score = 55.5 bits (132),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 25/40 (63%), Positives = 32/40 (80%), Gaps = 0/40 (0%)
 Frame = +2

Query  824  DELEIVGRCLGKRGGYSGTSVLVRNKLTGELIAEGRHSLF  943
            DELEI  + LG+RGGY+G  +++RNK TGE+ AEGRHSL 
Sbjct  121  DELEITSKRLGRRGGYTGIVIVLRNKTTGEITAEGRHSLL  160



>ref|XP_009361298.1| PREDICTED: uncharacterized protein LOC103951599 isoform X3 [Pyrus 
x bretschneideri]
Length=670

 Score = 58.5 bits (140),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 24/34 (71%), Positives = 30/34 (88%), Gaps = 0/34 (0%)
 Frame = +3

Query  1044  GVSLAPSSLLGMATFIPPGQIAALHPFLMHQ*GV  1145
             GV ++PSSLLGM +++PPGQ+ ALHPFLMHQ GV
Sbjct  372   GVPISPSSLLGMPSYLPPGQVTALHPFLMHQQGV  405



>dbj|BAJ94865.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=183

 Score = 55.5 bits (132),  Expect = 9e-06, Method: Compositional matrix adjust.
 Identities = 25/41 (61%), Positives = 28/41 (68%), Gaps = 0/41 (0%)
 Frame = +2

Query  824  DELEIVGRCLGKRGGYSGTSVLVRNKLTGELIAEGRHSLFG  946
            D L I  R LG +G YSGT VL  N  TG ++AEGRHSLFG
Sbjct  125  DRLSITARALGHKGAYSGTHVLFTNAATGNVVAEGRHSLFG  165



>gb|EMT26876.1| hypothetical protein F775_26175 [Aegilops tauschii]
Length=186

 Score = 55.5 bits (132),  Expect = 9e-06, Method: Compositional matrix adjust.
 Identities = 25/41 (61%), Positives = 28/41 (68%), Gaps = 0/41 (0%)
 Frame = +2

Query  824  DELEIVGRCLGKRGGYSGTSVLVRNKLTGELIAEGRHSLFG  946
            D L I  R LG +G YSGT VL  N  TG ++AEGRHSLFG
Sbjct  127  DRLSITARALGHKGAYSGTHVLFTNACTGNVVAEGRHSLFG  167



>ref|XP_011044713.1| PREDICTED: uncharacterized protein LOC105139805 isoform X1 [Populus 
euphratica]
 ref|XP_011044714.1| PREDICTED: uncharacterized protein LOC105139805 isoform X1 [Populus 
euphratica]
Length=821

 Score = 58.2 bits (139),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 23/34 (68%), Positives = 31/34 (91%), Gaps = 0/34 (0%)
 Frame = +3

Query  1044  GVSLAPSSLLGMATFIPPGQIAALHPFLMHQ*GV  1145
             GV +AP+SLLGM T++PPGQ+AALHPF++HQ G+
Sbjct  374   GVPMAPTSLLGMPTYLPPGQVAALHPFILHQQGI  407



>ref|XP_011044715.1| PREDICTED: uncharacterized protein LOC105139805 isoform X2 [Populus 
euphratica]
Length=819

 Score = 58.2 bits (139),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 23/34 (68%), Positives = 31/34 (91%), Gaps = 0/34 (0%)
 Frame = +3

Query  1044  GVSLAPSSLLGMATFIPPGQIAALHPFLMHQ*GV  1145
             GV +AP+SLLGM T++PPGQ+AALHPF++HQ G+
Sbjct  372   GVPMAPTSLLGMPTYLPPGQVAALHPFILHQQGI  405



>ref|XP_009361296.1| PREDICTED: uncharacterized protein LOC103951599 isoform X1 [Pyrus 
x bretschneideri]
Length=846

 Score = 58.2 bits (139),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 24/34 (71%), Positives = 30/34 (88%), Gaps = 0/34 (0%)
 Frame = +3

Query  1044  GVSLAPSSLLGMATFIPPGQIAALHPFLMHQ*GV  1145
             GV ++PSSLLGM +++PPGQ+ ALHPFLMHQ GV
Sbjct  372   GVPISPSSLLGMPSYLPPGQVTALHPFLMHQQGV  405



>ref|XP_009361297.1| PREDICTED: uncharacterized protein LOC103951599 isoform X2 [Pyrus 
x bretschneideri]
Length=844

 Score = 58.2 bits (139),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 24/34 (71%), Positives = 30/34 (88%), Gaps = 0/34 (0%)
 Frame = +3

Query  1044  GVSLAPSSLLGMATFIPPGQIAALHPFLMHQ*GV  1145
             GV ++PSSLLGM +++PPGQ+ ALHPFLMHQ GV
Sbjct  370   GVPISPSSLLGMPSYLPPGQVTALHPFLMHQQGV  403



>ref|XP_008234670.1| PREDICTED: uncharacterized protein LOC103333581 isoform X8 [Prunus 
mume]
Length=856

 Score = 58.2 bits (139),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 24/34 (71%), Positives = 30/34 (88%), Gaps = 0/34 (0%)
 Frame = +3

Query  1044  GVSLAPSSLLGMATFIPPGQIAALHPFLMHQ*GV  1145
             GV ++PSSLLGM +++PPGQ+ ALHPFLMHQ GV
Sbjct  372   GVPISPSSLLGMPSYLPPGQVTALHPFLMHQQGV  405



>ref|XP_008376808.1| PREDICTED: kinesin-related protein 8 isoform X2 [Malus domestica]
Length=843

 Score = 58.2 bits (139),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 24/34 (71%), Positives = 30/34 (88%), Gaps = 0/34 (0%)
 Frame = +3

Query  1044  GVSLAPSSLLGMATFIPPGQIAALHPFLMHQ*GV  1145
             GV ++PSSLLGM +++PPGQ+ ALHPFLMHQ GV
Sbjct  370   GVPISPSSLLGMPSYLPPGQVTALHPFLMHQQGV  403



>ref|XP_008234665.1| PREDICTED: probable GPI-anchored adhesin-like protein PGA55 isoform 
X3 [Prunus mume]
Length=858

 Score = 58.2 bits (139),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 24/34 (71%), Positives = 30/34 (88%), Gaps = 0/34 (0%)
 Frame = +3

Query  1044  GVSLAPSSLLGMATFIPPGQIAALHPFLMHQ*GV  1145
             GV ++PSSLLGM +++PPGQ+ ALHPFLMHQ GV
Sbjct  371   GVPISPSSLLGMPSYLPPGQVTALHPFLMHQQGV  404



>ref|XP_008234662.1| PREDICTED: probable GPI-anchored adhesin-like protein PGA55 isoform 
X1 [Prunus mume]
 ref|XP_008234663.1| PREDICTED: probable GPI-anchored adhesin-like protein PGA55 isoform 
X2 [Prunus mume]
Length=859

 Score = 58.2 bits (139),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 24/34 (71%), Positives = 30/34 (88%), Gaps = 0/34 (0%)
 Frame = +3

Query  1044  GVSLAPSSLLGMATFIPPGQIAALHPFLMHQ*GV  1145
             GV ++PSSLLGM +++PPGQ+ ALHPFLMHQ GV
Sbjct  372   GVPISPSSLLGMPSYLPPGQVTALHPFLMHQQGV  405



>ref|XP_008376807.1| PREDICTED: kinesin-related protein 8 isoform X1 [Malus domestica]
Length=845

 Score = 58.2 bits (139),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 24/34 (71%), Positives = 30/34 (88%), Gaps = 0/34 (0%)
 Frame = +3

Query  1044  GVSLAPSSLLGMATFIPPGQIAALHPFLMHQ*GV  1145
             GV ++PSSLLGM +++PPGQ+ ALHPFLMHQ GV
Sbjct  372   GVPISPSSLLGMPSYLPPGQVTALHPFLMHQQGV  405



>ref|XP_008234669.1| PREDICTED: probable GPI-anchored adhesin-like protein PGA55 isoform 
X7 [Prunus mume]
Length=856

 Score = 58.2 bits (139),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 24/34 (71%), Positives = 30/34 (88%), Gaps = 0/34 (0%)
 Frame = +3

Query  1044  GVSLAPSSLLGMATFIPPGQIAALHPFLMHQ*GV  1145
             GV ++PSSLLGM +++PPGQ+ ALHPFLMHQ GV
Sbjct  369   GVPISPSSLLGMPSYLPPGQVTALHPFLMHQQGV  402



>ref|XP_008234666.1| PREDICTED: probable GPI-anchored adhesin-like protein PGA55 isoform 
X4 [Prunus mume]
 ref|XP_008234667.1| PREDICTED: probable GPI-anchored adhesin-like protein PGA55 isoform 
X5 [Prunus mume]
Length=857

 Score = 58.2 bits (139),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 24/34 (71%), Positives = 30/34 (88%), Gaps = 0/34 (0%)
 Frame = +3

Query  1044  GVSLAPSSLLGMATFIPPGQIAALHPFLMHQ*GV  1145
             GV ++PSSLLGM +++PPGQ+ ALHPFLMHQ GV
Sbjct  370   GVPISPSSLLGMPSYLPPGQVTALHPFLMHQQGV  403



>ref|XP_008234668.1| PREDICTED: probable GPI-anchored adhesin-like protein PGA55 isoform 
X6 [Prunus mume]
Length=856

 Score = 58.2 bits (139),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 24/34 (71%), Positives = 30/34 (88%), Gaps = 0/34 (0%)
 Frame = +3

Query  1044  GVSLAPSSLLGMATFIPPGQIAALHPFLMHQ*GV  1145
             GV ++PSSLLGM +++PPGQ+ ALHPFLMHQ GV
Sbjct  369   GVPISPSSLLGMPSYLPPGQVTALHPFLMHQQGV  402



>gb|AAP83395.1| SEPALLATA3-like MADS-box [Petunia x hybrida]
Length=210

 Score = 55.5 bits (132),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 24/31 (77%), Positives = 26/31 (84%), Gaps = 0/31 (0%)
 Frame = +3

Query  939   CLVDIMIKTLERYQKCNYGTPETNISTRDAL  1031
             C    M+KTLERYQKCNYG PETNISTR+AL
Sbjct  27    CSSSSMLKTLERYQKCNYGAPETNISTREAL  57



>ref|XP_009351932.1| PREDICTED: uncharacterized protein LOC103943368 isoform X2 [Pyrus 
x bretschneideri]
Length=846

 Score = 57.8 bits (138),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 24/34 (71%), Positives = 30/34 (88%), Gaps = 0/34 (0%)
 Frame = +3

Query  1044  GVSLAPSSLLGMATFIPPGQIAALHPFLMHQ*GV  1145
             GV ++PSSLLGM +++PPGQ+ ALHPFLMHQ GV
Sbjct  371   GVPISPSSLLGMPSYLPPGQVTALHPFLMHQQGV  404



>ref|XP_009351931.1| PREDICTED: uncharacterized protein LOC103943368 isoform X1 [Pyrus 
x bretschneideri]
Length=847

 Score = 57.8 bits (138),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 24/34 (71%), Positives = 30/34 (88%), Gaps = 0/34 (0%)
 Frame = +3

Query  1044  GVSLAPSSLLGMATFIPPGQIAALHPFLMHQ*GV  1145
             GV ++PSSLLGM +++PPGQ+ ALHPFLMHQ GV
Sbjct  372   GVPISPSSLLGMPSYLPPGQVTALHPFLMHQQGV  405



>ref|XP_007220603.1| hypothetical protein PRUPE_ppa001350mg [Prunus persica]
 gb|EMJ21802.1| hypothetical protein PRUPE_ppa001350mg [Prunus persica]
Length=847

 Score = 57.8 bits (138),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 24/34 (71%), Positives = 30/34 (88%), Gaps = 0/34 (0%)
 Frame = +3

Query  1044  GVSLAPSSLLGMATFIPPGQIAALHPFLMHQ*GV  1145
             GV ++PSSLLGM +++PPGQ+ ALHPFLMHQ GV
Sbjct  372   GVPISPSSLLGMPSYLPPGQVTALHPFLMHQQGV  405



>ref|XP_009351933.1| PREDICTED: uncharacterized protein LOC103943368 isoform X3 [Pyrus 
x bretschneideri]
Length=845

 Score = 57.8 bits (138),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 24/34 (71%), Positives = 30/34 (88%), Gaps = 0/34 (0%)
 Frame = +3

Query  1044  GVSLAPSSLLGMATFIPPGQIAALHPFLMHQ*GV  1145
             GV ++PSSLLGM +++PPGQ+ ALHPFLMHQ GV
Sbjct  370   GVPISPSSLLGMPSYLPPGQVTALHPFLMHQQGV  403



>gb|KDP26829.1| hypothetical protein JCGZ_17987 [Jatropha curcas]
Length=257

 Score = 56.2 bits (134),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 23/29 (79%), Positives = 27/29 (93%), Gaps = 0/29 (0%)
 Frame = +3

Query  954   MIKTLERYQKCNYGTPETNISTRDALSDL  1040
             M+KTLERYQKCNYG PETN+STR+AL +L
Sbjct  77    MLKTLERYQKCNYGAPETNVSTREALQEL  105



>ref|XP_007043947.1| K-box region and MADS-box transcription factor family protein 
isoform 1 [Theobroma cacao]
 gb|EOX99778.1| K-box region and MADS-box transcription factor family protein 
isoform 1 [Theobroma cacao]
Length=242

 Score = 55.8 bits (133),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 24/31 (77%), Positives = 26/31 (84%), Gaps = 0/31 (0%)
 Frame = +3

Query  939   CLVDIMIKTLERYQKCNYGTPETNISTRDAL  1031
             C    MIKTLERYQKCNYG PETN+STR+AL
Sbjct  58    CSSSSMIKTLERYQKCNYGAPETNVSTREAL  88



>ref|XP_007043949.1| K-box region and MADS-box transcription factor family protein 
isoform 3 [Theobroma cacao]
 gb|EOX99780.1| K-box region and MADS-box transcription factor family protein 
isoform 3 [Theobroma cacao]
Length=247

 Score = 56.2 bits (134),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 24/31 (77%), Positives = 26/31 (84%), Gaps = 0/31 (0%)
 Frame = +3

Query  939   CLVDIMIKTLERYQKCNYGTPETNISTRDAL  1031
             C    MIKTLERYQKCNYG PETN+STR+AL
Sbjct  58    CSSSSMIKTLERYQKCNYGAPETNVSTREAL  88



>dbj|BAG55316.1| transcription factor [Petunia integrifolia subsp. inflata]
 dbj|BAG55317.1| transcription factor [Petunia integrifolia subsp. inflata]
Length=240

 Score = 55.5 bits (132),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 24/32 (75%), Positives = 26/32 (81%), Gaps = 0/32 (0%)
 Frame = +3

Query  939   CLVDIMIKTLERYQKCNYGTPETNISTRDALS  1034
             C    M+KTLERYQKCNYG PETNISTR+AL 
Sbjct  58    CSSSSMLKTLERYQKCNYGAPETNISTREALE  89



>sp|Q03489.2|AGL9_PETHY RecName: Full=Agamous-like MADS-box protein AGL9 homolog; AltName: 
Full=Floral homeotic protein FBP2; AltName: Full=Floral-binding 
protein 2 [Petunia x hybrida]
 gb|AAA86854.1| transcription factor [Petunia x hybrida]
Length=241

 Score = 55.5 bits (132),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 24/32 (75%), Positives = 26/32 (81%), Gaps = 0/32 (0%)
 Frame = +3

Query  939   CLVDIMIKTLERYQKCNYGTPETNISTRDALS  1034
             C    M+KTLERYQKCNYG PETNISTR+AL 
Sbjct  58    CSSSSMLKTLERYQKCNYGAPETNISTREALE  89



>ref|NP_001289529.1| agamous-like MADS-box protein AGL9 homolog [Nicotiana sylvestris]
 gb|AAD39034.1|AF068722_1 MADS-box protein MADS3 [Nicotiana sylvestris]
 gb|AFY06679.1| sepallata3-like MADS-box [Nicotiana tabacum]
Length=241

 Score = 55.5 bits (132),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 24/32 (75%), Positives = 26/32 (81%), Gaps = 0/32 (0%)
 Frame = +3

Query  939   CLVDIMIKTLERYQKCNYGTPETNISTRDALS  1034
             C    M+KTLERYQKCNYG PETNISTR+AL 
Sbjct  58    CSSSSMLKTLERYQKCNYGAPETNISTREALE  89



>gb|EYU33468.1| hypothetical protein MIMGU_mgv1a0126181mg, partial [Erythranthe 
guttata]
Length=88

 Score = 53.5 bits (127),  Expect = 2e-05, Method: Composition-based stats.
 Identities = 22/31 (71%), Positives = 25/31 (81%), Gaps = 0/31 (0%)
 Frame = +3

Query  939   CLVDIMIKTLERYQKCNYGTPETNISTRDAL  1031
             C    M+KTLERYQKCNYG PETN+S R+AL
Sbjct  58    CSSSSMLKTLERYQKCNYGAPETNVSAREAL  88



>ref|XP_007043948.1| K-box region and MADS-box transcription factor family protein 
isoform 2 [Theobroma cacao]
 gb|EOX99779.1| K-box region and MADS-box transcription factor family protein 
isoform 2 [Theobroma cacao]
Length=258

 Score = 55.8 bits (133),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 24/32 (75%), Positives = 26/32 (81%), Gaps = 0/32 (0%)
 Frame = +3

Query  939   CLVDIMIKTLERYQKCNYGTPETNISTRDALS  1034
             C    MIKTLERYQKCNYG PETN+STR+AL 
Sbjct  58    CSSSSMIKTLERYQKCNYGAPETNVSTREALE  89



>ref|XP_004504400.1| PREDICTED: agamous-like MADS-box protein AGL9 homolog isoform 
X4 [Cicer arietinum]
Length=227

 Score = 55.5 bits (132),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 23/31 (74%), Positives = 26/31 (84%), Gaps = 0/31 (0%)
 Frame = +3

Query  939   CLVDIMIKTLERYQKCNYGTPETNISTRDAL  1031
             C    M+KTLERYQKCNYG PETN+STR+AL
Sbjct  58    CSSSSMLKTLERYQKCNYGAPETNVSTREAL  88



>ref|XP_009600809.1| PREDICTED: agamous-like MADS-box protein AGL9 homolog [Nicotiana 
tomentosiformis]
Length=242

 Score = 55.5 bits (132),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 24/32 (75%), Positives = 26/32 (81%), Gaps = 0/32 (0%)
 Frame = +3

Query  939   CLVDIMIKTLERYQKCNYGTPETNISTRDALS  1034
             C    M+KTLERYQKCNYG PETNISTR+AL 
Sbjct  58    CSSSSMLKTLERYQKCNYGAPETNISTREALE  89



>ref|XP_004504399.1| PREDICTED: agamous-like MADS-box protein AGL9 homolog isoform 
X3 [Cicer arietinum]
Length=228

 Score = 55.5 bits (132),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 23/31 (74%), Positives = 26/31 (84%), Gaps = 0/31 (0%)
 Frame = +3

Query  939   CLVDIMIKTLERYQKCNYGTPETNISTRDAL  1031
             C    M+KTLERYQKCNYG PETN+STR+AL
Sbjct  58    CSSSSMLKTLERYQKCNYGAPETNVSTREAL  88



>gb|ADP09004.1| SEP3-like protein [Lycium barbarum]
Length=241

 Score = 55.5 bits (132),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 24/32 (75%), Positives = 26/32 (81%), Gaps = 0/32 (0%)
 Frame = +3

Query  939   CLVDIMIKTLERYQKCNYGTPETNISTRDALS  1034
             C    M+KTLERYQKCNYG PETNISTR+AL 
Sbjct  58    CSSSSMLKTLERYQKCNYGAPETNISTREALE  89



>ref|XP_007158666.1| hypothetical protein PHAVU_002G1723001g, partial [Phaseolus vulgaris]
 gb|ESW30660.1| hypothetical protein PHAVU_002G1723001g, partial [Phaseolus vulgaris]
Length=146

 Score = 53.9 bits (128),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 22/31 (71%), Positives = 25/31 (81%), Gaps = 0/31 (0%)
 Frame = +3

Query  939   CLVDIMIKTLERYQKCNYGTPETNISTRDAL  1031
             C    M+KTLERYQKCNYG PE N+STR+AL
Sbjct  58    CSSSSMLKTLERYQKCNYGAPEANVSTREAL  88



>ref|XP_007158665.1| hypothetical protein PHAVU_002G1723001g, partial [Phaseolus vulgaris]
 gb|ESW30659.1| hypothetical protein PHAVU_002G1723001g, partial [Phaseolus vulgaris]
Length=144

 Score = 53.9 bits (128),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 22/31 (71%), Positives = 25/31 (81%), Gaps = 0/31 (0%)
 Frame = +3

Query  939   CLVDIMIKTLERYQKCNYGTPETNISTRDAL  1031
             C    M+KTLERYQKCNYG PE N+STR+AL
Sbjct  58    CSSSSMLKTLERYQKCNYGAPEANVSTREAL  88



>ref|XP_004504397.1| PREDICTED: agamous-like MADS-box protein AGL9 homolog isoform 
X1 [Cicer arietinum]
Length=242

 Score = 55.5 bits (132),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 23/31 (74%), Positives = 26/31 (84%), Gaps = 0/31 (0%)
 Frame = +3

Query  939   CLVDIMIKTLERYQKCNYGTPETNISTRDAL  1031
             C    M+KTLERYQKCNYG PETN+STR+AL
Sbjct  58    CSSSSMLKTLERYQKCNYGAPETNVSTREAL  88



>ref|XP_004504398.1| PREDICTED: agamous-like MADS-box protein AGL9 homolog isoform 
X2 [Cicer arietinum]
Length=241

 Score = 55.1 bits (131),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 23/31 (74%), Positives = 26/31 (84%), Gaps = 0/31 (0%)
 Frame = +3

Query  939   CLVDIMIKTLERYQKCNYGTPETNISTRDAL  1031
             C    M+KTLERYQKCNYG PETN+STR+AL
Sbjct  58    CSSSSMLKTLERYQKCNYGAPETNVSTREAL  88



>gb|ABW21690.1| SEP3-like protein [Viola pubescens]
Length=77

 Score = 52.8 bits (125),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 22/31 (71%), Positives = 25/31 (81%), Gaps = 0/31 (0%)
 Frame = +3

Query  939   CLVDIMIKTLERYQKCNYGTPETNISTRDAL  1031
             C    M+KTLERYQKCNYG PE N+STR+AL
Sbjct  17    CSSSSMLKTLERYQKCNYGAPEPNVSTREAL  47



>ref|XP_004310096.1| PREDICTED: agamous-like MADS-box protein AGL9 homolog [Fragaria 
vesca subsp. vesca]
Length=180

 Score = 54.3 bits (129),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 22/27 (81%), Positives = 25/27 (93%), Gaps = 0/27 (0%)
 Frame = +3

Query  954   MIKTLERYQKCNYGTPETNISTRDALS  1034
             M+KTLERYQKCNYG PETN+STR+AL 
Sbjct  1     MLKTLERYQKCNYGAPETNVSTREALE  27



>dbj|BAJ11578.1| transcription factor [Pyrus pyrifolia var. culta]
Length=235

 Score = 55.1 bits (131),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 23/32 (72%), Positives = 26/32 (81%), Gaps = 0/32 (0%)
 Frame = +3

Query  939   CLVDIMIKTLERYQKCNYGTPETNISTRDALS  1034
             C    M+KTLERYQKCNYG PETN+STR+AL 
Sbjct  55    CSSSSMLKTLERYQKCNYGAPETNVSTREALE  86



>gb|AEF59026.1| MADS-2 [Fragaria x ananassa]
Length=180

 Score = 53.9 bits (128),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 22/27 (81%), Positives = 25/27 (93%), Gaps = 0/27 (0%)
 Frame = +3

Query  954   MIKTLERYQKCNYGTPETNISTRDALS  1034
             M+KTLERYQKCNYG PETN+STR+AL 
Sbjct  1     MLKTLERYQKCNYGAPETNVSTREALE  27



>gb|ADF49576.1| transcription factor MADS-box 2 [Fragaria chiloensis]
Length=242

 Score = 55.1 bits (131),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 23/32 (72%), Positives = 26/32 (81%), Gaps = 0/32 (0%)
 Frame = +3

Query  939   CLVDIMIKTLERYQKCNYGTPETNISTRDALS  1034
             C    M+KTLERYQKCNYG PETN+STR+AL 
Sbjct  58    CSSSSMLKTLERYQKCNYGAPETNVSTREALE  89



>ref|NP_001289232.1| agamous-like MADS-box protein AGL9 homolog [Pyrus x bretschneideri]
 ref|XP_009343139.1| PREDICTED: agamous-like MADS-box protein AGL9 homolog [Pyrus 
x bretschneideri]
 ref|XP_009343141.1| PREDICTED: agamous-like MADS-box protein AGL9 homolog [Pyrus 
x bretschneideri]
 dbj|BAF44101.1| transcription factor MADS [Pyrus x bretschneideri]
 dbj|BAM71398.1| transcription factor [Pyrus pyrifolia]
Length=239

 Score = 55.1 bits (131),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 23/32 (72%), Positives = 26/32 (81%), Gaps = 0/32 (0%)
 Frame = +3

Query  939   CLVDIMIKTLERYQKCNYGTPETNISTRDALS  1034
             C    M+KTLERYQKCNYG PETN+STR+AL 
Sbjct  58    CSSSSMLKTLERYQKCNYGAPETNVSTREALE  89



>dbj|BAM36705.1| MADS transcriptional factor SEP3 homolog, partial [Rosa hybrid 
cultivar]
Length=244

 Score = 55.1 bits (131),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 23/32 (72%), Positives = 26/32 (81%), Gaps = 0/32 (0%)
 Frame = +3

Query  939   CLVDIMIKTLERYQKCNYGTPETNISTRDALS  1034
             C    M+KTLERYQKCNYG PETN+STR+AL 
Sbjct  58    CSSSSMLKTLERYQKCNYGAPETNVSTREALE  89



>emb|CBI27678.3| unnamed protein product [Vitis vinifera]
Length=242

 Score = 55.1 bits (131),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 23/32 (72%), Positives = 26/32 (81%), Gaps = 0/32 (0%)
 Frame = +3

Query  939   CLVDIMIKTLERYQKCNYGTPETNISTRDALS  1034
             C    M+KTLERYQKCNYG PETN+STR+AL 
Sbjct  58    CSSSSMLKTLERYQKCNYGAPETNVSTREALE  89



>ref|NP_001268114.1| MADS-box protein 4 [Vitis vinifera]
 gb|AAM21344.1|AF373603_1 MADS-box protein 4 [Vitis vinifera]
Length=242

 Score = 55.1 bits (131),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 23/32 (72%), Positives = 26/32 (81%), Gaps = 0/32 (0%)
 Frame = +3

Query  939   CLVDIMIKTLERYQKCNYGTPETNISTRDALS  1034
             C    M+KTLERYQKCNYG PETN+STR+AL 
Sbjct  58    CSSSSMLKTLERYQKCNYGAPETNVSTREALE  89



>ref|XP_010653929.1| PREDICTED: MADS-box protein 4 isoform X1 [Vitis vinifera]
Length=258

 Score = 55.1 bits (131),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 23/31 (74%), Positives = 26/31 (84%), Gaps = 0/31 (0%)
 Frame = +3

Query  939   CLVDIMIKTLERYQKCNYGTPETNISTRDAL  1031
             C    M+KTLERYQKCNYG PETN+STR+AL
Sbjct  58    CSSSSMLKTLERYQKCNYGAPETNVSTREAL  88



>ref|XP_002318464.2| hypothetical protein POPTR_0012s03030g [Populus trichocarpa]
 gb|EEE96684.2| hypothetical protein POPTR_0012s03030g [Populus trichocarpa]
Length=814

 Score = 56.2 bits (134),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 22/34 (65%), Positives = 30/34 (88%), Gaps = 0/34 (0%)
 Frame = +3

Query  1044  GVSLAPSSLLGMATFIPPGQIAALHPFLMHQ*GV  1145
             GV +AP+SLLGM T++PPGQ+ ALHPF++HQ G+
Sbjct  371   GVPMAPTSLLGMPTYLPPGQVTALHPFILHQQGI  404



>ref|XP_010662921.1| PREDICTED: uncharacterized protein LOC100252015 isoform X2 [Vitis 
vinifera]
Length=875

 Score = 56.2 bits (134),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 23/33 (70%), Positives = 29/33 (88%), Gaps = 0/33 (0%)
 Frame = +3

Query  1047  VSLAPSSLLGMATFIPPGQIAALHPFLMHQ*GV  1145
             V +APSSLLGM T++PPGQ+ A+HPF+MHQ GV
Sbjct  380   VPIAPSSLLGMPTYLPPGQVTAMHPFVMHQQGV  412



>ref|XP_010662923.1| PREDICTED: uncharacterized protein LOC100252015 isoform X4 [Vitis 
vinifera]
Length=868

 Score = 56.2 bits (134),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 23/33 (70%), Positives = 29/33 (88%), Gaps = 0/33 (0%)
 Frame = +3

Query  1047  VSLAPSSLLGMATFIPPGQIAALHPFLMHQ*GV  1145
             V +APSSLLGM T++PPGQ+ A+HPF+MHQ GV
Sbjct  382   VPIAPSSLLGMPTYLPPGQVTAMHPFVMHQQGV  414



>ref|XP_010662919.1| PREDICTED: uncharacterized protein LOC100252015 isoform X1 [Vitis 
vinifera]
 ref|XP_010662920.1| PREDICTED: uncharacterized protein LOC100252015 isoform X1 [Vitis 
vinifera]
Length=877

 Score = 56.2 bits (134),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 23/33 (70%), Positives = 29/33 (88%), Gaps = 0/33 (0%)
 Frame = +3

Query  1047  VSLAPSSLLGMATFIPPGQIAALHPFLMHQ*GV  1145
             V +APSSLLGM T++PPGQ+ A+HPF+MHQ GV
Sbjct  382   VPIAPSSLLGMPTYLPPGQVTAMHPFVMHQQGV  414



>ref|XP_010662922.1| PREDICTED: uncharacterized protein LOC100252015 isoform X3 [Vitis 
vinifera]
Length=874

 Score = 56.2 bits (134),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 23/33 (70%), Positives = 29/33 (88%), Gaps = 0/33 (0%)
 Frame = +3

Query  1047  VSLAPSSLLGMATFIPPGQIAALHPFLMHQ*GV  1145
             V +APSSLLGM T++PPGQ+ A+HPF+MHQ GV
Sbjct  379   VPIAPSSLLGMPTYLPPGQVTAMHPFVMHQQGV  411



>gb|KGN49814.1| hypothetical protein Csa_5G138460 [Cucumis sativus]
Length=867

 Score = 56.2 bits (134),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 30/57 (53%), Positives = 39/57 (68%), Gaps = 6/57 (11%)
 Frame = +3

Query  993   GTPET----NISTRDALSDLH--GVSLAPSSLLGMATFIPPGQIAALHPFLMHQ*GV  1145
             G PE     N+++  ++   H  GV +APSSL GM  ++PPGQ+AALHPFLMHQ GV
Sbjct  351   GNPENVSSFNLTSNSSIQIDHVSGVPMAPSSLPGMPPYLPPGQMAALHPFLMHQPGV  407



>emb|CBI23069.3| unnamed protein product [Vitis vinifera]
Length=833

 Score = 55.8 bits (133),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 23/33 (70%), Positives = 29/33 (88%), Gaps = 0/33 (0%)
 Frame = +3

Query  1047  VSLAPSSLLGMATFIPPGQIAALHPFLMHQ*GV  1145
             V +APSSLLGM T++PPGQ+ A+HPF+MHQ GV
Sbjct  380   VPIAPSSLLGMPTYLPPGQVTAMHPFVMHQQGV  412



>ref|XP_004145992.1| PREDICTED: uncharacterized protein LOC101218478 [Cucumis sativus]
Length=790

 Score = 55.8 bits (133),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 30/57 (53%), Positives = 39/57 (68%), Gaps = 6/57 (11%)
 Frame = +3

Query  993   GTPET----NISTRDALSDLH--GVSLAPSSLLGMATFIPPGQIAALHPFLMHQ*GV  1145
             G PE     N+++  ++   H  GV +APSSL GM  ++PPGQ+AALHPFLMHQ GV
Sbjct  274   GNPENVSSFNLTSNSSIQIDHVSGVPMAPSSLPGMPPYLPPGQMAALHPFLMHQPGV  330



>ref|XP_008437669.1| PREDICTED: uncharacterized protein LOC103483009 isoform X2 [Cucumis 
melo]
Length=867

 Score = 55.8 bits (133),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 30/57 (53%), Positives = 38/57 (67%), Gaps = 6/57 (11%)
 Frame = +3

Query  993   GTPET----NISTRDALSDLH--GVSLAPSSLLGMATFIPPGQIAALHPFLMHQ*GV  1145
             G PE     N++   ++   H  GV +APSSL GM  ++PPGQ+AALHPFLMHQ GV
Sbjct  351   GNPENVPSFNLTGNSSIQTDHVSGVPMAPSSLPGMPPYLPPGQMAALHPFLMHQPGV  407



>ref|NP_001242742.1| uncharacterized protein LOC100805078 [Glycine max]
 gb|ACU17977.1| unknown [Glycine max]
Length=226

 Score = 53.9 bits (128),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 22/31 (71%), Positives = 25/31 (81%), Gaps = 0/31 (0%)
 Frame = +3

Query  939   CLVDIMIKTLERYQKCNYGTPETNISTRDAL  1031
             C    M+KTLERYQKCNYG PE N+STR+AL
Sbjct  58    CSSSSMLKTLERYQKCNYGAPEANVSTREAL  88



>ref|XP_008437668.1| PREDICTED: uncharacterized protein LOC103483009 isoform X1 [Cucumis 
melo]
Length=869

 Score = 55.8 bits (133),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 30/57 (53%), Positives = 38/57 (67%), Gaps = 6/57 (11%)
 Frame = +3

Query  993   GTPET----NISTRDALSDLH--GVSLAPSSLLGMATFIPPGQIAALHPFLMHQ*GV  1145
             G PE     N++   ++   H  GV +APSSL GM  ++PPGQ+AALHPFLMHQ GV
Sbjct  353   GNPENVPSFNLTGNSSIQTDHVSGVPMAPSSLPGMPPYLPPGQMAALHPFLMHQPGV  409



>emb|CAL36578.1| deficiens H200 homologue [Misopates orontium]
Length=241

 Score = 53.9 bits (128),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 23/31 (74%), Positives = 26/31 (84%), Gaps = 0/31 (0%)
 Frame = +3

Query  939   CLVDIMIKTLERYQKCNYGTPETNISTRDAL  1031
             C    M+KTLERYQKCNYG PETN+STR+AL
Sbjct  58    CSSTSMLKTLERYQKCNYGPPETNVSTREAL  88



>ref|XP_004171788.1| PREDICTED: agamous-like MADS-box protein AGL9 homolog, partial 
[Cucumis sativus]
Length=196

 Score = 53.1 bits (126),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 22/32 (69%), Positives = 25/32 (78%), Gaps = 0/32 (0%)
 Frame = +3

Query  939   CLVDIMIKTLERYQKCNYGTPETNISTRDALS  1034
             C    M+KTLERYQKCNYG PE N+STR+AL 
Sbjct  12    CAKSSMLKTLERYQKCNYGAPEPNVSTREALE  43



>gb|ADU56818.1| MADS-box protein AGL2 subfamily [Coffea arabica]
Length=170

 Score = 52.8 bits (125),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 22/26 (85%), Positives = 24/26 (92%), Gaps = 0/26 (0%)
 Frame = +3

Query  954   MIKTLERYQKCNYGTPETNISTRDAL  1031
             M+KTLERYQKCNYG PE NISTR+AL
Sbjct  68    MLKTLERYQKCNYGAPEPNISTREAL  93



>ref|XP_002321976.2| hypothetical protein POPTR_0015s00910g [Populus trichocarpa]
 gb|EEF06103.2| hypothetical protein POPTR_0015s00910g [Populus trichocarpa]
Length=763

 Score = 55.5 bits (132),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 22/34 (65%), Positives = 30/34 (88%), Gaps = 0/34 (0%)
 Frame = +3

Query  1044  GVSLAPSSLLGMATFIPPGQIAALHPFLMHQ*GV  1145
             GV +AP+SLLGM T++P GQ+AALHPF++HQ G+
Sbjct  359   GVPMAPTSLLGMPTYLPSGQVAALHPFILHQQGI  392



>ref|XP_002321969.1| hypothetical protein POPTR_0015s00910g [Populus trichocarpa]
 gb|EEF06096.1| hypothetical protein POPTR_0015s00910g [Populus trichocarpa]
Length=768

 Score = 55.5 bits (132),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 22/34 (65%), Positives = 30/34 (88%), Gaps = 0/34 (0%)
 Frame = +3

Query  1044  GVSLAPSSLLGMATFIPPGQIAALHPFLMHQ*GV  1145
             GV +AP+SLLGM T++P GQ+AALHPF++HQ G+
Sbjct  359   GVPMAPTSLLGMPTYLPSGQVAALHPFILHQQGI  392



>gb|EYU33467.1| hypothetical protein MIMGU_mgv1a0126181mg, partial [Erythranthe 
guttata]
 gb|EYU33469.1| hypothetical protein MIMGU_mgv1a0126181mg, partial [Erythranthe 
guttata]
 gb|EYU33470.1| hypothetical protein MIMGU_mgv1a0126181mg, partial [Erythranthe 
guttata]
Length=89

 Score = 51.6 bits (122),  Expect = 8e-05, Method: Composition-based stats.
 Identities = 21/26 (81%), Positives = 24/26 (92%), Gaps = 0/26 (0%)
 Frame = +3

Query  954   MIKTLERYQKCNYGTPETNISTRDAL  1031
             M+KTLERYQKCNYG PETN+S R+AL
Sbjct  64    MLKTLERYQKCNYGAPETNVSAREAL  89



>gb|AAP83377.1| SEPALLATA3-like MADS-box [Solanum lycopersicum]
Length=210

 Score = 53.1 bits (126),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 23/31 (74%), Positives = 25/31 (81%), Gaps = 0/31 (0%)
 Frame = +3

Query  939   CLVDIMIKTLERYQKCNYGTPETNISTRDAL  1031
             C    M+KTLERYQKCNYG PE NISTR+AL
Sbjct  27    CSSSSMLKTLERYQKCNYGAPEPNISTREAL  57



>gb|ADN37686.1| SEP3 [Papaver somniferum]
Length=143

 Score = 52.4 bits (124),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 21/31 (68%), Positives = 24/31 (77%), Gaps = 0/31 (0%)
 Frame = +3

Query  939   CLVDIMIKTLERYQKCNYGTPETNISTRDAL  1031
             C    M KTLERYQKCNYG PETN+S R++L
Sbjct  20    CSSSSMFKTLERYQKCNYGQPETNVSARESL  50



>ref|XP_006579435.1| PREDICTED: uncharacterized protein LOC100805078 isoform X3 [Glycine 
max]
Length=242

 Score = 53.5 bits (127),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 22/31 (71%), Positives = 25/31 (81%), Gaps = 0/31 (0%)
 Frame = +3

Query  939   CLVDIMIKTLERYQKCNYGTPETNISTRDAL  1031
             C    M+KTLERYQKCNYG PE N+STR+AL
Sbjct  58    CSSSSMLKTLERYQKCNYGAPEANVSTREAL  88



>ref|XP_006585130.1| PREDICTED: MADS-box transcription factor 1-like isoform X2 [Glycine 
max]
Length=243

 Score = 53.5 bits (127),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 22/31 (71%), Positives = 25/31 (81%), Gaps = 0/31 (0%)
 Frame = +3

Query  939   CLVDIMIKTLERYQKCNYGTPETNISTRDAL  1031
             C    M+KTLERYQKCNYG PE N+STR+AL
Sbjct  58    CSSSSMLKTLERYQKCNYGAPEANVSTREAL  88



>ref|XP_006585129.1| PREDICTED: MADS-box transcription factor 1-like isoform X1 [Glycine 
max]
Length=244

 Score = 53.5 bits (127),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 22/31 (71%), Positives = 25/31 (81%), Gaps = 0/31 (0%)
 Frame = +3

Query  939   CLVDIMIKTLERYQKCNYGTPETNISTRDAL  1031
             C    M+KTLERYQKCNYG PE N+STR+AL
Sbjct  58    CSSSSMLKTLERYQKCNYGAPEANVSTREAL  88



>gb|KHN34832.1| MADS-box transcription factor 1 [Glycine soja]
Length=241

 Score = 53.5 bits (127),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 22/31 (71%), Positives = 25/31 (81%), Gaps = 0/31 (0%)
 Frame = +3

Query  939   CLVDIMIKTLERYQKCNYGTPETNISTRDAL  1031
             C    M+KTLERYQKCNYG PE N+STR+AL
Sbjct  58    CSSSSMLKTLERYQKCNYGAPEANVSTREAL  88



>ref|XP_006579436.1| PREDICTED: uncharacterized protein LOC100805078 isoform X4 [Glycine 
max]
Length=241

 Score = 53.5 bits (127),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 22/31 (71%), Positives = 25/31 (81%), Gaps = 0/31 (0%)
 Frame = +3

Query  939   CLVDIMIKTLERYQKCNYGTPETNISTRDAL  1031
             C    M+KTLERYQKCNYG PE N+STR+AL
Sbjct  58    CSSSSMLKTLERYQKCNYGAPEANVSTREAL  88



>ref|XP_006579434.1| PREDICTED: uncharacterized protein LOC100805078 isoform X2 [Glycine 
max]
Length=243

 Score = 53.5 bits (127),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 22/31 (71%), Positives = 25/31 (81%), Gaps = 0/31 (0%)
 Frame = +3

Query  939   CLVDIMIKTLERYQKCNYGTPETNISTRDAL  1031
             C    M+KTLERYQKCNYG PE N+STR+AL
Sbjct  58    CSSSSMLKTLERYQKCNYGAPEANVSTREAL  88



>ref|XP_006579433.1| PREDICTED: uncharacterized protein LOC100805078 isoform X1 [Glycine 
max]
Length=244

 Score = 53.5 bits (127),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 22/31 (71%), Positives = 25/31 (81%), Gaps = 0/31 (0%)
 Frame = +3

Query  939   CLVDIMIKTLERYQKCNYGTPETNISTRDAL  1031
             C    M+KTLERYQKCNYG PE N+STR+AL
Sbjct  58    CSSSSMLKTLERYQKCNYGAPEANVSTREAL  88



>ref|XP_006585132.1| PREDICTED: MADS-box transcription factor 1-like isoform X4 [Glycine 
max]
 gb|KHN12377.1| MADS-box transcription factor 1 [Glycine soja]
Length=241

 Score = 53.5 bits (127),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 22/31 (71%), Positives = 25/31 (81%), Gaps = 0/31 (0%)
 Frame = +3

Query  939   CLVDIMIKTLERYQKCNYGTPETNISTRDAL  1031
             C    M+KTLERYQKCNYG PE N+STR+AL
Sbjct  58    CSSSSMLKTLERYQKCNYGAPEANVSTREAL  88



>ref|XP_006585131.1| PREDICTED: MADS-box transcription factor 1-like isoform X3 [Glycine 
max]
Length=242

 Score = 53.5 bits (127),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 22/31 (71%), Positives = 25/31 (81%), Gaps = 0/31 (0%)
 Frame = +3

Query  939   CLVDIMIKTLERYQKCNYGTPETNISTRDAL  1031
             C    M+KTLERYQKCNYG PE N+STR+AL
Sbjct  58    CSSSSMLKTLERYQKCNYGAPEANVSTREAL  88



>gb|AFU81296.1| SEPALLATA3 [Medicago polyceratia]
Length=244

 Score = 53.5 bits (127),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 22/31 (71%), Positives = 25/31 (81%), Gaps = 0/31 (0%)
 Frame = +3

Query  939   CLVDIMIKTLERYQKCNYGTPETNISTRDAL  1031
             C    M+KTLERYQKCNYG PETN+S R+AL
Sbjct  58    CSSSSMLKTLERYQKCNYGAPETNVSAREAL  88



>sp|Q42464.1|AGL9_SOLLC RecName: Full=Agamous-like MADS-box protein AGL9 homolog; AltName: 
Full=TM5 [Solanum lycopersicum]
 emb|CAA43010.1| TDR5 [Solanum lycopersicum]
 emb|CAA43170.1| TDR5 [Solanum lycopersicum]
Length=224

 Score = 53.1 bits (126),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 23/31 (74%), Positives = 25/31 (81%), Gaps = 0/31 (0%)
 Frame = +3

Query  939   CLVDIMIKTLERYQKCNYGTPETNISTRDAL  1031
             C    M+KTLERYQKCNYG PE NISTR+AL
Sbjct  58    CSSSSMLKTLERYQKCNYGAPEPNISTREAL  88



>ref|XP_007039176.1| Uncharacterized protein isoform 1 [Theobroma cacao]
 gb|EOY23677.1| Uncharacterized protein isoform 1 [Theobroma cacao]
Length=872

 Score = 55.1 bits (131),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 25/46 (54%), Positives = 33/46 (72%), Gaps = 0/46 (0%)
 Frame = +3

Query  1008  NISTRDALSDLHGVSLAPSSLLGMATFIPPGQIAALHPFLMHQ*GV  1145
             N  T++    +  V +APSSLLGM T++PPGQ+ ALH F+MHQ GV
Sbjct  389   NAPTQNQNDHVSSVPIAPSSLLGMPTYLPPGQVTALHSFVMHQQGV  434



>ref|XP_007039177.1| Uncharacterized protein isoform 2 [Theobroma cacao]
 gb|EOY23678.1| Uncharacterized protein isoform 2 [Theobroma cacao]
Length=852

 Score = 55.1 bits (131),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 25/46 (54%), Positives = 33/46 (72%), Gaps = 0/46 (0%)
 Frame = +3

Query  1008  NISTRDALSDLHGVSLAPSSLLGMATFIPPGQIAALHPFLMHQ*GV  1145
             N  T++    +  V +APSSLLGM T++PPGQ+ ALH F+MHQ GV
Sbjct  369   NAPTQNQNDHVSSVPIAPSSLLGMPTYLPPGQVTALHSFVMHQQGV  414



>gb|AEQ75503.1| MADS-domain transcription factor, partial [Davidia involucrata]
Length=212

 Score = 52.8 bits (125),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 22/32 (69%), Positives = 25/32 (78%), Gaps = 0/32 (0%)
 Frame = +3

Query  939   CLVDIMIKTLERYQKCNYGTPETNISTRDALS  1034
             C    M+KTLERYQKCNYG PE N+STR+AL 
Sbjct  19    CSSSSMLKTLERYQKCNYGAPEPNVSTREALE  50



>gb|AAX13298.1| MADS box protein SEP3 [Lotus japonicus]
Length=243

 Score = 53.5 bits (127),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 22/31 (71%), Positives = 25/31 (81%), Gaps = 0/31 (0%)
 Frame = +3

Query  939   CLVDIMIKTLERYQKCNYGTPETNISTRDAL  1031
             C    M+KTLERYQKCNYG PE N+STR+AL
Sbjct  58    CSSSSMLKTLERYQKCNYGAPEANVSTREAL  88



>ref|XP_004168213.1| PREDICTED: uncharacterized protein LOC101229859, partial [Cucumis 
sativus]
Length=650

 Score = 54.7 bits (130),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 25/36 (69%), Positives = 30/36 (83%), Gaps = 0/36 (0%)
 Frame = +3

Query  1038  LHGVSLAPSSLLGMATFIPPGQIAALHPFLMHQ*GV  1145
             + GV +APSSL GM  ++PPGQ+AALHPFLMHQ GV
Sbjct  155   VSGVPMAPSSLPGMPPYLPPGQMAALHPFLMHQPGV  190



>ref|XP_009372256.1| PREDICTED: agamous-like MADS-box protein AGL9 homolog isoform 
X2 [Pyrus x bretschneideri]
Length=250

 Score = 53.5 bits (127),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 22/32 (69%), Positives = 26/32 (81%), Gaps = 0/32 (0%)
 Frame = +3

Query  939   CLVDIMIKTLERYQKCNYGTPETNISTRDALS  1034
             C    M+KTL+RYQKCNYG PETN+STR+AL 
Sbjct  58    CSSSSMLKTLDRYQKCNYGAPETNVSTREALE  89



>gb|AEN75254.1| transcription factor MADS3 [Prunus avium]
 gb|AIU94282.1| agamous-like MADS-box protein [Prunus pseudocerasus]
Length=240

 Score = 53.1 bits (126),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 22/32 (69%), Positives = 25/32 (78%), Gaps = 0/32 (0%)
 Frame = +3

Query  939   CLVDIMIKTLERYQKCNYGTPETNISTRDALS  1034
             C    M+KTLERYQKCNYG PETN+S R+AL 
Sbjct  58    CSSSSMLKTLERYQKCNYGAPETNVSAREALE  89



>gb|AET04966.2| MADS-box transcription factor [Medicago truncatula]
Length=242

 Score = 53.5 bits (127),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 22/31 (71%), Positives = 25/31 (81%), Gaps = 0/31 (0%)
 Frame = +3

Query  939   CLVDIMIKTLERYQKCNYGTPETNISTRDAL  1031
             C    M+KTLERYQKCNYG PETN+S R+AL
Sbjct  58    CSSSSMLKTLERYQKCNYGAPETNVSAREAL  88



>ref|XP_007039178.1| Uncharacterized protein isoform 3 [Theobroma cacao]
 gb|EOY23679.1| Uncharacterized protein isoform 3 [Theobroma cacao]
Length=861

 Score = 55.1 bits (131),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 25/46 (54%), Positives = 33/46 (72%), Gaps = 0/46 (0%)
 Frame = +3

Query  1008  NISTRDALSDLHGVSLAPSSLLGMATFIPPGQIAALHPFLMHQ*GV  1145
             N  T++    +  V +APSSLLGM T++PPGQ+ ALH F+MHQ GV
Sbjct  369   NAPTQNQNDHVSSVPIAPSSLLGMPTYLPPGQVTALHSFVMHQQGV  414



>emb|CDP05002.1| unnamed protein product [Coffea canephora]
Length=869

 Score = 54.7 bits (130),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 23/35 (66%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = +3

Query  1041  HGVSLAPSSLLGMATFIPPGQIAALHPFLMHQ*GV  1145
             HGV +APSSLLGM T++P GQ+ A+HPF++HQ GV
Sbjct  377   HGVPIAPSSLLGMPTYLPHGQMTAVHPFVVHQQGV  411



>gb|ADU56817.1| MADS-box protein AGL2 subfamily [Coffea arabica]
 emb|CDP13360.1| unnamed protein product [Coffea canephora]
Length=241

 Score = 53.1 bits (126),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 23/32 (72%), Positives = 25/32 (78%), Gaps = 0/32 (0%)
 Frame = +3

Query  939   CLVDIMIKTLERYQKCNYGTPETNISTRDALS  1034
             C    M+KTLERYQKCNYG PE NISTR+AL 
Sbjct  58    CSSSSMLKTLERYQKCNYGAPEPNISTREALE  89



>gb|AAO22982.1| MADS-box transcription factor CDM44 [Chrysanthemum x morifolium]
Length=249

 Score = 53.5 bits (127),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 22/31 (71%), Positives = 25/31 (81%), Gaps = 0/31 (0%)
 Frame = +3

Query  939   CLVDIMIKTLERYQKCNYGTPETNISTRDAL  1031
             C    M+KTLERYQKCNYG PETN+S R+AL
Sbjct  58    CSSSSMLKTLERYQKCNYGAPETNVSAREAL  88



>gb|AAP83366.1| SEPALLATA3-like MADS-box [Antirrhinum majus]
Length=204

 Score = 52.8 bits (125),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 21/26 (81%), Positives = 24/26 (92%), Gaps = 0/26 (0%)
 Frame = +3

Query  954   MIKTLERYQKCNYGTPETNISTRDAL  1031
             M+KTLERYQKCNYG PE N+STR+AL
Sbjct  25    MLKTLERYQKCNYGAPEANVSTREAL  50



>ref|XP_008222191.1| PREDICTED: agamous-like MADS-box protein AGL9 homolog [Prunus 
mume]
Length=240

 Score = 53.1 bits (126),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 22/32 (69%), Positives = 25/32 (78%), Gaps = 0/32 (0%)
 Frame = +3

Query  939   CLVDIMIKTLERYQKCNYGTPETNISTRDALS  1034
             C    M+KTLERYQKCNYG PETN+S R+AL 
Sbjct  58    CSSSSMLKTLERYQKCNYGAPETNVSAREALE  89



>ref|XP_009372255.1| PREDICTED: agamous-like MADS-box protein AGL9 homolog isoform 
X1 [Pyrus x bretschneideri]
Length=264

 Score = 53.5 bits (127),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 22/32 (69%), Positives = 26/32 (81%), Gaps = 0/32 (0%)
 Frame = +3

Query  939   CLVDIMIKTLERYQKCNYGTPETNISTRDALS  1034
             C    M+KTL+RYQKCNYG PETN+STR+AL 
Sbjct  58    CSSSSMLKTLDRYQKCNYGAPETNVSTREALE  89



>ref|XP_007223808.1| hypothetical protein PRUPE_ppa010679mg [Prunus persica]
 gb|ABO27621.1| transcription factor MADS5 [Prunus persica]
 gb|EMJ25007.1| hypothetical protein PRUPE_ppa010679mg [Prunus persica]
Length=240

 Score = 53.1 bits (126),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 22/32 (69%), Positives = 25/32 (78%), Gaps = 0/32 (0%)
 Frame = +3

Query  939   CLVDIMIKTLERYQKCNYGTPETNISTRDALS  1034
             C    M+KTLERYQKCNYG PETN+S R+AL 
Sbjct  58    CSSSSMLKTLERYQKCNYGAPETNVSAREALE  89



>gb|AAR01779.1| MADS-box protein [Prunus dulcis]
Length=247

 Score = 53.1 bits (126),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 22/31 (71%), Positives = 25/31 (81%), Gaps = 0/31 (0%)
 Frame = +3

Query  939   CLVDIMIKTLERYQKCNYGTPETNISTRDAL  1031
             C    M+KTLERYQKCNYG PETN+S R+AL
Sbjct  49    CSSSSMLKTLERYQKCNYGAPETNVSAREAL  79



>ref|XP_006352168.1| PREDICTED: agamous-like MADS-box protein AGL9 homolog [Solanum 
tuberosum]
Length=241

 Score = 53.1 bits (126),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 23/32 (72%), Positives = 25/32 (78%), Gaps = 0/32 (0%)
 Frame = +3

Query  939   CLVDIMIKTLERYQKCNYGTPETNISTRDALS  1034
             C    M+KTLERYQKCNYG PE NISTR+AL 
Sbjct  58    CSSSSMLKTLERYQKCNYGAPEPNISTREALE  89



>ref|NP_001234384.1| agamous-like MADS-box protein AGL9 homolog [Solanum lycopersicum]
 gb|AAP57413.1| MADS-box protein 5 [Solanum lycopersicum]
Length=241

 Score = 53.1 bits (126),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 23/32 (72%), Positives = 25/32 (78%), Gaps = 0/32 (0%)
 Frame = +3

Query  939   CLVDIMIKTLERYQKCNYGTPETNISTRDALS  1034
             C    M+KTLERYQKCNYG PE NISTR+AL 
Sbjct  58    CSSSSMLKTLERYQKCNYGAPEPNISTREALE  89



>gb|KGN46460.1| hypothetical protein Csa_6G095270 [Cucumis sativus]
Length=180

 Score = 52.0 bits (123),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 21/27 (78%), Positives = 24/27 (89%), Gaps = 0/27 (0%)
 Frame = +3

Query  954   MIKTLERYQKCNYGTPETNISTRDALS  1034
             M+KTLERYQKCNYG PE N+STR+AL 
Sbjct  1     MLKTLERYQKCNYGAPEPNVSTREALE  27



>gb|ABQ59277.2| sepallata 3-like MADS box protein [Eustoma exaltatum subsp. russellianum]
Length=204

 Score = 52.4 bits (124),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 22/32 (69%), Positives = 25/32 (78%), Gaps = 0/32 (0%)
 Frame = +3

Query  939   CLVDIMIKTLERYQKCNYGTPETNISTRDALS  1034
             C    M+KTLERYQKCNYG PE N+STR+AL 
Sbjct  24    CSSSSMLKTLERYQKCNYGAPEPNMSTREALE  55



>ref|XP_010091186.1| hypothetical protein L484_002581 [Morus notabilis]
 gb|EXB43113.1| hypothetical protein L484_002581 [Morus notabilis]
Length=840

 Score = 54.3 bits (129),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 26/49 (53%), Positives = 36/49 (73%), Gaps = 2/49 (4%)
 Frame = +3

Query  999   PETNISTRDALSDLHGVSLAPSSLLGMATFIPPGQIAALHPFLMHQ*GV  1145
             P  N ST+  +  + GV + PSS+LGM +++PPGQ+ ALHPF+MHQ GV
Sbjct  361   PTGNSSTQ--IDHVAGVPIPPSSILGMPSYLPPGQLTALHPFVMHQQGV  407



>ref|XP_003575601.2| PREDICTED: uncharacterized protein LOC100839238 [Brachypodium 
distachyon]
Length=226

 Score = 52.8 bits (125),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 25/41 (61%), Positives = 29/41 (71%), Gaps = 0/41 (0%)
 Frame = +2

Query  824  DELEIVGRCLGKRGGYSGTSVLVRNKLTGELIAEGRHSLFG  946
            D+L IV R LG +G YSGT VL  N   G ++AEGRHSLFG
Sbjct  165  DKLCIVARALGHKGAYSGTHVLFTNAGNGRVVAEGRHSLFG  205



>ref|NP_001280756.1| agamous-like MADS-box protein AGL9 homolog [Malus domestica]
 ref|XP_008389896.1| PREDICTED: agamous-like MADS-box protein AGL9 homolog [Malus 
domestica]
 ref|XP_008350960.1| PREDICTED: agamous-like MADS-box protein AGL9 homolog [Malus 
domestica]
 gb|ADL36740.1| MADS domain class transcription factor [Malus domestica]
Length=239

 Score = 52.8 bits (125),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 23/32 (72%), Positives = 25/32 (78%), Gaps = 0/32 (0%)
 Frame = +3

Query  939   CLVDIMIKTLERYQKCNYGTPETNISTRDALS  1034
             C     +KTLERYQKCNYG PETNISTR+AL 
Sbjct  58    CSSSSTLKTLERYQKCNYGAPETNISTREALE  89



>ref|XP_008459849.1| PREDICTED: agamous-like MADS-box protein AGL9 homolog isoform 
X2 [Cucumis melo]
Length=228

 Score = 52.4 bits (124),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 22/32 (69%), Positives = 25/32 (78%), Gaps = 0/32 (0%)
 Frame = +3

Query  939   CLVDIMIKTLERYQKCNYGTPETNISTRDALS  1034
             C    M+KTLERYQKCNYG PE N+STR+AL 
Sbjct  58    CSSSSMLKTLERYQKCNYGAPEPNVSTREALE  89



>gb|AAP83364.1| SEPALLATA3-like MADS-box [Antirrhinum majus]
Length=212

 Score = 52.4 bits (124),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 22/31 (71%), Positives = 25/31 (81%), Gaps = 0/31 (0%)
 Frame = +3

Query  939   CLVDIMIKTLERYQKCNYGTPETNISTRDAL  1031
             C    M+ TLERYQKCNYG PETN+STR+AL
Sbjct  28    CSSTSMLNTLERYQKCNYGPPETNVSTREAL  58



>ref|XP_004140534.1| PREDICTED: agamous-like MADS-box protein AGL9 homolog [Cucumis 
sativus]
Length=242

 Score = 52.8 bits (125),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 22/32 (69%), Positives = 25/32 (78%), Gaps = 0/32 (0%)
 Frame = +3

Query  939   CLVDIMIKTLERYQKCNYGTPETNISTRDALS  1034
             C    M+KTLERYQKCNYG PE N+STR+AL 
Sbjct  58    CSSSSMLKTLERYQKCNYGAPEPNVSTREALE  89



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 3345061407520