BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c25581_g1_i2 len=3028 path=[2619:0-240 2860:241-292 2912:293-301
2921:302-372 9226:373-400 3020:401-445 10001:446-516 3135:517-543
3161:544-544 3162:545-708 3323:709-724 1758:725-757 3371:758-764
345:765-795 855:796-796 10128:797-807 10139:808-882 942:883-904
964:905-910 970:911-951 10246:952-966 1851:967-1009 10264:1010-1029
10284:1030-1050 3656:1051-1065 1010:1066-1084 1363:1085-1113
10425:1114-1122 2591:1123-1165 3766:1166-1264 @2311@!:1265-1997
4597:1998-3027]

Length=3028
                                                                      Score     E

emb|CDP20610.1|  unnamed protein product                                509   4e-163   
ref|XP_009773751.1|  PREDICTED: wall-associated receptor kinase-l...    507   2e-162   
ref|XP_009627286.1|  PREDICTED: wall-associated receptor kinase-l...    500   6e-160   
emb|CDP11258.1|  unnamed protein product                                493   2e-156   
ref|XP_006365061.1|  PREDICTED: wall-associated receptor kinase-l...    488   2e-155   
ref|XP_010317039.1|  PREDICTED: wall-associated receptor kinase-l...    483   3e-153   
ref|XP_002274809.1|  PREDICTED: wall-associated receptor kinase-l...    473   3e-149   Vitis vinifera
ref|XP_007035467.1|  Wall associated kinase-like 6, putative            474   5e-149   
gb|KDP41423.1|  hypothetical protein JCGZ_15830                         458   1e-148   
ref|XP_010663520.1|  PREDICTED: wall-associated receptor kinase-l...    469   7e-148   
ref|XP_011082236.1|  PREDICTED: wall-associated receptor kinase-l...    470   9e-148   
ref|XP_006368666.1|  hypothetical protein POPTR_0001s07550g             468   1e-147   
ref|XP_002297684.2|  wall-associated kinase family protein              467   7e-147   Populus trichocarpa [western balsam poplar]
emb|CDP20609.1|  unnamed protein product                                466   1e-146   
ref|XP_011082237.1|  PREDICTED: wall-associated receptor kinase-l...    466   1e-146   
ref|XP_008222638.1|  PREDICTED: wall-associated receptor kinase-l...    463   6e-146   
ref|XP_002513974.1|  kinase, putative                                   463   8e-146   Ricinus communis
ref|XP_007224001.1|  hypothetical protein PRUPE_ppa014914mg             462   9e-146   
ref|XP_006368673.1|  hypothetical protein POPTR_0001s076201g            462   1e-145   
ref|XP_011013612.1|  PREDICTED: wall-associated receptor kinase-l...    464   1e-145   
ref|XP_006368665.1|  hypothetical protein POPTR_0001s07540g             461   1e-145   
ref|XP_008222635.1|  PREDICTED: wall-associated receptor kinase-l...    462   2e-145   
ref|XP_008229710.1|  PREDICTED: wall-associated receptor kinase-l...    461   3e-145   
ref|XP_010663521.1|  PREDICTED: wall-associated receptor kinase-l...    461   3e-145   
ref|XP_002297682.1|  kinase family protein                              463   5e-145   Populus trichocarpa [western balsam poplar]
ref|XP_011011597.1|  PREDICTED: wall-associated receptor kinase-l...    462   5e-145   
ref|XP_007226334.1|  hypothetical protein PRUPE_ppa022257mg             460   5e-145   
ref|XP_011034597.1|  PREDICTED: wall-associated receptor kinase-l...    462   9e-145   
ref|XP_007035468.1|  Wall associated kinase-like 6, putative            459   6e-144   
ref|XP_008222637.1|  PREDICTED: wall-associated receptor kinase-l...    459   9e-144   
ref|XP_010023385.1|  PREDICTED: wall-associated receptor kinase-l...    458   3e-143   
ref|XP_006388140.1|  hypothetical protein POPTR_0316s00220g             446   4e-143   
ref|XP_010038779.1|  PREDICTED: wall-associated receptor kinase-l...    457   6e-143   
emb|CDP19182.1|  unnamed protein product                                452   8e-143   
ref|XP_010038777.1|  PREDICTED: wall-associated receptor kinase-l...    456   1e-142   
gb|KCW47712.1|  hypothetical protein EUGRSUZ_K01459                     454   2e-142   
ref|XP_011011593.1|  PREDICTED: wall-associated receptor kinase-l...    456   2e-142   
ref|XP_011034598.1|  PREDICTED: wall-associated receptor kinase-l...    455   4e-142   
ref|XP_008342477.1|  PREDICTED: wall-associated receptor kinase-l...    454   4e-142   
gb|KCW47714.1|  hypothetical protein EUGRSUZ_K01462                     453   5e-142   
ref|XP_011082235.1|  PREDICTED: wall-associated receptor kinase-l...    454   8e-142   
ref|XP_007217600.1|  hypothetical protein PRUPE_ppa018374mg             452   1e-141   
gb|KCW81737.1|  hypothetical protein EUGRSUZ_C03090                     450   1e-141   
ref|XP_002513972.1|  kinase, putative                                   453   2e-141   Ricinus communis
ref|XP_011011594.1|  PREDICTED: wall-associated receptor kinase-l...    453   2e-141   
ref|XP_008229606.1|  PREDICTED: wall-associated receptor kinase-l...    453   2e-141   
ref|XP_003634276.1|  PREDICTED: wall-associated receptor kinase-l...    451   5e-141   
ref|XP_011017594.1|  PREDICTED: wall-associated receptor kinase-l...    439   1e-140   
ref|XP_002297686.2|  putative wall-associated kinase family protein     449   1e-140   Populus trichocarpa [western balsam poplar]
ref|XP_006492008.1|  PREDICTED: putative wall-associated receptor...    441   1e-140   
ref|XP_006388660.1|  hypothetical protein POPTR_0126s00200g             448   2e-140   
ref|XP_010041300.1|  PREDICTED: wall-associated receptor kinase-l...    447   5e-140   
ref|XP_006387117.1|  hypothetical protein POPTR_1809s00200g             449   6e-140   
gb|KDO58193.1|  hypothetical protein CISIN_1g0431572mg                  438   7e-140   
ref|XP_006441113.1|  hypothetical protein CICLE_v10020606mg             436   9e-140   
ref|XP_004486489.1|  PREDICTED: wall-associated receptor kinase-l...    448   1e-139   
ref|XP_006465432.1|  PREDICTED: wall-associated receptor kinase-l...    449   1e-139   
ref|XP_002274962.1|  PREDICTED: wall-associated receptor kinase-l...    447   1e-139   Vitis vinifera
gb|KDO65456.1|  hypothetical protein CISIN_1g0053552mg                  435   2e-139   
gb|KDO65458.1|  hypothetical protein CISIN_1g014725mg                   436   2e-139   
ref|XP_010036178.1|  PREDICTED: wall-associated receptor kinase-l...    447   4e-139   
ref|XP_006487806.1|  PREDICTED: wall-associated receptor kinase-l...    438   5e-139   
ref|XP_006372236.1|  hypothetical protein POPTR_0018s14500g             446   5e-139   
ref|XP_006492001.1|  PREDICTED: putative wall-associated receptor...    438   1e-138   
gb|KDO38339.1|  hypothetical protein CISIN_1g038345mg                   444   2e-138   
ref|XP_002511965.1|  kinase, putative                                   445   2e-138   Ricinus communis
ref|XP_006490105.1|  PREDICTED: wall-associated receptor kinase-l...    444   2e-138   
ref|XP_006492003.1|  PREDICTED: putative wall-associated receptor...    437   4e-138   
ref|XP_011017593.1|  PREDICTED: wall-associated receptor kinase-l...    444   5e-138   
ref|XP_006441121.1|  hypothetical protein CICLE_v10023277mg             432   6e-138   
ref|XP_002297680.2|  hypothetical protein POPTR_0001s032402g            437   6e-138   Populus trichocarpa [western balsam poplar]
ref|XP_011013617.1|  PREDICTED: wall-associated receptor kinase-l...    431   7e-138   
ref|XP_010051299.1|  PREDICTED: wall-associated receptor kinase-l...    447   7e-138   
ref|XP_010039081.1|  PREDICTED: wall-associated receptor kinase-l...    438   1e-137   
emb|CAN65982.1|  hypothetical protein VITISV_017971                     441   1e-137   Vitis vinifera
ref|XP_008229715.1|  PREDICTED: wall-associated receptor kinase-l...    432   2e-137   
gb|KFK42442.1|  hypothetical protein AALP_AA2G257100                    434   2e-137   
ref|XP_004305856.1|  PREDICTED: wall-associated receptor kinase-l...    443   2e-137   
ref|XP_006372237.1|  hypothetical protein POPTR_0018s14510g             442   2e-137   
gb|KDP41424.1|  hypothetical protein JCGZ_15831                         442   2e-137   
ref|XP_010051290.1|  PREDICTED: LOW QUALITY PROTEIN: wall-associa...    448   3e-137   
ref|XP_006421680.1|  hypothetical protein CICLE_v10006431mg             431   3e-137   
gb|KCW47715.1|  hypothetical protein EUGRSUZ_K01465                     437   6e-137   
ref|XP_010247759.1|  PREDICTED: wall-associated receptor kinase-l...    431   6e-137   
ref|XP_010532063.1|  PREDICTED: wall-associated receptor kinase-l...    443   7e-137   
ref|XP_011013615.1|  PREDICTED: wall-associated receptor kinase-l...    441   7e-137   
gb|KCW48948.1|  hypothetical protein EUGRSUZ_K02557                     437   8e-137   
ref|XP_011013613.1|  PREDICTED: wall-associated receptor kinase-l...    441   1e-136   
ref|XP_004305858.1|  PREDICTED: wall-associated receptor kinase-l...    429   1e-136   
ref|XP_010269806.1|  PREDICTED: wall-associated receptor kinase-l...    449   1e-136   
ref|XP_006427112.1|  hypothetical protein CICLE_v10025130mg             437   1e-136   
ref|XP_011034599.1|  PREDICTED: wall-associated receptor kinase-l...    439   1e-136   
gb|KCW81782.1|  hypothetical protein EUGRSUZ_C03141                     437   2e-136   
ref|XP_008229608.1|  PREDICTED: wall-associated receptor kinase-l...    440   3e-136   
ref|XP_010088575.1|  Wall-associated receptor kinase-like 9             439   3e-136   
ref|XP_010532062.1|  PREDICTED: wall-associated receptor kinase-l...    440   3e-136   
ref|XP_006490107.1|  PREDICTED: wall-associated receptor kinase-l...    439   3e-136   
ref|XP_010519689.1|  PREDICTED: wall-associated receptor kinase-l...    439   3e-136   
ref|XP_006427111.1|  hypothetical protein CICLE_v10025047mg             437   5e-136   
emb|CAN82287.1|  hypothetical protein VITISV_028337                     427   5e-136   Vitis vinifera
gb|KCW89810.1|  hypothetical protein EUGRSUZ_A02052                     433   6e-136   
gb|KDO45148.1|  hypothetical protein CISIN_1g042371mg                   427   6e-136   
ref|XP_008229712.1|  PREDICTED: wall-associated receptor kinase-l...    429   6e-136   
ref|XP_010497637.1|  PREDICTED: wall-associated receptor kinase-l...    431   6e-136   
ref|XP_006495309.1|  PREDICTED: wall-associated receptor kinase-l...    437   9e-136   
ref|XP_010663523.1|  PREDICTED: wall-associated receptor kinase-l...    437   1e-135   
ref|XP_006421677.1|  hypothetical protein CICLE_v10004476mg             436   1e-135   
gb|KDO36626.1|  hypothetical protein CISIN_1g038707mg                   433   1e-135   
ref|XP_006471186.1|  PREDICTED: wall-associated receptor kinase-l...    426   1e-135   
ref|XP_003594614.1|  Wall-associated receptor kinase-like protein       437   2e-135   
ref|XP_010648088.1|  PREDICTED: wall-associated receptor kinase-l...    438   2e-135   
ref|XP_006421687.1|  hypothetical protein CICLE_v10004431mg             437   2e-135   
gb|KDO65453.1|  hypothetical protein CISIN_1g005492mg                   436   3e-135   
ref|XP_006427110.1|  hypothetical protein CICLE_v10025012mg             436   4e-135   
ref|XP_010040708.1|  PREDICTED: wall-associated receptor kinase-l...    426   4e-135   
ref|XP_006490106.1|  PREDICTED: wall-associated receptor kinase-l...    437   4e-135   
emb|CAN70207.1|  hypothetical protein VITISV_007744                     434   4e-135   Vitis vinifera
ref|XP_010545975.1|  PREDICTED: wall-associated receptor kinase-l...    437   5e-135   
ref|XP_003594613.1|  Wall-associated receptor kinase-like protein       435   5e-135   
gb|KCW47673.1|  hypothetical protein EUGRSUZ_K01412                     434   9e-135   
ref|XP_010497625.1|  PREDICTED: wall-associated receptor kinase-l...    431   1e-134   
ref|XP_006388915.1|  hypothetical protein POPTR_0075s00200g             425   1e-134   
ref|XP_010023309.1|  PREDICTED: wall-associated receptor kinase-l...    433   2e-134   
ref|XP_010037267.1|  PREDICTED: wall-associated receptor kinase-l...    434   2e-134   
ref|XP_006490104.1|  PREDICTED: putative wall-associated receptor...    434   2e-134   
gb|ABI97350.1|  cold-induced wall associated kinase                     424   3e-134   Ammopiptanthus mongolicus
ref|XP_007147446.1|  hypothetical protein PHAVU_006G125300g             433   3e-134   
ref|XP_007147445.1|  hypothetical protein PHAVU_006G125300g             432   3e-134   
ref|XP_006388916.1|  hypothetical protein POPTR_0075s00210g             439   3e-134   
ref|XP_011018200.1|  PREDICTED: wall-associated receptor kinase-l...    429   5e-134   
ref|XP_004306285.1|  PREDICTED: wall-associated receptor kinase-l...    434   5e-134   
ref|XP_006465431.1|  PREDICTED: wall-associated receptor kinase-l...    434   6e-134   
ref|XP_008229610.1|  PREDICTED: wall-associated receptor kinase-l...    432   6e-134   
ref|XP_006385943.1|  hypothetical protein POPTR_0003s18440g             430   7e-134   
ref|XP_003534786.1|  PREDICTED: wall-associated receptor kinase-l...    432   7e-134   
ref|XP_006388728.1|  hypothetical protein POPTR_0112s00230g             432   8e-134   
emb|CDX91964.1|  BnaC03g32660D                                          430   9e-134   
ref|XP_010038763.1|  PREDICTED: wall-associated receptor kinase-l...    432   1e-133   
ref|XP_010497632.1|  PREDICTED: wall-associated receptor kinase-l...    428   1e-133   
ref|XP_010648089.1|  PREDICTED: wall-associated receptor kinase-l...    431   1e-133   
emb|CBI15393.3|  unnamed protein product                                441   2e-133   
ref|XP_011015192.1|  PREDICTED: wall-associated receptor kinase-l...    430   3e-133   
ref|XP_007216118.1|  hypothetical protein PRUPE_ppa018817mg             430   5e-133   
gb|KCW47701.1|  hypothetical protein EUGRSUZ_K01439                     432   5e-133   
emb|CAN65309.1|  hypothetical protein VITISV_043466                     419   6e-133   Vitis vinifera
gb|KDO44467.1|  hypothetical protein CISIN_1g017262mg                   418   6e-133   
ref|XP_011020553.1|  PREDICTED: wall-associated receptor kinase-l...    430   6e-133   
gb|KFK36623.1|  hypothetical protein AALP_AA4G147800                    422   8e-133   
ref|XP_004306021.1|  PREDICTED: wall-associated receptor kinase-l...    422   9e-133   
gb|KCW81760.1|  hypothetical protein EUGRSUZ_C03125                     426   1e-132   
ref|XP_010277643.1|  PREDICTED: LOW QUALITY PROTEIN: wall-associa...    419   2e-132   
ref|XP_004305857.1|  PREDICTED: wall-associated receptor kinase-l...    429   2e-132   
ref|XP_010051307.1|  PREDICTED: wall-associated receptor kinase-l...    437   2e-132   
ref|XP_006431668.1|  hypothetical protein CICLE_v10003989mg             416   2e-132   
ref|XP_006368674.1|  hypothetical protein POPTR_0001s07630g             417   3e-132   
emb|CDX79334.1|  BnaC06g19690D                                          427   3e-132   
ref|NP_177131.1|  wall-associated receptor kinase-like 9                431   3e-132   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009356568.1|  PREDICTED: wall-associated receptor kinase-l...    429   4e-132   
ref|XP_002889263.1|  hypothetical protein ARALYDRAFT_477143             419   5e-132   
gb|KHN14302.1|  Wall-associated receptor kinase-like 9                  426   5e-132   
gb|KDO44465.1|  hypothetical protein CISIN_1g041043mg                   426   5e-132   
ref|XP_008380153.1|  PREDICTED: wall-associated receptor kinase-l...    429   6e-132   
ref|XP_010663682.1|  PREDICTED: wall-associated receptor kinase-l...    427   6e-132   
ref|XP_006490219.1|  PREDICTED: wall-associated receptor kinase-l...    437   6e-132   
emb|CAN64181.1|  hypothetical protein VITISV_007799                     427   7e-132   Vitis vinifera
ref|XP_010039746.1|  PREDICTED: wall-associated receptor kinase-l...    428   8e-132   
ref|XP_006465430.1|  PREDICTED: wall-associated receptor kinase-l...    427   8e-132   
ref|XP_010648093.1|  PREDICTED: wall-associated receptor kinase-l...    415   9e-132   
ref|XP_010497621.1|  PREDICTED: wall-associated receptor kinase-l...    428   9e-132   
ref|XP_006495029.1|  PREDICTED: wall-associated receptor kinase-l...    427   1e-131   
gb|KCW44987.1|  hypothetical protein EUGRSUZ_L01427                     425   2e-131   
gb|KCW81743.1|  hypothetical protein EUGRSUZ_C03101                     433   3e-131   
ref|XP_006427114.1|  hypothetical protein CICLE_v10024995mg             426   3e-131   
ref|XP_004309764.1|  PREDICTED: wall-associated receptor kinase-l...    429   3e-131   
ref|XP_010051297.1|  PREDICTED: wall-associated receptor kinase-l...    420   3e-131   
ref|XP_010051334.1|  PREDICTED: wall-associated receptor kinase-l...    433   5e-131   
ref|XP_006427113.1|  hypothetical protein CICLE_v10024995mg             425   6e-131   
ref|XP_010038783.1|  PREDICTED: LOW QUALITY PROTEIN: wall-associa...    420   6e-131   
ref|XP_010476712.1|  PREDICTED: wall-associated receptor kinase-l...    426   6e-131   
gb|KDO58195.1|  hypothetical protein CISIN_1g036483mg                   425   7e-131   
gb|KCW44989.1|  hypothetical protein EUGRSUZ_L014281                    413   7e-131   
ref|XP_010049240.1|  PREDICTED: wall-associated receptor kinase-l...    425   8e-131   
ref|XP_007217163.1|  hypothetical protein PRUPE_ppa002047mg             424   9e-131   
ref|XP_006586859.1|  PREDICTED: wall-associated receptor kinase-l...    425   9e-131   
ref|XP_008380329.1|  PREDICTED: wall-associated receptor kinase-l...    424   1e-130   
ref|XP_010512026.1|  PREDICTED: wall-associated receptor kinase-l...    426   1e-130   
ref|XP_008229609.1|  PREDICTED: wall-associated receptor kinase-l...    424   2e-130   
gb|KHN44655.1|  Wall-associated receptor kinase-like 9                  424   2e-130   
ref|XP_006492600.1|  PREDICTED: wall-associated receptor kinase-l...    420   2e-130   
ref|XP_010512027.1|  PREDICTED: wall-associated receptor kinase-l...    426   3e-130   
ref|XP_006441119.1|  hypothetical protein CICLE_v10019288mg             415   4e-130   
ref|XP_007211126.1|  hypothetical protein PRUPE_ppa025607mg             422   4e-130   
ref|XP_007216280.1|  hypothetical protein PRUPE_ppa019342mg             432   5e-130   
ref|XP_010030448.1|  PREDICTED: wall-associated receptor kinase-l...    414   5e-130   
ref|XP_010036179.1|  PREDICTED: wall-associated receptor kinase-l...    417   5e-130   
gb|KDO41534.1|  hypothetical protein CISIN_1g0470382mg                  411   6e-130   
emb|CDX67982.1|  BnaA07g20220D                                          424   6e-130   
ref|XP_006300756.1|  hypothetical protein CARUB_v10019823mg             424   7e-130   
ref|XP_006431624.1|  hypothetical protein CICLE_v10003390mg             421   8e-130   
ref|XP_004306301.1|  PREDICTED: wall-associated receptor kinase-l...    423   9e-130   
gb|KFK42488.1|  hypothetical protein AALP_AA2G263200                    419   9e-130   
ref|XP_011078212.1|  PREDICTED: wall-associated receptor kinase-l...    422   1e-129   
ref|XP_010459150.1|  PREDICTED: wall-associated receptor kinase-l...    422   1e-129   
ref|XP_010273366.1|  PREDICTED: wall-associated receptor kinase-l...    435   1e-129   
ref|XP_004295611.1|  PREDICTED: wall-associated receptor kinase 2...    422   1e-129   
ref|XP_006388727.1|  hypothetical protein POPTR_0112s00220g             410   1e-129   
ref|XP_006441112.1|  hypothetical protein CICLE_v10024076mg             421   2e-129   
gb|KCW47700.1|  hypothetical protein EUGRSUZ_K01438                     421   2e-129   
ref|XP_010415630.1|  PREDICTED: wall-associated receptor kinase-l...    423   2e-129   
ref|XP_009104507.1|  PREDICTED: wall-associated receptor kinase-l...    423   3e-129   
gb|KHN44654.1|  Wall-associated receptor kinase-like 8                  419   4e-129   
emb|CBI15571.3|  unnamed protein product                                426   5e-129   
ref|XP_011078223.1|  PREDICTED: wall-associated receptor kinase-l...    419   7e-129   
emb|CDY15528.1|  BnaA08g28120D                                          420   9e-129   
ref|XP_003534789.2|  PREDICTED: wall-associated receptor kinase-l...    419   1e-128   
ref|XP_006492575.1|  PREDICTED: wall-associated receptor kinase-l...    415   1e-128   
ref|XP_010474237.1|  PREDICTED: wall-associated receptor kinase-l...    421   1e-128   
ref|XP_010051379.1|  PREDICTED: wall-associated receptor kinase-l...    426   2e-128   
gb|KCW89818.1|  hypothetical protein EUGRSUZ_A02062                     416   2e-128   
ref|XP_007217318.1|  hypothetical protein PRUPE_ppa017167mg             418   2e-128   
ref|XP_003534784.1|  PREDICTED: wall-associated receptor kinase-l...    417   2e-128   
ref|XP_010279502.1|  PREDICTED: putative wall-associated receptor...    414   2e-128   
gb|KCW47702.1|  hypothetical protein EUGRSUZ_K01441                     418   2e-128   
ref|XP_007034139.1|  Wall associated kinase-like 6, putative            423   3e-128   
ref|XP_010673947.1|  PREDICTED: wall-associated receptor kinase-l...    419   3e-128   
ref|XP_006385945.1|  hypothetical protein POPTR_0003s18470g             405   4e-128   
emb|CDX79336.1|  BnaC06g19670D                                          419   5e-128   
ref|XP_010476715.1|  PREDICTED: wall-associated receptor kinase-l...    417   6e-128   
gb|AAY86486.1|  RFO1                                                    418   7e-128   Arabidopsis thaliana [mouse-ear cress]
ref|NP_849908.1|  wall-associated receptor kinase-like 22               416   9e-128   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009111072.1|  PREDICTED: wall-associated receptor kinase-l...    418   9e-128   
ref|XP_010051317.1|  PREDICTED: wall-associated receptor kinase-l...    424   1e-127   
ref|XP_010051335.1|  PREDICTED: wall-associated receptor kinase-l...    422   1e-127   
ref|XP_010516829.1|  PREDICTED: wall-associated receptor kinase-l...    419   1e-127   
ref|XP_002264469.1|  PREDICTED: wall-associated receptor kinase-l...    416   2e-127   Vitis vinifera
ref|XP_009119474.1|  PREDICTED: wall-associated receptor kinase-l...    418   2e-127   
ref|XP_010476714.1|  PREDICTED: wall-associated receptor kinase-l...    416   2e-127   
ref|XP_009106691.1|  PREDICTED: wall-associated receptor kinase-l...    417   2e-127   
ref|XP_011020556.1|  PREDICTED: wall-associated receptor kinase-l...    416   2e-127   
ref|XP_003534785.1|  PREDICTED: wall-associated receptor kinase-l...    416   2e-127   
ref|XP_010417636.1|  PREDICTED: wall-associated receptor kinase-l...    417   2e-127   
gb|KDO39343.1|  hypothetical protein CISIN_1g044312mg                   412   3e-127   
gb|KCW80259.1|  hypothetical protein EUGRSUZ_C01607                     404   3e-127   
ref|XP_010459161.1|  PREDICTED: wall-associated receptor kinase-l...    415   3e-127   
ref|NP_178085.1|  wall-associated receptor kinase-like 22               416   3e-127   Arabidopsis thaliana [mouse-ear cress]
gb|KHN40782.1|  Wall-associated receptor kinase-like 22                 414   3e-127   
ref|XP_006441115.1|  hypothetical protein CICLE_v10024305mg             412   3e-127   
ref|XP_010489203.1|  PREDICTED: wall-associated receptor kinase-l...    417   3e-127   
ref|XP_006297043.1|  hypothetical protein CARUB_v10013039mg             416   3e-127   
ref|XP_002304841.2|  putative wall-associated kinase family protein     415   3e-127   Populus trichocarpa [western balsam poplar]
ref|XP_006492574.1|  PREDICTED: wall-associated receptor kinase-l...    414   4e-127   
gb|KHN44650.1|  Wall-associated receptor kinase-like 8                  415   4e-127   
ref|XP_006427115.1|  hypothetical protein CICLE_v10027068mg             412   4e-127   
ref|XP_011095036.1|  PREDICTED: wall-associated receptor kinase 2...    417   4e-127   
gb|KCW54558.1|  hypothetical protein EUGRSUZ_I00517                     415   4e-127   
ref|XP_009106689.1|  PREDICTED: wall-associated receptor kinase-l...    415   6e-127   
ref|XP_010030450.1|  PREDICTED: wall-associated receptor kinase-l...    415   7e-127   
gb|KDP41932.1|  hypothetical protein JCGZ_26950                         413   7e-127   
ref|XP_008383460.1|  PREDICTED: wall-associated receptor kinase 2...    417   9e-127   
ref|XP_010023371.1|  PREDICTED: wall-associated receptor kinase-l...    414   9e-127   
ref|XP_007147591.1|  hypothetical protein PHAVU_006G137500g             414   1e-126   
ref|XP_010269758.1|  PREDICTED: wall-associated receptor kinase-l...    412   1e-126   
ref|XP_004306243.1|  PREDICTED: putative wall-associated receptor...    416   1e-126   
ref|NP_178086.1|  wall-associated receptor kinase-like 10               415   1e-126   Arabidopsis thaliana [mouse-ear cress]
gb|KCW89817.1|  hypothetical protein EUGRSUZ_A02061                     413   1e-126   
ref|XP_010038775.1|  PREDICTED: wall-associated receptor kinase-l...    412   1e-126   
ref|XP_010040706.1|  PREDICTED: wall-associated receptor kinase-l...    413   1e-126   
gb|KDO45151.1|  hypothetical protein CISIN_1g012214mg                   405   2e-126   
ref|XP_004306300.1|  PREDICTED: wall-associated receptor kinase-l...    410   2e-126   
gb|AAF18508.1|AC010924_21  Contains similarity to gb|AJ009696 wal...    411   2e-126   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006421683.1|  hypothetical protein CICLE_v10007060mg             412   2e-126   
ref|XP_010497671.1|  PREDICTED: wall-associated receptor kinase-l...    413   2e-126   
gb|KDO45153.1|  hypothetical protein CISIN_1g040763mg                   400   2e-126   
ref|XP_002304840.1|  putative wall-associated kinase family protein     412   2e-126   Populus trichocarpa [western balsam poplar]
ref|XP_009117775.1|  PREDICTED: wall-associated receptor kinase-l...    415   2e-126   
ref|XP_010088576.1|  Wall-associated receptor kinase-like 9             414   2e-126   
ref|XP_010023344.1|  PREDICTED: wall-associated receptor kinase-l...    412   2e-126   
ref|XP_007034133.1|  Wall associated kinase-like 6, putative            416   3e-126   
gb|KCW47711.1|  hypothetical protein EUGRSUZ_K01454                     410   3e-126   
ref|XP_010539015.1|  PREDICTED: wall-associated receptor kinase-l...    414   3e-126   
gb|AAF79451.1|AC025808_33  F18O14.11                                    415   3e-126   
ref|NP_173372.1|  putative wall-associated receptor kinase-like 11      414   4e-126   
ref|XP_006431622.1|  hypothetical protein CICLE_v10000464mg             411   4e-126   
ref|XP_003534747.2|  PREDICTED: wall-associated receptor kinase-l...    414   4e-126   
emb|CDP11263.1|  unnamed protein product                                403   5e-126   
ref|XP_004306284.1|  PREDICTED: wall-associated receptor kinase-l...    416   5e-126   
emb|CDX88557.1|  BnaC06g40010D                                          413   5e-126   
ref|XP_010065114.1|  PREDICTED: putative wall-associated receptor...    407   6e-126   
gb|KCW89815.1|  hypothetical protein EUGRSUZ_A02059                     411   6e-126   
ref|XP_010691611.1|  PREDICTED: wall-associated receptor kinase-l...    414   7e-126   
gb|KCW89814.1|  hypothetical protein EUGRSUZ_A02057                     411   8e-126   
ref|XP_010279596.1|  PREDICTED: wall-associated receptor kinase 3...    424   8e-126   
ref|XP_006471146.1|  PREDICTED: wall-associated receptor kinase-l...    400   8e-126   
ref|XP_010273346.1|  PREDICTED: wall-associated receptor kinase-l...    424   9e-126   
emb|CDP11264.1|  unnamed protein product                                400   1e-125   
ref|XP_006494617.1|  PREDICTED: wall-associated receptor kinase-l...    410   1e-125   
ref|XP_011020557.1|  PREDICTED: wall-associated receptor kinase-l...    410   1e-125   
ref|XP_010497676.1|  PREDICTED: wall-associated receptor kinase-l...    409   1e-125   
ref|XP_010472840.1|  PREDICTED: wall-associated receptor kinase-l...    410   2e-125   
ref|XP_006389860.1|  hypothetical protein EUTSA_v10018175mg             412   2e-125   
gb|KCW81759.1|  hypothetical protein EUGRSUZ_C031231                    396   3e-125   
ref|XP_010688575.1|  PREDICTED: wall-associated receptor kinase-l...    410   3e-125   
ref|NP_173063.1|  wall-associated receptor kinase-like 1                410   3e-125   
ref|XP_010472837.1|  PREDICTED: wall-associated receptor kinase-l...    411   3e-125   
ref|XP_010472836.1|  PREDICTED: wall-associated receptor kinase-l...    411   3e-125   
ref|XP_010460387.1|  PREDICTED: wall-associated receptor kinase-l...    407   3e-125   
ref|XP_011077656.1|  PREDICTED: wall-associated receptor kinase 2...    411   4e-125   
ref|XP_010438084.1|  PREDICTED: wall-associated receptor kinase-l...    408   4e-125   
ref|XP_010472841.1|  PREDICTED: wall-associated receptor kinase-l...    410   5e-125   
ref|XP_010038771.1|  PREDICTED: wall-associated receptor kinase-l...    398   5e-125   
ref|XP_010691609.1|  PREDICTED: wall-associated receptor kinase-l...    410   6e-125   
gb|KFK43950.1|  hypothetical protein AALP_AA1G195700                    408   6e-125   
ref|XP_007209854.1|  hypothetical protein PRUPE_ppa014824mg             409   6e-125   
ref|XP_010472838.1|  PREDICTED: wall-associated receptor kinase-l...    410   6e-125   
ref|XP_007147589.1|  hypothetical protein PHAVU_006G137300g             408   8e-125   
ref|XP_010041845.1|  PREDICTED: wall-associated receptor kinase 2...    410   8e-125   
ref|XP_009376854.1|  PREDICTED: wall-associated receptor kinase-l...    409   9e-125   
emb|CDX88558.1|  BnaC06g40020D                                          410   1e-124   
ref|XP_007217680.1|  hypothetical protein PRUPE_ppa021669mg             405   1e-124   
ref|XP_010038769.1|  PREDICTED: wall-associated receptor kinase-l...    397   1e-124   
ref|XP_002303870.2|  hypothetical protein POPTR_0003s18410g             407   1e-124   
ref|XP_004157111.1|  PREDICTED: wall-associated receptor kinase 2...    408   1e-124   
ref|XP_010472839.1|  PREDICTED: wall-associated receptor kinase-l...    410   2e-124   
ref|XP_010472833.1|  PREDICTED: wall-associated receptor kinase-l...    410   2e-124   
ref|XP_010497656.1|  PREDICTED: wall-associated receptor kinase-l...    408   2e-124   
ref|XP_009356575.1|  PREDICTED: wall-associated receptor kinase-l...    408   2e-124   
ref|XP_004145610.1|  PREDICTED: wall-associated receptor kinase 2...    408   2e-124   
ref|XP_006304509.1|  hypothetical protein CARUB_v10011311mg             409   3e-124   
gb|KFK44073.1|  hypothetical protein AALP_AA1G212600                    402   3e-124   
ref|XP_010050143.1|  PREDICTED: wall-associated receptor kinase-l...    395   3e-124   
ref|XP_010038782.1|  PREDICTED: wall-associated receptor kinase-l...    406   3e-124   
ref|XP_008365150.1|  PREDICTED: wall-associated receptor kinase 2...    409   4e-124   
ref|XP_006431663.1|  hypothetical protein CICLE_v10003315mg             400   4e-124   
ref|XP_002264514.2|  PREDICTED: wall-associated receptor kinase-l...    407   4e-124   
gb|KFK44074.1|  hypothetical protein AALP_AA1G212900                    395   4e-124   
ref|XP_011077655.1|  PREDICTED: wall-associated receptor kinase 5...    408   4e-124   
ref|XP_006383654.1|  hypothetical protein POPTR_0005s22500g             404   6e-124   
ref|XP_008229709.1|  PREDICTED: wall-associated receptor kinase-l...    408   6e-124   
ref|XP_002312857.1|  putative wall-associated kinase family protein     395   7e-124   
ref|XP_010459154.1|  PREDICTED: wall-associated receptor kinase-l...    407   8e-124   
ref|XP_007015316.1|  Kinase, Peptidoglycan-binding LysM, putative       406   8e-124   
ref|XP_010673953.1|  PREDICTED: wall-associated receptor kinase-l...    400   9e-124   
ref|XP_002893045.1|  hypothetical protein ARALYDRAFT_889371             408   1e-123   
ref|XP_008453036.1|  PREDICTED: wall-associated receptor kinase 2...    407   1e-123   
gb|KCW47709.1|  hypothetical protein EUGRSUZ_K01450                     406   1e-123   
ref|XP_008229614.1|  PREDICTED: wall-associated receptor kinase-l...    399   1e-123   
ref|XP_007216159.1|  hypothetical protein PRUPE_ppa015292mg             404   1e-123   
ref|XP_006416845.1|  hypothetical protein EUTSA_v10006943mg             405   1e-123   
ref|XP_010476722.1|  PREDICTED: wall-associated receptor kinase-l...    405   2e-123   
gb|KCW81763.1|  hypothetical protein EUGRSUZ_C03129                     412   2e-123   
ref|XP_009117542.1|  PREDICTED: putative wall-associated receptor...    407   2e-123   
ref|XP_010476719.1|  PREDICTED: wall-associated receptor kinase-l...    406   2e-123   
gb|KFK44075.1|  hypothetical protein AALP_AA1G212900                    397   2e-123   
ref|NP_173064.1|  wall-associated receptor kinase-like 2                406   2e-123   
ref|XP_008229686.1|  PREDICTED: wall-associated receptor kinase-l...    405   2e-123   
ref|XP_010051321.1|  PREDICTED: wall-associated receptor kinase-l...    412   2e-123   
gb|KFK28619.1|  hypothetical protein AALP_AA7G023000                    404   2e-123   
ref|XP_006372238.1|  hypothetical protein POPTR_0018s14520g             402   3e-123   
gb|AAF18509.1|AC010924_22  Contains similarity to gb|AJ009695 wal...    404   3e-123   
ref|XP_010438083.1|  PREDICTED: wall-associated receptor kinase-l...    407   3e-123   
gb|AAF18510.1|AC010924_23  Contains similarity to gb|AJ009695 wal...    403   5e-123   
ref|XP_010497664.1|  PREDICTED: wall-associated receptor kinase-l...    405   5e-123   
ref|XP_010432907.1|  PREDICTED: wall-associated receptor kinase-l...    406   5e-123   
ref|XP_006416508.1|  hypothetical protein EUTSA_v10006827mg             406   6e-123   
ref|NP_173076.1|  wall-associated receptor kinase-like 8                404   6e-123   
ref|XP_006306987.1|  hypothetical protein CARUB_v10008562mg             401   7e-123   
ref|XP_010447619.1|  PREDICTED: wall-associated receptor kinase-l...    406   7e-123   
ref|XP_004295935.1|  PREDICTED: wall-associated receptor kinase-l...    403   8e-123   
ref|XP_006416836.1|  hypothetical protein EUTSA_v10006974mg             402   8e-123   
ref|XP_009376845.1|  PREDICTED: wall-associated receptor kinase-l...    403   1e-122   
gb|KFK44076.1|  hypothetical protein AALP_AA1G212900                    394   1e-122   
ref|XP_008229721.1|  PREDICTED: wall-associated receptor kinase-l...    405   1e-122   
ref|XP_010674685.1|  PREDICTED: wall-associated receptor kinase-l...    394   1e-122   
emb|CAN71409.1|  hypothetical protein VITISV_031032                     402   1e-122   
ref|XP_009111225.1|  PREDICTED: wall-associated receptor kinase-l...    402   2e-122   
gb|KHN44651.1|  Wall-associated receptor kinase-like 9                  403   2e-122   
gb|KDP41930.1|  hypothetical protein JCGZ_26948                         403   2e-122   
ref|XP_008229723.1|  PREDICTED: wall-associated receptor kinase-l...    404   2e-122   
ref|XP_010673951.1|  PREDICTED: wall-associated receptor kinase-l...    404   2e-122   
ref|XP_010431649.1|  PREDICTED: wall-associated receptor kinase-l...    410   2e-122   
ref|XP_008229716.1|  PREDICTED: wall-associated receptor kinase-l...    400   2e-122   
ref|XP_010036549.1|  PREDICTED: wall-associated receptor kinase-l...    402   3e-122   
ref|XP_004492813.1|  PREDICTED: wall-associated receptor kinase-l...    400   3e-122   
ref|XP_003551679.1|  PREDICTED: wall-associated receptor kinase-l...    400   3e-122   
ref|XP_009376860.1|  PREDICTED: wall-associated receptor kinase-l...    401   3e-122   
emb|CDY26669.1|  BnaA06g13530D                                          394   6e-122   
emb|CDX96662.1|  BnaA08g22050D                                          403   7e-122   
ref|XP_010674015.1|  PREDICTED: wall-associated receptor kinase-l...    393   8e-122   
ref|XP_002888731.1|  hypothetical protein ARALYDRAFT_476104             402   1e-121   
emb|CDX81756.1|  BnaC08g38450D                                          396   1e-121   
ref|XP_010497736.1|  PREDICTED: wall-associated receptor kinase-l...    400   1e-121   
ref|XP_010038774.1|  PREDICTED: wall-associated receptor kinase-l...    399   1e-121   
ref|XP_006306876.1|  hypothetical protein CARUB_v10008430mg             400   2e-121   
ref|XP_010051380.1|  PREDICTED: LOW QUALITY PROTEIN: wall-associa...    406   2e-121   
ref|XP_006388773.1|  hypothetical protein POPTR_0103s00200g             399   2e-121   
gb|ABE65629.1|  wall-associated kinase                                  389   2e-121   
sp|Q9S9M2.2|WAKLD_ARATH  RecName: Full=Wall-associated receptor k...    400   2e-121   
emb|CDX81748.1|  BnaC08g38530D                                          399   3e-121   
ref|XP_006305138.1|  hypothetical protein CARUB_v10009505mg             387   3e-121   
ref|XP_006416846.1|  hypothetical protein EUTSA_v10009310mg             400   4e-121   
gb|KCW47710.1|  hypothetical protein EUGRSUZ_K01452                     400   4e-121   
gb|KCW47703.1|  hypothetical protein EUGRSUZ_K01443                     389   4e-121   
dbj|BAF01218.1|  serine/threonine-specific protein kinase like pr...    388   4e-121   
ref|XP_010476713.1|  PREDICTED: wall-associated receptor kinase-l...    399   5e-121   
ref|XP_010246116.1|  PREDICTED: wall-associated receptor kinase-l...    390   5e-121   
ref|XP_006306734.1|  hypothetical protein CARUB_v10008263mg             404   5e-121   
ref|XP_006305972.1|  hypothetical protein CARUB_v10011235mg             399   6e-121   
ref|XP_004295597.1|  PREDICTED: uncharacterized protein LOC101293382    417   6e-121   
emb|CDX81749.1|  BnaC08g38520D                                          398   6e-121   
sp|Q9S9M3.2|WAKLC_ARATH  RecName: Full=Wall-associated receptor k...    399   7e-121   
ref|XP_010673952.1|  PREDICTED: wall-associated receptor kinase 5...    400   7e-121   
emb|CDY28241.1|  BnaA01g06080D                                          400   8e-121   
ref|XP_008229496.1|  PREDICTED: wall-associated receptor kinase-l...    399   9e-121   
gb|ACN87673.1|  kinase-like protein                                     382   1e-120   
ref|XP_009117779.1|  PREDICTED: wall-associated receptor kinase-l...    397   1e-120   
ref|XP_010429873.1|  PREDICTED: wall-associated receptor kinase-l...    393   2e-120   
ref|XP_010111033.1|  Wall-associated receptor kinase-like 2             392   2e-120   
ref|XP_007147587.1|  hypothetical protein PHAVU_006G137100g             385   2e-120   
ref|XP_010476729.1|  PREDICTED: wall-associated receptor kinase-l...    398   2e-120   
ref|XP_009127255.1|  PREDICTED: wall-associated receptor kinase-l...    399   2e-120   
ref|XP_007216176.1|  hypothetical protein PRUPE_ppa015763mg             395   2e-120   
ref|XP_009117780.1|  PREDICTED: wall-associated receptor kinase-l...    396   2e-120   
ref|NP_173066.1|  wall associated kinase-like 4                         399   3e-120   
ref|XP_008229613.1|  PREDICTED: wall-associated receptor kinase-l...    399   3e-120   
gb|ACN87674.1|  kinase-like protein                                     380   3e-120   
emb|CAN76425.1|  hypothetical protein VITISV_023562                     397   3e-120   
gb|AAF68122.1|AC010793_17  F20B17.10                                    413   3e-120   
ref|XP_002869345.1|  kinase                                             398   4e-120   
ref|XP_002265582.3|  PREDICTED: wall-associated receptor kinase 5...    397   4e-120   
gb|KFK44736.1|  hypothetical protein AALP_AA1G296300                    392   5e-120   
gb|KDP29525.1|  hypothetical protein JCGZ_19238                         394   7e-120   
ref|XP_007217301.1|  hypothetical protein PRUPE_ppa018696mg             396   7e-120   
ref|XP_007139762.1|  hypothetical protein PHAVU_008G056900g             394   8e-120   
ref|XP_002312867.2|  hypothetical protein POPTR_0009s15690g             396   8e-120   
ref|XP_007216693.1|  hypothetical protein PRUPE_ppa026738mg             397   8e-120   
ref|XP_009134636.1|  PREDICTED: wall-associated receptor kinase-l...    382   9e-120   
ref|XP_010674686.1|  PREDICTED: putative wall-associated receptor...    395   9e-120   
gb|KCW47717.1|  hypothetical protein EUGRSUZ_K01469                     392   1e-119   
ref|XP_004295865.1|  PREDICTED: wall-associated receptor kinase-l...    394   1e-119   
ref|XP_010417637.1|  PREDICTED: wall-associated receptor kinase-l...    394   1e-119   
ref|XP_007139761.1|  hypothetical protein PHAVU_008G056800g             393   1e-119   
ref|XP_002890150.1|  hypothetical protein ARALYDRAFT_471814             396   1e-119   
ref|XP_010099234.1|  Wall-associated receptor kinase-like 9             391   2e-119   
ref|XP_010429872.1|  PREDICTED: wall-associated receptor kinase-l...    393   2e-119   
ref|XP_010058434.1|  PREDICTED: wall-associated receptor kinase 5...    395   2e-119   
ref|XP_006282852.1|  hypothetical protein CARUB_v10006795mg             397   2e-119   
ref|XP_008229717.1|  PREDICTED: LOW QUALITY PROTEIN: wall-associa...    382   2e-119   
ref|XP_007216825.1|  hypothetical protein PRUPE_ppa022857mg             394   2e-119   
ref|XP_002312856.2|  hypothetical protein POPTR_0009s15630g             391   2e-119   
gb|KFK42296.1|  hypothetical protein AALP_AA2G237300                    385   2e-119   
gb|KCW81746.1|  hypothetical protein EUGRSUZ_C03105                     389   2e-119   
ref|XP_010673969.1|  PREDICTED: wall-associated receptor kinase-l...    396   3e-119   
ref|XP_010429871.1|  PREDICTED: wall-associated receptor kinase-l...    393   3e-119   
ref|XP_010459408.1|  PREDICTED: putative wall-associated receptor...    390   3e-119   
ref|XP_010655764.1|  PREDICTED: wall-associated receptor kinase 5...    394   4e-119   
ref|NP_194840.3|  wall-associated receptor kinase-like 18               395   4e-119   
gb|KCW47705.1|  hypothetical protein EUGRSUZ_K01446                     393   5e-119   
ref|XP_008229719.1|  PREDICTED: wall-associated receptor kinase-l...    392   6e-119   
ref|XP_004301029.1|  PREDICTED: wall-associated receptor kinase-l...    394   6e-119   
emb|CDX86600.1|  BnaC08g01030D                                          394   7e-119   
emb|CAB79828.1|  serine/threonine-specific protein kinase-like          390   8e-119   
gb|ABD28574.1|  Protein kinase; Peptidoglycan-binding LysM              391   1e-118   
ref|XP_010688363.1|  PREDICTED: wall-associated receptor kinase-l...    392   1e-118   
ref|NP_194839.2|  wall-associated receptor kinase-like 17               394   1e-118   
gb|KCW47706.1|  hypothetical protein EUGRSUZ_K01446                     393   1e-118   
ref|XP_010689237.1|  PREDICTED: wall-associated receptor kinase-l...    380   1e-118   
ref|XP_010038768.1|  PREDICTED: wall-associated receptor kinase-l...    392   1e-118   
emb|CDY61277.1|  BnaA06g38650D                                          379   2e-118   
ref|XP_010431650.1|  PREDICTED: wall-associated receptor kinase-l...    382   2e-118   
ref|XP_003534529.1|  PREDICTED: wall-associated receptor kinase-l...    390   3e-118   
emb|CDY52852.1|  BnaA09g56440D                                          392   3e-118   
ref|XP_010476954.1|  PREDICTED: putative wall-associated receptor...    392   3e-118   
ref|XP_010463079.1|  PREDICTED: wall-associated receptor kinase-l...    390   3e-118   
ref|XP_010059387.1|  PREDICTED: wall-associated receptor kinase 2...    400   4e-118   
ref|XP_010655762.1|  PREDICTED: putative wall-associated receptor...    382   4e-118   
gb|ACI05984.1|  kinase-like protein pac.W.VtB.201                       374   4e-118   
ref|XP_006441116.1|  hypothetical protein CICLE_v10023494mg             377   5e-118   
gb|KDP26859.1|  hypothetical protein JCGZ_18017                         388   6e-118   
gb|ACN87672.1|  kinase-like protein                                     374   9e-118   
ref|XP_002891113.1|  predicted protein                                  389   1e-117   
ref|XP_010501504.1|  PREDICTED: putative wall-associated receptor...    390   2e-117   
ref|XP_010674027.1|  PREDICTED: wall-associated receptor kinase-l...    390   2e-117   
ref|XP_010480838.1|  PREDICTED: wall-associated receptor kinase-l...    389   2e-117   
ref|XP_004306299.1|  PREDICTED: wall-associated receptor kinase-l...    389   2e-117   
gb|KDO54052.1|  hypothetical protein CISIN_1g009340mg                   383   2e-117   
emb|CAB79829.1|  putative protein                                       393   2e-117   
gb|KCW47718.1|  hypothetical protein EUGRSUZ_K01470                     384   2e-117   
ref|XP_010026194.1|  PREDICTED: putative wall-associated receptor...    384   2e-117   
ref|XP_002892899.1|  kinase family protein                              389   2e-117   
ref|XP_010674021.1|  PREDICTED: wall-associated receptor kinase-l...    389   3e-117   
ref|XP_010674019.1|  PREDICTED: wall-associated receptor kinase-l...    389   3e-117   
gb|ACN87675.1|  kinase-like protein                                     372   3e-117   
ref|XP_003624108.1|  Wall-associated receptor kinase-like protein       390   3e-117   
ref|XP_007139789.1|  hypothetical protein PHAVU_008G058800g             386   3e-117   
ref|XP_010674018.1|  PREDICTED: wall-associated receptor kinase-l...    389   4e-117   
ref|XP_010673978.1|  PREDICTED: wall-associated receptor kinase-l...    388   5e-117   
ref|XP_009117778.1|  PREDICTED: wall-associated receptor kinase-l...    389   5e-117   
ref|XP_011095218.1|  PREDICTED: wall-associated receptor kinase 2...    389   5e-117   
ref|NP_173233.1|  putative wall-associated receptor kinase-like 13      389   6e-117   
gb|KHN40451.1|  Wall-associated receptor kinase-like 2                  400   7e-117   



>emb|CDP20610.1| unnamed protein product [Coffea canephora]
Length=706

 Score =   509 bits (1310),  Expect = 4e-163, Method: Compositional matrix adjust.
 Identities = 304/552 (55%), Positives = 370/552 (67%), Gaps = 27/552 (5%)
 Frame = -1

Query  1771  LSETPFMYSND-NNFMLFGCGNAFITMPGEELDQPGYNLNCSSKNTTAPKTAHDCQGINC  1595
             L  TPF YS   NN ++FGCGNA +    +     G    C   +         C G+NC
Sbjct  115   LGGTPFFYSKTYNNLVIFGCGNAVLINQNDNKILSGCTSTCEFNSPAQAIDTSSCYGVNC  174

Query  1594  NHLTVDYDVNTYQVNFTHS----SSFNACNYAFFlsassslpptlqslpsrqQEMVVVPV  1427
                T+ + ++ Y +NFT S         C+  F    + S     +S  S       VPV
Sbjct  175   CETTIPFYLSKYHLNFTASRFSLGGTGNCSSVFLADQNWSPEKFSESTQS-------VPV  227

Query  1426  ELRWTITQEDVPPSYSKYCSPSTYINPQLQWHNYLQCDCP----GGDDR---NVYLSGGC  1268
              L WT+ + DV   Y +     TY+  +    N     CP    GG D    N YL   C
Sbjct  228   VLAWTLGRNDVQAIY-RCPYEMTYLELE-AGGNLATFMCPTCEFGGTDPQEINPYLQEQC  285

Query  1267  EWKHKDYVISSNK--LRPAIIGISASFGFVFLIWAFVILYkaikkrkmkklrqkffkRNG  1094
               +   +++   +  L+ A+IG+ A  G +  I      YK +K+R+ K +++KFFKRNG
Sbjct  286   GPR---FIVDPGRRNLKAALIGVFAGIGVLIFIAISFTSYKLVKRRRDKMIKEKFFKRNG  342

Query  1093  GlllqqqlLTKEGTIEKTKIFTASELDKATDHFNADRIVGRGGQGTVYKGMLIDGQIVAV  914
             GLLLQQQL   +  I KT+IFTA ELDKATDHFN +R++GRGGQGTVYKGML DG + A+
Sbjct  343   GLLLQQQLSGDDRVINKTRIFTAKELDKATDHFNENRVLGRGGQGTVYKGMLADGNLAAI  402

Query  913   KKSQAVDEDQLEPFINEVVILSQINHRNVVKLMGCCLETEVPILVYEFIPNGTLFGLIHN  734
             KKS+ VDE QL  FINEVVILSQ+NHRNVVKL+GCCLETEVPILVYE IPNGTLF LIHN
Sbjct  403   KKSKKVDESQLGEFINEVVILSQVNHRNVVKLLGCCLETEVPILVYELIPNGTLFSLIHN  462

Query  733   NFDNELIPLSWDIRLRIASEVACALAYLHSVTLVPIYHRDIKTGNILLDEKFRAKVSDFG  554
               D+E  P +W +RLR+A+EVA ALAYLHS T VPIYHRDIK+ NILLD K+ AKVSDFG
Sbjct  463   ENDDEF-PFTWSLRLRMAAEVAGALAYLHSATSVPIYHRDIKSSNILLDAKYTAKVSDFG  521

Query  553   TSRSISIDKTHFTTMVKGTFGYLDPEYFQSSQFTEKSDVYSFGVVLAELLTGQKPISFEL  374
             TSRSISIDKTHFTTMVKGTFGYLDP YFQSSQFTEKSDVYSFGVVL ELLT +KP+S EL
Sbjct  522   TSRSISIDKTHFTTMVKGTFGYLDPAYFQSSQFTEKSDVYSFGVVLVELLTRKKPVSSEL  581

Query  373   DDDEDRSLVSRFLLCMEENRLMEMLDGEVIEQGKKEDVVAMAWLAQRCLNFNGKKRPTMK  194
             ++D   SL +RFL+ M+ENRL  +LD E+ ++  +E+VVA+A LAQRCLN NGKKRPTMK
Sbjct  582   EEDSHLSLATRFLITMDENRLNSILDPELQDERTEEEVVAVAKLAQRCLNLNGKKRPTMK  641

Query  193   EVATELDAIKAS  158
             EVATELD+IK S
Sbjct  642   EVATELDSIKMS  653



>ref|XP_009773751.1| PREDICTED: wall-associated receptor kinase-like 1 [Nicotiana 
sylvestris]
Length=699

 Score =   507 bits (1305),  Expect = 2e-162, Method: Compositional matrix adjust.
 Identities = 316/597 (53%), Positives = 389/597 (65%), Gaps = 37/597 (6%)
 Frame = -1

Query  1879  DFLGMSYDSQTITIKESISPSCQGSNNFSNIIHN-SKLSETPFMYSND-NNFMLFGCGNA  1706
             + + +S ++QTIT   SI   C GS+  S II   + LS +PF YS D N  ML GCGN 
Sbjct  83    EVISVSLENQTITTLISIINFCNGSSQGSRIITTGTDLSGSPFYYSKDRNKLMLVGCGNG  142

Query  1705  FITMPGEELDQPGYNLNCSSKNTTAPKTAHDCQGINCNHLTVDYDVNTYQVNFTHSS---  1535
              +T     L   G    CS   T        C GINC    V +D++ Y  NFT+S    
Sbjct  143   LVTQKQNVLS--GCTSICSEGATLT-----GCYGINCCQSLVPFDLSLYTANFTNSGIQE  195

Query  1534  -SFNACNYAFFlsassslpptlqslpsrqQEMVVVPVELRWTITQEDVPPSYSKYCSPST  1358
               +  C+ AF +  +       Q        +   PV   WT+  +++       C+ S 
Sbjct  196   GPYPKCSAAFLVDQTWVPDEVAQPFTF----LGYAPVVWLWTVQAKELEAGL--LCNKSG  249

Query  1357  YINPQLQWHNY---LQCDCPGGDDRNVYLSGGCEWKH-----KDYVISSNKLRPAIIGIS  1202
              ++ +L+       LQC C      N Y S GC+         + V  S K    II +S
Sbjct  250   -VSVKLENGTSVANLQCHCGPRTQGNPYFSSGCQAIQGCTNCTEVVYYSKKPASTIILLS  308

Query  1201  A--SFGFVFLIWAFVILYkaikkrkmkklrqkffkRNGGlllqqqlLTKEGTIEKTKIFT  1028
                S G + +++   +LYK  KKR+ K+ +Q FFKRNGGLLLQQQL + EG I+K K+FT
Sbjct  309   VFLSIGVLLILFVSYLLYKTFKKRRNKRQKQMFFKRNGGLLLQQQLSSNEGIIDKAKLFT  368

Query  1027  ASELDKATDHFNADRIVGRGGQGTVYKGMLIDGQIVAVKKSQAVDEDQLEPFINEVVILS  848
             A EL+KATDHFN +RI+GRGGQGTVYKGML DG IVAVKKS+ VDE+QL+ FINEVVILS
Sbjct  369   AKELEKATDHFNENRILGRGGQGTVYKGMLPDGNIVAVKKSKLVDENQLDQFINEVVILS  428

Query  847   QINHRNVVKLMGCCLETEVPILVYEFIPNGTLFGLIHNNFDNELIPLSWDIRLRIASEVA  668
             QINHRNVVKL+GCCLETEVP+LVYEFI NGTL+  IHN  +N  +P  W  RLRIA+EVA
Sbjct  429   QINHRNVVKLLGCCLETEVPLLVYEFIINGTLYSFIHN--ENNELPFPWSTRLRIATEVA  486

Query  667   CALAYLHSVTLVPIYHRDIKTGNILLDEKFRAKVSDFGTSRSISIDKTHFTTMVKGTFGY  488
              ALAYLHS T VPIYHRDIK+ NILLDEK+RAKVSDFGTSRSI+ID+TH TT V+GTFGY
Sbjct  487   GALAYLHSATSVPIYHRDIKSSNILLDEKYRAKVSDFGTSRSIAIDQTHLTTRVQGTFGY  546

Query  487   LDPEYFQSSQFTEKSDVYSFGVVLAELLTGQKPISFELDDDEDRSLVSRFLLCMEENRLM  308
             LDPEYFQSSQFTEKSDVYSFGVVLAELLTG+K IS     +E RSL + FLL M EN L 
Sbjct  547   LDPEYFQSSQFTEKSDVYSFGVVLAELLTGKKAIS--TTTNEGRSLATNFLLAMNENCLD  604

Query  307   EMLDGEVIEQGKKEDVVAMAWLAQRCLNFNGKKRPTMKEVATELDAIKASNSHLPLA  137
              +L  EV ++G+KED++A A +A RCLN NG+KRPTMKEV+  L+AI+   S +P A
Sbjct  605   TILHTEVTQEGRKEDIMAAANIAYRCLNLNGRKRPTMKEVSIALEAIR---SQVPSA  658



>ref|XP_009627286.1| PREDICTED: wall-associated receptor kinase-like 1 [Nicotiana 
tomentosiformis]
Length=700

 Score =   500 bits (1288),  Expect = 6e-160, Method: Compositional matrix adjust.
 Identities = 315/600 (53%), Positives = 387/600 (65%), Gaps = 43/600 (7%)
 Frame = -1

Query  1879  DFLGMSYDSQTITIKESISPSCQGSNNFSNIIHN-SKLSETPFMYSND-NNFMLFGCGNA  1706
             + + +S  +QTIT   SI   C  S+  S II   + LS +PF YS D N  ML GCGN 
Sbjct  83    EVISVSLKNQTITTLVSIINFCNDSSQGSRIITTGTNLSGSPFYYSKDRNKLMLVGCGNG  142

Query  1705  FITMPGEELDQPGYNLNCSSKNTT---APKTAHDCQGINCNHLTVDYDVNTYQVNFTHS-  1538
              +T           NLN  S  T+      T   C GINC    V +D++ Y  NFT+S 
Sbjct  143   LVTQ----------NLNVLSGCTSICSEGATLTGCYGINCCQSLVPFDLSLYTANFTNSG  192

Query  1537  ---SSFNACNYAFFlsassslpptlqslpsrqQEMVVVPVELRWTITQEDVPPSYSKYCS  1367
                  +  C+ AF +  +       Q        +   PV   WT+  +++       C+
Sbjct  193   IQQGPYPKCSAAFLVDQTWVPDEVAQPFTF----LGYAPVVWLWTLQAKELEAGL--LCN  246

Query  1366  PSTYINPQLQWHNY---LQCDCPGGDDRNVYLSGGCEWKH-----KDYVISSNKLRPAII  1211
              S  +  +L+       LQC C      N Y S GC+         + V  S K    II
Sbjct  247   KSG-VAVKLEDGTSVANLQCHCGPRTQGNPYFSNGCQAIQGCTNCTEVVYYSKKPASTII  305

Query  1210  GISA--SFGFVFLIWAFVILYkaikkrkmkklrqkffkRNGGlllqqqlLTKEGTIEKTK  1037
              +S   S G + +++   +LYK  KKR+ K+ +Q FFKRNGGLLLQQQL + EG I+K K
Sbjct  306   LLSVFLSIGVLLILFGSYLLYKTFKKRRNKRQKQMFFKRNGGLLLQQQLSSNEGIIDKAK  365

Query  1036  IFTASELDKATDHFNADRIVGRGGQGTVYKGMLIDGQIVAVKKSQAVDEDQLEPFINEVV  857
             +FTA EL+KATD+FN +RI+GRGGQGTVYKGML DG IVAVKKS+ VDE+QL+ FINEVV
Sbjct  366   LFTAKELEKATDYFNENRILGRGGQGTVYKGMLPDGNIVAVKKSKLVDENQLDQFINEVV  425

Query  856   ILSQINHRNVVKLMGCCLETEVPILVYEFIPNGTLFGLIHNNFDNELIPLSWDIRLRIAS  677
             ILSQINHRNVVKL+GCCLETEVP+LVYEFI NGTL+  IHN  +N   P  W  RLRIA+
Sbjct  426   ILSQINHRNVVKLLGCCLETEVPLLVYEFIINGTLYSFIHN--ENNEFPFPWSTRLRIAT  483

Query  676   EVACALAYLHSVTLVPIYHRDIKTGNILLDEKFRAKVSDFGTSRSISIDKTHFTTMVKGT  497
             EVA ALAYLHS T VPIYHRDIK+ NILLDEK+R+KVSDFGTSRSI+ID+TH TT V+GT
Sbjct  484   EVAGALAYLHSATSVPIYHRDIKSSNILLDEKYRSKVSDFGTSRSIAIDQTHLTTRVQGT  543

Query  496   FGYLDPEYFQSSQFTEKSDVYSFGVVLAELLTGQKPISFELDDDEDRSLVSRFLLCMEEN  317
             FGYLDPEYFQSSQFTEKSDVYSFGVVLAELLTG K I      +E RSL + FLL M+EN
Sbjct  544   FGYLDPEYFQSSQFTEKSDVYSFGVVLAELLTGNKAIL--TTTNEGRSLATNFLLAMDEN  601

Query  316   RLMEMLDGEVIEQGKKEDVVAMAWLAQRCLNFNGKKRPTMKEVATELDAIKASNSHLPLA  137
             RL  +L  EV ++G+KED++A A +A RCLN NGKKRPTMKEV+  L+AI+   S +P A
Sbjct  602   RLDTILHAEVTQEGRKEDIMAAANVAYRCLNLNGKKRPTMKEVSIALEAIR---SQVPSA  658



>emb|CDP11258.1| unnamed protein product [Coffea canephora]
Length=765

 Score =   493 bits (1269),  Expect = 2e-156, Method: Compositional matrix adjust.
 Identities = 305/625 (49%), Positives = 402/625 (64%), Gaps = 44/625 (7%)
 Frame = -1

Query  1882  VDFLGMSYDSQTITIKESISPSCQG----SNNFSNIIHNSKLSETPFMYSN-DNNFMLFG  1718
             ++ L +S ++ T+T+  S++  C       N  S    +S L+ TPF YS  DN  MLFG
Sbjct  128   LEVLNISLENHTVTVNSSLASFCNADQAQRNGSSTTWISSDLAGTPFFYSRIDNKMMLFG  187

Query  1717  CGNAFITMPGEELDQPGYNLNCS-SKNTTAPKTAHDCQGINCNHLTVDYDVNTYQVNFTH  1541
             CGNA +     ++   G    C  + +  A  ++  C G++C    + + ++ Y +NF  
Sbjct  188   CGNAVLNQADNKI-LSGCTSTCEFNTSDLATNSSSRCYGVSCCETIIPFYLSKYNLNF-R  245

Query  1540  SSSFN---ACNYAFFlsassslpptlqslpsrqQEMVVVPVELRWTITQEDVPPSYS-KY  1373
              S FN    C+  F +  +       +        +  +PV L WT++Q D     +  Y
Sbjct  246   GSRFNRSGQCSTTFLVDQNWLPEKFSE-------SLQFIPVVLAWTLSQADATAVVNCTY  298

Query  1372  CSPSTYINPQLQWHNYLQCDCPGGDDRNVYLSGGCE--------------WKH---KDYV  1244
              S S Y++      N+L   C  G D N YL   C               W     +++ 
Sbjct  299   VSGSFYLDSGEYVENFLCAFC--GSDINPYLQSVCSSPRLGATCNRPERFWLFSIVRNFF  356

Query  1243  ISSNKLRPAIIGISASFGFVFLIWAFVILYkaikkrkmkklrqkffkRNGGlllqqqlLT  1064
              +S  L   I  +  S G +FLI A    YK +K+R+ K++R KFFKRNGGLLLQ+QL  
Sbjct  357   CTSCNLF-CISRVFISIGVLFLIAASFAGYKLVKRRRNKRIRNKFFKRNGGLLLQRQLSA  415

Query  1063  KEGTIEKTKIFTASELDKATDHFNADRIVGRGGQGTVYKGMLIDGQIVAVKKSQAVDEDQ  884
              +  I++T+IF  +EL KA+D F+ DRI+GRGGQGTVYKGML DG+IVA+KKS  VDE Q
Sbjct  416   DDSVIKRTRIFKENELAKASDQFSEDRILGRGGQGTVYKGMLTDGKIVAIKKSMKVDESQ  475

Query  883   LEPFINEVVILSQINHRNVVKLMGCCLETEVPILVYEFIPNGTLFGLIHNNFDNELIPLS  704
             LEPFINEVVILSQ+NHRNVVKL+GCCLETEVP+LVYEFIPNGTL  LIHN+ D+E  P +
Sbjct  476   LEPFINEVVILSQVNHRNVVKLLGCCLETEVPLLVYEFIPNGTLSSLIHNHIDDEF-PFT  534

Query  703   WDIRLRIASEVACALAYLHSVTLVPIYHRDIKTGNILLDEKFRAKVSDFGTSRSISIDKT  524
             W+ RLRIA E+A ALAYLHS   +PIYHRDIK+ NILLDEK+ AKVSDFGTSRSI  DKT
Sbjct  535   WNFRLRIAGEIAGALAYLHSAISIPIYHRDIKSSNILLDEKYIAKVSDFGTSRSIGADKT  594

Query  523   HFTTMVKGTFGYLDPEYFQSSQFTEKSDVYSFGVVLAELLTGQKPI-SFELDDDEDRSLV  347
             H TT+VKGTFGYLDPEYFQSSQFTEKSDVYSFGVVL ELLT +KPI S E ++D + +L 
Sbjct  595   HLTTLVKGTFGYLDPEYFQSSQFTEKSDVYSFGVVLVELLTRKKPISSSESEEDGNLNLA  654

Query  346   SRFLLCMEENRLMEMLDGEVIEQGKKEDVVAMAWLAQRCLNFNGKKRPTMKEVATELDAI  167
             +RFL+ M+ENRL  +LD +++++  KE+V+++A LAQRCL+ NGK RPTMKEVA EL+ I
Sbjct  655   TRFLMMMDENRLDSILDCQLLDESIKEEVISVAKLAQRCLDSNGKNRPTMKEVAIELENI  714

Query  166   KASNSHLPLAMEAF---EIESDFIA  101
             + + +   +  + F   E ES F+A
Sbjct  715   RRAANGSTVHSQVFEKGECESAFLA  739



>ref|XP_006365061.1| PREDICTED: wall-associated receptor kinase-like 1-like [Solanum 
tuberosum]
Length=701

 Score =   488 bits (1257),  Expect = 2e-155, Method: Compositional matrix adjust.
 Identities = 308/597 (52%), Positives = 389/597 (65%), Gaps = 37/597 (6%)
 Frame = -1

Query  1879  DFLGMSYDSQTITIKESISPSCQGSNNFSNIIHN-SKLSETPFMYSND-NNFMLFGCGNA  1706
             + + +S ++QTI    SI   C  S+  S II   + LS +PF Y+ D N  ML GCGN 
Sbjct  83    EVISVSIENQTIITSVSIVNFCNKSSEGSKIITTGTDLSGSPFYYAKDRNKLMLVGCGNG  142

Query  1705  FITMPGEELDQPGYNLNCSSKNTTAPKTAHDCQGINCNHLTVDYDVNTYQVNFTHS----  1538
              +T     L        C+S  T    T   C GINC    V +D+++Y+ NFT+S    
Sbjct  143   LVTQKQNILS------GCTSICTEGA-TLTGCYGINCCQSLVPFDLSSYKANFTNSGIQQ  195

Query  1537  SSFNACNYAFFlsassslpptlqslpsrqQEMVVVPVELRWTITQEDVPPSYSKYCSPST  1358
              ++  C+  F +  +       Q            PV   WT+  +++       C  S 
Sbjct  196   GAYPRCSAVFLVDQTWVPDEVAQPFVFLGH----APVVWLWTLQSKELEAGL--LCDKSE  249

Query  1357  YINPQLQWHNY--LQCDCPGGDDRNVYLSGGCEWKHK-----DYVISSNKLRP--AIIGI  1205
              +       +   LQC C  G   N Y S GC+   +     D VI   K  P  A+  +
Sbjct  250   AVVKLEDGTSVANLQCRCGPGTQGNPYFSNGCQAIQRCTNCTDMVIYM-KRSPTIALFSV  308

Query  1204  SASFGFVFLIWAFVILYkaikkrkmkklrqkffkRNGGlllqqqlLT-KEGTIEKTKIFT  1028
               S G + L++   +LYK +KKR+  + RQ+FFKRNGGLLLQQQL +  EGTI+K K+FT
Sbjct  309   FISIGVLLLLFGSYLLYKTVKKRRNIRQRQRFFKRNGGLLLQQQLSSNNEGTIDKGKLFT  368

Query  1027  ASELDKATDHFNADRIVGRGGQGTVYKGMLIDGQIVAVKKSQAVDEDQLEPFINEVVILS  848
             A EL+KATDHFN +RI+GRGGQGTVYKGML DG+IVAVKKS+ VDE+QL+ FINEV +LS
Sbjct  369   AKELEKATDHFNENRILGRGGQGTVYKGMLPDGKIVAVKKSKLVDENQLDQFINEVAVLS  428

Query  847   QINHRNVVKLMGCCLETEVPILVYEFIPNGTLFGLIHNNFDNELIPLSWDIRLRIASEVA  668
             QINHRNVVKL+GCCLETEVP+LVYEFI NGTL+ LIHN  +N   P +W  RLRIA+EVA
Sbjct  429   QINHRNVVKLLGCCLETEVPLLVYEFIINGTLYSLIHN--ENNEFPFTWSTRLRIATEVA  486

Query  667   CALAYLHSVTLVPIYHRDIKTGNILLDEKFRAKVSDFGTSRSISIDKTHFTTMVKGTFGY  488
              ALAYLHS T VP+YHRDIK+ NILLDEK+RAKVSDFGTSRSI+ID+TH TT V+GTFGY
Sbjct  487   GALAYLHSATSVPVYHRDIKSSNILLDEKYRAKVSDFGTSRSIAIDQTHLTTGVQGTFGY  546

Query  487   LDPEYFQSSQFTEKSDVYSFGVVLAELLTGQKPISFELDDDEDRSLVSRFLLCMEENRLM  308
             LDPEYFQSSQ+TEKSDVYSFGVVLAELLTG K IS     ++DRSL + FLL  E N L 
Sbjct  547   LDPEYFQSSQYTEKSDVYSFGVVLAELLTGNKAIS--TTTNQDRSLATNFLLATERNLLD  604

Query  307   EMLDGEVIEQGKKEDVVAMAWLAQRCLNFNGKKRPTMKEVATELDAIKASNSHLPLA  137
              ++  ++ ++G+KED++A A +A RC+N NGKKRPTMKEV T L+AI+   S +P A
Sbjct  605   TIIYTKISQEGRKEDIMAAANIAYRCMNLNGKKRPTMKEVTTALEAIR---SQMPSA  658



>ref|XP_010317039.1| PREDICTED: wall-associated receptor kinase-like 1 [Solanum lycopersicum]
Length=708

 Score =   483 bits (1244),  Expect = 3e-153, Method: Compositional matrix adjust.
 Identities = 297/600 (50%), Positives = 376/600 (63%), Gaps = 43/600 (7%)
 Frame = -1

Query  1879  DFLGMSYDSQTITIKESISPSCQGSNNFSNIIHN-SKLSETPFMYSND-NNFMLFGCGNA  1706
             + + +S ++QTIT   SI   C  S+  S II   + LS +PF Y+ D N  ML GCGN 
Sbjct  90    EVISVSIENQTITTSVSIVNFCNKSSEGSRIITTGTDLSGSPFYYAKDRNKLMLVGCGNG  149

Query  1705  FITMPGEELDQPGYNLNCSSKNTTAPKTAHDCQGINCNHLTVDYDVNTYQVNFTHSS---  1535
              +T     L   G    CS   T        C GINC      +D+++Y+ NFT+S    
Sbjct  150   LVTQKQNVLS--GCTSICSEGATLT-----GCYGINCCQSLFPFDLSSYKANFTNSGIQQ  202

Query  1534  -SFNACNYAFFlsassslpptlqslpsrqQEMVVVPVELRWTITQEDVPPSYSKYCSPST  1358
              ++  C+  F +  +       Q        +   PV   WT+  +++       C  S 
Sbjct  203   EAYPRCSAVFLVDQTWVPDEVAQPFVF----LGYAPVVWLWTLQAKELEAGL--LCDKSE  256

Query  1357  YI------NPQLQWHNYLQCDCPGGDDRNVYLSGGCEWKHK----DYVISSNKLRPAIIG  1208
              +           W    QC C  G   N Y S GC+   +      ++   K  P I+ 
Sbjct  257   AVVKLEDGTSVANW----QCRCGNGTQGNPYFSNGCQANQRCTNCTEIVIYMKQSPKIVL  312

Query  1207  ISASFGFVFLIWAFVILYkaikkrkmkklrqkff--kRNGGlllqqqlLTK-EGTIEKTK  1037
             +S       L+            +K +  RQ+    KRNGGLLLQQQL +  EGTI+K K
Sbjct  313   LSVCISIGVLLLLLGSYLLYKTVKKRENKRQRQRFFKRNGGLLLQQQLSSNNEGTIDKGK  372

Query  1036  IFTASELDKATDHFNADRIVGRGGQGTVYKGMLIDGQIVAVKKSQAVDEDQLEPFINEVV  857
             +FTA EL+KATDHFN +RI+GRGGQGTVYKGML DG+IVAVKKS+ VDE+QL+ FINEV 
Sbjct  373   LFTARELEKATDHFNENRILGRGGQGTVYKGMLPDGKIVAVKKSKLVDENQLDQFINEVA  432

Query  856   ILSQINHRNVVKLMGCCLETEVPILVYEFIPNGTLFGLIHNNFDNELIPLSWDIRLRIAS  677
             +LSQINHRNVVKL+GCCLETEVP+LVYEFI NGTL+ LIHN  +N   P +W  RLRIA+
Sbjct  433   VLSQINHRNVVKLLGCCLETEVPLLVYEFIINGTLYSLIHN--ENNEFPFTWSTRLRIAT  490

Query  676   EVACALAYLHSVTLVPIYHRDIKTGNILLDEKFRAKVSDFGTSRSISIDKTHFTTMVKGT  497
             EVA ALAYLHS T VP+YHRDIK+ NILLDEK+RAKVSDFGTSRSI+ID+TH TT V+GT
Sbjct  491   EVAGALAYLHSATSVPVYHRDIKSSNILLDEKYRAKVSDFGTSRSIAIDQTHLTTGVQGT  550

Query  496   FGYLDPEYFQSSQFTEKSDVYSFGVVLAELLTGQKPISFELDDDEDRSLVSRFLLCMEEN  317
             FGYLDPEYFQSSQ+TEKSDVYSFGVVLAELLTG+K IS     ++DRSL + FLL  E N
Sbjct  551   FGYLDPEYFQSSQYTEKSDVYSFGVVLAELLTGKKAIS--TTTNQDRSLATNFLLATERN  608

Query  316   RLMEMLDGEVIEQGKKEDVVAMAWLAQRCLNFNGKKRPTMKEVATELDAIKASNSHLPLA  137
              L  ++  ++ ++GK+ED++A A +A RC+N NGKKRPTMKEV T L+AI+   S +P A
Sbjct  609   LLDTIIYAKISQEGKREDIMAAANIAYRCMNLNGKKRPTMKEVTTALEAIR---SQMPAA  665



>ref|XP_002274809.1| PREDICTED: wall-associated receptor kinase-like 8 [Vitis vinifera]
Length=718

 Score =   473 bits (1217),  Expect = 3e-149, Method: Compositional matrix adjust.
 Identities = 282/562 (50%), Positives = 374/562 (67%), Gaps = 40/562 (7%)
 Frame = -1

Query  1762  TPFMYSNDNNFMLFGCGNAFITMPGEELDQPGYNLNCSSKNTTAPKTAHDCQGINCNHLT  1583
             +PF+YS  N+ +  GC N  +    EE+        C+S    +  T     GINC    
Sbjct  123   SPFLYSLHNDLVGVGCHNVLLRDRNEEI-----MAGCASTCDKSITTKGCLYGINCCLTR  177

Query  1582  VDYDVNTYQVNFTHSSSFNA---CNYAFFlsassslpptlqslpsrqQEMVVVPVELRWT  1412
             +  D++ Y ++ T SSS      C YAF     +++      +     +    P+ + W 
Sbjct  178   LQEDLDFYSLSTTASSSERGDPDCTYAFLAYNYNNVSNVTTIVR----DAKYAPLLISWL  233

Query  1411  ITQEDVPPSYSKYCSPSTYINPQLQWHNYLQCDCPGGDDRNVYLSGGCE-----------  1265
             I ++  P +    C   T    +  + NY +C C   ++ N YL+ GC+           
Sbjct  234   IPEQVDPQN----CVDDTVYTSRGNYPNY-RCACNWAEEGNPYLAHGCQVVRECANCRWG  288

Query  1264  ---------WKHKDYVISSNKLRPAIIGISASFGFVFLIWAFVILYkaikkrkmkklrqk  1112
                      +K+  Y  + NK +  I+G S S G + L+     LYK ++K+   +++++
Sbjct  289   CDGRYNSSTYKYDFYCSTKNKSKALILGCSISGGLLLLLIFSFGLYKVVRKQLDIRVKKR  348

Query  1111  ffkRNGGlllqqqlLTKEGTIEKTKIFTASELDKATDHFNADRIVGRGGQGTVYKGMLID  932
             FFKRNGGLLLQQQ+ + +   EKTKIFT+ EL+KATD+FN +RI+G+GGQGTVYKGML D
Sbjct  349   FFKRNGGLLLQQQISSDKIAFEKTKIFTSDELEKATDNFNKNRILGQGGQGTVYKGMLND  408

Query  931   GQIVAVKKSQAVDEDQLEPFINEVVILSQINHRNVVKLMGCCLETEVPILVYEFIPNGTL  752
             G+IVAVKKS+ VDE+QLE FINE+VILSQINHRNVV ++GCCLETEVP+LVYEFI NGTL
Sbjct  409   GRIVAVKKSKIVDENQLEHFINEIVILSQINHRNVVGILGCCLETEVPLLVYEFISNGTL  468

Query  751   FGLIHNNFDNELIPLSWDIRLRIASEVACALAYLHSVTLVPIYHRDIKTGNILLDEKFRA  572
             F LIH+   N   PLSW++RLRIA EV+ AL+YLHS   +PIYHRDIK+ NILLD+K++A
Sbjct  469   FQLIHDQ--NSEFPLSWEMRLRIALEVSGALSYLHSACSIPIYHRDIKSTNILLDDKYKA  526

Query  571   KVSDFGTSRSISIDKTHFTTMVKGTFGYLDPEYFQSSQFTEKSDVYSFGVVLAELLTGQK  392
             KVSDFGTSRSISID+TH TT+V+GTFGYLDPEYFQSSQFTEKSDVYSFGVVL ELLTGQK
Sbjct  527   KVSDFGTSRSISIDQTHLTTIVQGTFGYLDPEYFQSSQFTEKSDVYSFGVVLVELLTGQK  586

Query  391   PISFELDDDEDRSLVSRFLLCMEENRLMEMLDGEVIEQGKKEDVVAMAWLAQRCLNFNGK  212
             PIS      E++SL + F+L ++E+RL ++LD  V+++G+KED++  A LA RCLN NG+
Sbjct  587   PIS-STRSPEEKSLATHFILSLQESRLFDILDARVVKEGRKEDIMTFAKLAGRCLNLNGR  645

Query  211   KRPTMKEVATELDAIKASNSHL  146
             KRPTMKEV TE+D I+ S  HL
Sbjct  646   KRPTMKEVTTEIDNIRVSALHL  667



>ref|XP_007035467.1| Wall associated kinase-like 6, putative [Theobroma cacao]
 gb|EOY06393.1| Wall associated kinase-like 6, putative [Theobroma cacao]
Length=758

 Score =   474 bits (1219),  Expect = 5e-149, Method: Compositional matrix adjust.
 Identities = 298/597 (50%), Positives = 376/597 (63%), Gaps = 36/597 (6%)
 Frame = -1

Query  1828  ISPSCQGSNNFSNIIHNSKLSETPFMYSND-NNFMLFGCGN-AFITMPGEELDQPGYNLN  1655
             IS +C G      +     ++ +PF +S   N F+  GC N AF+T  G E    G    
Sbjct  99    ISKNCSGRETSRRV----NITGSPFCFSESMNKFIAAGCNNEAFMT--GIEPTIVGCESA  152

Query  1654  CSSKNTTAPKTAHDCQGINCNHLTVDYDVNTYQVNF-THSSSFNACNYAFFlsassslpp  1478
             C       P     C G  C    +   ++ +   F +  S    C  AF +        
Sbjct  153   CIGNRLFGPNPNATCDGSTCCETVIPSRLHVFNATFQSKESESEGCKLAFLVEEEWFYNN  212

Query  1477  tlqslpsrqQEMVVVPVELRWTITQE--DVPPSYSK--YCSPSTYINPQLQWHNYLQCDC  1310
                   + Q  +  VP  L W I  E  ++P    +  YC+   Y++ +  + N  +C C
Sbjct  213   ITDKSSAFQ-NVDYVPALLDWAIPDEAFELPTKRGRDYYCNGHRYMDTEPYYLNSSRCYC  271

Query  1309  PGGDDRNVYLSGGCE-------WKHK------------DYVISSNKLRPAIIGISASFGF  1187
              GG + N YL  GC+         HK             Y     K    I GIS  FG 
Sbjct  272   YGGYEGNAYLPNGCQDIDECLDGPHKRCGNATCVNRPGHYECERKKTWIIIFGISLGFGV  331

Query  1186  VFLIWAFVILYkaikkrkmkklrqkffkRNGGlllqqqlLTKEGTIEKTKIFTASELDKA  1007
             + L  A   LYK +KKR+  KL++KFFKRNGGLLLQQQ+ + E +IEKTKIFT+ ELDKA
Sbjct  332   LCLAIAGWWLYKFLKKRRNIKLKKKFFKRNGGLLLQQQMSSSESSIEKTKIFTSKELDKA  391

Query  1006  TDHFNADRIVGRGGQGTVYKGMLIDGQIVAVKKSQAVDEDQLEPFINEVVILSQINHRNV  827
             TD+FN +R++G+GGQGTVYKGML+DG+IVAVKKS+ VD +++E FINEVVILSQINHRNV
Sbjct  392   TDYFNKNRVLGQGGQGTVYKGMLVDGRIVAVKKSKVVDAEKVEEFINEVVILSQINHRNV  451

Query  826   VKLMGCCLETEVPILVYEFIPNGTLFGLIHNNFDNELIPLSWDIRLRIASEVACALAYLH  647
             VKL+GCCLETEVP+LVYEFIPNGTLF  +H+   +E  PLSWD RLRIA E+A AL+YLH
Sbjct  452   VKLLGCCLETEVPLLVYEFIPNGTLFQYLHDQ--SEEFPLSWDTRLRIAKEIAEALSYLH  509

Query  646   SVTLVPIYHRDIKTGNILLDEKFRAKVSDFGTSRSISIDKTHFTTMVKGTFGYLDPEYFQ  467
             S   +PIYHRDIK+ NILLDEK+RAKVSDFGTSRSISID+TH TT V+GTFGYLDPEYFQ
Sbjct  510   SAASIPIYHRDIKSSNILLDEKYRAKVSDFGTSRSISIDQTHLTTHVQGTFGYLDPEYFQ  569

Query  466   SSQFTEKSDVYSFGVVLAELLTGQKPISFELDDDEDRSLVSRFLLCMEENRLMEMLDGEV  287
             SSQFTEKSDVYSFGVVL ELLT +KPIS E   +E RSL + F+L +EEN+L +++D  V
Sbjct  570   SSQFTEKSDVYSFGVVLVELLTSEKPISLE-RAEEGRSLATHFILSVEENQLFDIVDARV  628

Query  286   IEQGKKEDVVAMAWLAQRCLNFNGKKRPTMKEVATELDAIKASNSHLPLAMEAFEIE  116
              +Q K  +VV +A LA RCL+  G+KRPTMKEVA EL+ I +  +   +  +  EIE
Sbjct  629   TKQAKDGEVVMVAKLAYRCLSLCGRKRPTMKEVAMELERILSLQNDSNVQHDQEEIE  685



>gb|KDP41423.1| hypothetical protein JCGZ_15830 [Jatropha curcas]
Length=356

 Score =   458 bits (1179),  Expect = 1e-148, Method: Compositional matrix adjust.
 Identities = 226/315 (72%), Positives = 270/315 (86%), Gaps = 3/315 (1%)
 Frame = -1

Query  1099  NGGlllqqqlLTKEGTIEKTKIFTASELDKATDHFNADRIVGRGGQGTVYKGMLIDGQIV  920
             NGGLLLQQQL + E  +E+TK+FT+ EL+KATD++N +RI+G+GGQGTVYKGML DG++V
Sbjct  11    NGGLLLQQQLSSTETNVEQTKLFTSKELEKATDYYNLNRILGQGGQGTVYKGMLTDGRVV  70

Query  919   AVKKSQAVDEDQLEPFINEVVILSQINHRNVVKLMGCCLETEVPILVYEFIPNGTLFGLI  740
             A+KKS+ VDED+L+ FINEVVILSQINHRNVVKL+GCCLETEVP+LVYEFIPNGTLF  I
Sbjct  71    AIKKSKVVDEDKLDQFINEVVILSQINHRNVVKLIGCCLETEVPLLVYEFIPNGTLFQYI  130

Query  739   HNNFDNELIPLSWDIRLRIASEVACALAYLHSVTLVPIYHRDIKTGNILLDEKFRAKVSD  560
             HN   NE  P++W++RLRIA+EVA AL YLHS   +PIYHRDIK+ NILLDEK+RAKV+D
Sbjct  131   HNQ--NEEFPITWEMRLRIATEVAGALFYLHSAASIPIYHRDIKSSNILLDEKYRAKVAD  188

Query  559   FGTSRSISIDKTHFTTMVKGTFGYLDPEYFQSSQFTEKSDVYSFGVVLAELLTGQKPISF  380
             FGTS+SISID+TH TT V+GTFGYLDPEYFQSSQFTEKSDVYSFGVVL ELLTGQKPISF
Sbjct  189   FGTSKSISIDQTHVTTRVQGTFGYLDPEYFQSSQFTEKSDVYSFGVVLVELLTGQKPISF  248

Query  379   ELDDDEDRSLVSRFLLCMEENRLMEMLDGEVIEQGKKEDVVAMAWLAQRCLNFNGKKRPT  200
                 DE RSL + FLL MEE  L E+LD +V+++G K+++ A+A LAQ+CLN NGKKRPT
Sbjct  249   -TRSDEGRSLATYFLLSMEEKHLFEILDAQVVKEGGKDEIFAIAKLAQKCLNLNGKKRPT  307

Query  199   MKEVATELDAIKASN  155
             MK VA EL+ I+AS 
Sbjct  308   MKTVAMELEGIRASQ  322



>ref|XP_010663520.1| PREDICTED: wall-associated receptor kinase-like 1 isoform X1 
[Vitis vinifera]
 emb|CAN76906.1| hypothetical protein VITISV_006595 [Vitis vinifera]
Length=726

 Score =   469 bits (1208),  Expect = 7e-148, Method: Compositional matrix adjust.
 Identities = 294/623 (47%), Positives = 401/623 (64%), Gaps = 53/623 (9%)
 Frame = -1

Query  1882  VDFLGMSYDSQTITIKESISPSCQ--GSNNFSNIIHNSKLSETPFMYSN-DNNFMLFGCG  1712
             ++ L +S + QT+T+   I+   Q  GS+     I+   L ++PF++S  DN F++ GCG
Sbjct  83    LELLNVSLEYQTVTVYSPIASYDQQKGSSELQTSIN---LDQSPFLFSTLDNIFVVLGCG  139

Query  1711  NAFITMPGEELDQPGYNLNCSSKNTTAPKTAHDCQGINCNHLTV----DYDVNTYQVNFT  1544
             +A + M  E++     ++NCS    + P     C GINC   T+     Y ++TY V FT
Sbjct  140   HAKL-MEHEKIWAGCTSINCSD---SFPDQG--CYGINCCQTTIPTIDSYYLSTYSVKFT  193

Query  1543  HSSSFNACNYAFFlsassslpptlqslpsrqQEMVVVPVELRWTITQEDVPPSYSKYCSP  1364
                  N  + +           +          +    + L W I + D   S    C+ 
Sbjct  194   LDDEGNNHSTSTHAFLVDRDWFSRNFTELEDVSVKYAALSLLWMIKEGDNADSS---CNG  250

Query  1363  STYINPQLQWHNYLQCDCPGGDDRNVYLSGGCEWKHKD----------------------  1250
             S Y +  +  +    C CP   + N YL  GC+   K+                      
Sbjct  251   SNYYSLSIGSYVRSSCGCPPRYEGNPYLHDGCDHVVKECANCLKTCDYRYIIDNQSYHIE  310

Query  1249  -YVISSNKL-RPAIIGISASFGFVFLIWAFVILYkaikkrkmkklrqkffkRNGGlllqq  1076
              Y I+ ++L RP I+G S   G + L+     LYK +KK+K  +L+++FFKRNGGLLL+Q
Sbjct  311   YYCITKDRLSRPLILGFSIGGGSLLLLLGSFGLYKVVKKKKEIRLKKRFFKRNGGLLLEQ  370

Query  1075  qlLTKEGTIEKTKIFTASELDKATDHFNADRIVGRGGQGTVYKGMLIDGQIVAVKKSQAV  896
             Q+ + +  +EKTKIFT+ EL+KATD+FN DRI+G+GGQGTVYKGML DG+IVAVKKS+ V
Sbjct  371   QISSDKVAVEKTKIFTSKELEKATDNFNLDRILGQGGQGTVYKGMLTDGRIVAVKKSKIV  430

Query  895   DEDQLEPFINEVVILSQINHRNVVKLMGCCLETEVPILVYEFIPNGTLFGLIHNNFDNEL  716
             DE Q+E FINE+VILSQI+HRNVV L+GCCLETEVP+LVYEFI NGTLF  IHN  D++ 
Sbjct  431   DESQIEHFINEIVILSQISHRNVVGLLGCCLETEVPLLVYEFISNGTLFQHIHNQ-DSDF  489

Query  715   IPLSWDIRLRIASEVACALAYLHSVTLVPIYHRDIKTGNILLDEKFRAKVSDFGTSRSIS  536
              PLSW +RL+IA EVA ALAYLHS   +PIYHRDIK+ NILLD+K RAKVSDFGTSRSIS
Sbjct  490   -PLSWKMRLQIAIEVAGALAYLHSACSIPIYHRDIKSTNILLDDKHRAKVSDFGTSRSIS  548

Query  535   IDKTHFTTMVKGTFGYLDPEYFQSSQFTEKSDVYSFGVVLAELLTGQKPISFELDDDEDR  356
             I++TH TT+V GTFGYLDPEYFQSSQFTEKSDVYSFGVVL ELLTGQKPI       E++
Sbjct  549   IEQTHLTTLVHGTFGYLDPEYFQSSQFTEKSDVYSFGVVLVELLTGQKPIC-STRSQEEK  607

Query  355   SLVSRFLLCMEENRLMEMLDGEVIEQGKKEDVVAMAWLAQRCLNFNGKKRPTMKEVATEL  176
             SL + F+L ++E+RL ++LD  V+++G+KE+++A+A+LA +CLN +G+KRPTMKE+  EL
Sbjct  608   SLATHFILSLQESRLFDILDAGVVKEGEKEEIMALAYLAYQCLNLSGRKRPTMKEITMEL  667

Query  175   DAIKASNSHLPLAMEAFEIESDF  107
             +       H+ +++   ++E +F
Sbjct  668   E-------HIRMSLPPLKVEQNF  683



>ref|XP_011082236.1| PREDICTED: wall-associated receptor kinase-like 2 [Sesamum indicum]
Length=735

 Score =   470 bits (1209),  Expect = 9e-148, Method: Compositional matrix adjust.
 Identities = 280/565 (50%), Positives = 367/565 (65%), Gaps = 39/565 (7%)
 Frame = -1

Query  1771  LSETPFMYSNDNNFMLFGCGNAFITMPGEELDQPGYNLNCSSKNTTAPKTAHD--CQGIN  1598
             LS TPF +SN N   + GC +         + + G  ++      + P+  ++  C GI 
Sbjct  143   LSGTPFSFSNQNKLTVVGCNHVSF------MSKLGTYISACVAVCSKPQELNNGSCTGIG  196

Query  1597  CNHLTVD-----YDVNTYQVNF-THSSSFNACNYAFFlsassslpptlqslpsrqQE--M  1442
             C   ++       D     +N+ +   +FN C Y+F    +S +            +  M
Sbjct  197   CCQASIPKGLQYIDTTMMFMNYPSGDDNFNPCGYSFLAEQNSYIFSVSDISDPSFVDRTM  256

Query  1441  VVVPVELRWTITQEDVPPSYSKYCSP-STYINPQLQWHNYLQCDCPGGDDRNVYLSGGCE  1265
               VP+ + W I       S    C   S  ++P      Y +C+C  G   N YLS GC+
Sbjct  257   GTVPLLIDWEIPSRTCNDSSGIICEEGSVCVDPDTTLGGY-RCNCSQGYQGNPYLSPGCQ  315

Query  1264  ---------------WKHKDYVISSNKLRPAII---GISASFGFVFLIWAFVILYkaikk  1139
                            +   D+ I ++ +    I   G+    G   L+   + LYK ++K
Sbjct  316   DINECDSNPCDPKAIFNAIDFNIKNSLISLVKILFPGLLVGCGLFILLAVSLWLYKLLRK  375

Query  1138  rkmkklrqkffkRNGGlllqqqlLTKEGTIEKTKIFTASELDKATDHFNADRIVGRGGQG  959
              + K+L+Q  FKRNGGLLLQQ +   +  + K +IFT+ EL++ATD FN +RI+GRGGQG
Sbjct  376   TRAKQLKQSIFKRNGGLLLQQHMSAHDLLLGKMRIFTSKELERATDRFNENRILGRGGQG  435

Query  958   TVYKGMLIDGQIVAVKKSQAVDEDQLEPFINEVVILSQINHRNVVKLMGCCLETEVPILV  779
             TVYKGML DG+IVAVKKS+ VD++Q E FINEVVILSQINHRNVVKL+GCCLETEVP+LV
Sbjct  436   TVYKGMLSDGRIVAVKKSKQVDKNQQEEFINEVVILSQINHRNVVKLLGCCLETEVPLLV  495

Query  778   YEFIPNGTLFGLIHNNFDNELIPLSWDIRLRIASEVACALAYLHSVTLVPIYHRDIKTGN  599
             YEFIPNGTL+ LIH+  D+   P SWD+RLRIA+E+A ALAYLH  T +PIYHRD+K+ N
Sbjct  496   YEFIPNGTLYDLIHD--DSTGFPFSWDLRLRIAAEIADALAYLHYATSIPIYHRDMKSNN  553

Query  598   ILLDEKFRAKVSDFGTSRSISIDKTHFTTMVKGTFGYLDPEYFQSSQFTEKSDVYSFGVV  419
             ILLDEK+RAK+SDFG SRS++ID+TH TT V+GTFGYLDPEYFQ+SQFTEKSDVYSFGVV
Sbjct  554   ILLDEKYRAKLSDFGISRSVAIDQTHLTTKVQGTFGYLDPEYFQTSQFTEKSDVYSFGVV  613

Query  418   LAELLTGQKPISFELDDDEDRSLVSRFLLCMEENRLMEMLDGEVIEQGKKEDVVAMAWLA  239
             L ELLTGQKPIS  + + E +SLV RFLL MEENRL  +LD  +IEQG KE+ +A+A LA
Sbjct  614   LIELLTGQKPISTSVTEKE-KSLVMRFLLTMEENRLQTILDSRIIEQGAKEEHLAVANLA  672

Query  238   QRCLNFNGKKRPTMKEVATELDAIK  164
             +RCLNF+GKKRPT++EVATEL++I+
Sbjct  673   RRCLNFSGKKRPTIREVATELESIR  697



>ref|XP_006368666.1| hypothetical protein POPTR_0001s07550g [Populus trichocarpa]
 gb|ERP65235.1| hypothetical protein POPTR_0001s07550g [Populus trichocarpa]
Length=701

 Score =   468 bits (1204),  Expect = 1e-147, Method: Compositional matrix adjust.
 Identities = 292/601 (49%), Positives = 376/601 (63%), Gaps = 44/601 (7%)
 Frame = -1

Query  1828  ISPSCQGSNNFSNIIHNSKLSETPFMYSNDNNFMLFGCGNAFITMPGEELDQPGYNLNCS  1649
             IS  C G    S I     ++ +PF +S+ N F   GC N  + + G E +  G    C 
Sbjct  74    ISSGCSGRGANSAI----NMTGSPFAFSSSNIFTAMGCNNRAL-LNGIEPEIVGCTSTCG  128

Query  1648  SKNTTAPKTAHD-----CQGINCNHLTVDYDVNTYQVNF------THSSSFNACNYAFFl  1502
             + N T+  +A       C G NC   T+   +  +  +        +    N C  AF +
Sbjct  129   ANNLTSNSSAEGKENSYCSGNNCCQTTIPSSLQVFNASLGTPDHPINDQGRNECKVAFIV  188

Query  1501  sassslpptlqslpsrqQEMVVVPVELRWTITQEDVPPSYSKYCSPSTYINPQLQWHNYL  1322
                            +  +M  VPV L W +      P   K    +T     + + N  
Sbjct  189   EEEWFRNNISSPEVVK--DMQYVPVILDWDMYYGTDIPEGVKNSDANT-----VTYSNST  241

Query  1321  QCDCPGGDDRNVYLSGGC----EWKHKDYVISSNKLR--------------PAIIGISAS  1196
              C C  G D N YL  GC    + K     + S   +                I  +SA+
Sbjct  242   TCWCFPGYDGNPYLPDGCTDIDQCKIPGLNLCSGMTKCVNVPGLYKCELDKAKITFLSAA  301

Query  1195  FGFVFLIWAFVILYkaikkrkmkklrqkffkRNGGlllqqqlLTKEGTIEKTKIFTASEL  1016
              G + L+     LYK +KKRK  +L++KFFKRNGGLLLQQQL + +G+I+KTKIFT+ EL
Sbjct  302   TGLLLLLVGIWRLYKLVKKRKNIELKKKFFKRNGGLLLQQQLSSSDGSIQKTKIFTSKEL  361

Query  1015  DKATDHFNADRIVGRGGQGTVYKGMLIDGQIVAVKKSQAVDEDQLEPFINEVVILSQINH  836
             +KATD FN +RI+G+GGQGTVYKGM  DG IVAVKKS+ VDE++LE FINEVVILSQ+NH
Sbjct  362   EKATDRFNDNRILGQGGQGTVYKGMQADGMIVAVKKSKMVDEEKLEEFINEVVILSQVNH  421

Query  835   RNVVKLMGCCLETEVPILVYEFIPNGTLFGLIHNNFDNELIPLSWDIRLRIASEVACALA  656
             RNVVKL+GCCLETEVP+LVYEFIPNG LF  IH+    E    SW++RLRIA+EVA AL+
Sbjct  422   RNVVKLLGCCLETEVPLLVYEFIPNGNLFEYIHD--QKEEFEFSWEMRLRIATEVARALS  479

Query  655   YLHSVTLVPIYHRDIKTGNILLDEKFRAKVSDFGTSRSISIDKTHFTTMVKGTFGYLDPE  476
             YLHS   +PIYHRDIK+ NILLDEKF+AKVSDFGTSRSI+ID+TH TT V+GTFGYLDPE
Sbjct  480   YLHSAASIPIYHRDIKSTNILLDEKFKAKVSDFGTSRSITIDQTHLTTHVQGTFGYLDPE  539

Query  475   YFQSSQFTEKSDVYSFGVVLAELLTGQKPISFELDDDEDRSLVSRFLLCMEENRLMEMLD  296
             YFQSSQFT KSDVYSFGVVLAELL+GQKPIS+E   +E R L + F+L MEEN++ ++LD
Sbjct  540   YFQSSQFTGKSDVYSFGVVLAELLSGQKPISYE-RPEERRGLATHFILLMEENKIFDILD  598

Query  295   GEVIEQGKKEDVVAMAWLAQRCLNFNGKKRPTMKEVATELDAIKASNSHLPLAMEAFEIE  116
               ++ Q ++E+V+A+A LA+RCLN NG+KRPTM+EVA EL+ I+ S   L     + E+E
Sbjct  599   ERLMGQDREEEVIAVANLARRCLNLNGRKRPTMREVAIELEQIRLSKGALHAQQSSKELE  658

Query  115   S  113
             +
Sbjct  659   N  659



>ref|XP_002297684.2| wall-associated kinase family protein [Populus trichocarpa]
 gb|EEE82489.2| wall-associated kinase family protein [Populus trichocarpa]
Length=711

 Score =   467 bits (1201),  Expect = 7e-147, Method: Compositional matrix adjust.
 Identities = 293/622 (47%), Positives = 382/622 (61%), Gaps = 52/622 (8%)
 Frame = -1

Query  1882  VDFLGMSYDSQTITIKESI-SPSCQGSNNFSNIIHNSKLSETPFMYSNDNNFMLFGCGNA  1706
             ++   +S +S  + +   I S  C G    +N+  N  ++ +PF +S+ N F   GC N 
Sbjct  79    MEVFKISLESSVVRVNSPIISSGCSGRG--ANLAIN--MTGSPFSFSSSNIFTAMGCNNR  134

Query  1705  FITMPGEELDQPGYNLNCSSKNTTAPKTAHDCQGINCNHLTVDYDVNTYQVNF------T  1544
              + + G E +  G    C +  +T  K    C G NC   T+   +     +        
Sbjct  135   AL-LNGIEPEIVGCTSTCGA--STEGKENSYCSGNNCCQTTIPSSLQVVNASLGTPEHPI  191

Query  1543  HSSSFNACNYAFFlsassslpptlqslpsrqQEMVVVPVELRWTITQEDVPPSYSKYCSP  1364
             +    N C  AF +               +  +M  VPV L W         S + YC P
Sbjct  192   NDQGRNQCKVAFIVQEKWFRNNISSPEVVQ--DMQYVPVILDWN--------SDAMYCDP  241

Query  1363  STYINPQLQ-------WHNYLQCDCPGGDDRNVYLSGGCEWKHKDYVISSNKL-------  1226
                +            + N   C C  G D N YL  GC    +  +   N         
Sbjct  242   PMNLTSGRSGLRTVTLYSNSTICSCNWGYDGNPYLPDGCTDIDECKIPRGNSCSGMTKCV  301

Query  1225  -----------RPAIIGISASFGFVFLIWAFVILYkaikkrkmkklrqkffkRNGGlllq  1079
                        +  I  +SA+ G + L+     LYK +KKRK  +L++KFFKRNGGLLLQ
Sbjct  302   NVPGGFKCELDKAKITFLSAATGLLLLLVGIWRLYKLVKKRKNIELKKKFFKRNGGLLLQ  361

Query  1078  qqlLTKEGTIEKTKIFTASELDKATDHFNADRIVGRGGQGTVYKGMLIDGQIVAVKKSQA  899
             QQL + +G+I+KTKIFT+ EL+KATD FN +RI+G+GGQGTVYKGM  DG IVAVKKS  
Sbjct  362   QQLSSSDGSIQKTKIFTSKELEKATDRFNDNRILGQGGQGTVYKGMQADGMIVAVKKSIL  421

Query  898   VDEDQLEPFINEVVILSQINHRNVVKLMGCCLETEVPILVYEFIPNGTLFGLIHNNFDNE  719
             VDE++LE FINEVVILSQ+NHRNVVKL+GCCLETEVP+LVYEFIPNG LF  IH+    E
Sbjct  422   VDEEKLEEFINEVVILSQVNHRNVVKLLGCCLETEVPLLVYEFIPNGNLFEYIHD--QKE  479

Query  718   LIPLSWDIRLRIASEVACALAYLHSVTLVPIYHRDIKTGNILLDEKFRAKVSDFGTSRSI  539
                 SW++RLRIA+EVA AL+YLHS   +P+YHRDIK+ NI+LDEKFRAKVSDFGTSRSI
Sbjct  480   EFEFSWEMRLRIATEVARALSYLHSAASIPVYHRDIKSTNIMLDEKFRAKVSDFGTSRSI  539

Query  538   SIDKTHFTTMVKGTFGYLDPEYFQSSQFTEKSDVYSFGVVLAELLTGQKPISFELDDDED  359
             +ID+TH TT V+GTFGYLDPEYFQSSQFT KSDVYSFGVVLAELL+GQKPIS+E   +E 
Sbjct  540   AIDQTHLTTHVQGTFGYLDPEYFQSSQFTGKSDVYSFGVVLAELLSGQKPISYE-RSEER  598

Query  358   RSLVSRFLLCMEENRLMEMLDGEVIEQGKKEDVVAMAWLAQRCLNFNGKKRPTMKEVATE  179
             RSL + F+L MEEN++ ++LD  ++ Q ++E+V+A+A LA+RCLN NG+KRPTM+EVA E
Sbjct  599   RSLATHFILLMEENKIFDILDERLMGQDREEEVIAVANLARRCLNLNGRKRPTMREVALE  658

Query  178   LDAIKASNSHLPLAMEAFEIES  113
             L+ I+ S   L     + E+E+
Sbjct  659   LEQIRLSKGALHAQQSSKELEN  680



>emb|CDP20609.1| unnamed protein product [Coffea canephora]
Length=709

 Score =   466 bits (1198),  Expect = 1e-146, Method: Compositional matrix adjust.
 Identities = 294/611 (48%), Positives = 376/611 (62%), Gaps = 53/611 (9%)
 Frame = -1

Query  1882  VDFLGMSYDSQTITIKESISPSCQGSNNFSNII-----HNSKLSETPFMYSND-NNFMLF  1721
             ++ L +S  + T+T+   I+ S   S   +  I     ++S L+ TPF YS   N  +LF
Sbjct  81    LEVLKVSLRNLTVTVNTPITASSCSSGAQTGAISSWRSNSSDLAGTPFFYSKTYNKLVLF  140

Query  1720  GCGNAFITMPGEELDQPGYNLNCSSKNTTAPKTAHDCQGINCNHLTVDYDVNTYQVNFTH  1541
             GCG A +          G    C S     P   +     NC    + +D+  Y +NFT 
Sbjct  141   GCGTAVLLNQNNNKILSGCTSICKSDTPPQPININS-TCYNCCETAIPFDLPKYHLNFT-  198

Query  1540  SSSFN------------ACNYAFFlsassslpptlqslpsrqQEMVVVPVELRWTITQED  1397
             +S FN            +C+  F +  S S     Q        M  VPV L WT+ ++D
Sbjct  199   ASRFNRGTIRSRINGTSSCSSVFLVDQSLSPVTYSQ-------SMHSVPVVLAWTLGRDD  251

Query  1396  VPPSYSKYCSPSTYINPQLQWHN-----YLQCDCPGGDDRNVYLS---------GGCEW-  1262
             V   Y     P  YI   L+  +       +C   G +  ++Y +          G +  
Sbjct  252   VQAIY-----PCPYIITYLELESGENMATFRCTTCGTEPEDIYTNPYLQKFQCGTGTQLL  306

Query  1261  --KHKDYVISSNKLRPAIIGISASFGFVFLIWAFVILYkaikkrkmkklrqkffkRNGGl  1088
               + +   +   +L     G SA  G +  + A   LY+ +K+R+ K +++KFFKRNGGL
Sbjct  307   LVRQRHPFLLHFELNNVTHGASAGIGVLIFVAASFTLYELVKRRRDKMIKEKFFKRNGGL  366

Query  1087  llqqqlLTKEGTIEKTKIFTASELDKATDHFNADRIVGRGGQGTVYKGMLIDGQIVAVKK  908
             +LQQQL   +  I KT+IFTA ELDK TDHFN +R++GRGGQGTVYKGML DG + A+KK
Sbjct  367   ILQQQLSADDIVINKTRIFTAKELDKGTDHFNENRVLGRGGQGTVYKGMLADGNLAAIKK  426

Query  907   SQAVDEDQLEPFINEVVILSQINHRNVVKLMGCCLETEVPILVYEFIPNGTLFGLIHNNF  728
             S+ VDE QL  FINEVVILSQ+NHRNVVKL+GCCLETEVP+LVYEFIPNGTL  LIHN+ 
Sbjct  427   SKKVDESQLGQFINEVVILSQVNHRNVVKLLGCCLETEVPMLVYEFIPNGTLDRLIHND-  485

Query  727   DNELIPLSWDIRLRIASEVACALAYLHSVTLVPIYHRDIKTGNILLDEKFRAKVSDFGTS  548
               E  P +W +RL+IA+EVA ALAYLHS   +PIYHRDIK+ NILLDEK+ AKVSDFG S
Sbjct  486   --EEFPFTWSVRLKIAAEVAGALAYLHSAITIPIYHRDIKSSNILLDEKYIAKVSDFGIS  543

Query  547   RSISIDKTHFTTMVKGTFGYLDPEYFQSSQFTEKSDVYSFGVVLAELLTGQKPISFELD-  371
             +SISIDKTH TT V+GTFGYLDPEYFQSSQFTEKSDVYSFGVVL ELLT +KP S     
Sbjct  544   KSISIDKTHLTTQVRGTFGYLDPEYFQSSQFTEKSDVYSFGVVLVELLTRKKPASLSGSF  603

Query  370   DDEDRSLVSRFLLCMEENRLMEMLDGEVIEQGKKEDVVAMAWLAQRCLNFNGKKRPTMKE  191
             +D    L  RFL+ M+ENRL  +LD +V++Q  +E+V+A+A LAQRCLN NGK+RPTMKE
Sbjct  604   EDSHLGLAKRFLVMMDENRLASILDPQVLDQRIEEEVIAVAELAQRCLNLNGKERPTMKE  663

Query  190   VATELDAIKAS  158
             VA  L+ IK S
Sbjct  664   VAIVLENIKLS  674



>ref|XP_011082237.1| PREDICTED: wall-associated receptor kinase-like 2 [Sesamum indicum]
Length=728

 Score =   466 bits (1200),  Expect = 1e-146, Method: Compositional matrix adjust.
 Identities = 292/610 (48%), Positives = 379/610 (62%), Gaps = 57/610 (9%)
 Frame = -1

Query  1846  ITIKESISPSCQGSNNFSNIIHNSKLSETPFMYSNDNNFMLFGCGNAFITMPGEELDQPG  1667
             I IK  ++  C  +N+  N +    LS TPF  SN N   + GC +  +     +LD   
Sbjct  101   IRIKNHLASIC--NNSIDNSMSVLDLSGTPFSLSNQNKLTVVGCNHVSLMSKESKLDN--  156

Query  1666  YNLNCSSKNTTAPKTAHD--CQGINCNHLTV----DYDVNTYQVNFTHSSS--FNACNYA  1511
             Y  +C +   + P+   D  C GI C   ++     Y   T  +    SS+  FN C Y+
Sbjct  157   YISSCIAV-CSKPQELSDGSCSGIGCCQASIPKGLQYIATTMLLLNAQSSNDNFNPCGYS  215

Query  1510  FFlsassslpptlqslpsrqQE--MVVVPVELRWTITQEDVPPSYSKYCS-PSTYINPQL  1340
             F    SS          +   +  M  VP+ + W I       S +  C+  S  ++P  
Sbjct  216   FLAEQSSYSFRASDISDTSFTKRTMDTVPLVIDWAIANRTCNQSSNIICAGESVCVDPGT  275

Query  1339  QWHNYLQCDCPGGDDRNVYLSGGCEWKHK-------------------------DYVISS  1235
                 Y +C+C  G   N YLS GC+  ++                         +Y+   
Sbjct  276   TIGGY-RCNCSRGYQGNPYLSPGCQDINECKFNPCHPKAICINLPGSFNCSCPPNYLGDG  334

Query  1234  NKLRPAII------------GISASFGFVFLIWAFVILYkaikkrkmkklrqkffkRNGG  1091
              K     I            G+    G   L+   + L K +++R+ K+L+Q  FKRNGG
Sbjct  335   AKYGSGCISLPPPNKTALYAGLLIGSGLFILLAVSLWLCKVLRRRRAKQLKQSIFKRNGG  394

Query  1090  lllqqqlLTKEGTIEKTKIFTASELDKATDHFNADRIVGRGGQGTVYKGMLIDGQIVAVK  911
             LLLQQ +   +  + K +IFT+ EL+KATD FN  RI+GRGGQGTVYKGML DG+IVAVK
Sbjct  395   LLLQQHISAHDLVLGKMRIFTSKELEKATDRFNESRILGRGGQGTVYKGMLSDGRIVAVK  454

Query  910   KSQAVDEDQLEPFINEVVILSQINHRNVVKLMGCCLETEVPILVYEFIPNGTLFGLIHNN  731
             KS+ VDE++LE FINEVVILSQINHRNVVKL+G CLETEVP+LVYEFIPNGTL+ LIH+ 
Sbjct  455   KSKQVDENRLEEFINEVVILSQINHRNVVKLLGSCLETEVPLLVYEFIPNGTLYDLIHD-  513

Query  730   FDNELIPLSWDIRLRIASEVACALAYLHSVTLVPIYHRDIKTGNILLDEKFRAKVSDFGT  551
              DN   P SWD+RLRIA+E+A ALAYLH  T +PIYHRD+K+ NILLDEK+RAK+SDFG 
Sbjct  514   -DNTGFPFSWDLRLRIATEIANALAYLHYATSIPIYHRDMKSNNILLDEKYRAKLSDFGI  572

Query  550   SRSISIDKTHFTTMVKGTFGYLDPEYFQSSQFTEKSDVYSFGVVLAELLTGQKPISFELD  371
             SRS+S D+TH TT V+GTFGYLDPEYFQ+S+FTEKSDVYSFGVVL ELLTGQKPIS  + 
Sbjct  573   SRSVSTDQTHLTTKVQGTFGYLDPEYFQTSKFTEKSDVYSFGVVLVELLTGQKPISTSV-  631

Query  370   DDEDRSLVSRFLLCMEENRLMEMLDGEVIEQGKKEDVVAMAWLAQRCLNFNGKKRPTMKE  191
              +E++SLV+RFLL MEENRL  +LD ++ EQG KE+ +A+A LA+RCLN NGKKRPT++E
Sbjct  632   TEEEKSLVTRFLLTMEENRLHTILDSQITEQGAKEEHLAVANLARRCLNLNGKKRPTIRE  691

Query  190   VATELDAIKA  161
             VA EL++I+A
Sbjct  692   VAMELESIRA  701



>ref|XP_008222638.1| PREDICTED: wall-associated receptor kinase-like 1 [Prunus mume]
Length=672

 Score =   463 bits (1191),  Expect = 6e-146, Method: Compositional matrix adjust.
 Identities = 272/557 (49%), Positives = 356/557 (64%), Gaps = 29/557 (5%)
 Frame = -1

Query  1771  LSETPFMYSNDNNFMLFGCGNAFITMPGEELDQPGYNLNCSSKNTTAPKTAHDCQGINCN  1592
             L  +PF++S  N F    CG   +    +     G    C   +T+  +T   C G+NC 
Sbjct  96    LEGSPFVFSQKNRFTSLSCGGVALMTSLDGSTIAGCLSICDYTSTSYLRT-KSCIGMNCC  154

Query  1591  HLTVDYDVNTYQVNFTH---SSSFNACNYAFFlsassslpptlqslpsrqQEMVVVPVEL  1421
               T+   + ++  +F     ++    C YAF +        +         EM  VP+ L
Sbjct  155   QTTITPYLRSFSTSFGALLLNADRQTCKYAFLVEHDWFTSNSTNVSAIG--EMDYVPMVL  212

Query  1420  RWTITQEDVPPSYSKYCSPSTYINPQLQWHNYLQCDCPGGDDRNVYLSGGCEWKHKDYVI  1241
              W +   D+  + S     + + + +    +  QC C  G   N YL  GC+        
Sbjct  213   EWHVF--DLNYTKSDIYGTNNWRDDKSTECSSSQCFCSKGHHGNPYLLHGCQVP------  264

Query  1240  SSNKLRPAIIGISASFGFVFLIWAFVILYkaikkrkmkklrqkffkRNGGlllqqqlLTK  1061
                         S+  G +FL+      +K IKKRK  K ++KFF++NGGL+L+QQL + 
Sbjct  265   ------------SSVLGLLFLLTGIWWAHKVIKKRKDMKRKEKFFRQNGGLVLEQQLSSG  312

Query  1060  EGTIEKTKIFTASELDKATDHFNADRIVGRGGQGTVYKGMLIDGQIVAVKKSQAVDEDQL  881
             E  +EK K+F   EL+KATDHFNADR++G+GGQGTVYKGML DG+IVAVKKS+ V+  ++
Sbjct  313   ELNVEKVKLFNCKELEKATDHFNADRVIGQGGQGTVYKGMLADGRIVAVKKSKIVEGGEV  372

Query  880   EPFINEVVILSQINHRNVVKLMGCCLETEVPILVYEFIPNGTLFGLIHNNFDNELIPLSW  701
               FINE+VILSQI+HRNVVKL+GCCLETEVP+LVYEFIPNGTLF  IH+   NE  PL+W
Sbjct  373   RQFINEIVILSQISHRNVVKLLGCCLETEVPLLVYEFIPNGTLFQYIHHQ--NEEFPLTW  430

Query  700   DIRLRIASEVACALAYLHSVTLVPIYHRDIKTGNILLDEKFRAKVSDFGTSRSISIDKTH  521
             + RLR++ EVA AL+YLHS    PIYHRD+K+ NILLDEK+RAKV+DFGTSRSISID+TH
Sbjct  431   ETRLRVSIEVAGALSYLHSAASFPIYHRDVKSSNILLDEKYRAKVADFGTSRSISIDQTH  490

Query  520   FTTMVKGTFGYLDPEYFQSSQFTEKSDVYSFGVVLAELLTGQKPISFELDDDEDRSLVSR  341
              TT+V+GTFGYLDPEYFQSSQFTEKSDVYSFGVVLAELLTGQKP+SF +   E RSL + 
Sbjct  491   LTTLVRGTFGYLDPEYFQSSQFTEKSDVYSFGVVLAELLTGQKPVSF-MRSPESRSLATY  549

Query  340   FLLCMEENRLMEMLDGEVIEQGKKEDVVAMAWLAQRCLNFNGKKRPTMKEVATELDAIKA  161
             FLL ME+N L  +LD +V++ G K+ +VA+A L + CLN NG+KRPTMKEVA EL+ I+ 
Sbjct  550   FLLSMEDNNLFAILDAQVMKDGGKDQIVAVANLTKACLNLNGRKRPTMKEVAVELEGIQL  609

Query  160   SNSHLPLAMEAFEIESD  110
             S     +     E+E D
Sbjct  610   SVKASGVQQNFAEVEYD  626



>ref|XP_002513974.1| kinase, putative [Ricinus communis]
 gb|EEF48557.1| kinase, putative [Ricinus communis]
Length=694

 Score =   463 bits (1192),  Expect = 8e-146, Method: Compositional matrix adjust.
 Identities = 303/612 (50%), Positives = 388/612 (63%), Gaps = 63/612 (10%)
 Frame = -1

Query  1834  ESISPSCQGSNN---FSNIIHNSK------LSETPFMYSN-DNNFMLFGCGNAFITMPGE  1685
             E +SP+    NN   +SN  H +       LS TPF +SN  N F   GC N  I M  +
Sbjct  81    EVLSPNQVQVNNPVIYSNCSHKTSTASRVSLSGTPFTFSNASNRFTAKGCNNYAILMQ-D  139

Query  1684  ELDQPGYNLN-CSSKNTTAPKTAHDCQGINCNHLTVDYDVNTYQVNFTH--SSSFNACNY  1514
               D  G  L+ C  +  ++      C GINC   T+   + +++ N T+  S + N C  
Sbjct  140   IGDTVGGCLSICRDEANSS-----GCYGINCWQTTIPPYMKSFEANMTNPFSDNTNNCKS  194

Query  1513  AFFlsassslpptlqslpsrqQEMV-VVPVELRWTITQE--DVPPSYSKYCSP-STYINP  1346
             AF +  S     +  S           VP  L W   Q   D+   Y+  C+  S+Y   
Sbjct  195   AFMVDQSWFAFQSSSSRSLDDLNYKDHVPAVLDWANYQGYCDISEYYNITCTTDSSYCWK  254

Query  1345  QLQWHNYLQCDCPGGDDRN---------------VYLSGG----CEWKHKDYVISSNKLR  1223
             +L       C C   +D N               +Y  GG    C   H  Y  +SN+  
Sbjct  255   ELNRSQVCICQC---EDPNKCPDQSSNYNCRLFCMYRPGGYNCPCPRGHGKYE-NSNRCY  310

Query  1222  PAIIGISAS--------------FGFVFLIWAFVILYkaikkrkmkklrqkffkRNGGll  1085
             P  +    S               GF+ L+     LYK IK+R+  KL+Q FFKRNGGLL
Sbjct  311   PNSVFWGKSRTKTKSIIIGCGSGIGFLLLLIGIWSLYKIIKRRRAMKLKQNFFKRNGGLL  370

Query  1084  lqqqlLTKEGTIEKTKIFTASELDKATDHFNADRIVGRGGQGTVYKGMLIDGQIVAVKKS  905
             L+QQL + E  +E+TK+FT+ EL+KATD ++ +RI+G+GGQGTVYKGMLIDG++VA+KKS
Sbjct  371   LEQQLSSTENYVEQTKVFTSKELEKATDDYHTNRILGQGGQGTVYKGMLIDGRVVAIKKS  430

Query  904   QAVDEDQLEPFINEVVILSQINHRNVVKLMGCCLETEVPILVYEFIPNGTLFGLIHNNFD  725
             + VDED+L+ FINEVVILSQINHRNVVKL+GCCLETEVP+LVYEFIPNGTL+  IHN   
Sbjct  431   KVVDEDKLDQFINEVVILSQINHRNVVKLIGCCLETEVPLLVYEFIPNGTLYQYIHN--P  488

Query  724   NELIPLSWDIRLRIASEVACALAYLHSVTLVPIYHRDIKTGNILLDEKFRAKVSDFGTSR  545
             NE  P++W++RLRIA+EVA ALAYLH+   +PIYHRDIK+ NILLDEK+RAKV+DFGTS+
Sbjct  489   NEEFPVTWEMRLRIATEVAGALAYLHAAASMPIYHRDIKSSNILLDEKYRAKVADFGTSK  548

Query  544   SISIDKTHFTTMVKGTFGYLDPEYFQSSQFTEKSDVYSFGVVLAELLTGQKPISFELDDD  365
             SISID+TH TT V+GTFGYLDPEYFQSSQFTEKSDVYSFGVVL ELLTGQKPIS      
Sbjct  549   SISIDQTHVTTRVQGTFGYLDPEYFQSSQFTEKSDVYSFGVVLVELLTGQKPIS-SYRSV  607

Query  364   EDRSLVSRFLLCMEENRLMEMLDGEVIEQGKKEDVVAMAWLAQRCLNFNGKKRPTMKEVA  185
             E+RSL + FL+ MEE+RL E+LD  V+++G +E+++AMA LA++CLN NGKKRP MK VA
Sbjct  608   EERSLATYFLMTMEESRLFEILDARVLKEGGREEIIAMAKLAEKCLNLNGKKRPKMKTVA  667

Query  184   TELDAIKASNSH  149
              EL+ I++S  H
Sbjct  668   IELEGIRSSQGH  679



>ref|XP_007224001.1| hypothetical protein PRUPE_ppa014914mg [Prunus persica]
 gb|EMJ25200.1| hypothetical protein PRUPE_ppa014914mg [Prunus persica]
Length=669

 Score =   462 bits (1189),  Expect = 9e-146, Method: Compositional matrix adjust.
 Identities = 279/567 (49%), Positives = 366/567 (65%), Gaps = 58/567 (10%)
 Frame = -1

Query  1771  LSETPFMYSNDNNFMLFGCGN-AFITMPGEELDQPGYNLNCSSKNTTAPKTAHDCQGINC  1595
             L  +PF++S  N F    CG  A +T+ G  +   G  L+     +T+      C G+NC
Sbjct  107   LEGSPFLFSRKNKFTSMSCGGIALMTLHGSTI---GGCLSICDYYSTSVLQTKSCSGMNC  163

Query  1594  NHLTVDYDVNTYQVNF--THSSSFNACNYAFFlsassslpptlqslpsrqQEMVVVPVEL  1421
                T+ Y ++++  +F   ++ S  AC +AF +        +         EM  VPV L
Sbjct  164   CQTTLPYCLSSFNTSFGAVNAESQKACKFAFLVDNDWFTSNSTNISAIG--EMDYVPVVL  221

Query  1420  RWTI---TQEDV------PPSYSKYCSPSTYINPQLQWHNYLQCDCPGGDDRNVYLSGGC  1268
              W +   T+ D+          S  CS S             QC C  G   N YL  GC
Sbjct  222   EWYVVNYTKFDIYGTNNWKDDNSTDCSSS-------------QCFCSKGYHGNPYLLHGC  268

Query  1267  EWKHKDYVISSNKLRPAIIGISASFGFVFLIWAFVILYkaikkrkmkklrqkffkRNGGl  1088
             +                    S+  G +FL+      +K IKKRK  K ++KFFK+NGGL
Sbjct  269   QVP------------------SSVLGLLFLMIGSWWSHKGIKKRKNIKRKEKFFKQNGGL  310

Query  1087  llqqqlLTKEGTIEKTKIFTASELDKATDHFNADRIVGRGGQGTVYKGMLIDGQIVAVKK  908
             +L+QQL + E  +EK K+F   EL+KATDHFNADR++G+GGQGTVYKGML DG+IVAVKK
Sbjct  311   VLEQQLSSGELNVEKVKLFNCKELEKATDHFNADRVIGQGGQGTVYKGMLADGRIVAVKK  370

Query  907   SQAVDEDQLEPFINEVVILSQINHRNVVKLMGCCLETEVPILVYEFIPNGTLFGLIHNNF  728
             S+ V+   +  FINE+VILSQI+HRNVVKL+GCCLETEVP+LVYEFI NGTLF  IH+  
Sbjct  371   SKIVEGGDVGQFINEIVILSQISHRNVVKLLGCCLETEVPLLVYEFILNGTLFEYIHHK-  429

Query  727   DNELIPLSWDIRLRIASEVACALAYLHSVTLVPIYHRDIKTGNILLDEKFRAKVSDFGTS  548
              NE  PL+W++RLRI+ EVA AL+YLHS    PIYHRD+K+ NILLDEK+RAKV+DFGTS
Sbjct  430   -NEDFPLTWEMRLRISIEVAGALSYLHSAAAFPIYHRDVKSSNILLDEKYRAKVADFGTS  488

Query  547   RSISIDKTHFTTMVKGTFGYLDPEYFQSSQFTEKSDVYSFGVVLAELLTGQKPISFELDD  368
             RS+SID+TH TT+V+GTFGYLDPEYFQSSQFT KSDVYSFGVVLAELLTGQKP+SF +  
Sbjct  489   RSVSIDQTHLTTLVRGTFGYLDPEYFQSSQFTAKSDVYSFGVVLAELLTGQKPVSF-MRP  547

Query  367   DEDRSLVSRFLLCMEENRLMEMLDGEVIEQGKKEDVVAMAWLAQRCLNFNGKKRPTMKEV  188
              E RSL + FL+ MEEN L ++LD +V++ G+ + +VA+A LA+ CLN NG+KRPTMKEV
Sbjct  548   QESRSLATYFLISMEENSLFDILDAQVMKDGENDQIVAVANLAKACLNLNGRKRPTMKEV  607

Query  187   ATELDAIKASNSHLPLAMEAFEIESDF  107
             A EL+ I+       L+++A +++ +F
Sbjct  608   AVELEGIQ-------LSIKASDVQQNF  627



>ref|XP_006368673.1| hypothetical protein POPTR_0001s076201g, partial [Populus trichocarpa]
 gb|ERP65242.1| hypothetical protein POPTR_0001s076201g, partial [Populus trichocarpa]
Length=678

 Score =   462 bits (1190),  Expect = 1e-145, Method: Compositional matrix adjust.
 Identities = 291/609 (48%), Positives = 389/609 (64%), Gaps = 47/609 (8%)
 Frame = -1

Query  1882  VDFLGMSYDSQTITIKESI-SPSCQGSNNFSNIIHNSKLSETPFMYSNDNNFMLFGCGNA  1706
             ++ L +S  S  + +   I S  C G    +N+  +  ++ +PF++S+ N F+  GC N 
Sbjct  81    MEVLKISLGSSRVRVNSPIISSGCSGRG--ANLSFD--MTGSPFVFSSLNIFIAMGCNNR  136

Query  1705  FITMPGEELDQPGYNLNCSSKNTTAPKTAHD----CQGINCNHLTVDYDVNTYQVNF---  1547
              + +   E +  G    C + N T+  T       C G NC    +  ++  +  +    
Sbjct  137   AL-LNRIEPEIVGCTSTCGANNLTSSSTEGKEKRYCSGNNCCQTRIPSNLQVFSASLGTT  195

Query  1546  --THSSSFNACNYAFFlsassslpptlqslpsrqQEMVVVPVELRWTITQED--VPPSYS  1379
               ++    N C  AF +  + SL         +  +M  VPV L W +  +D  V  S +
Sbjct  196   EDSNDQGRNQCKVAFIVDRAWSLDNIKSPEAVQ--DMQHVPVILDWFMYSDDIRVENSEA  253

Query  1378  KYCSPSTYINPQLQ-------WHNYLQCDCPGGDDRNVYLSGGCEWKHKDYVISSNKLRP  1220
             K CSP   +   +        + N   C C  G D N YL  GC       + ++  L  
Sbjct  254   KNCSPPVQLVSGMWGLSTLTLYSNSTTCSCNLGYDGNPYLPDGC-----TVLGAATGLLL  308

Query  1219  AIIGISASFGFVFLIWAFVILYkaikkrkmkklrqkffkRNGGlllqqqlLTKEGTIEKT  1040
              ++GI          W    LYK +KKRK  ++++K FKRNGGLLLQQQL + +G+I+KT
Sbjct  309   LLVGI----------WR---LYKLVKKRKNIEMKKKLFKRNGGLLLQQQLSSSDGSIQKT  355

Query  1039  KIFTASELDKATDHFNADRIVGRGGQGTVYKGMLIDGQIVAVKKSQAVDEDQLEPFINEV  860
             KIFT+ EL+KATD FN +RI+G+GGQGTVYKGML DG IVAVKKS+ VDE++LE FINEV
Sbjct  356   KIFTSKELEKATDRFNDNRILGQGGQGTVYKGMLADGMIVAVKKSKIVDEEKLEEFINEV  415

Query  859   VILSQINHRNVVKLMGCCLETEVPILVYEFIPNGTLFGLIHNNFDNELIPLSWDIRLRIA  680
             VILSQ+NHR+VVKL+GCCLETEVP+LVYEFIPNG LF  IHN+   E    SW++RLRI+
Sbjct  416   VILSQVNHRHVVKLLGCCLETEVPLLVYEFIPNGNLFEYIHNH--KEEFEFSWEMRLRIS  473

Query  679   SEVACALAYLHSVTLVPIYHRDIKTGNILLDEKFRAKVSDFGTSRSISIDKTHFTTMVKG  500
             +EVA AL+YLHS   + IYHRDIK+ NILLDEKF+AKVSDFGTSRSI+ID+TH TT V+G
Sbjct  474   TEVARALSYLHSAVSIMIYHRDIKSTNILLDEKFQAKVSDFGTSRSIAIDQTHLTTHVQG  533

Query  499   TFGYLDPEYFQSSQFTEKSDVYSFGVVLAELLTGQKPISFELDDDEDRSLVSRFLLCMEE  320
             TFGY DPEYFQSS FTEKSDVYSFGVVLAELL+GQKPIS+E   +E R L + F+L MEE
Sbjct  534   TFGYFDPEYFQSSHFTEKSDVYSFGVVLAELLSGQKPISYE-RSEERRGLATHFILLMEE  592

Query  319   NRLMEMLDGEVIEQGKKEDVVAMAWLAQRCLNFNGKKRPTMKEVATELDAIKASNSHLPL  140
             N++ ++LD  ++ Q ++E+V+A+A LA+RCLN NG+KRPTM+EVA EL+ I+ S   L  
Sbjct  593   NKIFDILDERLMRQDREEEVIAVANLARRCLNLNGRKRPTMREVAIELEQIRLSKGALHA  652

Query  139   AMEAFEIES  113
                  E+E+
Sbjct  653   PQSRKELEN  661



>ref|XP_011013612.1| PREDICTED: wall-associated receptor kinase-like 22 [Populus euphratica]
Length=738

 Score =   464 bits (1194),  Expect = 1e-145, Method: Compositional matrix adjust.
 Identities = 295/629 (47%), Positives = 389/629 (62%), Gaps = 49/629 (8%)
 Frame = -1

Query  1882  VDFLGMSYDSQTITIKESI-SPSCQGSNNFSNIIHNSKLSETPFMYSNDNNFMLFGCGNA  1706
             ++ LG+    + + +   I S  C G    +N+  N  ++ +PF +S+ N+F   GC N 
Sbjct  78    MEVLGIPLGERWVRVNSPIISSGCSGRG--ANLAIN--MTGSPFAFSSSNSFAAMGCNNR  133

Query  1705  FITMPGEELDQPGYNLNCSSKNTTAPKTAHD----CQGINCNHLTVDYDVNTYQVNFTHS  1538
              + +   E +  G    C + N T+  T       C G NC    +  D+  +  +   +
Sbjct  134   AL-LNRIEPEIVGCKSTCGANNLTSSSTEGKENCYCSGNNCCQTRIPSDLQVFNASLETT  192

Query  1537  S-----SFNACNYAFFlsassslpptlqslpsrqQEMVVVPVELRWTITQED--VPPSYS  1379
                     N C  AF +    S          +  +M  VPV L W +  +D  V  S +
Sbjct  193   EDPNDHGRNQCKVAFIVDREWSRDNIKSPEAVQ--DMQHVPVILDWFVYSDDISVGNSDA  250

Query  1378  KYCSPSTYI-------NPQLQWHNYLQCDCPGGDDRNVYLSGGCEWKHKDYVISSNKLRP  1220
             K CSP+  +            + N   C C  G D N YL  GC    +   ++ N    
Sbjct  251   KNCSPTVNLISGRWGLRTVKLYSNSTTCRCNPGYDGNPYLPDGCTDIDECRNLNGNWCSG  310

Query  1219  AIIGISASFGF---------VFLIWAFVI-----------LYkaikkrkmkklrqkffkR  1100
                 ++   G+          FLI                LYK +KKRK  +L++KFFK+
Sbjct  311   MTKCVNVPGGYKCELDKAKITFLILGAATGLLLLLVGIWRLYKLVKKRKNIELKKKFFKQ  370

Query  1099  NGGlllqqqlLTKEGTIEKTKIFTASELDKATDHFNADRIVGRGGQGTVYKGMLIDGQIV  920
             NGGLLLQQQL + +G+I+KTKIFT+ EL+KATD FN +RI+G+GGQGTVYKGML DG IV
Sbjct  371   NGGLLLQQQLSSSDGSIQKTKIFTSKELEKATDRFNDNRILGKGGQGTVYKGMLADGMIV  430

Query  919   AVKKSQAVDEDQLEPFINEVVILSQINHRNVVKLMGCCLETEVPILVYEFIPNGTLFGLI  740
             AVKKS+ VD+++LE FINEVVILSQ+NHRNVVKL+GCCLETEVP+LVYEFIPNG LF  I
Sbjct  431   AVKKSKIVDKEKLEEFINEVVILSQVNHRNVVKLLGCCLETEVPLLVYEFIPNGNLFEYI  490

Query  739   HNNFDNELIPLSWDIRLRIASEVACALAYLHSVTLVPIYHRDIKTGNILLDEKFRAKVSD  560
             H     E    SW++RLRIA+EVA AL+YLHS   +P+YHRDIK+ NILLDEKFRAKVSD
Sbjct  491   HEQ--KEEFQFSWEMRLRIATEVAGALSYLHSAASIPVYHRDIKSTNILLDEKFRAKVSD  548

Query  559   FGTSRSISIDKTHFTTMVKGTFGYLDPEYFQSSQFTEKSDVYSFGVVLAELLTGQKPISF  380
             FGTSRSI+ID+TH TT V+GTFGY DPEYFQSSQFT KSDVYSFGVVLAELL+GQKPIS+
Sbjct  549   FGTSRSIAIDQTHLTTHVRGTFGYFDPEYFQSSQFTGKSDVYSFGVVLAELLSGQKPISY  608

Query  379   ELDDDEDRSLVSRFLLCMEENRLMEMLDGEVIEQGKKEDVVAMAWLAQRCLNFNGKKRPT  200
             E   +E  SL + F+L MEEN++ ++LD  +I Q ++E+V+A+A LA+RCLN+NG+KRPT
Sbjct  609   E-RSEERGSLATHFILLMEENKIFDILDERLIGQDREEEVIAVANLARRCLNWNGRKRPT  667

Query  199   MKEVATELDAIKASNSHLPLAMEAFEIES  113
             M+EVA EL+ I+ S   L     + E+E+
Sbjct  668   MREVAIELEQIRLSKGALHAQRSSKELEN  696



>ref|XP_006368665.1| hypothetical protein POPTR_0001s07540g [Populus trichocarpa]
 gb|ERP65234.1| hypothetical protein POPTR_0001s07540g [Populus trichocarpa]
Length=657

 Score =   461 bits (1187),  Expect = 1e-145, Method: Compositional matrix adjust.
 Identities = 288/588 (49%), Positives = 378/588 (64%), Gaps = 46/588 (8%)
 Frame = -1

Query  1882  VDFLGMSYDSQTITIKESI-SPSCQGSNNFSNIIHNSKLSETPFMYSNDNNFMLFGCGNA  1706
             ++ L +S +  T+ +   I S  C G    +N+  N  ++ +PF +S+ N F   GC N 
Sbjct  53    MEVLEISLEDSTVRVYSPIISSGCAGRG--ANLAIN--MTTSPFAFSSSNIFTAMGCNNL  108

Query  1705  FITMPGEELDQPGYNLNCSSKNTTAPKTAHD-----CQGINCNHLTVDYDVNTYQVNF--  1547
              + + G E +  G    C + N T+  +A       C G NC   T+   +  +  +   
Sbjct  109   AL-LNGIEPEIVGCTSTCGANNLTSNSSAEGKENSYCSGNNCCQTTIPSSLQVFNASLGT  167

Query  1546  ----THSSSFNACNYAFFlsassslpptlqslpsrqQEMVVVPVELRWTIT-QEDVPPSY  1382
                  +    N C  AF +               +   M  VPV LRW +    D+P   
Sbjct  168   PEHPINDQGRNQCKAAFIVEEEWFRNNISSPEVVQY--MQYVPVILRWLMYYGTDIPEGV  225

Query  1381  SKYCSPSTYINPQLQWHNYLQCDCPGGDDRNVYLSGGCEWKHKDYVISSNKLRPAIIGIS  1202
             + +   +  +     + N   C C  G D + YL  GC       + ++  L   ++GI 
Sbjct  226   TLWGLRTVTL-----YSNSTTCWCSPGYDGHPYLPDGC-----TVLGAATGLLLLLVGI-  274

Query  1201  ASFGFVFLIWAFVILYkaikkrkmkklrqkffkRNGGlllqqqlLTKEGTIEKTKIFTAS  1022
                      W    LYK +KKRK  +L++KFFKRNGGLLLQQQL + +G+I+KTKIFT+ 
Sbjct  275   ---------WR---LYKLVKKRKNIELKKKFFKRNGGLLLQQQLSSSDGSIQKTKIFTSK  322

Query  1021  ELDKATDHFNADRIVGRGGQGTVYKGMLIDGQIVAVKKSQAVDEDQLEPFINEVVILSQI  842
             EL+KATD FN +RI+G+GGQGTVYKGM  DG IVAVKKS  VDE++LE FINEVVILSQ+
Sbjct  323   ELEKATDRFNDNRILGQGGQGTVYKGMQADGMIVAVKKSILVDEEKLEEFINEVVILSQV  382

Query  841   NHRNVVKLMGCCLETEVPILVYEFIPNGTLFGLIHNNFDNELIPLSWDIRLRIASEVACA  662
             NHRNVVKL+GCCLETEVP+LVYEFIPNG LF  IH+    E    SW++RLRIA+EVA A
Sbjct  383   NHRNVVKLLGCCLETEVPLLVYEFIPNGNLFEYIHD--QKEEFEFSWEMRLRIATEVARA  440

Query  661   LAYLHSVTLVPIYHRDIKTGNILLDEKFRAKVSDFGTSRSISIDKTHFTTMVKGTFGYLD  482
             L+YLHS   +P+YHRDIK+ NI+LDEKFRAKVSDFGTSRSI+ID+TH TT V+GTFGYLD
Sbjct  441   LSYLHSAASIPVYHRDIKSTNIMLDEKFRAKVSDFGTSRSIAIDQTHLTTHVQGTFGYLD  500

Query  481   PEYFQSSQFTEKSDVYSFGVVLAELLTGQKPISFELDDDEDRSLVSRFLLCMEENRLMEM  302
             PEYFQSSQFT KSDVYSFGVVLAELL+GQKPIS+E  +D  RSL + F+L MEEN++ ++
Sbjct  501   PEYFQSSQFTGKSDVYSFGVVLAELLSGQKPISYERPEDR-RSLATHFILLMEENKIFDI  559

Query  301   LDGEVIEQGKKEDVVAMAWLAQRCLNFNGKKRPTMKEVATELDAIKAS  158
             LD  ++ Q ++E+V+A+A LA+RCLN NG+KRPTM+EVA EL+ I+ S
Sbjct  560   LDERLMGQDREEEVIAVANLARRCLNLNGRKRPTMREVAIELEQIRVS  607



>ref|XP_008222635.1| PREDICTED: wall-associated receptor kinase-like 22 [Prunus mume]
Length=713

 Score =   462 bits (1190),  Expect = 2e-145, Method: Compositional matrix adjust.
 Identities = 285/590 (48%), Positives = 375/590 (64%), Gaps = 55/590 (9%)
 Frame = -1

Query  1771  LSETPFMYSNDNNFMLFGCGN-AFITMPGEELDQPGYNLNCSSKNTTAPKTAHDCQGINC  1595
             L  +PF++S  N F    CG  A +T+ G  +   G  L+     +T+      C G+NC
Sbjct  107   LEGSPFLFSRKNKFTSMSCGGIALMTLHGSTI---GGCLSICDYYSTSVLQTKSCSGMNC  163

Query  1594  NHLTVDYDVNTYQVNF---THSSSFNACNYAFFlsassslpptlqslpsrqQEMVVVPVE  1424
                T+ Y ++++  +F    ++ S  AC YAF +        +         EM  VPV 
Sbjct  164   CQTTLPYCLSSFNTSFGAELNADSQKACKYAFLVDNDWFTSNSTNISAIG--EMDYVPVV  221

Query  1423  LRWTITQEDVPPSYSKYCSPSTYINPQLQWHN-------YLQCDCPGGDDRNVYLSGGC-  1268
             L W +       +Y+K+      I     W +         QC C  G   N YL  GC 
Sbjct  222   LEWYVV------NYTKF-----DIYGTNNWRDDNSTDCSSSQCFCSKGYHGNPYLLHGCK  270

Query  1267  ------EWKHKDYVIS------------------SNKLRPAIIGISASFGFVFLIWAFVI  1160
                   + +H +   S                  S+++  AII  S+  G +FL+     
Sbjct  271   DINECEDPEHPNRCGSGICINYPGKFFCQLPDRRSSRVNLAIIVPSSVLGLLFLMIGSWW  330

Query  1159  LYkaikkrkmkklrqkffkRNGGlllqqqlLTKEGTIEKTKIFTASELDKATDHFNADRI  980
              +K IKKRK  K ++KFFK+NGGL+L+QQL + E  +EK K+F   EL+KATDHFNADRI
Sbjct  331   SHKGIKKRKNIKRKEKFFKQNGGLVLEQQLSSGELNVEKVKLFNCKELEKATDHFNADRI  390

Query  979   VGRGGQGTVYKGMLIDGQIVAVKKSQAVDEDQLEPFINEVVILSQINHRNVVKLMGCCLE  800
             +G+GGQGTVYKGML+DG+IVAVKKS+ V+  ++  FINE+VILSQI+HRNVVKL+GCCLE
Sbjct  391   IGQGGQGTVYKGMLVDGRIVAVKKSKIVEGGEVGQFINEIVILSQISHRNVVKLLGCCLE  450

Query  799   TEVPILVYEFIPNGTLFGLIHNNFDNELIPLSWDIRLRIASEVACALAYLHSVTLVPIYH  620
             TEVP+LVYEFI NGTLF  IH+   NE  PL+W++RLRI+ EVA AL+YLHS    PI+H
Sbjct  451   TEVPLLVYEFILNGTLFEYIHHK--NEDFPLTWEMRLRISIEVAGALSYLHSAAAFPIFH  508

Query  619   RDIKTGNILLDEKFRAKVSDFGTSRSISIDKTHFTTMVKGTFGYLDPEYFQSSQFTEKSD  440
             RD+K+ NILLDEK+RAKV+DFGTSRS+SID+TH TT+V+GTFGYLDPEYFQSSQ TEKSD
Sbjct  509   RDVKSSNILLDEKYRAKVADFGTSRSVSIDQTHLTTLVRGTFGYLDPEYFQSSQLTEKSD  568

Query  439   VYSFGVVLAELLTGQKPISFELDDDEDRSLVSRFLLCMEENRLMEMLDGEVIEQGKKEDV  260
             VYSFGVVLAELLTGQKP+SF +   E RSL + FL+ MEEN L ++LD +V++ G+ + +
Sbjct  569   VYSFGVVLAELLTGQKPVSF-MRPQESRSLATYFLISMEENSLFDILDAQVMKDGENDQI  627

Query  259   VAMAWLAQRCLNFNGKKRPTMKEVATELDAIKASNSHLPLAMEAFEIESD  110
             VA+A LA+ CLN NG+KRPTMKEVA EL+ I+ S     +     E+E D
Sbjct  628   VAVANLAKACLNLNGRKRPTMKEVAVELERIQLSVKASGVQQNFAEVEYD  677



>ref|XP_008229710.1| PREDICTED: wall-associated receptor kinase-like 22 [Prunus mume]
Length=669

 Score =   461 bits (1185),  Expect = 3e-145, Method: Compositional matrix adjust.
 Identities = 294/632 (47%), Positives = 390/632 (62%), Gaps = 61/632 (10%)
 Frame = -1

Query  1882  VDFLGMSYDSQTITIKESISPSCQGSNNFSNIIHNSKLSETPFMYSNDNNFMLFGCGNAF  1703
             ++ L +S +  T+ ++  I+ S   +   S    N  +  TPF+YS  N F   GCG   
Sbjct  18    LEVLEISVEEGTLKVRNPITFSNCSNKPISRQTAN--VEGTPFVYSQKNIFTAVGCG---  72

Query  1702  ITMPGEELDQPGYNLN--CSSKNTTAPKTAHDCQGINCNHLTVDYDVNTYQVNFTHSSSF  1529
               M     +  GY ++  CSS+   +   +  CQ    + L+     +T   ++ + S+ 
Sbjct  73    -VMATITSNSNGYIISSGCSSECNISTNRSDTCQAALPSSLSA---FSTSFQDYGNYSTR  128

Query  1528  NACNYAFFlsassslpptlqslpsrqQEMVVVPVELRWTI--TQEDVPPSYSK-------  1376
             ++C+YAF          +      R  EM  VPV L W++  +  DV  ++ K       
Sbjct  129   SSCHYAFLADRDWFGNNSTNFSAIR--EMDYVPVMLEWSLFHSTTDVYGTFFKPNFTIGS  186

Query  1375  ------YC---SPSTYINPQLQWHNYLQCDCPGGDDRNVYLSGGC---------EWKHKD  1250
                   YC   + S+ IN      + L+C CPGG   N YL  GC         +    +
Sbjct  187   SGPGRAYCLSYNDSSSINES----SRLECSCPGGYKGNPYLLDGCLDINECELPDRHCSE  242

Query  1249  YVI--------------SSNKLRPAIIGISASFGFVFLIWAFVILYkaikkrkmkklrqk  1112
             + I              S+++++   IGI +S GF+FL+ A   LYK IKKRK  K + K
Sbjct  243   HFICVNSAGGYGCYPPKSNSQVKVIFIGIGSSLGFLFLLIASWWLYKVIKKRKAIKQKAK  302

Query  1111  ffkRNGGlllqqqlLTKEGTIEKTKIFTASELDKATDHFNADRIVGRGGQGTVYKGMLID  932
              FK+NGGLLL+QQL + E  +EK K+F + EL+ ATDHFN DRI+G+GGQGTVYKGML D
Sbjct  303   LFKQNGGLLLEQQLSSGEVNVEKIKLFNSKELETATDHFNVDRILGQGGQGTVYKGMLTD  362

Query  931   GQIVAVKKSQAVDEDQLEPFINEVVILSQINHRNVVKLMGCCLETEVPILVYEFIPNGTL  752
             G+IVAVKKS+ VD  ++  FINE+VILSQINHRNVVKL+GCCLETEVP+LVYEFIP GT+
Sbjct  363   GRIVAVKKSKVVDGGEVAQFINEIVILSQINHRNVVKLLGCCLETEVPLLVYEFIPKGTI  422

Query  751   FGLIHNNFDNELIPLSWDIRLRIASEVACALAYLHSVTLVPIYHRDIKTGNILLDEKFRA  572
                +H    NE   L W +RLRIA+EVA AL+YLHS    PIYHRDIK+ NILLDE++RA
Sbjct  423   HQYLHQQ--NEEFLLKWQMRLRIAAEVAGALSYLHSAAGFPIYHRDIKSTNILLDEEYRA  480

Query  571   KVSDFGTSRSISIDKTHFTTMVKGTFGYLDPEYFQSSQFTEKSDVYSFGVVLAELLTGQK  392
             KV+DFGTSRS+S D+TH TT+V GTFGYLDPEYFQSSQFT+KSDVYSFGVVL ELLTG+K
Sbjct  481   KVADFGTSRSVSTDQTHLTTVVHGTFGYLDPEYFQSSQFTDKSDVYSFGVVLVELLTGEK  540

Query  391   PISFELDDDEDRSLVSRFLLCMEENRLMEMLDGEVIEQGKKEDVVAMAWLAQRCLNFNGK  212
             P+S      E R LV+ F   MEENRL +++D +V E+G  ED++A+A LA+RCL+ +GK
Sbjct  541   PVSLA-RSPEVRGLVAYFNFSMEENRLFDIVDAQVKEEGVTEDILAVATLAKRCLDLSGK  599

Query  211   KRPTMKEVATELDAIKASNSHLPLAMEAFEIE  116
             +RPTMKEVA EL+ I+ S     L     E+E
Sbjct  600   RRPTMKEVAMELEGIQKSVKASNLQQNQEEVE  631



>ref|XP_010663521.1| PREDICTED: wall-associated receptor kinase-like 1 isoform X2 
[Vitis vinifera]
Length=685

 Score =   461 bits (1187),  Expect = 3e-145, Method: Compositional matrix adjust.
 Identities = 287/599 (48%), Positives = 389/599 (65%), Gaps = 46/599 (8%)
 Frame = -1

Query  1882  VDFLGMSYDSQTITIKESISPSCQ--GSNNFSNIIHNSKLSETPFMYSN-DNNFMLFGCG  1712
             ++ L +S + QT+T+   I+   Q  GS+     I+   L ++PF++S  DN F++ GCG
Sbjct  83    LELLNVSLEYQTVTVYSPIASYDQQKGSSELQTSIN---LDQSPFLFSTLDNIFVVLGCG  139

Query  1711  NAFITMPGEELDQPGYNLNCSSKNTTAPKTAHDCQGINCNHLTV----DYDVNTYQVNFT  1544
             +A + M  E++     ++NCS    + P     C GINC   T+     Y ++TY V FT
Sbjct  140   HAKL-MEHEKIWAGCTSINCSD---SFPDQG--CYGINCCQTTIPTIDSYYLSTYSVKFT  193

Query  1543  HSSSFNACNYAFFlsassslpptlqslpsrqQEMVVVPVELRWTITQEDVPPSYSKYCSP  1364
                  N  + +           +          +    + L W I + D   S    C+ 
Sbjct  194   LDDEGNNHSTSTHAFLVDRDWFSRNFTELEDVSVKYAALSLLWMIKEGDNADSS---CNG  250

Query  1363  STYINPQLQWHNYLQCDCPGGDDRNVYLSGGCEWKHKDYVISSNKLRPAIIGISASFGFV  1184
             S Y +  +  +    C CP   + N YL  GC+                  G S   G +
Sbjct  251   SNYYSLSIGSYVRSSCGCPPRYEGNPYLHDGCDH-----------------GFSIGGGSL  293

Query  1183  FLIWAFVILYkaikkrkmkklrqkffkRNGGlllqqqlLTKEGTIEKTKIFTASELDKAT  1004
              L+     LYK +KK+K  +L+++FFKRNGGLLL+QQ+ + +  +EKTKIFT+ EL+KAT
Sbjct  294   LLLLGSFGLYKVVKKKKEIRLKKRFFKRNGGLLLEQQISSDKVAVEKTKIFTSKELEKAT  353

Query  1003  DHFNADRIVGRGGQGTVYKGMLIDGQIVAVKKSQAVDEDQLEPFINEVVILSQINHRNVV  824
             D+FN DRI+G+GGQGTVYKGML DG+IVAVKKS+ VDE Q+E FINE+VILSQI+HRNVV
Sbjct  354   DNFNLDRILGQGGQGTVYKGMLTDGRIVAVKKSKIVDESQIEHFINEIVILSQISHRNVV  413

Query  823   KLMGCCLETEVPILVYEFIPNGTLFGLIHNNFDNELIPLSWDIRLRIASEVACALAYLHS  644
              L+GCCLETEVP+LVYEFI NGTLF  IHN  D++  PLSW +RL+IA EVA ALAYLHS
Sbjct  414   GLLGCCLETEVPLLVYEFISNGTLFQHIHNQ-DSDF-PLSWKMRLQIAIEVAGALAYLHS  471

Query  643   VTLVPIYHRDIKTGNILLDEKFRAKVSDFGTSRSISIDKTHFTTMVKGTFGYLDPEYFQS  464
                +PIYHRDIK+ NILLD+K RAKVSDFGTSRSISI++TH TT+V GTFGYLDPEYFQS
Sbjct  472   ACSIPIYHRDIKSTNILLDDKHRAKVSDFGTSRSISIEQTHLTTLVHGTFGYLDPEYFQS  531

Query  463   SQFTEKSDVYSFGVVLAELLTGQKPISFELDDDEDRSLVSRFLLCMEENRLMEMLDGEVI  284
             SQFTEKSDVYSFGVVL ELLTGQKPI       E++SL + F+L ++E+RL ++LD  V+
Sbjct  532   SQFTEKSDVYSFGVVLVELLTGQKPIC-STRSQEEKSLATHFILSLQESRLFDILDAGVV  590

Query  283   EQGKKEDVVAMAWLAQRCLNFNGKKRPTMKEVATELDAIKASNSHLPLAMEAFEIESDF  107
             ++G+KE+++A+A+LA +CLN +G+KRPTMKE+  EL+       H+ +++   ++E +F
Sbjct  591   KEGEKEEIMALAYLAYQCLNLSGRKRPTMKEITMELE-------HIRMSLPPLKVEQNF  642



>ref|XP_002297682.1| kinase family protein [Populus trichocarpa]
 gb|EEE82487.1| kinase family protein [Populus trichocarpa]
Length=741

 Score =   463 bits (1191),  Expect = 5e-145, Method: Compositional matrix adjust.
 Identities = 298/613 (49%), Positives = 381/613 (62%), Gaps = 54/613 (9%)
 Frame = -1

Query  1828  ISPSCQGSNNFSNIIHNSKLSETPFMYSNDNNFMLFGCGNAFITMPGEELDQPGYNLNCS  1649
             IS  C GS   +N+  N  ++ +PF +S+ N F+  GC N  + +   E +  G    C 
Sbjct  100   ISSGCAGSG--ANLAIN--MTGSPFAFSSSNIFIAMGCNNRAL-LSRIEPEIVGCTSTCG  154

Query  1648  SKNTTAP----KTAHDCQGINCNHLTVDYDVNTYQVNF------THSSSFNACNYAFFls  1499
             + N T+     K    C G NC   T+   +  +  +        +    N C  AF + 
Sbjct  155   ANNLTSSSAEGKENSYCSGNNCCQTTIPSSLQVFDASLGTPEHPINDQGRNQCKTAFIVE  214

Query  1498  assslpptlqslpsrqQEMVVVPVELRW-----TITQEDVPPSYSKYCSPSTY---INPQ  1343
                           R  +M  VPV L W     T   EDV  S +K C        +   
Sbjct  215   EEWFRNNISSPEVVR--DMQYVPVILDWEMYYGTDIPEDVTNSDAKNCWRGLTMWGLRTV  272

Query  1342  LQWHNYLQCDCPGGDDRNVYLSGGCEWKHKDYVISSNKL--------RPAIIGI---SAS  1196
               + N   C C  G D N YL  GC    +  +   N          RP         A 
Sbjct  273   TLYSNSTTCSCNPGYDGNPYLPDGCTDIDECKIPGENSCSGMTKCVNRPGRYKCELDKAK  332

Query  1195  FGFVFL------------IWAFVILYkaikkrkmkklrqkffkRNGGlllqqqlLTKEGT  1052
               F+ L            IW    LYK +KK+K  +L++KFFKRNGGLLLQQQL + +G+
Sbjct  333   ITFLILGAATGLLLLLVGIWR---LYKLVKKKKNIELKKKFFKRNGGLLLQQQLSSSDGS  389

Query  1051  IEKTKIFTASELDKATDHFNADRIVGRGGQGTVYKGMLIDGQIVAVKKSQAVDEDQLEPF  872
             I+KTKIFT+ EL+KATD FN +RI+G+GGQGTVYKGML DG IVAVKKS+ VDE++LE F
Sbjct  390   IQKTKIFTSKELEKATDRFNDNRILGQGGQGTVYKGMLADGMIVAVKKSKIVDEEKLEEF  449

Query  871   INEVVILSQINHRNVVKLMGCCLETEVPILVYEFIPNGTLFGLIHNNFDNELIPLSWDIR  692
             INEVVILSQ+NHRNVVKL+GCCLETEVP+LVYEFIPNG LF  IH+    E    SW++R
Sbjct  450   INEVVILSQLNHRNVVKLLGCCLETEVPLLVYEFIPNGNLFEYIHDQ--KEEFEFSWEMR  507

Query  691   LRIASEVACALAYLHSVTLVPIYHRDIKTGNILLDEKFRAKVSDFGTSRSISIDKTHFTT  512
             LRIA+EVA AL+YLHS   +P+YHRDIK+ NI+LDEKFRAKVSDFGTSRSI+ID+TH TT
Sbjct  508   LRIATEVARALSYLHSAASIPVYHRDIKSTNIMLDEKFRAKVSDFGTSRSIAIDQTHLTT  567

Query  511   MVKGTFGYLDPEYFQSSQFTEKSDVYSFGVVLAELLTGQKPISFELDDDEDRSLVSRFLL  332
              V+GTFGYLDPEYFQSSQFT KSDVYSFGVVLAELL+GQKPIS+E  +D  RSL + F+L
Sbjct  568   HVQGTFGYLDPEYFQSSQFTGKSDVYSFGVVLAELLSGQKPISYERPEDR-RSLATHFIL  626

Query  331   CMEENRLMEMLDGEVIEQGKKEDVVAMAWLAQRCLNFNGKKRPTMKEVATELDAIKASNS  152
              MEEN++ ++LD  ++EQ ++E+V+A+A LA+RCLN NG+KRPT++EVA EL+ I+ S  
Sbjct  627   LMEENKIFDILDERLMEQDREEEVIAVANLARRCLNLNGRKRPTIREVAIELEQIRLSKG  686

Query  151   HLPLAMEAFEIES  113
              L     + E+E+
Sbjct  687   ALHAQQSSKELEN  699



>ref|XP_011011597.1| PREDICTED: wall-associated receptor kinase-like 22 [Populus euphratica]
Length=738

 Score =   462 bits (1190),  Expect = 5e-145, Method: Compositional matrix adjust.
 Identities = 295/611 (48%), Positives = 381/611 (62%), Gaps = 50/611 (8%)
 Frame = -1

Query  1828  ISPSCQGSNNFSNIIHNSKLSETPFMYSNDNNFMLFGCGN-AFITMPGEELDQPGYNLNC  1652
             IS  C G    +N+  N  ++ +PF +S+ N+F   GC N A +T    E+   G    C
Sbjct  97    ISSGCSGRG--ANLAIN--MTGSPFAFSSSNSFAAMGCNNHALLTQIKPEI--VGCTSTC  150

Query  1651  SSKNTTAPKTAHD----CQGINCNHLTVDYDVNTYQVNFTHSS-----SFNACNYAFFls  1499
              + N T+  T       C G NC    +  D+  +  +   +        N C  AF + 
Sbjct  151   GANNLTSSSTEGKENCYCSGNNCCQTRIPSDLQVFNASLETTEDPNDHGRNQCKVAFIVD  210

Query  1498  assslpptlqslpsrqQEMVVVPVELRWTITQED--VPPSYSKYCSPSTYI-------NP  1346
                S          R  +M  VPV L W +  +D  V  S +K CSP+  +         
Sbjct  211   REWSRDNIKSPEAVR--DMQHVPVILDWFVYSDDIRVENSDAKNCSPTMNLISGRWGSRT  268

Query  1345  QLQWHNYLQCDCPGGDDRNVYLSGGCEWKHKDYVISSNKLRPAIIGISASFGF-------  1187
                + N   C C  G D N YL  GC    +   ++ N        ++   G+       
Sbjct  269   VKLYSNSTTCRCNPGYDGNPYLPDGCTDIDECKNLNGNWCSGMTKCVNVPGGYKCELDKA  328

Query  1186  --VFLIWAFVI-----------LYkaikkrkmkklrqkffkRNGGlllqqqlLTKEGTIE  1046
                FLI                LYK +KKRK  +L++KFFK+NGGLLLQQQL + +G+I+
Sbjct  329   KITFLILGAATGLLLLLVGIWRLYKLVKKRKNIELKKKFFKQNGGLLLQQQLSSSDGSIQ  388

Query  1045  KTKIFTASELDKATDHFNADRIVGRGGQGTVYKGMLIDGQIVAVKKSQAVDEDQLEPFIN  866
             KTKIFT+ EL+KATD FN +RI+G+GGQGTVYKGML DG IVAVKKS+ VD+++LE FIN
Sbjct  389   KTKIFTSKELEKATDRFNDNRILGKGGQGTVYKGMLADGMIVAVKKSKIVDKEKLEEFIN  448

Query  865   EVVILSQINHRNVVKLMGCCLETEVPILVYEFIPNGTLFGLIHNNFDNELIPLSWDIRLR  686
             EVVILSQ+NHRNVVKL+GCCLETEVP+LVYEFIPNG LF  IH     E    SW++RLR
Sbjct  449   EVVILSQVNHRNVVKLLGCCLETEVPLLVYEFIPNGNLFEYIHEQ--KEEFQFSWEMRLR  506

Query  685   IASEVACALAYLHSVTLVPIYHRDIKTGNILLDEKFRAKVSDFGTSRSISIDKTHFTTMV  506
             IA+EVA AL+YLHS   +P+YHRDIK+ +ILLDEKFRAKVSD GTSRSI+ID+TH TT V
Sbjct  507   IATEVAGALSYLHSAASIPVYHRDIKSTHILLDEKFRAKVSDIGTSRSIAIDQTHLTTHV  566

Query  505   KGTFGYLDPEYFQSSQFTEKSDVYSFGVVLAELLTGQKPISFELDDDEDRSLVSRFLLCM  326
             +GTFGYLDP YFQSSQFT KSDVYSFGVVLAELL+GQKPIS+E   DE  SL + F+L M
Sbjct  567   QGTFGYLDPAYFQSSQFTGKSDVYSFGVVLAELLSGQKPISYE-RSDERGSLATHFILLM  625

Query  325   EENRLMEMLDGEVIEQGKKEDVVAMAWLAQRCLNFNGKKRPTMKEVATELDAIKASNSHL  146
             EEN++ ++LD  +I Q ++E+V+A+A LA+RCLN+NG+KRPTM+EVA EL+ I+ S   L
Sbjct  626   EENKIFDILDERLIGQDREEEVIAVANLARRCLNWNGRKRPTMREVAIELEQIRLSKGAL  685

Query  145   PLAMEAFEIES  113
                  + E+E+
Sbjct  686   HAQRSSKELEN  696



>ref|XP_007226334.1| hypothetical protein PRUPE_ppa022257mg, partial [Prunus persica]
 gb|EMJ27533.1| hypothetical protein PRUPE_ppa022257mg, partial [Prunus persica]
Length=663

 Score =   460 bits (1183),  Expect = 5e-145, Method: Compositional matrix adjust.
 Identities = 271/558 (49%), Positives = 362/558 (65%), Gaps = 32/558 (6%)
 Frame = -1

Query  1771  LSETPFMYSNDNNFMLFGCGNAFITMPGEELDQPGYNLNCSSKNTTAPKTAHDCQGINCN  1592
             L  +PF++S  N F    CG   +    +     G    C   +T+  +T   C G+NC 
Sbjct  117   LEGSPFVFSMKNRFTSLSCGEIALMTSLDGSTIAGCLSICDDSSTSYLRT-KSCIGMNCC  175

Query  1591  HLTVDYDVNTYQVNF--THSSSFNACNYAFFlsassslpptlqslpsrqQEMVVVPVELR  1418
               T+   + ++  +F    ++   AC YAF +        +         EM  VP+ L 
Sbjct  176   QTTITPYLRSFNTSFGVVLNADRKACKYAFLVEHDWFTSNSTNVSAIG--EMDYVPMVLE  233

Query  1417  WTITQEDVPPSYSKY--CSPSTYINPQLQWHNYLQCDCPGGDDRNVYLSGGCEWKHKDYV  1244
             W +    +  +Y+K+     + + + +    +  QC C  G   N YL  GC+       
Sbjct  234   WHV----LDLNYTKFDIYGTNNWRDDKSTDCSSSQCFCSKGHHGNPYLLHGCQVP-----  284

Query  1243  ISSNKLRPAIIGISASFGFVFLIWAFVILYkaikkrkmkklrqkffkRNGGlllqqqlLT  1064
                          S+  G +FL+ +    +K IKKRK  K ++KFF++NGGL+L+QQL +
Sbjct  285   -------------SSVLGLLFLLTSIWWAHKVIKKRKDIKRKEKFFRQNGGLVLEQQLSS  331

Query  1063  KEGTIEKTKIFTASELDKATDHFNADRIVGRGGQGTVYKGMLIDGQIVAVKKSQAVDEDQ  884
              E  +EK K+F   EL+KATDHFNADR++G+GGQGTVYKGML DG+IVAVKK + V+  +
Sbjct  332   GELNVEKVKLFNCKELEKATDHFNADRVIGQGGQGTVYKGMLADGRIVAVKKPKIVEGGE  391

Query  883   LEPFINEVVILSQINHRNVVKLMGCCLETEVPILVYEFIPNGTLFGLIHNNFDNELIPLS  704
             +  FINE+VILSQI+HRNVVKL+GCCLETEVP+LVYEFIPNGTLF  IH+   NE  PL+
Sbjct  392   VGQFINEIVILSQISHRNVVKLLGCCLETEVPLLVYEFIPNGTLFQYIHHQ--NEEFPLT  449

Query  703   WDIRLRIASEVACALAYLHSVTLVPIYHRDIKTGNILLDEKFRAKVSDFGTSRSISIDKT  524
             W+ RLR++ EVA AL+YLHS    PIYHRD+K+ NILLDEK+RAKV+DFGTSRSISID+T
Sbjct  450   WETRLRVSIEVAGALSYLHSAASFPIYHRDVKSSNILLDEKYRAKVADFGTSRSISIDQT  509

Query  523   HFTTMVKGTFGYLDPEYFQSSQFTEKSDVYSFGVVLAELLTGQKPISFELDDDEDRSLVS  344
             H TT+V+GTFGYLDPEYFQSSQFTEKSDVYSFGV+LAELLTGQKP+SF +   E R L +
Sbjct  510   HLTTLVRGTFGYLDPEYFQSSQFTEKSDVYSFGVILAELLTGQKPVSF-MRSPESRCLAT  568

Query  343   RFLLCMEENRLMEMLDGEVIEQGKKEDVVAMAWLAQRCLNFNGKKRPTMKEVATELDAIK  164
              FLL ME+N L  +LD +V++ G K+++VA+A LA++CLN NG+KRPTMKEVA EL+ I+
Sbjct  569   YFLLSMEDNNLFAILDAQVMKDGGKDEIVAVAILAKKCLNLNGRKRPTMKEVAVELEGIQ  628

Query  163   ASNSHLPLAMEAFEIESD  110
              S     +  +  E+E D
Sbjct  629   LSVKASDVKQKFAEVEYD  646



>ref|XP_011034597.1| PREDICTED: wall-associated receptor kinase-like 22 [Populus euphratica]
Length=738

 Score =   462 bits (1188),  Expect = 9e-145, Method: Compositional matrix adjust.
 Identities = 295/629 (47%), Positives = 389/629 (62%), Gaps = 49/629 (8%)
 Frame = -1

Query  1882  VDFLGMSYDSQTITIKESI-SPSCQGSNNFSNIIHNSKLSETPFMYSNDNNFMLFGCGNA  1706
             ++ LG+    + + +   I S  C G    +N+  N  ++ +PF +S+ N+F   GC N 
Sbjct  78    MEVLGIPLGERWVRVNSPIISSGCSGRG--ANLAIN--MTGSPFAFSSSNSFAAMGCNNR  133

Query  1705  FITMPGEELDQPGYNLNCSSKNTTAPKTAHD----CQGINCNHLTVDYDVNTYQVNFTHS  1538
              + +   E +  G    CS+ N T+  T       C G NC    +  D+  +  +   +
Sbjct  134   AL-LNRIEPEIVGCKSTCSANNLTSSSTEGKENCYCSGNNCCQTRIPSDLQVFSASLETT  192

Query  1537  S-----SFNACNYAFFlsassslpptlqslpsrqQEMVVVPVELRWTITQED--VPPSYS  1379
                     N C  AF +    S          +  +M  VPV L W +  +D  V  S +
Sbjct  193   EDPNDHGRNQCKVAFIVDREWSRDNIKSPEAVQ--DMQHVPVILDWFVYSDDISVGNSDA  250

Query  1378  KYCSPSTYI-------NPQLQWHNYLQCDCPGGDDRNVYLSGGCEWKHKDYVISSNKLRP  1220
             K CSP+  +            + N   C C  G D N YL  GC    +   ++ N    
Sbjct  251   KNCSPTVNLISGRWGLRTVKLYSNSTTCRCNPGYDGNPYLPDGCTDIDECRNLNGNWCSG  310

Query  1219  AIIGISASFGF---------VFLIWAFVI-----------LYkaikkrkmkklrqkffkR  1100
                 ++   G+          FLI                LYK +KKRK  +L++KFFK+
Sbjct  311   MTKCVNVPGGYKCELDKAKITFLILGAATGLLLLLVGIWRLYKLVKKRKNIELKKKFFKQ  370

Query  1099  NGGlllqqqlLTKEGTIEKTKIFTASELDKATDHFNADRIVGRGGQGTVYKGMLIDGQIV  920
             NGGLLLQQQL + +G+I+KTKIFT+ EL+KATD FN +RI+G+GGQGTVYKGML DG IV
Sbjct  371   NGGLLLQQQLSSSDGSIQKTKIFTSKELEKATDRFNDNRILGKGGQGTVYKGMLADGMIV  430

Query  919   AVKKSQAVDEDQLEPFINEVVILSQINHRNVVKLMGCCLETEVPILVYEFIPNGTLFGLI  740
             AVKKS+ VD+++LE FINEVVILSQ+NHRNVVKL+GC LETEVP+LVYEFIPNG LF  I
Sbjct  431   AVKKSKIVDKEKLEEFINEVVILSQVNHRNVVKLLGCGLETEVPLLVYEFIPNGNLFEYI  490

Query  739   HNNFDNELIPLSWDIRLRIASEVACALAYLHSVTLVPIYHRDIKTGNILLDEKFRAKVSD  560
             H     E    SW++RLRIA+EVA AL+YLHS   +P+YHRDIK+ NILLDEKFRAKVSD
Sbjct  491   HEQ--KEEFQFSWEMRLRIATEVAGALSYLHSAASIPVYHRDIKSTNILLDEKFRAKVSD  548

Query  559   FGTSRSISIDKTHFTTMVKGTFGYLDPEYFQSSQFTEKSDVYSFGVVLAELLTGQKPISF  380
             FGTSRSI+ID+TH TT V+GTFGY DPEYFQSSQFT KSDVYSFGVVLAELL+GQKPIS+
Sbjct  549   FGTSRSIAIDQTHLTTHVRGTFGYFDPEYFQSSQFTGKSDVYSFGVVLAELLSGQKPISY  608

Query  379   ELDDDEDRSLVSRFLLCMEENRLMEMLDGEVIEQGKKEDVVAMAWLAQRCLNFNGKKRPT  200
             E   +E  SL + F+L MEEN++ ++LD  +I Q ++E+V+A+A LA+RCLN+NG+KRPT
Sbjct  609   E-RSEERGSLATHFILLMEENKIFDILDERLIGQDREEEVIAVANLARRCLNWNGRKRPT  667

Query  199   MKEVATELDAIKASNSHLPLAMEAFEIES  113
             M+EVA EL+ I+ S   L     + E+E+
Sbjct  668   MREVAIELEQIRLSKGALHAQRSSKELEN  696



>ref|XP_007035468.1| Wall associated kinase-like 6, putative [Theobroma cacao]
 gb|EOY06394.1| Wall associated kinase-like 6, putative [Theobroma cacao]
Length=719

 Score =   459 bits (1181),  Expect = 6e-144, Method: Compositional matrix adjust.
 Identities = 286/561 (51%), Positives = 357/561 (64%), Gaps = 34/561 (6%)
 Frame = -1

Query  1771  LSETPFMYSND-NNFMLFGCGN-AFITMPGEELDQPGYNLNCSSKNTTAPKTAHDCQGIN  1598
             ++ +PF +S   N F+  GC N AF+T  G E    G    C       P   + C G  
Sbjct  110   ITGSPFFFSGSMNKFIAAGCNNKAFMT--GTEPTIVGCESACIDNRLFGPN--NTCNGET  165

Query  1597  CNHLTVDYDVNTYQVNF-THSSSFNACNYAFFlsassslpptlqslpsrqQEMVVVPVEL  1421
             C    +   +  +   F +  S    C  AF +              + Q  M  VP  L
Sbjct  166   CCETVIPSRLRVFNARFESKESQSEGCKLAFLVEEKWFDVNITDKSSALQ-NMDYVPALL  224

Query  1420  RWTITQE--DVPPSYSK--YCSPSTYINPQLQWHNYLQCDCPGGDDRNVYLSGGCEWKHK  1253
              W I  E   +P    +  YC+    ++ +  + N  +C C  G + N YL  GC+   +
Sbjct  225   DWGIPDEALGLPKKRGREYYCTGYYSMHLEPYYLNSSRCYCQYGYEGNAYLLNGCQDIDE  284

Query  1252  -------------------DYVISSNKLRPAIIGISASFGFVFLIWAFVILYkaikkrkm  1130
                                 Y     K    I+GIS  FG + L      LYK +KKR+ 
Sbjct  285   CQDDPQKRCGDATCVNIPGHYQCERRKTWVIILGISLGFGVLCLAIGGWWLYKYLKKRRN  344

Query  1129  kklrqkffkRNGGlllqqqlLTKEGTIEKTKIFTASELDKATDHFNADRIVGRGGQGTVY  950
              KLR+KFFKRNGGLLLQQQ+ + EG+I+KTKIFT+ ELDKATD+FN +R++G+GGQGTVY
Sbjct  345   IKLREKFFKRNGGLLLQQQVSSSEGSIDKTKIFTSKELDKATDNFNKNRVLGQGGQGTVY  404

Query  949   KGMLIDGQIVAVKKSQAVDEDQLEPFINEVVILSQINHRNVVKLMGCCLETEVPILVYEF  770
             KGML+DG+IVAVKKS  VD +++E FINEVVILSQINHRNVVKL+GCCLET VP+LVYEF
Sbjct  405   KGMLVDGRIVAVKKSIVVDAEKVEEFINEVVILSQINHRNVVKLLGCCLETAVPLLVYEF  464

Query  769   IPNGTLFGLIHNNFDNELIPLSWDIRLRIASEVACALAYLHSVTLVPIYHRDIKTGNILL  590
             IPNGTLF  +H+   +E  PLSW+ RLRIA E+A AL+YLHS   +PIYHRDIK+ NILL
Sbjct  465   IPNGTLFQYLHDQ--SEEFPLSWETRLRIAKEIAEALSYLHSAASIPIYHRDIKSSNILL  522

Query  589   DEKFRAKVSDFGTSRSISIDKTHFTTMVKGTFGYLDPEYFQSSQFTEKSDVYSFGVVLAE  410
             DEK+RAKVSDFGTSRSISID+TH TT V GTFGYLDPEYFQSSQFTEKSDVYSFGVVL E
Sbjct  523   DEKYRAKVSDFGTSRSISIDQTHLTTHVHGTFGYLDPEYFQSSQFTEKSDVYSFGVVLVE  582

Query  409   LLTGQKPISFELDDDEDRSLVSRFLLCMEENRLMEMLDGEVIEQGKKEDVVAMAWLAQRC  230
             LLT +KPISFE   +E RSL +  +L MEEN+L +++D  V +Q K  +VV +A LA RC
Sbjct  583   LLTSEKPISFE-RAEEGRSLATHSILSMEENQLFDIVDARVTKQTKDGEVVMVATLAYRC  641

Query  229   LNFNGKKRPTMKEVATELDAI  167
             L+ +G+KRPTMKE A EL+ I
Sbjct  642   LSLSGRKRPTMKEAAMELERI  662



>ref|XP_008222637.1| PREDICTED: wall-associated receptor kinase-like 8 [Prunus mume]
Length=726

 Score =   459 bits (1180),  Expect = 9e-144, Method: Compositional matrix adjust.
 Identities = 282/588 (48%), Positives = 369/588 (63%), Gaps = 49/588 (8%)
 Frame = -1

Query  1771  LSETPFMYSNDNNFMLFGCGNAFITMPGEELDQPGYNLNCSSKNTTAPKTAHDCQGINCN  1592
             L  +PF++S  N F    CG+  +    +     G    C   +T+  +T   C G+NC 
Sbjct  108   LEGSPFVFSMKNRFTSLSCGDIALMTSLDGSTIAGCLSICDYTSTSYLRT-KSCIGMNCC  166

Query  1591  HLTVDYDVNTYQVNF--THSSSFNACNYAFFlsassslpptlqslpsrqQEMVVVPVELR  1418
               T+   + ++  +F    ++   AC YAF +        +         EM  VP+ L 
Sbjct  167   QTTITPYLRSFNTSFGAVLNADRKACKYAFLVEHDWFTSNSTNVSAIG--EMDYVPMVLE  224

Query  1417  WTITQEDVPPSYSKYCSPSTYINPQLQWHN-------YLQCDCPGGDDRNVYLSGGC---  1268
             W +    +  +Y+++      IN    W +         QC C  G   N YL  GC   
Sbjct  225   WHV----LDLNYTEF-----DINGTNNWRDDKSTDCSSSQCVCSKGYHGNPYLLHGCQDI  275

Query  1267  -EWKHKD----------------YVISSNKLRP-----AIIGISASFGFVFLIWAFVILY  1154
              E +  D                ++      RP     AII  S+  G +FL+      +
Sbjct  276   NECEDPDHPNRCGSGICIDYPGRFMCQLPDQRPSRVTLAIIVPSSVLGLLFLLTGIWWAH  335

Query  1153  kaikkrkmkklrqkffkRNGGlllqqqlLTKEGTIEKTKIFTASELDKATDHFNADRIVG  974
             K IKKRK  K ++KFF++NGGL+L+QQL + E  +EK K+F   EL+KATDHFNADR++G
Sbjct  336   KVIKKRKDMKRKEKFFRQNGGLVLEQQLSSGELNVEKVKLFNCKELEKATDHFNADRVIG  395

Query  973   RGGQGTVYKGMLIDGQIVAVKKSQAVDEDQLEPFINEVVILSQINHRNVVKLMGCCLETE  794
             +GGQGTVYKGML DG+IVAVKKS+ V+  ++  FINE+VILSQI+HRNVVKL+GCCLETE
Sbjct  396   QGGQGTVYKGMLADGRIVAVKKSKIVEGGEVGQFINEIVILSQISHRNVVKLLGCCLETE  455

Query  793   VPILVYEFIPNGTLFGLIHNNFDNELIPLSWDIRLRIASEVACALAYLHSVTLVPIYHRD  614
             VP+LVYEFIPNGTLF  IH+   NE  PL+W+ RLR++ EVA AL+YLHS    PIYHRD
Sbjct  456   VPLLVYEFIPNGTLFQYIHHQ--NEEFPLTWETRLRVSIEVAGALSYLHSAASFPIYHRD  513

Query  613   IKTGNILLDEKFRAKVSDFGTSRSISIDKTHFTTMVKGTFGYLDPEYFQSSQFTEKSDVY  434
             +K+ NILLDEK+RAKV+DFGTSRSISID+TH TT+V+GTFGYLDPEYFQSSQFTEKSDVY
Sbjct  514   VKSSNILLDEKYRAKVADFGTSRSISIDQTHLTTLVRGTFGYLDPEYFQSSQFTEKSDVY  573

Query  433   SFGVVLAELLTGQKPISFELDDDEDRSLVSRFLLCMEENRLMEMLDGEVIEQGKKEDVVA  254
             SFGVVLAELLTGQKP+SF +   E RSL + FLL ME+N L  +LD +V++ G+ + +VA
Sbjct  574   SFGVVLAELLTGQKPVSF-MRSPESRSLATYFLLSMEDNNLFAILDAQVMKDGENDQIVA  632

Query  253   MAWLAQRCLNFNGKKRPTMKEVATELDAIKASNSHLPLAMEAFEIESD  110
             +A LA+ CLN NG+KRPTMKEVA EL+ I+ S     +     E+E D
Sbjct  633   VANLAKACLNLNGRKRPTMKEVAVELEGIQLSVKASGVQQNFAEVEYD  680



>ref|XP_010023385.1| PREDICTED: wall-associated receptor kinase-like 1 [Eucalyptus 
grandis]
Length=747

 Score =   458 bits (1179),  Expect = 3e-143, Method: Compositional matrix adjust.
 Identities = 286/609 (47%), Positives = 376/609 (62%), Gaps = 57/609 (9%)
 Frame = -1

Query  1852  QTITIKESISPSCQGSNNFSNIIHNSKLSETPFMYSNDNN-FMLFGCGN-AFITMPGEEL  1679
             Q +   E   P+C G     NI  +  L+ + FMYS+  N F+  GC N A++  P    
Sbjct  102   QPVFYSEPNLPNCTGRAVSGNIPTSLNLTGSSFMYSHTKNVFVSGGCNNLAYMVSPSMMS  161

Query  1678  DQPGYNLNCSSKNTTAPKTAHDC-QGINCNHLTVDYDVNTYQVNFTHSSSF-----NACN  1517
                G    CS        +  DC  GI C   T+ + +  Y VNFT  +        +C 
Sbjct  162   AVVGCRSTCSGT-----ASQDDCWNGIGCCMNTIPFGLQVYWVNFTTENGSPMGTDGSCR  216

Query  1516  YAFFlsassslpptlqslpsrqQEMVVVPVELRWTITQE---DVPPS---------YSKY  1373
             YAF +       P+  +        V  PV L W I+ E    +P S          S +
Sbjct  217   YAFLVDHLGYDFPSNMTDTRTLPSHV--PVTLEWGISDEVFVHMPISNDLYLYNLTTSYW  274

Query  1372  CSPSTYI-----NPQLQWHNYLQCDCPGGDDRNVYLSGGCE------------------W  1262
             C    Y+     NP+L    Y+QC C  G   N Y+  GC+                   
Sbjct  275   CDDYGYLYYGSDNPRL----YVQCRCRSGFAGNPYIKDGCKDINECLNPNATYCPGKCVN  330

Query  1261  KHKDYVISSNKLRPAIIGISASFGFVFLIWAFVILYkaikkrkmkklrqkffkRNGGlll  1082
             +   Y    N    AIIG+ + FG VF +      YK IK+R   KL++KFFKRNGG LL
Sbjct  331   RPGSYDCVDNNNNVAIIGVGSGFGAVFFLGLSWWFYKFIKRRHEIKLKEKFFKRNGGFLL  390

Query  1081  qqqlLTKEGTIEKTKIFTASELDKATDHFNADRIVGRGGQGTVYKGMLIDGQIVAVKKSQ  902
             QQ    +   +EK+K+FT+ EL+KATDHFN +RI+G+GGQGTVYKGML DG+IVAVK+S+
Sbjct  391   QQLSYDEGSHMEKSKLFTSKELEKATDHFNENRILGQGGQGTVYKGMLTDGRIVAVKRSR  450

Query  901   AVDEDQLEPFINEVVILSQINHRNVVKLMGCCLETEVPILVYEFIPNGTLFGLIHNNFDN  722
              VDE Q+E F+NEV+ILSQINHRN+VKL+GCCLETEVP+LVYEFI  GTLF  +HN    
Sbjct  451   IVDEGQVEQFVNEVMILSQINHRNIVKLLGCCLETEVPLLVYEFISKGTLFQHLHNPI--  508

Query  721   ELIPLSWDIRLRIASEVACALAYLHSVTLVPIYHRDIKTGNILLDEKFRAKVSDFGTSRS  542
             E  P+SW +R+RIA+EVA AL+YLH    +PIYHRD+K+ NILLD+++RAKV+DFGTSRS
Sbjct  509   EEFPMSWGMRMRIATEVAGALSYLHFTAAIPIYHRDVKSSNILLDDQYRAKVADFGTSRS  568

Query  541   ISIDKTHFTTMVKGTFGYLDPEYFQSSQFTEKSDVYSFGVVLAELLTGQKPISFELDDDE  362
             I+ID+TH TTMVKGT GYLDPEYFQ+ QFT+KSDVYSFGVVL ELLTGQKPIS  +  ++
Sbjct  569   IAIDQTHLTTMVKGTIGYLDPEYFQTCQFTDKSDVYSFGVVLVELLTGQKPIS-AMRAED  627

Query  361   DRSLVSRFLLCMEENRLMEMLDGEVIEQGKKEDVVAMAWLAQRCLNFNGKKRPTMKEVAT  182
              RSL   F+  MEEN L+++++  +I+Q ++E+++ +A LA+RCLN NG+ RPTMKEVA 
Sbjct  628   GRSLAVYFIESMEENHLLDIVEAGLIKQSQEEEILGVANLAKRCLNSNGRNRPTMKEVAM  687

Query  181   ELDAIKASN  155
             EL+ I+A +
Sbjct  688   ELERIRAQH  696



>ref|XP_006388140.1| hypothetical protein POPTR_0316s00220g [Populus trichocarpa]
 gb|ERP47054.1| hypothetical protein POPTR_0316s00220g [Populus trichocarpa]
Length=407

 Score =   446 bits (1147),  Expect = 4e-143, Method: Compositional matrix adjust.
 Identities = 224/328 (68%), Positives = 274/328 (84%), Gaps = 5/328 (2%)
 Frame = -1

Query  1099  NGGlllqqqlLTKEGTIEKTKIFTASELDKATDHFNADRIVGRGGQGTVYKGMLIDGQIV  920
             NGGLLLQQQL + +G+I+KTKIFT+ EL+KATD FN +RI+G+GGQGTVYKGML DG IV
Sbjct  40    NGGLLLQQQLSSSDGSIQKTKIFTSKELEKATDRFNDNRILGQGGQGTVYKGMLADGMIV  99

Query  919   AVKKSQAVDEDQLEPFINEVVILSQINHRNVVKLMGCCLETEVPILVYEFIPNGTLFGLI  740
             AVKKS+ VDE++LE FINEVVILSQ+NHRNVVKL+GCCLETEVP+LVYEFIPNG LF  I
Sbjct  100   AVKKSKMVDEEKLEEFINEVVILSQLNHRNVVKLLGCCLETEVPLLVYEFIPNGNLFEYI  159

Query  739   HNNFDNELIPLSWDIRLRIASEVACALAYLHSVTLVPIYHRDIKTGNILLDEKFRAKVSD  560
             H+    E    SW++RLRIA+EVA AL+YLHS   +P+YHRDIK+ NI+LDEKFRAKVSD
Sbjct  160   HDQ--KEEFEFSWEMRLRIATEVARALSYLHSAASIPVYHRDIKSTNIMLDEKFRAKVSD  217

Query  559   FGTSRSISIDKTHFTTMVKGTFGYLDPEYFQSSQFTEKSDVYSFGVVLAELLTGQKPISF  380
             FGTSRSI+ID+TH TT V+GTFGYLDPEYFQSSQFT KSDVYSFGVVLAELL+GQKPIS+
Sbjct  218   FGTSRSIAIDQTHLTTHVQGTFGYLDPEYFQSSQFTGKSDVYSFGVVLAELLSGQKPISY  277

Query  379   ELDDDEDRSLVSRFLLCMEENRLMEMLDGEVIEQGKKEDVVAMAWLAQRCLNFNGKKRPT  200
             E  +D  RSL + F+L MEEN++ ++LD  ++ Q ++E+V+A+A LA+RCLN NG+KRPT
Sbjct  278   ERPEDR-RSLATHFILLMEENKIFDILDERLMGQDREEEVIAVANLARRCLNLNGRKRPT  336

Query  199   MKEVATELDAIKASNS--HLPLAMEAFE  122
             M+EVA EL+ I+ S    H P + +  E
Sbjct  337   MREVAIELEQIRLSKGALHAPQSRKELE  364



>ref|XP_010038779.1| PREDICTED: wall-associated receptor kinase-like 1 [Eucalyptus 
grandis]
Length=724

 Score =   457 bits (1175),  Expect = 6e-143, Method: Compositional matrix adjust.
 Identities = 276/567 (49%), Positives = 375/567 (66%), Gaps = 40/567 (7%)
 Frame = -1

Query  1771  LSETPFMYSND-NNFMLFGCGNAFITMPGEELDQPGYNLNCSSKNTTAPKTAHDCQGIN-  1598
             L  + F++S   N F+  GC N    +   E D  G   +C+  NT+     + C G + 
Sbjct  116   LEGSQFIFSQTWNVFISVGC-NTLAIVNSTESDVVGCRSSCAGTNTSV-SMYNACSGRDG  173

Query  1597  CNHLTVDYDVNTYQVNFT-HSSSFNACNYAFFlsassslpptlqslpsrqQEMVVVPVEL  1421
             C   T+ +++  + V F         C YAF    +  L   +  L        +VPV L
Sbjct  174   CCQSTLPFNLQFFSVVFKDERGPQEGCKYAFLADRTWFLRSNITDLSFND----MVPVVL  229

Query  1420  RWTITQE-DVPPSYSKYCSPSTYINP-QLQWHN----------YLQCDCPGGDDRNVYLS  1277
              W I+ + +      +  + S Y++P +   +N          ++QC C  G   N YL+
Sbjct  230   EWGISNKTEYGLKLFQQANGSGYLDPFRCTRYNLYGSYTSEMPFVQCFCSSGYRGNPYLT  289

Query  1276  GGC----EWKHKD------------YVISSNKLRPAIIGISASFGFVFLIWAFVILYkai  1145
              GC    E +H++            Y   + +    IIG+ A+ G + L      LYK +
Sbjct  290   EGCQDINECEHRNLCPGICVNKRGSYDCVAGRKTAIIIGVGAASGALVLCVVLWRLYKYV  349

Query  1144  kkrkmkklrqkffkRNGGlllqqqlLTKEGTIEKTKIFTASELDKATDHFNADRIVGRGG  965
             KKR+  KL++K FKRNGGLLL+ +L + EG +EK K+F + +L+KATD+F+ DRI+G+GG
Sbjct  350   KKRREIKLKEKHFKRNGGLLLKNELSSPEGNVEKNKLFNSKDLEKATDNFSDDRILGQGG  409

Query  964   QGTVYKGMLIDGQIVAVKKSQAVDEDQLEPFINEVVILSQINHRNVVKLMGCCLETEVPI  785
             QGTVYKGML DG+IVA+KKS+ +DE ++E FINEV+ILSQINHRNVVKL+GCCLETEVP+
Sbjct  410   QGTVYKGMLTDGKIVAIKKSKVIDEGKVEQFINEVLILSQINHRNVVKLLGCCLETEVPL  469

Query  784   LVYEFIPNGTLFGLIHNNFDNELIPLSWDIRLRIASEVACALAYLHSVTLVPIYHRDIKT  605
             LVYEFIPNGTL+  +H+   N+   +SWD RLRIA+E+A AL YLHS   +PIYHRDIK+
Sbjct  470   LVYEFIPNGTLYQYLHD--PNQEFHVSWDTRLRIATEIAGALFYLHSAASIPIYHRDIKS  527

Query  604   GNILLDEKFRAKVSDFGTSRSISIDKTHFTTMVKGTFGYLDPEYFQSSQFTEKSDVYSFG  425
              NILLDEK+RAKV+DFGTS+S+S+D+TH TT+V+GTFGYLDPEYFQSSQFT+KSDVYSFG
Sbjct  528   TNILLDEKYRAKVADFGTSKSVSLDQTHVTTLVQGTFGYLDPEYFQSSQFTDKSDVYSFG  587

Query  424   VVLAELLTGQKPISFELDDDEDRSLVSRFLLCMEENRLMEMLDGEVIEQGKKEDVVAMAW  245
             VVL ELLTGQKPIS  L + E RSLV+ F++ MEEN L  ++D +V+++GKKE++ ++A 
Sbjct  588   VVLVELLTGQKPIS-SLREQEGRSLVTYFIISMEENCLFNIVDAQVLKEGKKEEIASVAN  646

Query  244   LAQRCLNFNGKKRPTMKEVATELDAIK  164
             LA+RCLN NG+KRPTMKEVA EL+ I+
Sbjct  647   LAKRCLNLNGRKRPTMKEVAMELERIR  673



>emb|CDP19182.1| unnamed protein product [Coffea canephora]
Length=599

 Score =   452 bits (1163),  Expect = 8e-143, Method: Compositional matrix adjust.
 Identities = 253/393 (64%), Positives = 305/393 (78%), Gaps = 14/393 (4%)
 Frame = -1

Query  1318  CDCPGG----DDRNVYLSGGCEWKHKDYVISSNKLRPAIIGISASFGFVFLIWAFVILYk  1151
             C CP G    DD     S GC  + K         +  + G  A  G +FL+ A   LYK
Sbjct  167   CSCPKGYLQKDDGKG--SEGCIPQPKK------SYQALVAGAFAGAGVLFLVIATYTLYK  218

Query  1150  aikkrkmkklrqkffkRNGGlllqqqlLTKEGTIEKTKIFTASELDKATDHFNADRIVGR  971
              +K+R+ KK ++KFFKRNGGLLLQ QL   EG +EKT +F+A EL+KA+D FN +RI+G+
Sbjct  219   VVKRRRNKKRQEKFFKRNGGLLLQHQLSADEGGVEKTMLFSAKELNKASDGFNENRILGQ  278

Query  970   GGQGTVYKGMLIDGQIVAVKKSQAVDEDQLEPFINEVVILSQINHRNVVKLMGCCLETEV  791
             GGQGTVYKGML DG+IVA+KKS+ VDE+QL  FINEVV+LSQINHRNVVKL+GCCLETEV
Sbjct  279   GGQGTVYKGMLTDGRIVAIKKSKKVDENQLGQFINEVVLLSQINHRNVVKLLGCCLETEV  338

Query  790   PILVYEFIPNGTLFGLIHNNFDNELIPLSWDIRLRIASEVACALAYLHSVTLVPIYHRDI  611
             P+LVYEFIPNGTLF LIHN  +NE +PL+W++RLRIA EVA ALAYLHS   +PIYH DI
Sbjct  339   PLLVYEFIPNGTLFTLIHNG-NNEELPLTWNLRLRIAIEVAGALAYLHSAVSIPIYHGDI  397

Query  610   KTGNILLDEKFRAKVSDFGTSRSISIDKTHFTTMVKGTFGYLDPEYFQSSQFTEKSDVYS  431
             K+ NILLDEK+ AKVSDFGTSRS++IDKTH TT+VKGTFGYLDPEYFQSSQFTEKSDVYS
Sbjct  398   KSSNILLDEKYIAKVSDFGTSRSVTIDKTHLTTVVKGTFGYLDPEYFQSSQFTEKSDVYS  457

Query  430   FGVVLAELLTGQKPISFELDDDE-DRSLVSRFLLCMEENRLMEMLDGEVIEQGKKEDVVA  254
             FGVVLAELLT QKPIS    D+  + SL +RFL+ ME++ L  +LD E+I QG + ++ A
Sbjct  458   FGVVLAELLTRQKPISSAATDEHCNLSLATRFLISMEQDSLRNILDPELINQGNELEITA  517

Query  253   MAWLAQRCLNFNGKKRPTMKEVATELDAIKASN  155
             +A LAQRCLN NGKKRPTMKEVA  L+++K S+
Sbjct  518   VAKLAQRCLNLNGKKRPTMKEVAIGLESMKLSS  550



>ref|XP_010038777.1| PREDICTED: wall-associated receptor kinase-like 10 [Eucalyptus 
grandis]
Length=710

 Score =   456 bits (1172),  Expect = 1e-142, Method: Compositional matrix adjust.
 Identities = 269/560 (48%), Positives = 361/560 (64%), Gaps = 32/560 (6%)
 Frame = -1

Query  1762  TPFMYSND-NNFMLFGCGNAFITMPGEELDQPGYNLNCSSKNTTAPKTAHDCQGINCNHL  1586
             + F++S   N F   GC N   T+   E    G    C+  +    + +       C   
Sbjct  118   SQFIFSQRWNVFTSVGC-NTLATVNSTESAVVGCRSKCTGTSANVVRYSACFGRDQCCQT  176

Query  1585  TVDYDVNTYQVNFTHSSSFNACNYAFFlsassslpptlqslpsrqQEMVVVPVELRWTIT  1406
             T+ +++ ++ V+F        C YAF    S  L   +           V PV L W I+
Sbjct  177   TLPFNLQSFSVDFKEEGESQGCKYAFLADRSWFLRSNVTGSYDLNLSKTV-PVVLEWGIS  235

Query  1405  ----------QEDVPPSYSKYCSPSTYINPQLQWHNYLQCDCPGGDDRNVYLSGGC----  1268
                       Q      Y    +  +          ++QC C  G   N YL+ GC    
Sbjct  236   NKTDYELKLIQRSYRLDYPFISNRDSLYGSYTSEMPFIQCHCSWGYRGNPYLTEGCQDIN  295

Query  1267  EWKHKD------------YVISSNKLRPAIIGISASFGFVFLIWAFVILYkaikkrkmkk  1124
             E + +D            Y   + +  P IIG+ A+FG + L      LYK IKK+K  K
Sbjct  296   ECEDRDLCPGICVNEQGTYACVAGRKTPIIIGVGAAFGALVLCLVLWRLYKYIKKKKEIK  355

Query  1123  lrqkffkRNGGlllqqqlLTKEGTIEKTKIFTASELDKATDHFNADRIVGRGGQGTVYKG  944
             L++K+FKRNGGLLL+ +L + EG +EK+K+F + +L+KATD+FN DRI+G+GGQGTVYKG
Sbjct  356   LKEKYFKRNGGLLLKSELSSPEGNVEKSKLFNSKDLEKATDNFNDDRILGQGGQGTVYKG  415

Query  943   MLIDGQIVAVKKSQAVDEDQLEPFINEVVILSQINHRNVVKLMGCCLETEVPILVYEFIP  764
             ML  G+IVA+KKS+ +DE +++ FINEV+ILSQINHRNVVKL+GCCLETEVP+LVYEFIP
Sbjct  416   MLTHGKIVAIKKSKVIDEGKVKHFINEVLILSQINHRNVVKLLGCCLETEVPLLVYEFIP  475

Query  763   NGTLFGLIHNNFDNELIPLSWDIRLRIASEVACALAYLHSVTLVPIYHRDIKTGNILLDE  584
             NGTL+  +H+   N+   +SWD RLRIA+E+A AL YLHS   +PIYHRDIK+ NILLDE
Sbjct  476   NGTLYQYLHD--PNQEFHVSWDTRLRIATEIARALFYLHSAASIPIYHRDIKSSNILLDE  533

Query  583   KFRAKVSDFGTSRSISIDKTHFTTMVKGTFGYLDPEYFQSSQFTEKSDVYSFGVVLAELL  404
             K+RAKV+DFGTS+S+S+D+TH TT+V+GTFGYLDPEYFQSSQFT+KSDVYSFGVVL ELL
Sbjct  534   KYRAKVADFGTSKSVSLDQTHVTTLVQGTFGYLDPEYFQSSQFTDKSDVYSFGVVLVELL  593

Query  403   TGQKPISFELDDDEDRSLVSRFLLCMEENRLMEMLDGEVIEQGKKEDVVAMAWLAQRCLN  224
             TGQKPIS  L + E RSL + F++ MEEN L +++D +V+++GKKE++ ++A LA+RCLN
Sbjct  594   TGQKPIS-SLREQEGRSLATYFIISMEENHLFDIVDAQVLKEGKKEEIASVANLAKRCLN  652

Query  223   FNGKKRPTMKEVATELDAIK  164
              NG+KRP MKEVA EL+ I+
Sbjct  653   LNGRKRPAMKEVAMELEGIR  672



>gb|KCW47712.1| hypothetical protein EUGRSUZ_K01459 [Eucalyptus grandis]
Length=699

 Score =   454 bits (1169),  Expect = 2e-142, Method: Compositional matrix adjust.
 Identities = 271/571 (47%), Positives = 365/571 (64%), Gaps = 36/571 (6%)
 Frame = -1

Query  1762  TPFMYSND-NNFMLFGCGNAFITMPGEELDQPGYNLNCSSKNTTAPKTAHDCQGINCNHL  1586
             + F++S   N F   GC N   T+   E    G    C+  +    + +       C   
Sbjct  118   SQFIFSQRWNVFTSVGC-NTLATVNSTESAVVGCRSKCTGTSANVVRYSACFGRDQCCQT  176

Query  1585  TVDYDVNTYQVNFTHSSSFNACNYAFFlsassslpptlqslpsrqQEMVVVPVELRWTIT  1406
             T+ +++ ++ V+F        C YAF    S  L   +           V PV L W I+
Sbjct  177   TLPFNLQSFSVDFKEEGESQGCKYAFLADRSWFLRSNVTGSYDLNLSKTV-PVVLEWGIS  235

Query  1405  ----------QEDVPPSYSKYCSPSTYINPQLQWHNYLQCDCPGGDDRNVYLSGGC----  1268
                       Q      Y    +  +          ++QC C  G   N YL+ GC    
Sbjct  236   NKTDYELKLIQRSYRLDYPFISNRDSLYGSYTSEMPFIQCHCSWGYRGNPYLTEGCQDIN  295

Query  1267  EWKHKD------------YVISSNKLRPAIIGISASFGFVFLIWAFVILYkaikkrkmkk  1124
             E + +D            Y   + +  P IIG+ A+FG + L      LYK IKK+K  K
Sbjct  296   ECEDRDLCPGICVNEQGTYACVAGRKTPIIIGVGAAFGALVLCLVLWRLYKYIKKKKEIK  355

Query  1123  lrqkffkRNGGlllqqqlLTKEGTIEKTKIFTASELDKATDHFNADRIVGRGGQGTVYKG  944
             L++K+FKRNGGLLL+ +L + EG +EK+K+F + +L+KATD+FN DRI+G+GGQGTVYKG
Sbjct  356   LKEKYFKRNGGLLLKSELSSPEGNVEKSKLFNSKDLEKATDNFNDDRILGQGGQGTVYKG  415

Query  943   MLIDGQIVAVKKSQAVDEDQLEPFINEVVILSQINHRNVVKLMGCCLETEVPILVYEFIP  764
             ML  G+IVA+KKS+ +DE +++ FINEV+ILSQINHRNVVKL+GCCLETEVP+LVYEFIP
Sbjct  416   MLTHGKIVAIKKSKVIDEGKVKHFINEVLILSQINHRNVVKLLGCCLETEVPLLVYEFIP  475

Query  763   NGTLFGLIHNNFDNELIPLSWDIRLRIASEVACALAYLHSVTLVPIYHRDIKTGNILLDE  584
             NGTL+  +H+   N+   +SWD RLRIA+E+A AL YLHS   +PIYHRDIK+ NILLDE
Sbjct  476   NGTLYQYLHD--PNQEFHVSWDTRLRIATEIARALFYLHSAASIPIYHRDIKSSNILLDE  533

Query  583   KFRAKVSDFGTSRSISIDKTHFTTMVKGTFGYLDPEYFQSSQFTEKSDVYSFGVVLAELL  404
             K+RAKV+DFGTS+S+S+D+TH TT+V+GTFGYLDPEYFQSSQFT+KSDVYSFGVVL ELL
Sbjct  534   KYRAKVADFGTSKSVSLDQTHVTTLVQGTFGYLDPEYFQSSQFTDKSDVYSFGVVLVELL  593

Query  403   TGQKPISFELDDDEDRSLVSRFLLCMEENRLMEMLDGEVIEQGKKEDVVAMAWLAQRCLN  224
             TGQKPIS  L + E RSL + F++ MEEN L +++D +V+++GKKE++ ++A LA+RCLN
Sbjct  594   TGQKPIS-SLREQEGRSLATYFIISMEENHLFDIVDAQVLKEGKKEEIASVANLAKRCLN  652

Query  223   FNGKKRPTMKEVATEL----DAIKASNSHLP  143
              NG+KRP MKEVA EL    +A ++ N+  P
Sbjct  653   LNGRKRPAMKEVAMELEGNHEATESYNAAFP  683



>ref|XP_011011593.1| PREDICTED: wall-associated receptor kinase-like 2 isoform X1 
[Populus euphratica]
Length=739

 Score =   456 bits (1172),  Expect = 2e-142, Method: Compositional matrix adjust.
 Identities = 293/630 (47%), Positives = 391/630 (62%), Gaps = 51/630 (8%)
 Frame = -1

Query  1882  VDFLGMSYDSQTITIKESI-SPSCQGSNNFSNIIHNSKLSETPFMYSNDNNFMLFGCGNA  1706
             ++ LG+S  +  + +   I S  C G    +N+  +  +S +PF++S+ N F+  GC N 
Sbjct  78    MEVLGISLGNSRVRVNSPIISSGCSGRG--ANLAFD--MSGSPFIFSSLNIFIAMGCNNR  133

Query  1705  FITMPGEELDQPGYNLNCSSKNTTAPKTAHD----CQGINCNHLTVDYDVNTYQVNF---  1547
              + +   E +  G    C + N T+  T       C G NC    +  ++  +  +    
Sbjct  134   AL-LNRIEPEIVGCTSTCGANNLTSSSTEGKEKRYCSGDNCCQTRIPSNLQVFSASLGTT  192

Query  1546  --THSSSFNACNYAFFlsassslpptlqslpsrqQEMVVVPVELRWTITQED--VPPSYS  1379
                +    N C  AF +    SL         R  +M  VPV L W +  +D  V  S +
Sbjct  193   EDPNDQGRNQCKVAFIVDRGWSLDNIKSPEAVR--DMQHVPVILDWFVYSDDFRVENSDA  250

Query  1378  KYCSPSTYINPQLQW--------HNYLQCDCPGGDDRNVYLSGGCEWKHKDYVISSNKLR  1223
             K CSP   +    +W         N   C C  G D N YL  GC    +   ++ N   
Sbjct  251   KNCSPPVQL-ASGRWGLSTLTLYSNSTTCSCNPGYDGNPYLPDGCTDIDECKNLNGNWCS  309

Query  1222  PAIIGISASFGF---------VFLIWAFVIL-----------Ykaikkrkmkklrqkffk  1103
                  ++   G+          FLI                 YK ++KRK  +L++KFFK
Sbjct  310   GMTKCVNVPGGYKCELDKAKITFLILGAATGLLLLLVGIWGLYKLVRKRKNIELKKKFFK  369

Query  1102  RNGGlllqqqlLTKEGTIEKTKIFTASELDKATDHFNADRIVGRGGQGTVYKGMLIDGQI  923
             +NGGLLLQQQL + +G+I+KTKIFT+ EL+KATD FN +RI+G+GGQGTVYK ML DG I
Sbjct  370   QNGGLLLQQQLSSSDGSIQKTKIFTSKELEKATDRFNDNRILGKGGQGTVYKRMLADGMI  429

Query  922   VAVKKSQAVDEDQLEPFINEVVILSQINHRNVVKLMGCCLETEVPILVYEFIPNGTLFGL  743
             VAVKKS+ VDE++LE FINEVVILSQ+NHR+VVKL+GCCLETEVP+LVYEFIPNG L+  
Sbjct  430   VAVKKSKIVDEEKLEEFINEVVILSQVNHRHVVKLLGCCLETEVPLLVYEFIPNGNLYEY  489

Query  742   IHNNFDNELIPLSWDIRLRIASEVACALAYLHSVTLVPIYHRDIKTGNILLDEKFRAKVS  563
             IH+    E    SW++RLRIA+EVA AL+YLHS   +P+YHRDIK+ NILLDEK RAKVS
Sbjct  490   IHDQ--KEEFEFSWEMRLRIATEVARALSYLHSAASIPVYHRDIKSTNILLDEKLRAKVS  547

Query  562   DFGTSRSISIDKTHFTTMVKGTFGYLDPEYFQSSQFTEKSDVYSFGVVLAELLTGQKPIS  383
             DFGTSRSI+ID+TH TT V+GTFGYLDPEYFQSSQFT KSDVYSFGVVLAELL+GQKPIS
Sbjct  548   DFGTSRSIAIDQTHLTTHVQGTFGYLDPEYFQSSQFTGKSDVYSFGVVLAELLSGQKPIS  607

Query  382   FELDDDEDRSLVSRFLLCMEENRLMEMLDGEVIEQGKKEDVVAMAWLAQRCLNFNGKKRP  203
             +E   +E  SL + F+L MEEN++ ++LD  +I Q ++E+V+A+A LA+RCLN+NG+KRP
Sbjct  608   YE-RSEERGSLATHFILLMEENKIFDVLDERLIGQDREEEVIAVANLARRCLNWNGRKRP  666

Query  202   TMKEVATELDAIKASNSHLPLAMEAFEIES  113
             TM+EVA EL+ I+ S   L     + ++E+
Sbjct  667   TMREVAIELEQIRLSKGALQAQRSSKQLEN  696



>ref|XP_011034598.1| PREDICTED: wall-associated receptor kinase-like 22 [Populus euphratica]
Length=739

 Score =   455 bits (1170),  Expect = 4e-142, Method: Compositional matrix adjust.
 Identities = 291/630 (46%), Positives = 391/630 (62%), Gaps = 51/630 (8%)
 Frame = -1

Query  1882  VDFLGMSYDSQTITIKESI-SPSCQGSNNFSNIIHNSKLSETPFMYSNDNNFMLFGCGNA  1706
             ++ LG+S  S  + +   I S  C G    +N+  +  ++ +PF++S+ N F+  GC N 
Sbjct  78    MEVLGISLGSSRVRVNSPIISSGCSGRG--ANLAFD--MTGSPFVFSSLNIFIAMGCNNH  133

Query  1705  FITMPGEELDQPGYNLNCSSKNTTAP----KTAHDCQGINCNHLTVDYDVNTYQVNF---  1547
              + +   E +  G    C + N T+     K    C G NC    +  ++  +  +    
Sbjct  134   AL-LNRIEPEVVGCTSTCGANNLTSSITEGKEKRYCSGNNCCQTRIPSNLQVFNASLGTT  192

Query  1546  --THSSSFNACNYAFFlsassslpptlqslpsrqQEMVVVPVELRWTITQED--VPPSYS  1379
                +    N C  AF +    SL         + ++ V  PV L W +  ++  V  S +
Sbjct  193   EDPNDQGRNQCKVAFIVDRGWSLDNIKSPEAVQDRQHV--PVILDWFVYSDNIRVENSDA  250

Query  1378  KYCSPSTYINPQLQW--------HNYLQCDCPGGDDRNVYLSGGCEWKHKDYVISSNKLR  1223
             K C P   + P  +W         N   C C  G D N YL  GC    +   ++ N   
Sbjct  251   KNCRPPVQL-PSGRWGLSTLTLYSNSTTCSCNLGYDGNPYLPDGCTDIDECKNLNGNWCS  309

Query  1222  PAIIGISASFGF---------VFLIWAFVIL-----------Ykaikkrkmkklrqkffk  1103
                  ++   G+          FLI                 YK ++KRK  +L++KFFK
Sbjct  310   GMTKCVNVPGGYKCELDKAKITFLILGAATGLLLLLVGIWGLYKLVRKRKNIELKKKFFK  369

Query  1102  RNGGlllqqqlLTKEGTIEKTKIFTASELDKATDHFNADRIVGRGGQGTVYKGMLIDGQI  923
             +NGGLLLQQQL + +G+I+KTKIFT+ EL+KATD FN +RI+G+GGQGTVYKGML DG I
Sbjct  370   QNGGLLLQQQLSSSDGSIQKTKIFTSKELEKATDRFNDNRILGKGGQGTVYKGMLADGMI  429

Query  922   VAVKKSQAVDEDQLEPFINEVVILSQINHRNVVKLMGCCLETEVPILVYEFIPNGTLFGL  743
             VAVKKS+ VDE++LE FINEVVILSQ+NHR+VVKL+GCCLETEVP+LVYEFIPNG L+  
Sbjct  430   VAVKKSKIVDEEKLEEFINEVVILSQVNHRHVVKLLGCCLETEVPLLVYEFIPNGNLYEY  489

Query  742   IHNNFDNELIPLSWDIRLRIASEVACALAYLHSVTLVPIYHRDIKTGNILLDEKFRAKVS  563
             IH+    E    SW++RLRIA+EVA AL+YLHS   +P+YHRDIK+ NILLDEK RAKVS
Sbjct  490   IHD--QKEEFEFSWEMRLRIATEVARALSYLHSAASIPVYHRDIKSTNILLDEKLRAKVS  547

Query  562   DFGTSRSISIDKTHFTTMVKGTFGYLDPEYFQSSQFTEKSDVYSFGVVLAELLTGQKPIS  383
             DFGTSRSI+ID+TH TT V+GTFGY DPEYFQSSQFT KSDVYSFGVVLAELL+GQKPIS
Sbjct  548   DFGTSRSIAIDQTHLTTHVQGTFGYFDPEYFQSSQFTGKSDVYSFGVVLAELLSGQKPIS  607

Query  382   FELDDDEDRSLVSRFLLCMEENRLMEMLDGEVIEQGKKEDVVAMAWLAQRCLNFNGKKRP  203
             +E   +E  SL + F+L MEEN++ ++LD  +I Q ++E+V+A+A LA+RCLN+NGKKRP
Sbjct  608   YE-RSEERGSLATHFILLMEENKIFDILDERLIGQEREEEVIAVANLARRCLNWNGKKRP  666

Query  202   TMKEVATELDAIKASNSHLPLAMEAFEIES  113
             TM+EVA EL+ I+ S   L     + ++E+
Sbjct  667   TMREVAIELEQIRLSKGALQAQRSSKQLEN  696



>ref|XP_008342477.1| PREDICTED: wall-associated receptor kinase-like 22 [Malus domestica]
Length=729

 Score =   454 bits (1169),  Expect = 4e-142, Method: Compositional matrix adjust.
 Identities = 284/587 (48%), Positives = 363/587 (62%), Gaps = 58/587 (10%)
 Frame = -1

Query  1771  LSETPFMYS-NDNNFMLFGCGN-AFITMP-GEELDQPGYNLNCSSKNTTAPKTAHDCQGI  1601
             L   PF++S + N F   GC N A +TM  G  +   G    C S  T +  T   C GI
Sbjct  98    LEGGPFVFSQSKNRFTAVGCNNLALMTMVNGSTIG--GCLSFCRSGLTASSST---CNGI  152

Query  1600  NCNHLTVDYDVNTYQVNFTHSSS---FNACNYAFFlsassslpptlqslpsrqQEMVVVP  1430
             +C   T+  D+  +        +      C YAF +         L+     Q  M  +P
Sbjct  153   DCCQTTIPSDLQVFNTTIESVETGEPTEGCKYAFLVDRQWFENEGLRKASDIQ-NMDSLP  211

Query  1429  VELRWTI---------TQEDVPPSYSKYCSPSTYINPQL--QWHNYLQCDCPGGDDRNVY  1283
             V L W I         T + +  + S  C   +++N       ++ ++C C  G + N Y
Sbjct  212   VVLEWRIDRRTYDSLATNKSIAFNNSTVCESGSFVNSTSFSNKNSMVRCSCKRGYEGNPY  271

Query  1282  LSGGCE-------------WKHKDYVISSNK-------------------LRPAIIGISA  1199
             L  GC+              ++  Y    N                    ++P +IGI A
Sbjct  272   LPDGCQDIDECVDPQSPCLLENLGYTFICNNTIGSYECYFFGPPEKKKSAVKPVVIGIGA  331

Query  1198  SFGFVFLIWAFVILYkaikkrkmkklrqkffkRNGGlllqqqlLTKEGTIEKTKIFTASE  1019
             S G + L+     LYK +KKR   K R+KFFK+NGG  +++QL + E  +EK KIF   E
Sbjct  332   SLGLLLLLATAWWLYKVVKKRNDTKRREKFFKQNGGFFIKEQLSSGEVNVEKIKIFDPKE  391

Query  1018  LDKATDHFNADRIVGRGGQGTVYKGMLIDGQIVAVKKSQAVDEDQLEPFINEVVILSQIN  839
             L+KATDHFN +RI+G+GGQGTVYKGML DG++VAV KS+ +DE +L PFINE+VILSQ+N
Sbjct  392   LEKATDHFNVNRILGQGGQGTVYKGMLTDGRLVAVXKSKVIDEGKLRPFINEIVILSQLN  451

Query  838   HRNVVKLMGCCLETEVPILVYEFIPNGTLFGLIHNNFDNELIPLSWDIRLRIASEVACAL  659
             HRNVVKL GCCLET VP+LVYE++PNGTLF  IH   DNE  PL WD+RLRIA EVA AL
Sbjct  452   HRNVVKLFGCCLETNVPLLVYEYVPNGTLFEYIHE--DNEEFPLLWDMRLRIAIEVAGAL  509

Query  658   AYLHSVTLVPIYHRDIKTGNILLDEKFRAKVSDFGTSRSISIDKTHFTTMVKGTFGYLDP  479
              YLHS   +PIYHRDIK+ NILLD+K+RAKV+DFGTSRSISID+TH TT+V+GTFGYLDP
Sbjct  510   FYLHSSASIPIYHRDIKSTNILLDDKYRAKVADFGTSRSISIDQTHVTTLVQGTFGYLDP  569

Query  478   EYFQSSQFTEKSDVYSFGVVLAELLTGQKPISFELDDDEDRSLVSRFLLCMEENRLMEML  299
             EYFQSSQFTEKSDVYSFGVVL ELLT QKPISF    +E RSL + F+L MEE RL +++
Sbjct  570   EYFQSSQFTEKSDVYSFGVVLIELLTSQKPISF-TRSEEGRSLATYFILKMEEKRLFDIV  628

Query  298   DGEVIEQGKKEDVVAMAWLAQRCLNFNGKKRPTMKEVATELDAIKAS  158
             D  + ++G KE + A+A LA+RCL+ NGK+RPTMKEVA EL+ IK S
Sbjct  629   DVRITKEGSKEQIEAVACLARRCLDLNGKRRPTMKEVAMELEGIKKS  675



>gb|KCW47714.1| hypothetical protein EUGRSUZ_K01462 [Eucalyptus grandis]
Length=690

 Score =   453 bits (1165),  Expect = 5e-142, Method: Compositional matrix adjust.
 Identities = 271/551 (49%), Positives = 366/551 (66%), Gaps = 42/551 (8%)
 Frame = -1

Query  1771  LSETPFMYSND-NNFMLFGCGNAFITMPGEELDQPGYNLNCSSKNTTAPKTAHDCQGIN-  1598
             L  + F++S   N F+  GC N    +   E D  G   +C+  NT+     + C G + 
Sbjct  116   LEGSQFIFSQTWNVFISVGC-NTLAIVNSTESDVVGCRSSCAGTNTSV-SMYNACSGRDG  173

Query  1597  CNHLTVDYDVNTYQVNFT-HSSSFNACNYAFFlsassslpptlqslpsrqQEMVVVPVEL  1421
             C   T+ +++  + V F         C YAF    +  L   +  L        +VPV L
Sbjct  174   CCQSTLPFNLQFFSVVFKDERGPQEGCKYAFLADRTWFLRSNITDLSFND----MVPVVL  229

Query  1420  RWTITQE-DVPPSYSKYCSPSTYINP-QLQWHN----------YLQCDCPGGDDRNVYLS  1277
              W I+ + +      +  + S Y++P +   +N          ++QC C  G   N YL+
Sbjct  230   EWGISNKTEYGLKLFQQANGSGYLDPFRCTRYNLYGSYTSEMPFVQCFCSSGYRGNPYLT  289

Query  1276  GGCEWKHKDYVISSNKLRPAIIGISASFGFVFLIWAFVILYkaikkrkmkklrqkffkRN  1097
              GC+                  G+ A+ G + L      LYK +KKR+  KL++K FKRN
Sbjct  290   EGCQ------------------GVGAASGALVLCVVLWRLYKYVKKRREIKLKEKHFKRN  331

Query  1096  GGlllqqqlLTKEGTIEKTKIFTASELDKATDHFNADRIVGRGGQGTVYKGMLIDGQIVA  917
             GGLLL+ +L + EG +EK K+F + +L+KATD+F+ DRI+G+GGQGTVYKGML DG+IVA
Sbjct  332   GGLLLKNELSSPEGNVEKNKLFNSKDLEKATDNFSDDRILGQGGQGTVYKGMLTDGKIVA  391

Query  916   VKKSQAVDEDQLEPFINEVVILSQINHRNVVKLMGCCLETEVPILVYEFIPNGTLFGLIH  737
             +KKS+ +DE ++E FINEV+ILSQINHRNVVKL+GCCLETEVP+LVYEFIPNGTL+  +H
Sbjct  392   IKKSKVIDEGKVEQFINEVLILSQINHRNVVKLLGCCLETEVPLLVYEFIPNGTLYQYLH  451

Query  736   NNFDNELIPLSWDIRLRIASEVACALAYLHSVTLVPIYHRDIKTGNILLDEKFRAKVSDF  557
             +   N+   +SWD RLRIA+E+A AL YLHS   +PIYHRDIK+ NILLDEK+RAKV+DF
Sbjct  452   D--PNQEFHVSWDTRLRIATEIAGALFYLHSAASIPIYHRDIKSTNILLDEKYRAKVADF  509

Query  556   GTSRSISIDKTHFTTMVKGTFGYLDPEYFQSSQFTEKSDVYSFGVVLAELLTGQKPISFE  377
             GTS+S+S+D+TH TT+V+GTFGYLDPEYFQSSQFT+KSDVYSFGVVL ELLTGQKPIS  
Sbjct  510   GTSKSVSLDQTHVTTLVQGTFGYLDPEYFQSSQFTDKSDVYSFGVVLVELLTGQKPIS-S  568

Query  376   LDDDEDRSLVSRFLLCMEENRLMEMLDGEVIEQGKKEDVVAMAWLAQRCLNFNGKKRPTM  197
             L + E RSLV+ F++ MEEN L  ++D +V+++GKKE++ ++A LA+RCLN NG+KRPTM
Sbjct  569   LREQEGRSLVTYFIISMEENCLFNIVDAQVLKEGKKEEIASVANLAKRCLNLNGRKRPTM  628

Query  196   KEVATELDAIK  164
             KEVA EL+ I+
Sbjct  629   KEVAMELERIR  639



>ref|XP_011082235.1| PREDICTED: wall-associated receptor kinase-like 8 [Sesamum indicum]
Length=744

 Score =   454 bits (1169),  Expect = 8e-142, Method: Compositional matrix adjust.
 Identities = 285/621 (46%), Positives = 382/621 (62%), Gaps = 58/621 (9%)
 Frame = -1

Query  1879  DFLGMSYDSQTITIKESISPSCQGSNNFSNI-IHNSKLSETPFMYSNDNNFMLFGCGNAF  1703
             + LG+S     + I+  ++  C   NN   +   ++  S TPF +SN N   L GC +  
Sbjct  93    EVLGIS--ETKVLIRNKLASLCYIDNNTPEVNDFDTDFSGTPFSFSNQNKLSLVGCNHIS  150

Query  1702  ITMPGEELDQPGYNLNCSSKNTTAPKTAH-DCQGINCNHLTVD-----YDVNTYQVNFTH  1541
             +   G ELD   Y  +C +  +   + ++  C GI C   ++       +++   +N   
Sbjct  151   LMSKGSELDT--YTSSCVAVCSKPQELSNGSCSGIGCCQASIPKGLQYINISVLSLNVLS  208

Query  1540  SS-SFNACNYAFFlsassslpptlqslpsrqQEMV--VVPVELRWTITQEDVPPSYSKYC  1370
             S  +FN C Y+F    +S +        S         +P+ + W I       S    C
Sbjct  209   SEYNFNPCGYSFLAEQNSYIFSVSDISDSSFINKTKETLPLVIDWAIANRTCNDSSEIIC  268

Query  1369  -SPSTYINPQLQWHNYLQCDCPGGDDRNVYLSGGCE---------WKHKDYVIS-----S  1235
                S  ++       Y +C+C  G   N YLS GC+            K   I+     +
Sbjct  269   QGESVCVDSGTTLGGY-RCNCSRGYGGNPYLSPGCQDINECEFNPCHPKAICINLPGSFN  327

Query  1234  NKLRPAIIGISASFG------------------------FVFLIWAFVILYkaikkrkmk  1127
                 P  +G  A +G                        F+ L  +F  LYK ++KR++K
Sbjct  328   CSCPPNYLGDGAKYGTGCIYLPPPNKTALYTGLPIGAGLFILLAVSF-WLYKDLRKRRVK  386

Query  1126  klrqkffkRNGGlllqqqlLTKEGTIEKTKIFTASELDKATDHFNADRIVGRGGQGTVYK  947
             +L+Q  FKRNGGLLLQQ +   +  + K ++FT+ EL+KATD FN  RI+GRGGQGTVYK
Sbjct  387   QLKQSIFKRNGGLLLQQHMSAHDLVLGKMRLFTSKELEKATDRFNESRILGRGGQGTVYK  446

Query  946   GMLIDGQIVAVKKSQAVDEDQLEPFINEVVILSQINHRNVVKLMGCCLETEVPILVYEFI  767
             GML DG+I+AVKKS+ VDE++LE FINEVVILSQINHRNVVKL+GCCLETEVP+LVYEFI
Sbjct  447   GMLSDGRIIAVKKSKQVDENRLEEFINEVVILSQINHRNVVKLLGCCLETEVPLLVYEFI  506

Query  766   PNGTLFGLIHNNFDNELIPLSWDIRLRIASEVACALAYLHSVTLVPIYHRDIKTGNILLD  587
             PNGTL+ LIH+  D+   P SWD+RLRIA+E+A ALAYLH  T +PIYHRD+K+ NILLD
Sbjct  507   PNGTLYDLIHD--DSNGFPFSWDLRLRIAAEIANALAYLHYATSIPIYHRDMKSNNILLD  564

Query  586   EKFRAKVSDFGTSRSISIDKTHFTTMVKGTFGYLDPEYFQSSQFTEKSDVYSFGVVLAEL  407
             EK+RAK+SDFG SRS++ID+TH TT V+GTFGYLDPEYFQ+SQFTEKSDVYSFGVVL EL
Sbjct  565   EKYRAKLSDFGISRSVAIDQTHLTTKVQGTFGYLDPEYFQTSQFTEKSDVYSFGVVLVEL  624

Query  406   LTGQKPISFELDDDEDRSLVSRFLLCMEENRLMEMLDGEVIEQGKKEDVVAMAWLAQRCL  227
             LTGQKPIS  +  +E++SL +RFL  ME NRL  +LD ++IEQG  E+ V +A LA+RCL
Sbjct  625   LTGQKPISTSV-TEEEKSLATRFLTTMEGNRLQTILDSQIIEQGYTEEHVIVANLARRCL  683

Query  226   NFNGKKRPTMKEVATELDAIK  164
             N  G++RPT++EVA EL++I+
Sbjct  684   NLTGRRRPTIREVALELESIR  704



>ref|XP_007217600.1| hypothetical protein PRUPE_ppa018374mg, partial [Prunus persica]
 gb|EMJ18799.1| hypothetical protein PRUPE_ppa018374mg, partial [Prunus persica]
Length=689

 Score =   452 bits (1163),  Expect = 1e-141, Method: Compositional matrix adjust.
 Identities = 285/604 (47%), Positives = 372/604 (62%), Gaps = 64/604 (11%)
 Frame = -1

Query  1882  VDFLGMSYDSQTITIKESISPSCQGSNNFSNIIHNSKLSETPFMYSN-DNNFMLFGCGN-  1709
             ++ L +S +  T+ +   ++ +C G  + +N++    +  +PF++S  DN F   GC N 
Sbjct  83    LEVLEVSTELGTVRVNFPVNSTC-GDRSNANVM---SMEGSPFVFSQADNRFTGVGCNNL  138

Query  1708  AFITMPGEELDQPGYNLNCSSKN--------TTAPKTAHDCQGINCNHLTVDYDV---NT  1562
             A +T+           LN S+           +   ++  C GI+C   T+  D+   NT
Sbjct  139   ALMTL-----------LNGSTIGGCLSFCFSGSTGGSSTTCNGIDCCQTTIPSDLQAFNT  187

Query  1561  YQVNFTHSSSFNACNYAFFlsassslpptlqslpsrqQEMVVVPVELRWTI---------  1409
                N     +   C YAF +           +  S  Q     PV L W I         
Sbjct  188   TIENIEARENSEGCKYAFLVDQQWFESNVRVAKASAIQNRDNFPVVLEWRIDRWKYDSLV  247

Query  1408  TQEDVPPSYSKYCSPSTYINPQL--QWHNYLQCDCPGGDDRNVYLSGGCEWKHKDYVISS  1235
             T + +  + S  C    +IN        + ++C C  G + N YL  GC        +  
Sbjct  248   TNKSISLNNSTLCESGVFINSTSFSNQTSVVRCSCKRGYEGNPYLPEGCLGIGASLGLLL  307

Query  1234  NKLRPAIIGISASFGFVFLIWAFVILYkaikkrkmkklrqkffkRNGGlllqqqlLTKEG  1055
                                      LYK +KKR   K R+KFFK+NGGLLL +QL + E 
Sbjct  308   LLA------------------GAWWLYKVVKKRNNVKRREKFFKQNGGLLLHEQLSSGEV  349

Query  1054  TIEKTKIFTASELDKATDHFNADRIVGRGGQGTVYKGMLIDGQIVAVKKSQAVDEDQLEP  875
              +EK K+F   EL+KATDHFN +RI+G+GGQGTVYKGML DG+IVAVKKS+ VDE +L  
Sbjct  350   NVEKIKLFDPKELEKATDHFNVNRILGQGGQGTVYKGMLTDGRIVAVKKSKVVDEGKLRH  409

Query  874   FINEVVILSQINHRNVVKLMGCCLETEVPILVYEFIPNGTLFGLIHNNFDNELIPLSWDI  695
             FINE+VILSQ+NHRNVVKL+GCCLETEVP+LVYEF+PNGTLF  IH   DNE  PL+WD+
Sbjct  410   FINEIVILSQLNHRNVVKLLGCCLETEVPLLVYEFVPNGTLFEYIHE--DNEEFPLTWDM  467

Query  694   RLRIASEVACALAYLHSVTLVPIYHRDIKTGNILLDEKFRAKVSDFGTSRSISIDKTHFT  515
             R+RIA EVA AL YLHS   +PIYHRDIK+ NILLD+K+RAKV+DFGTSRSISID+TH T
Sbjct  468   RVRIAIEVAGALFYLHSAASIPIYHRDIKSTNILLDDKYRAKVADFGTSRSISIDQTHVT  527

Query  514   TMVKGTFGYLDPEYFQSSQFTEKSDVYSFGVVLAELLTGQKPISFELDDDEDRSLVSRFL  335
             T+V+GTFGYLDPEYFQSSQFTEKSDVYSFGVVL ELLT QKPISF    ++ RSL + F+
Sbjct  528   TIVQGTFGYLDPEYFQSSQFTEKSDVYSFGVVLVELLTSQKPISF-TRSEQGRSLATYFI  586

Query  334   LCMEENRLMEMLDGEVIEQGKKEDVVAMAWLAQRCLNFNGKKRPTMKEVATELD----AI  167
             L MEENRL +++D   +++G K+ +VA+A LA+RCL+ NGK+RPTMKEVA EL+    A+
Sbjct  587   LSMEENRLFDIVDVRFMKEGSKDQIVAVANLAKRCLDLNGKRRPTMKEVAMELEGTQKAV  646

Query  166   KASN  155
             KAS+
Sbjct  647   KASH  650



>gb|KCW81737.1| hypothetical protein EUGRSUZ_C03090 [Eucalyptus grandis]
Length=637

 Score =   450 bits (1158),  Expect = 1e-141, Method: Compositional matrix adjust.
 Identities = 278/575 (48%), Positives = 367/575 (64%), Gaps = 53/575 (9%)
 Frame = -1

Query  1771  LSETPFMYSNDNN-FMLFGCGNAFITMPGEELDQPGYNLNCSSKNTTAPKTAHDCQGINC  1595
             L  +PF++S   N F + GC N  +   G+E    G    C+  N T+ K +   +   C
Sbjct  26    LKGSPFVFSQKTNIFTVVGC-NTLLIANGKESAVFGCQSKCAGANFTSSKYSACSEREGC  84

Query  1594  NHLTVDYDVNTYQVNFTHSSSFNACNYAFFlsassslpptlqslpsrqQEMVVVPVELRW  1415
                +V  ++  + V+F   S    C YAF  S S                   VP  L W
Sbjct  85    CQSSVPLNLQGFGVDFEEESGDEGCKYAFLGSDSGVYDLRPSDK---------VPGMLEW  135

Query  1414  TIT---------QEDVPPSYSKYCSPSTYINPQLQ-----WHNY---------LQCDCPG  1304
              I          Q     + S YC+    ++ +++     + +Y          QC C  
Sbjct  136   GIANNTKYALDLQGRGRYNESFYCTKFKSLSSEVEGIIYRYRSYSVNSGEILSAQCYCRK  195

Query  1303  GDDRNVYLSGGCEWKHKD---------------YVISSNKLRPAIIGISASFGFVFLIWA  1169
             G   N YLSGGCE   K                  +   K +  +IG+ A  G + L   
Sbjct  196   GYHGNAYLSGGCEDIDKCNSRCPGTCVNTGTSFRCVGGGKTKFILIGVGAGLGALLLCLV  255

Query  1168  FVILYkaikkrkmkklrqkffkRNGGlllqqqlLTKEGTIEKTKIFTASELDKATDHFNA  989
                LYK IKKRK  KL++K FKRNGGLLL+ +L + EG +EK K+F + +L+KAT++FN 
Sbjct  256   LWGLYKYIKKRKEIKLKEKNFKRNGGLLLECEL-SFEGHVEKNKLFNSKDLEKATNNFNE  314

Query  988   DRIVGRGGQGTVYKGMLIDGQIVAVKKSQAVDEDQLEPFINEVVILSQINHRNVVKLMGC  809
             DRI+GRGGQGTVYKGML DG+IVA+KKS+A+DE ++E FINEV+ILSQINHRN+VKL+GC
Sbjct  315   DRILGRGGQGTVYKGMLTDGKIVAIKKSKAIDEGKVEQFINEVLILSQINHRNIVKLLGC  374

Query  808   CLETEVPILVYEFIPNGTLFGLIHNNFDNELIPLSWDIRLRIASEVACALAYLHSVTLVP  629
             CLETEVP+LVYEFIPNGTL+  +H+    E   +SWD RLRIA+E+A AL YLHS   +P
Sbjct  375   CLETEVPLLVYEFIPNGTLYQYLHDPM--EEYHVSWDTRLRIATEIAGALFYLHSAASIP  432

Query  628   IYHRDIKTGNILLDEKFRAKVSDFGTSRSISIDKTHFTTMVKGTFGYLDPEYFQSSQFTE  449
             IYHRDIK+ NILLDEK+RAKV+DFG S+S+S+D+TH TT+V+GTFGYLDPEYFQSSQFT+
Sbjct  433   IYHRDIKSTNILLDEKYRAKVADFGASKSVSLDQTHVTTLVQGTFGYLDPEYFQSSQFTD  492

Query  448   KSDVYSFGVVLAELLTGQKPISFELDDDEDRSLVSRFLLCMEENRLMEMLDGEVIEQGKK  269
             KSDVYSFGVVL ELLTGQKPIS  L + E RSL + F++ MEENRL +++D +V+++GKK
Sbjct  493   KSDVYSFGVVLVELLTGQKPIS-SLREQEGRSLATYFIISMEENRLFDIVDAQVLKEGKK  551

Query  268   EDVVAMAWLAQRCLNFNGKKRPTMKEVATELDAIK  164
             E++ ++A LA+RCLN NG+ RPTMKEVA EL+ ++
Sbjct  552   EEIASVADLAKRCLNLNGRNRPTMKEVAMELEGMR  586



>ref|XP_002513972.1| kinase, putative [Ricinus communis]
 gb|EEF48555.1| kinase, putative [Ricinus communis]
Length=727

 Score =   453 bits (1165),  Expect = 2e-141, Method: Compositional matrix adjust.
 Identities = 301/628 (48%), Positives = 407/628 (65%), Gaps = 64/628 (10%)
 Frame = -1

Query  1864  SYDSQTITIKES-ISPSCQGSNNFSNIIHNSKLSETPFMYSNDNN-FMLFGCGN-AFITM  1694
             S  S+ IT+    IS +C   ++ S  +    L  T F++SN++N F   GC + A +T 
Sbjct  84    SIGSERITVNSPVISSNCSNKSSTSTEV---SLLGTSFLFSNESNRFTTIGCDSYAMLTQ  140

Query  1693  PGEELDQPGYNLNCSSKNTTAPKTAHDCQGINCNHLTVDYDVNTYQVNFTHSSSFNA---  1523
              G  +   G  L+    N+++      C G+NC   T+   V +++VN T+   FN+   
Sbjct  141   SGNTV---GGCLSICRDNSSS-----GCYGLNCCQTTIPPYVQSFEVNITNP--FNSDGD  190

Query  1522  ----CNYAFFlsassslpptlqslpsrqQEMVVVPVELRWTITQE--DVPPSYSKYCSPS  1361
                 C  AF +S +     +      R  +M  VP  L W   Q   D+  + +  C+ S
Sbjct  191   GRDRCKSAFMVSQNWLASKSTNLDEVR--QMDHVPAVLDWANDQGYCDISKNPNITCT-S  247

Query  1360  TYINPQLQWHNYL---QCDCPGG--DDRNVYLSGGCEWK----------------HKDYV  1244
              Y   QL  + +    QC+  G   + +N Y    C+ K                HK+Y 
Sbjct  248   RYCWAQLTENQFCICRQCEDVGKCTNPKNYYY---CQLKCMYNRGGYNCPCPVEHHKEYS  304

Query  1243  I--------SSNKLRPAIIGISASFGFVFLIWAFVILYkaikkrkmkklrqkffkRNGGl  1088
             I          ++++  +IG  +  G + LI    + YK IK+R+  KL+QKFFKRNGGL
Sbjct  305   ICYPDSAFAGKSRIKTILIGCGSGLGLLLLIIGIWLSYKIIKRRRATKLKQKFFKRNGGL  364

Query  1087  llqqqlLTKEGTIEKTKIFTASELDKATDHFNADRIVGRGGQGTVYKGMLIDGQIVAVKK  908
             LL+QQL + E  +E+TK+FT+ EL+KATD+++  RI+G+GGQGTVYKGML DG++VA+KK
Sbjct  365   LLEQQLSSTESHVEQTKVFTSKELEKATDNYHTSRILGQGGQGTVYKGMLTDGRVVAIKK  424

Query  907   SQAVDEDQLEPFINEVVILSQINHRNVVKLMGCCLETEVPILVYEFIPNGTLFGLIHNNF  728
             S+ VDED+L+ FINEVVILSQINHRNVVKL GCCLETEVP+LVYEFIPNGTLF  I N  
Sbjct  425   SKLVDEDKLDQFINEVVILSQINHRNVVKLTGCCLETEVPLLVYEFIPNGTLFQYIQN--  482

Query  727   DNELIPLSWDIRLRIASEVACALAYLHSVTLVPIYHRDIKTGNILLDEKFRAKVSDFGTS  548
              N+  P++W++RLRIA+EVA ALAYLHS   +PIYHRDIK+ NILLDEK+RAKV+DFGTS
Sbjct  483   PNKEFPITWEMRLRIATEVAGALAYLHSAASMPIYHRDIKSSNILLDEKYRAKVADFGTS  542

Query  547   RSISIDKTHFTTMVKGTFGYLDPEYFQSSQFTEKSDVYSFGVVLAELLTGQKPISFELDD  368
             +SI+I++TH TT+V+GTFGYLDPEYFQSSQFTEKSDVYSFGVVL ELLTGQKPIS  L  
Sbjct  543   KSIAIEQTHVTTLVQGTFGYLDPEYFQSSQFTEKSDVYSFGVVLVELLTGQKPIS-SLRS  601

Query  367   DEDRSLVSRFLLCMEENRLMEMLDGEVIEQGKKEDVVAMAWLAQRCLNFNGKKRPTMKEV  188
              E+RSL + FL+ MEENRL E+LD  V+++G +E+++AMA +A++CLN NGKKRP MK V
Sbjct  602   VEERSLATYFLMTMEENRLFEILDARVLKEGGREEIIAMAKMAEKCLNLNGKKRPKMKTV  661

Query  187   ATELDAIKASNSHLPLAMEAFEIESDFI  104
             A EL+ I++S        + +E E D++
Sbjct  662   AIELEGIRSSQGVSSTIQQDYE-EVDYV  688



>ref|XP_011011594.1| PREDICTED: wall-associated receptor kinase-like 2 isoform X2 
[Populus euphratica]
 ref|XP_011011595.1| PREDICTED: wall-associated receptor kinase-like 2 isoform X3 
[Populus euphratica]
Length=739

 Score =   453 bits (1166),  Expect = 2e-141, Method: Compositional matrix adjust.
 Identities = 291/630 (46%), Positives = 389/630 (62%), Gaps = 51/630 (8%)
 Frame = -1

Query  1882  VDFLGMSYDSQTITIKESI-SPSCQGSNNFSNIIHNSKLSETPFMYSNDNNFMLFGCGNA  1706
             ++ LG+S  +  + +   I S  C G    +N+  +  +S +PF++S+ N F+  GC N 
Sbjct  78    MEVLGISLGNSRVRVNSPIISSGCSGRG--ANLAFD--MSGSPFIFSSLNIFIAMGCNNR  133

Query  1705  FITMPGEELDQPGYNLNCSSKNTTAPKTAHD----CQGINCNHLTVDYDVNTYQVNF---  1547
              + +   E +  G    C + N T+  T       C G NC    +  ++  +  +    
Sbjct  134   AL-LNRIEPEIVGCTSTCGANNLTSSSTEGKEKRYCSGDNCCQTRIPSNLQVFSASLGTT  192

Query  1546  --THSSSFNACNYAFFlsassslpptlqslpsrqQEMVVVPVELRWTITQED--VPPSYS  1379
                +    N C  AF +    SL         R  +M  VPV L W +  +D  V  S +
Sbjct  193   EDPNDQGRNQCKVAFIVDRGWSLDNIKSPEAVR--DMQHVPVILDWFVYSDDFRVENSDA  250

Query  1378  KYCSPSTYINPQLQW--------HNYLQCDCPGGDDRNVYLSGGCEWKHKDYVISSNKLR  1223
             K CSP   +    +W         N   C C  G D N YL  GC    +   ++ N   
Sbjct  251   KNCSPPVQL-ASGRWGLSTLTLYSNSTTCSCNPGYDGNPYLPDGCTDIDECKNLNGNWCS  309

Query  1222  PAIIGISASFGF---------VFLIWAFVIL-----------Ykaikkrkmkklrqkffk  1103
                  ++   G+          FLI                 YK ++KRK  +L++KFFK
Sbjct  310   GMTKCVNVPGGYKCELDKAKITFLILGAATGLLLLLVGIWGLYKLVRKRKNIELKKKFFK  369

Query  1102  RNGGlllqqqlLTKEGTIEKTKIFTASELDKATDHFNADRIVGRGGQGTVYKGMLIDGQI  923
             +NGGLLLQQQL + +G+I+KTKIFT+ EL+KATD FN +RI+G+GGQGTVYKGML DG I
Sbjct  370   QNGGLLLQQQLSSSDGSIQKTKIFTSKELEKATDRFNDNRILGKGGQGTVYKGMLADGMI  429

Query  922   VAVKKSQAVDEDQLEPFINEVVILSQINHRNVVKLMGCCLETEVPILVYEFIPNGTLFGL  743
             VAVKKS+ VDE++LE FIN VVILSQ+NHR+VVKL+GCCLETEVP+LVYEFIPNG L+  
Sbjct  430   VAVKKSKIVDEEKLEEFINVVVILSQVNHRHVVKLLGCCLETEVPLLVYEFIPNGNLYEY  489

Query  742   IHNNFDNELIPLSWDIRLRIASEVACALAYLHSVTLVPIYHRDIKTGNILLDEKFRAKVS  563
             IH+    E    SW++RLRIA+EVA AL+YLHS   +P+YHRDIK+ NILLDEK RAKVS
Sbjct  490   IHDQ--KEEFEFSWEMRLRIATEVAGALSYLHSAASIPVYHRDIKSTNILLDEKLRAKVS  547

Query  562   DFGTSRSISIDKTHFTTMVKGTFGYLDPEYFQSSQFTEKSDVYSFGVVLAELLTGQKPIS  383
             DFGTSRSI+ID+TH TT V+GTFGY DPEYFQSS FT KSDVYSFGVVLAELL+GQKPIS
Sbjct  548   DFGTSRSIAIDQTHLTTHVRGTFGYFDPEYFQSSHFTGKSDVYSFGVVLAELLSGQKPIS  607

Query  382   FELDDDEDRSLVSRFLLCMEENRLMEMLDGEVIEQGKKEDVVAMAWLAQRCLNFNGKKRP  203
             +E   +E  SL + F+L MEEN++ ++LD  +I Q ++E+V+A+A LA+RCLN+NG+KRP
Sbjct  608   YE-RSEERGSLATHFILLMEENKIFDVLDERLIGQDREEEVIAVANLARRCLNWNGRKRP  666

Query  202   TMKEVATELDAIKASNSHLPLAMEAFEIES  113
             TM+EVA EL+ I+ S   L     + ++E+
Sbjct  667   TMREVAIELEQIRLSKGALQAQRSSKQLEN  696



>ref|XP_008229606.1| PREDICTED: wall-associated receptor kinase-like 22 [Prunus mume]
Length=732

 Score =   453 bits (1165),  Expect = 2e-141, Method: Compositional matrix adjust.
 Identities = 288/597 (48%), Positives = 369/597 (62%), Gaps = 75/597 (13%)
 Frame = -1

Query  1762  TPFMYSN-DNNFMLFGCGN-AFITMPGEELDQPGYNLNCSSKN--------TTAPKTAHD  1613
             +PF++S  DN F   GC N A +T+           LN S+           +   ++  
Sbjct  111   SPFVFSQADNRFTGVGCNNLALMTL-----------LNGSTIGGCLSFCFSGSTGGSSTT  159

Query  1612  CQGINCNHLTVDYDV---NTYQVNFTHSSSFNACNYAFFlsassslpptlqslpsrqQEM  1442
             C GI+C   T+  D+   NT   N     +   C YAF +           +  S  Q  
Sbjct  160   CNGIDCCQTTIPSDLQAFNTTIENIEARENSEGCKYAFLVDQQWFESNVRVAKASAIQNR  219

Query  1441  VVVPVELRWTI---------TQEDVPPSYSKYCSPSTYINPQL--QWHNYLQCDCPGGDD  1295
                PV L W I         T + +  + S  C     IN        + ++C C  G +
Sbjct  220   DNFPVVLEWRIDRWKYDSLVTNKSISFNNSTLCESGVLINSTSFSNQTSVVRCSCKRGYE  279

Query  1294  RNVYLSGGC----------------------------EWKHKDYVI-----SSNKLRPAI  1214
              N YL  GC                            E  ++ +         + ++P +
Sbjct  280   GNPYLPEGCLDIDECADPKNIPCLQENLGPTFTCKNTEGSYECHFYGPPEKKKSAVKPVL  339

Query  1213  IGISASFGFVFLIWAFVILYkaikkrkmkklrqkffkRNGGlllqqqlLTKEGTIEKTKI  1034
             IGI AS G + ++     LYK  K+R   K R KFFK+NGGLLLQ+QL + E  +EK K+
Sbjct  340   IGIGASLGLLLVLAGAWWLYKVGKERNNVKRRAKFFKQNGGLLLQEQLSSGEVNVEKIKL  399

Query  1033  FTASELDKATDHFNADRIVGRGGQGTVYKGMLIDGQIVAVKKSQAVDEDQLEPFINEVVI  854
             F   EL+KATDHFN +RI+G+GGQGTVYKGML DG+IVAVK+S+ VDE +L PFINE+VI
Sbjct  400   FDPKELEKATDHFNVNRILGQGGQGTVYKGMLTDGRIVAVKRSKVVDEGKLRPFINEIVI  459

Query  853   LSQINHRNVVKLMGCCLETEVPILVYEFIPNGTLFGLIHNNFDNELIPLSWDIRLRIASE  674
             LSQ+NHRNVVKL+GCCLETEVP+LVYEF+PNGTLF  IH   DNE  PL+WD+R+RIA E
Sbjct  460   LSQLNHRNVVKLLGCCLETEVPLLVYEFVPNGTLFEYIHE--DNEEFPLTWDMRVRIAIE  517

Query  673   VACALAYLHSVTLVPIYHRDIKTGNILLDEKFRAKVSDFGTSRSISIDKTHFTTMVKGTF  494
             VA AL YLHS   +PIYHRDIK+ NILLD+K+RAKV+DFGTSRSISID+TH TT+V+GTF
Sbjct  518   VAGALFYLHSAASIPIYHRDIKSTNILLDDKYRAKVADFGTSRSISIDQTHVTTIVQGTF  577

Query  493   GYLDPEYFQSSQFTEKSDVYSFGVVLAELLTGQKPISFELDDDEDRSLVSRFLLCMEENR  314
             GYLDPEYFQSSQFTEKSDVYSFGVVL ELLT QKPISF    ++ RSL + F+L MEENR
Sbjct  578   GYLDPEYFQSSQFTEKSDVYSFGVVLVELLTSQKPISFT-RSEQGRSLATYFILSMEENR  636

Query  313   LMEMLDGEVIEQGKKEDVVAMAWLAQRCLNFNGKKRPTMKEVATELD----AIKASN  155
             L +++D  V+++G K+ +VA+A LA+RCL+ NGK+RPTMKEVA EL+    A+KAS+
Sbjct  637   LFDIVDVRVMKEGSKDQIVAVANLAKRCLDLNGKRRPTMKEVAMELEGTQKAVKASH  693



>ref|XP_003634276.1| PREDICTED: wall-associated receptor kinase-like 8 [Vitis vinifera]
Length=706

 Score =   451 bits (1160),  Expect = 5e-141, Method: Compositional matrix adjust.
 Identities = 287/628 (46%), Positives = 392/628 (62%), Gaps = 63/628 (10%)
 Frame = -1

Query  1927  THPDIQQNVRIIYECVDFLGMSYDSQTITIKESISPSCQGSNNFSNIIHNSKLSETPFMY  1748
             +HP I   V+ I         S + QT++++  +   CQ     +    +  L ETPF +
Sbjct  71    SHPRINLEVQQI---------SVEYQTVSVQTPMPAYCQNQEETNRTWDSIDLKETPFFF  121

Query  1747  SND-NNFMLFGCGNA-FITMPGEELDQPGYNLNCSS--KNTTAPKTAH-DCQGINCNHLT  1583
             S + N+  + GCGNA  +T  G  L        CSS  +NT+     +  C GINC   T
Sbjct  122   SAERNSLRVIGCGNAVLVTRSGVTL------AGCSSFCQNTSNNFVGNGGCFGINCCQAT  175

Query  1582  VDYDVNTYQVNFTHS---SSFNACNYAFFlsassslpptlqslpsrqQEMVVVPVELRWT  1412
             +  ++N +++N T +   SS + C +A              S      +     +EL W 
Sbjct  176   IPSNLNFFRLNTTATSYLSSESPCTFA--------ALGNGFSTDQASPQQSWASIELTWM  227

Query  1411  ITQEDVPPSYSKYCSPSTYINPQLQWHNYLQCDCPGGDDRNVYLSGGCE-----------  1265
             I +E V  S    C  +T    ++  + Y  C C   ++ N Y    C+           
Sbjct  228   I-EEAVEGS---QCQKNTLNGAEVGNYTYYNCSCLPYEEGNPYRPHACQVPEVCKNCAEC  283

Query  1264  WKHKDYVIS----------SNKLRPAIIGISASF-GFVFLIWAFVILYkaikkrkmkklr  1118
              K  D   S          S   +P I+G+S    G VFLI     LYK IKK+++ K +
Sbjct  284   RKEADGSFSCVVRGSTSTSSTSPKPLILGLSFGIGGSVFLIIGSCWLYKFIKKQRVIKRK  343

Query  1117  qkffkRNGGlllqqqlLTKEGTIEKTKIFTASELDKATDHFNADRIVGRGGQGTVYKGML  938
             + FFKRNGGLLLQQ++ +    +EKTKIF++ EL  AT++FN +RI+G+GGQGTVYKGML
Sbjct  344   EHFFKRNGGLLLQQEMSSDRIAVEKTKIFSSEELAIATENFNKNRILGQGGQGTVYKGML  403

Query  937   IDGQIVAVKKSQAVDEDQLEPFINEVVILSQINHRNVVKLMGCCLETEVPILVYEFIPNG  758
             IDG+IVA+KKS+ VDEDQLE FINE++ILSQINHRN++KL+GCCLETEVP+LV+EFI NG
Sbjct  404   IDGKIVAIKKSKIVDEDQLEQFINEIMILSQINHRNIMKLLGCCLETEVPLLVFEFISNG  463

Query  757   TLFGLIHNNFDNELIPLSWDIRLRIASEVACALAYLHSVTLVPIYHRDIKTGNILLDEKF  578
             TLF LIH+   N   P SW++RL+IA+EVA A+ YLHS + VPIYHRDIK+ NILLD+K+
Sbjct  464   TLFQLIHDK--NNEFPFSWEMRLQIAAEVADAITYLHSASSVPIYHRDIKSSNILLDDKY  521

Query  577   RAKVSDFGTSRSISIDKTHFTTMVKGTFGYLDPEYFQSSQFTEKSDVYSFGVVLAELLTG  398
             +AKVSDFG SRS+S+ +TH TT+V+GTFGYLDPEYF ++ FTEKSDVYSFGVVL ELLTG
Sbjct  522   KAKVSDFGISRSVSLGQTHLTTLVQGTFGYLDPEYFVTNHFTEKSDVYSFGVVLVELLTG  581

Query  397   QKPISFELDDDEDRSLVSRFLLCMEENRLMEMLDGEVIEQGKKEDVVAMAWLAQRCLNFN  218
             QKPI      +E+RSLV+ F   +E+ RL +++D  V+++G K++++A+A LA RCL+F 
Sbjct  582   QKPIP-STRSEEERSLVAYFTSSLEQGRLFDIIDNRVMKEGGKDEILAVANLASRCLHFK  640

Query  217   GKKRPTMKEVATELDAIKAS---NSHLP  143
             GK+RPTMKEV  EL+  + S    SH+P
Sbjct  641   GKERPTMKEVTKELEHFRTSFLPFSHVP  668



>ref|XP_011017594.1| PREDICTED: wall-associated receptor kinase-like 1 isoform X1 
[Populus euphratica]
 ref|XP_011017595.1| PREDICTED: wall-associated receptor kinase-like 1 isoform X1 
[Populus euphratica]
 ref|XP_011017596.1| PREDICTED: wall-associated receptor kinase-like 1 isoform X2 
[Populus euphratica]
Length=402

 Score =   439 bits (1129),  Expect = 1e-140, Method: Compositional matrix adjust.
 Identities = 227/354 (64%), Positives = 289/354 (82%), Gaps = 2/354 (1%)
 Frame = -1

Query  1219  AIIGISASFGFVFLIWAFVILYkaikkrkmkklrqkffkRNGGlllqqqlLTKEGTIEKT  1040
             A +G+   FG +FL+     LY+  K+++ +KL++K+FKRNGGLLLQ+QL + E  +EK 
Sbjct  2     AGLGVGVGFGALFLLIGLWWLYRVFKRKRSEKLKKKYFKRNGGLLLQEQLSSGEVNVEKI  61

Query  1039  KIFTASELDKATDHFNADRIVGRGGQGTVYKGMLIDGQIVAVKKSQAVDEDQLEPFINEV  860
             K+F + ELDKATDH+N +R +G+GGQGTVYKGML DG+IVAVKKS+ +DE  L  FI EV
Sbjct  62    KMFPSKELDKATDHYNVNRTLGQGGQGTVYKGMLADGKIVAVKKSKVIDEGNLRLFIIEV  121

Query  859   VILSQINHRNVVKLMGCCLETEVPILVYEFIPNGTLFGLIHNNFDNELIPLSWDIRLRIA  680
             V+LSQINHRNVVKL+GCCLETE+P+LVYEFIPNGTLF  +H+   NE  PL+W++RLRIA
Sbjct  122   VLLSQINHRNVVKLLGCCLETELPLLVYEFIPNGTLFQFLHD--PNEEFPLAWEMRLRIA  179

Query  679   SEVACALAYLHSVTLVPIYHRDIKTGNILLDEKFRAKVSDFGTSRSISIDKTHFTTMVKG  500
             +EVA AL YLHS   +PI+HRDIK+ NILLDEK+RAKV+DFGTSRS+SID+TH TT+V+G
Sbjct  180   AEVAGALFYLHSAASLPIFHRDIKSTNILLDEKYRAKVADFGTSRSVSIDQTHVTTLVQG  239

Query  499   TFGYLDPEYFQSSQFTEKSDVYSFGVVLAELLTGQKPISFELDDDEDRSLVSRFLLCMEE  320
             TFGYLDPEYFQSSQFT+KSDVYSFGVVL ELLTGQKPISF   +++ RSL + F++ ME 
Sbjct  240   TFGYLDPEYFQSSQFTDKSDVYSFGVVLVELLTGQKPISFTRSEEQGRSLATYFIMAMES  299

Query  319   NRLMEMLDGEVIEQGKKEDVVAMAWLAQRCLNFNGKKRPTMKEVATELDAIKAS  158
             N L ++LD +V++QG++EDV+ +A LA+ CL  NGK+RPTMKEV   L+ IK S
Sbjct  300   NCLFDILDPQVVKQGEREDVLMVASLARSCLRLNGKERPTMKEVTMVLERIKKS  353



>ref|XP_002297686.2| putative wall-associated kinase family protein [Populus trichocarpa]
 gb|EEE82491.2| putative wall-associated kinase family protein [Populus trichocarpa]
Length=686

 Score =   449 bits (1156),  Expect = 1e-140, Method: Compositional matrix adjust.
 Identities = 294/593 (50%), Positives = 376/593 (63%), Gaps = 50/593 (8%)
 Frame = -1

Query  1882  VDFLGMSYDSQTITIKESI-SPSCQGSNNFSNIIHNSKLSETPFMYS-NDNNFMLFGCGN  1709
             ++ L +S +  T T+K  I S +C G  +   +     L+ TPF++S NDN F+  GC N
Sbjct  72    MEVLNISAERATATVKSPIISSNCTGREDGVPL----NLTGTPFVFSRNDNVFIAVGC-N  126

Query  1708  AFITMPGEELDQPGYNLNCSSKNTTAPKTAHDCQGINCNHLTVDYDVNTYQVNFTHSSSF  1529
                 M G   +  G    CS       K+ + CQ    + L V    N        +   
Sbjct  127   TQALMTGITPNLIGCVSTCSD-----VKSKNFCQASAPSFLQV---FNPKLEATDDNQDR  178

Query  1528  NACNYAFFlsassslpptlqslpsrqQEMVVVPVELRWTITQEDVPPSYSKYCSPSTYIN  1349
               C  AF ++ +            + ++ V  P EL WT++  D  P Y +      Y N
Sbjct  179   EGCKLAFLVNQTWFESNISDPFTLQYRDYV--PAELGWTMSWNDDDPVYCR-----GYYN  231

Query  1348  PQLQWHNYLQCDCPGGDDRNVYLSGGC-------EWKH-----------KDYV-ISSNKL  1226
                      +C+C GG +   YL  GC       E KH           + Y     NKL
Sbjct  232   RSFG----SECECDGGYEGIPYL--GCIDVDECKESKHSCRGLLKCVNTRGYFNCEINKL  285

Query  1225  RPAIIGISASFGFVFLIWAFVILYkaikkrkmkklrqkffkRNGGlllqqqlLTKEGTIE  1046
               A+I I A    + L+     LYK +KK K  +L++KFFKRNGGLLLQQ+L   EG ++
Sbjct  286   YIALIVIGAVVLALSLLMGIWWLYKLVKKWKKIELKKKFFKRNGGLLLQQELRAAEGWVQ  345

Query  1045  KTKIFTASELDKATDHFNADRIVGRGGQGTVYKGMLIDGQIVAVKKSQAVDEDQLEPFIN  866
             KTKI+++ EL+ ATD FN +RI+G+GGQGTVYKGML DG+IVAVKKS  VDE +LE FIN
Sbjct  346   KTKIYSSKELEVATDRFNVNRILGQGGQGTVYKGMLADGRIVAVKKSMVVDEGKLEEFIN  405

Query  865   EVVILSQINHRNVVKLMGCCLETEVPILVYEFIPNGTLFGLIHNNFDNELIPLSWDIRLR  686
             EVV+LSQINHRNVVKL+GCCLETEVP+LVYEFIPNG L+  IH+   NE   LSW++RLR
Sbjct  406   EVVVLSQINHRNVVKLLGCCLETEVPLLVYEFIPNGNLYKYIHD--PNEDFLLSWEMRLR  463

Query  685   IASEVACALAYLHSVTLVPIYHRDIKTGNILLDEKFRAKVSDFGTSRSISIDKTHFTTMV  506
             IA EVA AL+YLHS T +PIYHRDIK+ NILLDEK+RAKVSDFG+SRSISID+TH TT+V
Sbjct  464   IAIEVAGALSYLHSATSIPIYHRDIKSTNILLDEKYRAKVSDFGSSRSISIDQTHLTTLV  523

Query  505   KGTFGYLDPEYFQSSQFTEKSDVYSFGVVLAELLTGQKPISFELDDDEDRSLVSRFLLCM  326
             +GTFGYLDPEYFQSSQFTEKSDVYSFGVVL EL++GQKPI F +   E RSL + F++ M
Sbjct  524   QGTFGYLDPEYFQSSQFTEKSDVYSFGVVLVELISGQKPI-FSVSQTETRSLATHFIMLM  582

Query  325   EENRLMEMLDGEVIEQGKKEDVVAMAWLAQRCLNFNGKKRPTMKEVATELDAI  167
             E+NRL ++LD  V E  + E+V+++A LA+RCLN NGK RPTM+EV +EL+ I
Sbjct  583   EDNRLSDVLDARVKEGCQNEEVISVANLAKRCLNLNGKNRPTMREVTSELERI  635



>ref|XP_006492008.1| PREDICTED: putative wall-associated receptor kinase-like 11-like 
[Citrus sinensis]
Length=441

 Score =   441 bits (1133),  Expect = 1e-140, Method: Compositional matrix adjust.
 Identities = 241/390 (62%), Positives = 299/390 (77%), Gaps = 8/390 (2%)
 Frame = -1

Query  1315  DCPGGDDRNVYLS---GGCEWKHKDYVI--SSNKLRPAIIGISASFGFVFLIWAFVILYk  1151
             +C  G  +  +L    GGC   ++   I   ++ ++  IIG ++  G +FL+     LYK
Sbjct  14    NCSSGFPKGYFLDNYLGGCTSSYEPNPILHKNSHVKFIIIGCNSGLGMLFLLIGTWWLYK  73

Query  1150  aikkrkmkklrqkffkRNGGlllqqqlLTKEGTIEKTKIFTASELDKATDHFNADRIVGR  971
              IK+R+  KL+QKFFKRNGGLLLQQQ  + EG  EKTK+FT+ EL+ ATD+FN +RI+G+
Sbjct  74    FIKRRREIKLKQKFFKRNGGLLLQQQSSSNEGNTEKTKLFTSMELEMATDNFNTNRILGQ  133

Query  970   GGQGTVYKGMLIDGQIVAVKKSQAVDEDQLEPFINEVVILSQINHRNVVKLMGCCLETEV  791
             GGQGTVYKGML DG+I AVKKS+ VDE  +E FINEVVIL+QINHRNVVKL GCCLETEV
Sbjct  134   GGQGTVYKGMLTDGRIAAVKKSKLVDESNIEQFINEVVILTQINHRNVVKLFGCCLETEV  193

Query  790   PILVYEFIPNGTLFGLIHNNFDNELIPLSWDIRLRIASEVACALAYLHSVTLVPIYHRDI  611
             P+LVYEFIPNGTL+  IH     E   ++W++RLRIA EV+ AL+YLHS T +PIYHRDI
Sbjct  194   PLLVYEFIPNGTLYQYIHEK--TEEFSITWEMRLRIAVEVSSALSYLHSTTSIPIYHRDI  251

Query  610   KTGNILLDEKFRAKVSDFGTSRSISIDKTHFTTMVKGTFGYLDPEYFQSSQFTEKSDVYS  431
             K+ NILLD+KFRAKVSDFG SR ++ID+TH TT V GTFGYLDPEYF+SSQFTEKSDVYS
Sbjct  252   KSANILLDDKFRAKVSDFGASRCVTIDQTHLTTRVLGTFGYLDPEYFRSSQFTEKSDVYS  311

Query  430   FGVVLAELLTGQKPISFELDDDEDRSLVSRFLLCMEENRLMEMLDGEVIEQGKKEDVVAM  251
             FGVVL ELLTGQKPI    D +ED+SL   FLL M+ENRL ++LD +V+ + K+E+++ +
Sbjct  312   FGVVLVELLTGQKPIR-STDAEEDKSLAGYFLLAMKENRLFDVLDTQVLREAKEEEIITV  370

Query  250   AWLAQRCLNFNGKKRPTMKEVATELDAIKA  161
               LA+RCLN NG KRPTMKEVA EL  I+A
Sbjct  371   GMLAKRCLNLNGTKRPTMKEVAFELGGIRA  400



>ref|XP_006388660.1| hypothetical protein POPTR_0126s00200g [Populus trichocarpa]
 gb|ERP47574.1| hypothetical protein POPTR_0126s00200g [Populus trichocarpa]
Length=667

 Score =   448 bits (1153),  Expect = 2e-140, Method: Compositional matrix adjust.
 Identities = 268/560 (48%), Positives = 356/560 (64%), Gaps = 50/560 (9%)
 Frame = -1

Query  1771  LSETPFMYSNDNNFMLFGCGNAFITMPGEELDQPGYNLNCSSKNTTAPKTAHDCQGINCN  1592
             L  +PF++S++N F+  GC N  + +  +     G  ++   KN+ +   +  C GI+C 
Sbjct  87    LEGSPFVFSSENYFIARGCDN--LALMTQNQSTVGGCVSICDKNSDSMMAS--CSGIDCC  142

Query  1591  HLTVDYDVNTYQVNFTH------SSSFNACNYAFFlsassslpptlqslpsrqQEMVV--  1436
                +   +  + V          SS    C YA+ +  S         L        +  
Sbjct  143   QTRIPSFLKVFNVTMNGLGDGKGSSGEKQCRYAYLIDQSWIESWRYYYLGGNFDPYDMRH  202

Query  1435  ---VPVELRWTITQEDVPP----------SYSKYCSP-STYINPQLQWHNYLQCDCPGGD  1298
                VPV L W I +    P           YS +C   ++ IN   Q  + +QC C  G 
Sbjct  203   RDSVPVVLDWGIDERVFEPLFKNGSFYNSGYSYWCKKVNSSINSTDQ-SSTVQCSCYPGF  261

Query  1297  DRNVYLSGGCEWKHKDYVISSNKLRPAIIGISASFGFVFLIWAFVILYkaikkrkmkklr  1118
               N YL G C+                  G+ A F  + L W + +     +KR  K  +
Sbjct  262   VGNPYLYGYCQ------------------GVGALFLLIGLWWLYKVF---KRKRSEKLKK  300

Query  1117  qkffkRNGGlllqqqlLTKEGTIEKTKIFTASELDKATDHFNADRIVGRGGQGTVYKGML  938
             + FFKRNGGLLLQ+QL + E  +EK K+F + ELDKATDH+N +R +G+GGQGTVYKGML
Sbjct  301   KNFFKRNGGLLLQEQLSSGEVNVEKIKMFPSKELDKATDHYNVNRTLGQGGQGTVYKGML  360

Query  937   IDGQIVAVKKSQAVDEDQLEPFINEVVILSQINHRNVVKLMGCCLETEVPILVYEFIPNG  758
              DG+IVAVKKS+ +DE  L  FINEVV+LSQINHRNVVKL+GCCLETE+P+L+YEFIPNG
Sbjct  361   ADGKIVAVKKSKEIDEGNLRQFINEVVLLSQINHRNVVKLLGCCLETELPLLIYEFIPNG  420

Query  757   TLFGLIHNNFDNELIPLSWDIRLRIASEVACALAYLHSVTLVPIYHRDIKTGNILLDEKF  578
             TLF  +H+   NE  PL+W++RLRIA+EVA AL YLHS   +PI+HRDIK+ NILLD+++
Sbjct  421   TLFQFLHD--PNEEFPLTWEMRLRIAAEVAEALFYLHSAASLPIFHRDIKSTNILLDKEY  478

Query  577   RAKVSDFGTSRSISIDKTHFTTMVKGTFGYLDPEYFQSSQFTEKSDVYSFGVVLAELLTG  398
             RAKV+DFGTSRS+SID+TH TT+V+GTFGYLDPEYFQSSQFT+KSDVYSFGVVL ELLTG
Sbjct  479   RAKVADFGTSRSVSIDQTHVTTLVQGTFGYLDPEYFQSSQFTDKSDVYSFGVVLVELLTG  538

Query  397   QKPISFELDDDEDRSLVSRFLLCMEENRLMEMLDGEVIEQGKKEDVVAMAWLAQRCLNFN  218
             QKPISF   +++ RSL + F++ +E N L ++LD +V++QGK+EDV+ +A LA+ CL  N
Sbjct  539   QKPISFTRSEEQGRSLATYFIMVLESNCLFDILDPQVVKQGKREDVLMVASLARSCLRLN  598

Query  217   GKKRPTMKEVATELDAIKAS  158
             G+KRPTMKEV   L+ IK S
Sbjct  599   GRKRPTMKEVTMALERIKKS  618



>ref|XP_010041300.1| PREDICTED: wall-associated receptor kinase-like 10 [Eucalyptus 
grandis]
Length=677

 Score =   447 bits (1151),  Expect = 5e-140, Method: Compositional matrix adjust.
 Identities = 265/536 (49%), Positives = 358/536 (67%), Gaps = 30/536 (6%)
 Frame = -1

Query  1762  TPFMYSND-NNFMLFGCGNAFITMPGEELDQPGYNLNCSSKNTTAPKTAHD-CQGIN-CN  1592
             + F++S   N F   GC N   T+   E    G    C+   T+A  + ++ C G + C 
Sbjct  118   SQFIFSQRWNVFTSVGC-NTLATVNSTESVVVGCRSKCAG--TSANISQYNACSGRDGCC  174

Query  1591  HLTVDYDVNTYQVNFTHSSSFNACNYAFFlsassslpptlqslpsrqQEMVVVPVELRWT  1412
               T+  ++  + V+F        C YAF    S       + L               + 
Sbjct  175   QTTLPDNLRGFSVDFKEEGGPQGCKYAFLADRSWLFRSNGRGL---------------YD  219

Query  1411  ITQEDVPPSYSKYCSPSTYINPQLQWHNYLQCDCPGGDDRNVYLSGGCEWKHKDYVISSN  1232
             ++  D  P    +C+     NP L        +C   +DR++   G C  K   Y   + 
Sbjct  220   LSLNDTVPVC--FCNDGYRGNPYLTEGCQDINEC---EDRDL-CPGTCVNKRGSYDCVTG  273

Query  1231  KLRPAIIGISASFGFVFLIWAFVILYkaikkrkmkklrqkffkRNGGlllqqqlLTKEGT  1052
             +    +IG+ A+ G + L      LYK +KKR+  KL++K FKRNGGLLL+ +L + EG 
Sbjct  274   RKTAILIGVGAALGALVLCLVLWRLYKYVKKRREIKLKEKHFKRNGGLLLKSELSSPEGN  333

Query  1051  IEKTKIFTASELDKATDHFNADRIVGRGGQGTVYKGMLIDGQIVAVKKSQAVDEDQLEPF  872
             +EK+K+F + +L+KATD+FN DRI+G+GGQGTVYKGML DG+IVA+KKS+ +DE ++E F
Sbjct  334   VEKSKLFNSKDLEKATDNFNDDRILGQGGQGTVYKGMLTDGKIVAIKKSKVIDEGKVEQF  393

Query  871   INEVVILSQINHRNVVKLMGCCLETEVPILVYEFIPNGTLFGLIHNNFDNELIPLSWDIR  692
             INEV+ILSQINHRNVVKL+GCCLETEVP+LVYEFIPNGTL+  +H+   N+   +SWD R
Sbjct  394   INEVLILSQINHRNVVKLLGCCLETEVPLLVYEFIPNGTLYQYLHD--PNQEFHVSWDTR  451

Query  691   LRIASEVACALAYLHSVTLVPIYHRDIKTGNILLDEKFRAKVSDFGTSRSISIDKTHFTT  512
             LRIA E+A AL YLHS   +PIYHRDIK+ NILLDEK+RAKV+DFGTS+S+S+D+TH TT
Sbjct  452   LRIAIEIAGALFYLHSAASIPIYHRDIKSTNILLDEKYRAKVADFGTSKSVSLDQTHVTT  511

Query  511   MVKGTFGYLDPEYFQSSQFTEKSDVYSFGVVLAELLTGQKPISFELDDDEDRSLVSRFLL  332
             +V+GTFGYLDPEYFQSSQFT+KSDVYSFGVVLAELLTGQKPIS  L + E RSL + F++
Sbjct  512   LVQGTFGYLDPEYFQSSQFTDKSDVYSFGVVLAELLTGQKPIS-SLREQEGRSLATYFII  570

Query  331   CMEENRLMEMLDGEVIEQGKKEDVVAMAWLAQRCLNFNGKKRPTMKEVATELDAIK  164
              MEENRL +++D +++++GK E++ ++A LA+RCLN NG+KRPTMKEVA EL+ I+
Sbjct  571   SMEENRLFDIVDAQILKEGKMEEIASVANLAKRCLNLNGRKRPTMKEVAMELEGIR  626



>ref|XP_006387117.1| hypothetical protein POPTR_1809s00200g [Populus trichocarpa]
 gb|ERP46031.1| hypothetical protein POPTR_1809s00200g [Populus trichocarpa]
Length=739

 Score =   449 bits (1156),  Expect = 6e-140, Method: Compositional matrix adjust.
 Identities = 291/610 (48%), Positives = 387/610 (63%), Gaps = 48/610 (8%)
 Frame = -1

Query  1828  ISPSCQGSNNFSNIIHNSKLSETPFMYSNDNNFMLFGCGNAFITMPGEELDQPGYNLNCS  1649
             IS  C G    +N+  N  ++ +PF++S+ N F+  GC N  + +   E +  G    C 
Sbjct  98    ISSGCSGRG--ANLAFN--MTGSPFVFSSLNIFIAMGCNNRAL-LNRIEPEIVGCTSTCG  152

Query  1648  SKNTTAPKTAHD----CQGINCNHLTVDYDVNTYQVNF-----THSSSFNACNYAFFlsa  1496
             + N T+  T  +    C G NC    +  ++  +  +       +    N C  AF +  
Sbjct  153   ANNLTSSSTTGEEKRYCSGNNCCQTRIPSNLQVFSASLGTTEDPNDQGRNQCKVAFIVDR  212

Query  1495  ssslpptlqslpsrqQEMVVVPVELRWTITQED--VPPSYSKYCSPSTYI-------NPQ  1343
               SL         +  +M  VPV L W +  +D  V  S +K CSP   +       +  
Sbjct  213   GWSLDNIKSPEAVQ--DMQHVPVFLDWFMYSDDIGVENSDAKNCSPPVQLVSGRWGLSTL  270

Query  1342  LQWHNYLQCDCPGGDDRNVYLSGGC----EWKHKD----------------YVISSNKLR  1223
               + N   C C  G D N YL  GC    E K+ +                Y    +K +
Sbjct  271   TLYSNSTTCSCNLGYDGNPYLPDGCTDIDECKNPNGNWCSGMTKCVNVPGGYKCELDKAK  330

Query  1222  PAIIGISASFGFVFLIWAFVILYkaikkrkmkklrqkffkRNGGlllqqqlLTKEGTIEK  1043
                + + A+ G + L+     LYK +KKRK  +L++KFFK+NGGLLLQQQL + +G+I+K
Sbjct  331   ITFLILGAATGLLLLLVGIWRLYKLVKKRKNIELKKKFFKQNGGLLLQQQLSSSDGSIQK  390

Query  1042  TKIFTASELDKATDHFNADRIVGRGGQGTVYKGMLIDGQIVAVKKSQAVDEDQLEPFINE  863
             TKIFT+ EL+KATD FN +RI+G+GGQGTVYKGML DG IVAVKKS+ +DE++ E FINE
Sbjct  391   TKIFTSKELEKATDRFNDNRILGQGGQGTVYKGMLADGMIVAVKKSKMMDEEKSEEFINE  450

Query  862   VVILSQINHRNVVKLMGCCLETEVPILVYEFIPNGTLFGLIHNNFDNELIPLSWDIRLRI  683
             VVILSQ+NHRNVVKL+GCCLETEVP+LVYEFIPNG LF  IH+    E    SW++RLRI
Sbjct  451   VVILSQLNHRNVVKLLGCCLETEVPLLVYEFIPNGNLFEYIHDQ--KEEFQFSWEMRLRI  508

Query  682   ASEVACALAYLHSVTLVPIYHRDIKTGNILLDEKFRAKVSDFGTSRSISIDKTHFTTMVK  503
             A+EVA AL+YLHS   +P+YHRDIK+ NILLDEKFRAKVSDFGTSRSI+ID+TH TT V+
Sbjct  509   ATEVARALSYLHSAATIPVYHRDIKSTNILLDEKFRAKVSDFGTSRSIAIDQTHLTTHVQ  568

Query  502   GTFGYLDPEYFQSSQFTEKSDVYSFGVVLAELLTGQKPISFELDDDEDRSLVSRFLLCME  323
             GTFGY DPEYFQSSQFT KSDVYSFGVVLAELL+GQKPIS+E   +E  SL + F+L +E
Sbjct  569   GTFGYFDPEYFQSSQFTGKSDVYSFGVVLAELLSGQKPISYE-RSEERGSLATHFILLVE  627

Query  322   ENRLMEMLDGEVIEQGKKEDVVAMAWLAQRCLNFNGKKRPTMKEVATELDAIKASNSHLP  143
             EN++ ++LD  ++ Q ++E+V+A+A LA+RCLN  G+KRPTM+EVA EL+ I+ S   L 
Sbjct  628   ENKIFDILDERLMGQDREEEVIAVANLARRCLNLIGRKRPTMREVAIELEQIRLSKGALH  687

Query  142   LAMEAFEIES  113
                 + E+E+
Sbjct  688   PQQCSKELEN  697



>gb|KDO58193.1| hypothetical protein CISIN_1g0431572mg, partial [Citrus sinensis]
Length=433

 Score =   438 bits (1127),  Expect = 7e-140, Method: Compositional matrix adjust.
 Identities = 235/366 (64%), Positives = 297/366 (81%), Gaps = 5/366 (1%)
 Frame = -1

Query  1249  YVISSNKLRPAIIG-ISASFGFVFLIWAFVILYkaikkrkmkklrqkffkRNGGlllqqq  1073
             Y IS  +L  + +G  S   G   LI A+  L+K +K+R+  KL++KFFKRNGGLLLQQ+
Sbjct  64    YAISILRLSSSGVGCTSGGLGMFLLIGAW-WLFKFVKRRREIKLKRKFFKRNGGLLLQQE  122

Query  1072  lLTKEGTIEKTKIFTASELDKATDHFNADRIVGRGGQGTVYKGMLIDGQIVAVKKSQAVD  893
             L + EGTIEKTK+FT+ EL++ATD+FN +RI+G+GGQGTVYKGML DG+IVAVKKS+ +D
Sbjct  123   LASTEGTIEKTKLFTSKELERATDNFNLNRILGQGGQGTVYKGMLPDGKIVAVKKSKVID  182

Query  892   EDQLEPFINEVVILSQINHRNVVKLMGCCLETEVPILVYEFIPNGTLFGLIHNNFDNELI  713
             E ++E FINE+VILSQINHRNVVKL+GCCLETEVP+LVYEFIPNGTLF  IH+   NE  
Sbjct  183   ESKVEEFINEMVILSQINHRNVVKLLGCCLETEVPLLVYEFIPNGTLFQYIHDQ--NEDF  240

Query  712   PLSWDIRLRIASEVACALAYLHSVTLVPIYHRDIKTGNILLDEKFRAKVSDFGTSRSISI  533
             P++W++RLRIA EV+ AL+YLHS   +PIYHRDIK+ NILLD+K+RAKVSDFG SRS+++
Sbjct  241   PITWEMRLRIAIEVSGALSYLHSAASIPIYHRDIKSTNILLDDKYRAKVSDFGASRSMAV  300

Query  532   DKTHFTTMVKGTFGYLDPEYFQSSQFTEKSDVYSFGVVLAELLTGQKPISFELDDDEDRS  353
             D+TH TT V GTFGYLDPEYF+SSQFT+KSDVYSFGVVLAELLTG+KPI F    +ED+S
Sbjct  301   DQTHMTTQVHGTFGYLDPEYFRSSQFTDKSDVYSFGVVLAELLTGEKPIRFT-TLEEDKS  359

Query  352   LVSRFLLCMEENRLMEMLDGEVIEQGKKEDVVAMAWLAQRCLNFNGKKRPTMKEVATELD  173
             L + FL  M+E RL E+LD  V+++   ++++  A +A+RCLN NGKKRPTM+EV +EL 
Sbjct  360   LAAYFLFAMKEERLFEILDARVMKESGGDEIITFAKVAKRCLNLNGKKRPTMREVTSELA  419

Query  172   AIKASN  155
              IKA N
Sbjct  420   GIKAWN  425



>ref|XP_006441113.1| hypothetical protein CICLE_v10020606mg [Citrus clementina]
 gb|ESR54353.1| hypothetical protein CICLE_v10020606mg [Citrus clementina]
Length=380

 Score =   436 bits (1121),  Expect = 9e-140, Method: Compositional matrix adjust.
 Identities = 215/313 (69%), Positives = 260/313 (83%), Gaps = 4/313 (1%)
 Frame = -1

Query  1099  NGGlllqqqlLTKEGTIEKTKIFTASELDKATDHFNADRIVGRGGQGTVYKGMLIDGQIV  920
             NGGLLLQQQ  + EG  EK K+FT+ EL+ ATD+FN +RI+G+GGQGTVYKGML DG+I 
Sbjct  31    NGGLLLQQQSSSNEGNTEKKKLFTSMELEMATDNFNTNRILGQGGQGTVYKGMLTDGRIA  90

Query  919   AVKKSQAVDEDQLEPFINEVVILSQINHRNVVKLMGCCLETEVPILVYEFIPNGTLFGLI  740
             AVKKS+ VDE  +E FINEVVIL+QINHRNVVKL+GCCLETEVP+LVYEFIPNGTL+  I
Sbjct  91    AVKKSKLVDESNIEQFINEVVILTQINHRNVVKLLGCCLETEVPLLVYEFIPNGTLYQYI  150

Query  739   HNNFDNELIPLSWDIRLRIASEVACALAYLHSVTLVPIYHRDIKTGNILLDEKFRAKVSD  560
             H   + E   ++W++RL IA EV+ AL+YLHS T +PIYHRDIK+ NILLD+KFRAKVSD
Sbjct  151   H---EIEEFSITWEMRLLIAIEVSSALSYLHSTTSIPIYHRDIKSANILLDDKFRAKVSD  207

Query  559   FGTSRSISIDKTHFTTMVKGTFGYLDPEYFQSSQFTEKSDVYSFGVVLAELLTGQKPISF  380
             FGTSRS++ID+TH TT V GTFGYLDPEYF+SSQFTEKSDVYSFGVVL ELLTGQKPI  
Sbjct  208   FGTSRSVTIDQTHLTTRVLGTFGYLDPEYFRSSQFTEKSDVYSFGVVLVELLTGQKPIR-  266

Query  379   ELDDDEDRSLVSRFLLCMEENRLMEMLDGEVIEQGKKEDVVAMAWLAQRCLNFNGKKRPT  200
               D +ED+SL   FLL M+ENRL ++LD +V+ + K+E+++ +  LA+RCLN NG+KRPT
Sbjct  267   STDAEEDKSLAGYFLLAMKENRLFDVLDAQVLREAKEEEIITVGMLAKRCLNLNGRKRPT  326

Query  199   MKEVATELDAIKA  161
             MKEVA EL AI+A
Sbjct  327   MKEVAFELGAIRA  339



>ref|XP_004486489.1| PREDICTED: wall-associated receptor kinase-like 8-like [Cicer 
arietinum]
Length=725

 Score =   448 bits (1153),  Expect = 1e-139, Method: Compositional matrix adjust.
 Identities = 271/571 (47%), Positives = 363/571 (64%), Gaps = 29/571 (5%)
 Frame = -1

Query  1771  LSETPFMYSND-NNFMLFGCGN-AFITMPGEELDQPGYNLNCSSKNTTAPKTAHDCQGIN  1598
             L ++PF+YS   N F+  GC N AF+   G  +   G    C   N      +  C G  
Sbjct  125   LKDSPFIYSQQYNTFLAVGCNNLAFLQSNGTTVG--GCVSICEDNNNNFNLESRSCNGRY  182

Query  1597  CNHLTVDYDVNTYQVNF----THSSSFNACNYA------FFlsassslpptlqslpsrqQ  1448
             C   ++   +  Y          SS  + C+YA      +F    S +  +     +  +
Sbjct  183   CCETSLPMHLAEYNATLQGLRKESSDHDECSYALIASDFWFSFDWSFMTDSEIEKMNNLK  242

Query  1447  EMVVVPVELRWTITQE-------DVPPSYSKYCSPSTYINPQLQWHNYLQCDCPGGDDRN  1289
              M   P  L W I  E        +P     Y S  T +  +       +CDCP G + N
Sbjct  243   NMEYAPGILEWEILNEMFVNSTFQIPSDSVCYDSKRTSLTNRTTGR---RCDCPSGYNGN  299

Query  1288  VYLSGGCEWKHKDYVISSNKLRPAIIGISASFGFVFLIWAFVILYkaikkrkmkklrqkf  1109
              Y+ GGC      +  ++   +  I+G+S+S G +  +    +L+K +KKR +KK ++KF
Sbjct  300   PYVLGGCTVIQGFFNKNNRSKKWVIVGVSSSLGSIGFLIGLWLLHKDVKKRMIKKRKEKF  359

Query  1108  fkRNGGlllqqqlLTKEGTIEKTKIFTASELDKATDHFNADRIVGRGGQGTVYKGMLIDG  929
             FKRNGGLLLQ+++ + E  I++T +FT  +L KATD+FN +R++G+GGQGTVYKGML+DG
Sbjct  360   FKRNGGLLLQKRMSSGEVNIDQTVLFTLKDLKKATDNFNKNRVLGKGGQGTVYKGMLVDG  419

Query  928   QIVAVKKSQAVDEDQLEPFINEVVILSQINHRNVVKLMGCCLETEVPILVYEFIPNGTLF  749
             +IVAVKK +   E ++E FINE VILSQIN+RNVVKL+GCCLETE+P+LVYEFIPNG LF
Sbjct  420   RIVAVKKFKV--EGKVEEFINEFVILSQINNRNVVKLLGCCLETEIPLLVYEFIPNGNLF  477

Query  748   GLIHNNFDNELIPLSWDIRLRIASEVACALAYLHSVTLVPIYHRDIKTGNILLDEKFRAK  569
               +H+   NE IP++WD+RLRIA+E+A AL YLHS+   PIYHRD+K+ NILLDEK+RAK
Sbjct  478   EYLHDR--NEDIPMTWDMRLRIATEIAGALFYLHSIASQPIYHRDVKSTNILLDEKYRAK  535

Query  568   VSDFGTSRSISIDKTHFTTMVKGTFGYLDPEYFQSSQFTEKSDVYSFGVVLAELLTGQKP  389
             ++DFG SR ISI+ TH TT+V+GTFGYLDPEYF +SQFTEKSDVYSFGVVLAELLTG+KP
Sbjct  536   LADFGASRIISIEATHLTTVVQGTFGYLDPEYFHTSQFTEKSDVYSFGVVLAELLTGKKP  595

Query  388   ISFELDDDEDRSLVSRFLLCMEENRLMEMLDGEVIEQGKKEDVVAMAWLAQRCLNFNGKK  209
             I+  ++  E +SL S F+ CMEENRL +++D  V ++G+KE +VA A LA RCL  NG+K
Sbjct  596   IT-SVESGESQSLASYFVQCMEENRLFDIVDERVTKEGEKEHIVAGANLAYRCLEMNGRK  654

Query  208   RPTMKEVATELDAIKASNSHLPLAMEAFEIE  116
             RPTMKEV  EL+ I   N  L       EIE
Sbjct  655   RPTMKEVTLELEGIMRLNKKLNAQQNHEEIE  685



>ref|XP_006465432.1| PREDICTED: wall-associated receptor kinase-like 10-like [Citrus 
sinensis]
Length=741

 Score =   449 bits (1154),  Expect = 1e-139, Method: Compositional matrix adjust.
 Identities = 238/377 (63%), Positives = 305/377 (81%), Gaps = 5/377 (1%)
 Frame = -1

Query  1249  YVISSNKLRPAIIG-ISASFGFVFLIWAFVILYkaikkrkmkklrqkffkRNGGlllqqq  1073
             ++    +++  +IG IS   G   LI A+ +L K +K+R+  KL+QKFFKRNGGLLL+Q+
Sbjct  326   FLRKKTRVKYVVIGCISGGLGMFLLIGAWWLL-KFVKRRREIKLKQKFFKRNGGLLLKQE  384

Query  1072  lLTKEGTIEKTKIFTASELDKATDHFNADRIVGRGGQGTVYKGMLIDGQIVAVKKSQAVD  893
             L + EGT+EKTK+FT+ EL+KATD+FN +RI+G+GGQGTVYKGML DG+IVAVKKS+ +D
Sbjct  385   LASTEGTVEKTKLFTSKELEKATDYFNLNRILGQGGQGTVYKGMLADGKIVAVKKSKVID  444

Query  892   EDQLEPFINEVVILSQINHRNVVKLMGCCLETEVPILVYEFIPNGTLFGLIHNNFDNELI  713
             E ++E FINEVVILSQINHRNVVKL+GCCLETEVP+LVYEFIPNGTLF  IH+   NE  
Sbjct  445   ESKVEEFINEVVILSQINHRNVVKLLGCCLETEVPLLVYEFIPNGTLFQYIHDQ--NEDF  502

Query  712   PLSWDIRLRIASEVACALAYLHSVTLVPIYHRDIKTGNILLDEKFRAKVSDFGTSRSISI  533
             P++W++RLRIA E++ AL+YLHS   +PIYHRDIK+ NILLD+K+RAKVSDFG SRS+++
Sbjct  503   PITWEMRLRIAIEISGALSYLHSAASIPIYHRDIKSTNILLDDKYRAKVSDFGASRSMAV  562

Query  532   DKTHFTTMVKGTFGYLDPEYFQSSQFTEKSDVYSFGVVLAELLTGQKPISFELDDDEDRS  353
             D+TH TT V GTFGYLDPEYF+SSQFT+KSDVYSFGVVLAELLTG+KPI F    +ED+S
Sbjct  563   DQTHMTTQVHGTFGYLDPEYFRSSQFTDKSDVYSFGVVLAELLTGEKPIRFTT-LEEDKS  621

Query  352   LVSRFLLCMEENRLMEMLDGEVIEQGKKEDVVAMAWLAQRCLNFNGKKRPTMKEVATELD  173
             L + FL  M+E RL E+LD +V+++G K++++ +A L +RCLN NGKKRPTM+EVA+EL 
Sbjct  622   LAAYFLCAMKEERLFEILDAQVMKEGGKDEIITVAKLTKRCLNLNGKKRPTMREVASELA  681

Query  172   AIKASNSHLPLAMEAFE  122
              IKA N    +  E  E
Sbjct  682   GIKAGNGASNVMEEGLE  698



>ref|XP_002274962.1| PREDICTED: wall-associated receptor kinase-like 2 [Vitis vinifera]
Length=717

 Score =   447 bits (1151),  Expect = 1e-139, Method: Compositional matrix adjust.
 Identities = 279/607 (46%), Positives = 374/607 (62%), Gaps = 52/607 (9%)
 Frame = -1

Query  1882  VDFLGMSYDSQTITIKESISPSCQGSNNFSNIIHNSKLSETPFMYSNDNN-FMLFGCGNA  1706
             ++   +S + +T+ +   I   C  +  + +    +    +PF +S+ +N FM+ GC   
Sbjct  78    LELFNVSLEYKTVMVNSPIPSLCADNGTWKS----NDFGGSPFRFSSVHNIFMVVGCDTN  133

Query  1705  FITMPGEELDQPGYNLNCSSKNTTAPKTAHDCQGINCNHLTVDYDVNTYQV---NFTHSS  1535
              +   G+E+   G   NC ++     +T   C GI C   T+ Y+  +  +   N ++  
Sbjct  134   AVLATGDEI-LAGCTSNCDNR---IARTRRRCYGIKCCQTTISYNSQSTHLGMYNVSYVK  189

Query  1534  SFNACNYAFFlsassslpptlqslpsrqQEMVVVPVELRWTITQEDVPPSYSKYCSPSTY  1355
             +   C YAF                +        P+ + W +    +   Y +       
Sbjct  190   TGEGCAYAFMGGRDWYANNNSDPANTTNSGYA--PLVMFWEMETTSLGSCYLQ-------  240

Query  1354  INPQLQWHNYLQ---CDCPGGDDRNVYLSGGCEWKH---------------KDYVISSNK  1229
                 L W +      C C    + N YL  GC+                  + +  +SN+
Sbjct  241   ---DLDWQSGKTIEICSCEHRYEGNPYLPNGCQVVEACANCSLLDCGMIGTEYHCFASNR  297

Query  1228  ----LRPAIIGISASFGFVFLIWAFVILYkaikkrkmkklrqkffkRNGGlllqqqlLTK  1061
                 L+  I+G+S   G   L+     LYK +KKR+    +QKFFKRNGGLLLQQQL + 
Sbjct  298   MAKQLKAMILGLSIGGGSFLLLVGSFGLYKGVKKRREFIRKQKFFKRNGGLLLQQQLSSS  357

Query  1060  EGTIEKTKIFTASELDKATDHFNADRIVGRGGQGTVYKGMLIDGQIVAVKKSQAVDEDQL  881
             E  +EKTKIFT+ EL+KATD+FN  RI+G GGQGTVYKGML DG+IVAVK+S  VDE QL
Sbjct  358   E-IVEKTKIFTSKELEKATDNFNKSRILGHGGQGTVYKGMLNDGRIVAVKRSNLVDESQL  416

Query  880   EPFINEVVILSQINHRNVVKLMGCCLETEVPILVYEFIPNGTLFGLIHNNFDNELIPLSW  701
             EPFINE++ILSQINHRN+V L GCCLETEVP+LVYEFI NG+L  LIH+   N   P SW
Sbjct  417   EPFINEIMILSQINHRNIVGLFGCCLETEVPLLVYEFISNGSLLQLIHDQ--NNEFPFSW  474

Query  700   DIRLRIASEVACALAYLHSVTLVPIYHRDIKTGNILLDEKFRAKVSDFGTSRSISIDKTH  521
              +RL+IA + A ALAYLHS + VPIYHRDIK+ NIL+DEK+RA VSDFGTSRSISID+TH
Sbjct  475   SMRLQIAVDAAGALAYLHSSSSVPIYHRDIKSSNILIDEKYRAIVSDFGTSRSISIDQTH  534

Query  520   FTTMVKGTFGYLDPEYFQSSQFTEKSDVYSFGVVLAELLTGQKPISFELDDDEDRSLVSR  341
              TT V+GTFGYLDPEYFQSSQFT+KSDVYSFGVVL ELLTG+KP+++    +E++SLV  
Sbjct  535   LTTHVQGTFGYLDPEYFQSSQFTDKSDVYSFGVVLVELLTGKKPVAWS-SSEEEKSLVVH  593

Query  340   FLLCMEENRLMEMLDGEVIEQGKKEDVVAMAWLAQRCLNFNGKKRPTMKEVATELDAIKA  161
             F+L +EEN L ++LD  V ++G+KE ++AMA LA+RCLN +GKKRPTMKEV  EL+ I+ 
Sbjct  594   FILSLEENHLYDILDDRVRKEGEKEKIMAMANLAKRCLNLSGKKRPTMKEVTFELERIRM  653

Query  160   SNSHLPL  140
             S+  LP+
Sbjct  654   SS--LPI  658



>gb|KDO65456.1| hypothetical protein CISIN_1g0053552mg, partial [Citrus sinensis]
Length=379

 Score =   435 bits (1119),  Expect = 2e-139, Method: Compositional matrix adjust.
 Identities = 215/314 (68%), Positives = 259/314 (82%), Gaps = 3/314 (1%)
 Frame = -1

Query  1099  NGGlllqqqlLTKEGTIEKTKIFTASELDKATDHFNADRIVGRGGQGTVYKGMLIDGQIV  920
             NGGLLLQQ+  + EG  EKTK+FT+ EL+ ATD+FN +RI+G+GGQGTVYKGML +G+IV
Sbjct  37    NGGLLLQQESSSNEGNSEKTKLFTSMELEMATDNFNTNRILGQGGQGTVYKGMLTNGRIV  96

Query  919   AVKKSQAVDEDQLEPFINEVVILSQINHRNVVKLMGCCLETEVPILVYEFIPNGTLFGLI  740
             A+KKS+ VDE  +E FINEV ILSQINHRNVVKL+GCCLETEVP+LVYEFIPNGTL+  I
Sbjct  97    AIKKSKLVDESNIEQFINEVAILSQINHRNVVKLLGCCLETEVPLLVYEFIPNGTLYQYI  156

Query  739   HNNFDNELIPLSWDIRLRIASEVACALAYLHSVTLVPIYHRDIKTGNILLDEKFRAKVSD  560
             H+    E  P++W+IRLRIA EV+ AL YLHS   +PIYHRDIK+ NILLD+K+RAKVSD
Sbjct  157   HDQ--TEEFPITWEIRLRIAIEVSDALCYLHSAASIPIYHRDIKSANILLDDKYRAKVSD  214

Query  559   FGTSRSISIDKTHFTTMVKGTFGYLDPEYFQSSQFTEKSDVYSFGVVLAELLTGQKPISF  380
             FG SRS+ ID+TH TT V+GTFGYLDPEYF+SSQFTEKSDVYSFGVVL ELLTGQKPI  
Sbjct  215   FGASRSVMIDQTHLTTRVQGTFGYLDPEYFRSSQFTEKSDVYSFGVVLVELLTGQKPIR-  273

Query  379   ELDDDEDRSLVSRFLLCMEENRLMEMLDGEVIEQGKKEDVVAMAWLAQRCLNFNGKKRPT  200
               D +ED+SLV  FL  M+ENRL E+LD  V+++ K+E+++ +A LA+RCLN  GKKRPT
Sbjct  274   STDSEEDKSLVGYFLEAMKENRLFEVLDARVLKEAKEEEIITVAMLAKRCLNMIGKKRPT  333

Query  199   MKEVATELDAIKAS  158
             MKE A EL  I+AS
Sbjct  334   MKEAAFELGGIRAS  347



>gb|KDO65458.1| hypothetical protein CISIN_1g014725mg [Citrus sinensis]
Length=419

 Score =   436 bits (1122),  Expect = 2e-139, Method: Compositional matrix adjust.
 Identities = 216/314 (69%), Positives = 265/314 (84%), Gaps = 3/314 (1%)
 Frame = -1

Query  1099  NGGlllqqqlLTKEGTIEKTKIFTASELDKATDHFNADRIVGRGGQGTVYKGMLIDGQIV  920
             NGGLLLQQQL + EG IEKTK+FT  +L+KATD++NA+RI+G+GGQGTVYKGML DG IV
Sbjct  59    NGGLLLQQQLSSNEGNIEKTKLFTKMDLEKATDNYNANRILGQGGQGTVYKGMLADGGIV  118

Query  919   AVKKSQAVDEDQLEPFINEVVILSQINHRNVVKLMGCCLETEVPILVYEFIPNGTLFGLI  740
             AVKKS+ VDE  +E FINEVVILSQINHRNVVKL+GCCLE+EVP+LVYEFIPNGTL+  +
Sbjct  119   AVKKSKLVDESNVEQFINEVVILSQINHRNVVKLLGCCLESEVPLLVYEFIPNGTLYHYL  178

Query  739   HNNFDNELIPLSWDIRLRIASEVACALAYLHSVTLVPIYHRDIKTGNILLDEKFRAKVSD  560
             H+    E  P++W++RLRIA EV+ A++YLHS T +PIYHRDIK+ NILLD+K+RAKVSD
Sbjct  179   HDQ--TEEFPITWEMRLRIAIEVSGAMSYLHSATSIPIYHRDIKSSNILLDDKYRAKVSD  236

Query  559   FGTSRSISIDKTHFTTMVKGTFGYLDPEYFQSSQFTEKSDVYSFGVVLAELLTGQKPISF  380
             FG SR+I +D+TH TT V+GTFGYLDPEYF+SSQFTEKSDVYSFGVVL ELLTGQKPI  
Sbjct  237   FGASRTIKVDQTHLTTRVQGTFGYLDPEYFRSSQFTEKSDVYSFGVVLVELLTGQKPIR-  295

Query  379   ELDDDEDRSLVSRFLLCMEENRLMEMLDGEVIEQGKKEDVVAMAWLAQRCLNFNGKKRPT  200
               D +EDRSLV  FL  M E+RL E+L+  V+++GK+E+++ +A L +RCLN  GKKRP+
Sbjct  296   STDAEEDRSLVGFFLQAMNEDRLFEVLEARVLKEGKEEEIITVAMLGKRCLNMIGKKRPS  355

Query  199   MKEVATELDAIKAS  158
             MKEVA EL+ I+AS
Sbjct  356   MKEVAFELEGIRAS  369



>ref|XP_010036178.1| PREDICTED: wall-associated receptor kinase-like 6 [Eucalyptus 
grandis]
Length=755

 Score =   447 bits (1151),  Expect = 4e-139, Method: Compositional matrix adjust.
 Identities = 275/567 (49%), Positives = 362/567 (64%), Gaps = 43/567 (8%)
 Frame = -1

Query  1759  PFMYSNDNN-FMLFGCGNAFITMPGEELDQPGYNLNCSSKNTTAPKTAHDCQGIN-CNHL  1586
             PF++S   N F   GC +   T+   E    G    C+  +T        C G + C   
Sbjct  147   PFVFSQTRNVFTSVGC-DTLATVGTTESAVVGCRSKCAEISTNISWHYSTCSGRDECCQS  205

Query  1585  TVDYDVNTYQVNFTHSSSFNACNYAFFlsassslpptlqslpsrqQEMVVVPVELRWTIT  1406
             T+ +D+  + V+F      + C +AF    S  L      L   +    V PV L W IT
Sbjct  206   TLPFDLQVFSVDFKEEGGHHGCKHAFLADRSWFLKSNETGLYDLRMGNTV-PVVLEWGIT  264

Query  1405  ----------QEDVPPSYS-KYCSP----STYINPQLQWHNYLQCDCPGGDDRNVYLSGG  1271
                       Q++    YS  Y  P    S++   ++    ++QC C  G   N YL  G
Sbjct  265   DNTHYSRELMQQNYSTIYSLSYNEPFNCDSSFSGIEMP---FMQCYCGSGYHGNPYLIKG  321

Query  1270  CE------------------WKHKDYVISSNKLRPAIIGISASFGFVFLIWAFVILYkai  1145
             CE                    + D V      +  ++G+ AS G + L      LY+ I
Sbjct  322   CEDINECEDPKNCNGTCLNKQGYYDCVDGRTTTKFILVGVGASLGALLLCLLLWRLYEYI  381

Query  1144  kkrkmkklrqkffkRNGGlllqqqlLTKEGTIEKTKIFTASELDKATDHFNADRIVGRGG  965
             KKRK  KL++K+F  NGGLLL+ +L + +  +EK+K+F + EL+KATD+FN DRI+G+GG
Sbjct  382   KKRKEIKLKEKYFIHNGGLLLESELSSPKYNVEKSKLFNSKELEKATDNFNNDRILGQGG  441

Query  964   QGTVYKGMLIDGQIVAVKKSQAVDEDQLEPFINEVVILSQINHRNVVKLMGCCLETEVPI  785
             QGTVYKGML DG+IVA+KKS+ +D+ Q+E FINEV+ILSQINHRNVVKL+GCCLETEVP+
Sbjct  442   QGTVYKGMLTDGKIVAIKKSKVIDKGQVEQFINEVLILSQINHRNVVKLLGCCLETEVPL  501

Query  784   LVYEFIPNGTLFGLIHNNFDNELIPLSWDIRLRIASEVACALAYLHSVTLVPIYHRDIKT  605
             LVYEFIPNGTL+  +H+   +   P+SWD RLRIA+E+A AL YLHS   +PIYHRDIK+
Sbjct  502   LVYEFIPNGTLYEYLHD--PSAEFPISWDTRLRIATEIAGALFYLHSAASIPIYHRDIKS  559

Query  604   GNILLDEKFRAKVSDFGTSRSISIDKTHFTTMVKGTFGYLDPEYFQSSQFTEKSDVYSFG  425
              NILLDEK+RAKV+DFGTS+SIS+D+TH TT+V+GTFGYLDPEYFQSSQFT+KSDVYSFG
Sbjct  560   TNILLDEKYRAKVADFGTSKSISLDQTHITTLVQGTFGYLDPEYFQSSQFTDKSDVYSFG  619

Query  424   VVLAELLTGQKPISFELDDDEDRSLVSRFLLCMEENRLMEMLDGEVIEQGKKEDVVAMAW  245
             VVL ELLTGQKPIS +  +   RSLV+ F+  MEE RL ++ D  V+++GKKE++ +MA 
Sbjct  620   VVLVELLTGQKPISSQ-REQVGRSLVTYFINSMEEIRLFDIADAHVLKEGKKEEIASMAK  678

Query  244   LAQRCLNFNGKKRPTMKEVATELDAIK  164
             LA+RCLN NG+KRPTMKE A EL+ I+
Sbjct  679   LAKRCLNLNGRKRPTMKEAAIELEGIR  705



>ref|XP_006487806.1| PREDICTED: wall-associated receptor kinase-like 22-like [Citrus 
sinensis]
Length=488

 Score =   438 bits (1127),  Expect = 5e-139, Method: Compositional matrix adjust.
 Identities = 213/314 (68%), Positives = 268/314 (85%), Gaps = 2/314 (1%)
 Frame = -1

Query  1099  NGGlllqqqlLTKEGTIEKTKIFTASELDKATDHFNADRIVGRGGQGTVYKGMLIDGQIV  920
             NGGLLL+Q+L + EG IEKTK+FT+ +L+KATD++N  RI+G+GGQGTV+KGML DG+IV
Sbjct  126   NGGLLLRQELSSNEGNIEKTKLFTSKDLEKATDNYNVSRILGQGGQGTVFKGMLTDGRIV  185

Query  919   AVKKSQAVDEDQLEPFINEVVILSQINHRNVVKLMGCCLETEVPILVYEFIPNGTLFGLI  740
             AVKKS++V E  +E FINEVVILSQINHRNVVKL+GCCLET+VP+LVYEFIPNG+L+  I
Sbjct  186   AVKKSKSVHESNVEQFINEVVILSQINHRNVVKLLGCCLETDVPLLVYEFIPNGSLYQYI  245

Query  739   HNNFDNELIPLSWDIRLRIASEVACALAYLHSVTLVPIYHRDIKTGNILLDEKFRAKVSD  560
             H   +++L P++W++RLRIA EV+ AL+YLHS   +PIYHRDIK+ NILLD+K+RAK+SD
Sbjct  246   HEQTEDQL-PITWEMRLRIAVEVSGALSYLHSAASIPIYHRDIKSANILLDDKYRAKISD  304

Query  559   FGTSRSISIDKTHFTTMVKGTFGYLDPEYFQSSQFTEKSDVYSFGVVLAELLTGQKPISF  380
             FGTSRS+++D+TH TT VKGTFGYLDPEYF+SSQFTEKSDVYSFGVVL ELLTGQKPI  
Sbjct  305   FGTSRSMAVDQTHLTTQVKGTFGYLDPEYFRSSQFTEKSDVYSFGVVLVELLTGQKPIRL  364

Query  379   ELDDDEDRSLVSRFLLCMEENRLMEMLDGEVIEQGKKEDVVAMAWLAQRCLNFNGKKRPT  200
              ++ +E+RSL + FL  + ENRL E+LD EV+ + KKE+V+ +A +A+RCL  NGKKRPT
Sbjct  365   -VETEENRSLAAYFLQVINENRLFEVLDAEVLREAKKEEVITVAMVAKRCLKLNGKKRPT  423

Query  199   MKEVATELDAIKAS  158
             MKEVA EL  I+AS
Sbjct  424   MKEVALELAGIRAS  437



>ref|XP_006372236.1| hypothetical protein POPTR_0018s14500g [Populus trichocarpa]
 gb|ERP50033.1| hypothetical protein POPTR_0018s14500g [Populus trichocarpa]
Length=708

 Score =   446 bits (1146),  Expect = 5e-139, Method: Compositional matrix adjust.
 Identities = 276/595 (46%), Positives = 376/595 (63%), Gaps = 48/595 (8%)
 Frame = -1

Query  1861  YDSQTITIKESISPSCQGSNNFSNIIHNSKLSETPFMYSNDNNFMLFGCGNAFITMPGEE  1682
             YDS    +   +  +C G +  + +     L  +PF++S++N F+  GC N  + +  + 
Sbjct  86    YDSTIQVMFPIVFANCSGKDRNTVV----DLEGSPFVFSSENYFIARGCDN--LALMTQN  139

Query  1681  LDQPGYNLNCSSKNTTAPKTAHDCQGINCNHLTVDYDVNTYQVNFTH------SSSFNAC  1520
                 G  ++   +N+ + + +  C GI+C    +   +  + V          SS    C
Sbjct  140   QSTIGGCVSICDENSDSMRAS--CSGIHCCQTRIPSFLKVFNVTMKGLDDGKGSSGEKQC  197

Query  1519  NYAFFlsassslpptlqslpsrqQEMVVVPVELRWTITQEDVPP----------SYSKYC  1370
               A+  S        ++       +   VPV+L W I +               SY+  C
Sbjct  198   RSAYLSSGYYYSVGRVR-------DRDYVPVDLDWGIDKRVFESLVKNGSFYNSSYTSMC  250

Query  1369  SPSTYINPQLQWHNYLQCDCPGGDDRNVYLSGGCEWKHK-----------DYVISSNKLR  1223
                + IN   Q  + +QC C  G + N YL G C+  +              +I  N L 
Sbjct  251   KIVS-INSTNQ-SSTVQCFCKPGFEGNPYLYGFCQASNNCGHCTITQANIQNLIECNWLT  308

Query  1222  PAIIGISASFGFVFLIWAFVILYkaikkrkmkklrqkffkRNGGlllqqqlLTKEGTIEK  1043
              A  G+   FG + L+     LYK  K+++ +KL++K+FKRNGGLLLQ+QL + E  +EK
Sbjct  309   CA--GVGVGFGALLLLIGLWWLYKVFKRKRSEKLKKKYFKRNGGLLLQEQLSSGEVNVEK  366

Query  1042  TKIFTASELDKATDHFNADRIVGRGGQGTVYKGMLIDGQIVAVKKSQAVDEDQLEPFINE  863
              K+F + ELDKATDH+N +R +G+GGQGTVYKGML DG+IVAVKKS+ +DE  L  FINE
Sbjct  367   IKMFPSKELDKATDHYNVNRTLGQGGQGTVYKGMLADGKIVAVKKSKVIDEGNLRQFINE  426

Query  862   VVILSQINHRNVVKLMGCCLETEVPILVYEFIPNGTLFGLIHNNFDNELIPLSWDIRLRI  683
             VV+LSQINHRNVVKL+GCCLETEVP+LVYEFIPNGTLF  +H+   NE  PL+W++RLRI
Sbjct  427   VVLLSQINHRNVVKLLGCCLETEVPLLVYEFIPNGTLFQFLHD--PNEEFPLTWEMRLRI  484

Query  682   ASEVACALAYLHSVTLVPIYHRDIKTGNILLDEKFRAKVSDFGTSRSISIDKTHFTTMVK  503
             A+EVA AL YLHS   +PI+HRDIK+ NILLDEK+RAKV+DFGTSRS+SID+TH TT+V+
Sbjct  485   AAEVAGALFYLHSAASLPIFHRDIKSTNILLDEKYRAKVADFGTSRSVSIDQTHVTTLVQ  544

Query  502   GTFGYLDPEYFQSSQFTEKSDVYSFGVVLAELLTGQKPISFELDDDEDRSLVSRFLLCME  323
             GTFGYLDPEYFQSSQFT+KSDVYSFGVVL ELLTGQK ISF   +++ RSL + F++ ME
Sbjct  545   GTFGYLDPEYFQSSQFTDKSDVYSFGVVLVELLTGQKAISFTRSEEQGRSLATYFIMAME  604

Query  322   ENRLMEMLDGEVIEQGKKEDVVAMAWLAQRCLNFNGKKRPTMKEVATELDAIKAS  158
              N L ++LD +V++QG++E+V+ +A LA+ CL  NGK+RPTMKEV   L+ I  S
Sbjct  605   SNCLFDILDPQVVKQGEREEVLMVASLARSCLRLNGKERPTMKEVTMVLERITKS  659



>ref|XP_006492001.1| PREDICTED: putative wall-associated receptor kinase-like 11-like 
[Citrus sinensis]
Length=517

 Score =   438 bits (1127),  Expect = 1e-138, Method: Compositional matrix adjust.
 Identities = 239/384 (62%), Positives = 298/384 (78%), Gaps = 4/384 (1%)
 Frame = -1

Query  1312  CPGGDDRNVYLSGGCEWKHKDYVISSNKLRPAIIGISASFGFVFLIWAFVILYkaikkrk  1133
             CP G + +      C  +    +  ++ ++  IIG ++  G +FL+     LYK IK+R+
Sbjct  97    CPKGYNSSNPPFSDCRNEPNPILHKNSHVKFIIIGCNSGLGMLFLLIGTWWLYKFIKRRR  156

Query  1132  mkklrqkffkRNGGlllqqqlLTKEGTIEKTKIFTASELDKATDHFNADRIVGRGGQGTV  953
               KL+QKFFKRNGGLLLQQQ  + EG  EKTK+FT+ EL+ ATD+FN +RI+G+GGQGTV
Sbjct  157   EIKLKQKFFKRNGGLLLQQQSSSNEGNTEKTKLFTSMELEMATDNFNTNRILGQGGQGTV  216

Query  952   YKGMLIDGQIVAVKKSQAVDEDQLEPFINEVVILSQINHRNVVKLMGCCLETEVPILVYE  773
             YKGML DG+I AVKKS+ VDE  +E FINEVVIL+QINHRNVVKL GCCLETEVP+LVYE
Sbjct  217   YKGMLTDGRIAAVKKSKLVDESNIEQFINEVVILTQINHRNVVKLFGCCLETEVPLLVYE  276

Query  772   FIPNGTLFGLIHNNFDNELIPLSWDIRLRIASEVACALAYLHSVTLVPIYHRDIKTGNIL  593
             FIPNGTL+  IH   + E   ++W++RL IA EV+  L+YLHS T +PIYHRDIK+ NIL
Sbjct  277   FIPNGTLYQYIH---EIEEFSITWEMRLLIAIEVSSTLSYLHSTTSIPIYHRDIKSANIL  333

Query  592   LDEKFRAKVSDFGTSRSISIDKTHFTTMVKGTFGYLDPEYFQSSQFTEKSDVYSFGVVLA  413
             LD+KFRAKVSDFGTSRS++ID+TH TT V GTFGYLDPEYF+SSQFTEKSDVYSFGVVL 
Sbjct  334   LDDKFRAKVSDFGTSRSVTIDQTHLTTRVLGTFGYLDPEYFRSSQFTEKSDVYSFGVVLV  393

Query  412   ELLTGQKPISFELDDDEDRSLVSRFLLCMEENRLMEMLDGEVIEQGKKEDVVAMAWLAQR  233
             ELLTGQKPI    D +ED+SL   FLL M+ENRL ++LD +V+ + K+E+++ +A LA+R
Sbjct  394   ELLTGQKPIR-STDAEEDKSLAGYFLLAMKENRLFDVLDAQVLREAKEEEIITVAMLAKR  452

Query  232   CLNFNGKKRPTMKEVATELDAIKA  161
             CLN NG+KRPTMKEVA EL  I+A
Sbjct  453   CLNLNGRKRPTMKEVAFELGGIRA  476



>gb|KDO38339.1| hypothetical protein CISIN_1g038345mg, partial [Citrus sinensis]
Length=686

 Score =   444 bits (1141),  Expect = 2e-138, Method: Compositional matrix adjust.
 Identities = 283/619 (46%), Positives = 385/619 (62%), Gaps = 56/619 (9%)
 Frame = -1

Query  1882  VDFLGMSYDSQTITIKESISPSCQGSNNFSNIIHNSKLSETPFMYSN-DNNFMLFGCGNA  1706
             ++ + +S D   + + +  +  C  +  +S   +   ++ + F  SN +N F++ GC ++
Sbjct  21    IEVVNISIDGH-LNVLQYTAKDCYNAKGYSVDSNLPTITLSKFTVSNTENRFVVIGC-DS  78

Query  1705  FITMPGEELDQPGYNLNCSSK-NTTAPKTAHDCQGINCNHLTVDYDVNTYQVNFTHSSSF  1529
             +  + G  L +  Y   C S  ++    T   C G  C  + +     +++ N T+ SSF
Sbjct  79    YAYVRGY-LGENRYRAGCMSMCDSFDFVTNGSCIGTGCCQIEIPR--GSFK-NHTNVSSF  134

Query  1528  NACNYAFFlsassslpptlqslpsrqQEMVVVPVELRWTITQEDVPPSYSKYCSPSTYIN  1349
             N C YAF +  S     +         +    P+ L W IT  +     +K C P+   +
Sbjct  135   NPCTYAFVVDQSQFHFTSNYLAFDGIPDDF--PIVLDWEITTIETCEE-AKICGPNASCD  191

Query  1348  PQ---LQWHNYLQCDCPGGDDRNVYLSGGCEWKHK------------------DYVI---  1241
                      +   C C  G + N YLS GC   ++                  +Y     
Sbjct  192   KSKDNTTTSSGYHCKCNKGYEGNPYLSDGCRDVNEFEDPSLNNCTHICDNTAGNYTCRCP  251

Query  1240  -----------------SSNKLRPAI-IGISASFGFVFLIWAFVILYkaikkrkmkklrq  1115
                                N ++ A+  G S   G +FLI     LYK  KKR+  K +Q
Sbjct  252   KGFRGDGRRDGGGCIPNQKNLIKVALGAGCSGGLGLLFLIVGIWGLYKFTKKRREIKSKQ  311

Query  1114  kffkRNGGlllqqqlLTKEGTIEKTKIFTASELDKATDHFNADRIVGRGGQGTVYKGMLI  935
             KFFKRNGGLLLQQ+L + + ++EKTK+FT+ +L+KATD++NA+RI+G+GGQGTVYKGML 
Sbjct  312   KFFKRNGGLLLQQELSSNKSSVEKTKLFTSKDLEKATDNYNANRILGQGGQGTVYKGMLA  371

Query  934   DGQIVAVKKSQAVDEDQLEPFINEVVILSQINHRNVVKLMGCCLETEVPILVYEFIPNGT  755
             DG+IVAVKKS+ VDE+ +E FINEVVILSQINHRN+VKL+GCCLETEVP+LVYEF+PNGT
Sbjct  372   DGRIVAVKKSKLVDENNVEQFINEVVILSQINHRNIVKLLGCCLETEVPLLVYEFVPNGT  431

Query  754   LFGLIHNNFDNELIPLSWDIRLRIASEVACALAYLHSVTLVPIYHRDIKTGNILLDEKFR  575
             L+  IHN+   E  P++W++ LRIA EV+ AL YLHS   + IY RDIK+ NILLD+K+R
Sbjct  432   LYQNIHNHI--EEFPITWELLLRIAVEVSGALFYLHSAASISIYRRDIKSANILLDDKYR  489

Query  574   AKVSDFGTSRSISIDKTHFTTMVKGTFGYLDPEYFQSSQFTEKSDVYSFGVVLAELLTGQ  395
             AKVSDFGTSRSI++D+TH TT V+GTFGY+DPEYFQSSQFTEKSDVYSFGVVL E+LTGQ
Sbjct  490   AKVSDFGTSRSITVDQTHLTTKVQGTFGYVDPEYFQSSQFTEKSDVYSFGVVLVEILTGQ  549

Query  394   KPISFELDDDEDRSLVSRFLLCMEENRLMEMLDGEVIEQGKKEDVVAMAWLAQRCLNFNG  215
             KPI   ++ DEDRSLV  FL  M ENRL E+LD  V+++ ++E+++ +A LA+RCLN NG
Sbjct  550   KPIR-AINIDEDRSLVGYFLQAMNENRLFEVLDALVLKEAEREEIMTVATLAKRCLNLNG  608

Query  214   KKRPTMKEVATELDAIKAS  158
             K RPTMKEVA EL  I+AS
Sbjct  609   KNRPTMKEVAFELGGIRAS  627



>ref|XP_002511965.1| kinase, putative [Ricinus communis]
 gb|EEF50634.1| kinase, putative [Ricinus communis]
Length=743

 Score =   445 bits (1145),  Expect = 2e-138, Method: Compositional matrix adjust.
 Identities = 249/392 (64%), Positives = 304/392 (78%), Gaps = 17/392 (4%)
 Frame = -1

Query  1321  QCDCPGG---DDRNVYLSGGCEWKHKDYVISSNKLRPAI-IGISASFGFVFLIWAFVILY  1154
             +C CP G      N YL+ G           + + RP I I +SA  G  FL+     LY
Sbjct  300   KCSCPDGYISMGNNCYLTDG----------YTERFRPVIAIVLSAGLGIPFLLIGTWWLY  349

Query  1153  kaikkrkmkklrqkffkRNGGlllqqqlLTKEGTIEKTKIFTASELDKATDHFNADRIVG  974
             K  K+RK  KLRQ+FFKRNGGLLLQQQL + E +IEKT +FTA EL+KATDH+N +RI+G
Sbjct  350   KVQKRRKDAKLRQRFFKRNGGLLLQQQLSSSESSIEKTNMFTAKELEKATDHYNENRILG  409

Query  973   RGGQGTVYKGMLIDGQIVAVKKSQAVDEDQLEPFINEVVILSQINHRNVVKLMGCCLETE  794
             +GGQGTVYKGML DG++VA+KKS+  DE + E FINEVVILSQINHRNVVKL+GCCLETE
Sbjct  410   QGGQGTVYKGMLTDGKVVAIKKSKIADESKTEQFINEVVILSQINHRNVVKLLGCCLETE  469

Query  793   VPILVYEFIPNGTLFGLIHNNFDNELIPLSWDIRLRIASEVACALAYLHSVTLVPIYHRD  614
             VP+LVYEFIPNGTL+  +H+   +E  P++W++RLRIA E   AL+YLHS   VPIYHRD
Sbjct  470   VPLLVYEFIPNGTLYQHLHD--PSEEFPITWEMRLRIAIETGSALSYLHSAASVPIYHRD  527

Query  613   IKTGNILLDEKFRAKVSDFGTSRSISIDKTHFTTMVKGTFGYLDPEYFQSSQFTEKSDVY  434
             IK+ NILLD+K+RAKVSDFGTS+SI++D+TH TT V+GTFGYLDPEYFQSSQFTEKSDVY
Sbjct  528   IKSTNILLDDKYRAKVSDFGTSKSIAVDQTHVTTRVQGTFGYLDPEYFQSSQFTEKSDVY  587

Query  433   SFGVVLAELLTGQKPISFELDDDEDRSLVSRFLLCMEENRLMEMLDGEVIEQGKKEDVVA  254
             SFGVVL ELLTGQKPIS      E+RSL   FLL ME+NRL E+LD  V+++G KE+++A
Sbjct  588   SFGVVLVELLTGQKPIS-SARAVEERSLAMYFLLSMEQNRLFEILDARVLKEGGKEEILA  646

Query  253   MAWLAQRCLNFNGKKRPTMKEVATELDAIKAS  158
             +A LA+RCLN NGKKRPTM+ V TE++ I+AS
Sbjct  647   VAKLARRCLNLNGKKRPTMRTVVTEVERIRAS  678



>ref|XP_006490105.1| PREDICTED: wall-associated receptor kinase-like 10-like [Citrus 
sinensis]
Length=715

 Score =   444 bits (1143),  Expect = 2e-138, Method: Compositional matrix adjust.
 Identities = 243/404 (60%), Positives = 308/404 (76%), Gaps = 8/404 (2%)
 Frame = -1

Query  1312  CPGGDDRNVYLSGGCEWKHKDYVISSNKLRPAIIGISASFGFVFLIWAFVILYkaikkrk  1133
             CP G   + Y  G C+    +     ++++  +IG S     +FL+     LYK +K+++
Sbjct  286   CPQGYYSDRY--GSCQ-PILEIFFHKSRVKYIVIGCSGGLVLLFLLIGIWWLYKFVKRKR  342

Query  1132  mkklrqkffkRNGGlllqqqlLTKEGTIEKTKIFTASELDKATDHFNADRIVGRGGQGTV  953
               KL+QKFFKRNGGL+LQQ+L   EG IEKTK+FT+ +L+KATD++N +RI+G+GGQGTV
Sbjct  343   QIKLKQKFFKRNGGLILQQELSLSEGNIEKTKLFTSYDLEKATDNYNTNRILGQGGQGTV  402

Query  952   YKGMLIDGQIVAVKKSQAVDEDQLEPFINEVVILSQINHRNVVKLMGCCLETEVPILVYE  773
             YKGML +G+IVAVKKS+ VDE  +E FINEVVILSQ+NHRNVVKL+GCCLETEVP+LVYE
Sbjct  403   YKGMLTNGRIVAVKKSKLVDESNVEQFINEVVILSQLNHRNVVKLLGCCLETEVPLLVYE  462

Query  772   FIPNGTLFGLIHNNFDNELIPLSWDIRLRIASEVACALAYLHSVTLVPIYHRDIKTGNIL  593
             FIPNGTL+  +H+    E  PL+W++RLRIA EV+ AL+YLHS   +PIYHRDIK+ NIL
Sbjct  463   FIPNGTLYQYVHDPI--EEFPLTWEMRLRIAVEVSGALSYLHSAASIPIYHRDIKSANIL  520

Query  592   LDEKFRAKVSDFGTSRSISIDKTHFTTMVKGTFGYLDPEYFQSSQFTEKSDVYSFGVVLA  413
             LD+KFRAKVSDFG SRSI++D+TH TT V+GTFGYLDPEYF+SSQFTEKSDVYSFGVVL 
Sbjct  521   LDDKFRAKVSDFGASRSITVDQTHLTTQVQGTFGYLDPEYFRSSQFTEKSDVYSFGVVLV  580

Query  412   ELLTGQKPISFELDDDEDRSLVSRFLLCMEENRLMEMLDGEVIEQGKKEDVVAMAWLAQR  233
             ELLTGQKPI    D +ED+SL   FL  M+ENRL E+ D + +++ K+E++V +A LA++
Sbjct  581   ELLTGQKPIR-STDGEEDKSLAGYFLQAMKENRLFEVFDAQFLKEAKEEEIVTVAVLAKK  639

Query  232   CLNFNGKKRPTMKEVATELDAIKASNSHLPLAMEAFEIESDFIA  101
             CLN NGKKRPTMKEVA EL  I+AS     L     EI  DF+ 
Sbjct  640   CLNLNGKKRPTMKEVALELGGIRASTGASVLQHSREEI--DFVG  681



>ref|XP_006492003.1| PREDICTED: putative wall-associated receptor kinase-like 11-like 
[Citrus sinensis]
Length=517

 Score =   437 bits (1123),  Expect = 4e-138, Method: Compositional matrix adjust.
 Identities = 238/384 (62%), Positives = 297/384 (77%), Gaps = 4/384 (1%)
 Frame = -1

Query  1312  CPGGDDRNVYLSGGCEWKHKDYVISSNKLRPAIIGISASFGFVFLIWAFVILYkaikkrk  1133
             CP G + +      C  +    +  ++ ++  IIG ++  G +FL+     LYK IK+R+
Sbjct  97    CPKGYNSSNPPFSDCRNEPNPILHKNSHVKFIIIGCNSGLGMLFLLIGTWWLYKFIKRRR  156

Query  1132  mkklrqkffkRNGGlllqqqlLTKEGTIEKTKIFTASELDKATDHFNADRIVGRGGQGTV  953
               KL+QKFFKRNGGLLLQQQ  + EG  EKTK+FT+ EL+ ATD+FN +RI+G+GGQGTV
Sbjct  157   EIKLKQKFFKRNGGLLLQQQSSSNEGNTEKTKLFTSMELEMATDNFNTNRILGQGGQGTV  216

Query  952   YKGMLIDGQIVAVKKSQAVDEDQLEPFINEVVILSQINHRNVVKLMGCCLETEVPILVYE  773
             YKGML DG+I AVKKS+ VDE  +E FINEVVIL+QINHRNVVKL GCCLETEVP+LVYE
Sbjct  217   YKGMLTDGRIAAVKKSKLVDESNIEQFINEVVILTQINHRNVVKLFGCCLETEVPLLVYE  276

Query  772   FIPNGTLFGLIHNNFDNELIPLSWDIRLRIASEVACALAYLHSVTLVPIYHRDIKTGNIL  593
             FIPNGTL+  IH   + E   ++W++RL IA EV+  L+YLHS T +PIYHRDIK+ NIL
Sbjct  277   FIPNGTLYQYIH---EIEEFSITWEMRLLIAIEVSSTLSYLHSTTSIPIYHRDIKSANIL  333

Query  592   LDEKFRAKVSDFGTSRSISIDKTHFTTMVKGTFGYLDPEYFQSSQFTEKSDVYSFGVVLA  413
             LD+KFRAKVSDFGTSRS++ID+TH TT V GTFGYLDPEYF+SSQFTEKSDVYSFGVVL 
Sbjct  334   LDDKFRAKVSDFGTSRSVTIDQTHLTTRVLGTFGYLDPEYFRSSQFTEKSDVYSFGVVLV  393

Query  412   ELLTGQKPISFELDDDEDRSLVSRFLLCMEENRLMEMLDGEVIEQGKKEDVVAMAWLAQR  233
             ELLTGQKPI    D +ED+SL   FLL M+ENRL ++LD +V+ + K+E+++ +  LA+R
Sbjct  394   ELLTGQKPIR-STDAEEDKSLAGYFLLAMKENRLFDVLDAQVLREAKEEEIITVGMLAKR  452

Query  232   CLNFNGKKRPTMKEVATELDAIKA  161
             CLN NG+KRPTMKEVA EL  I+A
Sbjct  453   CLNLNGRKRPTMKEVAFELGGIRA  476



>ref|XP_011017593.1| PREDICTED: wall-associated receptor kinase-like 10 [Populus euphratica]
Length=737

 Score =   444 bits (1142),  Expect = 5e-138, Method: Compositional matrix adjust.
 Identities = 277/575 (48%), Positives = 365/575 (63%), Gaps = 44/575 (8%)
 Frame = -1

Query  1771  LSETPFMYSNDNNFMLFGCGNAFITMPGEELDQPGYNLNCSSKNTTAPKTAHDCQGINCN  1592
             L +TPF +S +N F+  GC N  + +   E    G    C+  ++ A      C GINC 
Sbjct  113   LEDTPFSFSTENRFIAVGCNNLAL-LSRNEATVGGCMSICNVSSSDASANGTICNGINCC  171

Query  1591  HLTV----DYDVNTYQVNFTHSSSFNACNYAFFlsassslpptlqslpsrqQEMVVVPVE  1424
               T+    D+   T QV        + C YA+ +  +        ++     +M  VPV 
Sbjct  172   ETTIPSGLDFFNATLQV--VGDKVKDGCKYAYLVDQNWFNLRLDNNISVI--DMDYVPVV  227

Query  1423  LRWTI---TQEDVPPSYSKYCSP---STYINPQLQWHNYLQCDCPGGDDRNVYLSGG---  1271
             L W I     E++  + S Y      S+  +   Q   +L+C C  G   N Y+  G   
Sbjct  228   LNWRIDLGLYENMTLNGSAYRVTNLTSSGTSRCSQNSTFLRCSCSSGFQGNPYIPDGCQD  287

Query  1270  -------------CEWK---------HKDYVISSNKLRPAIIGISASFGFVFLIWAFVI-  1160
                          C W          H+   +   K R  ++G+    GF  L+      
Sbjct  288   INECQSSPNNNTICSWDLICQNLYGGHQCVKLEIKKSRVKMVGLGFGVGFGVLVLLICSW  347

Query  1159  -LYkaikkrkmkklrqkffkRNGGlllqqqlLTKEGTIEKTKIFTASELDKATDHFNADR  983
              LYK IKK + +K ++ FF+RNGGLLLQ+QL + E  +EK K+F + ELDKATDH+N +R
Sbjct  348   WLYKVIKKSRNEKRKKMFFERNGGLLLQEQLSSGEVNVEKIKLFGSKELDKATDHYNVNR  407

Query  982   IVGRGGQGTVYKGMLIDGQIVAVKKSQAVDEDQLEPFINEVVILSQINHRNVVKLMGCCL  803
              +G+GGQGTVYKGML DG+I+AVKKS+ +DED L  FINEVVILSQINHRNVVKL GCCL
Sbjct  408   TLGQGGQGTVYKGMLADGKIIAVKKSKVLDEDNLRQFINEVVILSQINHRNVVKLFGCCL  467

Query  802   ETEVPILVYEFIPNGTLFGLIHNNFDNELIPLSWDIRLRIASEVACALAYLHSVTLVPIY  623
             ETEVP+LVYEFIPNGTL   +H++  NE  PL+W++RLRIA+EV+ AL+YLHS   +PI+
Sbjct  468   ETEVPLLVYEFIPNGTLCQFLHDS--NEEFPLTWEMRLRIATEVSGALSYLHSAASIPIF  525

Query  622   HRDIKTGNILLDEKFRAKVSDFGTSRSISIDKTHFTTMVKGTFGYLDPEYFQSSQFTEKS  443
             HRDIK+ NILLDEK+RAKV+DFGTS+S++ID+T  TT+V GTFGYLDPEYFQ+SQ T KS
Sbjct  526   HRDIKSTNILLDEKYRAKVADFGTSKSVTIDQTRVTTLVLGTFGYLDPEYFQTSQLTAKS  585

Query  442   DVYSFGVVLAELLTGQKPISFELDDDEDRSLVSRFLLCMEENRLMEMLDGEVIEQGKKED  263
             DVYSFGVVLAELLTGQKPIS    ++E+RSLV+ F++ MEEN L ++LD +V  QGKKED
Sbjct  586   DVYSFGVVLAELLTGQKPISSMRSEEENRSLVTYFIVSMEENHLFDILDPQVTMQGKKED  645

Query  262   VVAMAWLAQRCLNFNGKKRPTMKEVATELDAIKAS  158
             V+ +A LA+RCL+  G++RPTMKEVA  L+ I+ S
Sbjct  646   VMMVAMLAKRCLSMKGRERPTMKEVAMVLEGIQKS  680



>ref|XP_006441121.1| hypothetical protein CICLE_v10023277mg [Citrus clementina]
 gb|ESR54361.1| hypothetical protein CICLE_v10023277mg [Citrus clementina]
Length=391

 Score =   432 bits (1110),  Expect = 6e-138, Method: Compositional matrix adjust.
 Identities = 214/313 (68%), Positives = 255/313 (81%), Gaps = 5/313 (2%)
 Frame = -1

Query  1099  NGGlllqqqlLTKEGTIEKTKIFTASELDKATDHFNADRIVGRGGQGTVYKGMLIDGQIV  920
             NGGLLLQQQ  + EG  EKTK+FT+ EL+ ATD+FN +RI+G+GGQGTVYKGML DG+I 
Sbjct  59    NGGLLLQQQSSSNEGNTEKTKLFTSMELEMATDNFNTNRILGQGGQGTVYKGMLTDGRIA  118

Query  919   AVKKSQAVDEDQLEPFINEVVILSQINHRNVVKLMGCCLETEVPILVYEFIPNGTLFGLI  740
             AVKKS+ VDE  +E FINEVVIL+QINHRNVVKL GCCLETEVP+LVYEFIPNGTL+  I
Sbjct  119   AVKKSKLVDESNIEQFINEVVILTQINHRNVVKLFGCCLETEVPLLVYEFIPNGTLYQYI  178

Query  739   HNNFDNELIPLSWDIRLRIASEVACALAYLHSVTLVPIYHRDIKTGNILLDEKFRAKVSD  560
             H         ++W++RLRIA EV+ AL+YLHS T +PIYHRDIK+ NILLD+KFRAKVSD
Sbjct  179   HET----EFSITWEMRLRIAIEVSSALSYLHSTTSIPIYHRDIKSANILLDDKFRAKVSD  234

Query  559   FGTSRSISIDKTHFTTMVKGTFGYLDPEYFQSSQFTEKSDVYSFGVVLAELLTGQKPISF  380
             FG SRS++ID+TH TT V GTFGYLDPEYF+SSQFTEKSDVYSFGVVL ELLTGQKPI  
Sbjct  235   FGASRSVTIDQTHLTTRVLGTFGYLDPEYFRSSQFTEKSDVYSFGVVLVELLTGQKPIR-  293

Query  379   ELDDDEDRSLVSRFLLCMEENRLMEMLDGEVIEQGKKEDVVAMAWLAQRCLNFNGKKRPT  200
               D +ED+SL   FLL M+ENRL ++LD +V+ + K E+++ +  LA+RCLN NG KRPT
Sbjct  294   STDAEEDKSLAGYFLLAMKENRLFDVLDAQVLREAKGEEIITVGMLAKRCLNLNGTKRPT  353

Query  199   MKEVATELDAIKA  161
             MKEVA EL  I+A
Sbjct  354   MKEVAFELGGIRA  366



>ref|XP_002297680.2| hypothetical protein POPTR_0001s032402g, partial [Populus trichocarpa]
 gb|EEE82485.2| hypothetical protein POPTR_0001s032402g, partial [Populus trichocarpa]
Length=529

 Score =   437 bits (1123),  Expect = 6e-138, Method: Compositional matrix adjust.
 Identities = 257/442 (58%), Positives = 317/442 (72%), Gaps = 33/442 (7%)
 Frame = -1

Query  1435  VPVELRWTITQEDVPPSYSKYCSPSTYINPQLQWHNYLQCDCPGGDDRNVYLSGGC----  1268
             VP EL WT++  D  P Y +      Y N         +C+C  G +   YL  GC    
Sbjct  44    VPAELGWTMSWTDDDPVYCR-----GYYNRSFG----SECECDWGYEGIPYL--GCTDVD  92

Query  1267  ---EWKH-----------KDYV-ISSNKLRPAIIGISASFGFVFLIWAFVILYkaikkrk  1133
                E KH           + Y     NKL  A+I I A    + L+     LYK +KK K
Sbjct  93    ECKESKHSCRGLLKCVNTRGYFNCEINKLYIALIVIGAVVLALSLLMGIWWLYKLVKKWK  152

Query  1132  mkklrqkffkRNGGlllqqqlLTKEGTIEKTKIFTASELDKATDHFNADRIVGRGGQGTV  953
               +L++KFFKRNGGLLLQQ+L   EG ++KTKI+++ EL+ ATD FN +RI+G+GGQGTV
Sbjct  153   KIELKKKFFKRNGGLLLQQELRAAEGWVQKTKIYSSKELEVATDRFNVNRILGQGGQGTV  212

Query  952   YKGMLIDGQIVAVKKSQAVDEDQLEPFINEVVILSQINHRNVVKLMGCCLETEVPILVYE  773
             YKGML DG+IVAVKKS  VDE +LE FINEVV+LSQINHRNVVKL+GCCLETEVP+LVYE
Sbjct  213   YKGMLADGRIVAVKKSMVVDEGKLEEFINEVVVLSQINHRNVVKLLGCCLETEVPLLVYE  272

Query  772   FIPNGTLFGLIHNNFDNELIPLSWDIRLRIASEVACALAYLHSVTLVPIYHRDIKTGNIL  593
             FIPNG L+  IH+   NE   LSW++RL+IA EVA AL+YLHS T +PIYHRDIK+ NIL
Sbjct  273   FIPNGNLYKYIHDQ--NEDFLLSWEMRLQIAIEVAGALSYLHSATSIPIYHRDIKSTNIL  330

Query  592   LDEKFRAKVSDFGTSRSISIDKTHFTTMVKGTFGYLDPEYFQSSQFTEKSDVYSFGVVLA  413
             LDEK+RAKVSDFG+SRSISID+TH TT+V+GTFGYLDPEYFQSSQFTEKSDVYSFGVVL 
Sbjct  331   LDEKYRAKVSDFGSSRSISIDQTHLTTLVQGTFGYLDPEYFQSSQFTEKSDVYSFGVVLV  390

Query  412   ELLTGQKPISFELDDDEDRSLVSRFLLCMEENRLMEMLDGEVIEQGKKEDVVAMAWLAQR  233
             EL++GQKPI F +   E RSL + F++ ME+NRL ++LD  V E  + E+V+++A LA+R
Sbjct  391   ELISGQKPI-FSVSQTETRSLATHFIMLMEDNRLCDVLDARVKEGCQNEEVISVANLAKR  449

Query  232   CLNFNGKKRPTMKEVATELDAI  167
             CLN NGK RPTM+EV +EL+ I
Sbjct  450   CLNLNGKNRPTMREVTSELERI  471



>ref|XP_011013617.1| PREDICTED: wall-associated receptor kinase-like 1, partial [Populus 
euphratica]
Length=380

 Score =   431 bits (1108),  Expect = 7e-138, Method: Compositional matrix adjust.
 Identities = 215/311 (69%), Positives = 261/311 (84%), Gaps = 3/311 (1%)
 Frame = -1

Query  1099  NGGlllqqqlLTKEGTIEKTKIFTASELDKATDHFNADRIVGRGGQGTVYKGMLIDGQIV  920
             NGGLLLQQ+L   EG ++KTKI+++ EL+ ATD FN +RI+G+GGQGTVYKGML DG+IV
Sbjct  15    NGGLLLQQELRAAEGWVQKTKIYSSKELEVATDRFNVNRILGQGGQGTVYKGMLADGRIV  74

Query  919   AVKKSQAVDEDQLEPFINEVVILSQINHRNVVKLMGCCLETEVPILVYEFIPNGTLFGLI  740
             AVKKS  VDE +LE FINEVV+LSQINHRNVVKL+GCCLETEVP+LVYEFIPNG L+  I
Sbjct  75    AVKKSVVVDEGKLEEFINEVVVLSQINHRNVVKLLGCCLETEVPLLVYEFIPNGNLYKYI  134

Query  739   HNNFDNELIPLSWDIRLRIASEVACALAYLHSVTLVPIYHRDIKTGNILLDEKFRAKVSD  560
             H+   NE + LSW++RLRIA EVA AL+YLHS T + IYHRDIK+ NILLDEK+RAKVSD
Sbjct  135   HDQ--NEDLLLSWEMRLRIAIEVAGALSYLHSATSISIYHRDIKSTNILLDEKYRAKVSD  192

Query  559   FGTSRSISIDKTHFTTMVKGTFGYLDPEYFQSSQFTEKSDVYSFGVVLAELLTGQKPISF  380
             FG+SRSISID+TH TT+V+GTFGYLDPEYFQSSQFTEKSDVYSFGVVL EL++GQKPI F
Sbjct  193   FGSSRSISIDQTHLTTLVQGTFGYLDPEYFQSSQFTEKSDVYSFGVVLVELISGQKPI-F  251

Query  379   ELDDDEDRSLVSRFLLCMEENRLMEMLDGEVIEQGKKEDVVAMAWLAQRCLNFNGKKRPT  200
              +   E RSL + F++ ME+NRL ++LD  V E  + E+V+++A LA+RCLN NGK RPT
Sbjct  252   SVSQTETRSLATHFIMLMEDNRLSDVLDARVKEGCQNEEVISVANLAKRCLNLNGKNRPT  311

Query  199   MKEVATELDAI  167
             M+EV +EL+ I
Sbjct  312   MREVTSELERI  322



>ref|XP_010051299.1| PREDICTED: wall-associated receptor kinase-like 1 [Eucalyptus 
grandis]
Length=856

 Score =   447 bits (1151),  Expect = 7e-138, Method: Compositional matrix adjust.
 Identities = 278/575 (48%), Positives = 367/575 (64%), Gaps = 53/575 (9%)
 Frame = -1

Query  1771  LSETPFMYSNDNN-FMLFGCGNAFITMPGEELDQPGYNLNCSSKNTTAPKTAHDCQGINC  1595
             L  +PF++S   N F + GC N  +   G+E    G    C+  N T+ K +   +   C
Sbjct  245   LKGSPFVFSQKTNIFTVVGC-NTLLIANGKESAVFGCQSKCAGANFTSSKYSACSEREGC  303

Query  1594  NHLTVDYDVNTYQVNFTHSSSFNACNYAFFlsassslpptlqslpsrqQEMVVVPVELRW  1415
                +V  ++  + V+F   S    C YAF  S S                   VP  L W
Sbjct  304   CQSSVPLNLQGFGVDFEEESGDEGCKYAFLGSDSGVYDLRPSDK---------VPGMLEW  354

Query  1414  TIT---------QEDVPPSYSKYCSPSTYINPQLQ-----WHNY---------LQCDCPG  1304
              I          Q     + S YC+    ++ +++     + +Y          QC C  
Sbjct  355   GIANNTKYALDLQGRGRYNESFYCTKFKSLSSEVEGIIYRYRSYSVNSGEILSAQCYCRK  414

Query  1303  GDDRNVYLSGGCEWKHKD---------------YVISSNKLRPAIIGISASFGFVFLIWA  1169
             G   N YLSGGCE   K                  +   K +  +IG+ A  G + L   
Sbjct  415   GYHGNAYLSGGCEDIDKCNSRCPGTCVNTGTSFRCVGGGKTKFILIGVGAGLGALLLCLV  474

Query  1168  FVILYkaikkrkmkklrqkffkRNGGlllqqqlLTKEGTIEKTKIFTASELDKATDHFNA  989
                LYK IKKRK  KL++K FKRNGGLLL+ +L + EG +EK K+F + +L+KAT++FN 
Sbjct  475   LWGLYKYIKKRKEIKLKEKNFKRNGGLLLECEL-SFEGHVEKNKLFNSKDLEKATNNFNE  533

Query  988   DRIVGRGGQGTVYKGMLIDGQIVAVKKSQAVDEDQLEPFINEVVILSQINHRNVVKLMGC  809
             DRI+GRGGQGTVYKGML DG+IVA+KKS+A+DE ++E FINEV+ILSQINHRN+VKL+GC
Sbjct  534   DRILGRGGQGTVYKGMLTDGKIVAIKKSKAIDEGKVEQFINEVLILSQINHRNIVKLLGC  593

Query  808   CLETEVPILVYEFIPNGTLFGLIHNNFDNELIPLSWDIRLRIASEVACALAYLHSVTLVP  629
             CLETEVP+LVYEFIPNGTL+  +H+    E   +SWD RLRIA+E+A AL YLHS   +P
Sbjct  594   CLETEVPLLVYEFIPNGTLYQYLHDPM--EEYHVSWDTRLRIATEIAGALFYLHSAASIP  651

Query  628   IYHRDIKTGNILLDEKFRAKVSDFGTSRSISIDKTHFTTMVKGTFGYLDPEYFQSSQFTE  449
             IYHRDIK+ NILLDEK+RAKV+DFG S+S+S+D+TH TT+V+GTFGYLDPEYFQSSQFT+
Sbjct  652   IYHRDIKSTNILLDEKYRAKVADFGASKSVSLDQTHVTTLVQGTFGYLDPEYFQSSQFTD  711

Query  448   KSDVYSFGVVLAELLTGQKPISFELDDDEDRSLVSRFLLCMEENRLMEMLDGEVIEQGKK  269
             KSDVYSFGVVL ELLTGQKPIS  L + E RSL + F++ MEENRL +++D +V+++GKK
Sbjct  712   KSDVYSFGVVLVELLTGQKPIS-SLREQEGRSLATYFIISMEENRLFDIVDAQVLKEGKK  770

Query  268   EDVVAMAWLAQRCLNFNGKKRPTMKEVATELDAIK  164
             E++ ++A LA+RCLN NG+ RPTMKEVA EL+ ++
Sbjct  771   EEIASVADLAKRCLNLNGRNRPTMKEVAMELEGMR  805



>ref|XP_010039081.1| PREDICTED: wall-associated receptor kinase-like 1 [Eucalyptus 
grandis]
Length=582

 Score =   438 bits (1126),  Expect = 1e-137, Method: Compositional matrix adjust.
 Identities = 272/584 (47%), Positives = 368/584 (63%), Gaps = 45/584 (8%)
 Frame = -1

Query  1825  SPSCQGSNNFSNIIHNSKLSETPFMYSND-NNFMLFGCG-NAFITMP---GEELDQPGYN  1661
             + +CQG+     II    L  + F +S   N F L GC  NA +T     G      G  
Sbjct  12    NANCQGNG----IIEPVSLEGSNFFFSQRWNVFTLVGCDTNATVTSTKSDGMVFTSTGCR  67

Query  1660  LNCSSKNTTAPKTAHDCQGIN-CNHLTVDYDVNTYQVNFTHSSSFNACNYAFFlsasssl  1484
               C+  NT+  + +  C G + C    +  ++  Y VN         CNYAF    S   
Sbjct  68    SKCAGTNTSIRRYSA-CSGWDGCCQTMLPLNLQAYSVNIKEEGGQQGCNYAFPAERSWFS  126

Query  1483  pptlqslpsrqQEMVVVPVELRWTITQEDVPPSYSKYCSPSTYINPQLQW-----HNYLQ  1319
                +  L   +    V PVEL W I Q +   S   + S     N  + W        + 
Sbjct  127   KLNVTGLYDLRLNDTV-PVELVWGI-QNNTDYSIGLHQSSK---NSHVLWCYNSSLRSVY  181

Query  1318  CDCPGGDDRNVYLSGGCE---------------------WKHKDYVISSNKLRPAIIGIS  1202
             C C  G D N YL GGC+                         D + S    +  +IG+ 
Sbjct  182   CYCREGYDGNPYLIGGCQDIDECEDSKKCPGIGSICVNKQGGYDCIDSRKTAKFILIGVG  241

Query  1201  ASFGFVFLIWAFVILYkaikkrkmkklrqkffkRNGGlllqqqlLTKEGTIEKTKIFTAS  1022
             A  G + L      LYK I+KRK  KL++K+FKRNGGLLL+ +L + +G +E++K+  + 
Sbjct  242   AGVGALLLCLFLWRLYKYIQKRKEIKLKEKYFKRNGGLLLESELSSPQGNVEESKLLNSK  301

Query  1021  ELDKATDHFNADRIVGRGGQGTVYKGMLIDGQIVAVKKSQAVDEDQLEPFINEVVILSQI  842
             +L+KATD+FN DRI+G+GGQGTVYKGML DG+IVA+KKS+ +DE ++E FINE++ILSQI
Sbjct  302   DLEKATDNFNEDRILGQGGQGTVYKGMLTDGKIVAIKKSKVIDEGKVEHFINEILILSQI  361

Query  841   NHRNVVKLMGCCLETEVPILVYEFIPNGTLFGLIHNNFDNELIPLSWDIRLRIASEVACA  662
             NHRNVVKL+GCCLETEVP+LVYEFIPNGTL+  +H+   N+   +SWD RLRIA+E++ A
Sbjct  362   NHRNVVKLLGCCLETEVPLLVYEFIPNGTLYQHLHD--PNKEFHVSWDTRLRIATEISGA  419

Query  661   LAYLHSVTLVPIYHRDIKTGNILLDEKFRAKVSDFGTSRSISIDKTHFTTMVKGTFGYLD  482
             L YLHS   +PIYHRDIK+ NILLDEK+RAKV+DFGTS+S+S+D+TH TT+V+GTFGYLD
Sbjct  420   LFYLHSAASIPIYHRDIKSTNILLDEKYRAKVADFGTSKSVSLDQTHVTTLVQGTFGYLD  479

Query  481   PEYFQSSQFTEKSDVYSFGVVLAELLTGQKPISFELDDDEDRSLVSRFLLCMEENRLMEM  302
             PEYFQS+QFT+KSDVYSFGVVL ELLTGQKPI   L + E RSL + F++  E+N+L ++
Sbjct  480   PEYFQSNQFTDKSDVYSFGVVLVELLTGQKPI-LSLREQEGRSLATYFIISTEQNQLFDI  538

Query  301   LDGEVIEQGKKEDVVAMAWLAQRCLNFNGKKRPTMKEVATELDA  170
             +D +V+++GKKE++ ++A LA++CL+ NG+ RPTMKEV  EL+ 
Sbjct  539   VDAQVLKEGKKEEITSVANLAKKCLHLNGRNRPTMKEVTLELEG  582



>emb|CAN65982.1| hypothetical protein VITISV_017971 [Vitis vinifera]
Length=671

 Score =   441 bits (1134),  Expect = 1e-137, Method: Compositional matrix adjust.
 Identities = 285/621 (46%), Positives = 379/621 (61%), Gaps = 57/621 (9%)
 Frame = -1

Query  1882  VDFLGMSYDSQTITIKESISPSCQGSNNFSNIIHNSKLSETPFMYSNDNN-FMLFGCG-N  1709
             ++ L +S + +T+ +   I+P C G+  +      + +   PF +S  +N FM+ GC  N
Sbjct  77    LELLNVSLEYKTVMVNSPITPLCGGNGTW----RTTDVGGRPFRFSRVHNIFMVVGCDTN  132

Query  1708  AFITMPGEELDQPGYNLNCSSKNTTAPKTAHDCQGINCNHLTVDYD-----VNTYQVNFT  1544
             A +    +E    G   NC+S  T+   T   C GI C   T+ Y      +  YQV + 
Sbjct  133   AVLMTDDQEEILAGCTSNCNSGITS---TGTGCYGIQCCQTTIPYSNQSTHLGMYQVKYI  189

Query  1543  HSSSFNACNYAFFlsassslpptlqslpsrqQEMVVVPVELRWTITQEDVPPSYSKYCSP  1364
              +S    C+YAF                S        P+ + W +    +   YS     
Sbjct  190   KTSG--DCSYAFLGVRDWFANNISNPAISTNSGYA--PLVMFWEMETGSLGRCYSL----  241

Query  1363  STYINPQLQWHNYL---QCDCPGGDDRNVYLSGGCE---------------WKHKDYVIS  1238
                    L W +      C C    + N YL  GC+                  + +   
Sbjct  242   ------NLDWQSETAIDSCSCVNRYEGNPYLPNGCQVVEACANCSILDCGMIGAEYHCFP  295

Query  1237  SNKLRPAIIGISASFGFVFLIWAFVI----LYkaikkrkmkklrqkffkRNGGlllqqql  1070
             SN+    +  +             ++    LYK +KKR+    +QKFFKRNGGLLLQQQL
Sbjct  296   SNRRAKELKAMILGLSIGGGSLLLLVGSFGLYKGVKKRREIIRKQKFFKRNGGLLLQQQL  355

Query  1069  LTKEGTIEKTKIFTASELDKATDHFNADRIVGRGGQGTVYKGMLIDGQIVAVKKSQAVDE  890
              + E TIEKTKIFT  EL+ ATD+FN  RI+G+GGQGTVYKGML DG+I+AVK+S+ +DE
Sbjct  356   SSIE-TIEKTKIFTFKELEMATDNFNKSRILGQGGQGTVYKGMLNDGRIIAVKRSKIIDE  414

Query  889   DQLEPFINEVVILSQINHRNVVKLMGCCLETEVPILVYEFIPNGTLFGLIHNNFDNELIP  710
              QLE FINE++ILSQINHRN++ L+GCCLETEVP+LVYEFI NGTLF LIH+   N   P
Sbjct  415   SQLEQFINEIMILSQINHRNILGLLGCCLETEVPLLVYEFISNGTLFQLIHD--QNNEFP  472

Query  709   LSWDIRLRIASEVACALAYLHSVTLVPIYHRDIKTGNILLDEKFRAKVSDFGTSRSISID  530
              SW +RL+IASE A ALAYLHS + +PIYHRDIK+ NIL+DEK+RAKVSDFGTSRSISI+
Sbjct  473   FSWHMRLQIASEAAGALAYLHSSSSMPIYHRDIKSTNILIDEKYRAKVSDFGTSRSISIE  532

Query  529   KTHFTTMVKGTFGYLDPEYFQSSQFTEKSDVYSFGVVLAELLTGQKPISFELDDDEDRSL  350
             +TH TT VKGTFGY DPEYFQS +FTEKSDVYSFGVVL ELLTG+KP+S+    +E++SL
Sbjct  533   QTHLTTHVKGTFGYFDPEYFQSGRFTEKSDVYSFGVVLVELLTGKKPVSWT-TLEEEKSL  591

Query  349   VSRFLLCM-EENRLMEMLDGEVIEQGKKEDVVAMAWLAQRCLNFNGKKRPTMKEVATELD  173
             V+RF+L + EE+ L ++LD  V ++G+KE ++A+A LA+RCLN NGKKRPTMKEV  EL+
Sbjct  592   VARFILSLEEESHLYDILDDRVRKEGEKERIIAVANLAKRCLNLNGKKRPTMKEVTFELE  651

Query  172   AIKASNSHLPLAMEAFEIESD  110
              I+ S+  LP+  + + +  D
Sbjct  652   YIRMSS--LPINSQQYILNED  670



>ref|XP_008229715.1| PREDICTED: wall-associated receptor kinase-like 9 [Prunus mume]
Length=441

 Score =   432 bits (1112),  Expect = 2e-137, Method: Compositional matrix adjust.
 Identities = 208/314 (66%), Positives = 257/314 (82%), Gaps = 2/314 (1%)
 Frame = -1

Query  1099  NGGlllqqqlLTKEGTIEKTKIFTASELDKATDHFNADRIVGRGGQGTVYKGMLIDGQIV  920
             NGGLLL++QL + E  +EK K+F + EL+ +TD+FN DRI+G+G QGTVYKGML DG+IV
Sbjct  74    NGGLLLEKQLSSGEVNVEKIKLFKSKELETSTDNFNIDRILGQGSQGTVYKGMLTDGRIV  133

Query  919   AVKKSQAVDEDQLEPFINEVVILSQINHRNVVKLMGCCLETEVPILVYEFIPNGTLFGLI  740
             AVKKS+ VDE QL  FINEVVILSQINHRNVV+L+GCCLETEVPILVYEFIPNG L   I
Sbjct  134   AVKKSKIVDESQLSDFINEVVILSQINHRNVVQLLGCCLETEVPILVYEFIPNGNLSQYI  193

Query  739   HNNFDNELIPLSWDIRLRIASEVACALAYLHSVTLVPIYHRDIKTGNILLDEKFRAKVSD  560
             H    NE  PL+W++RLRIA E+A AL+YLH+    PIYHRDIK+ NILLD K+RAKV+D
Sbjct  194   HEQ--NEEFPLTWEVRLRIAKEIAGALSYLHASAAFPIYHRDIKSTNILLDAKYRAKVAD  251

Query  559   FGTSRSISIDKTHFTTMVKGTFGYLDPEYFQSSQFTEKSDVYSFGVVLAELLTGQKPISF  380
             FGTSRS++ID+TH TT+V GTFGY+DPEYFQSSQFTEKSDVYSFGVVL ELLTGQKPISF
Sbjct  252   FGTSRSVAIDQTHLTTLVHGTFGYMDPEYFQSSQFTEKSDVYSFGVVLVELLTGQKPISF  311

Query  379   ELDDDEDRSLVSRFLLCMEENRLMEMLDGEVIEQGKKEDVVAMAWLAQRCLNFNGKKRPT  200
                 +E +SL + F++ M+ +RL E+LD +V++ G K D++ +A LA+RCLN +G+KRPT
Sbjct  312   RRSQEEGKSLAAYFIISMQLDRLFEILDAQVVKGGSKADIITVANLARRCLNLSGRKRPT  371

Query  199   MKEVATELDAIKAS  158
             M+EV  EL+ I+ S
Sbjct  372   MREVTAELEGIQMS  385



>gb|KFK42442.1| hypothetical protein AALP_AA2G257100 [Arabis alpina]
Length=502

 Score =   434 bits (1117),  Expect = 2e-137, Method: Compositional matrix adjust.
 Identities = 233/413 (56%), Positives = 307/413 (74%), Gaps = 25/413 (6%)
 Frame = -1

Query  1330  NYLQCDCPGGDDRNVYLSGGC----EWKHKD------------------YVISSNKLRPA  1217
             +Y +C C  G + N YL GGC    E  H D                    + +N L P 
Sbjct  29    SYARCSCNRGYEGNPYLQGGCTDVNECLHSDGSLVRCWRGTCVDFQGHWECVYTNHL-PL  87

Query  1216  IIGISASFGFVFLIWAFVILYkaikkrkmkklrqkffkRNGGlllqqqlLTKEGTIEKTK  1037
              IG+ +SFG +  I     +YK I+K++  + ++KFFKRNGGLLL+QQL + EG  EKTK
Sbjct  88    AIGLGSSFGSLIFIGVVYGIYKFIRKQRKLRQKKKFFKRNGGLLLEQQLTSTEGNAEKTK  147

Query  1036  IFTASELDKATDHFNADRIVGRGGQGTVYKGMLIDGQIVAVKKSQAVDEDQLEPFINEVV  857
             +F++ EL KAT++F+ +RI+G GGQGTVYKGML+DG+IVAVKKS+ VDED+LE FINEVV
Sbjct  148   VFSSRELKKATENFSLNRILGEGGQGTVYKGMLVDGRIVAVKKSKVVDEDKLEEFINEVV  207

Query  856   ILSQINHRNVVKLMGCCLETEVPILVYEFIPNGTLFGLIHNNFDNELIPLSWDIRLRIAS  677
             ILSQINHRN+VKL+GCCLET VP+LVYEFIPNG LF L+H+ FD+  +  +W++RLRIA 
Sbjct  208   ILSQINHRNIVKLLGCCLETNVPVLVYEFIPNGNLFELLHDEFDDNTMA-TWEVRLRIAV  266

Query  676   EVACALAYLHSVTLVPIYHRDIKTGNILLDEKFRAKVSDFGTSRSISIDKTHFTTMVKGT  497
             ++A AL+YLHS    PIYHRD+K+ NI+LDEK+RAKVSDFGTSRS+++D TH TT+V GT
Sbjct  267   DIAGALSYLHSSASSPIYHRDVKSTNIMLDEKYRAKVSDFGTSRSVTVDHTHLTTVVSGT  326

Query  496   FGYLDPEYFQSSQFTEKSDVYSFGVVLAELLTGQKPISFELDDDEDRSLVSRFLLCMEEN  317
              GY+DPEYFQSSQFT+KSDVYSFGVVL EL+TG+KPISF L   E+R+L + F+L M+EN
Sbjct  327   VGYVDPEYFQSSQFTDKSDVYSFGVVLVELMTGEKPISF-LRSQENRTLATYFILAMKEN  385

Query  316   RLMEMLDGEVIEQGKKEDVVAMAWLAQRCLNFNGKKRPTMKEVATELDAIKAS  158
             RL  ++D  + +  K   V A+A +A++CLN  G+KRP+M+EV+ EL+ I++S
Sbjct  386   RLSNIIDARIKDGCKLNQVTAVAKIARKCLNLKGRKRPSMREVSMELEKIRSS  438



>ref|XP_004305856.1| PREDICTED: wall-associated receptor kinase-like 22-like [Fragaria 
vesca subsp. vesca]
Length=756

 Score =   443 bits (1140),  Expect = 2e-137, Method: Compositional matrix adjust.
 Identities = 285/630 (45%), Positives = 378/630 (60%), Gaps = 69/630 (11%)
 Frame = -1

Query  1873  LGMSYDSQTITIKESISPS-CQGSNNFSNIIHNSKLSETPF-MYSNDNNFMLFGCG-NAF  1703
             L +S    T+ ++  I+ S C G  N   +     L  +PF  +S  N F   GCG  A 
Sbjct  87    LNISVVEGTLRVRNPITFSNCSGKPNRQAV----NLEGSPFTFFSQKNMFTAVGCGVMAT  142

Query  1702  ITMPGEELD-QPGYNLNC-----SSKNTTAPKTAHDCQGINCNHLTVDYDVNTYQVNFTH  1541
             IT     +    G    C     S+ ++T+P T   C G++C    +   +  +  +F  
Sbjct  143   ITSNSNGVTISAGCRSECYASVDSTNSSTSPNT---CNGVDCCQTVIPSSLCAFNTSFQQ  199

Query  1540  SS---SFNACNYAFFlsas-sslpptlqslpsrqQEMVVVPVELRW-----------TIT  1406
             ++   + ++C+YAF +            +  S   +M  VP+ LRW           T  
Sbjct  200   ANDNLTKSSCSYAFLVDRDWFESFAKSSTNISATGDMDQVPIVLRWNLYHSTTDVFGTFI  259

Query  1405  QEDVPPSY----SKYCSPSTYINPQLQWHNYLQCDCPGGDDRNVYLSGGCE---------  1265
              E+V   Y      YC   +  +      + L+C C  G + N YL  GC          
Sbjct  260   AENVTRDYYDVLDGYCESYSDSSSLYG-SSRLECFCRWGSEGNPYLLQGCRDINECEDPV  318

Query  1264  -------------------W--KHKDYVISSNKLRPAIIGISASFGFVFLIWAFVILYka  1148
                                W   + + +IS ++++   IGI +  GF+ L++    L K 
Sbjct  319   NRASCSPGVCVNSLPGDSGWGCHYPETMISKSRVKAIFIGIGSGLGFLVLLFCAWWLIKL  378

Query  1147  ikkrkmkklrqkffkRNGGlllqqqlLTKEGTIEKTKIFTASELDKATDHFNADRIVGRG  968
              KKRK  +L+++FFK+NGGLLL+QQL + E  +EK K+F   EL+KATD FN DRI+G+G
Sbjct  379   WKKRKNIRLKKEFFKQNGGLLLEQQLSSGEVNVEKIKLFNVKELEKATDRFNVDRILGQG  438

Query  967   GQGTVYKGMLIDGQIVAVKKSQAVDEDQLEPFINEVVILSQINHRNVVKLMGCCLETEVP  788
             GQGTVYKGML DG+IVAVKKS+ VD  ++  FINE+VILSQINHRNVVKL+GCCLETEVP
Sbjct  439   GQGTVYKGMLADGRIVAVKKSKIVDGGEVGQFINEIVILSQINHRNVVKLLGCCLETEVP  498

Query  787   ILVYEFIPNGTLFGLIHNNFDNELIPLSWDIRLRIASEVACALAYLHSVTLVPIYHRDIK  608
             +LVYEFIP GT++  +H    NE  PL+W++RLRI++EVA AL+YLHS    PIYHRDIK
Sbjct  499   LLVYEFIPKGTIYQYLHEQ--NEEFPLTWEMRLRISAEVAGALSYLHSAAGFPIYHRDIK  556

Query  607   TGNILLDEKFRAKVSDFGTSRSISIDKTHFTTMVKGTFGYLDPEYFQSSQFTEKSDVYSF  428
             T NILLD+K+RAKV+DFGTSRS+SID+TH TT V GTFGYLDPEYFQSSQFT+KSDVYSF
Sbjct  557   TTNILLDDKYRAKVADFGTSRSVSIDQTHLTTFVHGTFGYLDPEYFQSSQFTDKSDVYSF  616

Query  427   GVVLAELLTGQKPISFELDDDEDRSLVSRFLLCMEENRLMEMLDGEVIEQGKKEDVVAMA  248
             GVVL ELLTG+KP+S      E R LVS F L +EEN L +++D  V   G  ED++ +A
Sbjct  617   GVVLVELLTGEKPVSLT-RSQEARGLVSYFNLSVEENNLFDIIDARVKVDGVTEDILVVA  675

Query  247   WLAQRCLNFNGKKRPTMKEVATELDAIKAS  158
              LA+RCL+ NGK+RPTMKEVA EL+ I  S
Sbjct  676   NLAKRCLDMNGKRRPTMKEVAMELEVIHKS  705



>ref|XP_006372237.1| hypothetical protein POPTR_0018s14510g [Populus trichocarpa]
 gb|ERP50034.1| hypothetical protein POPTR_0018s14510g [Populus trichocarpa]
Length=738

 Score =   442 bits (1138),  Expect = 2e-137, Method: Compositional matrix adjust.
 Identities = 274/576 (48%), Positives = 367/576 (64%), Gaps = 45/576 (8%)
 Frame = -1

Query  1771  LSETPFMYSNDNNFMLFGCGNAFITMPGEELDQPGYNLNCSSKNTTAPKTAHDCQGINCN  1592
             L +TPF +S +N F+  GC N  + +   E    G    C+  ++ A      C GINC 
Sbjct  113   LEDTPFSFSTENRFVAAGCNNLAL-LSRNEATVGGCMSICNVSSSDASADGTICNGINCC  171

Query  1591  HLTV----DYDVNTYQVNFTHSSSFNACNYAFFlsassslpptlqslpsrqQEMVVVPVE  1424
               T+    D+   T QV        + C YA+ +  +        ++     +M  VPV 
Sbjct  172   ETTIPSGLDFFNATLQV--VGDKVKDGCKYAYLVDQNWFNLRLDNNISVI--DMDYVPVV  227

Query  1423  LRWTIT---QEDVPPSYSKYCSP---STYINPQLQWHNYLQCDCPGGDDRNVYLSGG---  1271
             L W I     E++  + S Y      S+  +  +Q    L C C  G + N Y+  G   
Sbjct  228   LNWRINLGLYENMTLNGSAYSVTNLTSSGTSGCIQNSTVLLCSCSSGFEGNPYIPDGCQD  287

Query  1270  --------------CEWK---------HK--DYVISSNKLRPAIIGISASFGFVFLIWAF  1166
                           C W          H+     I  ++++   +G    FG + L+   
Sbjct  288   INECQSSSINNTTICSWDLICQNLYGGHQCVKLEIKKSRVKMVGLGFGVGFGVLVLLIGS  347

Query  1165  VILYkaikkrkmkklrqkffkRNGGlllqqqlLTKEGTIEKTKIFTASELDKATDHFNAD  986
               LYK IKK + +K ++ FF+RNGGLLLQ+QL + E  +EK K+F + ELDKATDH+N +
Sbjct  348   WWLYKVIKKSRNEKRKKMFFERNGGLLLQEQLSSGEVNVEKIKLFGSKELDKATDHYNVN  407

Query  985   RIVGRGGQGTVYKGMLIDGQIVAVKKSQAVDEDQLEPFINEVVILSQINHRNVVKLMGCC  806
             R +G+GGQGTVYKGML DG+I+AVKKS+ +DED L  FINEVVILSQINHRNVVKL GCC
Sbjct  408   RTLGQGGQGTVYKGMLADGKIIAVKKSKVLDEDNLRQFINEVVILSQINHRNVVKLFGCC  467

Query  805   LETEVPILVYEFIPNGTLFGLIHNNFDNELIPLSWDIRLRIASEVACALAYLHSVTLVPI  626
             LETEVP+LVYEFIPNGTL+  +H++  NE  PL+W++RLRIA+EV+ AL+YLHS   +PI
Sbjct  468   LETEVPLLVYEFIPNGTLYQFLHDS--NEEFPLTWEMRLRIATEVSGALSYLHSAASIPI  525

Query  625   YHRDIKTGNILLDEKFRAKVSDFGTSRSISIDKTHFTTMVKGTFGYLDPEYFQSSQFTEK  446
             +HRDIK+ NILLDEK+RAKV+DFGTS+S++ID+T  TT+V GTFGYLDPEYFQ+SQ T K
Sbjct  526   FHRDIKSTNILLDEKYRAKVADFGTSKSVTIDQTRVTTLVLGTFGYLDPEYFQTSQLTAK  585

Query  445   SDVYSFGVVLAELLTGQKPISFELDDDEDRSLVSRFLLCMEENRLMEMLDGEVIEQGKKE  266
             SDVYSFGVVLAELLTG+KPIS    ++E+RSLV+ F++ MEEN L ++LD +V  +GKKE
Sbjct  586   SDVYSFGVVLAELLTGEKPISSMRSEEENRSLVTYFIVSMEENHLFDILDPQVTMKGKKE  645

Query  265   DVVAMAWLAQRCLNFNGKKRPTMKEVATELDAIKAS  158
             DV+ +A LA+RCL+  G++RPTMKEVA  L+ I+ S
Sbjct  646   DVMMVAMLAKRCLSMKGRERPTMKEVAMVLEGIQKS  681



>gb|KDP41424.1| hypothetical protein JCGZ_15831 [Jatropha curcas]
Length=731

 Score =   442 bits (1137),  Expect = 2e-137, Method: Compositional matrix adjust.
 Identities = 222/314 (71%), Positives = 266/314 (85%), Gaps = 3/314 (1%)
 Frame = -1

Query  1099  NGGlllqqqlLTKEGTIEKTKIFTASELDKATDHFNADRIVGRGGQGTVYKGMLIDGQIV  920
             NGGLLLQQQL + E  +E+TK+FT+ EL+KATD+++ +RI+G GGQGTVYKGML DG++V
Sbjct  368   NGGLLLQQQLFSTETNVEQTKLFTSKELEKATDYYHVNRILGHGGQGTVYKGMLTDGRVV  427

Query  919   AVKKSQAVDEDQLEPFINEVVILSQINHRNVVKLMGCCLETEVPILVYEFIPNGTLFGLI  740
             A+KKS  VDED+L+ FINEVVILSQ+NHRNVVKL+GCCLETEVP+LVYEFIPNGTLF  I
Sbjct  428   AIKKSTVVDEDKLDQFINEVVILSQVNHRNVVKLIGCCLETEVPLLVYEFIPNGTLFQYI  487

Query  739   HNNFDNELIPLSWDIRLRIASEVACALAYLHSVTLVPIYHRDIKTGNILLDEKFRAKVSD  560
             HN   NE  P++W++RLRIA+EVA AL+YLHS   +PIYHRDIK+ NILLDEK+ AKV+D
Sbjct  488   HNQ--NEEFPITWEMRLRIATEVAGALSYLHSAASIPIYHRDIKSSNILLDEKYGAKVAD  545

Query  559   FGTSRSISIDKTHFTTMVKGTFGYLDPEYFQSSQFTEKSDVYSFGVVLAELLTGQKPISF  380
             FGTSRSISID+TH TT V+GTFGYLDPEYFQSSQFTEKSDVYSFGVVL ELLTGQKPIS 
Sbjct  546   FGTSRSISIDQTHVTTRVQGTFGYLDPEYFQSSQFTEKSDVYSFGVVLVELLTGQKPIS-  604

Query  379   ELDDDEDRSLVSRFLLCMEENRLMEMLDGEVIEQGKKEDVVAMAWLAQRCLNFNGKKRPT  200
              +   E+RSL + FLL MEEN L E+LD  + E+G+K+D++A A LA+ CLN NGKKRPT
Sbjct  605   AVRSGEERSLATYFLLAMEENHLFEILDARLAEEGEKKDIIATAKLAEGCLNLNGKKRPT  664

Query  199   MKEVATELDAIKAS  158
             MK VA  L+ I+AS
Sbjct  665   MKTVAMVLEGIRAS  678



>ref|XP_010051290.1| PREDICTED: LOW QUALITY PROTEIN: wall-associated receptor kinase-like 
6 [Eucalyptus grandis]
Length=940

 Score =   448 bits (1153),  Expect = 3e-137, Method: Compositional matrix adjust.
 Identities = 272/557 (49%), Positives = 359/557 (64%), Gaps = 62/557 (11%)
 Frame = -1

Query  1771  LSETPFMYSNDNN-FMLFGCGNAFITMPGEELDQPGYNLNCSSKNTTAPKTAHDCQGIN-  1598
             L  + F++S   N F + GC N  +T+   E    G    C+  N T  K +  C G + 
Sbjct  374   LKGSQFVFSQKRNIFTVVGC-NTLVTVNSTESAVFGCRSKCAGTNFTISKYSA-CSGRDG  431

Query  1597  CNHLTVDYDVNTYQVNFTHSSSFNACNYAFFlsassslpptlqslpsrqQEMVVVPVELR  1418
             C   ++  ++  + VNF        C YAF  S  + +     S          VPV L 
Sbjct  432   CCQSSLPLNLQGFDVNFKEEGGHEGCKYAFLRSDFTGVYDLRLSD--------TVPVVLE  483

Query  1417  WTITQ-------------EDVPPSY------SKYCSPSTYINPQLQWHNYLQCDCPGGDD  1295
             W I               +D   SY      SK C P T +N Q  +       C GG  
Sbjct  484   WGIANNTKYALDLIRQEYDDESFSYIDECEDSKRC-PGTCVNEQGSFR------CVGGRK  536

Query  1294  RNVYLSGGCEWKHKDYVISSNKLRPAIIGISASFGFVFLIWAFVILYkaikkrkmkklrq  1115
                ++                     +IG+    G +FL      LYK IKKRK  KL++
Sbjct  537   TTKFI---------------------LIGVGVGLGALFLCLFIWGLYKFIKKRKEIKLKE  575

Query  1114  kffkRNGGlllqqqlLTKEGTIEKTKIFTASELDKATDHFNADRIVGRGGQGTVYKGMLI  935
             K FKRNGGLLL+ +L + EG +EK K+F + +L+KATD+FN +RI+G+GGQG VYKGML 
Sbjct  576   KNFKRNGGLLLESELSSVEGHVEKNKLFNSKDLEKATDNFNENRILGQGGQGIVYKGMLA  635

Query  934   DGQIVAVKKSQAVDEDQLEPFINEVVILSQINHRNVVKLMGCCLETEVPILVYEFIPNGT  755
             DG+IVA+KKS+A+DE ++E FINEV+ILSQINHRN+VKL+GCCLET+VP+LVYEFIPNGT
Sbjct  636   DGKIVAIKKSKAIDEGKVEQFINEVLILSQINHRNIVKLLGCCLETKVPLLVYEFIPNGT  695

Query  754   LFGLIHNNFDNELIPLSWDIRLRIASEVACALAYLHSVTLVPIYHRDIKTGNILLDEKFR  575
             L+  +H+   NE   +SW+ RLRIA+E+A AL YLHSV  +PIYHRDIK+ NILLDEK+R
Sbjct  696   LYQYLHD--PNEEFHVSWETRLRIATEIAGALFYLHSVASIPIYHRDIKSTNILLDEKYR  753

Query  574   AKVSDFGTSRSISIDKTHFTTMVKGTFGYLDPEYFQSSQFTEKSDVYSFGVVLAELLTGQ  395
             AKV+DFGTS+SIS+D+TH TT+V+GTFGYLDPEYFQSSQFT+KSDVYSFGVVL ELLTGQ
Sbjct  754   AKVADFGTSKSISLDQTHVTTLVQGTFGYLDPEYFQSSQFTDKSDVYSFGVVLVELLTGQ  813

Query  394   KPISFELDDDEDRSLVSRFLLCMEENRLMEMLDGEVIEQGKKEDVVAMAWLAQRCLNFNG  215
             KPIS  L + E RSL + F++ ME+N+L +++D +V+++GKKE+  ++A LA+RCLN NG
Sbjct  814   KPIS-SLREQEGRSLATYFIISMEKNQLFDIVDAQVLKEGKKEEFASVANLAKRCLNLNG  872

Query  214   KKRPTMKEVATELDAIK  164
             +KRPTMKEVA EL+ ++
Sbjct  873   RKRPTMKEVAMELEGMR  889



>ref|XP_006421680.1| hypothetical protein CICLE_v10006431mg [Citrus clementina]
 gb|ESR34920.1| hypothetical protein CICLE_v10006431mg [Citrus clementina]
Length=420

 Score =   431 bits (1108),  Expect = 3e-137, Method: Compositional matrix adjust.
 Identities = 212/314 (68%), Positives = 259/314 (82%), Gaps = 3/314 (1%)
 Frame = -1

Query  1099  NGGlllqqqlLTKEGTIEKTKIFTASELDKATDHFNADRIVGRGGQGTVYKGMLIDGQIV  920
             NGGLLLQQ+L + E  IEKTK+FT+ +L+KATD++NA+RI+G+GGQGTVYKGML DG+IV
Sbjct  72    NGGLLLQQELSSNESNIEKTKLFTSKDLEKATDNYNANRILGQGGQGTVYKGMLTDGRIV  131

Query  919   AVKKSQAVDEDQLEPFINEVVILSQINHRNVVKLMGCCLETEVPILVYEFIPNGTLFGLI  740
             AVKKS+ VDE  +E FINEVV+LSQINHRN+VKL+GCCLETEVP+LVYEFIPNGTL+  I
Sbjct  132   AVKKSKLVDETNVERFINEVVVLSQINHRNIVKLLGCCLETEVPLLVYEFIPNGTLYQYI  191

Query  739   HNNFDNELIPLSWDIRLRIASEVACALAYLHSVTLVPIYHRDIKTGNILLDEKFRAKVSD  560
             HN    E  P+ W++  RIA EV+ AL YLHS   +PIYHRDIK+ NILLD+K+RAK+SD
Sbjct  192   HNQI--EEFPIKWELLSRIAVEVSGALFYLHSAASIPIYHRDIKSANILLDDKYRAKISD  249

Query  559   FGTSRSISIDKTHFTTMVKGTFGYLDPEYFQSSQFTEKSDVYSFGVVLAELLTGQKPISF  380
             FGTSRS+ +D+TH TT V+GTFGY+DPEYFQS QFTEKSDVYSFGVVL E+LTGQKPI  
Sbjct  250   FGTSRSVMVDQTHLTTKVQGTFGYVDPEYFQSGQFTEKSDVYSFGVVLVEILTGQKPIR-  308

Query  379   ELDDDEDRSLVSRFLLCMEENRLMEMLDGEVIEQGKKEDVVAMAWLAQRCLNFNGKKRPT  200
              ++ +EDRSLV  FL  + ENRL E+LD  V+++ KKE+++ +A LA+RCLN NGK RPT
Sbjct  309   AINTNEDRSLVGYFLQAINENRLFEVLDARVLKEAKKEEIMTVATLAKRCLNLNGKMRPT  368

Query  199   MKEVATELDAIKAS  158
             MKEV  EL  IK S
Sbjct  369   MKEVTFELGGIKTS  382



>gb|KCW47715.1| hypothetical protein EUGRSUZ_K01465 [Eucalyptus grandis]
Length=625

 Score =   437 bits (1125),  Expect = 6e-137, Method: Compositional matrix adjust.
 Identities = 268/554 (48%), Positives = 359/554 (65%), Gaps = 44/554 (8%)
 Frame = -1

Query  1825  SPSCQGSNNFSNIIHNSKLSETPFMYSN-DNNFMLFGCGNAFITMPGEELDQPGYNLNCS  1649
             S SC G    + +  N     + F++S  +N F   GC NA   +   E    G    C+
Sbjct  101   SASCGGEGLGARVNFNG----SQFVFSQTENVFTSVGC-NAQTIVNSTESAVVGCRSKCA  155

Query  1648  SKNT-TAPKTAHDCQGIN-CNHLTVDYDVNTYQVNFTHSSSFNACNYAFFlsassslppt  1475
               N    P +A  C G + C   T+ +++  + V+F        C YAF    S  L   
Sbjct  156   GSNADIGPYSA--CFGRDQCCQTTLSFNLQGFDVDFQEEREPQGCKYAFLADRSWFLRSN  213

Query  1474  lqslpsrqQEMVVVPVELRWTITQE-DVPPSYSKYCSPSTYINP-----QLQWHNY----  1325
             +  L        V PV L W I+ + D      +    S Y++P        + +Y    
Sbjct  214   VTGLYDLSLNDTV-PVVLEWGISNKTDYELKLIQQGYGSGYLDPFGCSRYSLYGSYTSEM  272

Query  1324  --LQCDCPGGDDRNVYLSGGCEWKHKDYVISSNKLRPAIIGISASFGFVFLIWAFVILYk  1151
               +QC C  G   N YL+ GC+                  G+ A+FG + L      LYK
Sbjct  273   PIIQCYCRWGYRGNPYLTEGCQ------------------GVGAAFGALVLCLVLWRLYK  314

Query  1150  aikkrkmkklrqkffkRNGGlllqqqlLTKEGTIEKTKIFTASELDKATDHFNADRIVGR  971
              +KKR+  KL++K FKRNGGLLL+ +L + EG +EK+K+F + +L+KATD+FN DRI+G+
Sbjct  315   YVKKRREIKLKEKHFKRNGGLLLKSELSSPEGNVEKSKLFNSKDLEKATDNFNDDRILGQ  374

Query  970   GGQGTVYKGMLIDGQIVAVKKSQAVDEDQLEPFINEVVILSQINHRNVVKLMGCCLETEV  791
             GGQGTVYKGML DG+IVA+KKS+ +DE ++E FINEV+ILSQINHRNVVKL+GCCLETEV
Sbjct  375   GGQGTVYKGMLTDGKIVAIKKSKVIDEGKVEQFINEVLILSQINHRNVVKLLGCCLETEV  434

Query  790   PILVYEFIPNGTLFGLIHNNFDNELIPLSWDIRLRIASEVACALAYLHSVTLVPIYHRDI  611
             P+LVYEFIPNGTL+  +H+   N+   +SWD RLRIA+E+A AL YLHS   +PIYHRDI
Sbjct  435   PLLVYEFIPNGTLYQYLHD--PNQEFHVSWDTRLRIATEIAGALFYLHSSASIPIYHRDI  492

Query  610   KTGNILLDEKFRAKVSDFGTSRSISIDKTHFTTMVKGTFGYLDPEYFQSSQFTEKSDVYS  431
             K+ NILLDEK+RAKV+DFGTS+S+S+D+TH TT+V+GTFGYLDPEYFQSSQFT+KSDVYS
Sbjct  493   KSTNILLDEKYRAKVADFGTSKSVSLDQTHVTTLVQGTFGYLDPEYFQSSQFTDKSDVYS  552

Query  430   FGVVLAELLTGQKPISFELDDDEDRSLVSRFLLCMEENRLMEMLDGEVIEQGKKEDVVAM  251
             FGVVLAELLTGQKPIS  L + E RSL + F++ MEENRL +++D +++++GK E++ ++
Sbjct  553   FGVVLAELLTGQKPIS-SLREQEGRSLATYFIISMEENRLFDIVDAQILKEGKMEEIASV  611

Query  250   AWLAQRCLNFNGKK  209
             A LA+RCLN NG+K
Sbjct  612   ANLAKRCLNLNGRK  625



>ref|XP_010247759.1| PREDICTED: wall-associated receptor kinase-like 10 [Nelumbo nucifera]
Length=448

 Score =   431 bits (1109),  Expect = 6e-137, Method: Compositional matrix adjust.
 Identities = 231/397 (58%), Positives = 301/397 (76%), Gaps = 17/397 (4%)
 Frame = -1

Query  1318  CDCPGGDDRNVYLSG---GC-EWKHKDYVISSNKLRPAIIGISASFGFVFLIWAFVILYk  1151
             C CP G   + +  G   GC + + + + I        + GI +S   +   +A + LY+
Sbjct  11    CLCPEGTYGDGFKGGSGTGCIKIQSQTFAI--------VTGIGSSLALLVSFFASLWLYQ  62

Query  1150  aikkrkmkklrqkffkRNGGlllqqqlLTKEGTIEKTKIFTASELDKATDHFNADRIVGR  971
               K+ + KK+++ FFK+NGGLLLQQQ+  +EG    TKIF A EL+KATDH+N +RI+G+
Sbjct  63    LHKRIRSKKIKEHFFKQNGGLLLQQQISLEEGNFGNTKIFQAEELEKATDHYNVNRILGQ  122

Query  970   GGQGTVYKGMLIDGQIVAVKKS---QAVDEDQLEPFINEVVILSQINHRNVVKLMGCCLE  800
             GGQGTVYKGML DG+IVA+KKS   + VDE Q++ FINE+VILS+INHRNVVKL+GCCLE
Sbjct  123   GGQGTVYKGMLTDGRIVAIKKSKKVEMVDEGQIKQFINELVILSKINHRNVVKLLGCCLE  182

Query  799   TEVPILVYEFIPNGTLFGLIHNNFDNELIPLSWDIRLRIASEVACALAYLHSVTLVPIYH  620
             TEVP+LVYEFI +GTLF  IH+  D+++ P +WD RLRIA+EVA AL+YLHS   +PIYH
Sbjct  183   TEVPLLVYEFISSGTLFNHIHDRSDDDM-PFTWDNRLRIATEVAGALSYLHSAASIPIYH  241

Query  619   RDIKTGNILLDEKFRAKVSDFGTSRSISIDKTHFTTMVKGTFGYLDPEYFQSSQFTEKSD  440
             RD+K+ NILLD+K+RAKVSDFGTSR I++DKTH TT V+GT GYLDP+YFQSSQFTEKSD
Sbjct  242   RDVKSSNILLDDKYRAKVSDFGTSRPIAVDKTHLTTXVQGTLGYLDPQYFQSSQFTEKSD  301

Query  439   VYSFGVVLAELLTGQKPISFELDDDEDRSLVSRFLLCMEENRLMEMLDGEVIEQGKKEDV  260
             VYSFGVVL ELLTG+KPIS      E++SL + FL  MEENRL E+LD +V+++G+K ++
Sbjct  302   VYSFGVVLVELLTGEKPIS-SFRPGENKSLATYFLSSMEENRLFEILDAQVVKKGEKAEI  360

Query  259   VAMAWLAQRCLNFNGKKRPTMKEVATELDAIKASNSH  149
               +A LA+RCL+ NGK RPTMKEV  EL+ ++ S +H
Sbjct  361   EVVANLAKRCLDLNGKNRPTMKEVTVELEGLRISKAH  397



>ref|XP_010532063.1| PREDICTED: wall-associated receptor kinase-like 22 [Tarenaya 
hassleriana]
Length=797

 Score =   443 bits (1139),  Expect = 7e-137, Method: Compositional matrix adjust.
 Identities = 278/579 (48%), Positives = 357/579 (62%), Gaps = 48/579 (8%)
 Frame = -1

Query  1771  LSETPFMYSNDNNFMLFGCGN-AFITMPGEELDQPGYNLNCSSKNTTAPKTAHDCQGINC  1595
             ++ +PF  S  N  +  GC N AF+T    E    G    C        +    C G  C
Sbjct  172   VTGSPFSVSKVNILVASGCNNKAFMT--NVEPSIIGCESTCDHGRQRRRRGKDLCDGYGC  229

Query  1594  NHLTVDYD-------VNTYQVNFTHSSSFNACNYAFFlsassslpptlqslpsrqQEMVV  1436
                    D       V T  ++ T+S+    C  AF            +           
Sbjct  230   CQAATPSDRSLQVIGVRTENMDGTNSTG-GGCRVAFLTCEGYYASAVREPRAFLANGSSS  288

Query  1435  VPVELRWTITQEDVPPSYSKYCSPSTYIN----PQ---------LQWHNYLQCDCPGGDD  1295
             + +E  W I+  D+P   S  C  ST  N    P+         +   +Y  C C  G  
Sbjct  289   LLLE--WFISTVDLPLDVSLICLNSTIDNGFGQPRGNCECNYEYISGVSYPSCVCMYGYR  346

Query  1294  RNVYLSGGC----EWKHK---------------DYVISSNKLRPAIIGISASFGFVFLIW  1172
              N YL GGC    E   K               DY     K  P IIG+S+ FG +FL+ 
Sbjct  347   GNPYLPGGCRDIDECSEKPYYCGEHTTCVNTRGDYKCVPKKTLPTIIGVSSGFGLLFLVA  406

Query  1171  AFVILYkaikkrkmkklrqkffkRNGGlllqqqlLTKEGTIEKTKIFTASELDKATDHFN  992
                 LYK IKKRK    ++KFFKRNGGLLLQQQL + EG +EKTKIFT+ EL+KAT++F+
Sbjct  407   GMYWLYKFIKKRKEIHRKKKFFKRNGGLLLQQQLNSTEGNVEKTKIFTSKELEKATENFS  466

Query  991   ADRIVGRGGQGTVYKGMLIDGQIVAVKKSQAVDEDQLEPFINEVVILSQINHRNVVKLMG  812
              DR++G+GGQGTVYKGML+DG+IVAVKKS+AVDED+LE FINEVVILSQINHRN+VKL+G
Sbjct  467   TDRVLGQGGQGTVYKGMLLDGRIVAVKKSKAVDEDKLEEFINEVVILSQINHRNIVKLLG  526

Query  811   CCLETEVPILVYEFIPNGTLFGLIHNNFDNELIPLSWDIRLRIASEVACALAYLHSVTLV  632
             CCLET+VP+LVYEFI NG LF  +H+  DN    ++W+ RLRIA E+A A++YLHS    
Sbjct  527   CCLETDVPLLVYEFITNGNLFEHLHDGSDN--YTMTWEERLRIAVEIAGAVSYLHSAASC  584

Query  631   PIYHRDIKTGNILLDEKFRAKVSDFGTSRSISIDKTHFTTMVKGTFGYLDPEYFQSSQFT  452
             P+YHRDIK+ NILLDEK+RAKVSDFGTSRS++ID TH TT+V GT GY+DPEYFQSSQFT
Sbjct  585   PVYHRDIKSSNILLDEKYRAKVSDFGTSRSVTIDHTHLTTVVSGTVGYVDPEYFQSSQFT  644

Query  451   EKSDVYSFGVVLAELLTGQKPISFELDDDEDRSLVSRFLLCMEENRLMEMLDGEVIEQGK  272
             +KSDVYSFGVVL EL+TG+KP+S  L   E+R L ++F+  M++N L +M+D  + +  K
Sbjct  645   DKSDVYSFGVVLVELITGEKPVSL-LRFQENRILATQFIAIMKQNNLSDMIDARIKDDCK  703

Query  271   KEDVVAMAWLAQRCLNFNGKKRPTMKEVATELDAIKASN  155
              E V+A+A LA+RCLN  G KRP M+EV+ EL+ I++SN
Sbjct  704   VEQVMAVANLAKRCLNLKGNKRPNMREVSVELERIRSSN  742



>ref|XP_011013615.1| PREDICTED: wall-associated receptor kinase-like 22 isoform X3 
[Populus euphratica]
Length=728

 Score =   441 bits (1133),  Expect = 7e-137, Method: Compositional matrix adjust.
 Identities = 286/630 (45%), Positives = 385/630 (61%), Gaps = 51/630 (8%)
 Frame = -1

Query  1882  VDFLGMSYDSQTITIKESI-SPSCQGSNNFSNIIHNSKLSETPFMYSNDNNFMLFGCGNA  1706
             ++ LG+S  +  + +   I S  C G    +N+  +  ++ +PF++S+ N F+  GC N 
Sbjct  78    MEVLGISLGNSRVRVNSPIISSGCSGRG--ANLAFD--MTGSPFIFSSLNIFIAMGCNNR  133

Query  1705  FITMPGEELDQPGYNLNCSSKNTTAPKTAHD----CQGINCNHLTVDYDVNTYQVNF---  1547
              + +   E +  G    C + N T+  T       C G NC    +  ++  +  +    
Sbjct  134   AL-LNRIEPEIVGCTSTCGANNLTSSSTEGKEKRYCSGDNCCQTRIPSNLQVFSASLGTT  192

Query  1546  --THSSSFNACNYAFFlsassslpptlqslpsrqQEMVVVPVELRWTITQED--VPPSYS  1379
                +    N C  AF +    SL         R  +M  VPV L W +  +D  V  S +
Sbjct  193   EDPNDQGRNQCKVAFIVDRGWSLDNIKSPEAVR--DMQHVPVILDWFVYSDDFRVENSDA  250

Query  1378  KYCSPSTYINPQLQW--------HNYLQCDCPGGDDRNVYLSGGCEWKHKDYVISSNKLR  1223
             K CSP   +    +W         N   C C  G D N YL  GC    +   ++ N   
Sbjct  251   KNCSPPVQL-ASGRWGLSTLTLYSNSTTCSCNLGYDGNPYLPDGCTDIDECKNLNGNWCS  309

Query  1222  PAIIGISASFGF---------VFLIWAFVIL-----------Ykaikkrkmkklrqkffk  1103
                  ++   G+          FLI                 YK ++KRK  +L++KFFK
Sbjct  310   GMTKCVNVPGGYKCELDKAKITFLILGAATGLLLLLVGIWGLYKLVRKRKNIELKKKFFK  369

Query  1102  RNGGlllqqqlLTKEGTIEKTKIFTASELDKATDHFNADRIVGRGGQGTVYKGMLIDGQI  923
             +NGGLLLQQQL + +G+I+KTKIFT+ +L+KATD FN +RI+G+GGQGTVYKGML DG I
Sbjct  370   QNGGLLLQQQLSSSDGSIQKTKIFTSKQLEKATDRFNDNRILGKGGQGTVYKGMLADGMI  429

Query  922   VAVKKSQAVDEDQLEPFINEVVILSQINHRNVVKLMGCCLETEVPILVYEFIPNGTLFGL  743
             VAVKKS+ VDE++LE FINEVVILSQ+NHR+VVKL+GCCLETEVP+LVYEFIPNG L+  
Sbjct  430   VAVKKSKIVDEEKLEEFINEVVILSQVNHRHVVKLLGCCLETEVPLLVYEFIPNGNLYEY  489

Query  742   IHNNFDNELIPLSWDIRLRIASEVACALAYLHSVTLVPIYHRDIKTGNILLDEKFRAKVS  563
             IH+    E    SW++RLRIA+EVA AL+YLHS   +P+YHRDIK+ NILLDEK RAKVS
Sbjct  490   IHD--QKEEFEFSWEMRLRIATEVAGALSYLHSAASIPVYHRDIKSTNILLDEKLRAKVS  547

Query  562   DFGTSRSISIDKTHFTTMVKGTFGYLDPEYFQSSQFTEKSDVYSFGVVLAELLTGQKPIS  383
             DFGTSRSI+ID+TH TT V+GTFGY DPEYFQSS FT KSDVYSFGVVLAEL +GQKPIS
Sbjct  548   DFGTSRSIAIDQTHLTTHVRGTFGYFDPEYFQSSHFTGKSDVYSFGVVLAELWSGQKPIS  607

Query  382   FELDDDEDRSLVSRFLLCMEENRLMEMLDGEVIEQGKKEDVVAMAWLAQRCLNFNGKKRP  203
             +E   +E   L + F+  MEEN++ + LD  +I Q ++E+ +A+A LA+RCLN+NG+KRP
Sbjct  608   YE-RSEERACLPTHFIPLMEENKIFDGLDERLIGQDREEEGIAVANLARRCLNWNGRKRP  666

Query  202   TMKEVATELDAIKASNSHLPLAMEAFEIES  113
             TM+EVA EL+ I+ S   L     + ++E+
Sbjct  667   TMREVAIELEQIRLSKGALQAQRSSKQLEN  696



>gb|KCW48948.1| hypothetical protein EUGRSUZ_K02557 [Eucalyptus grandis]
Length=633

 Score =   437 bits (1125),  Expect = 8e-137, Method: Compositional matrix adjust.
 Identities = 269/561 (48%), Positives = 361/561 (64%), Gaps = 42/561 (7%)
 Frame = -1

Query  1819  SCQGSNNFSNIIHNSKLSETPFMYSND-NNFMLFGCG-NAFITMP---GEELDQPGYNLN  1655
             +CQG+     II    L  + F +S   N F L GC  NA +T     G      G    
Sbjct  104   NCQGNG----IIEPVSLEGSNFFFSQRWNVFTLVGCDTNATVTSTKSDGMVFTSTGCRSK  159

Query  1654  CSSKNTTAPKTAHDCQGIN-CNHLTVDYDVNTYQVNFTHSSSFNACNYAFFlsassslpp  1478
             C+  NT+  + +  C G + C    +  ++  Y VN         CNYAF    S     
Sbjct  160   CAGTNTSIRRYSA-CSGWDGCCQTMLPLNLQAYSVNIKEEGGQQGCNYAFPAERSWFSKL  218

Query  1477  tlqslpsrqQEMVVVPVELRWTITQEDVPPSYSKYCSPSTYINPQLQW-----HNYLQCD  1313
              +  L   +    V PVEL W I Q +   S   + S     N  + W        + C 
Sbjct  219   NVTGLYDLRLNDTV-PVELVWGI-QNNTDYSIGLHQSSK---NSHVLWCYNSSLRSVYCY  273

Query  1312  CPGGDDRNVYLSGGCEWKHKDYVISSNKLRPAIIGISASFGFVFLIWAFVILYkaikkrk  1133
             C  G D N YL GGC+                  G+ A  G + L      LYK I+KRK
Sbjct  274   CREGYDGNPYLIGGCQ------------------GVGAGVGALLLCLFLWRLYKYIQKRK  315

Query  1132  mkklrqkffkRNGGlllqqqlLTKEGTIEKTKIFTASELDKATDHFNADRIVGRGGQGTV  953
               KL++K+FKRNGGLLL+ +L + +G +E++K+  + +L+KATD+FN DRI+G+GGQGTV
Sbjct  316   EIKLKEKYFKRNGGLLLESELSSPQGNVEESKLLNSKDLEKATDNFNEDRILGQGGQGTV  375

Query  952   YKGMLIDGQIVAVKKSQAVDEDQLEPFINEVVILSQINHRNVVKLMGCCLETEVPILVYE  773
             YKGML DG+IVA+KKS+ +DE ++E FINE++ILSQINHRNVVKL+GCCLETEVP+LVYE
Sbjct  376   YKGMLTDGKIVAIKKSKVIDEGKVEHFINEILILSQINHRNVVKLLGCCLETEVPLLVYE  435

Query  772   FIPNGTLFGLIHNNFDNELIPLSWDIRLRIASEVACALAYLHSVTLVPIYHRDIKTGNIL  593
             FIPNGTL+  +H+   N+   +SWD RLRIA+E++ AL YLHS   +PIYHRDIK+ NIL
Sbjct  436   FIPNGTLYQHLHD--PNKEFHVSWDTRLRIATEISGALFYLHSAASIPIYHRDIKSTNIL  493

Query  592   LDEKFRAKVSDFGTSRSISIDKTHFTTMVKGTFGYLDPEYFQSSQFTEKSDVYSFGVVLA  413
             LDEK+RAKV+DFGTS+S+S+D+TH TT+V+GTFGYLDPEYFQS+QFT+KSDVYSFGVVL 
Sbjct  494   LDEKYRAKVADFGTSKSVSLDQTHVTTLVQGTFGYLDPEYFQSNQFTDKSDVYSFGVVLV  553

Query  412   ELLTGQKPISFELDDDEDRSLVSRFLLCMEENRLMEMLDGEVIEQGKKEDVVAMAWLAQR  233
             ELLTGQKPI   L + E RSL + F++  E+N+L +++D +V+++GKKE++ ++A LA++
Sbjct  554   ELLTGQKPI-LSLREQEGRSLATYFIISTEQNQLFDIVDAQVLKEGKKEEITSVANLAKK  612

Query  232   CLNFNGKKRPTMKEVATELDA  170
             CL+ NG+ RPTMKEV  EL+ 
Sbjct  613   CLHLNGRNRPTMKEVTLELEG  633



>ref|XP_011013613.1| PREDICTED: wall-associated receptor kinase-like 22 isoform X1 
[Populus euphratica]
 ref|XP_011013614.1| PREDICTED: wall-associated receptor kinase-like 22 isoform X2 
[Populus euphratica]
Length=739

 Score =   441 bits (1134),  Expect = 1e-136, Method: Compositional matrix adjust.
 Identities = 286/630 (45%), Positives = 385/630 (61%), Gaps = 51/630 (8%)
 Frame = -1

Query  1882  VDFLGMSYDSQTITIKESI-SPSCQGSNNFSNIIHNSKLSETPFMYSNDNNFMLFGCGNA  1706
             ++ LG+S  +  + +   I S  C G    +N+  +  ++ +PF++S+ N F+  GC N 
Sbjct  78    MEVLGISLGNSRVRVNSPIISSGCSGRG--ANLAFD--MTGSPFIFSSLNIFIAMGCNNR  133

Query  1705  FITMPGEELDQPGYNLNCSSKNTTAPKTAHD----CQGINCNHLTVDYDVNTYQVNF---  1547
              + +   E +  G    C + N T+  T       C G NC    +  ++  +  +    
Sbjct  134   AL-LNRIEPEIVGCTSTCGANNLTSSSTEGKEKRYCSGDNCCQTRIPSNLQVFSASLGTT  192

Query  1546  --THSSSFNACNYAFFlsassslpptlqslpsrqQEMVVVPVELRWTITQED--VPPSYS  1379
                +    N C  AF +    SL         R  +M  VPV L W +  +D  V  S +
Sbjct  193   EDPNDQGRNQCKVAFIVDRGWSLDNIKSPEAVR--DMQHVPVILDWFVYSDDFRVENSDA  250

Query  1378  KYCSPSTYINPQLQW--------HNYLQCDCPGGDDRNVYLSGGCEWKHKDYVISSNKLR  1223
             K CSP   +    +W         N   C C  G D N YL  GC    +   ++ N   
Sbjct  251   KNCSPPVQL-ASGRWGLSTLTLYSNSTTCSCNLGYDGNPYLPDGCTDIDECKNLNGNWCS  309

Query  1222  PAIIGISASFGF---------VFLIWAFVIL-----------Ykaikkrkmkklrqkffk  1103
                  ++   G+          FLI                 YK ++KRK  +L++KFFK
Sbjct  310   GMTKCVNVPGGYKCELDKAKITFLILGAATGLLLLLVGIWGLYKLVRKRKNIELKKKFFK  369

Query  1102  RNGGlllqqqlLTKEGTIEKTKIFTASELDKATDHFNADRIVGRGGQGTVYKGMLIDGQI  923
             +NGGLLLQQQL + +G+I+KTKIFT+ +L+KATD FN +RI+G+GGQGTVYKGML DG I
Sbjct  370   QNGGLLLQQQLSSSDGSIQKTKIFTSKQLEKATDRFNDNRILGKGGQGTVYKGMLADGMI  429

Query  922   VAVKKSQAVDEDQLEPFINEVVILSQINHRNVVKLMGCCLETEVPILVYEFIPNGTLFGL  743
             VAVKKS+ VDE++LE FINEVVILSQ+NHR+VVKL+GCCLETEVP+LVYEFIPNG L+  
Sbjct  430   VAVKKSKIVDEEKLEEFINEVVILSQVNHRHVVKLLGCCLETEVPLLVYEFIPNGNLYEY  489

Query  742   IHNNFDNELIPLSWDIRLRIASEVACALAYLHSVTLVPIYHRDIKTGNILLDEKFRAKVS  563
             IH+    E    SW++RLRIA+EVA AL+YLHS   +P+YHRDIK+ NILLDEK RAKVS
Sbjct  490   IHDQ--KEEFEFSWEMRLRIATEVAGALSYLHSAASIPVYHRDIKSTNILLDEKLRAKVS  547

Query  562   DFGTSRSISIDKTHFTTMVKGTFGYLDPEYFQSSQFTEKSDVYSFGVVLAELLTGQKPIS  383
             DFGTSRSI+ID+TH TT V+GTFGY DPEYFQSS FT KSDVYSFGVVLAEL +GQKPIS
Sbjct  548   DFGTSRSIAIDQTHLTTHVRGTFGYFDPEYFQSSHFTGKSDVYSFGVVLAELWSGQKPIS  607

Query  382   FELDDDEDRSLVSRFLLCMEENRLMEMLDGEVIEQGKKEDVVAMAWLAQRCLNFNGKKRP  203
             +E   +E   L + F+  MEEN++ + LD  +I Q ++E+ +A+A LA+RCLN+NG+KRP
Sbjct  608   YE-RSEERACLPTHFIPLMEENKIFDGLDERLIGQDREEEGIAVANLARRCLNWNGRKRP  666

Query  202   TMKEVATELDAIKASNSHLPLAMEAFEIES  113
             TM+EVA EL+ I+ S   L     + ++E+
Sbjct  667   TMREVAIELEQIRLSKGALQAQRSSKQLEN  696



>ref|XP_004305858.1| PREDICTED: wall-associated receptor kinase-like 9-like [Fragaria 
vesca subsp. vesca]
Length=405

 Score =   429 bits (1103),  Expect = 1e-136, Method: Compositional matrix adjust.
 Identities = 209/315 (66%), Positives = 262/315 (83%), Gaps = 3/315 (1%)
 Frame = -1

Query  1099  NGGlllqqqlLTKEGTIEKTKIFTASELDKATDHFNADRIVGRGGQGTVYKGMLIDGQIV  920
             NGGLLL+QQL + E  +EK K+F + EL+K+TD+FN DRI+G+GGQGTVYKGML DG+IV
Sbjct  40    NGGLLLEQQLSSGEVNVEKIKLFKSQELEKSTDNFNVDRILGQGGQGTVYKGMLEDGRIV  99

Query  919   AVKKSQAVDEDQLEPFINEVVILSQINHRNVVKLMGCCLETEVPILVYEFIPNGTLFGLI  740
             AVKK++ VDE QL  FINEVVILSQINHRN+V+L+GCCLETEVP+LVYEFIPNGTL   I
Sbjct  100   AVKKAKMVDESQLSEFINEVVILSQINHRNIVQLLGCCLETEVPLLVYEFIPNGTLSKYI  159

Query  739   HNNFDNELIPLSWDIRLRIASEVACALAYLHSVTLVPIYHRDIKTGNILLDEKFRAKVSD  560
                 +    PL+W +RLRIA+E+A AL+YLH     PIYHRDIK+ NILLD+K+RAK++D
Sbjct  160   TKQIEE--FPLTWKMRLRIATEIAGALSYLHYTASFPIYHRDIKSTNILLDDKYRAKIAD  217

Query  559   FGTSRSISIDKTHFTT-MVKGTFGYLDPEYFQSSQFTEKSDVYSFGVVLAELLTGQKPIS  383
             FGTSRSI+ID+TH TT +V GTFGYLDPEYFQSSQFTEKSDVYSFGVVL ELLTGQKPIS
Sbjct  218   FGTSRSIAIDQTHLTTSLVHGTFGYLDPEYFQSSQFTEKSDVYSFGVVLVELLTGQKPIS  277

Query  382   FELDDDEDRSLVSRFLLCMEENRLMEMLDGEVIEQGKKEDVVAMAWLAQRCLNFNGKKRP  203
             F   +DE RSL + F++ M ++RL E++D +V+++G KED++A+A LA+RCLN +G+KRP
Sbjct  278   FLRSEDEGRSLATYFIISMHKDRLFEIVDAQVLKEGSKEDILAVANLARRCLNLSGRKRP  337

Query  202   TMKEVATELDAIKAS  158
             TM+EV  EL+ I+ +
Sbjct  338   TMREVTAELEVIQMT  352



>ref|XP_010269806.1| PREDICTED: wall-associated receptor kinase-like 8 [Nelumbo nucifera]
Length=1028

 Score =   449 bits (1155),  Expect = 1e-136, Method: Compositional matrix adjust.
 Identities = 246/404 (61%), Positives = 305/404 (75%), Gaps = 13/404 (3%)
 Frame = -1

Query  1318  CDCPGGDDRNVYLSGGCEWK---HKDYVISSNKLRPAIIGISASFGFVFLIWAFVILYka  1148
             C CP G     Y   G        KD  I   + RP IIG+ +S   +  + A +  Y+ 
Sbjct  591   CSCPPG-----YTGDGMRHGIPCRKDSFI--KRYRPWIIGVGSSLALLIAVLASICFYQL  643

Query  1147  ikkrkmkklrqkffkRNGGlllqqqlLTKEGTIEKTKIFTASELDKATDHFNADRIVGRG  968
              KK K KK+++KFFK+NGGLLLQQQ+ ++EG +E+ KIF A EL+KATDH+N +RI G+G
Sbjct  644   HKKLKSKKIKEKFFKQNGGLLLQQQISSEEGNVEQAKIFHAEELEKATDHYNVNRIXGQG  703

Query  967   GQGTVYKGMLIDGQIVAVKKSQAVDEDQLEPFINEVVILSQINHRNVVKLMGCCLETEVP  788
             GQGTVYKGML DG+IVA+KKS+ VDE Q+E FINEVVILSQINHRNVVKL+GCCLETEVP
Sbjct  704   GQGTVYKGMLTDGRIVAIKKSKKVDESQIEQFINEVVILSQINHRNVVKLLGCCLETEVP  763

Query  787   ILVYEFIPNGTLFGLIHNNFDNELIPLSWDIRLRIASEVACALAYLHSVTLVPIYHRDIK  608
             +LVYEFIP GTLF  IH+  DN  +  +W+ RLRI +EVA AL+YLHS    PIYHRD+K
Sbjct  764   LLVYEFIPCGTLFHHIHDQSDN--MSCTWNNRLRIXTEVAGALSYLHSAASTPIYHRDVK  821

Query  607   TGNILLDEKFRAKVSDFGTSRSISIDKTHFTTMVKGTFGYLDPEYFQSSQFTEKSDVYSF  428
             + NILLD+K+RAKVSDFGTSRSI++DKTH TT V GTFGYLDPEY+QSSQFTEKSDVYSF
Sbjct  822   STNILLDDKYRAKVSDFGTSRSIAVDKTHLTTAVHGTFGYLDPEYYQSSQFTEKSDVYSF  881

Query  427   GVVLAELLTGQKPISFELDDDEDRSLVSRFLLCMEENRLMEMLDGEVIEQGKKEDVVAMA  248
             GVVL ELLTG++PI F L   E RSL + FL  +EENRL E+LD +V+++G+K +V A+A
Sbjct  882   GVVLVELLTGKEPI-FLLRPGEQRSLATYFLTSIEENRLFEILDAQVVKEGEKVEVEAVA  940

Query  247   WLAQRCLNFNGKKRPTMKEVATELDAIKASNSHLPLAMEAFEIE  116
             +LA+RCLN NGKKRPTMKEV  EL+ ++ S   + +     E+E
Sbjct  941   YLAKRCLNLNGKKRPTMKEVTMELEGLRISKGQVFVQETHEEVE  984


 Score =   299 bits (766),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 148/232 (64%), Positives = 181/232 (78%), Gaps = 3/232 (1%)
 Frame = -1

Query  811  CCLETEVPILVYEFIPNGTLFGLIHNNFDNELIPLSWDIRLRIASEVACALAYLHSVTLV  632
            CCLETE P+LVYEFIP GTLF  IH+  DN  +  +W+ RLRIA+EVA AL+YLHS    
Sbjct  325  CCLETEAPLLVYEFIPCGTLFQHIHDQSDN--MSCTWNNRLRIATEVAGALSYLHSAAST  382

Query  631  PIYHRDIKTGNILLDEKFRAKVSDFGTSRSISIDKTHFTTMVKGTFGYLDPEYFQSSQFT  452
            PIYHRD+K+ NILLD+K+RAKVSDFGTSRSI++DKTH TT V GTFGYLDPEY+QSSQFT
Sbjct  383  PIYHRDVKSTNILLDDKYRAKVSDFGTSRSIAVDKTHLTTAVHGTFGYLDPEYYQSSQFT  442

Query  451  EKSDVYSFGVVLAELLTGQKPISFELDDDEDRSLVSRFLLCMEENRLMEMLDGEVIEQGK  272
            EKSDVYSFGVVL ELLTG++PI F     E RSL + FL  +EENRL E+LD +V+++G+
Sbjct  443  EKSDVYSFGVVLVELLTGKEPI-FLSRPGEQRSLATYFLTSIEENRLFEILDAQVVKEGE  501

Query  271  KEDVVAMAWLAQRCLNFNGKKRPTMKEVATELDAIKASNSHLPLAMEAFEIE  116
            K +V A+A+LA+RCLN NGKKRPTMKEV  EL+ ++ S     +     E+E
Sbjct  502  KVEVEAVAYLAKRCLNLNGKKRPTMKEVTIELEGLRISKGQAFVQETHQEVE  553



>ref|XP_006427112.1| hypothetical protein CICLE_v10025130mg [Citrus clementina]
 gb|ESR40352.1| hypothetical protein CICLE_v10025130mg [Citrus clementina]
Length=639

 Score =   437 bits (1124),  Expect = 1e-136, Method: Compositional matrix adjust.
 Identities = 246/434 (57%), Positives = 319/434 (74%), Gaps = 16/434 (4%)
 Frame = -1

Query  1387  SYSKYCSPSTYINPQLQWHNYLQCDCPGGDDRNV-------YLSGGCEWKHKDYVISSNK  1229
             S  + C+  + ++P   + NYL+      D + +          G C   +  +    NK
Sbjct  192   SIPQGCTSLSLVDPDWIFSNYLKTPSGLKDKKKIPAVLEWGKYKGVCYEDYNSHTKVCNK  251

Query  1228  LRPAIIGISAS-----FGFVFLIWAFVILYkaikkrkmkklrqkffkRNGGlllqqqlLT  1064
                 +I +S+       G   LI A+  L+K +K+R+  KL+QKFFKRNGGLLLQQ+L +
Sbjct  252   DDRCLIQLSSGCTSGGLGMFLLIGAW-WLFKFVKRRREIKLKQKFFKRNGGLLLQQELAS  310

Query  1063  KEGTIEKTKIFTASELDKATDHFNADRIVGRGGQGTVYKGMLIDGQIVAVKKSQAVDEDQ  884
              EGTIEKTK+FT+ EL++ATD+FN +RI+G+GGQGTVYKGML DG+IVAVKKS+ +DE +
Sbjct  311   TEGTIEKTKLFTSKELERATDNFNLNRILGQGGQGTVYKGMLPDGKIVAVKKSKVIDERK  370

Query  883   LEPFINEVVILSQINHRNVVKLMGCCLETEVPILVYEFIPNGTLFGLIHNNFDNELIPLS  704
             +E FINE+VILSQINHRNVVKL+GCCLETEVP+LVYEFIPNGTLF  IH+   NE  P++
Sbjct  371   VEEFINEMVILSQINHRNVVKLLGCCLETEVPLLVYEFIPNGTLFQYIHDQ--NEDFPIT  428

Query  703   WDIRLRIASEVACALAYLHSVTLVPIYHRDIKTGNILLDEKFRAKVSDFGTSRSISIDKT  524
             W++RLRIA EV+ AL+YLHS   +PIYHRDIK+ NILLD+K+RAKVSDFG SRS+++D+T
Sbjct  429   WEMRLRIAIEVSGALSYLHSAASIPIYHRDIKSTNILLDDKYRAKVSDFGASRSMAVDQT  488

Query  523   HFTTMVKGTFGYLDPEYFQSSQFTEKSDVYSFGVVLAELLTGQKPISFELDDDEDRSLVS  344
             H TT V GTFGYLDPEYF+SSQFT+KSDVYSFGVVL ELLTG+KPI F    +ED+SL +
Sbjct  489   HMTTQVHGTFGYLDPEYFRSSQFTDKSDVYSFGVVLVELLTGEKPIRFT-TLEEDKSLAA  547

Query  343   RFLLCMEENRLMEMLDGEVIEQGKKEDVVAMAWLAQRCLNFNGKKRPTMKEVATELDAIK  164
              FL  M+E RL E+LD  V+++G  ++++  A +A+RCLN NGKKRPTM+EVA+EL  IK
Sbjct  548   YFLCAMKEERLFEILDARVMKEGGGDEIIIFAKVAKRCLNLNGKKRPTMREVASELAGIK  607

Query  163   ASNSHLPLAMEAFE  122
             A N    +  E  E
Sbjct  608   AWNGASNVIEEDLE  621



>ref|XP_011034599.1| PREDICTED: wall-associated receptor kinase-like 22 [Populus euphratica]
Length=697

 Score =   439 bits (1129),  Expect = 1e-136, Method: Compositional matrix adjust.
 Identities = 288/593 (49%), Positives = 371/593 (63%), Gaps = 50/593 (8%)
 Frame = -1

Query  1882  VDFLGMSYDSQTITIKESI-SPSCQGSNNFSNIIHNSKLSETPFMYS-NDNNFMLFGCGN  1709
             ++ L +S +  T+T+K  I S +C G  +   +      + TPF++S NDN F+  GC N
Sbjct  76    MEVLNISAERATVTVKSPIISSNCTGGEDGVPL----NFTGTPFVFSGNDNVFIAVGC-N  130

Query  1708  AFITMPGEELDQPGYNLNCSSKNTTAPKTAHDCQGINCNHLTVDYDVNTYQVNFTHSSSF  1529
                 M G      G    CS       K+ + CQ    + L V    N        +   
Sbjct  131   TQALMTGITPSLIGCVSTCSD-----VKSKNFCQASPPSFLQV---FNPKLEATDDNQDR  182

Query  1528  NACNYAFFlsassslpptlqslpsrqQEMVVVPVELRWTITQEDVPPSYSKYCSPSTYIN  1349
               C  AF ++ +            + ++ V  P EL WT+      P + +      Y N
Sbjct  183   EGCKLAFLVNQTWFELNVSDPFSLQYRDYV--PAELSWTMNVNTDDPVHCR-----GYYN  235

Query  1348  PQLQWHNYLQCDCPGGDDRNVYLSGGC-------EWKH-----------KDYV-ISSNKL  1226
                +     +C C  G +   YL  GC       E KH           + Y     NKL
Sbjct  236   ESFR----SECVCGWGYEGIPYL--GCIDVDECKESKHSCRGLLKCVNTRGYFNCEINKL  289

Query  1225  RPAIIGISASFGFVFLIWAFVILYkaikkrkmkklrqkffkRNGGlllqqqlLTKEGTIE  1046
               A+I I A    +  +     LYK +KK +  +L++KFFKRNGGLLLQQ+L   EG ++
Sbjct  290   YIALIVIGAVVLALLSLMGIWWLYKLVKKWQKIELKKKFFKRNGGLLLQQELRAAEGWVQ  349

Query  1045  KTKIFTASELDKATDHFNADRIVGRGGQGTVYKGMLIDGQIVAVKKSQAVDEDQLEPFIN  866
             KTKI+++ EL+ ATD FN +RI+G+GGQGTVYKGML DG+IVAVKKS  VDE +LE FIN
Sbjct  350   KTKIYSSKELELATDRFNVNRILGQGGQGTVYKGMLADGRIVAVKKSVVVDEGKLEEFIN  409

Query  865   EVVILSQINHRNVVKLMGCCLETEVPILVYEFIPNGTLFGLIHNNFDNELIPLSWDIRLR  686
             EVV+LSQINHRNVVKL+GCCLETEVP+LVYEFIPNG L+  IH+   NE   LSW++RLR
Sbjct  410   EVVVLSQINHRNVVKLLGCCLETEVPLLVYEFIPNGNLYKYIHDQ--NEDFLLSWEMRLR  467

Query  685   IASEVACALAYLHSVTLVPIYHRDIKTGNILLDEKFRAKVSDFGTSRSISIDKTHFTTMV  506
             IA EVA AL+YLHS T +PIYHRDIK+ NILLDEK+RAKVSDFG+SRSISID+TH TT+V
Sbjct  468   IAIEVAGALSYLHSATSIPIYHRDIKSTNILLDEKYRAKVSDFGSSRSISIDQTHLTTLV  527

Query  505   KGTFGYLDPEYFQSSQFTEKSDVYSFGVVLAELLTGQKPISFELDDDEDRSLVSRFLLCM  326
             +GTFGYLDPEYFQSSQFTEKSDVYSFGVVL EL++GQKPI F +   E RSL + F++ M
Sbjct  528   QGTFGYLDPEYFQSSQFTEKSDVYSFGVVLVELISGQKPI-FSVSQTETRSLATHFIMLM  586

Query  325   EENRLMEMLDGEVIEQGKKEDVVAMAWLAQRCLNFNGKKRPTMKEVATELDAI  167
             E+NRL ++LD  V E  + E+V+++A LA+RCLN NGK RPTM+EV +EL+ I
Sbjct  587   EDNRLSDVLDARVKEGCQNEEVISVANLAKRCLNLNGKNRPTMREVTSELERI  639



>gb|KCW81782.1| hypothetical protein EUGRSUZ_C03141 [Eucalyptus grandis]
Length=639

 Score =   437 bits (1123),  Expect = 2e-136, Method: Compositional matrix adjust.
 Identities = 274/580 (47%), Positives = 363/580 (63%), Gaps = 61/580 (11%)
 Frame = -1

Query  1771  LSETPFMYSNDNN-FMLFGCGNAFITMPGEELDQPGYNLNCSSKNTTAPKTAHDCQGIN-  1598
             L  +PF++S   N F + GC N  +T    E    G    C+  N T  K +  C G + 
Sbjct  26    LKGSPFVFSQKRNIFTVVGC-NTLVTANSTESAVFGCQSKCAGTNFTISKYSA-CSGEDG  83

Query  1597  CNHLTVDYDVNTYQVNFTHSSSFNACNYAFFlsassslpptlqslpsrqQEMVVVPVELR  1418
             C   ++  ++    V+F   S    C YAF  S S      L            VP  L 
Sbjct  84    CCQSSLPLNLQGLGVDFEEESGDEGCKYAFLGSDSGVYDLKLSD---------TVPGVLE  134

Query  1417  WTITQED------VPPSYSKYCSPSTYINPQLQ------------WHNY---------LQ  1319
             W I  +       +   Y  Y S  ++   + +            + +Y          Q
Sbjct  135   WGIANDTTYALDLIEQGY--YLSNESFTCTRFKSLSSEGEGIIYRYRSYSVDSGEILSAQ  192

Query  1318  CDCPGGDDRNVYLSGGCE-------WKHKDYV--------ISSNKLRPAIIGISASFGFV  1184
             C C  G   N YL GGC+       W     V        +   K +  +IG+ A  G +
Sbjct  193   CRCRTGYHGNAYLIGGCKDIDECNSWCTGTCVNTGASFRCVGGGKTKFILIGVGAGLGAL  252

Query  1183  FLIWAFVILYkaikkrkmkklrqkffkRNGGlllqqqlLTKEGTIEKTKIFTASELDKAT  1004
              L      LYK I +RK  KL++K FKRNGGLLL+ +L +K G +EK K+F + +L+KAT
Sbjct  253   LLCLVLWGLYKYINRRKEIKLKEKNFKRNGGLLLESELSSK-GHVEKNKLFNSKDLEKAT  311

Query  1003  DHFNADRIVGRGGQGTVYKGMLIDGQIVAVKKSQAVDEDQLEPFINEVVILSQINHRNVV  824
             ++FN DRI+GRGGQGTVYKGML DG+IVA+KKS+A+DE ++E FINEV ILSQINHRN+V
Sbjct  312   NNFNEDRILGRGGQGTVYKGMLTDGKIVAIKKSKAIDEGKVEQFINEVFILSQINHRNIV  371

Query  823   KLMGCCLETEVPILVYEFIPNGTLFGLIHNNFDNELIPLSWDIRLRIASEVACALAYLHS  644
             KL+GCCLET+VP+LVYEFIPNGTL+  +H+    E   +SWD RLRIA+E+A AL YLHS
Sbjct  372   KLLGCCLETKVPLLVYEFIPNGTLYQYLHD--PKEEYHVSWDTRLRIATEIAGALFYLHS  429

Query  643   VTLVPIYHRDIKTGNILLDEKFRAKVSDFGTSRSISIDKTHFTTMVKGTFGYLDPEYFQS  464
                +PIYHRDIK+ NILLDEK+RAKV+DFGTS+S+S+D+TH TT+V+GTFGYLDPEYFQS
Sbjct  430   AASIPIYHRDIKSTNILLDEKYRAKVADFGTSKSVSLDQTHVTTLVQGTFGYLDPEYFQS  489

Query  463   SQFTEKSDVYSFGVVLAELLTGQKPISFELDDDEDRSLVSRFLLCMEENRLMEMLDGEVI  284
             SQFT+KSDVYSFGVVL ELLTGQKPIS  L + E RSL + F++ MEENR+ +++D +V+
Sbjct  490   SQFTDKSDVYSFGVVLVELLTGQKPIS-SLREQEGRSLATYFIISMEENRVFDIVDAQVL  548

Query  283   EQGKKEDVVAMAWLAQRCLNFNGKKRPTMKEVATELDAIK  164
             ++G KE++ ++A LA+RCLN NG+ RPTMKEVA EL+ ++
Sbjct  549   KEGNKEEIASVANLAKRCLNLNGRNRPTMKEVAMELEGMR  588



>ref|XP_008229608.1| PREDICTED: wall-associated receptor kinase-like 3 [Prunus mume]
Length=750

 Score =   440 bits (1132),  Expect = 3e-136, Method: Compositional matrix adjust.
 Identities = 275/592 (46%), Positives = 357/592 (60%), Gaps = 69/592 (12%)
 Frame = -1

Query  1777  SKLSETPFMYSNDNN-FMLFGCGNAFITMPGEELDQPGYNLNCSSKNTTAPKTAHDCQ-G  1604
             + LS +PF+YS  +N F    CG  ++ +   E    G    C S       +  DC+ G
Sbjct  120   ANLSGSPFVYSGKHNKFTAVSCG--YLALVSSEKYLVG---GCRSICEGTSISPEDCEIG  174

Query  1603  INCNHLTVDYDVNTYQVNFTHSSSFNACN--YAFFlsassslpptlqslpsrqQEMVVVP  1430
             +NC   ++   ++    +        AC   YAF +         + S  S  ++M  VP
Sbjct  175   VNCCQTSIPPHLSVINTDIEDDRRARACKDVYAFLVDQDWFRNNFMASNFSVLKDMHSVP  234

Query  1429  VELRWTITQED---------VPPSYSK-YCSPSTYINPQLQWHNY-------LQCDCPGG  1301
             V L W++  +D         +P   S+ Y  P+    P  +  N        L C CP G
Sbjct  235   VVLDWSLGLDDTSLRLFQRFIPQHDSRAYDDPT----PTCKIQNVTSTSRPSLVCSCPRG  290

Query  1300  DDRNVYLSGGCEWKHKDYVISSNKLRPAII------GISASFGFVF--------------  1181
              + N YL   C     D     N+  P         G    +G+                
Sbjct  291   FEGNAYLGYDCH--DIDECTDQNRCGPGAPYCLNHNGTYTCYGYRVGGKKRIKLILIGLG  348

Query  1180  -----------LIWAFVILYkaikkrkmkklrqkffkRNGGlllqqqlLTKEGTIEKTKI  1034
                         +W   +L    KKRK  K ++ FFKRNGGLLL+QQL + E  +EK K+
Sbjct  349   VGVGLLLLLTGALWVHEVL----KKRKRIKRKEFFFKRNGGLLLEQQLSSGEVNVEKIKL  404

Query  1033  FTASELDKATDHFNADRIVGRGGQGTVYKGMLIDGQIVAVKKSQAVDEDQLEPFINEVVI  854
             F + EL+K+TD+FN DRI+G+GGQGTVYKGML DG+IVAVKKS+ VDE QL  FINEVVI
Sbjct  405   FKSKELEKSTDNFNTDRILGQGGQGTVYKGMLADGRIVAVKKSKIVDESQLSGFINEVVI  464

Query  853   LSQINHRNVVKLMGCCLETEVPILVYEFIPNGTLFGLIHNNFDNELIPLSWDIRLRIASE  674
             LSQINHRNVV+L+GCCLETEVPILVYEFIPNG L   IH    NE  PL+W++RLRIA E
Sbjct  465   LSQINHRNVVQLLGCCLETEVPILVYEFIPNGNLSQYIHEQ--NEEFPLTWEVRLRIAKE  522

Query  673   VACALAYLHSVTLVPIYHRDIKTGNILLDEKFRAKVSDFGTSRSISIDKTHFTTMVKGTF  494
             +A AL+YLH+    PIYHRDIK+ NILLD K+RAKV+DFGTSRS++ID+TH TT+V GTF
Sbjct  523   IAGALSYLHASAAFPIYHRDIKSTNILLDAKYRAKVADFGTSRSVAIDQTHLTTLVHGTF  582

Query  493   GYLDPEYFQSSQFTEKSDVYSFGVVLAELLTGQKPISFELDDDEDRSLVSRFLLCMEENR  314
             GY+DPEYFQSSQFTEKSDVYSFGVVL ELLTGQKPISF    +E +SL + F++ M+ +R
Sbjct  583   GYMDPEYFQSSQFTEKSDVYSFGVVLVELLTGQKPISFRRSQEEGKSLAAYFIISMQLDR  642

Query  313   LMEMLDGEVIEQGKKEDVVAMAWLAQRCLNFNGKKRPTMKEVATELDAIKAS  158
             L E+LD +V++ G K D++ +A LA+RCLN +G+KRPTM+EV  EL+ I+ S
Sbjct  643   LFEILDAQVVKGGSKADIITVANLARRCLNLSGRKRPTMREVTAELEGIQMS  694



>ref|XP_010088575.1| Wall-associated receptor kinase-like 9 [Morus notabilis]
 gb|EXB36716.1| Wall-associated receptor kinase-like 9 [Morus notabilis]
Length=729

 Score =   439 bits (1130),  Expect = 3e-136, Method: Compositional matrix adjust.
 Identities = 275/596 (46%), Positives = 369/596 (62%), Gaps = 52/596 (9%)
 Frame = -1

Query  1777  SKLSETPFMYSNDNN-FMLFGCGNAFITMPGEEL--DQPGYNLNCSSKNTTAPKTAHDCQ  1607
             + L+ +PF++S   N F    C    +     +   D  G  ++   K TT       C 
Sbjct  98    ANLTGSPFVFSQKKNRFTAVSCDQLALMKSTNDYYADTVGACMSICDKTTTE----KSCN  153

Query  1606  GINCNHLTVDYDVNTYQVNFTHSSSF----------NACNYAFFlsassslpptlqslps  1457
             G+NC   T+  ++ ++   F    S             C YAF +               
Sbjct  154   GMNCCQTTIPLNLRSFHTEFGDQISIYWRNNSRRQRGECVYAFLVDLEWFQVNHSGGYKG  213

Query  1456  rqQEMVVVPVELRWTI---TQEDVPPSYSKYCSPSTYINPQLQWHNYLQCDCPGGDDRNV  1286
              + EM  VPV L W++   T ED+  S++   + S +        ++ +C C  G + N 
Sbjct  214   IK-EMGKVPVALEWSLYNWTMEDLGISFALNSTSSFHCENDRNASSF-KCYCNRGFEGNP  271

Query  1285  YLSGGCEWKHKDYVISSN----------------------KLRPA----IIGISASFGFV  1184
             Y+  GC+ K++     +N                      + R A    I+G+S  F  +
Sbjct  272   YIVDGCQEKNECKSDGNNPCGDGICMNLSGSYQCLWPDDPRKRTAGKRVILGLSVGFSLL  331

Query  1183  FLIWAFVILYkaikkrkmkklrqkffkRNGGlllqqqlLTKEGTIEKTKIFTASELDKAT  1004
             FL+ +   L+K IKKR+  + ++KFFKRNGGLLLQQ++ + +  +EKTK+FTA EL KAT
Sbjct  332   FLLISSWCLHKIIKKRRRTRRKEKFFKRNGGLLLQQEMSSSKVNVEKTKLFTAKELKKAT  391

Query  1003  DHFNADRIVGRGGQGTVYKGMLIDGQIVAVKKSQAVDEDQLEPFINEVVILSQINHRNVV  824
             D+FNADRI+G+GGQGTVYKGML DG+IVAVKKS+ +DE ++  FINEVVILSQINHRNVV
Sbjct  392   DNFNADRILGQGGQGTVYKGMLADGRIVAVKKSKILDEGKIAEFINEVVILSQINHRNVV  451

Query  823   KLMGCCLETEVPILVYEFIPNGTLFGLIHNNFDNELIPLSWDIRLRIASEVACALAYLHS  644
             KL+GCCLETEVP+LVYEFI NGTL   IHN   NE  P +W+IRLR+A+E+A AL YLHS
Sbjct  452   KLLGCCLETEVPLLVYEFIQNGTLSEYIHNK--NEEFPFTWEIRLRVATEIAGALFYLHS  509

Query  643   VTLVPIYHRDIKTGNILLDEKFRAKVSDFGTSRSISIDKTHFTTMVKGTFGYLDPEYFQS  464
                 PIYHRDIK+ N+LLD+K++AK++DFGTSR++++D+TH TT V GTFGYLDPEYFQS
Sbjct  510   AASRPIYHRDIKSTNVLLDDKYKAKIADFGTSRTLNVDQTHLTTQVHGTFGYLDPEYFQS  569

Query  463   SQFTEKSDVYSFGVVLAELLTGQKPISFELDDDEDRSLVSRFLLCMEENRLMEMLDGEVI  284
             +QFTEKSDVYSFGV+L ELLTGQK IS      E RSL   F+L M+ENRL ++LD +V+
Sbjct  570   NQFTEKSDVYSFGVLLVELLTGQKAISMN-RSPEGRSLAIYFILSMKENRLFDILDAKVM  628

Query  283   EQGKKEDVVAMAWLAQRCLNFNGKKRPTMKEVATELDAIKASNSHLPLAMEAFEIE  116
             E G KE+V+ +A +A RCL+ +G+KRPTMKEV  EL+ IK S        +  EIE
Sbjct  629   E-GPKEEVLVVANIANRCLSLSGRKRPTMKEVTVELEGIKISEKASNFQPQYEEIE  683



>ref|XP_010532062.1| PREDICTED: wall-associated receptor kinase-like 22 [Tarenaya 
hassleriana]
Length=753

 Score =   440 bits (1132),  Expect = 3e-136, Method: Compositional matrix adjust.
 Identities = 274/617 (44%), Positives = 375/617 (61%), Gaps = 44/617 (7%)
 Frame = -1

Query  1879  DFLGMSYDSQTITIKESISPS-CQGSNNFSNIIHNSKLSETPFMYSNDNNFMLFGCG-NA  1706
             +++ ++    T++I   I+ S C G  +  ++++   L+ +PF     N  +  GC   A
Sbjct  98    NYVRLASSDLTVSITSPIASSGCSGREDVGSLLN---LTGSPFFVGYGNKLVAMGCDIKA  154

Query  1705  FITMPGEELDQPGYNLNCSSKNTTAPKTAHDCQGINCNHLTVDYDVNTYQVNFTHSSSFN  1526
             F+T    E    G    C   +        +    +   L V   V T  ++ T+S+   
Sbjct  155   FMT--DVEPRIIGCQSTCDRGSKNRGYGYCEAAAPSGGSLQV-IGVRTENMDGTNSTG-E  210

Query  1525  ACNYAFFlsassslpptlqslpsrqQEMVVVPVELRWTITQEDVPPSYSKYCSPSTYIN-  1349
              C  AF    + S     +             + L W I   D+    +   S   YI  
Sbjct  211   GCRVAFLTDRTYSSSAVREPRAFLANGSSSSSLRLYWYIPFMDLSAPSNCLNSTRGYITT  270

Query  1348  -----------PQLQWHNYLQCDCPGGDDRNVYLSGGC----EWKHK-------------  1253
                          L   +Y  C C  G   N YL GGC    E   K             
Sbjct  271   SETRENCHCRYAHLSGISYASCGCISGYRGNPYLPGGCRDIDECSKKPSPCGDGSTCVNT  330

Query  1252  --DYVISSNKLRPAIIGISASFGFVFLIWAFVILYkaikkrkmkklrqkffkRNGGlllq  1079
                Y     K+ PAI+GIS+ FG + L+     LYK IKKRK    ++KFF+RNGGLLLQ
Sbjct  331   RGSYKCVQKKISPAIVGISSGFGLLLLVAGMYWLYKFIKKRKEISRKKKFFERNGGLLLQ  390

Query  1078  qq-lLTKEGTIEKTKIFTASELDKATDHFNADRIVGRGGQGTVYKGMLIDGQIVAVKKSQ  902
             QQ   T EG +EKTKIF++ EL+KAT++F+ DR++G+GGQGTVYKGML+DG+I+AVKKS+
Sbjct  391   QQLTSTMEGNVEKTKIFSSKELEKATENFSKDRVLGQGGQGTVYKGMLLDGRIIAVKKSK  450

Query  901   AVDEDQLEPFINEVVILSQINHRNVVKLMGCCLETEVPILVYEFIPNGTLFGLIHNNFDN  722
             AVD+D+LE FINEVVILSQINHRN+VKL+GCCLET+VP+LVYEFI NG LF  +H+  D+
Sbjct  451   AVDKDKLEEFINEVVILSQINHRNIVKLLGCCLETDVPLLVYEFISNGNLFEHLHDGSDD  510

Query  721   ELIPLSWDIRLRIASEVACALAYLHSVTLVPIYHRDIKTGNILLDEKFRAKVSDFGTSRS  542
                 ++W+ RLRI  E+A AL+YLHS    PI+HRDIK+ NILLDEK+R+KVSDFGTSRS
Sbjct  511   --YTMTWEERLRITVEIAGALSYLHSAASCPIFHRDIKSSNILLDEKYRSKVSDFGTSRS  568

Query  541   ISIDKTHFTTMVKGTFGYLDPEYFQSSQFTEKSDVYSFGVVLAELLTGQKPISFELDDDE  362
             ++ID+TH TT+V GTFGYLDPEYFQSS FT+KSDVYSFGVVLAEL+TG+K +S ++  +E
Sbjct  569   VTIDQTHVTTLVAGTFGYLDPEYFQSSHFTDKSDVYSFGVVLAELITGEKAVS-DVRSEE  627

Query  361   DRSLVSRFLLCMEENRLMEMLDGEVIEQGKKEDVVAMAWLAQRCLNFNGKKRPTMKEVAT  182
             +R L + F+  M+E RL +M+DG + E  K E V+A+A LA++CLN  GKKRP+M+EV+ 
Sbjct  628   NRGLAAHFIEAMKEKRLDDMVDGRIKEHSKLEQVMAVAKLARKCLNLKGKKRPSMREVSM  687

Query  181   ELDAIKASNSHLPLAME  131
              L+ I++S+   P  ++
Sbjct  688   GLERIRSSSPGDPFLVD  704



>ref|XP_006490107.1| PREDICTED: wall-associated receptor kinase-like 8-like [Citrus 
sinensis]
Length=724

 Score =   439 bits (1129),  Expect = 3e-136, Method: Compositional matrix adjust.
 Identities = 232/359 (65%), Positives = 291/359 (81%), Gaps = 3/359 (1%)
 Frame = -1

Query  1234  NKLRPAIIGISASFGFVFLIWAFVILYkaikkrkmkklrqkffkRNGGlllqqqlLTKEG  1055
             ++++  IIG  +  G   L+     L K +K+R+  KL++ FFK+NGGLLLQQQL + EG
Sbjct  319   SRVKAIIIGCGSGLGLFILLIGMWGLRKFVKRRREIKLKRMFFKKNGGLLLQQQLSSNEG  378

Query  1054  TIEKTKIFTASELDKATDHFNADRIVGRGGQGTVYKGMLIDGQIVAVKKSQAVDEDQLEP  875
              IEKTK+FT  +L+KATD++NA+RI+G+GGQGTVYKGML DG IVAVKKS+ VDE  +E 
Sbjct  379   NIEKTKLFTKMDLEKATDNYNANRILGQGGQGTVYKGMLADGGIVAVKKSKLVDESNVEQ  438

Query  874   FINEVVILSQINHRNVVKLMGCCLETEVPILVYEFIPNGTLFGLIHNNFDNELIPLSWDI  695
             FINEVVILSQINHRNVVKL+GCCLETEVP+LVYEFIPNGTL+  +H+    E  P++W++
Sbjct  439   FINEVVILSQINHRNVVKLLGCCLETEVPLLVYEFIPNGTLYHYLHDQ--TEEFPITWEM  496

Query  694   RLRIASEVACALAYLHSVTLVPIYHRDIKTGNILLDEKFRAKVSDFGTSRSISIDKTHFT  515
             RLRIA EVA A++YLHS T +PIYHRDIK+ NILLD+K+RAKVSDFG SR+I +D+TH T
Sbjct  497   RLRIAIEVAGAMSYLHSATSIPIYHRDIKSSNILLDDKYRAKVSDFGASRTIKVDQTHLT  556

Query  514   TMVKGTFGYLDPEYFQSSQFTEKSDVYSFGVVLAELLTGQKPISFELDDDEDRSLVSRFL  335
             T V+GTFGYLDPEYF+SSQFTEKSDVYSFGVVL ELLTGQKPI    D +EDRSLV  FL
Sbjct  557   TRVQGTFGYLDPEYFRSSQFTEKSDVYSFGVVLVELLTGQKPIR-STDAEEDRSLVGFFL  615

Query  334   LCMEENRLMEMLDGEVIEQGKKEDVVAMAWLAQRCLNFNGKKRPTMKEVATELDAIKAS  158
               M E+RL E+L+  V+++GK+E+++ +A L +RCLN  GKKRP+MKEVA EL+ I+AS
Sbjct  616   QAMNEDRLFEVLEARVLKEGKEEEIITVAMLGKRCLNMIGKKRPSMKEVAFELEGIRAS  674



>ref|XP_010519689.1| PREDICTED: wall-associated receptor kinase-like 22 [Tarenaya 
hassleriana]
Length=745

 Score =   439 bits (1130),  Expect = 3e-136, Method: Compositional matrix adjust.
 Identities = 268/599 (45%), Positives = 366/599 (61%), Gaps = 42/599 (7%)
 Frame = -1

Query  1852  QTITIKESISPS-CQGSNNFSNIIHNSKLSETPFMYSNDNNFMLFGCGNAFITMPGEELD  1676
             +T+ I+  ++ S C      S  + N  L  +PF     N+ +  GC N    M     +
Sbjct  98    RTVRIRSPVTSSGCADGRGDSGSLLN--LRGSPFFLGEGNSLVSVGC-NTKALMTNVNPN  154

Query  1675  QPGYNLNCSSKNTTAPKTAHDCQGINCNHLTVDYD-------VNTYQVNFTHSSSFNACN  1517
               G   +C   +    +    C G  C               V T +V+ T+ +    C 
Sbjct  155   IIGCESSCDEGSGLEQEDQSFCNGYKCCQAATPSSRFLQVIGVRTERVDGTNDTR-GGCR  213

Query  1516  YAFFlsassslpptlqslpsrqQEMVVVPVELRWTITQEDVPPSYSKYCS--PSTYINPQ  1343
              AF    +       + L           ++L+W ++  D+  + S  C    +   N +
Sbjct  214   VAFLTDQTYFSSNISEPLAFLANGSTTT-LQLQWFMSPTDLQLAASSDCGDLSNARSNCE  272

Query  1342  LQWHN-----YLQCDCPGGDDRNVYLSGGC-------EWKHK------------DYVISS  1235
               +HN     Y  C C  G   N YL GGC       E +++             Y   +
Sbjct  273   CGYHNVSGISYGSCRCRYGYRGNPYLPGGCKDIDECSEDRYRCGGRITCVNTPGSYKCVT  332

Query  1234  NKLRPAIIGISASFGFVFLIWAFVILYkaikkrkmkklrqkffkRNGGlllqqqlLTKEG  1055
             NK    I G+S  FG +  +    +LYK IKKRK    ++ FFKRNGG+LLQQQL + EG
Sbjct  333   NKSFLTIAGLSLGFGLLIAVGGVYLLYKFIKKRKEINRKKNFFKRNGGMLLQQQLTSTEG  392

Query  1054  TIEKTKIFTASELDKATDHFNADRIVGRGGQGTVYKGMLIDGQIVAVKKSQAVDEDQLEP  875
              +EKT+IF + EL+KAT++F+  R++G+GGQGTVYKGML+DG+IVAVKKS+AVDED+LE 
Sbjct  393   NVEKTRIFGSRELEKATENFSVKRVLGQGGQGTVYKGMLVDGRIVAVKKSKAVDEDKLEE  452

Query  874   FINEVVILSQINHRNVVKLMGCCLETEVPILVYEFIPNGTLFGLIHNNFDNELIPLSWDI  695
             FINEVVILSQ+NHRN+VKL+GCCLETEVP+LVYEFIPNG LF  +H+  D+    ++W+ 
Sbjct  453   FINEVVILSQVNHRNIVKLLGCCLETEVPLLVYEFIPNGNLFEYLHDGSDD--YTMTWEE  510

Query  694   RLRIASEVACALAYLHSVTLVPIYHRDIKTGNILLDEKFRAKVSDFGTSRSISIDKTHFT  515
             RLRIA EV+ AL+YLHS    P+YHRDIK+ NILLDEK+R KVSDFGTSRSI++D+TH T
Sbjct  511   RLRIAIEVSRALSYLHSAASCPVYHRDIKSSNILLDEKYRGKVSDFGTSRSIAVDQTHLT  570

Query  514   TMVKGTFGYLDPEYFQSSQFTEKSDVYSFGVVLAELLTGQKPISFELDDDEDRSLVSRFL  335
             T+V GTFGYLDPEYFQ+SQFT+KSDVYSFGVVL EL+TG+K +S  +  +E+R L + F+
Sbjct  571   TLVAGTFGYLDPEYFQTSQFTDKSDVYSFGVVLVELITGKKAVS-NVRSEENRGLAAHFV  629

Query  334   LCMEENRLMEMLDGEVIEQGKKEDVVAMAWLAQRCLNFNGKKRPTMKEVATELDAIKAS  158
               M ENRL+ M+D  + E  K E V+++A LA++CLN  GKKRP+M+EV+ EL+ I++S
Sbjct  630   EAMRENRLLGMVDARIKEDSKLEQVMSVAKLARKCLNLKGKKRPSMREVSMELERIRSS  688



>ref|XP_006427111.1| hypothetical protein CICLE_v10025047mg [Citrus clementina]
 gb|ESR40351.1| hypothetical protein CICLE_v10025047mg [Citrus clementina]
Length=690

 Score =   437 bits (1125),  Expect = 5e-136, Method: Compositional matrix adjust.
 Identities = 208/312 (67%), Positives = 261/312 (84%), Gaps = 3/312 (1%)
 Frame = -1

Query  1057  GTIEKTKIFTASELDKATDHFNADRIVGRGGQGTVYKGMLIDGQIVAVKKSQAVDEDQLE  878
             GT+EKTK+FT+ EL+KATD+FN +RI+G+GGQGTVYKGML DG+IVAVKKS+ +DE ++E
Sbjct  339   GTVEKTKLFTSKELEKATDYFNLNRILGQGGQGTVYKGMLADGKIVAVKKSKVIDESKVE  398

Query  877   PFINEVVILSQINHRNVVKLMGCCLETEVPILVYEFIPNGTLFGLIHNNFDNELIPLSWD  698
              FINEVVILSQINHRNVVKL+GCCLETEVP+LVYEFIPNGTLF  IH+   NE  P++W+
Sbjct  399   EFINEVVILSQINHRNVVKLLGCCLETEVPLLVYEFIPNGTLFQYIHDQ--NEDFPITWE  456

Query  697   IRLRIASEVACALAYLHSVTLVPIYHRDIKTGNILLDEKFRAKVSDFGTSRSISIDKTHF  518
             +RLRIA E++ AL+YLHS   +PIYHRDIK+ NILLD+K+RAKVSDFG SRS+++D+TH 
Sbjct  457   MRLRIAIEISGALSYLHSAASIPIYHRDIKSTNILLDDKYRAKVSDFGASRSMAVDQTHM  516

Query  517   TTMVKGTFGYLDPEYFQSSQFTEKSDVYSFGVVLAELLTGQKPISFELDDDEDRSLVSRF  338
             TT V GTFGYLDPEYF+SSQFT+KSDVYSFGVVLAELLTG+KPI F    +E++SL + F
Sbjct  517   TTQVHGTFGYLDPEYFRSSQFTDKSDVYSFGVVLAELLTGEKPIRFTT-LEENKSLAAYF  575

Query  337   LLCMEENRLMEMLDGEVIEQGKKEDVVAMAWLAQRCLNFNGKKRPTMKEVATELDAIKAS  158
             L  M+E RL E+LD +V+++G K++++ +A L +RCLN NGKKRPTM+EVA+EL  IKA 
Sbjct  576   LCAMKEERLFEILDAQVMKEGGKDEIITVAKLTKRCLNLNGKKRPTMREVASELAGIKAG  635

Query  157   NSHLPLAMEAFE  122
             N    +  E  E
Sbjct  636   NGASNVMEEGLE  647



>emb|CAN82287.1| hypothetical protein VITISV_028337 [Vitis vinifera]
Length=413

 Score =   427 bits (1099),  Expect = 5e-136, Method: Compositional matrix adjust.
 Identities = 210/332 (63%), Positives = 271/332 (82%), Gaps = 3/332 (1%)
 Frame = -1

Query  1099  NGGlllqqqlLTKEGTIEKTKIFTASELDKATDHFNADRIVGRGGQGTVYKGMLIDGQIV  920
             NGGLLL+QQL + EG ++KTK+FT+ EL+KATD +N +R++G+GGQGTVYKGML+DG+IV
Sbjct  49    NGGLLLEQQLSSSEGNVDKTKLFTSKELEKATDRYNENRVIGQGGQGTVYKGMLMDGRIV  108

Query  919   AVKKSQAVDEDQLEPFINEVVILSQINHRNVVKLMGCCLETEVPILVYEFIPNGTLFGLI  740
             AVKK + V + +LE FINEVVILSQINHRNVVKL+GCCLE EVP+LVYE+IPNGTL   I
Sbjct  109   AVKKLKIVGDGKLEQFINEVVILSQINHRNVVKLLGCCLEIEVPLLVYEYIPNGTLSEHI  168

Query  739   HNNFDNELIPLSWDIRLRIASEVACALAYLHSVTLVPIYHRDIKTGNILLDEKFRAKVSD  560
             H+   NE  P++W +RL+IA+EVA AL+YLHS   +PIYHRDIK+ NILLD+K+RAKV+D
Sbjct  169   HDQ--NEEFPITWKMRLQIATEVAGALSYLHSAASIPIYHRDIKSTNILLDDKYRAKVAD  226

Query  559   FGTSRSISIDKTHFTTMVKGTFGYLDPEYFQSSQFTEKSDVYSFGVVLAELLTGQKPISF  380
             FGTS+S++ID+TH TT V+GTFGYLDPEYFQSSQFTEKSDVYSFG+VL ELLTG+KPI  
Sbjct  227   FGTSKSVAIDQTHLTTKVQGTFGYLDPEYFQSSQFTEKSDVYSFGIVLIELLTGKKPI-L  285

Query  379   ELDDDEDRSLVSRFLLCMEENRLMEMLDGEVIEQGKKEDVVAMAWLAQRCLNFNGKKRPT  200
              +   E +SL S F++ M+E+RL ++LD  V+++G+KE++ A+A+LA+RC+N NGKKRPT
Sbjct  286   SIGSGEGKSLASYFIMSMKEDRLSDLLDARVVKEGRKEEINAIAFLAKRCINLNGKKRPT  345

Query  199   MKEVATELDAIKASNSHLPLAMEAFEIESDFI  104
             M EVA EL+ I+           + E+E D I
Sbjct  346   MMEVAMELERIRKCEGDFNAQENSDEVEYDTI  377



>gb|KCW89810.1| hypothetical protein EUGRSUZ_A02052 [Eucalyptus grandis]
Length=574

 Score =   433 bits (1114),  Expect = 6e-136, Method: Compositional matrix adjust.
 Identities = 266/547 (49%), Positives = 360/547 (66%), Gaps = 48/547 (9%)
 Frame = -1

Query  1657  NCSSKNTTAPKTAHDCQGINCNHLTVDYDVNTYQVNFTH------SSSFNACNYAFFlsa  1496
             NCSSK+    +++    G  C   ++   + +Y V F        ++    C+YAF +  
Sbjct  11    NCSSKS----ESSRCFNGTTCCFTSIPNQITSYSVEFQTPYGRAIATRGAGCSYAFLVEE  66

Query  1495  ssslpptlqslpsrqQEMVVVPVELRWTITQEDVPPSYSKYCSPSTY-----INPQLQWH  1331
             +        SL         VPV L W I  +D     ++  + ++      ++P   + 
Sbjct  67    AWWFNTDFYSLLPS-----AVPVVLEWGINSDDFELLSNRNHTGNSGGCFWDLSPMTVY-  120

Query  1330  NYLQCDCPGGDDRNVYLSGGC----EWKHKDYVISSNKL--RPA-----------IIGIS  1202
                 C C  G   N YL  GC    E K   Y+    K   RP            IIG+S
Sbjct  121   ----CSCNEGYKGNYYLPDGCQDVDECKEDPYINCRGKCVNRPGSYTCIDYKIITIIGVS  176

Query  1201  ASFGFVFLIWAFVILYkaikkrkmkklrqkffkRNGGlllqqqlLTKEGT-IEKTKIFTA  1025
                G + L      LYK I +R++ KL+++FFKRNGGLLLQQ L + E + ++K K+FT+
Sbjct  177   TGIGAIALPLLSWGLYKYIVRRRVAKLKRQFFKRNGGLLLQQHLSSIEDSHVDKGKLFTS  236

Query  1024  SELDKATDHFNADRIVGRGGQGTVYKGMLIDGQIVAVKKSQAVDEDQLEPFINEVVILSQ  845
              E+D ATDHFN +RI+GRGGQGTVYKGML+DG I+AVKKS++VD  Q++ F+NEVVILSQ
Sbjct  237   MEIDTATDHFNENRILGRGGQGTVYKGMLLDGMIIAVKKSKSVDVGQVQQFVNEVVILSQ  296

Query  844   INHRNVVKLMGCCLETEVPILVYEFIPNGTLFGLIHNNFDNELIPLSWDIRLRIASEVAC  665
             INHRNVVKL+G CLE+EVP+LVYEFIPNGTL+  +H+   +E  P SW+IRLRIA+EVA 
Sbjct  297   INHRNVVKLLGFCLESEVPLLVYEFIPNGTLYHYLHD--PDEEFPFSWEIRLRIANEVAG  354

Query  664   ALAYLHSVTLVPIYHRDIKTGNILLDEKFRAKVSDFGTSRSISIDKTHFTTMVKGTFGYL  485
             AL+YLH    +PI+HRDIK+ NILLDEK++AKV+DFG S+S+ ID+TH TTMV+GTFGYL
Sbjct  355   ALSYLHFAAAIPIHHRDIKSSNILLDEKYQAKVADFGASKSLPIDQTHLTTMVRGTFGYL  414

Query  484   DPEYFQSSQFTEKSDVYSFGVVLAELLTGQKPISFELDDDEDRSLVSRFLLCMEENRLME  305
             DPEY+Q+SQFT+KSDVYSFGVVLAELLTG+KPIS +L  +EDR+L S F++ MEENRL +
Sbjct  415   DPEYYQTSQFTDKSDVYSFGVVLAELLTGEKPIS-QLRAEEDRNLASYFVISMEENRLFD  473

Query  304   MLDGEVIEQGKKEDVVAMAWLAQRCLNFNGKKRPTMKEVATELDAIKASNSHLPLAMEAF  125
             +LD EV++ G++E+++ ++ LA+RCLN NG+ RPTMKEVA EL+ +++  +  P      
Sbjct  474   VLDKEVLDHGEQEEIIVVSNLAKRCLNPNGRYRPTMKEVAMELEQVQSQRN--PTDFRQN  531

Query  124   EIESDFI  104
             E E D I
Sbjct  532   EEEIDHI  538



>gb|KDO45148.1| hypothetical protein CISIN_1g042371mg, partial [Citrus sinensis]
Length=400

 Score =   427 bits (1097),  Expect = 6e-136, Method: Compositional matrix adjust.
 Identities = 216/329 (66%), Positives = 265/329 (81%), Gaps = 3/329 (1%)
 Frame = -1

Query  1099  NGGlllqqqlLTKEGTIEKTKIFTASELDKATDHFNADRIVGRGGQGTVYKGMLIDGQIV  920
             NGGL+LQQQL + +G+I++ K+FT  ELDKATDHFN +RI+G+GGQGTVYKGML DG+IV
Sbjct  51    NGGLVLQQQLTSSDGSIDRCKLFTTKELDKATDHFNVNRILGQGGQGTVYKGMLADGRIV  110

Query  919   AVKKSQAVDEDQLEPFINEVVILSQINHRNVVKLMGCCLETEVPILVYEFIPNGTLFGLI  740
             AVKKS+ V E +LE FINEVVILSQINHRNVVKL+GCCLETEVP+LVYEFI NGTLF  +
Sbjct  111   AVKKSKIVHEGKLEEFINEVVILSQINHRNVVKLLGCCLETEVPLLVYEFISNGTLFQYL  170

Query  739   HNNFDNELIPLSWDIRLRIASEVACALAYLHSVTLVPIYHRDIKTGNILLDEKFRAKVSD  560
             H+   NE  PL+W++RLRIA+EVA +L+YLHS   +PIYHRDIK+ NILL+EK+ AKV+D
Sbjct  171   HDQ--NEEFPLTWEMRLRIATEVAGSLSYLHSAASMPIYHRDIKSTNILLNEKYTAKVAD  228

Query  559   FGTSRSISIDKTHFTTMVKGTFGYLDPEYFQSSQFTEKSDVYSFGVVLAELLTGQKPISF  380
             FGTS+ I ID+TH TT V+GTFGYLDPEYF+S QFT+KSDVYSFGVVL ELLTGQKPI  
Sbjct  229   FGTSKFIVIDQTHVTTKVQGTFGYLDPEYFRSGQFTDKSDVYSFGVVLVELLTGQKPIIL  288

Query  379   ELDDDEDRSLVSRFLLCMEENRLMEMLDGEVIEQGKKEDVVAMAWLAQRCLNFNGKKRPT  200
                  E   L + F+L MEENRL + LD +V++ G+KE+++ +A LA RCLN NGK+RPT
Sbjct  289   T-GSKEATGLAAYFILSMEENRLYDFLDDQVLKVGQKEEIMTIATLATRCLNLNGKRRPT  347

Query  199   MKEVATELDAIKASNSHLPLAMEAFEIES  113
             MKEVA EL+ I+A    + +     EIES
Sbjct  348   MKEVAMELERIQALQKDINVKQICDEIES  376



>ref|XP_008229712.1| PREDICTED: wall-associated receptor kinase-like 1 [Prunus mume]
Length=471

 Score =   429 bits (1104),  Expect = 6e-136, Method: Compositional matrix adjust.
 Identities = 244/415 (59%), Positives = 301/415 (73%), Gaps = 26/415 (6%)
 Frame = -1

Query  1333  HNYLQCDCPGGDDRNVYLSGGCE-----------------WKHKDYVISSNKLRP-----  1220
             +N+ QC C  G   N YL  GC+                  +  D+V      RP     
Sbjct  4     NNHWQCSCKTGYQGNPYLLDGCQDIDECLNSSSCRAGTCINRPGDFVCYQPDPRPIRRIN  63

Query  1219  -AIIGISASFGFVFLIWAFVILYkaikkrkmkklrqkffkRNGGlllqqqlLTKEGTIEK  1043
              A++      G +FL+      +K IKKRK  K +QKFFK+NGGLLL++QL + E  +EK
Sbjct  64    VAVLVAGGVIGLLFLLIGAWWSHKVIKKRKDNKRKQKFFKQNGGLLLEKQLSSGEVNVEK  123

Query  1042  TKIFTASELDKATDHFNADRIVGRGGQGTVYKGMLIDGQIVAVKKSQAVDEDQLEPFINE  863
              K+F++ +LDKATD F+ DRI+G+GGQGTVYKGML DG+IVAVKKS+ VD  ++  FINE
Sbjct  124   IKLFSSKDLDKATDKFSIDRILGQGGQGTVYKGMLSDGRIVAVKKSKIVDGGEVGQFINE  183

Query  862   VVILSQINHRNVVKLMGCCLETEVPILVYEFIPNGTLFGLIHNNFDNELIPLSWDIRLRI  683
             +VILSQI HRNVVK++GCCLETEVP+LVYEFIPNGTL   IH+   +E   L+W++RLRI
Sbjct  184   IVILSQIIHRNVVKILGCCLETEVPLLVYEFIPNGTLSQYIHH--PDEEFSLTWEMRLRI  241

Query  682   ASEVACALAYLHSVTLVPIYHRDIKTGNILLDEKFRAKVSDFGTSRSISIDKTHFTTMVK  503
             A EVA AL+YLHS    PIYHRDIK+ NILLDEK+RAKV+DFGTSRS+SID+TH TT+V 
Sbjct  242   AIEVAGALSYLHSAASFPIYHRDIKSSNILLDEKYRAKVADFGTSRSVSIDQTHLTTLVH  301

Query  502   GTFGYLDPEYFQSSQFTEKSDVYSFGVVLAELLTGQKPISFELDDDEDRSLVSRFLLCME  323
             GTFGYLDPEYFQSSQFTEKSDVYSFGVVLAELLTGQKP+SF +   E RSL + FLL ME
Sbjct  302   GTFGYLDPEYFQSSQFTEKSDVYSFGVVLAELLTGQKPVSF-MRSQESRSLATYFLLSME  360

Query  322   ENRLMEMLDGEVIEQGKKEDVVAMAWLAQRCLNFNGKKRPTMKEVATELDAIKAS  158
              N L ++LD +V++ G+KE + A+A LA RCLN NG+ RPTMKEVA EL+ I+ S
Sbjct  361   NNLLFDILDSQVMKDGRKEKITAVANLAVRCLNLNGRNRPTMKEVAVELEGIQLS  415



>ref|XP_010497637.1| PREDICTED: wall-associated receptor kinase-like 10 isoform X4 
[Camelina sativa]
Length=502

 Score =   431 bits (1107),  Expect = 6e-136, Method: Compositional matrix adjust.
 Identities = 238/422 (56%), Positives = 306/422 (73%), Gaps = 27/422 (6%)
 Frame = -1

Query  1333  HNYLQCDCPGGDDRNVYLSGGC-------EWKHKDY------------------VISSNK  1229
              +Y  C C GG   N YLS GC       E K + +                      NK
Sbjct  40    RSYRSCMCNGGYRGNPYLSSGCIDIDECEEAKAEGHNRCGEGSDCKNIPGNLSCTSKKNK  99

Query  1228  LRPAIIGISASFGFVFLIWAFVILYkaikkrkmkklrqkffkRNGGlllqqqlLTKEGTI  1049
                 I+GIS  FG + L      LYK I+K++  K ++KFFKRNGGLLLQQQL + EG +
Sbjct  100   TLAIILGISLGFGLLVLAIGVWWLYKFIRKQREIKRKKKFFKRNGGLLLQQQLFSNEGNV  159

Query  1048  EKTKIFTASELDKATDHFNADRIVGRGGQGTVYKGMLIDGQIVAVKKSQAVDEDQLEPFI  869
             E+T++F++ EL+KAT+ F+ +R++G+GGQGTVYKGML+DG+IVAVKKS+ VDED+LE FI
Sbjct  160   ERTRVFSSKELEKATEKFSVNRVLGQGGQGTVYKGMLVDGRIVAVKKSKVVDEDKLEEFI  219

Query  868   NEVVILSQINHRNVVKLMGCCLETEVPILVYEFIPNGTLF-GLIHNNFDNELIPLSWDIR  692
             NEVVILSQINHRN+VKL+GCCLET+VPILVYEFIPNG LF  L H++  ++    +W++R
Sbjct  220   NEVVILSQINHRNIVKLLGCCLETDVPILVYEFIPNGNLFEHLHHDDESDDYTMATWEMR  279

Query  691   LRIASEVACALAYLHSVTLVPIYHRDIKTGNILLDEKFRAKVSDFGTSRSISIDKTHFTT  512
             LRIA ++A AL+YLHS    PIYHRDIK+ NI+LDEK+RAKVSDFGTSRS++ID TH TT
Sbjct  280   LRIAVDIAGALSYLHSAASFPIYHRDIKSTNIMLDEKYRAKVSDFGTSRSVTIDHTHLTT  339

Query  511   MVKGTFGYLDPEYFQSSQFTEKSDVYSFGVVLAELLTGQKPISFELDDDEDRSLVSRFLL  332
             +V GT GY+DPEYFQSSQFT+KSDVYSFGVVL EL+TG+KPISF L  DE+R+L + F+L
Sbjct  340   VVAGTVGYVDPEYFQSSQFTDKSDVYSFGVVLVELITGEKPISF-LRSDENRTLATYFIL  398

Query  331   CMEENRLMEMLDGEVIEQGKKEDVVAMAWLAQRCLNFNGKKRPTMKEVATELDAIKASNS  152
              M+ ++L  ++D  + +    E V A+A LA+RCLN NGKKRP M+EV+TEL+ I+ S  
Sbjct  399   AMKNSKLSSIIDARIKDNCNMEQVTAVANLARRCLNLNGKKRPNMREVSTELERIRNSQV  458

Query  151   HL  146
              L
Sbjct  459   QL  460



>ref|XP_006495309.1| PREDICTED: wall-associated receptor kinase-like 9-like [Citrus 
sinensis]
Length=713

 Score =   437 bits (1125),  Expect = 9e-136, Method: Compositional matrix adjust.
 Identities = 238/384 (62%), Positives = 297/384 (77%), Gaps = 4/384 (1%)
 Frame = -1

Query  1312  CPGGDDRNVYLSGGCEWKHKDYVISSNKLRPAIIGISASFGFVFLIWAFVILYkaikkrk  1133
             CP G + +      C  +    +  ++ ++  IIG ++  G +FL+     LYK IK+R+
Sbjct  293   CPKGYNSSNPPFSDCRNEPNPILHKNSHVKFIIIGCNSGLGMLFLLIGTWWLYKFIKRRR  352

Query  1132  mkklrqkffkRNGGlllqqqlLTKEGTIEKTKIFTASELDKATDHFNADRIVGRGGQGTV  953
               KL+QKFFKRNGGLLLQQQ  + EG  EKTK+FT+ EL+ ATD+FN +RI+G+GGQGTV
Sbjct  353   EIKLKQKFFKRNGGLLLQQQSSSNEGNTEKTKLFTSMELEMATDNFNTNRILGQGGQGTV  412

Query  952   YKGMLIDGQIVAVKKSQAVDEDQLEPFINEVVILSQINHRNVVKLMGCCLETEVPILVYE  773
             YKGML DG+I AVKKS+ VDE  +E FINEVVIL+QINHRNVVKL GCCLETEVP+LVYE
Sbjct  413   YKGMLTDGRIAAVKKSKLVDESNIEQFINEVVILTQINHRNVVKLFGCCLETEVPLLVYE  472

Query  772   FIPNGTLFGLIHNNFDNELIPLSWDIRLRIASEVACALAYLHSVTLVPIYHRDIKTGNIL  593
             FIPNGTL+  IH   + E   ++W++RL IA EV+  L+YLHS T +PIYHRDIK+ NIL
Sbjct  473   FIPNGTLYQYIH---EIEEFSITWEMRLLIAIEVSSTLSYLHSTTSIPIYHRDIKSANIL  529

Query  592   LDEKFRAKVSDFGTSRSISIDKTHFTTMVKGTFGYLDPEYFQSSQFTEKSDVYSFGVVLA  413
             LD+KFRAKVSDFG SRS++ID+TH TT V GTFGYLDPEYF+SSQFTEKSDVYSFGVVL 
Sbjct  530   LDDKFRAKVSDFGASRSVTIDQTHLTTRVLGTFGYLDPEYFRSSQFTEKSDVYSFGVVLV  589

Query  412   ELLTGQKPISFELDDDEDRSLVSRFLLCMEENRLMEMLDGEVIEQGKKEDVVAMAWLAQR  233
             ELLTGQKPI    D +ED+SL   FLL M+ENRL ++LD +V+ + K+E+++ +A LA+R
Sbjct  590   ELLTGQKPIR-STDAEEDKSLAGYFLLAMKENRLFDVLDAQVLREAKEEEIITVAMLAKR  648

Query  232   CLNFNGKKRPTMKEVATELDAIKA  161
             CLN NG+KRPTMKEVA EL  I+A
Sbjct  649   CLNLNGRKRPTMKEVAFELGGIRA  672



>ref|XP_010663523.1| PREDICTED: wall-associated receptor kinase-like 2 [Vitis vinifera]
Length=708

 Score =   437 bits (1124),  Expect = 1e-135, Method: Compositional matrix adjust.
 Identities = 289/621 (47%), Positives = 384/621 (62%), Gaps = 57/621 (9%)
 Frame = -1

Query  1882  VDFLGMSYDSQTITIKESISPSCQGSNNFSNIIHNSKLSETPFMYSNDNN-FMLFGCG-N  1709
             ++ L +S + +T+ +   I+P C G+  +      + +   PF +S  +N FM+ GC  N
Sbjct  77    LELLNVSLEYKTVMVNSPITPLCGGNGTW----RTTDVGGRPFRFSRVHNIFMVVGCDTN  132

Query  1708  AFITMPGEELDQPGYNLNCSSKNTTAPKTAHDCQGINCNHLTVDYD-----VNTYQVNFT  1544
             A +    +E    G   NC+S  T+   T   C GI C   T+ Y      +  YQV + 
Sbjct  133   AVLMTDDQEEILAGCTSNCNSGITS---TGTGCYGIQCCQTTIPYSNQSTHLGMYQVKYI  189

Query  1543  HSSSFNACNYAFFlsassslpptlqslpsrqQEMVVVPVELRWTITQEDVPPSYSKYCSP  1364
              +S    C+YAF                S        P+ + W +    +   YS     
Sbjct  190   KTSG--DCSYAFLGVRDWFANNISNPAISTNSGYA--PLVMFWEMETGSLGRCYSL----  241

Query  1363  STYINPQLQWHNYL---QCDCPGGDDRNVYLSGGCE---------------WKHKDYVIS  1238
                    L W +      C C    + N YL  GC+                  + +   
Sbjct  242   ------NLDWQSETAIDSCSCVNRYEGNPYLPNGCQVVEACANCSILDCGMIGAEYHCFP  295

Query  1237  SNK----LRPAIIGISASFGFVFLIWAFVILYkaikkrkmkklrqkffkRNGGlllqqql  1070
             SN+    L+  I+G+    G + L+     LYK +KKR+    +QKFFKRNGGLLLQQQL
Sbjct  296   SNRRAKELKAMILGLGIGGGSLLLLVGSFGLYKGVKKRREIIRKQKFFKRNGGLLLQQQL  355

Query  1069  LTKEGTIEKTKIFTASELDKATDHFNADRIVGRGGQGTVYKGMLIDGQIVAVKKSQAVDE  890
              + E TIEKTKIFT  EL+ ATD+FN  RI+G+GGQGTVYKGML DG+I+AVK+S+ + E
Sbjct  356   SSIE-TIEKTKIFTFKELEMATDNFNKSRILGQGGQGTVYKGMLNDGRIIAVKRSKIIYE  414

Query  889   DQLEPFINEVVILSQINHRNVVKLMGCCLETEVPILVYEFIPNGTLFGLIHNNFDNELIP  710
              QLE FINE++ILSQINHRN++ L+GCCLETEVP+LVYEFI NGTLF LIH+   N   P
Sbjct  415   SQLEQFINEIMILSQINHRNILGLLGCCLETEVPLLVYEFISNGTLFQLIHD--QNNEFP  472

Query  709   LSWDIRLRIASEVACALAYLHSVTLVPIYHRDIKTGNILLDEKFRAKVSDFGTSRSISID  530
              SW +RL+IASE A ALAYLHS + +PIYHRDIK+ NIL+DEK+RAKVSDFGTSRSISI+
Sbjct  473   FSWHMRLQIASEAAGALAYLHSSSSMPIYHRDIKSTNILIDEKYRAKVSDFGTSRSISIE  532

Query  529   KTHFTTMVKGTFGYLDPEYFQSSQFTEKSDVYSFGVVLAELLTGQKPISFELDDDEDRSL  350
             +TH TT VKGTFGY DPEYFQS +FTEKSDVYSFGVVL ELLTG+KP+S+    +E++SL
Sbjct  533   QTHLTTHVKGTFGYFDPEYFQSGRFTEKSDVYSFGVVLVELLTGKKPVSWT-TLEEEKSL  591

Query  349   VSRFLLCME-ENRLMEMLDGEVIEQGKKEDVVAMAWLAQRCLNFNGKKRPTMKEVATELD  173
             V+RF+L +E E+ L ++LD  V ++G+KE ++A+A LA+RCLN NGKKRPTMKEV  EL+
Sbjct  592   VARFILSLEKESHLYDILDDRVRKEGEKERIIAVANLAKRCLNLNGKKRPTMKEVTFELE  651

Query  172   AIKASNSHLPLAMEAFEIESD  110
              I+ S+  LP+  + + +  D
Sbjct  652   YIRMSS--LPINSQQYILNED  670



>ref|XP_006421677.1| hypothetical protein CICLE_v10004476mg [Citrus clementina]
 gb|ESR34917.1| hypothetical protein CICLE_v10004476mg [Citrus clementina]
Length=676

 Score =   436 bits (1120),  Expect = 1e-135, Method: Compositional matrix adjust.
 Identities = 232/359 (65%), Positives = 290/359 (81%), Gaps = 3/359 (1%)
 Frame = -1

Query  1234  NKLRPAIIGISASFGFVFLIWAFVILYkaikkrkmkklrqkffkRNGGlllqqqlLTKEG  1055
             ++++  IIG  +  G   L+     L K +K+R+  KL++ FFK+NGGLLLQQQL + EG
Sbjct  315   SRVKAIIIGCGSGLGLFILLIGIWGLRKFVKRRREIKLKRMFFKKNGGLLLQQQLSSNEG  374

Query  1054  TIEKTKIFTASELDKATDHFNADRIVGRGGQGTVYKGMLIDGQIVAVKKSQAVDEDQLEP  875
              IEKTK+FT  +L+KATD++NA+RI+G+GGQGTVYKGML DG IVAVKKS+ VDE  +E 
Sbjct  375   NIEKTKLFTKMDLEKATDNYNANRILGQGGQGTVYKGMLADGGIVAVKKSKLVDESNVEQ  434

Query  874   FINEVVILSQINHRNVVKLMGCCLETEVPILVYEFIPNGTLFGLIHNNFDNELIPLSWDI  695
             FINEVVILSQINHRNVVKL+G CLETEVP+LVYEFIPNGTL+  +HN    E  P++W++
Sbjct  435   FINEVVILSQINHRNVVKLLGSCLETEVPLLVYEFIPNGTLYHYLHNQ--TEEFPITWEM  492

Query  694   RLRIASEVACALAYLHSVTLVPIYHRDIKTGNILLDEKFRAKVSDFGTSRSISIDKTHFT  515
             RLRIA EV+ A++YLHS T +PIYHRDIK+ NILLD+K+RAKVSDFG SR+I +D+TH T
Sbjct  493   RLRIAIEVSGAMSYLHSATSIPIYHRDIKSSNILLDDKYRAKVSDFGASRTIKVDQTHLT  552

Query  514   TMVKGTFGYLDPEYFQSSQFTEKSDVYSFGVVLAELLTGQKPISFELDDDEDRSLVSRFL  335
             T V+GTFGYLDPEYF+SSQFTEKSDVYSFGVVL ELLTGQKPI    D +EDRSLV  FL
Sbjct  553   TRVQGTFGYLDPEYFRSSQFTEKSDVYSFGVVLVELLTGQKPIR-STDAEEDRSLVGFFL  611

Query  334   LCMEENRLMEMLDGEVIEQGKKEDVVAMAWLAQRCLNFNGKKRPTMKEVATELDAIKAS  158
               M E+RL E+L+  V+++GK+E+++ +A LA+RCLN  GKKRP+MKEVA EL  I+AS
Sbjct  612   QAMNEDRLFEVLEARVLKEGKEEEIITVAILAKRCLNMIGKKRPSMKEVAFELGGIRAS  670



>gb|KDO36626.1| hypothetical protein CISIN_1g038707mg, partial [Citrus sinensis]
Length=597

 Score =   433 bits (1113),  Expect = 1e-135, Method: Compositional matrix adjust.
 Identities = 215/314 (68%), Positives = 261/314 (83%), Gaps = 3/314 (1%)
 Frame = -1

Query  1099  NGGlllqqqlLTKEGTIEKTKIFTASELDKATDHFNADRIVGRGGQGTVYKGMLIDGQIV  920
             NGGLLLQQ+L + E  IEKTK+FT+ +L+KATD++NA+RI+G+GGQGTVYKGML DG+IV
Sbjct  285   NGGLLLQQELSSNESNIEKTKLFTSKDLEKATDNYNANRILGQGGQGTVYKGMLTDGRIV  344

Query  919   AVKKSQAVDEDQLEPFINEVVILSQINHRNVVKLMGCCLETEVPILVYEFIPNGTLFGLI  740
             AVKKS+ VDE  +E FINEVVILSQINHRN+VKL+GCCLETEVP+LVYEFIPNGTL+  I
Sbjct  345   AVKKSKLVDETNVEQFINEVVILSQINHRNIVKLLGCCLETEVPLLVYEFIPNGTLYQYI  404

Query  739   HNNFDNELIPLSWDIRLRIASEVACALAYLHSVTLVPIYHRDIKTGNILLDEKFRAKVSD  560
             HN    E  P++W++ LRIA EV+ AL YLHS   +PIYHRDIK+ NILLD+K+RAKVSD
Sbjct  405   HNQI--EEFPITWELLLRIAVEVSGALFYLHSAASIPIYHRDIKSANILLDDKYRAKVSD  462

Query  559   FGTSRSISIDKTHFTTMVKGTFGYLDPEYFQSSQFTEKSDVYSFGVVLAELLTGQKPISF  380
             FGTSRS+ +D+TH TT V+GTFGY+DPEYFQSSQFTEKSDVYSFGVVL E+LTGQKPI  
Sbjct  463   FGTSRSVMVDQTHLTTKVQGTFGYVDPEYFQSSQFTEKSDVYSFGVVLVEILTGQKPIR-  521

Query  379   ELDDDEDRSLVSRFLLCMEENRLMEMLDGEVIEQGKKEDVVAMAWLAQRCLNFNGKKRPT  200
              ++ DED+SLV  FL  + ENRL E LD  V+++ KKE+++ +A LA+RCLN NGK RPT
Sbjct  522   AINTDEDKSLVGYFLQAINENRLFEALDARVLKEAKKEEIMTVATLAKRCLNLNGKMRPT  581

Query  199   MKEVATELDAIKAS  158
             MKEV  EL  I+ S
Sbjct  582   MKEVTNELGGIRTS  595



>ref|XP_006471186.1| PREDICTED: wall-associated receptor kinase-like 1-like [Citrus 
sinensis]
Length=411

 Score =   426 bits (1096),  Expect = 1e-135, Method: Compositional matrix adjust.
 Identities = 232/363 (64%), Positives = 286/363 (79%), Gaps = 6/363 (2%)
 Frame = -1

Query  1201  ASFGFVFLIWAFVILYkaikkrkmkklrqkffkRNGGlllqqqlLTKEGTIEKTKIFTAS  1022
              SFGF  + W   I    +KKR+  KL++KFFKRNGGL+LQQQL + +G+I++ K+FT  
Sbjct  31    GSFGFFSIFWWLRIW---VKKREDIKLKEKFFKRNGGLVLQQQLTSSDGSIDRCKLFTTK  87

Query  1021  ELDKATDHFNADRIVGRGGQGTVYKGMLIDGQIVAVKKSQAVDEDQLEPFINEVVILSQI  842
             ELDKATDHFN +RI+G+GGQGTVYKGML DG+IVAVKKS+ V E +LE FINEVVILSQI
Sbjct  88    ELDKATDHFNVNRILGQGGQGTVYKGMLADGRIVAVKKSKIVHEGKLEEFINEVVILSQI  147

Query  841   NHRNVVKLMGCCLETEVPILVYEFIPNGTLFGLIHNNFDNELIPLSWDIRLRIASEVACA  662
             NHRNVVKL+GCCLETEVP+LVYEFI NGTLF  +H+   NE  PL+W++RLRIA+EVA +
Sbjct  148   NHRNVVKLLGCCLETEVPLLVYEFISNGTLFQYLHDQ--NEEFPLTWEMRLRIATEVAGS  205

Query  661   LAYLHSVTLVPIYHRDIKTGNILLDEKFRAKVSDFGTSRSISIDKTHFTTMVKGTFGYLD  482
             L+YLHS   +PIYHRDIK+ NILL+EK+ AKV+DFGTS+ I ID+TH TT V+GTFGYLD
Sbjct  206   LSYLHSAASMPIYHRDIKSTNILLNEKYTAKVADFGTSKFIVIDQTHVTTKVQGTFGYLD  265

Query  481   PEYFQSSQFTEKSDVYSFGVVLAELLTGQKPISFELDDDEDRSLVSRFLLCMEENRLMEM  302
             PEYF+S QFT+KSDVYSFGVVL ELLTGQKPI       E   L + F+L MEENRL + 
Sbjct  266   PEYFRSGQFTDKSDVYSFGVVLVELLTGQKPIILT-GSKEATGLAAYFILSMEENRLYDF  324

Query  301   LDGEVIEQGKKEDVVAMAWLAQRCLNFNGKKRPTMKEVATELDAIKASNSHLPLAMEAFE  122
             LD +V++ G+KE+++ +A LA RCLN NGK+RPTMKEVA EL+ I+A    + +     E
Sbjct  325   LDDQVLKVGQKEEIMTIATLATRCLNLNGKRRPTMKEVAMELERIQALQKDINVKQICDE  384

Query  121   IES  113
             IES
Sbjct  385   IES  387



>ref|XP_003594614.1| Wall-associated receptor kinase-like protein [Medicago truncatula]
 gb|AES64865.1| wall associated kinase-like protein [Medicago truncatula]
Length=726

 Score =   437 bits (1124),  Expect = 2e-135, Method: Compositional matrix adjust.
 Identities = 275/583 (47%), Positives = 373/583 (64%), Gaps = 36/583 (6%)
 Frame = -1

Query  1822  PSCQGSNNFSNIIHNSKLSETPFMYSND-NNFMLFGCGN-AFITMPGEELDQPGYNLNCS  1649
             P+C+  NN   +I N  L   PF+YS D N F+  GC N AFI   G  +   G    C 
Sbjct  106   PNCRKYNNNKTVIIN--LGGGPFIYSQDYNKFLAVGCNNLAFIQSSGNMVG--GCVSICD  161

Query  1648  SKNTTAPK---TAHDCQGINCNHLTVDYDVNTYQVNFT--HSSSFNACNYA--------F  1508
               N  +     ++  C G  C   ++   ++ Y          + + C+YA        +
Sbjct  162   DNNINSNYFNLSSDGCNGRYCCETSLPMHLSEYNATLQGLRGPNISECSYALILSRRWVY  221

Query  1507  FlsassslpptlqslpsrqQEMVVVPVELRWTITQE-------DVPP-SYSK-YCSPSTY  1355
             F   SS L        ++ ++M   P  L W I  +        +P  SYS  Y S  T 
Sbjct  222   FDGLSSYLSTYYLENFNKLEDMEYAPAMLEWEILNDMLINSTFQLPSDSYSNCYDSQVTS  281

Query  1354  INPQLQWHNYLQCDCPGGDDRNVYLSGGCEWKHKDYVISSNKLRPAIIGISASFGFVFLI  1175
             IN +   +   QC C  G   N Y++GGC         ++   + AI+G+S+S G +  +
Sbjct  282   INNR---NTGRQCQCFSGYFGNPYIAGGCTESEVFNNKNNRSKKSAIVGVSSSLGSIGFM  338

Query  1174  WAFVILYkaikkrkmkklrqkffkRNGGlllqqqlLTKEGTIEKTKIFTASELDKATDHF  995
                 +L+K +KKR +KK ++KFFKRNGGLLL+Q++ + E  I++T +FT  +L KATD+F
Sbjct  339   IGLWLLHKDMKKRMIKKRKEKFFKRNGGLLLKQRMSSGEVNIDRTTLFTLKDLKKATDNF  398

Query  994   NADRIVGRGGQGTVYKGMLIDGQIVAVKKSQAVDEDQLEPFINEVVILSQINHRNVVKLM  815
             N +R++G+GGQGTVYKGML+DG+IVAVKK +   E ++E FINE VILSQIN+RNVVK++
Sbjct  399   NKNRVLGKGGQGTVYKGMLVDGKIVAVKKFKV--EGKVEEFINEFVILSQINNRNVVKIL  456

Query  814   GCCLETEVPILVYEFIPNGTLFGLIHNNFDNELIPLSWDIRLRIASEVACALAYLHSVTL  635
             GCCLETE+P+LVYEFIPNG LF  +H+   NE IP++WD+RLRI +E+A AL YLHS+  
Sbjct  457   GCCLETEIPLLVYEFIPNGDLFQYLHD--QNEDIPMTWDMRLRIGTEIAGALFYLHSIAS  514

Query  634   VPIYHRDIKTGNILLDEKFRAKVSDFGTSRSISIDKTHFTTMVKGTFGYLDPEYFQSSQF  455
              PIYHRDIK+ NILLDEK+R K++DFG SR ISI+ TH TT+V+GTFGYLDPEYF +SQF
Sbjct  515   QPIYHRDIKSTNILLDEKYRPKLADFGVSRIISIEATHLTTVVQGTFGYLDPEYFHTSQF  574

Query  454   TEKSDVYSFGVVLAELLTGQKPISFELDDDEDRSLVSRFLLCMEENRLMEMLDGEVIEQG  275
             TEKSDVYSFGVVLAELLTG+KPIS  +   E ++L S F+ C+EE+ L +++D  V ++G
Sbjct  575   TEKSDVYSFGVVLAELLTGKKPIS-AIGSGEYQNLASYFIQCIEEDMLFDIIDKRVTKEG  633

Query  274   KKEDVVAMAWLAQRCLNFNGKKRPTMKEVATELDAIKASNSHL  146
             +KE VVA+A LA RCL  NG+KRPTMKEV  +L+ I+  N  L
Sbjct  634   EKEHVVAVANLAYRCLELNGRKRPTMKEVTLKLEGIRGLNKKL  676



>ref|XP_010648088.1| PREDICTED: wall-associated receptor kinase-like 1 [Vitis vinifera]
Length=771

 Score =   438 bits (1127),  Expect = 2e-135, Method: Compositional matrix adjust.
 Identities = 242/430 (56%), Positives = 310/430 (72%), Gaps = 33/430 (8%)
 Frame = -1

Query  1324  LQCDCPGGDDRNVYLSGGCEWKHKDYVISSNKL---------------------------  1226
             L C CP G + N YL+ GCE        ++ KL                           
Sbjct  303   LTCRCPRGYEGNPYLTEGCEGTQSTEDCTNYKLYENGTVCINRNANFSCYPVDKLIVDPR  362

Query  1225  --RPAIIGISASFGFVFLIWAFVILYkaikkrkmkklrqkffkRNGGlllqqqlLTKEGT  1052
               R  + GI A  G + L+     LYK +K+R+  K ++K FKRNGGLLL+QQL + EG 
Sbjct  363   PRRMVLPGILAGVGTLLLVICAWWLYKVLKRRQKIKYKEKCFKRNGGLLLEQQLSSSEGN  422

Query  1051  IEKTKIFTASELDKATDHFNADRIVGRGGQGTVYKGMLIDGQIVAVKKSQAVDEDQLEPF  872
             ++KTK+FT+ EL+KATD +N +R++G+GGQGTVYKGML+DG+IVAVKK + V + ++E F
Sbjct  423   VDKTKLFTSKELEKATDRYNENRVIGQGGQGTVYKGMLMDGRIVAVKKLKIVGDGKVEQF  482

Query  871   INEVVILSQINHRNVVKLMGCCLETEVPILVYEFIPNGTLFGLIHNNFDNELIPLSWDIR  692
             INEVVILSQINHRNVVKL+GCCLET VP+LVYEFIPNGTL   IH+   NE  P++W++R
Sbjct  483   INEVVILSQINHRNVVKLLGCCLETAVPLLVYEFIPNGTLSEHIHDQ--NEEFPITWEMR  540

Query  691   LRIASEVACALAYLHSVTLVPIYHRDIKTGNILLDEKFRAKVSDFGTSRSISIDKTHFTT  512
             LRIA EVA AL+YLHS   +PIYHRDIK+ NILLD+K+RAKV+DFGTS+S++ID+TH TT
Sbjct  541   LRIAIEVAGALSYLHSAASIPIYHRDIKSTNILLDDKYRAKVADFGTSKSVAIDQTHLTT  600

Query  511   MVKGTFGYLDPEYFQSSQFTEKSDVYSFGVVLAELLTGQKPISFELDDDEDRSLVSRFLL  332
              V+GTFGYLDPEYFQSSQFTEKSDVYSFG+VL ELLTG+KPI      +E +SL S F+L
Sbjct  601   QVQGTFGYLDPEYFQSSQFTEKSDVYSFGIVLIELLTGKKPI-LSTASEEGKSLASYFIL  659

Query  331   CMEENRLMEMLDGEVIEQGKKEDVVAMAWLAQRCLNFNGKKRPTMKEVATELDAIKASNS  152
              M E+RL ++LD +V+++GKKE++ A+A+LA+RC+N NGKKRPTM EVA EL+ I+    
Sbjct  660   SMNEDRLSDLLDAQVVKEGKKEEINAIAFLARRCINLNGKKRPTMMEVAMELERIRKCQG  719

Query  151   HLPLAMEAFE  122
                 A E FE
Sbjct  720   DFN-AQENFE  728



>ref|XP_006421687.1| hypothetical protein CICLE_v10004431mg [Citrus clementina]
 gb|ESR34927.1| hypothetical protein CICLE_v10004431mg [Citrus clementina]
Length=723

 Score =   437 bits (1123),  Expect = 2e-135, Method: Compositional matrix adjust.
 Identities = 221/332 (67%), Positives = 268/332 (81%), Gaps = 5/332 (2%)
 Frame = -1

Query  1099  NGGlllqqqlLTKEGTIEKTKIFTASELDKATDHFNADRIVGRGGQGTVYKGMLIDGQIV  920
             NGGLLLQQ+L + E  IEKTK+FT+ +L+KATD++NA+RI+G+GGQGTVYKGML DG+IV
Sbjct  357   NGGLLLQQELSSNESNIEKTKLFTSKDLEKATDNYNANRILGQGGQGTVYKGMLTDGRIV  416

Query  919   AVKKSQAVDEDQLEPFINEVVILSQINHRNVVKLMGCCLETEVPILVYEFIPNGTLFGLI  740
             AVKKS+ VDE  +E FINEVVILSQINHRN+VKL+GCCLETEVP+LVYEFIPNGTL+  I
Sbjct  417   AVKKSKLVDETNVEQFINEVVILSQINHRNIVKLLGCCLETEVPLLVYEFIPNGTLYQYI  476

Query  739   HNNFDNELIPLSWDIRLRIASEVACALAYLHSVTLVPIYHRDIKTGNILLDEKFRAKVSD  560
             HN    E  P++W++ LRIA EV+ AL YLHS   +PIYHRDIK+ NILLD+K+RAKVSD
Sbjct  477   HNQI--EEFPITWELLLRIAVEVSSALFYLHSAASIPIYHRDIKSANILLDDKYRAKVSD  534

Query  559   FGTSRSISIDKTHFTTMVKGTFGYLDPEYFQSSQFTEKSDVYSFGVVLAELLTGQKPISF  380
             FGTSRS+ +D+TH TT V+GTFGY+DPEYFQSSQFTEKSDVYSFGVVL E+LTGQKPI  
Sbjct  535   FGTSRSVMVDQTHLTTKVQGTFGYVDPEYFQSSQFTEKSDVYSFGVVLVEILTGQKPIR-  593

Query  379   ELDDDEDRSLVSRFLLCMEENRLMEMLDGEVIEQGKKEDVVAMAWLAQRCLNFNGKKRPT  200
              ++ DED+SLV  FL  + ENRL E+LD  V+++ KKE ++ +A LA+RCLN NGK RPT
Sbjct  594   AINTDEDKSLVGYFLQAINENRLFEILDARVLKEAKKEGIMTVATLAKRCLNLNGKMRPT  653

Query  199   MKEVATELDAIKASNSHLPLAMEAFEIESDFI  104
             MKEVA EL  I+ S     L     EI  DF+
Sbjct  654   MKEVAFELGGIRTSTGASILQQNCEEI--DFV  683



>gb|KDO65453.1| hypothetical protein CISIN_1g005492mg [Citrus sinensis]
Length=694

 Score =   436 bits (1120),  Expect = 3e-135, Method: Compositional matrix adjust.
 Identities = 221/332 (67%), Positives = 268/332 (81%), Gaps = 5/332 (2%)
 Frame = -1

Query  1099  NGGlllqqqlLTKEGTIEKTKIFTASELDKATDHFNADRIVGRGGQGTVYKGMLIDGQIV  920
             NGGLLLQQ+L + E  IEKTK+FT+ +L+KATD++NA+RI+G+GGQGTVYKGML DG+IV
Sbjct  328   NGGLLLQQELSSNESNIEKTKLFTSKDLEKATDNYNANRILGQGGQGTVYKGMLTDGRIV  387

Query  919   AVKKSQAVDEDQLEPFINEVVILSQINHRNVVKLMGCCLETEVPILVYEFIPNGTLFGLI  740
             AVKKS+ VDE  +E FINEVVILSQINHRN+VKL+GCCLETEVP+LVYEFIPNGTL+  I
Sbjct  388   AVKKSKLVDETNVEQFINEVVILSQINHRNIVKLLGCCLETEVPLLVYEFIPNGTLYQYI  447

Query  739   HNNFDNELIPLSWDIRLRIASEVACALAYLHSVTLVPIYHRDIKTGNILLDEKFRAKVSD  560
             HN    E  P++W++ LRIA EV+ AL YLHS   +PIYHRDIK+ NILLD+K+RAKVSD
Sbjct  448   HNQI--EEFPITWELLLRIAVEVSGALFYLHSAASIPIYHRDIKSANILLDDKYRAKVSD  505

Query  559   FGTSRSISIDKTHFTTMVKGTFGYLDPEYFQSSQFTEKSDVYSFGVVLAELLTGQKPISF  380
             FGTSRS+ +D+TH TT V+GTFGY+DPEYFQSSQFTEKSDVYSFGVVL E+LTGQKPI  
Sbjct  506   FGTSRSVMVDQTHLTTKVQGTFGYVDPEYFQSSQFTEKSDVYSFGVVLVEILTGQKPIR-  564

Query  379   ELDDDEDRSLVSRFLLCMEENRLMEMLDGEVIEQGKKEDVVAMAWLAQRCLNFNGKKRPT  200
              ++ DED+SLV  FL  + ENRL E+LD  V+++ KKE ++ +A LA+RCLN NGK RPT
Sbjct  565   AINTDEDKSLVGYFLQAINENRLFEILDARVLKEAKKEGIMTVATLAKRCLNLNGKMRPT  624

Query  199   MKEVATELDAIKASNSHLPLAMEAFEIESDFI  104
             MKEVA EL  I+ S     L     EI  DF+
Sbjct  625   MKEVAFELGGIRTSTGASILQQNCEEI--DFV  654



>ref|XP_006427110.1| hypothetical protein CICLE_v10025012mg [Citrus clementina]
 gb|ESR40350.1| hypothetical protein CICLE_v10025012mg [Citrus clementina]
Length=723

 Score =   436 bits (1122),  Expect = 4e-135, Method: Compositional matrix adjust.
 Identities = 214/326 (66%), Positives = 271/326 (83%), Gaps = 3/326 (1%)
 Frame = -1

Query  1099  NGGlllqqqlLTKEGTIEKTKIFTASELDKATDHFNADRIVGRGGQGTVYKGMLIDGQIV  920
             NGGLLL+Q+L + +GT+EKTK+FT+ EL+KATD+FN +RI+G+GGQGTVYKGML DG+IV
Sbjct  358   NGGLLLKQELASTDGTVEKTKLFTSKELEKATDYFNLNRILGQGGQGTVYKGMLADGKIV  417

Query  919   AVKKSQAVDEDQLEPFINEVVILSQINHRNVVKLMGCCLETEVPILVYEFIPNGTLFGLI  740
             AVKKS+ +DE ++E FINEVVILSQINHRNVVKL+GCCLETEVP+LVYEFIPNGTLF  I
Sbjct  418   AVKKSKVIDESKVEEFINEVVILSQINHRNVVKLLGCCLETEVPLLVYEFIPNGTLFQYI  477

Query  739   HNNFDNELIPLSWDIRLRIASEVACALAYLHSVTLVPIYHRDIKTGNILLDEKFRAKVSD  560
             H+   NE  P++W++RLRIA E++ AL+YLHS   +PIYHRDIK+ NILLD+K+RAKVSD
Sbjct  478   HDQ--NEDFPITWEMRLRIAIEISGALSYLHSAASIPIYHRDIKSTNILLDDKYRAKVSD  535

Query  559   FGTSRSISIDKTHFTTMVKGTFGYLDPEYFQSSQFTEKSDVYSFGVVLAELLTGQKPISF  380
             FG SRS+++D+TH TT V GT GYLDPEYF+SSQFT+KSDVYSFGVVLAELLTG+KPI F
Sbjct  536   FGASRSMAVDQTHMTTQVHGTVGYLDPEYFRSSQFTDKSDVYSFGVVLAELLTGEKPIRF  595

Query  379   ELDDDEDRSLVSRFLLCMEENRLMEMLDGEVIEQGKKEDVVAMAWLAQRCLNFNGKKRPT  200
                 +ED+SL + FL  M+E RL E+L  +V+++G +++++ +A L +RCLN NGKKRPT
Sbjct  596   TT-LEEDKSLAAYFLCAMKEERLFEILGAQVMKEGGEDEIITVAKLTKRCLNLNGKKRPT  654

Query  199   MKEVATELDAIKASNSHLPLAMEAFE  122
             M+EVA+EL  IKA N    +  E  E
Sbjct  655   MREVASELAGIKAGNGASNVMEEGLE  680



>ref|XP_010040708.1| PREDICTED: wall-associated receptor kinase-like 1 [Eucalyptus 
grandis]
Length=423

 Score =   426 bits (1094),  Expect = 4e-135, Method: Compositional matrix adjust.
 Identities = 221/355 (62%), Positives = 291/355 (82%), Gaps = 7/355 (2%)
 Frame = -1

Query  1219  AIIGISASFGFVFLIWAFVILYkaikkrkmkklrqkffkRNGGlllqqqlLTKEGTIEKT  1040
             +++G+ A    +F  W    LYK IKKRK  KL++K+FKRNGGLLL+++L T EG +E++
Sbjct  31    SVVGLGALLLCLFSRW----LYKYIKKRKETKLKEKYFKRNGGLLLERELSTPEGNVERS  86

Query  1039  KIFTASELDKATDHFNADRIVGRGGQGTVYKGMLIDGQIVAVKKSQAVDEDQLEPFINEV  860
             K+F + +L KAT++F+  RI+G+GGQGTVYKGML DG+IVA+KKS A+D+ ++E FINEV
Sbjct  87    KLFNSKDLGKATNNFDNSRILGQGGQGTVYKGMLTDGKIVAIKKSMAIDKRKIEQFINEV  146

Query  859   VILSQINHRNVVKLMGCCLETEVPILVYEFIPNGTLFGLIHNNFDNELIPLSWDIRLRIA  680
             VILSQINHRNVVKL+GCCLETEVP+LVYEFIPNGTL+  +H+   N   P+SWD RLRIA
Sbjct  147   VILSQINHRNVVKLLGCCLETEVPLLVYEFIPNGTLYQYLHD--PNAEAPISWDTRLRIA  204

Query  679   SEVACALAYLHSVTLVPIYHRDIKTGNILLDEKFRAKVSDFGTSRSISIDKTHFTTMVKG  500
             +E+A AL YLHS   +PIYHRDIK+ NILLDEK+RAKV+DFGTS+S+S+D+TH TT+V+G
Sbjct  205   TEIAGALFYLHSAASIPIYHRDIKSTNILLDEKYRAKVADFGTSKSVSLDQTHVTTLVQG  264

Query  499   TFGYLDPEYFQSSQFTEKSDVYSFGVVLAELLTGQKPISFELDDDEDRSLVSRFLLCMEE  320
             TFGYLDPEYF+SSQFT+KSDVYSFGVVL ELLTGQKPIS +  ++E RSL   F++ +EE
Sbjct  265   TFGYLDPEYFRSSQFTDKSDVYSFGVVLVELLTGQKPISSQ-REEEGRSLAMYFIISVEE  323

Query  319   NRLMEMLDGEVIEQGKKEDVVAMAWLAQRCLNFNGKKRPTMKEVATELDAIKASN  155
             NRL +++D  V+++GK  ++ ++A LA+RCL+ NG+ RPTMKEVA EL+ I+ + 
Sbjct  324   NRLFDIVDAHVLKEGKMGEIASVANLAKRCLDLNGRNRPTMKEVAMELEGIRKTQ  378



>ref|XP_006490106.1| PREDICTED: wall-associated receptor kinase-like 9-like [Citrus 
sinensis]
Length=742

 Score =   437 bits (1123),  Expect = 4e-135, Method: Compositional matrix adjust.
 Identities = 230/353 (65%), Positives = 286/353 (81%), Gaps = 3/353 (1%)
 Frame = -1

Query  1216  IIGISASFGFVFLIWAFVILYkaikkrkmkklrqkffkRNGGlllqqqlLTKEGTIEKTK  1037
             IIG S   G  FL++    L++ +++R++ KL+Q FFKRNGGLLLQQ+  + EG  EKTK
Sbjct  340   IIGCSVGAGLPFLLFMIGRLHEIVERRRVIKLKQNFFKRNGGLLLQQESSSNEGNSEKTK  399

Query  1036  IFTASELDKATDHFNADRIVGRGGQGTVYKGMLIDGQIVAVKKSQAVDEDQLEPFINEVV  857
             +FT+ EL+ ATD+FN +RI+G+GGQGTVYKGML +G+IVA+KKS+ VDE  +E FINEV 
Sbjct  400   LFTSMELEMATDNFNTNRILGQGGQGTVYKGMLTNGRIVAIKKSKLVDESNIEQFINEVA  459

Query  856   ILSQINHRNVVKLMGCCLETEVPILVYEFIPNGTLFGLIHNNFDNELIPLSWDIRLRIAS  677
             ILSQINHRNVVKL+GCCLETEVP+LVYEFIPNGTL+  IH+    E  P++W+IRLRIA 
Sbjct  460   ILSQINHRNVVKLLGCCLETEVPLLVYEFIPNGTLYQYIHDQ--TEEFPITWEIRLRIAI  517

Query  676   EVACALAYLHSVTLVPIYHRDIKTGNILLDEKFRAKVSDFGTSRSISIDKTHFTTMVKGT  497
             EV+ AL YLHS   +PIYHRDIK+ NILLD+K++AKVSDFG SRS+ ID+TH TT V+GT
Sbjct  518   EVSDALCYLHSAASIPIYHRDIKSANILLDDKYQAKVSDFGASRSVMIDQTHLTTRVQGT  577

Query  496   FGYLDPEYFQSSQFTEKSDVYSFGVVLAELLTGQKPISFELDDDEDRSLVSRFLLCMEEN  317
             FGYLDPEYF+SSQFTEKSDVYSFGVV+ ELLTGQKPI    D +ED+SLV  FL  M+EN
Sbjct  578   FGYLDPEYFRSSQFTEKSDVYSFGVVVVELLTGQKPIR-STDSEEDKSLVGYFLEAMKEN  636

Query  316   RLMEMLDGEVIEQGKKEDVVAMAWLAQRCLNFNGKKRPTMKEVATELDAIKAS  158
             RL E+LD  V+++ K+E+++ +A LA+RCLN  GKKRPTMKEVA EL  I+AS
Sbjct  637   RLFEVLDARVLKEAKEEEIITVAMLAKRCLNMIGKKRPTMKEVAFELGGIRAS  689



>emb|CAN70207.1| hypothetical protein VITISV_007744 [Vitis vinifera]
Length=679

 Score =   434 bits (1117),  Expect = 4e-135, Method: Compositional matrix adjust.
 Identities = 264/558 (47%), Positives = 348/558 (62%), Gaps = 38/558 (7%)
 Frame = -1

Query  1759  PFMYSND-NNFMLFGCGNAFITMPGEELDQPGYNLNCSSKNTTAPKTAHDCQGINCNHLT  1583
             PF +SN    F   GC      M  + +      L C     TA K A  C G+ C    
Sbjct  114   PFSFSNTYTRFTAVGCSAMAYFMQDDTVIGGCMTL-CKKDVATAAKNA-SCYGLECCQTQ  171

Query  1582  VDYDVNTYQVNFTHSSSFNA-----CNYAFFlsassslpptlqslpsrqQEMVVVPVELR  1418
             V   + ++  N       +A     C YAF +     +         +  +M  VP  L 
Sbjct  172   VPPGLLSFTANLDTFPEGSADEQEPCKYAFMVDQEWFISNVPDPHTVK--DMEYVPAVLD  229

Query  1417  WTITQEDVPPSYS------KYCSPSTYINPQLQWHNYLQCDCPGGDDRNVYLSGGCEWKH  1256
             W I       S S       +C  +T+ +   Q  + L C CP   + N YL  GC+   
Sbjct  230   WRIYNATCDASTSNLNTSTSFCGENTFCSTDTQ-TSSLTCSCPLLYEGNPYLPQGCQ---  285

Query  1255  KDYVISSNKLRPAIIGISASFGFVFLIWAFVILYkaikkrkmkklrqkffkRNGGlllqq  1076
                          +I I  S G + L+     LY  +K+RK  K ++K F RNGGLLL+Q
Sbjct  286   -------------VITI-GSLGTLLLVLCAWWLYIXLKRRKKIKYKEKCFNRNGGLLLEQ  331

Query  1075  qlLTKEGTIEKTKIFTASELDKATDHFNADRIVGRGGQGTVYKGMLIDGQIVAVKKSQAV  896
             QL + EG I+KTK+FT+ EL+KATD +N +R++G+G QGT YKGML+DG+IVAVKK + +
Sbjct  332   QLSSSEGNIDKTKLFTSKELEKATDRYNENRVIGQGXQGTXYKGMLMDGRIVAVKKLKIM  391

Query  895   DEDQLEPFINEVVILSQINHRNVVKLMGCCLETEVPILVYEFIPNGTLFGLIHNNFDNEL  716
              + +LE FINEVVIL QINHRNVVKL+GCCLETEVP+LVYEFIPNGTL   IH    NE 
Sbjct  392   SDSKLEQFINEVVILCQINHRNVVKLLGCCLETEVPLLVYEFIPNGTLSEHIHGQ--NEE  449

Query  715   IPLSWDIRLRIASEVACALAYLHSVTLVPIYHRDIKTGNILLDEKFRAKVSDFGTSRSIS  536
              P++W++RLRIA+EV  AL+YLHS   +PIYHRDIK+ NILL++K+RAKV+DFG S+ ++
Sbjct  450   FPITWEMRLRIATEVXGALSYLHSXASIPIYHRDIKSTNILLBDKYRAKVADFGISKFVA  509

Query  535   IDKTHFTTMVKGTFGYLDPEYFQSSQFTEKSDVYSFGVVLAELLTGQKPISFELDDDEDR  356
             ID+TH TT V+GTFGYLDPEYFQSSQFTEKSDVYSFG+VL ELLTG+KPI   +  +E +
Sbjct  510   IDQTHLTTQVQGTFGYLDPEYFQSSQFTEKSDVYSFGIVLIELLTGKKPI-LSIASEEGK  568

Query  355   SLVSRFLLCMEENRLMEMLDGEVIEQGKKEDVVAMAWLAQRCLNFNGKKRPTMKEVATEL  176
             SL S F+L M E+RL ++LD +V+++ +KE++ A+A+LA+RC+N NGKKRPTM EVA EL
Sbjct  569   SLASYFILSMNEDRLSDLLDAQVVKESRKEEINAIAFLARRCINLNGKKRPTMMEVAMEL  628

Query  175   DAIKASNSHLPLAMEAFE  122
             + I+        A E FE
Sbjct  629   ERIRKCQGDF-RAQENFE  645



>ref|XP_010545975.1| PREDICTED: wall-associated receptor kinase-like 22 [Tarenaya 
hassleriana]
Length=756

 Score =   437 bits (1123),  Expect = 5e-135, Method: Compositional matrix adjust.
 Identities = 271/623 (43%), Positives = 365/623 (59%), Gaps = 47/623 (8%)
 Frame = -1

Query  1870  GMSYDSQTITIKESISPS-CQGSNNFSNIIHNSKLSETPFMYSNDNNFMLFGCGNAFITM  1694
             G S +  ++ IK  I+ S C     FS+ +    ++ +PF  +  N+ +  GC N  + M
Sbjct  95    GFSSNFGSVRIKAPITSSGCSDGEEFSSTLD---VTGSPFFLTTRNSLVAVGCNNKAV-M  150

Query  1693  PGEELDQPGYNLNCSSKNTTAPKTAHDCQGINCNHLTVDYDVNTYQVNFTH---SSSFNA  1523
                E    G    C  +   A      C G  C    +   +    V       + +   
Sbjct  151   TNVEPQIGGCESVCDVR-FAARGQNTSCNGYRCCEARIATSLQLIGVRIEDVDGNITGKT  209

Query  1522  CNYAFFlsassslpptlqslpsrqQEMVVVPVELRWTITQEDVPPSYSKYCSPSTYINPQ  1343
             C  AF    + S     Q      +    V  EL W +   D     S  C   T     
Sbjct  210   CRVAFLTDEAYSPSNITQPELLYSKGQATV--ELGWFVDMSDNVSVNSASCLNVTEARGY  267

Query  1342  LQ------------WHNYLQCDCPGGDDRNVYLSGGCE---------------WKHKD--  1250
                             +Y  C C  G   N YLS GC                 + K   
Sbjct  268   SAANGCICLYGYSFGRSYRSCSCNSGYKGNPYLSSGCSDINECEENTVEVRDNCRGKSCV  327

Query  1249  -----YVISSNKLRPAIIGISASFGFVFLIWAFVILYkaikkrkmkklrqkffkRNGGll  1085
                  Y     K  P I+G+   FG + L      LYK IKK+K     ++FFKRNGGLL
Sbjct  328   NHPGYYSCEEKKTWPIIVGVCVGFGVLLLAIGAWWLYKFIKKQKKINRMKRFFKRNGGLL  387

Query  1084  lqqqlLTKEGTIEKTKIFTASELDKATDHFNADRIVGRGGQGTVYKGMLIDGQIVAVKKS  905
             LQQQL   EG IEKTKIF+++EL+KAT++F+  R++G+GGQGTVYKGML+DG+IVAVK+S
Sbjct  388   LQQQLTATEGNIEKTKIFSSNELEKATENFSVKRVLGQGGQGTVYKGMLVDGRIVAVKRS  447

Query  904   QAVDEDQLEPFINEVVILSQINHRNVVKLMGCCLETEVPILVYEFIPNGTLFGLIHNNFD  725
             + VDED+LE FINEVVILSQ+NHRN+VKL+GCCLETEVPILVYEF+PNG LF  +HN F 
Sbjct  448   KVVDEDKLEEFINEVVILSQVNHRNIVKLLGCCLETEVPILVYEFVPNGNLFEYLHNGFV  507

Query  724   NELIPLSWDIRLRIASEVACALAYLHSVTLVPIYHRDIKTGNILLDEKFRAKVSDFGTSR  545
             ++   ++W++RLRIA+E+A +L+YLHS    P+YHRDIK+ NILLDEK+RAKVSDFGTSR
Sbjct  508   DDYT-MTWEVRLRIATEIAGSLSYLHSAASSPVYHRDIKSTNILLDEKYRAKVSDFGTSR  566

Query  544   SISIDKTHFTTMVKGTFGYLDPEYFQSSQFTEKSDVYSFGVVLAELLTGQKPISFELDDD  365
             S+++D TH TT+V GT GY+DPEYFQSSQFT+KSDVYSFGVVL EL+TG+K +S  L   
Sbjct  567   SVTVDHTHLTTVVAGTIGYVDPEYFQSSQFTDKSDVYSFGVVLVELITGEKAVSL-LRTQ  625

Query  364   EDRSLVSRFLLCMEENRLMEMLDGEVIEQGKKEDVVAMAWLAQRCLNFNGKKRPTMKEVA  185
             E R+L + F+L M+EN+L +++D  + E    + V  +  LA+RCLN NG+KRP+M+EV+
Sbjct  626   ESRTLATHFILTMKENKLFDIIDARIKEHCDVKQVTGVGNLARRCLNLNGRKRPSMREVS  685

Query  184   TELDAIKASNSHLPLAMEAFEIE  116
             TEL+ I++S+  L + ++  E E
Sbjct  686   TELERIRSSSEDLQVDVQDGEEE  708



>ref|XP_003594613.1| Wall-associated receptor kinase-like protein [Medicago truncatula]
 gb|AES64864.1| wall associated kinase-like protein [Medicago truncatula]
Length=712

 Score =   435 bits (1119),  Expect = 5e-135, Method: Compositional matrix adjust.
 Identities = 269/566 (48%), Positives = 364/566 (64%), Gaps = 18/566 (3%)
 Frame = -1

Query  1819  SCQGSNNFSNIIHNSKLSETPFMYSND-NNFMLFGCGN-AFITMPGEELDQPGYNLNCSS  1646
             +CQ   N +N      L  +PFMYS   N F+  GC N AF+   G  +       +  +
Sbjct  107   NCQ--QNINNKTVTINLGVSPFMYSQSYNKFLAVGCNNLAFLQSNGTTVGGCVSICDDGN  164

Query  1645  KNTTAPKTAHDCQGINCNHLTVDYDVNTYQVNFTHSS--SFNACNYAFFlsas-sslppt  1475
              N     +   C G  C   ++   ++ Y   F   S  S + C+YA  LS +  S   +
Sbjct  165   FNNNFNSSNDRCNGRYCCETSLPTHLSEYNATFQGLSEQSIDQCSYALILSDNWISFDGS  224

Query  1474  lqslpsrqQEMVVVPVELRWTI---TQEDVPPSYSKYCSPSTYINPQLQWHNYLQCDCPG  1304
               S  +    M   P  L W I   +   +P     Y S  T +N +       +C C  
Sbjct  225   YLSTFNELGNMEYAPAMLEWEILVNSTFQLPSDSYCYDSKVTSLNNRTTGR---KCQCSS  281

Query  1303  GDDRNVYLSGGCEWKHKDYVISSNKLRPAIIGISASFGFVFLIWAFVILYkaikkrkmkk  1124
             G   N Y+ GGC         ++   + AI+G+S+S G +  +    +L+K +KKR +KK
Sbjct  282   GYTGNPYIVGGCTETEVFNNKNNRSKKSAIVGVSSSLGSIGFMVGLWLLHKDMKKRMIKK  341

Query  1123  lrqkffkRNGGlllqqqlLTKEGTIEKTKIFTASELDKATDHFNADRIVGRGGQGTVYKG  944
              ++KFFKRNGG LL+Q++ + E  I++T +FT  +L KATD+FN +R++G+GGQGTVYKG
Sbjct  342   RKEKFFKRNGGFLLKQRMSSGEVNIDRTTLFTLKDLKKATDNFNKNRVLGKGGQGTVYKG  401

Query  943   MLIDGQIVAVKKSQAVDEDQLEPFINEVVILSQINHRNVVKLMGCCLETEVPILVYEFIP  764
             ML+DG+IVAVKK +   E ++E FINE VILSQIN+RNVVK++GCCLETE+P+LVYEFIP
Sbjct  402   MLVDGKIVAVKKFKV--EGKVEEFINEFVILSQINNRNVVKILGCCLETEIPLLVYEFIP  459

Query  763   NGTLFGLIHNNFDNELIPLSWDIRLRIASEVACALAYLHSVTLVPIYHRDIKTGNILLDE  584
             NG LF  +H    NE IP++WD+RLRIA+E+A AL YLHS+   PIYHRDIK+ NILLDE
Sbjct  460   NGNLFQYLHA--QNEDIPMTWDMRLRIATEIAGALFYLHSIASQPIYHRDIKSTNILLDE  517

Query  583   KFRAKVSDFGTSRSISIDKTHFTTMVKGTFGYLDPEYFQSSQFTEKSDVYSFGVVLAELL  404
             K+RAK++DFGTSR ISI+ TH TT+V+GTFGYLDPEYF +SQFTEKSDV+SFGVVLAELL
Sbjct  518   KYRAKLADFGTSRIISIEATHLTTVVQGTFGYLDPEYFHTSQFTEKSDVFSFGVVLAELL  577

Query  403   TGQKPISFELDDDEDRSLVSRFLLCMEENRLMEMLDGEVIEQGKKEDVVAMAWLAQRCLN  224
             TG+KP+S  +   E +SL S F+ C++EN L +++D  V ++G+KE VVA+A LA RCL 
Sbjct  578   TGKKPVS-SIGSGEYQSLASYFIECIDENMLFDIIDKRVTKEGEKEHVVAVANLAYRCLE  636

Query  223   FNGKKRPTMKEVATELDAIKASNSHL  146
              NG+KRPTMKEV  +L+ I+  N  L
Sbjct  637   LNGRKRPTMKEVTLKLEGIRGLNRKL  662



>gb|KCW47673.1| hypothetical protein EUGRSUZ_K01412 [Eucalyptus grandis]
Length=688

 Score =   434 bits (1116),  Expect = 9e-135, Method: Compositional matrix adjust.
 Identities = 268/571 (47%), Positives = 359/571 (63%), Gaps = 63/571 (11%)
 Frame = -1

Query  1819  SCQGSNNFSNIIHNSKLSETPFMYSND-NNFMLFGCG-NAFITMPGEE-----LDQPGYN  1661
             SCQG       I +  L E+ F++S   N F+L GC   A I+    E     L +    
Sbjct  111   SCQG-------IKSVNLEESNFVFSQRLNVFILVGCDTKATISSTKSEGVVSTLTETSCE  163

Query  1660  LNCSSKNTTAPKTAHDCQGIN-CNHLTVDYDVNTYQVNFTHSSSFNACNYAFFlsasssl  1484
               C+  NT   + +  C G + C  + +  D+  + V+         C  A     SS L
Sbjct  164   SKCAETNTNISQYSA-CTGRDGCCQIKLPTDLQAFNVSIEG----QRCESAILAEQSSLL  218

Query  1483  pptlqslpsrqQEMVVVPVELRWTIT-----------QEDVPPSYSKYCSPSTYINPQLQ  1337
                   L   +    V P  L+W I            +     + S Y S S Y+     
Sbjct  219   KSGATDLYDLRVNGTV-PFVLQWGIPINNSDSFKLLDESMSSDAVSCYASSSPYV-----  272

Query  1336  WHNYLQCDCPGGDDRNVYLSGGCEWKHKDYVISSNKLRPAIIGISASFGFVFLIWAFVIL  1157
                  +C C  G   N Y   GC+                  G+ A  G + L      L
Sbjct  273   -----ECGCQSGYRGNPYFIEGCQ------------------GVGAGVGALLLGLFLWRL  309

Query  1156  YkaikkrkmkklrqkffkRNGGlllqqqlLTKEGTIEKTKIFTASELDKATDHFNADRIV  977
             Y  +KKRK  KL++K FKRNGGLLL+ +L + +G +EK+K+F + +L+KATD+FN DRI+
Sbjct  310   YIYMKKRKEIKLKEKCFKRNGGLLLESELSSPQGNVEKSKLFNSKDLEKATDNFNEDRIL  369

Query  976   GRGGQGTVYKGMLIDGQIVAVKKSQAVDEDQLEPFINEVVILSQINHRNVVKLMGCCLET  797
             G+GGQGTVYKGML DG+IVA+KKS+ +DE ++E FINE++ILSQINHRNVVKL+GCCLET
Sbjct  370   GQGGQGTVYKGMLTDGKIVAIKKSKVIDEGKVEHFINEILILSQINHRNVVKLLGCCLET  429

Query  796   EVPILVYEFIPNGTLFGLIHNNFDNELIPLSWDIRLRIASEVACALAYLHSVTLVPIYHR  617
             EVP+LVYEFIPNGTL+  +H+   NE   +SWD RLR+A+E++ AL YLHS   +PIYHR
Sbjct  430   EVPLLVYEFIPNGTLYQYLHD--PNEKFHVSWDTRLRLATEISGALFYLHSAASIPIYHR  487

Query  616   DIKTGNILLDEKFRAKVSDFGTSRSISIDKTHFTTMVKGTFGYLDPEYFQSSQFTEKSDV  437
             DIK+ NILLDEK+RAKV+DFGTS+++S+D+TH TT+V+GTFGYLDPEYFQSSQFT+KSDV
Sbjct  488   DIKSTNILLDEKYRAKVADFGTSKTVSLDQTHVTTLVQGTFGYLDPEYFQSSQFTDKSDV  547

Query  436   YSFGVVLAELLTGQKPISFELDDDEDRSLVSRFLLCMEENRLMEMLDGEVIEQGKKEDVV  257
             YSFGVVL ELLTGQKPIS  L + E RSL + F++ ME+N L +++D +V+++GKKED+ 
Sbjct  548   YSFGVVLVELLTGQKPIS-SLREQEGRSLATYFIISMEQNHLFDIVDSQVLKEGKKEDIA  606

Query  256   AMAWLAQRCLNFNGKKRPTMKEVATELDAIK  164
              +A LA+RCL+ NG+ RPTMKE+A EL+ I+
Sbjct  607   VVANLARRCLHLNGRNRPTMKELAMELEGIR  637



>ref|XP_010497625.1| PREDICTED: wall-associated receptor kinase-like 22 isoform X2 
[Camelina sativa]
Length=600

 Score =   431 bits (1108),  Expect = 1e-134, Method: Compositional matrix adjust.
 Identities = 243/440 (55%), Positives = 313/440 (71%), Gaps = 28/440 (6%)
 Frame = -1

Query  1387  SYSKYCSPSTYINPQLQWHNYLQCDCPGGDDRNVYLSGGC-------EWKHKDY------  1247
             +YS Y S        L+  +Y  C C GG   N YLS GC       E K + +      
Sbjct  121   AYSNYQSCICRYGKYLE-RSYRSCMCNGGYRGNPYLSSGCIDIDECEEAKAEGHNRCGEG  179

Query  1246  ------------VISSNKLRPAIIGISASFGFVFLIWAFVILYkaikkrkmkklrqkffk  1103
                             NK    I+GIS  FG + L      LYK I+K++  K ++KFFK
Sbjct  180   SDCKNIPGNLSCTSKKNKTLAIILGISLGFGLLVLAIGVWWLYKFIRKQREIKRKKKFFK  239

Query  1102  RNGGlllqqqlLTKEGTIEKTKIFTASELDKATDHFNADRIVGRGGQGTVYKGMLIDGQI  923
             RNGGLLLQQQL + EG +E+T++F++ EL+KAT+ F+ +R++G+GGQGTVYKGML+DG+I
Sbjct  240   RNGGLLLQQQLFSNEGNVERTRVFSSKELEKATEKFSVNRVLGQGGQGTVYKGMLVDGRI  299

Query  922   VAVKKSQAVDEDQLEPFINEVVILSQINHRNVVKLMGCCLETEVPILVYEFIPNGTLF-G  746
             VAVKKS+ VDED+LE FINEVVILSQINHRN+VKL+GCCLET+VPILVYEFIPNG LF  
Sbjct  300   VAVKKSKVVDEDKLEEFINEVVILSQINHRNIVKLLGCCLETDVPILVYEFIPNGNLFEH  359

Query  745   LIHNNFDNELIPLSWDIRLRIASEVACALAYLHSVTLVPIYHRDIKTGNILLDEKFRAKV  566
             L H++  ++    +W++RLRIA ++A AL+YLHS    PIYHRDIK+ NI+LDEK+RAKV
Sbjct  360   LHHDDESDDYTMATWEMRLRIAVDIAGALSYLHSAASFPIYHRDIKSTNIMLDEKYRAKV  419

Query  565   SDFGTSRSISIDKTHFTTMVKGTFGYLDPEYFQSSQFTEKSDVYSFGVVLAELLTGQKPI  386
             SDFGTSRS++ID TH TT+V GT GY+DPEYFQSSQFT+KSDVYSFGVVL EL+TG+KPI
Sbjct  420   SDFGTSRSVTIDHTHLTTVVAGTVGYVDPEYFQSSQFTDKSDVYSFGVVLVELITGEKPI  479

Query  385   SFELDDDEDRSLVSRFLLCMEENRLMEMLDGEVIEQGKKEDVVAMAWLAQRCLNFNGKKR  206
             SF L  DE+R+L + F+L M+ ++L  ++D  + +    E V A+A LA+RCLN NGKKR
Sbjct  480   SF-LRSDENRTLATYFILAMKNSKLSSIIDARIKDNCNMEQVTAVANLARRCLNLNGKKR  538

Query  205   PTMKEVATELDAIKASNSHL  146
             P M+EV+TEL+ I+ S   L
Sbjct  539   PNMREVSTELERIRNSQVQL  558



>ref|XP_006388915.1| hypothetical protein POPTR_0075s00200g, partial [Populus trichocarpa]
 gb|ERP47829.1| hypothetical protein POPTR_0075s00200g, partial [Populus trichocarpa]
Length=446

 Score =   425 bits (1093),  Expect = 1e-134, Method: Compositional matrix adjust.
 Identities = 254/430 (59%), Positives = 312/430 (73%), Gaps = 33/430 (8%)
 Frame = -1

Query  1435  VPVELRWTITQEDVPPSY-SKYCSPSTYINPQLQWHNYLQCDCPGGDDRNVYLSGGCEWK  1259
             VP  L W +   +V  SY S YC  +   N  L      +C C  G + N YL  GC   
Sbjct  38    VPAILGWVM---NVNVSYISFYCQRNN--NESL----ISECACWPGFEGNPYLELGC---  85

Query  1258  HKDYVISSNKLRPAIIGISASFGFVFLIWAFVILYkaikkrkmkklrqkffkRNGGlllq  1079
                      K+  ++I I      +F +W    LYK IKKR+ K+L++KFFKRNGGLLLQ
Sbjct  86    ---------KVVGSVIFI---LVLLFGLWR---LYKLIKKRQNKELKKKFFKRNGGLLLQ  130

Query  1078  qqlLTKEGTIEKTKIFTASELDKATDHFNADRIVGRGGQGTVYKGMLIDGQIVAVKKSQA  899
             QQL T +G+++KTKI+++ EL+ ATD FN +RI+G GGQGTVYKGML DG+I+AVKKS+ 
Sbjct  131   QQLSTSDGSVQKTKIYSSKELEVATDGFNVNRILGEGGQGTVYKGMLTDGRIIAVKKSKV  190

Query  898   VDEDQLEPFINEVVILSQINHRNVVKLMGCCLETEVPILVYEFIPNGTLFGLIHNNFDNE  719
             VDE+ LE FINEVVILSQ+NHRNVVKL+GCCLET+VPILVYEFI NG L+  IH   D+ 
Sbjct  191   VDEENLEEFINEVVILSQMNHRNVVKLLGCCLETQVPILVYEFISNGNLYKYIHVQNDDF  250

Query  718   LIPLSWDIRLRIASEVACALAYLHSVTLVPIYHRDIKTGNILLDEKFRAKVSDFGTSRSI  539
             L  LSW++RLRIA EVA AL+YLHS   +PIYHRDIK+ NILLDEK+RA +SDFG+SRSI
Sbjct  251   L--LSWEMRLRIAIEVAGALSYLHSAASIPIYHRDIKSTNILLDEKYRATISDFGSSRSI  308

Query  538   SIDKTHFTTMVKGTFGYLDPEYFQSSQFTEKSDVYSFGVVLAELLTGQKPISFELDDDED  359
             +ID+TH TT V+GTFGYLDPEYFQSSQFTEKSDVYSFGVVL ELL+G+KPI F     E 
Sbjct  309   AIDQTHLTTHVQGTFGYLDPEYFQSSQFTEKSDVYSFGVVLVELLSGKKPI-FSASPTES  367

Query  358   RSLVSRFLLCMEENRLMEMLDGEVIEQGKKEDVVAMAWLAQRCLNFNGKKRPTMKEVATE  179
             RSL + F++ ME+NRL ++LD  V E    E+VVA+  LA++CLN NGK RPTMKEV TE
Sbjct  368   RSLATHFIMLMEDNRLFDILDARVKEHCHNEEVVAVGNLARKCLNLNGKNRPTMKEVTTE  427

Query  178   LDAI--KASN  155
             L+ +  K SN
Sbjct  428   LERVIQKGSN  437



>ref|XP_010023309.1| PREDICTED: wall-associated receptor kinase-like 2 [Eucalyptus 
grandis]
Length=689

 Score =   433 bits (1114),  Expect = 2e-134, Method: Compositional matrix adjust.
 Identities = 266/570 (47%), Positives = 371/570 (65%), Gaps = 59/570 (10%)
 Frame = -1

Query  1822  PSC---QGSNNFSNIIHNSKLSETPFMYSNDNN-FMLFGCGNAFITMPGEELDQPGYNLN  1655
             P+C   Q ++   +++HN+      F YS   N F+  GC +  + +  E +       N
Sbjct  110   PNCTANQQNDPPVDLVHNNGT----FFYSRHRNYFVAKGCDSLALMVSAEAV----VGCN  161

Query  1654  CSSKNTTAPKTAHDCQGINCNHLTVDYDVNTYQVNFTH------SSSFNACNYAFFlsas  1493
             CSSK+    +++    G  C   ++   + +Y V F        ++    C+YAF +  +
Sbjct  162   CSSKS----ESSRCFNGTTCCFTSIPNQITSYSVEFQTPYGRAIATRGAGCSYAFLVEEA  217

Query  1492  sslpptlqslpsrqQEMVVVPVELRWTITQEDVPPSYSKYCSPSTY-----INPQLQWHN  1328
                     SL         VPV L W I  +D     ++  + ++      ++P   +  
Sbjct  218   WWFNTDFYSLLPS-----AVPVVLEWGINSDDFELLSNRNHTGNSGGCFWDLSPMTVY--  270

Query  1327  YLQCDCPGGDDRNVYLSGGCEWKHKDYVISSNKLRPAIIGISASFGFVFLIWAFVILYka  1148
                C C  G   N YL  GC+                  G+S   G + L      LYK 
Sbjct  271   ---CSCNEGYKGNYYLPDGCQ------------------GVSTGIGAIALPLLSWGLYKY  309

Query  1147  ikkrkmkklrqkffkRNGGlllqqqlLTKEGT-IEKTKIFTASELDKATDHFNADRIVGR  971
             I +R++ KL+++FFKRNGGLLLQQ L + E + ++K K+FT+ E+D ATDHFN +RI+GR
Sbjct  310   IVRRRVAKLKRQFFKRNGGLLLQQHLSSIEDSHVDKGKLFTSMEIDTATDHFNENRILGR  369

Query  970   GGQGTVYKGMLIDGQIVAVKKSQAVDEDQLEPFINEVVILSQINHRNVVKLMGCCLETEV  791
             GGQGTVYKGML+DG I+AVKKS++VD  Q++ F+NEVVILSQINHRNVVKL+G CLE+EV
Sbjct  370   GGQGTVYKGMLLDGMIIAVKKSKSVDVGQVQQFVNEVVILSQINHRNVVKLLGFCLESEV  429

Query  790   PILVYEFIPNGTLFGLIHNNFDNELIPLSWDIRLRIASEVACALAYLHSVTLVPIYHRDI  611
             P+LVYEFIPNGTL+  +H+   +E  P SW+IRLRIA+EVA AL+YLH    +PI+HRDI
Sbjct  430   PLLVYEFIPNGTLYHYLHD--PDEEFPFSWEIRLRIANEVAGALSYLHFAAAIPIHHRDI  487

Query  610   KTGNILLDEKFRAKVSDFGTSRSISIDKTHFTTMVKGTFGYLDPEYFQSSQFTEKSDVYS  431
             K+ NILLDEK++AKV+DFG S+S+ ID+TH TTMV+GTFGYLDPEY+Q+SQFT+KSDVYS
Sbjct  488   KSSNILLDEKYQAKVADFGASKSLPIDQTHLTTMVRGTFGYLDPEYYQTSQFTDKSDVYS  547

Query  430   FGVVLAELLTGQKPISFELDDDEDRSLVSRFLLCMEENRLMEMLDGEVIEQGKKEDVVAM  251
             FGVVLAELLTG+KPIS +L  +EDR+L S F++ MEENRL ++LD EV++ G++E+++ +
Sbjct  548   FGVVLAELLTGEKPIS-QLRAEEDRNLASYFVISMEENRLFDVLDKEVLDHGEQEEIIVV  606

Query  250   AWLAQRCLNFNGKKRPTMKEVATELDAIKA  161
             + LA+RCLN NG+ RPTMKEVA EL+ +++
Sbjct  607   SNLAKRCLNPNGRYRPTMKEVAMELEQVQS  636



>ref|XP_010037267.1| PREDICTED: wall-associated receptor kinase-like 22 [Eucalyptus 
grandis]
 gb|KCW48947.1| hypothetical protein EUGRSUZ_K02556 [Eucalyptus grandis]
Length=723

 Score =   434 bits (1116),  Expect = 2e-134, Method: Compositional matrix adjust.
 Identities = 256/524 (49%), Positives = 344/524 (66%), Gaps = 27/524 (5%)
 Frame = -1

Query  1669  GYNLNCSSKNTTAPKTAHDCQGIN-CNHLTVDYDVNTYQVNFTHSSSFNACNYAFFlsas  1493
             G    C+  NT    ++  C G + C   T+  ++  + V+         C YAF    S
Sbjct  154   GCRSKCAGTNTNISWSSA-CSGADGCCQTTLPLNLQAFGVDIKEEGGQQGCKYAFLAERS  212

Query  1492  sslpptlqslpsrqQEMVVVPVELRWTITQEDVPPSYSKYCSPSTYINPQLQWHNYLQCD  1313
                   +  L   + +  V PV L+W I          +  S ++ +         L+C 
Sbjct  213   WFSKADVTGLYDLRVKDKV-PVVLQWGIQNNTDYSLALRNSSMNSDVVSCYMSSTPLECW  271

Query  1312  CPGGDDRNVYLSGGCEWKHK---------------------DYVISSNKLRPAIIGISAS  1196
             C  G   N Y  GGC+  ++                     D V S    +  +IG+ A 
Sbjct  272   CRDGYGGNPYFIGGCQDINECEDSNICHRMDRTCVNKRGGYDCVDSRKTAKVILIGVGAG  331

Query  1195  FGFVFLIWAFVILYkaikkrkmkklrqkffkRNGGlllqqqlLTKEGTIEKTKIFTASEL  1016
              G + L      L K IKKRK+ KL++K+FKRNGGLLL+ +  +  G I+K+K+F + +L
Sbjct  332   LGVLLLCLFIWRLCKYIKKRKIIKLKEKYFKRNGGLLLEIEPSSPGGKIKKSKLFNSKDL  391

Query  1015  DKATDHFNADRIVGRGGQGTVYKGMLIDGQIVAVKKSQAVDEDQLEPFINEVVILSQINH  836
             + ATD+FN DRI+G+GGQGT+YKGML DG+IVA+KKS+A+DE ++E FINE++ILSQI+H
Sbjct  392   ENATDNFNDDRILGQGGQGTIYKGMLTDGKIVAIKKSKAIDEGKVEQFINEILILSQISH  451

Query  835   RNVVKLMGCCLETEVPILVYEFIPNGTLFGLIHNNFDNELIPLSWDIRLRIASEVACALA  656
             RNVVKL+GCCLETEVP+LVYEFIPNGTL+  +H+   NE   +SWD RLRIA+E+A AL 
Sbjct  452   RNVVKLLGCCLETEVPLLVYEFIPNGTLYQYLHD--PNEEFHVSWDTRLRIATEIAGALF  509

Query  655   YLHSVTLVPIYHRDIKTGNILLDEKFRAKVSDFGTSRSISIDKTHFTTMVKGTFGYLDPE  476
             YLHS   +PIYHRDIK+ NILLDEKFRAKV+DFGTS+S+S+D+TH TT+V+GTFGYLDPE
Sbjct  510   YLHSAASIPIYHRDIKSTNILLDEKFRAKVADFGTSKSVSLDQTHVTTLVQGTFGYLDPE  569

Query  475   YFQSSQFTEKSDVYSFGVVLAELLTGQKPISFELDDDEDRSLVSRFLLCMEENRLMEMLD  296
             YFQSSQFT+KSDVYSFGVVL ELLTGQKPIS  L + E RSL + F++ MEE+ L +++D
Sbjct  570   YFQSSQFTDKSDVYSFGVVLVELLTGQKPIS-SLREQEGRSLATYFIVSMEESHLFDIVD  628

Query  295   GEVIEQGKKEDVVAMAWLAQRCLNFNGKKRPTMKEVATELDAIK  164
              +V+++GKKE++  +A LA RCL+ NG+ RPTMKEVA EL+ I+
Sbjct  629   AQVLKEGKKEEIAIVANLANRCLSLNGRSRPTMKEVAMELEGIR  672



>ref|XP_006490104.1| PREDICTED: putative wall-associated receptor kinase-like 11-like 
[Citrus sinensis]
Length=722

 Score =   434 bits (1116),  Expect = 2e-134, Method: Compositional matrix adjust.
 Identities = 220/332 (66%), Positives = 267/332 (80%), Gaps = 5/332 (2%)
 Frame = -1

Query  1099  NGGlllqqqlLTKEGTIEKTKIFTASELDKATDHFNADRIVGRGGQGTVYKGMLIDGQIV  920
             NGGLLLQQ+L + E  IEKTK+FT+ +L+KATD++NA+RI+G+GGQGTVYKGML DG+IV
Sbjct  356   NGGLLLQQELSSNESNIEKTKLFTSKDLEKATDNYNANRILGQGGQGTVYKGMLTDGRIV  415

Query  919   AVKKSQAVDEDQLEPFINEVVILSQINHRNVVKLMGCCLETEVPILVYEFIPNGTLFGLI  740
             AVKKS+ VDE  +E FINEVVILSQINHRN+VKL+GCCLETEVP+LVYEFIPNGTL+  I
Sbjct  416   AVKKSKLVDETNVEQFINEVVILSQINHRNIVKLLGCCLETEVPLLVYEFIPNGTLYQYI  475

Query  739   HNNFDNELIPLSWDIRLRIASEVACALAYLHSVTLVPIYHRDIKTGNILLDEKFRAKVSD  560
             HN    E  P++W++ LRIA EV+ AL YLHS   +PIYHRDIK+ NILLD+K+RAKVSD
Sbjct  476   HNQI--EEFPITWELLLRIAVEVSGALFYLHSAASIPIYHRDIKSANILLDDKYRAKVSD  533

Query  559   FGTSRSISIDKTHFTTMVKGTFGYLDPEYFQSSQFTEKSDVYSFGVVLAELLTGQKPISF  380
             FGTSRS+ +D+TH TT V+GTFGY+DPEYFQSSQFTEKSDVYSFGVVL E+LTGQKPI  
Sbjct  534   FGTSRSVMVDQTHLTTKVQGTFGYVDPEYFQSSQFTEKSDVYSFGVVLVEILTGQKPIR-  592

Query  379   ELDDDEDRSLVSRFLLCMEENRLMEMLDGEVIEQGKKEDVVAMAWLAQRCLNFNGKKRPT  200
              ++ DED+SLV  FL  + ENRL E LD  V+++ KKE+++ +A LA+RCLN NGK RPT
Sbjct  593   AINTDEDKSLVGYFLQAINENRLFEALDARVLKEAKKEEIMTVATLAKRCLNLNGKMRPT  652

Query  199   MKEVATELDAIKASNSHLPLAMEAFEIESDFI  104
             MKEV  EL  I+ S     L     EI  DF+
Sbjct  653   MKEVTNELGGIRTSIGASILQQNCEEI--DFV  682



>gb|ABI97350.1| cold-induced wall associated kinase, partial [Ammopiptanthus 
mongolicus]
Length=453

 Score =   424 bits (1091),  Expect = 3e-134, Method: Compositional matrix adjust.
 Identities = 225/402 (56%), Positives = 305/402 (76%), Gaps = 5/402 (1%)
 Frame = -1

Query  1321  QCDCPGGDDRNVYLSGGCEWKHKDYVISSNKLRPAIIGISASFGFVFLIWAFVILYkaik  1142
             +C+CP G   + Y++G C    + Y  +    + A++G+ +S G + L++    LYK ++
Sbjct  20    RCECPFGYSGDPYIAGSCTAIPRFYGETIRSKKWALVGVLSSLGSIILLFGLWWLYKVVR  79

Query  1141  krkmkklrqkffkRNGGlllqqqlLTKEGTIEKTKIFTASELDKATDHFNADRIVGRGGQ  962
             KR +KK ++KFFK++GGLLLQQ+L + E ++++  +F+  +L++ATD+FN +R++G+GGQ
Sbjct  80    KRMIKKRKEKFFKQHGGLLLQQRLSSGEVSVDRAILFSLKDLERATDNFNINRVLGKGGQ  139

Query  961   GTVYKGMLIDGQIVAVKKSQAVDEDQLEPFINEVVILSQINHRNVVKLMGCCLETEVPIL  782
             GTVYKGML+DG+ VAVKK +   + ++E FINE VILSQINHRNVVKL+GCCLETE+P+L
Sbjct  140   GTVYKGMLVDGRTVAVKKFKV--QGKVEEFINEFVILSQINHRNVVKLLGCCLETEIPLL  197

Query  781   VYEFIPNGTLFGLIHNNFDNELIPLSWDIRLRIASEVACALAYLHSVTLVPIYHRDIKTG  602
             VYEFIPNG LF  +H+   NE +P++WD+RLRIA+E+A AL YLHSV   PIYHRDIK+ 
Sbjct  198   VYEFIPNGNLFQYLHDQ--NEDLPMTWDMRLRIATEIAGALFYLHSVASQPIYHRDIKST  255

Query  601   NILLDEKFRAKVSDFGTSRSISIDKTHFTTMVKGTFGYLDPEYFQSSQFTEKSDVYSFGV  422
             NILLDEK+RAKV+DFGTSR +SI+ TH TT+V+GTFGYLDPEYF +SQFTEKSDVYSFGV
Sbjct  256   NILLDEKYRAKVADFGTSRIVSIEATHLTTVVQGTFGYLDPEYFHTSQFTEKSDVYSFGV  315

Query  421   VLAELLTGQKPISFELDDDEDRSLVSRFLLCMEENRLMEMLDGEVIEQGKKEDVVAMAWL  242
             VLAELLTG+KPIS  +  +E ++L S F L MEE+ L E++D  V ++G+KE ++ +A L
Sbjct  316   VLAELLTGRKPISL-VSSEEAKNLASYFALSMEEDSLFEIIDKRVAKKGEKEHIMGVANL  374

Query  241   AQRCLNFNGKKRPTMKEVATELDAIKASNSHLPLAMEAFEIE  116
             A RCL  NGKKRPTMKEV  EL+ I+  +          EIE
Sbjct  375   AYRCLELNGKKRPTMKEVTLELERIRGPDKKFNAQQNHEEIE  416



>ref|XP_007147446.1| hypothetical protein PHAVU_006G125300g [Phaseolus vulgaris]
 gb|ESW19440.1| hypothetical protein PHAVU_006G125300g [Phaseolus vulgaris]
Length=691

 Score =   433 bits (1113),  Expect = 3e-134, Method: Compositional matrix adjust.
 Identities = 265/557 (48%), Positives = 358/557 (64%), Gaps = 44/557 (8%)
 Frame = -1

Query  1771  LSETPFMYSND-NNFMLFGCGN-AFITMPGEELDQPGYNLNCSSKNTTAPKTAHD-----  1613
             L  +PF+YS D N FM  GC N AF       L   G N+ C        +  +D     
Sbjct  114   LRGSPFVYSQDANKFMAIGCNNLAF-------LQSNGSNVACCVSICDDSEEVNDNFNLV  166

Query  1612  ----CQGINCNHLTV-----DYDVNTYQVNFTHSSSFN-ACNYAFFlsassslpptlqsl  1463
                 C G  C   ++     +Y+      N  ++++ +  C+YA  +    +        
Sbjct  167   REGSCSGRYCCETSLPKYLLEYNATLQDFNTQNNNTVSEPCSYALIVHGQVTSDFN----  222

Query  1462  psrqQEMVVVPVELRWTITQEDVPPSYSKYCSPSTYI-----NPQLQWHNYLQCDCPGGD  1298
                   M  VP  L W I    +  S  +  S S Y+     N         +CDC  G 
Sbjct  223   -----NMDHVPAILEWKILDNTLHNSTLQLLSESDYVTCNRSNFTSSQTTGWRCDCLEGF  277

Query  1297  DRNVYLSGGCEWKHKDYVISSNKLRPAIIGISASFGFVFLIWAFVILYkaikkrkmkklr  1118
               N YL+GGC      Y  S  K + AI+G+S+S G +  +    +LYK ++KR ++K +
Sbjct  278   YGNPYLAGGCT-ALPGYNNSQTK-KWAIVGVSSSVGSIIFLLGLWLLYKDVRKRVIEKGK  335

Query  1117  qkffkRNGGlllqqqlLTKEGTIEKTKIFTASELDKATDHFNADRIVGRGGQGTVYKGML  938
             QKFFK+NGGLLLQQ++ + E  ++K  +F+  +L+KATDHFN +R+VG+GGQGTVYKGML
Sbjct  336   QKFFKKNGGLLLQQRISSNEANLDKAILFSLDDLEKATDHFNMNRVVGKGGQGTVYKGML  395

Query  937   IDGQIVAVKKSQAVDEDQLEPFINEVVILSQINHRNVVKLMGCCLETEVPILVYEFIPNG  758
             +DG IVAVKK +   E  +E FINE VILSQIN+RNVV+L+GCCLETE+P+LVYEFIPNG
Sbjct  396   VDGTIVAVKKFKV--EGNVEEFINEFVILSQINNRNVVRLLGCCLETEIPLLVYEFIPNG  453

Query  757   TLFGLIHNNFDNELIPLSWDIRLRIASEVACALAYLHSVTLVPIYHRDIKTGNILLDEKF  578
              LF  +H+  + EL+P++WD+ LRIA+E+A A+ YLHSV   PIYHRDIK+ NILLDEK+
Sbjct  454   NLFEYLHDQ-NKELLPMTWDMCLRIATEIAGAMFYLHSVASKPIYHRDIKSTNILLDEKY  512

Query  577   RAKVSDFGTSRSISIDKTHFTTMVKGTFGYLDPEYFQSSQFTEKSDVYSFGVVLAELLTG  398
             RAK++DFGTSR ISI+ TH TT+V+GTFGYLDPEYF +SQFTEKSDVYSFGVVLAELLTG
Sbjct  513   RAKIADFGTSRVISIEATHLTTVVQGTFGYLDPEYFHTSQFTEKSDVYSFGVVLAELLTG  572

Query  397   QKPISFELDDDEDRSLVSRFLLCMEENRLMEMLDGEVIEQGKKEDVVAMAWLAQRCLNFN  218
             QKPIS  +   E +SL S F+ C+EE+ L++++D  ++++ +K +++A+A LA RCL  N
Sbjct  573   QKPIS-SVRSGEFKSLASYFVECVEEDNLLDIVDKRIVKEAEKREIIAVANLANRCLELN  631

Query  217   GKKRPTMKEVATELDAI  167
             GKKRPTMKE+  EL+ I
Sbjct  632   GKKRPTMKEITFELEEI  648



>ref|XP_007147445.1| hypothetical protein PHAVU_006G125300g [Phaseolus vulgaris]
 gb|ESW19439.1| hypothetical protein PHAVU_006G125300g [Phaseolus vulgaris]
Length=689

 Score =   432 bits (1112),  Expect = 3e-134, Method: Compositional matrix adjust.
 Identities = 265/557 (48%), Positives = 358/557 (64%), Gaps = 44/557 (8%)
 Frame = -1

Query  1771  LSETPFMYSND-NNFMLFGCGN-AFITMPGEELDQPGYNLNCSSKNTTAPKTAHD-----  1613
             L  +PF+YS D N FM  GC N AF       L   G N+ C        +  +D     
Sbjct  114   LRGSPFVYSQDANKFMAIGCNNLAF-------LQSNGSNVACCVSICDDSEEVNDNFNLV  166

Query  1612  ----CQGINCNHLTV-----DYDVNTYQVNFTHSSSFN-ACNYAFFlsassslpptlqsl  1463
                 C G  C   ++     +Y+      N  ++++ +  C+YA  +    +        
Sbjct  167   REGSCSGRYCCETSLPKYLLEYNATLQDFNTQNNNTVSEPCSYALIVHGQVTSDFN----  222

Query  1462  psrqQEMVVVPVELRWTITQEDVPPSYSKYCSPSTYI-----NPQLQWHNYLQCDCPGGD  1298
                   M  VP  L W I    +  S  +  S S Y+     N         +CDC  G 
Sbjct  223   -----NMDHVPAILEWKILDNTLHNSTLQLLSESDYVTCNRSNFTSSQTTGWRCDCLEGF  277

Query  1297  DRNVYLSGGCEWKHKDYVISSNKLRPAIIGISASFGFVFLIWAFVILYkaikkrkmkklr  1118
               N YL+GGC      Y  S  K + AI+G+S+S G +  +    +LYK ++KR ++K +
Sbjct  278   YGNPYLAGGCT-ALPGYNNSQTK-KWAIVGVSSSVGSIIFLLGLWLLYKDVRKRVIEKGK  335

Query  1117  qkffkRNGGlllqqqlLTKEGTIEKTKIFTASELDKATDHFNADRIVGRGGQGTVYKGML  938
             QKFFK+NGGLLLQQ++ + E  ++K  +F+  +L+KATDHFN +R+VG+GGQGTVYKGML
Sbjct  336   QKFFKKNGGLLLQQRISSNEANLDKAILFSLDDLEKATDHFNMNRVVGKGGQGTVYKGML  395

Query  937   IDGQIVAVKKSQAVDEDQLEPFINEVVILSQINHRNVVKLMGCCLETEVPILVYEFIPNG  758
             +DG IVAVKK +   E  +E FINE VILSQIN+RNVV+L+GCCLETE+P+LVYEFIPNG
Sbjct  396   VDGTIVAVKKFKV--EGNVEEFINEFVILSQINNRNVVRLLGCCLETEIPLLVYEFIPNG  453

Query  757   TLFGLIHNNFDNELIPLSWDIRLRIASEVACALAYLHSVTLVPIYHRDIKTGNILLDEKF  578
              LF  +H+  + EL+P++WD+ LRIA+E+A A+ YLHSV   PIYHRDIK+ NILLDEK+
Sbjct  454   NLFEYLHDQ-NKELLPMTWDMCLRIATEIAGAMFYLHSVASKPIYHRDIKSTNILLDEKY  512

Query  577   RAKVSDFGTSRSISIDKTHFTTMVKGTFGYLDPEYFQSSQFTEKSDVYSFGVVLAELLTG  398
             RAK++DFGTSR ISI+ TH TT+V+GTFGYLDPEYF +SQFTEKSDVYSFGVVLAELLTG
Sbjct  513   RAKIADFGTSRVISIEATHLTTVVQGTFGYLDPEYFHTSQFTEKSDVYSFGVVLAELLTG  572

Query  397   QKPISFELDDDEDRSLVSRFLLCMEENRLMEMLDGEVIEQGKKEDVVAMAWLAQRCLNFN  218
             QKPIS  +   E +SL S F+ C+EE+ L++++D  ++++ +K +++A+A LA RCL  N
Sbjct  573   QKPIS-SVRSGEFKSLASYFVECVEEDNLLDIVDKRIVKEAEKREIIAVANLANRCLELN  631

Query  217   GKKRPTMKEVATELDAI  167
             GKKRPTMKE+  EL+ I
Sbjct  632   GKKRPTMKEITFELEEI  648



>ref|XP_006388916.1| hypothetical protein POPTR_0075s00210g [Populus trichocarpa]
 gb|ERP47830.1| hypothetical protein POPTR_0075s00210g [Populus trichocarpa]
Length=912

 Score =   439 bits (1130),  Expect = 3e-134, Method: Compositional matrix adjust.
 Identities = 282/577 (49%), Positives = 373/577 (65%), Gaps = 34/577 (6%)
 Frame = -1

Query  1882  VDFLGMSYDSQTITIKES-ISPSCQGSNNFSNIIHNSKLSETPFMYSNDNN-FMLFGCGN  1709
             ++ L +S  + T T+K   IS +C G  +  ++     L+ +PF++S   N F+  GC +
Sbjct  78    MEVLNISVKTATATVKSPVISFNCTGRKDGGSL----DLTGSPFVFSYFRNVFIAVGC-D  132

Query  1708  AFITMPGEELDQPGYNLNCSSKNTTAPKTAHD--CQGINCNHLTVDYDVNTYQVNFTHSS  1535
               + M G E    G    C ++ +T      +  C G NC   ++   +  ++     ++
Sbjct  133   TQVLMSGIEPQVLGCVPTCGNQQSTNVWLQENNMCSGQNCCQASIPSLLQVFKPTLVSTN  192

Query  1534  ---SFNACNYAFFlsassslpptlqslpsrqQEMVVVPVELRWTITQEDVPPSYSKYCSP  1364
                   AC  A  ++ +            + ++ V  P  L W +   D     S YC+ 
Sbjct  193   VDQGREACKLAVLVNTTWFASNISDPFALQHKDYV--PANLGWVMNISD--SDISIYCN-  247

Query  1363  STYINPQLQWHNYLQCDCPGGDDRNVYLSGGCEWKHKDYVISSNKLRPAIIGISASFGFV  1184
              TY N   +     +C C  G + N YL  GC    KD  ++ N    A++G S  F  V
Sbjct  248   -TYYNESFK----SECACRRGFEGNPYLELGC----KDLCVAVNN---AVVG-SVIFILV  294

Query  1183  FLIWAFVILYkaikkrkmkklrqkffkRNGGlllqqqlLTKEGTIEKTKIFTASELDKAT  1004
              L++    +YK +KKR+ K+L++KFFKRNGGLLLQQQL T +G+++KTKI+++ EL+ AT
Sbjct  295   -LLFGLWWIYKLVKKRQNKELKKKFFKRNGGLLLQQQLSTSDGSVQKTKIYSSKELEVAT  353

Query  1003  DHFNADRIVGRGGQGTVYKGMLIDGQIVAVKKSQAVDEDQLEPFINEVVILSQINHRNVV  824
             D FN  RI+G GGQGTVYKGML DG+I+AVKKS+ +DE+ LE FINEV ILSQINHRNVV
Sbjct  354   DGFNVSRILGEGGQGTVYKGMLTDGRIIAVKKSKVIDEENLEEFINEVFILSQINHRNVV  413

Query  823   KLMGCCLETEVPILVYEFIPNGTLFGLIHNNFDNELIPLSWDIRLRIASEVACALAYLHS  644
             KL+GCCLETEVPILVYEFI NG L+  IH   D+ L  LSW++RLRIA EVA AL+YLHS
Sbjct  414   KLLGCCLETEVPILVYEFISNGNLYKYIHVQNDDFL--LSWEMRLRIAIEVAGALSYLHS  471

Query  643   VTLVPIYHRDIKTGNILLDEKFRAKVSDFGTSRSISIDKTHFTTMVKGTFGYLDPEYFQS  464
                +PIYHRDIK+ NILLDEK+RA +SDFG+SRSI+ID+TH TT V+GTFGYLDPEYFQS
Sbjct  472   AASIPIYHRDIKSTNILLDEKYRAIISDFGSSRSIAIDQTHLTTHVQGTFGYLDPEYFQS  531

Query  463   SQFTEKSDVYSFGVVLAELLTGQKPISFELDDDEDRSLVSRFLLCMEENRLMEMLDGEVI  284
             SQFTEKSDVYSFGVVL ELL+GQKPI F     E RSL + F++ ME+NRL ++LD  V 
Sbjct  532   SQFTEKSDVYSFGVVLVELLSGQKPI-FSASPTESRSLATHFIMLMEDNRLFDILDARVK  590

Query  283   EQGKKEDVVAMAWLAQRCLNFNGKKRPTMKEVATELD  173
             +    E+VVA+  LA++CLN NGK RPTMKEV TEL+
Sbjct  591   QHCHNEEVVAVGNLARKCLNLNGKNRPTMKEVTTELE  627



>ref|XP_011018200.1| PREDICTED: wall-associated receptor kinase-like 22 [Populus euphratica]
Length=583

 Score =   429 bits (1102),  Expect = 5e-134, Method: Compositional matrix adjust.
 Identities = 225/354 (64%), Positives = 288/354 (81%), Gaps = 4/354 (1%)
 Frame = -1

Query  1210  GISASFGFVFLIWAFVILYkaikkrkmkklrqkffkRNGGlllqqqlLTKEGTIEKTKIF  1031
             GI   FG +FL+     LYK  K+R+ ++LR+++FKRNGGLLLQ+QL + E  +EK K+F
Sbjct  197   GIGVGFGVLFLLIGLWQLYKVFKRRRNERLRERYFKRNGGLLLQEQLSSGEVHVEKVKLF  256

Query  1030  TASELDKATDHFNADRIVGRGGQGTVYKGMLIDGQIVAVKKSQAVDEDQLEPFINEVVIL  851
              + ELD ATDH++ +R++G+GGQGTVYKGML DG+I+AVKKS+ +DE  L  FINEVVIL
Sbjct  257   ASKELDNATDHYSVNRMLGQGGQGTVYKGMLADGKIIAVKKSKILDEGNLRQFINEVVIL  316

Query  850   SQINHRNVVKLMGCCLETEVPILVYEFIPNGTLFGLIHNNFDNELIPLSWDIRLRIASEV  671
             SQINHRNVVKL+GCCLETEVP+LVYEFIPNGTL  L+H+  D   +P +WD+RLRIA+EV
Sbjct  317   SQINHRNVVKLLGCCLETEVPLLVYEFIPNGTLSQLLHSPSDE--LPFTWDMRLRIATEV  374

Query  670   ACALAYLHSVTLVPIYHRDIKTGNILLDEKFRAKVSDFGTSRSISIDKTHFTTMVKGTFG  491
             A AL+YLHS   +PIYHRDIK+ NILLD+K+RAKV+DFGTS+S++ID+TH TT+V+GTFG
Sbjct  375   AGALSYLHSAASIPIYHRDIKSTNILLDDKYRAKVADFGTSKSVTIDQTHVTTLVQGTFG  434

Query  490   YLDPEYFQSSQFTEKSDVYSFGVVLAELLTGQKPISFELDDDEDRSLVSRFLLCMEENRL  311
             YLDPEYFQSS+FT+KSDVYSFGVVL ELLT QK +SF   +DE RSLV+ FL+ +E+NRL
Sbjct  435   YLDPEYFQSSKFTDKSDVYSFGVVLVELLTAQKAVSFCRSEDEARSLVTYFLMSIEDNRL  494

Query  310   MEMLDGEVIEQGKKEDVVAMAWLAQRCLNFNGKKRPTMKEVATELDAIKASNSH  149
               +LD +V  QG+KED++ +A LA+ CL+  GK+RP MKEVA  L+ I+  NSH
Sbjct  495   SGILDPQVKVQGRKEDIMMVAVLAKSCLSMKGKERPAMKEVAMVLEGIR--NSH  546



>ref|XP_004306285.1| PREDICTED: wall-associated receptor kinase-like 2-like [Fragaria 
vesca subsp. vesca]
Length=737

 Score =   434 bits (1115),  Expect = 5e-134, Method: Compositional matrix adjust.
 Identities = 274/579 (47%), Positives = 357/579 (62%), Gaps = 65/579 (11%)
 Frame = -1

Query  1762  TPFMYSNDNNFMLFGCGN-AFITMPGEELDQPGYNLNCSSKNTTAPKTAHDCQGINCNHL  1586
             TPF  S +N F    CG  A +T P  E       L+   + +      + C GINC   
Sbjct  131   TPFRVSEENKFTSVSCGRIASLTFPEREGQIMAVCLSICDEYSPV-LVNNTCNGINCCQT  189

Query  1585  TVDYDVNTYQVNFTH--------SSSFNACNYAFFlsassslpptlqslpsrqQEMVVVP  1430
             ++ +  +T+ V  T          S  +AC YAF +        +  +      EM  VP
Sbjct  190   SIPF--STFGVLNTSFGPLINGSGSETSACKYAFLVDPEWFTSHSTNTSAIA--EMDYVP  245

Query  1429  VELRW----------TITQEDVPPSYSKYCSPSTYINPQLQWHNYLQCDCPGGDDRNVYL  1280
             + L W          T TQ+++  +   +  P               C C  G   N YL
Sbjct  246   IVLEWWLMFGGIDNSTSTQDNMNRNCKSWRGP---------------CFCSKGYQGNPYL  290

Query  1279  SGGCEWKHK----------DYVISSN----------KLRPAIIGISASFGFVFLIWAFVI  1160
              GGC+  ++             + SN            +P  + + +  G VF+I     
Sbjct  291   LGGCQDINECEDPKLPNICGSAVCSNIDGTFECYTYNPQPQNLVLCSVLGLVFVIIGVWC  350

Query  1159  LYkaikkrkmkklrqkffkRNGGlllqqqlLTKEGTIEKTKIFTASELDKATDHFNADRI  980
             L+K +KKRK  K +QKF+ +NGGLLL++ L + E  +E  K+F A EL+KATD FNADRI
Sbjct  351   LHKVLKKRKNIKRKQKFYTQNGGLLLEKLLSSGEINVEMIKLFDAKELEKATDQFNADRI  410

Query  979   VGRGGQGTVYKGMLIDGQIVAVKKSQAVDEDQLEPFINEVVILSQINHRNVVKLMGCCLE  800
             +G GGQGTVYKGML DG+IVAVKKS+  D+ ++  FINE+ ILSQINHRNVVKL+GCCLE
Sbjct  411   LGEGGQGTVYKGMLTDGRIVAVKKSKIADKGEVCQFINEIFILSQINHRNVVKLLGCCLE  470

Query  799   TEVPILVYEFIPNGTLFGLIHNNFDNELIPLSWDIRLRIASEVACALAYLHSVTLVPIYH  620
             +EVP+LVYEF+PNGTL   I +   +E  PL+W+IRLR+ +EVA AL+YLHS   +PIYH
Sbjct  471   SEVPLLVYEFLPNGTLSQYIRSR--DEDFPLTWEIRLRVGTEVAGALSYLHSSASMPIYH  528

Query  619   RDIKTGNILLDEKFRAKVSDFGTSRSISIDKTHFT-TMVKGTFGYLDPEYFQSSQFTEKS  443
             RDIK+ NILLDEK RAKV+DFGTSRS+SID+TH T T V GTFGYLDPEYFQSSQFT+KS
Sbjct  529   RDIKSSNILLDEKHRAKVADFGTSRSVSIDQTHLTMTHVNGTFGYLDPEYFQSSQFTDKS  588

Query  442   DVYSFGVVLAELLTGQKPISFELDDD---EDRSLVSRFLLCMEENRLMEMLDGEVIEQGK  272
             DVYSFGVVLAELLTGQKP+S    ++   E RSL + F++ MEEN L ++LD EV++ GK
Sbjct  589   DVYSFGVVLAELLTGQKPVSVTRSEEGRQEGRSLATYFIVSMEENFLFDILDAEVMKGGK  648

Query  271   KEDVVAMAWLAQRCLNFNGKKRPTMKEVATELDAIKASN  155
             KE+++A+A LA+RCLN  GKKRPTMKE+A EL+ I  S+
Sbjct  649   KEEIMAVANLAKRCLNMKGKKRPTMKEIAVELEGILMSS  687



>ref|XP_006465431.1| PREDICTED: wall-associated receptor kinase-like 10-like [Citrus 
sinensis]
Length=741

 Score =   434 bits (1115),  Expect = 6e-134, Method: Compositional matrix adjust.
 Identities = 231/370 (62%), Positives = 298/370 (81%), Gaps = 3/370 (1%)
 Frame = -1

Query  1231  KLRPAIIGISASFGFVFLIWAFVILYkaikkrkmkklrqkffkRNGGlllqqqlLTKEGT  1052
             +++  +IG ++    +FL+     L+K +K+R+  KL++KFFKRNGGLLLQQ+L + EGT
Sbjct  332   RVKYVVIGCTSGGLGMFLLIGAWWLFKFVKRRREIKLKRKFFKRNGGLLLQQELASTEGT  391

Query  1051  IEKTKIFTASELDKATDHFNADRIVGRGGQGTVYKGMLIDGQIVAVKKSQAVDEDQLEPF  872
             IEKTK+FT+ EL++ATD+FN +RI+G+GGQGTVYKGML DG+IVAVKKS+ +DE ++E F
Sbjct  392   IEKTKLFTSKELERATDNFNLNRILGQGGQGTVYKGMLPDGKIVAVKKSKVIDESKVEEF  451

Query  871   INEVVILSQINHRNVVKLMGCCLETEVPILVYEFIPNGTLFGLIHNNFDNELIPLSWDIR  692
             INE+VILSQINHRNVVKL+GCCLETEVP+LVYEFIPNGTLF  IH+   NE  P++W++R
Sbjct  452   INEMVILSQINHRNVVKLLGCCLETEVPLLVYEFIPNGTLFQYIHDQ--NEDFPITWEMR  509

Query  691   LRIASEVACALAYLHSVTLVPIYHRDIKTGNILLDEKFRAKVSDFGTSRSISIDKTHFTT  512
             LRIA EV+ AL+YLHS   +PIYHRDIK+ NILLD+K+RAKVSDFG SRS+++D+TH TT
Sbjct  510   LRIAIEVSGALSYLHSAASIPIYHRDIKSTNILLDDKYRAKVSDFGASRSMAVDQTHMTT  569

Query  511   MVKGTFGYLDPEYFQSSQFTEKSDVYSFGVVLAELLTGQKPISFELDDDEDRSLVSRFLL  332
              V GTFGYLDPEYF+SSQFT+KSDVYSFGVVLAELLTG+KPI F    +ED+SL + FL 
Sbjct  570   QVHGTFGYLDPEYFRSSQFTDKSDVYSFGVVLAELLTGEKPIRFTT-LEEDKSLAAYFLF  628

Query  331   CMEENRLMEMLDGEVIEQGKKEDVVAMAWLAQRCLNFNGKKRPTMKEVATELDAIKASNS  152
              M+E RL E+LD  V+++   ++++  A +A+RCLN NGKKRPTM+EV +EL  IKA N 
Sbjct  629   AMKEERLFEILDARVMKESGGDEIITFAKVAKRCLNLNGKKRPTMREVTSELAGIKAWNG  688

Query  151   HLPLAMEAFE  122
                +  E  E
Sbjct  689   ASNVIEEDLE  698



>ref|XP_008229610.1| PREDICTED: wall-associated receptor kinase-like 1 isoform X2 
[Prunus mume]
Length=706

 Score =   432 bits (1112),  Expect = 6e-134, Method: Compositional matrix adjust.
 Identities = 280/592 (47%), Positives = 355/592 (60%), Gaps = 67/592 (11%)
 Frame = -1

Query  1849  TITIKESISPSCQGSNNFSNIIHNSKLSETPFMYSNDNN-FMLFGCGNAFITMPGEELDQ  1673
             T+ +   ++  C G N  S +   + L+ +PF+YS D N F    CG     M   E   
Sbjct  98    TLRVNSPVTKFCNG-NGSSQM---ADLTGSPFVYSQDKNRFTAVSCG-FLAGMVSAEFVV  152

Query  1672  PGYNLNCSSKNTTAPKTAHDCQGINCNHLTVDYDVNTYQVNFTHSSSF--NACN-YAFFl  1502
              G    C  K     K+A    GINC   T+   +     +  +      ++C+ YAF +
Sbjct  153   GGCRSVCDHK-----KSASCDIGINCCQTTIPPYLTMIGASILYQGETRDSSCDDYAFLV  207

Query  1501  sassslpptlqslpsrqQEMVVVPVELRWTI--------------TQEDVPPSY------  1382
                     +       ++    VPV L W I              T     P Y      
Sbjct  208   DKDWFERSSSAHAIKSRRH---VPVVLEWNIINYTSSLAIFGSYVTNYSFDPYYYYNFNY  264

Query  1381  --SKYCSPSTYINPQLQWHNY--LQCDCPGGDDRNVYLSGGCEWKHKDYVISSNKLRPAI  1214
               + YC  ST     L ++N   L C CP G + N YL   C+       +         
Sbjct  265   QGTPYCLGST----ALDYNNRSTLSCYCPDGFEGNPYLLETCQGLGAGLGLLLLL-----  315

Query  1213  IGISASFGFVFLIWAFVILYkaikkrkmkklrqkffkRNGGlllqqqlLTKEGTIEKTKI  1034
               ISA  G+ FL           KKR   K R+ FFKRNGGLLL++QL + E  +EK K+
Sbjct  316   --ISAWLGYRFL-----------KKRHTMKRREMFFKRNGGLLLEKQLSSGEVNVEKIKL  362

Query  1033  FTASELDKATDHFNADRIVGRGGQGTVYKGMLIDGQIVAVKKSQAVDEDQLEPFINEVVI  854
             F + EL+K+TD+FN DRI+G+GGQGTVYKGML DG+IVAVKKS+ VDE QL  FINEVVI
Sbjct  363   FKSKELEKSTDNFNTDRILGQGGQGTVYKGMLTDGRIVAVKKSKIVDESQLSDFINEVVI  422

Query  853   LSQINHRNVVKLMGCCLETEVPILVYEFIPNGTLFGLIHNNFDNELIPLSWDIRLRIASE  674
             LSQINHRNVV+L+GCCLETEVPILVYEFIPNG L   IH    NE  PL+W++RLRIA E
Sbjct  423   LSQINHRNVVQLLGCCLETEVPILVYEFIPNGNLSQYIHEQ--NEEFPLTWEVRLRIAIE  480

Query  673   VACALAYLHSVTLVPIYHRDIKTGNILLDEKFRAKVSDFGTSRSISIDKTHFTTMVKGTF  494
             +A AL+Y  +    PIYHRDIK+ N+LLDEK+RAK++DFGTSRSISID+TH TT V GTF
Sbjct  481   IAGALSY--NAASFPIYHRDIKSANVLLDEKYRAKIADFGTSRSISIDQTHLTTCVHGTF  538

Query  493   GYLDPEYFQSSQFTEKSDVYSFGVVLAELLTGQKPISFELDDDEDRSLVSRFLLCMEENR  314
             GYLDPEYFQSSQFTEKSDVYSFGVVL ELLTGQKPISF    +E +SL + F+  M+ +R
Sbjct  539   GYLDPEYFQSSQFTEKSDVYSFGVVLVELLTGQKPISFRRSQEEGKSLATYFITSMQLDR  598

Query  313   LMEMLDGEVIEQGKKEDVVAMAWLAQRCLNFNGKKRPTMKEVATELDAIKAS  158
             L E+LD +V++ G K D++ +A LA+RCLN +G+KRPTM+EV  EL+ I+ S
Sbjct  599   LFEILDAQVVKGGSKADIILVADLARRCLNLSGRKRPTMREVTAELEGIQMS  650



>ref|XP_006385943.1| hypothetical protein POPTR_0003s18440g, partial [Populus trichocarpa]
 gb|ERP63740.1| hypothetical protein POPTR_0003s18440g, partial [Populus trichocarpa]
Length=645

 Score =   430 bits (1106),  Expect = 7e-134, Method: Compositional matrix adjust.
 Identities = 275/595 (46%), Positives = 369/595 (62%), Gaps = 42/595 (7%)
 Frame = -1

Query  1882  VDFLGMSYDSQTITIKES-ISPSCQGSNNFSNIIHNSKLSETPFMYSNDNNFMLFGCGNA  1706
             ++ L +S +    T+K   IS +C G  +  ++     L+ +PF++S+  N  + G  + 
Sbjct  67    MEVLNISVEKGLATVKSPVISFNCTGREDGGSL----DLTGSPFVFSDSWNVFIAGGCDT  122

Query  1705  FITMPGEELDQPGYNLNCSSKNTTAPKTAHD-CQGINCNHLTVDYDVNTYQVNFTHSS--  1535
                M G E    G    C ++ +      ++ C G NC   ++   +  ++     ++  
Sbjct  123   RAFMSGIEPQVLGCVPTCGNQRSNVSLQENNMCSGRNCCQASIPSLLQVFKPTLVSTNVD  182

Query  1534  -SFNACNYAFFlsassslpptlqslpsrqQEMVVVPVELRWTITQEDVPPSYSKYCSPST  1358
                 AC  A  ++ +              ++ V  P  L W +   D     S YC+  T
Sbjct  183   QGREACKLAVLVNGTWFASNISDPFALLHKDYV--PANLGWVMNISD--SDISIYCN--T  236

Query  1357  YINPQLQWHNYLQCDCPGGDDRNVYLSGGCEWKHKDYVISSNKLRPAIIGISASFGF---  1187
             Y N  L+     +C C  G + N YL  GC    +      N  +  +  ++   G+   
Sbjct  237   YYNQSLK----SECACWRGFEGNPYLELGCIDVDECKTSEKNTCQRMLKCVNTRGGYRCA  292

Query  1186  -----------------VFLIWAFVILYkaikkrkmkklrqkffkRNGGlllqqqlLTKE  1058
                              + L++    LYK IKKR+ K+L++KFFKRNGGLLLQQQL T +
Sbjct  293   INKIYIIIIVVGSVIFILVLLFGLWRLYKLIKKRQNKELKKKFFKRNGGLLLQQQLSTSD  352

Query  1057  GTIEKTKIFTASELDKATDHFNADRIVGRGGQGTVYKGMLIDGQIVAVKKSQAVDEDQLE  878
             G+++KTKI+++ EL+ ATD FN +RI+G GGQGTVYKGML DG+I+AVKKS+ VDE+ LE
Sbjct  353   GSVQKTKIYSSKELEVATDGFNVNRILGEGGQGTVYKGMLTDGRIIAVKKSKVVDEENLE  412

Query  877   PFINEVVILSQINHRNVVKLMGCCLETEVPILVYEFIPNGTLFGLIHNNFDNELIPLSWD  698
              FINEVVILSQ+NHRNVVKL+GCCLET+VPILVYEFI NG L+  IH   D+ L  LSW+
Sbjct  413   EFINEVVILSQMNHRNVVKLLGCCLETQVPILVYEFISNGNLYKYIHVQNDDFL--LSWE  470

Query  697   IRLRIASEVACALAYLHSVTLVPIYHRDIKTGNILLDEKFRAKVSDFGTSRSISIDKTHF  518
             +RLRIA EVA AL+YLHS   +PIYHRDIK+ NILLDEK+RA +SDFG+SRSI+ID+TH 
Sbjct  471   MRLRIAIEVAGALSYLHSAASIPIYHRDIKSTNILLDEKYRATISDFGSSRSIAIDQTHL  530

Query  517   TTMVKGTFGYLDPEYFQSSQFTEKSDVYSFGVVLAELLTGQKPISFELDDDEDRSLVSRF  338
             TT V+GTFGYLDPEYFQSSQFTEKSDVYSFGVVL ELL+G+KPI F     E RSL + F
Sbjct  531   TTHVQGTFGYLDPEYFQSSQFTEKSDVYSFGVVLVELLSGKKPI-FSASPTESRSLATHF  589

Query  337   LLCMEENRLMEMLDGEVIEQGKKEDVVAMAWLAQRCLNFNGKKRPTMKEVATELD  173
             ++ ME+NRL ++LD  V E    E+VVA+  LA++CLN NGK RPTMKEV TEL+
Sbjct  590   IMLMEDNRLFDILDARVKEHCHNEEVVAVGNLARKCLNLNGKNRPTMKEVTTELE  644



>ref|XP_003534786.1| PREDICTED: wall-associated receptor kinase-like 22-like [Glycine 
max]
Length=712

 Score =   432 bits (1112),  Expect = 7e-134, Method: Compositional matrix adjust.
 Identities = 262/546 (48%), Positives = 349/546 (64%), Gaps = 36/546 (7%)
 Frame = -1

Query  1762  TPFMYSND-NNFMLFGCGN-AFITMPGEELDQPGYNLNCSSK-NTTAPKTAHDCQGINCN  1592
             +PF+YS   N F+  GCGN A     GEE+        C+S  N        +C+G  C 
Sbjct  136   SPFVYSARYNTFLAVGCGNTASFWSNGEEVS------GCASMCNGDDLIKVDNCRGRKCC  189

Query  1591  HLTVDYDVNTYQVNFTHSSSFNACNYAFFlsassslpptlqslpsrqQEMVVVPVELRWT  1412
               ++   ++ Y V+F        C Y   ++                 E   VP  L+W 
Sbjct  190   EASLPRYLSEYNVSFEGQE----CAYGLIIAVRLGYWNLTIKDVKHLNE---VPAVLKWE  242

Query  1411  ITQEDVPPSYSKYCSPS------TYINPQL---QWHNYLQCDCP-GGDDRNVYLSGGCEW  1262
             I  +    + S +  P       TY+   L      +  +C C  G    N Y+ G C  
Sbjct  243   IPFDTFYSNISFFRDPDIVSCYDTYLKHSLNNSSQSSGRRCHCRYGAPPANPYIRGSCLG  302

Query  1261  KHKDYVISSNKLRPAIIGISASFGFVFLIWAFVILYkaikkrkmkklrqkffkRNGGlll  1082
             + +       ++R AIIG+S+S G + L+     L K ++K   KK ++KFFK+NGGLLL
Sbjct  303   EKR-----KTRVRWAIIGVSSSLGTILLLLVLWWLNKFVRKNIEKKRKEKFFKQNGGLLL  357

Query  1081  qqqlLTKEGTIEKTKIFTASELDKATDHFNADRIVGRGGQGTVYKGMLIDGQIVAVKKSQ  902
              Q+L + E  ++K K+FT  +LDKATDHFN +R++G+GGQGTVYKGML+DG IVAVKK +
Sbjct  358   NQKLSSGEANVDKIKLFTLKDLDKATDHFNINRVLGKGGQGTVYKGMLVDGNIVAVKKFK  417

Query  901   AVDEDQLEPFINEVVILSQINHRNVVKLMGCCLETEVPILVYEFIPNGTLFGLIHNNFDN  722
                   +E FINE V+LSQINHRNVVKL+GCCLETE+P+LVYEFIPNG L+  +     N
Sbjct  418   V--NGNVEEFINEFVVLSQINHRNVVKLLGCCLETEIPLLVYEFIPNGNLYEYLLG--QN  473

Query  721   ELIPLSWDIRLRIASEVACALAYLHSVTLVPIYHRDIKTGNILLDEKFRAKVSDFGTSRS  542
             + +P++WD+RLRIA+EVA AL YLHS    PIYHRD+K+ NILLDEK++AKV+DFG SR 
Sbjct  474   DELPMTWDMRLRIATEVAGALFYLHSAASQPIYHRDVKSTNILLDEKYKAKVADFGASRM  533

Query  541   ISIDKTHFTTMVKGTFGYLDPEYFQSSQFTEKSDVYSFGVVLAELLTGQKPISFELDDDE  362
             +SI+ TH TT V+GTFGYLDPEYF +SQFTEKSDVYSFGVVL ELLTGQKPIS  + +  
Sbjct  534   VSIEATHLTTAVQGTFGYLDPEYFHTSQFTEKSDVYSFGVVLVELLTGQKPIS-SVKEQG  592

Query  361   DRSLVSRFLLCMEENRLMEMLDGEVIEQGKKEDVVAMAWLAQRCLNFNGKKRPTMKEVAT  182
              +SL S FLLCMEENRL +++D  V+++G+KED++ +A LA+RCL  NG+KRPTMKEV  
Sbjct  593   LQSLASYFLLCMEENRLFDIVDARVMQEGEKEDIIVVANLARRCLQLNGRKRPTMKEVTL  652

Query  181   ELDAIK  164
             EL++I+
Sbjct  653   ELESIQ  658



>ref|XP_006388728.1| hypothetical protein POPTR_0112s00230g [Populus trichocarpa]
 gb|ERP47642.1| hypothetical protein POPTR_0112s00230g [Populus trichocarpa]
Length=693

 Score =   432 bits (1110),  Expect = 8e-134, Method: Compositional matrix adjust.
 Identities = 284/606 (47%), Positives = 377/606 (62%), Gaps = 50/606 (8%)
 Frame = -1

Query  1882  VDFLGMSYDSQTITIKES-ISPSCQGSNNFSNIIHNSKLSETPFMYSND-NNFMLFGCG-  1712
             V+ L +S ++   T+K   IS +C G  +  ++     L+ +PF++S+  N F+  GC  
Sbjct  78    VEVLNISVETGLATVKSPVISFNCTGRKDGGSL----NLTGSPFVFSDFWNVFIAVGCDT  133

Query  1711  NAFITMPGEELDQPGYNLNCSS-KNTTAPKTAHDCQGINCNHLTVDYDVNTYQVNFTHSS  1535
              AF  M G E    G    C + +N  + +  + C G NC   ++   +  ++     ++
Sbjct  134   RAF--MSGIEPQVLGCVPTCGNQRNNVSLQENNMCSGRNCCEASIPSLLQVFKPTLVSTN  191

Query  1534  ---SFNACNYAFFlsassslpptlqslpsrqQEMVVVPVELRWTITQEDVPPSYSKYCSP  1364
                   AC  A  ++ +            +  + V  P +L W +       +YS   S 
Sbjct  192   VDQGREACKLAVLVNETWFASNISDPFALQHIDYV--PTDLGWVMN-----VNYSHDISI  244

Query  1363  S-TYINPQLQWHNYLQCDCPGGDDRNVYLSGGCEWKHKDYVISSNKLRPAIIGISASFGF  1187
             S  Y N  L      +C C  G + N YL  GC    +      N  +  +  ++   GF
Sbjct  245   SCMYYNESLNS----ECACRRGFEGNPYLELGCIDVDECKTPEKNTCQGMLKCVNTRGGF  300

Query  1186  --------------------VFLIWAFVILYkaikkrkmkklrqkffkRNGGlllqqqlL  1067
                                 + L++    +Y+ +KKR+ K+L++KFFKRNGGLLLQQQL 
Sbjct  301   RCGINKIYIIIIVVGSIIFILVLLFGLWWIYRLVKKRQNKELKKKFFKRNGGLLLQQQLS  360

Query  1066  TKEGTIEKTKIFTASELDKATDHFNADRIVGRGGQGTVYKGMLIDGQIVAVKKSQAVDED  887
             T +G+++KTKI+++ EL+ ATD FN +RI+G GGQGTVYKGML DG+I+AVKKS+ +DE+
Sbjct  361   TSDGSVQKTKIYSSKELEVATDGFNVNRILGEGGQGTVYKGMLTDGRIIAVKKSKVIDEE  420

Query  886   QLEPFINEVVILSQINHRNVVKLMGCCLETEVPILVYEFIPNGTLFGLIHNNFDNELIPL  707
              LE FINEVVILSQINHRNVVKL+GCCLETEVPILVYEFI NG L+  IH   D+ L  L
Sbjct  421   NLEEFINEVVILSQINHRNVVKLLGCCLETEVPILVYEFISNGNLYKYIHVQSDDFL--L  478

Query  706   SWDIRLRIASEVACALAYLHSVTLVPIYHRDIKTGNILLDEKFRAKVSDFGTSRSISIDK  527
             SW++RLRIA EVA AL+YLHS   +PIYHRDIK+ NILLDEK+RA +SDFG+SRSI+ID+
Sbjct  479   SWEMRLRIAIEVAGALSYLHSTASIPIYHRDIKSTNILLDEKYRATISDFGSSRSIAIDQ  538

Query  526   THFTTMVKGTFGYLDPEYFQSSQFTEKSDVYSFGVVLAELLTGQKPISFELDDDEDRSLV  347
             TH TT V+GTFGYLDPEYFQSSQFTEKSDVYSFGVVL ELL+GQKPI F     E RSL 
Sbjct  539   THLTTHVQGTFGYLDPEYFQSSQFTEKSDVYSFGVVLVELLSGQKPI-FSASPTESRSLA  597

Query  346   SRFLLCMEENRLMEMLDGEVIEQGKKEDVVAMAWLAQRCLNFNGKKRPTMKEVATELDAI  167
             + F++ ME+NRL ++LD  V E    E+VVA+  LA++CLN NGK RPTMKEV TEL+ I
Sbjct  598   THFIMMMEDNRLFDILDARVKEHCHNEEVVAVGNLARKCLNLNGKNRPTMKEVTTELERI  657

Query  166   --KASN  155
               K SN
Sbjct  658   IKKGSN  663



>emb|CDX91964.1| BnaC03g32660D [Brassica napus]
Length=636

 Score =   430 bits (1105),  Expect = 9e-134, Method: Compositional matrix adjust.
 Identities = 235/438 (54%), Positives = 311/438 (71%), Gaps = 30/438 (7%)
 Frame = -1

Query  1390  PSYSKYCSPSTYINPQLQWHNYLQCDCPGGDDRNVYLSGGCE------------------  1265
             PSY + C+ S   +     + Y  C C  G   N Y+ GGC+                  
Sbjct  152   PSYRRNCTCSYLAD----INYYASCACNKGYRGNPYVPGGCKDIDECQENKITKGHELCS  207

Query  1264  -----WKHKDY-VISSNKLRPAIIGISASFGFVFLIWAFVILYkaikkrkmkklrqkffk  1103
                    H+ Y      K RP  IGI   F  +  I     LYK  K+++    ++KFFK
Sbjct  208   SGSTCVNHQGYYTCVPPKTRPIAIGIVIGFVILISIGGLYWLYKLFKRQRRINRKKKFFK  267

Query  1102  RNGGlllqqqlLTKEGTIEKTKIFTASELDKATDHFNADRIVGRGGQGTVYKGMLIDGQI  923
             RNGGLLLQQQL++ EG +E+TKIF++ EL+KAT++F+ +R++G+GGQGTVYKGML+DG+I
Sbjct  268   RNGGLLLQQQLISTEGNVEQTKIFSSKELEKATENFSINRVLGQGGQGTVYKGMLVDGRI  327

Query  922   VAVKKSQAVDEDQLEPFINEVVILSQINHRNVVKLMGCCLETEVPILVYEFIPNGTLFGL  743
             VAVKKS+ VDED+LE FINEVVILSQINHRN+VKL GCCLET+VP+LVYEFIPNG LF  
Sbjct  328   VAVKKSKVVDEDKLEEFINEVVILSQINHRNIVKLFGCCLETQVPVLVYEFIPNGNLFEH  387

Query  742   IHNNFDNELIPLSWDIRLRIASEVACALAYLHSVTLVPIYHRDIKTGNILLDEKFRAKVS  563
             +H+  D++ +  +W++RLRIA++VA AL+YLHS    PIYHRDIK+ NI+LDEK RAKVS
Sbjct  388   LHDELDDDTMT-TWEVRLRIATDVAGALSYLHSAASFPIYHRDIKSTNIMLDEKCRAKVS  446

Query  562   DFGTSRSISIDKTHFTTMVKGTFGYLDPEYFQSSQFTEKSDVYSFGVVLAELLTGQKPIS  383
             DFGTSRS+++D TH TT+V GT GY+DPEYFQSSQFT+KSDVYSFGVVL EL+TG K IS
Sbjct  447   DFGTSRSVTVDHTHLTTVVSGTVGYVDPEYFQSSQFTDKSDVYSFGVVLVELITGAKAIS  506

Query  382   FELDDDEDRSLVSRFLLCMEENRLMEMLDGEVIEQGKKEDVVAMAWLAQRCLNFNGKKRP  203
             + +  +E+R+L + F+L M+E+RL E++D  + EQ K E V   A LA++CLN  GKKRP
Sbjct  507   Y-MRSEENRTLATYFILAMKEDRLEEIIDARIKEQCKLEQVRVAAKLARKCLNLKGKKRP  565

Query  202   TMKEVATELDAIKASNSH  149
             +M+EV+ EL+ +++ + H
Sbjct  566   SMREVSMELEKLRSLHGH  583



>ref|XP_010038763.1| PREDICTED: wall-associated receptor kinase-like 1 [Eucalyptus 
grandis]
Length=722

 Score =   432 bits (1112),  Expect = 1e-133, Method: Compositional matrix adjust.
 Identities = 271/592 (46%), Positives = 364/592 (61%), Gaps = 66/592 (11%)
 Frame = -1

Query  1819  SCQGSNNFSNIIHNSKLSETPFMYSND-NNFMLFGCG-NAFITMPGEE-----LDQPGYN  1661
             SCQG       I +  L E+ F++S   N F+L GC   A I+    E     L +    
Sbjct  106   SCQG-------IKSVNLEESNFVFSQRLNVFILVGCDTKATISSTKSEGVVSTLTETSCE  158

Query  1660  LNCSSKNTTAPKTAHDCQGIN-CNHLTVDYDVNTYQVNFTHSSSFNACNYAFFlsasssl  1484
               C+  NT   + +  C G + C  + +  D+  + V+         C  A     SS L
Sbjct  159   SKCAETNTNISQYSA-CTGRDGCCQIKLPTDLQAFNVSIEG----QRCESAILAEQSSLL  213

Query  1483  pptlqslpsrqQEMVVVPVELRWTIT-----------QEDVPPSYSKYCSPSTYINPQLQ  1337
                   L   +    V P  L+W I            +     + S Y S S Y+     
Sbjct  214   KSGATDLYDLRVNGTV-PFVLQWGIPINNSDSFKLLDESMSSDAVSCYASSSPYV-----  267

Query  1336  WHNYLQCDCPGGDDRNVYLSGGCE---------------------WKHKDYVISSNKLRP  1220
                  +C C  G   N Y   GC+                         D V      + 
Sbjct  268   -----ECGCQSGYRGNPYFIEGCQDIDECENSAICPKTGSACVNKPGRYDCVDGRKTAKL  322

Query  1219  AIIGISASFGFVFLIWAFVILYkaikkrkmkklrqkffkRNGGlllqqqlLTKEGTIEKT  1040
              +IG+ A  G + L      LY  +KKRK  KL++K FKRNGGLLL+ +L + +G +EK+
Sbjct  323   IVIGVGAGVGALLLGLFLWRLYIYMKKRKEIKLKEKCFKRNGGLLLESELSSPQGNVEKS  382

Query  1039  KIFTASELDKATDHFNADRIVGRGGQGTVYKGMLIDGQIVAVKKSQAVDEDQLEPFINEV  860
             K+F + +L+KATD+FN DRI+G+GGQGTVYKGML DG+IVA+KKS+ +DE ++E FINE+
Sbjct  383   KLFNSKDLEKATDNFNEDRILGQGGQGTVYKGMLTDGKIVAIKKSKVIDEGKVEHFINEI  442

Query  859   VILSQINHRNVVKLMGCCLETEVPILVYEFIPNGTLFGLIHNNFDNELIPLSWDIRLRIA  680
             +ILSQINHRNVVKL+GCCLETEVP+LVYEFIPNGTL+  +H+   NE   +SWD RLR+A
Sbjct  443   LILSQINHRNVVKLLGCCLETEVPLLVYEFIPNGTLYQYLHD--PNEKFHVSWDTRLRLA  500

Query  679   SEVACALAYLHSVTLVPIYHRDIKTGNILLDEKFRAKVSDFGTSRSISIDKTHFTTMVKG  500
             +E++ AL YLHS   +PIYHRDIK+ NILLDEK+RAKV+DFGTS+++S+D+TH TT+V+G
Sbjct  501   TEISGALFYLHSAASIPIYHRDIKSTNILLDEKYRAKVADFGTSKTVSLDQTHVTTLVQG  560

Query  499   TFGYLDPEYFQSSQFTEKSDVYSFGVVLAELLTGQKPISFELDDDEDRSLVSRFLLCMEE  320
             TFGYLDPEYFQSSQFT+KSDVYSFGVVL ELLTGQKPIS  L + E RSL + F++ ME+
Sbjct  561   TFGYLDPEYFQSSQFTDKSDVYSFGVVLVELLTGQKPIS-SLREQEGRSLATYFIISMEQ  619

Query  319   NRLMEMLDGEVIEQGKKEDVVAMAWLAQRCLNFNGKKRPTMKEVATELDAIK  164
             N L +++D +V+++GKKED+  +A LA+RCL+ NG+ RPTMKE+A EL+ I+
Sbjct  620   NHLFDIVDSQVLKEGKKEDIAVVANLARRCLHLNGRNRPTMKELAMELEGIR  671



>ref|XP_010497632.1| PREDICTED: wall-associated receptor kinase-like 22 isoform X3 
[Camelina sativa]
Length=599

 Score =   428 bits (1100),  Expect = 1e-133, Method: Compositional matrix adjust.
 Identities = 244/439 (56%), Positives = 313/439 (71%), Gaps = 27/439 (6%)
 Frame = -1

Query  1387  SYSKYCSPSTYINPQLQWHNYLQCDCPGGDDRNVYLSGGC-------EWKH-------KD  1250
             +YS Y S        L+  +Y  C C GG   N YLS GC       E K        K 
Sbjct  121   AYSNYQSCICRYGKYLE-RSYRSCMCNGGYRGNPYLSSGCIDIDECEEAKAEGRNPCGKG  179

Query  1249  Y----------VISSNKLRPAIIGISASFGFVFLIWAFVILYkaikkrkmkklrqkffkR  1100
             Y              +K    I+GIS  FG + L      LYK I+K++  K ++KFFKR
Sbjct  180   YDCENIQGNLSCRKKSKTLAIILGISLGFGLLVLAIGVWWLYKFIRKQREIKRKKKFFKR  239

Query  1099  NGGlllqqqlLTKEGTIEKTKIFTASELDKATDHFNADRIVGRGGQGTVYKGMLIDGQIV  920
             NGGLLLQQQL + EG +E+T++F++ EL+KAT+ F+ +R++G+GGQGTVYKGML+DG+IV
Sbjct  240   NGGLLLQQQLFSNEGNVERTRVFSSKELEKATEKFSVNRVLGQGGQGTVYKGMLVDGRIV  299

Query  919   AVKKSQAVDEDQLEPFINEVVILSQINHRNVVKLMGCCLETEVPILVYEFIPNGTLF-GL  743
             AVKKS+ VDED+LE FINEVVILSQINHRN+VKL+GCCLET+VPILVYEFIPNG LF  L
Sbjct  300   AVKKSKVVDEDKLEEFINEVVILSQINHRNIVKLLGCCLETDVPILVYEFIPNGNLFEHL  359

Query  742   IHNNFDNELIPLSWDIRLRIASEVACALAYLHSVTLVPIYHRDIKTGNILLDEKFRAKVS  563
              H++  ++    +W++RLRIA ++A AL+YLHS    PIYHRDIK+ NI+LDEK+RAKVS
Sbjct  360   HHDDESDDYTMATWEMRLRIAVDIAGALSYLHSAASFPIYHRDIKSTNIMLDEKYRAKVS  419

Query  562   DFGTSRSISIDKTHFTTMVKGTFGYLDPEYFQSSQFTEKSDVYSFGVVLAELLTGQKPIS  383
             DFGTSRS++ID TH TT+V GT GY+DPEYFQSSQFT+KSDVYSFGVVL EL+TG+KPIS
Sbjct  420   DFGTSRSVTIDHTHLTTVVAGTVGYVDPEYFQSSQFTDKSDVYSFGVVLVELITGEKPIS  479

Query  382   FELDDDEDRSLVSRFLLCMEENRLMEMLDGEVIEQGKKEDVVAMAWLAQRCLNFNGKKRP  203
             F L  DE+R+L + F+L M+ ++L  ++D  + +    E V A+A LA+RCLN NGKKRP
Sbjct  480   F-LRSDENRTLATYFILAMKNSKLSSIIDARIKDNCNMEQVTAVANLARRCLNLNGKKRP  538

Query  202   TMKEVATELDAIKASNSHL  146
              M+EV+TEL+ I+ S   L
Sbjct  539   NMREVSTELERIRNSQVQL  557



>ref|XP_010648089.1| PREDICTED: wall-associated receptor kinase-like 10 [Vitis vinifera]
Length=677

 Score =   431 bits (1107),  Expect = 1e-133, Method: Compositional matrix adjust.
 Identities = 244/454 (54%), Positives = 315/454 (69%), Gaps = 27/454 (6%)
 Frame = -1

Query  1447  EMVVVPVELRWTITQEDVPPSYS------KYCSPSTYINPQLQWHNYLQCDCPGGDDRNV  1286
             +M  VP  L W I       S S       +C  +T  +   Q  + L C C    + N 
Sbjct  218   DMEYVPAVLDWRIYNATCAASTSNLNTSTSFCGENTLCSTDTQ-TSSLICSCFPVYEGNP  276

Query  1285  YLSGGCEWKHKDYVISSNKLRPAIIGISASFGFVFLIWAFVILYkaikkrkmkklrqkff  1106
             YL  GC+                +I I A  G + L+     LY  +K+RK  K ++K F
Sbjct  277   YLPQGCQ----------------VITIGA-LGTLLLVLCAWWLYIVLKRRKKIKYKEKCF  319

Query  1105  kRNGGlllqqqlLTKEGTIEKTKIFTASELDKATDHFNADRIVGRGGQGTVYKGMLIDGQ  926
              RNGGLLL+QQL + EG I+KTK+FT+ EL+KATD +N +R++G+GG+GTVYKGML+DG+
Sbjct  320   NRNGGLLLEQQLSSTEGNIDKTKLFTSKELEKATDRYNENRVIGQGGEGTVYKGMLMDGR  379

Query  925   IVAVKKSQAVDEDQLEPFINEVVILSQINHRNVVKLMGCCLETEVPILVYEFIPNGTLFG  746
             IVAVKK + + + +LE FINEVVIL QINHRNVVKL+GCCLETEVP+LVYEFIPNGTL  
Sbjct  380   IVAVKKLKIMSDSKLEQFINEVVILCQINHRNVVKLLGCCLETEVPLLVYEFIPNGTLSE  439

Query  745   LIHNNFDNELIPLSWDIRLRIASEVACALAYLHSVTLVPIYHRDIKTGNILLDEKFRAKV  566
              IH    NE  P++W+IRLRIA+EVA AL+YLHS   VPIYHRDIK+ NILLD+K+RAKV
Sbjct  440   HIHGQ--NEEFPITWEIRLRIATEVAGALSYLHSAASVPIYHRDIKSTNILLDDKYRAKV  497

Query  565   SDFGTSRSISIDKTHFTTMVKGTFGYLDPEYFQSSQFTEKSDVYSFGVVLAELLTGQKPI  386
             +DFG S+ ++ID+TH TT V+GTFGYLDPEYFQSSQFTEKSDVYSFG+VL ELLTG+KPI
Sbjct  498   ADFGISKFVAIDQTHLTTQVQGTFGYLDPEYFQSSQFTEKSDVYSFGIVLIELLTGKKPI  557

Query  385   SFELDDDEDRSLVSRFLLCMEENRLMEMLDGEVIEQGKKEDVVAMAWLAQRCLNFNGKKR  206
                   +E +SL S F+L M E+RL ++LD +V+++ +KE++ A+A+LA+RC+N NGKKR
Sbjct  558   -LSTASEEGKSLASYFILSMNEDRLSDLLDAQVVKESRKEEINAIAFLARRCINLNGKKR  616

Query  205   PTMKEVATELDAIKASNSHLPLAMEAFEIESDFI  104
             PTM EVA EL+ I+           + EIE + I
Sbjct  617   PTMMEVAMELERIRKCQGDFGAQENSEEIEYNTI  650



>emb|CBI15393.3| unnamed protein product [Vitis vinifera]
Length=1029

 Score =   441 bits (1133),  Expect = 2e-133, Method: Compositional matrix adjust.
 Identities = 240/373 (64%), Positives = 302/373 (81%), Gaps = 3/373 (1%)
 Frame = -1

Query  1264  WKHKDYVISSNKLRPAIIGISASFGFVFLIWAFVILYkaikkrkmkklrqkffkRNGGll  1085
             +K+  Y  + NK +  I+G S S G + L+     LYK ++K+   +++++FFKRNGGLL
Sbjct  178   YKYDFYCSTKNKSKALILGCSISGGLLLLLIFSFGLYKVVRKQLDIRVKKRFFKRNGGLL  237

Query  1084  lqqqlLTKEGTIEKTKIFTASELDKATDHFNADRIVGRGGQGTVYKGMLIDGQIVAVKKS  905
             LQQQ+ + +   EKTKIFT+ EL+KATD+FN +RI+G+GGQGTVYKGML DG+IVAVKKS
Sbjct  238   LQQQISSDKIAFEKTKIFTSDELEKATDNFNKNRILGQGGQGTVYKGMLNDGRIVAVKKS  297

Query  904   QAVDEDQLEPFINEVVILSQINHRNVVKLMGCCLETEVPILVYEFIPNGTLFGLIHNNFD  725
             + VDE+QLE FINE+VILSQINHRNVV ++GCCLETEVP+LVYEFI NGTLF LIH+   
Sbjct  298   KIVDENQLEHFINEIVILSQINHRNVVGILGCCLETEVPLLVYEFISNGTLFQLIHDQ--  355

Query  724   NELIPLSWDIRLRIASEVACALAYLHSVTLVPIYHRDIKTGNILLDEKFRAKVSDFGTSR  545
             N   PLSW++RLRIA EV+ AL+YLHS   +PIYHRDIK+ NILLD+K++AKVSDFGTSR
Sbjct  356   NSEFPLSWEMRLRIALEVSGALSYLHSACSIPIYHRDIKSTNILLDDKYKAKVSDFGTSR  415

Query  544   SISIDKTHFTTMVKGTFGYLDPEYFQSSQFTEKSDVYSFGVVLAELLTGQKPISFELDDD  365
             SISID+TH TT+V+GTFGYLDPEYFQSSQFTEKSDVYSFGVVL ELLTGQKPIS      
Sbjct  416   SISIDQTHLTTIVQGTFGYLDPEYFQSSQFTEKSDVYSFGVVLVELLTGQKPIS-STRSP  474

Query  364   EDRSLVSRFLLCMEENRLMEMLDGEVIEQGKKEDVVAMAWLAQRCLNFNGKKRPTMKEVA  185
             E++SL + F+L ++E+RL ++LD  V+++G+KED++  A LA RCLN NG+KRPTMKEV 
Sbjct  475   EEKSLATHFILSLQESRLFDILDARVVKEGRKEDIMTFAKLAGRCLNLNGRKRPTMKEVT  534

Query  184   TELDAIKASNSHL  146
             TE+D I+ S  HL
Sbjct  535   TEIDNIRVSALHL  547



>ref|XP_011015192.1| PREDICTED: wall-associated receptor kinase-like 22 isoform X1 
[Populus euphratica]
Length=693

 Score =   430 bits (1106),  Expect = 3e-133, Method: Compositional matrix adjust.
 Identities = 298/648 (46%), Positives = 390/648 (60%), Gaps = 64/648 (10%)
 Frame = -1

Query  1963  DDCVDLN-SYIGSTHPDIQQNVRIIYEC---------------VDFLGMSYDSQTITIKE  1832
             D C D+   Y   T  D  ++ R   EC               V+ L +S +    T+K 
Sbjct  35    DRCGDITIPYPFGTGKDCYKDERFAVECDETANPPRAFISRINVEVLNISVERGLATVKS  94

Query  1831  S-ISPSCQGSNNFSNIIHNSKLSETPFMYSND-NNFMLFGCG-NAFITMPGEELDQPGYN  1661
               IS +C G  +  ++     L+ +PF++S+  N F+  GC   AF++  G E    G  
Sbjct  95    PVISFNCTGREDGGSL----DLTGSPFVFSDFWNVFVAVGCDTRAFLS--GIEPQVLGCV  148

Query  1660  LNCSSKNTTAPKTAHD-CQGINCNHLTVDYDVNTYQVNFTHSS---SFNACNYAFFlsas  1493
               C ++ +      ++ C G NC   ++      ++     ++      AC  A  ++ +
Sbjct  149   PTCGNQRSNVSLQENNMCSGRNCCQASIPSLPQVFKPTLVSTNVDQGREACKLAVLVNRT  208

Query  1492  sslpptlqslpsrqQEMVVVPVELRWTITQEDVPPSYSKYCSPSTYINPQLQWHNYLQCD  1313
                         +  + V  P  L W +   D       +CS  TY N  L+     +C 
Sbjct  209   WFASNLSDPFALQYNDYV--PANLGWVMNMND--SDIPIFCS--TYYNESLK----SECA  258

Query  1312  CPGGDDRNVYLSGGC----EWKHKD----------------YVISSNKLRPAIIGISASF  1193
             C  G + N YL  GC    E K  +                Y  + NK+   II + +  
Sbjct  259   CWRGFEGNPYLEHGCIDVDECKTPEKNTCQGMLKCVNTRGWYRCAINKIYIIIIVVGSVI  318

Query  1192  GFVFLIWAFVILYkaikkrkmkklrqkffkRNGGlllqqqlLTKEGTIEKTKIFTASELD  1013
               + L++    +YK +KKR+ K+L++KFFKRNGGLLLQQQL T +G ++KTKI+++ EL+
Sbjct  319   FILVLLFGLWWIYKLVKKRQNKELKKKFFKRNGGLLLQQQLSTSDGGVQKTKIYSSKELE  378

Query  1012  KATDHFNADRIVGRGGQGTVYKGMLIDGQIVAVKKSQAVDEDQLEPFINEVVILSQINHR  833
              ATD FN +RI+G GGQGTVYKGML DG+I+AVKKS+ VDE+ LE FINEVVILSQINHR
Sbjct  379   VATDGFNVNRILGEGGQGTVYKGMLTDGRIIAVKKSKVVDEENLEEFINEVVILSQINHR  438

Query  832   NVVKLMGCCLETEVPILVYEFIPNGTLFGLIHNNFDNELIPLSWDIRLRIASEVACALAY  653
             NVVKL+GCCLETEVPILVYEFI NG L+  IH   D+ L  LSW++RLRIA EVA ALAY
Sbjct  439   NVVKLLGCCLETEVPILVYEFISNGNLYKYIHVQNDDFL--LSWEMRLRIAIEVAGALAY  496

Query  652   LHSVTLVPIYHRDIKTGNILLDEKFRAKVSDFGTSRSISIDKTHFTTMVKGTFGYLDPEY  473
             LHS   +PIYHRDIK+ NILLDEK+RA +SDFG+SRSI+ID+TH TT V+GTFGYLDPEY
Sbjct  497   LHSAASIPIYHRDIKSTNILLDEKYRATISDFGSSRSIAIDQTHLTTHVQGTFGYLDPEY  556

Query  472   FQSSQFTEKSDVYSFGVVLAELLTGQKPISFELDDDEDRSLVSRFLLCMEENRLMEMLDG  293
             FQSSQFTEKSDVYSFGVVL ELL+GQKPI F     E RSL + F++ ME+NRL ++LD 
Sbjct  557   FQSSQFTEKSDVYSFGVVLVELLSGQKPI-FSASPTESRSLATHFIMLMEDNRLFDILDA  615

Query  292   EVIEQGKKEDVVAMAWLAQRCLNFNGKKRPTMKEVATELDAI--KASN  155
              V E    E+VVA+  LA++CLN NGK RPTMKEV TEL+ I  K SN
Sbjct  616   RVKEHCHNEEVVAVGNLARKCLNLNGKNRPTMKEVTTELERIIQKGSN  663



>ref|XP_007216118.1| hypothetical protein PRUPE_ppa018817mg, partial [Prunus persica]
 gb|EMJ17317.1| hypothetical protein PRUPE_ppa018817mg, partial [Prunus persica]
Length=712

 Score =   430 bits (1106),  Expect = 5e-133, Method: Compositional matrix adjust.
 Identities = 212/314 (68%), Positives = 257/314 (82%), Gaps = 2/314 (1%)
 Frame = -1

Query  1099  NGGlllqqqlLTKEGTIEKTKIFTASELDKATDHFNADRIVGRGGQGTVYKGMLIDGQIV  920
             NGGLLL++QL + E  +EK K+F + EL+K+TD+FN DRI+G+GGQGTVYKGML DG+IV
Sbjct  343   NGGLLLEKQLSSGEVNVEKIKLFKSKELEKSTDNFNTDRILGQGGQGTVYKGMLTDGRIV  402

Query  919   AVKKSQAVDEDQLEPFINEVVILSQINHRNVVKLMGCCLETEVPILVYEFIPNGTLFGLI  740
             AVKKS+ VDE QL  FINEVVILSQINHRNVV+L+GCCLETEVPILVYEFIPNG L   I
Sbjct  403   AVKKSKIVDESQLSDFINEVVILSQINHRNVVQLLGCCLETEVPILVYEFIPNGNLSQYI  462

Query  739   HNNFDNELIPLSWDIRLRIASEVACALAYLHSVTLVPIYHRDIKTGNILLDEKFRAKVSD  560
             H    NE  PL+W++RLRIA EVA AL+YLH     PIYHRDIK+ NILLD K+RAK++D
Sbjct  463   HEQ--NEEFPLTWEVRLRIAMEVAGALSYLHVSAAFPIYHRDIKSTNILLDAKYRAKIAD  520

Query  559   FGTSRSISIDKTHFTTMVKGTFGYLDPEYFQSSQFTEKSDVYSFGVVLAELLTGQKPISF  380
             FGTSRS++ID+TH TT+V GTFGYLDPEYFQSSQFTEKSDVYSFGVVL ELLTGQKPISF
Sbjct  521   FGTSRSVAIDQTHLTTLVHGTFGYLDPEYFQSSQFTEKSDVYSFGVVLVELLTGQKPISF  580

Query  379   ELDDDEDRSLVSRFLLCMEENRLMEMLDGEVIEQGKKEDVVAMAWLAQRCLNFNGKKRPT  200
                 +E +SL + F+  M+ +RL E+LD EV++ G K D++ +A LA+RCLN +G+KRPT
Sbjct  581   RRSQEEGKSLATYFITSMQLDRLFEILDAEVVKGGSKADIILVANLARRCLNLSGRKRPT  640

Query  199   MKEVATELDAIKAS  158
             M+EV  EL+ I+ S
Sbjct  641   MREVTAELEGIQMS  654



>gb|KCW47701.1| hypothetical protein EUGRSUZ_K01439 [Eucalyptus grandis]
Length=776

 Score =   432 bits (1111),  Expect = 5e-133, Method: Compositional matrix adjust.
 Identities = 278/588 (47%), Positives = 363/588 (62%), Gaps = 64/588 (11%)
 Frame = -1

Query  1759  PFMYSNDNN-FMLFGCGNAFITMPGEELDQPGYNLNCSSKNTTAPKTAHDCQGIN-CNHL  1586
             PF++S   N F   GC +   T+   E    G    C+  +T        C G + C   
Sbjct  120   PFVFSQTRNVFTSVGC-DTLATVGTTESAVVGCRSKCAEISTNISWHYSTCSGRDECCQS  178

Query  1585  TVDYDVNTYQVNFTHSSSFNACNYAFFlsassslpptlqslpsrqQEMVVVPVELRWTIT  1406
             T+ +D+  + V+F      + C +AF    S  L      L   +    V PV L W IT
Sbjct  179   TLPFDLQVFSVDFKEEGGHHGCKHAFLADRSWFLKSNETGLYDLRMGNTV-PVVLEWGIT  237

Query  1405  ----------QEDVPPSYS-KYCSP----STYINPQLQWHNYLQCDCPGGDDRNVYL---  1280
                       Q++    YS  Y  P    S++   ++    ++QC C  G   N YL   
Sbjct  238   DNTHYSRELMQQNYSTIYSLSYNEPFNCDSSFSGIEMP---FMQCYCGSGYHGNPYLIKG  294

Query  1279  -------------SGGCEWKHKDY-----------VISSNKL------RPAIIGI-----  1205
                          +G C  K   Y           ++  NK       R   I I     
Sbjct  295   CEDINECEDPKNCNGTCLNKQGYYDCVDGRTTTKFILVGNKKTLELFKRRCFISIKRYPR  354

Query  1204  -SASFGFVFLIWAFVILYkaikkrkmkklrqkffkRNGGlllqqqlLTKEGTIEKTKIFT  1028
               AS G + L      LY+ IKKRK  KL++K+F  NGGLLL+ +L + +  +EK+K+F 
Sbjct  355   VGASLGALLLCLLLWRLYEYIKKRKEIKLKEKYFIHNGGLLLESELSSPKYNVEKSKLFN  414

Query  1027  ASELDKATDHFNADRIVGRGGQGTVYKGMLIDGQIVAVKKSQAVDEDQLEPFINEVVILS  848
             + EL+KATD+FN DRI+G+GGQGTVYKGML DG+IVA+KKS+ +D+ Q+E FINEV+ILS
Sbjct  415   SKELEKATDNFNNDRILGQGGQGTVYKGMLTDGKIVAIKKSKVIDKGQVEQFINEVLILS  474

Query  847   QINHRNVVKLMGCCLETEVPILVYEFIPNGTLFGLIHNNFDNELIPLSWDIRLRIASEVA  668
             QINHRNVVKL+GCCLETEVP+LVYEFIPNGTL+  +H+   +   P+SWD RLRIA+E+A
Sbjct  475   QINHRNVVKLLGCCLETEVPLLVYEFIPNGTLYEYLHD--PSAEFPISWDTRLRIATEIA  532

Query  667   CALAYLHSVTLVPIYHRDIKTGNILLDEKFRAKVSDFGTSRSISIDKTHFTTMVKGTFGY  488
              AL YLHS   +PIYHRDIK+ NILLDEK+RAKV+DFGTS+SIS+D+TH TT+V+GTFGY
Sbjct  533   GALFYLHSAASIPIYHRDIKSTNILLDEKYRAKVADFGTSKSISLDQTHITTLVQGTFGY  592

Query  487   LDPEYFQSSQFTEKSDVYSFGVVLAELLTGQKPISFELDDDEDRSLVSRFLLCMEENRLM  308
             LDPEYFQSSQFT+KSDVYSFGVVL ELLTGQKPIS +  +   RSLV+ F+  MEE RL 
Sbjct  593   LDPEYFQSSQFTDKSDVYSFGVVLVELLTGQKPISSQ-REQVGRSLVTYFINSMEEIRLF  651

Query  307   EMLDGEVIEQGKKEDVVAMAWLAQRCLNFNGKKRPTMKEVATELDAIK  164
             ++ D  V+++GKKE++ +MA LA+RCLN NG+KRPTMKE A EL+ I+
Sbjct  652   DIADAHVLKEGKKEEIASMAKLAKRCLNLNGRKRPTMKEAAIELEGIR  699



>emb|CAN65309.1| hypothetical protein VITISV_043466 [Vitis vinifera]
Length=386

 Score =   419 bits (1076),  Expect = 6e-133, Method: Compositional matrix adjust.
 Identities = 208/328 (63%), Positives = 263/328 (80%), Gaps = 3/328 (1%)
 Frame = -1

Query  1099  NGGlllqqqlLTKEGTIEKTKIFTASELDKATDHFNADRIVGRGGQGTVYKGMLIDGQIV  920
             NGGLLL+QQL + +G ++KTK+FT+ EL+KATD +N +R++G+GGQGTVYKGML+DG+IV
Sbjct  53    NGGLLLEQQLFSSKGNVDKTKLFTSKELEKATDRYNENRVIGQGGQGTVYKGMLMDGRIV  112

Query  919   AVKKSQAVDEDQLEPFINEVVILSQINHRNVVKLMGCCLETEVPILVYEFIPNGTLFGLI  740
             AVKK + +++ +LE FINEVVIL QINHRNVVKL+GCCLETEVP+LVYEFIPNGTLF  I
Sbjct  113   AVKKLKIMNDSKLEQFINEVVILCQINHRNVVKLLGCCLETEVPLLVYEFIPNGTLFEHI  172

Query  739   HNNFDNELIPLSWDIRLRIASEVACALAYLHSVTLVPIYHRDIKTGNILLDEKFRAKVSD  560
             H    NE  P++W++RLRIA+EVA AL+YLHS   +PIYHRDIK+ NILLD+K+RAKV+D
Sbjct  173   HGQ--NEEFPITWEMRLRIATEVARALSYLHSAASIPIYHRDIKSTNILLDDKYRAKVAD  230

Query  559   FGTSRSISIDKTHFTTMVKGTFGYLDPEYFQSSQFTEKSDVYSFGVVLAELLTGQKPISF  380
             FGTS+  SID+TH TT V+GTFGYLDPEYFQSSQFTEKSDVYSFGVVL ELLTG+KPI  
Sbjct  231   FGTSKFFSIDQTHLTTQVQGTFGYLDPEYFQSSQFTEKSDVYSFGVVLIELLTGKKPI-L  289

Query  379   ELDDDEDRSLVSRFLLCMEENRLMEMLDGEVIEQGKKEDVVAMAWLAQRCLNFNGKKRPT  200
                 +E +SL   F + M+E+ L ++LD  V+++G  ED+  +A+LA+RC+N NGKKRPT
Sbjct  290   STRSEERKSLALYFKISMKEDHLSDLLDARVVKEGMXEDINEIAFLARRCINLNGKKRPT  349

Query  199   MKEVATELDAIKASNSHLPLAMEAFEIE  116
             M EVA EL+ I+           + EIE
Sbjct  350   MMEVAMELERIRKCQGDFRAQENSKEIE  377



>gb|KDO44467.1| hypothetical protein CISIN_1g017262mg [Citrus sinensis]
Length=374

 Score =   418 bits (1074),  Expect = 6e-133, Method: Compositional matrix adjust.
 Identities = 222/356 (62%), Positives = 288/356 (81%), Gaps = 13/356 (4%)
 Frame = -1

Query  1210  GISASFGFVFL----IWAFVILYkaikkrkmkklrqkffkRNGGlllqqqlLTKEGTIEK  1043
             GI    G +FL    +W  +I+      RK  K ++K FK+NGGLLLQQQL +  G+I++
Sbjct  5     GIGTGLGGLFLSIGALWLCIII------RKRIKQKEKNFKKNGGLLLQQQLNSIGGSIDR  58

Query  1042  TKIFTASELDKATDHFNADRIVGRGGQGTVYKGMLIDGQIVAVKKSQAVDEDQLEPFINE  863
              +IF + ELDKATD+FN +RI+G+GGQGTVYKGML DG+I+AVKKS+ VDE +LE FINE
Sbjct  59    CRIFNSKELDKATDYFNMNRILGQGGQGTVYKGMLADGRIIAVKKSKVVDESKLEEFINE  118

Query  862   VVILSQINHRNVVKLMGCCLETEVPILVYEFIPNGTLFGLIHNNFDNELIPLSWDIRLRI  683
             VVILSQINHRNVVKL+GCCLE EVP+LVYEFIPNGTLF  +H+ +  E + L+W++RLRI
Sbjct  119   VVILSQINHRNVVKLLGCCLEVEVPLLVYEFIPNGTLFQYLHDPY--EELSLTWEMRLRI  176

Query  682   ASEVACALAYLHSVTLVPIYHRDIKTGNILLDEKFRAKVSDFGTSRSISIDKTHFTTMVK  503
             A+EVA ALAYLHS   +PIYHRDIK+ NILLDEK+RAK++DFGTSRSI+ID+TH +T V+
Sbjct  177   ATEVAEALAYLHSSAYLPIYHRDIKSTNILLDEKYRAKIADFGTSRSIAIDQTHVSTKVQ  236

Query  502   GTFGYLDPEYFQSSQFTEKSDVYSFGVVLAELLTGQKPISFELDDDEDRSLVSRFLLCME  323
             GTFGYLDPEYF+SSQFT+KSDVYSFGVVL ELLTGQKPIS  +  +E R+L + F+ C+E
Sbjct  237   GTFGYLDPEYFRSSQFTDKSDVYSFGVVLVELLTGQKPIS-SIWANEGRNLTTYFVECIE  295

Query  322   ENRLMEMLDGEVIEQGKKEDVVAMAWLAQRCLNFNGKKRPTMKEVATELDAIKASN  155
             EN L +++D +V + G+ E+++A++ +A+RCLN  G+ RPTMKEVA EL+ I+A++
Sbjct  296   ENCLFDIIDDQVRKSGEAEEIMAVSDVAKRCLNSYGRNRPTMKEVAMELERIRANS  351



>ref|XP_011020553.1| PREDICTED: wall-associated receptor kinase-like 22 isoform X1 
[Populus euphratica]
Length=721

 Score =   430 bits (1106),  Expect = 6e-133, Method: Compositional matrix adjust.
 Identities = 298/648 (46%), Positives = 390/648 (60%), Gaps = 64/648 (10%)
 Frame = -1

Query  1963  DDCVDLN-SYIGSTHPDIQQNVRIIYEC---------------VDFLGMSYDSQTITIKE  1832
             D C D+   Y   T  D  ++ R   EC               V+ L +S +    T+K 
Sbjct  63    DRCGDITIPYPFGTGKDCYKDERFAVECDETANPPRAFISRINVEVLNISVERGLATVKS  122

Query  1831  S-ISPSCQGSNNFSNIIHNSKLSETPFMYSND-NNFMLFGCG-NAFITMPGEELDQPGYN  1661
               IS +C G  +  ++     L+ +PF++S+  N F+  GC   AF++  G E    G  
Sbjct  123   PVISFNCTGREDGGSL----DLTGSPFVFSDFWNVFVAVGCDTRAFLS--GIEPQVLGCV  176

Query  1660  LNCSSKNTTAPKTAHD-CQGINCNHLTVDYDVNTYQVNFTHSS---SFNACNYAFFlsas  1493
               C ++ +      ++ C G NC   ++      ++     ++      AC  A  ++ +
Sbjct  177   PTCGNQRSNVSLQENNMCSGRNCCQASIPSLPQVFKPTLVSTNVDQGREACKLAVLVNRT  236

Query  1492  sslpptlqslpsrqQEMVVVPVELRWTITQEDVPPSYSKYCSPSTYINPQLQWHNYLQCD  1313
                         +  + V  P  L W +   D       +CS  TY N  L+     +C 
Sbjct  237   WFASNLSDPFALQYNDYV--PANLGWVMNMND--SDIPIFCS--TYYNESLK----SECA  286

Query  1312  CPGGDDRNVYLSGGC----EWKHKD----------------YVISSNKLRPAIIGISASF  1193
             C  G + N YL  GC    E K  +                Y  + NK+   II + +  
Sbjct  287   CWRGFEGNPYLEHGCIDVDECKTPEKNTCQGMLKCVNTRGWYRCAINKIYIIIIVVGSVI  346

Query  1192  GFVFLIWAFVILYkaikkrkmkklrqkffkRNGGlllqqqlLTKEGTIEKTKIFTASELD  1013
               + L++    +YK +KKR+ K+L++KFFKRNGGLLLQQQL T +G ++KTKI+++ EL+
Sbjct  347   FILVLLFGLWWIYKLVKKRQNKELKKKFFKRNGGLLLQQQLSTSDGGVQKTKIYSSKELE  406

Query  1012  KATDHFNADRIVGRGGQGTVYKGMLIDGQIVAVKKSQAVDEDQLEPFINEVVILSQINHR  833
              ATD FN +RI+G GGQGTVYKGML DG+I+AVKKS+ VDE+ LE FINEVVILSQINHR
Sbjct  407   VATDGFNVNRILGEGGQGTVYKGMLTDGRIIAVKKSKVVDEENLEEFINEVVILSQINHR  466

Query  832   NVVKLMGCCLETEVPILVYEFIPNGTLFGLIHNNFDNELIPLSWDIRLRIASEVACALAY  653
             NVVKL+GCCLETEVPILVYEFI NG L+  IH   D+ L  LSW++RLRIA EVA ALAY
Sbjct  467   NVVKLLGCCLETEVPILVYEFISNGNLYKYIHVQNDDFL--LSWEMRLRIAIEVAGALAY  524

Query  652   LHSVTLVPIYHRDIKTGNILLDEKFRAKVSDFGTSRSISIDKTHFTTMVKGTFGYLDPEY  473
             LHS   +PIYHRDIK+ NILLDEK+RA +SDFG+SRSI+ID+TH TT V+GTFGYLDPEY
Sbjct  525   LHSAASIPIYHRDIKSTNILLDEKYRATISDFGSSRSIAIDQTHLTTHVQGTFGYLDPEY  584

Query  472   FQSSQFTEKSDVYSFGVVLAELLTGQKPISFELDDDEDRSLVSRFLLCMEENRLMEMLDG  293
             FQSSQFTEKSDVYSFGVVL ELL+GQKPI F     E RSL + F++ ME+NRL ++LD 
Sbjct  585   FQSSQFTEKSDVYSFGVVLVELLSGQKPI-FSASPTESRSLATHFIMLMEDNRLFDILDA  643

Query  292   EVIEQGKKEDVVAMAWLAQRCLNFNGKKRPTMKEVATELDAI--KASN  155
              V E    E+VVA+  LA++CLN NGK RPTMKEV TEL+ I  K SN
Sbjct  644   RVKEHCHNEEVVAVGNLARKCLNLNGKNRPTMKEVTTELERIIQKGSN  691



>gb|KFK36623.1| hypothetical protein AALP_AA4G147800 [Arabis alpina]
Length=479

 Score =   422 bits (1084),  Expect = 8e-133, Method: Compositional matrix adjust.
 Identities = 226/388 (58%), Positives = 298/388 (77%), Gaps = 7/388 (2%)
 Frame = -1

Query  1309  PGGDDRNVYLSGGCEWKHKDYVI--SSNKLRPAIIGISASFGFVFLIWAFVILYkaikkr  1136
             PG  ++N    G C      Y+     +K  P  IG+   FG + L    +  YK IKK+
Sbjct  96    PGSCNKN---EGTCVNTPGSYICVPKKDKTLPITIGLCVGFGVLILFGVTLWFYKFIKKQ  152

Query  1135  kmkklrqkffkRNGGlllqqqlLTKEGTIEKTKIFTASELDKATDHFNADRIVGRGGQGT  956
             +    ++KFFKRNGGLLL+QQL + EG+IEKT +F + EL+KAT++F+ +R++G+GGQGT
Sbjct  153   RKINRKKKFFKRNGGLLLKQQLTSTEGSIEKTIVFNSKELEKATENFSLNRVLGQGGQGT  212

Query  955   VYKGMLIDGQIVAVKKSQAVDEDQLEPFINEVVILSQINHRNVVKLMGCCLETEVPILVY  776
             VYKGML+DG+IVAVKKS+ VDED+LE FINEVVILSQINHRN+VKL+GCCLET+VP+LVY
Sbjct  213   VYKGMLVDGRIVAVKKSKVVDEDKLEEFINEVVILSQINHRNIVKLIGCCLETQVPLLVY  272

Query  775   EFIPNGTLFGLIHNNFDNELIPLSWDIRLRIASEVACALAYLHSVTLVPIYHRDIKTGNI  596
             EFI NG LF  +H+ FD+  +  +W++RLRIA ++A AL+YLHS    PIYHRDIK+ NI
Sbjct  273   EFISNGNLFEHLHDEFDDYTMA-TWEVRLRIAIDIAGALSYLHSAASSPIYHRDIKSTNI  331

Query  595   LLDEKFRAKVSDFGTSRSISIDKTHFTTMVKGTFGYLDPEYFQSSQFTEKSDVYSFGVVL  416
             +LDEK+RAKVSDFGTSRSI++D TH TT+V GT GY+DPEYFQSSQFT+KSDVYSFGVVL
Sbjct  332   MLDEKYRAKVSDFGTSRSITVDHTHLTTVVSGTVGYVDPEYFQSSQFTDKSDVYSFGVVL  391

Query  415   AELLTGQKPISFELDDDEDRSLVSRFLLCMEENRLMEMLDGEVIEQGKKEDVVAMAWLAQ  236
              EL+TG+KPIS  L   E+R+L + F+L M++NRL +++D  + +  K+E V+A A LA+
Sbjct  392   VELITGEKPISI-LRFQENRTLATYFILAMKDNRLADIIDRRIRDACKQEQVMAAAQLAR  450

Query  235   RCLNFNGKKRPTMKEVATELDAIKASNS  152
             RCLN NGKKRP+M+EV+ EL+ I +  +
Sbjct  451   RCLNLNGKKRPSMREVSMELERIHSPKT  478



>ref|XP_004306021.1| PREDICTED: wall-associated receptor kinase-like 10-like [Fragaria 
vesca subsp. vesca]
Length=500

 Score =   422 bits (1085),  Expect = 9e-133, Method: Compositional matrix adjust.
 Identities = 249/455 (55%), Positives = 316/455 (69%), Gaps = 31/455 (7%)
 Frame = -1

Query  1444  MVVVPVELRWTI-------TQEDV---------PPSYSKYCSPSTYINPQLQWHNYLQCD  1313
             M  VP+ L W +       T+++V         P S +K    + Y++ + Q  N  +CD
Sbjct  1     MEYVPIVLDWFLYRLIDDSTEDNVTRNCESEQGPCSCAKGYQGNPYLSGRCQDIN--ECD  58

Query  1312  -----CPGGDDRNVYLSGGCEWKHKDYVISSNKLRPAIIGISASFGFVFLIWAFVILYka  1148
                  C  G   N+  +  C   H D  +   KL   II +   FG +F I     L K 
Sbjct  59    EDPDICRSGICSNLNGTYECFKPHPDRPLKPIKL--GIIVLCCVFGLLFQIGGAWWLRKV  116

Query  1147  ikkrkmkklrqkffkRNGGlllqqqlLTKEGTIEKTKIFTASELDKATDHFNADRIVGRG  968
             IKKRK    +++ F+ NGGLLL+QQL + E  +EK K+F   ELDKATD FNADRI+G G
Sbjct  117   IKKRKNIMRKKRNFRLNGGLLLKQQLSSGEANVEKIKLFDEKELDKATDRFNADRILGEG  176

Query  967   GQGTVYKGMLIDGQIVAVKKSQAVDEDQLEPFINEVVILSQINHRNVVKLMGCCLETEVP  788
             GQGTVYKGML DG+IVAVKKS+ VD   +  FINE+VILSQINHRNVVK++GCCLE+EVP
Sbjct  177   GQGTVYKGMLKDGRIVAVKKSKIVDGGDVSQFINEIVILSQINHRNVVKILGCCLESEVP  236

Query  787   ILVYEFIPNGTLFGLIHNNFDNELIPLSWDIRLRIASEVACALAYLHSVTLVPIYHRDIK  608
             +LVYEF+PNGTL   IH+  D+   PL+W++RLR+A EV  AL+YLHS   +PIYHRDIK
Sbjct  237   LLVYEFLPNGTLSQYIHSRDDD--FPLTWEVRLRVAIEVVGALSYLHSSASMPIYHRDIK  294

Query  607   TGNILLDEKFRAKVSDFGTSRSISIDKTHFT-TMVKGTFGYLDPEYFQSSQFTEKSDVYS  431
             + NILLDE+ RAKV+DFGTSRS+SID+TH T T V GTFGYLDPEYFQSSQFT+KSDVYS
Sbjct  295   SSNILLDERHRAKVADFGTSRSVSIDQTHLTMTHVNGTFGYLDPEYFQSSQFTDKSDVYS  354

Query  430   FGVVLAELLTGQKPISFELDDD---EDRSLVSRFLLCMEENRLMEMLDGEVIEQGKKEDV  260
             FGVVLAELLTGQKP+S     +   + RSL + F++ MEEN L ++LD EV++ GKKE++
Sbjct  355   FGVVLAELLTGQKPVSVTRSQEGRQDGRSLATYFMVSMEENSLFDILDAEVMKGGKKEEI  414

Query  259   VAMAWLAQRCLNFNGKKRPTMKEVATELDAIKASN  155
             +A+A LA+RCLN  GKKRPTMK++A EL+ I  S+
Sbjct  415   MAVANLAKRCLNMKGKKRPTMKDIAVELEGIIMSS  449



>gb|KCW81760.1| hypothetical protein EUGRSUZ_C03125 [Eucalyptus grandis]
Length=621

 Score =   426 bits (1096),  Expect = 1e-132, Method: Compositional matrix adjust.
 Identities = 199/296 (67%), Positives = 254/296 (86%), Gaps = 3/296 (1%)
 Frame = -1

Query  1051  IEKTKIFTASELDKATDHFNADRIVGRGGQGTVYKGMLIDGQIVAVKKSQAVDEDQLEPF  872
             +EK K+F + +L+KAT++FN DRI+GRGGQGTVYKGML DG+IVA+KKS+A+DE ++E F
Sbjct  278   VEKNKLFNSKDLEKATNNFNEDRILGRGGQGTVYKGMLTDGKIVAIKKSKAIDEGKVEQF  337

Query  871   INEVVILSQINHRNVVKLMGCCLETEVPILVYEFIPNGTLFGLIHNNFDNELIPLSWDIR  692
             INEV ILSQINHRN+VKL+GCCLETEVP+LVYEFIPNGTL+  +H+    E   +SWD R
Sbjct  338   INEVFILSQINHRNIVKLLGCCLETEVPLLVYEFIPNGTLYQYLHD--PKEEYHVSWDTR  395

Query  691   LRIASEVACALAYLHSVTLVPIYHRDIKTGNILLDEKFRAKVSDFGTSRSISIDKTHFTT  512
             LRIA+E+A AL YLHS   +PIYHRDIK+ NILLDEK+RAKV+DFGTS+S+S+D+TH TT
Sbjct  396   LRIATEIAGALFYLHSAASIPIYHRDIKSTNILLDEKYRAKVADFGTSKSVSLDQTHVTT  455

Query  511   MVKGTFGYLDPEYFQSSQFTEKSDVYSFGVVLAELLTGQKPISFELDDDEDRSLVSRFLL  332
             +V+GTFGYLDPEYFQSSQFT+KSDVYSFGVVL ELLTGQKPIS  L + E RSL + F++
Sbjct  456   LVQGTFGYLDPEYFQSSQFTDKSDVYSFGVVLVELLTGQKPIS-SLREQEGRSLATYFII  514

Query  331   CMEENRLMEMLDGEVIEQGKKEDVVAMAWLAQRCLNFNGKKRPTMKEVATELDAIK  164
              MEEN+L +++D +V+++GKKE++ ++A LA+RCLN NG+ RPTMKEVA EL+ ++
Sbjct  515   SMEENQLFDIVDAQVLKEGKKEEIASVANLAKRCLNLNGRNRPTMKEVAMELEGMR  570



>ref|XP_010277643.1| PREDICTED: LOW QUALITY PROTEIN: wall-associated receptor kinase-like 
1 [Nelumbo nucifera]
Length=419

 Score =   419 bits (1076),  Expect = 2e-132, Method: Compositional matrix adjust.
 Identities = 208/312 (67%), Positives = 260/312 (83%), Gaps = 3/312 (1%)
 Frame = -1

Query  1099  NGGlllqqqlLTKEGTIEKTKIFTASELDKATDHFNADRIVGRGGQGTVYKGMLIDGQIV  920
             NGGLLLQQQ+L+ EG +EK K+F A EL KATD +N +R++G+GGQGTVYKGML DG+IV
Sbjct  49    NGGLLLQQQILSIEGNVEKIKVFMAEELGKATDQYNENRVLGQGGQGTVYKGMLSDGRIV  108

Query  919   AVKKSQAVDEDQLEPFINEVVILSQINHRNVVKLMGCCLETEVPILVYEFIPNGTLFGLI  740
              +KKS+ +DE +LE FINE+VILSQINHRNVVKL+GCCLETE+P+LVYEFI   TLF  I
Sbjct  109   VIKKSKILDESKLEQFINEIVILSQINHRNVVKLLGCCLETEIPLLVYEFISGETLFYNI  168

Query  739   HNNFDNELIPLSWDIRLRIASEVACALAYLHSVTLVPIYHRDIKTGNILLDEKFRAKVSD  560
             H+   NE   LSWD RLRIA+EVA  +AYLHS   +PIYHRDIK+ NI LD+K+RAKV+D
Sbjct  169   HHK--NEDFSLSWDNRLRIATEVAGPVAYLHSAASIPIYHRDIKSSNIFLDDKYRAKVAD  226

Query  559   FGTSRSISIDKTHFTTMVKGTFGYLDPEYFQSSQFTEKSDVYSFGVVLAELLTGQKPISF  380
             FGTSRSI+IDKTH TT+V+GTFGYLDPEYFQSSQFTEKSDVYSFGVVL ELLTG+KPIS+
Sbjct  227   FGTSRSIAIDKTHLTTIVQGTFGYLDPEYFQSSQFTEKSDVYSFGVVLVELLTGEKPISY  286

Query  379   ELDDDEDRSLVSRFLLCMEENRLMEMLDGEVIEQGKKEDVVAMAWLAQRCLNFNGKKRPT  200
                  E R+LV+ F+  M+EN L E+LD +V+++ +KE++  +A LA+RCL+ NGK+RPT
Sbjct  287   T-RPTEGRNLVTYFISSMDENXLFEILDAQVVKESRKEELQVVANLAKRCLSLNGKERPT  345

Query  199   MKEVATELDAIK  164
             MKE+A+EL+ ++
Sbjct  346   MKEIASELEGLR  357



>ref|XP_004305857.1| PREDICTED: wall-associated receptor kinase-like 8-like [Fragaria 
vesca subsp. vesca]
Length=710

 Score =   429 bits (1102),  Expect = 2e-132, Method: Compositional matrix adjust.
 Identities = 282/578 (49%), Positives = 357/578 (62%), Gaps = 34/578 (6%)
 Frame = -1

Query  1849  TITIKESIS---PSCQGSNNFSNIIHNSKLSETPFMYSNDNNFMLFGCG-NAFITMPGEE  1682
             T+T++  I+   P C     + N    + LS +PF++S  N   + GCG   ++T     
Sbjct  90    TLTVRSPITFLDPIC--GCPWPNSGQPANLSGSPFVFSQKNRLAVMGCGGTTWMT-----  142

Query  1681  LDQPGYNLNCSS---KNTTAPKTAHDCQGINCNHLTVDYDVNTYQVNFTHSSSFN----A  1523
             LD      +C S        P T   C GINC  +    ++  +   F  S+       +
Sbjct  143   LDNGSRVASCPSVCGDGGKLPDTLDRCNGINCCQINTPPELTAFNYTFEASNKTTPGTES  202

Query  1522  CNYAFFlsassslpptlqslpsrqQEMVVVPVELRWTITQEDVPPSYSKYCSPSTYIN-P  1346
             C YAF +   S +  +      +   ++ +PV L W + +      Y ++     + N  
Sbjct  203   CKYAFLVDQESWVYDSTGLSSIQ--NVMSIPVLLDWNLNRYSTVQIYGRH----DWTNDS  256

Query  1345  QLQWHNYLQCDCPGGDDRNVYLSGGC---EWKHKDYVISSNKLRPAIIGISASFGFVFLI  1175
              +   +  QC C  G   N YL  GC   +            L+ AI+ IS   G +FL 
Sbjct  257   TMNCTSAHQCVCSRGYQGNPYLIDGCRDVDECEDPITCGPLWLKVAILVISCVLGLLFLH  316

Query  1174  WAFVILYkaikkrkmkklrqkffkRNGGlllqqqlLTKEGT-IEKTKIFTASELDKATDH  998
                   YK IKKRK  K +QKFFK+NGGLLLQQQ  + + T IEK K+F + EL+KATD 
Sbjct  317   GGTWWSYKVIKKRKNIKRKQKFFKQNGGLLLQQQSSSGDQTSIEKLKLFHSEELEKATDG  376

Query  997   FNADRIVGRGGQGTVYKGMLIDGQIVAVKKSQAVDEDQLEPFINEVVILSQINHRNVVKL  818
             FNADRI+GRGGQGTVYKGML DG+IVAVKKS   +  +L  FINE+V+LSQI HRNVVKL
Sbjct  377   FNADRILGRGGQGTVYKGMLADGKIVAVKKSLLANGSELRQFINEIVVLSQIIHRNVVKL  436

Query  817   MGCCLETEVPILVYEFIPNGTLFGLIHNNFDNELIPLSWDIRLRIASEVACALAYLHSVT  638
              GCCLETEVP+LVYEFIPNGTL   I +  +NE  PL+W IRLR+A EVA AL+YLHS  
Sbjct  437   WGCCLETEVPLLVYEFIPNGTLSHYIQH--ENEDFPLTWGIRLRVAKEVAGALSYLHSAA  494

Query  637   LVPIYHRDIKTGNILLDEKFRAKVSDFGTSRSISIDKTHFT-TMVKGTFGYLDPEYFQSS  461
               PIYHRDIK+ NILLD+K+  KV+DFGTSRS+SIDKTH T + V+GTFGYLDPEYFQ+S
Sbjct  495   TTPIYHRDIKSSNILLDDKYTVKVADFGTSRSVSIDKTHLTLSQVQGTFGYLDPEYFQTS  554

Query  460   QFTEKSDVYSFGVVLAELLTGQKPISFELDDDEDRSLVSRFLLCMEENRLMEMLDGEVIE  281
             QFT+KSDVYSFGVVLAELLTG+KPI F+    E  SL   FL+ MEENRL ++LD  V+ 
Sbjct  555   QFTDKSDVYSFGVVLAELLTGKKPI-FQTKSQETMSLSHYFLVSMEENRLSDILDARVMN  613

Query  280   QGKKEDVVAMAWLAQRCLNFNGKKRPTMKEVATELDAI  167
               KKE V+A+A LA RCLN  GK+RP MKEV  EL+AI
Sbjct  614   SEKKE-VMAVANLAMRCLNMKGKERPAMKEVVAELEAI  650



>ref|XP_010051307.1| PREDICTED: wall-associated receptor kinase-like 3 [Eucalyptus 
grandis]
Length=1004

 Score =   437 bits (1124),  Expect = 2e-132, Method: Compositional matrix adjust.
 Identities = 274/602 (46%), Positives = 367/602 (61%), Gaps = 71/602 (12%)
 Frame = -1

Query  1825  SPSCQGSNNFSNIIHNSKLSETPFMYSND-NNFMLFGCGNAFITMPGEELDQPGYNLNCS  1649
             S SC G    + +     L  + F++S   N F + GC N  +T    E    G    C+
Sbjct  375   SASCGGDGRGAMV----SLKGSQFVFSEKWNTFTVVGC-NTLVTGNNTESAVFGCRSKCT  429

Query  1648  SKNTTAPKTAHDCQGIN-CNHLTVDYDVNTYQVNFTHSSSFNACNYAFFlsassslpptl  1472
               + T  K +  C G + C    +  ++  + V+F        C YAF  S  + +    
Sbjct  430   GTDFTIRKNS-SCSGRDGCCQSLLPLNLQGFGVDFKEEGGNGGCKYAFLRSDFTGVYDLR  488

Query  1471  qslpsrqQEMVVVPVELRWTIT----------------------------QEDVPPSYSK  1376
              S          VPV L W I                             + +    Y +
Sbjct  489   SSD--------TVPVVLDWGIANNTNYALDLIRQPYHDESFHCRSLENSARTERGSIYDR  540

Query  1375  YCSPSTYINPQLQWHNYLQCDCPGGDDRNVYLSGGCEWKHKDYVISSNKLRPAIIGISAS  1196
             Y S S      L    +++C C  G   N Y+ GGC  K  D    SN+     +    S
Sbjct  541   YGSYSVDSGEML----FMECHCAEGYRGNAYVDGGC--KDIDECEDSNRCSGTCVNEPGS  594

Query  1195  FGFVFLIWAFVIL------------------YkaikkrkmkklrqkffkRNGGlllqqql  1070
             F  +     F+++                  YK IKKRK  KL++K+FKRNGGLLL+ +L
Sbjct  595   FRCIGGRTKFILIGIGAGLGALLLCLVLWGLYKYIKKRKEIKLKEKYFKRNGGLLLESEL  654

Query  1069  LTKEGTIEKTKIFTASELDKATDHFNADRIVGRGGQGTVYKGMLIDGQIVAVKKSQAVDE  890
              + +  +EK K+F + +L+KATD+FN DRI+G+GGQGTVYKGML DG+IVA+KKS+A+DE
Sbjct  655   SSAKSHVEKNKLFNSKDLEKATDNFNKDRILGQGGQGTVYKGMLTDGKIVAIKKSKAIDE  714

Query  889   DQLEPFINEVVILSQINHRNVVKLMGCCLETEVPILVYEFIPNGTLFGLIHNNFDNELIP  710
              ++E FINEV+ILSQINHRN+VKL+GCCLETEVP+LVYEFIPNGTL+  +H+    E   
Sbjct  715   GKVEQFINEVLILSQINHRNIVKLLGCCLETEVPLLVYEFIPNGTLYQYLHD--PKEEYH  772

Query  709   LSWDIRLRIASEVACALAYLHSVTLVPIYHRDIKTGNILLDEKFRAKVSDFGTSRSISID  530
             +SWD RLRIA+E+A AL YLHS   +PIYHRDIK+ NILLDEK+RAKV+DFGTS+S+S+D
Sbjct  773   VSWDTRLRIATEIAGALFYLHSAASIPIYHRDIKSTNILLDEKYRAKVADFGTSKSVSLD  832

Query  529   KTHFTTMVKGTFGYLDPEYFQSSQFTEKSDVYSFGVVLAELLTGQKPISFELDDDEDRSL  350
             +TH TT+V+GTFGYLDPEYFQSSQFT+KSDVYSFGVVL EL TGQKPIS  L + E RSL
Sbjct  833   QTHVTTLVQGTFGYLDPEYFQSSQFTDKSDVYSFGVVLVELFTGQKPIS-SLREQEGRSL  891

Query  349   VSRFLLCMEENRLMEMLDGEVIEQGKKEDVVAMAWLAQRCLNFNGKKRPTMKEVATELDA  170
              + F++ MEENRL +++D +V+++GKKE++ ++A LA+RCLN NG+ RPTMKEVA EL+ 
Sbjct  892   ATYFIISMEENRLFDIVDAQVLKEGKKEEIASVANLAKRCLNLNGRNRPTMKEVAMELEG  951

Query  169   IK  164
             ++
Sbjct  952   MR  953



>ref|XP_006431668.1| hypothetical protein CICLE_v10003989mg, partial [Citrus clementina]
 gb|ESR44908.1| hypothetical protein CICLE_v10003989mg, partial [Citrus clementina]
Length=371

 Score =   416 bits (1070),  Expect = 2e-132, Method: Compositional matrix adjust.
 Identities = 209/317 (66%), Positives = 258/317 (81%), Gaps = 3/317 (1%)
 Frame = -1

Query  1099  NGGlllqqqlLTKEGTIEKTKIFTASELDKATDHFNADRIVGRGGQGTVYKGMLIDGQIV  920
             NGGLLLQ+QL + +G+I++ K+FT  ELDKATDHFN +RI+G+GGQGTVYKGML DG+IV
Sbjct  40    NGGLLLQKQLTSFDGSIDRCKLFTTKELDKATDHFNVNRILGQGGQGTVYKGMLADGRIV  99

Query  919   AVKKSQAVDEDQLEPFINEVVILSQINHRNVVKLMGCCLETEVPILVYEFIPNGTLFGLI  740
             AVKKS+ V E +LE FINEVVIL QINHRNVVKL+GCCLETEVP+LVYEFI NGTLF  +
Sbjct  100   AVKKSKIVHEGKLEEFINEVVILLQINHRNVVKLLGCCLETEVPLLVYEFISNGTLFQYL  159

Query  739   HNNFDNELIPLSWDIRLRIASEVACALAYLHSVTLVPIYHRDIKTGNILLDEKFRAKVSD  560
             H+   NE  PL+W++RLRIA+EVA +L+YLHS   +PIYHRDIK+ NILL EK++AKV+D
Sbjct  160   HDQ--NEEFPLTWEMRLRIATEVAGSLSYLHSAASMPIYHRDIKSTNILLGEKYKAKVAD  217

Query  559   FGTSRSISIDKTHFTTMVKGTFGYLDPEYFQSSQFTEKSDVYSFGVVLAELLTGQKPISF  380
             FGTS+ I+ID+TH TT V+GTFGYLDPEYF+S QFT+KSDVYSFGVVL ELLTGQKPI  
Sbjct  218   FGTSKFIAIDQTHVTTKVQGTFGYLDPEYFRSGQFTDKSDVYSFGVVLVELLTGQKPIIL  277

Query  379   ELDDDEDRSLVSRFLLCMEENRLMEMLDGEVIEQGKKEDVVAMAWLAQRCLNFNGKKRPT  200
                  E   L + F+L MEENRL + LD + ++ G+KE+++ +A LA RCLN +GK+RPT
Sbjct  278   T-GSKEATGLAAYFILSMEENRLYDFLDDQALKVGQKEEIMTIANLATRCLNLSGKRRPT  336

Query  199   MKEVATELDAIKASNSH  149
             MKEVA EL+ I+    H
Sbjct  337   MKEVAMELERIQNEFKH  353



>ref|XP_006368674.1| hypothetical protein POPTR_0001s07630g, partial [Populus trichocarpa]
 gb|ERP65243.1| hypothetical protein POPTR_0001s07630g, partial [Populus trichocarpa]
Length=402

 Score =   417 bits (1073),  Expect = 3e-132, Method: Compositional matrix adjust.
 Identities = 203/297 (68%), Positives = 247/297 (83%), Gaps = 3/297 (1%)
 Frame = -1

Query  1057  GTIEKTKIFTASELDKATDHFNADRIVGRGGQGTVYKGMLIDGQIVAVKKSQAVDEDQLE  878
             G ++KTKI+++  L+ ATD FN +RI+G+GGQGTVYKGML DG+IVAVKKS  VDE +LE
Sbjct  51    GWVQKTKIYSSKGLEVATDRFNVNRILGQGGQGTVYKGMLADGRIVAVKKSMVVDEGKLE  110

Query  877   PFINEVVILSQINHRNVVKLMGCCLETEVPILVYEFIPNGTLFGLIHNNFDNELIPLSWD  698
              FINEVV+LSQINHRNVVKL+GCCLETEVP+LVYEFI NG L+  IH+   NE   LSW+
Sbjct  111   EFINEVVVLSQINHRNVVKLLGCCLETEVPLLVYEFISNGNLYKYIHDR--NEDFLLSWE  168

Query  697   IRLRIASEVACALAYLHSVTLVPIYHRDIKTGNILLDEKFRAKVSDFGTSRSISIDKTHF  518
             +RLRIA EVA AL+YLHS T +PIYHRDIK+ NILLDEK+RAKVSDFG+SRSISID+TH 
Sbjct  169   MRLRIAIEVAGALSYLHSATSIPIYHRDIKSTNILLDEKYRAKVSDFGSSRSISIDQTHL  228

Query  517   TTMVKGTFGYLDPEYFQSSQFTEKSDVYSFGVVLAELLTGQKPISFELDDDEDRSLVSRF  338
             TT+V+GTFGYLDPEYFQSSQFTEKSDV SFGVVL EL++GQKPI F +   E RSL + F
Sbjct  229   TTLVQGTFGYLDPEYFQSSQFTEKSDVCSFGVVLVELISGQKPI-FSVSQTETRSLATHF  287

Query  337   LLCMEENRLMEMLDGEVIEQGKKEDVVAMAWLAQRCLNFNGKKRPTMKEVATELDAI  167
             ++ ME+NRL ++LD  V E  + E+V+++A LA+RCLN NGK RPTM+EV +EL+ I
Sbjct  288   IMLMEDNRLSDVLDARVKEGCQNEEVISVANLAKRCLNLNGKNRPTMREVTSELERI  344



>emb|CDX79334.1| BnaC06g19690D [Brassica napus]
Length=695

 Score =   427 bits (1099),  Expect = 3e-132, Method: Compositional matrix adjust.
 Identities = 229/418 (55%), Positives = 306/418 (73%), Gaps = 25/418 (6%)
 Frame = -1

Query  1330  NYLQCDCPGGDDRNVYLSGGC----EWKHKDY-----------------VISSNKLRPAI  1214
             NY  C C  G   N Y+ GGC    E    DY                 V S+++L    
Sbjct  224   NYTSCRCNRGYKGNPYIPGGCKDINECTENDYSICGDGTCVNMQGSLKCVFSNHRL---A  280

Query  1213  IGISASFGFVFLIWAFVILYkaikkrkmkklrqkffkRNGGlllqqqlLTKEGTIEKTKI  1034
             IG  +SFG +  I     LY+ I+K++    ++KFFKRNGGLLLQQQL++ EG++EKT++
Sbjct  281   IGFGSSFGSLIFIGGIYGLYRFIRKQRRLNQKKKFFKRNGGLLLQQQLISTEGSVEKTRV  340

Query  1033  FTASELDKATDHFNADRIVGRGGQGTVYKGMLIDGQIVAVKKSQAVDEDQLEPFINEVVI  854
             F++ EL KAT +F   RI+G+GGQGTVYKGML+DG+IVAVKKS+ VDED+LE F+NEVVI
Sbjct  341   FSSRELKKATLNFCLTRILGQGGQGTVYKGMLVDGRIVAVKKSKVVDEDKLEEFVNEVVI  400

Query  853   LSQINHRNVVKLMGCCLETEVPILVYEFIPNGTLFGLIHNNFDNELIPLSWDIRLRIASE  674
             LSQINHRN+VKL+GCCLET+VP+LVYEFIPNG LF  +H +  ++    +W++RLRIA +
Sbjct  401   LSQINHRNIVKLLGCCLETDVPVLVYEFIPNGNLFEHLHEDESDDHTMTTWEVRLRIAID  460

Query  673   VACALAYLHSVTLVPIYHRDIKTGNILLDEKFRAKVSDFGTSRSISIDKTHFTTMVKGTF  494
             +A AL+YLHS    PIYHRD+K+ NI+LDEK+RAKVSDFGTSR++++D TH TT+V GT 
Sbjct  461   IAGALSYLHSAASSPIYHRDVKSTNIMLDEKYRAKVSDFGTSRTVTVDHTHLTTVVSGTV  520

Query  493   GYLDPEYFQSSQFTEKSDVYSFGVVLAELLTGQKPISFELDDDEDRSLVSRFLLCMEENR  314
             GY+DPEYFQSSQFT+KSDVYSFGVVLAEL+TG+K +SF L   E+R+L + F+L M+ENR
Sbjct  521   GYVDPEYFQSSQFTDKSDVYSFGVVLAELITGEKSVSF-LRSQENRTLSTYFILAMKENR  579

Query  313   LMEMLDGEVIEQGKKEDVVAMAWLAQRCLNFNGKKRPTMKEVATELDAIKASNSHLPL  140
             L +++D  + +  K   V+A A LA++CLN  G+KRP+M+EV+ EL+ I+ S+  + L
Sbjct  580   LFDIIDARIRDGCKLNQVIATANLARKCLNLKGRKRPSMREVSMELEKIRGSSVDMQL  637



>ref|NP_177131.1| wall-associated receptor kinase-like 9 [Arabidopsis thaliana]
 sp|Q9C9L5.1|WAKLH_ARATH RecName: Full=Wall-associated receptor kinase-like 9; Flags: 
Precursor [Arabidopsis thaliana]
 gb|AAG52551.1|AC013289_18 putative protein kinase; 39563-42199 [Arabidopsis thaliana]
 gb|AEE34968.1| wall-associated receptor kinase-like 9 [Arabidopsis thaliana]
Length=792

 Score =   431 bits (1107),  Expect = 3e-132, Method: Compositional matrix adjust.
 Identities = 237/439 (54%), Positives = 317/439 (72%), Gaps = 30/439 (7%)
 Frame = -1

Query  1420  RWTITQEDVPPSYSKYCSPSTYINPQLQWHNYLQCDCPGGDDRNVYLSGGC----EWKHK  1253
             R+T TQ  +  + S  C  + Y++       Y +C C  G   N Y  GGC    E K +
Sbjct  294   RYTSTQRRINIT-SCICDDNAYLS-------YARCSCTRGFQGNPYRLGGCKDINECKEE  345

Query  1252  D----------------YVISSNKLRPAIIGISASFGFVFLIWAFVILYkaikkrkmkkl  1121
             +                +    N  RP  IG+ ASFG +  +    +LYK IKK++    
Sbjct  346   EGMTYCGTNKCVNLQGHFKCVYNNHRPLAIGLGASFGSLIFVVGIYLLYKFIKKQRKLNQ  405

Query  1120  rqkffkRNGGlllqqqlLTKEGTIEKTKIFTASELDKATDHFNADRIVGRGGQGTVYKGM  941
             ++KFFKRNGGLLLQQQL++  G +EKT +F++ EL+KAT++F+++RI+G+GGQGTVYKGM
Sbjct  406   KKKFFKRNGGLLLQQQLISTVGMVEKTIVFSSRELEKATENFSSNRILGQGGQGTVYKGM  465

Query  940   LIDGQIVAVKKSQAVDEDQLEPFINEVVILSQINHRNVVKLMGCCLETEVPILVYEFIPN  761
             L+DG+IVAVKKS+ VDED+LE FINEVVILSQINHRN+VKL+GCCLET+VP+LVYEFIPN
Sbjct  466   LVDGRIVAVKKSKVVDEDKLEEFINEVVILSQINHRNIVKLLGCCLETKVPVLVYEFIPN  525

Query  760   GTLFGLIHNNFDNELIPLSWDIRLRIASEVACALAYLHSVTLVPIYHRDIKTGNILLDEK  581
             G LF  +H+ FD E I  +W+IRLRIA ++A AL+YLHS    PIYHRD+K+ NI+LDEK
Sbjct  526   GNLFEHLHDEFD-ENIMATWNIRLRIAIDIAGALSYLHSSASSPIYHRDVKSTNIMLDEK  584

Query  580   FRAKVSDFGTSRSISIDKTHFTTMVKGTFGYLDPEYFQSSQFTEKSDVYSFGVVLAELLT  401
             +RAKVSDFGTSR++++D TH TT+V GT GY+DPEYFQSSQFT+KSDVYSFGVVL EL+T
Sbjct  585   YRAKVSDFGTSRTVTVDHTHLTTVVSGTVGYMDPEYFQSSQFTDKSDVYSFGVVLVELIT  644

Query  400   GQKPISFELDDDEDRSLVSRFLLCMEENRLMEMLDGEVIEQGKKEDVVAMAWLAQRCLNF  221
             G+K ISF L   E+R+L + F+L M+EN+L +++D  + +      V A A +A++CLN 
Sbjct  645   GEKSISF-LRSQENRTLATYFILAMKENKLFDIIDARIRDGCMLSQVTATAKVARKCLNL  703

Query  220   NGKKRPTMKEVATELDAIK  164
              G+KRP+M+EV+ ELD+I+
Sbjct  704   KGRKRPSMREVSMELDSIR  722



>ref|XP_009356568.1| PREDICTED: wall-associated receptor kinase-like 1 [Pyrus x bretschneideri]
Length=744

 Score =   429 bits (1102),  Expect = 4e-132, Method: Compositional matrix adjust.
 Identities = 275/625 (44%), Positives = 372/625 (60%), Gaps = 67/625 (11%)
 Frame = -1

Query  1882  VDFLGMSYDSQTITIKESISPSCQGSNNFSNIIHNSKLSETPFMYSNDNN-FMLFGCGNA  1706
             ++ L +S    TI +K  ++  C G+++       + L  TPF+YS  +N F    CG  
Sbjct  79    LEVLNISIAEGTIQVKNPVTFFCGGNSSR----QPANLKGTPFVYSERHNRFTAVSCG--  132

Query  1705  FITMPGEELDQPGYNLNCSSKNTTAPKTAHDCQ-GINCNHLTVDYDVN--TYQVNFTHSS  1535
             ++ + G +    G    C S          +C+ GINC   T+   ++  +  ++    +
Sbjct  133   YLVLVGSDKYVVG---GCRSVCEGTGINYGNCEVGINCCQTTIPPHLSAISMHIDTGIRA  189

Query  1534  SFNACN--YAFFlsassslpptlqslpsrqQEMVVVPVELRWTI----------------  1409
               + CN  YAF +  +        S  S  +    VPV L+W++                
Sbjct  190   RGDDCNNAYAFLVDKNWFRSIASVSNFSVNEYQENVPVVLKWSLNFDHTSDKFFHRFIGR  249

Query  1408  ----TQEDVPPSYSKYCSPSTYINPQLQWHNYLQCDCPGGDDRNVYLSGGCEW--KHKDY  1247
                    D  P  +K  +   Y  P+LQ      C CP G + N YL   C    + KD 
Sbjct  250   NESRADGDPMPCCTKLNATPPYDQPRLQ------CSCPRGFEGNPYLGDPCHDIDECKDQ  303

Query  1246  VISSNKLRPAIIGISASFGFVFLIWAFVI----------------------LYkaikkrk  1133
              I  N    + + I   +    +     +                      ++K +KKRK
Sbjct  304   KICGNGGASSCMNIQGGYTCYIVAQRTRVKLILTGLGAGMGLLLLLISAWWIHKVLKKRK  363

Query  1132  mkklrqkffkRNGGlllqqqlLTKEGTIEKTKIFTASELDKATDHFNADRIVGRGGQGTV  953
               K +Q FFKRNGGLLL+Q+L + E  +EK K+F + EL+K+TD+FN DRI+G G QGTV
Sbjct  364   NIKRKQIFFKRNGGLLLEQRLSSGEVNVEKIKLFKSKELEKSTDNFNVDRILGHGSQGTV  423

Query  952   YKGMLIDGQIVAVKKSQAVDEDQLEPFINEVVILSQINHRNVVKLMGCCLETEVPILVYE  773
             YKGML DG+IVAVKKS  +DE QL  FINEVVILSQINHR+VV+L+GCCLETEVP+LVYE
Sbjct  424   YKGMLADGKIVAVKKSTIIDESQLSYFINEVVILSQINHRHVVQLLGCCLETEVPLLVYE  483

Query  772   FIPNGTLFGLIHNNFDNELIPLSWDIRLRIASEVACALAYLHSVTLVPIYHRDIKTGNIL  593
             FIPNGTL   IH    NE  PL+W+IRLRIA+E+A AL YLH+    PIYHRDIK+ NIL
Sbjct  484   FIPNGTLSQYIHEQ--NEEFPLTWEIRLRIATEIAGALFYLHTSATFPIYHRDIKSTNIL  541

Query  592   LDEKFRAKVSDFGTSRSISIDKTHFTTMVKGTFGYLDPEYFQSSQFTEKSDVYSFGVVLA  413
             LD K+RAKV+DFGTSRS++ID+TH TT+V GTFGYLDPEYFQSSQFT+KSDVYSFGVVL 
Sbjct  542   LDAKYRAKVADFGTSRSVAIDQTHLTTLVHGTFGYLDPEYFQSSQFTDKSDVYSFGVVLV  601

Query  412   ELLTGQKPISFELDDDEDRSLVSRFLLCMEENRLMEMLDGEVIEQGKKEDVVAMAWLAQR  233
             ELLTGQKPIS     ++ RSL + F++ M+E+RL ++LD +V++ G K D+  +A LA+R
Sbjct  602   ELLTGQKPISSSRSQEQGRSLATYFIISMQEDRLFDILDAQVVKGGPKADIAIVANLARR  661

Query  232   CLNFNGKKRPTMKEVATELDAIKAS  158
             CLN +G+KRPTM+EV  EL+ ++ +
Sbjct  662   CLNLSGRKRPTMREVMAELEGVQMA  686



>ref|XP_002889263.1| hypothetical protein ARALYDRAFT_477143 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH65522.1| hypothetical protein ARALYDRAFT_477143 [Arabidopsis lyrata subsp. 
lyrata]
Length=474

 Score =   419 bits (1078),  Expect = 5e-132, Method: Compositional matrix adjust.
 Identities = 222/386 (58%), Positives = 293/386 (76%), Gaps = 16/386 (4%)
 Frame = -1

Query  1291  NVYLSGGCEWKHKDYVISSNKLRPAIIGISASFGFVFL---IWAFVILYkaikkrkmkkl  1121
             NV  S  CE K       + K++P    +   F  +FL   IW F+ L K  +K   K++
Sbjct  76    NVPGSWRCEPKE------AQKIKPVFQHLVLGFALLFLVLGIWGFIKLVKKRRKIIRKRM  129

Query  1120  rqkffkRNGGlllqqqlLTKEG-TIEKTKIFTASELDKATDHFNADRIVGRGGQGTVYKG  944
               K    NGGLLL+QQL T+EG  +E +KIF++ +L+KATD+FN +R++G+GGQGTVYKG
Sbjct  130   FFKR---NGGLLLKQQLTTREGGNVETSKIFSSKDLEKATDNFNKNRVLGQGGQGTVYKG  186

Query  943   MLIDGQIVAVKKSQAVDEDQLEPFINEVVILSQINHRNVVKLMGCCLETEVPILVYEFIP  764
             ML+DG+IVAVK+S+ +DED++E FINE+ +LSQINHRNVVKLMGCCLETEVPILVYE IP
Sbjct  187   MLVDGRIVAVKRSKVLDEDKVEEFINELGVLSQINHRNVVKLMGCCLETEVPILVYEHIP  246

Query  763   NGTLFGLIHNNFDNELIPLSWDIRLRIASEVACALAYLHSVTLVPIYHRDIKTGNILLDE  584
             NG LF  +H++ D+    ++WD+RLRIA E+A ALAYLHS    P+YHRD+KT NILLDE
Sbjct  247   NGDLFKRLHDDSDD--YTMTWDVRLRIAVEIAGALAYLHSAASTPVYHRDVKTTNILLDE  304

Query  583   KFRAKVSDFGTSRSISIDKTHFTTMVKGTFGYLDPEYFQSSQFTEKSDVYSFGVVLAELL  404
             K+RAKVSDFGTSRSI++D+TH TT+V GTFGYLDPEYFQ+SQFT+KSDVYSFGVVL EL+
Sbjct  305   KYRAKVSDFGTSRSINVDQTHLTTLVAGTFGYLDPEYFQTSQFTDKSDVYSFGVVLVELI  364

Query  403   TGQKPISFELDDDEDRSLVSRFLLCMEENRLMEMLDGEVIEQGKKEDVVAMAWLAQRCLN  224
             TG+KP S  +  +E+R L S F+  M++NR+++++D  + E  K E V+A+A LA+RCL+
Sbjct  365   TGEKPFSV-MRPEENRGLASHFIEAMKQNRVLDIVDSRIKEDCKLEQVLAVAKLARRCLS  423

Query  223   FNGKKRPTMKEVATELDAIKASNSHL  146
               GKKRP M+EV+ EL+ I++S   L
Sbjct  424   LKGKKRPNMREVSIELERIRSSPEDL  449



>gb|KHN14302.1| Wall-associated receptor kinase-like 9 [Glycine soja]
Length=647

 Score =   426 bits (1094),  Expect = 5e-132, Method: Compositional matrix adjust.
 Identities = 275/613 (45%), Positives = 364/613 (59%), Gaps = 58/613 (9%)
 Frame = -1

Query  1849  TITIKESI-SPSCQGSNNFSNIIHNSKLSETPFMYSND-NNFMLFGCGNAFITMPGEELD  1676
             T+ IK  I  P C  ++   N      L   PF+YS D N+F+  GC NA + +  + + 
Sbjct  49    TVGIKNPIFHPGCDNTSTGIN------LEGGPFVYSQDYNSFVTVGCQNAALLLSNDTIL  102

Query  1675  QPGYNLNCSSKNTTAPKTAH-----DCQGINCNHLTVDYDVNTYQVNF----THSSSFNA  1523
                    C S     PK A+      C+G  C   ++   +  Y V+       S     
Sbjct  103   TA-----CVSVCYDDPKNANMMDVSSCRGKYCCETSLPPYLQAYNVSVGTVEVKSEIKPE  157

Query  1522  CNYA--------FFlsassslpptlqslpsrqQEMVVVPVELRWTI-------------T  1406
             C Y         F                   +++  VP  L+W I             T
Sbjct  158   CGYGLIKADYFQFNYVYDEYNSSYWVPTLGNLKKVKDVPAVLQWEIPIHMPNNSFPEFRT  217

Query  1405  QEDVPPSYSKY-CSPSTYINPQLQ--WHNYLQCDCPGGDDRNVYLSGGCEWKHKDYVISS  1235
               D   SY+ Y CS +   + Q +  W    +C C  G   N YL  GC+   +D    +
Sbjct  218   DAD---SYANYNCSYTNVTSAQSKSGW----RCTCKYGFKGNPYLDQGCKLAMEDSPERN  270

Query  1234  NKLRPAIIGISASFGFVFLIWAFVILYkaikkrkmkklrqkffkRNGGlllqqqlLTKEG  1055
                    IG+S+S G V L+     L+K I+K    K ++KFFK+NGGLLL+Q+L + E 
Sbjct  271   KTRLKWAIGVSSSLGTVILLLGLWWLHKVIRKSIATKRKEKFFKQNGGLLLKQRLSSGEV  330

Query  1054  TIEKTKIFTASELDKATDHFNADRIVGRGGQGTVYKGMLIDGQIVAVKKSQAVDEDQLEP  875
              ++K K+F+  +L KATDHFN +R++G+GGQGTVYKGML+DG IVAVKK +     ++E 
Sbjct  331   NVDKIKLFSLKDLQKATDHFNINRVLGKGGQGTVYKGMLVDGNIVAVKKFKV--NGKVEE  388

Query  874   FINEVVILSQINHRNVVKLMGCCLETEVPILVYEFIPNGTLFGLIHNNFDNELIPLSWDI  695
             FINE VILSQINHRNVVKL+GCCLETE+P+LVYEFIPNG LF  IH    NE +P++W++
Sbjct  389   FINEFVILSQINHRNVVKLLGCCLETEIPLLVYEFIPNGNLFEYIHGQ--NEDLPMTWEM  446

Query  694   RLRIASEVACALAYLHSVTLVPIYHRDIKTGNILLDEKFRAKVSDFGTSRSISIDKTHFT  515
             RLRI+ EVA AL YLHS    PIYHRDIK+ NILLD K+RAKV+DFG SR +SI+ TH T
Sbjct  447   RLRISIEVAGALFYLHSAASQPIYHRDIKSRNILLDGKYRAKVADFGASRMVSIEATHLT  506

Query  514   TMVKGTFGYLDPEYFQSSQFTEKSDVYSFGVVLAELLTGQKPISFELDDDEDRSLVSRFL  335
             T V+GTFGYLDPEYF++SQ T+KSDVYSFGVVL ELLTG++PIS      E +SLVS FL
Sbjct  507   TTVQGTFGYLDPEYFRTSQLTDKSDVYSFGVVLIELLTGKEPIS-SAKQQELKSLVSYFL  565

Query  334   LCMEENRLMEMLDGEVIEQGKKEDVVAMAWLAQRCLNFNGKKRPTMKEVATELDAIKASN  155
             L MEENRL +++D  V+++ +KE +V +A LA+RCL  NGK+RPTMKEVA EL++I+ S 
Sbjct  566   LSMEENRLFDIVDERVMKEAEKEHIVVVANLARRCLELNGKRRPTMKEVALELESIQKSK  625

Query  154   SHLPLAMEAFEIE  116
                    +  E+E
Sbjct  626   KQSAAQEQHEELE  638



>gb|KDO44465.1| hypothetical protein CISIN_1g041043mg [Citrus sinensis]
Length=678

 Score =   426 bits (1096),  Expect = 5e-132, Method: Compositional matrix adjust.
 Identities = 273/606 (45%), Positives = 375/606 (62%), Gaps = 51/606 (8%)
 Frame = -1

Query  1888  ECVDFLGMSYDSQTITIKESISPSCQGSNNFSNIIHNSKLSETPFMYSN-DNNFMLFGCG  1712
             E ++FL    +  T+ + +S+  SCQ     ++ ++  KL   PF +S  DN F   GC 
Sbjct  79    EVLEFL---LEKSTMRVNQSVISSCQDKTTEASFVNLEKL---PFYFSYYDNIFSGIGCN  132

Query  1711  N-AFITMPGEELDQPGYNLNCSSKNTTAPKTAHDCQGINCNHLTVDYDVNTYQVNF----  1547
             N A ++    +    G    C  +N T   +   C GI C    V + + ++ ++     
Sbjct  133   NLASMSSADHDFILGGCFSICDPRNKTEDDS---CNGIECCKAGVPWALKSFNISIISIN  189

Query  1546  ------THSSSFNACNYAFFlsassslpptlqslpsrqQEMVVVPVELRWTITQ----ED  1397
                   + S     C YAF +           +   +    V  PV L W I      E 
Sbjct  190   NATSSSSSSQEEGKCKYAFMVEKEWFESNFKSARRVQNWNQV--PVILDWRIPNSSFGEL  247

Query  1396  VPPSYSKYCSPSTYINPQLQWHNYLQCDCPGGDDRNVYLSGGCE-WKHKDY---VISSNK  1229
                  SK+ S S   + +       +C C      N Y   GC+  + ++Y       N 
Sbjct  248   ERDESSKFTSTS---HCESDEGGLFRCSCKEKYHGNPYFLHGCQDLRCENYEGGYRCVNP  304

Query  1228  LRPAI--------IGISASFGFVFLIWAFVILYkaikkrkmkklrqkffkRNGGlllqqq  1073
              RP +         G+      +  +W  +I+      R+  K +++ FK+NGGLLL+QQ
Sbjct  305   KRPKVYTIILGIGTGLGGLLLSIGALWLCIII------RRRIKQKEENFKKNGGLLLEQQ  358

Query  1072  lLTKEGTIEKTKIFTASELDKATDHFNADRIVGRGGQGTVYKGMLIDGQIVAVKKSQAVD  893
             L + +G+I++ KIF + ELDKATDHFN +RI+G+GGQGTVYKGML DG+I+AVKKS+ VD
Sbjct  359   LNSLDGSIDRCKIFNSKELDKATDHFNVNRILGQGGQGTVYKGMLADGRIIAVKKSKVVD  418

Query  892   EDQLEPFINEVVILSQINHRNVVKLMGCCLETEVPILVYEFIPNGTLFGLIHNNFDNELI  713
             E +LE FINEVVILSQI+HRNVVKL+G CLE EVP+LVYEFIPNGTLF  +H+   +E +
Sbjct  419   ESKLEEFINEVVILSQISHRNVVKLLGSCLEVEVPLLVYEFIPNGTLFQYLHD--PSEEL  476

Query  712   PLSWDIRLRIASEVACALAYLHSVTLVPIYHRDIKTGNILLDEKFRAKVSDFGTSRSISI  533
              L+W++RLRIA+EVA ALAYLHS   +PIYHRDIK+ NILLDEK+RAK++DFGTSRSI+I
Sbjct  477   SLTWEMRLRIATEVAEALAYLHSSAYLPIYHRDIKSTNILLDEKYRAKIADFGTSRSIAI  536

Query  532   DKTHFTTMVKGTFGYLDPEYFQSSQFTEKSDVYSFGVVLAELLTGQKPISFELDDDEDRS  353
             D+TH +T V+GTFGYLDPEYF SSQFT+KSDVYSFGVVL ELLTGQKPIS+ +  +E R+
Sbjct  537   DQTHVSTKVQGTFGYLDPEYFHSSQFTDKSDVYSFGVVLVELLTGQKPISY-IWANEGRN  595

Query  352   LVSRFLLCMEENRLMEMLDGEVIEQGKKEDVVAMAWLAQRCLNFNGKKRPTMKEVATELD  173
             L + F+ C+EEN L ++LD +V + GK E+++ ++ +A+RCLN NG+ RPTMKEVA EL+
Sbjct  596   LATYFVECVEENCLFDILDDQVRKSGKTEEIMEVSDVAKRCLNSNGRSRPTMKEVAMELE  655

Query  172   AIKASN  155
              I+A N
Sbjct  656   RIRACN  661



>ref|XP_008380153.1| PREDICTED: wall-associated receptor kinase-like 1 [Malus domestica]
Length=764

 Score =   429 bits (1103),  Expect = 6e-132, Method: Compositional matrix adjust.
 Identities = 278/619 (45%), Positives = 380/619 (61%), Gaps = 55/619 (9%)
 Frame = -1

Query  1882  VDFLGMSYDSQTITIKESISPSCQGSNNFSNIIHNSKLSETPFMYSNDNN-FMLFGCGNA  1706
             ++ L +S    TI +K  ++  C G +        + L+ TPF+YS  +N F    CG  
Sbjct  100   LEVLNISIADGTIQVKNPVAFFCGGKSGR----QPANLTGTPFVYSERHNRFTAVSCG--  153

Query  1705  FITMPGEELDQPGYNLNCSSKNTTAPKTAHDCQ-GINCNHLTVDYDVNTYQVNFTHSSSF  1529
             ++ M G +    G    C S          +C+ GINC   T+   ++    +    +  
Sbjct  154   YLAMVGSDEYLVG---GCRSICEGTSINYGNCEVGINCCQTTIPPHLSAISTDIIKDNRG  210

Query  1528  NA--CN--YAFFlsassslpptlqslpsrqQEMVVVPVELRWTITQEDVPPS-YSKYCSP  1364
                 CN  YAF +  +        S  S   +   VPV LRW++  ++     + ++   
Sbjct  211   RGDDCNNAYAFLVDKNWFRSIASVSNFSVNGDTENVPVVLRWSLNYDNTSAKLFHRFIGR  270

Query  1363  S------------TYINP-QLQWHNYLQCDCPGGDDRNVYL-----------------SG  1274
             +            T +N   L   + L C CP G + N YL                 +G
Sbjct  271   NESRADDDPMPCCTILNATSLYNRSRLLCSCPPGFEGNPYLGHPCYDIDECTDQKICRNG  330

Query  1273  GCEW------KHKDYVIS-SNKLRPAIIGISASFGFVFLIWAFVILYkaikkrkmkklrq  1115
             G  +       +  Y++    +++P ++G+ A  G + L+ +   ++K +KKRK  K +Q
Sbjct  331   GASYCINYPGGYACYIVGEKTRVKPILVGLGAGVGLLLLLISAWWIHKVLKKRKNIKRKQ  390

Query  1114  kffkRNGGlllqqqlLTKEGTIEKTKIFTASELDKATDHFNADRIVGRGGQGTVYKGMLI  935
              FFKRNGGLLL+QQL + E  +EK K+F + EL+K+TD+FN DRI+G GGQGTVYKGML 
Sbjct  391   IFFKRNGGLLLEQQLSSGEVNVEKIKLFKSKELEKSTDNFNVDRILGHGGQGTVYKGMLA  450

Query  934   DGQIVAVKKSQAVDEDQLEPFINEVVILSQINHRNVVKLMGCCLETEVPILVYEFIPNGT  755
             DG+IVAVKKS  +DE QL  FINEVVILSQINHR+VV+L+GCCLETEVP+LVYEFIPNGT
Sbjct  451   DGKIVAVKKSTIIDESQLSDFINEVVILSQINHRHVVQLLGCCLETEVPLLVYEFIPNGT  510

Query  754   LFGLIHNNFDNELIPLSWDIRLRIASEVACALAYLHSVTLVPIYHRDIKTGNILLDEKFR  575
             L   IH    NE  PL+W+IRLRIA+E+A AL YLH+    PIYHRDIK+ NILLD K+R
Sbjct  511   LSQYIHEQ--NEEFPLTWEIRLRIATEIAGALFYLHASAAFPIYHRDIKSTNILLDAKYR  568

Query  574   AKVSDFGTSRSISIDKTHFTTMVKGTFGYLDPEYFQSSQFTEKSDVYSFGVVLAELLTGQ  395
             AKV+DFGTSRS++ID+TH TT+V GTFGYLDPEYFQSSQFT+KSDVYSFGVVL ELLTGQ
Sbjct  569   AKVADFGTSRSVAIDQTHLTTLVHGTFGYLDPEYFQSSQFTDKSDVYSFGVVLVELLTGQ  628

Query  394   KPISFELDDDEDRSLVSRFLLCMEENRLMEMLDGEVIEQGKKEDVVAMAWLAQRCLNFNG  215
             KPIS     ++ RSL   F++ M+E+RL ++LD +V++ G K D+  +A LA+RCLN +G
Sbjct  629   KPISXXRSQEQGRSLAXYFIISMQEDRLFDILDAQVVKGGSKADIAIVANLARRCLNLSG  688

Query  214   KKRPTMKEVATELDAIKAS  158
             +KRPTM+EV  EL+ ++ +
Sbjct  689   RKRPTMREVMAELEGVQMA  707



>ref|XP_010663682.1| PREDICTED: wall-associated receptor kinase-like 8 [Vitis vinifera]
Length=705

 Score =   427 bits (1098),  Expect = 6e-132, Method: Compositional matrix adjust.
 Identities = 208/317 (66%), Positives = 262/317 (83%), Gaps = 7/317 (2%)
 Frame = -1

Query  1066  TKEGTIEKTKIFTASELDKATDHFNADRIVGRGGQGTVYKGMLIDGQIVAVKKSQAVDED  887
             + E +IE TKIFT +EL KA+D+FN +RI+GRGGQGTVYKGML DG+IVA+KKS+ VDE 
Sbjct  354   SNEISIENTKIFTFNELKKASDNFNENRILGRGGQGTVYKGMLTDGRIVAIKKSKIVDES  413

Query  886   QLEPFINEVVILSQINHRNVVKLMGCCLETEVPILVYEFIPNGTLFGLIHNNFDNELIPL  707
             Q E FINE+VILSQ+NHRN+VKL+GCCLE EVP+LVYEFI +GTLF LIH+  +N  +P 
Sbjct  414   QYEQFINEIVILSQLNHRNIVKLLGCCLEIEVPLLVYEFISHGTLFQLIHD--ENNELPF  471

Query  706   SWDIRLRIASEVACALAYLHSVTLVPIYHRDIKTGNILLDEKFRAKVSDFGTSRSISIDK  527
             SW+ RL IA+EVA ALAYLHS +  PI+HRDIK+ NILLDEK+RAKV+DFGTSRS+SID+
Sbjct  472   SWERRLEIATEVAGALAYLHSASSTPIFHRDIKSKNILLDEKYRAKVADFGTSRSVSIDQ  531

Query  526   THFTTMVKGTFGYLDPEYFQSSQFTEKSDVYSFGVVLAELLTGQKPISFELDDDEDRSLV  347
             TH TT+V+GTFGYLDPEYF++ QFTEKSDVYSFG+VL ELLTGQKPIS     +E+RSL 
Sbjct  532   THLTTLVRGTFGYLDPEYFRTGQFTEKSDVYSFGIVLVELLTGQKPIS-STRTEEERSLA  590

Query  346   SRFLLCMEENRLMEMLDGEVIEQGKKEDVVAMAWLAQRCLNFNGKKRPTMKEVATELDAI  167
             S F+L +EE  L ++LD +V+++G +E+++A+  +A +CLN NGKKRPTMKEVA EL+ +
Sbjct  591   SYFILSIEETNLFDILDAQVVKEGGEEEIMAVVNVATQCLNLNGKKRPTMKEVALELERV  650

Query  166   KASNSHLPLAMEA-FEI  119
             K   SHLPL +   FE+
Sbjct  651   K---SHLPLHVRGHFEL  664


 Score = 62.4 bits (150),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 62/226 (27%), Positives = 100/226 (44%), Gaps = 27/226 (12%)
 Frame = -1

Query  1927  THPDIQQNVRIIYECVDFLGMSYDSQTITIKESISPSCQGSNNFSNIIHNSKLSETPFMY  1748
             +HP++  N+++      F+ ++Y  Q +T+   ++  CQ  +   +      LS+TPF Y
Sbjct  71    SHPEL--NLKLT-----FVSLAY--QLVTVISPMAVYCQDHDRNRSTWKGIDLSKTPFFY  121

Query  1747  SNDNNFMLFGCGNA-FITMPGEELDQPGYNLNCSSK-NTTAPKTAHDCQGINCNHLTVDY  1574
             S  N   + GC N+  IT  G  L        CSS  + ++   ++ C GINC   TV  
Sbjct  122   SEGNALRVVGCANSVLITRQGTIL------AGCSSICDNSSSVLSNGCYGINCCKTTVPS  175

Query  1573  DVNTYQVNFTHSSSFNA---CNYAFFlsassslpptlqslpsrqQEMVVVPVELRWTITQ  1403
             +++ Y +N T S++      C YA F         +  S    +        E+ W I +
Sbjct  176   NLDFYILNTTWSTNMGTELNCTYAAFGRNFILRGKSSGSGMEYEASS---EGEMIWMI-K  231

Query  1402  EDVPPSYSKYCSPSTYINPQLQWHNYLQCDCPGGDDRNVYLSGGCE  1265
             E V  S    C  +T  +  L  H+Y  C CP   + N YL  GC+
Sbjct  232   ESVEGS---DCHKNTVPDGALGNHSYYSCSCPAYQEGNPYLPNGCQ  274



>ref|XP_006490219.1| PREDICTED: wall-associated receptor kinase-like 17-like [Citrus 
sinensis]
Length=1041

 Score =   437 bits (1123),  Expect = 6e-132, Method: Compositional matrix adjust.
 Identities = 221/332 (67%), Positives = 268/332 (81%), Gaps = 5/332 (2%)
 Frame = -1

Query  1099  NGGlllqqqlLTKEGTIEKTKIFTASELDKATDHFNADRIVGRGGQGTVYKGMLIDGQIV  920
             NGGLLLQQ+L + E  IEKTK+FT+ +L+KATD++NA+RI+G+GGQGTVYKGML DG+IV
Sbjct  675   NGGLLLQQELSSNESNIEKTKLFTSKDLEKATDNYNANRILGQGGQGTVYKGMLTDGRIV  734

Query  919   AVKKSQAVDEDQLEPFINEVVILSQINHRNVVKLMGCCLETEVPILVYEFIPNGTLFGLI  740
             AVKKS+ VDE  +E FINEVVILSQINHRN+VKL+GCCLETEVP+LVYEFIPNGTL+  I
Sbjct  735   AVKKSKLVDETNVEQFINEVVILSQINHRNIVKLLGCCLETEVPLLVYEFIPNGTLYQYI  794

Query  739   HNNFDNELIPLSWDIRLRIASEVACALAYLHSVTLVPIYHRDIKTGNILLDEKFRAKVSD  560
             HN    E  P++W++ LRIA EV+ AL YLHS   +PIYHRDIK+ NILLD+K+RAKVSD
Sbjct  795   HNQI--EEFPITWELLLRIAVEVSGALFYLHSAASIPIYHRDIKSANILLDDKYRAKVSD  852

Query  559   FGTSRSISIDKTHFTTMVKGTFGYLDPEYFQSSQFTEKSDVYSFGVVLAELLTGQKPISF  380
             FGTSRS+ +D+TH TT V+GTFGY+DPEYFQSSQFTEKSDVYSFGVVL E+LTGQKPI  
Sbjct  853   FGTSRSVMVDQTHLTTKVQGTFGYVDPEYFQSSQFTEKSDVYSFGVVLVEILTGQKPIR-  911

Query  379   ELDDDEDRSLVSRFLLCMEENRLMEMLDGEVIEQGKKEDVVAMAWLAQRCLNFNGKKRPT  200
              ++ DED+SLV  FL  + ENRL E+LD  V+++ KKE ++ +A LA+RCLN NGK RPT
Sbjct  912   AINTDEDKSLVGYFLQAINENRLFEILDARVLKEAKKEGIMTVATLAKRCLNLNGKMRPT  971

Query  199   MKEVATELDAIKASNSHLPLAMEAFEIESDFI  104
             MKEVA EL  I+ S     L     EI  DF+
Sbjct  972   MKEVAFELGGIRTSTGASILQQNCEEI--DFV  1001


 Score =   314 bits (804),  Expect = 3e-87, Method: Compositional matrix adjust.
 Identities = 154/216 (71%), Positives = 187/216 (87%), Gaps = 2/216 (1%)
 Frame = -1

Query  1099  NGGlllqqqlLTKEGTIEKTKIFTASELDKATDHFNADRIVGRGGQGTVYKGMLIDGQIV  920
             NGGLLLQQ+L + E  IEKTK+FT+ +L+KATD++NA+RI+G+GGQGTVYKGML DG+IV
Sbjct  357   NGGLLLQQELSSNESNIEKTKLFTSKDLEKATDNYNANRILGQGGQGTVYKGMLTDGRIV  416

Query  919   AVKKSQAVDEDQLEPFINEVVILSQINHRNVVKLMGCCLETEVPILVYEFIPNGTLFGLI  740
             AVKKS+ VDE  +E FINEVVILSQINHRN+VKL+GCCLETEVP+LVYEFIPNGTL+  I
Sbjct  417   AVKKSKLVDETNVEQFINEVVILSQINHRNIVKLLGCCLETEVPLLVYEFIPNGTLYQYI  476

Query  739   HNNFDNELIPLSWDIRLRIASEVACALAYLHSVTLVPIYHRDIKTGNILLDEKFRAKVSD  560
             HN    E  P++W++ LRIA EV+ AL YLHS   +PIYHRDIK+ NILLD+K+RAKVSD
Sbjct  477   HNQI--EEFPITWELLLRIAVEVSGALFYLHSAASIPIYHRDIKSANILLDDKYRAKVSD  534

Query  559   FGTSRSISIDKTHFTTMVKGTFGYLDPEYFQSSQFT  452
             FGTSRS+ +D+TH TT V+GTFGY+DPEYFQSSQF+
Sbjct  535   FGTSRSVMVDQTHLTTKVQGTFGYVDPEYFQSSQFS  570



>emb|CAN64181.1| hypothetical protein VITISV_007799 [Vitis vinifera]
Length=705

 Score =   427 bits (1098),  Expect = 7e-132, Method: Compositional matrix adjust.
 Identities = 208/317 (66%), Positives = 262/317 (83%), Gaps = 7/317 (2%)
 Frame = -1

Query  1066  TKEGTIEKTKIFTASELDKATDHFNADRIVGRGGQGTVYKGMLIDGQIVAVKKSQAVDED  887
             + E +IE TKIFT +EL KA+D+FN +RI+GRGGQGTVYKGML DG+IVA+KKS+ VDE 
Sbjct  354   SNEISIENTKIFTFNELKKASDNFNENRILGRGGQGTVYKGMLTDGRIVAIKKSKIVDES  413

Query  886   QLEPFINEVVILSQINHRNVVKLMGCCLETEVPILVYEFIPNGTLFGLIHNNFDNELIPL  707
             Q E FINE+VILSQ+NHRN+VKL+GCCLE EVP+LVYEFI +GTLF LIH+  +N  +P 
Sbjct  414   QYEQFINEIVILSQLNHRNIVKLLGCCLEIEVPLLVYEFISHGTLFQLIHD--ENNELPF  471

Query  706   SWDIRLRIASEVACALAYLHSVTLVPIYHRDIKTGNILLDEKFRAKVSDFGTSRSISIDK  527
             SW+ RL IA+EVA ALAYLHS +  PI+HRDIK+ NILLDEK+RAKV+DFGTSRS+SID+
Sbjct  472   SWERRLEIATEVAGALAYLHSASSTPIFHRDIKSKNILLDEKYRAKVADFGTSRSVSIDQ  531

Query  526   THFTTMVKGTFGYLDPEYFQSSQFTEKSDVYSFGVVLAELLTGQKPISFELDDDEDRSLV  347
             TH TT+V+GTFGYLDPEYF++ QFTEKSDVYSFG+VL ELLTGQKPIS     +E+RSL 
Sbjct  532   THLTTLVRGTFGYLDPEYFRTGQFTEKSDVYSFGIVLVELLTGQKPIS-STRTEEERSLA  590

Query  346   SRFLLCMEENRLMEMLDGEVIEQGKKEDVVAMAWLAQRCLNFNGKKRPTMKEVATELDAI  167
             S F+L +EE  L ++LD +V+++G +E+++A+  +A +CLN NGKKRPTMKEVA EL+ +
Sbjct  591   SYFILSIEETNLFDILDAQVVKEGGEEEIMAVVNVATQCLNLNGKKRPTMKEVALELERV  650

Query  166   KASNSHLPLAMEA-FEI  119
             K   SHLPL +   FE+
Sbjct  651   K---SHLPLHVRGHFEL  664


 Score = 60.8 bits (146),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 62/226 (27%), Positives = 100/226 (44%), Gaps = 27/226 (12%)
 Frame = -1

Query  1927  THPDIQQNVRIIYECVDFLGMSYDSQTITIKESISPSCQGSNNFSNIIHNSKLSETPFMY  1748
             +HP++  N+++      F+ ++Y  Q +T+   ++  CQ  +   +      LS+TPF Y
Sbjct  71    SHPEL--NLKLT-----FVSLAY--QLVTVISPMAVYCQDHDRNRSTWKGIDLSKTPFFY  121

Query  1747  SNDNNFMLFGCGNA-FITMPGEELDQPGYNLNCSSK-NTTAPKTAHDCQGINCNHLTVDY  1574
             S  N   + GC N+  IT  G  L        CSS  + ++   ++ C GINC   TV  
Sbjct  122   SEGNALRVVGCANSVLITRQGTIL------AGCSSICDNSSSVLSNGCYGINCCKTTVPS  175

Query  1573  DVNTYQVNFTHSSSFNA---CNYAFFlsassslpptlqslpsrqQEMVVVPVELRWTITQ  1403
             +++ Y +N T S++      C YA F         +  S    +        E+ W I +
Sbjct  176   NLDFYILNTTWSTNMVTELNCTYAAFGRNFILRGKSSGSGMEYEASS---EGEVIWMI-K  231

Query  1402  EDVPPSYSKYCSPSTYINPQLQWHNYLQCDCPGGDDRNVYLSGGCE  1265
             E V  S    C  +T  +  L  H+Y  C CP   + N YL  GC+
Sbjct  232   ESVEGS---DCHKNTVPDGALGNHSYYSCSCPAYQEGNPYLPNGCQ  274



>ref|XP_010039746.1| PREDICTED: wall-associated receptor kinase-like 8 [Eucalyptus 
grandis]
Length=757

 Score =   428 bits (1101),  Expect = 8e-132, Method: Compositional matrix adjust.
 Identities = 274/600 (46%), Positives = 372/600 (62%), Gaps = 65/600 (11%)
 Frame = -1

Query  1747  SNDNNFMLFGCGN-AFITMPGEELDQPGYNLNCSSKNTTAPKTAHDCQGINCNHLTVDYD  1571
             S  N F + GC   AF    GE++     +L CS+  T    ++  C GI C   ++  D
Sbjct  135   STKNKFTVVGCDTLAFFQDGGEKITFGCVSL-CSNTTTV---SSGSCSGIGCCETSIPTD  190

Query  1570  VNTYQV------NFTHSSSFNACNYAFFlsassslpptlqslpsrqQEMVVVPVELRWTI  1409
                YQ+      N T+   FN C+YAF     S           +  +  +V   L W I
Sbjct  191   SLNYQISIQSFYNHTYVLDFNPCSYAFVAEIGSYNFSVDDLKQLKFNKSSLV---LDWAI  247

Query  1408  ---TQEDVPPSYSKY-CSPSTYINPQLQWHNYLQCDCPGGDDRNVYLSGGC---------  1268
                T ED   + + Y C+ +T          Y +C C  G   N YL+ GC         
Sbjct  248   GNQTCEDARKNPASYMCTNNTKCTDTKDSSGY-KCTCLEGYRGNPYLANGCHDIDECADP  306

Query  1267  -----EWKHKDYVISSNKLRPA--------------------------IIGISASFGFVF  1181
                  E K  +   S   L P                           ++G+ A  GF+ 
Sbjct  307   EKYPCEGKCNNIEGSYTCLCPKGYHGYGKKGGEDGQGCIANPSYLMKILVGVGAGTGFIV  366

Query  1180  LIWAFVILYkaikkrkmkklrqkffkRNGGlllqqqlLTKEGT-IEKTKIFTASELDKAT  1004
             L +    L   I++R+  K +QKFF RNGG LLQQ+L + E   ++K K+FT++ELDKAT
Sbjct  367   LFFLCWWLCNYIRRRREAKRKQKFFIRNGGFLLQQRLSSIEDNHVKKGKLFTSTELDKAT  426

Query  1003  DHFNADRIVGRGGQGTVYKGMLIDGQIVAVKKSQAVDEDQLEPFINEVVILSQINHRNVV  824
             DHFN +RI+G+GGQGTVYKGMLIDG I+AVKKS+ +D +Q+E F+NEV ILS+INHRNVV
Sbjct  427   DHFNENRILGQGGQGTVYKGMLIDGMIIAVKKSKVIDAEQVEQFVNEVAILSEINHRNVV  486

Query  823   KLMGCCLETEVPILVYEFIPNGTLFGLIHNNFDNELIPLSWDIRLRIASEVACALAYLHS  644
             KL+G CLE+EVP+LVYEF+PNGTL+  +H+  D E  P+SW++RLRIA+EVA AL+YLHS
Sbjct  487   KLLGFCLESEVPLLVYEFVPNGTLYQYLHDP-DREF-PISWEMRLRIANEVAKALSYLHS  544

Query  643   VTLVPIYHRDIKTGNILLDEKFRAKVSDFGTSRSISIDKTHFTTMVKGTFGYLDPEYFQS  464
                +PIYHRDIK+ NILLDEK+RAKV+DFG S+SI ID+TH TTMV+GTFGYLDPEY+Q+
Sbjct  545   DAAIPIYHRDIKSSNILLDEKYRAKVADFGASKSIPIDQTHLTTMVRGTFGYLDPEYYQT  604

Query  463   SQFTEKSDVYSFGVVLAELLTGQKPISFELDDDEDRSLVSRFLLCMEENRLMEMLDGEVI  284
             SQFT+KSDVYSFGVVL ELLTG+KPIS +L  +E R+LVS F++ M++N L ++L  EV+
Sbjct  605   SQFTDKSDVYSFGVVLVELLTGEKPIS-QLRAEECRNLVSYFIISMDKNCLFDVLHKEVL  663

Query  283   EQGKKEDVVAMAWLAQRCLNFNGKKRPTMKEVATELDAIKASNSHLPLAMEAFEIESDFI  104
             + G K++++ ++ LA+RCL  +G+ RPTMKEVA EL+ +++  +  P+ +E  E E D I
Sbjct  664   DHGDKKEIIVVSNLAKRCLRLHGRYRPTMKEVAMELERVRSLQN--PMVVEQNEGEIDRI  721



>ref|XP_006465430.1| PREDICTED: wall-associated receptor kinase-like 10-like [Citrus 
sinensis]
Length=730

 Score =   427 bits (1099),  Expect = 8e-132, Method: Compositional matrix adjust.
 Identities = 283/610 (46%), Positives = 375/610 (61%), Gaps = 64/610 (10%)
 Frame = -1

Query  1801  NFSNIIHNSK---LSETPFMYSNDNN-FMLFGCGNAFITMPGEELDQPGYNLN---CSSK  1643
             N S  + N+K   L+ TPF +S  NN F   GC +        +L+Q   + N   C S 
Sbjct  104   NSSKSMGNAKGVNLTGTPFSFSQKNNKFTTAGCDSY------AKLNQKNDSSNSGKCQSV  157

Query  1642  NTTAPKTAHDCQGINCNHLTVDYDVNTYQVN--FTHSSSFNACNYAFFlsassslpptlq  1469
              T  P    DC  + C   TV  +   +  N  + +  S        F+     L    Q
Sbjct  158   CTCDPTQYADCCDLLC---TVPPNTKVFDTNSSYKYYQSIPQECSVVFVVEQEWLFNNYQ  214

Query  1468  slpsrqQEMVVVPVELRW-----TITQEDVPPSYSKYCSPSTYINPQLQWHNYLQCD---  1313
             +     ++   VP  L W     T T+E    S++K C+   +   QL   ++  CD   
Sbjct  215   TNSVVLKDQEQVPAVLEWGKYKGTCTEE--YNSHTKMCNKDNHCLLQLGTGHFCLCDYTR  272

Query  1312  ------CPGGDDRNVYLSGG--CEWKHKDYVISS--------------------NKLRPA  1217
                   C G  D     +GG  C    + Y +SS                    ++ +  
Sbjct  273   SVASRHCAG--DLICSTTGGHNCSECPQGYYLSSYNSDQEPLCSRSTQLTFGKKSRNKYI  330

Query  1216  IIG-ISASFGFVFLIWAFVILYkaikkrkmkklrqkffkRNGGlllqqqlLTKEGTIEKT  1040
             +IG  S  FG + L+     +YK +K++    L+QKFFKRNGGLLLQQ+L + EG I+K+
Sbjct  331   VIGCTSGGFGMLCLLTGAWWVYKFLKRKMEIMLKQKFFKRNGGLLLQQELASTEGNIDKS  390

Query  1039  KIFTASELDKATDHFNADRIVGRGGQGTVYKGMLIDGQIVAVKKSQAVDEDQLEPFINEV  860
             K+FT+ EL+ ATDH+N +RI+G+GGQGTVYKGML DG+IVA+KKS+ +DE +++ FINEV
Sbjct  391   KLFTSKELETATDHYNTNRILGQGGQGTVYKGMLADGKIVAIKKSKVIDESKVDEFINEV  450

Query  859   VILSQINHRNVVKLMGCCLETEVPILVYEFIPNGTLFGLIHNNFDNELIPLSWDIRLRIA  680
              ILSQINHRNVVKL+GCCLETEVP+LVYEFI NGTLF  +H+   NE  P++W+IRLRIA
Sbjct  451   AILSQINHRNVVKLLGCCLETEVPLLVYEFIINGTLFQYLHDQ--NEEFPITWEIRLRIA  508

Query  679   SEVACALAYLHSVTLVPIYHRDIKTGNILLDEKFRAKVSDFGTSRSISIDKTHFTTMVKG  500
              EV+ AL+YLHS   +PIYHRDIK+ NILLD K+RAKVSDFG SRS+SID+TH TT V+G
Sbjct  509   IEVSDALSYLHSAASIPIYHRDIKSTNILLDGKYRAKVSDFGASRSMSIDQTHMTTQVQG  568

Query  499   TFGYLDPEYFQSSQFTEKSDVYSFGVVLAELLTGQKPISFELDDDEDRSLVSRFLLCMEE  320
             TFGYLDPEYF+SS+FTEKSDVYSFGVVLAELLTG++ I    + +ED+SL + FL  M+E
Sbjct  569   TFGYLDPEYFRSSRFTEKSDVYSFGVVLAELLTGERAIRV-TNFEEDKSLAAYFLRAMKE  627

Query  319   NRLMEMLDGEVIEQGKKEDVVAMAWLAQRCLNFNGKKRPTMKEVATELDAIKASNSHLPL  140
             + L E+LD  V+++  +ED+V +A L  RCLN NGKKRPTMKEVA  L  IKA +    +
Sbjct  628   DSLFEILDAHVLKEASQEDIVTVAKLTNRCLNLNGKKRPTMKEVAVVLAGIKACDGTSNI  687

Query  139   AMEAFEIESD  110
               E+  +ESD
Sbjct  688   IQES--VESD  695



>ref|XP_010648093.1| PREDICTED: wall-associated receptor kinase-like 10 [Vitis vinifera]
Length=374

 Score =   415 bits (1066),  Expect = 9e-132, Method: Compositional matrix adjust.
 Identities = 207/328 (63%), Positives = 262/328 (80%), Gaps = 3/328 (1%)
 Frame = -1

Query  1099  NGGlllqqqlLTKEGTIEKTKIFTASELDKATDHFNADRIVGRGGQGTVYKGMLIDGQIV  920
             NGGLLL+QQL + +G ++KTK+FT+ EL+KATD +N +R++G+GGQGTVYKGML+DG+IV
Sbjct  41    NGGLLLEQQLSSSKGNVDKTKLFTSKELEKATDRYNENRVIGQGGQGTVYKGMLMDGRIV  100

Query  919   AVKKSQAVDEDQLEPFINEVVILSQINHRNVVKLMGCCLETEVPILVYEFIPNGTLFGLI  740
             AVKK + + + +LE FINEVVIL QINHRNVVKL+GCCLETEVP+LVYEFIPNGTL   I
Sbjct  101   AVKKLKIMSDSKLEQFINEVVILCQINHRNVVKLLGCCLETEVPLLVYEFIPNGTLSEHI  160

Query  739   HNNFDNELIPLSWDIRLRIASEVACALAYLHSVTLVPIYHRDIKTGNILLDEKFRAKVSD  560
             H    NE  P++W++RL+IA+EVA AL+YLHS   +PIYHRDIK+ NILLD+K+RAKV+D
Sbjct  161   HGQ--NEEFPITWEMRLQIATEVAKALSYLHSAASIPIYHRDIKSTNILLDDKYRAKVAD  218

Query  559   FGTSRSISIDKTHFTTMVKGTFGYLDPEYFQSSQFTEKSDVYSFGVVLAELLTGQKPISF  380
             FGTS+  SID+TH TT V+GTFGYLDPEYFQSSQFTEKSDVYSFGVVL ELLTG+KPI  
Sbjct  219   FGTSKFFSIDQTHLTTQVQGTFGYLDPEYFQSSQFTEKSDVYSFGVVLIELLTGKKPI-L  277

Query  379   ELDDDEDRSLVSRFLLCMEENRLMEMLDGEVIEQGKKEDVVAMAWLAQRCLNFNGKKRPT  200
                 +E +SL   F + M+E+ L ++LD  V+++G KED+  +A+LA+RC+N NGKKRPT
Sbjct  278   STRSEERKSLALYFKISMKEDHLSDLLDARVVKEGMKEDINEIAFLARRCINLNGKKRPT  337

Query  199   MKEVATELDAIKASNSHLPLAMEAFEIE  116
             M EVA EL+ I+           + EIE
Sbjct  338   MMEVAMELERIRKCQGDFRAQENSKEIE  365



>ref|XP_010497621.1| PREDICTED: wall-associated receptor kinase-like 22 isoform X1 
[Camelina sativa]
Length=749

 Score =   428 bits (1100),  Expect = 9e-132, Method: Compositional matrix adjust.
 Identities = 243/440 (55%), Positives = 311/440 (71%), Gaps = 28/440 (6%)
 Frame = -1

Query  1387  SYSKYCSPSTYINPQLQWHNYLQCDCPGGDDRNVYLSGGC-------EWKHKDY------  1247
             SYS Y S        L+   Y  C C  G   N YLS GC       E K + +      
Sbjct  270   SYSSYESCICRYGKYLE-RGYRSCMCNSGYRGNPYLSSGCLDIDECEEAKAEGHNRCGEG  328

Query  1246  ------------VISSNKLRPAIIGISASFGFVFLIWAFVILYkaikkrkmkklrqkffk  1103
                             NK    I+GIS  FG + L      LYK I+K++  K ++KFFK
Sbjct  329   SDCKNIPGNLSCTSKKNKTLAIILGISLGFGLLVLAIGVWWLYKFIRKQREIKRKKKFFK  388

Query  1102  RNGGlllqqqlLTKEGTIEKTKIFTASELDKATDHFNADRIVGRGGQGTVYKGMLIDGQI  923
             RNGGLLLQQQL + EG +E+T++F++ EL+KAT+ F+ +R++G+GGQGTVYKGML+DG+I
Sbjct  389   RNGGLLLQQQLFSNEGNVERTRVFSSKELEKATEKFSVNRVLGQGGQGTVYKGMLVDGRI  448

Query  922   VAVKKSQAVDEDQLEPFINEVVILSQINHRNVVKLMGCCLETEVPILVYEFIPNGTLF-G  746
             VAVKKS+ VDED+LE FINEVVILSQINHRN+VKL+GCCLET+VPILVYEFIPNG LF  
Sbjct  449   VAVKKSKVVDEDKLEEFINEVVILSQINHRNIVKLLGCCLETDVPILVYEFIPNGNLFEH  508

Query  745   LIHNNFDNELIPLSWDIRLRIASEVACALAYLHSVTLVPIYHRDIKTGNILLDEKFRAKV  566
             L H++  ++    +W++RLRIA ++A AL+YLHS    PIYHRDIK+ NI+LDEK+RAKV
Sbjct  509   LHHDDESDDYTMATWEMRLRIAVDIAGALSYLHSAASFPIYHRDIKSTNIMLDEKYRAKV  568

Query  565   SDFGTSRSISIDKTHFTTMVKGTFGYLDPEYFQSSQFTEKSDVYSFGVVLAELLTGQKPI  386
             SDFGTSRS++ID TH TT+V GT GY+DPEYFQSSQFT+KSDVYSFGVVL EL+TG+KPI
Sbjct  569   SDFGTSRSVTIDHTHLTTVVAGTVGYVDPEYFQSSQFTDKSDVYSFGVVLVELITGEKPI  628

Query  385   SFELDDDEDRSLVSRFLLCMEENRLMEMLDGEVIEQGKKEDVVAMAWLAQRCLNFNGKKR  206
             SF L  DE+R+L + F+L M+ ++L  ++D  + +    E V A+A LA+RCLN NGKKR
Sbjct  629   SF-LRSDENRTLATYFILAMKNSKLSSIIDARIKDNCNMEQVTAVANLARRCLNLNGKKR  687

Query  205   PTMKEVATELDAIKASNSHL  146
             P M+EV+TEL+ I+ S   L
Sbjct  688   PNMREVSTELERIRNSQVQL  707



>ref|XP_006495029.1| PREDICTED: wall-associated receptor kinase-like 2-like [Citrus 
sinensis]
Length=738

 Score =   427 bits (1099),  Expect = 1e-131, Method: Compositional matrix adjust.
 Identities = 211/314 (67%), Positives = 265/314 (84%), Gaps = 2/314 (1%)
 Frame = -1

Query  1099  NGGlllqqqlLTKEGTIEKTKIFTASELDKATDHFNADRIVGRGGQGTVYKGMLIDGQIV  920
             NGGLLL+Q+L + EG IEKTK+FT+ +L+KATD++   RI+G+GGQGTV+KGML DG+IV
Sbjct  377   NGGLLLRQELSSNEGNIEKTKLFTSKDLEKATDNYKVSRIIGQGGQGTVFKGMLTDGRIV  436

Query  919   AVKKSQAVDEDQLEPFINEVVILSQINHRNVVKLMGCCLETEVPILVYEFIPNGTLFGLI  740
             AVKKS++V E  +E FINEVVILSQINHRNVVKL+GCCLETEVP+LVYEFI NG+L+  I
Sbjct  437   AVKKSKSVHESNVEQFINEVVILSQINHRNVVKLLGCCLETEVPLLVYEFILNGSLYQYI  496

Query  739   HNNFDNELIPLSWDIRLRIASEVACALAYLHSVTLVPIYHRDIKTGNILLDEKFRAKVSD  560
             H   +++L P++W++RLRIA EV+ AL+YLHS   +PIYHRDIK+ NILLD+K+RAK+SD
Sbjct  497   HEQTEDQL-PITWEMRLRIAVEVSGALSYLHSAASIPIYHRDIKSANILLDDKYRAKISD  555

Query  559   FGTSRSISIDKTHFTTMVKGTFGYLDPEYFQSSQFTEKSDVYSFGVVLAELLTGQKPISF  380
             FGTS S+++D+TH TT VKGTFGYLDPEYF+SSQFTEKSDVYSFGVVL ELLTGQKPI  
Sbjct  556   FGTSSSMAVDQTHLTTQVKGTFGYLDPEYFRSSQFTEKSDVYSFGVVLVELLTGQKPIRL  615

Query  379   ELDDDEDRSLVSRFLLCMEENRLMEMLDGEVIEQGKKEDVVAMAWLAQRCLNFNGKKRPT  200
              ++ +E+RSL + FL  + ENRL E+LD EV+ + KKE+V+ +A +A+R LN NGKKRPT
Sbjct  616   -VETEENRSLAAYFLQVINENRLFEVLDAEVLREAKKEEVITVAMVAKRSLNLNGKKRPT  674

Query  199   MKEVATELDAIKAS  158
             MKEVA EL  I+AS
Sbjct  675   MKEVALELAGIRAS  688



>gb|KCW44987.1| hypothetical protein EUGRSUZ_L01427, partial [Eucalyptus grandis]
Length=681

 Score =   425 bits (1092),  Expect = 2e-131, Method: Compositional matrix adjust.
 Identities = 233/413 (56%), Positives = 311/413 (75%), Gaps = 21/413 (5%)
 Frame = -1

Query  1372  CSPSTYINPQLQWHNYLQCDCPGGDDRNVYLSGGCEWKHKDYVIS-------SNKLRPA-  1217
             CSP  + NP      Y++ D      + + +S   +    +Y  S        N +  A 
Sbjct  270   CSPGFFGNP------YIKMDAKSDSFKFLMISSFIDSCQAEYFFSHFCPLSFGNAVALAS  323

Query  1216  IIGISASFGFVFLIWAFVILYkaikkrkmkklrqkffkRNGGlllqqqlLTKEGTIEKTK  1037
             ++G+ A    +F  W    LYK IKKRK  KL++K+FKRNGGLLL+++L T EG +E++K
Sbjct  324   VVGLGALLLCLFSRW----LYKYIKKRKETKLKEKYFKRNGGLLLERELSTPEGNVERSK  379

Query  1036  IFTASELDKATDHFNADRIVGRGGQGTVYKGMLIDGQIVAVKKSQAVDEDQLEPFINEVV  857
             +F + +L KAT++F+  RI+G+GGQGTVYKGML DG+IVA+KKS A+D+ ++E FINEVV
Sbjct  380   LFNSKDLGKATNNFDNSRILGQGGQGTVYKGMLTDGKIVAIKKSMAIDKRKIEQFINEVV  439

Query  856   ILSQINHRNVVKLMGCCLETEVPILVYEFIPNGTLFGLIHNNFDNELIPLSWDIRLRIAS  677
             ILSQINHRNVVKL+GCCLETEVP+LVYEFIPNGTL+  +H+   N   P+SWD RLRIA+
Sbjct  440   ILSQINHRNVVKLLGCCLETEVPLLVYEFIPNGTLYQYLHD--PNAEAPISWDTRLRIAT  497

Query  676   EVACALAYLHSVTLVPIYHRDIKTGNILLDEKFRAKVSDFGTSRSISIDKTHFTTMVKGT  497
             E+A AL YLHS   +PIYHRDIK+ NILLDEK+RAKV+DFGTS+S+S+D+TH TT+V+GT
Sbjct  498   EIAGALFYLHSAASIPIYHRDIKSTNILLDEKYRAKVADFGTSKSVSLDQTHVTTLVQGT  557

Query  496   FGYLDPEYFQSSQFTEKSDVYSFGVVLAELLTGQKPISFELDDDEDRSLVSRFLLCMEEN  317
             FGYLDPEYF+SSQFT+KSDVYSFGVVL ELLTGQKPIS +  ++E RSL   F++ +EEN
Sbjct  558   FGYLDPEYFRSSQFTDKSDVYSFGVVLVELLTGQKPISSQ-REEEGRSLAMYFIISVEEN  616

Query  316   RLMEMLDGEVIEQGKKEDVVAMAWLAQRCLNFNGKKRPTMKEVATELDAIKAS  158
             RL +++D  V+++GK  ++ ++A LA+RCL+ NG+ RPTMKEVA EL+ I+ +
Sbjct  617   RLFDIVDAHVLKEGKMGEIASVANLAKRCLDLNGRNRPTMKEVAMELEGIRKT  669



>gb|KCW81743.1| hypothetical protein EUGRSUZ_C03101 [Eucalyptus grandis]
Length=962

 Score =   433 bits (1113),  Expect = 3e-131, Method: Compositional matrix adjust.
 Identities = 269/584 (46%), Positives = 357/584 (61%), Gaps = 69/584 (12%)
 Frame = -1

Query  1825  SPSCQGSNNFSNIIHNSKLSETPFMYSND-NNFMLFGCGNAFITMPGEELDQPGYNLNCS  1649
             S SC G    + +     L  + F++S   N F + GC N  +T    E    G    C+
Sbjct  367   SASCGGDGRGAMV----SLKGSQFVFSEKWNTFTVVGC-NTLVTGNNTESAVFGCRSKCT  421

Query  1648  SKNTTAPKTAHDCQGIN-CNHLTVDYDVNTYQVNFTHSSSFNACNYAFFlsassslpptl  1472
               + T  K +  C G + C    +  ++  + V+F        C YAF  S  + +    
Sbjct  422   GTDFTIRKNS-SCSGRDGCCQSLLPLNLQGFGVDFKEEGGNGGCKYAFLRSDFTGVYDLR  480

Query  1471  qslpsrqQEMVVVPVELRWTIT----------------------------QEDVPPSYSK  1376
              S          VPV L W I                             + +    Y +
Sbjct  481   SSD--------TVPVVLDWGIANNTNYALDLIRQPYHDESFHCRSLENSARTERGSIYDR  532

Query  1375  YCSPSTYINPQLQWHNYLQCDCPGGDDRNVYLSGGCEWKHKDYVISSNKLRPAIIGISAS  1196
             Y S S      L    +++C C  G   N Y+ GGC+            L          
Sbjct  533   YGSYSVDSGEML----FMECHCAEGYRGNAYVDGGCKGIGAGLGALLLCL----------  578

Query  1195  FGFVFLIWAFVILYkaikkrkmkklrqkffkRNGGlllqqqlLTKEGTIEKTKIFTASEL  1016
                         LYK IKKRK  KL++K+FKRNGGLLL+ +L + +  +EK K+F + +L
Sbjct  579   --------VLWGLYKYIKKRKEIKLKEKYFKRNGGLLLESELSSAKSHVEKNKLFNSKDL  630

Query  1015  DKATDHFNADRIVGRGGQGTVYKGMLIDGQIVAVKKSQAVDEDQLEPFINEVVILSQINH  836
             +KATD+FN DRI+G+GGQGTVYKGML DG+IVA+KKS+A+DE ++E FINEV+ILSQINH
Sbjct  631   EKATDNFNKDRILGQGGQGTVYKGMLTDGKIVAIKKSKAIDEGKVEQFINEVLILSQINH  690

Query  835   RNVVKLMGCCLETEVPILVYEFIPNGTLFGLIHNNFDNELIPLSWDIRLRIASEVACALA  656
             RN+VKL+GCCLETEVP+LVYEFIPNGTL+  +H+    E   +SWD RLRIA+E+A AL 
Sbjct  691   RNIVKLLGCCLETEVPLLVYEFIPNGTLYQYLHD--PKEEYHVSWDTRLRIATEIAGALF  748

Query  655   YLHSVTLVPIYHRDIKTGNILLDEKFRAKVSDFGTSRSISIDKTHFTTMVKGTFGYLDPE  476
             YLHS   +PIYHRDIK+ NILLDEK+RAKV+DFGTS+S+S+D+TH TT+V+GTFGYLDPE
Sbjct  749   YLHSAASIPIYHRDIKSTNILLDEKYRAKVADFGTSKSVSLDQTHVTTLVQGTFGYLDPE  808

Query  475   YFQSSQFTEKSDVYSFGVVLAELLTGQKPISFELDDDEDRSLVSRFLLCMEENRLMEMLD  296
             YFQSSQFT+KSDVYSFGVVL EL TGQKPIS  L + E RSL + F++ MEENRL +++D
Sbjct  809   YFQSSQFTDKSDVYSFGVVLVELFTGQKPIS-SLREQEGRSLATYFIISMEENRLFDIVD  867

Query  295   GEVIEQGKKEDVVAMAWLAQRCLNFNGKKRPTMKEVATELDAIK  164
              +V+++GKKE++ ++A LA+RCLN NG+ RPTMKEVA EL+ ++
Sbjct  868   AQVLKEGKKEEIASVANLAKRCLNLNGRNRPTMKEVAMELEGMR  911



>ref|XP_006427114.1| hypothetical protein CICLE_v10024995mg [Citrus clementina]
 gb|ESR40354.1| hypothetical protein CICLE_v10024995mg [Citrus clementina]
Length=719

 Score =   426 bits (1095),  Expect = 3e-131, Method: Compositional matrix adjust.
 Identities = 279/608 (46%), Positives = 371/608 (61%), Gaps = 60/608 (10%)
 Frame = -1

Query  1801  NFSNIIHNSK---LSETPFMYSNDNN-FMLFGCGNAFITMPGEELDQPGYNLN---CSSK  1643
             N S  + N+K   L+ TPF +S  NN F   GC +        +L+Q   + N   C S 
Sbjct  95    NSSKSMGNAKGVNLTGTPFSFSQKNNKFTAAGCDSY------AKLNQKNDSSNSGKCQSV  148

Query  1642  NTTAPKTAHDCQGINCNHLTVDYDVNTYQVN--FTHSSSFNACNYAFFlsassslpptlq  1469
              T  P    DC  + C   TV  +   +  N  + +  S        F+     L    Q
Sbjct  149   CTCDPTQYADCCDLLC---TVPPNTKVFDTNSSYKYYQSIPQECSVVFVVEQEWLFNNYQ  205

Query  1468  slpsrqQEMVVVPVELRW-----TITQEDVPPSYSKYCSPSTYINPQLQWHNYLQCD---  1313
             +     ++   VP  L W     T T+E    S++K C+   +   QL   ++  CD   
Sbjct  206   TNSVVLKDQEQVPAVLEWGKYKGTCTEE--YNSHTKMCNKDNHCLLQLGTGHFCLCDYTR  263

Query  1312  ------CPGGDDRNVYLSGGCEWKHKDYVISS--------------------NKLRPAII  1211
                   C G    +      C    + Y +SS                    ++ +  +I
Sbjct  264   SVASRHCAGDLICSTTSGHNCSECPQGYYLSSYNSDQEPLCSRSTQLTFGKKSRNKYIVI  323

Query  1210  G-ISASFGFVFLIWAFVILYkaikkrkmkklrqkffkRNGGlllqqqlLTKEGTIEKTKI  1034
             G  S  FG + L+     +YK +K++    L+QKFFKRNGGLLLQQ+L + EG I+K+K+
Sbjct  324   GCTSGGFGMLCLLTGAWWMYKFLKRKMEIMLKQKFFKRNGGLLLQQELASTEGNIDKSKL  383

Query  1033  FTASELDKATDHFNADRIVGRGGQGTVYKGMLIDGQIVAVKKSQAVDEDQLEPFINEVVI  854
             FT+ EL+ ATDH+N +RI+G+GGQGTVYKGML DG+IVA+KKS+ +DE +++ FINEV I
Sbjct  384   FTSKELETATDHYNTNRILGQGGQGTVYKGMLADGRIVAIKKSKVIDESKVDEFINEVAI  443

Query  853   LSQINHRNVVKLMGCCLETEVPILVYEFIPNGTLFGLIHNNFDNELIPLSWDIRLRIASE  674
             LSQINHRNVVKL+GCCLETEVP+LVYEFI NGTLF  +H+   NE  P++W+IRLRIA E
Sbjct  444   LSQINHRNVVKLLGCCLETEVPLLVYEFIINGTLFQYLHDQ--NEEFPITWEIRLRIAIE  501

Query  673   VACALAYLHSVTLVPIYHRDIKTGNILLDEKFRAKVSDFGTSRSISIDKTHFTTMVKGTF  494
             V+ A++YLHS   +PIYHRDIK+ NILLD K+RAKVSDFG SRS++ID+TH TT V+GTF
Sbjct  502   VSDAVSYLHSAASIPIYHRDIKSTNILLDGKYRAKVSDFGASRSMAIDQTHMTTQVQGTF  561

Query  493   GYLDPEYFQSSQFTEKSDVYSFGVVLAELLTGQKPISFELDDDEDRSLVSRFLLCMEENR  314
             GYLDPEYF+SSQFTEKSDVYSFGVVLAELLTG++ I    + +ED+SL + FL  M+E+ 
Sbjct  562   GYLDPEYFRSSQFTEKSDVYSFGVVLAELLTGERAIRV-TNFEEDKSLAAYFLCAMKEDS  620

Query  313   LMEMLDGEVIEQGKKEDVVAMAWLAQRCLNFNGKKRPTMKEVATELDAIKASNSHLPLAM  134
             L E+LD  V+++   ED+V +A L  RCLN NGKKRPTMKEVA  L  IKA +    +  
Sbjct  621   LFEILDAHVLKEASHEDIVTVAKLTNRCLNLNGKKRPTMKEVAVVLAGIKACDGTSNIIQ  680

Query  133   EAFEIESD  110
             E+  +ESD
Sbjct  681   ES--VESD  686



>ref|XP_004309764.1| PREDICTED: wall-associated receptor kinase-like 10-like [Fragaria 
vesca subsp. vesca]
Length=830

 Score =   429 bits (1103),  Expect = 3e-131, Method: Compositional matrix adjust.
 Identities = 274/576 (48%), Positives = 354/576 (61%), Gaps = 48/576 (8%)
 Frame = -1

Query  1771  LSETPFMYSNDNNFMLFGCGN-AFITMPGEELDQ-PGYNLNCSSKNTTAPKTAHDCQGIN  1598
             L  TP  +S  N F+   CG  A +T PG   +      L+   K ++     + C GI+
Sbjct  216   LQPTPAWFSEKNKFISVSCGRVASLTFPGPRGNTTAAVCLSICDKYSSIFVNNNSCGGIS  275

Query  1597  CNHLTVDYDVNTYQVNFT-------HSSSFNACNYAFFlsassslpptlqslpsrqQEMV  1439
             C   T+    + +  +F          +    C YAF +        +  +      EM 
Sbjct  276   CCQTTIPAGSDAWNTSFGPVIITTDDDADERPCVYAFLVDEEWFTSKSTNTSAIAD-EMD  334

Query  1438  VVPVELRWTITQEDVPPSYSKYCSPSTYINPQLQWHNYLQCDCPGGDDRNVYLSGGCE--  1265
              VPV L W         S     S   Y++   +      C C  G + N YL GGC+  
Sbjct  335   EVPVLLDWWF-------SGGIDNSTEDYVHTNCE-SELGPCSCLEGYEGNPYLPGGCQDI  386

Query  1264  ------------------WKHKDYVISSNKL----RPAIIGISASFGFVFLIWAFVILYk  1151
                                 ++ Y   S++L    +  II + + FG +F I     L K
Sbjct  387   NECEVPYTCPSGNCFNINGTYECYTSRSDRLLRQIKVGIIVLCSVFGLLFQIVGAWWLRK  446

Query  1150  aikkrkmkklrqkffkRNGGlllqqqlLTKEGTIEKTKIFTASELDKATDHFNADRIVGR  971
              IKKRK  K +QKFF+ NGGLLL+QQL + E  +EK K+F A EL+KATD FN DRI+G 
Sbjct  447   VIKKRKNIKHKQKFFRLNGGLLLEQQLSSGEVNVEKIKLFNAKELEKATDRFNLDRILGE  506

Query  970   GGQGTVYKGMLIDGQIVAVKKSQAVDEDQLEPFINEVVILSQINHRNVVKLMGCCLETEV  791
             GGQGTVYKGML DG+IVAVKKS+  +  ++  FINE+VILSQINHRNVVKL+GCCLE+EV
Sbjct  507   GGQGTVYKGMLADGRIVAVKKSKIENGGEVSQFINEIVILSQINHRNVVKLLGCCLESEV  566

Query  790   PILVYEFIPNGTLFGLIHNNFDNELIPLSWDIRLRIASEVACALAYLHSVTLVPIYHRDI  611
             P+LVYEF+PNGTL   IH+   +E  P +W++RLR+  EVA AL+YLHS   +PIYHRDI
Sbjct  567   PLLVYEFLPNGTLSQYIHSR--DEGFPFTWEMRLRVGIEVAGALSYLHSSASMPIYHRDI  624

Query  610   KTGNILLDEKFRAKVSDFGTSRSISIDKTHFT-TMVKGTFGYLDPEYFQSSQFTEKSDVY  434
             K+ NILLDE+ RAKV+DFGTSRS+SID+TH T T V GTFGYLDPEYFQSSQFT+KSDVY
Sbjct  625   KSSNILLDERHRAKVADFGTSRSVSIDQTHLTMTHVNGTFGYLDPEYFQSSQFTDKSDVY  684

Query  433   SFGVVLAELLTGQKPISFELDDD---EDRSLVSRFLLCMEENRLMEMLDGEVIEQGKKED  263
             SFGVVLAELLTGQKP+S    ++   E RSL + F++ MEEN L ++LD EV++ GKKE+
Sbjct  685   SFGVVLAELLTGQKPVSVTRSEEGRHEGRSLATYFIVSMEENFLFDILDAEVMKGGKKEE  744

Query  262   VVAMAWLAQRCLNFNGKKRPTMKEVATELDAIKASN  155
             + A+A LA+RCLN  GKKRP+MKE+A EL+ I  S+
Sbjct  745   ITAVANLAKRCLNMKGKKRPSMKEIAIELEEILMSS  780



>ref|XP_010051297.1| PREDICTED: wall-associated receptor kinase-like 1 [Eucalyptus 
grandis]
Length=543

 Score =   420 bits (1079),  Expect = 3e-131, Method: Compositional matrix adjust.
 Identities = 195/301 (65%), Positives = 254/301 (84%), Gaps = 3/301 (1%)
 Frame = -1

Query  1066  TKEGTIEKTKIFTASELDKATDHFNADRIVGRGGQGTVYKGMLIDGQIVAVKKSQAVDED  887
             + +G +EK K+F + +L+KATD+F+ DRI+G+GGQGTVYKGML DG+IVA+KK +A+DE 
Sbjct  195   SAKGHVEKNKLFKSKDLEKATDNFSKDRILGQGGQGTVYKGMLTDGKIVAIKKPKAIDEG  254

Query  886   QLEPFINEVVILSQINHRNVVKLMGCCLETEVPILVYEFIPNGTLFGLIHNNFDNELIPL  707
             +++ FINEVVILSQINHRN+VKL+GCCLET+VP+LVYEFIPNGTL+  +H++  NE   +
Sbjct  255   EVKQFINEVVILSQINHRNIVKLLGCCLETKVPLLVYEFIPNGTLYQYLHDS--NEEFHV  312

Query  706   SWDIRLRIASEVACALAYLHSVTLVPIYHRDIKTGNILLDEKFRAKVSDFGTSRSISIDK  527
             SWD RLRIA+E+  AL YLHS   +PIYHRDIK+ NILLDEK+RAKV+DFGTS+SIS+D+
Sbjct  313   SWDTRLRIAAEIVGALFYLHSAASIPIYHRDIKSTNILLDEKYRAKVADFGTSKSISLDQ  372

Query  526   THFTTMVKGTFGYLDPEYFQSSQFTEKSDVYSFGVVLAELLTGQKPISFELDDDEDRSLV  347
             TH TT+V+GT GYLDPEYFQS QFT+KSDVYSFGVVL ELLTGQKPIS  L + E RSL 
Sbjct  373   THVTTLVQGTIGYLDPEYFQSGQFTDKSDVYSFGVVLVELLTGQKPIS-SLREQEGRSLA  431

Query  346   SRFLLCMEENRLMEMLDGEVIEQGKKEDVVAMAWLAQRCLNFNGKKRPTMKEVATELDAI  167
             + F++ MEENRL +++D +++++ KKE++  +A LA+RCLN NG+ RPTMKEVA EL+ +
Sbjct  432   TYFIISMEENRLFDIVDVQILKEDKKEEIAFVANLAKRCLNLNGRSRPTMKEVAMELEVM  491

Query  166   K  164
             +
Sbjct  492   R  492



>ref|XP_010051334.1| PREDICTED: wall-associated receptor kinase-like 1 [Eucalyptus 
grandis]
Length=985

 Score =   433 bits (1113),  Expect = 5e-131, Method: Compositional matrix adjust.
 Identities = 273/578 (47%), Positives = 361/578 (62%), Gaps = 57/578 (10%)
 Frame = -1

Query  1771  LSETPFMYSNDNN-FMLFGCGNAFITMPGEELDQPGYNLNCSSKNTTAPKTAHDCQGIN-  1598
             L  +PF++S   N F + GC N  +T    E    G    C+  N T  K +  C G + 
Sbjct  372   LKGSPFVFSQKRNIFTVVGC-NTLVTANSTESAVFGCQSKCAGTNFTISKYSA-CSGEDG  429

Query  1597  CNHLTVDYDVNTYQVNFTHSSSFNACNYAFFlsassslpptlqslpsrqQEMVVVPVELR  1418
             C   ++  ++    V+F   S    C YAF  S S      L            VP  L 
Sbjct  430   CCQSSLPLNLQGLGVDFEEESGDEGCKYAFLGSDSGVYDLKLSD---------TVPGVLE  480

Query  1417  WTITQEDVPP----SYSKYCSPSTYINPQLQ------------WHNY---------LQCD  1313
             W I  +            Y S  ++   + +            + +Y          QC 
Sbjct  481   WGIANDTTYALDLIEQGYYLSNESFTCTRFKSLSSEGEGIIYRYRSYSVDSGEILSAQCR  540

Query  1312  CPGGDDRNVYLSGGCE-------WKHKDYV--------ISSNKLRPAIIGISASFGFVFL  1178
             C  G   N YL GGC+       W     V        +   K +  +IG+ A  G + L
Sbjct  541   CRTGYHGNAYLIGGCKDIDECNSWCTGTCVNTGASFRCVGGGKTKFILIGVGAGLGALLL  600

Query  1177  IWAFVILYkaikkrkmkklrqkffkRNGGlllqqqlLTKEGTIEKTKIFTASELDKATDH  998
                   LYK I +RK  KL++K FKRNGGLLL+ +L +K G +EK K+F + +L+KAT++
Sbjct  601   CLVLWGLYKYINRRKEIKLKEKNFKRNGGLLLESELSSK-GHVEKNKLFNSKDLEKATNN  659

Query  997   FNADRIVGRGGQGTVYKGMLIDGQIVAVKKSQAVDEDQLEPFINEVVILSQINHRNVVKL  818
             FN DRI+GRGGQGTVYKGML DG+IVA+KKS+A+DE ++E FINEV ILSQINHRN+VKL
Sbjct  660   FNEDRILGRGGQGTVYKGMLTDGKIVAIKKSKAIDEGKVEQFINEVFILSQINHRNIVKL  719

Query  817   MGCCLETEVPILVYEFIPNGTLFGLIHNNFDNELIPLSWDIRLRIASEVACALAYLHSVT  638
             +GCCLET+VP+LVYEFIPNGTL+  +H+    E   +SWD RLRIA+E+A AL YLHS  
Sbjct  720   LGCCLETKVPLLVYEFIPNGTLYQYLHD--PKEEYHVSWDTRLRIATEIAGALFYLHSAA  777

Query  637   LVPIYHRDIKTGNILLDEKFRAKVSDFGTSRSISIDKTHFTTMVKGTFGYLDPEYFQSSQ  458
              +PIYHRDIK+ NILLDEK+RAKV+DFGTS+S+S+D+TH TT+V+GTFGYLDPEYFQSSQ
Sbjct  778   SIPIYHRDIKSTNILLDEKYRAKVADFGTSKSVSLDQTHVTTLVQGTFGYLDPEYFQSSQ  837

Query  457   FTEKSDVYSFGVVLAELLTGQKPISFELDDDEDRSLVSRFLLCMEENRLMEMLDGEVIEQ  278
             FT+KSDVYSFGVVL ELLTGQKPIS  L + E RSL + F++ MEENR+ +++D +V+++
Sbjct  838   FTDKSDVYSFGVVLVELLTGQKPIS-SLREQEGRSLATYFIISMEENRVFDIVDAQVLKE  896

Query  277   GKKEDVVAMAWLAQRCLNFNGKKRPTMKEVATELDAIK  164
             G KE++ ++A LA+RCLN NG+ RPTMKEVA EL+ ++
Sbjct  897   GNKEEIASVANLAKRCLNLNGRNRPTMKEVAMELEGMR  934



>ref|XP_006427113.1| hypothetical protein CICLE_v10024995mg [Citrus clementina]
 gb|ESR40353.1| hypothetical protein CICLE_v10024995mg [Citrus clementina]
Length=731

 Score =   425 bits (1093),  Expect = 6e-131, Method: Compositional matrix adjust.
 Identities = 279/608 (46%), Positives = 371/608 (61%), Gaps = 60/608 (10%)
 Frame = -1

Query  1801  NFSNIIHNSK---LSETPFMYSNDNN-FMLFGCGNAFITMPGEELDQPGYNLN---CSSK  1643
             N S  + N+K   L+ TPF +S  NN F   GC +        +L+Q   + N   C S 
Sbjct  95    NSSKSMGNAKGVNLTGTPFSFSQKNNKFTAAGCDSY------AKLNQKNDSSNSGKCQSV  148

Query  1642  NTTAPKTAHDCQGINCNHLTVDYDVNTYQVN--FTHSSSFNACNYAFFlsassslpptlq  1469
              T  P    DC  + C   TV  +   +  N  + +  S        F+     L    Q
Sbjct  149   CTCDPTQYADCCDLLC---TVPPNTKVFDTNSSYKYYQSIPQECSVVFVVEQEWLFNNYQ  205

Query  1468  slpsrqQEMVVVPVELRW-----TITQEDVPPSYSKYCSPSTYINPQLQWHNYLQCD---  1313
             +     ++   VP  L W     T T+E    S++K C+   +   QL   ++  CD   
Sbjct  206   TNSVVLKDQEQVPAVLEWGKYKGTCTEE--YNSHTKMCNKDNHCLLQLGTGHFCLCDYTR  263

Query  1312  ------CPGGDDRNVYLSGGCEWKHKDYVISS--------------------NKLRPAII  1211
                   C G    +      C    + Y +SS                    ++ +  +I
Sbjct  264   SVASRHCAGDLICSTTSGHNCSECPQGYYLSSYNSDQEPLCSRSTQLTFGKKSRNKYIVI  323

Query  1210  G-ISASFGFVFLIWAFVILYkaikkrkmkklrqkffkRNGGlllqqqlLTKEGTIEKTKI  1034
             G  S  FG + L+     +YK +K++    L+QKFFKRNGGLLLQQ+L + EG I+K+K+
Sbjct  324   GCTSGGFGMLCLLTGAWWMYKFLKRKMEIMLKQKFFKRNGGLLLQQELASTEGNIDKSKL  383

Query  1033  FTASELDKATDHFNADRIVGRGGQGTVYKGMLIDGQIVAVKKSQAVDEDQLEPFINEVVI  854
             FT+ EL+ ATDH+N +RI+G+GGQGTVYKGML DG+IVA+KKS+ +DE +++ FINEV I
Sbjct  384   FTSKELETATDHYNTNRILGQGGQGTVYKGMLADGRIVAIKKSKVIDESKVDEFINEVAI  443

Query  853   LSQINHRNVVKLMGCCLETEVPILVYEFIPNGTLFGLIHNNFDNELIPLSWDIRLRIASE  674
             LSQINHRNVVKL+GCCLETEVP+LVYEFI NGTLF  +H+   NE  P++W+IRLRIA E
Sbjct  444   LSQINHRNVVKLLGCCLETEVPLLVYEFIINGTLFQYLHDQ--NEEFPITWEIRLRIAIE  501

Query  673   VACALAYLHSVTLVPIYHRDIKTGNILLDEKFRAKVSDFGTSRSISIDKTHFTTMVKGTF  494
             V+ A++YLHS   +PIYHRDIK+ NILLD K+RAKVSDFG SRS++ID+TH TT V+GTF
Sbjct  502   VSDAVSYLHSAASIPIYHRDIKSTNILLDGKYRAKVSDFGASRSMAIDQTHMTTQVQGTF  561

Query  493   GYLDPEYFQSSQFTEKSDVYSFGVVLAELLTGQKPISFELDDDEDRSLVSRFLLCMEENR  314
             GYLDPEYF+SSQFTEKSDVYSFGVVLAELLTG++ I    + +ED+SL + FL  M+E+ 
Sbjct  562   GYLDPEYFRSSQFTEKSDVYSFGVVLAELLTGERAIRV-TNFEEDKSLAAYFLCAMKEDS  620

Query  313   LMEMLDGEVIEQGKKEDVVAMAWLAQRCLNFNGKKRPTMKEVATELDAIKASNSHLPLAM  134
             L E+LD  V+++   ED+V +A L  RCLN NGKKRPTMKEVA  L  IKA +    +  
Sbjct  621   LFEILDAHVLKEASHEDIVTVAKLTNRCLNLNGKKRPTMKEVAVVLAGIKACDGTSNIIQ  680

Query  133   EAFEIESD  110
             E+  +ESD
Sbjct  681   ES--VESD  686



>ref|XP_010038783.1| PREDICTED: LOW QUALITY PROTEIN: wall-associated receptor kinase-like 
10 [Eucalyptus grandis]
Length=578

 Score =   420 bits (1080),  Expect = 6e-131, Method: Compositional matrix adjust.
 Identities = 230/382 (60%), Positives = 296/382 (77%), Gaps = 7/382 (2%)
 Frame = -1

Query  1297  DRNVYL----SGGCEWKHKDYVISSNKLRPAIIGISASFGFVFLIWAFVILYkaikkrkm  1130
             DR+ +L    +G C  K   Y   + +    +IGI AS G + L      LYK IKKRK 
Sbjct  173   DRSWFLRSNVTGFCVNKQGGYDCIAGRKTAILIGIGASLGAIVLCLFLWRLYKYIKKRKE  232

Query  1129  kklrqkffkRNGGlllqqqlLTKEGTIEKTKIFTASELDKATDHFNADRIVGRGGQGTVY  950
              KL++K+FKRNGGLLL+ +L + EG +EK+K+F A +L+KATD+FN DRI+G+GGQGTVY
Sbjct  233   IKLKEKYFKRNGGLLLKSELSSLEGNVEKSKLFNAKDLEKATDNFNDDRILGQGGQGTVY  292

Query  949   KGMLIDGQIVAVKKSQAVDEDQLEPFINEVVILSQINHRNVVKLMGCCLETEVPILVYEF  770
             KGML DG+IVA+KK++ +DE +++ FINEV+ILSQINHRNVVKL+GCCLETEVP+LVYEF
Sbjct  293   KGMLTDGKIVAIKKAKVIDEGKVKQFINEVLILSQINHRNVVKLLGCCLETEVPLLVYEF  352

Query  769   IPNGTLFGLIHNNFDNELIPLSWDIRLRIASEVACALAYLHSVTLVPIYHRDIKTGNILL  590
             IPNGTL+  +H+   NE   +SWD RLRI +E+A AL YLHS   +PIYHRDIK+ NILL
Sbjct  353   IPNGTLYQYLHD--PNEEFHVSWDTRLRITTEIAGALFYLHSAASIPIYHRDIKSTNILL  410

Query  589   DEKFRAKVSDFGTSRSISIDKTHFTTMVKGTFGYLDPEYFQSSQFTEKSDVYSFGVVLAE  410
             DEK+RAKV+DF TS+S+S+D+TH TT+V+GTFGYLD EYFQSSQFT KSDVYSFGVVL E
Sbjct  411   DEKYRAKVADFDTSKSVSLDQTHVTTLVQGTFGYLDLEYFQSSQFTXKSDVYSFGVVLVE  470

Query  409   LLTGQKPISFELDDDEDRSLVSRFLLCMEENRLMEMLDGEVIEQGKKEDVVAMAWLAQRC  230
             LLTGQKPIS  L + E RSL + F++ MEEN L +++D +V+++G KE++  +A L + C
Sbjct  471   LLTGQKPIS-SLREQEGRSLTTYFIISMEENCLFDIVDAQVLKEGNKEEIALVASLEKMC  529

Query  229   LNFNGKKRPTMKEVATELDAIK  164
             LN N + RPTMKEVA EL+ I+
Sbjct  530   LNLNRRNRPTMKEVAMELEGIR  551



>ref|XP_010476712.1| PREDICTED: wall-associated receptor kinase-like 22 [Camelina 
sativa]
Length=759

 Score =   426 bits (1095),  Expect = 6e-131, Method: Compositional matrix adjust.
 Identities = 244/445 (55%), Positives = 319/445 (72%), Gaps = 33/445 (7%)
 Frame = -1

Query  1387  SYSKYCSPSTYINPQLQWHNYLQ-----CDCPGGDDRNVYLSGGC-----------EWKH  1256
             SYS + S STY +   ++  YL+     C C  G   N YLS GC           E ++
Sbjct  266   SYSGW-SYSTYESCVCRYGKYLERSYRSCMCNSGYRGNPYLSSGCIDIDECEEAKAEGRN  324

Query  1255  KDYVISSNKLRPA--------------IIGISASFGFVFLIWAFVILYkaikkrkmkklr  1118
             +    S  K  P               I+GIS  FG + L      LYK I+K++  K +
Sbjct  325   RCGEGSDCKNIPGNLRCTSKKDKTLAIILGISLGFGLLVLAIGAWWLYKFIRKQREMKRK  384

Query  1117  qkffkRNGGlllqqqlLTKEGTIEKTKIFTASELDKATDHFNADRIVGRGGQGTVYKGML  938
             ++FFKRNGGLLLQQQL + EG +E+T++F++ EL+KAT+ F+ +R++G+GGQGTVYKGML
Sbjct  385   KRFFKRNGGLLLQQQLFSNEGNVERTRVFSSKELEKATEKFSVNRVLGQGGQGTVYKGML  444

Query  937   IDGQIVAVKKSQAVDEDQLEPFINEVVILSQINHRNVVKLMGCCLETEVPILVYEFIPNG  758
             +DG+IVAVKKS+ VDED+LE FINEVVILSQINHRN+VKL+GCCLET+VPILVYEFIPNG
Sbjct  445   VDGRIVAVKKSKVVDEDKLEEFINEVVILSQINHRNIVKLLGCCLETDVPILVYEFIPNG  504

Query  757   TLF-GLIHNNFDNELIPLSWDIRLRIASEVACALAYLHSVTLVPIYHRDIKTGNILLDEK  581
              LF  L H++  ++    +W++RLRIA ++A AL+YLHS    PIYHRDIK+ NI+LDEK
Sbjct  505   NLFEHLHHDDESDDYTMATWEMRLRIAVDIAGALSYLHSAASFPIYHRDIKSTNIMLDEK  564

Query  580   FRAKVSDFGTSRSISIDKTHFTTMVKGTFGYLDPEYFQSSQFTEKSDVYSFGVVLAELLT  401
             +RAKVSDFGTSRS++ID TH TT+V GT GY+DPEYFQSSQFT+KSDVYSFGVVL EL+T
Sbjct  565   YRAKVSDFGTSRSVTIDHTHLTTVVAGTVGYVDPEYFQSSQFTDKSDVYSFGVVLVELIT  624

Query  400   GQKPISFELDDDEDRSLVSRFLLCMEENRLMEMLDGEVIEQGKKEDVVAMAWLAQRCLNF  221
             G+KPISF L  DE+R+L + F+L M++++L  ++D  + +    E V A+A LA+RCLN 
Sbjct  625   GEKPISF-LRSDENRTLATYFILAMKDSKLSSIIDARINDNCNMEQVTAVANLARRCLNL  683

Query  220   NGKKRPTMKEVATELDAIKASNSHL  146
             NGKKRP M+EV+TEL+ I+ S   L
Sbjct  684   NGKKRPNMREVSTELERIRNSQIQL  708



>gb|KDO58195.1| hypothetical protein CISIN_1g036483mg [Citrus sinensis]
Length=721

 Score =   425 bits (1092),  Expect = 7e-131, Method: Compositional matrix adjust.
 Identities = 278/608 (46%), Positives = 372/608 (61%), Gaps = 60/608 (10%)
 Frame = -1

Query  1801  NFSNIIHNSK---LSETPFMYSNDNN-FMLFGCGNAFITMPGEELDQPGYNLN---CSSK  1643
             N S  + N+K   L+ TPF +S  NN F   GC +        +L+Q   + N   C S 
Sbjct  95    NSSKSMGNAKGVNLTGTPFSFSQKNNKFTTAGCDSY------AKLNQKNDSSNSGKCQSV  148

Query  1642  NTTAPKTAHDCQGINCNHLTVDYDVNTYQVN--FTHSSSFNACNYAFFlsassslpptlq  1469
              T  P    DC  + C   TV  +   +  N  + +  S        F+     L    Q
Sbjct  149   CTCDPTQYADCCDLLC---TVPPNTKVFDTNSSYKYYQSIPQECSVVFVVEQEWLFNNYQ  205

Query  1468  slpsrqQEMVVVPVELRW-----TITQEDVPPSYSKYCSPSTYINPQLQWHNYLQCD---  1313
             +     ++   VP  L W     T T+E    S++K C+   +   QL   ++  CD   
Sbjct  206   TNSVVLKDQEQVPAVLEWGKYKGTCTEE--YNSHTKMCNKDNHCLLQLGTGHFCLCDYTR  263

Query  1312  ------CPGGDDRNVYLSGGCEWKHKDYVISS--------------------NKLRPAII  1211
                   C G    +      C    + Y +SS                    ++ +  +I
Sbjct  264   SVASRHCAGDLICSTTSGHNCSECPQGYYLSSYNSDQEPLCSRSTQLTFGKKSRNKYIVI  323

Query  1210  G-ISASFGFVFLIWAFVILYkaikkrkmkklrqkffkRNGGlllqqqlLTKEGTIEKTKI  1034
             G  S  FG + L+     +YK +K++    L+QKFFKRNGGLLLQQ+L + EG I+K+K+
Sbjct  324   GCTSGGFGMLCLLTGAWWMYKFLKRKMEIMLKQKFFKRNGGLLLQQELASTEGNIDKSKL  383

Query  1033  FTASELDKATDHFNADRIVGRGGQGTVYKGMLIDGQIVAVKKSQAVDEDQLEPFINEVVI  854
             FT+ EL+ ATDH+N +RI+G+GGQGTVYKGML DG+IVA+KKS+ +DE +++ FINEV I
Sbjct  384   FTSKELETATDHYNTNRILGQGGQGTVYKGMLADGRIVAIKKSKVIDESKVDEFINEVAI  443

Query  853   LSQINHRNVVKLMGCCLETEVPILVYEFIPNGTLFGLIHNNFDNELIPLSWDIRLRIASE  674
             LSQINHRNVVKL+GCCLETEVP+LVYEFI NGTLF  +H+   NE  P++W+IRLRIA E
Sbjct  444   LSQINHRNVVKLLGCCLETEVPLLVYEFIINGTLFQYLHDQ--NEEFPITWEIRLRIAIE  501

Query  673   VACALAYLHSVTLVPIYHRDIKTGNILLDEKFRAKVSDFGTSRSISIDKTHFTTMVKGTF  494
             V+ A++YLHS   +PIYHRDIK+ NILLD K+RAKVSDFG SRS++ID+TH TT V+GTF
Sbjct  502   VSDAVSYLHSAASIPIYHRDIKSTNILLDGKYRAKVSDFGASRSMAIDQTHMTTQVQGTF  561

Query  493   GYLDPEYFQSSQFTEKSDVYSFGVVLAELLTGQKPISFELDDDEDRSLVSRFLLCMEENR  314
             GYLDPEYF+SS+FTEKSDVYSFGVVLAELLTG++ I    + +ED+SL + FL  M+E+ 
Sbjct  562   GYLDPEYFRSSRFTEKSDVYSFGVVLAELLTGERAIRV-TNFEEDKSLAAYFLRAMKEDS  620

Query  313   LMEMLDGEVIEQGKKEDVVAMAWLAQRCLNFNGKKRPTMKEVATELDAIKASNSHLPLAM  134
             L E+LD  V+++  +ED+V +A L  RCLN NGKKRPTMKEVA  L  IKA +    +  
Sbjct  621   LFEILDAHVLKEASQEDIVTVAKLTNRCLNLNGKKRPTMKEVAVVLAGIKACDGTSNIIQ  680

Query  133   EAFEIESD  110
             E+  +ESD
Sbjct  681   ES--VESD  686



>gb|KCW44989.1| hypothetical protein EUGRSUZ_L014281, partial [Eucalyptus grandis]
Length=383

 Score =   413 bits (1061),  Expect = 7e-131, Method: Compositional matrix adjust.
 Identities = 197/314 (63%), Positives = 263/314 (84%), Gaps = 3/314 (1%)
 Frame = -1

Query  1099  NGGlllqqqlLTKEGTIEKTKIFTASELDKATDHFNADRIVGRGGQGTVYKGMLIDGQIV  920
             NGGLLL+++L + EG +E++K++ + +L  AT++FN +RI+G+GGQGTVYKGML DG+IV
Sbjct  34    NGGLLLERELSSPEGNVERSKLYNSKDLGNATNNFNDNRILGQGGQGTVYKGMLKDGKIV  93

Query  919   AVKKSQAVDEDQLEPFINEVVILSQINHRNVVKLMGCCLETEVPILVYEFIPNGTLFGLI  740
             A+KKS+ +D  ++E FINEV+ILSQINHRN+V+L+GCCLETEVP+LVYEFIPNGTL+  +
Sbjct  94    AIKKSKVIDGRKVEQFINEVLILSQINHRNIVRLLGCCLETEVPLLVYEFIPNGTLYQYL  153

Query  739   HNNFDNELIPLSWDIRLRIASEVACALAYLHSVTLVPIYHRDIKTGNILLDEKFRAKVSD  560
             H+   N   P+SWD RLRIA+EVA AL YLHS   +PIYHRDIK+ NILLDEK++AKV+D
Sbjct  154   HD--PNAESPISWDTRLRIATEVAGALFYLHSAASIPIYHRDIKSTNILLDEKYQAKVAD  211

Query  559   FGTSRSISIDKTHFTTMVKGTFGYLDPEYFQSSQFTEKSDVYSFGVVLAELLTGQKPISF  380
             FGTS+S+S+D+TH TT+V+GTFGYLDPEYF+SSQFT+KSDVYSFGVVL ELLTGQKPIS 
Sbjct  212   FGTSKSVSLDQTHVTTLVQGTFGYLDPEYFRSSQFTDKSDVYSFGVVLVELLTGQKPISS  271

Query  379   ELDDDEDRSLVSRFLLCMEENRLMEMLDGEVIEQGKKEDVVAMAWLAQRCLNFNGKKRPT  200
             +  ++E RSLV  F++ MEENRL +++D  ++++ K  ++  +A LA+RCL+ NG+ RPT
Sbjct  272   Q-REEEGRSLVMYFIISMEENRLFDIVDAHMLKERKMGEIALVANLAKRCLDLNGRNRPT  330

Query  199   MKEVATELDAIKAS  158
             MKEVA EL+ I+ +
Sbjct  331   MKEVAMELEGIRET  344



>ref|XP_010049240.1| PREDICTED: wall-associated receptor kinase-like 1 [Eucalyptus 
grandis]
Length=729

 Score =   425 bits (1092),  Expect = 8e-131, Method: Compositional matrix adjust.
 Identities = 200/296 (68%), Positives = 252/296 (85%), Gaps = 3/296 (1%)
 Frame = -1

Query  1051  IEKTKIFTASELDKATDHFNADRIVGRGGQGTVYKGMLIDGQIVAVKKSQAVDEDQLEPF  872
             +EK K+F + +L KAT++FN DRI+GRGGQGTVYKGML DG+IVA+KKSQA+DE +++ F
Sbjct  386   VEKNKLFNSKDLKKATNNFNQDRILGRGGQGTVYKGMLTDGKIVAIKKSQAIDEGKVKQF  445

Query  871   INEVVILSQINHRNVVKLMGCCLETEVPILVYEFIPNGTLFGLIHNNFDNELIPLSWDIR  692
             INEV ILSQINHRN+VKL+GCCLET+VP+LVYEFIPNGTL+  +H+    E   +SWD R
Sbjct  446   INEVFILSQINHRNIVKLLGCCLETKVPLLVYEFIPNGTLYQYLHD--PKEEYHVSWDTR  503

Query  691   LRIASEVACALAYLHSVTLVPIYHRDIKTGNILLDEKFRAKVSDFGTSRSISIDKTHFTT  512
             LRIA+E+A AL YLHS   +PIYHRDIK+ NILLDEK+RAKV+DFGTS+SIS+D+TH TT
Sbjct  504   LRIATEIAGALFYLHSAASIPIYHRDIKSTNILLDEKYRAKVADFGTSKSISLDQTHVTT  563

Query  511   MVKGTFGYLDPEYFQSSQFTEKSDVYSFGVVLAELLTGQKPISFELDDDEDRSLVSRFLL  332
             +V+GTFGYLDPEYFQSSQFT+KSDVYSFGVVL ELLTGQKPIS  L + E RSL + F++
Sbjct  564   LVQGTFGYLDPEYFQSSQFTDKSDVYSFGVVLVELLTGQKPIS-SLREQEGRSLATYFII  622

Query  331   CMEENRLMEMLDGEVIEQGKKEDVVAMAWLAQRCLNFNGKKRPTMKEVATELDAIK  164
              MEENRL +++D +V+++GKKE++ + A LA+RCLN NG+ RPTMKEVA EL+ ++
Sbjct  623   SMEENRLFDIVDAQVLKEGKKEEIASFANLAKRCLNLNGRSRPTMKEVAMELEGMR  678



>ref|XP_007217163.1| hypothetical protein PRUPE_ppa002047mg [Prunus persica]
 gb|EMJ18362.1| hypothetical protein PRUPE_ppa002047mg [Prunus persica]
Length=724

 Score =   424 bits (1091),  Expect = 9e-131, Method: Compositional matrix adjust.
 Identities = 258/517 (50%), Positives = 334/517 (65%), Gaps = 44/517 (9%)
 Frame = -1

Query  1618  HDCQGINCNHLTVDYDVNTYQVNFTH-----SSSFNACNYAFFlsassslpptlqslpsr  1454
             + C G+ C   T+   ++ +  +F       S S   C YAF +     +   + ++   
Sbjct  166   NSCSGLRCCQTTILDGLSFFNTSFAAVLINGSDSEMECKYAFMVDHDWFMSTNISTIV--  223

Query  1453  qQEMVVVPVELRWTITQEDVPPSYSKYCSPSTYINPQLQWHNYLQCDCPGGDDRNVYLSG  1274
               +M  VPV L + + Q      Y  Y     + +  +  + + QC C  G   N YL  
Sbjct  224   --DMDSVPVVLEYQLNQYSEQHIYGTY----NFSHQNMNCNIFRQCSCKKGYQGNPYLLD  277

Query  1273  GCE-------------------------WKHKDYVISSNKLRPAIIGISASFGFVFLIWA  1169
             GC+                         ++    ++   ++   I+      G +FL+  
Sbjct  278   GCQDINECDNQYRCGPGTCINLPGHFVCYQPDRQIL---RINVGILVAGGVIGLLFLLIG  334

Query  1168  FVILYkaikkrkmkklrqkffkRNGGlllqqqlLTKEGTIEKTKIFTASELDKATDHFNA  989
                 +K IKKRK  K +QKFFK+NGGLLL++QL + E  +EK K+F++ +LDKATD F+ 
Sbjct  335   AWWSHKVIKKRKDIKRKQKFFKQNGGLLLEKQLSSGEVNVEKIKLFSSKDLDKATDKFSI  394

Query  988   DRIVGRGGQGTVYKGMLIDGQIVAVKKSQAVDEDQLEPFINEVVILSQINHRNVVKLMGC  809
             DRI+G+GGQGTVYKGML DG+IVAVKKS+ VD  ++  FINE+VILSQI HRNVVKL+GC
Sbjct  395   DRILGQGGQGTVYKGMLSDGRIVAVKKSKIVDGGEVGQFINEIVILSQIIHRNVVKLLGC  454

Query  808   CLETEVPILVYEFIPNGTLFGLIHNNFDNELIPLSWDIRLRIASEVACALAYLHSVTLVP  629
             CLETEVP+LVYEFI NGTL   IH+   NE   L+W++RLRIA EVA AL+YLHS    P
Sbjct  455   CLETEVPLLVYEFILNGTLSQYIHH--PNEEFCLTWEMRLRIAIEVAGALSYLHSAASFP  512

Query  628   IYHRDIKTGNILLDEKFRAKVSDFGTSRSISIDKTHFTTMVKGTFGYLDPEYFQSSQFTE  449
             IYHRDIK+ NILLDEK+RAKV+DFGTSRS+SID+TH TT+V GTFGYLDPEYFQSSQFTE
Sbjct  513   IYHRDIKSSNILLDEKYRAKVADFGTSRSVSIDQTHLTTLVHGTFGYLDPEYFQSSQFTE  572

Query  448   KSDVYSFGVVLAELLTGQKPISFELDDDEDRSLVSRFLLCMEENRLMEMLDGEVIEQGKK  269
             KSDVYSFGVVLAELLTGQKP+S  +   E RSL + FLL ME N L ++LD +V++ G+K
Sbjct  573   KSDVYSFGVVLAELLTGQKPVSL-MRSQESRSLATYFLLSMENNLLFDILDSQVMKDGRK  631

Query  268   EDVVAMAWLAQRCLNFNGKKRPTMKEVATELDAIKAS  158
             E + A+A LA RCLN NG+ RPTMKEVA EL+ I+ S
Sbjct  632   EKITAVANLAVRCLNLNGRNRPTMKEVAVELEGIQLS  668



>ref|XP_006586859.1| PREDICTED: wall-associated receptor kinase-like 1-like isoform 
X2 [Glycine max]
Length=742

 Score =   425 bits (1093),  Expect = 9e-131, Method: Compositional matrix adjust.
 Identities = 264/595 (44%), Positives = 361/595 (61%), Gaps = 48/595 (8%)
 Frame = -1

Query  1849  TITIKESI-SPSCQGSNNFSNIIHNSKLSETPFMYS-NDNNFMLFGCGNAFITMPGEELD  1676
             T+ IK  I  P C         +    L  +PF+YS N N+F+  GC NA I +  + + 
Sbjct  109   TVGIKNPIFHPGC------GKTVTGINLEGSPFVYSQNYNSFVGVGCQNAAIMLSNDTIL  162

Query  1675  QPGYNLNCSSKNTTAPKTAHDCQGINCNHLTVD-----YDVNTYQVNFTHSSSFNACNYA  1511
                 ++               C+G  C   ++      Y+++T  V    +      NY 
Sbjct  163   TACMSVCYEHLEKGNDIDISSCRGSYCCETSLPPYLSAYNISTETVEVKSNIKAECSNYL  222

Query  1510  --------FFlsassslpptlqslpsrqQEMVVVPVELRWTI---TQEDVPPSYS-----  1379
                     F                   ++   VP  L W I   T  +  P +      
Sbjct  223   LIRAEYSNFKYEYDEYNSSYWVPTLGDLKKQKDVPAVLEWEIPIHTPNNSFPEFRTDAYG  282

Query  1378  ------KYCSPSTYINPQLQWHNYLQCDCPGGDDRNVYLSGGCEWK--HKDYVISSNKL-  1226
                    Y + ++ + PQ  W    +C C  G + N Y+  GC+     +  +I   K  
Sbjct  283   HGSYNCSYTNVTSSLYPQSGW----RCSCSDGFEGNPYIQEGCKLSLDGRKIIIDPTKSY  338

Query  1225  -RPAIIGISASFGFVFLIWAFVILYkaikkrkmkklrqkffkRNGGlllqqqlLTKEGTI  1049
              + A+IG+ +S G + L++    L K ++K+  KK ++KFFK+NGGLLL+Q+L T E  +
Sbjct  339   GKVAMIGVFSSIGTIILLFGLWRLRKVVRKKIAKKRKEKFFKQNGGLLLEQRLSTGEVNV  398

Query  1048  EKTKIFTASELDKATDHFNADRIVGRGGQGTVYKGMLIDGQIVAVKKSQAVDEDQLEPFI  869
             +KTK+F+  EL KATDHFN +RI+G+GGQGTVYKGML+DG+IVAVKK +      +E FI
Sbjct  399   DKTKLFSLKELGKATDHFNINRILGKGGQGTVYKGMLVDGKIVAVKKFKV--NGNVEEFI  456

Query  868   NEVVILSQINHRNVVKLMGCCLETEVPILVYEFIPNGTLFGLIHNNFDNELIPLSWDIRL  689
             NE VILSQINHRNVVKL+GCCLETE+P+LVYEFIPNG L+  +H    N+ +P++WD+RL
Sbjct  457   NEFVILSQINHRNVVKLLGCCLETEIPLLVYEFIPNGNLYEYLHG--QNDELPMTWDMRL  514

Query  688   RIASEVACALAYLHSVTLVPIYHRDIKTGNILLDEKFRAKVSDFGTSRSISIDKTHFTTM  509
             RIA+EVA AL YLHS    PIYHRD+K+ NILLDEK++AKV+DFG SR +SI+ TH TT 
Sbjct  515   RIATEVAGALFYLHSAASQPIYHRDVKSTNILLDEKYKAKVADFGASRMVSIEATHLTTA  574

Query  508   VKGTFGYLDPEYFQSSQFTEKSDVYSFGVVLAELLTGQKPISFELDDDEDRSLVSRFLLC  329
             V+GTFGYLDPEYF +SQ TEKSDVYSFGVVL ELLTGQKPIS  +++   +SL S FLLC
Sbjct  575   VQGTFGYLDPEYFHTSQLTEKSDVYSFGVVLVELLTGQKPIS-SVNEQGLQSLASYFLLC  633

Query  328   MEENRLMEMLDGEVIEQGKKEDVVAMAWLAQRCLNFNGKKRPTMKEVATELDAIK  164
             MEENR  +++D  V+++ +KE ++ +A LA+RCL  NG+KRPTMKEV  EL++I+
Sbjct  634   MEENRFFDIVDARVMQEVEKEHIIVVANLARRCLQLNGRKRPTMKEVTLELESIQ  688



>ref|XP_008380329.1| PREDICTED: wall-associated receptor kinase-like 22 [Malus domestica]
Length=725

 Score =   424 bits (1090),  Expect = 1e-130, Method: Compositional matrix adjust.
 Identities = 265/524 (51%), Positives = 339/524 (65%), Gaps = 54/524 (10%)
 Frame = -1

Query  1618  HDCQGINCNHLTVDYDVNTYQVNF---THSSSFNACNYAFFlsassslpptlqslpsrqQ  1448
             + C G+NC   T+   ++T++ +F   T++     C YAF +        +         
Sbjct  165   NSCSGLNCCQTTIPSSLSTFRTSFGEITNAERAKLCKYAFLVDQDWFTSDSTNISDIG--  222

Query  1447  EMVVVPVELRWTITQEDVPPSYSKYCSPSTY-INPQLQWHNYLQ--------CDCPGGDD  1295
              M  VP+ L W            K+ S +T+ IN      +  +        C C  G  
Sbjct  223   HMDNVPIVLEW------------KFFSNTTFNINGTTNLTDIDKNMDCSGDNCFCSKGFQ  270

Query  1294  RNVYLSGGCE-WKHKDYVISSNKLRPAI-IGISASFGFVF-------LIWAFVI------  1160
              N YL  GCE     +  +  N+  P I I     +  VF       +  A ++      
Sbjct  271   GNPYLLHGCEDIDECEDPVHFNRCIPGICINYPGRYQCVFPDPRQSRVKLAIIVPISVLG  330

Query  1159  ----------LYkaikkrkmkklrqkffkRNGGlllqqqlLTKEGTIEKTKIFTASELDK  1010
                       L K IKKRK  K ++KFFK+NGGLLL+QQL + E  +EK K+F + EL+K
Sbjct  331   LLFLLVGAWWLRKVIKKRKNTKRKEKFFKQNGGLLLKQQLSSGEVNVEKIKLFNSKELEK  390

Query  1009  ATDHFNADRIVGRGGQGTVYKGMLIDGQIVAVKKSQAVDEDQLEPFINEVVILSQINHRN  830
             ATD+F+ADRI+G+GGQGTVYKGML DG+IVAVKKS+ V   ++  FINE+VILSQI+HRN
Sbjct  391   ATDNFSADRILGQGGQGTVYKGMLADGRIVAVKKSKIVAGGEVGQFINEIVILSQISHRN  450

Query  829   VVKLMGCCLETEVPILVYEFIPNGTLFGLIHNNFDNELIPLSWDIRLRIASEVACALAYL  650
             VVKL+GCCLETEVP+LVYEFI NGTL   IH+   NE  PL+W++RLR++ EVA AL+YL
Sbjct  451   VVKLLGCCLETEVPLLVYEFILNGTLSQYIHHQ--NEEFPLTWEMRLRVSIEVAGALSYL  508

Query  649   HSVTLVPIYHRDIKTGNILLDEKFRAKVSDFGTSRSISIDKTHFTTMVKGTFGYLDPEYF  470
             HS    PIYHRDIK+ NILLDEK+RAKV+DFGTSRS++ID+TH TT V GTFGYLDPEYF
Sbjct  509   HSAASFPIYHRDIKSSNILLDEKYRAKVADFGTSRSVAIDQTHLTTRVHGTFGYLDPEYF  568

Query  469   QSSQFTEKSDVYSFGVVLAELLTGQKPISFELDDDEDRSLVSRFLLCMEENRLMEMLDGE  290
             QSS+FTEKSDVYSFGVVLAELLTG+KP+S  L   E RSL + FLL MEENRL ++L   
Sbjct  569   QSSKFTEKSDVYSFGVVLAELLTGEKPVSV-LSSQESRSLATYFLLSMEENRLFDILHAR  627

Query  289   VIEQGKKEDVVAMAWLAQRCLNFNGKKRPTMKEVATELDAIKAS  158
             V+++  K+ ++A+A LAQRCLN NGKKRPTMKEVA EL+AI+ S
Sbjct  628   VMKEAGKDKIMAVANLAQRCLNLNGKKRPTMKEVAAELEAIQLS  671



>ref|XP_010512026.1| PREDICTED: wall-associated receptor kinase-like 9 isoform X1 
[Camelina sativa]
Length=803

 Score =   426 bits (1096),  Expect = 1e-130, Method: Compositional matrix adjust.
 Identities = 224/406 (55%), Positives = 302/406 (74%), Gaps = 6/406 (1%)
 Frame = -1

Query  1351  NPQL--QWHNYLQCDCPGGDDRNVYLS--GGCEWKHKDYVISSNKLRPAIIGISASFGFV  1184
             NP L     ++ +C  P  D  + +      C   H  Y       RP  IG+ ASFG +
Sbjct  337   NPYLLDGCKDFNECQVPLSDGTSTFCGPRASCVNLHGSYDCVYTNHRPLAIGLGASFGSL  396

Query  1183  FLIWAFVILYkaikkrkmkklrqkffkRNGGlllqqqlLTKEGTIEKTKIFTASELDKAT  1004
              L+    +LYK IKK++    ++KFFKRNGGLLLQQQL + EGT+E TK+F + +L+KAT
Sbjct  397   ILVGGIYLLYKFIKKQRELHKKKKFFKRNGGLLLQQQLTSAEGTVETTKVFGSKDLEKAT  456

Query  1003  DHFNADRIVGRGGQGTVYKGMLIDGQIVAVKKSQAVDEDQLEPFINEVVILSQINHRNVV  824
             ++F++DRI+G+GGQGTVYKGML+DG+IVAVKKS+ VDED+LE FINEVVILSQINHRN+V
Sbjct  457   ENFSSDRILGQGGQGTVYKGMLVDGRIVAVKKSKVVDEDKLEEFINEVVILSQINHRNIV  516

Query  823   KLMGCCLETEVPILVYEFIPNGTLFGLIHNNFDNELIPLSWDIRLRIASEVACALAYLHS  644
             KL+GCCLET VP+LVYEF+P G LF  +H+ FD+  +  +W +RLR+A ++A AL+YLHS
Sbjct  517   KLLGCCLETHVPLLVYEFVPKGNLFEHLHDEFDDNTMA-TWKVRLRMAIDIASALSYLHS  575

Query  643   VTLVPIYHRDIKTGNILLDEKFRAKVSDFGTSRSISIDKTHFTTMVKGTFGYLDPEYFQS  464
                 P+YHRD+K+ NI+LDEK+RAKVSDFGTSRS+++D TH TT+V GT GY+DPEYFQS
Sbjct  576   YASSPVYHRDVKSTNIMLDEKYRAKVSDFGTSRSVTVDHTHLTTVVSGTVGYMDPEYFQS  635

Query  463   SQFTEKSDVYSFGVVLAELLTGQKPISFELDDDEDRSLVSRFLLCMEENRLMEMLDGEVI  284
             SQFT+KSDVYSFGVVLAEL+TG+K ISF L   E+R+L + F+  ++EN+L +++D  + 
Sbjct  636   SQFTDKSDVYSFGVVLAELITGEKSISF-LRSQENRTLATYFIQAVKENKLFDIIDARIR  694

Query  283   EQGKKEDVVAMAWLAQRCLNFNGKKRPTMKEVATELDAIKASNSHL  146
             +      V A A +A++CLN  G+KRP+M+EV+ ELD I+ S+  +
Sbjct  695   DDCMLSQVTAAAKVARKCLNLKGRKRPSMREVSMELDNIRMSSGDM  740



>ref|XP_008229609.1| PREDICTED: wall-associated receptor kinase-like 1 isoform X1 
[Prunus mume]
Length=745

 Score =   424 bits (1091),  Expect = 2e-130, Method: Compositional matrix adjust.
 Identities = 280/614 (46%), Positives = 365/614 (59%), Gaps = 72/614 (12%)
 Frame = -1

Query  1849  TITIKESISPSCQGSNNFSNIIHNSKLSETPFMYSNDNN-FMLFGCGNAFITMPGEELDQ  1673
             T+ +   ++  C G N  S +   + L+ +PF+YS D N F    CG     M   E   
Sbjct  98    TLRVNSPVTKFCNG-NGSSQM---ADLTGSPFVYSQDKNRFTAVSCG-FLAGMVSAEFVV  152

Query  1672  PGYNLNCSSKNTTAPKTAHDCQGINCNHLTVDYDVNTYQVNFTHSSSF--NACN-YAFFl  1502
              G    C  K     K+A    GINC   T+   +     +  +      ++C+ YAF +
Sbjct  153   GGCRSVCDHK-----KSASCDIGINCCQTTIPPYLTMIGASILYQGETRDSSCDDYAFLV  207

Query  1501  sassslpptlqslpsrqQEMVVVPVELRWTI--------------TQEDVPPSY------  1382
                     +       ++    VPV L W I              T     P Y      
Sbjct  208   DKDWFERSSSAHAIKSRRH---VPVVLEWNIINYTSSLAIFGSYVTNYSFDPYYYYNFNY  264

Query  1381  --SKYCSPSTYINPQLQWHNY--LQCDCPGGDDRNVYLSGGCEWKHKDYVISSNKLRPAI  1214
               + YC  ST     L ++N   L C CP G + N YL   C+    + +I  N+  P  
Sbjct  265   QGTPYCLGST----ALDYNNRSTLSCYCPDGFEGNPYLLETCQ-DIDECMIGHNRCGPHS  319

Query  1213  IGISASFGFVFL----------------------IWAFVILYkaikkrkmkklrqkffkR  1100
               ++A   +V +                      + +  + Y+ +KKR   K R+ FFKR
Sbjct  320   KCVNAPGYYVCVDKKKTKLILIIGLGAGLGLLLLLISAWLGYRFLKKRHTMKRREMFFKR  379

Query  1099  NGGlllqqqlLTKEGTIEKTKIFTASELDKATDHFNADRIVGRGGQGTVYKGMLIDGQIV  920
             NGGLLL++QL + E  +EK K+F + EL+K+TD+FN DRI+G+GGQGTVYKGML DG+IV
Sbjct  380   NGGLLLEKQLSSGEVNVEKIKLFKSKELEKSTDNFNTDRILGQGGQGTVYKGMLTDGRIV  439

Query  919   AVKKSQAVDEDQLEPFINEVVILSQINHRNVVKLMGCCLETEVPILVYEFIPNGTLFGLI  740
             AVKKS+ VDE QL  FINEVVILSQINHRNVV+L+GCCLETEVPILVYEFIPNG L   I
Sbjct  440   AVKKSKIVDESQLSDFINEVVILSQINHRNVVQLLGCCLETEVPILVYEFIPNGNLSQYI  499

Query  739   HNNFDNELIPLSWDIRLRIASEVACALAYLHSVTLVPIYHRDIKTGNILLDEKFRAKVSD  560
             H    NE  PL+W++RLRIA E+A AL+Y  +    PIYHRDIK+ N+LLDEK+RAK++D
Sbjct  500   HEQ--NEEFPLTWEVRLRIAIEIAGALSY--NAASFPIYHRDIKSANVLLDEKYRAKIAD  555

Query  559   FGTSRSISIDKTHFTTMVKGTFGYLDPEYFQSSQFTEKSDVYSFGVVLAELLTGQKPISF  380
             FGTSRSISID+TH TT V GTFGYLDPEYFQSSQFTEKSDVYSFGVVL ELLTGQKPISF
Sbjct  556   FGTSRSISIDQTHLTTCVHGTFGYLDPEYFQSSQFTEKSDVYSFGVVLVELLTGQKPISF  615

Query  379   ELDDDEDRSLVSRFLLCMEENRLMEMLDGEVIEQGKKEDVVAMAWLAQRCLNFNGKKRPT  200
                 +E +SL + F+  M+ +RL E+LD +V++ G K D++ +A LA+RCLN +G+KRPT
Sbjct  616   RRSQEEGKSLATYFITSMQLDRLFEILDAQVVKGGSKADIILVADLARRCLNLSGRKRPT  675

Query  199   MKEVATELDAIKAS  158
             M+EV  EL+ I+ S
Sbjct  676   MREVTAELEGIQMS  689



>gb|KHN44655.1| Wall-associated receptor kinase-like 9 [Glycine soja]
Length=726

 Score =   424 bits (1090),  Expect = 2e-130, Method: Compositional matrix adjust.
 Identities = 264/595 (44%), Positives = 365/595 (61%), Gaps = 48/595 (8%)
 Frame = -1

Query  1849  TITIKESI-SPSCQGSNNFSNIIHNSKLSETPFMYS-NDNNFMLFGCGNAFITMPGEELD  1676
             T+ IK  I  P C         +    L  +PF+YS N N+F+  GC NA I +  + + 
Sbjct  93    TVGIKNPIFHPGC------GKTVTGINLEGSPFVYSQNYNSFVGVGCQNAAIMLSNDTIL  146

Query  1675  QPGYNLNCSSKNTTAPKTAHDCQGINCNHLTVD-----YDVNTYQVNFTHSSSFNACNYA  1511
                 ++               C+G  C   ++      Y+++T  V    +      NY 
Sbjct  147   TACMSVCYEHLEKGNDIDISSCRGSYCCETSLPPYLSAYNISTETVEVKSNIKAECSNYL  206

Query  1510  FFlsassslpptlqslpsr--------qQEMVVVPVELRWTI---TQEDVPPSYS-----  1379
                +  S+         S          ++   VP  L W I   T  +  P +      
Sbjct  207   LIRAEYSNFKYEYDEYNSSYWVPTLGDLKKQKDVPAVLEWEIPIHTPNNSFPEFRTDAYG  266

Query  1378  ------KYCSPSTYINPQLQWHNYLQCDCPGGDDRNVYLSGGCEWK--HKDYVISSNKL-  1226
                    Y + ++ + PQ  W    +C C  G + N Y+  GC+     +  +I   K  
Sbjct  267   HGSYNCSYTNVTSSLYPQSGW----RCSCSDGFEGNPYIQEGCKLSLDGRKIIIDPTKSY  322

Query  1225  -RPAIIGISASFGFVFLIWAFVILYkaikkrkmkklrqkffkRNGGlllqqqlLTKEGTI  1049
              + A+IG+ +S G + L++    L K ++K+  KK ++KFFK+NGGLLL+Q+L T E  +
Sbjct  323   GKVAMIGVFSSIGTIILLFGLWRLRKVVRKKIAKKRKEKFFKQNGGLLLEQRLSTGEVNV  382

Query  1048  EKTKIFTASELDKATDHFNADRIVGRGGQGTVYKGMLIDGQIVAVKKSQAVDEDQLEPFI  869
             +KTK+F+  EL KATDHFN +RI+G+GGQGTVYKGML+DG+IVAVKK +      +E FI
Sbjct  383   DKTKLFSLKELGKATDHFNINRILGKGGQGTVYKGMLVDGKIVAVKKFKV--NGNVEEFI  440

Query  868   NEVVILSQINHRNVVKLMGCCLETEVPILVYEFIPNGTLFGLIHNNFDNELIPLSWDIRL  689
             NE VILSQINHRNVVKL+GCCLETE+P+LVYEFIPNG L+  +H    N+ +P++WD+RL
Sbjct  441   NEFVILSQINHRNVVKLLGCCLETEIPLLVYEFIPNGNLYEYLHG--QNDELPMTWDMRL  498

Query  688   RIASEVACALAYLHSVTLVPIYHRDIKTGNILLDEKFRAKVSDFGTSRSISIDKTHFTTM  509
             RIA+EVA AL YLHS    PIYHRD+K+ NILLDEK++AKV+DFG SR +SI+ TH TT 
Sbjct  499   RIATEVAGALFYLHSAASQPIYHRDVKSTNILLDEKYKAKVADFGASRMVSIEATHLTTA  558

Query  508   VKGTFGYLDPEYFQSSQFTEKSDVYSFGVVLAELLTGQKPISFELDDDEDRSLVSRFLLC  329
             V+GTFGYLDPEYF++SQ T+KSDVYSFGVVL ELLTGQKPIS  +++   +SL S FLLC
Sbjct  559   VQGTFGYLDPEYFRTSQLTDKSDVYSFGVVLVELLTGQKPIS-SVNEQGLQSLASYFLLC  617

Query  328   MEENRLMEMLDGEVIEQGKKEDVVAMAWLAQRCLNFNGKKRPTMKEVATELDAIK  164
             MEENR  +++D  V+++ +KE ++ +A LA+RCL  NG+KRPTMKEV  EL++I+
Sbjct  618   MEENRFFDIVDARVMQEVEKEHIIVVANLARRCLQLNGRKRPTMKEVTLELESIQ  672



>ref|XP_006492600.1| PREDICTED: wall-associated receptor kinase-like 1-like [Citrus 
sinensis]
Length=607

 Score =   420 bits (1079),  Expect = 2e-130, Method: Compositional matrix adjust.
 Identities = 211/315 (67%), Positives = 267/315 (85%), Gaps = 3/315 (1%)
 Frame = -1

Query  1099  NGGlllqqqlLTKEGTIEKTKIFTASELDKATDHFNADRIVGRGGQGTVYKGMLIDGQIV  920
             NGGLLL+QQL + +G+I++ KIF + ELDKATDHFN +RI+G+GGQGTVYKGML DG+I+
Sbjct  279   NGGLLLEQQLNSLDGSIDRCKIFNSKELDKATDHFNVNRILGQGGQGTVYKGMLADGRII  338

Query  919   AVKKSQAVDEDQLEPFINEVVILSQINHRNVVKLMGCCLETEVPILVYEFIPNGTLFGLI  740
             AVKKS+ VDE +LE FINEVVILSQI+HRNVVKL+G CLE EVP+LVYEFIPNGTLF  +
Sbjct  339   AVKKSKVVDESKLEEFINEVVILSQISHRNVVKLLGSCLEVEVPLLVYEFIPNGTLFQYL  398

Query  739   HNNFDNELIPLSWDIRLRIASEVACALAYLHSVTLVPIYHRDIKTGNILLDEKFRAKVSD  560
             H+   +E + L+W++RLRIA+EVA ALAYLHS   +PIYHRDIK+ NILLDEK+RAK++D
Sbjct  399   HD--PSEELSLTWEMRLRIATEVAEALAYLHSSAYLPIYHRDIKSTNILLDEKYRAKIAD  456

Query  559   FGTSRSISIDKTHFTTMVKGTFGYLDPEYFQSSQFTEKSDVYSFGVVLAELLTGQKPISF  380
             FGTSRSI+ID+TH +T V+GTFGYLDPEYF SSQFT+KSDVYSFGVVL ELLTGQKPIS+
Sbjct  457   FGTSRSIAIDQTHVSTKVQGTFGYLDPEYFHSSQFTDKSDVYSFGVVLVELLTGQKPISY  516

Query  379   ELDDDEDRSLVSRFLLCMEENRLMEMLDGEVIEQGKKEDVVAMAWLAQRCLNFNGKKRPT  200
              +  +E R+L + F+ C+EEN L ++LD +V + GK E+++ ++ +A+RCLN NG+ RPT
Sbjct  517   -IWANEGRNLATYFVECIEENCLFDILDDQVRKSGKTEEIMEVSDVAKRCLNSNGRSRPT  575

Query  199   MKEVATELDAIKASN  155
             MKEVA EL+ I+A N
Sbjct  576   MKEVAMELERIRACN  590



>ref|XP_010512027.1| PREDICTED: wall-associated receptor kinase-like 9 isoform X2 
[Camelina sativa]
Length=817

 Score =   426 bits (1095),  Expect = 3e-130, Method: Compositional matrix adjust.
 Identities = 224/406 (55%), Positives = 302/406 (74%), Gaps = 6/406 (1%)
 Frame = -1

Query  1351  NPQL--QWHNYLQCDCPGGDDRNVYLS--GGCEWKHKDYVISSNKLRPAIIGISASFGFV  1184
             NP L     ++ +C  P  D  + +      C   H  Y       RP  IG+ ASFG +
Sbjct  351   NPYLLDGCKDFNECQVPLSDGTSTFCGPRASCVNLHGSYDCVYTNHRPLAIGLGASFGSL  410

Query  1183  FLIWAFVILYkaikkrkmkklrqkffkRNGGlllqqqlLTKEGTIEKTKIFTASELDKAT  1004
              L+    +LYK IKK++    ++KFFKRNGGLLLQQQL + EGT+E TK+F + +L+KAT
Sbjct  411   ILVGGIYLLYKFIKKQRELHKKKKFFKRNGGLLLQQQLTSAEGTVETTKVFGSKDLEKAT  470

Query  1003  DHFNADRIVGRGGQGTVYKGMLIDGQIVAVKKSQAVDEDQLEPFINEVVILSQINHRNVV  824
             ++F++DRI+G+GGQGTVYKGML+DG+IVAVKKS+ VDED+LE FINEVVILSQINHRN+V
Sbjct  471   ENFSSDRILGQGGQGTVYKGMLVDGRIVAVKKSKVVDEDKLEEFINEVVILSQINHRNIV  530

Query  823   KLMGCCLETEVPILVYEFIPNGTLFGLIHNNFDNELIPLSWDIRLRIASEVACALAYLHS  644
             KL+GCCLET VP+LVYEF+P G LF  +H+ FD+  +  +W +RLR+A ++A AL+YLHS
Sbjct  531   KLLGCCLETHVPLLVYEFVPKGNLFEHLHDEFDDNTMA-TWKVRLRMAIDIASALSYLHS  589

Query  643   VTLVPIYHRDIKTGNILLDEKFRAKVSDFGTSRSISIDKTHFTTMVKGTFGYLDPEYFQS  464
                 P+YHRD+K+ NI+LDEK+RAKVSDFGTSRS+++D TH TT+V GT GY+DPEYFQS
Sbjct  590   YASSPVYHRDVKSTNIMLDEKYRAKVSDFGTSRSVTVDHTHLTTVVSGTVGYMDPEYFQS  649

Query  463   SQFTEKSDVYSFGVVLAELLTGQKPISFELDDDEDRSLVSRFLLCMEENRLMEMLDGEVI  284
             SQFT+KSDVYSFGVVLAEL+TG+K ISF L   E+R+L + F+  ++EN+L +++D  + 
Sbjct  650   SQFTDKSDVYSFGVVLAELITGEKSISF-LRSQENRTLATYFIQAVKENKLFDIIDARIR  708

Query  283   EQGKKEDVVAMAWLAQRCLNFNGKKRPTMKEVATELDAIKASNSHL  146
             +      V A A +A++CLN  G+KRP+M+EV+ ELD I+ S+  +
Sbjct  709   DDCMLSQVTAAAKVARKCLNLKGRKRPSMREVSMELDNIRMSSGDM  754



>ref|XP_006441119.1| hypothetical protein CICLE_v10019288mg [Citrus clementina]
 gb|ESR54359.1| hypothetical protein CICLE_v10019288mg [Citrus clementina]
Length=499

 Score =   415 bits (1067),  Expect = 4e-130, Method: Compositional matrix adjust.
 Identities = 201/303 (66%), Positives = 250/303 (83%), Gaps = 3/303 (1%)
 Frame = -1

Query  1066  TKEGTIEKTKIFTASELDKATDHFNADRIVGRGGQGTVYKGMLIDGQIVAVKKSQAVDED  887
             + EG IEK K+FT+ +L+KATD++NA+RI+G+GGQG VYKGML DG IVAVKKS+ +DE 
Sbjct  147   SNEGNIEKMKLFTSKDLEKATDNYNANRILGQGGQGIVYKGMLADGGIVAVKKSKILDES  206

Query  886   QLEPFINEVVILSQINHRNVVKLMGCCLETEVPILVYEFIPNGTLFGLIHNNFDNELIPL  707
              LE FINEVVILSQINHRNVVKL+GCCLETEVP+LVYEFIPNG+L   IH  + +E  P+
Sbjct  207   NLEQFINEVVILSQINHRNVVKLLGCCLETEVPLLVYEFIPNGSLDQYIH--YQSEEFPI  264

Query  706   SWDIRLRIASEVACALAYLHSVTLVPIYHRDIKTGNILLDEKFRAKVSDFGTSRSISIDK  527
             +W++RLRIA EV+ AL+YLHS   +PIYHRDIK+ NILLD+K++AKVSDFG SRSI+ID+
Sbjct  265   TWEMRLRIAVEVSGALSYLHSAASIPIYHRDIKSANILLDDKYQAKVSDFGASRSITIDQ  324

Query  526   THFTTMVKGTFGYLDPEYFQSSQFTEKSDVYSFGVVLAELLTGQKPISFELDDDEDRSLV  347
             TH TT V+G+FGYLDPEYF+SS FTEKSDVYSFGVVL ELLTGQKPI    + +ED+SL 
Sbjct  325   THLTTQVQGSFGYLDPEYFRSSHFTEKSDVYSFGVVLVELLTGQKPIRL-TEAEEDKSLA  383

Query  346   SRFLLCMEENRLMEMLDGEVIEQGKKEDVVAMAWLAQRCLNFNGKKRPTMKEVATELDAI  167
               F+  M+EN L E+LD  V+++ +K +++ +A LA+RCLN NGKKRPTMKEVA EL  I
Sbjct  384   RYFIQAMKENCLFEVLDDRVLKEAEKVEIITVATLAKRCLNLNGKKRPTMKEVAFELRGI  443

Query  166   KAS  158
             + S
Sbjct  444   RES  446



>ref|XP_007211126.1| hypothetical protein PRUPE_ppa025607mg [Prunus persica]
 gb|EMJ12325.1| hypothetical protein PRUPE_ppa025607mg [Prunus persica]
Length=712

 Score =   422 bits (1086),  Expect = 4e-130, Method: Compositional matrix adjust.
 Identities = 264/583 (45%), Positives = 357/583 (61%), Gaps = 27/583 (5%)
 Frame = -1

Query  1861  YDSQTITIKESISP-SCQGSNNFSNIIHNSKLSETPFMYSN-DNNFMLFGCGNAFITMPG  1688
             Y  Q++ +K  I+  SC+G            L+ +PF+YS  DN F+  GC + F  M  
Sbjct  105   YGVQSVQVKNPITFFSCEGKETR----QPQNLTGSPFIYSRTDNIFIAVGC-DLFARMRS  159

Query  1687  EELDQPGYNLNCSSKNTTAPKTAHD----CQGINCNHLTVDYDVNTYQVNFTHSSSFNAC  1520
             +     G    C +         ++    CQG    +   +  +     + T S     C
Sbjct  160   DHGPVAGCGSICQNNADGDYDNCNEGNGCCQGTLLTYELTNLSIEIPSNSSTKSDPMGDC  219

Query  1519  NYAFFlsassslpptlqslpsrqQEMVVVPVELRWTITQEDVPPSYSKY-----CSPSTY  1355
              YAF +  +               +M  VPV L W +   D    + +       + ST 
Sbjct  220   KYAFLVDHNWFANNLTFRDVK---DMDSVPVVLDWMLNVHDYGERFREKPDLTDANQSTS  276

Query  1354  INPQLQWHN--YLQCDCPGGDDRNVYLSGGCEWKHKDYVISSNKLRPAIIGISASFGFVF  1181
             +      +N   + C CP G + N YL   C+    D    S+K     + + +S G   
Sbjct  277   LCTSNNDYNGTIMICVCPPGMEGNPYLLQPCQ--DIDECKGSSKCEVGDVCLGSSVGVWL  334

Query  1180  LIWAFVILYkaikkrkmkklrqkffkRNGGlllqqqlLTKEGTIEKTKIFTASELDKATD  1001
             L+    +++K +K +K    ++ FFKRNGGLLL+QQL + E  ++K K+F + EL+KAT+
Sbjct  335   LLIGAWLVHKIVKIKKTIARKKMFFKRNGGLLLEQQLSSGEVNVDKIKLFNSKELEKATN  394

Query  1000  HFNADRIVGRGGQGTVYKGMLIDGQIVAVKKSQAVDEDQLEPFINEVVILSQINHRNVVK  821
             +F+ DRI+G+GGQGTVYKGML DG+IVAVKKS+ VD  +L  FINE+VILSQINHRNVV+
Sbjct  395   NFSIDRILGQGGQGTVYKGMLADGRIVAVKKSKMVDTSKLSDFINEIVILSQINHRNVVQ  454

Query  820   LMGCCLETEVPILVYEFIPNGTLFGLIHNNFDNELIPLSWDIRLRIASEVACALAYLHSV  641
             +MGCCLETEVP+LVYEFIPNGTL   I      E   L+W++RL+IA+EVA AL+YLH  
Sbjct  455   IMGCCLETEVPLLVYEFIPNGTLSQYIQGQI--EEFTLTWEMRLQIATEVAGALSYLHGA  512

Query  640   TLVPIYHRDIKTGNILLDEKFRAKVSDFGTSRSISIDKTHFTTMVKGTFGYLDPEYFQSS  461
               VPIYHRDIK+ NILLD K+RAK++DFGTSRSISID+TH TT V GTFGYLDPEYFQSS
Sbjct  513   ASVPIYHRDIKSANILLDRKYRAKIADFGTSRSISIDQTHLTTCVHGTFGYLDPEYFQSS  572

Query  460   QFTEKSDVYSFGVVLAELLTGQKPISFEL--DDDEDRSLVSRFLLCMEENRLMEMLDGEV  287
             QFTEKSDVYSFGVVL ELLTGQKPIS      + E RSL + F+  M+E+RL  ++D  V
Sbjct  573   QFTEKSDVYSFGVVLVELLTGQKPISAVTWSQEKEYRSLATYFINSMQEDRLFNIVDARV  632

Query  286   IEQGKKEDVVAMAWLAQRCLNFNGKKRPTMKEVATELDAIKAS  158
             +++G + ++  +A LA+RCLN NG+ RPTM+EV +EL+A++ S
Sbjct  633   LKEGSETEIQVVANLARRCLNLNGRNRPTMREVTSELEAVQMS  675



>ref|XP_007216280.1| hypothetical protein PRUPE_ppa019342mg [Prunus persica]
 gb|EMJ17479.1| hypothetical protein PRUPE_ppa019342mg [Prunus persica]
Length=1064

 Score =   432 bits (1111),  Expect = 5e-130, Method: Compositional matrix adjust.
 Identities = 212/314 (68%), Positives = 259/314 (82%), Gaps = 2/314 (1%)
 Frame = -1

Query  1099  NGGlllqqqlLTKEGTIEKTKIFTASELDKATDHFNADRIVGRGGQGTVYKGMLIDGQIV  920
             NGGLLL+QQL + E  +EK K+F + EL+K+TD+FN DRI+G+GGQGTVYKGML DG+IV
Sbjct  693   NGGLLLEQQLSSGEVNVEKIKLFKSKELEKSTDNFNTDRILGQGGQGTVYKGMLADGRIV  752

Query  919   AVKKSQAVDEDQLEPFINEVVILSQINHRNVVKLMGCCLETEVPILVYEFIPNGTLFGLI  740
             AVKKS+ VDE QL  FINEVVILSQINHRNVV+L+GCCLETEVPILVYEFIPNG L   I
Sbjct  753   AVKKSKIVDESQLSGFINEVVILSQINHRNVVQLLGCCLETEVPILVYEFIPNGNLSQYI  812

Query  739   HNNFDNELIPLSWDIRLRIASEVACALAYLHSVTLVPIYHRDIKTGNILLDEKFRAKVSD  560
             H    NE  PL+W++RLRIA E+A AL+YLH+    PIYHRDIK+ NILLD K+RAKV+D
Sbjct  813   HEQ--NEEFPLTWEVRLRIAKEIAGALSYLHASAAFPIYHRDIKSTNILLDAKYRAKVAD  870

Query  559   FGTSRSISIDKTHFTTMVKGTFGYLDPEYFQSSQFTEKSDVYSFGVVLAELLTGQKPISF  380
             FGTSRS++ID+TH TT+V GTFGYLDPEYFQSSQFTEKSDVYSFGVVL ELLTGQKPISF
Sbjct  871   FGTSRSVAIDQTHLTTIVHGTFGYLDPEYFQSSQFTEKSDVYSFGVVLVELLTGQKPISF  930

Query  379   ELDDDEDRSLVSRFLLCMEENRLMEMLDGEVIEQGKKEDVVAMAWLAQRCLNFNGKKRPT  200
                 +E +SL + F++ M+ +RL E+LD +V++ G K D++ +A LA+RCLN +G+KRPT
Sbjct  931   RRSQEEGKSLATYFIISMQLDRLFEILDAQVVKGGSKADIITVANLARRCLNLSGRKRPT  990

Query  199   MKEVATELDAIKAS  158
             M+EV  EL+ I+ S
Sbjct  991   MREVTVELEGIQTS  1004


 Score =   279 bits (714),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 143/231 (62%), Positives = 174/231 (75%), Gaps = 16/231 (7%)
 Frame = -1

Query  943  MLIDGQIVAVKKSQAVDEDQLEPFINEVVILSQINHRNVVKLMGCCLETEVPILVYEFIP  764
            ML DG+IVAVKKS+ VDE QL  FINEVVILSQINHRNVVK++GCCLETEVP+LVYEFIP
Sbjct  1    MLTDGRIVAVKKSKVVDEGQLSEFINEVVILSQINHRNVVKILGCCLETEVPLLVYEFIP  60

Query  763  NGTLFGLIHNNFDNELIPLSWDIRLRIASEVACALAYLHSVTLVPIYHRDIKTGNILLDE  584
            NGTL+  I      E   L+W +RLRIA E++ AL+YLHS    PIYHRDIK        
Sbjct  61   NGTLYQYIQGQI--EEFQLTWQMRLRIALEISGALSYLHSAASFPIYHRDIK--------  110

Query  583  KFRAKVSDFGTSRSISIDKTHFTTMVKGTFGYLDPEYFQSSQFTEKSDVYSFGVVLAELL  404
               AKV+DFGTSRSI I +TH TT++ GTFGYLDPEYF+SSQFTEKSDVYSFGVVL ELL
Sbjct  111  ---AKVADFGTSRSIVIGQTHLTTVIHGTFGYLDPEYFRSSQFTEKSDVYSFGVVLVELL  167

Query  403  TGQKPISF---ELDDDEDRSLVSRFLLCMEENRLMEMLDGEVIEQGKKEDV  260
            TG+K IS       + E RSL + F+  MEE+RL++++D  V+++G + ++
Sbjct  168  TGEKHISLVTSSAKEKEYRSLAAYFITSMEEDRLLDIVDALVLKEGSEIEI  218



>ref|XP_010030448.1| PREDICTED: wall-associated receptor kinase-like 1 [Eucalyptus 
grandis]
Length=457

 Score =   414 bits (1063),  Expect = 5e-130, Method: Compositional matrix adjust.
 Identities = 196/303 (65%), Positives = 251/303 (83%), Gaps = 3/303 (1%)
 Frame = -1

Query  1066  TKEGTIEKTKIFTASELDKATDHFNADRIVGRGGQGTVYKGMLIDGQIVAVKKSQAVDED  887
             T EG +EK+K+F   +L KATD+F+  RI+G+GGQG VYKGML DG+IVA+KKS A+D+ 
Sbjct  114   TPEGNVEKSKLFNFKDLGKATDNFDNSRILGQGGQGIVYKGMLTDGKIVAIKKSMAIDKR  173

Query  886   QLEPFINEVVILSQINHRNVVKLMGCCLETEVPILVYEFIPNGTLFGLIHNNFDNELIPL  707
             ++E FINEV+ILSQINHRNVVKL+GCCLETEVP+LVYEFIPNGTL+  +H+   N   P+
Sbjct  174   KIEQFINEVLILSQINHRNVVKLLGCCLETEVPLLVYEFIPNGTLYQYLHD--PNVESPI  231

Query  706   SWDIRLRIASEVACALAYLHSVTLVPIYHRDIKTGNILLDEKFRAKVSDFGTSRSISIDK  527
             SWD RLRIA+E+A AL YLHS   +PIYHRDIK+ NILLDEK+ AKV+DFGTS+SIS+DK
Sbjct  232   SWDTRLRIATEIAGALFYLHSAASIPIYHRDIKSTNILLDEKYHAKVADFGTSKSISLDK  291

Query  526   THFTTMVKGTFGYLDPEYFQSSQFTEKSDVYSFGVVLAELLTGQKPISFELDDDEDRSLV  347
             TH TT+V+GTFGYLDPEYF+SSQFT+KSDVYSFGVVL ELLT QKPIS +  ++E RSL 
Sbjct  292   THVTTLVQGTFGYLDPEYFRSSQFTDKSDVYSFGVVLVELLTRQKPISSQ-REEEGRSLA  350

Query  346   SRFLLCMEENRLMEMLDGEVIEQGKKEDVVAMAWLAQRCLNFNGKKRPTMKEVATELDAI  167
               F++ +EENRL +++D  V+++GK  ++ ++A LA+RCL+ NG+ RPTMKEVA EL+ I
Sbjct  351   MYFIISVEENRLFDIVDAHVLKEGKMGEIASVANLAKRCLDLNGRNRPTMKEVAMELEGI  410

Query  166   KAS  158
             + +
Sbjct  411   RKT  413



>ref|XP_010036179.1| PREDICTED: wall-associated receptor kinase-like 9 [Eucalyptus 
grandis]
Length=550

 Score =   417 bits (1071),  Expect = 5e-130, Method: Compositional matrix adjust.
 Identities = 255/525 (49%), Positives = 342/525 (65%), Gaps = 46/525 (9%)
 Frame = -1

Query  1612  CQGIN-CNHLTVDYDVNTYQVNFT--HSSSFNACNYAFFlsassslpptlqslpsrqQEM  1442
             C G + C   T+  D+  + + F     S  N C YAF    S     +           
Sbjct  3     CSGSDGCCRTTITPDLQAFTITFIPDKGSPKNQCEYAFLGDRSKFTRSSKDFNKLEASGH  62

Query  1441  VVVPVELRWTITQEDVPPSY------SKYCSPSTYINPQLQWHNYLQCDCPGGDDRNVYL  1280
                P  L W I +     S       S  CS  ++ +   +   +LQC C GG   N Y+
Sbjct  63    F--PAVLEWGIAKSSRAASEIYKHGDSYNCSNFSFNSAYPKAMPFLQCSCRGGFTGNPYI  120

Query  1279  SGGCE--------------------WKHKDYVISSNKLRPAIIGISASFGFVFLIWAFVI  1160
               GCE                        D V  S  ++  +IG+ A  G + L+    +
Sbjct  121   KYGCEDVDECKGPTDPCPGRKCVNRQGSYDCVERSKTIKFLLIGMGAGLGVLLLLLFLWL  180

Query  1159  LYkaikkrkmkklrqkffkRNGGlllqqqlLTKEGTIEKTKIFTASELDKATDHFNADRI  980
             LY  +KKRK  KL++++FK NGGLLLQQQL + E  ++K K+F + +L+KATD+FN +RI
Sbjct  181   LYNFLKKRKEIKLKERYFKENGGLLLQQQLCSSETNVDKNKLFNSKDLEKATDNFNKNRI  240

Query  979   VGRGGQGTVYKGMLIDGQIVAVKKSQAVDEDQLEPFINEVVILSQINHRNVVKLMGCCLE  800
             +G+GGQGTVYKGML DG IVA+KKS+A+D+ ++E FINE+ ILSQINHRNVVKL+GCCLE
Sbjct  241   LGQGGQGTVYKGMLADGGIVAIKKSKAIDKGKVEQFINEIAILSQINHRNVVKLLGCCLE  300

Query  799   TEVPILVYEFIPNGTLFGLIHNNFDNELIPLSWDIRLRIASEVACALAYLHSVTLVPIYH  620
             TE P+LVYEFIPNGTLF  +H++       +SW  RL+IA++VA AL+YLHS   +PIYH
Sbjct  301   TESPLLVYEFIPNGTLFQYLHDSL------VSWGTRLQIATDVAGALSYLHSSASIPIYH  354

Query  619   RDIKTGNILLDEKFRAKVSDFGTSRSISIDKTHFTTMVKGTFGYLDPEYFQSSQFTEKSD  440
             RDIK+ NILLD+++RAKV+DFGTS+S+S+ +TH TT+V+GTFGYLDPEYFQS QFTEKSD
Sbjct  355   RDIKSTNILLDDRYRAKVADFGTSKSLSLYQTHVTTVVQGTFGYLDPEYFQSCQFTEKSD  414

Query  439   VYSFGVVLAELLTGQKPISFELDDDEDRSLVSRFLLCMEENRLMEMLDGEVIEQGKKEDV  260
             VYSFGVVL ELLTG+KP+SF L D+E+R+L S FLL M+EN L +++D +V++QGK+E +
Sbjct  415   VYSFGVVLVELLTGRKPVSF-LGDEEERNLASYFLLSMDENCLFDIVDPQVLKQGKEEGI  473

Query  259   VAMAWLAQRCLNFNGKKRPTMKEVATELD--------AIKASNSH  149
             VA A +A+ CLN +GK RPTM+EVA+EL+        AI+  N+H
Sbjct  474   VAFANIARGCLNLHGKMRPTMREVASELERIRKLENPAIRRGNTH  518



>gb|KDO41534.1| hypothetical protein CISIN_1g0470382mg, partial [Citrus sinensis]
Length=400

 Score =   411 bits (1057),  Expect = 6e-130, Method: Compositional matrix adjust.
 Identities = 205/315 (65%), Positives = 259/315 (82%), Gaps = 3/315 (1%)
 Frame = -1

Query  1099  NGGlllqqqlLTKEGTIEKTKIFTASELDKATDHFNADRIVGRGGQGTVYKGMLIDGQIV  920
             NGGLLLQQ+L + EG I+KTK+FT++EL+KATD+FN +RI+G+GGQGTVYKGML DG+IV
Sbjct  38    NGGLLLQQELSSNEGGIDKTKLFTSNELEKATDNFNTNRILGQGGQGTVYKGMLEDGKIV  97

Query  919   AVKKSQAVDEDQLEPFINEVVILSQINHRNVVKLMGCCLETEVPILVYEFIPNGTLFGLI  740
             AVKKS+ +DE ++E FINEVVILSQINHRNVVKL+GCCLETEVP+LVYEFI NGTL   I
Sbjct  98    AVKKSKIIDESKVEEFINEVVILSQINHRNVVKLLGCCLETEVPLLVYEFISNGTLSQYI  157

Query  739   HNNFDNELIPLSWDIRLRIASEVACALAYLHSVTLVPIYHRDIKTGNILLDEKFRAKVSD  560
              +   N+   +SW++RL IA +V+ A++YLHS   +PIYHRDIK+ NILLD+K+ AKVSD
Sbjct  158   DDQ--NKDFRISWEMRLCIAIDVSGAISYLHSAASIPIYHRDIKSTNILLDDKYCAKVSD  215

Query  559   FGTSRSISIDKTHFTTMVKGTFGYLDPEYFQSSQFTEKSDVYSFGVVLAELLTGQKPISF  380
             FG SRSI++D+TH TT V+GTFGYLDPEYFQSS FTEKSDVYSFGVVL ELLTG++PI  
Sbjct  216   FGASRSIAVDQTHLTTQVQGTFGYLDPEYFQSSHFTEKSDVYSFGVVLVELLTGERPIRL  275

Query  379   ELDDDEDRSLVSRFLLCMEENRLMEMLDGEVIEQGKKEDVVAMAWLAQRCLNFNGKKRPT  200
               + +ED+SL + FL  M E+RL E+LD +++++G K++   +A LA+RCLN NGKKRPT
Sbjct  276   T-NSEEDKSLAAYFLRAMREDRLFEILDAQILKEGGKDEFKMVAKLAKRCLNLNGKKRPT  334

Query  199   MKEVATELDAIKASN  155
             M+EV  EL  I+  N
Sbjct  335   MREVGIELTGIRGCN  349



>emb|CDX67982.1| BnaA07g20220D [Brassica napus]
Length=794

 Score =   424 bits (1091),  Expect = 6e-130, Method: Compositional matrix adjust.
 Identities = 226/419 (54%), Positives = 305/419 (73%), Gaps = 26/419 (6%)
 Frame = -1

Query  1330  NYLQCDCPGGDDRNVYLSGGCE----------------------WKHKDYVISSNKLRPA  1217
             N   C C  G   N Y+ GGC+                        H + V S+++L   
Sbjct  322   NDASCRCNNGYKGNPYIPGGCKDFNECAEKRYSDNCVGGTCVDFQGHYECVYSNHRL---  378

Query  1216  IIGISASFGFVFLIWAFVILYkaikkrkmkklrqkffkRNGGlllqqqlLTKEGTIEKTK  1037
              IG  +SFG +  I     LY+ I+K++    ++KFFKRNGGLLLQQQL + +G +EKT+
Sbjct  379   AIGFGSSFGSLIFIVGIYGLYRFIRKQRRLNQKKKFFKRNGGLLLQQQLTSTQGNVEKTR  438

Query  1036  IFTASELDKATDHFNADRIVGRGGQGTVYKGMLIDGQIVAVKKSQAVDEDQLEPFINEVV  857
             +F++ EL+KAT++F+  RI+G+GGQGTVYKGML+DG+IVAVKKS+ VDED+LE FINEVV
Sbjct  439   VFSSRELEKATENFSLTRILGQGGQGTVYKGMLVDGRIVAVKKSKVVDEDKLEEFINEVV  498

Query  856   ILSQINHRNVVKLMGCCLETEVPILVYEFIPNGTLFGLIHNNFDNELIPLSWDIRLRIAS  677
             ILSQINHRN+VKL+GCCLET+VP+LVYEFIPNG LF  +H +  ++    +W++RLRIA 
Sbjct  499   ILSQINHRNIVKLLGCCLETDVPVLVYEFIPNGNLFEHLHEDELDDHTMTTWEVRLRIAI  558

Query  676   EVACALAYLHSVTLVPIYHRDIKTGNILLDEKFRAKVSDFGTSRSISIDKTHFTTMVKGT  497
             ++A AL+YLHS    PIYHRD+K+ NI+LDEK+RAKVSDFGTSR++++D TH TT+V GT
Sbjct  559   DIASALSYLHSAASSPIYHRDVKSTNIMLDEKYRAKVSDFGTSRTVTVDHTHLTTVVSGT  618

Query  496   FGYLDPEYFQSSQFTEKSDVYSFGVVLAELLTGQKPISFELDDDEDRSLVSRFLLCMEEN  317
              GY+DPEYFQSSQFT+KSDVYSFGVVLAEL+TG+K +SF L   E+R+L + F L M+EN
Sbjct  619   VGYVDPEYFQSSQFTDKSDVYSFGVVLAELITGEKSVSF-LRSQENRTLATYFFLAMKEN  677

Query  316   RLMEMLDGEVIEQGKKEDVVAMAWLAQRCLNFNGKKRPTMKEVATELDAIKASNSHLPL  140
             RL++++D  + +  K   V A A LA++CLN  G+KRP+M+EV+ EL+ I+ S+  + L
Sbjct  678   RLLDIIDARIRDGCKLNQVTATANLARKCLNLKGRKRPSMREVSMELEKIRGSSVDMEL  736



>ref|XP_006300756.1| hypothetical protein CARUB_v10019823mg [Capsella rubella]
 gb|EOA33654.1| hypothetical protein CARUB_v10019823mg [Capsella rubella]
Length=794

 Score =   424 bits (1091),  Expect = 7e-130, Method: Compositional matrix adjust.
 Identities = 222/393 (56%), Positives = 296/393 (75%), Gaps = 3/393 (1%)
 Frame = -1

Query  1321  QCDCPGGDDRNVYLSGG-CEWKHKDYVISSNKLRPAIIGISASFGFVFLIWAFVILYkai  1145
             +C   G D  + Y  GG C   +  Y       RP  IG+  SFG +  +     LYK I
Sbjct  339   ECQQEGYDGAHFYCRGGRCVNSYGSYECRYTNHRPLAIGLGTSFGSLIFVGGIYWLYKII  398

Query  1144  kkrkmkklrqkffkRNGGlllqqqlLTKEGTIEKTKIFTASELDKATDHFNADRIVGRGG  965
             +K++    ++KFFKRNGGLLLQQQL + EG +E TK+F++ EL+KAT++F+++RI+G+GG
Sbjct  399   RKQRRINQKKKFFKRNGGLLLQQQLTSTEGKVETTKVFSSRELEKATENFSSNRILGQGG  458

Query  964   QGTVYKGMLIDGQIVAVKKSQAVDEDQLEPFINEVVILSQINHRNVVKLMGCCLETEVPI  785
             QGTVYKGML+DG+IVAVKKS+ VDED+LE FINEVVILSQINHRN+VKL+GCCLET+VP+
Sbjct  459   QGTVYKGMLVDGRIVAVKKSKVVDEDKLEEFINEVVILSQINHRNIVKLLGCCLETKVPV  518

Query  784   LVYEFIPNGTLFGLIHNNFDNELIPLSWDIRLRIASEVACALAYLHSVTLVPIYHRDIKT  605
             LVYEF+PNG LF  +H++ D+  +  +W +RLRIA ++A AL+YLHS    PIYHRD+K+
Sbjct  519   LVYEFVPNGNLFEHLHDDSDDNTMA-TWKVRLRIAIDIAGALSYLHSSASSPIYHRDVKS  577

Query  604   GNILLDEKFRAKVSDFGTSRSISIDKTHFTTMVKGTFGYLDPEYFQSSQFTEKSDVYSFG  425
              NI+LDEK+RAKVSDFGTSRS+++D TH TT+V GT GY+DPEYFQSSQFTEKSDVYSFG
Sbjct  578   TNIMLDEKYRAKVSDFGTSRSVTVDHTHLTTVVSGTVGYVDPEYFQSSQFTEKSDVYSFG  637

Query  424   VVLAELLTGQKPISFELDDDEDRSLVSRFLLCMEENRLMEMLDGEVIEQGKKEDVVAMAW  245
             VVLAEL+TG+K ISF     E+R+L + F+  M+EN+L +++D  + +      V A A 
Sbjct  638   VVLAELITGEKSISF-FRSQENRTLATYFITKMKENKLFDIIDARIRDDCMLSQVTAAAK  696

Query  244   LAQRCLNFNGKKRPTMKEVATELDAIKASNSHL  146
             +A++CLN  G+KRP+M+EV  ELD I+ S+  +
Sbjct  697   VARKCLNLKGRKRPSMREVLMELDNIRMSSGDM  729



>ref|XP_006431624.1| hypothetical protein CICLE_v10003390mg, partial [Citrus clementina]
 gb|ESR44864.1| hypothetical protein CICLE_v10003390mg, partial [Citrus clementina]
Length=674

 Score =   421 bits (1081),  Expect = 8e-130, Method: Compositional matrix adjust.
 Identities = 211/315 (67%), Positives = 267/315 (85%), Gaps = 3/315 (1%)
 Frame = -1

Query  1099  NGGlllqqqlLTKEGTIEKTKIFTASELDKATDHFNADRIVGRGGQGTVYKGMLIDGQIV  920
             NGGLLL+QQL + +G+I++ KIF + ELDKATDHFN +RI+G+GGQGTVYKGML DG+I+
Sbjct  346   NGGLLLEQQLHSLDGSIDRCKIFNSKELDKATDHFNVNRILGQGGQGTVYKGMLADGRII  405

Query  919   AVKKSQAVDEDQLEPFINEVVILSQINHRNVVKLMGCCLETEVPILVYEFIPNGTLFGLI  740
             AVKKS+ VDE +LE FINEVVILSQI+HRNVVKL+G CLE EVP+LVYEFIPNGTLF  +
Sbjct  406   AVKKSKVVDESKLEEFINEVVILSQISHRNVVKLLGSCLEVEVPLLVYEFIPNGTLFQYL  465

Query  739   HNNFDNELIPLSWDIRLRIASEVACALAYLHSVTLVPIYHRDIKTGNILLDEKFRAKVSD  560
             H+   +E + L+W++RLRIA+EVA ALAYLHS   +PIYHRDIK+ NILLDEK+RAK++D
Sbjct  466   HD--PSEELSLTWEMRLRIATEVAEALAYLHSSAYLPIYHRDIKSTNILLDEKYRAKIAD  523

Query  559   FGTSRSISIDKTHFTTMVKGTFGYLDPEYFQSSQFTEKSDVYSFGVVLAELLTGQKPISF  380
             FGTSRSI+ID+TH +T V+GTFGYLDPEYF SSQFT+KSDVYSFGVVL ELLTGQKPIS+
Sbjct  524   FGTSRSIAIDQTHVSTKVQGTFGYLDPEYFHSSQFTDKSDVYSFGVVLVELLTGQKPISY  583

Query  379   ELDDDEDRSLVSRFLLCMEENRLMEMLDGEVIEQGKKEDVVAMAWLAQRCLNFNGKKRPT  200
              +  +E R+L + F+ C+EEN L ++LD +V + GK E+++ ++ +A+RCLN NG+ RPT
Sbjct  584   -IWANEGRNLATYFVECVEENCLFDILDDQVRKSGKTEEIMEVSDVAKRCLNSNGRSRPT  642

Query  199   MKEVATELDAIKASN  155
             MKEVA EL+ I+A N
Sbjct  643   MKEVAMELERIRACN  657



>ref|XP_004306301.1| PREDICTED: wall-associated receptor kinase-like 1-like [Fragaria 
vesca subsp. vesca]
Length=771

 Score =   423 bits (1088),  Expect = 9e-130, Method: Compositional matrix adjust.
 Identities = 203/315 (64%), Positives = 261/315 (83%), Gaps = 2/315 (1%)
 Frame = -1

Query  1099  NGGlllqqqlLTKEGTIEKTKIFTASELDKATDHFNADRIVGRGGQGTVYKGMLIDGQIV  920
             NGGLLL++QL + E  +EK K+F + EL+K+TD+F+ DRI+G+GGQGTVYKGML DG+IV
Sbjct  400   NGGLLLKRQLSSGEVNLEKIKLFKSKELEKSTDNFHVDRILGKGGQGTVYKGMLTDGRIV  459

Query  919   AVKKSQAVDEDQLEPFINEVVILSQINHRNVVKLMGCCLETEVPILVYEFIPNGTLFGLI  740
             AVK+S  VDE +L  FINEVVILSQINHRNVVKL+GCCLETEVP+LVYEFIPNG+L   I
Sbjct  460   AVKRSTKVDEARLSQFINEVVILSQINHRNVVKLLGCCLETEVPLLVYEFIPNGSLSQYI  519

Query  739   HNNFDNELIPLSWDIRLRIASEVACALAYLHSVTLVPIYHRDIKTGNILLDEKFRAKVSD  560
             H    NE  PL+W++R+RIA+E+A AL+YLH    +PI+HRDIK+ NILLDEK+RAKV+D
Sbjct  520   HEQ--NEDFPLTWELRIRIATEIAGALSYLHGAASIPIFHRDIKSTNILLDEKYRAKVAD  577

Query  559   FGTSRSISIDKTHFTTMVKGTFGYLDPEYFQSSQFTEKSDVYSFGVVLAELLTGQKPISF  380
             FGTSRS++ID+TH TT+V GTFGYLDPEYFQSSQFT+KSDVYSFGVVL ELL+GQKPIS 
Sbjct  578   FGTSRSVAIDQTHLTTLVYGTFGYLDPEYFQSSQFTDKSDVYSFGVVLVELLSGQKPISS  637

Query  379   ELDDDEDRSLVSRFLLCMEENRLMEMLDGEVIEQGKKEDVVAMAWLAQRCLNFNGKKRPT  200
                 +E RSL + F++ M+++RL E++D +V+++  +ED++ +A LA+RCLN NG+ RPT
Sbjct  638   TRSQEEGRSLATHFIILMQDDRLFEIVDAQVLKEASREDILVVANLARRCLNLNGRNRPT  697

Query  199   MKEVATELDAIKASN  155
             M+EV  EL+ I+ S 
Sbjct  698   MREVTAELEGIQMSQ  712



>gb|KFK42488.1| hypothetical protein AALP_AA2G263200 [Arabis alpina]
Length=650

 Score =   419 bits (1078),  Expect = 9e-130, Method: Compositional matrix adjust.
 Identities = 221/382 (58%), Positives = 289/382 (76%), Gaps = 3/382 (1%)
 Frame = -1

Query  1297  DRNVYL-SGGCEWKHKDYVISSNKLRPAIIGISASFGFVFLIWAFVILYkaikkrkmkkl  1121
             DR +Y   G CE     Y    ++L   ++ +      + LI   + LY  I++ K    
Sbjct  206   DRPLYCYEGSCENLQGSYGCRYSQLPAPVLSLMIGIAMLILIGVGLCLYMCIRRLKRINR  265

Query  1120  rqkffkRNGGlllqqqlLTKEGTIEKTKIFTASELDKATDHFNADRIVGRGGQGTVYKGM  941
             ++K FKRNGGLLLQQQL + +G +E TK+FT+ EL KAT++F+  R++G+GGQGTVYKGM
Sbjct  266   KKKLFKRNGGLLLQQQLTSTQGNVETTKVFTSKELAKATENFSEKRVLGQGGQGTVYKGM  325

Query  940   LIDGQIVAVKKSQAVDEDQLEPFINEVVILSQINHRNVVKLMGCCLETEVPILVYEFIPN  761
             LIDG+IVAVKKS+ VDED+LE FINEVVILSQINHRN+VK++GCCLETEVP+LVYEFI N
Sbjct  326   LIDGRIVAVKKSKVVDEDKLEEFINEVVILSQINHRNIVKILGCCLETEVPLLVYEFISN  385

Query  760   GTLFGLIHNNF-DNELIPLSWDIRLRIASEVACALAYLHSVTLVPIYHRDIKTGNILLDE  584
             G LF  +H+   D  ++  +W++RLRIA E+A AL+YLHS    PIYHRDIKT NI+LDE
Sbjct  386   GNLFEHLHDESPDQTMMATTWEMRLRIAIEIAGALSYLHSAASTPIYHRDIKTTNIMLDE  445

Query  583   KFRAKVSDFGTSRSISIDKTHFTTMVKGTFGYLDPEYFQSSQFTEKSDVYSFGVVLAELL  404
             K+RAKVSDFGTSRS++ D TH TT+V GT GYLDPEYFQSSQFT+KSDVYSFGVVL EL+
Sbjct  446   KYRAKVSDFGTSRSVTEDHTHLTTLVSGTVGYLDPEYFQSSQFTDKSDVYSFGVVLVELI  505

Query  403   TGQKPISFELDDDEDRSLVSRFLLCMEENRLMEMLDGEVIEQGKKEDVVAMAWLAQRCLN  224
             TG+KPISF     E+R+LV+ F L M+ENR+++++D  + +  K E V+A+A +A+RCLN
Sbjct  506   TGEKPISFS-RSQENRTLVTYFNLAMKENRVVDIVDARIKDDCKMEQVMAVAKVARRCLN  564

Query  223   FNGKKRPTMKEVATELDAIKAS  158
                KKRP M++V+ EL+ I++S
Sbjct  565   MKRKKRPNMRQVSMELEMIRSS  586



>ref|XP_011078212.1| PREDICTED: wall-associated receptor kinase-like 10 [Sesamum indicum]
Length=731

 Score =   422 bits (1084),  Expect = 1e-129, Method: Compositional matrix adjust.
 Identities = 209/296 (71%), Positives = 247/296 (83%), Gaps = 3/296 (1%)
 Frame = -1

Query  1051  IEKTKIFTASELDKATDHFNADRIVGRGGQGTVYKGMLIDGQIVAVKKSQAVDEDQLEPF  872
             IEKTK+FT+ EL +ATDH+N DRIVGRGGQGTVYKGML DG+IVAVKKS+ VDED LE F
Sbjct  382   IEKTKLFTSKELAQATDHYNEDRIVGRGGQGTVYKGMLADGRIVAVKKSKRVDEDDLEFF  441

Query  871   INEVVILSQINHRNVVKLMGCCLETEVPILVYEFIPNGTLFGLIHNNFDNELIPLSWDIR  692
             INEVVILSQINHRNVVKL+GCCLETEVP+LVYEFIPNGTLF  IH    NE   LSW++R
Sbjct  442   INEVVILSQINHRNVVKLLGCCLETEVPLLVYEFIPNGTLFHHIHE--PNEDFLLSWEMR  499

Query  691   LRIASEVACALAYLHSVTLVPIYHRDIKTGNILLDEKFRAKVSDFGTSRSISIDKTHFTT  512
             ++IA EVA AL+YLHS    PIYHRDIK+ NILLD K+RAKVSDFGTSRS++ID+TH TT
Sbjct  500   VQIAREVAGALSYLHSAASTPIYHRDIKSTNILLDHKYRAKVSDFGTSRSVAIDQTHLTT  559

Query  511   MVKGTFGYLDPEYFQSSQFTEKSDVYSFGVVLAELLTGQKPISFELDDDEDRSLVSRFLL  332
              V GTFGYLDPEYFQSSQFTEKSDVYSFGVV+ ELLTG+K IS  +  +  +SL + FL 
Sbjct  560   RVLGTFGYLDPEYFQSSQFTEKSDVYSFGVVMVELLTGEKAIS-SVRAEVGKSLATHFLH  618

Query  331   CMEENRLMEMLDGEVIEQGKKEDVVAMAWLAQRCLNFNGKKRPTMKEVATELDAIK  164
              MEE+ L  +LD  ++++ ++E+VVA+A LA+RCL+ NGKKRPTMKEVA EL+ I+
Sbjct  619   SMEEDHLFNILDPSILKEDRREEVVAIAELARRCLHLNGKKRPTMKEVAVELEGIQ  674



>ref|XP_010459150.1| PREDICTED: wall-associated receptor kinase-like 1 [Camelina sativa]
Length=734

 Score =   422 bits (1085),  Expect = 1e-129, Method: Compositional matrix adjust.
 Identities = 264/591 (45%), Positives = 359/591 (61%), Gaps = 54/591 (9%)
 Frame = -1

Query  1762  TPFMYSNDNNFMLFGCGNAFITMPGEELDQPGYNLNCSSKNTTAPKTAHDCQGINCNHLT  1583
             +P+  +++N  +  GCG   + M   E +  G   +C +  +    T   C G  C    
Sbjct  138   SPYFLTDENRLVAVGCGTKAL-MTDIESEILGCESSCENSKSGEQVTNSVCTGYKCCQAR  196

Query  1582  VDYD---VNTYQVNFTHSSSFNACNYAFFlsassslpptlqslpsrqQEMVVVPVELRWT  1412
             +  +   V T  +    S     C  AF  +   S     +         VVV  EL W 
Sbjct  197   LPVERPQVITVIIEKNSSGEEERCKVAFLTNKRYSPSNVTEPEQFHSNGNVVV--ELGWY  254

Query  1411  ITQEDVP-------PSYSKYCSPSTYINPQLQWH-----NYLQCDCPGGDDRNVYLSGGC  1268
                 D          + S+  S S+  N   +++     +Y  C C  G   N YL GGC
Sbjct  255   FVTSDSRFRSLLGCANMSRKGSGSSDDNCSCEYNYFSGMSYRNCYCDYGYAGNPYLRGGC  314

Query  1267  EWKH--------KDYV-------ISSNKLRPAI-------------IGISASFGFVFLIW  1172
             +           +D V       +S  K +P I             IG+S  F FV L W
Sbjct  315   KDTDSCEGNTCGEDAVCVNMPGPMSMCKPKPKITKPANPPVVQGIVIGLSGLFLFVGLFW  374

Query  1171  AFVILYkaikkrkmkklrqkffkRNGGlllqqq-lLTKEGTIEKTKIFTASELDKATDHF  995
                 L+K  KKR+     +KFFKRNGGLLL QQ   TK+G +E +K+F++ EL KATD+F
Sbjct  375   ----LFKFAKKRRRIIQSKKFFKRNGGLLLNQQITTTKDGNVEMSKVFSSKELKKATDNF  430

Query  994   NADRIVGRGGQGTVYKGMLIDGQIVAVKKSQAVDEDQLEPFINEVVILSQINHRNVVKLM  815
             + +R++G+GGQGTVYKGML+DG+IVAVK+S+ VDED+LE FINEVV+LSQ+NHRN+VKL+
Sbjct  431   SVNRVLGQGGQGTVYKGMLVDGRIVAVKRSKLVDEDKLEEFINEVVLLSQMNHRNIVKLL  490

Query  814   GCCLETEVPILVYEFIPNGTLFGLIHNNFDNELIPLSWDIRLRIASEVACALAYLHSVTL  635
             GCCLETEVPILVYE+IPNG L+  +H+ FD+    ++W++RLRIA E A AL Y+HS   
Sbjct  491   GCCLETEVPILVYEYIPNGDLYKRLHDEFDD--YTMTWEVRLRIAIETAGALTYMHSAAS  548

Query  634   VPIYHRDIKTGNILLDEKFRAKVSDFGTSRSISIDKTHFTTMVKGTFGYLDPEYFQSSQF  455
              PI+HRDIKT NILLDEK+RAKVSDFGTSRSI+ID+TH TT+V GTFGY+DPEYF SSQ+
Sbjct  549   FPIFHRDIKTTNILLDEKYRAKVSDFGTSRSITIDQTHLTTLVAGTFGYMDPEYFMSSQY  608

Query  454   TEKSDVYSFGVVLAELLTGQKPISFELDDDEDRSLVSRFLLCMEENRLMEMLDGEVIEQG  275
             T KSDVYSFGVVL EL+TG+KP+S  +  +E R L + FL  M+ENR ++++D  + ++ 
Sbjct  609   THKSDVYSFGVVLVELITGEKPMS-RVRSEEGRGLATDFLEAMKENRAVDIIDIRMKDES  667

Query  274   KKEDVVAMAWLAQRCLNFNGKKRPTMKEVATELDAIKASNSHLPLAMEAFE  122
             K E ++A+A LA++CLN  GKKRP M++V+ EL+ I++S   L +  E  E
Sbjct  668   KLEQIMAVAKLARKCLNRKGKKRPNMRDVSIELERIRSSPEDLDVHSEIIE  718



>ref|XP_010273366.1| PREDICTED: wall-associated receptor kinase-like 1 [Nelumbo nucifera]
Length=1250

 Score =   435 bits (1119),  Expect = 1e-129, Method: Compositional matrix adjust.
 Identities = 235/357 (66%), Positives = 289/357 (81%), Gaps = 3/357 (1%)
 Frame = -1

Query  1186  VFLIWAFVILYkaikkrkmkklrqkffkRNGGlllqqqlLTKEGTIEKTKIFTASELDKA  1007
             V LI A   LYK +KKR++K  R+ +FKRNGGLLL QQ+ TKEG +EK K+FTA EL+KA
Sbjct  85    VVLILASYWLYKVLKKRQIKNRRESYFKRNGGLLLHQQVSTKEGNVEKVKLFTAEELEKA  144

Query  1006  TDHFNADRIVGRGGQGTVYKGMLIDGQIVAVKKSQAVDEDQLEPFINEVVILSQINHRNV  827
             TD +N +RI+G+GGQGTVYKGML+DG+IVAVKKS+ VDE QLE FINEVVILSQ+NHRNV
Sbjct  145   TDQYNENRILGQGGQGTVYKGMLLDGRIVAVKKSKIVDESQLEQFINEVVILSQVNHRNV  204

Query  826   VKLMGCCLETEVPILVYEFIPNGTLFGLIHNNFDNELIPLSWDIRLRIASEVACALAYLH  647
             VKL+GCCLE E+ +LVYEFI  GTL   IH+  +N  IPLSWD RLRIA EVA A+AYLH
Sbjct  205   VKLLGCCLEVEILLLVYEFISGGTLSYNIHHQSEN--IPLSWDNRLRIAREVAGAIAYLH  262

Query  646   SVTLVPIYHRDIKTGNILLDEKFRAKVSDFGTSRSISIDKTHFTTMVKGTFGYLDPEYFQ  467
             S   VPIYHRDIK+ NILLD+K RAKVSDFGTSRSI IDKTH TT+V+GTFGYLDPEYFQ
Sbjct  263   SAASVPIYHRDIKSSNILLDDKGRAKVSDFGTSRSIEIDKTHLTTIVQGTFGYLDPEYFQ  322

Query  466   SSQFTEKSDVYSFGVVLAELLTGQKPISFELDDDEDRSLVSRFLLCMEENRLMEMLDGEV  287
             SSQFT+KSDVYSFGVVL ELLTG+KPIS  +   E+++LV+ F+  MEEN L E+LD  V
Sbjct  323   SSQFTDKSDVYSFGVVLVELLTGEKPIS-SIRQAEEKNLVTYFVSSMEENHLFEILDTHV  381

Query  286   IEQGKKEDVVAMAWLAQRCLNFNGKKRPTMKEVATELDAIKASNSHLPLAMEAFEIE  116
             I++G+KED+  +A+LA+RCL+  GK+RPTMK+VA +L+++++   H  +     E+E
Sbjct  382   IKEGRKEDLQKIAYLAKRCLSLKGKERPTMKKVALKLESLRSFEGHSQIQQNIQEVE  438


 Score =   433 bits (1114),  Expect = 7e-129, Method: Compositional matrix adjust.
 Identities = 241/404 (60%), Positives = 298/404 (74%), Gaps = 10/404 (2%)
 Frame = -1

Query  1324  LQCDCPGGDDRNVYLSG-GCEWKHKDYVISSNKLRPAIIGISASFGFVFLIWAFVILYka  1148
              +C CP G + +    G GC         S  KL    + I    G VF++ ++  LY+ 
Sbjct  815   FKCTCPPGTEGDGKRKGQGC----IPLPPSRTKLLVTQVLIGVGLGAVFILASY-WLYQV  869

Query  1147  ikkrkmkklrqkffkRNGGlllqqqlLTKEGTIEKTKIFTASELDKATDHFNADRIVGRG  968
              KK+++K  ++ +FKRNGGLLL QQ+ TKEG +EK KIF+A EL++ATD +N DRI+G+G
Sbjct  870   FKKKQIKNRKESYFKRNGGLLLHQQVSTKEGNVEKIKIFSAEELERATDQYNEDRILGQG  929

Query  967   GQGTVYKGMLIDGQIVAVKKSQAVDEDQLEPFINEVVILSQINHRNVVKLMGCCLETEVP  788
             GQGTVYKGML DG+IVA+KKS+ VDE QLE FINEV+ILSQINHRNVVKL+GCCLE E+P
Sbjct  930   GQGTVYKGMLQDGRIVAIKKSKIVDESQLEQFINEVIILSQINHRNVVKLLGCCLEVEIP  989

Query  787   ILVYEFIPNGTLFGLIHNNFDNELIPLSWDIRLRIASEVACALAYLHSVTLVPIYHRDIK  608
             +LVYEFI  GTL   IH+  D    PLSWD RLRIA+EVA A+AYLHS   VPIYHRDIK
Sbjct  990   LLVYEFISGGTLSHNIHHYED---FPLSWDNRLRIATEVAGAIAYLHSAAAVPIYHRDIK  1046

Query  607   TGNILLDEKFRAKVSDFGTSRSISIDKTHFTTMVKGTFGYLDPEYFQSSQFTEKSDVYSF  428
             + NILLD+K R KVSDFGTSRS+ IDKTH TT+V+GTFGYLDPEYFQSSQFT+KSDVYSF
Sbjct  1047  SSNILLDDKGRVKVSDFGTSRSVEIDKTHLTTIVQGTFGYLDPEYFQSSQFTDKSDVYSF  1106

Query  427   GVVLAELLTGQKPISFELDDDEDRSLVSRFLLCMEENRLMEMLDGEVIEQGKKEDVVAMA  248
             GVVL ELLTG+KPIS      E ++LV+ F+  MEEN L E+LD  VI +GKKE++  +A
Sbjct  1107  GVVLVELLTGEKPIS-STRQAEGKNLVTYFVSKMEENHLFEILDAHVINEGKKEELQKIA  1165

Query  247   WLAQRCLNFNGKKRPTMKEVATELDAIKASNSHLPLAMEAFEIE  116
              LA+RCLN   KKRPTMKEVA +L+ +++   H  +     E+E
Sbjct  1166  DLAKRCLNLKRKKRPTMKEVALKLEGLRSFAGHSQIQRNTEEVE  1209



>ref|XP_004295611.1| PREDICTED: wall-associated receptor kinase 2-like [Fragaria vesca 
subsp. vesca]
Length=760

 Score =   422 bits (1086),  Expect = 1e-129, Method: Compositional matrix adjust.
 Identities = 201/299 (67%), Positives = 251/299 (84%), Gaps = 3/299 (1%)
 Frame = -1

Query  1060  EGTIEKTKIFTASELDKATDHFNADRIVGRGGQGTVYKGMLIDGQIVAVKKSQAVDEDQL  881
             +  +EK K+F + EL+KATD+F+ DR++G+GGQGTVYKGML+DGQIVAVKKS+ V+  ++
Sbjct  402   QANVEKIKLFNSRELEKATDNFSIDRVLGQGGQGTVYKGMLMDGQIVAVKKSKIVNGGEV  461

Query  880   EPFINEVVILSQINHRNVVKLMGCCLETEVPILVYEFIPNGTLFGLIHNNFDNELIPLSW  701
               FINE+VILSQ+NHRNVVKL+GCCLETE+P+LVYEF+PNGTL   IH+   +E   L+W
Sbjct  462   GQFINEIVILSQVNHRNVVKLLGCCLETEIPLLVYEFLPNGTLSQYIHDQ--DEEFHLTW  519

Query  700   DIRLRIASEVACALAYLHSVTLVPIYHRDIKTGNILLDEKFRAKVSDFGTSRSISIDKTH  521
               RLR+++EVA AL+YLHS   +PIYHRDIK  NILLD K+RAK++DFGTSRSISID+TH
Sbjct  520   GTRLRVSTEVAGALSYLHSAASIPIYHRDIKCTNILLDGKYRAKIADFGTSRSISIDQTH  579

Query  520   FTTMVKGTFGYLDPEYFQSSQFTEKSDVYSFGVVLAELLTGQKPISFELDDDEDRSLVSR  341
              TT+V+GTFGYLDPEYFQSSQFTEKSDVYSFGVVLAELLTGQKP+S  +   E RSL + 
Sbjct  580   LTTLVRGTFGYLDPEYFQSSQFTEKSDVYSFGVVLAELLTGQKPVSM-IRSQESRSLATH  638

Query  340   FLLCMEENRLMEMLDGEVIEQGKKEDVVAMAWLAQRCLNFNGKKRPTMKEVATELDAIK  164
             FLL ME + L ++LD +V+E G KE+++A+A LAQRCLN NGKKRPTMKEVA EL+A++
Sbjct  639   FLLSMEHDCLFDILDAQVMEDGSKEEIIAVANLAQRCLNLNGKKRPTMKEVAAELEAVR  697



>ref|XP_006388727.1| hypothetical protein POPTR_0112s00220g [Populus trichocarpa]
 gb|ERP47641.1| hypothetical protein POPTR_0112s00220g [Populus trichocarpa]
Length=394

 Score =   410 bits (1053),  Expect = 1e-129, Method: Compositional matrix adjust.
 Identities = 207/316 (66%), Positives = 257/316 (81%), Gaps = 3/316 (1%)
 Frame = -1

Query  1099  NGGlllqqqlLTKEGTIEKTKIFTASELDKATDHFNADRIVGRGGQGTVYKGMLIDGQIV  920
             NGGLLLQQQL + +G+++KTKIF+++EL+KATD+FN  RI+G GGQGTVYKGML  G IV
Sbjct  55    NGGLLLQQQLSSSDGSVQKTKIFSSNELEKATDYFNESRILGHGGQGTVYKGMLAAGTIV  114

Query  919   AVKKSQAVDEDQLEPFINEVVILSQINHRNVVKLMGCCLETEVPILVYEFIPNGTLFGLI  740
             AVKKS+ VDED+LE FINEVVILSQI+HRNVV+L+GCCLET+VP+LVYEFIP+GTLF  +
Sbjct  115   AVKKSKIVDEDKLEEFINEVVILSQISHRNVVRLLGCCLETDVPLLVYEFIPSGTLFQYL  174

Query  739   HNNFDNELIPLSWDIRLRIASEVACALAYLHSVTLVPIYHRDIKTGNILLDEKFRAKVSD  560
             H    NE   LSW++RLRIASE A A++YLHS   +PIYHRDIK+ NILLDEK+RAKVSD
Sbjct  175   HEQ--NEDFTLSWELRLRIASEAAGAISYLHSTASIPIYHRDIKSTNILLDEKYRAKVSD  232

Query  559   FGTSRSISIDKTHFTTMVKGTFGYLDPEYFQSSQFTEKSDVYSFGVVLAELLTGQKPISF  380
             FGTSRS+SID+TH TT V+GTFGYLDPEYF++SQ TEKSDVYSFGVVL ELL+G+KPI F
Sbjct  233   FGTSRSVSIDQTHLTTKVQGTFGYLDPEYFRTSQLTEKSDVYSFGVVLVELLSGKKPI-F  291

Query  379   ELDDDEDRSLVSRFLLCMEENRLMEMLDGEVIEQGKKEDVVAMAWLAQRCLNFNGKKRPT  200
                  E  SL   F+  ME++RL +++D +V     +E+ + +A LA+RCLN NG+ RPT
Sbjct  292   LTHSLETMSLAEHFIKLMEDSRLFDIIDAQVKGDCSEEEAIVIANLAKRCLNLNGRNRPT  351

Query  199   MKEVATELDAIKASNS  152
             M+EVA EL+ I  S +
Sbjct  352   MREVAMELEGILLSRN  367



>ref|XP_006441112.1| hypothetical protein CICLE_v10024076mg [Citrus clementina]
 gb|ESR54352.1| hypothetical protein CICLE_v10024076mg [Citrus clementina]
Length=728

 Score =   421 bits (1083),  Expect = 2e-129, Method: Compositional matrix adjust.
 Identities = 223/357 (62%), Positives = 285/357 (80%), Gaps = 3/357 (1%)
 Frame = -1

Query  1228  LRPAIIGISASFGFVFLIWAFVILYkaikkrkmkklrqkffkRNGGlllqqqlLTKEGTI  1049
             L+    G        FL+     LYK +K+R+  KL+ KFFK+NGGLLLQQ+L + EG I
Sbjct  270   LKGYCAGCGGGLALFFLLIGIWWLYKFVKRRREIKLKHKFFKKNGGLLLQQELSSNEGNI  329

Query  1048  EKTKIFTASELDKATDHFNADRIVGRGGQGTVYKGMLIDGQIVAVKKSQAVDEDQLEPFI  869
             EK K+FT+ +L+ ATD++NA+RI+G+GGQG VYKGML DG+IVA+KKS+ +DE+ LE FI
Sbjct  330   EKMKLFTSKDLETATDNYNANRILGQGGQGIVYKGMLADGEIVAIKKSKILDENNLEQFI  389

Query  868   NEVVILSQINHRNVVKLMGCCLETEVPILVYEFIPNGTLFGLIHNNFDNELIPLSWDIRL  689
             NEVVILSQINHRNVVKL+GCCLETEVP+LVYEFI NG+L   IH  +++E  P++W++RL
Sbjct  390   NEVVILSQINHRNVVKLLGCCLETEVPLLVYEFILNGSLDQYIH--YESEEFPITWEMRL  447

Query  688   RIASEVACALAYLHSVTLVPIYHRDIKTGNILLDEKFRAKVSDFGTSRSISIDKTHFTTM  509
             RIA EV+ AL+YLHS   +PIYHRDIK+ NILLD+K+RAKVSDFG SRSI++D+TH TT 
Sbjct  448   RIAVEVSGALSYLHSAASIPIYHRDIKSANILLDDKYRAKVSDFGASRSITVDQTHLTTQ  507

Query  508   VKGTFGYLDPEYFQSSQFTEKSDVYSFGVVLAELLTGQKPISFELDDDEDRSLVSRFLLC  329
             V+G+FGYLDPEYF+SS FT+KSDVYSFGVVL ELLTGQKPI   +  +ED+SL   F+L 
Sbjct  508   VQGSFGYLDPEYFRSSHFTDKSDVYSFGVVLVELLTGQKPIRSTV-AEEDKSLARYFILA  566

Query  328   MEENRLMEMLDGEVIEQGKKEDVVAMAWLAQRCLNFNGKKRPTMKEVATELDAIKAS  158
             M+ENRL E+LD  V+++ +KE+++ +A L +RCLN NGKKRPTMKEVA EL  I+ S
Sbjct  567   MKENRLFEVLDDRVLKEAEKEEIITVATLTKRCLNLNGKKRPTMKEVAFELRGIRES  623



>gb|KCW47700.1| hypothetical protein EUGRSUZ_K01438 [Eucalyptus grandis]
Length=725

 Score =   421 bits (1082),  Expect = 2e-129, Method: Compositional matrix adjust.
 Identities = 273/582 (47%), Positives = 360/582 (62%), Gaps = 47/582 (8%)
 Frame = -1

Query  1849  TITIKESISPSCQGSNNFSNIIHNSKLSETPFMYSNDNN-FMLFGCGNAFITMPGEELDQ  1673
             ++ I  S + SC  + +F+ +     L  + F++S   N F   GCG  F+ M   +   
Sbjct  109   SLPILYSSNVSCGVNKSFAPV----SLKGSQFVFSESRNVFAAVGCGIRFL-MDDTKSAI  163

Query  1672  PGYNLNCSSKNTTAPKTAHDCQGIN-CNHLTVDYDVNTYQVNFTHSSSF---NACNYAFF  1505
              G   +C + N         C G + C   T+  D+  ++VNF  ++     N C YAF 
Sbjct  164   IGCTSSCGADNDVVGNVT--CSGSDGCCQTTITSDLQAFRVNFQPNNGTVGNNECKYAFL  221

Query  1504  lsassslpptlqslpsrqQEMVVVPVELRWTITQEDVPP----------SYSKYCSPSTY  1355
                S  +P T      R        +E  W I +   P             S YCS   +
Sbjct  222   GDRSQFVPATTDFDELRASGRFAAVLE--WGIAESSEPALEIYNYDYISGDSYYCSTVGF  279

Query  1354  INPQLQWHNYLQCDCPGGDDRNVYLSGGCEWKHKDYVIS-----SNKLRPAIIGISASFG  1190
                      +LQC C GG   N Y+  GCE K   Y IS     ++  +  I+ +  S G
Sbjct  280   NLGYRVAMPFLQCSCRGGFTGNPYIRHGCEGKSLRYHISIFCSSNHSCKFLILALQISLG  339

Query  1189  FVFLIWAFVILYkaikkrkmkklrqkffkRNGGlllqqqlLTKEGTIEKTKIFTASELDK  1010
              + L+    +LYK + KRK  KL++++FK+NGGLLLQQQL + E  ++ +K+   S    
Sbjct  340   ALLLLLLLWLLYKFMMKRKEIKLKERYFKQNGGLLLQQQLHSSENNVDNSKLTEYS----  395

Query  1009  ATDHFNADRIVGRGGQGTVYKGMLIDGQIVAVKKSQAVDEDQLEPFINEVVILSQINHRN  830
                         +GGQGTVYKGML DG IVA+KKS+A+ + ++E FINE+ ILSQINHRN
Sbjct  396   -----------AKGGQGTVYKGMLADGGIVAIKKSKAIHKGKVEQFINEIAILSQINHRN  444

Query  829   VVKLMGCCLETEVPILVYEFIPNGTLFGLIHNNFDNELIPLSWDIRLRIASEVACALAYL  650
             VVKL+GCCLETE+P+LVYEFIPNGTLF  +H    NE   +SWD RL+IA+EVA AL+YL
Sbjct  445   VVKLLGCCLETELPLLVYEFIPNGTLFQYLHA--PNEEFIVSWDTRLQIATEVAGALSYL  502

Query  649   HSVTLVPIYHRDIKTGNILLDEKFRAKVSDFGTSRSISIDKTHFTTMVKGTFGYLDPEYF  470
             HS   +PIYHRDIK+ NILLD+K+RAKV+DFGTS+S+ +D+TH TT V+GTFGYLDPEYF
Sbjct  503   HSSASIPIYHRDIKSTNILLDDKYRAKVADFGTSKSVMLDQTHVTTRVQGTFGYLDPEYF  562

Query  469   QSSQFTEKSDVYSFGVVLAELLTGQKPISFELDDDEDRSLVSRFLLCMEENRLMEMLDGE  290
             QSSQFT+KSDVYSFGVVL ELLTGQKPISF L DDE+R+L S FLL M++NRL +++D E
Sbjct  563   QSSQFTDKSDVYSFGVVLVELLTGQKPISF-LRDDEERNLASYFLLSMDDNRLFDIVDAE  621

Query  289   VIEQGKKEDVVAMAWLAQRCLNFNGKKRPTMKEVATELDAIK  164
             V++QGKKE +VA A LA+ CLN +GK RP MKEVA EL+ I+
Sbjct  622   VLKQGKKEGIVAFASLARSCLNLHGKTRPPMKEVAIELERIR  663



>ref|XP_010415630.1| PREDICTED: wall-associated receptor kinase-like 9 [Camelina sativa]
Length=799

 Score =   423 bits (1088),  Expect = 2e-129, Method: Compositional matrix adjust.
 Identities = 225/420 (54%), Positives = 304/420 (72%), Gaps = 25/420 (6%)
 Frame = -1

Query  1336  WHNYLQCDCPGGDDRNVYLSGGC------EWKHKD-----------------YVISSNKL  1226
             + +Y +C C  G + N Y   GC      + K  D                 Y       
Sbjct  318   YLSYARCSCNRGFEGNPYSLDGCKDINECQLKKSDGTPSHCSDSKCVNLRGSYDCVYTNH  377

Query  1225  RPAIIGISASFGFVFLIWAFVILYkaikkrkmkklrqkffkRNGGlllqqqlLTKEGTIE  1046
             RP  IG+ AS G +  +    +LYK IKK++    ++KFFKRNGGLLLQQQL + +GT+E
Sbjct  378   RPLAIGLGASIGSLLFVGGIYLLYKFIKKQRKLYQKKKFFKRNGGLLLQQQLTSTQGTVE  437

Query  1045  KTKIFTASELDKATDHFNADRIVGRGGQGTVYKGMLIDGQIVAVKKSQAVDEDQLEPFIN  866
              TK+F++ EL+KAT++F+++RI+G+GGQGTVYKGML DG+IVAVKKS+ VDED+LE FIN
Sbjct  438   TTKVFSSRELEKATENFSSNRILGQGGQGTVYKGMLADGRIVAVKKSKVVDEDKLEEFIN  497

Query  865   EVVILSQINHRNVVKLMGCCLETEVPILVYEFIPNGTLFGLIHNNFDNELIPLSWDIRLR  686
             EVVILSQINHRN+VKL+GCCLET VP+LVYEF+PNG LF  +H+ FD+  +  +W +RLR
Sbjct  498   EVVILSQINHRNIVKLLGCCLETHVPVLVYEFVPNGNLFEHLHDEFDDNTMA-TWKVRLR  556

Query  685   IASEVACALAYLHSVTLVPIYHRDIKTGNILLDEKFRAKVSDFGTSRSISIDKTHFTTMV  506
             +A ++A AL+YLHS    P+YHRD+K+ NI+LDEK+RAKVSDFGTSRS+++D TH TT+V
Sbjct  557   MAIDIASALSYLHSSASSPVYHRDVKSTNIMLDEKYRAKVSDFGTSRSVTVDHTHLTTVV  616

Query  505   KGTFGYLDPEYFQSSQFTEKSDVYSFGVVLAELLTGQKPISFELDDDEDRSLVSRFLLCM  326
              GT GY+DPEYFQSSQFT+KSDVYSFGVVLAEL+TG+K ISF L   E+R+L + F+  M
Sbjct  617   SGTVGYMDPEYFQSSQFTDKSDVYSFGVVLAELITGEKSISF-LRSQENRTLATYFICAM  675

Query  325   EENRLMEMLDGEVIEQGKKEDVVAMAWLAQRCLNFNGKKRPTMKEVATELDAIKASNSHL  146
             +EN+L +++D  + +  +   V A A +A++CLN  G+KRP+M+EV+ ELD I+ S+  +
Sbjct  676   KENKLFDIIDARIRDGCELNQVTAAAKVARKCLNLKGRKRPSMREVSMELDNIRMSSGDM  735



>ref|XP_009104507.1| PREDICTED: wall-associated receptor kinase-like 10 [Brassica 
rapa]
Length=791

 Score =   423 bits (1087),  Expect = 3e-129, Method: Compositional matrix adjust.
 Identities = 225/416 (54%), Positives = 305/416 (73%), Gaps = 23/416 (6%)
 Frame = -1

Query  1330  NYLQCDCPGGDDRNVYLSGGCE-----------WKHK--------DYVISSNKLRPAIIG  1208
             N   C C  G   N Y+ GGC+           W           + V S+++L    IG
Sbjct  322   NDASCRCNRGYMGNPYIPGGCKDINECTSVDNCWGGTCVNLQGSFNCVYSNHRL---AIG  378

Query  1207  ISASFGFVFLIWAFVILYkaikkrkmkklrqkffkRNGGlllqqqlLTKEGTIEKTKIFT  1028
               +SFG +  I     LY+ I+K++    ++KFFKRNGGLLLQQQL + +G+++KT++F+
Sbjct  379   FGSSFGSLIFIVGIYGLYRFIRKQRRLNQKKKFFKRNGGLLLQQQLTSTKGSVDKTRVFS  438

Query  1027  ASELDKATDHFNADRIVGRGGQGTVYKGMLIDGQIVAVKKSQAVDEDQLEPFINEVVILS  848
             + EL+KAT+ F+  RI+G+GGQGTVYKGML+DG+IVAVKKS+ VDED+LE FINEVVILS
Sbjct  439   SRELEKATEKFSTTRILGQGGQGTVYKGMLVDGRIVAVKKSKVVDEDKLEEFINEVVILS  498

Query  847   QINHRNVVKLMGCCLETEVPILVYEFIPNGTLFGLIHNNFDNELIPLSWDIRLRIASEVA  668
             QINHRN+VKL+GCCLET+VP+LVYEFIPNG LF  +H +  ++    +W++RLRIA ++A
Sbjct  499   QINHRNIVKLLGCCLETDVPVLVYEFIPNGNLFEHLHEDESDDHTMTTWEVRLRIAIDIA  558

Query  667   CALAYLHSVTLVPIYHRDIKTGNILLDEKFRAKVSDFGTSRSISIDKTHFTTMVKGTFGY  488
              AL+YLHS    PIYHRD+K+ NI+LDEK+RAKVSDFGTSR++++D TH TT+V GT GY
Sbjct  559   SALSYLHSAASSPIYHRDVKSTNIMLDEKYRAKVSDFGTSRTVTVDHTHLTTVVSGTVGY  618

Query  487   LDPEYFQSSQFTEKSDVYSFGVVLAELLTGQKPISFELDDDEDRSLVSRFLLCMEENRLM  308
             +DPEYFQSSQFT+KSDVYSFGVVLAEL+TG+K +SF L   E+R+L + F L M+ENRL+
Sbjct  619   VDPEYFQSSQFTDKSDVYSFGVVLAELITGEKSVSF-LRSQENRTLATYFFLAMKENRLL  677

Query  307   EMLDGEVIEQGKKEDVVAMAWLAQRCLNFNGKKRPTMKEVATELDAIKASNSHLPL  140
             +++D  + +  K   V A A LA++CLN  G+KRP+M+EV+ EL+ I+ S+  + L
Sbjct  678   DIIDARIRDGCKLNQVTATANLARKCLNLKGRKRPSMREVSMELEKIRGSSVDMEL  733



>gb|KHN44654.1| Wall-associated receptor kinase-like 8 [Glycine soja]
Length=690

 Score =   419 bits (1077),  Expect = 4e-129, Method: Compositional matrix adjust.
 Identities = 258/539 (48%), Positives = 343/539 (64%), Gaps = 28/539 (5%)
 Frame = -1

Query  1762  TPFMYSND-NNFMLFGCGN-AFITMPGEELDQPGYNLNCSSK-NTTAPKTAHDCQGINCN  1592
             +PF+YS   N F+  GCGN A     GEE+        C+S  N        +C+G  C 
Sbjct  120   SPFVYSARYNTFLAVGCGNTASFWSNGEEVRA------CASMCNGDDLIKVANCRGRKCC  173

Query  1591  HLTVDYDVNTYQVNFTHSSSFNACNYAFFlsassslpptlqslpsrqQEMVVVPVELRWT  1412
               ++   ++ Y V+F        C Y   ++                 E   VP  L W 
Sbjct  174   QTSLPRHLSEYNVSFDGQE----CAYGLIIAVRLGYWNLTIKDVKHLNE---VPAVLEWE  226

Query  1411  ITQEDVPPSYSKYCSPSTYI--NPQLQWHNYLQCDCPGGDDRNVYLSGGCEWKHKDYVIS  1238
             I  +    + S    P+  I  N  L+ H     D   G           ++K   Y+  
Sbjct  227   IPFDTFYSNISFLIDPAVAICYNTSLKQHP----DYYSGKLCRCRYDDDDDFKGSPYIRG  282

Query  1237  SNKL-RPAIIGISASFGFVFLIWAFVILYkaikkrkmkklrqkffkRNGGlllqqqlLTK  1061
             S K  +   +G+ +S G + L++    L K ++K+  KK ++KFFK+NGGLLL+Q+L T 
Sbjct  283   SCKATKFKCVGVFSSLGTIILLFGLWWLRKVVRKKIAKKRKEKFFKQNGGLLLEQRLSTG  342

Query  1060  EGTIEKTKIFTASELDKATDHFNADRIVGRGGQGTVYKGMLIDGQIVAVKKSQAVDEDQL  881
             E  ++KTK+F+  EL KATDHFN +RI+G+GGQGTVYKGML+DG+IVAVKK +      +
Sbjct  343   EDNVDKTKLFSLKELGKATDHFNINRILGKGGQGTVYKGMLVDGKIVAVKKFKV--NGNV  400

Query  880   EPFINEVVILSQINHRNVVKLMGCCLETEVPILVYEFIPNGTLFGLIHNNFDNELIPLSW  701
             E FINE VILSQINHRNVVKL+GCCLETE+P+LVYEFIPNG L+  +     N+ +P +W
Sbjct  401   EEFINEFVILSQINHRNVVKLLGCCLETEIPLLVYEFIPNGNLYEYLLG--QNDELPNAW  458

Query  700   DIRLRIASEVACALAYLHSVTLVPIYHRDIKTGNILLDEKFRAKVSDFGTSRSISIDKTH  521
             ++RLRIA+EVA AL YLHS    PIYHRD+K+ NILLDEK++AKV+DFG SR +SI+ TH
Sbjct  459   EMRLRIATEVAGALFYLHSAASQPIYHRDVKSTNILLDEKYKAKVADFGASRMVSIEATH  518

Query  520   FTTMVKGTFGYLDPEYFQSSQFTEKSDVYSFGVVLAELLTGQKPISFELDDDEDRSLVSR  341
              TT V+GTFGYLDPEYFQ+SQFTEKSDVYSFGVVL ELLTGQKPIS  + +   +SL S 
Sbjct  519   LTTAVQGTFGYLDPEYFQTSQFTEKSDVYSFGVVLVELLTGQKPIS-SVKEQGLQSLASY  577

Query  340   FLLCMEENRLMEMLDGEVIEQGKKEDVVAMAWLAQRCLNFNGKKRPTMKEVATELDAIK  164
             FLLCMEENRL +++D  V+++G+KE ++ +A L +RCL  NG+KRPTMKEV+ EL+ I+
Sbjct  578   FLLCMEENRLFDIVDARVMQEGEKEHIIVVANLVRRCLQLNGRKRPTMKEVSLELERIQ  636



>emb|CBI15571.3| unnamed protein product [Vitis vinifera]
Length=908

 Score =   426 bits (1094),  Expect = 5e-129, Method: Compositional matrix adjust.
 Identities = 206/309 (67%), Positives = 258/309 (83%), Gaps = 6/309 (2%)
 Frame = -1

Query  1066  TKEGTIEKTKIFTASELDKATDHFNADRIVGRGGQGTVYKGMLIDGQIVAVKKSQAVDED  887
             + E +IE TKIFT +EL KA+D+FN +RI+GRGGQGTVYKGML DG+IVA+KKS+ VDE 
Sbjct  536   SNEISIENTKIFTFNELKKASDNFNENRILGRGGQGTVYKGMLTDGRIVAIKKSKIVDES  595

Query  886   QLEPFINEVVILSQINHRNVVKLMGCCLETEVPILVYEFIPNGTLFGLIHNNFDNELIPL  707
             Q E FINE+VILSQ+NHRN+VKL+GCCLE EVP+LVYEFI +GTLF LIH+  +N  +P 
Sbjct  596   QYEQFINEIVILSQLNHRNIVKLLGCCLEIEVPLLVYEFISHGTLFQLIHD--ENNELPF  653

Query  706   SWDIRLRIASEVACALAYLHSVTLVPIYHRDIKTGNILLDEKFRAKVSDFGTSRSISIDK  527
             SW+ RL IA+EVA ALAYLHS +  PI+HRDIK+ NILLDEK+RAKV+DFGTSRS+SID+
Sbjct  654   SWERRLEIATEVAGALAYLHSASSTPIFHRDIKSKNILLDEKYRAKVADFGTSRSVSIDQ  713

Query  526   THFTTMVKGTFGYLDPEYFQSSQFTEKSDVYSFGVVLAELLTGQKPISFELDDDEDRSLV  347
             TH TT+V+GTFGYLDPEYF++ QFTEKSDVYSFG+VL ELLTGQKPIS     +E+RSL 
Sbjct  714   THLTTLVRGTFGYLDPEYFRTGQFTEKSDVYSFGIVLVELLTGQKPIS-STRTEEERSLA  772

Query  346   SRFLLCMEENRLMEMLDGEVIEQGKKEDVVAMAWLAQRCLNFNGKKRPTMKEVATELDAI  167
             S F+L +EE  L ++LD +V+++G +E+++A+  +A +CLN NGKKRPTMKEVA EL+ +
Sbjct  773   SYFILSIEETNLFDILDAQVVKEGGEEEIMAVVNVATQCLNLNGKKRPTMKEVALELERV  832

Query  166   KASNSHLPL  140
             K   SHLPL
Sbjct  833   K---SHLPL  838


 Score = 63.2 bits (152),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 62/226 (27%), Positives = 100/226 (44%), Gaps = 27/226 (12%)
 Frame = -1

Query  1927  THPDIQQNVRIIYECVDFLGMSYDSQTITIKESISPSCQGSNNFSNIIHNSKLSETPFMY  1748
             +HP++  N+++      F+ ++Y  Q +T+   ++  CQ  +   +      LS+TPF Y
Sbjct  253   SHPEL--NLKLT-----FVSLAY--QLVTVISPMAVYCQDHDRNRSTWKGIDLSKTPFFY  303

Query  1747  SNDNNFMLFGCGNA-FITMPGEELDQPGYNLNCSSK-NTTAPKTAHDCQGINCNHLTVDY  1574
             S  N   + GC N+  IT  G  L        CSS  + ++   ++ C GINC   TV  
Sbjct  304   SEGNALRVVGCANSVLITRQGTIL------AGCSSICDNSSSVLSNGCYGINCCKTTVPS  357

Query  1573  DVNTYQVNFTHSSSFNA---CNYAFFlsassslpptlqslpsrqQEMVVVPVELRWTITQ  1403
             +++ Y +N T S++      C YA F         +  S    +        E+ W I +
Sbjct  358   NLDFYILNTTWSTNMGTELNCTYAAFGRNFILRGKSSGSGMEYEASS---EGEMIWMI-K  413

Query  1402  EDVPPSYSKYCSPSTYINPQLQWHNYLQCDCPGGDDRNVYLSGGCE  1265
             E V  S    C  +T  +  L  H+Y  C CP   + N YL  GC+
Sbjct  414   ESVEGS---DCHKNTVPDGALGNHSYYSCSCPAYQEGNPYLPNGCQ  456


 Score = 60.5 bits (145),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 50/90 (56%), Positives = 68/90 (76%), Gaps = 1/90 (1%)
 Frame = -1

Query  1210  GISASFGFVFLIWAFVILYkaikkrkmkklrqkffkRNGGlllqqqlLTKEGTIEKTKIF  1031
             G+S   G +FL+     LYK +KKR+  KL+++FFK+NGGLLLQQQ+ + +  +EKTKIF
Sbjct  95    GLSVVGGSLFLLLGSFWLYKVLKKRREIKLKKQFFKQNGGLLLQQQISSNK-VVEKTKIF  153

Query  1030  TASELDKATDHFNADRIVGRGGQGTVYKGM  941
             T  EL+KA D+FN +RI+ +GGQGTVYK M
Sbjct  154   TTEELEKAIDNFNTNRILDQGGQGTVYKEM  183



>ref|XP_011078223.1| PREDICTED: wall-associated receptor kinase-like 8 [Sesamum indicum]
Length=714

 Score =   419 bits (1078),  Expect = 7e-129, Method: Compositional matrix adjust.
 Identities = 213/312 (68%), Positives = 256/312 (82%), Gaps = 3/312 (1%)
 Frame = -1

Query  1099  NGGlllqqqlLTKEGTIEKTKIFTASELDKATDHFNADRIVGRGGQGTVYKGMLIDGQIV  920
             NGGLLL+QQL + +  +EKTK+FT+ EL  ATDH+N +RI+G GGQGTVYKGML DG+IV
Sbjct  349   NGGLLLEQQLSSTDNGLEKTKLFTSKELAAATDHYNENRILGHGGQGTVYKGMLADGRIV  408

Query  919   AVKKSQAVDEDQLEPFINEVVILSQINHRNVVKLMGCCLETEVPILVYEFIPNGTLFGLI  740
             AVKKS+ VDED LE FINE+VILSQINHRNVVKL GCCLE EVP+LVYEFIPNGTLF  I
Sbjct  409   AVKKSKRVDEDDLEVFINEIVILSQINHRNVVKLHGCCLENEVPLLVYEFIPNGTLFRHI  468

Query  739   HNNFDNELIPLSWDIRLRIASEVACALAYLHSVTLVPIYHRDIKTGNILLDEKFRAKVSD  560
             H    NE  PLSW++R RIA +VA AL+YLHS    PIYHRDIK+ NILLDEK+ AKVSD
Sbjct  469   HE--PNEDFPLSWEMRTRIARDVAGALSYLHSAAYAPIYHRDIKSTNILLDEKYGAKVSD  526

Query  559   FGTSRSISIDKTHFTTMVKGTFGYLDPEYFQSSQFTEKSDVYSFGVVLAELLTGQKPISF  380
             FGTS+S++ID+TH TT V GTFGYLDPEYFQSSQFTEKSDVYSFGVV+ ELLTG+K IS 
Sbjct  527   FGTSKSVAIDQTHLTTRVLGTFGYLDPEYFQSSQFTEKSDVYSFGVVMVELLTGEKAIS-  585

Query  379   ELDDDEDRSLVSRFLLCMEENRLMEMLDGEVIEQGKKEDVVAMAWLAQRCLNFNGKKRPT  200
              +  +  +SL + FL  MEE+ L ++LD  V+++G +E+VVA+A LA+RCL+ NGK+RPT
Sbjct  586   SVRAEVGKSLATHFLHSMEEDHLFDILDPRVLKEGSREEVVAIAELARRCLHLNGKRRPT  645

Query  199   MKEVATELDAIK  164
             MKEVA EL+ I+
Sbjct  646   MKEVAVELEGIQ  657



>emb|CDY15528.1| BnaA08g28120D [Brassica napus]
Length=756

 Score =   420 bits (1080),  Expect = 9e-129, Method: Compositional matrix adjust.
 Identities = 274/639 (43%), Positives = 376/639 (59%), Gaps = 69/639 (11%)
 Frame = -1

Query  1921  PDIQQNVRIIY--ECVDFLGMSYDSQTITIKESISPSCQGSNNFSNIIHNSK---LSETP  1757
             P I + V  I+  E   + G +Y S  + IK +I+    G +N S+ I   +    + TP
Sbjct  73    PKIDKEVVKIFLPEPTGYEGDNYGS--LRIKTNITS--MGCSNTSDEIKFGEPLNFTGTP  128

Query  1756  FMYSNDNNFMLFGCG-NAFITMPGEELDQPGYNLNCSSKNTTAPKTAHD---CQGINCNH  1589
             F     N F+  GC   A +T     L      + C S  T  PK   D   C+G  C  
Sbjct  129   FTIGRSNIFLAIGCNYKATLTHLEPRL------VGCIS--TCEPKKIRDYTSCRGDKCCQ  180

Query  1588  L--------TVDYDVNTYQVNFTHSSSFNACNYAFFlsassslpptlqslpsrqQ---EM  1442
                       V   +  +  N T       C  AF    +   P    +  +  Q   + 
Sbjct  181   ADPPSGIRQIVGISMEEFSSNITRE---RGCRVAFLTDENRDRPAYPVAKFTDPQWFYDR  237

Query  1441  VVVPVELRWTITQEDVPPSYSKYCSPSTYINP--------QLQWHNYLQCDCPGGDDRNV  1286
               V ++LRW I   ++    S  C    YIN              + + C C  G   N 
Sbjct  238   QYVILQLRWAIPMTNLSFVNSLRCPMHQYINSINPCGCSNTDDGSSNVGCACNYGYTGNP  297

Query  1285  YLSGGCE------------------------WKHKDYVISSNKLRPAIIGISASFGFVFL  1178
             Y+ GGC+                              V+  NK  P  IG+   FG + +
Sbjct  298   YIMGGCKDIDECQLDSNIKYCRRQGGTCVNTPGASSCVVKKNKTVPITIGLCVGFGVLIV  357

Query  1177  IWAFVILYkaikkrkmkklrqkffkRNGGlllqqqlLTKEGTIEKTKIFTASELDKATDH  998
                 + LYK IKK++    ++K FKRNGGLLL+QQL + EG+IEKTK+FT+ EL+KAT++
Sbjct  358   SGGTLWLYKIIKKQRKINRKKKLFKRNGGLLLKQQLTSTEGSIEKTKVFTSKELEKATEN  417

Query  997   FNADRIVGRGGQGTVYKGMLIDGQIVAVKKSQAVDEDQLEPFINEVVILSQINHRNVVKL  818
             F++ R++G+GGQGTVYKGML+DG+IVAVKKS  VDED+LE FINEVVILSQINHRN+VKL
Sbjct  418   FSSTRVLGQGGQGTVYKGMLVDGRIVAVKKSTVVDEDKLEEFINEVVILSQINHRNIVKL  477

Query  817   MGCCLETEVPILVYEFIPNGTLFGLIHNNFDNELIPLSWDIRLRIASEVACALAYLHSVT  638
             +GCCLETEVP+LVYEFI NG LF  +H  FD   +  +W++RL I  ++A AL+YLHS  
Sbjct  478   IGCCLETEVPLLVYEFISNGNLFEHLHGEFDESAM-TTWEMRLCIVIDIAGALSYLHSAA  536

Query  637   LVPIYHRDIKTGNILLDEKFRAKVSDFGTSRSISIDKTHFTTMVKGTFGYLDPEYFQSSQ  458
               PI+HRD+K+ NI+LDEK+RAKV+DFGTSRS+++D TH TT+V GT GY+DPEYFQSSQ
Sbjct  537   ASPIFHRDVKSTNIMLDEKYRAKVADFGTSRSVTVDHTHLTTVVSGTVGYVDPEYFQSSQ  596

Query  457   FTEKSDVYSFGVVLAELLTGQKPISFELDDDEDRSLVSRFLLCMEENRLMEMLDGEVIEQ  278
             FT+KSDVYSFGVVL EL+TG+KPISF +   + R+L + F++ MEENR+++++D ++ + 
Sbjct  597   FTDKSDVYSFGVVLVELITGEKPISF-VRLQQSRTLATYFIVAMEENRVVDIIDPQIRDD  655

Query  277   GKKEDVVAMAWLAQRCLNFNGKKRPTMKEVATELDAIKA  161
                E V+A A LA+RCLN NG+ RP+M+EV+ EL+ I++
Sbjct  656   CNLEQVMAAAQLARRCLNLNGRNRPSMREVSMELERIRS  694



>ref|XP_003534789.2| PREDICTED: wall-associated receptor kinase-like 1-like isoform 
X1 [Glycine max]
Length=724

 Score =   419 bits (1077),  Expect = 1e-128, Method: Compositional matrix adjust.
 Identities = 260/591 (44%), Positives = 355/591 (60%), Gaps = 58/591 (10%)
 Frame = -1

Query  1849  TITIKESI-SPSCQGSNNFSNIIHNSKLSETPFMYS-NDNNFMLFGCGNAFITMPGEELD  1676
             T+ IK  I  P C         +    L  +PF+YS N N+F+  GC NA I +  + + 
Sbjct  109   TVGIKNPIFHPGC------GKTVTGINLEGSPFVYSQNYNSFVGVGCQNAAIMLSNDTIL  162

Query  1675  QPGYNLNCSSKNTTAPKTAHDCQGINCNHLTVD-----YDVNTYQVNFTHSSSFNACNYA  1511
                 ++               C+G  C   ++      Y+++T  V    +      NY 
Sbjct  163   TACMSVCYEHLEKGNDIDISSCRGSYCCETSLPPYLSAYNISTETVEVKSNIKAECSNYL  222

Query  1510  --------FFlsassslpptlqslpsrqQEMVVVPVELRWTI---TQEDVPPSYS-----  1379
                     F                   ++   VP  L W I   T  +  P +      
Sbjct  223   LIRAEYSNFKYEYDEYNSSYWVPTLGDLKKQKDVPAVLEWEIPIHTPNNSFPEFRTDAYG  282

Query  1378  ------KYCSPSTYINPQLQWHNYLQCDCPGGDDRNVYLSGGCEWKHKDYVISSNKLRPA  1217
                    Y + ++ + PQ  W    +C C  G + N Y+  GC              + +
Sbjct  283   HGSYNCSYTNVTSSLYPQSGW----RCSCSDGFEGNPYIQEGC--------------KLS  324

Query  1216  IIGISASFGFVFLIWAFVILYkaikkrkmkklrqkffkRNGGlllqqqlLTKEGTIEKTK  1037
             + G+ +S G + L++    L K ++K+  KK ++KFFK+NGGLLL+Q+L T E  ++KTK
Sbjct  325   LDGVFSSIGTIILLFGLWRLRKVVRKKIAKKRKEKFFKQNGGLLLEQRLSTGEVNVDKTK  384

Query  1036  IFTASELDKATDHFNADRIVGRGGQGTVYKGMLIDGQIVAVKKSQAVDEDQLEPFINEVV  857
             +F+  EL KATDHFN +RI+G+GGQGTVYKGML+DG+IVAVKK +      +E FINE V
Sbjct  385   LFSLKELGKATDHFNINRILGKGGQGTVYKGMLVDGKIVAVKKFKV--NGNVEEFINEFV  442

Query  856   ILSQINHRNVVKLMGCCLETEVPILVYEFIPNGTLFGLIHNNFDNELIPLSWDIRLRIAS  677
             ILSQINHRNVVKL+GCCLETE+P+LVYEFIPNG L+  +H    N+ +P++WD+RLRIA+
Sbjct  443   ILSQINHRNVVKLLGCCLETEIPLLVYEFIPNGNLYEYLHG--QNDELPMTWDMRLRIAT  500

Query  676   EVACALAYLHSVTLVPIYHRDIKTGNILLDEKFRAKVSDFGTSRSISIDKTHFTTMVKGT  497
             EVA AL YLHS    PIYHRD+K+ NILLDEK++AKV+DFG SR +SI+ TH TT V+GT
Sbjct  501   EVAGALFYLHSAASQPIYHRDVKSTNILLDEKYKAKVADFGASRMVSIEATHLTTAVQGT  560

Query  496   FGYLDPEYFQSSQFTEKSDVYSFGVVLAELLTGQKPISFELDDDEDRSLVSRFLLCMEEN  317
             FGYLDPEYF +SQ TEKSDVYSFGVVL ELLTGQKPIS  +++   +SL S FLLCMEEN
Sbjct  561   FGYLDPEYFHTSQLTEKSDVYSFGVVLVELLTGQKPIS-SVNEQGLQSLASYFLLCMEEN  619

Query  316   RLMEMLDGEVIEQGKKEDVVAMAWLAQRCLNFNGKKRPTMKEVATELDAIK  164
             R  +++D  V+++ +KE ++ +A LA+RCL  NG+KRPTMKEV  EL++I+
Sbjct  620   RFFDIVDARVMQEVEKEHIIVVANLARRCLQLNGRKRPTMKEVTLELESIQ  670



>ref|XP_006492575.1| PREDICTED: wall-associated receptor kinase-like 1-like isoform 
X2 [Citrus sinensis]
Length=606

 Score =   415 bits (1067),  Expect = 1e-128, Method: Compositional matrix adjust.
 Identities = 269/603 (45%), Positives = 366/603 (61%), Gaps = 69/603 (11%)
 Frame = -1

Query  1831  SISPSCQGSNNFSNIIHNSKLSETPFMYSN-DNNFMLFGCGN-AFITMPGEELDQPGYNL  1658
             S+  SCQ      + ++  KL   PF +S  DN F   GC N A ++    +    G   
Sbjct  6     SVIRSCQDKTKEPSFVNLEKL---PFYFSYYDNIFSGIGCNNLASMSSADHDFILGGCFS  62

Query  1657  NCSSKNTTAPKTAHDCQGINCNHLTVDYDVNTYQVNFTHSSSF-------NACNYAFFls  1499
              C  +N T   +   C GI C    V + + ++ ++  +++S          C YAF + 
Sbjct  63    ICDPRNKTDDDS---CNGIACCKAGVPWALKSFNISINNAASSRSSSQEEGKCKYAFMVE  119

Query  1498  assslpptlqslpsrqQEMVVVPVELRWTI-------TQEDVPPSYSK--YCSPSTYINP  1346
                       +   +    V  PV L W I        ++D  P ++   +C P      
Sbjct  120   KEWFESNFKSAEAVQDWNQV--PVILDWRIPNSSFGKLEKDKSPEFTSTSHCRPDE----  173

Query  1345  QLQWHNYLQCDCPGGDDRNVYLSGGC----EWKHKDYVISSN--------------KLRP  1220
                      C C      N Y   GC    E +      S N                RP
Sbjct  174   ----SGLFGCSCKEKYHGNPYFLHGCLDIDECRDGIANCSGNLHCENYEGGYRCVNPKRP  229

Query  1219  AI--------IGISASFGFVFLIWAFVILYkaikkrkmkklrqkffkRNGGlllqqqlLT  1064
              +         G+   F  +  +W  +I+      RK  K ++K FK+NGGLLLQQQL +
Sbjct  230   KVHTIILGIGTGLGGLFLSIGALWLCIII------RKRIKQKEKNFKKNGGLLLQQQLNS  283

Query  1063  KEGTIEKTKIFTASELDKATDHFNADRIVGRGGQGTVYKGMLIDGQIVAVKKSQAVDEDQ  884
               G+I++ +IF + ELDKATD+FN +RI+G+GGQGTVYKGML DG+I+AVKKS+ VDE +
Sbjct  284   IGGSIDRCRIFNSKELDKATDYFNMNRILGQGGQGTVYKGMLADGRIIAVKKSKVVDESK  343

Query  883   LEPFINEVVILSQINHRNVVKLMGCCLETEVPILVYEFIPNGTLFGLIHNNFDNELIPLS  704
             LE FINEVVILSQINHRNVVKL+GCCLE EVP+LVYEFIPNGTLF  +H+   +E + L+
Sbjct  344   LEEFINEVVILSQINHRNVVKLLGCCLEVEVPLLVYEFIPNGTLFQYLHD--PSEELSLT  401

Query  703   WDIRLRIASEVACALAYLHSVTLVPIYHRDIKTGNILLDEKFRAKVSDFGTSRSISIDKT  524
             W++RLRIA+EVA ALAYLHS   +PIYHRDIK+ NILLDEK+RAK++DFGTSRSI+ID+T
Sbjct  402   WEMRLRIATEVAEALAYLHSSAYLPIYHRDIKSTNILLDEKYRAKIADFGTSRSIAIDQT  461

Query  523   HFTTMVKGTFGYLDPEYFQSSQFTEKSDVYSFGVVLAELLTGQKPISFELDDDEDRSLVS  344
             H +T V+GTFGYLDPEYF+SSQFT+KSDVYSFGVVL ELLTGQKPIS  +  +E ++L +
Sbjct  462   HVSTKVQGTFGYLDPEYFRSSQFTDKSDVYSFGVVLVELLTGQKPIS-SIWANEGQNLTT  520

Query  343   RFLLCMEENRLMEMLDGEVIEQGKKEDVVAMAWLAQRCLNFNGKKRPTMKEVATELDAIK  164
              F+ C+EEN L +++D +V + G+ E+++A++ +A+RCLN  G+ RPTMKEVA EL+ I+
Sbjct  521   YFVECIEENCLFDIIDDQVRKSGEAEEIMAVSDVAKRCLNSYGRNRPTMKEVAMELERIR  580

Query  163   ASN  155
             A++
Sbjct  581   ANS  583



>ref|XP_010474237.1| PREDICTED: wall-associated receptor kinase-like 9 [Camelina sativa]
Length=791

 Score =   421 bits (1082),  Expect = 1e-128, Method: Compositional matrix adjust.
 Identities = 224/421 (53%), Positives = 301/421 (71%), Gaps = 30/421 (7%)
 Frame = -1

Query  1336  WHNYLQCDCPGGDDRNVYLSGGCE------------------------WKHKDYVISSNK  1229
             + +Y +C C  G + N YL  GC+                          H  +    + 
Sbjct  314   YLSYARCSCRFGFEGNPYLLDGCKDFNECQVKLSDGTSTFCGPRASCVNLHGSFDCVYSN  373

Query  1228  LRPAIIGISASFGFVFLIWAFVILYkaikkrkmkklrqkffkRNGGlllqqqlLTKEGTI  1049
              RP  IG+ ASFG +  +     LYK IKK++    ++KFFKRNGGLLL     + EGT+
Sbjct  374   HRPLAIGLGASFGSLLFVGGIYFLYKFIKKQRELNKKKKFFKRNGGLLLT----SVEGTV  429

Query  1048  EKTKIFTASELDKATDHFNADRIVGRGGQGTVYKGMLIDGQIVAVKKSQAVDEDQLEPFI  869
             E TK+F + +L+KAT++F++DRI+G+GGQGTVYKGML+DG+IVAVKKS+ VDED+LE FI
Sbjct  430   ETTKVFGSKDLEKATENFSSDRILGQGGQGTVYKGMLVDGRIVAVKKSKVVDEDKLEEFI  489

Query  868   NEVVILSQINHRNVVKLMGCCLETEVPILVYEFIPNGTLFGLIHNNFDNELIPLSWDIRL  689
             NEVVILSQINHRN+VKL+GCCLET VP+LVYEFIPNG LF  +H+ FD+  +  +W +RL
Sbjct  490   NEVVILSQINHRNIVKLLGCCLETNVPVLVYEFIPNGNLFEHLHDEFDDNTMA-TWKVRL  548

Query  688   RIASEVACALAYLHSVTLVPIYHRDIKTGNILLDEKFRAKVSDFGTSRSISIDKTHFTTM  509
             R+A +VA AL+YLHS    PIYHRD+K+ NI+LDEK+RAKVSDFGTSRS+++D TH TT+
Sbjct  549   RMAIDVAGALSYLHSYASSPIYHRDVKSTNIMLDEKYRAKVSDFGTSRSVTVDHTHLTTV  608

Query  508   VKGTFGYLDPEYFQSSQFTEKSDVYSFGVVLAELLTGQKPISFELDDDEDRSLVSRFLLC  329
             V GT GY+DPEYFQSSQFT+KSDVYSFGVVLAEL+TG+K ISF L    +R+L + F+  
Sbjct  609   VSGTVGYMDPEYFQSSQFTDKSDVYSFGVVLAELITGEKSISF-LRSQANRTLATYFIQA  667

Query  328   MEENRLMEMLDGEVIEQGKKEDVVAMAWLAQRCLNFNGKKRPTMKEVATELDAIKASNSH  149
             M+EN+L++++D  + +  +   V A A +A++CLN  G+KRP+M+EV+ ELD I+ S+  
Sbjct  668   MKENKLLDIIDARIRDGCELNQVTAAAKVARKCLNLKGRKRPSMREVSMELDNIRMSSGD  727

Query  148   L  146
             +
Sbjct  728   M  728



>ref|XP_010051379.1| PREDICTED: wall-associated receptor kinase-like 1 [Eucalyptus 
grandis]
Length=982

 Score =   426 bits (1094),  Expect = 2e-128, Method: Compositional matrix adjust.
 Identities = 200/296 (68%), Positives = 254/296 (86%), Gaps = 3/296 (1%)
 Frame = -1

Query  1051  IEKTKIFTASELDKATDHFNADRIVGRGGQGTVYKGMLIDGQIVAVKKSQAVDEDQLEPF  872
             +EK K+F + +L+KAT++FN DRI+GRGGQG VYKGML DG+IVA+KKS+A+DE ++E F
Sbjct  639   VEKNKLFNSKDLEKATNNFNEDRILGRGGQGNVYKGMLTDGKIVAIKKSKAIDEGKVEQF  698

Query  871   INEVVILSQINHRNVVKLMGCCLETEVPILVYEFIPNGTLFGLIHNNFDNELIPLSWDIR  692
             INEV ILSQINHRN+VKL+GCCLETEVP+LVYEFIPNGTL+  +H+    E   +SWD R
Sbjct  699   INEVFILSQINHRNIVKLLGCCLETEVPLLVYEFIPNGTLYQYLHD--PKEEYHVSWDTR  756

Query  691   LRIASEVACALAYLHSVTLVPIYHRDIKTGNILLDEKFRAKVSDFGTSRSISIDKTHFTT  512
             LRIA+E+A AL YLHS   +PIYHRDIK+ NILLDEK+RAKV+DFGTS+S+S+D+TH TT
Sbjct  757   LRIATEIAGALFYLHSAASIPIYHRDIKSTNILLDEKYRAKVADFGTSKSVSLDQTHVTT  816

Query  511   MVKGTFGYLDPEYFQSSQFTEKSDVYSFGVVLAELLTGQKPISFELDDDEDRSLVSRFLL  332
             +V+GTFGYLDPEYFQSSQFT+KSDVYSFGVVL ELLTGQKPIS  L + E RSLV+ F++
Sbjct  817   LVQGTFGYLDPEYFQSSQFTDKSDVYSFGVVLVELLTGQKPIS-SLREQEGRSLVTYFII  875

Query  331   CMEENRLMEMLDGEVIEQGKKEDVVAMAWLAQRCLNFNGKKRPTMKEVATELDAIK  164
              MEENRL +++D +V+++GKKE++ ++A LA+RCLN NG+ RPTMKEVA EL+ ++
Sbjct  876   SMEENRLFDIVDAQVLKEGKKEEIASIANLAKRCLNLNGRNRPTMKEVAMELEGMR  931



>gb|KCW89818.1| hypothetical protein EUGRSUZ_A02062 [Eucalyptus grandis]
Length=667

 Score =   416 bits (1070),  Expect = 2e-128, Method: Compositional matrix adjust.
 Identities = 219/352 (62%), Positives = 282/352 (80%), Gaps = 3/352 (1%)
 Frame = -1

Query  1210  GISASFGFVFLIWAFVILYkaikkrkmkklrqkffkRNGGlllqqqlLTKEGTIEKTKIF  1031
             G+ + FG VF +      YK IK+R   KL++KFFKRNGG LLQQ    +   +EK+K+F
Sbjct  236   GVGSGFGAVFFLGLSWWFYKFIKRRHEIKLKEKFFKRNGGFLLQQLSYDEGSHMEKSKLF  295

Query  1030  TASELDKATDHFNADRIVGRGGQGTVYKGMLIDGQIVAVKKSQAVDEDQLEPFINEVVIL  851
             T+ EL+KATDHFN +RI+G+GGQGTVYKGML DG+IVAVK+S+ VDE Q+E F+NEV+IL
Sbjct  296   TSKELEKATDHFNENRILGQGGQGTVYKGMLTDGRIVAVKRSRIVDEGQVEQFVNEVMIL  355

Query  850   SQINHRNVVKLMGCCLETEVPILVYEFIPNGTLFGLIHNNFDNELIPLSWDIRLRIASEV  671
             SQINHRN+VKL+GCCLETEVP+LVYEFI  GTLF  +HN    E  P+SW +R+RIA+EV
Sbjct  356   SQINHRNIVKLLGCCLETEVPLLVYEFISKGTLFQHLHNPI--EEFPMSWGMRMRIATEV  413

Query  670   ACALAYLHSVTLVPIYHRDIKTGNILLDEKFRAKVSDFGTSRSISIDKTHFTTMVKGTFG  491
             A AL+YLH    +PIYHRD+K+ NILLD+++RAKV+DFGTSRSI+ID+TH TTMVKGT G
Sbjct  414   AGALSYLHFTAAIPIYHRDVKSSNILLDDQYRAKVADFGTSRSIAIDQTHLTTMVKGTIG  473

Query  490   YLDPEYFQSSQFTEKSDVYSFGVVLAELLTGQKPISFELDDDEDRSLVSRFLLCMEENRL  311
             YLDPEYFQ+ QFT+KSDVYSFGVVL ELLTGQKPIS  +  ++ RSL   F+  MEEN L
Sbjct  474   YLDPEYFQTCQFTDKSDVYSFGVVLVELLTGQKPIS-AMRAEDGRSLAVYFIESMEENHL  532

Query  310   MEMLDGEVIEQGKKEDVVAMAWLAQRCLNFNGKKRPTMKEVATELDAIKASN  155
             +++++  +I+Q ++E+++ +A LA+RCLN NG+ RPTMKEVA EL+ I+A +
Sbjct  533   LDIVEAGLIKQSQEEEILGVANLAKRCLNSNGRNRPTMKEVAMELERIRAQH  584



>ref|XP_007217318.1| hypothetical protein PRUPE_ppa017167mg, partial [Prunus persica]
 gb|EMJ18517.1| hypothetical protein PRUPE_ppa017167mg, partial [Prunus persica]
Length=715

 Score =   418 bits (1074),  Expect = 2e-128, Method: Compositional matrix adjust.
 Identities = 276/644 (43%), Positives = 370/644 (57%), Gaps = 81/644 (13%)
 Frame = -1

Query  1882  VDFLGMSYDSQTITIKESI--SPSCQGSNNFSNIIHNSKLSETPFMYSNDNN-FMLFGCG  1712
             ++ L +S D  T+ +K  +  S  C+G            L+ +PF+Y +  N F    CG
Sbjct  69    MEVLNISIDG-TLQVKSPVTFSGGCKGKETR----QAPNLTGSPFVYLDRKNMFTAVSCG  123

Query  1711  NAFITMPGEELDQPGYNLNCSSKNTTAPKTAHDCQ--GINCNHLTVDYDVNTYQVNFTHS  1538
                 TM  +E    G +  C  ++T +    H C   G NC   T+  +++ +       
Sbjct  124   R-LATMRSDENVVHGCSSTCDDQSTDS--ATHRCGTIGTNCCQTTIPPNISVFTTEIQPR  180

Query  1537  SSFNACNYAFFlsassslpptlqslpsrqQEMVVVPVELRWTITQE--------------  1400
                + CNYAF +     L         +   M  VPV L W I+ +              
Sbjct  181   DQIDGCNYAFLVDQDWFLKNLSSYRAIQG--MDSVPVVLEWNISLDNTSHKAFEGFIGRR  238

Query  1399  ----DVPPSYSKYCSPSTYINPQLQWHNYLQCDCPGGDDRNVYL---------------S  1277
                 D     + YC             + + C CPGG   N YL               +
Sbjct  239   VGVYDFNNDSTPYCEIYNATTSSTYNQSSVHCFCPGGFQGNPYLLQPCQGTGSPICENVA  298

Query  1276  GG-------------------------CEWKHKDYVIS-SNKLRPAIIGISASFGFVFLI  1175
             GG                         C +K K  + S + ++R  ++G+    G + L+
Sbjct  299   GGYTCYSNVTVLLGVPTCEYYGGGGMQCYYKPKKPLPSRAYRIRTVLLGVFMGPGLLLLL  358

Query  1174  WAFVILYkaikkrkmkklrqkffkRNGGlllqqqlLTKEGTIEKTKIFTASELDKATDHF  995
                   YK IKKRK  K ++KFFKRNGGLLLQQQL + E  +EK K+F + EL+K+TD F
Sbjct  359   VGAWYAYKVIKKRKDIKRKEKFFKRNGGLLLQQQLSSGEINVEKIKLFKSEELEKSTDKF  418

Query  994   NADRIVGRGGQGTVYKGMLIDGQIVAVKKSQAVDEDQLEPFINEVVILSQINHRNVVKLM  815
             N DRI+G+GGQGTVYKGM  DG++VA+KKS+ +DE QL  FINEVVILSQINHRNVV+L+
Sbjct  419   NIDRILGQGGQGTVYKGMFADGRVVAIKKSKIIDEGQLSEFINEVVILSQINHRNVVQLL  478

Query  814   GCCLETEVPILVYEFIPNGTLFGLIHNNFDNELIPLSWDIRLRIASEVACALAYLHSVTL  635
             GCCLETEVP+LVYEFIPNGTL   IH    NE  P +W +RLRIA+E+A AL+YLH    
Sbjct  479   GCCLETEVPLLVYEFIPNGTLSHYIHEQ--NEDFPFTWKMRLRIATEIAGALSYLHRAAS  536

Query  634   VPIYHRDIKTGNILLDEKFRAKVSDFGTSRSISIDKTHFTTMVKGTFGYLDPEYFQSSQF  455
              PIYHRDIK+ NILLDEK+  KV+DFGTSRSI I +TH TT+V+GTFGYLDPEYFQSSQF
Sbjct  537   FPIYHRDIKSTNILLDEKYTGKVADFGTSRSIVIGQTHLTTVVQGTFGYLDPEYFQSSQF  596

Query  454   TEKSDVYSFGVVLAELLTGQKPI-----SFELDDDEDRSLVSRFLLCMEENRLMEMLDGE  290
             TEKSDVYSFGVVL ELLTG +P+     S E++D E RSL + F + M+E+RL ++LD  
Sbjct  597   TEKSDVYSFGVVLVELLTGLQPVFAVIGSTEVEDQEYRSLATYFNISMQEDRLFDILDAR  656

Query  289   VIEQGKKEDVVAMAWLAQRCLNFNGKKRPTMKEVATELDAIKAS  158
             V+ +G + ++  ++ LA+RCL+ NG+ RPTM+E+  EL+A++ S
Sbjct  657   VLMEGSETEIKLISNLAKRCLSLNGRNRPTMREITAELEALEIS  700



>ref|XP_003534784.1| PREDICTED: wall-associated receptor kinase-like 8-like [Glycine 
max]
Length=705

 Score =   417 bits (1073),  Expect = 2e-128, Method: Compositional matrix adjust.
 Identities = 266/555 (48%), Positives = 358/555 (65%), Gaps = 35/555 (6%)
 Frame = -1

Query  1771  LSETPFMYSNDNN-FMLFGCGN-AFITMPGEELDQPGYNLNCSSKNTTAPK----TAHDC  1610
             L  +PF+YS ++N F+  GC N AF+   G   D  G  ++    N         ++  C
Sbjct  112   LRGSPFVYSQESNKFVAVGCNNLAFLKSGG---DTVGGCVSICDNNEEFKNMDFISSDGC  168

Query  1609  QGINC------NHLTVDYDVNTYQVNFTHSS-SFNACNYAFFlsassslpptlqslpsrq  1451
              G  C      N+L+ +Y+      N  +SS   + C+ AF ++   S    +  L    
Sbjct  169   HGRYCCETSLPNYLS-EYNATLQDFNNQNSSVESHQCSSAFIVNKYWSQRYYMPHLN---  224

Query  1450  QEMVVVPVELRWTITQEDVPPSYSKY------CSPSTYINPQLQWHNYLQCDCPGGDDRN  1289
               M  V   L W I    +  S  ++      C  S   +   +   Y  C C  G   N
Sbjct  225   -NMDYVDAVLEWEILNNTLSDSVLQFLSDHARCHGSNVTSSFTRVSGY-TCRCIQGYQGN  282

Query  1288  VYLSGGCEWKHKDYVISSNKLRPAIIGISASFGFVFLIWAFVILYkaikkrkmkklrqkf  1109
              Y+ GGC     DY  +  K + AI+G+ +S G + L+    +LYK ++KR +KK +QKF
Sbjct  283   PYVRGGCT-ALPDYNKNLTK-KWAIVGVWSSLGSIILLLCRWLLYKVVRKRMIKKRKQKF  340

Query  1108  fkRNGGlllqqqlLTKEGTIEKTKIFTASELDKATDHFNADRIVGRGGQGTVYKGMLIDG  929
             FK+NGGLLLQQ++ + E  +++  +F+  +L+KATD FN +RI+G+GGQGTVYKGML+DG
Sbjct  341   FKKNGGLLLQQRMSSNEVNVDRAILFSLKDLEKATDRFNMNRILGKGGQGTVYKGMLVDG  400

Query  928   QIVAVKKSQAVDEDQLEPFINEVVILSQINHRNVVKLMGCCLETEVPILVYEFIPNGTLF  749
             +IVAVKK +   E  +E FINE VILSQIN+RNVVKL+GCCLETE+P+LVYEFIPNG LF
Sbjct  401   KIVAVKKFKV--EGNVEEFINEFVILSQINNRNVVKLLGCCLETEIPLLVYEFIPNGNLF  458

Query  748   GLIHNNFDNELIPLSWDIRLRIASEVACALAYLHSVTLVPIYHRDIKTGNILLDEKFRAK  569
               +H+   NE +P++WD+RLRIA+E+A AL YLHSV   PIYHRDIK+ NILLDEK+RAK
Sbjct  459   QYLHD--QNEDLPMTWDLRLRIATEIAGALFYLHSVASQPIYHRDIKSTNILLDEKYRAK  516

Query  568   VSDFGTSRSISIDKTHFTTMVKGTFGYLDPEYFQSSQFTEKSDVYSFGVVLAELLTGQKP  389
             ++DFG SR ISI+ TH TT+V+GTFGYLDPEYF +SQFTEKSDVYSFGVVLAELLTGQKP
Sbjct  517   IADFGASRIISIEDTHLTTVVQGTFGYLDPEYFHTSQFTEKSDVYSFGVVLAELLTGQKP  576

Query  388   ISFELDDDEDRSLVSRFLLCMEENRLMEMLDGEVIEQGKKEDVVAMAWLAQRCLNFNGKK  209
             IS  +   E ++L S F+ CMEE+ L +++D  V+++ +K  + A+A L  RCL  NGKK
Sbjct  577   IS-SVRTAESKNLASYFVQCMEEDNLFDIIDKRVVKEAEKGKITAVANLVNRCLELNGKK  635

Query  208   RPTMKEVATELDAIK  164
             RPTMKEV  EL+ I+
Sbjct  636   RPTMKEVTFELERIQ  650



>ref|XP_010279502.1| PREDICTED: putative wall-associated receptor kinase-like 11 [Nelumbo 
nucifera]
Length=593

 Score =   414 bits (1064),  Expect = 2e-128, Method: Compositional matrix adjust.
 Identities = 242/449 (54%), Positives = 321/449 (71%), Gaps = 16/449 (4%)
 Frame = -1

Query  1429  VELRWTITQEDVPPSYSKYCSP-STYINPQLQWHNYLQ-CDCPGGDDRNVYLSGGCEWKH  1256
             V+LRW I  E +       C P ST +  Q     Y+  C+C    + N YL  GC+   
Sbjct  120   VQLRWRIEDEALE------CGPKSTRVPYQSSNGTYVYYCECDYAYEGNPYLPDGCKGCR  173

Query  1255  KDYVISSNKLRP---AIIGISASFGFVFLIWAFVI--LYkaikkrkmkklrqkffkRNGG  1091
             K Y    N+ R     ++ ++       L+       LYK +K+RK+KK ++KFFKRNGG
Sbjct  174   KGYEDVCNRRRRFPVKVVSLAVGLSVGLLLLLAAGYWLYKVLKRRKIKKRKEKFFKRNGG  233

Query  1090  lllqqqlLTKEGTIEKTKIFTASELDKATDHFNADRIVGRGGQGTVYKGMLIDGQIVAVK  911
             LLLQQQ+ +++G+IEKTK+F   EL+KATD++N +RI+G+GGQGTVYKGML DG+IVA+K
Sbjct  234   LLLQQQISSEKGSIEKTKVFKVEELEKATDNYNENRILGQGGQGTVYKGMLSDGRIVAIK  293

Query  910   KSQAVDEDQLEPFINEVVILSQINHRNVVKLMGCCLETEVPILVYEFIPNGTLFGLIHNN  731
             KS+ +D+DQ+E FINEV IL+QINH+NVVKL+GCCLETEVP LVYEFI NG LF  IH+ 
Sbjct  294   KSKILDDDQVEQFINEVAILTQINHKNVVKLLGCCLETEVPSLVYEFISNGNLFDRIHDQ  353

Query  730   FDNELIPLSWDIRLRIASEVACALAYLHSVTLVPIYHRDIKTGNILLDEKFRAKVSDFGT  551
              ++ +   SWD R+RIA+EVA ALAYLHS T +PIYHRDIK+ NILLD K++AKVSDFGT
Sbjct  354   SEDYI--FSWDDRVRIATEVAGALAYLHSATSMPIYHRDIKSANILLDNKYKAKVSDFGT  411

Query  550   SRSISIDKTHFTTMVKGTFGYLDPEYFQSSQFTEKSDVYSFGVVLAELLTGQKPISFELD  371
             SR+I+ DKTH TT+V+GTFGYLDPEYFQSSQFTEKSDVYS GVVL ELLTG+ PIS    
Sbjct  412   SRTITTDKTHLTTIVQGTFGYLDPEYFQSSQFTEKSDVYSLGVVLVELLTGEMPISCT-R  470

Query  370   DDEDRSLVSRFLLCMEENRLMEMLDGEVIEQGKKEDVVAMAWLAQRCLNFNGKKRPTMKE  191
               E+R+L + F+  +E++ L ++LD  ++++ KKE+++A+A LA+RCL+ N K+RPTMKE
Sbjct  471   PLEERNLATYFVSSIEKDILFDILDEHIVKECKKEEILAIANLAKRCLDLNSKRRPTMKE  530

Query  190   VATELDAIKASNSHLPLAMEAFEIESDFI  104
             VA EL+ +K    +        E+E   +
Sbjct  531   VAMELEGLKTKQVNTLAGQNNQEVECSMV  559



>gb|KCW47702.1| hypothetical protein EUGRSUZ_K01441 [Eucalyptus grandis]
Length=713

 Score =   418 bits (1074),  Expect = 2e-128, Method: Compositional matrix adjust.
 Identities = 264/593 (45%), Positives = 366/593 (62%), Gaps = 51/593 (9%)
 Frame = -1

Query  1819  SCQGSNNFSNIIHNSKLSETPFMYSNDNNFMLFGCGNAFITMPGEELDQPGYNLNCSSKN  1640
             +C+G+ + + +     L+ + F++S   N +     N  + +  ++    G   +C    
Sbjct  104   TCRGNGSSTPV----SLNGSHFIFSESRNVLTAVGRNICVLLDDQKSAIIGCKSSCKDDK  159

Query  1639  TTAPKTAHDCQGINCNHLTVDYDVNTYQVNFT--HSSSFNACNYAFFlsassslpptlqs  1466
                  T     G  C   T+  D+  + + F     S  N C YAF    S     +   
Sbjct  160   VVTKMTCSGSDG--CCRTTITPDLQAFTITFIPDKGSPKNQCEYAFLGDRSKFTRSSKDF  217

Query  1465  lpsrqQEMVVVPVELRWTITQEDVPPSY------SKYCSPSTYINPQLQWHNYLQCDCPG  1304
                        P  L W I +     S       S  CS  ++ +   +   +LQC C G
Sbjct  218   NKLEASGHF--PAVLEWGIAKSSRAASEIYKHGDSYNCSNFSFNSAYPKAMPFLQCSCRG  275

Query  1303  GDDRNVYLSGGCE--------------------WKHKDYVISSNKLRPAIIGISASFGFV  1184
             G   N Y+  GCE                        D V  S  ++  +IG+ A  G +
Sbjct  276   GFTGNPYIKYGCEDVDECKGPTDPCPGRKCVNRQGSYDCVERSKTIKFLLIGMGAGLGVL  335

Query  1183  FLIWAFVILYkaikkrkmkklrqkffkRNGGlllqqqlLTKEGTIEKTKIFTASELDKAT  1004
              L+    +LY  +KKRK  KL++++FK NGGLLLQQQL + E  ++K K+F + +L+KAT
Sbjct  336   LLLLFLWLLYNFLKKRKEIKLKERYFKENGGLLLQQQLCSSETNVDKNKLFNSKDLEKAT  395

Query  1003  DHFNADRIVGRGGQGTVYKGMLIDGQIVAVKKSQAVDEDQLEPFINEVVILSQINHRNVV  824
             D+FN +RI+G+GGQGTVYKGML DG IVA+KKS+A+D+ ++E FINE+ ILSQINHRNVV
Sbjct  396   DNFNKNRILGQGGQGTVYKGMLADGGIVAIKKSKAIDKGKVEQFINEIAILSQINHRNVV  455

Query  823   KLMGCCLETEVPILVYEFIPNGTLFGLIHNNFDNELIPLSWDIRLRIASEVACALAYLHS  644
             KL+GCCLETE P+LVYEFIPNGTLF  +H++       +SW  RL+IA++VA AL+YLHS
Sbjct  456   KLLGCCLETESPLLVYEFIPNGTLFQYLHDSL------VSWGTRLQIATDVAGALSYLHS  509

Query  643   VTLVPIYHRDIKTGNILLDEKFRAKVSDFGTSRSISIDKTHFTTMVKGTFGYLDPEYFQS  464
                +PIYHRDIK+ NILLD+++RAKV+DFGTS+S+S+ +TH TT+V+GTFGYLDPEYFQS
Sbjct  510   SASIPIYHRDIKSTNILLDDRYRAKVADFGTSKSLSLYQTHVTTVVQGTFGYLDPEYFQS  569

Query  463   SQFTEKSDVYSFGVVLAELLTGQKPISFELDDDEDRSLVSRFLLCMEENRLMEMLDGEVI  284
              QFTEKSDVYSFGVVL ELLTG+KP+SF L D+E+R+L S FLL M+EN L +++D +V+
Sbjct  570   CQFTEKSDVYSFGVVLVELLTGRKPVSF-LGDEEERNLASYFLLSMDENCLFDIVDPQVL  628

Query  283   EQGKKEDVVAMAWLAQRCLNFNGKKRPTMKEVATELD--------AIKASNSH  149
             +QGK+E +VA A +A+ CLN +GK RPTM+EVA+EL+        AI+  N+H
Sbjct  629   KQGKEEGIVAFANIARGCLNLHGKMRPTMREVASELERIRKLENPAIRRGNTH  681



>ref|XP_007034139.1| Wall associated kinase-like 6, putative [Theobroma cacao]
 gb|EOY05065.1| Wall associated kinase-like 6, putative [Theobroma cacao]
Length=884

 Score =   423 bits (1087),  Expect = 3e-128, Method: Compositional matrix adjust.
 Identities = 231/376 (61%), Positives = 295/376 (78%), Gaps = 8/376 (2%)
 Frame = -1

Query  1270  CEWKHKDYVISSNKLRPAIIGISASFGFVFLIWAFVILYkaikkrkmkklrqkffkRNGG  1091
             C   + D+ I  N       G S S G +FL+ +   +YK +K+RK  KL+QK+FKRNGG
Sbjct  476   CVCSNTDFNIEDNYSMDGCGGCSTSIGTLFLLLSTWRMYKVLKRRKNIKLKQKYFKRNGG  535

Query  1090  lllqqqlLTKEGTIEKTKIFTASELDKATDHFNADRIVGRGGQGTVYKGMLIDGQIVAVK  911
             LLLQQQL + +G +E  ++FT+ EL+KATD++N +RI+G GGQG VYKGML DG IVA+K
Sbjct  536   LLLQQQLTSNDGNVENIRLFTSKELEKATDYYNENRILGHGGQGIVYKGMLTDGSIVAIK  595

Query  910   KSQAV-----DEDQLEPFINEVVILSQINHRNVVKLMGCCLETEVPILVYEFIPNGTLFG  746
             KS+ V     DE +L+ FINEV+ILS+INHRNVVKL+GCCLE EVP+LVYEF+ NGTL  
Sbjct  596   KSKMVEKEKLDEMKLQQFINEVIILSRINHRNVVKLLGCCLEIEVPLLVYEFVSNGTLSQ  655

Query  745   LIHNNFDNELIPLSWDIRLRIASEVACALAYLHSVTLVPIYHRDIKTGNILLDEKFRAKV  566
             LIH+   NE  PL+W++RLRIA+E+A AL+YLHS   VPIYHRDIK+ NILLD+K+RAKV
Sbjct  656   LIHDK--NEEFPLTWEMRLRIATEIANALSYLHSAASVPIYHRDIKSSNILLDDKYRAKV  713

Query  565   SDFGTSRSISIDKTHFTTMVKGTFGYLDPEYFQSSQFTEKSDVYSFGVVLAELLTGQKPI  386
             SDFG S+SI++D+TH TT V+GTFGYLDPEYF+SSQFTEKSDVYSFGVVL ELLTGQKP+
Sbjct  714   SDFGISKSIALDQTHLTTRVQGTFGYLDPEYFRSSQFTEKSDVYSFGVVLVELLTGQKPV  773

Query  385   SFELDDDEDRSLVSRFLLCMEENRLMEMLDGEVIEQGKKEDVVAMAWLAQRCLNFNGKKR  206
             S     +E RSLV  FLL ++EN + ++LD +V+  G +E+++A+A LA+RCLN NG+KR
Sbjct  774   S-STQSEEVRSLVPFFLLSIKENSVFDILDPQVMNDGPQEEIIAVAKLAKRCLNLNGQKR  832

Query  205   PTMKEVATELDAIKAS  158
             PTMK+VATEL+ IK S
Sbjct  833   PTMKQVATELERIKVS  848



>ref|XP_010673947.1| PREDICTED: wall-associated receptor kinase-like 8 [Beta vulgaris 
subsp. vulgaris]
Length=746

 Score =   419 bits (1076),  Expect = 3e-128, Method: Compositional matrix adjust.
 Identities = 274/655 (42%), Positives = 379/655 (58%), Gaps = 88/655 (13%)
 Frame = -1

Query  1873  LGMSYDSQTITIKE--------SISPSC---QGSNNFSNIIHNSKLSETPFMYSNDNNFM  1727
             LG S + + + I E         I+  C   QG N  S    N  + ++PF Y+  N   
Sbjct  57    LGFSENPEILNITEHQIMIRNSQIASKCYDLQG-NEVSGNQGNFDIYDSPFTYATTNRLT  115

Query  1726  LFGCGN-AFITMPGEEL---DQPGYNLNCSSKNTTAPKTAH-DCQGINCNHLTVDYDVNT  1562
             + GC + A I+     L   +Q  +   C +  +   +     C G+ C   +    + +
Sbjct  116   VVGCNDYALISASAGTLSTGNQFNFRAGCLALCSNPDEVIQGSCSGLGCCQTSFPVGLQS  175

Query  1561  YQVNFTH--------SSSFNACNYAFFlsassslpptlqslpsrqQEMVV--VPVELRWT  1412
             + V  +          S+   C YAFF    S        L        +  VP+ L W+
Sbjct  176   FTVTLSSLQNRTIGGVSAVQPCGYAFFAGEDSFRFHGASDLSGTVVNRTIQQVPLVLDWS  235

Query  1411  ITQEDVPPSYSKYC------SPSTYINPQLQWHNY----LQCDCPGGDDRNVYLSGGCE-  1265
             +    V PS    C      S + Y     +  +      +C+C  G + N YL  GC  
Sbjct  236   V---GVTPSTRLTCDQAKRNSTTYYCQSNTECIDSDAGGYRCNCLSGYEGNPYLEPGCTD  292

Query  1264  -------------------------WKHKDYVI----------------SSNKLRPAIIG  1208
                                      +    YV                 SS+ L+  I+G
Sbjct  293   VDECAAGSNSPCAMACRNTPGSYQCYCPSGYVGDGLKNGTGGCMRISDNSSSTLKKIILG  352

Query  1207  ISASFGFVFLIWAFVILYkaikkrkmkklrqkffkRNGGlllqqqlLTKEGTIEKTKIFT  1028
             +  S G + L++    LY  I++RK+ K + ++F+RNGGLLLQQQ+ + E  + + KIFT
Sbjct  353   LGISLGSMLLLFGVWSLYFFIQRRKIVKQKARYFERNGGLLLQQQMSSDESVVARMKIFT  412

Query  1027  ASELDKATDHFNADRIVGRGGQGTVYKGMLIDGQIVAVKKSQAVDEDQLEPFINEVVILS  848
             + EL++ATD+FN DRI+G+GGQGTVYKGML +G+IVA+KKS+ VDE QL  FINEVVILS
Sbjct  413   SEELERATDNFNIDRILGQGGQGTVYKGMLSEGRIVAIKKSKLVDESQLNEFINEVVILS  472

Query  847   QINHRNVVKLMGCCLETEVPILVYEFIPNGTLFGLIHNNFDNELIPLSWDIRLRIASEVA  668
             QINHRN+VKL+GCCLETEVP+LVYEFI NGTLF  IH+   +E  P++W +RL+IAS+ A
Sbjct  473   QINHRNIVKLLGCCLETEVPLLVYEFILNGTLFHHIHH--PSEEFPITWRMRLQIASDSA  530

Query  667   CALAYLHSVTLVPIYHRDIKTGNILLDEKFRAKVSDFGTSRSISIDKTHFTTMVKGTFGY  488
              ALAYLHS +  PI HRDIK+ NILLD+K+RAKVSDFGTSRSI++D+TH TT V GTFGY
Sbjct  531   GALAYLHSSSSTPILHRDIKSSNILLDDKYRAKVSDFGTSRSIALDQTHVTTRVVGTFGY  590

Query  487   LDPEYFQSSQFTEKSDVYSFGVVLAELLTGQKPISFELDDDEDRSLVSRFLLCMEENRLM  308
             LDPEYFQ+SQFTEKSDVYSFGVVL ELLTGQK +      +E+RSL S FL  ME +RL+
Sbjct  591   LDPEYFQTSQFTEKSDVYSFGVVLVELLTGQKAVRAAF--EEERSLTSWFLSHMETSRLL  648

Query  307   EMLDGEVIEQGKKEDVVAMAWLAQRCLNFNGKKRPTMKEVATELDAIKASNSHLP  143
             +++D +++++G +++ + +A LA+RCLN +GK RP MKEV  +++A+ +   HLP
Sbjct  649   DIIDNQLLQEGSEKEFLRIANLAKRCLNLDGKTRPAMKEVLIDIEAVLS--LHLP  701



>ref|XP_006385945.1| hypothetical protein POPTR_0003s18470g, partial [Populus trichocarpa]
 gb|ERP63742.1| hypothetical protein POPTR_0003s18470g, partial [Populus trichocarpa]
Length=385

 Score =   405 bits (1042),  Expect = 4e-128, Method: Compositional matrix adjust.
 Identities = 224/366 (61%), Positives = 283/366 (77%), Gaps = 5/366 (1%)
 Frame = -1

Query  1207  ISASFGFVFLIWAFVILYkaikkrkmkklrqkffkRNGGlllqqqlLTKEGTIEKTKIFT  1028
             I  + G +FL+     +YK  K+RK  +L++KFFKRNGGLLLQQQL + +G+++KTKIF+
Sbjct  14    IGLALGVLFLLIGAWWMYKLFKRRKSIQLKKKFFKRNGGLLLQQQLSSSDGSVQKTKIFS  73

Query  1027  ASELDKATDHFNADRIVGRGGQGTVYKGMLIDGQIVAVKKSQAVDEDQLEPFINEVVILS  848
             ++EL+KATD+FN +RI+G GGQGTVYKGML DG IVAVKKS  VDE++LE FINEVVILS
Sbjct  74    SNELEKATDYFNENRILGHGGQGTVYKGMLADGSIVAVKKSTIVDEEKLEAFINEVVILS  133

Query  847   QINHRNVVKLMGCCLETEVPILVYEFIPNGTLFGLIHNNFDNELIPLSWDIRLRIASEVA  668
             QI+HRNVV+L+GCCLET+VP+LVYEFIPNGTL   +H    NE   LSW+ RLRIASE A
Sbjct  134   QISHRNVVRLLGCCLETDVPLLVYEFIPNGTLSQYLHEQ--NEDFTLSWESRLRIASEAA  191

Query  667   CALAYLHSVTLVPIYHRDIKTGNILLDEKFRAKVSDFGTSRSISIDKTHFTTMVKGTFGY  488
              A++YLHS   +PIYHRDIK+ NILLDEK+RAKVSDFG SRS+SID+TH TT V+GTFGY
Sbjct  192   GAISYLHSTASIPIYHRDIKSTNILLDEKYRAKVSDFGISRSVSIDQTHLTTKVQGTFGY  251

Query  487   LDPEYFQSSQFTEKSDVYSFGVVLAELLTGQKPISFELDDDEDRSLVSRFLLCMEENRLM  308
             LDPEYF++SQ TEKSDVYSFGVVL ELL+G+K I F     E  SLV  F+  ME+ RL 
Sbjct  252   LDPEYFRTSQLTEKSDVYSFGVVLVELLSGKKTI-FLTHSLETMSLVEHFIDLMEDGRLF  310

Query  307   EMLDGEVIEQGKKEDVVAMAWLAQRCLNFNGKKRPTMKEVATELDAIKASNSHLPLA--M  134
             +++D +V     +E+ + +A LA+RCL+ NG+ RPTM+EVA EL+ I  S   + +   +
Sbjct  311   DIIDAQVKGDCTEEEAIVIANLAKRCLDLNGRNRPTMREVAMELEGILLSRKGINVQQIV  370

Query  133   EAFEIE  116
             EA  IE
Sbjct  371   EAISIE  376



>emb|CDX79336.1| BnaC06g19670D [Brassica napus]
Length=790

 Score =   419 bits (1078),  Expect = 5e-128, Method: Compositional matrix adjust.
 Identities = 229/429 (53%), Positives = 307/429 (72%), Gaps = 26/429 (6%)
 Frame = -1

Query  1330  NYLQCDCPGGDDRNVYLSGGC----EWKHKDY------------------VISSNKLRPA  1217
             N   C C  G   N Y+ GGC    E    DY                  V  +++L   
Sbjct  318   NDASCRCNRGYKGNPYIPGGCKDINECTEYDYPYCTGDATCVNVQGHYKCVYRNHRL---  374

Query  1216  IIGISASFGFVFLIWAFVILYkaikkrkmkklrqkffkRNGGlllqqqlLTKEGTIEKTK  1037
              IG  +SFG +  I     LY+ I+K++    ++KFFKRNGGLLLQQQL++ EG +EKT+
Sbjct  375   AIGFGSSFGSLIFIGGIYGLYRFIRKQRRLNQKKKFFKRNGGLLLQQQLISTEGNVEKTR  434

Query  1036  IFTASELDKATDHFNADRIVGRGGQGTVYKGMLIDGQIVAVKKSQAVDEDQLEPFINEVV  857
             +F++ EL KAT++F   RI+G+GGQGTVYKGM +DG+IVAVKKS+ VDED+LE FINEVV
Sbjct  435   VFSSRELKKATENFCLTRILGQGGQGTVYKGMRVDGRIVAVKKSKVVDEDKLEEFINEVV  494

Query  856   ILSQINHRNVVKLMGCCLETEVPILVYEFIPNGTLFGLIHNNFDNELIPLSWDIRLRIAS  677
             ILSQINHRN+VKL+GCCLETEVP+LVYEFIPNG LF  +H +  ++    +W++RLRIA 
Sbjct  495   ILSQINHRNIVKLLGCCLETEVPVLVYEFIPNGNLFEHLHEDESDDHTITTWEVRLRIAI  554

Query  676   EVACALAYLHSVTLVPIYHRDIKTGNILLDEKFRAKVSDFGTSRSISIDKTHFTTMVKGT  497
             ++A AL+YLHS    PIYHRD+K+ NI+LDEK++AKVSDFGTSR++++D TH TT+V GT
Sbjct  555   DIASALSYLHSAASSPIYHRDVKSTNIMLDEKYQAKVSDFGTSRTVTVDHTHLTTVVSGT  614

Query  496   FGYLDPEYFQSSQFTEKSDVYSFGVVLAELLTGQKPISFELDDDEDRSLVSRFLLCMEEN  317
              GY+DPEYFQSSQFT+KSDVYSFGVVLAEL+TG+K +SF L   E+R+L + F+L ++EN
Sbjct  615   VGYVDPEYFQSSQFTDKSDVYSFGVVLAELITGEKSVSF-LRSQENRTLATYFILAIKEN  673

Query  316   RLMEMLDGEVIEQGKKEDVVAMAWLAQRCLNFNGKKRPTMKEVATELDAIKASNSHLPLA  137
             RL++++D ++ +  K   V A A LA++CLN  G+KRP+M+EV+ EL+ I+ S+  + L 
Sbjct  674   RLLDIIDAQIRDGCKLTQVTATANLARKCLNLKGRKRPSMREVSMELEKIRGSSVDMELH  733

Query  136   MEAFEIESD  110
                 E E D
Sbjct  734   EYGSENEED  742



>ref|XP_010476715.1| PREDICTED: wall-associated receptor kinase-like 1 [Camelina sativa]
Length=729

 Score =   417 bits (1072),  Expect = 6e-128, Method: Compositional matrix adjust.
 Identities = 265/597 (44%), Positives = 361/597 (60%), Gaps = 55/597 (9%)
 Frame = -1

Query  1816  CQGSNNFSNIIHNSKLSETPFMYSNDNNFMLFGCGNAFITMPGEELDQPGYNLNCSSKNT  1637
             CQG  N S    N     +P+  +++N  +  GCG   + M   E +  G   +C    +
Sbjct  116   CQGPQN-SLPGLNLTGKGSPYFLTDENRLVAVGCGTKAL-MTDIESEILGCESSCEDSKS  173

Query  1636  TAPKTAHDCQGINCNHLTVDYD---VNTYQVNFTHSSSFNACNYAFFlsassslpptlqs  1466
                 T   C G  C    +  +   V T  +    S     C  AF  +   S     + 
Sbjct  174   GEQVTNSICTGYKCCQARLPVERPQVITVVIEKNSSGEEERCKVAFLTNKRYSPSNVTEP  233

Query  1465  lpsrqQEMVVVPVELRWTITQEDVP-------PSYSKYCSPSTYINPQLQWH-----NYL  1322
                     VVV  EL W     D          + S+  S S+  N   +++     +Y 
Sbjct  234   EQFHSNGNVVV--ELGWYFATSDSRFKSLLGCANMSRKGSGSSDDNCSCEYNYFSGMSYR  291

Query  1321  QCDCPGGDDRNVYLSGGCEWKH--------KDYV-------ISSNKLRPAI---------  1214
              C C  G   N YL GGC+           +D V       +S  + +P I         
Sbjct  292   NCYCDWGYAGNPYLRGGCKDTDSCEGHTCGEDAVCVNMPGPMSMCQPKPKITKRANPPVV  351

Query  1213  ----IGISASFGFVFLIWAFVILYkaikkrkmkklrqkffkRNGGlllqqq-lLTKEGTI  1049
                 IG+S  F FV L W    L+K +KKR+     +KFFKRNGGLLL QQ   T++G +
Sbjct  352   QGIVIGLSGLFLFVGLFW----LFKFVKKRRRIIQSKKFFKRNGGLLLNQQINTTQDGNV  407

Query  1048  EKTKIFTASELDKATDHFNADRIVGRGGQGTVYKGMLIDGQIVAVKKSQAVDEDQLEPFI  869
             E +K+F++ EL KATD+F+ +R++G+GGQGTVYKGML+DG+IVAVK+S+ VDED+LE FI
Sbjct  408   EMSKVFSSKELKKATDNFSVNRVLGQGGQGTVYKGMLVDGRIVAVKRSKVVDEDKLEEFI  467

Query  868   NEVVILSQINHRNVVKLMGCCLETEVPILVYEFIPNGTLFGLIHNNFDNELIPLSWDIRL  689
             NEVV+LSQ+NHRN+VKL+GCCLETEVPILVYE+IPNG L+  +H+ FD+    ++W++RL
Sbjct  468   NEVVLLSQMNHRNIVKLLGCCLETEVPILVYEYIPNGDLYKRLHDEFDD--YTMTWEVRL  525

Query  688   RIASEVACALAYLHSVTLVPIYHRDIKTGNILLDEKFRAKVSDFGTSRSISIDKTHFTTM  509
             RIA E A AL Y+HS    PI+HRD+KT NILLDEK+RAKVSDFGTSRSI+ID+TH TT+
Sbjct  526   RIAIETAGALTYMHSAASFPIFHRDVKTTNILLDEKYRAKVSDFGTSRSITIDQTHLTTL  585

Query  508   VKGTFGYLDPEYFQSSQFTEKSDVYSFGVVLAELLTGQKPISFELDDDEDRSLVSRFLLC  329
             V GTFGY+DPEYF SSQ+T KSDVYSFGVVL EL+TG+KP+S  +  +E R L S FL  
Sbjct  586   VAGTFGYMDPEYFMSSQYTHKSDVYSFGVVLVELITGEKPMS-RVRSEEGRGLASDFLEA  644

Query  328   MEENRLMEMLDGEVIEQGKKEDVVAMAWLAQRCLNFNGKKRPTMKEVATELDAIKAS  158
             M+ENR ++++D  + ++ K + ++A+A LA++CLN  GKKRP M+EV+ EL+ I++S
Sbjct  645   MKENRAVDIIDIRIKDESKLDQIMAVAKLARKCLNRKGKKRPNMREVSIELERIRSS  701



>gb|AAY86486.1| RFO1 [Arabidopsis thaliana]
Length=749

 Score =   418 bits (1074),  Expect = 7e-128, Method: Compositional matrix adjust.
 Identities = 219/373 (59%), Positives = 292/373 (78%), Gaps = 6/373 (2%)
 Frame = -1

Query  1264  WKHKDYVISSNKLRPAIIGISASFGFVFLIWAFVILYkaikkrkmkklrqkffkRNGGll  1085
             W+ ++ V    K++P   G+   F  +FL+     L K +KKR+    ++ FFKRNGGLL
Sbjct  333   WRCENGV---GKIKPLFPGLVLGFTLLFLVLGIWGLIKFVKKRRKIIRKRMFFKRNGGLL  389

Query  1084  lqqqlLTKEGTIEKTKIFTASELDKATDHFNADRIVGRGGQGTVYKGMLIDGQIVAVKKS  905
             L+QQL T+ G +E +KIF++ EL+KATD+FN +R++G+GGQGTVYKGML+DG+IVAVK+S
Sbjct  390   LKQQLTTRGGNVESSKIFSSKELEKATDNFNMNRVLGQGGQGTVYKGMLVDGRIVAVKRS  449

Query  904   QAVDEDQLEPFINEVVILSQINHRNVVKLMGCCLETEVPILVYEFIPNGTLFGLIHNNFD  725
             + +DED++E FINEV +LSQINHRN+VKLMGCCL+TEVPILVYE IPNG LF  +H++ D
Sbjct  450   KVLDEDKVEEFINEVGVLSQINHRNIVKLMGCCLQTEVPILVYEHIPNGDLFKRLHHDSD  509

Query  724   NELIPLSWDIRLRIASEVACALAYLHSVTLVPIYHRDIKTGNILLDEKFRAKVSDFGTSR  545
             +    ++WD+RLRIA E+A ALAYLHS    P+YHRD+KT NILLDEK+RAKVSDFGTSR
Sbjct  510   D--YTMTWDVRLRIAVEIAGALAYLHSAASTPVYHRDVKTTNILLDEKYRAKVSDFGTSR  567

Query  544   SISIDKTHFTTMVKGTFGYLDPEYFQSSQFTEKSDVYSFGVVLAELLTGQKPISFELDDD  365
             SI++D+TH TT+V GTFGYLDPEYFQ+SQFT+KSDVYSFGVVL EL+TG+KP S  +  +
Sbjct  568   SINVDQTHLTTLVAGTFGYLDPEYFQTSQFTDKSDVYSFGVVLVELITGEKPFSV-MRPE  626

Query  364   EDRSLVSRFLLCMEENRLMEMLDGEVIEQGKKEDVVAMAWLAQRCLNFNGKKRPTMKEVA  185
             E+R LVS F   M++NR+++++D  + E    E V+A+A LA+RCL+  GKKRP M+EV+
Sbjct  627   ENRGLVSHFNEAMKQNRVLDIVDSRIKEGCTLEQVLAVAKLARRCLSLKGKKRPNMREVS  686

Query  184   TELDAIKASNSHL  146
              EL+ I++S   L
Sbjct  687   IELERIRSSPEDL  699



>ref|NP_849908.1| wall-associated receptor kinase-like 22 [Arabidopsis thaliana]
 gb|AEE36285.1| wall-associated receptor kinase-like protein [Arabidopsis thaliana]
Length=714

 Score =   416 bits (1070),  Expect = 9e-128, Method: Compositional matrix adjust.
 Identities = 216/362 (60%), Positives = 287/362 (79%), Gaps = 3/362 (1%)
 Frame = -1

Query  1231  KLRPAIIGISASFGFVFLIWAFVILYkaikkrkmkklrqkffkRNGGlllqqqlLTKEGT  1052
             K++P   G+   F  +FL+     L K +KKR+    ++ FFKRNGGLLL+QQL T+ G 
Sbjct  306   KIKPLFPGLVLGFPLLFLVLGIWGLIKFVKKRRKIIRKRMFFKRNGGLLLKQQLTTRGGN  365

Query  1051  IEKTKIFTASELDKATDHFNADRIVGRGGQGTVYKGMLIDGQIVAVKKSQAVDEDQLEPF  872
             ++ +KIF++ EL+KATD+FN +R++G+GGQGTVYKGML+DG+IVAVK+S+ +DED++E F
Sbjct  366   VQSSKIFSSKELEKATDNFNMNRVLGQGGQGTVYKGMLVDGRIVAVKRSKVLDEDKVEEF  425

Query  871   INEVVILSQINHRNVVKLMGCCLETEVPILVYEFIPNGTLFGLIHNNFDNELIPLSWDIR  692
             INEV +LSQINHRN+VKLMGCCLETEVPILVYE IPNG LF  +H++ D+    ++WD+R
Sbjct  426   INEVGVLSQINHRNIVKLMGCCLETEVPILVYEHIPNGDLFKRLHHDSDD--YTMTWDVR  483

Query  691   LRIASEVACALAYLHSVTLVPIYHRDIKTGNILLDEKFRAKVSDFGTSRSISIDKTHFTT  512
             LRI+ E+A ALAYLHS    P+YHRD+KT NILLDEK+RAKVSDFGTSRSI++D+TH TT
Sbjct  484   LRISVEIAGALAYLHSAASTPVYHRDVKTTNILLDEKYRAKVSDFGTSRSINVDQTHLTT  543

Query  511   MVKGTFGYLDPEYFQSSQFTEKSDVYSFGVVLAELLTGQKPISFELDDDEDRSLVSRFLL  332
             +V GTFGYLDPEYFQ+SQFT+KSDVYSFGVVL EL+TG+KP S  +  +E+R LVS F  
Sbjct  544   LVAGTFGYLDPEYFQTSQFTDKSDVYSFGVVLVELITGEKPFSV-MRPEENRGLVSHFNE  602

Query  331   CMEENRLMEMLDGEVIEQGKKEDVVAMAWLAQRCLNFNGKKRPTMKEVATELDAIKASNS  152
              M++NR+++++D  + E    E V+A+A LA+RCL+  GKKRP M+EV+ EL+ I++S  
Sbjct  603   AMKQNRVLDIVDSRIKEGCTLEQVLAVAKLARRCLSLKGKKRPNMREVSVELERIRSSPE  662

Query  151   HL  146
              L
Sbjct  663   DL  664



>ref|XP_009111072.1| PREDICTED: wall-associated receptor kinase-like 9 [Brassica rapa]
Length=760

 Score =   418 bits (1074),  Expect = 9e-128, Method: Compositional matrix adjust.
 Identities = 262/592 (44%), Positives = 352/592 (59%), Gaps = 65/592 (11%)
 Frame = -1

Query  1762  TPFMYSNDNNFMLFGCGNAFITMPGEELDQPGYNLNCSSKNTTAPKTAHD--CQGINCNH  1589
             TPF     N F   GC N   T+   E    G    C  K     K  HD  C+G  C  
Sbjct  128   TPFTIGRSNTFHAIGC-NYKATLTHLEPRLVGCISTCDPK-----KMNHDMSCRGNRCCQ  181

Query  1588  L--------TVDYDVNTYQVNFTHSSSFNACNYAFFlsassslpptlqslpsrqQ---EM  1442
                       V   +  +  N T       C  AF    +   P    +  +  Q   + 
Sbjct  182   ADPPSGIGQIVGISMEEFSSNITRE---RGCRVAFLTDENRDRPAYPVAKFTDPQWFYDR  238

Query  1441  VVVPVELRWTITQEDVPPSYSKYCS------------PSTYINPQLQWHNYLQCDCPGGD  1298
               V ++LRW I   ++    S  C+            P    N   +  N + C C  G 
Sbjct  239   QYVILQLRWAIPMTNLSFVNSLRCADYLVGQYIDGINPCGCSNTDDESSN-VGCACNDGY  297

Query  1297  DRNVYLSGGCE------------------------WKHKDYVISSNKLRPAIIGISASFG  1190
               N Y+ GGC+                              V+  NK  P  IG+    G
Sbjct  298   TGNPYIMGGCKDIDECQLDSNIKYCRRQGGTCVNTPGASSCVVKKNKTVPITIGLCVGLG  357

Query  1189  FVFLIWAFVILYkaikkrkmkklrqkffkRNGGlllqqqlLTKEGTIEKTKIFTASELDK  1010
              + +    + LYK IKK++    ++K FKRNGGLLL+QQL + EG+I+K+K+FTA EL+K
Sbjct  358   ILIVSGVTLWLYKFIKKQRKINRKKKLFKRNGGLLLKQQLTSTEGSIQKSKVFTAKELEK  417

Query  1009  ATDHFNADRIVGRGGQGTVYKGMLIDGQIVAVKKSQAVDEDQLEPFINEVVILSQINHRN  830
             AT++FN+ R++G+GGQGTVYKGML+DG+IVAVKKS  VDED+LE FINEVVILSQINHRN
Sbjct  418   ATENFNSTRVLGQGGQGTVYKGMLVDGRIVAVKKSTVVDEDKLEEFINEVVILSQINHRN  477

Query  829   VVKLMGCCLETEVPILVYEFIPNGTLFGLIHNNFDNELIPLSWDIRLRIASEVACALAYL  650
             +VKL+GCCLETEVP+LVYEFI NG LF  +H  FD   +  +W++RL I  ++A AL+YL
Sbjct  478   IVKLIGCCLETEVPLLVYEFISNGNLFEHLHGEFDESTM-TTWEMRLCIVIDIAGALSYL  536

Query  649   HSVTLVPIYHRDIKTGNILLDEKFRAKVSDFGTSRSISIDKTHFTTMVKGTFGYLDPEYF  470
             HS    PI+HRD+K+ NI+LDEK+RAKV+DFGTSRS+++D TH TT+V GT GY+DPEYF
Sbjct  537   HSAAASPIFHRDVKSTNIMLDEKYRAKVADFGTSRSVTVDHTHLTTVVSGTVGYVDPEYF  596

Query  469   QSSQFTEKSDVYSFGVVLAELLTGQKPISFELDDDEDRSLVSRFLLCMEENRLMEMLDGE  290
             QSSQFT+KSDVYSFGVVL EL+TG+KPISF +   + R+L + F++ MEENRL++++D  
Sbjct  597   QSSQFTDKSDVYSFGVVLVELITGEKPISF-VRLQQSRTLATYFIVAMEENRLLDIIDPR  655

Query  289   VIEQGKKEDVVAMAWLAQRCLNFNGKKRPTMKEVATELDAIKA----SNSHL  146
             + E    E V+A + LA+RCLN NG+ RP+M+EV+ EL+ I++    S+SH+
Sbjct  656   IREDCNLEQVMAASQLARRCLNLNGRNRPSMREVSMELERIRSPTGDSHSHV  707



>ref|XP_010051317.1| PREDICTED: wall-associated receptor kinase-like 3 [Eucalyptus 
grandis]
Length=992

 Score =   424 bits (1090),  Expect = 1e-127, Method: Compositional matrix adjust.
 Identities = 199/296 (67%), Positives = 254/296 (86%), Gaps = 3/296 (1%)
 Frame = -1

Query  1051  IEKTKIFTASELDKATDHFNADRIVGRGGQGTVYKGMLIDGQIVAVKKSQAVDEDQLEPF  872
             +EK K+F + +L+KAT++FN DRI+GRGGQGTVYKGML DG+IVA+KKS+A+DE ++E F
Sbjct  649   VEKNKLFNSKDLEKATNNFNEDRILGRGGQGTVYKGMLTDGKIVAIKKSKAIDEGKVEQF  708

Query  871   INEVVILSQINHRNVVKLMGCCLETEVPILVYEFIPNGTLFGLIHNNFDNELIPLSWDIR  692
             INEV ILSQINHRN+VKL+GCCLETEVP+LVYEFIPNGTL+  +H+    E   +SWD R
Sbjct  709   INEVFILSQINHRNIVKLLGCCLETEVPLLVYEFIPNGTLYQYLHD--PKEEYHVSWDTR  766

Query  691   LRIASEVACALAYLHSVTLVPIYHRDIKTGNILLDEKFRAKVSDFGTSRSISIDKTHFTT  512
             LRIA+E+A AL YLHS   +PIYHRDIK+ NILLDEK+RAKV+DFGTS+S+S+D+TH TT
Sbjct  767   LRIATEIAGALFYLHSAASIPIYHRDIKSTNILLDEKYRAKVADFGTSKSVSLDQTHVTT  826

Query  511   MVKGTFGYLDPEYFQSSQFTEKSDVYSFGVVLAELLTGQKPISFELDDDEDRSLVSRFLL  332
             +V+GTFGYLDPEYFQSSQFT+KSDVYSFGVVL ELLTGQKPIS  L + E RSL + F++
Sbjct  827   LVQGTFGYLDPEYFQSSQFTDKSDVYSFGVVLVELLTGQKPIS-SLREQEGRSLATYFII  885

Query  331   CMEENRLMEMLDGEVIEQGKKEDVVAMAWLAQRCLNFNGKKRPTMKEVATELDAIK  164
              MEEN+L +++D +V+++GKKE++ ++A LA+RCLN NG+ RPTMKEVA EL+ ++
Sbjct  886   SMEENQLFDIVDAQVLKEGKKEEIASVANLAKRCLNLNGRNRPTMKEVAMELEGMR  941



>ref|XP_010051335.1| PREDICTED: wall-associated receptor kinase-like 1 [Eucalyptus 
grandis]
Length=928

 Score =   422 bits (1085),  Expect = 1e-127, Method: Compositional matrix adjust.
 Identities = 199/296 (67%), Positives = 253/296 (85%), Gaps = 3/296 (1%)
 Frame = -1

Query  1051  IEKTKIFTASELDKATDHFNADRIVGRGGQGTVYKGMLIDGQIVAVKKSQAVDEDQLEPF  872
             +EK K+F + +L+KAT++FN DRI+GRGGQGTVYKGML DG+IVA+KKS+A+DE ++E F
Sbjct  585   VEKNKLFNSKDLEKATNNFNEDRILGRGGQGTVYKGMLTDGKIVAIKKSKAIDEGKVEQF  644

Query  871   INEVVILSQINHRNVVKLMGCCLETEVPILVYEFIPNGTLFGLIHNNFDNELIPLSWDIR  692
             INEV+ILSQINHRN+VKL+GCCLETEVP+LVYEFIPNGTL+  +H+    E   +SWD R
Sbjct  645   INEVIILSQINHRNIVKLLGCCLETEVPLLVYEFIPNGTLYQYLHD--PKEEYHVSWDTR  702

Query  691   LRIASEVACALAYLHSVTLVPIYHRDIKTGNILLDEKFRAKVSDFGTSRSISIDKTHFTT  512
             LRIA+E+A AL YLHS   +PIYHRDIK+ NILLDEK+RAKV+DFGTS+S+S+D+TH TT
Sbjct  703   LRIATEIARALFYLHSAASIPIYHRDIKSTNILLDEKYRAKVADFGTSKSVSLDQTHVTT  762

Query  511   MVKGTFGYLDPEYFQSSQFTEKSDVYSFGVVLAELLTGQKPISFELDDDEDRSLVSRFLL  332
             +V+GTFGYLDPEYFQSSQFT+KSDVYSFGVVL ELLTGQKPIS  L + E RSL + F++
Sbjct  763   LVQGTFGYLDPEYFQSSQFTDKSDVYSFGVVLVELLTGQKPISL-LREQEGRSLATYFII  821

Query  331   CMEENRLMEMLDGEVIEQGKKEDVVAMAWLAQRCLNFNGKKRPTMKEVATELDAIK  164
              MEEN+L  ++D +V+++ KKE++ ++A LA+RCLN NG+ RPTMKEVA EL+ +K
Sbjct  822   SMEENQLFNIVDAQVLKEDKKEEIASVANLAKRCLNLNGRNRPTMKEVAMELEGMK  877



>ref|XP_010516829.1| PREDICTED: wall-associated receptor kinase-like 10 [Camelina 
sativa]
Length=802

 Score =   419 bits (1076),  Expect = 1e-127, Method: Compositional matrix adjust.
 Identities = 230/434 (53%), Positives = 308/434 (71%), Gaps = 30/434 (7%)
 Frame = -1

Query  1372  CSPSTYINPQLQWHNYLQCDCPGGDDRNVYLSGG--------CEWKHKD-----------  1250
             C  + Y N  L   +Y +C C    + N +L GG        C  K+ D           
Sbjct  312   CHYNAYNNASL---SYARCSCNRDYEGNPFLPGGGGCKDINECLLKNDDVTYKYCTSGTC  368

Query  1249  ------YVISSNKLRPAIIGISASFGFVFLIWAFVILYkaikkrkmkklrqkffkRNGGl  1088
                   Y       RP  +GI +SFG +  I     LYK I+K+K  K ++KFFKRNGGL
Sbjct  369   VNLPGHYTCVYKNQRPLAVGIGSSFGSLLFIVGIYWLYKFIRKQKRLKQKKKFFKRNGGL  428

Query  1087  llqqqlLTKEGTIEKTKIFTASELDKATDHFNADRIVGRGGQGTVYKGMLIDGQIVAVKK  908
             LLQQQL   EG +EKTK+F++ EL+KAT++F+ +RI+G+GGQGTVYKGML+DG+IVAVKK
Sbjct  429   LLQQQLTATEGNLEKTKVFSSRELEKATENFSLNRILGQGGQGTVYKGMLVDGRIVAVKK  488

Query  907   SQAVDEDQLEPFINEVVILSQINHRNVVKLMGCCLETEVPILVYEFIPNGTLFGLIHNNF  728
             S+ VDED+LE FINEVVILSQINHRN+VKL+GCCLET+VP+LVYEFIPNG LF  +H+  
Sbjct  489   SKVVDEDKLEEFINEVVILSQINHRNIVKLLGCCLETDVPVLVYEFIPNGNLFEHLHDEL  548

Query  727   DNELIPLSWDIRLRIASEVACALAYLHSVTLVPIYHRDIKTGNILLDEKFRAKVSDFGTS  548
             ++  +  +W++RLRIA ++A AL+YLHS    PIYHRD+K+ NI+LDEK+RAKVSDFGTS
Sbjct  549   EDYTMT-TWEVRLRIAVDIAGALSYLHSAASSPIYHRDVKSTNIMLDEKYRAKVSDFGTS  607

Query  547   RSISIDKTHFTTMVKGTFGYLDPEYFQSSQFTEKSDVYSFGVVLAELLTGQKPISFELDD  368
             RS+++D TH TT+V GT GY+DPEYFQSSQFT+KSDVYSFGVVL EL+TG+K +SF L  
Sbjct  608   RSVTVDHTHLTTVVSGTVGYMDPEYFQSSQFTDKSDVYSFGVVLVELITGEKSVSF-LRS  666

Query  367   DEDRSLVSRFLLCMEENRLMEMLDGEVIEQGKKEDVVAMAWLAQRCLNFNGKKRPTMKEV  188
              E+R+L + F+  M+ N L +++D  + +  K   V A A +A++CLN  G+KRP+M+EV
Sbjct  667   QENRTLATYFIHAMKHNTLFDIIDPRIRDGCKLNQVTAAAKIARKCLNLKGRKRPSMREV  726

Query  187   ATELDAIKASNSHL  146
             + EL+ I++S+  +
Sbjct  727   SMELENIRSSSGDM  740



>ref|XP_002264469.1| PREDICTED: wall-associated receptor kinase-like 8 [Vitis vinifera]
Length=736

 Score =   416 bits (1070),  Expect = 2e-127, Method: Compositional matrix adjust.
 Identities = 273/635 (43%), Positives = 370/635 (58%), Gaps = 63/635 (10%)
 Frame = -1

Query  1924  HPDIQQNVRIIYECVDFLGMSYDSQTITIK-ESISPSCQGSNNFSNIIHNS-KLSETPFM  1751
              P + QN+ +       LG+S    T+T+  +S S   +       I +    L  +PFM
Sbjct  68    QPFLLQNIPV-------LGISLAQGTVTVSLQSASERNKKHTLTDKIFYGGFNLEGSPFM  120

Query  1750  YSNDNNFMLFGCG-NAFITMPGEELDQPGYNLNCSSKNTTAPKTAHDCQGINC------N  1592
              SN N F++ GC   AFIT  G+EL + G    C+      P     C GI C      N
Sbjct  121   LSNSNKFIVLGCNVTAFIT-EGKEL-RSGCITFCNEDGN--PDELGSCSGIGCCKTSIPN  176

Query  1591  HLTVDYDVNTYQVNFTHSSSFNACNYAFFlsassslpptlqslpsrqQEMVVVPVELRWT  1412
             HL    +V+ + + F+ +SSF       FL+A  +   +  +L       +   V+L W 
Sbjct  177   HLK-SLNVSLFNLTFSDTSSFG---LHMFLAARGTFNFSETNLSEHLNRTINSQVDLDWV  232

Query  1411  ITQEDVP------------------PSYSKYCSPSTYINP----------QLQWHNYLQC  1316
             + ++                     P Y  +C P    NP          +    N  QC
Sbjct  233   VGEKTCKEAQANCGKNTVCSDSTNGPGYRCFCKPGFSGNPYRPNGCEDIDECSEPNIYQC  292

Query  1315  DCPGGDDRNVYLSGGCEWK---HKDYVISSNKLRPAII--GISASFGFVFLIWAFVILYk  1151
             +   G  RN   +  C      H +  ++      A +  GI  S GF+  +     LY 
Sbjct  293   E---GICRNTVGNYSCRCPFGMHGEGKVACRGHHTATVFLGIGLSLGFLLALSGLFRLYL  349

Query  1150  aikkrkmkklrqkffkRNGGlllqqqlLTKEGTIEKTKIFTASELDKATDHFNADRIVGR  971
              + ++   KL++KFFKRNGGLLL+QQ+ + +G +EK K FT+ EL+KATDH+N +RI+G+
Sbjct  350   LVHEQNSIKLKRKFFKRNGGLLLEQQISSDKGKLEKIKNFTSEELEKATDHYNDNRILGQ  409

Query  970   GGQGTVYKGMLIDGQIVAVKKSQAVDEDQLEPFINEVVILSQINHRNVVKLMGCCLETEV  791
             GGQG VYK ML DG +VAVKKS+ +DE Q+E F+NEVVILSQINHR+VVKL+GCCLETEV
Sbjct  410   GGQGIVYKAMLPDGNLVAVKKSEMMDEGQIEHFVNEVVILSQINHRHVVKLLGCCLETEV  469

Query  790   PILVYEFIPNGTLFGLIHNNFDNELIPLSWDIRLRIASEVACALAYLHSVTLVPIYHRDI  611
             P+LVYE++ NGTL   IH     E  P+ W  R RIA EVA A+AY+HS   VPIYHRD+
Sbjct  470   PLLVYEYVSNGTLSDHIHAQL--EEAPMKWADRFRIAKEVAGAIAYMHSAAAVPIYHRDV  527

Query  610   KTGNILLDEKFRAKVSDFGTSRSISIDKTHFTTMVKGTFGYLDPEYFQSSQFTEKSDVYS  431
             K+ NILLDEK+RAK+SDFG SRS+   KTH TT V+GTFGYLDPEYFQS Q T KSDVYS
Sbjct  528   KSSNILLDEKYRAKLSDFGISRSVPTGKTHLTTSVQGTFGYLDPEYFQSYQCTAKSDVYS  587

Query  430   FGVVLAELLTGQKPISFELDDDEDRSLVSRFLLCMEENRLMEMLDGEVIEQGKKEDVVAM  251
             FGVVL ELLTG++PIS    +D D  L + F+   +EN L+++LD +V+ +G+KE+++ +
Sbjct  588   FGVVLVELLTGRRPISMVRSED-DMGLAAHFISSAKENHLLDVLDPQVVLEGEKEELLIV  646

Query  250   AWLAQRCLNFNGKKRPTMKEVATELDAIKASNSHL  146
             + LA RCL  NG+KRPTMKEVA +L+ +K     L
Sbjct  647   SNLALRCLKLNGRKRPTMKEVALKLENLKNRRKRL  681



>ref|XP_009119474.1| PREDICTED: wall-associated receptor kinase-like 10 [Brassica 
rapa]
Length=786

 Score =   418 bits (1074),  Expect = 2e-127, Method: Compositional matrix adjust.
 Identities = 219/364 (60%), Positives = 289/364 (79%), Gaps = 2/364 (1%)
 Frame = -1

Query  1252  DYVISSNKLRPAIIGISASFGFVFLIWAFVILYkaikkrkmkklrqkffkRNGGlllqqq  1073
             D V   NK  P +IG S   G +  +     LYK IK R+    ++K+FKRNGGLLLQQQ
Sbjct  364   DCVEKKNKTLPIVIGFSVGIGVLVFVGVSFWLYKFIKSRRKLNRKRKYFKRNGGLLLQQQ  423

Query  1072  lLTKEGTIEKTKIFTASELDKATDHFNADRIVGRGGQGTVYKGMLIDGQIVAVKKSQAVD  893
             L++ EG I++T +F + EL+KAT++F+ +R++G+GGQGTVYKGML DG+IVAVKKS+ VD
Sbjct  424   LISNEGRIKETIVFNSKELEKATENFSLNRVLGQGGQGTVYKGMLEDGRIVAVKKSKVVD  483

Query  892   EDQLEPFINEVVILSQINHRNVVKLMGCCLETEVPILVYEFIPNGTLFGLIHNNFDNELI  713
             ED+LE FINEVVILSQINHRN+VKL+GCCLET VP+LVYEFIPNG LF  +H+ FD+  +
Sbjct  484   EDKLEEFINEVVILSQINHRNIVKLLGCCLETNVPLLVYEFIPNGNLFEHLHDQFDDYTM  543

Query  712   PLSWDIRLRIASEVACALAYLHSVTLVPIYHRDIKTGNILLDEKFRAKVSDFGTSRSISI  533
               +W++RLRIA ++A AL+YLHS    PIYHRDIK+ NI+LDEK+RAKVSDFGTSRS+++
Sbjct  544   -TTWEVRLRIAIDIAGALSYLHSAASSPIYHRDIKSTNIMLDEKYRAKVSDFGTSRSVTV  602

Query  532   DKTHFTTMVKGTFGYLDPEYFQSSQFTEKSDVYSFGVVLAELLTGQKPISFELDDDEDRS  353
             D TH TT+V GT GY+DPEYFQSSQFT+KSDVYSFGVVL EL+TG+KP+SF L   E+R+
Sbjct  603   DHTHLTTVVSGTVGYVDPEYFQSSQFTDKSDVYSFGVVLVELITGEKPVSF-LRSQENRT  661

Query  352   LVSRFLLCMEENRLMEMLDGEVIEQGKKEDVVAMAWLAQRCLNFNGKKRPTMKEVATELD  173
             L + F+L ++E++L+ ++D  + +  K E V+A A LA+RCLN NGKKRP+M+EV+ EL+
Sbjct  662   LATYFILAVKEDKLVNIIDPRIRDDCKLEQVMAAAVLARRCLNLNGKKRPSMREVSMELE  721

Query  172   AIKA  161
              I++
Sbjct  722   RIRS  725



>ref|XP_010476714.1| PREDICTED: wall-associated receptor kinase-like 1 [Camelina sativa]
Length=731

 Score =   416 bits (1069),  Expect = 2e-127, Method: Compositional matrix adjust.
 Identities = 271/653 (42%), Positives = 375/653 (57%), Gaps = 71/653 (11%)
 Frame = -1

Query  1945  NSYIGSTHPDIQQNVRIIYECVDF-LGMSYDSQTIT-IKESISPSCQGSNNFSNIIHNSK  1772
             NS I  +   +    RI  E V+  L   YD+  +  IK  ++     SNN S     S 
Sbjct  69    NSTISGSRTTVPFLTRINKEVVNISLPEIYDNHGVVYIKTHVTSLGCSSNNTSQGFQKSL  128

Query  1771  LS------ETPFMYSNDNNFMLFGCGNAFITMPGEELDQPGYNLNCSSKNTTAPKTAHDC  1610
                      +P+  +++N  +  GCG   + M   E +  G   +C    +    T   C
Sbjct  129   TGLNVTGKGSPYFLTDENRLVAVGCGTKAL-MTDIESEILGCESSCEKSKSGEQVTDSIC  187

Query  1609  QGINCNHLTVDYDV-NTYQVNFTHSSSF-NACNYAFFlsassslpptlqslpsrqQEMVV  1436
              G  C    +         VN  +S     +C  AF  +   S     ++         V
Sbjct  188   NGYRCCQARIPVGRPQVISVNVENSGGGEGSCKVAFLTNKRYSPLNVTEAEQFHSDGYEV  247

Query  1435  VPVELRWTITQEDVPPSYSKYCSPSTYINPQLQWHN----------------YLQCDCPG  1304
             V  EL W  +  D     S++ SP   +N   + H+                Y  C C G
Sbjct  248   V--ELGWYFSTSD-----SRFRSPLGCVNLTSKGHHLPDNCSCEYDYLSGTSYRNCYCNG  300

Query  1303  GDDRNVYLSGGC----------EWKHKDYVIS-----------SNKLRPA--------II  1211
             G   N YL GGC              + Y ++            N  +PA         I
Sbjct  301   GYAGNPYLRGGCIETDLCGGYHRCSEESYCVNMPGPAYTCKPKPNTNKPAKFTMIQGIAI  360

Query  1210  GISASFGFVFLIWAFVILYkaikkrkmkklrqkffkRNGGlllqqq-lLTKEGTIEKTKI  1034
             G+S    FV L W F  +    KKR+     +KFFKRNGGLLL QQ   TK+G +E +K+
Sbjct  361   GLSGLLFFVGLFWLFKFV----KKRRKIIQSKKFFKRNGGLLLNQQITTTKDGNVEMSKV  416

Query  1033  FTASELDKATDHFNADRIVGRGGQGTVYKGMLIDGQIVAVKKSQAVDEDQLEPFINEVVI  854
             F++ EL +ATD+F+ +R++G+GGQGTVYKGML+DG+IVAVK+S+ VDED+LE FINEVV+
Sbjct  417   FSSKELKRATDNFSVNRVLGQGGQGTVYKGMLVDGRIVAVKRSKVVDEDKLEEFINEVVL  476

Query  853   LSQINHRNVVKLMGCCLETEVPILVYEFIPNGTLFGLIHNNFDNELIPLSWDIRLRIASE  674
             LSQ+NHRN+VKL+GCCLETEVPILVYE+IPNG L+  +H+ +D+    ++W++RLRIA E
Sbjct  477   LSQMNHRNIVKLLGCCLETEVPILVYEYIPNGDLYKRLHDEYDD--YTMTWEVRLRIAIE  534

Query  673   VACALAYLHSVTLVPIYHRDIKTGNILLDEKFRAKVSDFGTSRSISIDKTHFTTMVKGTF  494
              A AL Y+HS    PI+HRDIKT NILLDEK+RAKVSDFGTSRSI+ID+TH TT+V GTF
Sbjct  535   TAGALTYMHSAASFPIFHRDIKTTNILLDEKYRAKVSDFGTSRSITIDQTHLTTLVAGTF  594

Query  493   GYLDPEYFQSSQFTEKSDVYSFGVVLAELLTGQKPISFELDDDEDRSLVSRFLLCMEENR  314
             GY+DPEYF SSQ+T KSDVYSFGVVL EL+TG+KP+S  +  +E R L + FL  ++ENR
Sbjct  595   GYMDPEYFMSSQYTHKSDVYSFGVVLVELITGEKPMS-RVRSEEGRGLATDFLEAVKENR  653

Query  313   LMEMLDGEVIEQGKKEDVVAMAWLAQRCLNFNGKKRPTMKEVATELDAIKASN  155
             + +++D  + ++ K + V+A+A LA++CL+  G KRP M+EV+ EL+ I++S+
Sbjct  654   VFDIIDDRMKDESKLDQVMAVAKLARKCLSRKGTKRPNMREVSFELERIRSSS  706



>ref|XP_009106691.1| PREDICTED: wall-associated receptor kinase-like 10 [Brassica 
rapa]
Length=774

 Score =   417 bits (1073),  Expect = 2e-127, Method: Compositional matrix adjust.
 Identities = 224/423 (53%), Positives = 305/423 (72%), Gaps = 28/423 (7%)
 Frame = -1

Query  1336  WHNYLQCDCPGGDDRNVYLSGGCE-----WKHKDY--------------------VISSN  1232
             +  Y  C+C  G   + Y+ GGC+      + KD                      +  N
Sbjct  296   FSTYGICECTEGYRGDPYVVGGCKDINECLEGKDENGNPVRCTNSICVNLQGGYNCVYEN  355

Query  1231  KLRPAI-IGISASFGFVFLIWAFVILYkaikkrkmkklrqkffkRNGGlllqqqlLTKEG  1055
             + RP I IG+ +SFG +  +    + Y+ I+K++    ++KFF+RNGGLLLQQQL + +G
Sbjct  356   QRRPVIAIGVGSSFGSLIFVAGIYLAYRFIRKQRRLNQKKKFFRRNGGLLLQQQLTSTQG  415

Query  1054  TIEKTKIFTASELDKATDHFNADRIVGRGGQGTVYKGMLIDGQIVAVKKSQAVDEDQLEP  875
              IE+T++FT+ EL+KAT++F+ +RI+G+GGQGTVYKGML+DG+IVAVKKS+ VDED+LE 
Sbjct  416   NIERTRVFTSKELEKATENFSLNRILGQGGQGTVYKGMLVDGRIVAVKKSKVVDEDKLEE  475

Query  874   FINEVVILSQINHRNVVKLMGCCLETEVPILVYEFIPNGTLFGLIHNNFDNELIPLSWDI  695
             FINEVVILSQINHRN+VK++GCCLET VP+LVYEFIPNG LF  +H+ F + ++  +W++
Sbjct  476   FINEVVILSQINHRNIVKILGCCLETHVPVLVYEFIPNGNLFEHLHDEFGDNMMA-TWEL  534

Query  694   RLRIASEVACALAYLHSVTLVPIYHRDIKTGNILLDEKFRAKVSDFGTSRSISIDKTHFT  515
             RLRIA +VA AL+YLHS    PIYHRD+K+ NI+LDEK+RAKVSDFGTSRSI++D TH T
Sbjct  535   RLRIAIDVAGALSYLHSSASFPIYHRDVKSTNIMLDEKYRAKVSDFGTSRSITVDHTHLT  594

Query  514   TMVKGTFGYLDPEYFQSSQFTEKSDVYSFGVVLAELLTGQKPISFELDDDEDRSLVSRFL  335
             T+V GT GY+DPEYFQSSQFT+KSDVYSFGVVL EL+TG+KP SF L   E+R+L S F 
Sbjct  595   TVVSGTAGYMDPEYFQSSQFTDKSDVYSFGVVLVELITGEKPFSF-LRSQENRTLSSYFT  653

Query  334   LCMEENRLMEMLDGEVIEQGKKEDVVAMAWLAQRCLNFNGKKRPTMKEVATELDAIKASN  155
             L M+E++L +++D  + +      V A A +A+ CLN   KKRP+M+EV+ EL+ I+ S+
Sbjct  654   LAMKEDKLFDIIDARIRDGCNLNQVTAAADIARTCLNMKRKKRPSMREVSMELEKIRGSS  713

Query  154   SHL  146
               +
Sbjct  714   EDM  716



>ref|XP_011020556.1| PREDICTED: wall-associated receptor kinase-like 8 [Populus euphratica]
Length=728

 Score =   416 bits (1069),  Expect = 2e-127, Method: Compositional matrix adjust.
 Identities = 237/405 (59%), Positives = 297/405 (73%), Gaps = 23/405 (6%)
 Frame = -1

Query  1321  QCDCPGGDDRNVYLSGGC----EWKHKD----------------YVISSNKLRPAIIGIS  1202
             +C C  G + N YL  GC    E K  +                Y    NK     I ++
Sbjct  268   ECSCSNGYEGNPYL--GCADINECKDPNRHSCLGITKCVNTLGSYKCEVNKYWIVPILVA  325

Query  1201  ASFGFVFLIWAFVILYkaikkrkmkklrqkffkRNGGlllqqqlLTKEGTIEKTKIFTAS  1022
             A  G   L+   + LYK  +KRK  +L++KFFKRNGGLLLQQQL +  G+++KTKIFT+ 
Sbjct  326   AIAGIFSLLAGILWLYKLARKRKNIELKRKFFKRNGGLLLQQQLSSNNGSVQKTKIFTSK  385

Query  1021  ELDKATDHFNADRIVGRGGQGTVYKGMLIDGQIVAVKKSQAVDEDQLEPFINEVVILSQI  842
             EL++ATD FN +RI+G+GGQGTVYKGML DG+IVAVK+S  V E++LE F+NEVVILSQI
Sbjct  386   ELERATDRFNENRILGQGGQGTVYKGMLEDGRIVAVKRSTIVGEEKLEEFVNEVVILSQI  445

Query  841   NHRNVVKLMGCCLETEVPILVYEFIPNGTLFGLIHNNFDNELIPLSWDIRLRIASEVACA  662
             NHRNVVKL GCCLETEVP+LVYEFI NG LF  +HN + NE   LSW++RL+IA EVA A
Sbjct  446   NHRNVVKLFGCCLETEVPLLVYEFISNGNLFQYLHNFYQNEDFILSWEMRLQIAIEVAGA  505

Query  661   LAYLHSVTLVPIYHRDIKTGNILLDEKFRAKVSDFGTSRSISIDKTHFTTMVKGTFGYLD  482
             L+YLHS   +PI+HRDIK+ NILLD+K+RAKVSDFG+SRS++ID+TH TT V+GTFGYLD
Sbjct  506   LSYLHSAASIPIFHRDIKSANILLDDKYRAKVSDFGSSRSMAIDQTHMTTNVQGTFGYLD  565

Query  481   PEYFQSSQFTEKSDVYSFGVVLAELLTGQKPISFELDDDEDRSLVSRFLLCMEENRLMEM  302
             PEY+QSSQFT+KSDVYSFGVVL ELL+G+KPI       E RSL + FL+ MEENRL ++
Sbjct  566   PEYYQSSQFTDKSDVYSFGVVLVELLSGKKPI-LSSTSQETRSLATHFLVLMEENRLFDI  624

Query  301   LDGEVIEQGKKEDVVAMAWLAQRCLNFNGKKRPTMKEVATELDAI  167
             LD  V E   +E+++A+A LA+RCLN + K RPTMKEV+ EL+ I
Sbjct  625   LDVLVKEDCLEEEIMAVANLAKRCLNVSRKHRPTMKEVSAELERI  669



>ref|XP_003534785.1| PREDICTED: wall-associated receptor kinase-like 8-like [Glycine 
max]
Length=732

 Score =   416 bits (1069),  Expect = 2e-127, Method: Compositional matrix adjust.
 Identities = 231/441 (52%), Positives = 307/441 (70%), Gaps = 19/441 (4%)
 Frame = -1

Query  1435  VPVELRWTITQEDVPPSYSKYCSPSTY------INPQLQWHNYLQCDCPGGDDRNVYLSG  1274
             VP  L W I       S+ ++ +  +Y      +   L   +  +C C  G + N Y+  
Sbjct  253   VPAVLEWEIPIHTPNNSFPEFRTDGSYNCSYTNVTSSLYSQSGWRCSCRDGFEGNPYIQE  312

Query  1273  GCEW------KHKDYVISSNKLRPAIIGISASFGFVFLIWAFVILYkaikkrkmkklrqk  1112
             GC++      + +D   +  K   AIIG+S+S G + L+     L K ++K   KK ++K
Sbjct  313   GCKFVATGDSELRDKRKTREKW--AIIGVSSSLGTIILLPRLCWLNKVVRKNIEKKRKEK  370

Query  1111  ffkRNGGlllqqqlLTKEGTIEKTKIFTASELDKATDHFNADRIVGRGGQGTVYKGMLID  932
             FF RNGGLLL+Q+L + E  ++K K+FT  +LDKATDHFN +R++G+GGQGTVYKGML+D
Sbjct  371   FFIRNGGLLLKQRLSSGEANVDKIKLFTLKDLDKATDHFNINRVLGKGGQGTVYKGMLVD  430

Query  931   GQIVAVKKSQAVDEDQLEPFINEVVILSQINHRNVVKLMGCCLETEVPILVYEFIPNGTL  752
             G IVAVKK +      +E FINE VILSQINHRNVVKL+GCCLETE+P+LVYEFIPNG L
Sbjct  431   GNIVAVKKFKV--NGNVEEFINEFVILSQINHRNVVKLLGCCLETEIPLLVYEFIPNGNL  488

Query  751   FGLIHNNFDNELIPLSWDIRLRIASEVACALAYLHSVTLVPIYHRDIKTGNILLDEKFRA  572
             +  +    D+  +P++WD+RLRIA+EVA AL YLHS    PIYHRDIK+ NILLD K++A
Sbjct  489   YEYLLGQNDD--LPMTWDMRLRIATEVAGALFYLHSAASQPIYHRDIKSRNILLDGKYKA  546

Query  571   KVSDFGTSRSISIDKTHFTTMVKGTFGYLDPEYFQSSQFTEKSDVYSFGVVLAELLTGQK  392
             KV+DFG SR +SI+ TH TT V+GTFGY+DPEYF +SQ T+KSDVYSFGVVL ELLTG++
Sbjct  547   KVADFGASRMVSIEATHLTTAVQGTFGYMDPEYFHTSQLTDKSDVYSFGVVLIELLTGKE  606

Query  391   PISFELDDDEDRSLVSRFLLCMEENRLMEMLDGEVIEQGKKEDVVAMAWLAQRCLNFNGK  212
             PIS      E RSL S FLLCMEENRL +++D  ++++ +KE +V +A LA+RCL   GK
Sbjct  607   PIS-SAKQQELRSLASYFLLCMEENRLFDIIDERIVKEAEKEHIVVVANLARRCLELKGK  665

Query  211   KRPTMKEVATELDAIKASNSH  149
             +RPTMKEV +EL++I+ S   
Sbjct  666   RRPTMKEVTSELESIQKSRKQ  686



>ref|XP_010417636.1| PREDICTED: wall-associated receptor kinase-like 10 [Camelina 
sativa]
Length=782

 Score =   417 bits (1073),  Expect = 2e-127, Method: Compositional matrix adjust.
 Identities = 219/382 (57%), Positives = 292/382 (76%), Gaps = 11/382 (3%)
 Frame = -1

Query  1312  CPGGDDRNVYLSGGCEWKHKDYVISSNKLRPAIIGISASFGFVFLIWAFVILYkaikkrk  1133
             CPGG   N+         H  Y  S+   RP  IGI  SFG +  +    +LYK I++++
Sbjct  344   CPGGKCVNL---------HGGYRCSNTNNRPLAIGIGTSFGSLIFVGGIYLLYKFIRRQR  394

Query  1132  mkklrqkffkRNGGlllqqqlLTKEGTIEKTKIFTASELDKATDHFNADRIVGRGGQGTV  953
                 ++KFFKRNGGLLLQQQL++ EG ++ T++F + EL+KAT++F+ +RI+G GGQGTV
Sbjct  395   RLNRKKKFFKRNGGLLLQQQLISTEGNVDNTRVFNSKELEKATENFSLNRILGEGGQGTV  454

Query  952   YKGMLIDGQIVAVKKSQAVDEDQLEPFINEVVILSQINHRNVVKLMGCCLETEVPILVYE  773
             YKGML DG+IVAVKKS+ VDED+LE FINEVVILSQINHRN+VKL+GCCLET+VPILVYE
Sbjct  455   YKGMLADGRIVAVKKSKVVDEDKLEEFINEVVILSQINHRNIVKLLGCCLETDVPILVYE  514

Query  772   FIPNGTLFGLIHNNFDNELIPLSWDIRLRIASEVACALAYLHSVTLVPIYHRDIKTGNIL  593
             FIPNG LF  +H++ D+  +  +W++RLRIA ++A AL+YLHS    PIYHRDIK+ NI+
Sbjct  515   FIPNGNLFEHLHDDSDDYTMT-TWEVRLRIALDIAGALSYLHSAASSPIYHRDIKSTNIM  573

Query  592   LDEKFRAKVSDFGTSRSISIDKTHFTTMVKGTFGYLDPEYFQSSQFTEKSDVYSFGVVLA  413
             LDEK+RAKVSDFGTSR++++D TH TT+V GT GY+DPEYFQSSQFT+KSDVYSFGVVLA
Sbjct  574   LDEKYRAKVSDFGTSRTVTVDHTHLTTVVSGTVGYMDPEYFQSSQFTDKSDVYSFGVVLA  633

Query  412   ELLTGQKPISFELDDDEDRSLVSRFLLCMEENRLMEMLDGEVIEQGKKEDVVAMAWLAQR  233
             EL+TG+K ISF +    +R+L + F L ++EN+L +++D  + +  K   V+A A +A +
Sbjct  634   ELITGEKSISF-MRSQANRTLSTYFTLAVKENKLSDIIDARIKDGCKINQVIAAAKIATK  692

Query  232   CLNFNGKKRPTMKEVATELDAI  167
             CLN  G+KRP+M+EV+ EL+ I
Sbjct  693   CLNMKGRKRPSMREVSMELEKI  714



>gb|KDO39343.1| hypothetical protein CISIN_1g044312mg, partial [Citrus sinensis]
Length=608

 Score =   412 bits (1058),  Expect = 3e-127, Method: Compositional matrix adjust.
 Identities = 227/376 (60%), Positives = 292/376 (78%), Gaps = 17/376 (5%)
 Frame = -1

Query  1249  YVISSNKLRPAIIGISASFGFVFLIWAFVILYkaikkrkmkklrqkffkRNGGlllqqql  1070
             +VIS  +L  + +G ++    +FL+     L+K +K+R+  KL++K+FKRNGGLLLQQ+L
Sbjct  207   FVISILRLYLSGVGCTSGGLGMFLLIGAWWLFKFVKRRREIKLKRKYFKRNGGLLLQQEL  266

Query  1069  LTKEGTIEKTKIFTASELDKATDHFNADRIVGRGGQGTVYKGMLIDGQIVAVKKSQAVDE  890
              + EGTIEKTK+FT+ EL+KATD+F+ +RI+G+GGQ              AVKKS+ +DE
Sbjct  267   ASTEGTIEKTKLFTSKELEKATDNFDLNRILGQGGQ--------------AVKKSKVIDE  312

Query  889   DQLEPFINEVVILSQINHRNVVKLMGCCLETEVPILVYEFIPNGTLFGLIHNNFDNELIP  710
              ++E FINEVVILSQINHRNVVKL+GCCLETEVP+LVYEFIPNGTLF  IH+   NE  P
Sbjct  313   SKVEEFINEVVILSQINHRNVVKLLGCCLETEVPLLVYEFIPNGTLFQYIHDQ--NEDFP  370

Query  709   LSWDIRLRIASEVACALAYLHSVTLVPIYHRDIKTGNILLDEKFRAKVSDFGTSRSISID  530
             ++W+IRLRIA EV+ AL+YLHS   +PIYHRDIK+ NILLD+K+RAKVSDFG SRS+++D
Sbjct  371   ITWEIRLRIAIEVSGALSYLHSAASIPIYHRDIKSTNILLDDKYRAKVSDFGASRSMAVD  430

Query  529   KTHFTTMVKGTFGYLDPEYFQSSQFTEKSDVYSFGVVLAELLTGQKPISFELDDDEDRSL  350
             +TH TT V GTFGYLDPEYF+SSQFT+KSDVYSFGVVL ELLTG+KPI F +  +ED+SL
Sbjct  431   QTHMTTQVHGTFGYLDPEYFRSSQFTDKSDVYSFGVVLTELLTGEKPIRFTI-LEEDKSL  489

Query  349   VSRFLLCMEENRLMEMLDGEVIEQGKKEDVVAMAWLAQRCLNFNGKKRPTMKEVATELDA  170
              + FL  M+E RL E+LD  V++QG K++++ +A LA+RCLN NGKKRPTM+EVA+EL  
Sbjct  490   AAYFLCAMKEERLFEILDARVMKQGGKDEIITVAKLAKRCLNLNGKKRPTMREVASELAG  549

Query  169   IKASNSHLPLAMEAFE  122
             IKA N    +  E  E
Sbjct  550   IKAWNGASNVIEEGLE  565



>gb|KCW80259.1| hypothetical protein EUGRSUZ_C01607 [Eucalyptus grandis]
Length=392

 Score =   404 bits (1038),  Expect = 3e-127, Method: Compositional matrix adjust.
 Identities = 193/314 (61%), Positives = 262/314 (83%), Gaps = 4/314 (1%)
 Frame = -1

Query  1099  NGGlllqqqlLTKEGT-IEKTKIFTASELDKATDHFNADRIVGRGGQGTVYKGMLIDGQI  923
             NGG LLQQ+L + E   +EK K+F  + LD+ATDHFN +RI+G+GGQG VYKGMLIDG I
Sbjct  29    NGGFLLQQRLTSIEDNHVEKGKLFALTVLDRATDHFNKNRILGQGGQGAVYKGMLIDGTI  88

Query  922   VAVKKSQAVDEDQLEPFINEVVILSQINHRNVVKLMGCCLETEVPILVYEFIPNGTLFGL  743
             +AVKKS+ +D  Q+E F+NE+ ILS+INHRNVVKL+G CLE+EVP+LVYEF+PNGTL+  
Sbjct  89    IAVKKSKVIDARQVEQFVNEIFILSEINHRNVVKLLGFCLESEVPLLVYEFVPNGTLYRH  148

Query  742   IHNNFDNELIPLSWDIRLRIASEVACALAYLHSVTLVPIYHRDIKTGNILLDEKFRAKVS  563
             +H+   NE  P+SW++RLRIA+EVA A++YLHS   +PIYHRDIK+ NILLDEK++AKV+
Sbjct  149   LHDA--NEEFPVSWEMRLRIANEVATAVSYLHSDAAMPIYHRDIKSTNILLDEKYQAKVA  206

Query  562   DFGTSRSISIDKTHFTTMVKGTFGYLDPEYFQSSQFTEKSDVYSFGVVLAELLTGQKPIS  383
             DFG S+ + ID+TH TT V+GTFGYLDPEY+Q+SQFT+KSDVYSFGVVLAELLTG++PIS
Sbjct  207   DFGASKLVPIDQTHLTTKVRGTFGYLDPEYYQTSQFTDKSDVYSFGVVLAELLTGERPIS  266

Query  382   FELDDDEDRSLVSRFLLCMEENRLMEMLDGEVIEQGKKEDVVAMAWLAQRCLNFNGKKRP  203
              +L  ++DR+L S F++ ++ENRL ++LD EV++ G+ E+++A++ LA+RCL  +G+ RP
Sbjct  267   -QLTAEDDRNLASYFIISIQENRLFDVLDKEVLDHGENEEIIAVSNLAKRCLQLHGRYRP  325

Query  202   TMKEVATELDAIKA  161
             TMK+V TEL+ +++
Sbjct  326   TMKQVVTELERVRS  339



>ref|XP_010459161.1| PREDICTED: wall-associated receptor kinase-like 8 [Camelina sativa]
Length=720

 Score =   415 bits (1067),  Expect = 3e-127, Method: Compositional matrix adjust.
 Identities = 265/606 (44%), Positives = 362/606 (60%), Gaps = 36/606 (6%)
 Frame = -1

Query  1921  PDIQQNVRIIYECVDFLGMSYDSQTITIKESISPSCQGSNNFSNIIHNSKLSETPFMYSN  1742
             P IQ+ V   +   +F  MS  ++       I   C   +  S+   N  L+E+PF  S 
Sbjct  77    PGIQREV-TSFNLGNFFSMSVYNRFYIQSPLIHTGCPSRDGDSSSSLN--LTESPFYISE  133

Query  1741  DNNFMLFGCGN-AFITMPGEELDQPGYNLNCSSKNTTAPKTAHDCQGINCNHLTVDYDVN  1565
             +N F   GC N AF+   G  L   G    C ++  +       C G  C  + +   + 
Sbjct  134   NNKFTAVGCNNKAFLNPTG--LQIVGCKTTCGNEIRSYQGANTSCVGYKCCQMNIPSHLQ  191

Query  1564  TYQVNFTH-SSSFNACNYAFFlsassslpptlqslpsrqQEMVVVPVELRWTITQEDVPP  1388
              +         S   C  AF   ++ S            ++  ++  EL W +    +  
Sbjct  192   EFYATVEKMEPSKEGCQVAFLSQSTLSGYLFTPPELPEYRDYAIM--ELEWHLNLASMT-  248

Query  1387  SYSKYCSPSTYINPQLQWHNYLQCDCPGGDDRNVYLSGGCE-------------WKHKDY  1247
             S    C P T+        NY +C C  G + N Y+  GC+              K+K  
Sbjct  249   SDGSLCQPKTFAE-----DNY-ECSCLTGYEGNPYIPHGCQDIDECSIPHQNNCGKNKCV  302

Query  1246  VISSN----KLRPAIIGISASFGFVFLIWAFVILYkaikkrkmkklrqkffkRNGGlllq  1079
              +  +    K  PAI+G + S G +  +     L   I+KRK  K ++KFFKRNGGLLLQ
Sbjct  303   NVRGSFRCEKTWPAILGGTLSSGLLLSVVGMWFLCNVIRKRKATKQKRKFFKRNGGLLLQ  362

Query  1078  qqlLTKEGTIEKTKIFTASELDKATDHFNADRIVGRGGQGTVYKGMLIDGQIVAVKKSQA  899
             QQ    +G++ +TK+F+++EL+KATD FNA RI+G+GGQGTVYKGML DG IVAVKKS+A
Sbjct  363   QQTSFLQGSVNRTKLFSSNELEKATDKFNASRILGQGGQGTVYKGMLEDGMIVAVKKSKA  422

Query  898   VDEDQLEPFINEVVILSQINHRNVVKLMGCCLETEVPILVYEFIPNGTLFGLIHNNFDNE  719
             ++E+ LE FINE+++LSQINHRNVVK++GCCLETEVP+LVYEFIPN  LF  +H+   +E
Sbjct  423   LEEENLEEFINEIILLSQINHRNVVKILGCCLETEVPVLVYEFIPNCNLFDHLHS--PSE  480

Query  718   LIPLSWDIRLRIASEVACALAYLHSVTLVPIYHRDIKTGNILLDEKFRAKVSDFGTSRSI  539
               P++W++RLRI+ EV+ AL+YLHS   VPIYHRD+K+ NILLDEK RAKVSDFG SRS+
Sbjct  481   DFPMTWEVRLRISCEVSDALSYLHSAASVPIYHRDVKSTNILLDEKHRAKVSDFGISRSV  540

Query  538   SIDKTHFTTMVKGTFGYLDPEYFQSSQFTEKSDVYSFGVVLAELLTGQKPISFELDDDED  359
              +D TH TT+V+GT GY+DPEY QSS FT KSDVYSFGV+L ELLTG+KP+S  L   E 
Sbjct  541   PLDDTHLTTIVQGTIGYVDPEYLQSSHFTGKSDVYSFGVLLIELLTGEKPVSL-LRRQEV  599

Query  358   RSLVSRFLLCMEENRLMEMLDGEVIEQGKKEDVVAMAWLAQRCLNFNGKKRPTMKEVATE  179
             R L + FL  M  +RL E+LD  + E   +E+V+A+A LA+RCL+ N + RPTM++V  E
Sbjct  600   RMLGAYFLEAMRNDRLHEILDARIKEDCDREEVLAVAKLARRCLSLNSQHRPTMRDVFIE  659

Query  178   LDAIKA  161
             LD I++
Sbjct  660   LDRIQS  665



>ref|NP_178085.1| wall-associated receptor kinase-like 22 [Arabidopsis thaliana]
 sp|Q8RY17.1|WAKLI_ARATH RecName: Full=Wall-associated receptor kinase-like 22; Flags: 
Precursor [Arabidopsis thaliana]
 gb|AAL84959.1| At1g79670/F20B17_27 [Arabidopsis thaliana]
 gb|AEE36284.1| wall-associated receptor kinase-like protein [Arabidopsis thaliana]
Length=751

 Score =   416 bits (1070),  Expect = 3e-127, Method: Compositional matrix adjust.
 Identities = 216/362 (60%), Positives = 287/362 (79%), Gaps = 3/362 (1%)
 Frame = -1

Query  1231  KLRPAIIGISASFGFVFLIWAFVILYkaikkrkmkklrqkffkRNGGlllqqqlLTKEGT  1052
             K++P   G+   F  +FL+     L K +KKR+    ++ FFKRNGGLLL+QQL T+ G 
Sbjct  343   KIKPLFPGLVLGFPLLFLVLGIWGLIKFVKKRRKIIRKRMFFKRNGGLLLKQQLTTRGGN  402

Query  1051  IEKTKIFTASELDKATDHFNADRIVGRGGQGTVYKGMLIDGQIVAVKKSQAVDEDQLEPF  872
             ++ +KIF++ EL+KATD+FN +R++G+GGQGTVYKGML+DG+IVAVK+S+ +DED++E F
Sbjct  403   VQSSKIFSSKELEKATDNFNMNRVLGQGGQGTVYKGMLVDGRIVAVKRSKVLDEDKVEEF  462

Query  871   INEVVILSQINHRNVVKLMGCCLETEVPILVYEFIPNGTLFGLIHNNFDNELIPLSWDIR  692
             INEV +LSQINHRN+VKLMGCCLETEVPILVYE IPNG LF  +H++ D+    ++WD+R
Sbjct  463   INEVGVLSQINHRNIVKLMGCCLETEVPILVYEHIPNGDLFKRLHHDSDD--YTMTWDVR  520

Query  691   LRIASEVACALAYLHSVTLVPIYHRDIKTGNILLDEKFRAKVSDFGTSRSISIDKTHFTT  512
             LRI+ E+A ALAYLHS    P+YHRD+KT NILLDEK+RAKVSDFGTSRSI++D+TH TT
Sbjct  521   LRISVEIAGALAYLHSAASTPVYHRDVKTTNILLDEKYRAKVSDFGTSRSINVDQTHLTT  580

Query  511   MVKGTFGYLDPEYFQSSQFTEKSDVYSFGVVLAELLTGQKPISFELDDDEDRSLVSRFLL  332
             +V GTFGYLDPEYFQ+SQFT+KSDVYSFGVVL EL+TG+KP S  +  +E+R LVS F  
Sbjct  581   LVAGTFGYLDPEYFQTSQFTDKSDVYSFGVVLVELITGEKPFSV-MRPEENRGLVSHFNE  639

Query  331   CMEENRLMEMLDGEVIEQGKKEDVVAMAWLAQRCLNFNGKKRPTMKEVATELDAIKASNS  152
              M++NR+++++D  + E    E V+A+A LA+RCL+  GKKRP M+EV+ EL+ I++S  
Sbjct  640   AMKQNRVLDIVDSRIKEGCTLEQVLAVAKLARRCLSLKGKKRPNMREVSVELERIRSSPE  699

Query  151   HL  146
              L
Sbjct  700   DL  701



>gb|KHN40782.1| Wall-associated receptor kinase-like 22 [Glycine soja]
Length=684

 Score =   414 bits (1064),  Expect = 3e-127, Method: Compositional matrix adjust.
 Identities = 239/441 (54%), Positives = 308/441 (70%), Gaps = 23/441 (5%)
 Frame = -1

Query  1435  VPVELRWTITQEDVPPSYSKYCSPSTYINPQLQWHNY--LQCDCPGGDD---RNVYLSGG  1271
             VP  L W I    +    S Y       N     +NY   +C C    D    N Y++ G
Sbjct  192   VPAVLEWEIVNATLKLPTSPYVD-CKVTNITSSRYNYSGRRCSCRYEADYNPPNPYIADG  250

Query  1270  CEWKHKDYVIS-----SNKLRPAIIGISASFGFVFLI---WAF--VI--LYkaikkrkmk  1127
             C   +  Y        +++ + AIIG+SAS G + L+   W    V+  + KA+ K  + 
Sbjct  251   CPADYDAYPPPKPTGLTSRAKQAIIGVSASLGSIILLLVLWRMGKVVWRIGKAVIKTILH  310

Query  1126  klrqkffkRNGGlllqqqlLTKEGTIEKTKIFTASELDKATDHFNADRIVGRGGQGTVYK  947
             K R+ F+K+NGGLLL+Q L + E   +K K+F+  +L+KATD+FN +R++G+GGQGTVYK
Sbjct  311   KRREMFYKKNGGLLLEQMLSSGEVNDDKVKLFSLKDLEKATDNFNKNRVLGKGGQGTVYK  370

Query  946   GMLIDGQIVAVKKSQAVDEDQLEPFINEVVILSQINHRNVVKLMGCCLETEVPILVYEFI  767
             GML DG+I AVKK +   E  +E FINE +ILSQINHRNVVKL+G CLETE+P+LVYEFI
Sbjct  371   GMLPDGKITAVKKFKV--EGNVEEFINEFIILSQINHRNVVKLLGSCLETEIPLLVYEFI  428

Query  766   PNGTLFGLIHNNFDNELIPLSWDIRLRIASEVACALAYLHSVTLVPIYHRDIKTGNILLD  587
             PNG LF  +H    NE  P++WDIRLRIA+EVA AL YLH     PIYHRDIK+ NILLD
Sbjct  429   PNGNLFEYLHG--QNEDFPMTWDIRLRIATEVAGALFYLHLAASRPIYHRDIKSTNILLD  486

Query  586   EKFRAKVSDFGTSRSISIDKTHFTTMVKGTFGYLDPEYFQSSQFTEKSDVYSFGVVLAEL  407
             EK+RAKV+DFGTSR ++ID TH TT+V+GTFGYLDPEYF +SQFTEKSDVYSFGVVL EL
Sbjct  487   EKYRAKVADFGTSRMVTIDATHLTTVVQGTFGYLDPEYFHTSQFTEKSDVYSFGVVLVEL  546

Query  406   LTGQKPISFELDDDEDRSLVSRFLLCMEENRLMEMLDGEVIEQGKKEDVVAMAWLAQRCL  227
             LTG+KPIS  L+ +E +SL S F+LC+EENRL +++D  V+++G+KE ++A+A LA RCL
Sbjct  547   LTGKKPISL-LNPEEAKSLASSFILCLEENRLFDIVDERVVKEGEKEHIMAVANLASRCL  605

Query  226   NFNGKKRPTMKEVATELDAIK  164
               NGKKRPTMKEV  EL+ I+
Sbjct  606   ELNGKKRPTMKEVTLELEGIR  626



>ref|XP_006441115.1| hypothetical protein CICLE_v10024305mg, partial [Citrus clementina]
 gb|ESR54355.1| hypothetical protein CICLE_v10024305mg, partial [Citrus clementina]
Length=618

 Score =   412 bits (1058),  Expect = 3e-127, Method: Compositional matrix adjust.
 Identities = 222/357 (62%), Positives = 282/357 (79%), Gaps = 5/357 (1%)
 Frame = -1

Query  1228  LRPAIIGISASFGFVFLIWAFVILYkaikkrkmkklrqkffkRNGGlllqqqlLTKEGTI  1049
             LR A  G        FL+     LYK  K+R+  KL+ KFFK+NGGLLLQQ+L + EG I
Sbjct  250   LRAA--GCGGGLALFFLLIGIWWLYKFTKRRREIKLKHKFFKKNGGLLLQQELSSNEGNI  307

Query  1048  EKTKIFTASELDKATDHFNADRIVGRGGQGTVYKGMLIDGQIVAVKKSQAVDEDQLEPFI  869
             EK K+FT+ +L+KATD++NA+RI+G+GGQG VYKGML+DG+IVAVKK++ +DE  LE FI
Sbjct  308   EKMKLFTSKDLEKATDNYNANRILGQGGQGIVYKGMLVDGRIVAVKKAKILDERNLEQFI  367

Query  868   NEVVILSQINHRNVVKLMGCCLETEVPILVYEFIPNGTLFGLIHNNFDNELIPLSWDIRL  689
             NEVVILSQI+ RNVVKL+GCCLETEVP+LVYEFIPNG+L   IH  + +E  P++W++ L
Sbjct  368   NEVVILSQIDPRNVVKLLGCCLETEVPLLVYEFIPNGSLNQYIH--YRSEEFPITWEMYL  425

Query  688   RIASEVACALAYLHSVTLVPIYHRDIKTGNILLDEKFRAKVSDFGTSRSISIDKTHFTTM  509
              IA EV+ AL+YLHS   +PIYHR IK+ NILLD+K++AKVS+FG SRSI+ID+TH TT 
Sbjct  426   SIAFEVSGALSYLHSAASIPIYHRGIKSANILLDDKYQAKVSNFGASRSITIDQTHLTTQ  485

Query  508   VKGTFGYLDPEYFQSSQFTEKSDVYSFGVVLAELLTGQKPISFELDDDEDRSLVSRFLLC  329
             V+GTFGY+DPEYF+SS FTEKSDVYSFGVVL ELLTGQKPI    D +ED+SL   F+  
Sbjct  486   VQGTFGYVDPEYFRSSYFTEKSDVYSFGVVLVELLTGQKPIR-STDAEEDKSLARYFIQA  544

Query  328   MEENRLMEMLDGEVIEQGKKEDVVAMAWLAQRCLNFNGKKRPTMKEVATELDAIKAS  158
             M+ENRL E+LD  V+++ +KE+++ +A LA+RCLN NG+KRPTMKEVA EL  I+ S
Sbjct  545   MKENRLFEVLDDRVLKEAEKEEIITVAMLAKRCLNLNGRKRPTMKEVAFELRGIRES  601



>ref|XP_010489203.1| PREDICTED: wall-associated receptor kinase-like 10 isoform X1 
[Camelina sativa]
Length=791

 Score =   417 bits (1072),  Expect = 3e-127, Method: Compositional matrix adjust.
 Identities = 216/360 (60%), Positives = 288/360 (80%), Gaps = 2/360 (1%)
 Frame = -1

Query  1225  RPAIIGISASFGFVFLIWAFVILYkaikkrkmkklrqkffkRNGGlllqqqlLTKEGTIE  1046
             RP  IGI +SFG +  I     LYK I+K+K  + ++ FFKRNGGLLLQQQL T EG +E
Sbjct  374   RPLAIGIGSSFGSLVFIVGIYWLYKLIRKQKRLRQKKTFFKRNGGLLLQQQLTTTEGNVE  433

Query  1045  KTKIFTASELDKATDHFNADRIVGRGGQGTVYKGMLIDGQIVAVKKSQAVDEDQLEPFIN  866
             KTK+F++ EL+KAT++F+ +RI+G+GGQGTVYKGML+DG+IVAVKKS+AVDED+LE FIN
Sbjct  434   KTKVFSSRELEKATENFSLNRILGQGGQGTVYKGMLVDGRIVAVKKSKAVDEDKLEEFIN  493

Query  865   EVVILSQINHRNVVKLMGCCLETEVPILVYEFIPNGTLFGLIHNNFDNELIPLSWDIRLR  686
             EVVILSQINHRN+VKL+GCCLET+VP+LVYEFIPNG LF  +H+  +N+ +  +W +RLR
Sbjct  494   EVVILSQINHRNIVKLLGCCLETDVPVLVYEFIPNGNLFEHLHDELENDTLT-TWVVRLR  552

Query  685   IASEVACALAYLHSVTLVPIYHRDIKTGNILLDEKFRAKVSDFGTSRSISIDKTHFTTMV  506
             IA ++A AL+YLHS    PIYHRD+K+ NI+LDEK+RAKVSDFGTSRS+++D TH TT+V
Sbjct  553   IAVDIAGALSYLHSAASSPIYHRDVKSTNIMLDEKYRAKVSDFGTSRSVTVDHTHLTTVV  612

Query  505   KGTFGYLDPEYFQSSQFTEKSDVYSFGVVLAELLTGQKPISFELDDDEDRSLVSRFLLCM  326
              GT G++DPEYFQSSQFT+KSDVYSFGVVL EL+TG+K +SF L   E+R+L + F+  M
Sbjct  613   SGTVGHVDPEYFQSSQFTDKSDVYSFGVVLVELITGEKSVSF-LRSQENRTLATYFIHAM  671

Query  325   EENRLMEMLDGEVIEQGKKEDVVAMAWLAQRCLNFNGKKRPTMKEVATELDAIKASNSHL  146
             + N L +++D  + +  K   V A A +A++CLN  G+KRP+M+EV+ EL+ I++S+  +
Sbjct  672   KHNTLFDIIDPRIKDGCKLNQVTAAAKIAKKCLNLKGRKRPSMREVSMELENIRSSSGDM  731



>ref|XP_006297043.1| hypothetical protein CARUB_v10013039mg [Capsella rubella]
 gb|EOA29941.1| hypothetical protein CARUB_v10013039mg [Capsella rubella]
Length=755

 Score =   416 bits (1069),  Expect = 3e-127, Method: Compositional matrix adjust.
 Identities = 224/398 (56%), Positives = 299/398 (75%), Gaps = 13/398 (3%)
 Frame = -1

Query  1339  QWHNYLQCDCPGGDDRNVYLSGGCEWKHKDYVISSNKLRPAIIGISASFGFVFLIWAFVI  1160
             ++ NY +C   GG   N+     C +K         K RP   GI +SFG +  I     
Sbjct  350   EYGNYKKCR--GGTCVNLPGHYRCVYK---------KHRPIATGIGSSFGSLAFIVGIYW  398

Query  1159  LYkaikkrkmkklrqkffkRNGGlllqqqlLTKEGTIEKTKIFTASELDKATDHFNADRI  980
             LY  I+K+K  K ++KFFKRNGGLLLQQQL   EG +EKTK+F++ EL+KAT++F+ +RI
Sbjct  399   LYNFIRKQKRLKQKKKFFKRNGGLLLQQQLTATEGNLEKTKVFSSRELEKATENFSVNRI  458

Query  979   VGRGGQGTVYKGMLIDGQIVAVKKSQAVDEDQLEPFINEVVILSQINHRNVVKLMGCCLE  800
             +G+GGQGTVYKGML+DG+IVAVKKS+ VDED+LE FINEVVILSQINHRN+VKL+GCCLE
Sbjct  459   LGQGGQGTVYKGMLVDGRIVAVKKSKVVDEDKLEEFINEVVILSQINHRNIVKLLGCCLE  518

Query  799   TEVPILVYEFIPNGTLFGLIHNNFDNELIPLSWDIRLRIASEVACALAYLHSVTLVPIYH  620
             T+VP+LVYEFIPNG LF  +H+  ++  +  +W++RLRIA +VA AL+YLHS    PIYH
Sbjct  519   TDVPVLVYEFIPNGNLFEHLHDELEDYTMT-TWEVRLRIAVDVAGALSYLHSAASSPIYH  577

Query  619   RDIKTGNILLDEKFRAKVSDFGTSRSISIDKTHFTTMVKGTFGYLDPEYFQSSQFTEKSD  440
             RD+K+ NI+LDEK+RAKVSDFGTSRS+++D TH TT+V GT GY+DPEYFQSSQFT+KSD
Sbjct  578   RDVKSTNIMLDEKYRAKVSDFGTSRSVTVDHTHLTTVVSGTVGYMDPEYFQSSQFTDKSD  637

Query  439   VYSFGVVLAELLTGQKPISFELDDDEDRSLVSRFLLCMEENRLMEMLDGEVIEQGKKEDV  260
             VYSFGVVL EL+TG+K +SF L   E+R+L + F+  M+ N L +++D  + +  K   V
Sbjct  638   VYSFGVVLVELITGEKSVSF-LRSQENRTLATYFIHAMKHNTLFDIIDPRIKDGCKLNQV  696

Query  259   VAMAWLAQRCLNFNGKKRPTMKEVATELDAIKASNSHL  146
              A A +A++CLN  G+KRP+M+EV+ EL+ I++S+  +
Sbjct  697   TAAAKIARKCLNLKGRKRPSMREVSVELENIRSSSRDM  734



>ref|XP_002304841.2| putative wall-associated kinase family protein [Populus trichocarpa]
 gb|EEE79820.2| putative wall-associated kinase family protein [Populus trichocarpa]
Length=729

 Score =   415 bits (1067),  Expect = 3e-127, Method: Compositional matrix adjust.
 Identities = 210/311 (68%), Positives = 257/311 (83%), Gaps = 1/311 (0%)
 Frame = -1

Query  1099  NGGlllqqqlLTKEGTIEKTKIFTASELDKATDHFNADRIVGRGGQGTVYKGMLIDGQIV  920
             NGGLLLQQQL +  G+++KTKIFT+ EL+ ATD FN +RI+G+GGQGTVYKGML DG+IV
Sbjct  360   NGGLLLQQQLSSNHGSVQKTKIFTSKELETATDRFNENRILGQGGQGTVYKGMLEDGRIV  419

Query  919   AVKKSQAVDEDQLEPFINEVVILSQINHRNVVKLMGCCLETEVPILVYEFIPNGTLFGLI  740
             AVK+S  V E++LE FINEVVILSQINHRNVVKL GCCLETEVP+LVYEFI NG LF  +
Sbjct  420   AVKRSTIVGEEKLEEFINEVVILSQINHRNVVKLFGCCLETEVPLLVYEFISNGNLFQYL  479

Query  739   HNNFDNELIPLSWDIRLRIASEVACALAYLHSVTLVPIYHRDIKTGNILLDEKFRAKVSD  560
             HN + NE   LSW++RL+IA EVA AL+YLHS   +PIYHRDIK+ NILLD+K+RAKVSD
Sbjct  480   HNFYQNEDFILSWEMRLQIAIEVAGALSYLHSAASIPIYHRDIKSANILLDDKYRAKVSD  539

Query  559   FGTSRSISIDKTHFTTMVKGTFGYLDPEYFQSSQFTEKSDVYSFGVVLAELLTGQKPISF  380
             FG+SRS++ID+TH TT V+GTFGYLDPEYFQSSQFT+KSDVYSFGVVL ELL+G+KPI  
Sbjct  540   FGSSRSMAIDQTHLTTNVQGTFGYLDPEYFQSSQFTDKSDVYSFGVVLVELLSGKKPI-I  598

Query  379   ELDDDEDRSLVSRFLLCMEENRLMEMLDGEVIEQGKKEDVVAMAWLAQRCLNFNGKKRPT  200
                  E RSL + F++ MEENRL ++LD +V E   +E+++A+A LA+RCLN + K RPT
Sbjct  599   SSTSQETRSLATHFIVLMEENRLFDILDVQVKEDCLEEEIMAVANLAKRCLNVSRKHRPT  658

Query  199   MKEVATELDAI  167
             MKEV+ EL+ I
Sbjct  659   MKEVSAELERI  669



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 9749779721916