BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c25580_g1_i3 len=3713 path=[5217:0-212 5429:213-237 1264:238-282
5498:283-318 5534:319-403 1164:404-449 5663:450-469 416:470-504
5716:505-513 1462:514-627 5837:628-642 286:643-806 6015:807-813
6022:814-854 6063:855-959 6168:960-983 6192:984-1032 6241:1033-1058
6267:1059-1345 6552:1346-1488 6695:1489-1538 6745:1539-1551
6758:1552-1598 11036:1599-1611 456:1612-1688 574:1689-1757
10295:1758-1773 6982:1774-1856 7064:1857-1942 123:1943-1975
1373:1976-2016 10119:2017-2130 7360:2131-2177 7407:2178-2185
7415:2186-3712]

Length=3713
                                                                      Score     E

ref|XP_009777839.1|  PREDICTED: cyclic nucleotide-gated ion chann...    906   0.0     
ref|XP_009598596.1|  PREDICTED: cyclic nucleotide-gated ion chann...    902   0.0     
ref|XP_010327006.1|  PREDICTED: cyclic nucleotide-gated ion chann...    895   0.0     
ref|XP_006339698.1|  PREDICTED: cyclic nucleotide-gated ion chann...    892   0.0     
ref|XP_011093040.1|  PREDICTED: cyclic nucleotide-gated ion chann...    887   0.0     
gb|EYU38895.1|  hypothetical protein MIMGU_mgv1a023022mg                879   0.0     
ref|XP_009627716.1|  PREDICTED: cyclic nucleotide-gated ion chann...    877   0.0     
ref|XP_010555719.1|  PREDICTED: cyclic nucleotide-gated ion chann...    872   0.0     
ref|XP_009783793.1|  PREDICTED: cyclic nucleotide-gated ion chann...    867   0.0     
gb|AAF33669.1|AF079871_1  cyclic nucleotide-gated calmodulin-bind...    862   0.0     Nicotiana tabacum [American tobacco]
ref|XP_009600581.1|  PREDICTED: cyclic nucleotide-gated ion chann...    858   0.0     
ref|XP_010537104.1|  PREDICTED: cyclic nucleotide-gated ion chann...    858   0.0     
ref|XP_004502628.1|  PREDICTED: cyclic nucleotide-gated ion chann...    853   0.0     
ref|XP_003526699.1|  PREDICTED: cyclic nucleotide-gated ion chann...    853   0.0     
ref|XP_008234765.1|  PREDICTED: cyclic nucleotide-gated ion chann...    853   0.0     
ref|XP_009352037.1|  PREDICTED: cyclic nucleotide-gated ion chann...    851   0.0     
ref|XP_007220229.1|  hypothetical protein PRUPE_ppa002135mg             852   0.0     
ref|XP_011076015.1|  PREDICTED: cyclic nucleotide-gated ion chann...    851   0.0     
ref|XP_009352036.1|  PREDICTED: cyclic nucleotide-gated ion chann...    850   0.0     
ref|XP_006350570.1|  PREDICTED: cyclic nucleotide-gated ion chann...    849   0.0     
ref|XP_008380711.1|  PREDICTED: cyclic nucleotide-gated ion chann...    849   0.0     
gb|AES72465.2|  cyclic nucleotide-gated ion channel-like protein        849   0.0     
ref|XP_002268992.1|  PREDICTED: cyclic nucleotide-gated ion chann...    848   0.0     Vitis vinifera
ref|XP_009368670.1|  PREDICTED: cyclic nucleotide-gated ion chann...    847   0.0     
ref|XP_009127193.1|  PREDICTED: cyclic nucleotide-gated ion chann...    848   0.0     
ref|XP_007136556.1|  hypothetical protein PHAVU_009G054700g             848   0.0     
ref|XP_010103211.1|  Cyclic nucleotide-gated ion channel 1              848   0.0     
ref|XP_010055024.1|  PREDICTED: cyclic nucleotide-gated ion chann...    848   0.0     
ref|XP_004234170.1|  PREDICTED: cyclic nucleotide-gated ion chann...    847   0.0     
emb|CDY27024.1|  BnaA02g10440D                                          847   0.0     
ref|XP_010321516.1|  PREDICTED: cyclic nucleotide-gated ion chann...    847   0.0     
ref|XP_004308001.1|  PREDICTED: cyclic nucleotide-gated ion chann...    847   0.0     
ref|XP_006578923.1|  PREDICTED: cyclic nucleotide-gated ion chann...    847   0.0     
ref|XP_004240079.1|  PREDICTED: cyclic nucleotide-gated ion chann...    846   0.0     
ref|XP_010266494.1|  PREDICTED: cyclic nucleotide-gated ion chann...    846   0.0     
ref|XP_009368667.1|  PREDICTED: cyclic nucleotide-gated ion chann...    846   0.0     
ref|XP_009368668.1|  PREDICTED: cyclic nucleotide-gated ion chann...    846   0.0     
ref|XP_008376706.1|  PREDICTED: cyclic nucleotide-gated ion chann...    845   0.0     
ref|XP_008376705.1|  PREDICTED: cyclic nucleotide-gated ion chann...    845   0.0     
ref|XP_009357320.1|  PREDICTED: cyclic nucleotide-gated ion chann...    845   0.0     
ref|XP_007038982.1|  Cyclic nucleotide gated channel 1 isoform 1        845   0.0     
ref|XP_002317760.1|  cyclic nucleotide-gated channel C family pro...    844   0.0     Populus trichocarpa [western balsam poplar]
ref|XP_002513573.1|  Cyclic nucleotide-gated ion channel, putative      848   0.0     Ricinus communis
ref|XP_010445559.1|  PREDICTED: cyclic nucleotide-gated ion chann...    843   0.0     
ref|XP_010261582.1|  PREDICTED: cyclic nucleotide-gated ion chann...    841   0.0     
gb|KHG10918.1|  Cyclic nucleotide-gated ion channel 1 -like protein     841   0.0     
ref|XP_011010453.1|  PREDICTED: cyclic nucleotide-gated ion chann...    839   0.0     
ref|XP_006345559.1|  PREDICTED: cyclic nucleotide-gated ion chann...    839   0.0     
gb|KHN04121.1|  Cyclic nucleotide-gated ion channel 1                   837   0.0     
ref|XP_011084497.1|  PREDICTED: cyclic nucleotide-gated ion chann...    838   0.0     
ref|XP_010482698.1|  PREDICTED: cyclic nucleotide-gated ion chann...    838   0.0     
ref|XP_009336790.1|  PREDICTED: cyclic nucleotide-gated ion chann...    838   0.0     
ref|XP_003544128.1|  PREDICTED: cyclic nucleotide-gated ion chann...    838   0.0     
ref|XP_004145926.1|  PREDICTED: cyclic nucleotide-gated ion chann...    838   0.0     
ref|XP_008437585.1|  PREDICTED: cyclic nucleotide-gated ion chann...    837   0.0     
ref|XP_008788856.1|  PREDICTED: cyclic nucleotide-gated ion chann...    837   0.0     
ref|XP_011001886.1|  PREDICTED: cyclic nucleotide-gated ion chann...    837   0.0     
ref|XP_002865954.1|  hypothetical protein ARALYDRAFT_918383             837   0.0     
ref|XP_009778096.1|  PREDICTED: cyclic nucleotide-gated ion chann...    836   0.0     
ref|XP_008783842.1|  PREDICTED: cyclic nucleotide-gated ion chann...    835   0.0     
ref|XP_010442868.1|  PREDICTED: cyclic nucleotide-gated ion chann...    835   0.0     
ref|XP_004160370.1|  PREDICTED: cyclic nucleotide-gated ion chann...    835   0.0     
ref|XP_004240273.1|  PREDICTED: cyclic nucleotide-gated ion chann...    834   0.0     
ref|XP_006280090.1|  hypothetical protein CARUB_v10025973mg             834   0.0     
ref|XP_009599134.1|  PREDICTED: cyclic nucleotide-gated ion chann...    833   0.0     
ref|XP_008351078.1|  PREDICTED: cyclic nucleotide-gated ion chann...    834   0.0     
ref|XP_009405709.1|  PREDICTED: cyclic nucleotide-gated ion chann...    831   0.0     
ref|XP_008343452.1|  PREDICTED: cyclic nucleotide-gated ion chann...    836   0.0     
ref|NP_200125.1|  cyclic nucleotide-gated ion channel 1                 832   0.0     Arabidopsis thaliana [mouse-ear cress]
emb|CDP05082.1|  unnamed protein product                                831   0.0     
ref|XP_010671493.1|  PREDICTED: cyclic nucleotide-gated ion chann...    830   0.0     
ref|XP_006401742.1|  hypothetical protein EUTSA_v10012801mg             830   0.0     
ref|XP_010915663.1|  PREDICTED: cyclic nucleotide-gated ion chann...    828   0.0     
gb|EYU25206.1|  hypothetical protein MIMGU_mgv1a024404mg                828   0.0     
ref|XP_007220613.1|  hypothetical protein PRUPE_ppa002071mg             828   0.0     
ref|XP_008233184.1|  PREDICTED: cyclic nucleotide-gated ion chann...    828   0.0     
ref|XP_006422139.1|  hypothetical protein CICLE_v10004452mg             827   0.0     
ref|XP_007161376.1|  hypothetical protein PHAVU_001G063700g             826   0.0     
ref|XP_006444860.1|  hypothetical protein CICLE_v10019048mg             826   0.0     
emb|CDX96195.1|  BnaC02g14560D                                          825   0.0     
ref|XP_004240953.1|  PREDICTED: cyclic nucleotide-gated ion chann...    825   0.0     
ref|XP_006360173.1|  PREDICTED: cyclic nucleotide-gated ion chann...    824   0.0     
ref|XP_002322017.2|  cyclic nucleotide-gated channel C family pro...    823   0.0     Populus trichocarpa [western balsam poplar]
ref|XP_006345562.1|  PREDICTED: cyclic nucleotide-gated ion chann...    823   0.0     
ref|XP_009787221.1|  PREDICTED: cyclic nucleotide-gated ion chann...    823   0.0     
ref|XP_006345561.1|  PREDICTED: cyclic nucleotide-gated ion chann...    823   0.0     
ref|XP_010925731.1|  PREDICTED: cyclic nucleotide-gated ion chann...    822   0.0     
gb|AAF33670.1|AF079872_1  cyclic nucleotide-gated calmodulin-bind...    822   0.0     Nicotiana tabacum [American tobacco]
gb|KDP28497.1|  hypothetical protein JCGZ_14268                         819   0.0     
ref|XP_003553784.1|  PREDICTED: cyclic nucleotide-gated ion chann...    820   0.0     
ref|XP_008376138.1|  PREDICTED: cyclic nucleotide-gated ion chann...    819   0.0     
gb|KEH40404.1|  cyclic nucleotide-gated ion channel-like protein        819   0.0     
gb|KHN43104.1|  Cyclic nucleotide-gated ion channel 1                   813   0.0     
ref|XP_010456194.1|  PREDICTED: putative cyclic nucleotide-gated ...    815   0.0     
ref|XP_004306680.1|  PREDICTED: cyclic nucleotide-gated ion chann...    815   0.0     
ref|XP_010456193.1|  PREDICTED: putative cyclic nucleotide-gated ...    814   0.0     
ref|XP_009119851.1|  PREDICTED: cyclic nucleotide-gated ion chann...    814   0.0     
ref|XP_010422754.1|  PREDICTED: putative cyclic nucleotide-gated ...    813   0.0     
ref|XP_010427945.1|  PREDICTED: putative cyclic nucleotide-gated ...    813   0.0     
ref|XP_009119850.1|  PREDICTED: cyclic nucleotide-gated ion chann...    816   0.0     
ref|XP_009404479.1|  PREDICTED: cyclic nucleotide-gated ion chann...    811   0.0     
ref|XP_011038085.1|  PREDICTED: cyclic nucleotide-gated ion chann...    810   0.0     
ref|XP_006287167.1|  hypothetical protein CARUB_v10000339mg             809   0.0     
ref|XP_006396313.1|  hypothetical protein EUTSA_v10028473mg             809   0.0     
ref|XP_010095775.1|  Cyclic nucleotide-gated ion channel 1              811   0.0     
gb|KEH24625.1|  cyclic nucleotide-gated ion channel-like protein        806   0.0     
ref|XP_010474728.1|  PREDICTED: probable cyclic nucleotide-gated ...    808   0.0     
pir||T10541  cyclic nucleotide gated channel homolog F3I3.30 - Ar...    807   0.0  
ref|XP_007220953.1|  hypothetical protein PRUPE_ppa026143mg             808   0.0     
gb|KEH24626.1|  cyclic nucleotide-gated ion channel-like protein        808   0.0     
ref|XP_002320197.2|  hypothetical protein POPTR_0014s09350g             807   0.0     Populus trichocarpa [western balsam poplar]
ref|XP_003626568.1|  Cyclic nucleotide-gated channel C                  807   0.0     
ref|NP_192010.2|  cyclic nucleotide-gated channel 13                    806   0.0     Arabidopsis thaliana [mouse-ear cress]
ref|NP_563625.1|  cyclic nucleotide gated channel 10                    806   0.0     Arabidopsis thaliana [mouse-ear cress]
ref|XP_006306882.1|  hypothetical protein CARUB_v10008437mg             806   0.0     
ref|XP_006345563.1|  PREDICTED: cyclic nucleotide-gated ion chann...    803   0.0     
ref|NP_001184885.1|  cyclic nucleotide gated channel 10                 806   0.0     
ref|XP_010462522.1|  PREDICTED: probable cyclic nucleotide-gated ...    805   0.0     
ref|XP_002872915.1|  ATCNGC13                                           804   0.0     
emb|CDY49458.1|  BnaA10g06480D                                          803   0.0     
ref|XP_002889372.1|  ATCNGC10                                           801   0.0     
ref|XP_008233189.1|  PREDICTED: cyclic nucleotide-gated ion chann...    802   0.0     
ref|XP_010522922.1|  PREDICTED: putative cyclic nucleotide-gated ...    801   0.0     
ref|XP_007051571.1|  Cyclic nucleotide-gated channel 13                 801   0.0     
ref|XP_011023191.1|  PREDICTED: putative cyclic nucleotide-gated ...    800   0.0     
ref|XP_010049315.1|  PREDICTED: cyclic nucleotide-gated ion chann...    796   0.0     
ref|XP_010327010.1|  PREDICTED: cyclic nucleotide-gated ion chann...    793   0.0     
ref|XP_004494973.1|  PREDICTED: cyclic nucleotide-gated ion chann...    795   0.0     
ref|XP_004494812.1|  PREDICTED: cyclic nucleotide-gated ion chann...    794   0.0     
ref|XP_003520870.1|  PREDICTED: cyclic nucleotide-gated ion chann...    794   0.0     
gb|KHN35375.1|  Cyclic nucleotide-gated ion channel 1                   790   0.0     
ref|XP_002301407.2|  hypothetical protein POPTR_0002s17120g             791   0.0     Populus trichocarpa [western balsam poplar]
ref|XP_008677361.1|  PREDICTED: LOC100285094 isoform X1                 789   0.0     
ref|NP_001151461.1|  LOC100285094                                       788   0.0     Zea mays [maize]
ref|XP_010668155.1|  PREDICTED: cyclic nucleotide-gated ion chann...    789   0.0     
ref|XP_006647126.1|  PREDICTED: cyclic nucleotide-gated ion chann...    784   0.0     
emb|CDX74369.1|  BnaA03g26780D                                          783   0.0     
emb|CDP08690.1|  unnamed protein product                                780   0.0     
emb|CAB45784.2|  cyclic nucleotide gated channel (CNGC4) like pro...    780   0.0     Arabidopsis thaliana [mouse-ear cress]
gb|KHN23385.1|  Cyclic nucleotide-gated ion channel 1                   776   0.0     
ref|XP_004951291.1|  PREDICTED: cyclic nucleotide-gated ion chann...    780   0.0     
ref|XP_009134501.1|  PREDICTED: putative cyclic nucleotide-gated ...    780   0.0     
gb|KHG25326.1|  Cyclic nucleotide-gated ion channel 1 -like protein     774   0.0     
ref|XP_010234108.1|  PREDICTED: cyclic nucleotide-gated ion chann...    778   0.0     
emb|CDX91870.1|  BnaC03g31720D                                          778   0.0     
ref|XP_010544812.1|  PREDICTED: probable cyclic nucleotide-gated ...    778   0.0     
ref|XP_010544813.1|  PREDICTED: probable cyclic nucleotide-gated ...    778   0.0     
ref|XP_003572098.1|  PREDICTED: cyclic nucleotide-gated ion chann...    777   0.0     
dbj|BAJ97652.1|  predicted protein                                      776   0.0     
ref|XP_010667924.1|  PREDICTED: cyclic nucleotide-gated ion chann...    776   0.0     
ref|XP_003529892.1|  PREDICTED: cyclic nucleotide-gated ion chann...    775   0.0     
emb|CAA05637.1|  putative calmodulin binding transporter protein        775   0.0     Hordeum vulgare [barley]
gb|KHN44224.1|  Cyclic nucleotide-gated ion channel 1                   771   0.0     
ref|XP_002277224.2|  PREDICTED: cyclic nucleotide-gated ion chann...    775   0.0     Vitis vinifera
ref|XP_007147299.1|  hypothetical protein PHAVU_006G112200g             774   0.0     
ref|XP_003563795.1|  PREDICTED: cyclic nucleotide-gated ion chann...    773   0.0     
ref|XP_008380719.1|  PREDICTED: cyclic nucleotide-gated ion chann...    768   0.0     
ref|XP_008380728.1|  PREDICTED: cyclic nucleotide-gated ion chann...    767   0.0     
ref|XP_006397834.1|  hypothetical protein EUTSA_v10001335mg             766   0.0     
ref|XP_002880240.1|  ATCNGC3                                            766   0.0     
gb|EMT17021.1|  Cyclic nucleotide-gated ion channel 1                   765   0.0     
gb|EEC72858.1|  hypothetical protein OsI_06611                          765   0.0     Oryza sativa Indica Group [Indian rice]
ref|XP_004510678.1|  PREDICTED: cyclic nucleotide-gated ion chann...    763   0.0     
ref|XP_010925733.1|  PREDICTED: cyclic nucleotide-gated ion chann...    759   0.0     
ref|NP_566075.1|  cyclic nucleotide gated channel 3                     760   0.0     Arabidopsis thaliana [mouse-ear cress]
ref|XP_006843330.1|  hypothetical protein AMTR_s00053p00015490          759   0.0     
ref|XP_004498403.1|  PREDICTED: cyclic nucleotide-gated ion chann...    754   0.0     
gb|EPS70634.1|  hypothetical protein M569_04125                         758   0.0     
gb|KFK37409.1|  hypothetical protein AALP_AA4G253100                    756   0.0     
ref|XP_011093039.1|  PREDICTED: cyclic nucleotide-gated ion chann...    753   0.0     
ref|XP_004240080.1|  PREDICTED: cyclic nucleotide-gated ion chann...    756   0.0     
ref|XP_009142642.1|  PREDICTED: probable cyclic nucleotide-gated ...    755   0.0     
ref|XP_004965514.1|  PREDICTED: cyclic nucleotide-gated ion chann...    754   0.0     
ref|XP_010321518.1|  PREDICTED: cyclic nucleotide-gated ion chann...    755   0.0     
emb|CDY19679.1|  BnaC09g29350D                                          749   0.0     
ref|NP_001057767.1|  Os06g0527100                                       752   0.0     Oryza sativa Japonica Group [Japonica rice]
gb|KCW71513.1|  hypothetical protein EUGRSUZ_E00063                     749   0.0     
emb|CBI40508.3|  unnamed protein product                                774   0.0     
ref|XP_010506645.1|  PREDICTED: probable cyclic nucleotide-gated ...    751   0.0     
ref|XP_004510618.1|  PREDICTED: probable cyclic nucleotide-gated ...    750   0.0     
ref|XP_007135246.1|  hypothetical protein PHAVU_010G113100g             748   0.0     
emb|CDX80018.1|  BnaA05g01380D                                          746   0.0     
ref|XP_010518315.1|  PREDICTED: probable cyclic nucleotide-gated ...    746   0.0     
ref|XP_004163084.1|  PREDICTED: cyclic nucleotide-gated ion chann...    743   0.0     
ref|XP_004150319.1|  PREDICTED: cyclic nucleotide-gated ion chann...    742   0.0     
gb|AAD19610.1|  cyclic nucleotide gated channel                         744   0.0     Arabidopsis thaliana [mouse-ear cress]
ref|XP_006293455.1|  hypothetical protein CARUB_v10022736mg             744   0.0     
ref|XP_003602214.1|  Cyclic nucleotide-gated ion channel                746   0.0     
gb|KHN06303.1|  Putative cyclic nucleotide-gated ion channel 13         742   0.0     
ref|XP_008439332.1|  PREDICTED: cyclic nucleotide-gated ion chann...    741   0.0     
ref|XP_006656134.1|  PREDICTED: cyclic nucleotide-gated ion chann...    739   0.0     
ref|XP_010656612.1|  PREDICTED: probable cyclic nucleotide-gated ...    739   0.0     
ref|XP_010321517.1|  PREDICTED: cyclic nucleotide-gated ion chann...    736   0.0     
ref|XP_002278464.1|  PREDICTED: probable cyclic nucleotide-gated ...    740   0.0     Vitis vinifera
gb|KEH18669.1|  cyclic nucleotide-gated ion channel-like protein        737   0.0     
gb|EEE65813.1|  hypothetical protein OsJ_21543                          736   0.0     Oryza sativa Japonica Group [Japonica rice]
gb|KDO86447.1|  hypothetical protein CISIN_1g004940mg                   732   0.0     
ref|XP_006598906.1|  PREDICTED: putative cyclic nucleotide-gated ...    729   0.0     
ref|XP_004951290.1|  PREDICTED: cyclic nucleotide-gated ion chann...    726   0.0     
emb|CDP10239.1|  unnamed protein product                                730   0.0     
ref|XP_008367750.1|  PREDICTED: probable cyclic nucleotide-gated ...    726   0.0     
ref|XP_006293366.1|  hypothetical protein CARUB_v10022706mg             727   0.0     
ref|XP_004251749.1|  PREDICTED: probable cyclic nucleotide-gated ...    724   0.0     
ref|XP_002529385.1|  Cyclic nucleotide-gated ion channel, putative      725   0.0     Ricinus communis
ref|XP_011079403.1|  PREDICTED: probable cyclic nucleotide-gated ...    724   0.0     
emb|CDY42047.1|  BnaC04g01250D                                          723   0.0     
ref|XP_010941336.1|  PREDICTED: probable cyclic nucleotide-gated ...    723   0.0     
ref|XP_010251499.1|  PREDICTED: probable cyclic nucleotide-gated ...    720   0.0     
ref|XP_006350103.1|  PREDICTED: probable cyclic nucleotide-gated ...    720   0.0     
gb|KHG13117.1|  putative cyclic nucleotide-gated ion channel 5 -l...    721   0.0     
ref|XP_009616554.1|  PREDICTED: probable cyclic nucleotide-gated ...    720   0.0     
ref|XP_010251498.1|  PREDICTED: probable cyclic nucleotide-gated ...    719   0.0     
ref|XP_010251495.1|  PREDICTED: probable cyclic nucleotide-gated ...    720   0.0     
ref|XP_009787244.1|  PREDICTED: probable cyclic nucleotide-gated ...    719   0.0     
gb|AHN53203.1|  cyclic nucleotide-gated ion channel 5                   719   0.0     
ref|XP_008242994.1|  PREDICTED: probable cyclic nucleotide-gated ...    717   0.0     
ref|NP_565560.1|  cyclic nucleotide-gated channel 6                     719   0.0     Arabidopsis thaliana [mouse-ear cress]
ref|XP_002867341.1|  ATCNGC9                                            718   0.0     
ref|XP_007204256.1|  hypothetical protein PRUPE_ppa001993mg             718   0.0     
ref|XP_009614625.1|  PREDICTED: probable cyclic nucleotide-gated ...    716   0.0     
ref|XP_006474002.1|  PREDICTED: probable cyclic nucleotide-gated ...    717   0.0     
gb|EYU34343.1|  hypothetical protein MIMGU_mgv1a001946mg                717   0.0     
ref|XP_010438163.1|  PREDICTED: putative cyclic nucleotide-gated ...    717   0.0     
ref|XP_004510619.1|  PREDICTED: probable cyclic nucleotide-gated ...    713   0.0     
ref|NP_194785.1|  cyclic nucleotide gated channel 9                     717   0.0     Arabidopsis thaliana [mouse-ear cress]
ref|NP_001190873.1|  cyclic nucleotide gated channel 9                  716   0.0     
ref|XP_004242592.1|  PREDICTED: probable cyclic nucleotide-gated ...    717   0.0     
ref|XP_007011917.1|  Cyclic nucleotide gated channel 5 isoform 1        716   0.0     
ref|XP_010447700.1|  PREDICTED: putative cyclic nucleotide-gated ...    715   0.0     
ref|XP_010447699.1|  PREDICTED: putative cyclic nucleotide-gated ...    716   0.0     
ref|XP_009117262.1|  PREDICTED: probable cyclic nucleotide-gated ...    716   0.0     
ref|XP_008242993.1|  PREDICTED: probable cyclic nucleotide-gated ...    716   0.0     
ref|XP_006343649.1|  PREDICTED: probable cyclic nucleotide-gated ...    715   0.0     
ref|XP_008343895.1|  PREDICTED: probable cyclic nucleotide-gated ...    715   0.0     
ref|XP_009366181.1|  PREDICTED: probable cyclic nucleotide-gated ...    712   0.0     
ref|XP_008787797.1|  PREDICTED: probable cyclic nucleotide-gated ...    715   0.0     
ref|XP_008384360.1|  PREDICTED: probable cyclic nucleotide-gated ...    714   0.0     
ref|XP_006404894.1|  hypothetical protein EUTSA_v10000059mg             715   0.0     
ref|XP_009795112.1|  PREDICTED: probable cyclic nucleotide-gated ...    713   0.0     
gb|EPS68056.1|  hypothetical protein M569_06716                         714   0.0     
ref|XP_002880536.1|  ATCNGC6                                            714   0.0     
ref|XP_010472393.1|  PREDICTED: probable cyclic nucleotide-gated ...    714   0.0     
ref|XP_010417136.1|  PREDICTED: probable cyclic nucleotide-gated ...    714   0.0     
gb|EEC80737.1|  hypothetical protein OsI_23212                          722   0.0     Oryza sativa Indica Group [Indian rice]
ref|XP_006286176.1|  hypothetical protein CARUB_v10007740mg             713   0.0     
ref|XP_003540100.1|  PREDICTED: probable cyclic nucleotide-gated ...    713   0.0     
ref|XP_006453609.1|  hypothetical protein CICLE_v10007576mg             712   0.0     
ref|XP_009366180.1|  PREDICTED: probable cyclic nucleotide-gated ...    712   0.0     
ref|XP_009358434.1|  PREDICTED: probable cyclic nucleotide-gated ...    712   0.0     
emb|CDY20267.1|  BnaC04g36890D                                          713   0.0     
gb|AAN65366.1|  cyclic nucleotide-gated channel C                       706   0.0     Phaseolus vulgaris [French bean]
gb|KDP38683.1|  hypothetical protein JCGZ_04036                         712   0.0     
ref|XP_009140510.1|  PREDICTED: probable cyclic nucleotide-gated ...    712   0.0     
ref|XP_006412690.1|  hypothetical protein EUTSA_v10024520mg             710   0.0     
ref|XP_006412691.1|  hypothetical protein EUTSA_v10024520mg             711   0.0     
ref|XP_010429350.1|  PREDICTED: probable cyclic nucleotide-gated ...    711   0.0     
ref|XP_009398871.1|  PREDICTED: probable cyclic nucleotide-gated ...    710   0.0     
emb|CDY39686.1|  BnaA04g14030D                                          710   0.0     
ref|XP_003519149.1|  PREDICTED: probable cyclic nucleotide-gated ...    709   0.0     
ref|XP_008809584.1|  PREDICTED: probable cyclic nucleotide-gated ...    709   0.0     
ref|XP_003549541.1|  PREDICTED: probable cyclic nucleotide-gated ...    709   0.0     
gb|KDO59462.1|  hypothetical protein CISIN_1g004711mg                   709   0.0     
ref|XP_006830662.1|  hypothetical protein AMTR_s00210p00019190          709   0.0     
ref|XP_002325129.2|  cyclic nucleotide-gated ion channel 5 family...    707   0.0     Populus trichocarpa [western balsam poplar]
ref|XP_004507742.1|  PREDICTED: probable cyclic nucleotide-gated ...    706   0.0     
ref|XP_010525776.1|  PREDICTED: probable cyclic nucleotide-gated ...    706   0.0     
ref|XP_007154880.1|  hypothetical protein PHAVU_003G155800g             706   0.0     
ref|XP_004507740.1|  PREDICTED: probable cyclic nucleotide-gated ...    706   0.0     
ref|XP_010525774.1|  PREDICTED: probable cyclic nucleotide-gated ...    706   0.0     
ref|XP_010432974.1|  PREDICTED: putative cyclic nucleotide-gated ...    705   0.0     
ref|XP_009409792.1|  PREDICTED: probable cyclic nucleotide-gated ...    702   0.0     
gb|EMS52907.1|  Cyclic nucleotide-gated ion channel 1                   700   0.0     
ref|XP_009409791.1|  PREDICTED: probable cyclic nucleotide-gated ...    703   0.0     
ref|XP_008680847.1|  PREDICTED: cyclic nucleotide-gated ion chann...    698   0.0     
ref|NP_974953.1|  cyclic nucleotide gated channel 5                     701   0.0     Arabidopsis thaliana [mouse-ear cress]
emb|CBI25178.3|  unnamed protein product                                701   0.0     
ref|NP_851209.1|  cyclic nucleotide gated channel 5                     700   0.0     Arabidopsis thaliana [mouse-ear cress]
ref|XP_010923827.1|  PREDICTED: probable cyclic nucleotide-gated ...    699   0.0     
ref|XP_011018037.1|  PREDICTED: probable cyclic nucleotide-gated ...    699   0.0     
ref|XP_009401285.1|  PREDICTED: putative cyclic nucleotide-gated ...    699   0.0     
ref|XP_006401149.1|  hypothetical protein EUTSA_v10012803mg             698   0.0     
gb|KHN15941.1|  Putative cyclic nucleotide-gated ion channel 13         694   0.0     
gb|KCW71508.1|  hypothetical protein EUGRSUZ_E00059                     691   0.0     
ref|XP_010655090.1|  PREDICTED: putative cyclic nucleotide-gated ...    696   0.0     
ref|XP_009137935.1|  PREDICTED: putative cyclic nucleotide-gated ...    696   0.0     
ref|XP_010677825.1|  PREDICTED: probable cyclic nucleotide-gated ...    694   0.0     
ref|XP_010483350.1|  PREDICTED: probable cyclic nucleotide-gated ...    696   0.0     
ref|XP_010655088.1|  PREDICTED: putative cyclic nucleotide-gated ...    696   0.0     
ref|XP_009137931.1|  PREDICTED: putative cyclic nucleotide-gated ...    696   0.0     
emb|CDY39213.1|  BnaA03g50250D                                          696   0.0     
ref|XP_004168115.1|  PREDICTED: probable cyclic nucleotide-gated ...    694   0.0     
emb|CDX72251.1|  BnaC07g42730D                                          695   0.0     
ref|XP_002864540.1|  ATCNGC5                                            693   0.0     
ref|XP_010677822.1|  PREDICTED: probable cyclic nucleotide-gated ...    694   0.0     
ref|XP_004144729.1|  PREDICTED: probable cyclic nucleotide-gated ...    693   0.0     
ref|XP_010275105.1|  PREDICTED: probable cyclic nucleotide-gated ...    694   0.0     
ref|XP_003610314.1|  CNGC5-like protein                                 692   0.0     
gb|KCW71511.1|  hypothetical protein EUGRSUZ_E00062                     685   0.0     
ref|XP_004287136.1|  PREDICTED: probable cyclic nucleotide-gated ...    690   0.0     
ref|XP_008452826.1|  PREDICTED: probable cyclic nucleotide-gated ...    689   0.0     
ref|XP_002277261.2|  PREDICTED: cyclic nucleotide-gated ion chann...    686   0.0     
ref|XP_002453628.1|  hypothetical protein SORBIDRAFT_04g009250          686   0.0     
ref|XP_010048796.1|  PREDICTED: probable cyclic nucleotide-gated ...    687   0.0     
ref|XP_006281531.1|  hypothetical protein CARUB_v10027632mg             686   0.0     
ref|XP_010048794.1|  PREDICTED: probable cyclic nucleotide-gated ...    686   0.0     
ref|XP_010452973.1|  PREDICTED: probable cyclic nucleotide-gated ...    685   0.0     
emb|CDY02780.1|  BnaC02g11090D                                          685   0.0     
gb|KDP41965.1|  hypothetical protein JCGZ_26983                         685   0.0     
ref|XP_010275110.1|  PREDICTED: probable cyclic nucleotide-gated ...    685   0.0     
ref|XP_010048747.1|  PREDICTED: LOW QUALITY PROTEIN: probable cyc...    684   0.0     
emb|CDY32737.1|  BnaA02g07990D                                          683   0.0     
ref|XP_010275103.1|  PREDICTED: probable cyclic nucleotide-gated ...    685   0.0     
ref|XP_010275104.1|  PREDICTED: probable cyclic nucleotide-gated ...    684   0.0     
ref|XP_010275107.1|  PREDICTED: probable cyclic nucleotide-gated ...    684   0.0     
ref|XP_008443457.1|  PREDICTED: putative cyclic nucleotide-gated ...    681   0.0     
gb|KGN59614.1|  hypothetical protein Csa_3G829040                       681   0.0     
ref|XP_009126802.1|  PREDICTED: probable cyclic nucleotide-gated ...    681   0.0     
ref|XP_008443456.1|  PREDICTED: putative cyclic nucleotide-gated ...    681   0.0     
ref|XP_010275106.1|  PREDICTED: probable cyclic nucleotide-gated ...    683   0.0     
ref|XP_009788225.1|  PREDICTED: putative cyclic nucleotide-gated ...    680   0.0     
ref|XP_004147453.1|  PREDICTED: putative cyclic nucleotide-gated ...    680   0.0     
ref|XP_008443455.1|  PREDICTED: putative cyclic nucleotide-gated ...    680   0.0     
ref|XP_010676638.1|  PREDICTED: putative cyclic nucleotide-gated ...    680   0.0     
ref|XP_009611941.1|  PREDICTED: putative cyclic nucleotide-gated ...    678   0.0     
gb|EYU27176.1|  hypothetical protein MIMGU_mgv1a001945mg                679   0.0     
gb|KHN43102.1|  Cyclic nucleotide-gated ion channel 1                   671   0.0     
ref|XP_010063578.1|  PREDICTED: putative cyclic nucleotide-gated ...    676   0.0     
ref|XP_007038984.1|  Cyclic nucleotide gated channel 1 isoform 3        666   0.0     
ref|XP_002304729.2|  hypothetical protein POPTR_0003s18120g             675   0.0     
ref|XP_004977009.1|  PREDICTED: probable cyclic nucleotide-gated ...    674   0.0     
ref|XP_006416856.1|  hypothetical protein EUTSA_v10009463mg             672   0.0     
ref|XP_011093102.1|  PREDICTED: cyclic nucleotide-gated ion chann...    668   0.0     
ref|XP_011089272.1|  PREDICTED: putative cyclic nucleotide-gated ...    672   0.0     
ref|XP_011020599.1|  PREDICTED: putative cyclic nucleotide-gated ...    673   0.0     
emb|CDY35058.1|  BnaA06g10680D                                          671   0.0     
ref|XP_002447205.1|  hypothetical protein SORBIDRAFT_06g030420          671   0.0     
ref|NP_001147588.1|  LOC100281197                                       670   0.0     
tpg|DAA35729.1|  TPA: cyclic nucleotide-gated ion channel 9             670   0.0     
emb|CDY33362.1|  BnaC05g12210D                                          669   0.0     
ref|XP_006340177.1|  PREDICTED: putative cyclic nucleotide-gated ...    668   0.0     
ref|XP_004251400.1|  PREDICTED: putative cyclic nucleotide-gated ...    668   0.0     
gb|KCW81116.1|  hypothetical protein EUGRSUZ_C02494                     666   0.0     
ref|XP_007023447.1|  Cyclic nucleotide gated channel 8                  669   0.0     
ref|XP_010508024.1|  PREDICTED: probable cyclic nucleotide-gated ...    661   0.0     
ref|XP_006306900.1|  hypothetical protein CARUB_v10008459mg             665   0.0     
ref|XP_008228799.1|  PREDICTED: putative cyclic nucleotide-gated ...    666   0.0     
ref|XP_004291702.1|  PREDICTED: putative cyclic nucleotide-gated ...    664   0.0     
ref|XP_004986353.1|  PREDICTED: putative cyclic nucleotide-gated ...    663   0.0     
ref|XP_002892890.1|  predicted protein                                  664   0.0     
ref|XP_006422138.1|  hypothetical protein CICLE_v10004452mg             653   0.0     
ref|XP_010094044.1|  Putative cyclic nucleotide-gated ion channel 8     662   0.0     
ref|XP_010253719.1|  PREDICTED: putative cyclic nucleotide-gated ...    662   0.0     
ref|XP_006651634.1|  PREDICTED: probable cyclic nucleotide-gated ...    658   0.0     
ref|NP_173408.2|  cyclic nucleotide gated channel 8                     662   0.0     
ref|XP_006389841.1|  hypothetical protein EUTSA_v10018178mg             661   0.0     
ref|XP_006368503.1|  cyclic nucleotide gated channel 7 family pro...    661   0.0     
ref|XP_002893066.1|  hypothetical protein ARALYDRAFT_335228             661   0.0     
ref|NP_173051.1|  cyclic nucleotide gated channel 7                     659   0.0     
ref|XP_010476698.1|  PREDICTED: putative cyclic nucleotide-gated ...    660   0.0     
ref|XP_010459135.1|  PREDICTED: putative cyclic nucleotide-gated ...    660   0.0     
sp|Q9S9N5.1|CNGC7_ARATH  RecName: Full=Putative cyclic nucleotide...    660   0.0     
ref|XP_003559639.1|  PREDICTED: putative cyclic nucleotide-gated ...    660   0.0     
ref|XP_008439339.1|  PREDICTED: cyclic nucleotide-gated ion chann...    654   0.0     
ref|XP_007216504.1|  hypothetical protein PRUPE_ppa024071mg             659   0.0     
ref|XP_010275109.1|  PREDICTED: probable cyclic nucleotide-gated ...    659   0.0     
ref|XP_010537848.1|  PREDICTED: putative cyclic nucleotide-gated ...    659   0.0     
ref|XP_002512726.1|  Cyclic nucleotide-gated ion channel, putative      667   0.0     
ref|XP_010043766.1|  PREDICTED: putative cyclic nucleotide-gated ...    656   0.0     
ref|XP_003580666.1|  PREDICTED: probable cyclic nucleotide-gated ...    656   0.0     
ref|XP_009149039.1|  PREDICTED: putative cyclic nucleotide-gated ...    657   0.0     
ref|NP_001050768.1|  Os03g0646300                                       655   0.0     
gb|ABF97880.1|  Cyclic nucleotide-gated ion channel 9, putative, ...    655   0.0     
ref|XP_011034555.1|  PREDICTED: putative cyclic nucleotide-gated ...    655   0.0     
dbj|BAK04434.1|  predicted protein                                      654   0.0     
ref|XP_008437907.1|  PREDICTED: cyclic nucleotide-gated ion chann...    652   0.0     
ref|XP_007016780.1|  Cyclic nucleotide-gated channel 15                 652   0.0     
ref|XP_008439337.1|  PREDICTED: cyclic nucleotide-gated ion chann...    649   0.0     
ref|XP_008380996.1|  PREDICTED: putative cyclic nucleotide-gated ...    653   0.0     
gb|KGN56430.1|  hypothetical protein Csa_3G119630                       652   0.0     
ref|XP_004155245.1|  PREDICTED: cyclic nucleotide-gated ion chann...    651   0.0     
gb|KHG03806.1|  hypothetical protein F383_27172                         650   0.0     
ref|XP_004134305.1|  PREDICTED: cyclic nucleotide-gated ion chann...    652   0.0     
gb|EMT07564.1|  Putative cyclic nucleotide-gated ion channel 8          652   0.0     
ref|XP_006488071.1|  PREDICTED: putative cyclic nucleotide-gated ...    650   0.0     
ref|XP_006424547.1|  hypothetical protein CICLE_v10027932mg             649   0.0     
dbj|BAK02131.1|  predicted protein                                      649   0.0     
ref|XP_004235945.2|  PREDICTED: putative cyclic nucleotide-gated ...    649   0.0     
ref|XP_007208333.1|  hypothetical protein PRUPE_ppa002211mg             647   0.0     
ref|XP_006397835.1|  hypothetical protein EUTSA_v10001345mg             646   0.0     
ref|XP_006341683.1|  PREDICTED: putative cyclic nucleotide-gated ...    646   0.0     
gb|EMS46667.1|  Putative cyclic nucleotide-gated ion channel 8          647   0.0     
ref|XP_002466752.1|  hypothetical protein SORBIDRAFT_01g013500          646   0.0     
gb|EYU18815.1|  hypothetical protein MIMGU_mgv1a002146mg                645   0.0     
ref|XP_006585649.1|  PREDICTED: putative cyclic nucleotide-gated ...    646   0.0     
ref|XP_004487089.1|  PREDICTED: putative cyclic nucleotide-gated ...    644   0.0     
ref|XP_003529770.1|  PREDICTED: putative cyclic nucleotide-gated ...    646   0.0     
gb|KHN38048.1|  Putative cyclic nucleotide-gated ion channel 8          645   0.0     
emb|CDP07094.1|  unnamed protein product                                642   0.0     
gb|KDO44035.1|  hypothetical protein CISIN_1g005042mg                   643   0.0     
ref|XP_009372959.1|  PREDICTED: putative cyclic nucleotide-gated ...    641   0.0     
ref|XP_006493368.1|  PREDICTED: putative cyclic nucleotide-gated ...    643   0.0     
ref|XP_006652903.1|  PREDICTED: probable cyclic nucleotide-gated ...    641   0.0     
ref|XP_008344877.1|  PREDICTED: putative cyclic nucleotide-gated ...    640   0.0     
emb|CAD41906.2|  OSJNBa0033G05.7                                        640   0.0     
ref|XP_008463957.1|  PREDICTED: putative cyclic nucleotide-gated ...    639   0.0     
ref|XP_008644644.1|  PREDICTED: LOW QUALITY PROTEIN: putative cyc...    639   0.0     
ref|XP_008463956.1|  PREDICTED: putative cyclic nucleotide-gated ...    639   0.0     
ref|XP_010229329.1|  PREDICTED: putative cyclic nucleotide-gated ...    637   0.0     
ref|XP_008225934.1|  PREDICTED: putative cyclic nucleotide-gated ...    637   0.0     
gb|KGN46846.1|  hypothetical protein Csa_6G146420                       637   0.0     
gb|AAG12561.1|AC007797_21  Putative cyclic nucleotide and calmodu...    639   0.0     
ref|XP_004145808.1|  PREDICTED: putative cyclic nucleotide-gated ...    637   0.0     
ref|XP_009757836.1|  PREDICTED: putative cyclic nucleotide-gated ...    635   0.0     
gb|KDO86448.1|  hypothetical protein CISIN_1g004940mg                   629   0.0     
ref|XP_007135831.1|  hypothetical protein PHAVU_010G161800g             638   0.0     
ref|XP_009367052.1|  PREDICTED: putative cyclic nucleotide-gated ...    636   0.0     
ref|XP_009757823.1|  PREDICTED: putative cyclic nucleotide-gated ...    635   0.0     
ref|XP_002981169.1|  hypothetical protein SELMODRAFT_113786             635   0.0     
ref|XP_009368463.1|  PREDICTED: probable cyclic nucleotide-gated ...    635   0.0     
ref|XP_006427639.1|  hypothetical protein CICLE_v10027257mg             635   0.0     
ref|XP_006357568.1|  PREDICTED: putative cyclic nucleotide-gated ...    634   0.0     
ref|XP_010687712.1|  PREDICTED: probable cyclic nucleotide-gated ...    634   0.0     
gb|KHN11223.1|  Putative cyclic nucleotide-gated ion channel 15         631   0.0     
ref|XP_006592705.1|  PREDICTED: putative cyclic nucleotide-gated ...    632   0.0     
ref|XP_006664884.1|  PREDICTED: putative cyclic nucleotide-gated ...    634   0.0     
gb|AES88563.2|  cyclic nucleotide-gated ion channel protein, puta...    629   0.0     
ref|XP_006846810.1|  hypothetical protein AMTR_s00148p00073630          633   0.0     
ref|XP_008385327.1|  PREDICTED: putative cyclic nucleotide-gated ...    632   0.0     
ref|XP_011044406.1|  PREDICTED: putative cyclic nucleotide-gated ...    630   0.0     
gb|KHG01702.1|  hypothetical protein F383_22559                         632   0.0     
ref|XP_008348631.1|  PREDICTED: probable cyclic nucleotide-gated ...    632   0.0     
ref|XP_004964198.1|  PREDICTED: probable cyclic nucleotide-gated ...    631   0.0     
ref|XP_011044404.1|  PREDICTED: putative cyclic nucleotide-gated ...    630   0.0     
ref|XP_010542584.1|  PREDICTED: putative cyclic nucleotide-gated ...    630   0.0     
emb|CBI16330.3|  unnamed protein product                                630   0.0     
ref|XP_009787468.1|  PREDICTED: probable cyclic nucleotide-gated ...    630   0.0     
gb|KHN31833.1|  Putative cyclic nucleotide-gated ion channel 17         629   0.0     
ref|XP_009379504.1|  PREDICTED: probable cyclic nucleotide-gated ...    630   0.0     
ref|XP_003606366.1|  CNGC5-like protein                                 629   0.0     
ref|NP_180393.1|  cyclic nucleotide-gated channel 15                    629   0.0     
gb|KEH39345.1|  cyclic nucleotide-gated ion channel-like protein        629   0.0     
ref|XP_007150187.1|  hypothetical protein PHAVU_005G133900g             629   0.0     
ref|XP_002984030.1|  hypothetical protein SELMODRAFT_119500             627   0.0     
ref|XP_002880939.1|  ATCNGC15                                           628   0.0     
ref|XP_002282455.1|  PREDICTED: putative cyclic nucleotide-gated ...    629   0.0     
ref|XP_003540759.1|  PREDICTED: putative cyclic nucleotide-gated ...    629   0.0     
ref|XP_003522943.1|  PREDICTED: probable cyclic nucleotide-gated ...    629   0.0     
ref|XP_002523361.1|  Cyclic nucleotide-gated ion channel, putative      626   0.0     
gb|KCW51375.1|  hypothetical protein EUGRSUZ_J00919                     625   0.0     
gb|EPS59071.1|  hypothetical protein M569_15739                         628   0.0     
gb|KEH38064.1|  cyclic nucleotide-gated ion channel-like protein        628   0.0     
gb|ACD81989.1|  cyclic nucleotide gated ion channel 11                  625   0.0     
ref|XP_010508021.1|  PREDICTED: cyclic nucleotide-gated ion chann...    625   0.0     
ref|XP_007132272.1|  hypothetical protein PHAVU_011G080800g             627   0.0     
ref|XP_010268357.1|  PREDICTED: probable cyclic nucleotide-gated ...    629   0.0     
gb|EEE65814.1|  hypothetical protein OsJ_21544                          623   0.0     
ref|XP_007225213.1|  hypothetical protein PRUPE_ppa001990mg             629   0.0     
ref|XP_011082041.1|  PREDICTED: probable cyclic nucleotide-gated ...    628   0.0     
ref|XP_009103668.1|  PREDICTED: putative cyclic nucleotide-gated ...    626   0.0     
gb|KHN21507.1|  Putative cyclic nucleotide-gated ion channel 15         625   0.0     
ref|XP_006594976.1|  PREDICTED: putative cyclic nucleotide-gated ...    626   0.0     
ref|XP_008674097.1|  PREDICTED: putative cyclic nucleotide-gated ...    628   0.0     
ref|XP_002960111.1|  hypothetical protein SELMODRAFT_266514             624   0.0     
ref|XP_011044977.1|  PREDICTED: LOW QUALITY PROTEIN: probable cyc...    627   0.0     
ref|XP_004242662.1|  PREDICTED: probable cyclic nucleotide-gated ...    627   0.0     
ref|XP_010689094.1|  PREDICTED: putative cyclic nucleotide-gated ...    627   0.0     
dbj|BAK07443.1|  predicted protein                                      627   0.0     
ref|XP_001764487.1|  predicted protein                                  627   0.0     
ref|XP_009600937.1|  PREDICTED: probable cyclic nucleotide-gated ...    627   0.0     
gb|KDO59466.1|  hypothetical protein CISIN_1g004711mg                   621   0.0     
ref|XP_007027345.1|  Cyclic nucleotide-gated channel 15 isoform 2       624   0.0     
ref|XP_007027344.1|  Cyclic nucleotide-gated channel 15 isoform 1       625   0.0     
ref|XP_002324941.1|  cyclic nucleotide-regulated ion channel fami...    626   0.0     
ref|XP_010510648.1|  PREDICTED: putative cyclic nucleotide-gated ...    624   0.0     
ref|XP_008340634.1|  PREDICTED: LOW QUALITY PROTEIN: probable cyc...    625   0.0     
ref|XP_010112119.1|  putative cyclic nucleotide-gated ion channel 14    626   0.0     
ref|XP_006581411.1|  PREDICTED: probable cyclic nucleotide-gated ...    625   0.0     
ref|XP_010278052.1|  PREDICTED: probable cyclic nucleotide-gated ...    625   0.0     
ref|XP_001759387.1|  predicted protein                                  622   0.0     
ref|XP_002442555.1|  hypothetical protein SORBIDRAFT_08g021830          626   0.0     
ref|XP_002511425.1|  Cyclic nucleotide-gated ion channel, putative      624   0.0     
ref|XP_011018128.1|  PREDICTED: probable cyclic nucleotide-gated ...    625   0.0     
ref|XP_008223544.1|  PREDICTED: probable cyclic nucleotide-gated ...    625   0.0     
ref|XP_004507066.1|  PREDICTED: putative cyclic nucleotide-gated ...    624   0.0     
ref|XP_008223542.1|  PREDICTED: probable cyclic nucleotide-gated ...    625   0.0     
ref|XP_010048698.1|  PREDICTED: probable cyclic nucleotide-gated ...    623   0.0     
ref|XP_004507064.1|  PREDICTED: putative cyclic nucleotide-gated ...    624   0.0     
ref|XP_010414558.1|  PREDICTED: putative cyclic nucleotide-gated ...    622   0.0     
emb|CDX71365.1|  BnaC04g16000D                                          622   0.0     
ref|XP_010470108.1|  PREDICTED: putative cyclic nucleotide-gated ...    622   0.0     
ref|XP_003604260.1|  CNGC5-like protein                                 634   0.0     
ref|XP_010048696.1|  PREDICTED: probable cyclic nucleotide-gated ...    623   0.0     
emb|CDP02921.1|  unnamed protein product                                623   0.0     
emb|CBI24092.3|  unnamed protein product                                622   0.0     
gb|EPS66346.1|  hypothetical protein M569_08426                         619   0.0     
ref|XP_010929223.1|  PREDICTED: probable cyclic nucleotide-gated ...    622   0.0     
ref|XP_006293792.1|  hypothetical protein CARUB_v10022774mg             620   0.0     
ref|XP_004303237.1|  PREDICTED: putative cyclic nucleotide-gated ...    622   0.0     
ref|XP_002982649.1|  hypothetical protein SELMODRAFT_234015             620   0.0     
ref|XP_006409852.1|  hypothetical protein EUTSA_v10016341mg             620   0.0     



>ref|XP_009777839.1| PREDICTED: cyclic nucleotide-gated ion channel 1-like [Nicotiana 
sylvestris]
 ref|XP_009777845.1| PREDICTED: cyclic nucleotide-gated ion channel 1-like [Nicotiana 
sylvestris]
Length=722

 Score =   906 bits (2341),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 474/651 (73%), Positives = 544/651 (84%), Gaps = 14/651 (2%)
 Frame = +2

Query  47    KSKMHDPQGPFLQRWNRIFVIACILAATVDPLFFYIPVVDDQNKCLGLDRTLEITACILR  226
             K ++ DPQG F+Q+WN+IFV+ C +A ++DPLFFYIPV+D++NKCL LD TL+ITAC+LR
Sbjct  85    KKQILDPQGQFVQQWNKIFVLICTIAVSLDPLFFYIPVIDNKNKCLDLDTTLKITACVLR  144

Query  227   SVFDFFYIFHIILQFRTGFVPPSSRVFGRGDLIVDPSAIAKRYFFSYFFIDILAVLPLPQ  406
             S+ D FYIFHIILQFRTGF+ PSSRVFGRG+LI D SAIAKRY  SYF +D+LAVLPLPQ
Sbjct  145   SITDLFYIFHIILQFRTGFIAPSSRVFGRGELIQDSSAIAKRYLKSYFIVDVLAVLPLPQ  204

Query  407   VVLFMMIPRADRPFIMVAKDILKVVILVQSVPRLLRIYPLYKEVTRTSGFFTETAWAGAA  586
             +V+ ++ P  + P  +  K+ILK+VI VQ VPR+ RIYPLYKEVTRT+G FTETAW GAA
Sbjct  205   IVILIISPSVNSPISLATKEILKIVIFVQYVPRIFRIYPLYKEVTRTAGLFTETAWGGAA  264

Query  587   FNLFLYMIASYVAGAIWYITAIERQDKCWRRACEKHGSCDIDFLYCTKLGRRGGDFSSSF  766
             FNLFLYM+AS V GA WY+ ++ERQD CWR AC+K  SC  D+LYC   G R G+  +  
Sbjct  265   FNLFLYMLASNVVGAFWYLISVERQDTCWRDACKKIDSCSSDYLYCG--GNRNGN--ALL  320

Query  767   LNTSCALLEPENLK-ADDFDFGIFLDALKSNVVEKRYFWSKLFYCFWWGLRNLSSLGQNL  943
             LN+SC LL+ E++K  +DFDFGIFLDAL+  +VEK+ FWSKLFYCFWWGLRNLSSLGQNL
Sbjct  321   LNSSCPLLKSEDIKDPNDFDFGIFLDALQFRIVEKQNFWSKLFYCFWWGLRNLSSLGQNL  380

Query  944   KTSNFVGEilfailisiiglilfslligNMQKYLQSITVRVEEMRVKRMDAEQWMSHRML  1123
             KTS FVGEILFA+ ISIIGLILFSLLIGNMQKYLQSITVRVEEMRV+R DAEQWMSHRML
Sbjct  381   KTSTFVGEILFAVFISIIGLILFSLLIGNMQKYLQSITVRVEEMRVRRRDAEQWMSHRML  440

Query  1124  PDNLRERIRRYEQYRWQETRGVDEESLISNLPKDLRRDINRHLCWSLLKRVHMFKTMDEQ  1303
             PDNLR RIRR+EQY+WQETRGV+E+ LI NLP+DLRRD+ RHLCWSL+KRV +F  MDEQ
Sbjct  441   PDNLRGRIRRHEQYKWQETRGVEEDLLIHNLPRDLRRDLKRHLCWSLVKRVPIFDKMDEQ  500

Query  1304  LLDAICDRLKPVLYTEKSCIVREGDPVDEMIFVMRGNLLTMTTNGGRTGFLNSDVLNAGD  1483
             LLDA+CDRLKP LYTEKS I+REGDPVDEM+F+MRG LLTMTTNGGRTGF NS  L AGD
Sbjct  501   LLDAMCDRLKPALYTEKSFIIREGDPVDEMLFLMRGTLLTMTTNGGRTGFFNSVSLKAGD  560

Query  1484  FCGEELLTWALDPNSSSSLPISTRTVQALTDVEAFALTADFLKFFASQYRRLHSKQLQHK  1663
             FCGEELLTWALDP++SSSLPISTRTVQA TD+EAFALTAD LKF ASQ+RRLHSKQLQH 
Sbjct  561   FCGEELLTWALDPHTSSSLPISTRTVQAETDIEAFALTADDLKFVASQFRRLHSKQLQHS  620

Query  1664  FRFYSHQWKTWAACFIQAAWRRHCRNKLEKSLREEEDRLQDALILRMRREEGETTPSLGA  1843
             FRFYS QW+TW ACFIQ AWRRHCRNKLEKSLREEEDRLQ AL      +E    PSLGA
Sbjct  621   FRFYSQQWRTWGACFIQVAWRRHCRNKLEKSLREEEDRLQAALA-----KESTNAPSLGA  675

Query  1844  TIYASRFAANVLRTVRRNHplsvpklsprlpplllqkpAEPDFSAPENNNA  1996
             TIYASRFAAN LR +RRNH  +         PLLLQKPAEP+FS  E N++
Sbjct  676   TIYASRFAANALRALRRNH--TTGAKLSPTLPLLLQKPAEPNFS--EENHS  722



>ref|XP_009598596.1| PREDICTED: cyclic nucleotide-gated ion channel 1-like [Nicotiana 
tomentosiformis]
 ref|XP_009598597.1| PREDICTED: cyclic nucleotide-gated ion channel 1-like [Nicotiana 
tomentosiformis]
Length=717

 Score =   902 bits (2331),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 473/651 (73%), Positives = 543/651 (83%), Gaps = 14/651 (2%)
 Frame = +2

Query  47    KSKMHDPQGPFLQRWNRIFVIACILAATVDPLFFYIPVVDDQNKCLGLDRTLEITACILR  226
             K ++ DPQG FLQ+WN+IFV+ C +A ++DPLFFYIPV+D++NKCL LD TL+ITAC+LR
Sbjct  80    KKQILDPQGRFLQQWNKIFVLICTIAVSLDPLFFYIPVIDNENKCLDLDTTLKITACVLR  139

Query  227   SVFDFFYIFHIILQFRTGFVPPSSRVFGRGDLIVDPSAIAKRYFFSYFFIDILAVLPLPQ  406
             S+ D FYIFHIILQFRTGF+PPSSRVFGRG+LI D SAIAKRY  SYF +DILAVLPLPQ
Sbjct  140   SITDLFYIFHIILQFRTGFIPPSSRVFGRGELIEDSSAIAKRYLKSYFIVDILAVLPLPQ  199

Query  407   VVLFMMIPRADRPFIMVAKDILKVVILVQSVPRLLRIYPLYKEVTRTSGFFTETAWAGAA  586
             +V+ ++ P  + P  +  K+ILK+VI VQ VPR+ RIYPLYKEVTRT+G FTETAW GAA
Sbjct  200   IVILIISPSVNSPISLATKEILKIVIFVQYVPRIFRIYPLYKEVTRTAGLFTETAWGGAA  259

Query  587   FNLFLYMIASYVAGAIWYITAIERQDKCWRRACEKHGSCDIDFLYCTKLGRRGGDFSSSF  766
             FNLFLYM+AS V GA WY+ ++ERQD CWR AC+K  SC +D LYC   G R G+  +  
Sbjct  260   FNLFLYMLASNVVGAFWYLISVERQDTCWRDACDKIDSCSLDNLYCG--GNRNGN--ALL  315

Query  767   LNTSCALLEPENLK-ADDFDFGIFLDALKSNVVEKRYFWSKLFYCFWWGLRNLSSLGQNL  943
             LN+SC LL+ E++K  +DFDFGIFLDAL+  +VEK+ FWSKLFYCFWWGLRNLSSLGQNL
Sbjct  316   LNSSCPLLKSEDIKDPNDFDFGIFLDALQFRIVEKQKFWSKLFYCFWWGLRNLSSLGQNL  375

Query  944   KTSNFVGEilfailisiiglilfslligNMQKYLQSITVRVEEMRVKRMDAEQWMSHRML  1123
             KTS FVGEILFA+ ISIIGLILFSLLIGNMQKYLQSITVRVEEMRV+R DAEQWMSHRML
Sbjct  376   KTSTFVGEILFAVFISIIGLILFSLLIGNMQKYLQSITVRVEEMRVRRRDAEQWMSHRML  435

Query  1124  PDNLRERIRRYEQYRWQETRGVDEESLISNLPKDLRRDINRHLCWSLLKRVHMFKTMDEQ  1303
             PDNLR RIRR+EQY+WQETRGV+E+ LI NLP+DLRRD+ RHLCWSL+KRV MF+ MDEQ
Sbjct  436   PDNLRARIRRHEQYKWQETRGVEEDLLIHNLPRDLRRDLKRHLCWSLVKRVPMFEKMDEQ  495

Query  1304  LLDAICDRLKPVLYTEKSCIVREGDPVDEMIFVMRGNLLTMTTNGGRTGFLNSDVLNAGD  1483
             LLDA+C RLKP LYTEKS I+REGDPVDEM+F+MRG L+TMTTNGGRTGF NS  L AGD
Sbjct  496   LLDAMCGRLKPALYTEKSFIIREGDPVDEMLFLMRGTLITMTTNGGRTGFFNSVSLKAGD  555

Query  1484  FCGEELLTWALDPNSSSSLPISTRTVQALTDVEAFALTADFLKFFASQYRRLHSKQLQHK  1663
             FCGEELLTWALDP++SSSLP STRTVQA TD+EAFALTAD LKF ASQ+RRL+SKQLQH 
Sbjct  556   FCGEELLTWALDPHTSSSLPTSTRTVQAETDIEAFALTADDLKFVASQFRRLNSKQLQHS  615

Query  1664  FRFYSHQWKTWAACFIQAAWRRHCRNKLEKSLREEEDRLQDALILRMRREEGETTPSLGA  1843
             FR YS QW+TW ACFIQ AWRRHCRNKLEKSLREEEDRLQ AL      +E    PSLGA
Sbjct  616   FRLYSQQWRTWGACFIQVAWRRHCRNKLEKSLREEEDRLQVALA-----KESTNAPSLGA  670

Query  1844  TIYASRFAANVLRTVRRNHplsvpklsprlpplllqkpAEPDFSAPENNNA  1996
             TIYASRFAAN LR +RRNH  +         PLLLQKPAEP+FS  E N++
Sbjct  671   TIYASRFAANALRALRRNH--TTGAKLSPTLPLLLQKPAEPNFS--EENHS  717



>ref|XP_010327006.1| PREDICTED: cyclic nucleotide-gated ion channel 1-like isoform 
X1 [Solanum lycopersicum]
Length=706

 Score =   895 bits (2314),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 461/644 (72%), Positives = 530/644 (82%), Gaps = 10/644 (2%)
 Frame = +2

Query  47    KSKMHDPQGPFLQRWNRIFVIACILAATVDPLFFYIPVVDDQNKCLGLDRTLEITACILR  226
             ++K+ DPQ PFLQ WN++F+ ACI++  +DPLFFYIPV+D++ KCL LDRTL+I   ILR
Sbjct  73    RNKILDPQEPFLQFWNKVFIFACIISLAIDPLFFYIPVIDNKRKCLDLDRTLKIPISILR  132

Query  227   SVFDFFYIFHIILQFRTGFVPPSSRVFGRGDLIVDPSAIAKRYFFSYFFIDILAVLPLPQ  406
             SV D  YI+HIILQFRTGF+ PSSRVFGRG+LI D S IAKRY F YF ID+LAVLPLPQ
Sbjct  133   SVSDLIYIYHIILQFRTGFITPSSRVFGRGELIQDSSLIAKRYLFPYFIIDVLAVLPLPQ  192

Query  407   VVLFMMIPRADRPFIMVAKDILKVVILVQSVPRLLRIYPLYKEVTRTSGFFTETAWAGAA  586
             +VLF++ P  +RP  +V +  L +VIL Q +PR LRIYPLYKEVTRT+GF TETAWAGAA
Sbjct  193   MVLFIIAPNTNRPISLVTRKQLVIVILAQYIPRSLRIYPLYKEVTRTTGFLTETAWAGAA  252

Query  587   FNLFLYMIASYVAGAIWYITAIERQDKCWRRACEKHGSCDIDFLYCTKLGRRGGDFSSSF  766
             FNLFL+MIAS V GA WY+  IERQD CWR+ C     C +D + C  LG+     ++ F
Sbjct  253   FNLFLFMIASNVVGAFWYLITIERQDDCWRKVCRGIKKCVLDSICCGHLGKA----NTQF  308

Query  767   LNTSCALLEPENLKADDFDFGIFLDALKSNVVEKRYFWSKLFYCFWWGLRNLSSLGQNLK  946
             LN+SC LL+PE+++  DFDFGIFLDAL S V EKR FWSKL YCFWWGLRNLSSLGQ+LK
Sbjct  309   LNSSCPLLKPEDVQEHDFDFGIFLDALHSRVAEKRNFWSKLSYCFWWGLRNLSSLGQDLK  368

Query  947   TSNFVGEilfailisiiglilfslligNMQKYLQSITVRVEEMRVKRMDAEQWMSHRMLP  1126
             TSN V EILFA+ I I+GLILFSLLIGNMQ+YLQSITVRVE MR++R DAEQWMSHRMLP
Sbjct  369   TSNSVWEILFAVFICIVGLILFSLLIGNMQEYLQSITVRVEGMRLRRRDAEQWMSHRMLP  428

Query  1127  DNLRERIRRYEQYRWQETRGVDEESLISNLPKDLRRDINRHLCWSLLKRVHMFKTMDEQL  1306
             +NLRERIRRYEQY+WQETRGVDE+ LISNLPKDL+RD+ RHLCWSLLKRV MF+ MDEQL
Sbjct  429   ENLRERIRRYEQYKWQETRGVDEDYLISNLPKDLKRDVKRHLCWSLLKRVPMFEKMDEQL  488

Query  1307  LDAICDRLKPVLYTEKSCIVREGDPVDEMIFVMRGNLLTMTTNGGRTGFLNSDVLNAGDF  1486
             LDA+CDRLKP L+TE S I+REGDPV EM+F+MRG LLTMTTNGGRTGF NS  L AGDF
Sbjct  489   LDALCDRLKPALFTENSFIIREGDPVSEMLFLMRGTLLTMTTNGGRTGFFNSASLKAGDF  548

Query  1487  CGEELLTWALDPNSSSSLPISTRTVQALTDVEAFALTADFLKFFASQYRRLHSKQLQHKF  1666
             CGEELLTWALDP+SS++LP STRTV+A+ DVEAFALTAD LKF A+Q+RRLHSKQ++H F
Sbjct  549   CGEELLTWALDPHSSTTLPSSTRTVKAVIDVEAFALTADDLKFVAAQFRRLHSKQIRHTF  608

Query  1667  RFYSHQWKTWAACFIQAAWRRHCRNKLEKSLREEEDRLQDALILRMRREEGETTPSLGAT  1846
             RFYS  W+TWAACFIQAAWRRHCRNKLEKSL+EEEDRLQ AL       E    PSLGAT
Sbjct  609   RFYSQHWRTWAACFIQAAWRRHCRNKLEKSLKEEEDRLQAALA-----NETANLPSLGAT  663

Query  1847  IYASRFAANVLRTVRRNHplsvpklsprlpplllqkpAEPDFSA  1978
             IYASRFAAN LR +RRNH     K   RL PLLLQKPAEPDFS+
Sbjct  664   IYASRFAANALRALRRNH-PRGSKSFTRLSPLLLQKPAEPDFSS  706



>ref|XP_006339698.1| PREDICTED: cyclic nucleotide-gated ion channel 1-like [Solanum 
tuberosum]
Length=706

 Score =   892 bits (2305),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 462/643 (72%), Positives = 528/643 (82%), Gaps = 10/643 (2%)
 Frame = +2

Query  50    SKMHDPQGPFLQRWNRIFVIACILAATVDPLFFYIPVVDDQNKCLGLDRTLEITACILRS  229
             +K+ DPQ PFLQ WN++FV+ACI++  +DPLFFYIPV+D++ KCL LDRTL+I   ILRS
Sbjct  74    NKILDPQEPFLQFWNKVFVLACIISVAIDPLFFYIPVIDNKRKCLDLDRTLKIPISILRS  133

Query  230   VFDFFYIFHIILQFRTGFVPPSSRVFGRGDLIVDPSAIAKRYFFSYFFIDILAVLPLPQV  409
             V D  YI+HIILQFRTGF+ PSSRVFGRG+LI D S IAKRY F YF IDILAVLPLPQ+
Sbjct  134   VSDLCYIYHIILQFRTGFITPSSRVFGRGELIEDSSLIAKRYLFPYFIIDILAVLPLPQM  193

Query  410   VLFMMIPRADRPFIMVAKDILKVVILVQSVPRLLRIYPLYKEVTRTSGFFTETAWAGAAF  589
             VLF++ P  +RP  +V +  L +VI  Q +PRL RIYPLYKEVTRT+GF TETAWAGAAF
Sbjct  194   VLFIIAPNTNRPISLVTRKQLVIVIFAQYIPRLFRIYPLYKEVTRTTGFLTETAWAGAAF  253

Query  590   NLFLYMIASYVAGAIWYITAIERQDKCWRRACEKHGSCDIDFLYCTKLGRRGGDFSSSFL  769
             NLFL+MIAS V GA WY+  IERQD CW   C+   +C +D + C  LG+     ++ FL
Sbjct  254   NLFLFMIASNVVGAFWYLITIERQDDCWSHVCKDITNCVLDSICCGHLGKA----NTQFL  309

Query  770   NTSCALLEPENLKADDFDFGIFLDALKSNVVEKRYFWSKLFYCFWWGLRNLSSLGQNLKT  949
             N+SC LL+PE ++  DFDFGIFLDAL+S V EKR FWSKL YCFWWGLRNLSSLGQ+LKT
Sbjct  310   NSSCPLLKPEAVQEHDFDFGIFLDALQSRVAEKRNFWSKLSYCFWWGLRNLSSLGQDLKT  369

Query  950   SNFVGEilfailisiiglilfslligNMQKYLQSITVRVEEMRVKRMDAEQWMSHRMLPD  1129
             SN V EILFAI I I+GLILFSLLIGNMQ+YLQSITVRVE MR++R DAEQWMSHRMLPD
Sbjct  370   SNSVWEILFAIFICIVGLILFSLLIGNMQEYLQSITVRVEGMRLRRRDAEQWMSHRMLPD  429

Query  1130  NLRERIRRYEQYRWQETRGVDEESLISNLPKDLRRDINRHLCWSLLKRVHMFKTMDEQLL  1309
             NLR RIRRYEQY+WQETRGVDE+ LISNLPKDL+RD+ RHLCWSLLKRV MF+ MDEQLL
Sbjct  430   NLRVRIRRYEQYKWQETRGVDEDYLISNLPKDLKRDVKRHLCWSLLKRVPMFEKMDEQLL  489

Query  1310  DAICDRLKPVLYTEKSCIVREGDPVDEMIFVMRGNLLTMTTNGGRTGFLNSDVLNAGDFC  1489
             DA+CDRLKP L+TE S I+REGDPV EM+F+MRG LLTMTTNGGRTGF NS  L AGDFC
Sbjct  490   DALCDRLKPALFTENSFIIREGDPVSEMLFLMRGTLLTMTTNGGRTGFFNSASLKAGDFC  549

Query  1490  GEELLTWALDPNSSSSLPISTRTVQALTDVEAFALTADFLKFFASQYRRLHSKQLQHKFR  1669
             GEELLTWALDP++SS+LP STRTV+A+ DVEAFALTAD LKF A+Q+RRLHSKQL+H FR
Sbjct  550   GEELLTWALDPHASSTLPSSTRTVKAVIDVEAFALTADDLKFVAAQFRRLHSKQLRHTFR  609

Query  1670  FYSHQWKTWAACFIQAAWRRHCRNKLEKSLREEEDRLQDALILRMRREEGETTPSLGATI  1849
             FYS  W+TWAACFIQAAWRRHCRNKLEKSL+EEEDRLQ AL       E    PSLGATI
Sbjct  610   FYSQHWRTWAACFIQAAWRRHCRNKLEKSLKEEEDRLQAALA-----NETANLPSLGATI  664

Query  1850  YASRFAANVLRTVRRNHplsvpklsprlpplllqkpAEPDFSA  1978
             YAS+FAAN LR +RRNH     K   RL PLLLQKPAEPDFS+
Sbjct  665   YASKFAANALRAMRRNH-PKGSKSFTRLSPLLLQKPAEPDFSS  706



>ref|XP_011093040.1| PREDICTED: cyclic nucleotide-gated ion channel 1-like [Sesamum 
indicum]
Length=717

 Score =   887 bits (2293),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 459/645 (71%), Positives = 527/645 (82%), Gaps = 11/645 (2%)
 Frame = +2

Query  47    KSKMHDPQGPFLQRWNRIFVIACILAATVDPLFFYIPVVDDQNKCLGLDRTLEITACILR  226
             + K+ DPQGPFLQRWN+IFVI+C++A ++DPLFFY PVVD +  CL LD  LEITAC+LR
Sbjct  79    RKKVLDPQGPFLQRWNKIFVISCLIAVSLDPLFFYTPVVDAKKFCLSLDENLEITACVLR  138

Query  227   SVFDFFYIFHIILQFRTGFVPPSSRVFGRGDLIVDPSAIAKRYFFSYFFIDILAVLPLPQ  406
             S  D FYIFHI+LQF TGF+ P +RVFGRG+LI D  AIAKRY  SYF +DIL++LPLPQ
Sbjct  139   SFIDIFYIFHIVLQFHTGFIAPCTRVFGRGELIEDRRAIAKRYLSSYFIVDILSILPLPQ  198

Query  407   VVLFMMIPRADRPFIMVAKDILKVVILVQSVPRLLRIYPLYKEVTRTSGFFTETAWAGAA  586
             +V+ ++IP  + P  +  KD+LK+VI  Q +PR LRIYPL+KEV RTSG FTETAWAGAA
Sbjct  199   LVILIVIPSVNAPISLATKDLLKIVIFAQYIPRCLRIYPLFKEVNRTSGLFTETAWAGAA  258

Query  587   FNLFLYMIASYVAGAIWYITAIERQDKCWRRACEKHGSCDIDFLYCTKLGRRGGDFSSSF  766
             FNL LYM+AS+V G+ WY+ AIER+D+CWR AC  H  C+++ LYC   G   GD  +SF
Sbjct  259   FNLLLYMLASHVFGSFWYLIAIERKDRCWRNACRDHNGCNLNDLYC---GEDRGD--TSF  313

Query  767   LNTSCALLEPENLKAD-DFDFGIFLDALKSNVVEKRYFWSKLFYCFWWGLRNLSSLGQNL  943
             LN+SC LLEP  +K+  DFDFGIFLD L+S+V E R F  K+ YCFWWGLRNLSSLGQNL
Sbjct  314   LNSSCPLLEPNEIKSPADFDFGIFLDVLQSHVAEHRDFSKKISYCFWWGLRNLSSLGQNL  373

Query  944   KTSNFVGEilfailisiiglilfslligNMQKYLQSITVRVEEMRVKRMDAEQWMSHRML  1123
             KTS FVGEILFA+ ISI+GL+LFSLLIGNMQKYLQSITVR+EEMR+KR DAEQWMSHRML
Sbjct  374   KTSTFVGEILFAVFISIVGLVLFSLLIGNMQKYLQSITVRIEEMRMKRRDAEQWMSHRML  433

Query  1124  PDNLRERIRRYEQYRWQETRGVDEESLISNLPKDLRRDINRHLCWSLLKRVHMFKTMDEQ  1303
             P+NLR RIRRYEQY+WQE RGV+EESLI NLPKDLRRDI RHLCW+LL RV MF+ MDEQ
Sbjct  434   PENLRARIRRYEQYKWQENRGVEEESLIRNLPKDLRRDIKRHLCWTLLTRVPMFEKMDEQ  493

Query  1304  LLDAICDRLKPVLYTEKSCIVREGDPVDEMIFVMRGNLLTMTTNGGRTGFLNSDVLNAGD  1483
             LLDA+C RLKPVLYTE S IVREGDPVDEM+F+MRGN+LTMTTNGGRTGF NS  L AGD
Sbjct  494   LLDAMCSRLKPVLYTENSFIVREGDPVDEMLFIMRGNILTMTTNGGRTGFFNSVYLMAGD  553

Query  1484  FCGEELLTWALDPNSSSSLPISTRTVQALTDVEAFALTADFLKFFASQYRRLHSKQLQHK  1663
             FCGEELLTWALDPNSSSSLPISTRTVQA+ DVEAF L  D LK   SQ+RRLHSKQLQH 
Sbjct  554   FCGEELLTWALDPNSSSSLPISTRTVQAVKDVEAFCLMPDDLKSVTSQFRRLHSKQLQHT  613

Query  1664  FRFYSHQWKTWAACFIQAAWRRHCRNKLEKSLREEEDRLQDALILRMRREEGETTPSLGA  1843
             FRFYS QW+TW ACFIQAAWRRH R K+EK LRE EDRLQ+AL     +E   + PSL A
Sbjct  614   FRFYSQQWRTWGACFIQAAWRRHYRRKIEKMLREAEDRLQNALA----KEGSGSLPSLAA  669

Query  1844  TIYASRFAANVLRTVRRNHplsvpklsprlpplllqkpAEPDFSA  1978
             T+YASRFA N+L  +RRNH       SP+LPPLLLQKPAEPDFSA
Sbjct  670   TVYASRFATNMLGNLRRNH-PHNNISSPKLPPLLLQKPAEPDFSA  713



>gb|EYU38895.1| hypothetical protein MIMGU_mgv1a023022mg, partial [Erythranthe 
guttata]
Length=703

 Score =   879 bits (2272),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 455/650 (70%), Positives = 529/650 (81%), Gaps = 18/650 (3%)
 Frame = +2

Query  47    KSKMHDPQGPFLQRWNRIFVIACILAATVDPLFFYIPVVDDQNKCLGLDRTLEITACILR  226
             K K+ DPQG FLQRW++I V++C++A ++DPLFFYIPVVD  N+CL LD+ LEI AC+LR
Sbjct  71    KKKILDPQGTFLQRWDKIVVLSCVIAVSLDPLFFYIPVVDPVNRCLSLDKKLEIIACVLR  130

Query  227   SVFDFFYIFHIILQFRTGFVPPSSRVFGRGDLIVDPSAIAKRYFFSYFFIDILAVLPLPQ  406
             S  D FYIFHI LQFRTGF+ P SR+FGRG+L+ D  AIAKRY  SYF +D+L+VLPLPQ
Sbjct  131   SFMDLFYIFHIFLQFRTGFIAPCSRIFGRGELVEDAKAIAKRYLSSYFIVDVLSVLPLPQ  190

Query  407   VVLFMMIPRADRPFIMVAKDILKVVILVQSVPRLLRIYPLYKEVTRTSGFFTETAWAGAA  586
             VV+ ++IP    P  +V KD+LK+VI VQ +PRL R+YPLYKEVTRTSG FTET WAGAA
Sbjct  191   VVILIVIPSVSAPISLVTKDLLKIVIFVQYIPRLFRLYPLYKEVTRTSGLFTETPWAGAA  250

Query  587   FNLFLYMIASYVAGAIWYITAIERQDKCWRRACEKHGSCDIDFLYCTKLGRRGGDFSSSF  766
             FNLFLYM+AS+V GA WY+ AIER+D+CWR AC +   C++D LYC   G   GD  +SF
Sbjct  251   FNLFLYMLASHVLGAFWYLFAIERKDRCWRNAC-RDNKCNLDDLYCG--GEVKGD--TSF  305

Query  767   LNTSCALLEPENLKAD-DFDFGIFLDALKSNVVEKRYFWSKLFYCFWWGLRNLSSLGQNL  943
             LNTSC LLEP  +K++ DFDFGI LDAL+S V E++ F  K FYCFWWGLRNLSSLGQNL
Sbjct  306   LNTSCPLLEPNEIKSELDFDFGIVLDALQSRVAEQKDFSRKFFYCFWWGLRNLSSLGQNL  365

Query  944   KTSNFVGEilfailisiiglilfslligNMQKYLQSITVRVEEMRVKRMDAEQWMSHRML  1123
             KTS FVGEILFAI IS+IGLILFS LIGNMQKYLQS+TVRVEEMRVKR DAEQWM+HRML
Sbjct  366   KTSTFVGEILFAIAISVIGLILFSFLIGNMQKYLQSMTVRVEEMRVKRTDAEQWMAHRML  425

Query  1124  PDNLRERIRRYEQYRWQETRGVDEESLISNLPKDLRRDINRHLCWSLLKRVHMFKTMDEQ  1303
             P+ LR RIRRYEQY+WQETRGV+E+SLI N PKDLRRDI RHLCW+LL RV MF+ MDE+
Sbjct  426   PEELRGRIRRYEQYKWQETRGVEEDSLIWNFPKDLRRDIKRHLCWTLLTRVPMFEKMDER  485

Query  1304  LLDAICDRLKPVLYTEKSCIVREGDPVDEMIFVMRGNLLTMTTNGGRTGFLNSDVLNAGD  1483
             LLDA+C RLKPVLYTE S IVREGDPVDEM+F+MRGN+LT+TTNGGRTGF NS  L +GD
Sbjct  486   LLDAMCTRLKPVLYTENSFIVREGDPVDEMLFIMRGNILTVTTNGGRTGFYNSVYLMSGD  545

Query  1484  FCGEELLTWALDPNSSSSLPISTRTVQALTDVEAFALTADFLKFFASQYRRLHSKQLQHK  1663
             FCGEELLTWALDPNSSSSLPISTRTVQA+ DVEAF L AD LK  ASQ+RRLHSKQLQH 
Sbjct  546   FCGEELLTWALDPNSSSSLPISTRTVQAVKDVEAFCLMADDLKTVASQFRRLHSKQLQHT  605

Query  1664  FRFYSHQWKTWAACFIQAAWRRHCRNKLEKSLREEEDRLQDALILRMRREEGETTPSLGA  1843
             FR YS QW+TW ACFIQAAWRRHCR K+EKSLRE EDR+    +L      G  +PS+GA
Sbjct  606   FRLYSQQWRTWGACFIQAAWRRHCRRKMEKSLREAEDRVMHGALL------GVDSPSIGA  659

Query  1844  TIYASRFAANVLRTVRRNHplsvpklsprlpplllqkpAEPDFSAPENNN  1993
              +YAS+FA N+L  +RRN+       SP+LP LL QKPAEPDFS  EN++
Sbjct  660   AVYASKFATNMLANLRRNN-----IPSPKLPTLLPQKPAEPDFST-ENHS  703



>ref|XP_009627716.1| PREDICTED: cyclic nucleotide-gated ion channel 1-like [Nicotiana 
tomentosiformis]
 ref|XP_009627717.1| PREDICTED: cyclic nucleotide-gated ion channel 1-like [Nicotiana 
tomentosiformis]
Length=702

 Score =   877 bits (2267),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 455/644 (71%), Positives = 529/644 (82%), Gaps = 12/644 (2%)
 Frame = +2

Query  47    KSKMHDPQGPFLQRWNRIFVIACILAATVDPLFFYIPVVDDQNKCLGLDRTLEITACILR  226
             ++K+ DPQ PFLQ WN+IFV+ACI++  +DPLFFYI VVD + KCL LD +L+I   +LR
Sbjct  71    RNKVLDPQEPFLQFWNKIFVLACIVSVAIDPLFFYISVVDIKRKCLDLDHSLKIPISVLR  130

Query  227   SVFDFFYIFHIILQFRTGFVPPSSRVFGRGDLIVDPSAIAKRYFFSYFFIDILAVLPLPQ  406
             SV D FYI+HIILQFRTGF+ PSSRVFGRG+LI D S IAKRY   YF IDILAVLPLPQ
Sbjct  131   SVTDLFYIYHIILQFRTGFIAPSSRVFGRGELIEDSSLIAKRYI-PYFIIDILAVLPLPQ  189

Query  407   VVLFMMIPRADRPFIMVAKDILKVVILVQSVPRLLRIYPLYKEVTRTSGFFTETAWAGAA  586
             +VLF+  P A+R   +V K  L +V+  Q VPR+ RI+PLYKEVTRT+GFFTETAWAGAA
Sbjct  190   LVLFINAPNANRAISLVMKKQLVIVVFTQYVPRIFRIFPLYKEVTRTTGFFTETAWAGAA  249

Query  587   FNLFLYMIASYVAGAIWYITAIERQDKCWRRACEKHGSCDIDFLYCTKLGRRGGDFSSSF  766
             FNLFL+MIAS V GA+WY+  +ERQD CW + C+    C +D L C + G+     ++ F
Sbjct  250   FNLFLFMIASNVVGALWYLITVERQDNCWSQVCKGFEECVLDHLCCGQQGK-----NAQF  304

Query  767   LNTSCALLEPENLKADDFDFGIFLDALKSNVVEKRYFWSKLFYCFWWGLRNLSSLGQNLK  946
             LN+SC LL+PE ++ +DFDFGIF DAL+S VV++R FWSKL YCFWWGLRNLSSLGQ L 
Sbjct  305   LNSSCRLLKPEEIQENDFDFGIFRDALQSRVVQRRNFWSKLSYCFWWGLRNLSSLGQGLN  364

Query  947   TSNFVGEilfailisiiglilfslligNMQKYLQSITVRVEEMRVKRMDAEQWMSHRMLP  1126
             TS+F+GEILFA+ I I+GLILFSLLIGNMQ+YLQSITVRVE MR++R DAEQWMSHRMLP
Sbjct  365   TSDFLGEILFAVFICILGLILFSLLIGNMQEYLQSITVRVEGMRLRRRDAEQWMSHRMLP  424

Query  1127  DNLRERIRRYEQYRWQETRGVDEESLISNLPKDLRRDINRHLCWSLLKRVHMFKTMDEQL  1306
             DNLRERIRRYEQY+WQ+TRGVDE+ LI NLPKDLRRD+ RHLCWSLLKRV MF+ MDEQL
Sbjct  425   DNLRERIRRYEQYKWQQTRGVDEDYLICNLPKDLRRDVKRHLCWSLLKRVPMFEKMDEQL  484

Query  1307  LDAICDRLKPVLYTEKSCIVREGDPVDEMIFVMRGNLLTMTTNGGRTGFLNSDVLNAGDF  1486
             LDA+CDRLKP L+TE S I+REGDPV+EM+F+MRG LLT+TTNGGRTGF NS  L AGDF
Sbjct  485   LDALCDRLKPALFTENSFIIREGDPVNEMLFLMRGTLLTITTNGGRTGFFNSASLTAGDF  544

Query  1487  CGEELLTWALDPNSSSSLPISTRTVQALTDVEAFALTADFLKFFASQYRRLHSKQLQHKF  1666
             CGEELLTWALDP++SS+LP STRTVQA+ DVEAFALTAD LKF A+Q+R LHSKQ++H F
Sbjct  545   CGEELLTWALDPHASSTLPASTRTVQAVIDVEAFALTADDLKFVAAQFRHLHSKQIRHAF  604

Query  1667  RFYSHQWKTWAACFIQAAWRRHCRNKLEKSLREEEDRLQDALILRMRREEGETTPSLGAT  1846
             RFYS  W+TWAACFIQAAWRRH RNKLEKSLREEEDRLQ AL       E    PSLGAT
Sbjct  605   RFYSQHWRTWAACFIQAAWRRHYRNKLEKSLREEEDRLQAAL-----ENETANIPSLGAT  659

Query  1847  IYASRFAANVLRTVRRNHplsvpklsprlpplllqkpAEPDFSA  1978
             IYASRFAAN LR +RRNH L   K S R+ PLLLQKPAEPDFS+
Sbjct  660   IYASRFAANALRVLRRNH-LKGSKSSSRVSPLLLQKPAEPDFSS  702



>ref|XP_010555719.1| PREDICTED: cyclic nucleotide-gated ion channel 1 [Tarenaya hassleriana]
 ref|XP_010555720.1| PREDICTED: cyclic nucleotide-gated ion channel 1 [Tarenaya hassleriana]
 ref|XP_010555721.1| PREDICTED: cyclic nucleotide-gated ion channel 1 [Tarenaya hassleriana]
Length=713

 Score =   872 bits (2252),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 445/643 (69%), Positives = 529/643 (82%), Gaps = 11/643 (2%)
 Frame = +2

Query  50    SKMHDPQGPFLQRWNRIFVIACILAATVDPLFFYIPVVDDQNKCLGLDRTLEITACILRS  229
             +K+ DPQG FLQRWN+IFV+ACI+A ++DPLFFY+PV+DD  KCLGLD+ +EITA +LRS
Sbjct  81    NKVLDPQGAFLQRWNKIFVLACIIAVSLDPLFFYVPVIDDAKKCLGLDKKMEITASVLRS  140

Query  230   VFDFFYIFHIILQFRTGFVPPSSRVFGRGDLIVDPSAIAKRYFFSYFFIDILAVLPLPQV  409
               D FY+ HII QFRTGF+ P SRVFGRG L+ D   IAKRY  S+F IDILAVLPLPQV
Sbjct  141   FTDIFYVIHIIFQFRTGFIAPPSRVFGRGVLVEDKGEIAKRYLSSHFIIDILAVLPLPQV  200

Query  410   VLFMMIPRADRPFIMVAKDILKVVILVQSVPRLLRIYPLYKEVTRTSGFFTETAWAGAAF  589
             V+ ++IPR      +  K++LK ++  Q +PR +RIYPLYKEVTRTSG  TETAWAGAAF
Sbjct  201   VILIIIPRMQGSASLNTKNLLKFIVFFQYIPRFVRIYPLYKEVTRTSGILTETAWAGAAF  260

Query  590   NLFLYMIASYVAGAIWYITAIERQDKCWRRACEKHGSCDIDFLYCTKLGRRGGDFSSSFL  769
             NLFLYM+AS+V GA WY+ +IER+  CW+RAC+++ +C++  LYC   G RGG+   +FL
Sbjct  261   NLFLYMLASHVFGAFWYLFSIERETICWKRACKRNPACNLRLLYCDH-GTRGGN---AFL  316

Query  770   NTSCALLEPENLKADDFDFGIFLDALKSNVVEKRYFWSKLFYCFWWGLRNLSSLGQNLKT  949
             N SC +  P       FDFGIFLDAL+S VVE R F  K FYCFWWGL+NLSSLGQNL+T
Sbjct  317   NESCPVQTPNTTL---FDFGIFLDALQSGVVESRDFPQKFFYCFWWGLQNLSSLGQNLQT  373

Query  950   SNFVGEilfailisiiglilfslligNMQKYLQSITVRVEEMRVKRMDAEQWMSHRMLPD  1129
             S +V EI FA+ ISI GL+LFS LIGNMQ YLQS T R+EEMRVKR DAEQWM+HR+LP+
Sbjct  374   STYVWEICFAVFISISGLVLFSFLIGNMQTYLQSTTTRLEEMRVKRRDAEQWMAHRLLPE  433

Query  1130  NLRERIRRYEQYRWQETRGVDEESLISNLPKDLRRDINRHLCWSLLKRVHMFKTMDEQLL  1309
             NLR+RIRRYEQYRWQETRGVDEE+L+ NLPKDLRRDI RHLC +LL RV MF+ MDEQLL
Sbjct  434   NLRKRIRRYEQYRWQETRGVDEENLLRNLPKDLRRDIKRHLCLALLMRVPMFEKMDEQLL  493

Query  1310  DAICDRLKPVLYTEKSCIVREGDPVDEMIFVMRGNLLTMTTNGGRTGFLNSDVLNAGDFC  1489
             DA+CDRLKPVLYTE+S IVREGDPVDEM+FVMRG LLT+TTNGGRTGF NS+ L AGDFC
Sbjct  494   DAMCDRLKPVLYTEESYIVREGDPVDEMLFVMRGKLLTITTNGGRTGFFNSEYLKAGDFC  553

Query  1490  GEELLTWALDPNSSSSLPISTRTVQALTDVEAFALTADFLKFFASQYRRLHSKQLQHKFR  1669
             GEELLTWALDP+SSS+LPISTRTV+ALT+VEAFAL AD LKF ASQ+RRLHSKQL+H FR
Sbjct  554   GEELLTWALDPHSSSNLPISTRTVRALTEVEAFALKADDLKFVASQFRRLHSKQLRHTFR  613

Query  1670  FYSHQWKTWAACFIQAAWRRHCRNKLEKSLREEEDRLQDALILRMRREEGETTPSLGATI  1849
             FYS QW+TWAACFIQAAWRR+ + K+E+SLREEE+RLQDAL     +E G  +PSLGAT+
Sbjct  614   FYSQQWRTWAACFIQAAWRRYSKKKVEESLREEENRLQDALA----KESGGNSPSLGATM  669

Query  1850  YASRFAANVLRTVRRNHplsvpklsprlpplllqkpAEPDFSA  1978
             YASRFAAN+LRT+RR+  +   ++  R+PPLLLQKPAEPDF+ 
Sbjct  670   YASRFAANILRTIRRSGTMRKARVQERMPPLLLQKPAEPDFNG  712



>ref|XP_009783793.1| PREDICTED: cyclic nucleotide-gated ion channel 1-like [Nicotiana 
sylvestris]
Length=702

 Score =   867 bits (2239),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 450/644 (70%), Positives = 526/644 (82%), Gaps = 12/644 (2%)
 Frame = +2

Query  47    KSKMHDPQGPFLQRWNRIFVIACILAATVDPLFFYIPVVDDQNKCLGLDRTLEITACILR  226
             ++K+ DPQ PFLQ WN+IFV+ACI++  +DPLFFYI VVD + KCL LD +L+I   +LR
Sbjct  71    RNKILDPQEPFLQFWNKIFVLACIVSVAIDPLFFYISVVDIKRKCLDLDHSLKIPISVLR  130

Query  227   SVFDFFYIFHIILQFRTGFVPPSSRVFGRGDLIVDPSAIAKRYFFSYFFIDILAVLPLPQ  406
             SV D FYI+HI LQFRTGF+ PSSRVFGRG+LI D S IAKRY   Y  ID+LAVLPLPQ
Sbjct  131   SVTDLFYIYHIFLQFRTGFIAPSSRVFGRGELIEDSSLIAKRYI-PYCIIDVLAVLPLPQ  189

Query  407   VVLFMMIPRADRPFIMVAKDILKVVILVQSVPRLLRIYPLYKEVTRTSGFFTETAWAGAA  586
             +VL++  P A+R   +V K  L +V+  Q VPR+ RI+PLY+EVTRT+GFFTETAWAGAA
Sbjct  190   LVLYINAPNANRAISLVMKKQLVIVVFTQYVPRIFRIFPLYREVTRTTGFFTETAWAGAA  249

Query  587   FNLFLYMIASYVAGAIWYITAIERQDKCWRRACEKHGSCDIDFLYCTKLGRRGGDFSSSF  766
             FNLFL+MIAS V GA+WY+  +ERQD CW + C+    C +D L C + G+     ++ F
Sbjct  250   FNLFLFMIASNVVGALWYLITVERQDNCWSQVCKGFEECVLDHLCCGQQGK-----NAQF  304

Query  767   LNTSCALLEPENLKADDFDFGIFLDALKSNVVEKRYFWSKLFYCFWWGLRNLSSLGQNLK  946
             LN SC LL+PE ++ +DFDFGIF DAL+S VV++R FWSKL YCFWWGLRNLSSLGQ L 
Sbjct  305   LNFSCRLLKPEEIQENDFDFGIFRDALQSRVVQRRNFWSKLSYCFWWGLRNLSSLGQGLN  364

Query  947   TSNFVGEilfailisiiglilfslligNMQKYLQSITVRVEEMRVKRMDAEQWMSHRMLP  1126
             TS+F+GEILFA+ I I+GLILFSLLIGNMQ+YLQSITVRVE MR++R DAEQWMSHRMLP
Sbjct  365   TSDFLGEILFAVFICILGLILFSLLIGNMQEYLQSITVRVEGMRLRRRDAEQWMSHRMLP  424

Query  1127  DNLRERIRRYEQYRWQETRGVDEESLISNLPKDLRRDINRHLCWSLLKRVHMFKTMDEQL  1306
             DNLRERIRRYEQY+WQ+TRGVDE+ LI NLPKDLRRD+ RHLCWSLLKRV MF+ MDEQL
Sbjct  425   DNLRERIRRYEQYKWQQTRGVDEDYLICNLPKDLRRDVKRHLCWSLLKRVPMFEKMDEQL  484

Query  1307  LDAICDRLKPVLYTEKSCIVREGDPVDEMIFVMRGNLLTMTTNGGRTGFLNSDVLNAGDF  1486
             LDA+CDRLKP L+TE S I+REGDPV+EM+F+MRG LLT+TTNGGRTGF NS  L+AGDF
Sbjct  485   LDALCDRLKPALFTENSFIIREGDPVNEMLFLMRGTLLTITTNGGRTGFFNSASLSAGDF  544

Query  1487  CGEELLTWALDPNSSSSLPISTRTVQALTDVEAFALTADFLKFFASQYRRLHSKQLQHKF  1666
             CGEELLTWALDPN+SS LP STRTVQA+ DVEAFALTAD LKF A+Q+RRLHSKQ++H F
Sbjct  545   CGEELLTWALDPNASSCLPASTRTVQAVIDVEAFALTADDLKFVAAQFRRLHSKQIRHTF  604

Query  1667  RFYSHQWKTWAACFIQAAWRRHCRNKLEKSLREEEDRLQDALILRMRREEGETTPSLGAT  1846
             RFYS  W+TWAACFIQAAWRRH RNKLEKSLREEEDRLQ AL       E    PSLGAT
Sbjct  605   RFYSQHWRTWAACFIQAAWRRHYRNKLEKSLREEEDRLQAAL-----ENETANIPSLGAT  659

Query  1847  IYASRFAANVLRTVRRNHplsvpklsprlpplllqkpAEPDFSA  1978
             IYASRFAAN LR +RRNH     K S ++ PLLLQKPAEPDFS+
Sbjct  660   IYASRFAANALRILRRNH-PKGSKSSSKVSPLLLQKPAEPDFSS  702



>gb|AAF33669.1|AF079871_1 cyclic nucleotide-gated calmodulin-binding ion channel [Nicotiana 
tabacum]
Length=702

 Score =   862 bits (2227),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 448/644 (70%), Positives = 524/644 (81%), Gaps = 12/644 (2%)
 Frame = +2

Query  47    KSKMHDPQGPFLQRWNRIFVIACILAATVDPLFFYIPVVDDQNKCLGLDRTLEITACILR  226
             ++K+ DPQ PFLQ WN+IFV+ACI++  +DPLFFYI VVD + KCL LD +L+I   +LR
Sbjct  71    RNKILDPQEPFLQFWNKIFVLACIVSVAIDPLFFYISVVDIKRKCLDLDHSLKIPISVLR  130

Query  227   SVFDFFYIFHIILQFRTGFVPPSSRVFGRGDLIVDPSAIAKRYFFSYFFIDILAVLPLPQ  406
             S  D FYI+HI  QFRTGF+ PSSRVFGRG+LI D S IAKRY   Y  ID+LAVLPLPQ
Sbjct  131   SATDLFYIYHIFGQFRTGFIAPSSRVFGRGELIEDSSLIAKRYI-PYCIIDVLAVLPLPQ  189

Query  407   VVLFMMIPRADRPFIMVAKDILKVVILVQSVPRLLRIYPLYKEVTRTSGFFTETAWAGAA  586
             +VL++  P A+R   +V K  L +V+  Q VPR+ RI+PLY+EVTRT+GFFTETAWAGAA
Sbjct  190   LVLYINAPNANRAISLVMKKQLVIVVFTQYVPRIFRIFPLYREVTRTTGFFTETAWAGAA  249

Query  587   FNLFLYMIASYVAGAIWYITAIERQDKCWRRACEKHGSCDIDFLYCTKLGRRGGDFSSSF  766
             FNLFL+MIAS V GA+WY+  +ERQD CW + C+    C +D L C + G+     ++ F
Sbjct  250   FNLFLFMIASNVVGALWYLITVERQDNCWSQVCKGFEECVLDHLCCGQQGK-----NAQF  304

Query  767   LNTSCALLEPENLKADDFDFGIFLDALKSNVVEKRYFWSKLFYCFWWGLRNLSSLGQNLK  946
             LN SC LL+PE ++ +DFDFGIF DAL+S VV++R FWSKL YCFWWGLRNLSSLGQ L 
Sbjct  305   LNFSCRLLKPEEIQENDFDFGIFRDALQSRVVQRRNFWSKLSYCFWWGLRNLSSLGQGLN  364

Query  947   TSNFVGEilfailisiiglilfslligNMQKYLQSITVRVEEMRVKRMDAEQWMSHRMLP  1126
             TS+F+GEILFA+ I I+GLILFSLLIGNMQ+YLQSITVRVE MR++R DAEQWMSHRMLP
Sbjct  365   TSDFLGEILFAVFICILGLILFSLLIGNMQEYLQSITVRVEGMRLRRRDAEQWMSHRMLP  424

Query  1127  DNLRERIRRYEQYRWQETRGVDEESLISNLPKDLRRDINRHLCWSLLKRVHMFKTMDEQL  1306
             DNLRERIRRYEQY+WQ+TRGVDE+ LI NLPKDLRRD+ RHLCWSLLKRV MF+ MDEQL
Sbjct  425   DNLRERIRRYEQYKWQQTRGVDEDYLICNLPKDLRRDVKRHLCWSLLKRVPMFEKMDEQL  484

Query  1307  LDAICDRLKPVLYTEKSCIVREGDPVDEMIFVMRGNLLTMTTNGGRTGFLNSDVLNAGDF  1486
             LDA+CDRLKP L+TE S I+REGDPV+EM+F+MRG LLT+TTNGGRTGF NS  L+AGDF
Sbjct  485   LDALCDRLKPALFTENSFIIREGDPVNEMLFLMRGTLLTITTNGGRTGFFNSASLSAGDF  544

Query  1487  CGEELLTWALDPNSSSSLPISTRTVQALTDVEAFALTADFLKFFASQYRRLHSKQLQHKF  1666
             CGEELLTWALDPN+SS LP STRTVQA+ DVEAFALTAD LKF A+Q+RRLHSKQ++H F
Sbjct  545   CGEELLTWALDPNASSCLPASTRTVQAVIDVEAFALTADDLKFVAAQFRRLHSKQIRHTF  604

Query  1667  RFYSHQWKTWAACFIQAAWRRHCRNKLEKSLREEEDRLQDALILRMRREEGETTPSLGAT  1846
             RFYS  W+TWAACFIQAAWRRH RNKLEKSLREEEDRLQ AL       E    PSLGAT
Sbjct  605   RFYSQHWRTWAACFIQAAWRRHYRNKLEKSLREEEDRLQAAL-----ENETANIPSLGAT  659

Query  1847  IYASRFAANVLRTVRRNHplsvpklsprlpplllqkpAEPDFSA  1978
             IYASRFAAN LR +RRNH     K S ++ PLLLQKPAEPDFS+
Sbjct  660   IYASRFAANALRILRRNH-PKGSKSSSKVSPLLLQKPAEPDFSS  702



>ref|XP_009600581.1| PREDICTED: cyclic nucleotide-gated ion channel 1-like [Nicotiana 
tomentosiformis]
 ref|XP_009600582.1| PREDICTED: cyclic nucleotide-gated ion channel 1-like [Nicotiana 
tomentosiformis]
Length=702

 Score =   858 bits (2216),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 445/648 (69%), Positives = 524/648 (81%), Gaps = 17/648 (3%)
 Frame = +2

Query  47    KSKMHDPQGPFLQRWNRIFVIACILAATVDPLFFYIPVVDDQNKCLGLDRTLEITACILR  226
             + KM DPQGPFLQ+WN+IFV++C++A ++DPLFFYIPV+D+ NKCL LDR +EITA +LR
Sbjct  69    EKKMLDPQGPFLQKWNKIFVLSCVIAVSLDPLFFYIPVIDNDNKCLHLDRKMEITASVLR  128

Query  227   SVFDFFYIFHIILQFRTGFVPPSSRVFGRGDLIVDPSAIAKRYFFSYFFIDILAVLPLPQ  406
             S+ D FY+ HI+LQFRTGF+ PSSRVFGRG L+ D   IAKRY  SYF IDILAVLPLPQ
Sbjct  129   SITDIFYLLHIVLQFRTGFIAPSSRVFGRGVLVEDAWEIAKRYLSSYFLIDILAVLPLPQ  188

Query  407   VVLFMMIPRADRPFIMVAKDILKVVILVQSVPRLLRIYPLYKEVTRTSGFFTETAWAGAA  586
             VV+ ++IP+      +  K++LK V+  Q +PRLLR+YPLYKEVTRTSG  TETAWAGAA
Sbjct  189   VVILVVIPKLRGARSLNTKNLLKFVVFFQYIPRLLRVYPLYKEVTRTSGILTETAWAGAA  248

Query  587   FNLFLYMIASYVAGAIWYITAIERQDKCWRRACEKHGSCDIDFLYCTKLGRRGGDFSS--  760
             FNLFLYM+AS+V GA WY+ +IER+  CW+RAC    +C    LYC        D +   
Sbjct  249   FNLFLYMLASHVLGAFWYLFSIERESTCWQRACGNSSACHHASLYC------DDDHTGFK  302

Query  761   SFLNTSCALLEPENLKADDFDFGIFLDALKSNVVEKRYFWSKLFYCFWWGLRNLSSLGQN  940
             + LN+SC +  P    A  FDFGIFLDAL+S VVE   F  K FYCFWWGL+NLSSLGQN
Sbjct  303   TLLNSSCPIETP---NATLFDFGIFLDALQSGVVESMDFPQKFFYCFWWGLQNLSSLGQN  359

Query  941   LKTSNFVGEilfailisiiglilfslligNMQKYLQSITVRVEEMRVKRMDAEQWMSHRM  1120
             L+TS +V EI FA+ ISI GL+LFS LIGNMQ YLQS T+R+EEMRVKR DAEQWMSHR+
Sbjct  360   LQTSTYVWEICFAVFISIAGLVLFSFLIGNMQTYLQSTTIRLEEMRVKRRDAEQWMSHRL  419

Query  1121  LPDNLRERIRRYEQYRWQETRGVDEESLISNLPKDLRRDINRHLCWSLLKRVHMFKTMDE  1300
             LP++LRERIRRYEQY+WQETRGVDEE+LI NLPKDLRRDI RHLC +LL RV MF+ MDE
Sbjct  420   LPEHLRERIRRYEQYKWQETRGVDEENLIHNLPKDLRRDIKRHLCLALLMRVPMFEKMDE  479

Query  1301  QLLDAICDRLKPVLYTEKSCIVREGDPVDEMIFVMRGNLLTMTTNGGRTGFLNSDVLNAG  1480
             QLLDA+CDRL+PVLYTE S IVREGDPVDEM+F+MRG LLT+TTNGGRTGF NSD L AG
Sbjct  480   QLLDALCDRLRPVLYTENSFIVREGDPVDEMLFIMRGKLLTVTTNGGRTGFFNSDYLKAG  539

Query  1481  DFCGEELLTWALDPNSSSSLPISTRTVQALTDVEAFALTADFLKFFASQYRRLHSKQLQH  1660
             DFCGEELLTWALDP+ S++LPISTRTVQAL++VEAFAL AD LKF ASQ+RRLHSKQL+H
Sbjct  540   DFCGEELLTWALDPHPSNNLPISTRTVQALSEVEAFALVADDLKFVASQFRRLHSKQLRH  599

Query  1661  KFRFYSHQWKTWAACFIQAAWRRHCRNKLEKSLREEEDRLQDALILRMRREEGETTPSLG  1840
              FRFYS QW+TWAACFIQAAWRRHCR KLE+SL EEE+RLQDAL     R  G ++PSLG
Sbjct  600   TFRFYSQQWRTWAACFIQAAWRRHCRKKLEESLHEEENRLQDALA----RGSG-SSPSLG  654

Query  1841  ATIYASRFAANVLRTVRRNHplsvpklsprlpplllqkpAEPDFSAPE  1984
             ATIYASRFAAN LR +RRN      +++ R+ P+LLQKPAEPDF+A +
Sbjct  655   ATIYASRFAANALRALRRN-TSKKARMTDRISPILLQKPAEPDFTAED  701



>ref|XP_010537104.1| PREDICTED: cyclic nucleotide-gated ion channel 1-like [Tarenaya 
hassleriana]
 ref|XP_010537105.1| PREDICTED: cyclic nucleotide-gated ion channel 1-like [Tarenaya 
hassleriana]
 ref|XP_010537106.1| PREDICTED: cyclic nucleotide-gated ion channel 1-like [Tarenaya 
hassleriana]
 ref|XP_010537107.1| PREDICTED: cyclic nucleotide-gated ion channel 1-like [Tarenaya 
hassleriana]
 ref|XP_010537108.1| PREDICTED: cyclic nucleotide-gated ion channel 1-like [Tarenaya 
hassleriana]
Length=708

 Score =   858 bits (2216),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 445/648 (69%), Positives = 526/648 (81%), Gaps = 13/648 (2%)
 Frame = +2

Query  47    KSKMHDPQGPFLQRWNRIFVIACILAATVDPLFFYIPVVDDQNKCLGLDRTLEITACILR  226
             ++K+ DPQG FLQRWN+IFV+ACI+A ++DPLFFY+PV+DD  KCLGLD+ +EITA +LR
Sbjct  72    RNKVLDPQGAFLQRWNKIFVLACIVAVSLDPLFFYVPVIDDTKKCLGLDKKMEITASVLR  131

Query  227   SVFDFFYIFHIILQFRTGFVPPSSRVFGRGDLIVDPSAIAKRYFFSYFFIDILAVLPLPQ  406
             S  D FY+ HII QFRTGF+ P SRVFGRG L+ +   IAKRY  S F +D+LAVLPLPQ
Sbjct  132   SFTDIFYVIHIIFQFRTGFIAPPSRVFGRGVLVEEAKEIAKRYLSSRFIVDVLAVLPLPQ  191

Query  407   VVLFMMIPRADRPFIMVAKDILKVVILVQSVPRLLRIYPLYKEVTRTSGFFTETAWAGAA  586
             VV+ ++IPR      +  K++LK ++  Q +PR +RIYPLYKEVTRTSG  T+TAWAGAA
Sbjct  192   VVILIIIPRMRGSASLNTKNLLKFIVFFQYIPRFVRIYPLYKEVTRTSGILTKTAWAGAA  251

Query  587   FNLFLYMIASYVAGAIWYITAIERQDKCWRRACEKHGS-CDIDFLYCTKLGRRGGDFSSS  763
             FNLFLYM+AS+V GA WY+ +IER+  CW+RAC+++   CD   LYC   G RGG+   +
Sbjct  252   FNLFLYMLASHVFGAFWYLFSIERETVCWKRACKRNPIICDPRLLYCDH-GTRGGN---T  307

Query  764   FLNTSCALLEPENLKADDFDFGIFLDALKSNVVEKRYFWSKLFYCFWWGLRNLSSLGQNL  943
             FLN SC +  P       FDFGIFLDAL S VVE R F  K FYCFWWGL+NLSSLGQNL
Sbjct  308   FLNVSCPIQTPNTTL---FDFGIFLDALNSGVVESRDFPQKFFYCFWWGLQNLSSLGQNL  364

Query  944   KTSNFVGEilfailisiiglilfslligNMQKYLQSITVRVEEMRVKRMDAEQWMSHRML  1123
             KTS ++ EI FA+ ISI GL+LFS LIGNMQ YLQS T R+EEMRVKR DAEQWMSHR+L
Sbjct  365   KTSTYIWEICFAVFISISGLVLFSFLIGNMQTYLQSTTTRLEEMRVKRRDAEQWMSHRLL  424

Query  1124  PDNLRERIRRYEQYRWQETRGVDEESLISNLPKDLRRDINRHLCWSLLKRVHMFKTMDEQ  1303
             PDNLR+RIRRYEQYRWQETRGVDEE+L+ NLPKDLRRDI RHLC  LL RV MF+ MDEQ
Sbjct  425   PDNLRKRIRRYEQYRWQETRGVDEETLLCNLPKDLRRDIKRHLCLGLLMRVPMFEKMDEQ  484

Query  1304  LLDAICDRLKPVLYTEKSCIVREGDPVDEMIFVMRGNLLTMTTNGGRTGFLNSDVLNAGD  1483
             LLDA+CDRLKP LYTE+S IVREGDPVDEM+FVMRG LLTMTTNGGRTGF NS+ L AGD
Sbjct  485   LLDAMCDRLKPRLYTEESYIVREGDPVDEMLFVMRGKLLTMTTNGGRTGFFNSEYLKAGD  544

Query  1484  FCGEELLTWALDPNSSSSLPISTRTVQALTDVEAFALTADFLKFFASQYRRLHSKQLQHK  1663
             FCGEELLTWALDP+SSS+LPISTRTV+ALT+VEAFAL AD LK  ASQ+RRLHSKQL+H 
Sbjct  545   FCGEELLTWALDPHSSSNLPISTRTVRALTEVEAFALKADDLKSVASQFRRLHSKQLRHT  604

Query  1664  FRFYSHQWKTWAACFIQAAWRRHCRNKLEKSLREEEDRLQDALILRMRREEGE-TTPSLG  1840
             FRFYS QW+TWAACFIQAAW+R+ + KLE+SLREEE+RLQDAL     +E G  T+PSLG
Sbjct  605   FRFYSQQWRTWAACFIQAAWQRYSKKKLEESLREEENRLQDALA----KEAGSGTSPSLG  660

Query  1841  ATIYASRFAANVLRTVRRNHplsvpklsprlpplllqkpAEPDFSAPE  1984
             ATIYASRFAAN+LRT+RR+  +   ++  R+PP+LLQKPAEPDF+A +
Sbjct  661   ATIYASRFAANILRTIRRSGTMRKARIPERMPPILLQKPAEPDFNAAD  708



>ref|XP_004502628.1| PREDICTED: cyclic nucleotide-gated ion channel 1-like [Cicer 
arietinum]
Length=694

 Score =   853 bits (2203),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 426/617 (69%), Positives = 502/617 (81%), Gaps = 10/617 (2%)
 Frame = +2

Query  47    KSKMHDPQGPFLQRWNRIFVIACILAATVDPLFFYIPVVDDQNKCLGLDRTLEITACILR  226
             + K+ DPQGPFLQ+WN+IFV++C++A ++DPLFFYIPV+DD+ KCL  DR +E TA +LR
Sbjct  59    RKKILDPQGPFLQKWNKIFVLSCLIAVSIDPLFFYIPVIDDEKKCLARDRKMETTATVLR  118

Query  227   SVFDFFYIFHIILQFRTGFVPPSSRVFGRGDLIVDPSAIAKRYFFSYFFIDILAVLPLPQ  406
             S  D FYI HII QFRTGF+ PSSRVFGRG L+ D  AIAKRY  SYF IDILAVLPLPQ
Sbjct  119   SFSDIFYIIHIIFQFRTGFIAPSSRVFGRGVLVEDAWAIAKRYMSSYFLIDILAVLPLPQ  178

Query  407   VVLFMMIPRADRPFIMVAKDILKVVILVQSVPRLLRIYPLYKEVTRTSGFFTETAWAGAA  586
             VV+  +IP+      +  K++LK ++  Q +PR +RI PLYKEVTRTSG  TETAWAGAA
Sbjct  179   VVILFIIPKMRGSESLNTKNLLKFIVFFQYMPRFIRIVPLYKEVTRTSGILTETAWAGAA  238

Query  587   FNLFLYMIASYVAGAIWYITAIERQDKCWRRACEKHGSCDIDFLYCTKLGRRGGDFSSSF  766
             FNLFLYM+AS+V GA WY+ +IER+  CW+ AC K+ +C+   +YC      G    S+F
Sbjct  239   FNLFLYMLASHVIGAFWYLFSIERETTCWQHACRKNITCNKVEMYCDD--HHGLGTISTF  296

Query  767   LNTSCALLEPENLKADDFDFGIFLDALKSNVVEKRYFWSKLFYCFWWGLRNLSSLGQNLK  946
             LN SC +  P N     F+FGIFLDAL+S VVE   F  K FYCFWWGL+NLSSLGQNL 
Sbjct  297   LNASCPVQNPNNTL---FNFGIFLDALQSGVVESTDFPQKFFYCFWWGLKNLSSLGQNLA  353

Query  947   TSNFVGEilfailisiiglilfslligNMQKYLQSITVRVEEMRVKRMDAEQWMSHRMLP  1126
             TS FV EI FAI ISI GL+LF+ LIGNMQ YLQS T R+EEMRVKR DAEQWMSHR+LP
Sbjct  354   TSTFVWEICFAIFISIAGLVLFAFLIGNMQTYLQSTTTRLEEMRVKRRDAEQWMSHRLLP  413

Query  1127  DNLRERIRRYEQYRWQETRGVDEESLISNLPKDLRRDINRHLCWSLLKRVHMFKTMDEQL  1306
             D+LRERIRR+EQY+WQETRGVDE++LI NLPKDLRRDI RHLC +LL RV +F+ MDEQL
Sbjct  414   DSLRERIRRHEQYKWQETRGVDEDNLIHNLPKDLRRDIKRHLCLALLMRVPIFEKMDEQL  473

Query  1307  LDAICDRLKPVLYTEKSCIVREGDPVDEMIFVMRGNLLTMTTNGGRTGFLNSDVLNAGDF  1486
             LDA+CDRLK VLYT++SCIVREGDPVDEM+F+MRG LLT+TTNGGRTGF NS+ L AGDF
Sbjct  474   LDAVCDRLKTVLYTKQSCIVREGDPVDEMLFIMRGKLLTVTTNGGRTGFFNSEYLKAGDF  533

Query  1487  CGEELLTWALDPNSSSSLPISTRTVQALTDVEAFALTADFLKFFASQYRRLHSKQLQHKF  1666
             CGEELLTWALDP+SSS+LPISTRTVQ L++VEAFAL A+ LKF ASQ+RRLHSKQL+H F
Sbjct  534   CGEELLTWALDPHSSSNLPISTRTVQTLSEVEAFALKAEDLKFVASQFRRLHSKQLRHTF  593

Query  1667  RFYSHQWKTWAACFIQAAWRRHCRNKLEKSLREEEDRLQDALILRMRREEGETTPSLGAT  1846
             RFYS QW+TWAACFIQAAWRR+C+ KLE+SLREEE+RLQDAL      +EG ++PSLGAT
Sbjct  594   RFYSQQWRTWAACFIQAAWRRYCKKKLEESLREEENRLQDALA-----KEGGSSPSLGAT  648

Query  1847  IYASRFAANVLRTVRRN  1897
             IYASRFAANVLR +RRN
Sbjct  649   IYASRFAANVLRALRRN  665



>ref|XP_003526699.1| PREDICTED: cyclic nucleotide-gated ion channel 1-like isoform 
X1 [Glycine max]
 ref|XP_006581633.1| PREDICTED: cyclic nucleotide-gated ion channel 1-like isoform 
X2 [Glycine max]
Length=715

 Score =   853 bits (2204),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 437/647 (68%), Positives = 517/647 (80%), Gaps = 11/647 (2%)
 Frame = +2

Query  47    KSKMHDPQGPFLQRWNRIFVIACILAATVDPLFFYIPVVDDQNKCLGLDRTLEITACILR  226
             K K+ DPQGPFLQ+WN+IFV++C++A ++DPLFFY+PV+DD  KCL +DR +EITA +LR
Sbjct  80    KKKILDPQGPFLQKWNKIFVLSCLIAVSLDPLFFYVPVIDDNKKCLSMDRKMEITATVLR  139

Query  227   SVFDFFYIFHIILQFRTGFVPPSSRVFGRGDLIVDPSAIAKRYFFSYFFIDILAVLPLPQ  406
             S  D FYI HII QFRTGF+ PSSRVFGRG L+ D  AIA RY  SYF IDILAVLPLPQ
Sbjct  140   SFSDIFYIIHIIFQFRTGFIAPSSRVFGRGVLVEDAWAIAMRYLSSYFLIDILAVLPLPQ  199

Query  407   VVLFMMIPRADRPFIMVAKDILKVVILVQSVPRLLRIYPLYKEVTRTSGFFTETAWAGAA  586
             V + ++IP+      +  K +LK ++  Q +PR LRI PLYKEVTRTSG  TETAWAGAA
Sbjct  200   VAILIIIPKLSGSESLNTKTLLKFIVCFQYIPRFLRIIPLYKEVTRTSGILTETAWAGAA  259

Query  587   FNLFLYMIASYVAGAIWYITAIERQDKCWRRACEKHGSCDIDFLYCTKLGRRGGDFSSSF  766
             FNLFLYM+AS+V GA WY+ +IER+  CW+ AC ++ +C+   +YC      G    S+F
Sbjct  260   FNLFLYMLASHVIGAFWYLFSIERETTCWQDACRRNSTCNTTAMYCDNHQVLGT--MSAF  317

Query  767   LNTSCALLEPENLKADDFDFGIFLDALKSNVVEKRYFWSKLFYCFWWGLRNLSSLGQNLK  946
             LN SC +   ++     F+FGIFLDAL+S VVE R F  K FYCFWWGLRNLSSLGQNL 
Sbjct  318   LNASCPI---QDQNTTLFNFGIFLDALQSGVVESRDFPQKFFYCFWWGLRNLSSLGQNLA  374

Query  947   TSNFVGEilfailisiiglilfslligNMQKYLQSITVRVEEMRVKRMDAEQWMSHRMLP  1126
             TS +V EI FAI ISI GL+LF+ LIGNMQ YLQS T R+EEMRVKR DAEQWMSHR+LP
Sbjct  375   TSTYVWEISFAIFISIAGLVLFAFLIGNMQTYLQSTTTRLEEMRVKRRDAEQWMSHRLLP  434

Query  1127  DNLRERIRRYEQYRWQETRGVDEESLISNLPKDLRRDINRHLCWSLLKRVHMFKTMDEQL  1306
             D+LRERIRR+EQY+WQETRGVDE+SLI +LPKDLRRDI RHLC +LL RV MF+ MDEQL
Sbjct  435   DSLRERIRRHEQYKWQETRGVDEDSLIRDLPKDLRRDIKRHLCLALLMRVPMFENMDEQL  494

Query  1307  LDAICDRLKPVLYTEKSCIVREGDPVDEMIFVMRGNLLTMTTNGGRTGFLNSDVLNAGDF  1486
             LDA+CDRLKPVLYTE+SCI REGDPVDEM+F+MRG LLT+TTNGGRTGF NS+ L AGDF
Sbjct  495   LDAMCDRLKPVLYTEESCIAREGDPVDEMLFIMRGKLLTVTTNGGRTGFFNSEYLKAGDF  554

Query  1487  CGEELLTWALDPNSSSSLPISTRTVQALTDVEAFALTADFLKFFASQYRRLHSKQLQHKF  1666
             CGEELLTWALDP SSS+LPISTRTVQ L++VEAFAL AD LKF ASQ+RRLHSKQL+H F
Sbjct  555   CGEELLTWALDPQSSSNLPISTRTVQTLSEVEAFALKADDLKFVASQFRRLHSKQLRHTF  614

Query  1667  RFYSHQWKTWAACFIQAAWRRHCRNKLEKSLREEEDRLQDALILRMRREEGETTPSLGAT  1846
             RFYS QW+TWAACFIQAAWRR+ + KLE+SLREEE+RLQDAL      + G ++PSLGAT
Sbjct  615   RFYSQQWRTWAACFIQAAWRRYSKKKLEESLREEENRLQDALA-----KAGGSSPSLGAT  669

Query  1847  IYASRFAANVLRTVRRNHplsvpklsprlpplllqkpAEPDFSAPEN  1987
             IYASRFAAN LR +RRN      ++  R+ P+LLQKPAEPDF++ E 
Sbjct  670   IYASRFAANALRLLRRNG-TRKTRVPERISPMLLQKPAEPDFTSEEQ  715



>ref|XP_008234765.1| PREDICTED: cyclic nucleotide-gated ion channel 1-like [Prunus 
mume]
Length=711

 Score =   853 bits (2203),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 446/650 (69%), Positives = 526/650 (81%), Gaps = 18/650 (3%)
 Frame = +2

Query  50    SKMHDPQGPFLQRWNRIFVIACILAATVDPLFFYIPVVDDQNKCLGLDRTLEITACILRS  229
             S++ DPQGPFLQ+WN+IFV+AC++A ++DPLFFYIPV+DD+NKCLGLD+ ++ITA +LRS
Sbjct  76    SRILDPQGPFLQKWNKIFVLACLIAVSLDPLFFYIPVIDDKNKCLGLDKKMKITASVLRS  135

Query  230   VFDFFYIFHIILQFRTGFVPPSSRVFGRGDLIVDPSAIAKRYFFSYFFIDILAVLPLPQV  409
               D FYI HII QFRTGFV PSSRVFGRG L+ D  +IA+RY  SYF IDILAVLPLPQV
Sbjct  136   FTDIFYIVHIIFQFRTGFVAPSSRVFGRGVLVEDAWSIARRYLSSYFLIDILAVLPLPQV  195

Query  410   VLFMMIPRADRPFIMVAKDILKVVILVQSVPRLLRIYPLYKEVTRTSGFFTETAWAGAAF  589
             V+ + IP+      +  K++LK ++L Q VPR++RIYPLY+EVTR SG  TETAWAGAAF
Sbjct  196   VI-IFIPKLGGSEYLNTKNLLKFIVLFQYVPRVIRIYPLYREVTRASGILTETAWAGAAF  254

Query  590   NLFLYMIASYVAGAIWYITAIERQDKCWRRACEKHGS-CDIDFLYCTKLGRRGGDFSSS-  763
             NLFLYM+AS+V GA WY+ +IER+  CW+ AC  + + C  + LYC        DF+ + 
Sbjct  255   NLFLYMLASHVLGAFWYLVSIERETTCWKAACGNNTTICSREDLYCDT----AKDFNKTT  310

Query  764   -FLNTSCALLEPENLKADDFDFGIFLDALKSNVVEKR-YFWSKLFYCFWWGLRNLSSLGQ  937
               LN+SC + E +      FDFGIFLDAL+S +VE   +F  K FYCFWWGLRNLSSLGQ
Sbjct  311   FLLNSSCPIQEEDK---SQFDFGIFLDALQSGIVESSTHFPQKFFYCFWWGLRNLSSLGQ  367

Query  938   NLKTSNFVGEilfailisiiglilfslligNMQKYLQSITVRVEEMRVKRMDAEQWMSHR  1117
             NL TS +V EI FA+ ISI GL+LFS LIGNMQ YLQS T R+EEMRVKR DAEQWMSHR
Sbjct  368   NLGTSTYVWEICFAVFISIAGLVLFSFLIGNMQTYLQSTTTRLEEMRVKRRDAEQWMSHR  427

Query  1118  MLPDNLRERIRRYEQYRWQETRGVDEESLISNLPKDLRRDINRHLCWSLLKRVHMFKTMD  1297
             +LP+NLRERIRRYEQY+WQETRGVDEE+LI NLPKDLRRDI RHLC +LL RV MF+ MD
Sbjct  428   LLPENLRERIRRYEQYKWQETRGVDEENLICNLPKDLRRDIKRHLCLALLMRVPMFEKMD  487

Query  1298  EQLLDAICDRLKPVLYTEKSCIVREGDPVDEMIFVMRGNLLTMTTNGGRTGFLNSDVLNA  1477
             EQLLDA+CDRLKPVLYTE+S IVREGDPVDEM+F+MRG LLTMTTNGGRTGF NS+ L A
Sbjct  488   EQLLDAMCDRLKPVLYTEESYIVREGDPVDEMLFIMRGRLLTMTTNGGRTGFFNSEYLKA  547

Query  1478  GDFCGEELLTWALDPNSSSSLPISTRTVQALTDVEAFALTADFLKFFASQYRRLHSKQLQ  1657
             GDFCGEELLTWALDP+SSS+LPISTRTVQAL++VEAFAL AD LKF ASQ+RRLHSKQL+
Sbjct  548   GDFCGEELLTWALDPHSSSNLPISTRTVQALSEVEAFALKADDLKFVASQFRRLHSKQLR  607

Query  1658  HKFRFYSHQWKTWAACFIQAAWRRHCRNKLEKSLREEEDRLQDALILRMRREEGETTPSL  1837
             H FR YS QW+TWAACFIQAAWRRHC+ KLE SL EEE+RLQDAL      + G ++PSL
Sbjct  608   HTFRLYSQQWRTWAACFIQAAWRRHCKKKLETSLLEEENRLQDALA-----KAGASSPSL  662

Query  1838  GATIYASRFAANVLRTVRRNHplsvpklsprlpplllqkpAEPDFSAPEN  1987
             GATIYASRFAAN+LRT+RR+      ++  RLP +LLQKPAEPDF+A E 
Sbjct  663   GATIYASRFAANILRTIRRSG-TRKARVPERLPAMLLQKPAEPDFTAEEQ  711



>ref|XP_009352037.1| PREDICTED: cyclic nucleotide-gated ion channel 1-like isoform 
X2 [Pyrus x bretschneideri]
Length=684

 Score =   851 bits (2199),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 445/649 (69%), Positives = 525/649 (81%), Gaps = 14/649 (2%)
 Frame = +2

Query  50    SKMHDPQGPFLQRWNRIFVIACILAATVDPLFFYIPVVDDQNKCLGLDRTLEITACILRS  229
             S + DPQGPFLQ+WN+IFV+ACI+A ++DPLFFYIPV+DD+ KCLGLDR +EITA +LRS
Sbjct  47    SGILDPQGPFLQKWNKIFVLACIIAVSLDPLFFYIPVIDDKKKCLGLDRKMEITASVLRS  106

Query  230   VFDFFYIFHIILQFRTGFVPPSSRVFGRGDLIVDPSAIAKRYFFSYFFIDILAVLPLPQV  409
               D FYI HII QFRTGF+ PSSRVFGRG L+ D  AIA+RY  SYF IDILAVLPLPQV
Sbjct  107   FTDIFYIVHIIFQFRTGFIAPSSRVFGRGVLVEDAWAIARRYLSSYFLIDILAVLPLPQV  166

Query  410   VLFMMIPRADRPFIMVAKDILKVVILVQSVPRLLRIYPLYKEVTRTSGFFTETAWAGAAF  589
             V+ + IP+      +  K++LK V+L Q  PR +RIYPLY+EVTR SG  TETAWAGAAF
Sbjct  167   VILIFIPKLGGSKTLNTKNLLKFVVLFQYFPRFIRIYPLYREVTRASGILTETAWAGAAF  226

Query  590   NLFLYMIASYVAGAIWYITAIERQDKCWRRACEKHGS-CDIDFLYCTKLGRRGGDFSS-S  763
             NLFLYM+AS+V GA WY+ +IER+ KCW+ AC  + + C +  L+C  +      FS  +
Sbjct  227   NLFLYMLASHVLGAFWYLFSIERETKCWKAACGNNTTICSLKDLHCDTVSFNA--FSKIT  284

Query  764   FLNTSCALLEPENLKADDFDFGIFLDALKSNVVEKRY-FWSKLFYCFWWGLRNLSSLGQN  940
             FLN+SC + + +  +   FDFGIFLDAL+S +VE    F  K FYCFWWGLRNLSSLGQN
Sbjct  285   FLNSSCPIQDEDKTQ---FDFGIFLDALQSGIVESSTDFPQKFFYCFWWGLRNLSSLGQN  341

Query  941   LKTSNFVGEilfailisiiglilfslligNMQKYLQSITVRVEEMRVKRMDAEQWMSHRM  1120
             L TS +V EI FA+ ISI GL+LFS LIGNMQ YLQS T R+EEMRVKR DAEQWMSHR+
Sbjct  342   LATSTYVWEICFAVFISIAGLVLFSFLIGNMQTYLQSTTTRLEEMRVKRRDAEQWMSHRL  401

Query  1121  LPDNLRERIRRYEQYRWQETRGVDEESLISNLPKDLRRDINRHLCWSLLKRVHMFKTMDE  1300
             LP+NLRERIRRYEQY+WQETRGVDEE+LI NLPKDLRRDI RHLC +LL RV MF+ MDE
Sbjct  402   LPENLRERIRRYEQYKWQETRGVDEENLICNLPKDLRRDIKRHLCLALLMRVPMFEKMDE  461

Query  1301  QLLDAICDRLKPVLYTEKSCIVREGDPVDEMIFVMRGNLLTMTTNGGRTGFLNSDVLNAG  1480
             QLLDA+CDRLKPVLYTE+S IVREGDPVDEM+F+MRG LLTMTTNGGRTGF NS+ L AG
Sbjct  462   QLLDAMCDRLKPVLYTEESYIVREGDPVDEMLFIMRGRLLTMTTNGGRTGFFNSEYLKAG  521

Query  1481  DFCGEELLTWALDPNSSSSLPISTRTVQALTDVEAFALTADFLKFFASQYRRLHSKQLQH  1660
             DFCGEELLTWALDP++S++LPISTRTVQAL++VEAFAL AD LKF ASQ+RRLHSKQL+H
Sbjct  522   DFCGEELLTWALDPHTSANLPISTRTVQALSEVEAFALKADDLKFVASQFRRLHSKQLRH  581

Query  1661  KFRFYSHQWKTWAACFIQAAWRRHCRNKLEKSLREEEDRLQDALILRMRREEGETTPSLG  1840
              FRFYS QW+TWAA FIQAAWRRH + KLE+SL+EEE+RLQDAL      + G ++PSLG
Sbjct  582   TFRFYSQQWRTWAATFIQAAWRRHMKKKLEESLQEEENRLQDALA-----KAGGSSPSLG  636

Query  1841  ATIYASRFAANVLRTVRRNHplsvpklsprlpplllqkpAEPDFSAPEN  1987
             ATIYASRFAAN+LRT+RR+      ++  RLP +LLQKPAEPDF+A E 
Sbjct  637   ATIYASRFAANILRTIRRSG-TRKARVPERLPAMLLQKPAEPDFTAEEQ  684



>ref|XP_007220229.1| hypothetical protein PRUPE_ppa002135mg [Prunus persica]
 gb|EMJ21428.1| hypothetical protein PRUPE_ppa002135mg [Prunus persica]
Length=711

 Score =   852 bits (2200),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 448/651 (69%), Positives = 525/651 (81%), Gaps = 20/651 (3%)
 Frame = +2

Query  50    SKMHDPQGPFLQRWNRIFVIACILAATVDPLFFYIPVVDDQNKCLGLDRTLEITACILRS  229
             S++ DPQGPFLQ+WN+IFV+AC++A ++DPLFFYIPV+DD+NKCL LDR ++ITA +LRS
Sbjct  76    SRILDPQGPFLQKWNKIFVLACLIAVSLDPLFFYIPVIDDKNKCLDLDRKMKITASVLRS  135

Query  230   VFDFFYIFHIILQFRTGFVPPSSRVFGRGDLIVDPSAIAKRYFFSYFFIDILAVLPLPQV  409
               D FYI HII QFRTGFV PSSRVFGRG L+ D  +IA+RY  SYF IDILAVLPLPQV
Sbjct  136   FTDIFYIVHIIFQFRTGFVAPSSRVFGRGVLVEDAWSIARRYLSSYFLIDILAVLPLPQV  195

Query  410   VLFMMIPRADRPFIMVAKDILKVVILVQSVPRLLRIYPLYKEVTRTSGFFTETAWAGAAF  589
             V+ + IP+      +  K++LK ++L Q VPR++RIYPLY+EVTR SG  TETAWAGAAF
Sbjct  196   VI-IFIPKLGGSKSLNTKNLLKFIVLFQYVPRVIRIYPLYREVTRASGILTETAWAGAAF  254

Query  590   NLFLYMIASYVAGAIWYITAIERQDKCWRRACEKHGS-CDIDFLYCTK---LGRRGGDFS  757
             NLFLYM+AS+V GA WY+ +IER+  CW+ AC  + + C  D LYC     L R     +
Sbjct  255   NLFLYMLASHVLGAFWYLVSIERETTCWKAACRNNTTICSRDDLYCDTANVLNR-----T  309

Query  758   SSFLNTSCALLEPENLKADDFDFGIFLDALKSNVVEKR-YFWSKLFYCFWWGLRNLSSLG  934
               FLN+SC + E +      FDFGIFLDAL+S +VE   +F  K FYCFWWGLRNLSSLG
Sbjct  310   KFFLNSSCPIQEEDK---SQFDFGIFLDALQSGIVESSTHFPQKFFYCFWWGLRNLSSLG  366

Query  935   QNLKTSNFVGEilfailisiiglilfslligNMQKYLQSITVRVEEMRVKRMDAEQWMSH  1114
             QNL TS +V EI FA+ ISI GL+LFS LIGNMQ YLQS T R+EEMRVKR DAEQWMSH
Sbjct  367   QNLGTSTYVWEICFAVFISIAGLVLFSFLIGNMQTYLQSTTTRLEEMRVKRRDAEQWMSH  426

Query  1115  RMLPDNLRERIRRYEQYRWQETRGVDEESLISNLPKDLRRDINRHLCWSLLKRVHMFKTM  1294
             R+LP+NLRERIRRYEQY+WQETRGVDEE+LI NLPKDLRRDI RHLC +LL RV MF+ M
Sbjct  427   RLLPENLRERIRRYEQYKWQETRGVDEENLICNLPKDLRRDIKRHLCLALLMRVPMFEKM  486

Query  1295  DEQLLDAICDRLKPVLYTEKSCIVREGDPVDEMIFVMRGNLLTMTTNGGRTGFLNSDVLN  1474
             DEQLLDA+CDRLKPVLYTE+S IVREGDPVDEM+F+MRG LLTMTTNGGRTGF NS+ L 
Sbjct  487   DEQLLDAMCDRLKPVLYTEESYIVREGDPVDEMLFIMRGRLLTMTTNGGRTGFFNSEYLK  546

Query  1475  AGDFCGEELLTWALDPNSSSSLPISTRTVQALTDVEAFALTADFLKFFASQYRRLHSKQL  1654
             AGDFCGEELLTWALDP+SSS+LPISTRTVQAL++VEAFAL AD LKF ASQ+RRLHSKQL
Sbjct  547   AGDFCGEELLTWALDPHSSSNLPISTRTVQALSEVEAFALKADDLKFVASQFRRLHSKQL  606

Query  1655  QHKFRFYSHQWKTWAACFIQAAWRRHCRNKLEKSLREEEDRLQDALILRMRREEGETTPS  1834
             +H FR YS QW+TWAACFIQAAWRRHC+ KLE SL EEE+RLQDAL      + G ++PS
Sbjct  607   RHTFRLYSQQWRTWAACFIQAAWRRHCKKKLETSLLEEENRLQDALA-----KAGASSPS  661

Query  1835  LGATIYASRFAANVLRTVRRNHplsvpklsprlpplllqkpAEPDFSAPEN  1987
             LGATIYASRFAAN+LRT+RR+      ++  RLP +LLQKPAEPDF+A E 
Sbjct  662   LGATIYASRFAANILRTIRRSG-TRKARVPERLPAMLLQKPAEPDFTAEEQ  711



>ref|XP_011076015.1| PREDICTED: cyclic nucleotide-gated ion channel 1 [Sesamum indicum]
 ref|XP_011076016.1| PREDICTED: cyclic nucleotide-gated ion channel 1 [Sesamum indicum]
Length=711

 Score =   851 bits (2198),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 438/649 (67%), Positives = 519/649 (80%), Gaps = 17/649 (3%)
 Frame = +2

Query  47    KSKMHDPQGPFLQRWNRIFVIACILAATVDPLFFYIPVVDDQNKCLGLDRTLEITACILR  226
             + K+ DPQGPFLQ+WN+IFV++C++A ++DPLFFYIP+++D  KCL LDR LE+ ACILR
Sbjct  78    RKKILDPQGPFLQKWNKIFVLSCVIAVSLDPLFFYIPIINDNKKCLDLDRKLELAACILR  137

Query  227   SVFDFFYIFHIILQFRTGFVPPSSRVFGRGDLIVDPSAIAKRYFFSYFFIDILAVLPLPQ  406
             S  D FY+ HII QFRTGF+ PSSRVFGRG L+ D   IAKRY  SYF IDILAVLPLPQ
Sbjct  138   SFTDIFYLIHIIFQFRTGFIAPSSRVFGRGVLVQDSWEIAKRYLSSYFIIDILAVLPLPQ  197

Query  407   VVLFMMIPRADRPFIMVAKDILKVVILVQSVPRLLRIYPLYKEVTRTSGFFTETAWAGAA  586
             +V+ ++IP       +  K++LK V+ +Q +PR+LR+YPLY EVTRTSG  TETAWAGAA
Sbjct  198   IVILIVIPNLKGSRSLNTKNLLKFVVFLQYIPRVLRVYPLYGEVTRTSGILTETAWAGAA  257

Query  587   FNLFLYMIASYVAGAIWYITAIERQDKCWRRACEKHGSCDIDFLYCTKLGRRGGDFSS--  760
             FNLFLYM+AS+V GA WY+ +IER+  CW RAC    +C     YC        D +   
Sbjct  258   FNLFLYMLASHVLGAFWYLFSIERETTCWERACGDRSACKDASFYCE------ADHTGFI  311

Query  761   SFLNTSCALLEPENLKADDFDFGIFLDALKSNVVEKRYFWSKLFYCFWWGLRNLSSLGQN  940
              FLN SC +   +      FDFGIFL+AL+S +VE + F  K FYCFWWGL+NLSSLGQN
Sbjct  312   QFLNESCPV---QTANTTLFDFGIFLEALQSGIVESKDFPQKFFYCFWWGLQNLSSLGQN  368

Query  941   LKTSNFVGEilfailisiiglilfslligNMQKYLQSITVRVEEMRVKRMDAEQWMSHRM  1120
             L+TS +V EI FA+ ISI GL+LFS LIGNMQ YLQS T+R+EEMRVKR DAEQWMSHR+
Sbjct  369   LQTSTYVWEICFAVFISISGLVLFSFLIGNMQTYLQSTTLRLEEMRVKRRDAEQWMSHRL  428

Query  1121  LPDNLRERIRRYEQYRWQETRGVDEESLISNLPKDLRRDINRHLCWSLLKRVHMFKTMDE  1300
             LPD+LRERIRRYEQY+WQETRGVDEE+LI NLP+DLRRDI RHLC +LLKRV MF+ MD+
Sbjct  429   LPDSLRERIRRYEQYKWQETRGVDEENLIHNLPRDLRRDIKRHLCLALLKRVPMFEKMDD  488

Query  1301  QLLDAICDRLKPVLYTEKSCIVREGDPVDEMIFVMRGNLLTMTTNGGRTGFLNSDVLNAG  1480
             QLLDA+CDRLKPVLYTE S IVREGDPVDEM+F+MRG LLT+TTNGGRTGF NSD L AG
Sbjct  489   QLLDAMCDRLKPVLYTEDSYIVREGDPVDEMLFIMRGKLLTVTTNGGRTGFFNSDYLKAG  548

Query  1481  DFCGEELLTWALDPNSSSSLPISTRTVQALTDVEAFALTADFLKFFASQYRRLHSKQLQH  1660
             DFCGEELLTWALDP+SSS+LPISTRTVQAL++VEAFAL AD LKF ASQ+RRLHSKQL+H
Sbjct  549   DFCGEELLTWALDPHSSSNLPISTRTVQALSEVEAFALMADDLKFVASQFRRLHSKQLRH  608

Query  1661  KFRFYSHQWKTWAACFIQAAWRRHCRNKLEKSLREEEDRLQDALILRMRREEGETTPSLG  1840
              FRFYS QW+TWAACFIQAAWRR+CR KLE+SLREEE+RLQDAL      + G ++PSLG
Sbjct  609   TFRFYSQQWRTWAACFIQAAWRRYCRKKLEESLREEENRLQDALA-----KGGSSSPSLG  663

Query  1841  ATIYASRFAANVLRTVRRNHplsvpklsprlpplllqkpAEPDFSAPEN  1987
             ATIYASRFAAN LR +RRN      ++  R+ P+LLQKPAEPDF+A + 
Sbjct  664   ATIYASRFAANALRALRRNG-TRKTRMPERISPMLLQKPAEPDFTAEDK  711



>ref|XP_009352036.1| PREDICTED: cyclic nucleotide-gated ion channel 1-like isoform 
X1 [Pyrus x bretschneideri]
Length=713

 Score =   850 bits (2197),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 445/649 (69%), Positives = 525/649 (81%), Gaps = 14/649 (2%)
 Frame = +2

Query  50    SKMHDPQGPFLQRWNRIFVIACILAATVDPLFFYIPVVDDQNKCLGLDRTLEITACILRS  229
             S + DPQGPFLQ+WN+IFV+ACI+A ++DPLFFYIPV+DD+ KCLGLDR +EITA +LRS
Sbjct  76    SGILDPQGPFLQKWNKIFVLACIIAVSLDPLFFYIPVIDDKKKCLGLDRKMEITASVLRS  135

Query  230   VFDFFYIFHIILQFRTGFVPPSSRVFGRGDLIVDPSAIAKRYFFSYFFIDILAVLPLPQV  409
               D FYI HII QFRTGF+ PSSRVFGRG L+ D  AIA+RY  SYF IDILAVLPLPQV
Sbjct  136   FTDIFYIVHIIFQFRTGFIAPSSRVFGRGVLVEDAWAIARRYLSSYFLIDILAVLPLPQV  195

Query  410   VLFMMIPRADRPFIMVAKDILKVVILVQSVPRLLRIYPLYKEVTRTSGFFTETAWAGAAF  589
             V+ + IP+      +  K++LK V+L Q  PR +RIYPLY+EVTR SG  TETAWAGAAF
Sbjct  196   VILIFIPKLGGSKTLNTKNLLKFVVLFQYFPRFIRIYPLYREVTRASGILTETAWAGAAF  255

Query  590   NLFLYMIASYVAGAIWYITAIERQDKCWRRACEKHGS-CDIDFLYCTKLGRRGGDFSS-S  763
             NLFLYM+AS+V GA WY+ +IER+ KCW+ AC  + + C +  L+C  +      FS  +
Sbjct  256   NLFLYMLASHVLGAFWYLFSIERETKCWKAACGNNTTICSLKDLHCDTVSFNA--FSKIT  313

Query  764   FLNTSCALLEPENLKADDFDFGIFLDALKSNVVEKRY-FWSKLFYCFWWGLRNLSSLGQN  940
             FLN+SC + + +  +   FDFGIFLDAL+S +VE    F  K FYCFWWGLRNLSSLGQN
Sbjct  314   FLNSSCPIQDEDKTQ---FDFGIFLDALQSGIVESSTDFPQKFFYCFWWGLRNLSSLGQN  370

Query  941   LKTSNFVGEilfailisiiglilfslligNMQKYLQSITVRVEEMRVKRMDAEQWMSHRM  1120
             L TS +V EI FA+ ISI GL+LFS LIGNMQ YLQS T R+EEMRVKR DAEQWMSHR+
Sbjct  371   LATSTYVWEICFAVFISIAGLVLFSFLIGNMQTYLQSTTTRLEEMRVKRRDAEQWMSHRL  430

Query  1121  LPDNLRERIRRYEQYRWQETRGVDEESLISNLPKDLRRDINRHLCWSLLKRVHMFKTMDE  1300
             LP+NLRERIRRYEQY+WQETRGVDEE+LI NLPKDLRRDI RHLC +LL RV MF+ MDE
Sbjct  431   LPENLRERIRRYEQYKWQETRGVDEENLICNLPKDLRRDIKRHLCLALLMRVPMFEKMDE  490

Query  1301  QLLDAICDRLKPVLYTEKSCIVREGDPVDEMIFVMRGNLLTMTTNGGRTGFLNSDVLNAG  1480
             QLLDA+CDRLKPVLYTE+S IVREGDPVDEM+F+MRG LLTMTTNGGRTGF NS+ L AG
Sbjct  491   QLLDAMCDRLKPVLYTEESYIVREGDPVDEMLFIMRGRLLTMTTNGGRTGFFNSEYLKAG  550

Query  1481  DFCGEELLTWALDPNSSSSLPISTRTVQALTDVEAFALTADFLKFFASQYRRLHSKQLQH  1660
             DFCGEELLTWALDP++S++LPISTRTVQAL++VEAFAL AD LKF ASQ+RRLHSKQL+H
Sbjct  551   DFCGEELLTWALDPHTSANLPISTRTVQALSEVEAFALKADDLKFVASQFRRLHSKQLRH  610

Query  1661  KFRFYSHQWKTWAACFIQAAWRRHCRNKLEKSLREEEDRLQDALILRMRREEGETTPSLG  1840
              FRFYS QW+TWAA FIQAAWRRH + KLE+SL+EEE+RLQDAL      + G ++PSLG
Sbjct  611   TFRFYSQQWRTWAATFIQAAWRRHMKKKLEESLQEEENRLQDALA-----KAGGSSPSLG  665

Query  1841  ATIYASRFAANVLRTVRRNHplsvpklsprlpplllqkpAEPDFSAPEN  1987
             ATIYASRFAAN+LRT+RR+      ++  RLP +LLQKPAEPDF+A E 
Sbjct  666   ATIYASRFAANILRTIRRSG-TRKARVPERLPAMLLQKPAEPDFTAEEQ  713



>ref|XP_006350570.1| PREDICTED: cyclic nucleotide-gated ion channel 1-like [Solanum 
tuberosum]
Length=708

 Score =   849 bits (2194),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 441/646 (68%), Positives = 519/646 (80%), Gaps = 13/646 (2%)
 Frame = +2

Query  47    KSKMHDPQGPFLQRWNRIFVIACILAATVDPLFFYIPVVDDQNKCLGLDRTLEITACILR  226
             ++KM DPQGPFLQ+WN+IFV++C++A ++DPLFFYIPV+D+ NKCL LDR +E+TA +LR
Sbjct  75    ENKMLDPQGPFLQKWNKIFVLSCVIAISLDPLFFYIPVIDNNNKCLHLDRKMEVTASVLR  134

Query  227   SVFDFFYIFHIILQFRTGFVPPSSRVFGRGDLIVDPSAIAKRYFFSYFFIDILAVLPLPQ  406
             S+ D FY+FHI+LQFRTGF+ PSSRVFGRG L+ D   IAKRY  SYF IDILAVLPLPQ
Sbjct  135   SITDIFYLFHIVLQFRTGFIAPSSRVFGRGVLVEDAWEIAKRYLSSYFLIDILAVLPLPQ  194

Query  407   VVLFMMIPRADRPFIMVAKDILKVVILVQSVPRLLRIYPLYKEVTRTSGFFTETAWAGAA  586
             V + ++IP+      +  K +LK V+  Q +PRLLR+YPLYKEVTRTSG  TETAWAGAA
Sbjct  195   VAILVVIPKLRGAKSLNTKTLLKFVVFFQYIPRLLRVYPLYKEVTRTSGILTETAWAGAA  254

Query  587   FNLFLYMIASYVAGAIWYITAIERQDKCWRRACEKHGSCDIDFLYCTKLGRRGGDFSSSF  766
             FNL LYM+AS+V GA WY+ +IER+  CW+RAC    +C    LYC        DF    
Sbjct  255   FNLLLYMLASHVLGAFWYLFSIERESTCWQRACGNTSACHHSSLYCDD---DHTDFIK-L  310

Query  767   LNTSCALLEPENLKADDFDFGIFLDALKSNVVEKRYFWSKLFYCFWWGLRNLSSLGQNLK  946
             LN SC +  P       FDFGIF +ALKS VVE   F  K FYCFWWGL+NLSSLGQNL+
Sbjct  311   LNDSCPIETPNTTL---FDFGIFHEALKSGVVESMDFPQKFFYCFWWGLQNLSSLGQNLE  367

Query  947   TSNFVGEilfailisiiglilfslligNMQKYLQSITVRVEEMRVKRMDAEQWMSHRMLP  1126
             TS +V EI FA+ ISI GL+LFS LIGNMQ YLQS T+R+EEMRVKR DAEQWMSHR+LP
Sbjct  368   TSTYVWEICFAVFISIAGLVLFSFLIGNMQTYLQSTTLRLEEMRVKRRDAEQWMSHRLLP  427

Query  1127  DNLRERIRRYEQYRWQETRGVDEESLISNLPKDLRRDINRHLCWSLLKRVHMFKTMDEQL  1306
             ++LRERIRRYEQY+WQETRGVDEE+LI NLPKDLRRDI RHLC +LL RV MF+ MDEQL
Sbjct  428   EHLRERIRRYEQYKWQETRGVDEENLILNLPKDLRRDIKRHLCLALLMRVPMFEKMDEQL  487

Query  1307  LDAICDRLKPVLYTEKSCIVREGDPVDEMIFVMRGNLLTMTTNGGRTGFLNSDVLNAGDF  1486
             LDA+CDRL+PVLYTE S IVREGDPVDEM+F+MRG LLT+TTNGGRTGF NSD L AGDF
Sbjct  488   LDALCDRLRPVLYTENSFIVREGDPVDEMLFIMRGKLLTVTTNGGRTGFFNSDYLKAGDF  547

Query  1487  CGEELLTWALDPNSSSSLPISTRTVQALTDVEAFALTADFLKFFASQYRRLHSKQLQHKF  1666
             CGEELLTWALDP+ S++LPISTRTVQAL++VEAFAL AD LKF ASQ+RRLHSKQL+H F
Sbjct  548   CGEELLTWALDPHPSNNLPISTRTVQALSEVEAFALVADDLKFVASQFRRLHSKQLRHTF  607

Query  1667  RFYSHQWKTWAACFIQAAWRRHCRNKLEKSLREEEDRLQDALILRMRREEGETTPSLGAT  1846
             RFYS QW+TWAACFIQAAWRRHCR KLE+SL EEE+RLQDAL      + G ++PSLGAT
Sbjct  608   RFYSQQWRTWAACFIQAAWRRHCRKKLEESLCEEENRLQDALA-----KGGGSSPSLGAT  662

Query  1847  IYASRFAANVLRTVRRNHplsvpklsprlpplllqkpAEPDFSAPE  1984
             IYASRFAAN LR +RRN      +++ R+ P+LLQKPAEPDF+A +
Sbjct  663   IYASRFAANALRALRRN-TAKKARMADRISPILLQKPAEPDFTAED  707



>ref|XP_008380711.1| PREDICTED: cyclic nucleotide-gated ion channel 1-like isoform 
X1 [Malus domestica]
 ref|XP_008354253.1| PREDICTED: cyclic nucleotide-gated ion channel 1-like [Malus 
domestica]
Length=713

 Score =   849 bits (2193),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 445/649 (69%), Positives = 524/649 (81%), Gaps = 14/649 (2%)
 Frame = +2

Query  50    SKMHDPQGPFLQRWNRIFVIACILAATVDPLFFYIPVVDDQNKCLGLDRTLEITACILRS  229
             S + DPQGPFLQ+WN+IFV+ACI+A ++DPLFFYIPV++D+ KCLGLDR +EITA +LRS
Sbjct  76    SGVLDPQGPFLQKWNKIFVLACIIAVSLDPLFFYIPVINDKRKCLGLDRKMEITASVLRS  135

Query  230   VFDFFYIFHIILQFRTGFVPPSSRVFGRGDLIVDPSAIAKRYFFSYFFIDILAVLPLPQV  409
               D FYI HII QFRTGF+ PSSRVFGRG L+ D  AIA+RY  SYF IDILAVLPLPQV
Sbjct  136   FTDIFYIVHIIFQFRTGFIAPSSRVFGRGVLVEDAWAIARRYLSSYFLIDILAVLPLPQV  195

Query  410   VLFMMIPRADRPFIMVAKDILKVVILVQSVPRLLRIYPLYKEVTRTSGFFTETAWAGAAF  589
             V+ + IP+      +  K++LK V+L Q  PR +RIYPLY+EVTR SG  TETAWAGAAF
Sbjct  196   VILIFIPKLGGSKTLNTKNLLKFVVLFQYFPRFIRIYPLYREVTRASGILTETAWAGAAF  255

Query  590   NLFLYMIASYVAGAIWYITAIERQDKCWRRACEKHGS-CDIDFLYCTKLGRRGGDFSS-S  763
             NLFLYM+AS+V GA WY+ +IER+ KCW+ AC  + + C    LYC  +      FS  +
Sbjct  256   NLFLYMLASHVLGAFWYLFSIERETKCWKAACGNNTTICSHKDLYCDTVSSNA--FSKIT  313

Query  764   FLNTSCALLEPENLKADDFDFGIFLDALKSNVVEKRY-FWSKLFYCFWWGLRNLSSLGQN  940
             FLN+SC + + +  +   FDFGIFLDAL+S +VE    F  K FYCFWWGLRNLSSLGQN
Sbjct  314   FLNSSCPIQDEDKTQ---FDFGIFLDALQSGIVESSTDFPQKFFYCFWWGLRNLSSLGQN  370

Query  941   LKTSNFVGEilfailisiiglilfslligNMQKYLQSITVRVEEMRVKRMDAEQWMSHRM  1120
             L TS +V EI FA+ ISI GL+LFS LIGNMQ YLQS T R+EEMRVKR DAEQWMSHR+
Sbjct  371   LATSTYVWEICFAVFISIAGLVLFSFLIGNMQTYLQSTTTRLEEMRVKRRDAEQWMSHRL  430

Query  1121  LPDNLRERIRRYEQYRWQETRGVDEESLISNLPKDLRRDINRHLCWSLLKRVHMFKTMDE  1300
             LP+NLRERIRRYEQY+WQETRGVDEE+LI NLPKDLRRDI RHLC +LL RV MF+ MDE
Sbjct  431   LPENLRERIRRYEQYKWQETRGVDEENLICNLPKDLRRDIKRHLCLALLMRVPMFEKMDE  490

Query  1301  QLLDAICDRLKPVLYTEKSCIVREGDPVDEMIFVMRGNLLTMTTNGGRTGFLNSDVLNAG  1480
             QLLDA+CDRLKPVLYTE+S IVREGDPVDEM+F+MRG LLTMTTNGGRTGF NS+ L AG
Sbjct  491   QLLDAMCDRLKPVLYTEESYIVREGDPVDEMLFIMRGRLLTMTTNGGRTGFFNSEYLKAG  550

Query  1481  DFCGEELLTWALDPNSSSSLPISTRTVQALTDVEAFALTADFLKFFASQYRRLHSKQLQH  1660
             DFCGEELLTWALDP++S++LPISTRTVQAL++VEAFAL AD LKF ASQ+RRLHSKQL+H
Sbjct  551   DFCGEELLTWALDPHTSANLPISTRTVQALSEVEAFALKADDLKFVASQFRRLHSKQLRH  610

Query  1661  KFRFYSHQWKTWAACFIQAAWRRHCRNKLEKSLREEEDRLQDALILRMRREEGETTPSLG  1840
              FRFYS QW+TWAA FIQAAWRRH + KLE+SL+EEE+RLQDAL      + G ++PSLG
Sbjct  611   TFRFYSQQWRTWAATFIQAAWRRHMKKKLEESLQEEENRLQDALA-----KAGVSSPSLG  665

Query  1841  ATIYASRFAANVLRTVRRNHplsvpklsprlpplllqkpAEPDFSAPEN  1987
             ATIYASRFAAN+LRT+RR+      ++  RLP +LLQKPAEPDF+A E 
Sbjct  666   ATIYASRFAANILRTIRRSG-TRKARVPERLPAMLLQKPAEPDFTAEEQ  713



>gb|AES72465.2| cyclic nucleotide-gated ion channel-like protein [Medicago truncatula]
Length=713

 Score =   849 bits (2193),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 438/647 (68%), Positives = 521/647 (81%), Gaps = 11/647 (2%)
 Frame = +2

Query  47    KSKMHDPQGPFLQRWNRIFVIACILAATVDPLFFYIPVVDDQNKCLGLDRTLEITACILR  226
             ++K+ DPQGPFLQ+WN+IFV++C++A ++DPLFFYIPV+DD  KCL  D+ +E TA +LR
Sbjct  78    RNKILDPQGPFLQKWNKIFVLSCLIAVSIDPLFFYIPVIDDGKKCLSRDKKMETTATVLR  137

Query  227   SVFDFFYIFHIILQFRTGFVPPSSRVFGRGDLIVDPSAIAKRYFFSYFFIDILAVLPLPQ  406
             S  D FYI HII QFRTGF+ PSSRVFGRG L+ D  AIAKRY  SYF +DILAVLPLPQ
Sbjct  138   SFSDIFYIIHIIFQFRTGFIAPSSRVFGRGVLVQDAWAIAKRYMSSYFLVDILAVLPLPQ  197

Query  407   VVLFMMIPRADRPFIMVAKDILKVVILVQSVPRLLRIYPLYKEVTRTSGFFTETAWAGAA  586
             VV+  +IP+      +  K++LK ++  Q VPR +RI PLYKEVTRTSG  TETAWAGAA
Sbjct  198   VVILFIIPKMTGSESLNTKNLLKFIVFFQYVPRFIRIAPLYKEVTRTSGILTETAWAGAA  257

Query  587   FNLFLYMIASYVAGAIWYITAIERQDKCWRRACEKHGSCDIDFLYCTKLGRRGGDFSSSF  766
             FNLFLYM+AS+V GA WY+ +IER+  CW+RAC+K+ +C    LYC      G    ++F
Sbjct  258   FNLFLYMLASHVLGAFWYLFSIERETTCWQRACQKNTTCIKAELYCDD--HHGLSTITTF  315

Query  767   LNTSCALLEPENLKADDFDFGIFLDALKSNVVEKRYFWSKLFYCFWWGLRNLSSLGQNLK  946
             LN SC +  P+      FDFGIFLDAL+S VV    F  K FYCFWWGL+NLSSLGQNL 
Sbjct  316   LNASCPIQNPDK---KLFDFGIFLDALQSGVVGSMDFPQKFFYCFWWGLKNLSSLGQNLA  372

Query  947   TSNFVGEilfailisiiglilfslligNMQKYLQSITVRVEEMRVKRMDAEQWMSHRMLP  1126
             TS FV EI FAI ISI GL+LF+ LIGNMQ YLQS T R+EEMRVKR DAEQWMSHR+LP
Sbjct  373   TSTFVWEICFAIFISIAGLVLFAFLIGNMQTYLQSTTTRLEEMRVKRRDAEQWMSHRLLP  432

Query  1127  DNLRERIRRYEQYRWQETRGVDEESLISNLPKDLRRDINRHLCWSLLKRVHMFKTMDEQL  1306
             D+LRERIRR+EQY+WQETRGVDE++LI NLPKDLRRDI RHLC +LL RV +F+ MDEQL
Sbjct  433   DHLRERIRRHEQYKWQETRGVDEDNLIRNLPKDLRRDIKRHLCLALLMRVPIFEKMDEQL  492

Query  1307  LDAICDRLKPVLYTEKSCIVREGDPVDEMIFVMRGNLLTMTTNGGRTGFLNSDVLNAGDF  1486
             LDA+CD LKPVLYT++SCIVREGDPVDEM+F+MRG LLT+TTNGGRTGF NS+ L AGDF
Sbjct  493   LDAVCDCLKPVLYTKESCIVREGDPVDEMLFIMRGKLLTVTTNGGRTGFFNSEYLKAGDF  552

Query  1487  CGEELLTWALDPNSSSSLPISTRTVQALTDVEAFALTADFLKFFASQYRRLHSKQLQHKF  1666
             CGEELLTWALDP S+S+LPISTRTVQ L++VEAFAL A+ LKF ASQ+RRLHSKQL+H F
Sbjct  553   CGEELLTWALDPRSASNLPISTRTVQTLSEVEAFALKAEDLKFVASQFRRLHSKQLRHTF  612

Query  1667  RFYSHQWKTWAACFIQAAWRRHCRNKLEKSLREEEDRLQDALILRMRREEGETTPSLGAT  1846
             RFYS QW+TWAACFIQAAWRR+C+ KLE+SLREEE+RLQDAL      +EG ++PSLGAT
Sbjct  613   RFYSQQWRTWAACFIQAAWRRYCKKKLEESLREEENRLQDALA-----KEGGSSPSLGAT  667

Query  1847  IYASRFAANVLRTVRRNHplsvpklsprlpplllqkpAEPDFSAPEN  1987
             IYASRFAANVLR +R+N     P++  RLPP++LQKP EPDF+A E 
Sbjct  668   IYASRFAANVLRAIRKNG-SRKPRVPERLPPMMLQKPTEPDFTAEEQ  713



>ref|XP_002268992.1| PREDICTED: cyclic nucleotide-gated ion channel 1 [Vitis vinifera]
 ref|XP_010662580.1| PREDICTED: cyclic nucleotide-gated ion channel 1 [Vitis vinifera]
 ref|XP_010662581.1| PREDICTED: cyclic nucleotide-gated ion channel 1 [Vitis vinifera]
 emb|CBI22542.3| unnamed protein product [Vitis vinifera]
Length=709

 Score =   848 bits (2192),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 441/645 (68%), Positives = 516/645 (80%), Gaps = 15/645 (2%)
 Frame = +2

Query  53    KMHDPQGPFLQRWNRIFVIACILAATVDPLFFYIPVVDDQNKCLGLDRTLEITACILRSV  232
             K+ DPQGPFLQ+WN+IFV++CI+A ++DPLFFYIPV+D   KCL LD +L+ITA +LRS 
Sbjct  80    KILDPQGPFLQKWNKIFVLSCIIAVSLDPLFFYIPVIDKLKKCLSLDESLQITASVLRSF  139

Query  233   FDFFYIFHIILQFRTGFVPPSSRVFGRGDLIVDPSAIAKRYFFSYFFIDILAVLPLPQVV  412
              D FYI HII QFRTGF+ PSSRVFGRG L+ D  AIA+RY  SYF IDILAVLPLPQVV
Sbjct  140   TDIFYILHIIFQFRTGFIAPSSRVFGRGVLVEDSWAIARRYLSSYFLIDILAVLPLPQVV  199

Query  413   LFMMIPRADRPFIMVAKDILKVVILVQSVPRLLRIYPLYKEVTRTSGFFTETAWAGAAFN  592
             ++++IP+      M  K +LK V+  Q +PR+LR+ PLYKEVTRTSG  TETAWAGAAFN
Sbjct  200   IWIIIPKLGGSKYMNTKRLLKFVVFFQYIPRVLRVRPLYKEVTRTSGILTETAWAGAAFN  259

Query  593   LFLYMIASYVAGAIWYITAIERQDKCWRRACEKHGSCDIDFLYCTKLGRRGGDFSSSFLN  772
             LFLYM+AS+V GA WY+ AI+R+  CW +AC    SC    LYC       G  +++  N
Sbjct  260   LFLYMLASHVLGAFWYLFAIDRETTCWTKACGNDTSCIDSSLYCK------GTVNTTLFN  313

Query  773   TSCALLEPENLKADDFDFGIFLDALKSNVVEKRYFWSKLFYCFWWGLRNLSSLGQNLKTS  952
              SC ++EP       FDFGI LDAL+S VVE   F  K FYCFWWGL+NLSSLGQNLKTS
Sbjct  314   ASCPVIEPNTTV---FDFGILLDALQSGVVESTDFPQKFFYCFWWGLQNLSSLGQNLKTS  370

Query  953   NFVGEilfailisiiglilfslligNMQKYLQSITVRVEEMRVKRMDAEQWMSHRMLPDN  1132
              +V EI FA+ ISI GL+LFS LIGNMQ YLQS T+R+EEMRVKR DAEQWMSHR+LP++
Sbjct  371   TYVWEICFAVFISISGLVLFSFLIGNMQTYLQSTTIRLEEMRVKRRDAEQWMSHRLLPES  430

Query  1133  LRERIRRYEQYRWQETRGVDEESLISNLPKDLRRDINRHLCWSLLKRVHMFKTMDEQLLD  1312
             LRERIRRYEQY+WQETRGVDE++L+ NLPKDLRRDI RHLC +LL+RV MF+ MDEQL+D
Sbjct  431   LRERIRRYEQYKWQETRGVDEQNLLINLPKDLRRDIKRHLCLALLRRVPMFEKMDEQLMD  490

Query  1313  AICDRLKPVLYTEKSCIVREGDPVDEMIFVMRGNLLTMTTNGGRTGFLNSDVLNAGDFCG  1492
             A+CDRLKP LYTE S IVREGDPVDEM+FVMRG L TMTTNGGRTGFLNSD L AGDFCG
Sbjct  491   AMCDRLKPALYTEDSYIVREGDPVDEMLFVMRGKLSTMTTNGGRTGFLNSDYLKAGDFCG  550

Query  1493  EELLTWALDPNSSSSLPISTRTVQALTDVEAFALTADFLKFFASQYRRLHSKQLQHKFRF  1672
             EELLTWALDP+S+S+LPISTRTV AL++VEAFAL AD LKF ASQ+RRLHSKQL+H FR 
Sbjct  551   EELLTWALDPHSTSNLPISTRTVLALSEVEAFALMADDLKFVASQFRRLHSKQLRHTFRL  610

Query  1673  YSHQWKTWAACFIQAAWRRHCRNKLEKSLREEEDRLQDALILRMRREEGETTPSLGATIY  1852
             YSHQW+TWAACFIQAAWRR+ R KLE+SLREEEDRLQDAL      + G ++PSLGATIY
Sbjct  611   YSHQWRTWAACFIQAAWRRYWRKKLEESLREEEDRLQDALA-----KAGGSSPSLGATIY  665

Query  1853  ASRFAANVLRTVRRNHplsvpklsprlpplllqkpAEPDFSAPEN  1987
             ASRFAAN LR +RRN      +L  R+ P+LLQKPAEPDF+A + 
Sbjct  666   ASRFAANALRALRRNK-TRKARLPERISPILLQKPAEPDFTAEDQ  709



>ref|XP_009368670.1| PREDICTED: cyclic nucleotide-gated ion channel 1-like isoform 
X3 [Pyrus x bretschneideri]
Length=684

 Score =   847 bits (2188),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 444/648 (69%), Positives = 519/648 (80%), Gaps = 12/648 (2%)
 Frame = +2

Query  50    SKMHDPQGPFLQRWNRIFVIACILAATVDPLFFYIPVVDDQNKCLGLDRTLEITACILRS  229
              ++ DPQGPFLQ+WN+IFV+ACI A ++DPLFFYIPV+DD+NKCLGLDR +EITA +LRS
Sbjct  47    GRILDPQGPFLQKWNKIFVLACIFAVSLDPLFFYIPVIDDENKCLGLDRKMEITASVLRS  106

Query  230   VFDFFYIFHIILQFRTGFVPPSSRVFGRGDLIVDPSAIAKRYFFSYFFIDILAVLPLPQV  409
               D FYI HII QFRTGF+ PSSRVFGRG L+ D  AIA+RY  SYF IDILAVLPLPQV
Sbjct  107   FTDIFYIVHIIFQFRTGFIAPSSRVFGRGVLVQDAWAIARRYLSSYFVIDILAVLPLPQV  166

Query  410   VLFMMIPRADRPFIMVAKDILKVVILVQSVPRLLRIYPLYKEVTRTSGFFTETAWAGAAF  589
             V+ + IPR      +  K++LK V+L Q  PR +RIYPLY+EVTR SG  TETAWAGAAF
Sbjct  167   VILIFIPRLAGSRTLNTKNLLKFVVLFQYFPRFIRIYPLYREVTRASGILTETAWAGAAF  226

Query  590   NLFLYMIASYVAGAIWYITAIERQDKCWRRACEKHGS-CDIDFLYCTKLGRRGGDFSSSF  766
             NLFLYM+AS+V GA WY+ +IER+  CW+ AC  + + C  + LYC           ++F
Sbjct  227   NLFLYMLASHVLGAFWYLVSIERETTCWKAACGNNATICLWNDLYCDTASLNASS-KTTF  285

Query  767   LNTSCALLEPENLKADDFDFGIFLDALKSNVVEKRY-FWSKLFYCFWWGLRNLSSLGQNL  943
             LN+SC + + + LK   FDFGIFLDAL+S +VE    F  K FYCFWWGLRNLSSLGQNL
Sbjct  286   LNSSCPIQDEDKLK---FDFGIFLDALQSGIVESSTDFPQKFFYCFWWGLRNLSSLGQNL  342

Query  944   KTSNFVGEilfailisiiglilfslligNMQKYLQSITVRVEEMRVKRMDAEQWMSHRML  1123
              TS +V EI FAI ISI GL+LFS LIGNMQ YLQS T R+EEMRVKR DAEQWMSHR+L
Sbjct  343   ATSTYVWEICFAIFISIAGLVLFSFLIGNMQTYLQSTTTRLEEMRVKRRDAEQWMSHRLL  402

Query  1124  PDNLRERIRRYEQYRWQETRGVDEESLISNLPKDLRRDINRHLCWSLLKRVHMFKTMDEQ  1303
             PDNLRERIRRYEQY+WQETRGVDE++LI NLPKDLRRDI RHLC +LL RV MF+ MD+Q
Sbjct  403   PDNLRERIRRYEQYKWQETRGVDEQNLICNLPKDLRRDIKRHLCLALLMRVPMFEKMDDQ  462

Query  1304  LLDAICDRLKPVLYTEKSCIVREGDPVDEMIFVMRGNLLTMTTNGGRTGFLNSDVLNAGD  1483
             LLDA+CD LKPVLYTE S IVREGDPVDEM+F+MRG LLTMTTNGGRTGF NS+ L AGD
Sbjct  463   LLDAMCDCLKPVLYTEASYIVREGDPVDEMLFIMRGRLLTMTTNGGRTGFFNSEYLKAGD  522

Query  1484  FCGEELLTWALDPNSSSSLPISTRTVQALTDVEAFALTADFLKFFASQYRRLHSKQLQHK  1663
             FCGEELLTWALDP+ S++LPISTRTVQAL++VEAFAL AD LKF ASQ+RRLHSKQL+H 
Sbjct  523   FCGEELLTWALDPHPSANLPISTRTVQALSEVEAFALKADDLKFVASQFRRLHSKQLRHT  582

Query  1664  FRFYSHQWKTWAACFIQAAWRRHCRNKLEKSLREEEDRLQDALILRMRREEGETTPSLGA  1843
             FRFYS QW+TWAA FIQAAWRRH + KLE+SL+EEE+RLQDAL      +   ++PSLGA
Sbjct  583   FRFYSQQWRTWAATFIQAAWRRHMKKKLEESLQEEENRLQDALA-----KAEASSPSLGA  637

Query  1844  TIYASRFAANVLRTVRRNHplsvpklsprlpplllqkpAEPDFSAPEN  1987
             TIYASRFAAN+LRT+RR+      ++  RLP +LLQKPAEPDF+A E 
Sbjct  638   TIYASRFAANILRTLRRSG-TRKARVPERLPAMLLQKPAEPDFTAEEQ  684



>ref|XP_009127193.1| PREDICTED: cyclic nucleotide-gated ion channel 1 [Brassica rapa]
Length=711

 Score =   848 bits (2190),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 424/616 (69%), Positives = 505/616 (82%), Gaps = 12/616 (2%)
 Frame = +2

Query  53    KMHDPQGPFLQRWNRIFVIACILAATVDPLFFYIPVVDDQNKCLGLDRTLEITACILRSV  232
             K+ DPQGPFLQRWN+IFV+ACI+A ++DPLFFY+PVVDD  KCLGLD  +EITA +LRS 
Sbjct  78    KILDPQGPFLQRWNKIFVLACIIAVSLDPLFFYVPVVDDAKKCLGLDNKMEITASVLRSF  137

Query  233   FDFFYIFHIILQFRTGFVPPSSRVFGRGDLIVDPSAIAKRYFFSYFFIDILAVLPLPQVV  412
              D FY+ HII QFRTGF+ PSSRVFGRG L+ D   IA RY  S+F IDILAVLPLPQVV
Sbjct  138   TDIFYVIHIIFQFRTGFIAPSSRVFGRGVLVEDTRQIAIRYLSSHFIIDILAVLPLPQVV  197

Query  413   LFMMIPRADRPFIMVAKDILKVVILVQSVPRLLRIYPLYKEVTRTSGFFTETAWAGAAFN  592
             + ++IP       +  K++LK ++  Q +PR +RIYPLYKEVTRTSG  TETAWAGAAFN
Sbjct  198   ILIIIPHMRGSRSLNTKNLLKFIVFFQYIPRFIRIYPLYKEVTRTSGILTETAWAGAAFN  257

Query  593   LFLYMIASYVAGAIWYITAIERQDKCWRRACEKHGS-CDIDFLYCTKLGRRGGDFSSSFL  769
             LFLYM+AS+V GA WY+ +IER+  CW++AC ++ + CDI  LYC      G    ++FL
Sbjct  258   LFLYMLASHVFGAFWYLFSIERETVCWKQACNRNRNICDITSLYCDHKAAGG----NAFL  313

Query  770   NTSCALLEPENLKADDFDFGIFLDALKSNVVEKRYFWSKLFYCFWWGLRNLSSLGQNLKT  949
             N SC +  P    A  FDFGIFL+AL+S VVE + F  K FYCFWWGL+NLSSLGQNLKT
Sbjct  314   NASCPVQTP---NATLFDFGIFLNALQSGVVESQDFPQKFFYCFWWGLQNLSSLGQNLKT  370

Query  950   SNFVGEilfailisiiglilfslligNMQKYLQSITVRVEEMRVKRMDAEQWMSHRMLPD  1129
             S ++ EI FA+ ISI GL+LFS LIGNMQ YLQS T R+EEMRVKR DAEQWM+HR+LP+
Sbjct  371   STYIWEICFAVFISISGLVLFSFLIGNMQTYLQSTTTRLEEMRVKRRDAEQWMAHRLLPE  430

Query  1130  NLRERIRRYEQYRWQETRGVDEESLISNLPKDLRRDINRHLCWSLLKRVHMFKTMDEQLL  1309
             +LR+RIRRYEQY+WQETRGVDEE+L+SNLPKDLRRDI RHLC +LL RV MF+ MDEQLL
Sbjct  431   SLRKRIRRYEQYKWQETRGVDEENLLSNLPKDLRRDIKRHLCLALLMRVPMFEKMDEQLL  490

Query  1310  DAICDRLKPVLYTEKSCIVREGDPVDEMIFVMRGNLLTMTTNGGRTGFLNSDVLNAGDFC  1489
             DA+CDRL+PVLYTE+S IVREGDPVDEM+F+MRG LLTMTTNGGRTGF NS+ L AGDFC
Sbjct  491   DALCDRLQPVLYTEESYIVREGDPVDEMLFIMRGKLLTMTTNGGRTGFFNSEHLGAGDFC  550

Query  1490  GEELLTWALDPNSSSSLPISTRTVQALTDVEAFALTADFLKFFASQYRRLHSKQLQHKFR  1669
             GEELLTWALDP++SS+LPISTRTV+AL +VEAFAL AD LKF ASQ+RRLHSKQL+H FR
Sbjct  551   GEELLTWALDPHTSSNLPISTRTVRALVEVEAFALKADDLKFVASQFRRLHSKQLRHTFR  610

Query  1670  FYSHQWKTWAACFIQAAWRRHCRNKLEKSLREEEDRLQDALILRMRREEGETTPSLGATI  1849
             FYS QW+TWAACFIQAAWRRH + K+E+SL+EEE+RLQDAL     +E   ++PSLGAT+
Sbjct  611   FYSQQWRTWAACFIQAAWRRHVKKKMEESLKEEENRLQDALA----KEACGSSPSLGATM  666

Query  1850  YASRFAANVLRTVRRN  1897
             YASRFAAN+LRT+RR+
Sbjct  667   YASRFAANILRTIRRS  682



>ref|XP_007136556.1| hypothetical protein PHAVU_009G054700g [Phaseolus vulgaris]
 gb|ESW08550.1| hypothetical protein PHAVU_009G054700g [Phaseolus vulgaris]
Length=715

 Score =   848 bits (2191),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 434/647 (67%), Positives = 519/647 (80%), Gaps = 11/647 (2%)
 Frame = +2

Query  47    KSKMHDPQGPFLQRWNRIFVIACILAATVDPLFFYIPVVDDQNKCLGLDRTLEITACILR  226
             + K+ DPQGPFLQ+WN+IFV++C++A ++DPLFFY+PV+DD NKCL LDR +EITA +LR
Sbjct  80    RKKILDPQGPFLQKWNKIFVLSCLIAVSLDPLFFYVPVIDDDNKCLSLDRKMEITATVLR  139

Query  227   SVFDFFYIFHIILQFRTGFVPPSSRVFGRGDLIVDPSAIAKRYFFSYFFIDILAVLPLPQ  406
             S  D FYI HII QFRTGF+ PSSRVFGRG L+ D   IA RY  SYF IDILAVLPLPQ
Sbjct  140   SFSDIFYIIHIIFQFRTGFIAPSSRVFGRGVLVEDAWVIAMRYLSSYFLIDILAVLPLPQ  199

Query  407   VVLFMMIPRADRPFIMVAKDILKVVILVQSVPRLLRIYPLYKEVTRTSGFFTETAWAGAA  586
             V + ++IP+      +  K +LK ++  Q +PR LR+ PLYKEVTRTSG  TETAWAGAA
Sbjct  200   VAILIIIPKLRGSESLNTKTLLKFIVFFQYIPRFLRLIPLYKEVTRTSGILTETAWAGAA  259

Query  587   FNLFLYMIASYVAGAIWYITAIERQDKCWRRACEKHGSCDIDFLYCTKLGRRGGDFSSSF  766
             FNLFLYM+AS+V GA WY+ +IER+  CW+ AC ++ +C+ + +YC      G    S F
Sbjct  260   FNLFLYMLASHVIGAFWYLFSIERETTCWQDACRRNSTCNTEAMYCDNHKVLGT--ISVF  317

Query  767   LNTSCALLEPENLKADDFDFGIFLDALKSNVVEKRYFWSKLFYCFWWGLRNLSSLGQNLK  946
             LN SC +   ++     F+FGIFLDAL+S VVE R F  K FYCFWWGLRNLSSLGQNL 
Sbjct  318   LNASCPI---QDQNTTLFNFGIFLDALQSGVVESRDFPQKFFYCFWWGLRNLSSLGQNLA  374

Query  947   TSNFVGEilfailisiiglilfslligNMQKYLQSITVRVEEMRVKRMDAEQWMSHRMLP  1126
             TS +V EI FAI ISI GL+LF+ LIGNMQ YLQS T R+EEMRVKR DAEQWMSHR+LP
Sbjct  375   TSTYVWEICFAIFISIAGLVLFAFLIGNMQTYLQSTTTRLEEMRVKRRDAEQWMSHRLLP  434

Query  1127  DNLRERIRRYEQYRWQETRGVDEESLISNLPKDLRRDINRHLCWSLLKRVHMFKTMDEQL  1306
             D+LRERIRR+EQY+WQETRGVDE++LI +LPKDLRRDI RHLC +LL RV MF+ MDEQL
Sbjct  435   DSLRERIRRHEQYKWQETRGVDEDNLIRDLPKDLRRDIKRHLCLALLMRVPMFEKMDEQL  494

Query  1307  LDAICDRLKPVLYTEKSCIVREGDPVDEMIFVMRGNLLTMTTNGGRTGFLNSDVLNAGDF  1486
             LDA+CDRLKPVLYTE+SCIVREGDPVDE++F+MRG LLT+TTNGGRTGF NS+ L AGDF
Sbjct  495   LDAMCDRLKPVLYTEESCIVREGDPVDEILFIMRGKLLTVTTNGGRTGFFNSEYLKAGDF  554

Query  1487  CGEELLTWALDPNSSSSLPISTRTVQALTDVEAFALTADFLKFFASQYRRLHSKQLQHKF  1666
             CGEELLTWALDP+SSS+LPISTRTVQ L++VEAFAL AD LKF ASQ+RRLHSKQL+H F
Sbjct  555   CGEELLTWALDPHSSSNLPISTRTVQTLSEVEAFALKADDLKFVASQFRRLHSKQLRHTF  614

Query  1667  RFYSHQWKTWAACFIQAAWRRHCRNKLEKSLREEEDRLQDALILRMRREEGETTPSLGAT  1846
             RFYS QW++WAACFIQAAWRR+ + KLE+SLREEE+RLQDAL      + G ++PSLGAT
Sbjct  615   RFYSQQWRSWAACFIQAAWRRYSKKKLEESLREEENRLQDALA-----KAGGSSPSLGAT  669

Query  1847  IYASRFAANVLRTVRRNHplsvpklsprlpplllqkpAEPDFSAPEN  1987
             IYASRFAAN LR +RRN      ++  R+ P+LLQKPAEPDF++ E 
Sbjct  670   IYASRFAANALRLLRRNS-TRKARVPERISPMLLQKPAEPDFTSEEQ  715



>ref|XP_010103211.1| Cyclic nucleotide-gated ion channel 1 [Morus notabilis]
 gb|EXB95022.1| Cyclic nucleotide-gated ion channel 1 [Morus notabilis]
Length=717

 Score =   848 bits (2190),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 446/649 (69%), Positives = 524/649 (81%), Gaps = 13/649 (2%)
 Frame = +2

Query  47    KSKMHDPQGPFLQRWNRIFVIACILAATVDPLFFYIPVVDDQNKCLGLDRTLEITACILR  226
             + K+ DPQGPFLQRWN+IFV++C +A ++DPLFFY+PV++D+ KCL LDR +EITA +LR
Sbjct  80    QKKILDPQGPFLQRWNKIFVLSCFIAVSLDPLFFYVPVINDEEKCLDLDRKMEITASVLR  139

Query  227   SVFDFFYIFHIILQFRTGFVPPSSRVFGRGDLIVDPSAIAKRYFFSYFFIDILAVLPLPQ  406
             S  D FY+ HII QFRTGF+ PSSRVFGRG LI D  AIAKRY  S F IDILAVLPLPQ
Sbjct  140   SFTDIFYVLHIIFQFRTGFIAPSSRVFGRGVLIEDSWAIAKRYLSSNFLIDILAVLPLPQ  199

Query  407   VVLFMMIPRADRPFIMVAKDILKVVILVQSVPRLLRIYPLYKEVTRTSGFFTETAWAGAA  586
             VV+ ++IP+     I   K++LK V+L Q +PR++RIYPLY EVTRTSG  TETAWAGAA
Sbjct  200   VVILIIIPKLGGSRISNTKNLLKFVVLFQYLPRVIRIYPLYTEVTRTSGILTETAWAGAA  259

Query  587   FNLFLYMIASYVAGAIWYITAIERQDKCWRRACEKHG-SCDIDFLYCTKLGRRGGDFSSS  763
             FNLFLYM+AS+V GA WY+ +IER+  CW+ AC ++   C+ D LYC +     G  + +
Sbjct  260   FNLFLYMLASHVLGAFWYLCSIERETTCWQDACRRNPIQCNHDALYCDRDSNLAG--AKA  317

Query  764   FLNTSCALLEPENLKADDFDFGIFLDALKSNVVEKRY-FWSKLFYCFWWGLRNLSSLGQN  940
              LN SC +   +N     FDFGIFLDAL+S VVE    F  K FYCFWWGLRNLSSLGQN
Sbjct  318   LLNNSCPIQGSDN---PPFDFGIFLDALQSGVVESTTDFPQKFFYCFWWGLRNLSSLGQN  374

Query  941   LKTSNFVGEilfailisiiglilfslligNMQKYLQSITVRVEEMRVKRMDAEQWMSHRM  1120
             L TS +V EI FA+ ISI GL+LFS LIGNMQ YLQS T R+EEMRVKR DAEQWMSHR+
Sbjct  375   LATSTYVWEICFAVFISIAGLVLFSFLIGNMQTYLQSTTTRLEEMRVKRRDAEQWMSHRL  434

Query  1121  LPDNLRERIRRYEQYRWQETRGVDEESLISNLPKDLRRDINRHLCWSLLKRVHMFKTMDE  1300
             LP+NLRERIRRYEQYRWQETRGVDEE+LI NLPKDLRRDI RHLC +LL RV MF+ MD+
Sbjct  435   LPENLRERIRRYEQYRWQETRGVDEENLICNLPKDLRRDIKRHLCLALLMRVPMFEKMDD  494

Query  1301  QLLDAICDRLKPVLYTEKSCIVREGDPVDEMIFVMRGNLLTMTTNGGRTGFLNSDVLNAG  1480
             QLLDA+CDRLKPVLYTE+S IVREGDPVDEM+F+MRG LLT+TTNGGRTGF NS+ L AG
Sbjct  495   QLLDAMCDRLKPVLYTEESYIVREGDPVDEMLFIMRGRLLTVTTNGGRTGFFNSEYLKAG  554

Query  1481  DFCGEELLTWALDPNSSSSLPISTRTVQALTDVEAFALTADFLKFFASQYRRLHSKQLQH  1660
             DFCGEELLTWALDP+SSS+LPISTRTVQALT+VEAFAL AD LKF ASQ+RRLHSKQL+H
Sbjct  555   DFCGEELLTWALDPHSSSNLPISTRTVQALTEVEAFALKADDLKFVASQFRRLHSKQLRH  614

Query  1661  KFRFYSHQWKTWAACFIQAAWRRHCRNKLEKSLREEEDRLQDALILRMRREEGETTPSLG  1840
              FRFYS QW+TWAACFIQAAWRR+ + KLE+SLREEE+RLQDAL      + G ++PSLG
Sbjct  615   TFRFYSQQWRTWAACFIQAAWRRYSKKKLEESLREEENRLQDALA-----KAGGSSPSLG  669

Query  1841  ATIYASRFAANVLRTVRRNHplsvpklsprlpplllqkpAEPDFSAPEN  1987
             ATIYASRFAAN LR +RR+      ++  R+PP+LLQKPAEPDF+A E+
Sbjct  670   ATIYASRFAANALRLIRRSG-TRKARVPERIPPMLLQKPAEPDFTAEEH  717



>ref|XP_010055024.1| PREDICTED: cyclic nucleotide-gated ion channel 1-like [Eucalyptus 
grandis]
 ref|XP_010055025.1| PREDICTED: cyclic nucleotide-gated ion channel 1-like [Eucalyptus 
grandis]
 gb|KCW71512.1| hypothetical protein EUGRSUZ_E00063 [Eucalyptus grandis]
Length=719

 Score =   848 bits (2190),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 432/649 (67%), Positives = 527/649 (81%), Gaps = 14/649 (2%)
 Frame = +2

Query  47    KSKMHDPQGPFLQRWNRIFVIACILAATVDPLFFYIPVVDDQNKCLGLDRTLEITACILR  226
             + K+ DPQGPFL++WN+IF+I+C++A  +DPLFFYIPV++    CL  D  ++ITAC+ R
Sbjct  84    EKKILDPQGPFLRKWNKIFLISCVIALALDPLFFYIPVINVDYWCLDSDNIMKITACVFR  143

Query  227   SVFDFFYIFHIILQFRTGFVPPSSRVFGRGDLIVDPSAIAKRYFFSYFFIDILAVLPLPQ  406
             +V D FYIFHIILQFRTGF+ PSSRVFGRG+LI DPSA+++RY  SYFF+DILA+LP+PQ
Sbjct  144   TVIDAFYIFHIILQFRTGFIAPSSRVFGRGELIDDPSAVSQRYLSSYFFLDILAILPIPQ  203

Query  407   VVLFMMIPRADRPFIMVAKDILKVVILVQSVPRLLRIYPLYKEVTRTSGFFTETAWAGAA  586
             +V++++IP    P  +++K+ LK VI  Q VPR+ RIYPLY+E TRTSG   ETAWAGAA
Sbjct  204   LVVYIIIPTLPGPVALMSKESLKFVIYGQYVPRIARIYPLYQETTRTSGILYETAWAGAA  263

Query  587   FNLFLYMIASYVAGAIWYITAIERQDKCWRRACEKHGSCDIDFLYCTKLGRRGGDFSSSF  766
             FNL LYM+AS+V GA WY+ +I+R+ +CW + C K   CD  FLYC+   ++    ++++
Sbjct  264   FNLLLYMLASHVFGATWYLFSIDRKVRCWHQECGK-PVCDSKFLYCSPAHKQ----NNTY  318

Query  767   LNTSCALLEPENLK-ADDFDFGIFLDALKSNVVEKRYFWSKLFYCFWWGLRNLSSLGQNL  943
             LNT+C LLE + +K +  F+FGI +DAL+S VVE + F  KLFYCFWWGLRNLSSLGQNL
Sbjct  319   LNTACPLLEADEIKNSTQFNFGIAIDALQSGVVETKDFPKKLFYCFWWGLRNLSSLGQNL  378

Query  944   KTSNFVGEilfailisiiglilfslligNMQKYLQSITVRVEEMRVKRMDAEQWMSHRML  1123
             KTS +VGEI FA+ I+I GL+LF+LLIGNMQKYLQS TVRVEEMRVKR DAE+WMSHRML
Sbjct  379   KTSTYVGEIFFAVSIAIAGLVLFALLIGNMQKYLQSTTVRVEEMRVKRRDAERWMSHRML  438

Query  1124  PDNLRERIRRYEQYRWQETRGVDEESLISNLPKDLRRDINRHLCWSLLKRVHMFKTMDEQ  1303
             P+ L++RIRRYEQY+WQETRGV+EESLI NLPKDLRRDI RHLC  LL RV MF+ MDEQ
Sbjct  439   PEGLKDRIRRYEQYKWQETRGVEEESLIRNLPKDLRRDIKRHLCLDLLMRVPMFEKMDEQ  498

Query  1304  LLDAICDRLKPVLYTEKSCIVREGDPVDEMIFVMRGNLLTMTTNGGRTGFLNSDVLNAGD  1483
             LLDA+CDRLKPVLYTEKS IVREGDPVDEM+F++RG L+TMTTNGGRTGF NS  L AGD
Sbjct  499   LLDAMCDRLKPVLYTEKSSIVREGDPVDEMLFIIRGKLVTMTTNGGRTGFFNSVYLKAGD  558

Query  1484  FCGEELLTWALDPNSSSSLPISTRTVQALTDVEAFALTADFLKFFASQYRRLHSKQLQHK  1663
             FCGEELLTWALDPNSSS+LP STRTV+A+T+VEAFALTA+ LKF ASQ+RRLHSKQLQH+
Sbjct  559   FCGEELLTWALDPNSSSNLPTSTRTVEAITEVEAFALTANDLKFVASQFRRLHSKQLQHR  618

Query  1664  FRFYSHQWKTWAACFIQAAWRRHCRNKLEKSLREEEDRLQDALILRMRREEGETTPSLGA  1843
             FRFYS QW+TWAACFIQAAW RHC+ K +K+LR+ EDRL DAL       +G  +PSL A
Sbjct  619   FRFYSQQWRTWAACFIQAAWHRHCKRKRDKALRDAEDRLHDALA-----RDGGASPSLAA  673

Query  1844  TIYASRFAANVLRTVRRNHplsvpklsprlpplllqkpAEPDFSAPENN  1990
             TIYASRFAAN LR +R++      K   RLP L+ QKPAEPDF+   +N
Sbjct  674   TIYASRFAANALRNLRKSG---SIKTPQRLPLLMPQKPAEPDFTTDGSN  719



>ref|XP_004234170.1| PREDICTED: cyclic nucleotide-gated ion channel 1 [Solanum lycopersicum]
 ref|XP_010317473.1| PREDICTED: cyclic nucleotide-gated ion channel 1 [Solanum lycopersicum]
 gb|AJC00854.1| cyclic nucleotide gated channel CNGC6 [Solanum lycopersicum]
Length=708

 Score =   847 bits (2189),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 440/649 (68%), Positives = 517/649 (80%), Gaps = 19/649 (3%)
 Frame = +2

Query  47    KSKMHDPQGPFLQRWNRIFVIACILAATVDPLFFYIPVVDDQNKCLGLDRTLEITACILR  226
             + KM DPQGPFLQ+WN+IFV++C++A ++DPLFFYIPV+D+ NKCL LDR +E+TA +LR
Sbjct  75    EKKMLDPQGPFLQKWNKIFVLSCVIAISLDPLFFYIPVIDNNNKCLHLDRKMEVTASVLR  134

Query  227   SVFDFFYIFHIILQFRTGFVPPSSRVFGRGDLIVDPSAIAKRYFFSYFFIDILAVLPLPQ  406
             S+ D FY+FHI+LQFRTGF+ PSSRVFGRG L+ D   IAKRY  SYF IDILAVLPLPQ
Sbjct  135   SITDIFYLFHIVLQFRTGFIAPSSRVFGRGVLVEDAWEIAKRYLSSYFLIDILAVLPLPQ  194

Query  407   VVLFMMIPRADRPFIMVAKDILKVVILVQSVPRLLRIYPLYKEVTRTSGFFTETAWAGAA  586
             V + ++IP+      +  K +LK V+  Q +PRLLR+YPLYKEVTRTSG  TETAWAGAA
Sbjct  195   VAILIVIPKLRGAKSLNTKTLLKFVVFFQYIPRLLRVYPLYKEVTRTSGILTETAWAGAA  254

Query  587   FNLFLYMIASYVAGAIWYITAIERQDKCWRRACEKHGSCDIDFLYCTKLGRRGGDFSSSF  766
             FNL LYM+AS+V GA WY+ +IER+  CW+RAC    +C    LYC        D  ++F
Sbjct  255   FNLLLYMLASHVLGAFWYLFSIERESTCWQRACGNTSACHHSSLYC-------DDDHTNF  307

Query  767   ---LNTSCALLEPENLKADDFDFGIFLDALKSNVVEKRYFWSKLFYCFWWGLRNLSSLGQ  937
                LN SC +  P       FDFGIF DAL S VVE   F  K FYCFWWGL+NLSSLGQ
Sbjct  308   IKLLNDSCPIETPNTTL---FDFGIFHDALNSGVVESMDFPQKFFYCFWWGLQNLSSLGQ  364

Query  938   NLKTSNFVGEilfailisiiglilfslligNMQKYLQSITVRVEEMRVKRMDAEQWMSHR  1117
             NL+TS +V EI FA+ ISI GL+LFS LIGNMQ YLQS T+R+EEMRVKR DAEQWMSHR
Sbjct  365   NLETSTYVWEICFAVFISIAGLVLFSFLIGNMQTYLQSTTLRLEEMRVKRRDAEQWMSHR  424

Query  1118  MLPDNLRERIRRYEQYRWQETRGVDEESLISNLPKDLRRDINRHLCWSLLKRVHMFKTMD  1297
             +LP++LRERIRRYEQY+WQETRGVDEE+LI NLPKDLRRDI RHLC +LL RV MF+ MD
Sbjct  425   LLPEHLRERIRRYEQYKWQETRGVDEETLILNLPKDLRRDIKRHLCLALLMRVPMFEKMD  484

Query  1298  EQLLDAICDRLKPVLYTEKSCIVREGDPVDEMIFVMRGNLLTMTTNGGRTGFLNSDVLNA  1477
             EQLLDA+CDRL+PVLYTE S IVREGDPVDEM+F+MRG LLT+TTNGGRTGF NSD L A
Sbjct  485   EQLLDALCDRLRPVLYTENSFIVREGDPVDEMLFIMRGKLLTVTTNGGRTGFFNSDYLKA  544

Query  1478  GDFCGEELLTWALDPNSSSSLPISTRTVQALTDVEAFALTADFLKFFASQYRRLHSKQLQ  1657
             GDFCGEELLTWALDP+ S++LPISTRTVQAL++VEAFAL AD LKF ASQ+RRLHSKQL+
Sbjct  545   GDFCGEELLTWALDPHPSNNLPISTRTVQALSEVEAFALVADDLKFVASQFRRLHSKQLR  604

Query  1658  HKFRFYSHQWKTWAACFIQAAWRRHCRNKLEKSLREEEDRLQDALILRMRREEGETTPSL  1837
             H FRFYS QW+TWAACFIQAAWRRHCR KLE+SL EEE+RLQDAL        G ++PSL
Sbjct  605   HTFRFYSQQWRTWAACFIQAAWRRHCRKKLEESLCEEENRLQDALA-----RGGGSSPSL  659

Query  1838  GATIYASRFAANVLRTVRRNHplsvpklsprlpplllqkpAEPDFSAPE  1984
             GATIYASRFAAN LR +R N      +++ R+ P+LLQKPAEPDF+A +
Sbjct  660   GATIYASRFAANALRALRHN-TAKKARMTDRISPILLQKPAEPDFTAED  707



>emb|CDY27024.1| BnaA02g10440D [Brassica napus]
Length=711

 Score =   847 bits (2189),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 424/616 (69%), Positives = 505/616 (82%), Gaps = 12/616 (2%)
 Frame = +2

Query  53    KMHDPQGPFLQRWNRIFVIACILAATVDPLFFYIPVVDDQNKCLGLDRTLEITACILRSV  232
             K+ DPQGPFLQRWN+IFV+ACI+A ++DPLFFY+PVVDD  KCLGLD  +EITA +LRS 
Sbjct  78    KILDPQGPFLQRWNKIFVLACIIAVSLDPLFFYVPVVDDAKKCLGLDNKMEITASVLRSF  137

Query  233   FDFFYIFHIILQFRTGFVPPSSRVFGRGDLIVDPSAIAKRYFFSYFFIDILAVLPLPQVV  412
              D FY+ HII QFRTGF+ PSSRVFGRG L+ D   IA RY  S+F IDILAVLPLPQVV
Sbjct  138   TDVFYVIHIIFQFRTGFIAPSSRVFGRGVLVEDTRQIAIRYLSSHFIIDILAVLPLPQVV  197

Query  413   LFMMIPRADRPFIMVAKDILKVVILVQSVPRLLRIYPLYKEVTRTSGFFTETAWAGAAFN  592
             + ++IP       +  K++LK ++  Q +PR +RIYPLYKEVTRTSG  TETAWAGAAFN
Sbjct  198   ILIIIPHMRGSRSLNTKNLLKFIVFFQYIPRFIRIYPLYKEVTRTSGILTETAWAGAAFN  257

Query  593   LFLYMIASYVAGAIWYITAIERQDKCWRRACEKHGS-CDIDFLYCTKLGRRGGDFSSSFL  769
             LFLYM+AS+V GA WY+ +IER+  CW++AC ++ + CDI  LYC      G    ++FL
Sbjct  258   LFLYMLASHVFGAFWYLFSIERETVCWKQACNRNRNICDITSLYCDHKAAGG----NAFL  313

Query  770   NTSCALLEPENLKADDFDFGIFLDALKSNVVEKRYFWSKLFYCFWWGLRNLSSLGQNLKT  949
             N SC +  P    A  FDFGIFL+AL+S VVE + F  K FYCFWWGL+NLSSLGQNLKT
Sbjct  314   NASCPVQTP---NATLFDFGIFLNALQSGVVESQDFPQKFFYCFWWGLQNLSSLGQNLKT  370

Query  950   SNFVGEilfailisiiglilfslligNMQKYLQSITVRVEEMRVKRMDAEQWMSHRMLPD  1129
             S ++ EI FA+ ISI GL+LFS LIGNMQ YLQS T R+EEMRVKR DAEQWM+HR+LP+
Sbjct  371   STYIWEICFAVFISISGLVLFSFLIGNMQTYLQSTTTRLEEMRVKRRDAEQWMAHRLLPE  430

Query  1130  NLRERIRRYEQYRWQETRGVDEESLISNLPKDLRRDINRHLCWSLLKRVHMFKTMDEQLL  1309
             +LR+RIRRYEQY+WQETRGVDEE+L+SNLPKDLRRDI RHLC +LL RV MF+ MDEQLL
Sbjct  431   SLRKRIRRYEQYKWQETRGVDEENLLSNLPKDLRRDIKRHLCLALLMRVPMFEKMDEQLL  490

Query  1310  DAICDRLKPVLYTEKSCIVREGDPVDEMIFVMRGNLLTMTTNGGRTGFLNSDVLNAGDFC  1489
             DA+CDRL+PVLYTE+S IVREGDPVDEM+F+MRG LLTMTTNGGRTGF NS+ L AGDFC
Sbjct  491   DALCDRLQPVLYTEESYIVREGDPVDEMLFIMRGKLLTMTTNGGRTGFFNSEHLGAGDFC  550

Query  1490  GEELLTWALDPNSSSSLPISTRTVQALTDVEAFALTADFLKFFASQYRRLHSKQLQHKFR  1669
             GEELLTWALDP++SS+LPISTRTV+AL +VEAFAL AD LKF ASQ+RRLHSKQL+H FR
Sbjct  551   GEELLTWALDPHTSSNLPISTRTVRALVEVEAFALKADDLKFVASQFRRLHSKQLRHTFR  610

Query  1670  FYSHQWKTWAACFIQAAWRRHCRNKLEKSLREEEDRLQDALILRMRREEGETTPSLGATI  1849
             FYS QW+TWAACFIQAAWRRH + K+E+SL+EEE+RLQDAL     +E   ++PSLGAT+
Sbjct  611   FYSQQWRTWAACFIQAAWRRHVKKKMEESLKEEENRLQDALA----KEACGSSPSLGATM  666

Query  1850  YASRFAANVLRTVRRN  1897
             YASRFAAN+LRT+RR+
Sbjct  667   YASRFAANILRTIRRS  682



>ref|XP_010321516.1| PREDICTED: cyclic nucleotide-gated ion channel 1 isoform X2 [Solanum 
lycopersicum]
Length=713

 Score =   847 bits (2188),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 439/652 (67%), Positives = 531/652 (81%), Gaps = 15/652 (2%)
 Frame = +2

Query  47    KSKMHDPQGPFLQRWNRIFVIACILAATVDPLFFYIPVVDDQNKCLGLDRTLEITACILR  226
             K K+HDPQG FLQ+WN++FV+ CI+A ++DPLFFYIPV+D+  KCL LDRTL+ITAC+LR
Sbjct  75    KKKVHDPQGRFLQQWNKVFVLICIIAVSLDPLFFYIPVIDNDRKCLDLDRTLKITACVLR  134

Query  227   SVFDFFYIFHIILQFRTGFVPPSSRVFGRGDLIVDPSAIAKRYFFSYFFIDILAVLPLPQ  406
             S+ D FYIFHIILQFRTG++ P SR+FGRG+L+ D   IAKRY  SYF +D++AVLPLPQ
Sbjct  135   SITDLFYIFHIILQFRTGYIAPPSRIFGRGELVEDSYDIAKRYLLSYFIVDVVAVLPLPQ  194

Query  407   VVLFMMIPRADRPFIMVAKDILKVVILVQSVPRLLRIYPLYKEVTRTSGFFTETAWAGAA  586
             +V+ ++ P A+    +  K++LK+VI  Q  PR+ RIYPLYKEVTRTSG FTE+AW GA 
Sbjct  195   IVILVITPNANGSIALATKEMLKIVIFAQYFPRIFRIYPLYKEVTRTSGLFTESAWGGAV  254

Query  587   FNLFLYMIASYVAGAIWYITAIERQDKCWRRACEKHGSCDIDFLYCTKLGRRGGDFSSSF  766
             FNL LYM+AS V GA+WY+ ++ERQD CWR AC+K   C  ++LYC K        ++S 
Sbjct  255   FNLSLYMLASNVIGALWYLFSVERQDTCWRDACDKISGCSSNYLYCNK----SSIGNASL  310

Query  767   LNTSCALLEPENLKADD-FDFGIFLDALKSNVVEKRYFWSKLFYCFWWGLRNLSSLGQNL  943
             LN+SC L++ E++K    FDFGI LDAL+  +VEKR FW+KLFYCFWWGLRNLSSLGQNL
Sbjct  311   LNSSCPLVKQEDIKDPHVFDFGIALDALQFRIVEKRNFWTKLFYCFWWGLRNLSSLGQNL  370

Query  944   KTSNFVGEilfailisiiglilfslligNMQKYLQSITVRVEEMRVKRMDAEQWMSHRML  1123
             KTS F+GEILFA+ ISIIGLILFSLLIGNMQKYLQSITVRVEEMRV+R DAEQWMSHRML
Sbjct  371   KTSTFIGEILFAVFISIIGLILFSLLIGNMQKYLQSITVRVEEMRVRRRDAEQWMSHRML  430

Query  1124  PDNLRERIRRYEQYRWQETRGVDEESLISNLPKDLRRDINRHLCWSLLKRVHMFKTMDEQ  1303
             PD L+ERIRR+EQY+WQETRGV+E+ L+ +LP+DLRRD+ RHLCWS LK+V +F+ MD+Q
Sbjct  431   PDILKERIRRHEQYKWQETRGVEEDLLLQDLPRDLRRDLKRHLCWSFLKKVPIFEKMDDQ  490

Query  1304  LLDAICDRLKPVLYTEKSCIVREGDPVDEMIFVMRGNLLTMTTNGGRTGFLNSDVLNAGD  1483
             LLDA+CDRLKP L+T+KS I+REGDPV+EM+F+MRG LLTMTTNGGRTGF NS  L AG 
Sbjct  491   LLDALCDRLKPALFTDKSFIIREGDPVEEMLFLMRGTLLTMTTNGGRTGFFNSVYLKAGG  550

Query  1484  FCGEELLTWALDPNSSS-SLPISTRTVQALTDVEAFALTADFLKFFASQYRRLHSKQLQH  1660
             FCG+ELLTWALDPN+SS SLP+STRTVQA+TD+EAFA+TAD LKF A+Q+RRL+SKQ+QH
Sbjct  551   FCGDELLTWALDPNTSSGSLPLSTRTVQAVTDIEAFAVTADDLKFVAAQFRRLNSKQIQH  610

Query  1661  KFRFYSHQWKTWAACFIQAAWRRHCRNKLEKSLREEEDRLQDALILRMRREEGETTPSLG  1840
              F+F S QW+TW ACFIQ AWRR+CRNKLEKSLR EEDRLQ AL      +E   TPSLG
Sbjct  611   TFKFCSQQWRTWGACFIQVAWRRYCRNKLEKSLRVEEDRLQAALA-----KESTNTPSLG  665

Query  1841  ATIYASRFAANVLRTVRRNHplsvpklsprlpplllqkpAEPDFSAPENNNA  1996
             ATIYASRFAAN LR +RR H  +         PLLL KP+EPDFS  E N++
Sbjct  666   ATIYASRFAANALRALRRKH--ATSAKLSPTLPLLLHKPSEPDFS--EENDS  713



>ref|XP_004308001.1| PREDICTED: cyclic nucleotide-gated ion channel 1-like [Fragaria 
vesca subsp. vesca]
Length=713

 Score =   847 bits (2187),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 446/648 (69%), Positives = 520/648 (80%), Gaps = 12/648 (2%)
 Frame = +2

Query  50    SKMHDPQGPFLQRWNRIFVIACILAATVDPLFFYIPVVDDQNKCLGLDRTLEITACILRS  229
             S + DPQG FLQ+WN+IFV+AC+LA ++DPLFFY+PV+DD NKCL  DR +EITA +LRS
Sbjct  76    STVLDPQGQFLQKWNKIFVLACVLAVSLDPLFFYVPVIDDDNKCLDKDRKMEITASVLRS  135

Query  230   VFDFFYIFHIILQFRTGFVPPSSRVFGRGDLIVDPSAIAKRYFFSYFFIDILAVLPLPQV  409
               D FYI HII QFRTGF+ P SRVFGRG L+ D  AIAKRY  SYFFIDILAVLPLPQV
Sbjct  136   FTDIFYIVHIIFQFRTGFIAPPSRVFGRGVLVEDGWAIAKRYLSSYFFIDILAVLPLPQV  195

Query  410   VLFMMIPRADRPFIMVAKDILKVVILVQSVPRLLRIYPLYKEVTRTSGFFTETAWAGAAF  589
             V+  +IP+      +  K++LK V+L Q VPR++RIYPLY+EVTR SG  TETAWAGAAF
Sbjct  196   VILFIIPKLGGSTSLNTKNLLKFVVLFQYVPRVIRIYPLYREVTRASGILTETAWAGAAF  255

Query  590   NLFLYMIASYVAGAIWYITAIERQDKCWRRACEKHGSCDIDFLYCTKLGRRGGDFSSSFL  769
             NLFLYM+AS+V GA WY+ ++ER+  CW++AC     C    LYC   GR      ++FL
Sbjct  256   NLFLYMLASHVLGAFWYLISLERETTCWKQACGNSTICTRRDLYCDTGGRHPD--KTAFL  313

Query  770   NTSCALLEPENLKADDFDFGIFLDALKSNVVEKRY-FWSKLFYCFWWGLRNLSSLGQNLK  946
             N+SC +L  +  K   FDFGIFLD L+S +VE +  F  K FYCFWWGLRNLSSLGQNL+
Sbjct  314   NSSCPILVEDKEK---FDFGIFLDGLQSGIVESKTDFPQKFFYCFWWGLRNLSSLGQNLE  370

Query  947   TSNFVGEilfailisiiglilfslligNMQKYLQSITVRVEEMRVKRMDAEQWMSHRMLP  1126
             TS +V EILFA+ ISI GL+LFS LIGNMQ YLQS T R+EEMRVKR DAEQWMSHR+LP
Sbjct  371   TSTYVWEILFAVFISIAGLVLFSFLIGNMQTYLQSTTTRLEEMRVKRRDAEQWMSHRLLP  430

Query  1127  DNLRERIRRYEQYRWQETRGVDEESLISNLPKDLRRDINRHLCWSLLKRVHMFKTMDEQL  1306
             +NLRERIRRYEQYRWQETRGVDEE+LI NLPKDLRRDI RHLC +LL RV MF+ MD+QL
Sbjct  431   ENLRERIRRYEQYRWQETRGVDEENLICNLPKDLRRDIKRHLCLALLMRVPMFEKMDDQL  490

Query  1307  LDAICDRLKPVLYTEKSCIVREGDPVDEMIFVMRGNLLTMTTNGGRTGFLNSDVLNAGDF  1486
             LDA+CDRLKPVLYTE S IVREGDPVDEM+F+MRG LLTMTTNGGRTGF NS+ L AGDF
Sbjct  491   LDAMCDRLKPVLYTEDSYIVREGDPVDEMLFIMRGKLLTMTTNGGRTGFFNSEYLKAGDF  550

Query  1487  CGEELLTWALDPNSSSSLPISTRTVQALTDVEAFALTADFLKFFASQYRRLHSKQLQHKF  1666
             CGEELLTWALDP++SS+LPISTRTVQAL++VEAFAL AD L+F ASQ+RRLHSKQL+H F
Sbjct  551   CGEELLTWALDPHTSSNLPISTRTVQALSEVEAFALKADDLRFVASQFRRLHSKQLRHTF  610

Query  1667  RFYSHQWKTWAACFIQAAWRRHCRNKLEKSLREEEDRLQDALILRMRREEGETTPSLGAT  1846
             R YS QW+TWAACFIQAAWRR+ + KLE+SLREEE+RLQDAL      +   ++PSLGAT
Sbjct  611   RLYSQQWRTWAACFIQAAWRRYSKKKLEESLREEENRLQDALA-----KAETSSPSLGAT  665

Query  1847  IYASRFAANVLRTVR-RNHplsvpklsprlpplllqkpAEPDFSAPEN  1987
             IYASRFAANVLR VR R       ++  RLPP+LLQKPAEPDF+A E 
Sbjct  666   IYASRFAANVLRAVRLRRSGTHKGRVPDRLPPMLLQKPAEPDFTAEEQ  713



>ref|XP_006578923.1| PREDICTED: cyclic nucleotide-gated ion channel 1-like [Glycine 
max]
Length=715

 Score =   847 bits (2187),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 436/647 (67%), Positives = 517/647 (80%), Gaps = 11/647 (2%)
 Frame = +2

Query  47    KSKMHDPQGPFLQRWNRIFVIACILAATVDPLFFYIPVVDDQNKCLGLDRTLEITACILR  226
             + K+ DPQGPFLQ+WN+IFV++C++A ++DPLFFY+PV+DD  KCL +DR +EITA +LR
Sbjct  80    RKKILDPQGPFLQKWNKIFVLSCLIAVSLDPLFFYVPVIDDNKKCLSMDRKMEITATVLR  139

Query  227   SVFDFFYIFHIILQFRTGFVPPSSRVFGRGDLIVDPSAIAKRYFFSYFFIDILAVLPLPQ  406
             S  D FYI HII QFRTGF+ PSSRVFGRG L+ D  AIA RY  SYF IDILAVLPLPQ
Sbjct  140   SFSDIFYIIHIIFQFRTGFIAPSSRVFGRGVLVEDAWAIAMRYLSSYFLIDILAVLPLPQ  199

Query  407   VVLFMMIPRADRPFIMVAKDILKVVILVQSVPRLLRIYPLYKEVTRTSGFFTETAWAGAA  586
             V + ++IP+      +  K +LK ++  Q +PR LRI PLYKEVTRTSG  TETAWAGAA
Sbjct  200   VAILIIIPKLSGSESLNTKTLLKFIVFFQYIPRFLRIIPLYKEVTRTSGILTETAWAGAA  259

Query  587   FNLFLYMIASYVAGAIWYITAIERQDKCWRRACEKHGSCDIDFLYCTKLGRRGGDFSSSF  766
             FNLFLYM+AS+V GA WY+ +IER+  CW+  C ++ +C+   +YC      G    S+F
Sbjct  260   FNLFLYMLASHVIGAFWYLFSIERETTCWQDVCRRNSTCNTAAMYCDNHQVLGT--MSAF  317

Query  767   LNTSCALLEPENLKADDFDFGIFLDALKSNVVEKRYFWSKLFYCFWWGLRNLSSLGQNLK  946
             LN SC + + +N     F+FGIFLDAL+S VVE R F  K FYCFWWGLRNLSSLGQNL 
Sbjct  318   LNASCPI-QVQNTTL--FNFGIFLDALQSGVVESRDFPQKFFYCFWWGLRNLSSLGQNLA  374

Query  947   TSNFVGEilfailisiiglilfslligNMQKYLQSITVRVEEMRVKRMDAEQWMSHRMLP  1126
             TS +V EI FAI ISI GL+LF+ LIGNMQ YLQS T R+EEMRVKR DAEQWMSHR+LP
Sbjct  375   TSTYVWEICFAIFISIAGLVLFAFLIGNMQTYLQSTTTRLEEMRVKRRDAEQWMSHRLLP  434

Query  1127  DNLRERIRRYEQYRWQETRGVDEESLISNLPKDLRRDINRHLCWSLLKRVHMFKTMDEQL  1306
             D+LRERIRR+EQY+WQETRGVDE+SLI +LPKDLRRDI RHLC +LL RV MF+ MDEQL
Sbjct  435   DSLRERIRRHEQYKWQETRGVDEDSLIRDLPKDLRRDIKRHLCLALLMRVPMFENMDEQL  494

Query  1307  LDAICDRLKPVLYTEKSCIVREGDPVDEMIFVMRGNLLTMTTNGGRTGFLNSDVLNAGDF  1486
             LDA+CDRLKPVLYTE+SCIVREGDPV EM+F+MRG LLT+TTNGGRTGF NS+ L AGDF
Sbjct  495   LDAMCDRLKPVLYTEESCIVREGDPVGEMLFIMRGKLLTVTTNGGRTGFFNSEYLKAGDF  554

Query  1487  CGEELLTWALDPNSSSSLPISTRTVQALTDVEAFALTADFLKFFASQYRRLHSKQLQHKF  1666
             CGEELLTWALDP SSS+LPISTRTVQ L++VEAFAL AD LKF ASQ+RRLHSKQL+H F
Sbjct  555   CGEELLTWALDPQSSSNLPISTRTVQTLSEVEAFALKADDLKFVASQFRRLHSKQLRHTF  614

Query  1667  RFYSHQWKTWAACFIQAAWRRHCRNKLEKSLREEEDRLQDALILRMRREEGETTPSLGAT  1846
             RFYS QW+TWAACFIQAAWRR+ + KLE+SLREEE+RLQDAL      + G ++PSLGAT
Sbjct  615   RFYSQQWRTWAACFIQAAWRRYGKKKLEESLREEENRLQDAL-----SKAGGSSPSLGAT  669

Query  1847  IYASRFAANVLRTVRRNHplsvpklsprlpplllqkpAEPDFSAPEN  1987
             IYASRFAAN LR +RRN      ++  R+ P+LLQKPAEPDF++ E 
Sbjct  670   IYASRFAANALRLLRRNG-TRKARVPERISPMLLQKPAEPDFTSEEQ  715



>ref|XP_004240079.1| PREDICTED: cyclic nucleotide-gated ion channel 1 isoform X1 [Solanum 
lycopersicum]
Length=723

 Score =   846 bits (2186),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 439/652 (67%), Positives = 531/652 (81%), Gaps = 15/652 (2%)
 Frame = +2

Query  47    KSKMHDPQGPFLQRWNRIFVIACILAATVDPLFFYIPVVDDQNKCLGLDRTLEITACILR  226
             K K+HDPQG FLQ+WN++FV+ CI+A ++DPLFFYIPV+D+  KCL LDRTL+ITAC+LR
Sbjct  85    KKKVHDPQGRFLQQWNKVFVLICIIAVSLDPLFFYIPVIDNDRKCLDLDRTLKITACVLR  144

Query  227   SVFDFFYIFHIILQFRTGFVPPSSRVFGRGDLIVDPSAIAKRYFFSYFFIDILAVLPLPQ  406
             S+ D FYIFHIILQFRTG++ P SR+FGRG+L+ D   IAKRY  SYF +D++AVLPLPQ
Sbjct  145   SITDLFYIFHIILQFRTGYIAPPSRIFGRGELVEDSYDIAKRYLLSYFIVDVVAVLPLPQ  204

Query  407   VVLFMMIPRADRPFIMVAKDILKVVILVQSVPRLLRIYPLYKEVTRTSGFFTETAWAGAA  586
             +V+ ++ P A+    +  K++LK+VI  Q  PR+ RIYPLYKEVTRTSG FTE+AW GA 
Sbjct  205   IVILVITPNANGSIALATKEMLKIVIFAQYFPRIFRIYPLYKEVTRTSGLFTESAWGGAV  264

Query  587   FNLFLYMIASYVAGAIWYITAIERQDKCWRRACEKHGSCDIDFLYCTKLGRRGGDFSSSF  766
             FNL LYM+AS V GA+WY+ ++ERQD CWR AC+K   C  ++LYC K        ++S 
Sbjct  265   FNLSLYMLASNVIGALWYLFSVERQDTCWRDACDKISGCSSNYLYCNK----SSIGNASL  320

Query  767   LNTSCALLEPENLKADD-FDFGIFLDALKSNVVEKRYFWSKLFYCFWWGLRNLSSLGQNL  943
             LN+SC L++ E++K    FDFGI LDAL+  +VEKR FW+KLFYCFWWGLRNLSSLGQNL
Sbjct  321   LNSSCPLVKQEDIKDPHVFDFGIALDALQFRIVEKRNFWTKLFYCFWWGLRNLSSLGQNL  380

Query  944   KTSNFVGEilfailisiiglilfslligNMQKYLQSITVRVEEMRVKRMDAEQWMSHRML  1123
             KTS F+GEILFA+ ISIIGLILFSLLIGNMQKYLQSITVRVEEMRV+R DAEQWMSHRML
Sbjct  381   KTSTFIGEILFAVFISIIGLILFSLLIGNMQKYLQSITVRVEEMRVRRRDAEQWMSHRML  440

Query  1124  PDNLRERIRRYEQYRWQETRGVDEESLISNLPKDLRRDINRHLCWSLLKRVHMFKTMDEQ  1303
             PD L+ERIRR+EQY+WQETRGV+E+ L+ +LP+DLRRD+ RHLCWS LK+V +F+ MD+Q
Sbjct  441   PDILKERIRRHEQYKWQETRGVEEDLLLQDLPRDLRRDLKRHLCWSFLKKVPIFEKMDDQ  500

Query  1304  LLDAICDRLKPVLYTEKSCIVREGDPVDEMIFVMRGNLLTMTTNGGRTGFLNSDVLNAGD  1483
             LLDA+CDRLKP L+T+KS I+REGDPV+EM+F+MRG LLTMTTNGGRTGF NS  L AG 
Sbjct  501   LLDALCDRLKPALFTDKSFIIREGDPVEEMLFLMRGTLLTMTTNGGRTGFFNSVYLKAGG  560

Query  1484  FCGEELLTWALDPNSSS-SLPISTRTVQALTDVEAFALTADFLKFFASQYRRLHSKQLQH  1660
             FCG+ELLTWALDPN+SS SLP+STRTVQA+TD+EAFA+TAD LKF A+Q+RRL+SKQ+QH
Sbjct  561   FCGDELLTWALDPNTSSGSLPLSTRTVQAVTDIEAFAVTADDLKFVAAQFRRLNSKQIQH  620

Query  1661  KFRFYSHQWKTWAACFIQAAWRRHCRNKLEKSLREEEDRLQDALILRMRREEGETTPSLG  1840
              F+F S QW+TW ACFIQ AWRR+CRNKLEKSLR EEDRLQ AL      +E   TPSLG
Sbjct  621   TFKFCSQQWRTWGACFIQVAWRRYCRNKLEKSLRVEEDRLQAALA-----KESTNTPSLG  675

Query  1841  ATIYASRFAANVLRTVRRNHplsvpklsprlpplllqkpAEPDFSAPENNNA  1996
             ATIYASRFAAN LR +RR H  +         PLLL KP+EPDFS  E N++
Sbjct  676   ATIYASRFAANALRALRRKH--ATSAKLSPTLPLLLHKPSEPDFS--EENDS  723



>ref|XP_010266494.1| PREDICTED: cyclic nucleotide-gated ion channel 1-like [Nelumbo 
nucifera]
Length=718

 Score =   846 bits (2186),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 440/647 (68%), Positives = 516/647 (80%), Gaps = 14/647 (2%)
 Frame = +2

Query  47    KSKMHDPQGPFLQRWNRIFVIACILAATVDPLFFYIPVVDDQNKCLGLDRTLEITACILR  226
             + K+ DPQG FLQ+WN+IF ++C++A ++DPLFFYIPV++ + KCLGLD  +EITA +LR
Sbjct  83    RKKILDPQGSFLQKWNKIFALSCVIAVSLDPLFFYIPVINSKKKCLGLDSNMEITASVLR  142

Query  227   SVFDFFYIFHIILQFRTGFVPPSSRVFGRGDLIVDPSAIAKRYFFSYFFIDILAVLPLPQ  406
             S  D FYI HII QFRT F+ P SRVFGRG L+ DP  IAKRY  SYF IDILAVLPLPQ
Sbjct  143   SFTDIFYILHIIFQFRTAFIAPYSRVFGRGVLVEDPWKIAKRYLSSYFLIDILAVLPLPQ  202

Query  407   -VVLFMMIPRADRPFIMVAKDILKVVILVQSVPRLLRIYPLYKEVTRTSGFFTETAWAGA  583
              V+L +   R      +  K++LK V+L+Q VPRL+R+YPLYKEVTRTSG  TETAWAGA
Sbjct  203   MVILVVKTRRISGSKALHTKELLKFVVLLQYVPRLIRVYPLYKEVTRTSGIITETAWAGA  262

Query  584   AFNLFLYMIASYVAGAIWYITAIERQDKCWRRACEKHGSCDIDFLYCTKLGRRGGDFSSS  763
             AFNLFLYM+AS+V GA WY+ +I R++ CW+ AC+    C  DFLYC     +       
Sbjct  263   AFNLFLYMLASHVLGAFWYLISIGRENACWQDACKNQTGCKSDFLYCDVNATQ----DLG  318

Query  764   FLNTSCALLEPENLKADDFDFGIFLDALKSNVVEKRYFWSKLFYCFWWGLRNLSSLGQNL  943
             FL+ SC ++EP       FDFGIFLDAL+S+VV    F  KLFYCFWWGLRNLSSLGQNL
Sbjct  319   FLDVSCPVMEPNK---TFFDFGIFLDALQSDVVGSSDFPQKLFYCFWWGLRNLSSLGQNL  375

Query  944   KTSNFVGEilfailisiiglilfslligNMQKYLQSITVRVEEMRVKRMDAEQWMSHRML  1123
             +TS +V EI FA+ ISI GL+LF+ LIGNMQ YLQS TVR+EEMRVKR DAEQWMSHR+L
Sbjct  376   ETSTYVWEIAFAVAISIFGLVLFAFLIGNMQTYLQSSTVRLEEMRVKRRDAEQWMSHRLL  435

Query  1124  PDNLRERIRRYEQYRWQETRGVDEESLISNLPKDLRRDINRHLCWSLLKRVHMFKTMDEQ  1303
             P+NLRERIRRY+QY+WQETRGVDEE+L+ +LPKDLRRDI RHLC SLL RV MF  MDEQ
Sbjct  436   PENLRERIRRYDQYKWQETRGVDEENLLHSLPKDLRRDIKRHLCLSLLMRVPMFIKMDEQ  495

Query  1304  LLDAICDRLKPVLYTEKSCIVREGDPVDEMIFVMRGNLLTMTTNGGRTGFLNSDVLNAGD  1483
             LLDA+CDRLKPVLYTE+S IVREGDPVDEM+F+MRG LL++TTNGGRTGF NSD L AGD
Sbjct  496   LLDAMCDRLKPVLYTEESYIVREGDPVDEMLFIMRGKLLSVTTNGGRTGFFNSDYLKAGD  555

Query  1484  FCGEELLTWALDPNSSSSLPISTRTVQALTDVEAFALTADFLKFFASQYRRLHSKQLQHK  1663
             FCGEELLTWALDP+SSS+LPISTRTV+ +T+VEAFAL AD LKF ASQ+RRLHSKQL+H 
Sbjct  556   FCGEELLTWALDPHSSSNLPISTRTVRTITEVEAFALKADDLKFVASQFRRLHSKQLRHT  615

Query  1664  FRFYSHQWKTWAACFIQAAWRRHCRNKLEKSLREEEDRLQDALILRMRREEGETTPSLGA  1843
             FR YS QW+TWAACFIQAAWRR+CR KLE SLREEEDRLQDAL      + G ++PSLGA
Sbjct  616   FRLYSQQWRTWAACFIQAAWRRYCRKKLEGSLREEEDRLQDALA-----KGGGSSPSLGA  670

Query  1844  TIYASRFAANVLRTVRRNHplsvpklsprlpplllqkpAEPDFSAPE  1984
             TIYASRFAAN LR +RRN      +L  R+P +LLQKPAEPDFSA +
Sbjct  671   TIYASRFAANALRALRRNG-ARKARLPERVPQMLLQKPAEPDFSAED  716



>ref|XP_009368667.1| PREDICTED: cyclic nucleotide-gated ion channel 1-like isoform 
X1 [Pyrus x bretschneideri]
Length=713

 Score =   846 bits (2185),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 444/648 (69%), Positives = 519/648 (80%), Gaps = 12/648 (2%)
 Frame = +2

Query  50    SKMHDPQGPFLQRWNRIFVIACILAATVDPLFFYIPVVDDQNKCLGLDRTLEITACILRS  229
              ++ DPQGPFLQ+WN+IFV+ACI A ++DPLFFYIPV+DD+NKCLGLDR +EITA +LRS
Sbjct  76    GRILDPQGPFLQKWNKIFVLACIFAVSLDPLFFYIPVIDDENKCLGLDRKMEITASVLRS  135

Query  230   VFDFFYIFHIILQFRTGFVPPSSRVFGRGDLIVDPSAIAKRYFFSYFFIDILAVLPLPQV  409
               D FYI HII QFRTGF+ PSSRVFGRG L+ D  AIA+RY  SYF IDILAVLPLPQV
Sbjct  136   FTDIFYIVHIIFQFRTGFIAPSSRVFGRGVLVQDAWAIARRYLSSYFVIDILAVLPLPQV  195

Query  410   VLFMMIPRADRPFIMVAKDILKVVILVQSVPRLLRIYPLYKEVTRTSGFFTETAWAGAAF  589
             V+ + IPR      +  K++LK V+L Q  PR +RIYPLY+EVTR SG  TETAWAGAAF
Sbjct  196   VILIFIPRLAGSRTLNTKNLLKFVVLFQYFPRFIRIYPLYREVTRASGILTETAWAGAAF  255

Query  590   NLFLYMIASYVAGAIWYITAIERQDKCWRRACEKHGS-CDIDFLYCTKLGRRGGDFSSSF  766
             NLFLYM+AS+V GA WY+ +IER+  CW+ AC  + + C  + LYC           ++F
Sbjct  256   NLFLYMLASHVLGAFWYLVSIERETTCWKAACGNNATICLWNDLYCDTASLNASS-KTTF  314

Query  767   LNTSCALLEPENLKADDFDFGIFLDALKSNVVEKRY-FWSKLFYCFWWGLRNLSSLGQNL  943
             LN+SC + + + LK   FDFGIFLDAL+S +VE    F  K FYCFWWGLRNLSSLGQNL
Sbjct  315   LNSSCPIQDEDKLK---FDFGIFLDALQSGIVESSTDFPQKFFYCFWWGLRNLSSLGQNL  371

Query  944   KTSNFVGEilfailisiiglilfslligNMQKYLQSITVRVEEMRVKRMDAEQWMSHRML  1123
              TS +V EI FAI ISI GL+LFS LIGNMQ YLQS T R+EEMRVKR DAEQWMSHR+L
Sbjct  372   ATSTYVWEICFAIFISIAGLVLFSFLIGNMQTYLQSTTTRLEEMRVKRRDAEQWMSHRLL  431

Query  1124  PDNLRERIRRYEQYRWQETRGVDEESLISNLPKDLRRDINRHLCWSLLKRVHMFKTMDEQ  1303
             PDNLRERIRRYEQY+WQETRGVDE++LI NLPKDLRRDI RHLC +LL RV MF+ MD+Q
Sbjct  432   PDNLRERIRRYEQYKWQETRGVDEQNLICNLPKDLRRDIKRHLCLALLMRVPMFEKMDDQ  491

Query  1304  LLDAICDRLKPVLYTEKSCIVREGDPVDEMIFVMRGNLLTMTTNGGRTGFLNSDVLNAGD  1483
             LLDA+CD LKPVLYTE S IVREGDPVDEM+F+MRG LLTMTTNGGRTGF NS+ L AGD
Sbjct  492   LLDAMCDCLKPVLYTEASYIVREGDPVDEMLFIMRGRLLTMTTNGGRTGFFNSEYLKAGD  551

Query  1484  FCGEELLTWALDPNSSSSLPISTRTVQALTDVEAFALTADFLKFFASQYRRLHSKQLQHK  1663
             FCGEELLTWALDP+ S++LPISTRTVQAL++VEAFAL AD LKF ASQ+RRLHSKQL+H 
Sbjct  552   FCGEELLTWALDPHPSANLPISTRTVQALSEVEAFALKADDLKFVASQFRRLHSKQLRHT  611

Query  1664  FRFYSHQWKTWAACFIQAAWRRHCRNKLEKSLREEEDRLQDALILRMRREEGETTPSLGA  1843
             FRFYS QW+TWAA FIQAAWRRH + KLE+SL+EEE+RLQDAL      +   ++PSLGA
Sbjct  612   FRFYSQQWRTWAATFIQAAWRRHMKKKLEESLQEEENRLQDALA-----KAEASSPSLGA  666

Query  1844  TIYASRFAANVLRTVRRNHplsvpklsprlpplllqkpAEPDFSAPEN  1987
             TIYASRFAAN+LRT+RR+      ++  RLP +LLQKPAEPDF+A E 
Sbjct  667   TIYASRFAANILRTLRRSG-TRKARVPERLPAMLLQKPAEPDFTAEEQ  713



>ref|XP_009368668.1| PREDICTED: cyclic nucleotide-gated ion channel 1-like isoform 
X2 [Pyrus x bretschneideri]
Length=710

 Score =   846 bits (2185),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 444/648 (69%), Positives = 519/648 (80%), Gaps = 12/648 (2%)
 Frame = +2

Query  50    SKMHDPQGPFLQRWNRIFVIACILAATVDPLFFYIPVVDDQNKCLGLDRTLEITACILRS  229
              ++ DPQGPFLQ+WN+IFV+ACI A ++DPLFFYIPV+DD+NKCLGLDR +EITA +LRS
Sbjct  73    GRILDPQGPFLQKWNKIFVLACIFAVSLDPLFFYIPVIDDENKCLGLDRKMEITASVLRS  132

Query  230   VFDFFYIFHIILQFRTGFVPPSSRVFGRGDLIVDPSAIAKRYFFSYFFIDILAVLPLPQV  409
               D FYI HII QFRTGF+ PSSRVFGRG L+ D  AIA+RY  SYF IDILAVLPLPQV
Sbjct  133   FTDIFYIVHIIFQFRTGFIAPSSRVFGRGVLVQDAWAIARRYLSSYFVIDILAVLPLPQV  192

Query  410   VLFMMIPRADRPFIMVAKDILKVVILVQSVPRLLRIYPLYKEVTRTSGFFTETAWAGAAF  589
             V+ + IPR      +  K++LK V+L Q  PR +RIYPLY+EVTR SG  TETAWAGAAF
Sbjct  193   VILIFIPRLAGSRTLNTKNLLKFVVLFQYFPRFIRIYPLYREVTRASGILTETAWAGAAF  252

Query  590   NLFLYMIASYVAGAIWYITAIERQDKCWRRACEKHGS-CDIDFLYCTKLGRRGGDFSSSF  766
             NLFLYM+AS+V GA WY+ +IER+  CW+ AC  + + C  + LYC           ++F
Sbjct  253   NLFLYMLASHVLGAFWYLVSIERETTCWKAACGNNATICLWNDLYCDTASLNASS-KTTF  311

Query  767   LNTSCALLEPENLKADDFDFGIFLDALKSNVVEKRY-FWSKLFYCFWWGLRNLSSLGQNL  943
             LN+SC + + + LK   FDFGIFLDAL+S +VE    F  K FYCFWWGLRNLSSLGQNL
Sbjct  312   LNSSCPIQDEDKLK---FDFGIFLDALQSGIVESSTDFPQKFFYCFWWGLRNLSSLGQNL  368

Query  944   KTSNFVGEilfailisiiglilfslligNMQKYLQSITVRVEEMRVKRMDAEQWMSHRML  1123
              TS +V EI FAI ISI GL+LFS LIGNMQ YLQS T R+EEMRVKR DAEQWMSHR+L
Sbjct  369   ATSTYVWEICFAIFISIAGLVLFSFLIGNMQTYLQSTTTRLEEMRVKRRDAEQWMSHRLL  428

Query  1124  PDNLRERIRRYEQYRWQETRGVDEESLISNLPKDLRRDINRHLCWSLLKRVHMFKTMDEQ  1303
             PDNLRERIRRYEQY+WQETRGVDE++LI NLPKDLRRDI RHLC +LL RV MF+ MD+Q
Sbjct  429   PDNLRERIRRYEQYKWQETRGVDEQNLICNLPKDLRRDIKRHLCLALLMRVPMFEKMDDQ  488

Query  1304  LLDAICDRLKPVLYTEKSCIVREGDPVDEMIFVMRGNLLTMTTNGGRTGFLNSDVLNAGD  1483
             LLDA+CD LKPVLYTE S IVREGDPVDEM+F+MRG LLTMTTNGGRTGF NS+ L AGD
Sbjct  489   LLDAMCDCLKPVLYTEASYIVREGDPVDEMLFIMRGRLLTMTTNGGRTGFFNSEYLKAGD  548

Query  1484  FCGEELLTWALDPNSSSSLPISTRTVQALTDVEAFALTADFLKFFASQYRRLHSKQLQHK  1663
             FCGEELLTWALDP+ S++LPISTRTVQAL++VEAFAL AD LKF ASQ+RRLHSKQL+H 
Sbjct  549   FCGEELLTWALDPHPSANLPISTRTVQALSEVEAFALKADDLKFVASQFRRLHSKQLRHT  608

Query  1664  FRFYSHQWKTWAACFIQAAWRRHCRNKLEKSLREEEDRLQDALILRMRREEGETTPSLGA  1843
             FRFYS QW+TWAA FIQAAWRRH + KLE+SL+EEE+RLQDAL      +   ++PSLGA
Sbjct  609   FRFYSQQWRTWAATFIQAAWRRHMKKKLEESLQEEENRLQDALA-----KAEASSPSLGA  663

Query  1844  TIYASRFAANVLRTVRRNHplsvpklsprlpplllqkpAEPDFSAPEN  1987
             TIYASRFAAN+LRT+RR+      ++  RLP +LLQKPAEPDF+A E 
Sbjct  664   TIYASRFAANILRTLRRSG-TRKARVPERLPAMLLQKPAEPDFTAEEQ  710



>ref|XP_008376706.1| PREDICTED: cyclic nucleotide-gated ion channel 1-like isoform 
X2 [Malus domestica]
Length=707

 Score =   845 bits (2184),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 443/648 (68%), Positives = 520/648 (80%), Gaps = 15/648 (2%)
 Frame = +2

Query  50    SKMHDPQGPFLQRWNRIFVIACILAATVDPLFFYIPVVDDQNKCLGLDRTLEITACILRS  229
              ++ DPQGPFLQ+WN+IFV+ACI+A ++DPLFFYIPV+DD NKCLGLDR +EITA +LRS
Sbjct  73    GRILDPQGPFLQKWNKIFVLACIVAVSLDPLFFYIPVIDDANKCLGLDRKMEITASVLRS  132

Query  230   VFDFFYIFHIILQFRTGFVPPSSRVFGRGDLIVDPSAIAKRYFFSYFFIDILAVLPLPQV  409
               D FYI HII QFRTGF+ PSSRVFGRG L+ D  AIA+RY  SYF IDILAVLPLPQV
Sbjct  133   FTDIFYIVHIIFQFRTGFIAPSSRVFGRGVLVQDAWAIARRYLSSYFVIDILAVLPLPQV  192

Query  410   VLFMMIPRADRPFIMVAKDILKVVILVQSVPRLLRIYPLYKEVTRTSGFFTETAWAGAAF  589
             V+ + IP+      +  K++LK V+L Q +PR +RIYPLY+EVTR SG  TETAWAGAAF
Sbjct  193   VILIFIPKLGGSRTLNTKNLLKFVVLFQYLPRFIRIYPLYREVTRASGILTETAWAGAAF  252

Query  590   NLFLYMIASYVAGAIWYITAIERQDKCWRRACEKHGS-CDIDFLYCTKLGRRGGDFSSSF  766
             NLFLYM+AS+V GA WY+ +IER+  CW+ AC  + + C    LYC          +S+F
Sbjct  253   NLFLYMLASHVLGAFWYLVSIERETTCWKAACGNNATICSGKDLYCDTASWN----ASTF  308

Query  767   LNTSCALLEPENLKADDFDFGIFLDALKSNVVEKRY-FWSKLFYCFWWGLRNLSSLGQNL  943
             LN+SC + + + LK   FDFGIFLDAL+S +VE    F  K FYCFWWGLRNLSSLGQNL
Sbjct  309   LNSSCPIQDEDKLK---FDFGIFLDALQSGIVESSTDFPQKFFYCFWWGLRNLSSLGQNL  365

Query  944   KTSNFVGEilfailisiiglilfslligNMQKYLQSITVRVEEMRVKRMDAEQWMSHRML  1123
              TS +V EI FAI ISI GL+LFS LIGNMQ YLQS T R+EEMRVKR DAEQWMSHR+L
Sbjct  366   ATSTYVWEICFAIFISIAGLVLFSFLIGNMQTYLQSTTTRLEEMRVKRRDAEQWMSHRLL  425

Query  1124  PDNLRERIRRYEQYRWQETRGVDEESLISNLPKDLRRDINRHLCWSLLKRVHMFKTMDEQ  1303
             P++LRERIRRYEQY+WQETRGVDE++LI NLPKDLRRDI RHLC +LL RV MF+ MDEQ
Sbjct  426   PNDLRERIRRYEQYKWQETRGVDEQNLICNLPKDLRRDIKRHLCLALLMRVPMFEKMDEQ  485

Query  1304  LLDAICDRLKPVLYTEKSCIVREGDPVDEMIFVMRGNLLTMTTNGGRTGFLNSDVLNAGD  1483
             LLDA+CDRLKPVLYTE S IVREGDPVDEM+F+MRG LLTMTTNGGRTGF NS+ L AGD
Sbjct  486   LLDAMCDRLKPVLYTEASYIVREGDPVDEMLFIMRGRLLTMTTNGGRTGFFNSEYLKAGD  545

Query  1484  FCGEELLTWALDPNSSSSLPISTRTVQALTDVEAFALTADFLKFFASQYRRLHSKQLQHK  1663
             FCGEELLTWALDP+ S++LPISTRTVQAL++VEAFAL AD LKF ASQ+RRLHSKQL+H 
Sbjct  546   FCGEELLTWALDPHPSANLPISTRTVQALSEVEAFALKADDLKFVASQFRRLHSKQLRHT  605

Query  1664  FRFYSHQWKTWAACFIQAAWRRHCRNKLEKSLREEEDRLQDALILRMRREEGETTPSLGA  1843
             FR YS QW+TWAA FIQAAWRRH + KLE+SL+EEE+RLQDAL      +   ++PSLGA
Sbjct  606   FRLYSQQWRTWAATFIQAAWRRHMKKKLEESLQEEENRLQDALA-----KAEASSPSLGA  660

Query  1844  TIYASRFAANVLRTVRRNHplsvpklsprlpplllqkpAEPDFSAPEN  1987
             TIYASRFAAN+LRT+RR+      ++  RLP +LLQKPAEPDF+A E 
Sbjct  661   TIYASRFAANILRTLRRSG-TRKARVPERLPAMLLQKPAEPDFTAEEQ  707



>ref|XP_008376705.1| PREDICTED: cyclic nucleotide-gated ion channel 1-like isoform 
X1 [Malus domestica]
Length=710

 Score =   845 bits (2184),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 443/648 (68%), Positives = 520/648 (80%), Gaps = 15/648 (2%)
 Frame = +2

Query  50    SKMHDPQGPFLQRWNRIFVIACILAATVDPLFFYIPVVDDQNKCLGLDRTLEITACILRS  229
              ++ DPQGPFLQ+WN+IFV+ACI+A ++DPLFFYIPV+DD NKCLGLDR +EITA +LRS
Sbjct  76    GRILDPQGPFLQKWNKIFVLACIVAVSLDPLFFYIPVIDDANKCLGLDRKMEITASVLRS  135

Query  230   VFDFFYIFHIILQFRTGFVPPSSRVFGRGDLIVDPSAIAKRYFFSYFFIDILAVLPLPQV  409
               D FYI HII QFRTGF+ PSSRVFGRG L+ D  AIA+RY  SYF IDILAVLPLPQV
Sbjct  136   FTDIFYIVHIIFQFRTGFIAPSSRVFGRGVLVQDAWAIARRYLSSYFVIDILAVLPLPQV  195

Query  410   VLFMMIPRADRPFIMVAKDILKVVILVQSVPRLLRIYPLYKEVTRTSGFFTETAWAGAAF  589
             V+ + IP+      +  K++LK V+L Q +PR +RIYPLY+EVTR SG  TETAWAGAAF
Sbjct  196   VILIFIPKLGGSRTLNTKNLLKFVVLFQYLPRFIRIYPLYREVTRASGILTETAWAGAAF  255

Query  590   NLFLYMIASYVAGAIWYITAIERQDKCWRRACEKHGS-CDIDFLYCTKLGRRGGDFSSSF  766
             NLFLYM+AS+V GA WY+ +IER+  CW+ AC  + + C    LYC          +S+F
Sbjct  256   NLFLYMLASHVLGAFWYLVSIERETTCWKAACGNNATICSGKDLYCDTASWN----ASTF  311

Query  767   LNTSCALLEPENLKADDFDFGIFLDALKSNVVEKRY-FWSKLFYCFWWGLRNLSSLGQNL  943
             LN+SC + + + LK   FDFGIFLDAL+S +VE    F  K FYCFWWGLRNLSSLGQNL
Sbjct  312   LNSSCPIQDEDKLK---FDFGIFLDALQSGIVESSTDFPQKFFYCFWWGLRNLSSLGQNL  368

Query  944   KTSNFVGEilfailisiiglilfslligNMQKYLQSITVRVEEMRVKRMDAEQWMSHRML  1123
              TS +V EI FAI ISI GL+LFS LIGNMQ YLQS T R+EEMRVKR DAEQWMSHR+L
Sbjct  369   ATSTYVWEICFAIFISIAGLVLFSFLIGNMQTYLQSTTTRLEEMRVKRRDAEQWMSHRLL  428

Query  1124  PDNLRERIRRYEQYRWQETRGVDEESLISNLPKDLRRDINRHLCWSLLKRVHMFKTMDEQ  1303
             P++LRERIRRYEQY+WQETRGVDE++LI NLPKDLRRDI RHLC +LL RV MF+ MDEQ
Sbjct  429   PNDLRERIRRYEQYKWQETRGVDEQNLICNLPKDLRRDIKRHLCLALLMRVPMFEKMDEQ  488

Query  1304  LLDAICDRLKPVLYTEKSCIVREGDPVDEMIFVMRGNLLTMTTNGGRTGFLNSDVLNAGD  1483
             LLDA+CDRLKPVLYTE S IVREGDPVDEM+F+MRG LLTMTTNGGRTGF NS+ L AGD
Sbjct  489   LLDAMCDRLKPVLYTEASYIVREGDPVDEMLFIMRGRLLTMTTNGGRTGFFNSEYLKAGD  548

Query  1484  FCGEELLTWALDPNSSSSLPISTRTVQALTDVEAFALTADFLKFFASQYRRLHSKQLQHK  1663
             FCGEELLTWALDP+ S++LPISTRTVQAL++VEAFAL AD LKF ASQ+RRLHSKQL+H 
Sbjct  549   FCGEELLTWALDPHPSANLPISTRTVQALSEVEAFALKADDLKFVASQFRRLHSKQLRHT  608

Query  1664  FRFYSHQWKTWAACFIQAAWRRHCRNKLEKSLREEEDRLQDALILRMRREEGETTPSLGA  1843
             FR YS QW+TWAA FIQAAWRRH + KLE+SL+EEE+RLQDAL      +   ++PSLGA
Sbjct  609   FRLYSQQWRTWAATFIQAAWRRHMKKKLEESLQEEENRLQDALA-----KAEASSPSLGA  663

Query  1844  TIYASRFAANVLRTVRRNHplsvpklsprlpplllqkpAEPDFSAPEN  1987
             TIYASRFAAN+LRT+RR+      ++  RLP +LLQKPAEPDF+A E 
Sbjct  664   TIYASRFAANILRTLRRSG-TRKARVPERLPAMLLQKPAEPDFTAEEQ  710



>ref|XP_009357320.1| PREDICTED: cyclic nucleotide-gated ion channel 1-like [Pyrus 
x bretschneideri]
Length=713

 Score =   845 bits (2184),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 444/648 (69%), Positives = 518/648 (80%), Gaps = 12/648 (2%)
 Frame = +2

Query  50    SKMHDPQGPFLQRWNRIFVIACILAATVDPLFFYIPVVDDQNKCLGLDRTLEITACILRS  229
              ++ DPQGPFLQ+WN+IFV+ACI A ++DPLFFYIPV+DD+NKCLGLDR +EITA +LRS
Sbjct  76    GRILDPQGPFLQKWNKIFVLACIFAVSLDPLFFYIPVIDDENKCLGLDRKMEITASVLRS  135

Query  230   VFDFFYIFHIILQFRTGFVPPSSRVFGRGDLIVDPSAIAKRYFFSYFFIDILAVLPLPQV  409
               D FYI HII QFRTGF+ PSSRVFGRG L+ D  AIA+RY  SYF IDILAVLPLPQV
Sbjct  136   FTDIFYIVHIIFQFRTGFIAPSSRVFGRGVLVQDAWAIARRYLSSYFVIDILAVLPLPQV  195

Query  410   VLFMMIPRADRPFIMVAKDILKVVILVQSVPRLLRIYPLYKEVTRTSGFFTETAWAGAAF  589
             V+ + IPR      +  K++LK V+L Q  PRL+RIYPLY+EVTR SG  TETAWAGAAF
Sbjct  196   VILIFIPRLAGSRTLNTKNLLKFVVLFQYFPRLIRIYPLYREVTRASGILTETAWAGAAF  255

Query  590   NLFLYMIASYVAGAIWYITAIERQDKCWRRACEKHGS-CDIDFLYCTKLGRRGGDFSSSF  766
             NLFLYM+AS+V GA WY+ +IER+  CW+ AC  + + C    LYC            +F
Sbjct  256   NLFLYMLASHVLGAFWYLVSIERETTCWKAACGNNATICLRKDLYCDTASLNASS-KITF  314

Query  767   LNTSCALLEPENLKADDFDFGIFLDALKSNVVEKRY-FWSKLFYCFWWGLRNLSSLGQNL  943
             LN+SC + + + LK   FDFGIFLDAL+S +VE    F  K FYCFWWGLRNLSSLGQNL
Sbjct  315   LNSSCPIQDEDKLK---FDFGIFLDALQSGIVESSTDFPQKFFYCFWWGLRNLSSLGQNL  371

Query  944   KTSNFVGEilfailisiiglilfslligNMQKYLQSITVRVEEMRVKRMDAEQWMSHRML  1123
              TS +V EI FAI ISI GL+LFS LIGNMQ YLQS T R+EEMRVKR DAEQWMSHR+L
Sbjct  372   ATSTYVWEICFAIFISIAGLVLFSFLIGNMQTYLQSTTTRLEEMRVKRRDAEQWMSHRLL  431

Query  1124  PDNLRERIRRYEQYRWQETRGVDEESLISNLPKDLRRDINRHLCWSLLKRVHMFKTMDEQ  1303
             PDNLRERIRRYEQY+WQETRGVDE++LI NLPKDLRRDI RHLC +LL RV MF+ MD+Q
Sbjct  432   PDNLRERIRRYEQYKWQETRGVDEQNLICNLPKDLRRDIKRHLCLALLMRVPMFEKMDDQ  491

Query  1304  LLDAICDRLKPVLYTEKSCIVREGDPVDEMIFVMRGNLLTMTTNGGRTGFLNSDVLNAGD  1483
             LLDA+CD LKPVLYTE S IVREGDPVDEM+F+MRG LLTMTTNGGRTGF NS+ L AGD
Sbjct  492   LLDAMCDCLKPVLYTEASYIVREGDPVDEMLFIMRGRLLTMTTNGGRTGFFNSEYLKAGD  551

Query  1484  FCGEELLTWALDPNSSSSLPISTRTVQALTDVEAFALTADFLKFFASQYRRLHSKQLQHK  1663
             FCGEELLTWALDP+ +++LPISTRTVQAL++VEAFAL AD LKF ASQ+RRLHSKQL+H 
Sbjct  552   FCGEELLTWALDPHPTANLPISTRTVQALSEVEAFALKADDLKFVASQFRRLHSKQLRHT  611

Query  1664  FRFYSHQWKTWAACFIQAAWRRHCRNKLEKSLREEEDRLQDALILRMRREEGETTPSLGA  1843
             FRFYS QW+TWAA FIQAAWRRH + KLE+SL+EEE+RLQDAL      +   ++PSLGA
Sbjct  612   FRFYSQQWRTWAATFIQAAWRRHMKKKLEESLQEEENRLQDALA-----KAEASSPSLGA  666

Query  1844  TIYASRFAANVLRTVRRNHplsvpklsprlpplllqkpAEPDFSAPEN  1987
             TIYASRFAAN+LRT+RR+      ++  RLP +LLQKPAEPDF+A E 
Sbjct  667   TIYASRFAANILRTLRRSG-TRKARVPERLPAMLLQKPAEPDFTAEEQ  713



>ref|XP_007038982.1| Cyclic nucleotide gated channel 1 isoform 1 [Theobroma cacao]
 ref|XP_007038983.1| Cyclic nucleotide gated channel 1 isoform 1 [Theobroma cacao]
 gb|EOY23483.1| Cyclic nucleotide gated channel 1 isoform 1 [Theobroma cacao]
 gb|EOY23484.1| Cyclic nucleotide gated channel 1 isoform 1 [Theobroma cacao]
Length=713

 Score =   845 bits (2184),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 444/646 (69%), Positives = 515/646 (80%), Gaps = 15/646 (2%)
 Frame = +2

Query  53    KMHDPQGPFLQRWNRIFVIACILAATVDPLFFYIPVVDDQNKCLGLDRTLEITACILRSV  232
             K+ DPQG FLQRWN+IFV++CI+A ++DPLFFYIPV++D  KCL LD  +E TA +LRS 
Sbjct  82    KVLDPQGSFLQRWNKIFVLSCIIAVSIDPLFFYIPVINDDKKCLALDEKMEATASVLRSF  141

Query  233   FDFFYIFHIILQFRTGFVPPSSRVFGRGDLIVDPSAIAKRYFFSYFFIDILAVLPLPQVV  412
              D FY+ HI+ QFRTGF+ PSSRVFGRG L+ D  AIAKRY  SYF IDILAVLPLPQVV
Sbjct  142   TDIFYVIHIVFQFRTGFIAPSSRVFGRGVLVEDSWAIAKRYLKSYFVIDILAVLPLPQVV  201

Query  413   LFMMIPRADRPFIMVAKDILKVVILVQSVPRLLRIYPLYKEVTRTSGFFTETAWAGAAFN  592
             + ++IP       +  K++LK V+  Q VPR  RIYPLYKEVTRTSG  TETAWAGAAFN
Sbjct  202   ILIIIPHMRGLRSLNTKNLLKFVVFFQYVPRFFRIYPLYKEVTRTSGILTETAWAGAAFN  261

Query  593   LFLYMIASYVAGAIWYITAIERQDKCWRRACEKHGS-CDIDFLYCTKLGRRGGDFSSSFL  769
             LFLYM+AS+V GA WY+ +IER+  CW+ AC    + C  D L C      G    S+FL
Sbjct  262   LFLYMLASHVLGAFWYLFSIEREYTCWKDACRNSSTGCPPDSLSCP-----GDSSVSAFL  316

Query  770   NTSCALLEPENLKADDFDFGIFLDALKSNVVEKRYFWSKLFYCFWWGLRNLSSLGQNLKT  949
             N SC +  P       F+FGIFLDAL+S VVE + F  K FYCFWWGL+NLSSLGQNL+T
Sbjct  317   NQSCPIQTPNTTL---FNFGIFLDALQSGVVESKDFPEKFFYCFWWGLQNLSSLGQNLET  373

Query  950   SNFVGEilfailisiiglilfslligNMQKYLQSITVRVEEMRVKRMDAEQWMSHRMLPD  1129
             S +V EI FA+ +SI GL+LFS LIGNMQ YLQS T R+EEMRVKR DAEQWMSHR+LP+
Sbjct  374   STYVWEICFAVFMSISGLVLFSFLIGNMQTYLQSTTTRLEEMRVKRRDAEQWMSHRLLPE  433

Query  1130  NLRERIRRYEQYRWQETRGVDEESLISNLPKDLRRDINRHLCWSLLKRVHMFKTMDEQLL  1309
             NLRERIRRYEQYRWQETRGVDEE+L+ NLPKDLRRDI RHLC +LL RV MF+ MDEQLL
Sbjct  434   NLRERIRRYEQYRWQETRGVDEENLLRNLPKDLRRDIKRHLCLALLMRVPMFEKMDEQLL  493

Query  1310  DAICDRLKPVLYTEKSCIVREGDPVDEMIFVMRGNLLTMTTNGGRTGFLNSDVLNAGDFC  1489
             DA+CDRLKPVLYTE+S IVREGDPVDEM+F+MRG LLTMTTNGGRTGF NS+ L AGDFC
Sbjct  494   DAMCDRLKPVLYTEESYIVREGDPVDEMLFIMRGKLLTMTTNGGRTGFFNSEYLGAGDFC  553

Query  1490  GEELLTWALDPNSSSSLPISTRTVQALTDVEAFALTADFLKFFASQYRRLHSKQLQHKFR  1669
             GEELLTWALDP+SSS+LPISTRTV+ALT+VEAFAL AD LKF ASQ+RRLHSKQL+H FR
Sbjct  554   GEELLTWALDPHSSSNLPISTRTVRALTEVEAFALMADDLKFVASQFRRLHSKQLRHTFR  613

Query  1670  FYSHQWKTWAACFIQAAWRRHCRNKLEKSLREEEDRLQDALILRMRREEGETTPSLGATI  1849
             FYS QW+TWAACFIQAAWRR+ + KLE+SLREEE+RLQDAL        G ++PSLGATI
Sbjct  614   FYSQQWRTWAACFIQAAWRRYSKKKLEESLREEENRLQDALA-----NAGGSSPSLGATI  668

Query  1850  YASRFAANVLRTVRRNHplsvpklsprlpplllqkpAEPDFSAPEN  1987
             YASRFAAN LR +RRN      +L  R+PP+LLQKPAEPDF+A E+
Sbjct  669   YASRFAANALRALRRNR-TRKARLPERVPPMLLQKPAEPDFTAEEH  713



>ref|XP_002317760.1| cyclic nucleotide-gated channel C family protein [Populus trichocarpa]
 gb|EEE95980.1| cyclic nucleotide-gated channel C family protein [Populus trichocarpa]
Length=709

 Score =   844 bits (2181),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 439/647 (68%), Positives = 519/647 (80%), Gaps = 14/647 (2%)
 Frame = +2

Query  47    KSKMHDPQGPFLQRWNRIFVIACILAATVDPLFFYIPVVDDQNKCLGLDRTLEITACILR  226
             + K+ DPQG FLQ+WN+IFV++C++A ++DPLFFY+PV+DD  KCL LDRT+EITA +LR
Sbjct  76    RKKILDPQGHFLQKWNKIFVLSCLIAVSLDPLFFYVPVIDDGKKCLSLDRTMEITASVLR  135

Query  227   SVFDFFYIFHIILQFRTGFVPPSSRVFGRGDLIVDPSAIAKRYFFSYFFIDILAVLPLPQ  406
             S  D FYI HII QFRTGF+ PSSRVFGRG L+ D  AIAKRY  SYF IDILAVLPLPQ
Sbjct  136   SFTDIFYILHIIFQFRTGFIAPSSRVFGRGVLVEDTWAIAKRYLSSYFLIDILAVLPLPQ  195

Query  407   VVLFMMIPRADRPFIMVAKDILKVVILVQSVPRLLRIYPLYKEVTRTSGFFTETAWAGAA  586
             VV+ ++I +      +  K++LK V++ Q VPR +RIYPLYKEVT TSG  TETAWAGAA
Sbjct  196   VVILIIIRKMAGSRNLNTKNLLKFVVIFQYVPRFMRIYPLYKEVT-TSGILTETAWAGAA  254

Query  587   FNLFLYMIASYVAGAIWYITAIERQDKCWRRACEKHGSCDIDFLYCTKLGRRGGDFSSSF  766
             FNLFLYM+AS+V GA WY+ +IER+  CWR+AC KH  C  + L+C   G  G   + SF
Sbjct  255   FNLFLYMLASHVLGAFWYLFSIERETNCWRQACGKHAGCSRELLFCDTAGSVG---NLSF  311

Query  767   LNTSCALLEPENLKADDFDFGIFLDALKSNVVEKRY-FWSKLFYCFWWGLRNLSSLGQNL  943
             L+  C ++ P       F+FGIFLDAL+S VV     F  K FYCFWWGL+NLSSLGQNL
Sbjct  312   LDNYCPIITPNETV---FNFGIFLDALQSGVVSSSMDFPQKFFYCFWWGLQNLSSLGQNL  368

Query  944   KTSNFVGEilfailisiiglilfslligNMQKYLQSITVRVEEMRVKRMDAEQWMSHRML  1123
             KTS +V EI FA+ ISI GL+LFS LIGNMQ YLQS T R+EEMR+KR DAEQWMSHR+L
Sbjct  369   KTSTYVWEICFAVFISISGLVLFSFLIGNMQTYLQSTTTRLEEMRIKRRDAEQWMSHRLL  428

Query  1124  PDNLRERIRRYEQYRWQETRGVDEESLISNLPKDLRRDINRHLCWSLLKRVHMFKTMDEQ  1303
             PD++RERIRRYEQYRWQETRGVDEE L+ NLPKDLRRDI RHLC +LL RV MF+ MDEQ
Sbjct  429   PDSIRERIRRYEQYRWQETRGVDEEMLVHNLPKDLRRDIKRHLCLALLMRVPMFEKMDEQ  488

Query  1304  LLDAICDRLKPVLYTEKSCIVREGDPVDEMIFVMRGNLLTMTTNGGRTGFLNSDVLNAGD  1483
             LLDA+CDRLKPVLYTE+S IVREGDPVDEM+FVMRG LLT+TTNGGRTGF NS+ L AGD
Sbjct  489   LLDALCDRLKPVLYTEESYIVREGDPVDEMLFVMRGKLLTITTNGGRTGFFNSEYLKAGD  548

Query  1484  FCGEELLTWALDPNSSSSLPISTRTVQALTDVEAFALTADFLKFFASQYRRLHSKQLQHK  1663
             FCGEELLTWALDP SSS+LPISTRTV+ +T+VEAFAL AD LKF ASQ+RRLHSKQL+H 
Sbjct  549   FCGEELLTWALDPQSSSNLPISTRTVRTITEVEAFALMADDLKFVASQFRRLHSKQLRHT  608

Query  1664  FRFYSHQWKTWAACFIQAAWRRHCRNKLEKSLREEEDRLQDALILRMRREEGETTPSLGA  1843
             FRFYS QW+TWAACFIQAAWRR+ + KLE+SLR+EE+RLQDAL      +  E++PSLGA
Sbjct  609   FRFYSQQWRTWAACFIQAAWRRYSKKKLEESLRQEENRLQDALA-----KANESSPSLGA  663

Query  1844  TIYASRFAANVLRTVRRNHplsvpklsprlpplllqkpAEPDFSAPE  1984
             TIYASRFAAN+LR +RR       ++  R+PP+LLQKPAEPDF++ E
Sbjct  664   TIYASRFAANILRALRRGG-NRKARVPDRVPPMLLQKPAEPDFTSEE  709



>ref|XP_002513573.1| Cyclic nucleotide-gated ion channel, putative [Ricinus communis]
 gb|EEF48976.1| Cyclic nucleotide-gated ion channel, putative [Ricinus communis]
Length=838

 Score =   848 bits (2191),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 440/645 (68%), Positives = 518/645 (80%), Gaps = 13/645 (2%)
 Frame = +2

Query  50    SKMHDPQGPFLQRWNRIFVIACILAATVDPLFFYIPVVDDQNKCLGLDRTLEITACILRS  229
             +K+ DPQGPFLQRWN+IFV++C++A ++DPLFFY+PV++D  KCLGLD  +EI A +LR 
Sbjct  81    NKILDPQGPFLQRWNKIFVLSCLIAVSLDPLFFYVPVINDIEKCLGLDSRMEIVASVLRW  140

Query  230   VFDFFYIFHIILQFRTGFVPPSSRVFGRGDLIVDPSAIAKRYFFSYFFIDILAVLPLPQV  409
               D FYI HII QFRTGF+ PSSRVFGRG L+ D   IAKRY  SYF IDILAVLPLPQV
Sbjct  141   FTDIFYIIHIIFQFRTGFIAPSSRVFGRGVLVEDTWEIAKRYLSSYFLIDILAVLPLPQV  200

Query  410   VLFMMIPRADRPFIMVAKDILKVVILVQSVPRLLRIYPLYKEVTRTSGFFTETAWAGAAF  589
             V+ ++IP+      +  K++LK V+L Q +PR +RIYPLYKEVTRTSG  TETAWAGAAF
Sbjct  201   VILIIIPKMKGSRSLNTKNLLKFVVLFQYIPRFMRIYPLYKEVTRTSGILTETAWAGAAF  260

Query  590   NLFLYMIASYVAGAIWYITAIERQDKCWRRACEKHGSCDIDFLYCTKLGRRGGDFSSSFL  769
             NLFLYM+AS+V GA WY+ +IER+  CW++AC+ H  C  D LYC   G + G  + +FL
Sbjct  261   NLFLYMLASHVLGAFWYLVSIERETVCWKKACDDHIGCVRDSLYC---GNQAG-VNKTFL  316

Query  770   NTSCALLEPENLKADDFDFGIFLDALKSNVVEKRYFWSKLFYCFWWGLRNLSSLGQNLKT  949
             + +C +  P     + F+FGIFLDAL+S VV    F  K FYCFWWGLRNLSSLGQNL+T
Sbjct  317   DGACPVQIP---NTEIFNFGIFLDALQSGVVATHDFPKKFFYCFWWGLRNLSSLGQNLET  373

Query  950   SNFVGEilfailisiiglilfslligNMQKYLQSITVRVEEMRVKRMDAEQWMSHRMLPD  1129
             S FV EI FA+ ISI GL+LFS LIGNMQ YLQS T R+EEMRVKR DAEQWMSHR+LP+
Sbjct  374   STFVWEICFAVSISIFGLVLFSFLIGNMQTYLQSTTTRLEEMRVKRRDAEQWMSHRLLPE  433

Query  1130  NLRERIRRYEQYRWQETRGVDEESLISNLPKDLRRDINRHLCWSLLKRVHMFKTMDEQLL  1309
             NLRERIRR+EQY+WQETRGVDEE+L+ NLP+DLRRDI RHLC +LL RV MF+ MDEQLL
Sbjct  434   NLRERIRRHEQYKWQETRGVDEENLVCNLPRDLRRDIKRHLCLALLMRVPMFEKMDEQLL  493

Query  1310  DAICDRLKPVLYTEKSCIVREGDPVDEMIFVMRGNLLTMTTNGGRTGFLNSDVLNAGDFC  1489
             DA+CDRLKP LYTE+S IVREGDPVDEM+F+MRG LLTMTTNGGRTGF NS+ L AGDFC
Sbjct  494   DAMCDRLKPALYTEESYIVREGDPVDEMLFIMRGKLLTMTTNGGRTGFFNSEYLKAGDFC  553

Query  1490  GEELLTWALDPNSSSSLPISTRTVQALTDVEAFALTADFLKFFASQYRRLHSKQLQHKFR  1669
             GEELLTWALDPNSSS+LPISTRTVQ LT+VEAFAL AD LKF ASQ+RRLHSKQL+H FR
Sbjct  554   GEELLTWALDPNSSSNLPISTRTVQTLTEVEAFALMADDLKFVASQFRRLHSKQLRHTFR  613

Query  1670  FYSHQWKTWAACFIQAAWRRHCRNKLEKSLREEEDRLQDALILRMRREEGETTPSLGATI  1849
             FYS QW+TWAACFIQAAWRR+ + KLE+SLR+EE+RLQDAL      +    +PSLGATI
Sbjct  614   FYSQQWRTWAACFIQAAWRRYSKKKLEESLRQEENRLQDALA-----KTSGNSPSLGATI  668

Query  1850  YASRFAANVLRTVRRNHplsvpklsprlpplllqkpAEPDFSAPE  1984
             YASRFAAN LR +RR       +L  R+PP+LLQKPAEPDF+A E
Sbjct  669   YASRFAANALRALRRTG-TRKARLLERVPPMLLQKPAEPDFTAEE  712



>ref|XP_010445559.1| PREDICTED: cyclic nucleotide-gated ion channel 1-like [Camelina 
sativa]
Length=716

 Score =   843 bits (2177),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 441/643 (69%), Positives = 529/643 (82%), Gaps = 12/643 (2%)
 Frame = +2

Query  53    KMHDPQGPFLQRWNRIFVIACILAATVDPLFFYIPVVDDQNKCLGLDRTLEITACILRSV  232
             K+ DPQGPFLQRWN+IFV+ACI+A ++DPLFFY+P++DD  KCLG+D+ +EITA +LRS 
Sbjct  83    KILDPQGPFLQRWNKIFVLACIIAVSLDPLFFYVPIIDDAKKCLGIDKKMEITASVLRSF  142

Query  233   FDFFYIFHIILQFRTGFVPPSSRVFGRGDLIVDPSAIAKRYFFSYFFIDILAVLPLPQVV  412
              D FYI HII QFRTGF+ PSSRVFGRG L+ D   IAKRY  S+F IDILAVLPLPQ++
Sbjct  143   TDVFYIIHIIFQFRTGFIAPSSRVFGRGVLVEDKRQIAKRYLSSHFIIDILAVLPLPQMM  202

Query  413   LFMMIPRADRPFIMVAKDILKVVILVQSVPRLLRIYPLYKEVTRTSGFFTETAWAGAAFN  592
             + + IP       +  K++LK ++  Q +PR +RIYPLYKEVTRTSG  TETAWAGAAFN
Sbjct  203   ILIFIPHMRGSLSLNTKNMLKFIVFFQYIPRFIRIYPLYKEVTRTSGILTETAWAGAAFN  262

Query  593   LFLYMIASYVAGAIWYITAIERQDKCWRRACEKHGS-CDIDFLYCTKLGRRGGDFSSSFL  769
             LFLYM+AS+V GA WY+ +IER+  CW++AC++    C+  +LYC    R G    ++FL
Sbjct  263   LFLYMLASHVFGAFWYLFSIERETVCWKQACKRRTHLCNPKYLYCDHKSRGG----NAFL  318

Query  770   NTSCALLEPENLKADDFDFGIFLDALKSNVVEKRYFWSKLFYCFWWGLRNLSSLGQNLKT  949
             N SC +  P    A  FDFGIFLDAL+S VVE + F  K FYCFWWGL+NLSSLGQNLKT
Sbjct  319   NESCPIQTPN---ATLFDFGIFLDALQSGVVESQDFPQKFFYCFWWGLQNLSSLGQNLKT  375

Query  950   SNFVGEilfailisiiglilfslligNMQKYLQSITVRVEEMRVKRMDAEQWMSHRMLPD  1129
             S +V EI FA+ ISI GL+LFS LIGNMQ YLQS T R+EEMRVKR DAEQWMSHR+LP+
Sbjct  376   STYVWEICFAVFISIAGLVLFSFLIGNMQTYLQSTTTRLEEMRVKRRDAEQWMSHRLLPE  435

Query  1130  NLRERIRRYEQYRWQETRGVDEESLISNLPKDLRRDINRHLCWSLLKRVHMFKTMDEQLL  1309
             NLR+RIRRYEQY+WQETRGVDEE+L+SNLPKDLRRDI RHLC +LL RV MF+TMDEQLL
Sbjct  436   NLRKRIRRYEQYKWQETRGVDEENLLSNLPKDLRRDIKRHLCLALLMRVPMFETMDEQLL  495

Query  1310  DAICDRLKPVLYTEKSCIVREGDPVDEMIFVMRGNLLTMTTNGGRTGFLNSDVLNAGDFC  1489
             DA+CDRL+PVLYTE+S IVREGDPVDEM+F+MRG LLTMTTNGGRTGF NS+ L AGDFC
Sbjct  496   DALCDRLQPVLYTEESYIVREGDPVDEMLFIMRGKLLTMTTNGGRTGFFNSEYLGAGDFC  555

Query  1490  GEELLTWALDPNSSSSLPISTRTVQALTDVEAFALTADFLKFFASQYRRLHSKQLQHKFR  1669
             GEELLTWALDP++SS+LPISTRTV+AL +VEAFAL AD LKF ASQ+RRLHSKQL+H FR
Sbjct  556   GEELLTWALDPHTSSNLPISTRTVRALMEVEAFALKADDLKFVASQFRRLHSKQLRHTFR  615

Query  1670  FYSHQWKTWAACFIQAAWRRHCRNKLEKSLREEEDRLQDALILRMRREEGETTPSLGATI  1849
             FYS QW+TWAACFIQAAWRR+ + KLE+SL+EEE+RLQDAL     +E G ++PSLGATI
Sbjct  616   FYSQQWRTWAACFIQAAWRRYIKKKLEESLKEEENRLQDALA----KEAGGSSPSLGATI  671

Query  1850  YASRFAANVLRTVRRNHplsvpklsprlpplllqkpAEPDFSA  1978
             YASRFAAN+LRT+RR+  +  P++  R+PP+LLQKPAEPDF++
Sbjct  672   YASRFAANILRTIRRSGSVRKPRMPERMPPMLLQKPAEPDFNS  714



>ref|XP_010261582.1| PREDICTED: cyclic nucleotide-gated ion channel 1 [Nelumbo nucifera]
 ref|XP_010261584.1| PREDICTED: cyclic nucleotide-gated ion channel 1 [Nelumbo nucifera]
Length=719

 Score =   841 bits (2173),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 446/648 (69%), Positives = 520/648 (80%), Gaps = 14/648 (2%)
 Frame = +2

Query  47    KSKMHDPQGPFLQRWNRIFVIACILAATVDPLFFYIPVV--DDQNKCLGLDRTLEITACI  220
             + K+ DPQ PFLQRWN+IFV++C++A ++DPLFFYIPV+   D+ KCL LD+ LEITA +
Sbjct  83    RRKVLDPQEPFLQRWNKIFVLSCVVAISLDPLFFYIPVIYHKDEKKCLDLDKKLEITASV  142

Query  221   LRSVFDFFYIFHIILQFRTGFVPPSSRVFGRGDLIVDPSAIAKRYFFSYFFIDILAVLPL  400
             LRS  D FY+ HII QF TGF+ P SRVFGRG L+ DP AIAKRY  SYF IDILAVLPL
Sbjct  143   LRSFTDIFYLLHIIFQFNTGFIAPYSRVFGRGVLVKDPLAIAKRYLSSYFLIDILAVLPL  202

Query  401   PQVVLFMMIPRADRPFIMVAKDILKVVILVQSVPRLLRIYPLYKEVTRTSGFFTETAWAG  580
             PQVV+ ++IP       +  K++LK+V+L+Q VPRLLRIYPLYKEVTRTSG  TETAWA 
Sbjct  203   PQVVILIVIPNLQSSNSLNTKNLLKIVVLLQYVPRLLRIYPLYKEVTRTSGIITETAWAA  262

Query  581   AAFNLFLYMIASYVAGAIWYITAIERQDKCWRRACEKHGSCDIDFLYCTKLGRRGGDFSS  760
             AAFNLFLYM+AS+V GA+WY+ +IER+D CWRRAC     C  + LYC    + G     
Sbjct  263   AAFNLFLYMLASHVLGALWYLFSIEREDACWRRACGNDTVCR-ENLYCGGEAKTG--VRV  319

Query  761   SFLNTSCALLEPENLKADDFDFGIFLDALKSNVVEKRYFWSKLFYCFWWGLRNLSSLGQN  940
             SFLN SC +    +     FDFGIFLDAL+S VVE   F  KLFYCFWWGLRNLSSLGQN
Sbjct  320   SFLNDSCPI---SDKNTTFFDFGIFLDALQSEVVESSNFLQKLFYCFWWGLRNLSSLGQN  376

Query  941   LKTSNFVGEilfailisiiglilfslligNMQKYLQSITVRVEEMRVKRMDAEQWMSHRM  1120
             LKTS FV EI FA+ ISI GL+LFSLLIGNMQ YLQSITVR+EEMRVKR D EQWMSHR+
Sbjct  377   LKTSTFVWEICFAVFISIFGLVLFSLLIGNMQTYLQSITVRLEEMRVKRRDGEQWMSHRL  436

Query  1121  LPDNLRERIRRYEQYRWQETRGVDEESLISNLPKDLRRDINRHLCWSLLKRVHMFKTMDE  1300
             LPD LRERIRRY+ Y+WQETRGVDE++L+ NLPKDLRRDI RHLC  LLKRV +F+ MDE
Sbjct  437   LPDGLRERIRRYDHYKWQETRGVDEDNLLRNLPKDLRRDIKRHLCLDLLKRVPIFEKMDE  496

Query  1301  QLLDAICDRLKPVLYTEKSCIVREGDPVDEMIFVMRGNLLTMTTNGGRTGFLNSDVLNAG  1480
             QLLDA+CD LKPVLY ++S IVREGDPVDEM+F+MRG L + TTNGGRTGF NSD L AG
Sbjct  497   QLLDAMCDGLKPVLYPKESYIVREGDPVDEMLFIMRGKLWSETTNGGRTGFFNSDYLKAG  556

Query  1481  DFCGEELLTWALDPNSSSSLPISTRTVQALTDVEAFALTADFLKFFASQYRRLHSKQLQH  1660
             DFCGEELLTWALDP+SSS+LPISTRTV+ALT+VEAF+L AD LKF ASQ+RRLHSKQL+H
Sbjct  557   DFCGEELLTWALDPHSSSNLPISTRTVRALTEVEAFSLMADDLKFVASQFRRLHSKQLRH  616

Query  1661  KFRFYSHQWKTWAACFIQAAWRRHCRNKLEKSLREEEDRLQDALILRMRREEGETTPSLG  1840
              FRFYS QW+TWAACFIQAAWRR+C+ KLE+SLR+EEDRLQDAL      +   ++PSLG
Sbjct  617   TFRFYSQQWRTWAACFIQAAWRRYCKKKLEESLRQEEDRLQDALA-----KGVGSSPSLG  671

Query  1841  ATIYASRFAANVLRTVRRNHplsvpklsprlpplllqkpAEPDFSAPE  1984
             ATIYASRFAAN LR ++RN      +L  R+PP+LLQKPAEPDFSA +
Sbjct  672   ATIYASRFAANALRLLKRNG-ARKARLPERVPPMLLQKPAEPDFSAED  718



>gb|KHG10918.1| Cyclic nucleotide-gated ion channel 1 -like protein [Gossypium 
arboreum]
Length=708

 Score =   841 bits (2172),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 439/646 (68%), Positives = 517/646 (80%), Gaps = 16/646 (2%)
 Frame = +2

Query  53    KMHDPQGPFLQRWNRIFVIACILAATVDPLFFYIPVVDDQNKCLGLDRTLEITACILRSV  232
             K+ DPQGPFLQRWN+IF+++CI+A ++DPLFFY+PV++D  KCL LD  +EITA +LRS 
Sbjct  78    KVLDPQGPFLQRWNKIFLLSCIIAVSIDPLFFYVPVINDDKKCLVLDEKMEITASVLRSF  137

Query  233   FDFFYIFHIILQFRTGFVPPSSRVFGRGDLIVDPSAIAKRYFFSYFFIDILAVLPLPQVV  412
              D FYI HII QFRTGF+ PSSRVFGRG L+ D  AIAKRY  SYF ID+LAVLPLPQVV
Sbjct  138   TDIFYIIHIIFQFRTGFIAPSSRVFGRGVLVEDLLAIAKRYLKSYFVIDVLAVLPLPQVV  197

Query  413   LFMMIPRADRPFIMVAKDILKVVILVQSVPRLLRIYPLYKEVTRTSGFFTETAWAGAAFN  592
             + ++IP+      +  K++L  ++L Q +PR+ RIYPLYKE+TRTSG  TETAWAGAAFN
Sbjct  198   ILIIIPQMRGLKSLNTKNLLTFIVLFQYLPRVFRIYPLYKEITRTSGILTETAWAGAAFN  257

Query  593   LFLYMIASYVAGAIWYITAIERQDKCWRRACEKHGSCDIDFLYCTKLGRRGGDFS-SSFL  769
             LFLYM+AS+V GA WY+ +IER+  CW+ AC  +  C+    YC       GD S S FL
Sbjct  258   LFLYMLASHVFGAFWYLFSIEREYTCWKDACRNNTKCNPRSFYC------DGDSSFSMFL  311

Query  770   NTSCALLEPENLKADDFDFGIFLDALKSNVVEKRYFWSKLFYCFWWGLRNLSSLGQNLKT  949
             + SC +  P       F+FGIFL+AL+S VVE   F  K FYCFWWGL+NLSSLGQNL+T
Sbjct  312   HQSCPIQTPNTTL---FNFGIFLNALQSGVVESENFPEKFFYCFWWGLQNLSSLGQNLET  368

Query  950   SNFVGEilfailisiiglilfslligNMQKYLQSITVRVEEMRVKRMDAEQWMSHRMLPD  1129
             S +V EI FA+ ISI GL+LFS LIGNMQ YLQS T R+EEMRVKR DAEQWMSHR+LP+
Sbjct  369   STYVFEICFAVFISISGLVLFSFLIGNMQTYLQSTTTRLEEMRVKRRDAEQWMSHRLLPE  428

Query  1130  NLRERIRRYEQYRWQETRGVDEESLISNLPKDLRRDINRHLCWSLLKRVHMFKTMDEQLL  1309
             NLRERIRRYEQY+WQETRGVDEE+L+ NLPKDLRRDI RHLC +LL RV MF+ MDEQLL
Sbjct  429   NLRERIRRYEQYKWQETRGVDEENLLCNLPKDLRRDIKRHLCLALLMRVPMFEKMDEQLL  488

Query  1310  DAICDRLKPVLYTEKSCIVREGDPVDEMIFVMRGNLLTMTTNGGRTGFLNSDVLNAGDFC  1489
             DA+CDRLKPVLYTE+S IVREGDPVDEM+F+MRG LLTMTTNGGRTGF NS+ + AGDFC
Sbjct  489   DAMCDRLKPVLYTEESYIVREGDPVDEMLFIMRGKLLTMTTNGGRTGFFNSEYIGAGDFC  548

Query  1490  GEELLTWALDPNSSSSLPISTRTVQALTDVEAFALTADFLKFFASQYRRLHSKQLQHKFR  1669
             GEELLTWALDP+SSS+LPISTRTV+ALT+VEAFAL AD LKF ASQ+RRLHSKQL+H FR
Sbjct  549   GEELLTWALDPHSSSNLPISTRTVRALTEVEAFALVADDLKFVASQFRRLHSKQLRHTFR  608

Query  1670  FYSHQWKTWAACFIQAAWRRHCRNKLEKSLREEEDRLQDALILRMRREEGETTPSLGATI  1849
             FYS QW+TWAACFIQAAWRR+ + KLE+SLREEEDRLQDAL          ++PSLGATI
Sbjct  609   FYSQQWRTWAACFIQAAWRRYSKKKLEESLREEEDRLQDALA-----NASGSSPSLGATI  663

Query  1850  YASRFAANVLRTVRRNHplsvpklsprlpplllqkpAEPDFSAPEN  1987
             YASRFAAN LR +RRN      ++  R+PP+LLQKPAEPDF+A E 
Sbjct  664   YASRFAANALRALRRNR-SRKTRVLERVPPMLLQKPAEPDFTAEEQ  708



>ref|XP_011010453.1| PREDICTED: cyclic nucleotide-gated ion channel 1-like [Populus 
euphratica]
 ref|XP_011010454.1| PREDICTED: cyclic nucleotide-gated ion channel 1-like [Populus 
euphratica]
Length=708

 Score =   839 bits (2168),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 436/647 (67%), Positives = 518/647 (80%), Gaps = 15/647 (2%)
 Frame = +2

Query  47    KSKMHDPQGPFLQRWNRIFVIACILAATVDPLFFYIPVVDDQNKCLGLDRTLEITACILR  226
             + K+ DPQGPFLQRWN+IFV++C++A ++DPLFFY+PV+DD+ KCL LD T+EITA +LR
Sbjct  76    RQKILDPQGPFLQRWNKIFVLSCVIAVSLDPLFFYVPVIDDKKKCLSLDNTMEITASVLR  135

Query  227   SVFDFFYIFHIILQFRTGFVPPSSRVFGRGDLIVDPSAIAKRYFFSYFFIDILAVLPLPQ  406
             S  D FY+ HII +FRTGF+ PSSRVFGRG L+ D  AIAKRY  SYF IDILAVLPLPQ
Sbjct  136   SFTDIFYMLHIIFEFRTGFIAPSSRVFGRGVLVEDTWAIAKRYLSSYFLIDILAVLPLPQ  195

Query  407   VVLFMMIPRADRPFIMVAKDILKVVILVQSVPRLLRIYPLYKEVTRTSGFFTETAWAGAA  586
             VV+ ++IP+      +  K++LK V++ Q VPR +RIYPLYKEVT TSG  T TAWAGAA
Sbjct  196   VVILIIIPKMGGSSYLNTKNLLKFVVIFQYVPRFVRIYPLYKEVT-TSGILTATAWAGAA  254

Query  587   FNLFLYMIASYVAGAIWYITAIERQDKCWRRACEKHGSCDIDFLYCTKLGRRGGDFSSSF  766
             FNLFLYM+AS+V GA WY+ +IER+  CWR+AC K+  C+ D L+C     RG     +F
Sbjct  255   FNLFLYMLASHVLGAFWYLFSIERETNCWRKACGKNSGCNRDLLFCD----RGFVGDVTF  310

Query  767   LNTSCALLEPENLKADDFDFGIFLDALKSNVV-EKRYFWSKLFYCFWWGLRNLSSLGQNL  943
             L+  C +  P       F+FGIFLDAL+S VV     F  K FYCFWWGL+NLSSLGQNL
Sbjct  311   LDDYCPIQTPNE---TIFNFGIFLDALQSGVVLSSMDFPQKFFYCFWWGLQNLSSLGQNL  367

Query  944   KTSNFVGEilfailisiiglilfslligNMQKYLQSITVRVEEMRVKRMDAEQWMSHRML  1123
             +TS +V EI FA+ ISI GL+LFS LIGNMQ YLQS T R+EEMR+KR DAEQWMSHR+L
Sbjct  368   QTSTYVWEICFAVFISISGLVLFSFLIGNMQTYLQSTTTRLEEMRIKRRDAEQWMSHRLL  427

Query  1124  PDNLRERIRRYEQYRWQETRGVDEESLISNLPKDLRRDINRHLCWSLLKRVHMFKTMDEQ  1303
             PDN++ERIRRYEQYRWQETRGVDEE+L+ NLPKDLRRDI RHLC +LL RV MF+ MDEQ
Sbjct  428   PDNIKERIRRYEQYRWQETRGVDEETLVHNLPKDLRRDIKRHLCLALLMRVPMFEKMDEQ  487

Query  1304  LLDAICDRLKPVLYTEKSCIVREGDPVDEMIFVMRGNLLTMTTNGGRTGFLNSDVLNAGD  1483
             LLDA+CDRLKP LYTE+S IVREGDPVDEM+FVMRG LLTMTTNGGRTGF NS+ L AGD
Sbjct  488   LLDAMCDRLKPALYTEESYIVREGDPVDEMLFVMRGKLLTMTTNGGRTGFFNSEYLKAGD  547

Query  1484  FCGEELLTWALDPNSSSSLPISTRTVQALTDVEAFALTADFLKFFASQYRRLHSKQLQHK  1663
             FCGEELLTWALDP+SSS+LPISTRTV+ +T+VEAFAL AD LKF ASQ+RRLHSKQL+H 
Sbjct  548   FCGEELLTWALDPHSSSNLPISTRTVRTITEVEAFALMADDLKFVASQFRRLHSKQLRHT  607

Query  1664  FRFYSHQWKTWAACFIQAAWRRHCRNKLEKSLREEEDRLQDALILRMRREEGETTPSLGA  1843
             FRFYS QW+TWAACFIQAAWRR+ + KLE+SLR+EE+RLQDAL      +   ++PSLGA
Sbjct  608   FRFYSQQWRTWAACFIQAAWRRYSKKKLEESLRQEENRLQDALA-----KASASSPSLGA  662

Query  1844  TIYASRFAANVLRTVRRNHplsvpklsprlpplllqkpAEPDFSAPE  1984
             TIYASRFAAN LR +RR       ++  R+PP+LLQKPAEPDF+A E
Sbjct  663   TIYASRFAANALRALRRGG-NRKSRVPDRVPPMLLQKPAEPDFTAEE  708



>ref|XP_006345559.1| PREDICTED: cyclic nucleotide-gated ion channel 1-like isoform 
X1 [Solanum tuberosum]
 ref|XP_006345560.1| PREDICTED: cyclic nucleotide-gated ion channel 1-like isoform 
X2 [Solanum tuberosum]
Length=723

 Score =   839 bits (2168),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 438/652 (67%), Positives = 529/652 (81%), Gaps = 15/652 (2%)
 Frame = +2

Query  47    KSKMHDPQGPFLQRWNRIFVIACILAATVDPLFFYIPVVDDQNKCLGLDRTLEITACILR  226
             K K+HDPQG FLQ+WN++FV+ CI+A ++DPLFFYIPV+D+  KCL LDRTL+ITAC+LR
Sbjct  85    KKKVHDPQGRFLQQWNKVFVLVCIIAVSLDPLFFYIPVIDNDKKCLDLDRTLKITACVLR  144

Query  227   SVFDFFYIFHIILQFRTGFVPPSSRVFGRGDLIVDPSAIAKRYFFSYFFIDILAVLPLPQ  406
             S+ D FYIFHIILQFRTG++ P SR+FGRG+L+ D   IAKRY  S+F +D++AVLPLPQ
Sbjct  145   SITDLFYIFHIILQFRTGYIAPPSRIFGRGELVEDSYDIAKRYLLSHFIVDVVAVLPLPQ  204

Query  407   VVLFMMIPRADRPFIMVAKDILKVVILVQSVPRLLRIYPLYKEVTRTSGFFTETAWAGAA  586
             +V+ ++ P A+    +  K++LK+VI  Q  PR+ RIYPL KEVTRTSG FTE+AW GA 
Sbjct  205   IVILVVTPNANGSIALATKEMLKIVIFAQYFPRIFRIYPLCKEVTRTSGLFTESAWGGAV  264

Query  587   FNLFLYMIASYVAGAIWYITAIERQDKCWRRACEKHGSCDIDFLYCTKLGRRGGDFSSSF  766
             FNL LYM+AS V GA WY+ ++ERQD CWR AC K   C +D+LYC K        ++S 
Sbjct  265   FNLSLYMLASNVIGAFWYLFSVERQDTCWRNACAKIRGCSLDYLYCVKSSIE----NASL  320

Query  767   LNTSCALLEPENLKADD-FDFGIFLDALKSNVVEKRYFWSKLFYCFWWGLRNLSSLGQNL  943
             LN+SC L++ E++   + FDFGI LDAL+  +VEKR FW+KLFYCFWWGLRNLSSLGQNL
Sbjct  321   LNSSCPLVKQEDIHDPNVFDFGIALDALQFRIVEKRKFWTKLFYCFWWGLRNLSSLGQNL  380

Query  944   KTSNFVGEilfailisiiglilfslligNMQKYLQSITVRVEEMRVKRMDAEQWMSHRML  1123
             KTS FVGEILFA+ ISIIGLILFSLLIGNMQKYLQSITVRVEEMRV+R DAEQWMSHRML
Sbjct  381   KTSTFVGEILFAVFISIIGLILFSLLIGNMQKYLQSITVRVEEMRVRRRDAEQWMSHRML  440

Query  1124  PDNLRERIRRYEQYRWQETRGVDEESLISNLPKDLRRDINRHLCWSLLKRVHMFKTMDEQ  1303
             PDNL+ERIRR+EQY+WQETRGV+E+ L+ +LP+DLRRD+ RHLCWS LK+V +F+ MD+Q
Sbjct  441   PDNLKERIRRHEQYKWQETRGVEEDLLLQDLPRDLRRDLKRHLCWSFLKKVPIFEKMDDQ  500

Query  1304  LLDAICDRLKPVLYTEKSCIVREGDPVDEMIFVMRGNLLTMTTNGGRTGFLNSDVLNAGD  1483
             LLDA+CDRLKP L+T+KS I+REGDPV+EM+F+MRG LLTMTTNGGRTGF NS  L AG 
Sbjct  501   LLDALCDRLKPALFTDKSFIIREGDPVEEMLFLMRGTLLTMTTNGGRTGFFNSVHLKAGG  560

Query  1484  FCGEELLTWALDPN-SSSSLPISTRTVQALTDVEAFALTADFLKFFASQYRRLHSKQLQH  1660
             FCG+ELLTWALDP+ SSSSLPISTRTVQA+TD+EAFA+TAD LKF A+Q+RRL+SKQ++H
Sbjct  561   FCGDELLTWALDPHPSSSSLPISTRTVQAVTDIEAFAVTADDLKFVAAQFRRLNSKQIRH  620

Query  1661  KFRFYSHQWKTWAACFIQAAWRRHCRNKLEKSLREEEDRLQDALILRMRREEGETTPSLG  1840
              F+F S  W+TW ACFIQ AWRR+CRNKLEKSLREEEDRLQ AL      +E   T SLG
Sbjct  621   TFKFCSQHWRTWGACFIQVAWRRYCRNKLEKSLREEEDRLQAALA-----KENTNTTSLG  675

Query  1841  ATIYASRFAANVLRTVRRNHplsvpklsprlpplllqkpAEPDFSAPENNNA  1996
             ATIYASRFAAN LR +RR H  +         PLLL KP+EPDFS  E N++
Sbjct  676   ATIYASRFAANALRALRRKH--ATGAKLSPTLPLLLHKPSEPDFS--EENDS  723



>gb|KHN04121.1| Cyclic nucleotide-gated ion channel 1 [Glycine soja]
Length=661

 Score =   837 bits (2161),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 439/649 (68%), Positives = 517/649 (80%), Gaps = 13/649 (2%)
 Frame = +2

Query  47    KSKMHDPQGPFLQRWNRIFVIACILAATVDPLFFYIPVVDDQNKCLGLDRTLEITACILR  226
             + K+ DPQGPFLQ+WN+IFV+ C++A ++DPLFFY+PV++D  KCL LD  +EITA +LR
Sbjct  24    RKKILDPQGPFLQKWNKIFVLLCVIAVSLDPLFFYVPVIEDAKKCLSLDSKMEITATVLR  83

Query  227   SVFDFFYIFHIILQFRTGFVPPSSRVFGRGDLIVDPSAIAKRYFFSYFFIDILAVLPLPQ  406
             S  D  YI H+I QFRTGF+ PSSRVFGRG L+ D  AIA+RY  SYF IDILAVLPLPQ
Sbjct  84    SFSDALYIIHMIFQFRTGFIAPSSRVFGRGVLVEDSWAIARRYLSSYFIIDILAVLPLPQ  143

Query  407   VVLFMMIPRADRPFIMVAKDILKVVILVQSVPRLLRIYPLYKEVTRTSGFFTETAWAGAA  586
             VV+ ++IP       +  K++LK V+ +Q VPRLLRI PLY EVTRTSG  TETAWAGAA
Sbjct  144   VVILVIIPEMSGFKSLNTKNLLKFVVFLQYVPRLLRIIPLYNEVTRTSGILTETAWAGAA  203

Query  587   FNLFLYMIASYVAGAIWYITAIERQDKCWRRACEKHGS-CDIDFLYCTK-LGRRGGDFSS  760
             FNLFLYM+AS+V GA WY+ +IER+  CW+ AC+++ + C+   +YC   LG  G    S
Sbjct  204   FNLFLYMLASHVVGAFWYLFSIERETTCWQEACQRNTTVCNKADMYCNDYLG--GLSKIS  261

Query  761   SFLNTSCALLEPENLKADDFDFGIFLDALKSNVVEKRYFWSKLFYCFWWGLRNLSSLGQN  940
             +FL+TSC +   +N     FDFGIFLDAL+S VVE R F  K FYCFWWGL+NLSSLGQN
Sbjct  262   AFLSTSCPI---QNEDKKLFDFGIFLDALQSGVVESRDFPQKFFYCFWWGLKNLSSLGQN  318

Query  941   LKTSNFVGEilfailisiiglilfslligNMQKYLQSITVRVEEMRVKRMDAEQWMSHRM  1120
             L TS +V EI FA+ IS+ GL+LFS LIGNMQ YLQS T R+EEMRVKR DAEQWMSHR+
Sbjct  319   LATSTYVWEISFAVFISVSGLVLFSFLIGNMQTYLQSTTTRLEEMRVKRRDAEQWMSHRL  378

Query  1121  LPDNLRERIRRYEQYRWQETRGVDEESLISNLPKDLRRDINRHLCWSLLKRVHMFKTMDE  1300
             LPD LRERIRRYEQYRWQETRGVDE++LI NLPKDLRRDI RHLC +LL RV MF+ MDE
Sbjct  379   LPDGLRERIRRYEQYRWQETRGVDEDNLIRNLPKDLRRDIKRHLCLALLMRVPMFEKMDE  438

Query  1301  QLLDAICDRLKPVLYTEKSCIVREGDPVDEMIFVMRGNLLTMTTNGGRTGFLNSDVLNAG  1480
             QLLDA+CD LKPVLYTE+S IVREGDPVDEM+F+MRG LLTMTTNGGRTGF NS+ L AG
Sbjct  439   QLLDAMCDLLKPVLYTEESYIVREGDPVDEMLFIMRGKLLTMTTNGGRTGFFNSEYLKAG  498

Query  1481  DFCGEELLTWALDPNSSSSLPISTRTVQALTDVEAFALTADFLKFFASQYRRLHSKQLQH  1660
             DFCGEELLTWALDP+SS +LP STRTVQ L++VEAFAL AD LKF ASQ+RRLHSKQL+H
Sbjct  499   DFCGEELLTWALDPHSSPNLPTSTRTVQTLSEVEAFALKADDLKFVASQFRRLHSKQLRH  558

Query  1661  KFRFYSHQWKTWAACFIQAAWRRHCRNKLEKSLREEEDRLQDALILRMRREEGETTPSLG  1840
              FRFYS QW+TWAACFIQAAWRR+ + KLE+SL EEE+RLQDAL      + G ++PSLG
Sbjct  559   TFRFYSQQWRTWAACFIQAAWRRYSKRKLEESLVEEENRLQDALA-----KAGGSSPSLG  613

Query  1841  ATIYASRFAANVLRTVRRNHplsvpklsprlpplllqkpAEPDFSAPEN  1987
             ATIYASRFAAN LR +RRN      ++  RLPP+L QKPAEPDF+A E 
Sbjct  614   ATIYASRFAANALRLLRRNG-TKKGRVPERLPPMLPQKPAEPDFTADEE  661



>ref|XP_011084497.1| PREDICTED: cyclic nucleotide-gated ion channel 1-like [Sesamum 
indicum]
Length=713

 Score =   838 bits (2166),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 435/647 (67%), Positives = 519/647 (80%), Gaps = 13/647 (2%)
 Frame = +2

Query  47    KSKMHDPQGPFLQRWNRIFVIACILAATVDPLFFYIPVVDDQNKCLGLDRTLEITACILR  226
             + K+ DPQG FLQ+WN++FV++C++A ++DPLFFYIP+++   KCL LD  LE+ A ILR
Sbjct  80    RKKILDPQGSFLQKWNKVFVLSCVIAISLDPLFFYIPIINGDKKCLDLDWKLELAASILR  139

Query  227   SVFDFFYIFHIILQFRTGFVPPSSRVFGRGDLIVDPSAIAKRYFFSYFFIDILAVLPLPQ  406
             S  D FY+ HII QFRTGF+ PSSRVFGRG L+ D   IAKRY  SYF IDILAVLPLPQ
Sbjct  140   SFTDVFYLIHIIFQFRTGFIAPSSRVFGRGVLVEDSWEIAKRYVSSYFIIDILAVLPLPQ  199

Query  407   VVLFMMIPRADRPFIMVAKDILKVVILVQSVPRLLRIYPLYKEVTRTSGFFTETAWAGAA  586
             +V+ ++IP+ +    +  K++LK V+++Q +PR+LR+YPLYKEVTRTSG  TETAWAGAA
Sbjct  200   IVILIIIPKLEGARSLNTKNLLKFVVILQYIPRVLRVYPLYKEVTRTSGILTETAWAGAA  259

Query  587   FNLFLYMIASYVAGAIWYITAIERQDKCWRRACEKHGSCDIDFLYCTKLGRRGGDFSSSF  766
             FNLFLYM+AS+V GA +Y+ +IER+  CW RAC    +C    +YC     R G   +  
Sbjct  260   FNLFLYMLASHVIGAAYYLLSIERETTCWVRACGDRSACRNTIVYCD--ADRTGFIQT--  315

Query  767   LNTSCALLEPENLKADDFDFGIFLDALKSNVVEKRYFWSKLFYCFWWGLRNLSSLGQNLK  946
             LN SC +  P+      FDFGIFL+AL+S VVE + F  K FYCFWWGL+NLSSLGQNLK
Sbjct  316   LNQSCPIQTPDT---TIFDFGIFLNALQSGVVESKDFPQKFFYCFWWGLQNLSSLGQNLK  372

Query  947   TSNFVGEilfailisiiglilfslligNMQKYLQSITVRVEEMRVKRMDAEQWMSHRMLP  1126
             TS FV EI FA+ ISI GL+LFS LIGNMQ YLQS T+R+EEMRVKR DAEQWMSHR+LP
Sbjct  373   TSTFVWEICFAVFISISGLVLFSFLIGNMQTYLQSTTLRLEEMRVKRRDAEQWMSHRLLP  432

Query  1127  DNLRERIRRYEQYRWQETRGVDEESLISNLPKDLRRDINRHLCWSLLKRVHMFKTMDEQL  1306
             ++LRERIRRYEQY+WQETRGVDEE+LI NLPKDLRRDI RHLC +LLKRV MF+ MD+QL
Sbjct  433   ESLRERIRRYEQYKWQETRGVDEENLIHNLPKDLRRDIKRHLCLALLKRVPMFEKMDDQL  492

Query  1307  LDAICDRLKPVLYTEKSCIVREGDPVDEMIFVMRGNLLTMTTNGGRTGFLNSDVLNAGDF  1486
             LDA+ DRLKPVLYT+ S IVREGDPVDEM+F+MRG LLT+TTNGGRTGF NSD L AGDF
Sbjct  493   LDAMSDRLKPVLYTDDSYIVREGDPVDEMLFIMRGKLLTVTTNGGRTGFFNSDYLKAGDF  552

Query  1487  CGEELLTWALDPNSSSSLPISTRTVQALTDVEAFALTADFLKFFASQYRRLHSKQLQHKF  1666
             CGEELLTWALDP+SSS+LPISTRTVQAL++VEAFAL AD LKF ASQ+RRLHSKQL+H F
Sbjct  553   CGEELLTWALDPHSSSNLPISTRTVQALSEVEAFALMADDLKFVASQFRRLHSKQLRHTF  612

Query  1667  RFYSHQWKTWAACFIQAAWRRHCRNKLEKSLREEEDRLQDALILRMRREEGETTPSLGAT  1846
             RFYS QW+TWAACFIQAAWRR+CR KLE+SLREEE+RLQDAL      +   ++PSLGAT
Sbjct  613   RFYSQQWRTWAACFIQAAWRRYCRKKLEESLREEENRLQDALA-----KGSTSSPSLGAT  667

Query  1847  IYASRFAANVLRTVRRNHplsvpklsprlpplllqkpAEPDFSAPEN  1987
             IYASRFAAN LR +RRN      ++  R+ P+LLQKPAEPDF+A E 
Sbjct  668   IYASRFAANALRALRRNS-TRKTRMPERISPMLLQKPAEPDFTAEEK  713



>ref|XP_010482698.1| PREDICTED: cyclic nucleotide-gated ion channel 1 [Camelina sativa]
Length=717

 Score =   838 bits (2166),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 441/644 (68%), Positives = 528/644 (82%), Gaps = 13/644 (2%)
 Frame = +2

Query  53    KMHDPQGPFLQRWNRIFVIACILAATVDPLFFYIPVVDDQNKCLGLDRTLEITACILRSV  232
             K+ DPQGPFLQRWN+IFV+ACI+A ++DPLFFY+P++DD  KCLG+D+ +EITA +LRS 
Sbjct  83    KILDPQGPFLQRWNKIFVLACIIAVSLDPLFFYVPIIDDSKKCLGIDKKMEITASVLRSF  142

Query  233   FDFFYIFHIILQFRTGFVPPSSRVFGRGDLIVDPSAIAKRYFFSYFFIDILAVLPLPQVV  412
              D FYI HII QFRTGF+ PSSRVFGRG L+ D   IAKRY  S+F IDILAVLPLPQ+V
Sbjct  143   TDVFYIIHIIFQFRTGFIAPSSRVFGRGVLVKDKREIAKRYLSSHFIIDILAVLPLPQMV  202

Query  413   LFMMIPRADRPFIMVAKDILKVVILVQSVPRLLRIYPLYKEVTRTSGFFTETAWAGAAFN  592
             + + IP       +  K++LK ++  Q +PR +RIYPLYKEVTRTSG  TETAWAGAAFN
Sbjct  203   ILIFIPHMRGSTSLNTKNMLKFIVFFQYIPRFIRIYPLYKEVTRTSGILTETAWAGAAFN  262

Query  593   LFLYMIASYVAGAIWYITAIERQDKCWRRACEKHGS--CDIDFLYCTKLGRRGGDFSSSF  766
             LFLYM+AS+V GA WY+ +IER+  CW++AC++ G+  C+I  LYC      G    ++F
Sbjct  263   LFLYMLASHVFGAFWYLFSIERETVCWKQACKRRGNNICNIKLLYCDHKSPGG----NAF  318

Query  767   LNTSCALLEPENLKADDFDFGIFLDALKSNVVEKRYFWSKLFYCFWWGLRNLSSLGQNLK  946
             LN SC +  P    A  FDFGIFLDAL+S VVE + F  K FYCFWWGL+NLSSLGQNLK
Sbjct  319   LNESCPIQTPN---ATLFDFGIFLDALQSGVVESQDFPQKFFYCFWWGLQNLSSLGQNLK  375

Query  947   TSNFVGEilfailisiiglilfslligNMQKYLQSITVRVEEMRVKRMDAEQWMSHRMLP  1126
             TS +V EI FA+ ISI GL+LFS LIGNMQ YLQS T R+EEMRVKR DAEQWMSHR+LP
Sbjct  376   TSTYVWEICFAVFISIAGLVLFSFLIGNMQTYLQSTTTRLEEMRVKRRDAEQWMSHRLLP  435

Query  1127  DNLRERIRRYEQYRWQETRGVDEESLISNLPKDLRRDINRHLCWSLLKRVHMFKTMDEQL  1306
             +NLR+RIRRYEQY+WQETRGVDEE+L+SNLPKDLRRDI RHLC +LL RV MF+ MDEQL
Sbjct  436   ENLRKRIRRYEQYKWQETRGVDEENLLSNLPKDLRRDIKRHLCLALLMRVPMFEKMDEQL  495

Query  1307  LDAICDRLKPVLYTEKSCIVREGDPVDEMIFVMRGNLLTMTTNGGRTGFLNSDVLNAGDF  1486
             LDA+CDRL+PVLYTE+S IVREGDPVDEM+F+MRG LLTMTTNGGRTGF NS+ L AGDF
Sbjct  496   LDALCDRLQPVLYTEESYIVREGDPVDEMLFIMRGKLLTMTTNGGRTGFFNSEYLGAGDF  555

Query  1487  CGEELLTWALDPNSSSSLPISTRTVQALTDVEAFALTADFLKFFASQYRRLHSKQLQHKF  1666
             CGEELLTWALDP++SS+LPISTRTV+AL +VEAFAL AD LKF ASQ+RRLHSKQL+H F
Sbjct  556   CGEELLTWALDPHTSSNLPISTRTVRALMEVEAFALKADDLKFVASQFRRLHSKQLRHTF  615

Query  1667  RFYSHQWKTWAACFIQAAWRRHCRNKLEKSLREEEDRLQDALILRMRREEGETTPSLGAT  1846
             RFYS QW+TWAACFIQAAWRR+ + KLE+SL+EEE+RLQDAL     +E   ++PSLGAT
Sbjct  616   RFYSQQWRTWAACFIQAAWRRYIKKKLEESLKEEENRLQDALA----KEACGSSPSLGAT  671

Query  1847  IYASRFAANVLRTVRRNHplsvpklsprlpplllqkpAEPDFSA  1978
             IYASRFAAN+LRT+RR+  +  P++  R+PP+LLQKPAEPDF++
Sbjct  672   IYASRFAANILRTIRRSGSVRKPRMPERMPPMLLQKPAEPDFNS  715



>ref|XP_009336790.1| PREDICTED: cyclic nucleotide-gated ion channel 1-like [Pyrus 
x bretschneideri]
Length=719

 Score =   838 bits (2166),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 435/648 (67%), Positives = 520/648 (80%), Gaps = 17/648 (3%)
 Frame = +2

Query  47    KSKMHDPQGPFLQRWNRIFVIACILAATVDPLFFYIPVVDDQNKCLGLDRTLEITACILR  226
             + K+ DPQG FLQ WN+IFV++C++A ++DPLF Y PVVD + KC+ +D  L+I AC+LR
Sbjct  82    RRKILDPQGSFLQNWNKIFVLSCVIAVSLDPLFLYTPVVDGKKKCIEMDTRLQIIACVLR  141

Query  227   SVFDFFYIFHIILQFRTGFVPPSSRVFGRGDLIVDPSAIAKRYFFSYFFIDILAVLPLPQ  406
             S  D F++ HII QFRTGF+ PSSRVFGRG+LI DP AIAKRY  SYF IDILA+LPLPQ
Sbjct  142   SFTDIFHVLHIIFQFRTGFIAPSSRVFGRGELIDDPVAIAKRYLSSYFIIDILAILPLPQ  201

Query  407   VVLFMMIPRADRPFIMVAKDILKVVILVQSVPRLLRIYPLYKEVTRTSGFFTETAWAGAA  586
             VV+F++IP   RP   V KD+LK VI+ Q VPR  RI+PLYKEVTRTSGF TETAWAGAA
Sbjct  202   VVVFIVIPTISRPVSPVTKDLLKFVIVAQYVPRFWRIFPLYKEVTRTSGFLTETAWAGAA  261

Query  587   FNLFLYMIASYVAGAIWYITAIERQDKCWRRACEKHGSCDIDFLYCTKLGRRGGDFSSSF  766
             FNL LYM+AS++ GA WY+ ++ER+ +CWR  C+   +C    LYC +      D  +SF
Sbjct  262   FNLLLYMLASHIVGAFWYLFSMEREYRCWRDHCDGKDACKKS-LYCNR------DTGASF  314

Query  767   L---NTSCALLEPENLKADD-FDFGIFLDALKSNVVEKRYFWSKLFYCFWWGLRNLSSLG  934
             +   N SC  ++P ++K    F+FGIF DAL S VVE + F  K  +CFWWGLRNLSSLG
Sbjct  315   VANKNASCPFIDPGDIKNSSVFNFGIFYDALASGVVETKDFPKKFLFCFWWGLRNLSSLG  374

Query  935   QNLKTSNFVGEilfailisiiglilfslligNMQKYLQSITVRVEEMRVKRMDAEQWMSH  1114
             QNLKTS +V EI+FA+ ISI+GL+LFSLLIGNMQKYLQS TVR+EEMRVKR DAEQWM+H
Sbjct  375   QNLKTSTYVWEIIFAVSISILGLVLFSLLIGNMQKYLQSTTVRIEEMRVKRRDAEQWMAH  434

Query  1115  RMLPDNLRERIRRYEQYRWQETRGVDEESLISNLPKDLRRDINRHLCWSLLKRVHMFKTM  1294
             RMLP+NLRERIRRY+QY+WQETRGVDE++L+ NLPKDLR+DI RHLC  LL+RV +F+TM
Sbjct  435   RMLPENLRERIRRYDQYKWQETRGVDEDTLVRNLPKDLRKDIKRHLCLGLLQRVPIFETM  494

Query  1295  DEQLLDAICDRLKPVLYTEKSCIVREGDPVDEMIFVMRGNLLTMTTNGGRTGFLNSDVLN  1474
             DEQL+DA+CDRLKPVLYT+KS I REGDPVDEM+F+MRGNL TMTTNGGRTGF N+  L 
Sbjct  495   DEQLMDAMCDRLKPVLYTDKSYITREGDPVDEMLFIMRGNLATMTTNGGRTGFFNTADLK  554

Query  1475  AGDFCGEELLTWALDPNSSSSLPISTRTVQALTDVEAFALTADFLKFFASQYRRLHSKQL  1654
             AGDFCGEELLTWALDPNSS++LP STRTV+A T+VEAFAL AD LKF ASQ+RRLHSKQL
Sbjct  555   AGDFCGEELLTWALDPNSSTNLPTSTRTVEAKTEVEAFALKADDLKFVASQFRRLHSKQL  614

Query  1655  QHKFRFYSHQWKTWAACFIQAAWRRHCRNKLEKSLREEEDRLQDALILRMRREEGETTPS  1834
             QH FRFYS QW+TW+ACFIQAAWRRH + KLEKSLREEEDRLQDAL     R+ G T+PS
Sbjct  615   QHTFRFYSQQWRTWSACFIQAAWRRHWKRKLEKSLREEEDRLQDALT----RDAG-TSPS  669

Query  1835  LGATIYASRFAANVLRTVRRNHplsvpklsprlpplllqkpAEPDFSA  1978
             + A +YAS+FAAN LR +R+       + SP L PLL QKPAEPDF+A
Sbjct  670   ILAAVYASKFAANALRGLRQKG-KRDTRPSPTLLPLLPQKPAEPDFTA  716



>ref|XP_003544128.1| PREDICTED: cyclic nucleotide-gated ion channel 1-like [Glycine 
max]
Length=718

 Score =   838 bits (2165),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 439/648 (68%), Positives = 517/648 (80%), Gaps = 13/648 (2%)
 Frame = +2

Query  47    KSKMHDPQGPFLQRWNRIFVIACILAATVDPLFFYIPVVDDQNKCLGLDRTLEITACILR  226
             + K+ DPQGPFLQ+WN+IFV+ C++A ++DPLFFY+PV++D  KCL LD  +EITA +LR
Sbjct  81    RKKILDPQGPFLQKWNKIFVLLCVIAVSLDPLFFYVPVIEDAKKCLSLDSKMEITATVLR  140

Query  227   SVFDFFYIFHIILQFRTGFVPPSSRVFGRGDLIVDPSAIAKRYFFSYFFIDILAVLPLPQ  406
             S  D  YI H+I QFRTGF+ PSSRVFGRG L+ D  AIA+RY  SYF IDILAVLPLPQ
Sbjct  141   SFSDALYIIHMIFQFRTGFIAPSSRVFGRGVLVEDSWAIARRYLSSYFIIDILAVLPLPQ  200

Query  407   VVLFMMIPRADRPFIMVAKDILKVVILVQSVPRLLRIYPLYKEVTRTSGFFTETAWAGAA  586
             VV+ ++IP       +  K++LK V+ +Q VPRLLRI PLY EVTRTSG  TETAWAGAA
Sbjct  201   VVILVIIPEMSGFKSLNTKNLLKFVVFLQYVPRLLRIIPLYNEVTRTSGILTETAWAGAA  260

Query  587   FNLFLYMIASYVAGAIWYITAIERQDKCWRRACEKHGS-CDIDFLYCTK-LGRRGGDFSS  760
             FNLFLYM+AS+V GA WY+ +IER+  CW+ AC+++ + C+   +YC   LG  G    S
Sbjct  261   FNLFLYMLASHVVGAFWYLFSIERETTCWQEACQRNTTVCNKADMYCNDYLG--GLSKIS  318

Query  761   SFLNTSCALLEPENLKADDFDFGIFLDALKSNVVEKRYFWSKLFYCFWWGLRNLSSLGQN  940
             +FL+TSC +   +N     FDFGIFLDAL+S VVE R F  K FYCFWWGL+NLSSLGQN
Sbjct  319   AFLSTSCPI---QNEDKKLFDFGIFLDALQSGVVESRDFPQKFFYCFWWGLKNLSSLGQN  375

Query  941   LKTSNFVGEilfailisiiglilfslligNMQKYLQSITVRVEEMRVKRMDAEQWMSHRM  1120
             L TS +V EI FA+ IS+ GL+LFS LIGNMQ YLQS T R+EEMRVKR DAEQWMSHR+
Sbjct  376   LATSTYVWEISFAVFISVSGLVLFSFLIGNMQTYLQSTTTRLEEMRVKRRDAEQWMSHRL  435

Query  1121  LPDNLRERIRRYEQYRWQETRGVDEESLISNLPKDLRRDINRHLCWSLLKRVHMFKTMDE  1300
             LPD LRERIRRYEQYRWQETRGVDE++LI NLPKDLRRDI RHLC +LL RV MF+ MDE
Sbjct  436   LPDGLRERIRRYEQYRWQETRGVDEDNLIRNLPKDLRRDIKRHLCLALLMRVPMFEKMDE  495

Query  1301  QLLDAICDRLKPVLYTEKSCIVREGDPVDEMIFVMRGNLLTMTTNGGRTGFLNSDVLNAG  1480
             QLLDA+CD LKPVLYTE+S IVREGDPVDEM+F+MRG LLTMTTNGGRTGF NS+ L AG
Sbjct  496   QLLDAMCDLLKPVLYTEESYIVREGDPVDEMLFIMRGKLLTMTTNGGRTGFFNSEYLKAG  555

Query  1481  DFCGEELLTWALDPNSSSSLPISTRTVQALTDVEAFALTADFLKFFASQYRRLHSKQLQH  1660
             DFCGEELLTWALDP+SS +LP STRTVQ L++VEAFAL AD LKF ASQ+RRLHSKQL+H
Sbjct  556   DFCGEELLTWALDPHSSPNLPTSTRTVQTLSEVEAFALKADDLKFVASQFRRLHSKQLRH  615

Query  1661  KFRFYSHQWKTWAACFIQAAWRRHCRNKLEKSLREEEDRLQDALILRMRREEGETTPSLG  1840
              FRFYS QW+TWAACFIQAAWRR+ + KLE+SL EEE+RLQDAL      + G ++PSLG
Sbjct  616   TFRFYSQQWRTWAACFIQAAWRRYSKRKLEESLVEEENRLQDALA-----KAGGSSPSLG  670

Query  1841  ATIYASRFAANVLRTVRRNHplsvpklsprlpplllqkpAEPDFSAPE  1984
             ATIYASRFAAN LR +RRN      ++  RLPP+L QKPAEPDF+A E
Sbjct  671   ATIYASRFAANALRLLRRNG-TKKGRVPERLPPMLPQKPAEPDFTADE  717



>ref|XP_004145926.1| PREDICTED: cyclic nucleotide-gated ion channel 1-like [Cucumis 
sativus]
 gb|KGN49873.1| hypothetical protein Csa_5G139510 [Cucumis sativus]
Length=713

 Score =   838 bits (2164),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 441/647 (68%), Positives = 522/647 (81%), Gaps = 17/647 (3%)
 Frame = +2

Query  53    KMHDPQGPFLQRWNRIFVIACILAATVDPLFFYIPVVDDQNKCLGLDRTLEITACILRSV  232
             K+ DPQGPFLQ+WN+IFV++C++A ++DPLFFY+PV+DD  KCLGLD  +EITA +LRS 
Sbjct  82    KVLDPQGPFLQKWNKIFVLSCVIAVSLDPLFFYVPVIDDDKKCLGLDNKMEITASVLRSF  141

Query  233   FDFFYIFHIILQFRTGFVPPSSRVFGRGDLIVDPSAIAKRYFFSYFFIDILAVLPLPQVV  412
              D FYI HI+ QFRTGF+ PSSRVFGRG L+ D   IAKRY  SYF IDILAVLPLPQVV
Sbjct  142   TDIFYILHIVFQFRTGFIAPSSRVFGRGVLVEDAWEIAKRYLSSYFLIDILAVLPLPQVV  201

Query  413   LFMMIPRADRPFIMVAKDILKVVILVQSVPRLLRIYPLYKEVTRTSGFFTETAWAGAAFN  592
             + ++IP       +  KD+LK V+  Q VPR +RIYPLYKEVTRTS   TETAWAGAAFN
Sbjct  202   ILIIIPNMKGSRSLNTKDLLKFVVFFQYVPRFIRIYPLYKEVTRTS-VLTETAWAGAAFN  260

Query  593   LFLYMIASYVAGAIWYITAIERQDKCWRRACEKHGSCDIDFLYC-TKLGRRGGDFSSSFL  769
             LFLYM+AS+V GA WY+ +IER+  CW+RAC K G C  + LYC   + +R    +++FL
Sbjct  261   LFLYMLASHVFGAFWYLFSIERETTCWQRACHKTG-CVSNSLYCDADVIQR----NNAFL  315

Query  770   NTSCALLEPENLKADDFDFGIFLDALKSNVVEKRYFWSKLFYCFWWGLRNLSSLGQNLKT  949
             N SC+L+E        FDFGIFLDALKS VV    F  K FYCFWWGLRNLSSLGQNL+T
Sbjct  316   NVSCSLVEDN----PPFDFGIFLDALKSGVVGSMNFPQKFFYCFWWGLRNLSSLGQNLQT  371

Query  950   SNFVGEilfailisiiglilfslligNMQKYLQSITVRVEEMRVKRMDAEQWMSHRMLPD  1129
             S +V EI FA+ ISI GL+LFS LIGNMQ YLQS T R+EEMRV+R DAEQWMSHR+LP+
Sbjct  372   STYVWEICFAVFISISGLVLFSFLIGNMQTYLQSTTTRLEEMRVRRRDAEQWMSHRLLPE  431

Query  1130  NLRERIRRYEQYRWQETRGVDEESLISNLPKDLRRDINRHLCWSLLKRVHMFKTMDEQLL  1309
             +LRERIRRYEQY+WQETRGVDEE+L+ NLPKDLRRDI RHLC SLL RV +F+ MDEQLL
Sbjct  432   SLRERIRRYEQYKWQETRGVDEENLVRNLPKDLRRDIKRHLCLSLLMRVPIFEKMDEQLL  491

Query  1310  DAICDRLKPVLYTEKSCIVREGDPVDEMIFVMRGNLLTMTTNGGRTGFLNSDVLNAGDFC  1489
             DA+CDRLKPVLYTE+S IVREGDPVDEMIF+MRG LL++TTNGGRTGF NS+ L AGDFC
Sbjct  492   DAMCDRLKPVLYTEESYIVREGDPVDEMIFIMRGKLLSVTTNGGRTGFFNSEHLKAGDFC  551

Query  1490  GEELLTWALDPNSSSSLPISTRTVQALTDVEAFALTADFLKFFASQYRRLHSKQLQHKFR  1669
             GEELLTWALDP+SSS+LPISTRTV+ L++VEAFAL AD LKF ASQ+RRLHSKQL+H FR
Sbjct  552   GEELLTWALDPHSSSNLPISTRTVRTLSEVEAFALKADDLKFVASQFRRLHSKQLRHTFR  611

Query  1670  FYSHQWKTWAACFIQAAWRRHCRNKLEKSLREEEDRLQDALILRMRREEGETTPSLGATI  1849
              YS QW+TWAACFIQAAWRR+ R K E++L EEE+RL+DAL      + G ++PSLGATI
Sbjct  612   LYSQQWRTWAACFIQAAWRRYRRKKHEQTLLEEENRLKDALA-----KTGGSSPSLGATI  666

Query  1850  YASRFAANVLRTVRRNHplsvpklsprlpplllqkpAEPDFSAPENN  1990
             YASRFAAN+LRT+RR       ++  R+PPLLLQKPAEPDF++ EN+
Sbjct  667   YASRFAANILRTIRRTS-SRKARIPERIPPLLLQKPAEPDFTSEENS  712



>ref|XP_008437585.1| PREDICTED: cyclic nucleotide-gated ion channel 1 [Cucumis melo]
 ref|XP_008437586.1| PREDICTED: cyclic nucleotide-gated ion channel 1 [Cucumis melo]
Length=712

 Score =   837 bits (2162),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 440/649 (68%), Positives = 521/649 (80%), Gaps = 21/649 (3%)
 Frame = +2

Query  53    KMHDPQGPFLQRWNRIFVIACILAATVDPLFFYIPVVDDQNKCLGLDRTLEITACILRSV  232
             K+ DPQGPFLQ+WN+IFV++C++A ++DPLFFY+PV+DD  KCLGLD+ +EITA +LRS 
Sbjct  82    KVLDPQGPFLQKWNKIFVLSCVIAVSLDPLFFYVPVIDDDKKCLGLDKKMEITASVLRSF  141

Query  233   FDFFYIFHIILQFRTGFVPPSSRVFGRGDLIVDPSAIAKRYFFSYFFIDILAVLPLPQVV  412
              D FYI HI+ QFRTGF+ PSSRVFGRG L+ D   IAKRY  SYF IDILAVLPLPQVV
Sbjct  142   TDIFYILHIVFQFRTGFIAPSSRVFGRGVLVEDAWEIAKRYLSSYFLIDILAVLPLPQVV  201

Query  413   LFMMIPRADRPFIMVAKDILKVVILVQSVPRLLRIYPLYKEVTRTSGFFTETAWAGAAFN  592
             + ++IP       +  K++LK V+  Q VPR +RIYPLYKEVTRTS   TETAWAGAAFN
Sbjct  202   ILIIIPNMKGSRSLNTKNLLKFVVFFQYVPRFIRIYPLYKEVTRTS-VLTETAWAGAAFN  260

Query  593   LFLYMIASYVAGAIWYITAIERQDKCWRRACEKHGSCDIDFLYCTKLGRRGGDFS---SS  763
             LFLYM+AS+V GA WY+ +IER+  CW++AC K G C  + LYC       GD S   + 
Sbjct  261   LFLYMLASHVFGAFWYLFSIERETTCWQKACRKTG-CVSNSLYC------DGDASLRDNR  313

Query  764   FLNTSCALLEPENLKADDFDFGIFLDALKSNVVEKRYFWSKLFYCFWWGLRNLSSLGQNL  943
             FLN SC+L+E        FDFGIFLDALKS VV    F  K FYCFWWGLRNLSSLGQNL
Sbjct  314   FLNVSCSLVEDN----PPFDFGIFLDALKSGVVGSMNFPQKFFYCFWWGLRNLSSLGQNL  369

Query  944   KTSNFVGEilfailisiiglilfslligNMQKYLQSITVRVEEMRVKRMDAEQWMSHRML  1123
             +TS +V EI FA+ ISI GL+LFS LIGNMQ YLQS T R+EEMRV+R DAEQWMSHR+L
Sbjct  370   QTSTYVWEICFAVFISISGLVLFSFLIGNMQTYLQSTTTRLEEMRVRRRDAEQWMSHRLL  429

Query  1124  PDNLRERIRRYEQYRWQETRGVDEESLISNLPKDLRRDINRHLCWSLLKRVHMFKTMDEQ  1303
             P++LRERIRRYEQY+WQETRGVDEE+L+ NLPKDLRRDI RHLC SLL RV +F+ MDEQ
Sbjct  430   PESLRERIRRYEQYKWQETRGVDEENLVRNLPKDLRRDIKRHLCLSLLMRVPIFEKMDEQ  489

Query  1304  LLDAICDRLKPVLYTEKSCIVREGDPVDEMIFVMRGNLLTMTTNGGRTGFLNSDVLNAGD  1483
             LLDA+CDRLKPVLYTE+S IVREGDPVDEMIF+MRG LL++TTNGGRTGF NS+ L AGD
Sbjct  490   LLDAMCDRLKPVLYTEESYIVREGDPVDEMIFIMRGKLLSVTTNGGRTGFFNSEHLKAGD  549

Query  1484  FCGEELLTWALDPNSSSSLPISTRTVQALTDVEAFALTADFLKFFASQYRRLHSKQLQHK  1663
             FCGEELLTWALDP+SSS+LPISTRTV+ L++VEAFAL AD LKF ASQ+RRLHSKQL+H 
Sbjct  550   FCGEELLTWALDPHSSSNLPISTRTVRTLSEVEAFALKADDLKFVASQFRRLHSKQLRHT  609

Query  1664  FRFYSHQWKTWAACFIQAAWRRHCRNKLEKSLREEEDRLQDALILRMRREEGETTPSLGA  1843
             FR YS QW+TWAACFIQAAWRR+ R K E++L EEE+RL+DAL      + G ++PSLGA
Sbjct  610   FRLYSQQWRTWAACFIQAAWRRYRRKKHEQTLLEEENRLKDALA-----KTGGSSPSLGA  664

Query  1844  TIYASRFAANVLRTVRRNHplsvpklsprlpplllqkpAEPDFSAPENN  1990
             TIYASRFAAN+LRT+RR       ++  R+PP+LLQKPAEPDF++ EN+
Sbjct  665   TIYASRFAANILRTIRRTS-SRKARIPERIPPMLLQKPAEPDFTSEENS  712



>ref|XP_008788856.1| PREDICTED: cyclic nucleotide-gated ion channel 1 isoform X1 [Phoenix 
dactylifera]
 ref|XP_008788928.1| PREDICTED: cyclic nucleotide-gated ion channel 1 isoform X1 [Phoenix 
dactylifera]
 ref|XP_008788996.1| PREDICTED: cyclic nucleotide-gated ion channel 1 isoform X1 [Phoenix 
dactylifera]
 ref|XP_008789077.1| PREDICTED: cyclic nucleotide-gated ion channel 1 isoform X1 [Phoenix 
dactylifera]
Length=699

 Score =   837 bits (2161),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 436/647 (67%), Positives = 515/647 (80%), Gaps = 15/647 (2%)
 Frame = +2

Query  47    KSKMHDPQGPFLQRWNRIFVIACILAATVDPLFFYIPVVDDQNKCLGLDRTLEITACILR  226
             + K+ DPQGPFLQRWN++FVI+C++A +VDPLFFYIPV++D + CL LDR LEITA +LR
Sbjct  68    RKKILDPQGPFLQRWNKVFVISCVIAVSVDPLFFYIPVINDTDNCLELDRKLEITASVLR  127

Query  227   SVFDFFYIFHIILQFRTGFVPPSSRVFGRGDLIVDPSAIAKRYFFSYFFIDILAVLPLPQ  406
                D FYI HII QFRTGF+ P SRVFGRG L+ DPSAIAKRY  SYF IDILAVLPLPQ
Sbjct  128   FFTDIFYILHIIFQFRTGFIAPPSRVFGRGVLVKDPSAIAKRYISSYFLIDILAVLPLPQ  187

Query  407   VVLFMMIPRADRPFIMVAKDILKVVILVQSVPRLLRIYPLYKEVTRTSGFFTETAWAGAA  586
             VV+ ++IP+     ++ AK++L  +++ Q VPRL+RI PLY EVTRT+G  TETAWAGAA
Sbjct  188   VVVLIIIPKLKGSALLDAKNVLMFIVICQYVPRLVRIIPLYLEVTRTAGIITETAWAGAA  247

Query  587   FNLFLYMIASYVAGAIWYITAIERQDKCWRRACEKHGSCDIDFLYCTKLGRRGGDFSSSF  766
             FNL LYM+AS+V GA+WY+ AIERQD CWR AC K+  C    LYC    +   DF  + 
Sbjct  248   FNLLLYMLASHVLGALWYLLAIERQDTCWRYACSKN-KCTATSLYCGGENKGNNDFLLAA  306

Query  767   LNTSCALLEPENLKADDFDFGIFLDALKSNVVEKRYFWSKLFYCFWWGLRNLSSLGQNLK  946
                S A        A  FDFGI++ AL+ NVV+ R F  KLFYCFWWGL+NLSSLGQNL+
Sbjct  307   CPVSVA-------NASAFDFGIYIFALQ-NVVQSRNFLEKLFYCFWWGLQNLSSLGQNLE  358

Query  947   TSNFVGEilfailisiiglilfslligNMQKYLQSITVRVEEMRVKRMDAEQWMSHRMLP  1126
             TS +  EILFA+ +SI GL+LF+LLIGNMQ YLQS TVR+EEMRV+R D EQWMSHR+LP
Sbjct  359   TSTYTWEILFAVFVSISGLVLFALLIGNMQTYLQSTTVRIEEMRVRRRDTEQWMSHRLLP  418

Query  1127  DNLRERIRRYEQYRWQETRGVDEESLISNLPKDLRRDINRHLCWSLLKRVHMFKTMDEQL  1306
             + LRERIRR+EQYRWQETRGVDEE+L+ NLPKDLRRDI RHLC SLL RV MF+ MD+QL
Sbjct  419   ETLRERIRRHEQYRWQETRGVDEENLLRNLPKDLRRDIKRHLCLSLLMRVPMFEQMDDQL  478

Query  1307  LDAICDRLKPVLYTEKSCIVREGDPVDEMIFVMRGNLLTMTTNGGRTGFLNSDVLNAGDF  1486
             +DA+CDRL+PVLYTE S IVREGDPV EM+F+MRG L +MTTNGGRTGF NSD+L AGDF
Sbjct  479   MDAMCDRLEPVLYTEDSFIVREGDPVTEMLFIMRGKLESMTTNGGRTGFFNSDILKAGDF  538

Query  1487  CGEELLTWALDPNSSSSLPISTRTVQALTDVEAFALTADFLKFFASQYRRLHSKQLQHKF  1666
             CGEELLTWALDP+SSSS PISTRTV+ L++VEAFAL AD LKF ASQ+RRLHSKQLQH F
Sbjct  539   CGEELLTWALDPHSSSSFPISTRTVKTLSEVEAFALMADDLKFVASQFRRLHSKQLQHTF  598

Query  1667  RFYSHQWKTWAACFIQAAWRRHCRNKLEKSLREEEDRLQDALILRMRREEGETTPSLGAT  1846
             RFYS QW+TWAACFIQAAWRR+ R KLE +L EEE+RLQ A+        G ++PSLGAT
Sbjct  599   RFYSQQWRTWAACFIQAAWRRYSRKKLEDALHEEEERLQAAMA-----SSGTSSPSLGAT  653

Query  1847  IYASRFAANVLRTVRRNHplsvpklsprlpplllqkpAEPDFSAPEN  1987
             +YASRFAANVLRT+RR+      +L  RLP +LLQKPAEPDFSA E+
Sbjct  654   LYASRFAANVLRTLRRSG-TRKARLQERLPVMLLQKPAEPDFSAEEH  699



>ref|XP_011001886.1| PREDICTED: cyclic nucleotide-gated ion channel 1-like [Populus 
euphratica]
 ref|XP_011001887.1| PREDICTED: cyclic nucleotide-gated ion channel 1-like [Populus 
euphratica]
 ref|XP_011001888.1| PREDICTED: cyclic nucleotide-gated ion channel 1-like [Populus 
euphratica]
Length=709

 Score =   837 bits (2162),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 437/647 (68%), Positives = 517/647 (80%), Gaps = 14/647 (2%)
 Frame = +2

Query  47    KSKMHDPQGPFLQRWNRIFVIACILAATVDPLFFYIPVVDDQNKCLGLDRTLEITACILR  226
             + K+ DPQG FLQ+WN+IFV++C++A ++DPLFFY+PV+DD  KCL LD T+EITA +LR
Sbjct  76    RKKILDPQGHFLQKWNKIFVLSCLIAVSLDPLFFYVPVIDDGKKCLSLDSTMEITASVLR  135

Query  227   SVFDFFYIFHIILQFRTGFVPPSSRVFGRGDLIVDPSAIAKRYFFSYFFIDILAVLPLPQ  406
             S  D FYI HII QFRTGF+ PSSRVFGRG L+ D  AIAKRY  SYF IDILAVLPLPQ
Sbjct  136   SFTDIFYILHIIFQFRTGFIAPSSRVFGRGVLVEDTWAIAKRYLSSYFLIDILAVLPLPQ  195

Query  407   VVLFMMIPRADRPFIMVAKDILKVVILVQSVPRLLRIYPLYKEVTRTSGFFTETAWAGAA  586
             VV+ ++IP+      +  K++LK V++ Q VPR +RIYPLYKEVT TSG  TETAWAGAA
Sbjct  196   VVILIIIPKMAGSRYLNTKNMLKFVVIFQYVPRFMRIYPLYKEVT-TSGILTETAWAGAA  254

Query  587   FNLFLYMIASYVAGAIWYITAIERQDKCWRRACEKHGSCDIDFLYCTKLGRRGGDFSSSF  766
             FNLFLYM+AS+V GA WY+ +IER+  CWR+AC KH  C  + L+C    R GG    SF
Sbjct  255   FNLFLYMLASHVLGAFWYLFSIERETNCWRQACGKHAGCSRELLFC---DRAGGVEDLSF  311

Query  767   LNTSCALLEPENLKADDFDFGIFLDALKSNVVEKRY-FWSKLFYCFWWGLRNLSSLGQNL  943
             L+  C ++ P       F+FGIFLDAL+S VV     F  K FYCFWWGL+NLSSLGQNL
Sbjct  312   LDNYCPIVTPNETV---FNFGIFLDALQSGVVLSSMDFPQKFFYCFWWGLQNLSSLGQNL  368

Query  944   KTSNFVGEilfailisiiglilfslligNMQKYLQSITVRVEEMRVKRMDAEQWMSHRML  1123
             +TS +V EI FA+ ISI GL+LFS LIGNMQ YLQS T R+EEMR+KR DAEQWMSHR+L
Sbjct  369   QTSTYVWEICFAVFISISGLVLFSFLIGNMQTYLQSTTTRLEEMRIKRRDAEQWMSHRLL  428

Query  1124  PDNLRERIRRYEQYRWQETRGVDEESLISNLPKDLRRDINRHLCWSLLKRVHMFKTMDEQ  1303
             PDN+RERIRRYEQYRWQETRGVDEE L+ NLPKDLRRDI RHLC +LL RV MF+ MDEQ
Sbjct  429   PDNIRERIRRYEQYRWQETRGVDEEMLVHNLPKDLRRDIKRHLCLALLMRVPMFEKMDEQ  488

Query  1304  LLDAICDRLKPVLYTEKSCIVREGDPVDEMIFVMRGNLLTMTTNGGRTGFLNSDVLNAGD  1483
             LLDA+CDRLKPVLYTE+S IVREGDPVDEM+FVMRG LLT+TTNGGRTGF NS+ L AGD
Sbjct  489   LLDALCDRLKPVLYTEESFIVREGDPVDEMLFVMRGKLLTITTNGGRTGFFNSEYLKAGD  548

Query  1484  FCGEELLTWALDPNSSSSLPISTRTVQALTDVEAFALTADFLKFFASQYRRLHSKQLQHK  1663
             FCGEELLTWALDP+SSS+LPISTRTV+ +T+VEAFAL AD LKF ASQ+RRLHSKQL+H 
Sbjct  549   FCGEELLTWALDPHSSSNLPISTRTVRTITEVEAFALMADDLKFVASQFRRLHSKQLRHT  608

Query  1664  FRFYSHQWKTWAACFIQAAWRRHCRNKLEKSLREEEDRLQDALILRMRREEGETTPSLGA  1843
             FRFYS QW+TWAACFIQAAWRR+ + K E+SL +EE+RLQDAL      +   ++PSLGA
Sbjct  609   FRFYSQQWRTWAACFIQAAWRRYSKKKHEESLWQEENRLQDALA-----KANGSSPSLGA  663

Query  1844  TIYASRFAANVLRTVRRNHplsvpklsprlpplllqkpAEPDFSAPE  1984
             TIYASRFAAN+LR +RR       ++  R+PP+LLQKPAEPDF++ E
Sbjct  664   TIYASRFAANILRALRRGG-NRKARVPDRVPPMLLQKPAEPDFTSEE  709



>ref|XP_002865954.1| hypothetical protein ARALYDRAFT_918383 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH42213.1| hypothetical protein ARALYDRAFT_918383 [Arabidopsis lyrata subsp. 
lyrata]
Length=716

 Score =   837 bits (2161),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 442/643 (69%), Positives = 529/643 (82%), Gaps = 12/643 (2%)
 Frame = +2

Query  53    KMHDPQGPFLQRWNRIFVIACILAATVDPLFFYIPVVDDQNKCLGLDRTLEITACILRSV  232
             K+ DPQGPFLQRWN+IFV+ACI+A ++DPLFFY+P++DD  KCLG+D+ +EITA +LRS 
Sbjct  83    KILDPQGPFLQRWNKIFVLACIIAVSLDPLFFYVPIIDDTKKCLGIDKKMEITASVLRSF  142

Query  233   FDFFYIFHIILQFRTGFVPPSSRVFGRGDLIVDPSAIAKRYFFSYFFIDILAVLPLPQVV  412
              D FYI HII QFRTGF+ PSSRVFGRG L+ D   IAKRY  S+F IDILAVLPLPQ+V
Sbjct  143   TDVFYIIHIIFQFRTGFIAPSSRVFGRGVLVEDKQQIAKRYLSSHFIIDILAVLPLPQMV  202

Query  413   LFMMIPRADRPFIMVAKDILKVVILVQSVPRLLRIYPLYKEVTRTSGFFTETAWAGAAFN  592
             + ++IP       +  K++LK ++  Q +PR +RIYPLYKEVTRTSG  TETAWAGAAFN
Sbjct  203   ILIVIPHMRGSPSLNTKNMLKFIVFFQYIPRFIRIYPLYKEVTRTSGILTETAWAGAAFN  262

Query  593   LFLYMIASYVAGAIWYITAIERQDKCWRRACEK-HGSCDIDFLYCTKLGRRGGDFSSSFL  769
             LFLYM+AS+V GA WY+ +IER+  CW++ACEK + SC    LYC +    GG+   +FL
Sbjct  263   LFLYMLASHVFGAFWYLFSIERETVCWKQACEKTNSSCIPSLLYCDR-EIPGGN---AFL  318

Query  770   NTSCALLEPENLKADDFDFGIFLDALKSNVVEKRYFWSKLFYCFWWGLRNLSSLGQNLKT  949
             N SC +  P       FDFGIFLDAL+S VVE + F  K FYCFWWGL+NLSSLGQNLKT
Sbjct  319   NESCPIQTPNTTL---FDFGIFLDALQSGVVESQDFPQKFFYCFWWGLQNLSSLGQNLKT  375

Query  950   SNFVGEilfailisiiglilfslligNMQKYLQSITVRVEEMRVKRMDAEQWMSHRMLPD  1129
             S +V EI FA+ ISI GL+LFS LIGNMQ YLQS T R+EEMRVKR DAEQWMSHR+LP+
Sbjct  376   STYVWEICFAVFISIAGLVLFSFLIGNMQTYLQSTTTRLEEMRVKRRDAEQWMSHRLLPE  435

Query  1130  NLRERIRRYEQYRWQETRGVDEESLISNLPKDLRRDINRHLCWSLLKRVHMFKTMDEQLL  1309
             NLR+RIRRYEQY+WQETRGVDEE+L+SNLPKDLRRDI RHLC +LL RV MF+ MDEQLL
Sbjct  436   NLRKRIRRYEQYKWQETRGVDEENLLSNLPKDLRRDIKRHLCLALLMRVPMFEKMDEQLL  495

Query  1310  DAICDRLKPVLYTEKSCIVREGDPVDEMIFVMRGNLLTMTTNGGRTGFLNSDVLNAGDFC  1489
             DA+CDRL+PVLYTE+S IVREGDPVDEM+F+MRG LLT+TTNGGRTGF NS+ L AGDFC
Sbjct  496   DALCDRLQPVLYTEESYIVREGDPVDEMLFIMRGKLLTITTNGGRTGFFNSEYLGAGDFC  555

Query  1490  GEELLTWALDPNSSSSLPISTRTVQALTDVEAFALTADFLKFFASQYRRLHSKQLQHKFR  1669
             GEELLTWALDP++SS+LPISTRTV+AL +VEAFAL AD LKF ASQ+RRLHSKQL+H FR
Sbjct  556   GEELLTWALDPHTSSNLPISTRTVRALMEVEAFALKADDLKFVASQFRRLHSKQLRHTFR  615

Query  1670  FYSHQWKTWAACFIQAAWRRHCRNKLEKSLREEEDRLQDALILRMRREEGETTPSLGATI  1849
             FYS QW+TWAACFIQAAWRR+ + KLE+SL+EEE+RLQDAL     +E  E++PSLGATI
Sbjct  616   FYSQQWRTWAACFIQAAWRRYIKKKLEESLKEEENRLQDALA----KEACESSPSLGATI  671

Query  1850  YASRFAANVLRTVRRNHplsvpklsprlpplllqkpAEPDFSA  1978
             YASRFAAN+LRT+RR+  +  P++  R+PP+LLQKPAEPDF++
Sbjct  672   YASRFAANILRTIRRSGSVRKPRMPERMPPMLLQKPAEPDFNS  714



>ref|XP_009778096.1| PREDICTED: cyclic nucleotide-gated ion channel 1-like [Nicotiana 
sylvestris]
Length=708

 Score =   836 bits (2160),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 446/648 (69%), Positives = 524/648 (81%), Gaps = 17/648 (3%)
 Frame = +2

Query  47    KSKMHDPQGPFLQRWNRIFVIACILAATVDPLFFYIPVVDDQNKCLGLDRTLEITACILR  226
             + KM DPQGPFLQ+WN+IFV++C++A ++DPLFFYIPV+D+ NKCL LDR +E+TA +LR
Sbjct  75    EKKMLDPQGPFLQKWNKIFVLSCVIAVSLDPLFFYIPVIDNDNKCLHLDRKMEVTASVLR  134

Query  227   SVFDFFYIFHIILQFRTGFVPPSSRVFGRGDLIVDPSAIAKRYFFSYFFIDILAVLPLPQ  406
             S+ D FY+ HI+LQFRTGF+ PSSRVFGRG L+ D   IAKRY  SYFFIDILAVLPLPQ
Sbjct  135   SITDIFYLLHIVLQFRTGFIAPSSRVFGRGVLVEDAWEIAKRYLSSYFFIDILAVLPLPQ  194

Query  407   VVLFMMIPRADRPFIMVAKDILKVVILVQSVPRLLRIYPLYKEVTRTSGFFTETAWAGAA  586
             VV+ ++IPR      +  K++LK V+  Q +PRLLR+YPLYKEVTRTSG  TETAWAGAA
Sbjct  195   VVILVVIPRLRGARSLNTKNLLKFVVFFQYIPRLLRVYPLYKEVTRTSGILTETAWAGAA  254

Query  587   FNLFLYMIASYVAGAIWYITAIERQDKCWRRACEKHGSCDIDFLYCTKLGRRGGDFSS--  760
             FNLFLYM+AS+V GA WY+ +IER+  CW+RAC    +C    LYC        D +   
Sbjct  255   FNLFLYMLASHVLGAFWYLFSIERESTCWQRACGNSSACHHASLYCDD------DHTGFK  308

Query  761   SFLNTSCALLEPENLKADDFDFGIFLDALKSNVVEKRYFWSKLFYCFWWGLRNLSSLGQN  940
             + LN+SC +  P    A  FDFGIFLDAL+S VVE   F  K FYCFWWGL+NLSSLGQN
Sbjct  309   TLLNSSCPIETP---NATVFDFGIFLDALQSGVVESMDFPQKFFYCFWWGLQNLSSLGQN  365

Query  941   LKTSNFVGEilfailisiiglilfslligNMQKYLQSITVRVEEMRVKRMDAEQWMSHRM  1120
             L+TS +V EI FA+ ISI GL+LFS LIGNMQ YLQS T+R+EEMRVKR DAEQWMSHR+
Sbjct  366   LQTSTYVWEICFAVFISIAGLVLFSFLIGNMQTYLQSTTIRLEEMRVKRRDAEQWMSHRL  425

Query  1121  LPDNLRERIRRYEQYRWQETRGVDEESLISNLPKDLRRDINRHLCWSLLKRVHMFKTMDE  1300
             LP++LRERIRRYEQY+WQETRGVDEE+LI NLPKDLRRDI RHLC +LL RV MF+ MDE
Sbjct  426   LPEHLRERIRRYEQYKWQETRGVDEENLIHNLPKDLRRDIKRHLCLALLMRVPMFEKMDE  485

Query  1301  QLLDAICDRLKPVLYTEKSCIVREGDPVDEMIFVMRGNLLTMTTNGGRTGFLNSDVLNAG  1480
             QLLDA+CDRL+PVLYTE S IVREGDPVDEM+F+MRG LLT+TTNGGRTG  NSD L AG
Sbjct  486   QLLDALCDRLRPVLYTENSFIVREGDPVDEMLFIMRGKLLTVTTNGGRTGVFNSDYLKAG  545

Query  1481  DFCGEELLTWALDPNSSSSLPISTRTVQALTDVEAFALTADFLKFFASQYRRLHSKQLQH  1660
             DFCGEELLTWALDP+ S++LPISTRTVQAL++VEAFAL AD LKF ASQ+RRLHSKQL+H
Sbjct  546   DFCGEELLTWALDPHLSNNLPISTRTVQALSEVEAFALVADDLKFVASQFRRLHSKQLRH  605

Query  1661  KFRFYSHQWKTWAACFIQAAWRRHCRNKLEKSLREEEDRLQDALILRMRREEGETTPSLG  1840
              FRFYS QW+TWAACFIQAAWRRHCR KLE+SLREEE RLQDAL     R  G ++PSLG
Sbjct  606   TFRFYSQQWRTWAACFIQAAWRRHCRKKLEESLREEESRLQDALA----RGSG-SSPSLG  660

Query  1841  ATIYASRFAANVLRTVRRNHplsvpklsprlpplllqkpAEPDFSAPE  1984
             ATIYASRFAAN LR +RRN      +++ R+ P+LLQKPAEPDF+A +
Sbjct  661   ATIYASRFAANALRALRRN-TSKKARMADRISPILLQKPAEPDFTAED  707



>ref|XP_008783842.1| PREDICTED: cyclic nucleotide-gated ion channel 1-like [Phoenix 
dactylifera]
Length=699

 Score =   835 bits (2158),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 434/646 (67%), Positives = 520/646 (80%), Gaps = 17/646 (3%)
 Frame = +2

Query  53    KMHDPQGPFLQRWNRIFVIACILAATVDPLFFYIPVVDDQNKCLGLDRTLEITACILRSV  232
             K+ DPQG FLQ+WN++FVI+C++A +VDPLFFYIPV++D+ KCL LDR LEITA +LR  
Sbjct  70    KILDPQGSFLQKWNKVFVISCVIAVSVDPLFFYIPVINDEVKCLELDRKLEITASVLRFF  129

Query  233   FDFFYIFHIILQFRTGFVPPSSRVFGRGDLIVDPSAIAKRYFFSYFFIDILAVLPLPQVV  412
              D FYI HII QFRTGF+ PSSRVFGRG L+ DPSAIAKRY  SYF IDILAVLPLPQVV
Sbjct  130   TDIFYILHIIFQFRTGFIAPSSRVFGRGVLVEDPSAIAKRYISSYFLIDILAVLPLPQVV  189

Query  413   LFMMIPRADRPFIMVAKDILKVVILVQSVPRLLRIYPLYKEVTRTSGFFTETAWAGAAFN  592
             + ++IP+     ++ AK+IL ++I+ Q VPR +RI PLY EVTR++G  TETAWAGAAFN
Sbjct  190   VLIVIPKLKGSALLTAKNILMLIIICQYVPRFVRIIPLYLEVTRSAGIITETAWAGAAFN  249

Query  593   LFLYMIASYVAGAIWYITAIERQDKCWRRAC-EKHGSCDIDFLYCTKLGRRGGDFSSSFL  769
             L LYM+AS+V GA+WY+ AI+RQ  CWR AC +    C +  LYC   G   G+  +SFL
Sbjct  250   LLLYMLASHVLGAMWYLLAIDRQYACWRHACSQSQNHCHMASLYC---GEHNGN--NSFL  304

Query  770   NTSCALLEPENLKADDFDFGIFLDALKSNVVEKRYFWSKLFYCFWWGLRNLSSLGQNLKT  949
                C L E +N+    F+FGI+L AL+ NV + R F  KLFYCFWWGL+NLSSLGQNL+T
Sbjct  305   FHDCPLSEDQNV----FNFGIYLHALQ-NVAQSRNFLEKLFYCFWWGLQNLSSLGQNLET  359

Query  950   SNFVGEilfailisiiglilfslligNMQKYLQSITVRVEEMRVKRMDAEQWMSHRMLPD  1129
             S +  EILFA+ +SI GL+LF+LLIGNMQ YLQS TVR+EEMRVKR DAEQWMSHR+LPD
Sbjct  360   STYTWEILFAVFVSISGLVLFALLIGNMQTYLQSTTVRIEEMRVKRRDAEQWMSHRLLPD  419

Query  1130  NLRERIRRYEQYRWQETRGVDEESLISNLPKDLRRDINRHLCWSLLKRVHMFKTMDEQLL  1309
             +LRERIRR+EQYRWQETRGVDEE+L+ NLPKDLRRDI RHLC +LL RV MF+ MD+QL+
Sbjct  420   SLRERIRRHEQYRWQETRGVDEENLLRNLPKDLRRDIKRHLCLNLLMRVPMFEKMDDQLM  479

Query  1310  DAICDRLKPVLYTEKSCIVREGDPVDEMIFVMRGNLLTMTTNGGRTGFLNSDVLNAGDFC  1489
             DA+CDRLKPVLYTE SCIVREGDPV+EM+F+MRG L +MTTNGGRTGF N  VL AGDFC
Sbjct  480   DAMCDRLKPVLYTEGSCIVREGDPVNEMLFIMRGKLESMTTNGGRTGFFNLHVLKAGDFC  539

Query  1490  GEELLTWALDPNSSSSLPISTRTVQALTDVEAFALTADFLKFFASQYRRLHSKQLQHKFR  1669
             GEELLTWALDP+S+SSLP STRTV+AL++VEAFAL A+ LK  ASQ+RRLHSKQLQH FR
Sbjct  540   GEELLTWALDPHSASSLPSSTRTVKALSEVEAFALMAEDLKLVASQFRRLHSKQLQHTFR  599

Query  1670  FYSHQWKTWAACFIQAAWRRHCRNKLEKSLREEEDRLQDALILRMRREEGETTPSLGATI  1849
              YSHQW+TWAACFIQAAWRR+ R KLE +L EEE+RLQ A+        G ++PSLGAT+
Sbjct  600   LYSHQWRTWAACFIQAAWRRYSRKKLEDALHEEEERLQAAMA-----SGGASSPSLGATL  654

Query  1850  YASRFAANVLRTVRRNHplsvpklsprlpplllqkpAEPDFSAPEN  1987
             YASRFA NV+RT+RRN      +L  RLP +LLQKPAEP+FSA ++
Sbjct  655   YASRFAVNVMRTLRRN-GTRKARLQERLPVMLLQKPAEPNFSAEKH  699



>ref|XP_010442868.1| PREDICTED: cyclic nucleotide-gated ion channel 1-like [Camelina 
sativa]
Length=716

 Score =   835 bits (2158),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 439/643 (68%), Positives = 526/643 (82%), Gaps = 12/643 (2%)
 Frame = +2

Query  53    KMHDPQGPFLQRWNRIFVIACILAATVDPLFFYIPVVDDQNKCLGLDRTLEITACILRSV  232
             K+ DPQGPFLQRWN+IFV+ACI+A ++DPLFFY+P++DD  KCLG+D+ +EITA +LRS 
Sbjct  83    KILDPQGPFLQRWNKIFVLACIIAVSLDPLFFYVPIIDDSKKCLGIDKKMEITASVLRSF  142

Query  233   FDFFYIFHIILQFRTGFVPPSSRVFGRGDLIVDPSAIAKRYFFSYFFIDILAVLPLPQVV  412
              D FYI HII QFRTGF+ PSSRVFGRG L+ D   IAKRY  S+F IDILAVLPLPQ+V
Sbjct  143   TDVFYIIHIIFQFRTGFIAPSSRVFGRGVLVEDKRQIAKRYLSSHFIIDILAVLPLPQMV  202

Query  413   LFMMIPRADRPFIMVAKDILKVVILVQSVPRLLRIYPLYKEVTRTSGFFTETAWAGAAFN  592
             + + IP       +  K++LK ++  Q +PR +RIYPLYKEVTRTSG  TETAWAGAAFN
Sbjct  203   ILIFIPHMRGSISLNTKNMLKFIVFFQYIPRFIRIYPLYKEVTRTSGILTETAWAGAAFN  262

Query  593   LFLYMIASYVAGAIWYITAIERQDKCWRRACEKHGS-CDIDFLYCTKLGRRGGDFSSSFL  769
             LFLYM+AS+V GA WY+ +IER+  CW++AC++    C+   LYC    R G    ++FL
Sbjct  263   LFLYMLASHVFGAFWYLFSIERETVCWKQACKRRTDLCNPKLLYCDHKSRGG----NAFL  318

Query  770   NTSCALLEPENLKADDFDFGIFLDALKSNVVEKRYFWSKLFYCFWWGLRNLSSLGQNLKT  949
             N SC +  P    A  F+FGIFLDAL+S VVE + F  K FYCFWWGL+NLSSLGQNLKT
Sbjct  319   NESCPIQTPN---ATLFNFGIFLDALQSGVVESQDFPQKFFYCFWWGLQNLSSLGQNLKT  375

Query  950   SNFVGEilfailisiiglilfslligNMQKYLQSITVRVEEMRVKRMDAEQWMSHRMLPD  1129
             S +V EI FA+ ISI GL+LFS LIGNMQ YLQS T R+EEMRVKR DAEQWMSHR+LP+
Sbjct  376   STYVWEICFAVFISIAGLVLFSFLIGNMQTYLQSTTTRLEEMRVKRRDAEQWMSHRLLPE  435

Query  1130  NLRERIRRYEQYRWQETRGVDEESLISNLPKDLRRDINRHLCWSLLKRVHMFKTMDEQLL  1309
             NLR+RIRRYEQY+WQETRGVDEE+L+SNLPKDLRRDI RHLC +LL RV MF+ MDEQLL
Sbjct  436   NLRKRIRRYEQYKWQETRGVDEENLLSNLPKDLRRDIKRHLCLALLMRVPMFEKMDEQLL  495

Query  1310  DAICDRLKPVLYTEKSCIVREGDPVDEMIFVMRGNLLTMTTNGGRTGFLNSDVLNAGDFC  1489
             DA+CDRL+PVLYTE+S IVREGDPVDEM+F+MRG LLTMTTNGGRTGF NS+ L AGDFC
Sbjct  496   DALCDRLQPVLYTEESYIVREGDPVDEMLFIMRGKLLTMTTNGGRTGFFNSEYLGAGDFC  555

Query  1490  GEELLTWALDPNSSSSLPISTRTVQALTDVEAFALTADFLKFFASQYRRLHSKQLQHKFR  1669
             GEELLTWALDP++SS+LPISTRTV+AL +VEAFAL AD LKF ASQ+RRLHSKQL+H FR
Sbjct  556   GEELLTWALDPHTSSNLPISTRTVRALMEVEAFALKADDLKFVASQFRRLHSKQLRHTFR  615

Query  1670  FYSHQWKTWAACFIQAAWRRHCRNKLEKSLREEEDRLQDALILRMRREEGETTPSLGATI  1849
             FYS QW+TWAACFIQAAWRR+ + KLE+SL+EEE+RLQDAL     +E   ++PSLGATI
Sbjct  616   FYSQQWRTWAACFIQAAWRRYIKKKLEESLKEEENRLQDALA----KEACGSSPSLGATI  671

Query  1850  YASRFAANVLRTVRRNHplsvpklsprlpplllqkpAEPDFSA  1978
             YASRFAAN+LRT+RR+  +  P++  R+PP+LLQKPAEPDF++
Sbjct  672   YASRFAANILRTIRRSGSVRKPRMPERMPPMLLQKPAEPDFNS  714



>ref|XP_004160370.1| PREDICTED: cyclic nucleotide-gated ion channel 1-like [Cucumis 
sativus]
Length=714

 Score =   835 bits (2157),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 441/648 (68%), Positives = 522/648 (81%), Gaps = 18/648 (3%)
 Frame = +2

Query  53    KMHDPQGPFLQRWNRIFVIACILAATVDPLFFYIPVVDDQNKCLGLDRTLEITACILRSV  232
             K+ DPQGPFLQ+WN+IFV++C++A ++DPLFFY+PV+DD  KCLGLD  +EITA +LRS 
Sbjct  82    KVLDPQGPFLQKWNKIFVLSCVIAVSLDPLFFYVPVIDDDKKCLGLDNKMEITASVLRSF  141

Query  233   FDFFYIFHIILQFRTGFVPPSSRVFGRGDLIVDPSAIAKRYFFSYFFIDILAVLPLPQVV  412
              D FYI HI+ QFRTGF+ PSSRVFGRG L+ D   IAKRY  SYF IDILAVLPLPQVV
Sbjct  142   TDIFYILHIVFQFRTGFIAPSSRVFGRGVLVEDAWEIAKRYLSSYFLIDILAVLPLPQVV  201

Query  413   LFMMIPRADRPFIMVAKDILKVVILVQSVPRLLRIYPLYKEVTRTSGFFTETAWAGAAFN  592
             + ++IP       +  KD+LK V+  Q VPR +RIYPLYKEVTRTS   TETAWAGAAFN
Sbjct  202   ILIIIPNMKGSRSLNTKDLLKFVVFFQYVPRFIRIYPLYKEVTRTS-VLTETAWAGAAFN  260

Query  593   LFLYMIASYVAGAIWYITAIERQDKCWRRACEKHGSCDIDFLYC-TKLGRRGGDFSSSFL  769
             LFLYM+AS+V GA WY+ +IER+  CW+RAC K G C  + LYC   + +R    +++FL
Sbjct  261   LFLYMLASHVFGAFWYLFSIERETTCWQRACHKTG-CVSNSLYCDADVSQR----NNAFL  315

Query  770   NTSCALLEPENLKADDFDFGIFLDALKSNVVEKRYFWSKLFYCFWWGLRNLSSLGQNLKT  949
             N SC+L+E        FDFGIFLDALKS VV    F  K FYCFWWGLRNLSSLGQNL+T
Sbjct  316   NVSCSLVEDN----PPFDFGIFLDALKSGVVGSMNFPQKFFYCFWWGLRNLSSLGQNLQT  371

Query  950   SNFVGEilfailisiiglilfslligNMQKYLQSITVRVEEMRVKRMDAEQWMSHRMLPD  1129
             S +V EI FA+ ISI GL+LFS LIGNMQ YLQS T R+EEMRV+R DAEQWMSHR+LP+
Sbjct  372   STYVWEICFAVFISISGLVLFSFLIGNMQTYLQSTTTRLEEMRVRRRDAEQWMSHRLLPE  431

Query  1130  NLRERIRRYEQYRWQETRGVDEESLISNLPKDLRRDINRHLCWSLLKRV-HMFKTMDEQL  1306
             +LRERIRRYEQY+WQETRGVDEE+L+ NLPKDLRRDI RHLC SLL RV  +F+ MDEQL
Sbjct  432   SLRERIRRYEQYKWQETRGVDEENLVRNLPKDLRRDIKRHLCLSLLMRVIPIFEKMDEQL  491

Query  1307  LDAICDRLKPVLYTEKSCIVREGDPVDEMIFVMRGNLLTMTTNGGRTGFLNSDVLNAGDF  1486
             LDA+CDRLKPVLYTE+S IVREGDPVDEMIF+MRG LL++TTNGGRTGF NS+ L AGDF
Sbjct  492   LDAMCDRLKPVLYTEESYIVREGDPVDEMIFIMRGKLLSVTTNGGRTGFFNSEHLKAGDF  551

Query  1487  CGEELLTWALDPNSSSSLPISTRTVQALTDVEAFALTADFLKFFASQYRRLHSKQLQHKF  1666
             CGEELLTWALDP+SSS+LPISTRTV+ L++VEAFAL AD LKF ASQ+RRLHSKQL+H F
Sbjct  552   CGEELLTWALDPHSSSNLPISTRTVRTLSEVEAFALKADDLKFVASQFRRLHSKQLRHTF  611

Query  1667  RFYSHQWKTWAACFIQAAWRRHCRNKLEKSLREEEDRLQDALILRMRREEGETTPSLGAT  1846
             R YS QW+TWAACFIQAAWRR+ R K E++L EEE+RL+DAL      + G ++PSLGAT
Sbjct  612   RLYSQQWRTWAACFIQAAWRRYRRKKHEQTLLEEENRLKDALA-----KTGGSSPSLGAT  666

Query  1847  IYASRFAANVLRTVRRNHplsvpklsprlpplllqkpAEPDFSAPENN  1990
             IYASRFAAN+LRT+RR       ++  R+PPLLLQKPAEPDF++ EN+
Sbjct  667   IYASRFAANILRTIRRTS-SRKARIPERIPPLLLQKPAEPDFTSEENS  713



>ref|XP_004240273.1| PREDICTED: cyclic nucleotide-gated ion channel 1-like [Solanum 
lycopersicum]
 ref|XP_010321519.1| PREDICTED: cyclic nucleotide-gated ion channel 1-like [Solanum 
lycopersicum]
 ref|XP_010321520.1| PREDICTED: cyclic nucleotide-gated ion channel 1-like [Solanum 
lycopersicum]
Length=715

 Score =   834 bits (2155),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 433/640 (68%), Positives = 521/640 (81%), Gaps = 16/640 (3%)
 Frame = +2

Query  62    DPQGPFLQRWNRIFVIACILAATVDPLFFYIPVVDDQNKCLGLDRTLEITACILRSVFDF  241
             DPQG FLQ+WN++F++AC+ A ++DPLFFYIPV+DD+NKCL LD TL+ITAC+LRS+ D 
Sbjct  87    DPQGQFLQKWNKVFILACVFAVSLDPLFFYIPVIDDKNKCLDLDNTLKITACVLRSITDL  146

Query  242   FYIFHIILQFRTGFVPPSSRVFGRGDLIVDPSAIAKRYFFSYFFIDILAVLPLPQVVLFM  421
             FY+FHIIL+FRTGF+ PSSRV+G G+LI D SAIAKRY  SYF +D++AVLPLPQ+V+ +
Sbjct  147   FYVFHIILKFRTGFIAPSSRVYGVGELIEDSSAIAKRYLLSYFIVDVVAVLPLPQIVILI  206

Query  422   MIPRADRPFIMVAKDILKVVILVQSVPRLLRIYPLYKEVTRTSGFFTETAWAGAAFNLFL  601
             + P  + P  +  K++LK+VI  Q VPRL RIYPL KE+ RT+GFF E+A  GA FNLFL
Sbjct  207   IAPNVNGPIALATKEMLKIVIFAQYVPRLFRIYPLSKEIERTTGFFNESALGGAVFNLFL  266

Query  602   YMIASYVAGAIWYITAIERQDKCWRRACEKHGSCDIDFLYCTKLGRRGGDFSSSFLNTSC  781
             YM+ S V GA WY+ +IERQD CWR AC+K  +C  D+LYC   G+  G  S+  LN+SC
Sbjct  267   YMLYSNVIGAFWYLFSIERQDTCWRNACDKIPNCLSDYLYCG--GKMNG--SAFLLNSSC  322

Query  782   ALLEPENLK-ADDFDFGIFLDALKSNVVEKRYFWSKLFYCFWWGLRNLSSLGQNLKTSNF  958
              LL+ E++K  ++FDFGI LDAL+  VVEKR F +KL YCFWWGLRNLSSLGQNLKTS F
Sbjct  323   PLLQQEDIKDPNEFDFGIALDALQFQVVEKRKFRTKLVYCFWWGLRNLSSLGQNLKTSTF  382

Query  959   VGEilfailisiiglilfslligNMQKYLQSITVRVEEMRVKRMDAEQWMSHRMLPDNLR  1138
              G+I+FA+ ISIIGLILFSL+IGNMQK++QS  VRVEEMR++R D EQWMSHRMLPDNLR
Sbjct  383   DGDIIFAVFISIIGLILFSLIIGNMQKFMQSNLVRVEEMRMRRRDVEQWMSHRMLPDNLR  442

Query  1139  ERIRRYEQYRWQETRGVDEESLISNLPKDLRRDINRHLCWSLLKRVHMFKTMDEQLLDAI  1318
             ERIRR+EQY+WQET+GV+E+SLI +LP+DLRRD+ RHLCWSLLKRV +F+ MD+QLLDA+
Sbjct  443   ERIRRHEQYKWQETKGVEEDSLIQSLPRDLRRDLKRHLCWSLLKRVPIFEKMDDQLLDAL  502

Query  1319  CDRLKPVLYTEKSCIVREGDPVDEMIFVMRGNLLTMTTNGGRTGFLNSDVLNAGDFCGEE  1498
             CDRLKP L+ EKS I+REGDPV+EM F+MRG LLTMTTNGGRTGF NS  L AGDFCG+E
Sbjct  503   CDRLKPALFAEKSFIIREGDPVEEMHFLMRGTLLTMTTNGGRTGFFNSVHLKAGDFCGDE  562

Query  1499  LLTWALDPN-SSSSLPISTRTVQALTDVEAFALTADFLKFFASQYRRLHSKQLQHKFRFY  1675
             LLTWALDP+ SSSSLPISTRTVQA+TD+E+F+LTAD LKF ASQ+RRLHSKQLQH FRF+
Sbjct  563   LLTWALDPHTSSSSLPISTRTVQAVTDIESFSLTADDLKFVASQFRRLHSKQLQHTFRFF  622

Query  1676  SHQWKTWAACFIQAAWRRHCRNKLEKSLREEEDRLQDALILRMRREEGETTPSLGATIYA  1855
             S QW+TWAACFIQ AWRRHCR KLE SLREEED+LQ AL      +E     SLG+ +YA
Sbjct  623   SQQWRTWAACFIQVAWRRHCRKKLENSLREEEDKLQVALA-----KESTNASSLGSIMYA  677

Query  1856  SRFAANVLRTVRRNHplsvpklsprlpplllqkpAEPDFS  1975
             SRFAANVLR +R N+         R  PLL  KPAEPDFS
Sbjct  678   SRFAANVLRALRHNN-----TTGTRSLPLLFHKPAEPDFS  712



>ref|XP_006280090.1| hypothetical protein CARUB_v10025973mg [Capsella rubella]
 gb|EOA12988.1| hypothetical protein CARUB_v10025973mg [Capsella rubella]
Length=716

 Score =   834 bits (2154),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 440/643 (68%), Positives = 526/643 (82%), Gaps = 12/643 (2%)
 Frame = +2

Query  53    KMHDPQGPFLQRWNRIFVIACILAATVDPLFFYIPVVDDQNKCLGLDRTLEITACILRSV  232
             K+ DPQGPFLQRWN+IFV+ACI+A ++DPLFFY+P++DD  KCLG+DR +EITA +LRS 
Sbjct  83    KILDPQGPFLQRWNKIFVLACIIAVSLDPLFFYVPIIDDAKKCLGIDRKMEITASVLRSF  142

Query  233   FDFFYIFHIILQFRTGFVPPSSRVFGRGDLIVDPSAIAKRYFFSYFFIDILAVLPLPQVV  412
              D FYI HII QFRTGF+ PSSRVFGRG L+ D   IAKRY  S+F IDILAVLPLPQ+V
Sbjct  143   TDVFYIIHIIFQFRTGFIAPSSRVFGRGVLVEDKGQIAKRYLSSHFIIDILAVLPLPQMV  202

Query  413   LFMMIPRADRPFIMVAKDILKVVILVQSVPRLLRIYPLYKEVTRTSGFFTETAWAGAAFN  592
             + ++IP       +  K++LK ++  Q +PR +RIYPLYKEVTRTSG  TETAWAGAAFN
Sbjct  203   ILIVIPHMRGSPSLNTKNMLKFIVFFQYIPRFIRIYPLYKEVTRTSGILTETAWAGAAFN  262

Query  593   LFLYMIASYVAGAIWYITAIERQDKCWRRACEKHGS-CDIDFLYCTKLGRRGGDFSSSFL  769
             LFLYM+AS+V GA WY+ +IER+  CW++AC+K  S C  + LYC      G    ++FL
Sbjct  263   LFLYMLASHVFGAFWYLFSIERETVCWKQACKKRKSICITELLYCDPKTTVG----NAFL  318

Query  770   NTSCALLEPENLKADDFDFGIFLDALKSNVVEKRYFWSKLFYCFWWGLRNLSSLGQNLKT  949
             N SC +  P       FDFGIFL+AL+S VVE + F  K FYCFWWGL+NLSSLGQNLKT
Sbjct  319   NESCPIQTPNTTL---FDFGIFLNALQSGVVESQDFPQKFFYCFWWGLQNLSSLGQNLKT  375

Query  950   SNFVGEilfailisiiglilfslligNMQKYLQSITVRVEEMRVKRMDAEQWMSHRMLPD  1129
             S +V EI FA+ ISI GL+LFS LIGNMQ YLQS T R+EEMRVKR DAEQWMSHR+LP+
Sbjct  376   STYVWEICFAVFISIAGLVLFSFLIGNMQTYLQSTTTRLEEMRVKRRDAEQWMSHRLLPE  435

Query  1130  NLRERIRRYEQYRWQETRGVDEESLISNLPKDLRRDINRHLCWSLLKRVHMFKTMDEQLL  1309
             NLR+RIRRYEQY+WQETRGVDEE+L+SNLPKDLRRDI RHLC +LL RV MF+ MDEQLL
Sbjct  436   NLRKRIRRYEQYKWQETRGVDEENLLSNLPKDLRRDIKRHLCLALLMRVPMFEKMDEQLL  495

Query  1310  DAICDRLKPVLYTEKSCIVREGDPVDEMIFVMRGNLLTMTTNGGRTGFLNSDVLNAGDFC  1489
             DA+CDRL+PVLYTE+S IVREGDPVDEM+F+MRG LLTMTTNGGRTGF NS+ L AGDFC
Sbjct  496   DALCDRLQPVLYTEESYIVREGDPVDEMLFIMRGKLLTMTTNGGRTGFFNSEYLGAGDFC  555

Query  1490  GEELLTWALDPNSSSSLPISTRTVQALTDVEAFALTADFLKFFASQYRRLHSKQLQHKFR  1669
             GEELLTWALDP++SS+LPISTRTV+AL +VEAFAL AD LKF ASQ+RRLHSKQL+H FR
Sbjct  556   GEELLTWALDPHTSSNLPISTRTVRALMEVEAFALKADDLKFVASQFRRLHSKQLRHTFR  615

Query  1670  FYSHQWKTWAACFIQAAWRRHCRNKLEKSLREEEDRLQDALILRMRREEGETTPSLGATI  1849
             FYS QW+TWAACFIQAAWRR+ + KLE+SL+EEE+RLQDAL     +E   ++PSLGATI
Sbjct  616   FYSQQWRTWAACFIQAAWRRYIKKKLEESLKEEENRLQDALA----KEACGSSPSLGATI  671

Query  1850  YASRFAANVLRTVRRNHplsvpklsprlpplllqkpAEPDFSA  1978
             YASRFAAN+LRT+RR+  +  P++  R+PP+LLQKPAEPDF++
Sbjct  672   YASRFAANILRTIRRSGSVRKPRMPERMPPMLLQKPAEPDFNS  714



>ref|XP_009599134.1| PREDICTED: cyclic nucleotide-gated ion channel 1-like isoform 
X1 [Nicotiana tomentosiformis]
 ref|XP_009599135.1| PREDICTED: cyclic nucleotide-gated ion channel 1-like isoform 
X1 [Nicotiana tomentosiformis]
 ref|XP_009599136.1| PREDICTED: cyclic nucleotide-gated ion channel 1-like isoform 
X1 [Nicotiana tomentosiformis]
 ref|XP_009599137.1| PREDICTED: cyclic nucleotide-gated ion channel 1-like isoform 
X1 [Nicotiana tomentosiformis]
Length=708

 Score =   833 bits (2153),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 432/646 (67%), Positives = 510/646 (79%), Gaps = 13/646 (2%)
 Frame = +2

Query  47    KSKMHDPQGPFLQRWNRIFVIACILAATVDPLFFYIPVVDDQNKCLGLDRTLEITACILR  226
             K  + DPQGPFLQ+WN+IFV++C++A ++DPLF YIPV+D+ NKCLGLDRTLE+TA +LR
Sbjct  75    KKNILDPQGPFLQKWNKIFVLSCVIAISLDPLFLYIPVIDNDNKCLGLDRTLEVTASVLR  134

Query  227   SVFDFFYIFHIILQFRTGFVPPSSRVFGRGDLIVDPSAIAKRYFFSYFFIDILAVLPLPQ  406
             S  D FY  HI LQFRTGF+ PSSRVFGRG LI D   IAKRY  +YF IDILAVLPLPQ
Sbjct  135   SFTDIFYFLHIALQFRTGFIAPSSRVFGRGVLIEDAWEIAKRYLSTYFLIDILAVLPLPQ  194

Query  407   VVLFMMIPRADRPFIMVAKDILKVVILVQSVPRLLRIYPLYKEVTRTSGFFTETAWAGAA  586
             VV+ ++IP+      +  K++LK V+  Q +PR+LR+YPLYKEVTRTSG  TETAWAGAA
Sbjct  195   VVILIIIPKLRGSRSLNTKNLLKSVVFFQYIPRVLRVYPLYKEVTRTSGILTETAWAGAA  254

Query  587   FNLFLYMIASYVAGAIWYITAIERQDKCWRRACEKHGSCDIDFLYCTKLGRRGGDFSSSF  766
             FNLFLYM+AS+V GA WY+ +IER+  CW++AC     C    LYC     +      + 
Sbjct  255   FNLFLYMLASHVLGAFWYLFSIERETTCWKQACGNSSPCHHASLYCDDDHTK----FKTL  310

Query  767   LNTSCALLEPENLKADDFDFGIFLDALKSNVVEKRYFWSKLFYCFWWGLRNLSSLGQNLK  946
             LN+SC +  P    A  FDFGIFLDAL+S VV    F  K FYCFWWGL+NLSSLGQNL+
Sbjct  311   LNSSCPIETP---NATLFDFGIFLDALQSGVVGPMDFPQKFFYCFWWGLQNLSSLGQNLQ  367

Query  947   TSNFVGEilfailisiiglilfslligNMQKYLQSITVRVEEMRVKRMDAEQWMSHRMLP  1126
             TS F+ EI FA+ ISI GL+LF+ LIGNMQ  LQS T+R+EEMRVKR DAEQWMSHR+LP
Sbjct  368   TSTFIWEICFAVFISIAGLVLFAFLIGNMQTCLQSSTLRLEEMRVKRRDAEQWMSHRLLP  427

Query  1127  DNLRERIRRYEQYRWQETRGVDEESLISNLPKDLRRDINRHLCWSLLKRVHMFKTMDEQL  1306
             +NLRERIR YEQYRWQETRGVDEE+LI NLPKDLRRDI RHLC +LL RV MF+ MDEQL
Sbjct  428   ENLRERIRHYEQYRWQETRGVDEENLIHNLPKDLRRDIKRHLCLALLMRVPMFEKMDEQL  487

Query  1307  LDAICDRLKPVLYTEKSCIVREGDPVDEMIFVMRGNLLTMTTNGGRTGFLNSDVLNAGDF  1486
             LDA+CD LKPVL+T+ S IVREGDPVD M+FVMRG LL++TTNGGRTGF NS+ L AGDF
Sbjct  488   LDALCDHLKPVLFTKDSFIVREGDPVDAMLFVMRGKLLSVTTNGGRTGFFNSEHLKAGDF  547

Query  1487  CGEELLTWALDPNSSSSLPISTRTVQALTDVEAFALTADFLKFFASQYRRLHSKQLQHKF  1666
             CGEELLTWALDPNSS++LPISTRT QAL++VEAFAL AD LK  ASQ+RRLHSKQL+H F
Sbjct  548   CGEELLTWALDPNSSTNLPISTRTAQALSEVEAFALVADDLKLVASQFRRLHSKQLRHTF  607

Query  1667  RFYSHQWKTWAACFIQAAWRRHCRNKLEKSLREEEDRLQDALILRMRREEGETTPSLGAT  1846
             RFYS QW+TWAACFIQAAWR +CR K+E+SLREEE+RLQDAL       EG ++PSLGAT
Sbjct  608   RFYSGQWRTWAACFIQAAWRSYCRKKVEESLREEENRLQDALA-----NEGGSSPSLGAT  662

Query  1847  IYASRFAANVLRTVRRNHplsvpklsprlpplllqkpAEPDFSAPE  1984
              YASRFAAN LR +RRN      ++  R+ P+LLQKP EPDF+A +
Sbjct  663   FYASRFAANALRALRRN-TAKKARVPDRISPILLQKPTEPDFTAED  707



>ref|XP_008351078.1| PREDICTED: cyclic nucleotide-gated ion channel 1 [Malus domestica]
Length=721

 Score =   834 bits (2154),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 433/645 (67%), Positives = 514/645 (80%), Gaps = 9/645 (1%)
 Frame = +2

Query  47    KSKMHDPQGPFLQRWNRIFVIACILAATVDPLFFYIPVVDDQNKCLGLDRTLEITACILR  226
             + K+ DPQG FLQ WN+IFV++C++A ++DPLF Y PVVD + KC+ LDR L+I AC+LR
Sbjct  82    RRKILDPQGSFLQNWNKIFVLSCVIAVSLDPLFLYTPVVDGKYKCVDLDRRLQIIACVLR  141

Query  227   SVFDFFYIFHIILQFRTGFVPPSSRVFGRGDLIVDPSAIAKRYFFSYFFIDILAVLPLPQ  406
             S  D F++ HII QFRTGF+ PSSRVFGRG+LI DP AIAKRY  SYF IDILA+LPLPQ
Sbjct  142   SFTDIFHVLHIIFQFRTGFIAPSSRVFGRGELIDDPVAIAKRYLSSYFIIDILAILPLPQ  201

Query  407   VVLFMMIPRADRPFIMVAKDILKVVILVQSVPRLLRIYPLYKEVTRTSGFFTETAWAGAA  586
              V+F++IP    P   VAKD +K VI+ Q VPR  RIYPLYKEVTRTSGF TETAWAGAA
Sbjct  202   AVVFIVIPTISLPVSXVAKDXMKFVIVAQYVPRFWRIYPLYKEVTRTSGFLTETAWAGAA  261

Query  587   FNLFLYMIASYVAGAIWYITAIERQDKCWRRACEKHGSCDIDFLYCTKLGRRGGDFSSSF  766
             FNL LYM+AS++ GA WY+ ++ER+ +CWR  C+    C   FLYC         F ++ 
Sbjct  262   FNLLLYMLASHIXGAFWYLFSVEREYRCWRDQCBGDRXCK-KFLYCXSXXDTDASFVAN-  319

Query  767   LNTSCALLEPENLKADD-FDFGIFLDALKSNVVEKRYFWSKLFYCFWWGLRNLSSLGQNL  943
                SC  ++P ++K    F+FGI+ DAL S VVE R F  K  +CFWWGLRNLSSLGQNL
Sbjct  320   KXASCPFIDPGDIKNSSVFNFGIYYDALASGVVETRDFPKKXSFCFWWGLRNLSSLGQNL  379

Query  944   KTSNFVGEilfailisiiglilfslligNMQKYLQSITVRVEEMRVKRMDAEQWMSHRML  1123
             KTS FV EI+FA+ ISI+GL+LFSLLIGNMQKYLQS TVRVEEMRVKR DAEQWM+HRML
Sbjct  380   KTSTFVWEIVFAVTISILGLVLFSLLIGNMQKYLQSTTVRVEEMRVKRRDAEQWMAHRML  439

Query  1124  PDNLRERIRRYEQYRWQETRGVDEESLISNLPKDLRRDINRHLCWSLLKRVHMFKTMDEQ  1303
             P+NLRERIRRY+QY+WQETRGVDE++L+ NLPKDLR+DI RHLC +LL+RV +F+ MDEQ
Sbjct  440   PENLRERIRRYDQYKWQETRGVDEDTLVRNLPKDLRKDIKRHLCLALLQRVPIFEKMDEQ  499

Query  1304  LLDAICDRLKPVLYTEKSCIVREGDPVDEMIFVMRGNLLTMTTNGGRTGFLNSDVLNAGD  1483
             L+DA+CDRLKPVLYT+KS I REGDPVDEM+F+MRGNL TMTTNGGRTGF N+  L AGD
Sbjct  500   LMDAMCDRLKPVLYTDKSYITREGDPVDEMLFIMRGNLATMTTNGGRTGFFNTADLKAGD  559

Query  1484  FCGEELLTWALDPNSSSSLPISTRTVQALTDVEAFALTADFLKFFASQYRRLHSKQLQHK  1663
             FCGEELLTWALDPNSS++LP STRTV+A T+VEAFAL AD LKF ASQ+RR+HSKQLQH 
Sbjct  560   FCGEELLTWALDPNSSTNLPTSTRTVEAKTEVEAFALMADDLKFVASQFRRMHSKQLQHT  619

Query  1664  FRFYSHQWKTWAACFIQAAWRRHCRNKLEKSLREEEDRLQDALILRMRREEGETTPSLGA  1843
             FR YS QW+TW+ACFIQAAWRRH + KLEKSLREEEDRLQDAL     R+ G T+PSL A
Sbjct  620   FRLYSQQWRTWSACFIQAAWRRHWKRKLEKSLREEEDRLQDALT----RDAG-TSPSLLA  674

Query  1844  TIYASRFAANVLRTVRRNHplsvpklsprlpplllqkpAEPDFSA  1978
              +YAS+FAAN LR +R+   +   +  P L PLL QKPAEPDF+A
Sbjct  675   AVYASKFAANALRGLRQKG-IRDTRPPPTLLPLLPQKPAEPDFTA  718



>ref|XP_009405709.1| PREDICTED: cyclic nucleotide-gated ion channel 1-like [Musa acuminata 
subsp. malaccensis]
 ref|XP_009405710.1| PREDICTED: cyclic nucleotide-gated ion channel 1-like [Musa acuminata 
subsp. malaccensis]
Length=667

 Score =   831 bits (2146),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 430/647 (66%), Positives = 515/647 (80%), Gaps = 14/647 (2%)
 Frame = +2

Query  47    KSKMHDPQGPFLQRWNRIFVIACILAATVDPLFFYIPVVDDQNKCLGLDRTLEITACILR  226
             + K+ DPQGPFLQ+WN+IFV++C++A +VDPLFFYIP V+D++ C+ LD  L ITA +LR
Sbjct  35    RKKVLDPQGPFLQKWNKIFVLSCVVAISVDPLFFYIPFVNDKDTCVDLDENLVITASVLR  94

Query  227   SVFDFFYIFHIILQFRTGFVPPSSRVFGRGDLIVDPSAIAKRYFFSYFFIDILAVLPLPQ  406
             S  D FY+ HII QFRTGF+ P SRVFGRG L+ D SAIA RY  SYF IDILAV+PLPQ
Sbjct  95    SFTDIFYVLHIIFQFRTGFIAPPSRVFGRGVLVEDFSAIALRYLKSYFLIDILAVIPLPQ  154

Query  407   VVLFMMIPRADRPFIMVAKDILKVVILVQSVPRLLRIYPLYKEVTRTSGFFTETAWAGAA  586
             VV+ ++IP+      + AK +L  +I++Q VPRL+RI PLY EVT+++G   ETAWAGAA
Sbjct  155   VVILIIIPKLKGSGSVDAKTLLMYIIILQYVPRLVRIIPLYVEVTKSAGIIAETAWAGAA  214

Query  587   FNLFLYMIASYVAGAIWYITAIERQDKCWRRACEKHGSCDIDFLYCTKLGRRGGDFSSSF  766
              NLFLYM+AS+V GA WY  +IER+D CWRRAC KH +C   F YC        DF    
Sbjct  215   LNLFLYMLASHVLGACWYFLSIEREDSCWRRACHKH-NCTTMFWYCGVKKEESMDF----  269

Query  767   LNTSCALLEPENLKADDFDFGIFLDALKSNVVEKRYFWSKLFYCFWWGLRNLSSLGQNLK  946
             ++  C + E EN  A  FDFG++L AL+S++V  R F  K FYCFWWGL+NLSSLGQNL+
Sbjct  270   IDGECPIQE-EN--ATIFDFGMYLQALQSDIVLLRNFPEKFFYCFWWGLQNLSSLGQNLQ  326

Query  947   TSNFVGEilfailisiiglilfslligNMQKYLQSITVRVEEMRVKRMDAEQWMSHRMLP  1126
             TS ++GEILFA+ ISI GL+LFSLLIGNMQ YLQS TVR+EEMRVKR DAEQWMSHRMLP
Sbjct  327   TSTYLGEILFAVFISISGLVLFSLLIGNMQTYLQSTTVRIEEMRVKRQDAEQWMSHRMLP  386

Query  1127  DNLRERIRRYEQYRWQETRGVDEESLISNLPKDLRRDINRHLCWSLLKRVHMFKTMDEQL  1306
             +NLRERIRR+EQY+WQETRGVDEE L+ NLPKDLRRDI RHLC  LL+RV MF+ MD+QL
Sbjct  387   ENLRERIRRHEQYQWQETRGVDEEHLLQNLPKDLRRDIKRHLCLGLLRRVPMFELMDDQL  446

Query  1307  LDAICDRLKPVLYTEKSCIVREGDPVDEMIFVMRGNLLTMTTNGGRTGFLNSDVLNAGDF  1486
             +DA+CDRLKP+LYTE SCI+REGDPVDEM+F+MRG LL++TTNGGRTGF NSD L  GDF
Sbjct  447   MDAMCDRLKPILYTENSCIIREGDPVDEMLFIMRGRLLSVTTNGGRTGFFNSDYLKEGDF  506

Query  1487  CGEELLTWALDPNSSSSLPISTRTVQALTDVEAFALTADFLKFFASQYRRLHSKQLQHKF  1666
             CGEELLTWALDPNSSSSLPISTRTV+AL++VEAFAL AD LKF ASQ+R+LHSK+L+H F
Sbjct  507   CGEELLTWALDPNSSSSLPISTRTVKALSEVEAFALAADDLKFVASQFRKLHSKKLRHTF  566

Query  1667  RFYSHQWKTWAACFIQAAWRRHCRNKLEKSLREEEDRLQDALILRMRREEGETTPSLGAT  1846
             R YS QW+TWAACFIQAAWRR+ R KLE+SL EEE+RLQ AL+     ++G TTPSLGAT
Sbjct  567   RLYSQQWRTWAACFIQAAWRRYSRKKLEESLHEEENRLQAALV-----KDGTTTPSLGAT  621

Query  1847  IYASRFAANVLRTVRRNHplsvpklsprlpplllqkpAEPDFSAPEN  1987
             IYASRFA N LR +RRN      +L  R+P +LLQKP EPDF+  E 
Sbjct  622   IYASRFAVNALRALRRN-VTRKARLQERMPVMLLQKPPEPDFTVEEQ  667



>ref|XP_008343452.1| PREDICTED: cyclic nucleotide-gated ion channel 1-like [Malus 
domestica]
Length=806

 Score =   836 bits (2160),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 434/645 (67%), Positives = 515/645 (80%), Gaps = 9/645 (1%)
 Frame = +2

Query  47    KSKMHDPQGPFLQRWNRIFVIACILAATVDPLFFYIPVVDDQNKCLGLDRTLEITACILR  226
             + K+ DPQG  LQ WN+IFV++C++A ++DPLF Y PVVD + KC+ LDR L+I AC+LR
Sbjct  167   RRKILDPQGSVLQNWNKIFVLSCVIAVSLDPLFLYTPVVDGKYKCVDLDRRLQIIACVLR  226

Query  227   SVFDFFYIFHIILQFRTGFVPPSSRVFGRGDLIVDPSAIAKRYFFSYFFIDILAVLPLPQ  406
             S  D F++ HII QFRTGF+ PSSRVFGRG+LI DP AIAKRY  SYF IDILA+LPLPQ
Sbjct  227   SFTDIFHVLHIIFQFRTGFIAPSSRVFGRGELIDDPVAIAKRYLSSYFIIDILAILPLPQ  286

Query  407   VVLFMMIPRADRPFIMVAKDILKVVILVQSVPRLLRIYPLYKEVTRTSGFFTETAWAGAA  586
              V+F++IP    P  +VAKD++K VI+ Q VPR  RIYPLYKEVTRTSGF TETAWAGAA
Sbjct  287   AVVFIVIPTISLPVSVVAKDLMKFVIVAQYVPRFWRIYPLYKEVTRTSGFLTETAWAGAA  346

Query  587   FNLFLYMIASYVAGAIWYITAIERQDKCWRRACEKHGSCDIDFLYCTKLGRRGGDFSSSF  766
             FNL LYM+AS++ GA WY+ ++ER+ +CWR  C     C   FLYC         F ++ 
Sbjct  347   FNLLLYMLASHIIGAFWYLFSVEREYRCWRDQCNGDRRCK-KFLYCNSKNDTDASFVAN-  404

Query  767   LNTSCALLEPENLKADD-FDFGIFLDALKSNVVEKRYFWSKLFYCFWWGLRNLSSLGQNL  943
              N SC  ++P ++K    F+FGI+ DAL S VVE R F  KL +CFWWGLRNLSSLGQNL
Sbjct  405   KNASCPFIDPGDIKNSSVFNFGIYYDALASGVVETRDFPKKLSFCFWWGLRNLSSLGQNL  464

Query  944   KTSNFVGEilfailisiiglilfslligNMQKYLQSITVRVEEMRVKRMDAEQWMSHRML  1123
             KTS FV EI+FA+ ISI+GL+LFSLLIGNMQKYLQS TVRVEEMRVKR DAEQWM+HRML
Sbjct  465   KTSTFVWEIVFAVTISILGLVLFSLLIGNMQKYLQSTTVRVEEMRVKRRDAEQWMAHRML  524

Query  1124  PDNLRERIRRYEQYRWQETRGVDEESLISNLPKDLRRDINRHLCWSLLKRVHMFKTMDEQ  1303
             P+NLRERIRRY+QY+WQETRGVDE++L+ NLPKDLR+DI RHLC +LL+RV +F+ MDEQ
Sbjct  525   PENLRERIRRYDQYKWQETRGVDEDTLVRNLPKDLRKDIKRHLCLALLQRVPIFEKMDEQ  584

Query  1304  LLDAICDRLKPVLYTEKSCIVREGDPVDEMIFVMRGNLLTMTTNGGRTGFLNSDVLNAGD  1483
             L+DA+CDRLKPVLYT+KS I REGDPVDEM+F+MRGNL TMTTNGGRTGF N+  L AGD
Sbjct  585   LMDAMCDRLKPVLYTDKSYITREGDPVDEMLFIMRGNLATMTTNGGRTGFFNTADLKAGD  644

Query  1484  FCGEELLTWALDPNSSSSLPISTRTVQALTDVEAFALTADFLKFFASQYRRLHSKQLQHK  1663
             FCGEELLTWALDPNSS++LP STRTV+A T+VEAFAL AD LKF ASQ+RR+HSKQLQH 
Sbjct  645   FCGEELLTWALDPNSSTNLPTSTRTVEAKTEVEAFALMADDLKFVASQFRRMHSKQLQHT  704

Query  1664  FRFYSHQWKTWAACFIQAAWRRHCRNKLEKSLREEEDRLQDALILRMRREEGETTPSLGA  1843
             FR YS QW+TW+ACFIQAAWRRH + KLEKSLREEEDRLQDAL     R+ G T+PSL A
Sbjct  705   FRLYSQQWRTWSACFIQAAWRRHWKRKLEKSLREEEDRLQDALT----RDAG-TSPSLLA  759

Query  1844  TIYASRFAANVLRTVRRNHplsvpklsprlpplllqkpAEPDFSA  1978
              +YAS+FAAN LR +R+       +  P L PLL QKPAEPDF+A
Sbjct  760   AVYASKFAANALRGLRQKG-XRDTRPPPTLLPLLPQKPAEPDFTA  803



>ref|NP_200125.1| cyclic nucleotide-gated ion channel 1 [Arabidopsis thaliana]
 sp|O65717.1|CNGC1_ARATH RecName: Full=Cyclic nucleotide-gated ion channel 1; Short=AtCNGC1; 
AltName: Full=Cyclic nucleotide- and calmodulin-regulated 
ion channel 1 [Arabidopsis thaliana]
 gb|AAK43954.1|AF370139_1 putative cyclic nucleotide-regulated ion channel protein [Arabidopsis 
thaliana]
 emb|CAA76178.1| putative cyclic nucleotide-regulated ion channel [Arabidopsis 
thaliana]
 dbj|BAB08416.1| cyclic nucleotide-regulated ion channel [Arabidopsis thaliana]
 gb|AAN41391.1| putative cyclic nucleotide-regulated ion channel protein [Arabidopsis 
thaliana]
 gb|AED96311.1| cyclic nucleotide-gated ion channel 1 [Arabidopsis thaliana]
Length=716

 Score =   832 bits (2150),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 438/643 (68%), Positives = 526/643 (82%), Gaps = 12/643 (2%)
 Frame = +2

Query  53    KMHDPQGPFLQRWNRIFVIACILAATVDPLFFYIPVVDDQNKCLGLDRTLEITACILRSV  232
             K+ DPQGPFLQRWN+IFV+ACI+A ++DPLFFY+P++DD  KCLG+D+ +EITA +LRS 
Sbjct  83    KILDPQGPFLQRWNKIFVLACIIAVSLDPLFFYVPIIDDAKKCLGIDKKMEITASVLRSF  142

Query  233   FDFFYIFHIILQFRTGFVPPSSRVFGRGDLIVDPSAIAKRYFFSYFFIDILAVLPLPQVV  412
              D FY+ HII QFRTGF+ PSSRVFGRG L+ D   IAKRY  S+F IDILAVLPLPQ+V
Sbjct  143   TDVFYVLHIIFQFRTGFIAPSSRVFGRGVLVEDKREIAKRYLSSHFIIDILAVLPLPQMV  202

Query  413   LFMMIPRADRPFIMVAKDILKVVILVQSVPRLLRIYPLYKEVTRTSGFFTETAWAGAAFN  592
             + ++IP       +  K++LK ++  Q +PR +RIYPLYKEVTRTSG  TETAWAGAAFN
Sbjct  203   ILIIIPHMRGSSSLNTKNMLKFIVFFQYIPRFIRIYPLYKEVTRTSGILTETAWAGAAFN  262

Query  593   LFLYMIASYVAGAIWYITAIERQDKCWRRACEKHGS-CDIDFLYCTKLGRRGGDFSSSFL  769
             LFLYM+AS+V GA WY+ +IER+  CW++ACE++   C    LYC      G    ++FL
Sbjct  263   LFLYMLASHVFGAFWYLFSIERETVCWKQACERNNPPCISKLLYCDPETAGG----NAFL  318

Query  770   NTSCALLEPENLKADDFDFGIFLDALKSNVVEKRYFWSKLFYCFWWGLRNLSSLGQNLKT  949
             N SC +  P       FDFGIFLDAL+S VVE + F  K FYCFWWGL+NLSSLGQNLKT
Sbjct  319   NESCPIQTPNTTL---FDFGIFLDALQSGVVESQDFPQKFFYCFWWGLQNLSSLGQNLKT  375

Query  950   SNFVGEilfailisiiglilfslligNMQKYLQSITVRVEEMRVKRMDAEQWMSHRMLPD  1129
             S ++ EI FA+ ISI GL+LFS LIGNMQ YLQS T R+EEMRVKR DAEQWMSHR+LP+
Sbjct  376   STYIWEICFAVFISIAGLVLFSFLIGNMQTYLQSTTTRLEEMRVKRRDAEQWMSHRLLPE  435

Query  1130  NLRERIRRYEQYRWQETRGVDEESLISNLPKDLRRDINRHLCWSLLKRVHMFKTMDEQLL  1309
             NLR+RIRRYEQY+WQETRGVDEE+L+SNLPKDLRRDI RHLC +LL RV MF+ MDEQLL
Sbjct  436   NLRKRIRRYEQYKWQETRGVDEENLLSNLPKDLRRDIKRHLCLALLMRVPMFEKMDEQLL  495

Query  1310  DAICDRLKPVLYTEKSCIVREGDPVDEMIFVMRGNLLTMTTNGGRTGFLNSDVLNAGDFC  1489
             DA+CDRL+PVLYTE+S IVREGDPVDEM+F+MRG LLT+TTNGGRTGFLNS+ L AGDFC
Sbjct  496   DALCDRLQPVLYTEESYIVREGDPVDEMLFIMRGKLLTITTNGGRTGFLNSEYLGAGDFC  555

Query  1490  GEELLTWALDPNSSSSLPISTRTVQALTDVEAFALTADFLKFFASQYRRLHSKQLQHKFR  1669
             GEELLTWALDP+SSS+LPISTRTV+AL +VEAFAL AD LKF ASQ+RRLHSKQL+H FR
Sbjct  556   GEELLTWALDPHSSSNLPISTRTVRALMEVEAFALKADDLKFVASQFRRLHSKQLRHTFR  615

Query  1670  FYSHQWKTWAACFIQAAWRRHCRNKLEKSLREEEDRLQDALILRMRREEGETTPSLGATI  1849
             +YS QWKTWAACFIQAAWRR+ + KLE+SL+EEE+RLQDAL     +E   ++PSLGATI
Sbjct  616   YYSQQWKTWAACFIQAAWRRYIKKKLEESLKEEENRLQDALA----KEACGSSPSLGATI  671

Query  1850  YASRFAANVLRTVRRNHplsvpklsprlpplllqkpAEPDFSA  1978
             YASRFAAN+LRT+RR+  +  P++  R+PP+LLQKPAEPDF++
Sbjct  672   YASRFAANILRTIRRSGSVRKPRMPERMPPMLLQKPAEPDFNS  714



>emb|CDP05082.1| unnamed protein product [Coffea canephora]
Length=712

 Score =   831 bits (2146),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 436/639 (68%), Positives = 511/639 (80%), Gaps = 13/639 (2%)
 Frame = +2

Query  62    DPQGPFLQRWNRIFVIACILAATVDPLFFYIPVVDDQNKCLGLDRTLEITACILRSVFDF  241
             DPQG FLQ+WN+IFV++C++A ++DPLFFYIPV++   KCL  D+ LE+TA +LRS  D 
Sbjct  85    DPQGLFLQKWNKIFVLSCVIAVSLDPLFFYIPVINGHKKCLSFDKKLEVTASVLRSFTDI  144

Query  242   FYIFHIILQFRTGFVPPSSRVFGRGDLIVDPSAIAKRYFFSYFFIDILAVLPLPQVVLFM  421
             FY+ HII QFRTGF+ PSSRVFGRG L+ D  AIAKRY  SYF IDILAVLPLPQ  + +
Sbjct  145   FYLIHIIFQFRTGFIAPSSRVFGRGVLVEDSWAIAKRYLSSYFLIDILAVLPLPQAAMLI  204

Query  422   MIPRADRPFIMVAKDILKVVILVQSVPRLLRIYPLYKEVTRTSGFFTETAWAGAAFNLFL  601
             +IPR      +  K++LK V+  Q +PR+LRIYPLYKEVTRTSG  TETAWAGAAFNLFL
Sbjct  205   VIPRMRGARSLNTKNMLKFVVFFQYIPRVLRIYPLYKEVTRTSGILTETAWAGAAFNLFL  264

Query  602   YMIASYVAGAIWYITAIERQDKCWRRACEKHGSCDIDFLYCTKLGRRGGDFSSSFLNTSC  781
             YM+AS+V GA WY+ +IER+  CW+ AC     C    LYC     R       FLN SC
Sbjct  265   YMLASHVLGAFWYLFSIERETTCWQSACGNQTDCIHASLYCLDDHLR----FKQFLNDSC  320

Query  782   ALLEPENLKADDFDFGIFLDALKSNVVEKRYFWSKLFYCFWWGLRNLSSLGQNLKTSNFV  961
              +  P+  +   FDFGIFL+AL+S +VE   F  K FYCFWWGL+NLSSLGQNLKTS FV
Sbjct  321   PIQTPDTTR---FDFGIFLNALQSGIVESMDFPRKFFYCFWWGLQNLSSLGQNLKTSTFV  377

Query  962   GEilfailisiiglilfslligNMQKYLQSITVRVEEMRVKRMDAEQWMSHRMLPDNLRE  1141
              EI FA+ ISI GL+LFS LIGNMQ YLQS T+R+EEMRVKR DAEQWMSHR+LPD+L+E
Sbjct  378   WEICFAVFISISGLVLFSFLIGNMQAYLQSTTLRLEEMRVKRRDAEQWMSHRLLPDSLKE  437

Query  1142  RIRRYEQYRWQETRGVDEESLISNLPKDLRRDINRHLCWSLLKRVHMFKTMDEQLLDAIC  1321
             RIRRYEQY+WQE RGVDEE+LI NLPKDLRRDI RHLC +LL RV MF+ +DEQLLDA+C
Sbjct  438   RIRRYEQYKWQENRGVDEENLIQNLPKDLRRDIKRHLCLALLMRVPMFEKLDEQLLDALC  497

Query  1322  DRLKPVLYTEKSCIVREGDPVDEMIFVMRGNLLTMTTNGGRTGFLNSDVLNAGDFCGEEL  1501
             DRLKPVLYT+ S IVREGDPVDEM+F+MRG LLT+TTNGGRTGF NSD L AGDFCGEEL
Sbjct  498   DRLKPVLYTKHSFIVREGDPVDEMLFIMRGKLLTVTTNGGRTGFFNSDYLKAGDFCGEEL  557

Query  1502  LTWALDPNSSSSLPISTRTVQALTDVEAFALTADFLKFFASQYRRLHSKQLQHKFRFYSH  1681
             LTWALDP+SSS+LPISTRTVQAL++VEAFAL AD LKF ASQ+RRLHSKQL+H FRFYS 
Sbjct  558   LTWALDPHSSSNLPISTRTVQALSEVEAFALIADDLKFVASQFRRLHSKQLRHTFRFYSQ  617

Query  1682  QWKTWAACFIQAAWRRHCRNKLEKSLREEEDRLQDALILRMRREEGETTPSLGATIYASR  1861
             QW+TWAACFIQAAWRR CR KLE+SLREEE+ LQ+AL     + EG ++PSLGATIYASR
Sbjct  618   QWRTWAACFIQAAWRRCCRKKLEESLREEENWLQNALA----KNEG-SSPSLGATIYASR  672

Query  1862  FAANVLRTVRRNHplsvpklsprlpplllqkpAEPDFSA  1978
             FAAN LR +RRN      +L+ R+PP++LQKPAEPDF+A
Sbjct  673   FAANALRALRRNG-ARNSRLTDRVPPIMLQKPAEPDFTA  710



>ref|XP_010671493.1| PREDICTED: cyclic nucleotide-gated ion channel 1 [Beta vulgaris 
subsp. vulgaris]
Length=708

 Score =   830 bits (2145),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 428/652 (66%), Positives = 514/652 (79%), Gaps = 19/652 (3%)
 Frame = +2

Query  41    WWKSKMHDPQGPFLQRWNRIFVIACILAATVDPLFFYIPVVDDQNKCLGLDRTLEITACI  220
             W + K+ DPQG FLQ+WN+IFV++C++A ++DPLFFYIPV+++  KCL LD  LEITA +
Sbjct  73    WSEKKVLDPQGSFLQKWNKIFVLSCVIAVSIDPLFFYIPVINNNKKCLDLDHKLEITASV  132

Query  221   LRSVFDFFYIFHIILQFRTGFVPPSSRVFGRGDLIVDPSAIAKRYFFSYFFIDILAVLPL  400
             LR+  D FY+ HII QFRTGF+ PSSRVFGRG L+ D  AIAKRY  SYF+IDILAVLPL
Sbjct  133   LRTFTDIFYLLHIIFQFRTGFIAPSSRVFGRGVLVEDAKAIAKRYLSSYFWIDILAVLPL  192

Query  401   PQVVLFMMIPRADRPFIMVAKDILKVVILVQSVPRLLRIYPLYKEVTRTSGFFTETAWAG  580
             PQV + ++IP          KD+LK ++++Q VPR+LR++PLYKEVTRTSG  TETAWAG
Sbjct  193   PQVAILIIIPEMRGSRSANTKDLLKFLVVLQYVPRILRVFPLYKEVTRTSGILTETAWAG  252

Query  581   AAFNLFLYMIASYVAGAIWYITAIERQDKCWRRACEKHGSCDIDFLYCTKLGRRGGDFSS  760
             AAFNL LYM+AS+V GA WY+ +IER+  CWR+AC     C++  LYC        D SS
Sbjct  253   AAFNLLLYMLASHVVGAFWYLFSIERETTCWRKACRDRLQCNLGALYC--------DMSS  304

Query  761   ---SFLNTSCALLEPENLKADDFDFGIFLDALKSNVVEKRYFWSKLFYCFWWGLRNLSSL  931
                ++L   C +   ++  +  FDFG+FL+AL S VVE   F  KL +CFWWGL+NLSSL
Sbjct  305   GNNTYLEEFCPI---KSDNSGPFDFGMFLNALTSGVVETTDFPKKLLFCFWWGLQNLSSL  361

Query  932   GQNLKTSNFVGEilfailisiiglilfslligNMQKYLQSITVRVEEMRVKRMDAEQWMS  1111
             GQNL+TS ++ E  FAILI+I GL+LF+ LIGNMQ YLQSIT R+EEMRVK+ DAEQWMS
Sbjct  362   GQNLQTSTYIWENCFAILIAIAGLVLFAFLIGNMQTYLQSITTRLEEMRVKKRDAEQWMS  421

Query  1112  HRMLPDNLRERIRRYEQYRWQETRGVDEESLISNLPKDLRRDINRHLCWSLLKRVHMFKT  1291
             HR+LP +LR+RIRRYEQY+WQETRGVDEESLI NLPKDLRRDI RHLC  L+ RV MF+ 
Sbjct  422   HRLLPQDLRDRIRRYEQYKWQETRGVDEESLIQNLPKDLRRDIKRHLCLDLVTRVPMFEK  481

Query  1292  MDEQLLDAICDRLKPVLYTEKSCIVREGDPVDEMIFVMRGNLLTMTTNGGRTGFLNSDVL  1471
             MD+QLLDA+CDRLKPVLYTE S ++REGDPVD M+FVMRG LLTMTTNGGRTGF N + L
Sbjct  482   MDDQLLDAMCDRLKPVLYTESSFVIREGDPVDAMVFVMRGKLLTMTTNGGRTGFFNCEYL  541

Query  1472  NAGDFCGEELLTWALDPNSSSSLPISTRTVQALTDVEAFALTADFLKFFASQYRRLHSKQ  1651
              AGDFCGEELLTWALDPN SS+LP+STRTVQ LT+VEAFAL AD LKF ASQ+RRLHSKQ
Sbjct  542   KAGDFCGEELLTWALDPNPSSNLPLSTRTVQTLTEVEAFALMADDLKFVASQFRRLHSKQ  601

Query  1652  LQHKFRFYSHQWKTWAACFIQAAWRRHCRNKLEKSLREEEDRLQDALILRMRREEGETTP  1831
             L+H FRFYS QW+TWAACFIQAAWRR+ R K+E+SL+EEEDRLQDAL     RE G ++P
Sbjct  602   LRHTFRFYSQQWRTWAACFIQAAWRRYHRKKMEQSLKEEEDRLQDALA----REAGSSSP  657

Query  1832  SLGATIYASRFAANVLRTVRRNHplsvpklsprlpplllqkpAEPDFSAPEN  1987
             SLGATIYASRFAAN LR +R+N      +L  R+ P+LLQKPAEPDFS  + 
Sbjct  658   SLGATIYASRFAANALRALRKNG-ARKARLPERISPILLQKPAEPDFSVEDK  708



>ref|XP_006401742.1| hypothetical protein EUTSA_v10012801mg [Eutrema salsugineum]
 gb|ESQ43195.1| hypothetical protein EUTSA_v10012801mg [Eutrema salsugineum]
Length=719

 Score =   830 bits (2144),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 438/647 (68%), Positives = 527/647 (81%), Gaps = 16/647 (2%)
 Frame = +2

Query  53    KMHDPQGPFLQRWNRIFVIACILAATVDPLFFYIPVVDDQNKCLGLDRTLEITACILRSV  232
             K+ DPQGPFLQRWN+IFV+ACI+A ++DPLFFY+PV++D  KCLGLD+ +EITA +LRS 
Sbjct  82    KILDPQGPFLQRWNKIFVLACIIAVSLDPLFFYVPVINDAKKCLGLDKKMEITASVLRSF  141

Query  233   FDFFYIFHIILQFRTGFVPPSSRVFGRGDLIVDPSAIAKRYFFSYFFIDILAVLPLPQVV  412
              D FY+ HII QFRTGF+ PSSRVFGRG L+ D   IA+RY  S+F IDILAVLPLPQVV
Sbjct  142   TDIFYVIHIIFQFRTGFIAPSSRVFGRGVLVEDKREIARRYLSSHFIIDILAVLPLPQVV  201

Query  413   LFMMIPRADRPFIMVAKDILKVVILVQSVPRLLRIYPLYKEVTRTSGFFTETAWAGAAFN  592
             + ++IP       +  K++LK V+  Q +PR +RIYPLYKEVTRTSG  TETAWAGAAFN
Sbjct  202   ILIIIPNMKGSRSLNTKNLLKFVVFFQYIPRFIRIYPLYKEVTRTSGILTETAWAGAAFN  261

Query  593   LFLYMIASYVAGAIWYITAIERQDKCWRRACEKHGS-----CDIDFLYCTKLGRRGGDFS  757
             LFLYM+AS+V GA WY+ +IER+  CW+RAC++  S     C++  LYC       GD  
Sbjct  262   LFLYMLASHVFGAFWYLFSIERETVCWKRACQRRNSMQNSICNLKSLYCDH--SNAGD--  317

Query  758   SSFLNTSCALLEPENLKADDFDFGIFLDALKSNVVEKRYFWSKLFYCFWWGLRNLSSLGQ  937
             ++FLN SC    P    A  FDFGIFL+AL+S VVE + F  K FYCFWWGL+NLSSLGQ
Sbjct  318   NAFLNESCPFQTP---NATLFDFGIFLNALQSGVVESQDFPQKFFYCFWWGLQNLSSLGQ  374

Query  938   NLKTSNFVGEilfailisiiglilfslligNMQKYLQSITVRVEEMRVKRMDAEQWMSHR  1117
             NL+TS +V EI FA+ ISI GL+LFS LIGNMQ YLQS T R+EEMRVKR DAEQWM+HR
Sbjct  375   NLQTSTYVWEICFAVFISISGLVLFSFLIGNMQTYLQSTTTRLEEMRVKRRDAEQWMAHR  434

Query  1118  MLPDNLRERIRRYEQYRWQETRGVDEESLISNLPKDLRRDINRHLCWSLLKRVHMFKTMD  1297
             +LP+NLR+RIRRYEQY+WQETRGVDEE+L+SNLPKDLRRDI RHLC +LL RV MF+ MD
Sbjct  435   LLPENLRKRIRRYEQYKWQETRGVDEENLLSNLPKDLRRDIKRHLCLALLMRVPMFEKMD  494

Query  1298  EQLLDAICDRLKPVLYTEKSCIVREGDPVDEMIFVMRGNLLTMTTNGGRTGFLNSDVLNA  1477
             EQLLDA+CDRL+PVLYTE+S IVREGDPVDEM+F+MRG LLTMTTNGGRTGF NS+ L A
Sbjct  495   EQLLDALCDRLQPVLYTEESYIVREGDPVDEMLFIMRGKLLTMTTNGGRTGFFNSEHLGA  554

Query  1478  GDFCGEELLTWALDPNSSSSLPISTRTVQALTDVEAFALTADFLKFFASQYRRLHSKQLQ  1657
             GDFCGEELLTWALDP++SS+LPISTRTV+AL +VEAFAL AD LKF ASQ+RRLHSKQL+
Sbjct  555   GDFCGEELLTWALDPHTSSNLPISTRTVRALVEVEAFALKADDLKFVASQFRRLHSKQLR  614

Query  1658  HKFRFYSHQWKTWAACFIQAAWRRHCRNKLEKSLREEEDRLQDALILRMRREEGETTPSL  1837
             H FRFYS QW+TWAACFIQAAWRR+ + KLE+SL+EEE+RLQDAL     +E   ++PSL
Sbjct  615   HTFRFYSQQWRTWAACFIQAAWRRYVKKKLEESLKEEENRLQDALA----KEACGSSPSL  670

Query  1838  GATIYASRFAANVLRTVRRNHplsvpklsprlpplllqkpAEPDFSA  1978
             GAT+YASRFAAN+LRT+RR+  +  P++  R+PP+LLQKP EPDF++
Sbjct  671   GATMYASRFAANILRTIRRSGSVRKPRMPERMPPMLLQKPTEPDFNS  717



>ref|XP_010915663.1| PREDICTED: cyclic nucleotide-gated ion channel 1 [Elaeis guineensis]
Length=699

 Score =   828 bits (2140),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 429/647 (66%), Positives = 522/647 (81%), Gaps = 15/647 (2%)
 Frame = +2

Query  47    KSKMHDPQGPFLQRWNRIFVIACILAATVDPLFFYIPVVDDQNKCLGLDRTLEITACILR  226
             + K+ DPQG FLQ+WN++FVI+CI+A +VDPLFFYIPV++D+  CL LDR LEITA +LR
Sbjct  68    RKKILDPQGSFLQKWNKVFVISCIIAVSVDPLFFYIPVINDEGNCLELDRKLEITASVLR  127

Query  227   SVFDFFYIFHIILQFRTGFVPPSSRVFGRGDLIVDPSAIAKRYFFSYFFIDILAVLPLPQ  406
                D FYI HII QFRTGF+ P SRVFGRG L+ DPSAIAKRY  SYF IDILAVLPLPQ
Sbjct  128   FFTDIFYILHIIFQFRTGFIAPPSRVFGRGVLVEDPSAIAKRYISSYFLIDILAVLPLPQ  187

Query  407   VVLFMMIPRADRPFIMVAKDILKVVILVQSVPRLLRIYPLYKEVTRTSGFFTETAWAGAA  586
             VV+ ++IPR     ++ AK++L  +I+ Q VPRL RI  LY +VTR++G  TETAWAGAA
Sbjct  188   VVVLIIIPRLKGSALLNAKNVLMFIIICQYVPRLGRIMLLYLDVTRSAGIITETAWAGAA  247

Query  587   FNLFLYMIASYVAGAIWYITAIERQDKCWRRACEKHGSCDIDFLYCTKLGRRGGDFSSSF  766
              NL LYM+AS+V GA+WY+ AI+RQD CWR AC K+ +C +  L+C +     G  +++F
Sbjct  248   LNLLLYMLASHVLGAMWYLLAIDRQDACWRDACSKN-NCTMASLFCGE----NGIGNNNF  302

Query  767   LNTSCALLEPENLKADDFDFGIFLDALKSNVVEKRYFWSKLFYCFWWGLRNLSSLGQNLK  946
             L ++C +++     A  F+FGI+L AL+ NV + R F  KLFYCFWWGL+NLS+LGQNL+
Sbjct  303   LLSACPVIQD---NATIFNFGIYLQALQ-NVAQSRNFLEKLFYCFWWGLQNLSALGQNLE  358

Query  947   TSNFVGEilfailisiiglilfslligNMQKYLQSITVRVEEMRVKRMDAEQWMSHRMLP  1126
             TS +  EILFA+ +SI GL+LF+LLIGNMQ YLQS TVR+EEMRVKR DAEQWMSHR+LP
Sbjct  359   TSTYTWEILFAVFVSISGLVLFALLIGNMQTYLQSTTVRIEEMRVKRRDAEQWMSHRLLP  418

Query  1127  DNLRERIRRYEQYRWQETRGVDEESLISNLPKDLRRDINRHLCWSLLKRVHMFKTMDEQL  1306
             ++LRERIRR+EQYRWQETRGV+EE+++ NLPKDLRRDI RHLC  LL RV +F+ MD+QL
Sbjct  419   ESLRERIRRHEQYRWQETRGVNEENILRNLPKDLRRDIKRHLCLKLLMRVPLFEKMDDQL  478

Query  1307  LDAICDRLKPVLYTEKSCIVREGDPVDEMIFVMRGNLLTMTTNGGRTGFLNSDVLNAGDF  1486
             +DA+CDRLKPVLYTE SCIVREGDPV+EM+F+MRG L +MTTNGGRTGF NSDVL AGDF
Sbjct  479   MDAMCDRLKPVLYTEGSCIVREGDPVNEMLFIMRGKLESMTTNGGRTGFFNSDVLTAGDF  538

Query  1487  CGEELLTWALDPNSSSSLPISTRTVQALTDVEAFALTADFLKFFASQYRRLHSKQLQHKF  1666
             CGEELLTWALDP+S+SSLP STRTV+AL++VEAFAL A+ LKF ASQ+RRLHSKQLQH F
Sbjct  539   CGEELLTWALDPHSASSLPSSTRTVKALSEVEAFALMAEDLKFVASQFRRLHSKQLQHTF  598

Query  1667  RFYSHQWKTWAACFIQAAWRRHCRNKLEKSLREEEDRLQDALILRMRREEGETTPSLGAT  1846
             R YSHQW+TWAACFIQAAWRR+ R KLE +L EEE+RLQ A+        G ++PSLGAT
Sbjct  599   RLYSHQWRTWAACFIQAAWRRYSRKKLEDALHEEEERLQAAMA-----GSGASSPSLGAT  653

Query  1847  IYASRFAANVLRTVRRNHplsvpklsprlpplllqkpAEPDFSAPEN  1987
             +YASRFAANVLRT+RRN      +L  RLP +LLQKPAEPDFS  E+
Sbjct  654   LYASRFAANVLRTLRRNG-TRKARLQERLPVILLQKPAEPDFSGEEH  699



>gb|EYU25206.1| hypothetical protein MIMGU_mgv1a024404mg [Erythranthe guttata]
Length=715

 Score =   828 bits (2140),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 428/650 (66%), Positives = 511/650 (79%), Gaps = 19/650 (3%)
 Frame = +2

Query  47    KSKMHDPQGPFLQRWNRIFVIACILAATVDPLFFYIPVVDDQNKCLGLDRTLEITACILR  226
             ++K+ DPQG FLQ+WN+IFV++C++A ++DPLF YIP++++  KCL  D+ LEI A +LR
Sbjct  80    RNKILDPQGSFLQKWNKIFVLSCVIAVSLDPLFLYIPIINNDKKCLDSDKNLEIAASVLR  139

Query  227   SVFDFFYIFHIILQFRTGFVPPSSRVFGRGDLIVDPSAIAKRYFFSYFFIDILAVLPLPQ  406
             S  D FY+ HII QFRTGF+ P SRVFGRG ++ D   IAKRY  SYF IDILAVLPLPQ
Sbjct  140   SFTDIFYVVHIIFQFRTGFIAPPSRVFGRGVIVQDSWEIAKRYLSSYFLIDILAVLPLPQ  199

Query  407   VVLFMMIPRADRPFIMVAKDILKVVILVQSVPRLLRIYPLYKEVTRTSGFFTETAWAGAA  586
             +V+ ++IP+      +  K++LK+V++ Q VPR+LR+YPLY+EVTRTSG  TETAWAGAA
Sbjct  200   IVILIIIPKLKGARSLNTKNLLKLVVIFQYVPRVLRVYPLYREVTRTSGILTETAWAGAA  259

Query  587   FNLFLYMIASYVAGAIWYITAIERQDKCWRRACEKHGSCDIDFLYCTKLGRRGGDFS--S  760
             FNLFLYM+AS+V GA WY+ +IER+  CW +AC    +C     YC      G D +  S
Sbjct  260   FNLFLYMLASHVLGAFWYLFSIERETTCWEKACGNGSACREASFYC------GADHTGFS  313

Query  761   SFLNTSCALLEPENLKADDFDFGIFLDALKSNVVEKRYFWSKLFYCFWWGLRNLSSLGQN  940
               LN  C +    N  A  +DFGIFL+AL+S VVE   F  K FYCFWWGL+NLSSLGQN
Sbjct  314   QILNEFCPV---RNANATLYDFGIFLEALQSGVVESEDFSKKFFYCFWWGLQNLSSLGQN  370

Query  941   LKTSNFVGEilfailisiiglilfslligNMQKYLQSITVRVEEMRVKRMDAEQWMSHRM  1120
             L+TS F+ EI FA+ ISI GL+LFS LIGNMQ YLQS T+R EEMRVKR DAEQWMSHR+
Sbjct  371   LQTSTFIWEICFAVFISISGLVLFSFLIGNMQTYLQSTTLRFEEMRVKRRDAEQWMSHRL  430

Query  1121  LPDNLRERIRRYEQYRWQETRGVDEESLISNLPKDLRRDINRHLCWSLLKRVHMFKTMDE  1300
             LPD+LRERIR YEQY+WQETRGVDEE+LI +LPKDLRRDI RHLC +LLKRV MF+ MD+
Sbjct  431   LPDSLRERIRSYEQYKWQETRGVDEENLIHSLPKDLRRDIKRHLCLALLKRVPMFEKMDD  490

Query  1301  QLLDAICDRLKPVLYTEKSCIVREGDPVDEMIFVMRGNLLTMTTNGGRTGFLNSDVLNAG  1480
             QLLDA+CDRLKPVLYTE+S I+REGDPVDEM+F+MRG L T TTNGGRTGF NSD L AG
Sbjct  491   QLLDAMCDRLKPVLYTEESYILREGDPVDEMLFIMRGKLFTATTNGGRTGFFNSDYLKAG  550

Query  1481  DFCGEELLTWALDPNSSSSLPISTRTVQALTDVEAFALTADFLKFFASQYRRLHSKQLQH  1660
             DFCGEELLTWALDP SSS+LPISTRTVQAL++VEAFALTAD LKF ASQ+RRLHSKQL+H
Sbjct  551   DFCGEELLTWALDPTSSSNLPISTRTVQALSEVEAFALTADDLKFVASQFRRLHSKQLRH  610

Query  1661  KFRFYSHQWKTWAACFIQAAWRRHCRNKLEKSLREEEDRLQDALILRMRREEGET--TPS  1834
              FRFYS QW+TWAACF+QAAWRR+CR KLE+SLR EE+RLQDAL       EG T  +PS
Sbjct  611   TFRFYSQQWRTWAACFVQAAWRRYCRKKLEESLRWEENRLQDALT------EGGTPDSPS  664

Query  1835  LGATIYASRFAANVLRTVRRNHplsvpklsprlpplllqkpAEPDFSAPE  1984
             LGA +YASRFAAN LR +R N    +     R+ P+LLQKPAEPDFSA +
Sbjct  665   LGAAMYASRFAANALRGLRSNGTGKMRMKPGRISPILLQKPAEPDFSAGD  714



>ref|XP_007220613.1| hypothetical protein PRUPE_ppa002071mg [Prunus persica]
 gb|EMJ21812.1| hypothetical protein PRUPE_ppa002071mg [Prunus persica]
Length=721

 Score =   828 bits (2140),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 421/618 (68%), Positives = 494/618 (80%), Gaps = 9/618 (1%)
 Frame = +2

Query  47    KSKMHDPQGPFLQRWNRIFVIACILAATVDPLFFYIPVVDDQNKCLGLDRTLEITACILR  226
             + K+ DPQG FLQ WN++FVI C++A ++DPLF Y  VVD +NKC+G+D  L+I  C+LR
Sbjct  82    RRKILDPQGSFLQNWNKVFVITCVIAVSLDPLFLYTAVVDGENKCVGVDERLQIITCVLR  141

Query  227   SVFDFFYIFHIILQFRTGFVPPSSRVFGRGDLIVDPSAIAKRYFFSYFFIDILAVLPLPQ  406
             S  D F+I HII QFRTGF+ PSSRVFGRG+LI DP AIAKRY  SYF IDILA+LPLPQ
Sbjct  142   SFTDVFHILHIIFQFRTGFIAPSSRVFGRGELIDDPMAIAKRYLSSYFIIDILAILPLPQ  201

Query  407   VVLFMMIPRADRPFIMVAKDILKVVILVQSVPRLLRIYPLYKEVTRTSGFFTETAWAGAA  586
             +V+F +IP   RP   V KD+L +VI+ Q  PRL RIYPLY+EVTRTSGF TETAWAGAA
Sbjct  202   MVVFFIIP-ISRPVPRVTKDLLLIVIVAQYGPRLWRIYPLYEEVTRTSGFLTETAWAGAA  260

Query  587   FNLFLYMIASYVAGAIWYITAIERQDKCWRRACEKHGSCDIDFLYCTKLGRRGGDFSSSF  766
             +NL LYM+AS+V GA WY+ ++ER+  CWR+ C     C    LYC    +    +    
Sbjct  261   YNLLLYMLASHVVGAFWYLFSVEREYSCWRKQCHGDDGCK-KVLYCDPKYKADSSWIE-I  318

Query  767   LNTSCALLEPENLKADD-FDFGIFLDALKSNVVEKRYFWSKLFYCFWWGLRNLSSLGQNL  943
                SC  ++P+ +K    F+FGIF DAL+S V+E R F  K  YCFWWGLRNLSSLGQNL
Sbjct  319   KKASCPFIDPDQIKNSTVFNFGIFTDALQSGVLETRDFPKKFLYCFWWGLRNLSSLGQNL  378

Query  944   KTSNFVGEilfailisiiglilfslligNMQKYLQSITVRVEEMRVKRMDAEQWMSHRML  1123
             KTS FV EI+FA+ ISI GL+LFSLLIGNMQK+LQS TVRVEEMRVKR DAEQWMSHRML
Sbjct  379   KTSTFVWEIVFAVFISIFGLVLFSLLIGNMQKFLQSTTVRVEEMRVKRRDAEQWMSHRML  438

Query  1124  PDNLRERIRRYEQYRWQETRGVDEESLISNLPKDLRRDINRHLCWSLLKRVHMFKTMDEQ  1303
             P+NLRERIR Y+QY+WQETRGVDEE+L+ NLPKDLR+DI RHLC +LL RV MF+ MDEQ
Sbjct  439   PENLRERIRCYDQYKWQETRGVDEETLVRNLPKDLRKDIKRHLCLALLNRVPMFEKMDEQ  498

Query  1304  LLDAICDRLKPVLYTEKSCIVREGDPVDEMIFVMRGNLLTMTTNGGRTGFLNSDVLNAGD  1483
             L+DA+CDRLKPVLYT+KS I REGDPVDEM+F+MRG L TMTTNGGRTGF N+  L AGD
Sbjct  499   LMDALCDRLKPVLYTDKSVITREGDPVDEMLFIMRGYLATMTTNGGRTGFFNTADLKAGD  558

Query  1484  FCGEELLTWALDPNSSSSLPISTRTVQALTDVEAFALTADFLKFFASQYRRLHSKQLQHK  1663
             FCGEELLTWALDPNSS++LPISTRTV+A T+VEAFAL AD LKF ASQ+RRLHSKQLQH 
Sbjct  559   FCGEELLTWALDPNSSTNLPISTRTVEAKTEVEAFALMADDLKFVASQFRRLHSKQLQHT  618

Query  1664  FRFYSHQWKTWAACFIQAAWRRHCRNKLEKSLREEEDRLQDALILRMRREEGETTPSLGA  1843
             FRFYS QW+TW+ACFIQAAWRRHC+ KLEKSLRE EDRLQDAL     RE G ++PSL A
Sbjct  619   FRFYSLQWRTWSACFIQAAWRRHCKRKLEKSLREAEDRLQDALT----REAG-SSPSLLA  673

Query  1844  TIYASRFAANVLRTVRRN  1897
             T+YAS+FAAN LR +R+N
Sbjct  674   TVYASKFAANALRNLRQN  691



>ref|XP_008233184.1| PREDICTED: cyclic nucleotide-gated ion channel 1-like [Prunus 
mume]
Length=721

 Score =   828 bits (2139),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 438/650 (67%), Positives = 511/650 (79%), Gaps = 12/650 (2%)
 Frame = +2

Query  47    KSKMHDPQGPFLQRWNRIFVIACILAATVDPLFFYIPVVDDQNKCLGLDRTLEITACILR  226
             + K+ DPQG FLQ WN+IFVI C++A ++DPLF Y  VVD + KC+ LD+ L+I  C+LR
Sbjct  82    RRKILDPQGSFLQNWNKIFVITCVIAVSLDPLFLYTAVVDGKIKCVDLDKRLQIITCVLR  141

Query  227   SVFDFFYIFHIILQFRTGFVPPSSRVFGRGDLIVDPSAIAKRYFFSYFFIDILAVLPLPQ  406
             S  D F+I HII QFRTGF+ PSSRVFGRG+LI DP AIAKRY  SYF ID+LA+LPLPQ
Sbjct  142   SFTDVFHILHIIFQFRTGFIAPSSRVFGRGELIDDPVAIAKRYLSSYFIIDVLAILPLPQ  201

Query  407   VVLFMMIPRADRPFIMVAKDILKVVILVQSVPRLLRIYPLYKEVTRTSGFFTETAWAGAA  586
             VV+F +IP   RP   V KD+L  VI+ Q  PRL RIYPLYKEVTRTSGF TETAWAGAA
Sbjct  202   VVVFFIIP-ISRPVPRVTKDLLLFVIVAQYGPRLWRIYPLYKEVTRTSGFLTETAWAGAA  260

Query  587   FNLFLYMIASYVAGAIWYITAIERQDKCWRRACEKHGSCDID-FLYCTKLGRRGGDFSSS  763
             +NL LYM+AS+V GA WY+ + ER+  CWR  C  HG  D   FLYC    +    F   
Sbjct  261   YNLLLYMLASHVVGAFWYLFSAEREYSCWRIQC--HGDVDCKKFLYCDPKNKANSSFIKK  318

Query  764   FLNTSCALLEPENLKADD-FDFGIFLDALKSNVVEKRYFWSKLFYCFWWGLRNLSSLGQN  940
              LN SC  ++P+ +K    F+FGIF DAL+S V+E   F  K  YCFWWGLRNLSSLGQN
Sbjct  319   -LNASCPFIDPDEIKNSTVFNFGIFTDALQSGVLETNNFPKKFLYCFWWGLRNLSSLGQN  377

Query  941   LKTSNFVGEilfailisiiglilfslligNMQKYLQSITVRVEEMRVKRMDAEQWMSHRM  1120
             LKTS FV EI+FA+ ISI GL+LFSLLIGNMQK+LQS TVRVEEMRVKR DAEQWMSHRM
Sbjct  378   LKTSTFVWEIVFAVFISIFGLVLFSLLIGNMQKFLQSTTVRVEEMRVKRRDAEQWMSHRM  437

Query  1121  LPDNLRERIRRYEQYRWQETRGVDEESLISNLPKDLRRDINRHLCWSLLKRVHMFKTMDE  1300
             LP+ LRERIR Y+QY+WQETRGV+EE+L+ NLPKDLR+DI RHLC +LL RV MF+ MDE
Sbjct  438   LPEKLRERIRHYDQYKWQETRGVEEETLVRNLPKDLRKDIKRHLCLALLNRVPMFEKMDE  497

Query  1301  QLLDAICDRLKPVLYTEKSCIVREGDPVDEMIFVMRGNLLTMTTNGGRTGFLNSDVLNAG  1480
             QL+DA+CDRLKPVLYT+KS I REGDPVDEM+F+MRG L TMTTNGGRTGF N+  L AG
Sbjct  498   QLMDALCDRLKPVLYTDKSVITREGDPVDEMLFIMRGYLATMTTNGGRTGFFNTADLKAG  557

Query  1481  DFCGEELLTWALDPNSSSSLPISTRTVQALTDVEAFALTADFLKFFASQYRRLHSKQLQH  1660
             DFCGEELLTWALDPNSS++LPISTRTV+A T+VEAFAL AD LKF ASQ+RRLHSKQLQH
Sbjct  558   DFCGEELLTWALDPNSSTNLPISTRTVEAKTEVEAFALMADDLKFVASQFRRLHSKQLQH  617

Query  1661  KFRFYSHQWKTWAACFIQAAWRRHCRNKLEKSLREEEDRLQDALILRMRREEGETTPSLG  1840
              FRFYS QW+TW+ACFIQAAWRRHC+ KLEKSLRE EDRLQDAL     RE G ++PSL 
Sbjct  618   TFRFYSLQWRTWSACFIQAAWRRHCKRKLEKSLREAEDRLQDALT----REAG-SSPSLL  672

Query  1841  ATIYASRFAANVLRTVRRNHplsvpklsprlpplllqkpAEPDFSAPENN  1990
             AT+YAS+FAAN +R +R+       + SP L PLL QKPAEPDF+A  ++
Sbjct  673   ATVYASKFAANAVRNLRQK-GKRNTRPSPTLLPLLPQKPAEPDFTAERHD  721



>ref|XP_006422139.1| hypothetical protein CICLE_v10004452mg [Citrus clementina]
 ref|XP_006422141.1| hypothetical protein CICLE_v10004452mg [Citrus clementina]
 ref|XP_006490551.1| PREDICTED: cyclic nucleotide-gated ion channel 1-like [Citrus 
sinensis]
 gb|ESR35379.1| hypothetical protein CICLE_v10004452mg [Citrus clementina]
 gb|ESR35381.1| hypothetical protein CICLE_v10004452mg [Citrus clementina]
 gb|KDO56092.1| hypothetical protein CISIN_1g005199mg [Citrus sinensis]
 gb|KDO56093.1| hypothetical protein CISIN_1g005199mg [Citrus sinensis]
Length=709

 Score =   827 bits (2137),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 431/645 (67%), Positives = 515/645 (80%), Gaps = 17/645 (3%)
 Frame = +2

Query  53    KMHDPQGPFLQRWNRIFVIACILAATVDPLFFYIPVVDDQNKCLGLDRTLEITACILRSV  232
             K+ DPQG FLQ+WN+IFV++C++A ++DPLFFY+PV++   KC+ LD+ +E TA +LRS 
Sbjct  82    KVLDPQGAFLQKWNKIFVLSCVIAVSLDPLFFYVPVINGDRKCVDLDKKMETTASVLRSF  141

Query  233   FDFFYIFHIILQFRTGFVPPSSRVFGRGDLIVDPSAIAKRYFFSYFFIDILAVLPLPQVV  412
              D FYIFHIILQFRTGF+ PSSRVFGRG L+ D   IAK+Y  S+F +DILAVLPLPQVV
Sbjct  142   TDIFYIFHIILQFRTGFIAPSSRVFGRGVLVEDTWLIAKKYMSSHFLVDILAVLPLPQVV  201

Query  413   LFMMIPRADRPFIMVAKDILKVVILVQSVPRLLRIYPLYKEVTRTSGFFTETAWAGAAFN  592
             + ++IP      ++  K++LK V+L Q VPR LRIYPLYKEVTRTSG  TETAWAGAAFN
Sbjct  202   ILIIIPNMGGSEVVNTKNLLKFVVLFQYVPRFLRIYPLYKEVTRTSGILTETAWAGAAFN  261

Query  593   LFLYMIASYVAGAIWYITAIERQDKCWRRACEKHGSCDIDFLYCTKLGRRGGDFSSSFLN  772
             LFLYM+AS+V GA WY+ +IER+  CW+  C+    C    LYC       G  +++FL 
Sbjct  262   LFLYMLASHVLGASWYLFSIERETTCWKGHCKMDNGCK---LYCDD-----GQGNNAFLG  313

Query  773   TSCALLEPENLKADDFDFGIFLDALKSNVVEKRYFWSKLFYCFWWGLRNLSSLGQNLKTS  952
               C + +P + K   F+FGIFL AL+S +VE  YF  K FYCFWWGLRNLSSLGQNL+TS
Sbjct  314   DFCPI-QPADTKL--FNFGIFLGALESGIVESTYFPKKFFYCFWWGLRNLSSLGQNLETS  370

Query  953   NFVGEilfailisiiglilfslligNMQKYLQSITVRVEEMRVKRMDAEQWMSHRMLPDN  1132
              +V EI FA+ ISI GL+LFS LIGNMQ YLQS T R+EEMRVKR DAEQWM+HR+LPD 
Sbjct  371   TYVWEICFAVFISISGLVLFSFLIGNMQTYLQSTTTRLEEMRVKRRDAEQWMAHRLLPDT  430

Query  1133  LRERIRRYEQYRWQETRGVDEESLISNLPKDLRRDINRHLCWSLLKRVHMFKTMDEQLLD  1312
             LRERIRRYEQY+WQETRGVDEE+L+ NLPKDLRRDI RHLC +LL RV +F+ MDEQLLD
Sbjct  431   LRERIRRYEQYKWQETRGVDEENLLCNLPKDLRRDIKRHLCLALLMRVPLFEKMDEQLLD  490

Query  1313  AICDRLKPVLYTEKSCIVREGDPVDEMIFVMRGNLLTMTTNGGRTGFLNSDVLNAGDFCG  1492
             A+CDRLKPVLYTE+S IVREGDPVDEM+F+MRG LLT+TTNGGRTGF NS+ L AGDFCG
Sbjct  491   ALCDRLKPVLYTEESYIVREGDPVDEMLFIMRGKLLTITTNGGRTGFFNSEYLGAGDFCG  550

Query  1493  EELLTWALDPNSSSSLPISTRTVQALTDVEAFALTADFLKFFASQYRRLHSKQLQHKFRF  1672
             EELLTWALDP SSS+LPISTRTV+ALT+VEAFAL AD LKF ASQ+RRLHSKQL+H FRF
Sbjct  551   EELLTWALDPQSSSNLPISTRTVRALTEVEAFALMADDLKFVASQFRRLHSKQLRHTFRF  610

Query  1673  YSHQWKTWAACFIQAAWRRHCRNKLEKSLREEEDRLQDALILRMRREEGETTPSLGATIY  1852
             YS QW++WAACFIQAAWRR+ + KLE+SLR EE+RLQDAL      + G ++PSLGATIY
Sbjct  611   YSQQWRSWAACFIQAAWRRYSKKKLEESLRAEENRLQDALA-----KAGGSSPSLGATIY  665

Query  1853  ASRFAANVLRTVRRNHplsvpklsprlpplllqkpAEPDFSAPEN  1987
             ASRFAAN LR +RRN      ++  R+PP+LLQKPAEPDF+  E 
Sbjct  666   ASRFAANALRLIRRNS-TRKTRVPERVPPMLLQKPAEPDFTVEEQ  709



>ref|XP_007161376.1| hypothetical protein PHAVU_001G063700g [Phaseolus vulgaris]
 gb|ESW33370.1| hypothetical protein PHAVU_001G063700g [Phaseolus vulgaris]
Length=718

 Score =   826 bits (2134),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 431/648 (67%), Positives = 517/648 (80%), Gaps = 13/648 (2%)
 Frame = +2

Query  47    KSKMHDPQGPFLQRWNRIFVIACILAATVDPLFFYIPVVDDQNKCLGLDRTLEITACILR  226
             + K+ DPQGPFLQRWN+IFV+ C++A ++DPLFFY+PV+DD+ KCL LD  +EITA +LR
Sbjct  81    RKKILDPQGPFLQRWNKIFVLLCVIAVSLDPLFFYVPVIDDEKKCLSLDSKMEITATVLR  140

Query  227   SVFDFFYIFHIILQFRTGFVPPSSRVFGRGDLIVDPSAIAKRYFFSYFFIDILAVLPLPQ  406
             S  D FYI H+I QFRTGF+ PSSRVFGRG L+ D  AIA+RY  SYF +DILAVLPLPQ
Sbjct  141   SFSDAFYIIHMIFQFRTGFIAPSSRVFGRGVLVEDSWAIARRYLSSYFLVDILAVLPLPQ  200

Query  407   VVLFMMIPRADRPFIMVAKDILKVVILVQSVPRLLRIYPLYKEVTRTSGFFTETAWAGAA  586
             VV+ ++IP+      +  K++LK V+  Q VPRLLR+ PLY+EVTR SG  TETAWAGAA
Sbjct  201   VVILVIIPKMSGFKSLNTKNLLKFVVFFQYVPRLLRVIPLYREVTRASGILTETAWAGAA  260

Query  587   FNLFLYMIASYVAGAIWYITAIERQDKCWRRACEKHGS-CDIDFLYCTKLGRRGGDFSSS  763
             FNLFLYM+AS+V GA WY+ +IER+  CW+ AC  + + C+   +YC      G    S+
Sbjct  261   FNLFLYMLASHVVGAFWYLFSIERETTCWQEACRSNTTVCNKADMYCNDYWG-GLSKIST  319

Query  764   FLNTSCALL-EPENLKADDFDFGIFLDALKSNVVEKRYFWSKLFYCFWWGLRNLSSLGQN  940
             FLNTSC +  E +NL    FDFG+FLDAL+S VVE R F  K FYCFWWGL+NLSSLGQN
Sbjct  320   FLNTSCPIQKEDKNL----FDFGMFLDALQSGVVESRDFPQKFFYCFWWGLKNLSSLGQN  375

Query  941   LKTSNFVGEilfailisiiglilfslligNMQKYLQSITVRVEEMRVKRMDAEQWMSHRM  1120
             L TS +V EI FA+ IS+ GL+LFS LIGNMQ YLQS T R+EEMRVKR DAEQWMSHR+
Sbjct  376   LGTSTYVWEICFAVFISVSGLVLFSFLIGNMQTYLQSTTTRLEEMRVKRRDAEQWMSHRL  435

Query  1121  LPDNLRERIRRYEQYRWQETRGVDEESLISNLPKDLRRDINRHLCWSLLKRVHMFKTMDE  1300
             LPD LR RIRRYEQY+WQETRGVDE++L+ NLPKDLRRDI RHLC +LL RV MF+ MDE
Sbjct  436   LPDGLRVRIRRYEQYKWQETRGVDEDNLVRNLPKDLRRDIKRHLCLALLMRVPMFEKMDE  495

Query  1301  QLLDAICDRLKPVLYTEKSCIVREGDPVDEMIFVMRGNLLTMTTNGGRTGFLNSDVLNAG  1480
             QLLDA+CDRLKPVL+TE+S IVREGDPVDEM+F+MRG LLT+TTNGGRTGF NS+ L AG
Sbjct  496   QLLDAMCDRLKPVLFTEESYIVREGDPVDEMLFIMRGKLLTITTNGGRTGFFNSEYLKAG  555

Query  1481  DFCGEELLTWALDPNSSSSLPISTRTVQALTDVEAFALTADFLKFFASQYRRLHSKQLQH  1660
             DFCGEELLTWALDP+SSS+LP STRTVQ L++VEAFAL AD LKF ASQ+RRLHSKQL+H
Sbjct  556   DFCGEELLTWALDPHSSSNLPTSTRTVQTLSEVEAFALKADDLKFVASQFRRLHSKQLRH  615

Query  1661  KFRFYSHQWKTWAACFIQAAWRRHCRNKLEKSLREEEDRLQDALILRMRREEGETTPSLG  1840
              FRFYS QW++WAACFIQAAWRR+ + KLE+SL E+E+RLQ+ L      + G ++PSLG
Sbjct  616   TFRFYSQQWRSWAACFIQAAWRRYSKRKLEESLVEDENRLQNVLA-----KSGGSSPSLG  670

Query  1841  ATIYASRFAANVLRTVRRNHplsvpklsprlpplllqkpAEPDFSAPE  1984
             ATIYASRFAAN L  +RRN      +++ RLPP+L QKPAEPDF+A E
Sbjct  671   ATIYASRFAANALTLLRRNG-AKKGRVAERLPPMLFQKPAEPDFTADE  717



>ref|XP_006444860.1| hypothetical protein CICLE_v10019048mg [Citrus clementina]
 ref|XP_006491264.1| PREDICTED: cyclic nucleotide-gated ion channel 1-like [Citrus 
sinensis]
 gb|ESR58100.1| hypothetical protein CICLE_v10019048mg [Citrus clementina]
 gb|KDO86446.1| hypothetical protein CISIN_1g004940mg [Citrus sinensis]
Length=722

 Score =   826 bits (2134),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 431/655 (66%), Positives = 514/655 (78%), Gaps = 22/655 (3%)
 Frame = +2

Query  47    KSKMHDPQGPFLQRWNRIFVIACILAATVDPLFFYIPVVDDQNKCLGLDRTLEITACILR  226
             + ++ DPQGPFLQ WN+IFV++C++A ++DPLFFY+PV+D + KCLGLD+TLEITAC+LR
Sbjct  81    EKRILDPQGPFLQWWNKIFVLSCVIALSIDPLFFYMPVIDGKRKCLGLDKTLEITACVLR  140

Query  227   SVFDFFYIFHIILQFRTGFVPPSSRVFGRGDLIVDPSAIAKRYFFSYFFIDILAVLPLPQ  406
             S  D FYI  II QFRTGF+  SSRVFGRG+L+ DP AIAKRY  SYF +DILA+LPLPQ
Sbjct  141   SFIDTFYILRIIFQFRTGFIARSSRVFGRGELVDDPKAIAKRYLMSYFIVDILAILPLPQ  200

Query  407   VVLFMMIPRADRPFIMVAKDILKVVILVQSVPRLLRIYPLYKEVTRTSGFFTETAWAGAA  586
             +V+ +++P    P  +VAK++LK +I  Q VPR+ RIYPLY +V RTSG  TETAWAGAA
Sbjct  201   LVVLIIVPAVKGPVPLVAKEMLKTIIFCQYVPRIARIYPLYNDVKRTSGILTETAWAGAA  260

Query  587   FNLFLYMIASYVAGAIWYITAIERQDKCWRRACEK---HGSCDIDFLYCTKLGRRGGDFS  757
              NLFLYM+AS++ GA WY+ +IERQD CWR  C K     +C  + LYC       G+F 
Sbjct  261   LNLFLYMLASHIFGACWYLYSIERQDSCWRDVCRKLNDTSNCTTN-LYC-------GEFH  312

Query  758   SS---FLNTSCALLEPENLKADD-FDFGIFLDALKSNVVEKRYFWSKLFYCFWWGLRNLS  925
              S    L+ SC  + P+ +K    F+FGI +DAL+S VVE+  F  K FYCFWWGLRNLS
Sbjct  313   GSNNTLLHGSCPFISPDEIKNSSMFNFGISIDALQSRVVEEHDFPKKFFYCFWWGLRNLS  372

Query  926   SLGQNLKTSNFVGEilfailisiiglilfslligNMQKYLQSITVRVEEMRVKRMDAEQW  1105
             SLGQNLKTS FVGE+ FAI ISI GL+LF+LLIGNMQKYL+S TVR+EEMRVKR DAEQW
Sbjct  373   SLGQNLKTSTFVGEVFFAIFISISGLVLFALLIGNMQKYLESTTVRLEEMRVKRQDAEQW  432

Query  1106  MSHRMLPDNLRERIRRYEQYRWQETRGVDEESLISNLPKDLRRDINRHLCWSLLKRVHMF  1285
             MSHRMLP+NLR+RIRRYEQY+WQETRGV+EE L+ NLPKDLRRDI RHLCW LL RV MF
Sbjct  433   MSHRMLPENLRDRIRRYEQYKWQETRGVEEEGLLRNLPKDLRRDIKRHLCWDLLMRVPMF  492

Query  1286  KTMDEQLLDAICDRLKPVLYTEKSCIVREGDPVDEMIFVMRGNLLTMTTNGGRTGFLNSD  1465
             + MD+QLLDA+CD LKPVLYTEKS IVREGDPV+EM+FVMRGNL++ TT GGRTGF N+ 
Sbjct  493   EKMDDQLLDAMCDHLKPVLYTEKSFIVREGDPVEEMLFVMRGNLVSTTTYGGRTGFFNAV  552

Query  1466  VLNAGDFCGEELLTWALDPNSSSSLPISTRTVQALTDVEAFALTADFLKFFASQYRRLHS  1645
              L AGDFCGE LLTWALDP SSS+ P+STRTVQALT+VEAF+L AD LK  ASQ+RRLHS
Sbjct  553   YLKAGDFCGEALLTWALDPQSSSNRPLSTRTVQALTEVEAFSLMADDLKSVASQFRRLHS  612

Query  1646  KQLQHKFRFYSHQWKTWAACFIQAAWRRHCRNKLEKSLREEEDRLQDALILRMRREEGET  1825
             KQLQH FRF+S QW+TWAACFIQAAWRRH + KL +SL+E EDRLQDAL      E G  
Sbjct  613   KQLQHAFRFHSVQWRTWAACFIQAAWRRHSKKKLAQSLQEAEDRLQDALAT----EAGAL  668

Query  1826  TPSLGATIYASRFAANVLRT--VRRNHplsvpklsprlpplllqkpAEPDFSAPE  1984
             T SLGAT+YAS+FAAN+L    +R+N           LPPL+ QKPAEPDF+A +
Sbjct  669   T-SLGATMYASKFAANLLHPLRLRQNGSSGTRLPQRLLPPLIPQKPAEPDFTAKD  722



>emb|CDX96195.1| BnaC02g14560D [Brassica napus]
Length=711

 Score =   825 bits (2132),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 424/616 (69%), Positives = 504/616 (82%), Gaps = 12/616 (2%)
 Frame = +2

Query  53    KMHDPQGPFLQRWNRIFVIACILAATVDPLFFYIPVVDDQNKCLGLDRTLEITACILRSV  232
             K+ DPQGPFLQRWN+IFV+ACI+A ++DPLFFY+PVVDD  KCLGLD  +EITA +LRS 
Sbjct  78    KILDPQGPFLQRWNKIFVLACIVAVSLDPLFFYVPVVDDAKKCLGLDNKMEITASVLRSF  137

Query  233   FDFFYIFHIILQFRTGFVPPSSRVFGRGDLIVDPSAIAKRYFFSYFFIDILAVLPLPQVV  412
              D FY+ HII QFRTGF+ PSSRVFGRG L+ D   IA RY  S+F IDILAVLPLPQVV
Sbjct  138   TDVFYVIHIIFQFRTGFIAPSSRVFGRGVLVEDTRQIAMRYLSSHFIIDILAVLPLPQVV  197

Query  413   LFMMIPRADRPFIMVAKDILKVVILVQSVPRLLRIYPLYKEVTRTSGFFTETAWAGAAFN  592
             + ++IP       +  K++LK ++  Q +PR +RIYPLYKEVTRTSG  TETAWAGAAFN
Sbjct  198   ILIIIPHMRGSRSLNTKNLLKFIVFFQYIPRFIRIYPLYKEVTRTSGILTETAWAGAAFN  257

Query  593   LFLYMIASYVAGAIWYITAIERQDKCWRRACEKHGS-CDIDFLYCTKLGRRGGDFSSSFL  769
             LFLYM+AS+V GA WY+ +IER+  CW++AC ++ + CDI  LYC      G    ++FL
Sbjct  258   LFLYMLASHVFGAFWYLFSIERETVCWKQACNRNRNICDITSLYCDHKAAGG----NAFL  313

Query  770   NTSCALLEPENLKADDFDFGIFLDALKSNVVEKRYFWSKLFYCFWWGLRNLSSLGQNLKT  949
             N SC +  P       FDFGIFL+AL+S VVE + F  K FYCFWWGL+NLSSLGQNLKT
Sbjct  314   NASCPVQTPNTTL---FDFGIFLNALQSGVVESQDFPQKFFYCFWWGLQNLSSLGQNLKT  370

Query  950   SNFVGEilfailisiiglilfslligNMQKYLQSITVRVEEMRVKRMDAEQWMSHRMLPD  1129
             S ++ EI FA+ ISI GL+LFS LIGNMQ YLQS T R+EEMRVKR DAEQWM+HR+LP+
Sbjct  371   STYIWEICFAVFISISGLVLFSFLIGNMQTYLQSTTTRLEEMRVKRRDAEQWMAHRLLPE  430

Query  1130  NLRERIRRYEQYRWQETRGVDEESLISNLPKDLRRDINRHLCWSLLKRVHMFKTMDEQLL  1309
             +LR+RIRRYEQY+WQETRGVDEE+L+SNLPKDLRRDI RHLC +LL RV MF+ MDEQLL
Sbjct  431   SLRKRIRRYEQYKWQETRGVDEENLLSNLPKDLRRDIKRHLCLALLMRVPMFEKMDEQLL  490

Query  1310  DAICDRLKPVLYTEKSCIVREGDPVDEMIFVMRGNLLTMTTNGGRTGFLNSDVLNAGDFC  1489
             DA+CDRL+PVLYTE+S IVREGDPVDEM+F+MRG LLTMTTNGGRTGF NS+ L AGDFC
Sbjct  491   DALCDRLQPVLYTEESYIVREGDPVDEMLFIMRGKLLTMTTNGGRTGFFNSEHLGAGDFC  550

Query  1490  GEELLTWALDPNSSSSLPISTRTVQALTDVEAFALTADFLKFFASQYRRLHSKQLQHKFR  1669
             GEELLTWALDP++SS+LPISTRTV+AL +VEAFAL AD LKF ASQ+RRLHSKQL+H FR
Sbjct  551   GEELLTWALDPHTSSNLPISTRTVRALVEVEAFALKADDLKFVASQFRRLHSKQLRHTFR  610

Query  1670  FYSHQWKTWAACFIQAAWRRHCRNKLEKSLREEEDRLQDALILRMRREEGETTPSLGATI  1849
             FYS QW+TWAACFIQAAWRRH + KLE+SL+EEE+RLQDAL     +E   ++PSLGAT+
Sbjct  611   FYSQQWRTWAACFIQAAWRRHVKKKLEESLKEEENRLQDALA----KEACGSSPSLGATM  666

Query  1850  YASRFAANVLRTVRRN  1897
             YASRFAAN+LRT+RR+
Sbjct  667   YASRFAANILRTIRRS  682



>ref|XP_004240953.1| PREDICTED: cyclic nucleotide-gated ion channel 1-like [Solanum 
lycopersicum]
 ref|XP_010322209.1| PREDICTED: cyclic nucleotide-gated ion channel 1-like [Solanum 
lycopersicum]
 gb|AJC00853.1| cyclic nucleotide gated channel CNGC5 [Solanum lycopersicum]
Length=708

 Score =   825 bits (2131),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 425/644 (66%), Positives = 510/644 (79%), Gaps = 19/644 (3%)
 Frame = +2

Query  62    DPQGPFLQRWNRIFVIACILAATVDPLFFYIPVVDDQNKCLGLDRTLEITACILRSVFDF  241
             DPQGPFLQ+WN+IFV++C++A ++DPLF YIP++D+ NKCLG+DRTLE+TA +LRS  D 
Sbjct  80    DPQGPFLQKWNKIFVLSCVIAISLDPLFLYIPLIDNDNKCLGIDRTLEVTASVLRSFTDI  139

Query  242   FYIFHIILQFRTGFVPPSSRVFGRGDLIVDPSAIAKRYFFSYFFIDILAVLPLPQVVLFM  421
             FY  HI LQFRTGF+ PSSRVFGRG L+ D   IAKRY  +YF IDILAVLPLPQVV+ +
Sbjct  140   FYFLHIALQFRTGFIAPSSRVFGRGVLVEDAWEIAKRYLSTYFLIDILAVLPLPQVVILI  199

Query  422   MIPRADRPFIMVAKDILKVVILVQSVPRLLRIYPLYKEVTRTSGFFTETAWAGAAFNLFL  601
             +IP+      +  K++LK V+  Q +PR+LR+YPLYKEVTRTSG  TETAWAGAAFNLFL
Sbjct  200   IIPKLRGARSLNTKNLLKSVVFFQYIPRVLRVYPLYKEVTRTSGILTETAWAGAAFNLFL  259

Query  602   YMIASYVAGAIWYITAIERQDKCWRRACEKHGSCDIDFLYCTKLGRRGGDFSSSF---LN  772
             YM+AS+V GA WY+ +IER+  CW++AC    +C    LYC        D  + F   LN
Sbjct  260   YMLASHVLGAFWYLFSIERETTCWKQACANSSACRHASLYC-------DDNHTGFKTLLN  312

Query  773   TSCALLEPENLKADDFDFGIFLDALKSNVVEKRYFWSKLFYCFWWGLRNLSSLGQNLKTS  952
              SC +  P       FDFG+FLDAL+S+VV    F  K FYCFWWGL+NLSSLGQNL+TS
Sbjct  313   ISCPIETPNTTL---FDFGMFLDALQSDVVGSMNFPQKFFYCFWWGLQNLSSLGQNLQTS  369

Query  953   NFVGEilfailisiiglilfslligNMQKYLQSITVRVEEMRVKRMDAEQWMSHRMLPDN  1132
              +V EI FA+ ISI GL+LF+ LIGNMQ  LQS T+R+EEMRVKR DAEQWMSHR+LP+N
Sbjct  370   TYVWEICFAVFISISGLVLFAFLIGNMQTCLQSSTMRLEEMRVKRRDAEQWMSHRLLPEN  429

Query  1133  LRERIRRYEQYRWQETRGVDEESLISNLPKDLRRDINRHLCWSLLKRVHMFKTMDEQLLD  1312
             LRERIRRYEQY+WQETRGV+EE+LI NLPKDLRRDI RHLC +LL RV MF+ MDEQLLD
Sbjct  430   LRERIRRYEQYKWQETRGVEEENLIHNLPKDLRRDIKRHLCLALLMRVPMFEKMDEQLLD  489

Query  1313  AICDRLKPVLYTEKSCIVREGDPVDEMIFVMRGNLLTMTTNGGRTGFLNSDVLNAGDFCG  1492
             A+CDRLKPVLYTE S IVREGDPV+EM+FVMRG L ++TTNGGRTGF NS+ L AGDFCG
Sbjct  490   ALCDRLKPVLYTENSYIVREGDPVNEMLFVMRGKLQSVTTNGGRTGFFNSEYLKAGDFCG  549

Query  1493  EELLTWALDPNSSSSLPISTRTVQALTDVEAFALTADFLKFFASQYRRLHSKQLQHKFRF  1672
             EELLTWALDP+SS++LP STRT QAL++VEAFAL AD LKF ASQ+RRLHSKQL+H FRF
Sbjct  550   EELLTWALDPHSSTNLPTSTRTAQALSEVEAFALVADDLKFVASQFRRLHSKQLRHTFRF  609

Query  1673  YSHQWKTWAACFIQAAWRRHCRNKLEKSLREEEDRLQDALILRMRREEGETTPSLGATIY  1852
             YS  W+TWAACF+QAAWR +CR K+E+SLR EE RLQDAL      +EG ++PS GATIY
Sbjct  610   YSGHWRTWAACFLQAAWRNYCRKKVEESLRVEESRLQDALA-----KEGSSSPSFGATIY  664

Query  1853  ASRFAANVLRTVRRNHplsvpklsprlpplllqkpAEPDFSAPE  1984
             ASRFAAN LR +RRN   +  ++  R+ P+LLQKP EPDF+A +
Sbjct  665   ASRFAANALRALRRNK-ANKARVPDRISPILLQKPTEPDFTAED  707



>ref|XP_006360173.1| PREDICTED: cyclic nucleotide-gated ion channel 1-like [Solanum 
tuberosum]
Length=708

 Score =   824 bits (2128),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 426/643 (66%), Positives = 509/643 (79%), Gaps = 17/643 (3%)
 Frame = +2

Query  62    DPQGPFLQRWNRIFVIACILAATVDPLFFYIPVVDDQNKCLGLDRTLEITACILRSVFDF  241
             DPQGPFLQ+WN+IFV++C++A ++DPLF YIP++D+ NKCLGLDRTLE+TA +LRS  D 
Sbjct  80    DPQGPFLQKWNKIFVLSCVIAISLDPLFLYIPLIDNDNKCLGLDRTLEVTASVLRSFTDI  139

Query  242   FYIFHIILQFRTGFVPPSSRVFGRGDLIVDPSAIAKRYFFSYFFIDILAVLPLPQVVLFM  421
             FY  HI LQFRTGF+ PSSRVFGRG L+ D   IAKRY  +YF IDILAVLPLPQVV+ +
Sbjct  140   FYFLHIALQFRTGFIAPSSRVFGRGVLVEDAWEIAKRYLSTYFLIDILAVLPLPQVVILI  199

Query  422   MIPRADRPFIMVAKDILKVVILVQSVPRLLRIYPLYKEVTRTSGFFTETAWAGAAFNLFL  601
             +IP+      +  K++LK V+  Q +PR+LR+YPLYKEVTRTSG  TETAWAGAAFNLFL
Sbjct  200   IIPKLRGARSLNTKNLLKSVVFFQYIPRVLRVYPLYKEVTRTSGILTETAWAGAAFNLFL  259

Query  602   YMIASYVAGAIWYITAIERQDKCWRRACEKHGSCDIDFLYCTKLGRRGGDFSS--SFLNT  775
             YM+AS+V GA WY+ +IER+  CW++AC     C    LYC        D +   + LN 
Sbjct  260   YMLASHVLGAFWYLFSIERETTCWKQACANSSVCRHASLYCDD------DHTGFKTLLNI  313

Query  776   SCALLEPENLKADDFDFGIFLDALKSNVVEKRYFWSKLFYCFWWGLRNLSSLGQNLKTSN  955
             SC +  P       FDFG+FLDAL+S+VV    F  K FYCFWWGL+NLSSLGQNL+TS 
Sbjct  314   SCPIETPNTTL---FDFGMFLDALQSDVVGSMNFPQKFFYCFWWGLQNLSSLGQNLQTST  370

Query  956   FVGEilfailisiiglilfslligNMQKYLQSITVRVEEMRVKRMDAEQWMSHRMLPDNL  1135
             +V EI FA+ ISI GL+LF+ LIGNMQ  LQS T+R+EEMRVKR DAEQWMSHR+LP+NL
Sbjct  371   YVWEICFAVFISISGLVLFAFLIGNMQTCLQSSTMRLEEMRVKRRDAEQWMSHRLLPENL  430

Query  1136  RERIRRYEQYRWQETRGVDEESLISNLPKDLRRDINRHLCWSLLKRVHMFKTMDEQLLDA  1315
             RERIRRYEQY+WQETRGV+EE+LI NLPKDLRRDI RHLC +LL RV MF+ MDEQLLDA
Sbjct  431   RERIRRYEQYKWQETRGVEEENLIHNLPKDLRRDIKRHLCLALLMRVPMFEKMDEQLLDA  490

Query  1316  ICDRLKPVLYTEKSCIVREGDPVDEMIFVMRGNLLTMTTNGGRTGFLNSDVLNAGDFCGE  1495
             +CDRLKPVLYTE S IVREGDPV+EM+FVMRG L ++TTNGGRTGF NS+ L AGDFCGE
Sbjct  491   LCDRLKPVLYTEDSYIVREGDPVNEMLFVMRGKLQSVTTNGGRTGFFNSEYLKAGDFCGE  550

Query  1496  ELLTWALDPNSSSSLPISTRTVQALTDVEAFALTADFLKFFASQYRRLHSKQLQHKFRFY  1675
             ELLTWALDP+SS++LPISTRT QAL++VEAFAL AD LKF ASQ+RRLHSKQL+H FRFY
Sbjct  551   ELLTWALDPHSSTNLPISTRTAQALSEVEAFALVADDLKFVASQFRRLHSKQLRHTFRFY  610

Query  1676  SHQWKTWAACFIQAAWRRHCRNKLEKSLREEEDRLQDALILRMRREEGETTPSLGATIYA  1855
             S  W+TWAACF+QAAWR +CR K+E+SL  EE RLQDAL      +EG ++PS GATIYA
Sbjct  611   SGHWRTWAACFLQAAWRNYCRKKVEESLHVEESRLQDALA-----KEGSSSPSFGATIYA  665

Query  1856  SRFAANVLRTVRRNHplsvpklsprlpplllqkpAEPDFSAPE  1984
             SRFAAN LR +RRN   +  ++  R+ PLLLQKP EPDF+A +
Sbjct  666   SRFAANALRALRRNK-ANKARVPDRITPLLLQKPTEPDFTAED  707



>ref|XP_002322017.2| cyclic nucleotide-gated channel C family protein [Populus trichocarpa]
 gb|EEF06144.2| cyclic nucleotide-gated channel C family protein [Populus trichocarpa]
Length=705

 Score =   823 bits (2127),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 433/647 (67%), Positives = 514/647 (79%), Gaps = 18/647 (3%)
 Frame = +2

Query  47    KSKMHDPQGPFLQRWNRIFVIACILAATVDPLFFYIPVVDDQNKCLGLDRTLEITACILR  226
             K K+ DPQGPFLQRWN+IFV++C++A ++DPLFFY+PV+DD+  CL LD T+EITA +LR
Sbjct  76    KQKILDPQGPFLQRWNKIFVLSCVIAVSLDPLFFYVPVIDDKKNCLSLDNTMEITASVLR  135

Query  227   SVFDFFYIFHIILQFRTGFVPPSSRVFGRGDLIVDPSAIAKRYFFSYFFIDILAVLPLPQ  406
             S  D FYI HII +FRTGF+ PSSRVFGRG L+ D  AIAKRY  SYF IDILAVLPLPQ
Sbjct  136   SFTDIFYILHIIFEFRTGFIAPSSRVFGRGVLVEDTWAIAKRYLSSYFLIDILAVLPLPQ  195

Query  407   VVLFMMIPRADRPFIMVAKDILKVVILVQSVPRLLRIYPLYKEVTRTSGFFTETAWAGAA  586
             VV+ ++IP+      +  K++LK V++ Q VPR +RIYPLYKEVT TSG  TETAWAGAA
Sbjct  196   VVILIIIPKMGGSSYLNTKNLLKFVVIFQYVPRFVRIYPLYKEVT-TSGILTETAWAGAA  254

Query  587   FNLFLYMIASYVAGAIWYITAIERQDKCWRRACEKHGSCDIDFLYCTKLGRRGGDFSSSF  766
             FNLFLYM+AS++ GA WY+ +IER+  CW     K+  C  + L+C +     GD +  F
Sbjct  255   FNLFLYMLASHILGAFWYLFSIERETNCW---SGKNCGCKPELLFCDR--DVVGDVT--F  307

Query  767   LNTSCALLEPENLKADDFDFGIFLDALKSNVVEKRY-FWSKLFYCFWWGLRNLSSLGQNL  943
             L+  C +  P       F+FGIFLDAL+S VV     F  K FYCFWWGL+NLSSLGQNL
Sbjct  308   LDGYCPIQTPNE---TIFNFGIFLDALQSGVVLSSMDFPQKFFYCFWWGLQNLSSLGQNL  364

Query  944   KTSNFVGEilfailisiiglilfslligNMQKYLQSITVRVEEMRVKRMDAEQWMSHRML  1123
             +TS +V EI FA+ ISI GL+LFS LIGNMQ YLQS T R+EEMR+KR DAEQWMSHR+L
Sbjct  365   QTSTYVWEICFAVFISISGLVLFSFLIGNMQTYLQSTTTRLEEMRIKRRDAEQWMSHRLL  424

Query  1124  PDNLRERIRRYEQYRWQETRGVDEESLISNLPKDLRRDINRHLCWSLLKRVHMFKTMDEQ  1303
             PDN++ERIRRYEQYRWQETRGVDEE+L+ NLPKDLRRDI RHLC +LL RV MF+ MDEQ
Sbjct  425   PDNIKERIRRYEQYRWQETRGVDEETLVHNLPKDLRRDIKRHLCLALLMRVPMFEKMDEQ  484

Query  1304  LLDAICDRLKPVLYTEKSCIVREGDPVDEMIFVMRGNLLTMTTNGGRTGFLNSDVLNAGD  1483
             LLDA+CDRLKP LYTE+S IVREGDPVDEM+FVMRG LLTMTTNGGRTGF NS+ L AGD
Sbjct  485   LLDAMCDRLKPALYTEESYIVREGDPVDEMLFVMRGKLLTMTTNGGRTGFFNSEYLKAGD  544

Query  1484  FCGEELLTWALDPNSSSSLPISTRTVQALTDVEAFALTADFLKFFASQYRRLHSKQLQHK  1663
             FCGEELLTWALDP+SSS+LPISTRTV+ +T+VEAFAL AD LKF ASQ+RRLHSKQL+H 
Sbjct  545   FCGEELLTWALDPHSSSNLPISTRTVRTITEVEAFALMADDLKFVASQFRRLHSKQLRHT  604

Query  1664  FRFYSHQWKTWAACFIQAAWRRHCRNKLEKSLREEEDRLQDALILRMRREEGETTPSLGA  1843
             FRFYS QW+TWAACFIQAAWRR+ + KLE+SLR+EE+RLQDAL      +   ++PSLGA
Sbjct  605   FRFYSQQWRTWAACFIQAAWRRYSKKKLEESLRQEENRLQDALA-----KASASSPSLGA  659

Query  1844  TIYASRFAANVLRTVRRNHplsvpklsprlpplllqkpAEPDFSAPE  1984
             TIYASRFAAN LR +RR       ++  R+PP+LLQKPAEPDF+A E
Sbjct  660   TIYASRFAANALRALRRGS-NRKSRVPDRVPPMLLQKPAEPDFTAEE  705



>ref|XP_006345562.1| PREDICTED: cyclic nucleotide-gated ion channel 1-like isoform 
X2 [Solanum tuberosum]
Length=707

 Score =   823 bits (2127),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 430/640 (67%), Positives = 520/640 (81%), Gaps = 13/640 (2%)
 Frame = +2

Query  62    DPQGPFLQRWNRIFVIACILAATVDPLFFYIPVVDDQNKCLGLDRTLEITACILRSVFDF  241
             DPQ  FLQ+WN++F++AC+ A ++DPLFFYIPV+D+ NKCL LD+TL+ITAC+LRSV D 
Sbjct  76    DPQDQFLQKWNKVFILACVFAVSLDPLFFYIPVIDNNNKCLDLDKTLKITACVLRSVTDL  135

Query  242   FYIFHIILQFRTGFVPPSSRVFGRGDLIVDPSAIAKRYFFSYFFIDILAVLPLPQVVLFM  421
             FYIFHIIL+FRTGF+ PSSRV+GRG+LI D SAIAKRY  SYF +D++AVLPLPQ+V+++
Sbjct  136   FYIFHIILKFRTGFIAPSSRVYGRGELIEDSSAIAKRYLLSYFIVDVVAVLPLPQIVIWI  195

Query  422   MIPRADRPFIMVAKDILKVVILVQSVPRLLRIYPLYKEVTRTSGFFTETAWAGAAFNLFL  601
             + P  + P  +  K++LK+VI  Q VPR  RIYPL KE+ RT+GFF E+A  GA FNLFL
Sbjct  196   IAPNVNGPIALATKEMLKIVIFAQCVPRFFRIYPLSKEIERTTGFFNESALGGAVFNLFL  255

Query  602   YMIASYVAGAIWYITAIERQDKCWRRACEKHGSCDIDFLYCTKLGRRGGDFSSSFLNTSC  781
             YM+ S   GA WY+ +IERQD CWR AC+K  +C  D+LYC   G+  G+  +  LN+SC
Sbjct  256   YMLYSNGIGAFWYLFSIERQDTCWRNACDKIPNCSSDYLYCG--GKMNGN--AFLLNSSC  311

Query  782   ALLEPENLK-ADDFDFGIFLDALKSNVVEKRYFWSKLFYCFWWGLRNLSSLGQNLKTSNF  958
              L++ E++K  ++FDFGI LDAL+  VVEKR F +KL YCFWWGLRNLSSLGQNLKTS F
Sbjct  312   PLMQQEDIKDPNEFDFGIALDALQFQVVEKRKFRTKLLYCFWWGLRNLSSLGQNLKTSTF  371

Query  959   VGEilfailisiiglilfslligNMQKYLQSITVRVEEMRVKRMDAEQWMSHRMLPDNLR  1138
              G+I+FAI IS+IGLILFSL+IGNMQK++QS  VRVEEMR +R D E WMSHRMLPDNLR
Sbjct  372   DGDIIFAIFISVIGLILFSLIIGNMQKFMQSNLVRVEEMRTRRRDIELWMSHRMLPDNLR  431

Query  1139  ERIRRYEQYRWQETRGVDEESLISNLPKDLRRDINRHLCWSLLKRVHMFKTMDEQLLDAI  1318
             ERIRR+EQY+WQET+GV+E+SLI NLP+DLRRD+ RHLCWS LK+V +F+ MD+QLLDA+
Sbjct  432   ERIRRHEQYKWQETKGVEEDSLIQNLPRDLRRDLKRHLCWSFLKKVPIFEKMDKQLLDAL  491

Query  1319  CDRLKPVLYTEKSCIVREGDPVDEMIFVMRGNLLTMTTNGGRTGFLNSDVLNAGDFCGEE  1498
             CDRLKP L+T+KS I+REGDPV+EM F+MRG LLTMTTNGGRTGF NS  L AGDFCG E
Sbjct  492   CDRLKPALFTDKSFIIREGDPVEEMHFLMRGTLLTMTTNGGRTGFFNSVHLKAGDFCGNE  551

Query  1499  LLTWALDPN-SSSSLPISTRTVQALTDVEAFALTADFLKFFASQYRRLHSKQLQHKFRFY  1675
             LLTWALDP+ SSSSLP+STRTV+A+TD+EAFALTAD LKF ASQ+RRLHSKQLQH F++Y
Sbjct  552   LLTWALDPHTSSSSLPLSTRTVKAVTDIEAFALTADDLKFVASQFRRLHSKQLQHTFKYY  611

Query  1676  SHQWKTWAACFIQAAWRRHCRNKLEKSLREEEDRLQDALILRMRREEGETTPSLGATIYA  1855
             S QW+TWAACFIQ AWRRH R KL+KSLREEED+LQ AL      +      SLGATIYA
Sbjct  612   SQQWRTWAACFIQVAWRRHFRKKLKKSLREEEDKLQVALA-----KASTNASSLGATIYA  666

Query  1856  SRFAANVLRTVRRNHplsvpklsprlpplllqkpAEPDFS  1975
             SRFAANVL T+RRN+  +    S    PLLL KPAEPDFS
Sbjct  667   SRFAANVLCTLRRNN--TTGTKSSPTLPLLLHKPAEPDFS  704



>ref|XP_009787221.1| PREDICTED: cyclic nucleotide-gated ion channel 1-like isoform 
X1 [Nicotiana sylvestris]
 ref|XP_009787222.1| PREDICTED: cyclic nucleotide-gated ion channel 1-like isoform 
X1 [Nicotiana sylvestris]
Length=708

 Score =   823 bits (2126),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 428/647 (66%), Positives = 509/647 (79%), Gaps = 13/647 (2%)
 Frame = +2

Query  47    KSKMHDPQGPFLQRWNRIFVIACILAATVDPLFFYIPVVDDQNKCLGLDRTLEITACILR  226
             K  + DPQGPFLQ+WN+IFV++C++A ++DPLF YIPV+D+ NKCLGL+RTLE+TA +LR
Sbjct  75    KKNILDPQGPFLQKWNKIFVLSCVIAISLDPLFLYIPVIDNDNKCLGLNRTLEVTASVLR  134

Query  227   SVFDFFYIFHIILQFRTGFVPPSSRVFGRGDLIVDPSAIAKRYFFSYFFIDILAVLPLPQ  406
             S  D FY  HI LQFRTGF+ PSSRVFGRG LI D   IAKRY  +YF IDILAVLPLPQ
Sbjct  135   SFTDIFYFLHIALQFRTGFIAPSSRVFGRGVLIEDAWDIAKRYLSTYFLIDILAVLPLPQ  194

Query  407   VVLFMMIPRADRPFIMVAKDILKVVILVQSVPRLLRIYPLYKEVTRTSGFFTETAWAGAA  586
             VV+ ++IP+      +  K++LK V+  Q +PR+LR+YPLY+EVTRTSG  TETAWAGAA
Sbjct  195   VVILIIIPKLRGSRSLNTKNLLKSVVFFQYIPRVLRVYPLYREVTRTSGILTETAWAGAA  254

Query  587   FNLFLYMIASYVAGAIWYITAIERQDKCWRRACEKHGSCDIDFLYCTKLGRRGGDFSSSF  766
             FNLFLYM+AS+V GA WY+ +IER+  CW++AC     C    LYC     +      + 
Sbjct  255   FNLFLYMLASHVLGAFWYLFSIERETTCWKQACGNSSPCHHASLYCDDDHTK----FKTL  310

Query  767   LNTSCALLEPENLKADDFDFGIFLDALKSNVVEKRYFWSKLFYCFWWGLRNLSSLGQNLK  946
             LN+SC +  P    A  FDFGIFL AL+S VV    F  K FYCFWWGL+NLSSLGQNL+
Sbjct  311   LNSSCPIETP---NATLFDFGIFLGALQSGVVGPMDFPQKFFYCFWWGLQNLSSLGQNLQ  367

Query  947   TSNFVGEilfailisiiglilfslligNMQKYLQSITVRVEEMRVKRMDAEQWMSHRMLP  1126
             TS F+ EI FA+ ISI GL+LF+ LIGNMQ  LQS T+R+EEMRVKR DAEQWMSHR+LP
Sbjct  368   TSTFIWEICFAVFISIAGLVLFAFLIGNMQTCLQSSTLRLEEMRVKRRDAEQWMSHRLLP  427

Query  1127  DNLRERIRRYEQYRWQETRGVDEESLISNLPKDLRRDINRHLCWSLLKRVHMFKTMDEQL  1306
             +NLRERIR YEQYRWQETRGVDEE+LI NLPKDLRRDI RHLC +LL RV MF+ MDEQL
Sbjct  428   ENLRERIRCYEQYRWQETRGVDEENLIHNLPKDLRRDIKRHLCLALLMRVPMFEKMDEQL  487

Query  1307  LDAICDRLKPVLYTEKSCIVREGDPVDEMIFVMRGNLLTMTTNGGRTGFLNSDVLNAGDF  1486
             LDA+CD LKPVL+T+ S IVREGDPVD M+FVMRG LL++TTNGGRTGF NS+ L AGDF
Sbjct  488   LDALCDHLKPVLFTKDSFIVREGDPVDAMLFVMRGKLLSVTTNGGRTGFFNSEHLKAGDF  547

Query  1487  CGEELLTWALDPNSSSSLPISTRTVQALTDVEAFALTADFLKFFASQYRRLHSKQLQHKF  1666
             CGEELLTWALDPNSS++LPISTRT QAL++VEAFAL AD LK  ASQ+RRLHSKQL+H F
Sbjct  548   CGEELLTWALDPNSSTNLPISTRTAQALSEVEAFALVADDLKLVASQFRRLHSKQLRHTF  607

Query  1667  RFYSHQWKTWAACFIQAAWRRHCRNKLEKSLREEEDRLQDALILRMRREEGETTPSLGAT  1846
             RFYS QW+TWAACFIQAAWR +CR  +E+SLR+EE+RLQDAL       EG ++PSLGAT
Sbjct  608   RFYSGQWRTWAACFIQAAWRSYCRKNVEESLRDEENRLQDALA-----NEGGSSPSLGAT  662

Query  1847  IYASRFAANVLRTVRRNHplsvpklsprlpplllqkpAEPDFSAPEN  1987
              YASRFAANVL  +RRN      ++  R+ P+LLQKP EPDF+A +N
Sbjct  663   FYASRFAANVLHALRRN-TAKKARVPDRISPILLQKPTEPDFTAEDN  708



>ref|XP_006345561.1| PREDICTED: cyclic nucleotide-gated ion channel 1-like isoform 
X1 [Solanum tuberosum]
Length=713

 Score =   823 bits (2127),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 430/640 (67%), Positives = 520/640 (81%), Gaps = 13/640 (2%)
 Frame = +2

Query  62    DPQGPFLQRWNRIFVIACILAATVDPLFFYIPVVDDQNKCLGLDRTLEITACILRSVFDF  241
             DPQ  FLQ+WN++F++AC+ A ++DPLFFYIPV+D+ NKCL LD+TL+ITAC+LRSV D 
Sbjct  82    DPQDQFLQKWNKVFILACVFAVSLDPLFFYIPVIDNNNKCLDLDKTLKITACVLRSVTDL  141

Query  242   FYIFHIILQFRTGFVPPSSRVFGRGDLIVDPSAIAKRYFFSYFFIDILAVLPLPQVVLFM  421
             FYIFHIIL+FRTGF+ PSSRV+GRG+LI D SAIAKRY  SYF +D++AVLPLPQ+V+++
Sbjct  142   FYIFHIILKFRTGFIAPSSRVYGRGELIEDSSAIAKRYLLSYFIVDVVAVLPLPQIVIWI  201

Query  422   MIPRADRPFIMVAKDILKVVILVQSVPRLLRIYPLYKEVTRTSGFFTETAWAGAAFNLFL  601
             + P  + P  +  K++LK+VI  Q VPR  RIYPL KE+ RT+GFF E+A  GA FNLFL
Sbjct  202   IAPNVNGPIALATKEMLKIVIFAQCVPRFFRIYPLSKEIERTTGFFNESALGGAVFNLFL  261

Query  602   YMIASYVAGAIWYITAIERQDKCWRRACEKHGSCDIDFLYCTKLGRRGGDFSSSFLNTSC  781
             YM+ S   GA WY+ +IERQD CWR AC+K  +C  D+LYC   G+  G+  +  LN+SC
Sbjct  262   YMLYSNGIGAFWYLFSIERQDTCWRNACDKIPNCSSDYLYCG--GKMNGN--AFLLNSSC  317

Query  782   ALLEPENLK-ADDFDFGIFLDALKSNVVEKRYFWSKLFYCFWWGLRNLSSLGQNLKTSNF  958
              L++ E++K  ++FDFGI LDAL+  VVEKR F +KL YCFWWGLRNLSSLGQNLKTS F
Sbjct  318   PLMQQEDIKDPNEFDFGIALDALQFQVVEKRKFRTKLLYCFWWGLRNLSSLGQNLKTSTF  377

Query  959   VGEilfailisiiglilfslligNMQKYLQSITVRVEEMRVKRMDAEQWMSHRMLPDNLR  1138
              G+I+FAI IS+IGLILFSL+IGNMQK++QS  VRVEEMR +R D E WMSHRMLPDNLR
Sbjct  378   DGDIIFAIFISVIGLILFSLIIGNMQKFMQSNLVRVEEMRTRRRDIELWMSHRMLPDNLR  437

Query  1139  ERIRRYEQYRWQETRGVDEESLISNLPKDLRRDINRHLCWSLLKRVHMFKTMDEQLLDAI  1318
             ERIRR+EQY+WQET+GV+E+SLI NLP+DLRRD+ RHLCWS LK+V +F+ MD+QLLDA+
Sbjct  438   ERIRRHEQYKWQETKGVEEDSLIQNLPRDLRRDLKRHLCWSFLKKVPIFEKMDKQLLDAL  497

Query  1319  CDRLKPVLYTEKSCIVREGDPVDEMIFVMRGNLLTMTTNGGRTGFLNSDVLNAGDFCGEE  1498
             CDRLKP L+T+KS I+REGDPV+EM F+MRG LLTMTTNGGRTGF NS  L AGDFCG E
Sbjct  498   CDRLKPALFTDKSFIIREGDPVEEMHFLMRGTLLTMTTNGGRTGFFNSVHLKAGDFCGNE  557

Query  1499  LLTWALDPN-SSSSLPISTRTVQALTDVEAFALTADFLKFFASQYRRLHSKQLQHKFRFY  1675
             LLTWALDP+ SSSSLP+STRTV+A+TD+EAFALTAD LKF ASQ+RRLHSKQLQH F++Y
Sbjct  558   LLTWALDPHTSSSSLPLSTRTVKAVTDIEAFALTADDLKFVASQFRRLHSKQLQHTFKYY  617

Query  1676  SHQWKTWAACFIQAAWRRHCRNKLEKSLREEEDRLQDALILRMRREEGETTPSLGATIYA  1855
             S QW+TWAACFIQ AWRRH R KL+KSLREEED+LQ AL      +      SLGATIYA
Sbjct  618   SQQWRTWAACFIQVAWRRHFRKKLKKSLREEEDKLQVALA-----KASTNASSLGATIYA  672

Query  1856  SRFAANVLRTVRRNHplsvpklsprlpplllqkpAEPDFS  1975
             SRFAANVL T+RRN+  +    S    PLLL KPAEPDFS
Sbjct  673   SRFAANVLCTLRRNN--TTGTKSSPTLPLLLHKPAEPDFS  710



>ref|XP_010925731.1| PREDICTED: cyclic nucleotide-gated ion channel 1-like isoform 
X1 [Elaeis guineensis]
 ref|XP_010925732.1| PREDICTED: cyclic nucleotide-gated ion channel 1-like isoform 
X1 [Elaeis guineensis]
Length=698

 Score =   822 bits (2123),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 439/647 (68%), Positives = 519/647 (80%), Gaps = 16/647 (2%)
 Frame = +2

Query  47    KSKMHDPQGPFLQRWNRIFVIACILAATVDPLFFYIPVVDDQNKCLGLDRTLEITACILR  226
             + K+ DPQGPFLQRWN++FVI+C++A +VDPLFFYIPV++ Q+ CL LDR LEITA +LR
Sbjct  68    RKKILDPQGPFLQRWNKVFVISCVIAVSVDPLFFYIPVIN-QDNCLELDRKLEITASVLR  126

Query  227   SVFDFFYIFHIILQFRTGFVPPSSRVFGRGDLIVDPSAIAKRYFFSYFFIDILAVLPLPQ  406
                D FYI HII QFRTGF+ PSSRVFGRG L+ DPSAIAKRY  SYF IDILAVLPLPQ
Sbjct  127   FFTDIFYILHIIFQFRTGFIAPSSRVFGRGVLVEDPSAIAKRYISSYFLIDILAVLPLPQ  186

Query  407   VVLFMMIPRADRPFIMVAKDILKVVILVQSVPRLLRIYPLYKEVTRTSGFFTETAWAGAA  586
             VV+ ++IP+     ++ AK++L  +++ Q VPRL+RI PLY EVTR++G  TETAWAGAA
Sbjct  187   VVVLIVIPKLQGSALLNAKNVLMFIVICQYVPRLVRIIPLYLEVTRSAGIITETAWAGAA  246

Query  587   FNLFLYMIASYVAGAIWYITAIERQDKCWRRACEKHGSCDIDFLYCTKLGRRGGDFSSSF  766
             FNL LYM+AS+V GA+WY+ AIERQD CWR AC K+  C  D LYC   G   G+  + F
Sbjct  247   FNLLLYMLASHVFGALWYLLAIERQDTCWRHACSKN-KCTPDSLYCG--GEHKGN--NDF  301

Query  767   LNTSCALLEPENLKADDFDFGIFLDALKSNVVEKRYFWSKLFYCFWWGLRNLSSLGQNLK  946
             L+ +C L    +  +D FDFGI+L AL+ N+V+ R F  KLFYCFWWGL+ LSSLGQNL+
Sbjct  302   LSVACPL---NDSSSDVFDFGIYLLALQ-NIVQSRNFLEKLFYCFWWGLQTLSSLGQNLQ  357

Query  947   TSNFVGEilfailisiiglilfslligNMQKYLQSITVRVEEMRVKRMDAEQWMSHRMLP  1126
             TS +  EILFA+ +SI GL+LF+LLIGNMQ YLQS TVR+EEMRV+R D EQWMSHR+LP
Sbjct  358   TSTYTWEILFAVFVSISGLVLFALLIGNMQTYLQSTTVRIEEMRVRRRDTEQWMSHRLLP  417

Query  1127  DNLRERIRRYEQYRWQETRGVDEESLISNLPKDLRRDINRHLCWSLLKRVHMFKTMDEQL  1306
             ++LRERI R+EQYRWQETRGVDEESL+ NLPKDLRRDI RHLC SLL RV MF+ MD QL
Sbjct  418   ESLRERIHRHEQYRWQETRGVDEESLLRNLPKDLRRDIKRHLCLSLLVRVPMFEQMDAQL  477

Query  1307  LDAICDRLKPVLYTEKSCIVREGDPVDEMIFVMRGNLLTMTTNGGRTGFLNSDVLNAGDF  1486
             +DA+CDRLKPVLYTE SCIVREGDPV EM+F+MRG L +MTTNGGRTGF NSD+L AGDF
Sbjct  478   MDAMCDRLKPVLYTEDSCIVREGDPVTEMLFIMRGKLESMTTNGGRTGFFNSDILKAGDF  537

Query  1487  CGEELLTWALDPNSSSSLPISTRTVQALTDVEAFALTADFLKFFASQYRRLHSKQLQHKF  1666
             CGEELLTWALDP+SSSSLP STRTV+ L++VEAFAL AD LKF ASQ+RRLHSKQLQH F
Sbjct  538   CGEELLTWALDPHSSSSLPSSTRTVRTLSEVEAFALMADDLKFVASQFRRLHSKQLQHTF  597

Query  1667  RFYSHQWKTWAACFIQAAWRRHCRNKLEKSLREEEDRLQDALILRMRREEGETTPSLGAT  1846
             RFYS QW+TWA+CFIQAAWRR+ R KLE SL EEE RLQ A+        G  +PSLGAT
Sbjct  598   RFYSPQWRTWASCFIQAAWRRYSRKKLEDSLHEEEQRLQAAMA-----SSGANSPSLGAT  652

Query  1847  IYASRFAANVLRTVRRNHplsvpklsprlpplllqkpAEPDFSAPEN  1987
             +YASRFAA VLRT+RR+      +L  RLP +LLQKPAEPDFSA E+
Sbjct  653   LYASRFAAIVLRTLRRS-GTRKARLQERLPVMLLQKPAEPDFSAEEH  698



>gb|AAF33670.1|AF079872_1 cyclic nucleotide-gated calmodulin-binding ion channel [Nicotiana 
tabacum]
Length=708

 Score =   822 bits (2123),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 426/647 (66%), Positives = 509/647 (79%), Gaps = 13/647 (2%)
 Frame = +2

Query  47    KSKMHDPQGPFLQRWNRIFVIACILAATVDPLFFYIPVVDDQNKCLGLDRTLEITACILR  226
             K  + DPQGPFL++WN+IFV++C++A ++DPLF YIPV+D+ NKCLGL+RTLE+TA +LR
Sbjct  75    KKNILDPQGPFLRKWNKIFVLSCVIAISLDPLFLYIPVIDNDNKCLGLNRTLEVTASVLR  134

Query  227   SVFDFFYIFHIILQFRTGFVPPSSRVFGRGDLIVDPSAIAKRYFFSYFFIDILAVLPLPQ  406
             S  D FY  HI LQFRTGF+ PSSRVFGRG LI D   IAKRY  +YF IDILAVLPLPQ
Sbjct  135   SFTDIFYFLHIALQFRTGFIAPSSRVFGRGVLIEDAWEIAKRYLSTYFLIDILAVLPLPQ  194

Query  407   VVLFMMIPRADRPFIMVAKDILKVVILVQSVPRLLRIYPLYKEVTRTSGFFTETAWAGAA  586
             VV+ ++IP+      +  K++LK V+  Q +PR+LR+YPLY+EVTRTSG  TETAWAGAA
Sbjct  195   VVILIIIPKLRGSRSLNTKNLLKSVVFFQYIPRVLRVYPLYREVTRTSGILTETAWAGAA  254

Query  587   FNLFLYMIASYVAGAIWYITAIERQDKCWRRACEKHGSCDIDFLYCTKLGRRGGDFSSSF  766
             FNLFLYM+AS+V GA WY+ +IER+  CW++AC     C    LYC     +      + 
Sbjct  255   FNLFLYMLASHVLGAFWYLFSIERETTCWKQACGNSSPCHHASLYCDDDHTK----FKTL  310

Query  767   LNTSCALLEPENLKADDFDFGIFLDALKSNVVEKRYFWSKLFYCFWWGLRNLSSLGQNLK  946
             LN+SC +  P    A  FDFGIFL AL+S VV    F  K FYCFWWGL+NLSSLGQNL+
Sbjct  311   LNSSCPIETP---NATLFDFGIFLGALQSGVVGPMDFPQKFFYCFWWGLQNLSSLGQNLQ  367

Query  947   TSNFVGEilfailisiiglilfslligNMQKYLQSITVRVEEMRVKRMDAEQWMSHRMLP  1126
             TS F+ E+ FA+ ISI GL+LF+ LIGNMQ  LQS T+R+EEMRVKR DAEQWMSHR+LP
Sbjct  368   TSTFIWEMCFAVFISIAGLVLFAFLIGNMQTCLQSSTLRLEEMRVKRRDAEQWMSHRLLP  427

Query  1127  DNLRERIRRYEQYRWQETRGVDEESLISNLPKDLRRDINRHLCWSLLKRVHMFKTMDEQL  1306
             +NLRERIR YEQYRWQETRGVDEE+LI NLPKDLRRDI RHLC +LL RV MF+ MDEQL
Sbjct  428   ENLRERIRCYEQYRWQETRGVDEENLIHNLPKDLRRDIKRHLCLALLMRVPMFEKMDEQL  487

Query  1307  LDAICDRLKPVLYTEKSCIVREGDPVDEMIFVMRGNLLTMTTNGGRTGFLNSDVLNAGDF  1486
             LDA+CD LKPVL+T+ S IVREGDPVD M+FVMRG LL++TTNGGRTGF NS+ L AGDF
Sbjct  488   LDALCDHLKPVLFTKDSFIVREGDPVDAMLFVMRGKLLSVTTNGGRTGFFNSEHLKAGDF  547

Query  1487  CGEELLTWALDPNSSSSLPISTRTVQALTDVEAFALTADFLKFFASQYRRLHSKQLQHKF  1666
             CGEELLTWALDPNSS++LPISTRT QAL++VEAFAL AD LK  ASQ+RRLHSKQL+H F
Sbjct  548   CGEELLTWALDPNSSTNLPISTRTAQALSEVEAFALVADDLKLVASQFRRLHSKQLRHTF  607

Query  1667  RFYSHQWKTWAACFIQAAWRRHCRNKLEKSLREEEDRLQDALILRMRREEGETTPSLGAT  1846
             RFYS QW+TWAACFIQAAWR +CR  +E+SLR+EE+RLQDAL       EG ++PSLGAT
Sbjct  608   RFYSGQWRTWAACFIQAAWRSYCRKNVEESLRDEENRLQDALA-----NEGGSSPSLGAT  662

Query  1847  IYASRFAANVLRTVRRNHplsvpklsprlpplllqkpAEPDFSAPEN  1987
              YASRFAANVL  +RRN      ++  R+ P+LLQKP EPDF+A +N
Sbjct  663   FYASRFAANVLHALRRN-TAKKARVPDRISPILLQKPTEPDFTAEDN  708



>gb|KDP28497.1| hypothetical protein JCGZ_14268 [Jatropha curcas]
Length=657

 Score =   819 bits (2116),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 420/645 (65%), Positives = 505/645 (78%), Gaps = 10/645 (2%)
 Frame = +2

Query  47    KSKMHDPQGPFLQRWNRIFVIACILAATVDPLFFYIPVVDDQNKCLGLDRTLEITACILR  226
             K K+ DPQG FLQ+WN+IFV+AC LA ++DPLFFYIPV+D  NKCL LD+ LE TAC+LR
Sbjct  19    KRKIFDPQGAFLQKWNKIFVLACFLAVSLDPLFFYIPVIDGVNKCLDLDKKLETTACVLR  78

Query  227   SVFDFFYIFHIILQFRTGFVPPSSRVFGRGDLIVDPSAIAKRYFFSYFFIDILAVLPLPQ  406
             +  D FY+  II QFRTGF+ PSSRVFGRG+L+ DP  IA+RY  S F ID++++LPLPQ
Sbjct  79    TFIDVFYVLRIIFQFRTGFIAPSSRVFGRGELVEDPIVIARRYLTSNFVIDVMSILPLPQ  138

Query  407   VVLFMMIPRADRPFIMVAKDILKVVILVQSVPRLLRIYPLYKEVTRTSGFFTETAWAGAA  586
             VV+ ++IP    P  +VAKD+LK +IL Q VPRL+RIYPL+ EVTR+SG  TETA AGA 
Sbjct  139   VVVLIIIPSLKGPVSLVAKDLLKYIILSQYVPRLMRIYPLFNEVTRSSGILTETAGAGAI  198

Query  587   FNLFLYMIASYVAGAIWYITAIERQDKCWRRACEKHGSCDIDFLYCTKLGRRGGDFSSSF  766
             FNLFLYM+AS+V GA WY+ ++ERQD CWRR CE    C  + LYC    R      S+F
Sbjct  199   FNLFLYMLASHVIGACWYLLSVERQDNCWRRVCEAP-LCRSNDLYCGD-HRADNTALSTF  256

Query  767   LNTSCALLEPENLKADD-FDFGIFLDALKSNVVEKRYFWSKLFYCFWWGLRNLSSLGQNL  943
             L  SC  ++P+ +K    F+FG+F DAL S VVE   F  K FYCFWWGLRNLSS GQNL
Sbjct  257   LKDSCPFIQPDEIKNSTIFNFGLFTDALDSGVVESWDFPKKFFYCFWWGLRNLSSSGQNL  316

Query  944   KTSNFVGEilfailisiiglilfslligNMQKYLQSITVRVEEMRVKRMDAEQWMSHRML  1123
             KTS +VGEILFA+ ISI GL+LFSLLIGNMQKYLQS TVRVEEMRVKR DA+QWM+HRML
Sbjct  317   KTSTYVGEILFAVFISIAGLVLFSLLIGNMQKYLQSTTVRVEEMRVKRRDADQWMAHRML  376

Query  1124  PDNLRERIRRYEQYRWQETRGVDEESLISNLPKDLRRDINRHLCWSLLKRVHMFKTMDEQ  1303
             P+NLRERIR+YEQY+WQETRGV+E+++I  LPKDLRRDINRHLC+ L+ RV MF+ MDE+
Sbjct  377   PENLRERIRKYEQYKWQETRGVEEQTVIRTLPKDLRRDINRHLCFDLITRVPMFEKMDEK  436

Query  1304  LLDAICDRLKPVLYTEKSCIVREGDPVDEMIFVMRGNLLTMTTNGGRTGFLNSDVLNAGD  1483
             +LDAICDRL+P LYT+ SCIVREGDPVDEM+F+MRG+L+++TTNGGRTGF N+  L AGD
Sbjct  437   ILDAICDRLRPTLYTKDSCIVREGDPVDEMLFIMRGDLVSVTTNGGRTGFFNAVYLKAGD  496

Query  1484  FCGEELLTWALDPNSSSSLPISTRTVQALTDVEAFALTADFLKFFASQYRRLHSKQLQHK  1663
             FCGE LLTWALDP S+S+LPIS+RTVQAL++VEAFAL A+ LK  ASQ+RRLH K +QH 
Sbjct  497   FCGEALLTWALDPQSTSNLPISSRTVQALSEVEAFALVAEDLKSVASQFRRLHHKDIQHT  556

Query  1664  FRFYSHQWKTWAACFIQAAWRRHCRNKLEKSLREEEDRLQDALILRMRREEGETTPSLGA  1843
             FRF+S QWKTWAACFIQAAWRR+CR K   SLR+ E+ LQD L      +E  + PSLGA
Sbjct  557   FRFFSVQWKTWAACFIQAAWRRYCRRKQANSLRQAEENLQDIL-----GKEAASLPSLGA  611

Query  1844  TIYASRFAANVLRTVRRNHplsvpklsprlpplllqkpAEPDFSA  1978
             TIYAS+FAAN LR +R+N         P    L+ QKP EPDFSA
Sbjct  612   TIYASKFAANALRNLRQNG--GRTPRLPHRLALVPQKPTEPDFSA  654



>ref|XP_003553784.1| PREDICTED: cyclic nucleotide-gated ion channel 1-like isoform 
X1 [Glycine max]
 ref|XP_006604904.1| PREDICTED: cyclic nucleotide-gated ion channel 1-like isoform 
X2 [Glycine max]
 ref|XP_006604905.1| PREDICTED: cyclic nucleotide-gated ion channel 1-like isoform 
X3 [Glycine max]
Length=716

 Score =   820 bits (2119),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 428/649 (66%), Positives = 512/649 (79%), Gaps = 13/649 (2%)
 Frame = +2

Query  47    KSKMHDPQGPFLQRWNRIFVIACILAATVDPLFFYIPVVDDQNKCLGLDRTLEITACILR  226
             + K+ DPQGP LQ+WN+IFVI C+LA +VDPLF YIPV++++ KC+ LD  L+ITA +LR
Sbjct  79    RKKILDPQGPVLQKWNKIFVITCVLAVSVDPLFSYIPVINNEEKCVHLDGALQITASVLR  138

Query  227   SVFDFFYIFHIILQFRTGFVPPSSRVFGRGDLIVDPSAIAKRYFFSYFFIDILAVLPLPQ  406
             + FD FYI  II QF+T F+PPSSRVFGRG+LI DP AI KRY  S+F IDIL+++PLPQ
Sbjct  139   TFFDLFYILRIIFQFKTAFIPPSSRVFGRGELIDDPVAIMKRYLTSHFIIDILSIIPLPQ  198

Query  407   VVLFMMIPRADRPFIMVAKDILKVVILVQSVPRLLRIYPLYKEVTRTSGFFTETAWAGAA  586
             V++  +   +      VAKD+LK  +L+Q VPRLLR+YPL+KEVTRTSG  TETAWAGAA
Sbjct  199   VIVLAINRNSKTSDPFVAKDLLKYSVLIQYVPRLLRMYPLFKEVTRTSGILTETAWAGAA  258

Query  587   FNLFLYMIASYVAGAIWYITAIERQDKCWRRACEKHGSCDIDFLYCTKLGRRGGDFSSSF  766
             FNLFLYM+AS+V GA WY+ ++E + +CWRR           ++ C  + R    F+   
Sbjct  259   FNLFLYMLASHVVGANWYMLSVESELRCWRRELRNASLYHRKYMSC--VDRNPNVFT--L  314

Query  767   LNTSCALLEPENLK-ADDFDFGIFLDALKSNVVEKRY-FWSKLFYCFWWGLRNLSSLGQN  940
             LN +C+L++P+ +K  + F++GIF DAL S VVE    F  K FYCFWWGLRNLSSLGQN
Sbjct  315   LNRTCSLVDPDTIKDPNTFNYGIFFDALDSRVVESTTDFPQKFFYCFWWGLRNLSSLGQN  374

Query  941   LKTSNFVGEilfailisiiglilfslligNMQKYLQSITVRVEEMRVKRMDAEQWMSHRM  1120
             LKTS  V EI FAI I+I GL+LFSLLIGNMQKYLQS TVRVEEMRVKR DAEQWMSHRM
Sbjct  375   LKTSTDVSEIAFAIFIAIFGLVLFSLLIGNMQKYLQSTTVRVEEMRVKRQDAEQWMSHRM  434

Query  1121  LPDNLRERIRRYEQYRWQETRGVDEESLISNLPKDLRRDINRHLCWSLLKRVHMFKTMDE  1300
             LP+NLRERIR+YEQY+WQE RGV+EE+LI NLPKDLRRDI RHLC +L+K+V MF+ MDE
Sbjct  435   LPENLRERIRKYEQYQWQENRGVEEEALIRNLPKDLRRDIKRHLCLTLVKKVPMFEKMDE  494

Query  1301  QLLDAICDRLKPVLYTEKSCIVREGDPVDEMIFVMRGNLLTMTTNGGRTGFLNSDVLNAG  1480
             QLLDA+CDRLKPVLYTEKS IVRE DPVDEM+F+MRG + TMTTNGGRTGF NS  L AG
Sbjct  495   QLLDAMCDRLKPVLYTEKSYIVREEDPVDEMLFIMRGKVSTMTTNGGRTGFFNSMFLKAG  554

Query  1481  DFCGEELLTWALDPNSSSSLPISTRTVQALTDVEAFALTADFLKFFASQYRRLHSKQLQH  1660
             DFCGEELLTWALDPNSSS+LPISTRTV+ +++VEAFALTAD LKF ASQ+RRLHSKQLQH
Sbjct  555   DFCGEELLTWALDPNSSSNLPISTRTVETISEVEAFALTADDLKFVASQFRRLHSKQLQH  614

Query  1661  KFRFYSHQWKTWAACFIQAAWRRHCRNKLEKSLREEEDRLQDALILRMRREEGETTPSLG  1840
              FRFYS QWKTWAA FIQAAWRR+ + K+E+SLRE ED LQDAL       E E++ SLG
Sbjct  615   AFRFYSSQWKTWAATFIQAAWRRYWKKKIERSLREAEDELQDALA-----NEEESSLSLG  669

Query  1841  ATIYASRFAANVLRTVRRNHplsvpklsprlpplllqkpAEPDFSAPEN  1987
             ATIYASRFAAN LR +R N      ++  RL PLL  KPAEPDF++ ++
Sbjct  670   ATIYASRFAANALRNLREN--SRHNRMQQRLLPLLPPKPAEPDFTSQKH  716



>ref|XP_008376138.1| PREDICTED: cyclic nucleotide-gated ion channel 1-like [Malus 
domestica]
Length=716

 Score =   819 bits (2116),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 428/645 (66%), Positives = 509/645 (79%), Gaps = 14/645 (2%)
 Frame = +2

Query  47    KSKMHDPQGPFLQRWNRIFVIACILAATVDPLFFYIPVVDDQNKCLGLDRTLEITACILR  226
             + ++  PQGPFLQ WNRIFV++C++A ++DPLFFY  VVD + KCL L +TL+I  C+LR
Sbjct  82    RRRILHPQGPFLQNWNRIFVLSCVIAVSLDPLFFYTAVVDGKKKCLNLHKTLQIIVCVLR  141

Query  227   SVFDFFYIFHIILQFRTGFVPPSSRVFGRGDLIVDPSAIAKRYFFSYFFIDILAVLPLPQ  406
             S  D F++FHIILQFRTGF+ PSSRVFGRG+LI DP AIAKRY  SYF IDILA+LPLPQ
Sbjct  142   SCTDIFHVFHIILQFRTGFIAPSSRVFGRGELIDDPVAIAKRYLSSYFIIDILAILPLPQ  201

Query  407   VVLFMMIPRADRPFIMVAKDILKVVILVQSVPRLLRIYPLYKEVTRTSGFFTETAWAGAA  586
             VV+F++IP    P  +VAKD+LK +I+ Q VPR  RIYPLY+EVTRTSGF TETAWAGAA
Sbjct  202   VVVFVIIPTISGPVPLVAKDLLKFIIVAQYVPRFWRIYPLYQEVTRTSGFMTETAWAGAA  261

Query  587   FNLFLYMIASYVAGAIWYITAIERQDKCWRRACEKHGSCDIDFLYCTKLGRRGGDFSSSF  766
              NL L+M+AS++ GA WY+ ++ER+ +CWR  C  +  C   FLYC         F +  
Sbjct  262   VNLLLFMLASHIVGAFWYLLSVEREYRCWRDQCNGNVDCK-KFLYCVPNHDNDASFVAK-  319

Query  767   LNTSCALLEPENLK-ADDFDFGIFLDALKSNVVEKRYFWSKLFYCFWWGLRNLSSLGQNL  943
             +N SC   +P N+K +  F+FGI+ DAL S V E + F  K  +CFWWGLRNLSSLGQNL
Sbjct  320   MNASCPFSDPGNIKNSSAFNFGIYNDALASGVTETKDFPKKFLFCFWWGLRNLSSLGQNL  379

Query  944   KTSNFVGEilfailisiiglilfslligNMQKYLQSITVRVEEMRVKRMDAEQWMSHRML  1123
             +TS +V EI+FA+ ISI GL+LFSLLIGNMQKYLQS TVRVEEMRVKR DAEQWMSHRML
Sbjct  380   QTSTYVWEIIFAVAISIFGLVLFSLLIGNMQKYLQSTTVRVEEMRVKRRDAEQWMSHRML  439

Query  1124  PDNLRERIRRYEQYRWQETRGVDEESLISNLPKDLRRDINRHLCWSLLKRVHMFKTMDEQ  1303
             P+ LRERIRRY+QY+WQETRGV+E++L+ NLPKDLR+DI RHLC +LLKRV MF+ MDEQ
Sbjct  440   PEKLRERIRRYDQYKWQETRGVEEDNLVRNLPKDLRKDIKRHLCLALLKRVPMFEKMDEQ  499

Query  1304  LLDAICDRLKPVLYTEKSCIVREGDPVDEMIFVMRGNLLTMTTNGGRTGFLNSDVLNAGD  1483
             L+DA+CDRLKPVLYT+KS I REGDPVDEM+F+MRGNL TMTTNGGRTGF N+  L AGD
Sbjct  500   LMDAMCDRLKPVLYTDKSFITREGDPVDEMLFIMRGNLATMTTNGGRTGFFNTADLKAGD  559

Query  1484  FCGEELLTWALDPNSSSSLPISTRTVQALTDVEAFALTADFLKFFASQYRRLHSKQLQHK  1663
             FCGEELLTWAL PNSS++LP STRTV+A T+VEAFAL AD LKF ASQ+RRLHSKQL+H 
Sbjct  560   FCGEELLTWALVPNSSTNLPTSTRTVEAKTEVEAFALMADDLKFVASQFRRLHSKQLRHT  619

Query  1664  FRFYSHQWKTWAACFIQAAWRRHCRNKLEKSLREEEDRLQDALILRMRREEGETTPSLGA  1843
             FRFYS QW+T +ACFIQAAWRRH + KLEKSLREEEDRLQDA           T PSL A
Sbjct  620   FRFYSLQWRTRSACFIQAAWRRHWKRKLEKSLREEEDRLQDA----------GTLPSLLA  669

Query  1844  TIYASRFAANVLRTVRRNHplsvpklsprlpplllqkpAEPDFSA  1978
              +YAS+FAAN LR +R+       + SP L PLL QKPAEPDF+A
Sbjct  670   AVYASKFAANALRGLRQK-VKRDTRPSPTLLPLLHQKPAEPDFTA  713



>gb|KEH40404.1| cyclic nucleotide-gated ion channel-like protein [Medicago truncatula]
Length=716

 Score =   819 bits (2116),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 426/648 (66%), Positives = 508/648 (78%), Gaps = 12/648 (2%)
 Frame = +2

Query  47    KSKMHDPQGPFLQRWNRIFVIACILAATVDPLFFYIPVVDDQNKCLGLDRTLEITACILR  226
             K K+ DPQG FLQ+WN+IFV+ C++A ++DPLFFY+PV+D +NKCL LDR +EITA  LR
Sbjct  80    KRKILDPQGTFLQKWNKIFVLLCVIAVSLDPLFFYVPVIDGENKCLSLDRGMEITATFLR  139

Query  227   SVFDFFYIFHIILQFRTGFVPPSSRVFGRGDLIVDPSAIAKRYFFSYFFIDILAVLPLPQ  406
             +  D FYI H+I QFRTGF+ PSSRVFGRG LI D   IAKRY  SYF +DILA+LPLPQ
Sbjct  140   TFSDVFYIIHMIFQFRTGFIAPSSRVFGRGVLIDDSWVIAKRYLSSYFLVDILAILPLPQ  199

Query  407   VVLFMMIPRADRPFIMVAKDILKVVILVQSVPRLLRIYPLYKEVTRTSGFFTETAWAGAA  586
             VV+ ++IP+      +  K++LKVV++ Q VPRL+RI PLYKEVTRTSG  TETAWAGAA
Sbjct  200   VVILVIIPKMSGFQSLNTKNLLKVVVIFQYVPRLIRIIPLYKEVTRTSGILTETAWAGAA  259

Query  587   FNLFLYMIASYVAGAIWYITAIERQDKCWRRACEKHGSCDIDFLYCTKLGRRGGDFS-SS  763
             FNL LYM+AS+V GA WY+ +IER+  CW+ AC  +  C+  +++C     RGG  S + 
Sbjct  260   FNLLLYMLASHVLGAFWYLFSIERETTCWQEACRSNIMCNTAYMHCNP---RGGFKSIAK  316

Query  764   FLNTSCALLEPENLKADDFDFGIFLDALKSNVVEKRYFWSKLFYCFWWGLRNLSSLGQNL  943
             FLN SC + E +      FDFGIFLDAL+S VVE R F SKLFYCFWWGL+NLSSLGQNL
Sbjct  317   FLNDSCPIQEEDK---KLFDFGIFLDALQSGVVESRDFPSKLFYCFWWGLKNLSSLGQNL  373

Query  944   KTSNFVGEilfailisiiglilfslligNMQKYLQSITVRVEEMRVKRMDAEQWMSHRML  1123
              TS    EI FAI I+I GL+LFS LIGNMQ YLQS   R+EEMRVKR DAEQWMSHR+L
Sbjct  374   ATSTDFWEICFAIFIAIAGLVLFSFLIGNMQTYLQSTQTRLEEMRVKRRDAEQWMSHRLL  433

Query  1124  PDNLRERIRRYEQYRWQETRGVDEESLISNLPKDLRRDINRHLCWSLLKRVHMFKTMDEQ  1303
             PD+LRERIRRY+QY+WQETRGV+E++L+ +LPKDLRRDI RHLC  LL RV MF+ MDEQ
Sbjct  434   PDDLRERIRRYDQYKWQETRGVNEDNLVRDLPKDLRRDIKRHLCLDLLMRVPMFEKMDEQ  493

Query  1304  LLDAICDRLKPVLYTEKSCIVREGDPVDEMIFVMRGNLLTMTTNGGRTGFLNSDVLNAGD  1483
             LLDA+CDRLKPVLYTE+S +VREGDPVDEM+F+MRG LLT+TTNGGRTGF NS+ L AGD
Sbjct  494   LLDAMCDRLKPVLYTEQSYVVREGDPVDEMLFIMRGKLLTITTNGGRTGFFNSEYLKAGD  553

Query  1484  FCGEELLTWALDPNSSSSLPISTRTVQALTDVEAFALTADFLKFFASQYRRLHSKQLQHK  1663
             FCGEELLTWALDP  S +LPISTRTV+ + +VEAFAL AD LKF ASQ+RRLHSKQL+H 
Sbjct  554   FCGEELLTWALDPRPSYNLPISTRTVRTIIEVEAFALKADDLKFVASQFRRLHSKQLRHT  613

Query  1664  FRFYSHQWKTWAACFIQAAWRRHCRNKLEKSLREEEDRLQDALILRMRREEGETTPSLGA  1843
             FRFYS  W+TWAACFIQAAWRR+ + KLE+SL EEE+RLQDAL      + G  T SLGA
Sbjct  614   FRFYSQHWRTWAACFIQAAWRRYSKKKLEESLDEEENRLQDALA-----KTGGNTTSLGA  668

Query  1844  TIYASRFAANVLRTVRRNHplsvpklsprlpplllqkpAEPDFSAPEN  1987
             TIYASRFAAN LR +RR+      +   R+P +LLQKP EP+F+  E 
Sbjct  669   TIYASRFAANALRLLRRSRTARKTRALERMPAILLQKPEEPNFTDDEQ  716



>gb|KHN43104.1| Cyclic nucleotide-gated ion channel 1 [Glycine soja]
Length=668

 Score =   813 bits (2101),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 429/657 (65%), Positives = 512/657 (78%), Gaps = 21/657 (3%)
 Frame = +2

Query  47    KSKMHDPQGPFLQRWNRIFVIACILAATVDPLFFYIPVVDDQNKCLGLDRTLEITACILR  226
             + K+ DPQGP LQ+WN+IFVI C+LA +VDPLF YIPV++++ KC+ LD  L+ITA +LR
Sbjct  23    RKKILDPQGPVLQKWNKIFVITCVLAVSVDPLFSYIPVINNEEKCVHLDGALQITASVLR  82

Query  227   SVFDFFYIFHIILQFRTGFVPPSSRVFGRGDLIVDPSAIAKRYFFSYFFIDILAVLPLPQ  406
             + FD FYI  II QF+T F+PPSSRVFGRG+LI DP AI KRY  S+F IDIL+++PLPQ
Sbjct  83    TFFDLFYILRIIFQFKTAFIPPSSRVFGRGELIDDPVAIMKRYLTSHFIIDILSIIPLPQ  142

Query  407   VVLFMMIPRADRPFIMVAKDILKVVILVQSVPRLLRIYPLYKEVTRTSGFFTETAWAGAA  586
             V++  +   +      VAKD+LK  +L+Q VPRLLRIYPL+KEVTRTSG  TETAWAGAA
Sbjct  143   VIVLAINRNSKTSDPFVAKDLLKYSVLIQYVPRLLRIYPLFKEVTRTSGILTETAWAGAA  202

Query  587   FNLFLYMIASYVAGAIWYITAIERQDKCWRRACEKHGSCDIDFLYCTKLGRRGGDFSSSF  766
             FNLFLYM+AS+V GA WY+ ++E + +CWRR           ++ C  + R    F+   
Sbjct  203   FNLFLYMLASHVVGANWYMLSVESELRCWRRELRNASLYHRKYMSC--VDRNPNVFT--L  258

Query  767   LNTSCALLEPENLK-ADDFDFGIFLDALKSNVVEKRY-FWSKLFYCFWWGLRNLSSLGQN  940
             LN +C+L++P+ +K  + F++GIF DAL S VVE    F  K FYCFWWGLRNLSSLGQN
Sbjct  259   LNRTCSLVDPDTIKDPNTFNYGIFFDALDSRVVESTTDFPQKFFYCFWWGLRNLSSLGQN  318

Query  941   LKTSNFVGEilfailisiiglilfslligNMQKYLQSITVRVEEMRVKRMDAEQWMSHRM  1120
             LKTS  V EI FAI I+I GL+LFSLLIGNMQKYLQS TVRVEEMRVKR DAEQWMSHRM
Sbjct  319   LKTSTDVSEIAFAIFIAIFGLVLFSLLIGNMQKYLQSTTVRVEEMRVKRQDAEQWMSHRM  378

Query  1121  LPDNLRERIRRYEQYRWQETRGVDEESLISNLPKDLRRDINRHLCWSLLKRVHMFKTMDE  1300
             LP+NLRERIR+YEQY+WQE RGV+EE+LI NLPKDLRRDI RHLC +L+K+V MF+ MDE
Sbjct  379   LPENLRERIRKYEQYQWQENRGVEEEALIRNLPKDLRRDIKRHLCLTLVKKVPMFEKMDE  438

Query  1301  QLLDAICDRLKPVLYTEKSCIVREGDPVDEMIFVMRGNLLTMTTNGGRTGFLNSDVLNAG  1480
             QLLDA+CDRLKPVLYTEKS IVRE DPVDEM+F+MRG + TMTTNGGRTGF NS  L AG
Sbjct  439   QLLDAMCDRLKPVLYTEKSYIVREEDPVDEMLFIMRGKVSTMTTNGGRTGFFNSMFLKAG  498

Query  1481  DFCGEELLTWALDPNSSSSLPISTRTVQALTDVEAFALTADFLKFFASQYRRLHSKQLQH  1660
             DFCGEELLTWALDPNSSS+LPISTRTV+ +++VEAFALTAD LKF ASQ+RRLHSKQLQH
Sbjct  499   DFCGEELLTWALDPNSSSNLPISTRTVETISEVEAFALTADDLKFVASQFRRLHSKQLQH  558

Query  1661  KFR--------FYSHQWKTWAACFIQAAWRRHCRNKLEKSLREEEDRLQDALILRMRREE  1816
              FR        FYS QWKTWAA FIQAAWRR+ + K+E+SLRE ED LQDAL       E
Sbjct  559   AFRQGLIIYIMFYSSQWKTWAATFIQAAWRRYWKKKIERSLREAEDELQDALA-----NE  613

Query  1817  GETTPSLGATIYASRFAANVLRTVRRNHplsvpklsprlpplllqkpAEPDFSAPEN  1987
              E++ SLGATIYASRFAAN LR +R N      ++  RL PLL  KPAEPDF++ ++
Sbjct  614   EESSLSLGATIYASRFAANALRNLREN--SRHNRMQQRLLPLLPPKPAEPDFTSQKH  668



>ref|XP_010456194.1| PREDICTED: putative cyclic nucleotide-gated ion channel 13 isoform 
X2 [Camelina sativa]
Length=711

 Score =   815 bits (2104),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 407/641 (63%), Positives = 495/641 (77%), Gaps = 17/641 (3%)
 Frame = +2

Query  62    DPQGPFLQRWNRIFVIACILAATVDPLFFYIPVVDDQNKCLGLDRTLEITACILRSVFDF  241
             +PQG FLQ WN+IF+ A ++A  +DPLFFYIP+VD +  CL L   LEI A +LR+  D 
Sbjct  80    NPQGSFLQNWNKIFLFASVIALAIDPLFFYIPIVDGERHCLNLHHNLEIAASVLRTFIDA  139

Query  242   FYIFHIILQFRTGFVPPSSRVFGRGDLIVDPSAIAKRYFFSYFFIDILAVLPLPQVVLFM  421
             FYI HI+ QFRT ++ PSSRVFGRG+L+ DP AIA +Y  SYF ID+L++LPLPQ+V+  
Sbjct  140   FYIIHIVFQFRTAYISPSSRVFGRGELVDDPKAIAIKYLSSYFIIDVLSILPLPQLVVLA  199

Query  422   MIPRADRPFIMVAKDILKVVILVQSVPRLLRIYPLYKEVTRTSGFFTETAWAGAAFNLFL  601
             +IP  ++P  ++ KD L  VI  Q +PR+LRI+PLY EVTRTSG  TETAWAGAA+NL L
Sbjct  200   VIPNVNKPVSLITKDYLVTVIFTQYIPRILRIFPLYSEVTRTSGIVTETAWAGAAWNLSL  259

Query  602   YMIASYVAGAIWYITAIERQDKCWRRACEKHGS-CDIDFLYCTKLGRRGGDFSSSFLNTS  778
             YM+AS+V GA+WY+ ++ER+D+CWR ACEK    C  +FLYC     R     + FL TS
Sbjct  260   YMLASHVFGALWYLISVEREDRCWREACEKRPEVCTFEFLYCD----RNRTVKNDFLTTS  315

Query  779   CALLEPENL-KADDFDFGIFLDALKSNVVEKRYFWSKLFYCFWWGLRNLSSLGQNLKTSN  955
             C  + P+++ K+  F+FGIF DALKS +VE   FW K FYCFWWGLRNLS+LGQNL TS 
Sbjct  316   CPFINPDDITKSTVFNFGIFTDALKSGIVESDDFWKKFFYCFWWGLRNLSALGQNLNTSK  375

Query  956   FVGEilfailisiiglilfslligNMQKYLQSITVRVEEMRVKRMDAEQWMSHRMLPDNL  1135
             FVGEI+FA+ I I GL+LF+LLIGNMQKYL+S TVR EEMRV++ DAEQWMSHRMLPD+L
Sbjct  376   FVGEIIFAVSICISGLVLFALLIGNMQKYLESTTVREEEMRVRKRDAEQWMSHRMLPDDL  435

Query  1136  RERIRRYEQYRWQETRGVDEESLISNLPKDLRRDINRHLCWSLLKRVHMFKTMDEQLLDA  1315
             R+RIRRYEQY+WQETRGV+EE+L+ NLPKDLRRDI RH C  LLK+V +F+ MDEQLLDA
Sbjct  436   RKRIRRYEQYKWQETRGVEEENLLRNLPKDLRRDIKRHFCLDLLKKVPLFEIMDEQLLDA  495

Query  1316  ICDRLKPVLYTEKSCIVREGDPVDEMIFVMRGNLLTMTTNGGRTGFLNSDVLNAGDFCGE  1495
             +CD+LKPVLYTE S  +REGDPV+EM+FVMRG L++ TTNGGRTGF N+  L A DFCGE
Sbjct  496   VCDKLKPVLYTENSYAIREGDPVEEMLFVMRGKLMSATTNGGRTGFFNAVYLKASDFCGE  555

Query  1496  ELLTWALDPNSSSSLPISTRTVQALTDVEAFALTADFLKFFASQYRRLHSKQLQHKFRFY  1675
             +LLTWALDP SSS  PISTRTVQALT+VEAFAL AD LK  ASQ+RRLHSKQLQH FRFY
Sbjct  556   DLLTWALDPQSSSHFPISTRTVQALTEVEAFALAADDLKLVASQFRRLHSKQLQHTFRFY  615

Query  1676  SHQWKTWAACFIQAAWRRHCRNKLEKSLREEEDRLQDALILRMRREEGETTPSLGATIYA  1855
             S QW+TW A FIQAAWRRHCR KL +SL  EEDR ++A+  R R  +  ++ SL AT+YA
Sbjct  616   SVQWRTWGASFIQAAWRRHCRRKLARSLTAEEDRFRNAIAQRERERDAASSSSLVATLYA  675

Query  1856  SRFAANVLRTVRRNHplsvpklsprlpplllqkpAEPDFSA  1978
             SRFA+N LR +R N+            PLL  KP+EPDFSA
Sbjct  676   SRFASNALRNLRTNN-----------LPLLPPKPSEPDFSA  705



>ref|XP_004306680.1| PREDICTED: cyclic nucleotide-gated ion channel 1-like [Fragaria 
vesca subsp. vesca]
Length=719

 Score =   815 bits (2104),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 403/617 (65%), Positives = 492/617 (80%), Gaps = 7/617 (1%)
 Frame = +2

Query  47    KSKMHDPQGPFLQRWNRIFVIACILAATVDPLFFYIPVVDDQNKCLGLDRTLEITACILR  226
             +  + DPQG FLQ WN+IFVI+C++A ++DPLF Y  VVD +NKCLGLD+ L+I AC+LR
Sbjct  79    RKNILDPQGSFLQTWNKIFVISCVIAVSLDPLFLYTSVVDGKNKCLGLDKELQIVACVLR  138

Query  227   SVFDFFYIFHIILQFRTGFVPPSSRVFGRGDLIVDPSAIAKRYFFSYFFIDILAVLPLPQ  406
             S  D F+I HII QFRTGF+ PSSRVFGRG+L  DP AIAKRY  SYF ID+LA+LPLPQ
Sbjct  139   SFTDVFHILHIIFQFRTGFIAPSSRVFGRGELNDDPVAIAKRYLSSYFIIDVLAILPLPQ  198

Query  407   VVLFMMIPRADRPFIMVAKDILKVVILVQSVPRLLRIYPLYKEVTRTSGFFTETAWAGAA  586
             VV+F+++P  +RP  M AK++L +VI+ Q VPRL+RIYPLYKEVT+TSGF TETAWA AA
Sbjct  199   VVVFLIVPIIERPVPMTAKNLLTIVIVCQYVPRLIRIYPLYKEVTKTSGFLTETAWAAAA  258

Query  587   FNLFLYMIASYVAGAIWYITAIERQDKCWRRACEKHGSCDIDFLYCTKLGRRGGDFSSSF  766
             FNL LYM+AS+V GAIWY+ ++ER+ +CW   C    +C  ++LYC    +         
Sbjct  259   FNLLLYMLASHVVGAIWYLFSVEREYRCWHDHCGNDVNCK-NYLYCGGSDKVANMTIVDM  317

Query  767   LNTSCALLEPENLKADD-FDFGIFLDALKSNVVEKRYFWSKLFYCFWWGLRNLSSLGQNL  943
             L  SC    P+++K    F+FGIF +AL+S V+E   F  K  YCFWWGLR+LSSLGQNL
Sbjct  318   LKDSCPFTNPDDIKNSSVFNFGIFAEALESGVMETTDFPMKFLYCFWWGLRSLSSLGQNL  377

Query  944   KTSNFVGEilfailisiiglilfslligNMQKYLQSITVRVEEMRVKRMDAEQWMSHRML  1123
             KTS +V EILFA+ ISI GL+LF+LLIGNMQK+LQS TVRVEEMRVKR DAEQWMSHRML
Sbjct  378   KTSTYVWEILFAVFISIFGLVLFALLIGNMQKFLQSTTVRVEEMRVKRRDAEQWMSHRML  437

Query  1124  PDNLRERIRRYEQYRWQETRGVDEESLISNLPKDLRRDINRHLCWSLLKRVHMFKTMDEQ  1303
             P+ LRERIRRY+QY+WQETRGV+E+ L+ NLPKDLR+DI RHLC +L+KRV MF+ MD++
Sbjct  438   PEKLRERIRRYDQYKWQETRGVEEDELVRNLPKDLRKDIKRHLCLALVKRVPMFEKMDDR  497

Query  1304  LLDAICDRLKPVLYTEKSCIVREGDPVDEMIFVMRGNLLTMTTNGGRTGFLNSDVLNAGD  1483
             L+DA+CD LKPVL+T+ S I+REGDPVDEM+FVMRGN+ TMTTNGGRTGF N   L AGD
Sbjct  498   LMDALCDHLKPVLFTDDSFIIREGDPVDEMLFVMRGNIATMTTNGGRTGFFNCANLKAGD  557

Query  1484  FCGEELLTWALDPNSSSSLPISTRTVQALTDVEAFALTADFLKFFASQYRRLHSKQLQHK  1663
             FCGEELLTWALDP S+++LPISTRTV+A+T+VEAFAL AD LKF ASQ+RRLHS+Q+QH 
Sbjct  558   FCGEELLTWALDPKSTTNLPISTRTVEAITEVEAFALRADDLKFVASQFRRLHSRQVQHA  617

Query  1664  FRFYSHQWKTWAACFIQAAWRRHCRNKLEKSLREEEDRLQDALILRMRREEGETTPSLGA  1843
             FRFYS QW+TWA+CFIQAAWRRHC+ KLEKSL E E++L DA        +   TPSL A
Sbjct  618   FRFYSMQWRTWASCFIQAAWRRHCKRKLEKSLHEAEEKLHDAFA-----SDAGNTPSLVA  672

Query  1844  TIYASRFAANVLRTVRR  1894
             T+YASRFAAN LR +R+
Sbjct  673   TVYASRFAANALRALRQ  689



>ref|XP_010456193.1| PREDICTED: putative cyclic nucleotide-gated ion channel 13 isoform 
X1 [Camelina sativa]
Length=713

 Score =   814 bits (2103),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 407/641 (63%), Positives = 495/641 (77%), Gaps = 17/641 (3%)
 Frame = +2

Query  62    DPQGPFLQRWNRIFVIACILAATVDPLFFYIPVVDDQNKCLGLDRTLEITACILRSVFDF  241
             +PQG FLQ WN+IF+ A ++A  +DPLFFYIP+VD +  CL L   LEI A +LR+  D 
Sbjct  82    NPQGSFLQNWNKIFLFASVIALAIDPLFFYIPIVDGERHCLNLHHNLEIAASVLRTFIDA  141

Query  242   FYIFHIILQFRTGFVPPSSRVFGRGDLIVDPSAIAKRYFFSYFFIDILAVLPLPQVVLFM  421
             FYI HI+ QFRT ++ PSSRVFGRG+L+ DP AIA +Y  SYF ID+L++LPLPQ+V+  
Sbjct  142   FYIIHIVFQFRTAYISPSSRVFGRGELVDDPKAIAIKYLSSYFIIDVLSILPLPQLVVLA  201

Query  422   MIPRADRPFIMVAKDILKVVILVQSVPRLLRIYPLYKEVTRTSGFFTETAWAGAAFNLFL  601
             +IP  ++P  ++ KD L  VI  Q +PR+LRI+PLY EVTRTSG  TETAWAGAA+NL L
Sbjct  202   VIPNVNKPVSLITKDYLVTVIFTQYIPRILRIFPLYSEVTRTSGIVTETAWAGAAWNLSL  261

Query  602   YMIASYVAGAIWYITAIERQDKCWRRACEKHGS-CDIDFLYCTKLGRRGGDFSSSFLNTS  778
             YM+AS+V GA+WY+ ++ER+D+CWR ACEK    C  +FLYC     R     + FL TS
Sbjct  262   YMLASHVFGALWYLISVEREDRCWREACEKRPEVCTFEFLYCD----RNRTVKNDFLTTS  317

Query  779   CALLEPENL-KADDFDFGIFLDALKSNVVEKRYFWSKLFYCFWWGLRNLSSLGQNLKTSN  955
             C  + P+++ K+  F+FGIF DALKS +VE   FW K FYCFWWGLRNLS+LGQNL TS 
Sbjct  318   CPFINPDDITKSTVFNFGIFTDALKSGIVESDDFWKKFFYCFWWGLRNLSALGQNLNTSK  377

Query  956   FVGEilfailisiiglilfslligNMQKYLQSITVRVEEMRVKRMDAEQWMSHRMLPDNL  1135
             FVGEI+FA+ I I GL+LF+LLIGNMQKYL+S TVR EEMRV++ DAEQWMSHRMLPD+L
Sbjct  378   FVGEIIFAVSICISGLVLFALLIGNMQKYLESTTVREEEMRVRKRDAEQWMSHRMLPDDL  437

Query  1136  RERIRRYEQYRWQETRGVDEESLISNLPKDLRRDINRHLCWSLLKRVHMFKTMDEQLLDA  1315
             R+RIRRYEQY+WQETRGV+EE+L+ NLPKDLRRDI RH C  LLK+V +F+ MDEQLLDA
Sbjct  438   RKRIRRYEQYKWQETRGVEEENLLRNLPKDLRRDIKRHFCLDLLKKVPLFEIMDEQLLDA  497

Query  1316  ICDRLKPVLYTEKSCIVREGDPVDEMIFVMRGNLLTMTTNGGRTGFLNSDVLNAGDFCGE  1495
             +CD+LKPVLYTE S  +REGDPV+EM+FVMRG L++ TTNGGRTGF N+  L A DFCGE
Sbjct  498   VCDKLKPVLYTENSYAIREGDPVEEMLFVMRGKLMSATTNGGRTGFFNAVYLKASDFCGE  557

Query  1496  ELLTWALDPNSSSSLPISTRTVQALTDVEAFALTADFLKFFASQYRRLHSKQLQHKFRFY  1675
             +LLTWALDP SSS  PISTRTVQALT+VEAFAL AD LK  ASQ+RRLHSKQLQH FRFY
Sbjct  558   DLLTWALDPQSSSHFPISTRTVQALTEVEAFALAADDLKLVASQFRRLHSKQLQHTFRFY  617

Query  1676  SHQWKTWAACFIQAAWRRHCRNKLEKSLREEEDRLQDALILRMRREEGETTPSLGATIYA  1855
             S QW+TW A FIQAAWRRHCR KL +SL  EEDR ++A+  R R  +  ++ SL AT+YA
Sbjct  618   SVQWRTWGASFIQAAWRRHCRRKLARSLTAEEDRFRNAIAQRERERDAASSSSLVATLYA  677

Query  1856  SRFAANVLRTVRRNHplsvpklsprlpplllqkpAEPDFSA  1978
             SRFA+N LR +R N+            PLL  KP+EPDFSA
Sbjct  678   SRFASNALRNLRTNN-----------LPLLPPKPSEPDFSA  707



>ref|XP_009119851.1| PREDICTED: cyclic nucleotide-gated ion channel 1-like isoform 
X2 [Brassica rapa]
Length=720

 Score =   814 bits (2103),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 414/614 (67%), Positives = 500/614 (81%), Gaps = 13/614 (2%)
 Frame = +2

Query  62    DPQGPFLQRWNRIFVIACILAATVDPLFFYIPVVDDQNKCLGLDRTLEITACILRSVFDF  241
             DPQG FLQ+WN+IFV+ACI+A +VDPLFFY+PV+D  N CL +D+ ++ TA +LRSV D 
Sbjct  75    DPQGTFLQKWNKIFVLACIIAVSVDPLFFYVPVLDKANNCLDVDKKMQTTASVLRSVTDI  134

Query  242   FYIFHIILQFRTGFVPPSSRVFGRGDLIVDPSAIAKRYFFSYFFIDILAVLPLPQVVLFM  421
             FY  H++ QFRTGF+ PSSRVFGRG L+ D   IAKRY  S+F IDILAVLPLPQ+V+ +
Sbjct  135   FYAIHMVFQFRTGFIAPSSRVFGRGVLVEDRRKIAKRYLSSHFIIDILAVLPLPQMVISI  194

Query  422   MIPRADRPFIMVAKDILKVVILVQSVPRLLRIYPLYKEVTRTSGFFTETAWAGAAFNLFL  601
             +IPR   P  +  K++LK ++  Q +PR +RIYPLYK+VTRTSG  TETAWAGAAFNLFL
Sbjct  195   IIPRMREPKTLHTKNMLKFIVFFQYIPRFMRIYPLYKQVTRTSGILTETAWAGAAFNLFL  254

Query  602   YMIASYVAGAIWYITAIERQDKCWRRACEKHG--SCDIDFLYCTKLGRRGGDFSSSFLNT  775
             YM+AS+V GA WY+ +IER+  CW++A  + G   CD+  LYC     R    +++FLN 
Sbjct  255   YMLASHVFGAFWYLFSIERKTVCWKQAWNRAGRSKCDMRSLYCA----REHYGNNTFLNG  310

Query  776   SCALLEPENLKADDFDFGIFLDALKSNVVEKRYFWSKLFYCFWWGLRNLSSLGQNLKTSN  955
             SC +L+P    A  F+FGIFL AL+S VVE   F  K FYCFWWGL+NLSSLGQNLKTS 
Sbjct  311   SCPVLKPN---ATCFEFGIFLGALESGVVESHDFPQKFFYCFWWGLQNLSSLGQNLKTST  367

Query  956   FVGEilfailisiiglilfslligNMQKYLQSITVRVEEMRVKRMDAEQWMSHRMLPDNL  1135
             ++ E  FA+ ISI GL+LFS LIGNMQ YLQS T R+EEMRVKR DAEQWMSHR+LPDNL
Sbjct  368   YIWENCFAVFISISGLVLFSFLIGNMQTYLQSTTTRLEEMRVKRRDAEQWMSHRLLPDNL  427

Query  1136  RERIRRYEQYRWQETRGVDEESLISNLPKDLRRDINRHLCWSLLKRVHMFKTMDEQLLDA  1315
             R+RIRRYEQY+WQETRGV+EE+L+SNLPKDLRRDI RHLC +L+ RV MF+ MDEQLLDA
Sbjct  428   RKRIRRYEQYKWQETRGVNEENLLSNLPKDLRRDIKRHLCLALVMRVPMFEQMDEQLLDA  487

Query  1316  ICDRLKPVLYTEKSCIVREGDPVDEMIFVMRGNLLTMTTNGGRTGFLNSDVLNAGDFCGE  1495
             +CDRL+PVLYTE+S IVREGDPVDEM+F+MRG LLTMTTNGGRTGF NS+ L AGDFCGE
Sbjct  488   LCDRLQPVLYTEESYIVREGDPVDEMLFIMRGKLLTMTTNGGRTGFFNSEHLGAGDFCGE  547

Query  1496  ELLTWALDPNSSSSLPISTRTVQALTDVEAFALTADFLKFFASQYRRLHSKQLQHKFRFY  1675
             ELLTWALDP++S++LPISTRTVQAL +VEAFAL AD LKF ASQ+RRLHSKQL+H FRFY
Sbjct  548   ELLTWALDPHTSTNLPISTRTVQALVEVEAFALKADNLKFVASQFRRLHSKQLRHTFRFY  607

Query  1676  SHQWKTWAACFIQAAWRRHCRNKLEKSLREEEDRLQDALILRMRREEGETTPSLGATIYA  1855
             S QW+TWAACFIQAAWRRH + +LE+SLREEE+RLQDAL     ++   ++PS GAT+YA
Sbjct  608   SQQWRTWAACFIQAAWRRHVKKRLEESLREEENRLQDALA----KQACGSSPSFGATMYA  663

Query  1856  SRFAANVLRTVRRN  1897
             SRFAAN+LRT+RR+
Sbjct  664   SRFAANILRTIRRS  677



>ref|XP_010422754.1| PREDICTED: putative cyclic nucleotide-gated ion channel 13 [Camelina 
sativa]
 ref|XP_010422755.1| PREDICTED: putative cyclic nucleotide-gated ion channel 13 [Camelina 
sativa]
 ref|XP_010422756.1| PREDICTED: putative cyclic nucleotide-gated ion channel 13 [Camelina 
sativa]
Length=714

 Score =   813 bits (2101),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 407/641 (63%), Positives = 494/641 (77%), Gaps = 16/641 (2%)
 Frame = +2

Query  62    DPQGPFLQRWNRIFVIACILAATVDPLFFYIPVVDDQNKCLGLDRTLEITACILRSVFDF  241
             +PQG FLQ WN+IF+ A ++A  +DPLFFYIP+VD +  CL L   LEI A +LR+  D 
Sbjct  82    NPQGSFLQNWNKIFLFASVIALAIDPLFFYIPIVDGERHCLNLHHNLEIAASVLRTFIDA  141

Query  242   FYIFHIILQFRTGFVPPSSRVFGRGDLIVDPSAIAKRYFFSYFFIDILAVLPLPQVVLFM  421
             FYI HI+ QFRT ++ PSSRVFGRG+L+ DP AIA +Y  SYF ID+L++LPLPQ+V+  
Sbjct  142   FYIIHIVFQFRTAYISPSSRVFGRGELVDDPKAIAIKYLSSYFIIDVLSILPLPQLVVLA  201

Query  422   MIPRADRPFIMVAKDILKVVILVQSVPRLLRIYPLYKEVTRTSGFFTETAWAGAAFNLFL  601
             +IP  ++P  ++ KD L  VI  Q +PR+LRI+PLY EVTRTSG  TETAWAGAA+NL L
Sbjct  202   VIPNVNKPVSLITKDYLVTVIFTQDIPRILRIFPLYSEVTRTSGIDTETAWAGAAWNLSL  261

Query  602   YMIASYVAGAIWYITAIERQDKCWRRACEKHGS-CDIDFLYCTKLGRRGGDFSSSFLNTS  778
             YM+AS+V GA+WY+ ++ER+D+CWR ACEK    C   FLYC     R     + FL TS
Sbjct  262   YMLASHVFGALWYLISVEREDRCWREACEKRPEVCTFRFLYCD----RNRTVKNDFLTTS  317

Query  779   CALLEPENL-KADDFDFGIFLDALKSNVVEKRYFWSKLFYCFWWGLRNLSSLGQNLKTSN  955
             C  + P+++  +  F+FGIF DALKS +VE   FW K FYCFWWGLRNLS+LGQNL TS 
Sbjct  318   CPFINPDDITNSTVFNFGIFTDALKSGIVESDDFWKKFFYCFWWGLRNLSALGQNLNTSK  377

Query  956   FVGEilfailisiiglilfslligNMQKYLQSITVRVEEMRVKRMDAEQWMSHRMLPDNL  1135
             FVGEI+FA+ I I GL+LF+LLIGNMQKYL+S TVR EEMRV++ DAEQWMSHRMLPD+L
Sbjct  378   FVGEIIFAVSICISGLVLFALLIGNMQKYLESTTVREEEMRVRKRDAEQWMSHRMLPDDL  437

Query  1136  RERIRRYEQYRWQETRGVDEESLISNLPKDLRRDINRHLCWSLLKRVHMFKTMDEQLLDA  1315
             R+RIRRYEQY+WQETRGV+EE+L+ NLPKDLRRDI RH C  LLK+V +F+ MDEQLLDA
Sbjct  438   RKRIRRYEQYKWQETRGVEEENLLRNLPKDLRRDIKRHFCLDLLKKVPLFEIMDEQLLDA  497

Query  1316  ICDRLKPVLYTEKSCIVREGDPVDEMIFVMRGNLLTMTTNGGRTGFLNSDVLNAGDFCGE  1495
             +CD+LKPVLYTE S  +REGDPV+EM+FVMRG L++ TTNGGRTGF N+  L A DFCGE
Sbjct  498   VCDKLKPVLYTENSYAIREGDPVEEMLFVMRGKLMSATTNGGRTGFFNAVYLKASDFCGE  557

Query  1496  ELLTWALDPNSSSSLPISTRTVQALTDVEAFALTADFLKFFASQYRRLHSKQLQHKFRFY  1675
             +LLTWALDP SSS  PISTRTVQALT+VEAFAL AD LK  ASQ+RRLHSKQLQH FRFY
Sbjct  558   DLLTWALDPQSSSHFPISTRTVQALTEVEAFALAADDLKLVASQFRRLHSKQLQHTFRFY  617

Query  1676  SHQWKTWAACFIQAAWRRHCRNKLEKSLREEEDRLQDALILRMRREEGETTPSLGATIYA  1855
             S QW+TW A FIQAAWRRHCR KL +SL  EEDR ++A+ LR R  +  ++ SL AT+YA
Sbjct  618   SVQWRTWGASFIQAAWRRHCRRKLARSLTAEEDRFRNAIALRERERDAASSSSLVATLYA  677

Query  1856  SRFAANVLRTVRRNHplsvpklsprlpplllqkpAEPDFSA  1978
             SRFA+N LR +R N+            PLL  KP+EPDFSA
Sbjct  678   SRFASNALRNLRTNN----------NLPLLPPKPSEPDFSA  708



>ref|XP_010427945.1| PREDICTED: putative cyclic nucleotide-gated ion channel 13 [Camelina 
sativa]
Length=703

 Score =   813 bits (2099),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 406/641 (63%), Positives = 494/641 (77%), Gaps = 16/641 (2%)
 Frame = +2

Query  62    DPQGPFLQRWNRIFVIACILAATVDPLFFYIPVVDDQNKCLGLDRTLEITACILRSVFDF  241
             +PQG FLQ WN+IF+ A ++A  +DPLFFYIP+VD +  CL L   LEI A +LR+  D 
Sbjct  71    NPQGSFLQNWNKIFLFASVIALAIDPLFFYIPIVDGERHCLNLHHNLEIAASVLRTFIDA  130

Query  242   FYIFHIILQFRTGFVPPSSRVFGRGDLIVDPSAIAKRYFFSYFFIDILAVLPLPQVVLFM  421
             FYI HI+ QFRT ++ PSSRVFGRG+L+ DP AIA +Y  SYF ID+L++LPLPQ+V+  
Sbjct  131   FYIVHIVFQFRTAYISPSSRVFGRGELVDDPKAIAIKYLSSYFIIDVLSILPLPQLVVLA  190

Query  422   MIPRADRPFIMVAKDILKVVILVQSVPRLLRIYPLYKEVTRTSGFFTETAWAGAAFNLFL  601
             +IP  ++P  ++ KD L  VI  Q +PR+LRI+PLY EVTRTSG  TETAWAGAA+NL L
Sbjct  191   VIPNVNKPVSLITKDYLVTVIFTQYIPRILRIFPLYSEVTRTSGIVTETAWAGAAWNLSL  250

Query  602   YMIASYVAGAIWYITAIERQDKCWRRACEKHGS-CDIDFLYCTKLGRRGGDFSSSFLNTS  778
             YM+AS+V GA+WY+ ++ER+D+CWR ACEK    C  +FLYC     R     + FL TS
Sbjct  251   YMLASHVFGALWYLISVEREDRCWREACEKRPEVCTFEFLYCD----RNRSVKNDFLTTS  306

Query  779   CALLEPENL-KADDFDFGIFLDALKSNVVEKRYFWSKLFYCFWWGLRNLSSLGQNLKTSN  955
             C  + P+++  +  F+FGIF DALKS +VE   FW K FYCFWWGLRNLS+LGQNL TS 
Sbjct  307   CPFINPDDITNSTVFNFGIFTDALKSGIVESDDFWKKFFYCFWWGLRNLSALGQNLNTSK  366

Query  956   FVGEilfailisiiglilfslligNMQKYLQSITVRVEEMRVKRMDAEQWMSHRMLPDNL  1135
             FVGEI+FA+ I I GL+LF+LLIGNMQKYL+S TVR EEMRV++ DAEQWMSHRMLPD+L
Sbjct  367   FVGEIIFAVSICISGLVLFALLIGNMQKYLESTTVREEEMRVRKRDAEQWMSHRMLPDDL  426

Query  1136  RERIRRYEQYRWQETRGVDEESLISNLPKDLRRDINRHLCWSLLKRVHMFKTMDEQLLDA  1315
             R+RIRRYEQY+WQETRGV+EE+L+ NLPKDLRRDI RH C  LLK+V +F+ MDEQLLDA
Sbjct  427   RKRIRRYEQYKWQETRGVEEENLLRNLPKDLRRDIKRHFCLDLLKKVPLFEIMDEQLLDA  486

Query  1316  ICDRLKPVLYTEKSCIVREGDPVDEMIFVMRGNLLTMTTNGGRTGFLNSDVLNAGDFCGE  1495
             +CD+LKPVLYTE S  +REGDPV+EM+FVMRG L++ TTNGGRTGF N+  L A DFCGE
Sbjct  487   VCDKLKPVLYTENSYAIREGDPVEEMLFVMRGKLMSATTNGGRTGFFNAVYLKASDFCGE  546

Query  1496  ELLTWALDPNSSSSLPISTRTVQALTDVEAFALTADFLKFFASQYRRLHSKQLQHKFRFY  1675
             +LLTWALDP SSS  PISTRTVQALT+VEAFAL AD LK  ASQ+RRLHSKQLQH FRFY
Sbjct  547   DLLTWALDPQSSSHFPISTRTVQALTEVEAFALAADDLKLVASQFRRLHSKQLQHTFRFY  606

Query  1676  SHQWKTWAACFIQAAWRRHCRNKLEKSLREEEDRLQDALILRMRREEGETTPSLGATIYA  1855
             S QW+TW A FIQAAWRRHCR KL +SL  EEDR ++A+  R R  +  ++ SL AT+YA
Sbjct  607   SVQWRTWGASFIQAAWRRHCRRKLARSLTAEEDRFRNAIAQRERERDTASSSSLVATLYA  666

Query  1856  SRFAANVLRTVRRNHplsvpklsprlpplllqkpAEPDFSA  1978
             SRFA+N LR +R N+            PLL  KP+EPDFSA
Sbjct  667   SRFASNALRNLRTNN----------NLPLLPPKPSEPDFSA  697



>ref|XP_009119850.1| PREDICTED: cyclic nucleotide-gated ion channel 1-like isoform 
X1 [Brassica rapa]
Length=809

 Score =   816 bits (2109),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 414/614 (67%), Positives = 500/614 (81%), Gaps = 13/614 (2%)
 Frame = +2

Query  62    DPQGPFLQRWNRIFVIACILAATVDPLFFYIPVVDDQNKCLGLDRTLEITACILRSVFDF  241
             DPQG FLQ+WN+IFV+ACI+A +VDPLFFY+PV+D  N CL +D+ ++ TA +LRSV D 
Sbjct  164   DPQGTFLQKWNKIFVLACIIAVSVDPLFFYVPVLDKANNCLDVDKKMQTTASVLRSVTDI  223

Query  242   FYIFHIILQFRTGFVPPSSRVFGRGDLIVDPSAIAKRYFFSYFFIDILAVLPLPQVVLFM  421
             FY  H++ QFRTGF+ PSSRVFGRG L+ D   IAKRY  S+F IDILAVLPLPQ+V+ +
Sbjct  224   FYAIHMVFQFRTGFIAPSSRVFGRGVLVEDRRKIAKRYLSSHFIIDILAVLPLPQMVISI  283

Query  422   MIPRADRPFIMVAKDILKVVILVQSVPRLLRIYPLYKEVTRTSGFFTETAWAGAAFNLFL  601
             +IPR   P  +  K++LK ++  Q +PR +RIYPLYK+VTRTSG  TETAWAGAAFNLFL
Sbjct  284   IIPRMREPKTLHTKNMLKFIVFFQYIPRFMRIYPLYKQVTRTSGILTETAWAGAAFNLFL  343

Query  602   YMIASYVAGAIWYITAIERQDKCWRRACEKHG--SCDIDFLYCTKLGRRGGDFSSSFLNT  775
             YM+AS+V GA WY+ +IER+  CW++A  + G   CD+  LYC     R    +++FLN 
Sbjct  344   YMLASHVFGAFWYLFSIERKTVCWKQAWNRAGRSKCDMRSLYCA----REHYGNNTFLNG  399

Query  776   SCALLEPENLKADDFDFGIFLDALKSNVVEKRYFWSKLFYCFWWGLRNLSSLGQNLKTSN  955
             SC +L+P    A  F+FGIFL AL+S VVE   F  K FYCFWWGL+NLSSLGQNLKTS 
Sbjct  400   SCPVLKPN---ATCFEFGIFLGALESGVVESHDFPQKFFYCFWWGLQNLSSLGQNLKTST  456

Query  956   FVGEilfailisiiglilfslligNMQKYLQSITVRVEEMRVKRMDAEQWMSHRMLPDNL  1135
             ++ E  FA+ ISI GL+LFS LIGNMQ YLQS T R+EEMRVKR DAEQWMSHR+LPDNL
Sbjct  457   YIWENCFAVFISISGLVLFSFLIGNMQTYLQSTTTRLEEMRVKRRDAEQWMSHRLLPDNL  516

Query  1136  RERIRRYEQYRWQETRGVDEESLISNLPKDLRRDINRHLCWSLLKRVHMFKTMDEQLLDA  1315
             R+RIRRYEQY+WQETRGV+EE+L+SNLPKDLRRDI RHLC +L+ RV MF+ MDEQLLDA
Sbjct  517   RKRIRRYEQYKWQETRGVNEENLLSNLPKDLRRDIKRHLCLALVMRVPMFEQMDEQLLDA  576

Query  1316  ICDRLKPVLYTEKSCIVREGDPVDEMIFVMRGNLLTMTTNGGRTGFLNSDVLNAGDFCGE  1495
             +CDRL+PVLYTE+S IVREGDPVDEM+F+MRG LLTMTTNGGRTGF NS+ L AGDFCGE
Sbjct  577   LCDRLQPVLYTEESYIVREGDPVDEMLFIMRGKLLTMTTNGGRTGFFNSEHLGAGDFCGE  636

Query  1496  ELLTWALDPNSSSSLPISTRTVQALTDVEAFALTADFLKFFASQYRRLHSKQLQHKFRFY  1675
             ELLTWALDP++S++LPISTRTVQAL +VEAFAL AD LKF ASQ+RRLHSKQL+H FRFY
Sbjct  637   ELLTWALDPHTSTNLPISTRTVQALVEVEAFALKADNLKFVASQFRRLHSKQLRHTFRFY  696

Query  1676  SHQWKTWAACFIQAAWRRHCRNKLEKSLREEEDRLQDALILRMRREEGETTPSLGATIYA  1855
             S QW+TWAACFIQAAWRRH + +LE+SLREEE+RLQDAL     ++   ++PS GAT+YA
Sbjct  697   SQQWRTWAACFIQAAWRRHVKKRLEESLREEENRLQDALA----KQACGSSPSFGATMYA  752

Query  1856  SRFAANVLRTVRRN  1897
             SRFAAN+LRT+RR+
Sbjct  753   SRFAANILRTIRRS  766



>ref|XP_009404479.1| PREDICTED: cyclic nucleotide-gated ion channel 1-like [Musa acuminata 
subsp. malaccensis]
 ref|XP_009404480.1| PREDICTED: cyclic nucleotide-gated ion channel 1-like [Musa acuminata 
subsp. malaccensis]
 ref|XP_009404481.1| PREDICTED: cyclic nucleotide-gated ion channel 1-like [Musa acuminata 
subsp. malaccensis]
 ref|XP_009404482.1| PREDICTED: cyclic nucleotide-gated ion channel 1-like [Musa acuminata 
subsp. malaccensis]
 ref|XP_009404483.1| PREDICTED: cyclic nucleotide-gated ion channel 1-like [Musa acuminata 
subsp. malaccensis]
 ref|XP_009404484.1| PREDICTED: cyclic nucleotide-gated ion channel 1-like [Musa acuminata 
subsp. malaccensis]
Length=692

 Score =   811 bits (2096),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 418/644 (65%), Positives = 501/644 (78%), Gaps = 20/644 (3%)
 Frame = +2

Query  47    KSKMHDPQGPFLQRWNRIFVIACILAATVDPLFFYIPVVDDQNKCLGLDRTLEITACILR  226
             K K+ DPQGPFLQRWN+IFVI+CI+A +VDPLFFYIPV+D  N CL LD+ LEI A +LR
Sbjct  68    KKKVLDPQGPFLQRWNKIFVISCIVAVSVDPLFFYIPVIDGDNNCLYLDKKLEIAASVLR  127

Query  227   SVFDFFYIFHIILQFRTGFVPPSSRVFGRGDLIVDPSAIAKRYFFSYFFIDILAVLPLPQ  406
                D FY+ HI+ QFRTGF+ PSSRVFGRG L+ D SAIAKRY  SYF IDILAV PLPQ
Sbjct  128   FFTDIFYLVHIVFQFRTGFIAPSSRVFGRGVLVKDLSAIAKRYLSSYFLIDILAVFPLPQ  187

Query  407   VVLFMMIPRADRPFIMVAKDILKVVILVQSVPRLLRIYPLYKEVTRTSGFFTETAWAGAA  586
             +++ ++IP+ +   ++ AK+ L   ++ Q VPR+LRI PLY EVTR++G   ETAW GAA
Sbjct  188   IMILLIIPKLEGSALLNAKNALMFAVIFQYVPRVLRIIPLYLEVTRSAGIIAETAWVGAA  247

Query  587   FNLFLYMIASYVAGAIWYITAIERQDKCWRRACEKHGSCDIDFLYCTKLGRRGGDFSSSF  766
             FNL LYM+AS++ GA WY  +IER+  CW +AC +H  C ID L C +   +    ++ F
Sbjct  248   FNLLLYMLASHILGAFWYFLSIEREGTCWGKACAQH-DCKIDSLICGQQNNQ----NNGF  302

Query  767   LNTSCALLEPENLKADDFDFGIFLDALKSNVVEKRYFWSKLFYCFWWGLRNLSSLGQNLK  946
             L   C +  P+N     FDFGI+L AL+ NVV    F  K FYCFWWGL+NLSSLGQNLK
Sbjct  303   LGGDCPI-SPKN--GTIFDFGIYLQALQ-NVVRSEKFLEKFFYCFWWGLQNLSSLGQNLK  358

Query  947   TSNFVGEilfailisiiglilfslligNMQKYLQSITVRVEEMRVKRMDAEQWMSHRMLP  1126
             TS ++ E +FA+ +SI GL+LF+LLIGNMQ YLQS TVR+EEMRVKR DAEQWMSHR LP
Sbjct  359   TSTYIWENIFAVCVSIFGLVLFALLIGNMQTYLQSTTVRIEEMRVKRRDAEQWMSHRSLP  418

Query  1127  DNLRERIRRYEQYRWQETRGVDEESLISNLPKDLRRDINRHLCWSLLKRVHMFKTMDEQL  1306
             ++L+ERIRRYEQYRWQETRGVDEE L+ NLPKDLRRDI  HLC SLLKRV MF+ MD+QL
Sbjct  419   ESLKERIRRYEQYRWQETRGVDEEHLLHNLPKDLRRDIKHHLCLSLLKRVPMFEKMDDQL  478

Query  1307  LDAICDRLKPVLYTEKSCIVREGDPVDEMIFVMRGNLLTMTTNGGRTGFLNSDVLNAGDF  1486
             +DA+ DRLKPVLYT+ SCIVREGDPV+EM+F+MRG L +MTTNGGRTGF NSD+L AGDF
Sbjct  479   IDAMSDRLKPVLYTKCSCIVREGDPVNEMLFIMRGKLESMTTNGGRTGFFNSDILKAGDF  538

Query  1487  CGEELLTWALDPNSSSSLPISTRTVQALTDVEAFALTADFLKFFASQYRRLHSKQLQHKF  1666
             CGEELLTWALDP SSSSLPISTRTV+ L++VEAFAL AD LKF A+Q+RRLHSKQLQH F
Sbjct  539   CGEELLTWALDPYSSSSLPISTRTVKTLSEVEAFALMADDLKFVATQFRRLHSKQLQHSF  598

Query  1667  RFYSHQWKTWAACFIQAAWRRHCRNKLEKSLREEEDRLQDALILRMRREEGETTPSLGAT  1846
             R++S QW+TWAACFIQAAWRR+ R KLE SL E+E RLQ A++       G ++PSLGA 
Sbjct  599   RYHSQQWRTWAACFIQAAWRRYSRKKLEDSLHEKEKRLQAAMV-----SGGASSPSLGAA  653

Query  1847  IYASRFAANVLRTVRRNHplsvpklsprlpplllqkpAEPDFSA  1978
             +YASRFAANVLR +RR+            P +LLQKPAEPDFSA
Sbjct  654   LYASRFAANVLRNLRRHK------SRKAPPLMLLQKPAEPDFSA  691



>ref|XP_011038085.1| PREDICTED: cyclic nucleotide-gated ion channel 1 [Populus euphratica]
Length=720

 Score =   810 bits (2093),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 401/623 (64%), Positives = 486/623 (78%), Gaps = 18/623 (3%)
 Frame = +2

Query  47    KSKMHDPQGPFLQRWNRIFVIACILAATVDPLFFYIPVVD--DQNKCLGLDRTLEITACI  220
             K K+ DPQGPFL +WN+ F++ C+LA  +DPLFFYIP V   ++ KCL +D  +E+ AC+
Sbjct  82    KRKILDPQGPFLLKWNKFFMLVCVLAVAIDPLFFYIPWVKSTEKGKCLDVDLKMEVAACV  141

Query  221   LRSVFDFFYIFHIILQFRTGFVPPSSRVFGRGDLIVDPSAIAKRYFFSYFFIDILAVLPL  400
             LR++ D  Y   ++ QFRTGF+ PSSRVFGRG+L+ DP AIAK+Y  SYF IDILA+LPL
Sbjct  142   LRTLIDILYTLRLVFQFRTGFIAPSSRVFGRGELVEDPRAIAKKYLTSYFIIDILAILPL  201

Query  401   PQVVLFMMIPRADRPFIMVAKDILKVVILVQSVPRLLRIYPLYKEVTRTSGFFTETAWAG  580
             PQVV+ +++PR D P  + AK++ + VI  Q +PRL+RIYPL+KE+ RTSG  TETAWAG
Sbjct  202   PQVVVLIILPRVDGPVSLAAKNLFEFVIFSQYIPRLVRIYPLFKEINRTSGILTETAWAG  261

Query  581   AAFNLFLYMIASYVAGAIWYITAIERQDKCWRRACEKHGSCDIDFLYCTKLGRRGGDFSS  760
             A FNLFLYM+AS++ GA W + +IERQD CW   C+    CD  + YC       GD  +
Sbjct  262   AVFNLFLYMLASHIIGAFWNLFSIERQDTCWYEVCKDQARCDTTYRYC-------GDHRT  314

Query  761   ---SFLNTSCALLEPENL-KADDFDFGIFLDALKSNVVEKRYFWSKLFYCFWWGLRNLSS  928
                +FL  SC  ++P+ +  +  F+FGI +DAL S VVE  YF  KLFYCFWWGLRNLSS
Sbjct  315   ENYTFLTESCPFIQPDQVHNSTVFNFGILIDALDSGVVESTYFPQKLFYCFWWGLRNLSS  374

Query  929   LGQNLKTSNFVGEilfailisiiglilfslligNMQKYLQSITVRVEEMRVKRMDAEQWM  1108
             LGQNLKTS ++GEILFAI ISI GL+LF+LLIGNMQKYL+S TVRVEEMRVKR D +QWM
Sbjct  375   LGQNLKTSTYIGEILFAIFISIAGLVLFALLIGNMQKYLESTTVRVEEMRVKRRDTDQWM  434

Query  1109  SHRMLPDNLRERIRRYEQYRWQETRGVDEESLISNLPKDLRRDINRHLCWSLLKRVHMFK  1288
             S RMLPDNLRER+RRYEQY+WQETRGV+E  LI NLPKDLRRDINRHLC  L+K+V MF+
Sbjct  435   SQRMLPDNLRERVRRYEQYKWQETRGVEERGLIHNLPKDLRRDINRHLCLDLIKKVPMFE  494

Query  1289  TMDEQLLDAICDRLKPVLYTEKSCIVREGDPVDEMIFVMRGNLLTMTTNGGRTGFLNSDV  1468
              MDE++LDA+CDRLK  LYT+ S IVREGDPVDEM+F+MRG+LL++TTNGGRTGF N+  
Sbjct  495   KMDEKILDAVCDRLKAALYTKDSYIVREGDPVDEMLFIMRGHLLSVTTNGGRTGFFNAVS  554

Query  1469  LNAGDFCGEELLTWALDPNSSSSLPISTRTVQALTDVEAFALTADFLKFFASQYRRLHSK  1648
             L AGDFCGE LLTWALDP SSS LPISTRTVQAL++VEAFAL AD LK  ASQ+R+LH K
Sbjct  555   LKAGDFCGEGLLTWALDPQSSSHLPISTRTVQALSEVEAFALEADDLKSVASQFRQLHHK  614

Query  1649  QLQHKFRFYSHQWKTWAACFIQAAWRRHCRNKLEKSLREEEDRLQDALILRMRREEGETT  1828
              +QH FRF+S QWKTWAACFIQAAWRRHCR K  KSLR+ E++LQD+L       E  T+
Sbjct  615   DIQHTFRFFSVQWKTWAACFIQAAWRRHCRRKQAKSLRQAEEKLQDSLA-----NEASTS  669

Query  1829  PSLGATIYASRFAANVLRTVRRN  1897
             PSLG  IYAS+FAAN LR +RRN
Sbjct  670   PSLGVAIYASQFAANALRNLRRN  692



>ref|XP_006287167.1| hypothetical protein CARUB_v10000339mg [Capsella rubella]
 gb|EOA20065.1| hypothetical protein CARUB_v10000339mg [Capsella rubella]
Length=710

 Score =   809 bits (2089),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 407/643 (63%), Positives = 492/643 (77%), Gaps = 19/643 (3%)
 Frame = +2

Query  62    DPQGPFLQRWNRIFVIACILAATVDPLFFYIPVVDDQNKCLGLDRTLEITACILRSVFDF  241
             +PQG FLQ WN+IF+ A ++A  +DPL+FYIP+VD +  CL L   LEI A +LR+  D 
Sbjct  77    NPQGSFLQNWNKIFLFASVIALAIDPLYFYIPIVDGERHCLNLHHNLEIAASVLRTFIDA  136

Query  242   FYIFHIILQFRTGFVPPSSRVFGRGDLIVDPSAIAKRYFFSYFFIDILAVLPLPQVVLFM  421
             FYI HI+ QFRT ++ PSSRVFGRG+L+ DP AIA +Y  SYF ID+L++LPLPQ+V+  
Sbjct  137   FYIIHIVFQFRTAYISPSSRVFGRGELVDDPKAIAIKYLSSYFIIDVLSILPLPQLVVLA  196

Query  422   MIPRADRPFIMVAKDILKVVILVQSVPRLLRIYPLYKEVTRTSGFFTETAWAGAAFNLFL  601
             +IP  ++P  ++ KD L  VI  Q +PR++RIYPLY EVTRTSG  TETAWAGAA+NL L
Sbjct  197   VIPSINKPISLITKDYLVSVIFTQYIPRIIRIYPLYSEVTRTSGIVTETAWAGAAWNLSL  256

Query  602   YMIASYVAGAIWYITAIERQDKCWRRACEKHGS-CDIDFLYCTKLGRRGGDFSSSFLNTS  778
             YM+AS+V GA+WY+ ++ER+D+CWR ACEK    C   FLYC K         + FL TS
Sbjct  257   YMLASHVFGALWYLISVEREDRCWREACEKRPEVCTFRFLYCDK----NSTVRNDFLTTS  312

Query  779   CALLEPENL-KADDFDFGIFLDALKSNVVEKRYFWSKLFYCFWWGLRNLSSLGQNLKTSN  955
             C    P+++  +  F+FGIF DALKS +VE   FW K FYCFWWGLRNLS+LGQNL TS 
Sbjct  313   CPFTNPDDITNSTVFNFGIFTDALKSGIVESDDFWKKFFYCFWWGLRNLSALGQNLNTSK  372

Query  956   FVGEilfailisiiglilfslligNMQKYLQSITVRVEEMRVKRMDAEQWMSHRMLPDNL  1135
             FVGEI+FA+ I I GL+LF+LLIGNMQKYL+S TVR EEMRV++ DAEQWMSHRMLPD+L
Sbjct  373   FVGEIIFAVSICISGLVLFALLIGNMQKYLESTTVREEEMRVRKRDAEQWMSHRMLPDDL  432

Query  1136  RERIRRYEQYRWQETRGVDEESLISNLPKDLRRDINRHLCWSLLKRVHMFKTMDEQLLDA  1315
             R+RIRRYEQY+WQETRGV+EE+L+ NLPKDLRRDI RH C  LLK+V +F+ MDEQLLDA
Sbjct  433   RKRIRRYEQYKWQETRGVEEENLLRNLPKDLRRDIKRHFCLDLLKKVPLFEIMDEQLLDA  492

Query  1316  ICDRLKPVLYTEKSCIVREGDPVDEMIFVMRGNLLTMTTNGGRTGFLNSDVLNAGDFCGE  1495
             +CD+LKPVLYTE S  +REGDPV+EM+FVMRG L++ TTNGGRTGF N+  L A DFCGE
Sbjct  493   VCDKLKPVLYTENSYAIREGDPVEEMLFVMRGKLMSATTNGGRTGFFNAVYLKASDFCGE  552

Query  1496  ELLTWALDPNSSSSLPISTRTVQALTDVEAFALTADFLKFFASQYRRLHSKQLQHKFRFY  1675
             +LLTWALDP SSS  PISTRTVQALT+VEAFAL AD LK  ASQ+RRLHSKQLQH FRFY
Sbjct  553   DLLTWALDPQSSSHFPISTRTVQALTEVEAFALAADDLKLVASQFRRLHSKQLQHTFRFY  612

Query  1676  SHQWKTWAACFIQAAWRRHCRNKLEKSLREEEDRLQDALILRMRREE--GETTPSLGATI  1849
             S QWKTW A FIQAAWRRHCR KL +SL  EEDR Q+A+  R R  E    ++ SL AT+
Sbjct  613   SVQWKTWGASFIQAAWRRHCRRKLARSLTAEEDRFQNAIAQRKRERERDAASSSSLVATL  672

Query  1850  YASRFAANVLRTVRRNHplsvpklsprlpplllqkpAEPDFSA  1978
             YASRFA+N LR +R N+            P+L  KP+EPDFSA
Sbjct  673   YASRFASNALRNLRTNN-----------LPMLPPKPSEPDFSA  704



>ref|XP_006396313.1| hypothetical protein EUTSA_v10028473mg [Eutrema salsugineum]
 gb|ESQ37766.1| hypothetical protein EUTSA_v10028473mg [Eutrema salsugineum]
Length=710

 Score =   809 bits (2089),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 392/615 (64%), Positives = 486/615 (79%), Gaps = 7/615 (1%)
 Frame = +2

Query  62    DPQGPFLQRWNRIFVIACILAATVDPLFFYIPVVDDQNKCLGLDRTLEITACILRSVFDF  241
             +PQG FLQ WN+IF+ A ++A  +DPLFFYIP+VD +  CL L   LEI A +LR+  D 
Sbjct  80    NPQGSFLQNWNKIFLFASVIALAIDPLFFYIPIVDGEKHCLNLHSELEIAASVLRTFIDA  139

Query  242   FYIFHIILQFRTGFVPPSSRVFGRGDLIVDPSAIAKRYFFSYFFIDILAVLPLPQVVLFM  421
             FYI HI+ +FRT +V PSSR+FGRG+L+ DP AIAK+Y  SYF +D+L++LPLPQ+V+  
Sbjct  140   FYIIHIVFKFRTAYVSPSSRIFGRGELVEDPKAIAKKYLSSYFIVDVLSILPLPQLVVLA  199

Query  422   MIPRADRPFIMVAKDILKVVILVQSVPRLLRIYPLYKEVTRTSGFFTETAWAGAAFNLFL  601
             +IP  ++P  ++ KD L  VI  Q +PR++RIYPLY EVTRTSG  TETAWAGAA+NL L
Sbjct  200   VIPNVNKPASLLTKDYLITVIFTQYIPRIIRIYPLYSEVTRTSGIVTETAWAGAAWNLSL  259

Query  602   YMIASYVAGAIWYITAIERQDKCWRRACEK-HGSCDIDFLYCTKLGRRGGDFSSSFLNTS  778
             YM+AS+V GA+WY+ ++ER+D+CWR AC K  G CD  FLYC +      +  + FL TS
Sbjct  260   YMLASHVFGALWYLISVEREDRCWREACAKRQGGCDFTFLYCDE----NSNVINDFLTTS  315

Query  779   CALLEPENL-KADDFDFGIFLDALKSNVVEKRYFWSKLFYCFWWGLRNLSSLGQNLKTSN  955
             C  + P+++  +  F+FGIF DALKS +VE   FW K FYCFWWGLRNLS+LGQNL TS 
Sbjct  316   CPFINPDDITNSTVFNFGIFTDALKSGIVESDDFWKKFFYCFWWGLRNLSALGQNLNTSK  375

Query  956   FVGEilfailisiiglilfslligNMQKYLQSITVRVEEMRVKRMDAEQWMSHRMLPDNL  1135
             FVGEI+FA+ I I GL+LF+LLIGNMQKYL+S TVR EEMRV++ DAEQWM+HRMLP++L
Sbjct  376   FVGEIIFAVSICISGLVLFALLIGNMQKYLESTTVREEEMRVRKRDAEQWMAHRMLPEDL  435

Query  1136  RERIRRYEQYRWQETRGVDEESLISNLPKDLRRDINRHLCWSLLKRVHMFKTMDEQLLDA  1315
             R+RIRRYEQY+WQETRGV+EE+L+ NLPKDLRRDI RH C  LLK+V +F+ MDEQLLDA
Sbjct  436   RKRIRRYEQYKWQETRGVEEENLLRNLPKDLRRDIKRHFCLDLLKKVPLFEIMDEQLLDA  495

Query  1316  ICDRLKPVLYTEKSCIVREGDPVDEMIFVMRGNLLTMTTNGGRTGFLNSDVLNAGDFCGE  1495
             +CD+LKPVLYTE S  +REGDPV+EM+FVMRG L++ TTNGGRTGF N+  L A DFCGE
Sbjct  496   VCDKLKPVLYTENSYAIREGDPVEEMLFVMRGKLMSATTNGGRTGFFNAVYLKASDFCGE  555

Query  1496  ELLTWALDPNSSSSLPISTRTVQALTDVEAFALTADFLKFFASQYRRLHSKQLQHKFRFY  1675
             +LLTWALDP SSS  PISTRTVQALT+VEAFAL A+ LK  ASQ+RRLHSKQLQH FRFY
Sbjct  556   DLLTWALDPQSSSHFPISTRTVQALTEVEAFALAAEDLKLVASQFRRLHSKQLQHTFRFY  615

Query  1676  SHQWKTWAACFIQAAWRRHCRNKLEKSLREEEDRLQDALILRMRREEGETTPSLGATIYA  1855
             S QW+TW A FIQAAWRRHCR KL +SL +EEDR ++A I +  R+E  ++ SL AT+YA
Sbjct  616   SVQWRTWGASFIQAAWRRHCRRKLARSLTDEEDRFRNA-IAKRERDEASSSSSLVATLYA  674

Query  1856  SRFAANVLRTVRRNH  1900
             SRFA+N LR +R N+
Sbjct  675   SRFASNALRNLRHNN  689



>ref|XP_010095775.1| Cyclic nucleotide-gated ion channel 1 [Morus notabilis]
 gb|EXB62195.1| Cyclic nucleotide-gated ion channel 1 [Morus notabilis]
Length=756

 Score =   811 bits (2094),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 430/656 (66%), Positives = 511/656 (78%), Gaps = 26/656 (4%)
 Frame = +2

Query  47    KSKMHDPQGPFLQRWNRIFVIACILAATVDPLFFYIPVVDDQNKCLGLDRTLEITACILR  226
             ++ + DPQG  LQ WN+IF+++CI+A +VDPLFFYIPV+DD+ KCL LD +LEI AC+LR
Sbjct  112   RNNILDPQGSLLQLWNKIFILSCIIAVSVDPLFFYIPVLDDKKKCLSLDTSLEIIACVLR  171

Query  227   SVFDFFYIFHIILQFRTGFVPPSSRVFGRGDLIVDPSAIAKRYFFSYFFIDILAVLPLPQ  406
             +  D FYI  II QFRTGF+ PSSRVFGRG+LI DP+AIA+RY  SYF +D+L++LP PQ
Sbjct  172   TFVDIFYILRIIFQFRTGFIAPSSRVFGRGELIDDPAAIARRYLSSYFIVDVLSILPFPQ  231

Query  407   VVLFMMIPRADRPFIM-VAKDILKVVILVQSVPRLLRIYPLYKEVTRTSGFFTETAWAGA  583
             V + +    + R  +  V KD L++V++ Q VPR +RI PL+KEVTRTSG  TETAWAGA
Sbjct  232   VTVLLATNHSPRGAVAKVTKDWLRIVVISQYVPRFVRIRPLFKEVTRTSGILTETAWAGA  291

Query  584   AFNLFLYMIASYVAGAIWYITAIERQDKCWRRA-CEKHGSCDIDFLYCTKLGRRGG----  748
             AFNLFLYM+AS++ GA WY+ ++ER D CWRR   E  GS +    YC    R+G     
Sbjct  292   AFNLFLYMLASHMVGAFWYLFSLERVDTCWRRHFNESWGSYE---YYC----RKGHLQLQ  344

Query  749   -----DFSSSFLNTSCALLEPENLK-ADDFDFGIFLDALKSNVVEKRYFWSKLFYCFWWG  910
                  D   S LN SC  ++P+++  +  F+FGIF+DALKS VV    F SK FYCFWWG
Sbjct  345   SNVVIDVPKS-LNDSCPYIDPDDISDSKAFNFGIFIDALKSGVVASEDFRSKFFYCFWWG  403

Query  911   LRNLSSLGQNLKTSNFVGEilfailisiiglilfslligNMQKYLQSITVRVEEMRVKRM  1090
             LRNLSSLGQNLKTS FV E++FA+ ISI GL+LFSLLIGNMQKYLQS TVRVEEMRVKR 
Sbjct  404   LRNLSSLGQNLKTSTFVAEVVFAVGISIFGLVLFSLLIGNMQKYLQSTTVRVEEMRVKRR  463

Query  1091  DAEQWMSHRMLPDNLRERIRRYEQYRWQETRGVDEESLISNLPKDLRRDINRHLCWSLLK  1270
             DAEQWMSHRMLP+NLRERIRRYEQY+WQETRGV+E++L+ NLPKDLRRDI RHLC  LLK
Sbjct  464   DAEQWMSHRMLPENLRERIRRYEQYKWQETRGVEEDNLVQNLPKDLRRDIKRHLCLKLLK  523

Query  1271  RVHMFKTMDEQLLDAICDRLKPVLYTEKSCIVREGDPVDEMIFVMRGNLLTMTTNGGRTG  1450
             RV MF+ MDEQLLDA+C+ LKP LYTEKS IVREGDPVDEM+F+MRG L TMTTNGGRTG
Sbjct  524   RVPMFEKMDEQLLDAMCNHLKPALYTEKSSIVREGDPVDEMLFIMRGTLATMTTNGGRTG  583

Query  1451  FLNSDVLNAGDFCGEELLTWALDPNSSSSLPISTRTVQALTDVEAFALTADFLKFFASQY  1630
             F NS  L AG+FCGEELLTWALDPNS+++LP ST TV+A T+VEAFAL AD LK  ASQ+
Sbjct  584   FFNSVDLKAGNFCGEELLTWALDPNSATNLPTSTWTVEAKTEVEAFALKADDLKSVASQF  643

Query  1631  RRLHSKQLQHKFRFYSHQWKTWAACFIQAAWRRHCRNKLEKSLREEEDRLQDALILRMRR  1810
             RRLH+KQLQH FRFYS QWKTWAACFIQ AWRRHC+ KL+K+L + EDRLQDAL      
Sbjct  644   RRLHNKQLQHTFRFYSLQWKTWAACFIQTAWRRHCKRKLDKTLCDAEDRLQDALA-----  698

Query  1811  EEGETTPSLGATIYASRFAANVLRTVRRNHplsvpklsprlpplllqkpAEPDFSA  1978
              E   TP+LGATIYASRFA+N LR +R+       +   RLPPLL QKPAEPDF+A
Sbjct  699   NEAGNTPTLGATIYASRFASNALRALRQKG-ARSSRPPQRLPPLLPQKPAEPDFTA  753



>gb|KEH24625.1| cyclic nucleotide-gated ion channel-like protein [Medicago truncatula]
Length=664

 Score =   806 bits (2081),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 423/650 (65%), Positives = 505/650 (78%), Gaps = 14/650 (2%)
 Frame = +2

Query  47    KSKMHDPQGPFLQRWNRIFVIACILAATVDPLFFYIPVVDDQNKCLGLDRTLEITACILR  226
             K K+ DPQGP LQ+WN+IFVI C+LA +VDP FFYIPV+  + KCL LD TL+ T  +LR
Sbjct  26    KRKILDPQGPMLQKWNKIFVITCVLAISVDPFFFYIPVIVGKQKCLDLDGTLQTTISVLR  85

Query  227   SVFDFFYIFHIILQFRTGFVPPSSRVFGRGDLIVDPSAIAKRYFFSYFFIDILAVLPLPQ  406
             + FD FYI  II QFRTGF+ PSSRVFGRG+L+ DP AI KRY  S+F +DIL+++PLPQ
Sbjct  86    TFFDLFYILRIIFQFRTGFIAPSSRVFGRGELVDDPVAIMKRYLSSHFIVDILSIIPLPQ  145

Query  407   VVLFMMIPRADRPFIMVAKDILKVVILVQSVPRLLRIYPLYKEVTRTSGFFTETAWAGAA  586
             +++  +IP        +AKD+LK  +L+Q VPRLLRI PL+KEVTRTSG  TETAWAGA 
Sbjct  146   IIVLAIIPNLKSSGPFLAKDLLKYTVLIQYVPRLLRIRPLFKEVTRTSGILTETAWAGAV  205

Query  587   FNLFLYMIASYVAGAIWYITAIERQDKCWRRACEKHGSCDIDFLYCTKLGRRGGDFSSSF  766
             +NLFLYM+AS+V GA WY+ ++E Q +CWRR           FL C   G R     S  
Sbjct  206   YNLFLYMLASHVVGANWYLLSVESQVRCWRRVMNNASIFHDSFLGC---GPRNATVLS-L  261

Query  767   LNTSCALLEPENLK-ADDFDFGIFLDALKSNVVEKRY-FWSKLFYCFWWGLRNLSSLGQN  940
             LN +C L++P+ +     F+FGIF DAL+S VV+    F  K FYCFWWGLRNLSSLGQN
Sbjct  262   LNGACTLVDPDEINNTTTFNFGIFYDALQSLVVDSNTDFPQKFFYCFWWGLRNLSSLGQN  321

Query  941   LKTSNFVGEilfailisiiglilfslligNMQKYLQSITVRVEEMRVKRMDAEQWMSHRM  1120
             LKT+ +V EI FAI I+I GL+LFSLLIGNMQKYL+S TVR EEMRVKR DAE+WMSHRM
Sbjct  322   LKTTTYVTEIAFAIFIAIFGLVLFSLLIGNMQKYLESTTVREEEMRVKRRDAERWMSHRM  381

Query  1121  LPDNLRERIRRYEQYRWQETRGVDEESLISNLPKDLRRDINRHLCWSLLKRVHMFKTMDE  1300
             LPDNL++RIRRYEQY+WQE RGV+EE+LI NLPKDLRRDI RHLC +L+K+V MF+ MD 
Sbjct  382   LPDNLKQRIRRYEQYKWQENRGVEEETLIHNLPKDLRRDIKRHLCLALVKKVPMFEKMDA  441

Query  1301  QLLDAICDRLKPVLYTEKSCIVREGDPVDEMIFVMRGNLLTMTTNGGRTGFLNSDVLNAG  1480
             QLLDA+CDRLKPVLYTEKSCIVRE DPVDEM+F+MRG + TMTTNGGRTGF NS  L  G
Sbjct  442   QLLDAMCDRLKPVLYTEKSCIVREEDPVDEMLFIMRGKVATMTTNGGRTGFFNSLFLMPG  501

Query  1481  DFCGEELLTWALDPNSSSSLPISTRTVQALTDVEAFALTADFLKFFASQYRRL-HSKQLQ  1657
             DFCGEELLTWALDPNSSS+LP STRTV+ +++VEAFAL AD LKF ASQ+RRL +SKQLQ
Sbjct  502   DFCGEELLTWALDPNSSSNLPTSTRTVETISEVEAFALKADDLKFVASQFRRLINSKQLQ  561

Query  1658  HKFRFYSHQWKTWAACFIQAAWRRHCRNKLEKSLREEEDRLQDALILRMRREEGETTPSL  1837
             H FR YS QWKTW ACFIQAAWRR+C+ K+E++LRE ED+LQDAL      EEG T  SL
Sbjct  562   HTFRSYSPQWKTWGACFIQAAWRRYCKKKIERTLREAEDKLQDALA----NEEGSTI-SL  616

Query  1838  GATIYASRFAANVLRTVRRNHplsvpklsprlpplllqkpAEPDFSAPEN  1987
             GATIYASRFAANVL+ +R N+     ++  RL PLL  KPAEPDF+A ++
Sbjct  617   GATIYASRFAANVLKNLRENN--RQNRMPQRLLPLLPPKPAEPDFTAQKH  664



>ref|XP_010474728.1| PREDICTED: probable cyclic nucleotide-gated ion channel 10 [Camelina 
sativa]
Length=724

 Score =   808 bits (2087),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 398/618 (64%), Positives = 482/618 (78%), Gaps = 5/618 (1%)
 Frame = +2

Query  47    KSKMHDPQGPFLQRWNRIFVIACILAATVDPLFFYIPVVDDQNKCLGLDRTLEITACILR  226
             K  + +PQ  FLQ WN+IF+ AC+LA  +DPLFFYIP+VD    CL +D  LEI A  LR
Sbjct  81    KKNIINPQDSFLQNWNKIFLFACVLALAIDPLFFYIPIVDGTRHCLTMDSKLEIAASFLR  140

Query  227   SVFDFFYIFHIILQFRTGFVPPSSRVFGRGDLIVDPSAIAKRYFFSYFFIDILAVLPLPQ  406
             ++ D FYI HI+ QFRT ++ PSSRVFGRG+L+ D  AIA +Y  SYF ID+L+++PLPQ
Sbjct  141   TLIDAFYIIHIVFQFRTAYIAPSSRVFGRGELVDDAKAIALKYLSSYFIIDVLSIIPLPQ  200

Query  407   VVLFMMIPRADRPFIMVAKDILKVVILVQSVPRLLRIYPLYKEVTRTSGFFTETAWAGAA  586
             +V+  +IP    P  ++ KD L  VI+VQ VPR+LR+YPLY EVTRTSG  TETAWAGAA
Sbjct  201   IVVLAVIPSVKEPDSLLTKDYLMSVIIVQYVPRILRLYPLYTEVTRTSGIVTETAWAGAA  260

Query  587   FNLFLYMIASYVAGAIWYITAIERQDKCWRRACEKHGSCDIDFLYCTKLGRRGGDFSSSF  766
             +NL LYM+AS+V GA+WY+ ++ER+D+CW+ ACEK   C +  LYC   G  G D+    
Sbjct  261   WNLSLYMLASHVFGALWYLISVEREDRCWQEACEKKNGCSLSSLYCHGNGNAGNDY----  316

Query  767   LNTSCALLEPENL-KADDFDFGIFLDALKSNVVEKRYFWSKLFYCFWWGLRNLSSLGQNL  943
             L TSC  L+P ++  +  F+FGIF DALKS VVE   FW K FYCFWWGLRNLS+LGQNL
Sbjct  317   LTTSCPFLDPGDITNSTIFNFGIFTDALKSGVVESHDFWEKFFYCFWWGLRNLSALGQNL  376

Query  944   KTSNFVGEilfailisiiglilfslligNMQKYLQSITVRVEEMRVKRMDAEQWMSHRML  1123
             +TS FVGEI+FAI I I GL+LF+LLIGNMQKYL+S TVR EEMRV++ DAEQWMSHRML
Sbjct  377   QTSKFVGEIIFAISICISGLVLFALLIGNMQKYLESTTVREEEMRVRKRDAEQWMSHRML  436

Query  1124  PDNLRERIRRYEQYRWQETRGVDEESLISNLPKDLRRDINRHLCWSLLKRVHMFKTMDEQ  1303
             P++LR+RIRRYEQYRWQETRGV+EE+L+ NLPKDLRRDI RHLC  LLK+V +F+ MDEQ
Sbjct  437   PEDLRKRIRRYEQYRWQETRGVEEENLLRNLPKDLRRDIKRHLCLDLLKKVPLFEIMDEQ  496

Query  1304  LLDAICDRLKPVLYTEKSCIVREGDPVDEMIFVMRGNLLTMTTNGGRTGFLNSDVLNAGD  1483
             LLDA+CDRLKPVLYTE S ++REGDPV EM+FVMRG L++ TTNGGRTG  NS  L A D
Sbjct  497   LLDAVCDRLKPVLYTENSYVIREGDPVGEMMFVMRGRLVSATTNGGRTGVFNSVDLKASD  556

Query  1484  FCGEELLTWALDPNSSSSLPISTRTVQALTDVEAFALTADFLKFFASQYRRLHSKQLQHK  1663
             FCGE+LL WALDP SSS  PISTRTVQALT+VEAFAL A+ LK  ASQ+RRLHSKQLQH 
Sbjct  557   FCGEDLLPWALDPQSSSHFPISTRTVQALTEVEAFALMAEDLKSVASQFRRLHSKQLQHT  616

Query  1664  FRFYSHQWKTWAACFIQAAWRRHCRNKLEKSLREEEDRLQDALILRMRREEGETTPSLGA  1843
             FRFYS QW+TW+  FIQAAWRR+CR KL KSLR+EE+RL+DAL          ++ S+GA
Sbjct  617   FRFYSVQWRTWSVSFIQAAWRRYCRKKLAKSLRDEEERLRDALAREGDGTTASSSLSIGA  676

Query  1844  TIYASRFAANVLRTVRRN  1897
              +YASRFA+N LR +R N
Sbjct  677   ALYASRFASNALRNLRHN  694



>pir||T10541 cyclic nucleotide gated channel homolog F3I3.30 - Arabidopsis 
thaliana
Length=698

 Score =   807 bits (2084),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 396/615 (64%), Positives = 481/615 (78%), Gaps = 8/615 (1%)
 Frame = +2

Query  62    DPQGPFLQRWNRIFVIACILAATVDPLFFYIPVVDDQNKCLGLDRTLEITACILRSVFDF  241
             +PQG FLQ WN+IF+ A ++A  +DPLFFYIP+VD +  CL L R LEI A +LR+  D 
Sbjct  72    NPQGSFLQNWNKIFLFASVIALAIDPLFFYIPIVDGERHCLNLHRNLEIAASVLRTFIDA  131

Query  242   FYIFHIILQFRTGFVPPSSRVFGRGDLIVDPSAIAKRYFFSYFFIDILAVLPLPQVVLFM  421
             FYI HI+ QFRT ++ PSSRVFGRG+L+ DP AIA +Y  SYF ID+L++LPLPQ+V+  
Sbjct  132   FYIIHIVFQFRTAYISPSSRVFGRGELVDDPKAIAIKYLSSYFIIDLLSILPLPQLVVLA  191

Query  422   MIPRADRPFIMVAKDILKVVILVQSVPRLLRIYPLYKEVTRTSGFFTETAWAGAAFNLFL  601
             +IP  ++P  ++ KD L  VI  Q +PR+LRIYPLY EVTRTSG  TETAWAGAA+NL L
Sbjct  192   VIPNVNKPVSLITKDYLITVIFTQYIPRILRIYPLYTEVTRTSGIVTETAWAGAAWNLSL  251

Query  602   YMIASYVAGAIWYITAIERQDKCWRRACEKHGS-CDIDFLYCTKLGRRGGDFSSSFLNTS  778
             YM+AS+V GA+WY+ ++ER+D+CWR ACEK    C+  FLYC           + FL TS
Sbjct  252   YMLASHVFGALWYLISVEREDRCWREACEKIPEVCNFRFLYCDG----NSSVRNDFLTTS  307

Query  779   CALLEPENL-KADDFDFGIFLDALKSNVVEKRYFWSKLFYCFWWGLRNLSSLGQNLKTSN  955
             C  + P+++  +  F+FGIF DALKS +VE   FW K FYCFWWGLRNLS+LGQNL TS 
Sbjct  308   CPFINPDDITNSTVFNFGIFTDALKSGIVESDDFWKKFFYCFWWGLRNLSALGQNLNTSK  367

Query  956   FVGEilfailisiiglilfslligNMQKYLQSITVRVEEMRVKRMDAEQWMSHRMLPDNL  1135
             FVGEI+FA+ I I GL+LF+LLIGNMQKYL+S TVR EEMRV++ DAEQWMSHRMLPD+L
Sbjct  368   FVGEIIFAVSICISGLVLFALLIGNMQKYLESTTVREEEMRVRKRDAEQWMSHRMLPDDL  427

Query  1136  RERIRRYEQYRWQETRGVDEESLISNLPKDLRRDINRHLCWSLLKRVHMFKTMDEQLLDA  1315
             R+RIRRYEQY+WQETRGV+EE+L+ NLPKDLRRDI RH C  LLK+V +F+ MDEQLLDA
Sbjct  428   RKRIRRYEQYKWQETRGVEEENLLRNLPKDLRRDIKRHFCLDLLKKVPLFEIMDEQLLDA  487

Query  1316  ICDRLKPVLYTEKSCIVREGDPVDEMIFVMRGNLLTMTTNGGRTGFLNSDVLNAGDFCGE  1495
             +CD+LKPVLYTE S  +REGDPV+EM+FVMRG L++ TTNGGRTGF N+  L   DFCGE
Sbjct  488   VCDKLKPVLYTENSYAIREGDPVEEMLFVMRGKLMSATTNGGRTGFFNAVYLKPSDFCGE  547

Query  1496  ELLTWALDPNSSSSLPISTRTVQALTDVEAFALTADFLKFFASQYRRLHSKQLQHKFRFY  1675
             +LLTWALDP SSS  PISTRTVQALT+VEAFAL AD LK  ASQ+RRLHSKQLQH FRFY
Sbjct  548   DLLTWALDPQSSSHFPISTRTVQALTEVEAFALAADDLKLVASQFRRLHSKQLQHTFRFY  607

Query  1676  SHQWKTWAACFIQAAWRRHCRNKLEKSLREEEDRLQDALILRMRREEGETTPSLGATIYA  1855
             S QW+TW A FIQAAWRRHCR KL +SL EEEDR ++A+  R R     ++ SL AT+YA
Sbjct  608   SVQWRTWGASFIQAAWRRHCRRKLARSLTEEEDRFRNAITKRER--NAASSSSLVATLYA  665

Query  1856  SRFAANVLRTVRRNH  1900
             SRFA+N LR +R N+
Sbjct  666   SRFASNALRNLRTNN  680



>ref|XP_007220953.1| hypothetical protein PRUPE_ppa026143mg [Prunus persica]
 gb|EMJ22152.1| hypothetical protein PRUPE_ppa026143mg [Prunus persica]
Length=739

 Score =   808 bits (2088),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 434/666 (65%), Positives = 506/666 (76%), Gaps = 26/666 (4%)
 Frame = +2

Query  47    KSKMHDPQGPFLQRWNRIFVIACILAATVDPLFFYIPVVDDQNKCLGLDRTLEITACILR  226
             + K+ DPQG FLQ WN+IFVI C++A +VDPLF Y  VVD +NKC+G+D+ L I  C+LR
Sbjct  82    RRKILDPQGSFLQNWNKIFVITCVIAVSVDPLFLYTAVVDGENKCVGVDKRLLIITCVLR  141

Query  227   SVFDFFYIFHIILQFRTGFVPPSSRVFGRGDLIVDPSAIAKRYFFSYFFIDILAVLPLPQ  406
             S  D F+I HII QFRTGF+ PSSRVFGRG+LI DP AIAKRY  SYF IDILAV PLPQ
Sbjct  142   SFIDVFHILHIIFQFRTGFIAPSSRVFGRGELIDDPVAIAKRYLSSYFIIDILAVFPLPQ  201

Query  407   VVLF-----------MMIPRADR------PFIMVAKDILKVVILVQSVPRLLRIYPLYKE  535
                F           M+I   +R       F  V K +L  VI+ Q  PRL RIYPLY+E
Sbjct  202   KTFFQSNTLLWHSCFMLIQNKNRLSSQPVSFSRVTKHLLLFVIVAQYGPRLWRIYPLYEE  261

Query  536   VTRTSGFFTETAWAGAAFNLFLYMIASYVAGAIWYITAIERQDKCWRRACEKHGSCDIDF  715
             VTRTSGF TETAWAGAA+NL LYM+AS+V GA WY+ ++ER+  CWR+ C     C    
Sbjct  262   VTRTSGFLTETAWAGAAYNLLLYMLASHVVGAFWYLFSVEREYSCWRKQCHGDDGCK-KV  320

Query  716   LYCTKLGRRGGDFSSSFLNTSCALLEPENLKADD-FDFGIFLDALKSNVVEKRYFWSKLF  892
             LYC    +    +       SC  ++P+ +K    F+FGIF DAL+S V+E R F  K  
Sbjct  321   LYCDPKYKADSSWIK-IKKASCPFIDPDQIKNSTVFNFGIFTDALQSGVLETRDFPKKFL  379

Query  893   YCFWWGLRNLSSLGQNLKTSNFVGEilfailisiiglilfslligNMQKYLQSITVRVEE  1072
             YCFWWGLRNLSSLGQNLKTS FV EI+FA+ ISI GL+LFSLLIGNMQK+LQS TVRVEE
Sbjct  380   YCFWWGLRNLSSLGQNLKTSTFVWEIVFAVFISIFGLVLFSLLIGNMQKFLQSTTVRVEE  439

Query  1073  MRVKRMDAEQWMSHRMLPDNLRERIRRYEQYRWQETRGVDEESLISNLPKDLRRDINRHL  1252
             MRVKR DAEQWMSHRMLP+NLRERIR Y+QY+WQETRGVDEE+L+ NLPKDLR+DI RHL
Sbjct  440   MRVKRRDAEQWMSHRMLPENLRERIRCYDQYKWQETRGVDEETLVRNLPKDLRKDIKRHL  499

Query  1253  CWSLLKRVHMFKTMDEQLLDAICDRLKPVLYTEKSCIVREGDPVDEMIFVMRGNLLTMTT  1432
             C +LL RV MF+ MDEQL+DA+CDRLKPVLYT+KS I REGDPVDEM+F+MRG L TMTT
Sbjct  500   CLALLNRVPMFEKMDEQLMDALCDRLKPVLYTDKSVITREGDPVDEMLFIMRGYLATMTT  559

Query  1433  NGGRTGFLNSDVLNAGDFCGEELLTWALDPNSSSSLPISTRTVQALTDVEAFALTADFLK  1612
             NGGRTGF N+  L AGDFCGEELLTWALDPNSS++LPISTRTV+A T+VEAFAL AD LK
Sbjct  560   NGGRTGFFNTADLKAGDFCGEELLTWALDPNSSTNLPISTRTVEAKTEVEAFALMADDLK  619

Query  1613  FFASQYRRLHSKQLQHKFRFYSHQWKTWAACFIQAAWRRHCRNKLEKSLREEEDRLQDAL  1792
             F ASQ+RRLHSKQLQH FRFYS QW+TW+ACFIQAAWRRHC+ K EKSLRE EDRLQDAL
Sbjct  620   FVASQFRRLHSKQLQHTFRFYSLQWRTWSACFIQAAWRRHCKRKHEKSLREAEDRLQDAL  679

Query  1793  ILRMRREEGETTPSLGATIYASRFAANVLRTVRRNHplsvpklsprlpplllqkpAEPDF  1972
                  RE G ++PSL AT+YAS+FAAN LR +R+       + SP L PLL QKPAEPDF
Sbjct  680   T----REAG-SSPSLLATVYASKFAANALRNLRQK-GKRDTRPSPTLLPLLPQKPAEPDF  733

Query  1973  SAPENN  1990
             +A  ++
Sbjct  734   TAERHD  739



>gb|KEH24626.1| cyclic nucleotide-gated ion channel-like protein [Medicago truncatula]
Length=730

 Score =   808 bits (2086),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 423/650 (65%), Positives = 505/650 (78%), Gaps = 14/650 (2%)
 Frame = +2

Query  47    KSKMHDPQGPFLQRWNRIFVIACILAATVDPLFFYIPVVDDQNKCLGLDRTLEITACILR  226
             K K+ DPQGP LQ+WN+IFVI C+LA +VDP FFYIPV+  + KCL LD TL+ T  +LR
Sbjct  92    KRKILDPQGPMLQKWNKIFVITCVLAISVDPFFFYIPVIVGKQKCLDLDGTLQTTISVLR  151

Query  227   SVFDFFYIFHIILQFRTGFVPPSSRVFGRGDLIVDPSAIAKRYFFSYFFIDILAVLPLPQ  406
             + FD FYI  II QFRTGF+ PSSRVFGRG+L+ DP AI KRY  S+F +DIL+++PLPQ
Sbjct  152   TFFDLFYILRIIFQFRTGFIAPSSRVFGRGELVDDPVAIMKRYLSSHFIVDILSIIPLPQ  211

Query  407   VVLFMMIPRADRPFIMVAKDILKVVILVQSVPRLLRIYPLYKEVTRTSGFFTETAWAGAA  586
             +++  +IP        +AKD+LK  +L+Q VPRLLRI PL+KEVTRTSG  TETAWAGA 
Sbjct  212   IIVLAIIPNLKSSGPFLAKDLLKYTVLIQYVPRLLRIRPLFKEVTRTSGILTETAWAGAV  271

Query  587   FNLFLYMIASYVAGAIWYITAIERQDKCWRRACEKHGSCDIDFLYCTKLGRRGGDFSSSF  766
             +NLFLYM+AS+V GA WY+ ++E Q +CWRR           FL C   G R     S  
Sbjct  272   YNLFLYMLASHVVGANWYLLSVESQVRCWRRVMNNASIFHDSFLGC---GPRNATVLS-L  327

Query  767   LNTSCALLEPENLK-ADDFDFGIFLDALKSNVVEKRY-FWSKLFYCFWWGLRNLSSLGQN  940
             LN +C L++P+ +     F+FGIF DAL+S VV+    F  K FYCFWWGLRNLSSLGQN
Sbjct  328   LNGACTLVDPDEINNTTTFNFGIFYDALQSLVVDSNTDFPQKFFYCFWWGLRNLSSLGQN  387

Query  941   LKTSNFVGEilfailisiiglilfslligNMQKYLQSITVRVEEMRVKRMDAEQWMSHRM  1120
             LKT+ +V EI FAI I+I GL+LFSLLIGNMQKYL+S TVR EEMRVKR DAE+WMSHRM
Sbjct  388   LKTTTYVTEIAFAIFIAIFGLVLFSLLIGNMQKYLESTTVREEEMRVKRRDAERWMSHRM  447

Query  1121  LPDNLRERIRRYEQYRWQETRGVDEESLISNLPKDLRRDINRHLCWSLLKRVHMFKTMDE  1300
             LPDNL++RIRRYEQY+WQE RGV+EE+LI NLPKDLRRDI RHLC +L+K+V MF+ MD 
Sbjct  448   LPDNLKQRIRRYEQYKWQENRGVEEETLIHNLPKDLRRDIKRHLCLALVKKVPMFEKMDA  507

Query  1301  QLLDAICDRLKPVLYTEKSCIVREGDPVDEMIFVMRGNLLTMTTNGGRTGFLNSDVLNAG  1480
             QLLDA+CDRLKPVLYTEKSCIVRE DPVDEM+F+MRG + TMTTNGGRTGF NS  L  G
Sbjct  508   QLLDAMCDRLKPVLYTEKSCIVREEDPVDEMLFIMRGKVATMTTNGGRTGFFNSLFLMPG  567

Query  1481  DFCGEELLTWALDPNSSSSLPISTRTVQALTDVEAFALTADFLKFFASQYRRL-HSKQLQ  1657
             DFCGEELLTWALDPNSSS+LP STRTV+ +++VEAFAL AD LKF ASQ+RRL +SKQLQ
Sbjct  568   DFCGEELLTWALDPNSSSNLPTSTRTVETISEVEAFALKADDLKFVASQFRRLINSKQLQ  627

Query  1658  HKFRFYSHQWKTWAACFIQAAWRRHCRNKLEKSLREEEDRLQDALILRMRREEGETTPSL  1837
             H FR YS QWKTW ACFIQAAWRR+C+ K+E++LRE ED+LQDAL      EEG T  SL
Sbjct  628   HTFRSYSPQWKTWGACFIQAAWRRYCKKKIERTLREAEDKLQDALA----NEEGSTI-SL  682

Query  1838  GATIYASRFAANVLRTVRRNHplsvpklsprlpplllqkpAEPDFSAPEN  1987
             GATIYASRFAANVL+ +R N+     ++  RL PLL  KPAEPDF+A ++
Sbjct  683   GATIYASRFAANVLKNLRENN--RQNRMPQRLLPLLPPKPAEPDFTAQKH  730



>ref|XP_002320197.2| hypothetical protein POPTR_0014s09350g [Populus trichocarpa]
 gb|EEE98512.2| hypothetical protein POPTR_0014s09350g [Populus trichocarpa]
Length=723

 Score =   807 bits (2085),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 403/622 (65%), Positives = 484/622 (78%), Gaps = 14/622 (2%)
 Frame = +2

Query  47    KSKMHDPQGPFLQRWNRIFVIACILAATVDPLFFYIPVVD--DQNKCLGLDRTLEITACI  220
             K K+ DPQGPFLQ+WN+ F++ C+LA  +DPLFFYIP +   +++KCL +DR ++  ACI
Sbjct  82    KRKILDPQGPFLQKWNKFFMLVCVLAVAIDPLFFYIPWIKSTEKDKCLDVDRKMQAAACI  141

Query  221   LRSVFDFFYIFHIILQFRTGFVPPSSRVFGRGDLIVDPSAIAKRYFFSYFFIDILAVLPL  400
             LR++ D  YI  I+ QFRTGF+ PSSRVFGRG+L+ DP AIAK+Y  SYF IDILA+LPL
Sbjct  142   LRTLIDILYILRIVFQFRTGFIAPSSRVFGRGELVEDPKAIAKKYVTSYFIIDILAILPL  201

Query  401   PQVVLFMMIPRADRPFIMVAKDILKVVILVQSVPRLLRIYPLYKEVTRTSGFFTETAWAG  580
             PQVV+ +++PR D P  + AK++ + VI  Q +PRL+RIYPL+KE+ RTSG  TETAWAG
Sbjct  202   PQVVVLIILPRVDGPVSLAAKNLFEFVIFSQYIPRLIRIYPLFKEINRTSGILTETAWAG  261

Query  581   AAFNLFLYMIASYVAGAIWYITAIERQDKCWRRACEKHGSCDIDFLYCTKLGRRGGDFSS  760
             A FNLFLYM+AS+V GA WY+ +IERQD CW   C+    CD  + YC     R  D++ 
Sbjct  262   AVFNLFLYMLASHVIGAFWYLFSIERQDTCWHEVCKDQARCDTMYRYCGD--HRKKDYT-  318

Query  761   SFLNTSCALLEPENL-KADDFDFGIFLDALKSNVVEKRYFWSKLFYCFWWGLRNLSSLGQ  937
              F   SC  ++P+ +  +  F+FGIF+DAL S VVE  YF  K FYCFWWGLRNLSSLGQ
Sbjct  319   -FPTESCPFIQPDQVHNSTVFNFGIFIDALDSGVVESTYFPRKFFYCFWWGLRNLSSLGQ  377

Query  938   NLKTSNFVGEilfailisiiglilfslligNMQKYLQSITVRVEEMRVKRMDAEQWMSHR  1117
             NLKTS F+GEILFAI ISI GL+LF+LLIGNMQKYL+S TVRVEEMRVKR D + WMS R
Sbjct  378   NLKTSTFIGEILFAIFISIAGLVLFALLIGNMQKYLESTTVRVEEMRVKRRDTDHWMSQR  437

Query  1118  MLPDNLRERIRRYEQYRWQETRGVDEESLISNLPKDLRRDINRHLCWSLLKRVHMFKTMD  1297
             MLPDNLRERIRRYEQY+WQETRGV+E  LI NLPKDLRRDINRHLC  L+K+V MFK MD
Sbjct  438   MLPDNLRERIRRYEQYKWQETRGVEERGLIRNLPKDLRRDINRHLCLDLIKKVPMFKKMD  497

Query  1298  EQLLDAICDRLKPVLYTEKSCIVREGDPVDEMIFVMRGNLLTMTTNGGRTGFLNSDVLNA  1477
             E +LDA+CDRLK  LYT+ S IVREG+PVDEM+F+MRGNL+++TTNGGRTGF N+  L A
Sbjct  498   ETILDAVCDRLKAALYTKDSYIVREGEPVDEMLFIMRGNLVSVTTNGGRTGFFNAVSLKA  557

Query  1478  GDFCGEELLTWALDPNSSSSLPISTRTVQALTDVEAFALTADFLKFFASQYRRLHSKQLQ  1657
             GDFCGE LLTWALDP  SS+LPISTRTVQAL++VEAFAL AD LK  ASQ+R+LH K +Q
Sbjct  558   GDFCGEGLLTWALDPQCSSNLPISTRTVQALSEVEAFALEADDLKSVASQFRQLHHKDIQ  617

Query  1658  HKFR--FYSHQWKTWAACFIQAAWRRHCRNKLEKSLREEEDRLQDALILRMRREEGETTP  1831
             H FR  F   QWKTWAACFIQAAWRRHCR K  KSLR+ E++LQD+L       E  T+P
Sbjct  618   HTFRQVFKDLQWKTWAACFIQAAWRRHCRRKQAKSLRQAEEKLQDSLA-----NEASTSP  672

Query  1832  SLGATIYASRFAANVLRTVRRN  1897
             SLG  IYAS+FAAN LR +RR 
Sbjct  673   SLGVAIYASQFAANALRNLRRK  694



>ref|XP_003626568.1| Cyclic nucleotide-gated channel C [Medicago truncatula]
 gb|AES82786.1| cyclic nucleotide-gated ion channel-like protein [Medicago truncatula]
Length=718

 Score =   807 bits (2084),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 423/650 (65%), Positives = 505/650 (78%), Gaps = 14/650 (2%)
 Frame = +2

Query  47    KSKMHDPQGPFLQRWNRIFVIACILAATVDPLFFYIPVVDDQNKCLGLDRTLEITACILR  226
             K K+ DPQGP LQ+WN+IFVI C+LA +VDP FFYIPV+  + KCL LD TL+ T  +LR
Sbjct  80    KRKILDPQGPMLQKWNKIFVITCVLAISVDPFFFYIPVIVGKQKCLDLDGTLQTTISVLR  139

Query  227   SVFDFFYIFHIILQFRTGFVPPSSRVFGRGDLIVDPSAIAKRYFFSYFFIDILAVLPLPQ  406
             + FD FYI  II QFRTGF+ PSSRVFGRG+L+ DP AI KRY  S+F +DIL+++PLPQ
Sbjct  140   TFFDLFYILRIIFQFRTGFIAPSSRVFGRGELVDDPVAIMKRYLSSHFIVDILSIIPLPQ  199

Query  407   VVLFMMIPRADRPFIMVAKDILKVVILVQSVPRLLRIYPLYKEVTRTSGFFTETAWAGAA  586
             +++  +IP        +AKD+LK  +L+Q VPRLLRI PL+KEVTRTSG  TETAWAGA 
Sbjct  200   IIVLAIIPNLKSSGPFLAKDLLKYTVLIQYVPRLLRIRPLFKEVTRTSGILTETAWAGAV  259

Query  587   FNLFLYMIASYVAGAIWYITAIERQDKCWRRACEKHGSCDIDFLYCTKLGRRGGDFSSSF  766
             +NLFLYM+AS+V GA WY+ ++E Q +CWRR           FL C   G R     S  
Sbjct  260   YNLFLYMLASHVVGANWYLLSVESQVRCWRRVMNNASIFHDSFLGC---GPRNATVLS-L  315

Query  767   LNTSCALLEPENLK-ADDFDFGIFLDALKSNVVEKRY-FWSKLFYCFWWGLRNLSSLGQN  940
             LN +C L++P+ +     F+FGIF DAL+S VV+    F  K FYCFWWGLRNLSSLGQN
Sbjct  316   LNGACTLVDPDEINNTTTFNFGIFYDALQSLVVDSNTDFPQKFFYCFWWGLRNLSSLGQN  375

Query  941   LKTSNFVGEilfailisiiglilfslligNMQKYLQSITVRVEEMRVKRMDAEQWMSHRM  1120
             LKT+ +V EI FAI I+I GL+LFSLLIGNMQKYL+S TVR EEMRVKR DAE+WMSHRM
Sbjct  376   LKTTTYVTEIAFAIFIAIFGLVLFSLLIGNMQKYLESTTVREEEMRVKRRDAERWMSHRM  435

Query  1121  LPDNLRERIRRYEQYRWQETRGVDEESLISNLPKDLRRDINRHLCWSLLKRVHMFKTMDE  1300
             LPDNL++RIRRYEQY+WQE RGV+EE+LI NLPKDLRRDI RHLC +L+K+V MF+ MD 
Sbjct  436   LPDNLKQRIRRYEQYKWQENRGVEEETLIHNLPKDLRRDIKRHLCLALVKKVPMFEKMDA  495

Query  1301  QLLDAICDRLKPVLYTEKSCIVREGDPVDEMIFVMRGNLLTMTTNGGRTGFLNSDVLNAG  1480
             QLLDA+CDRLKPVLYTEKSCIVRE DPVDEM+F+MRG + TMTTNGGRTGF NS  L  G
Sbjct  496   QLLDAMCDRLKPVLYTEKSCIVREEDPVDEMLFIMRGKVATMTTNGGRTGFFNSLFLMPG  555

Query  1481  DFCGEELLTWALDPNSSSSLPISTRTVQALTDVEAFALTADFLKFFASQYRRL-HSKQLQ  1657
             DFCGEELLTWALDPNSSS+LP STRTV+ +++VEAFAL AD LKF ASQ+RRL +SKQLQ
Sbjct  556   DFCGEELLTWALDPNSSSNLPTSTRTVETISEVEAFALKADDLKFVASQFRRLINSKQLQ  615

Query  1658  HKFRFYSHQWKTWAACFIQAAWRRHCRNKLEKSLREEEDRLQDALILRMRREEGETTPSL  1837
             H FR YS QWKTW ACFIQAAWRR+C+ K+E++LRE ED+LQDAL      EEG T  SL
Sbjct  616   HTFRSYSPQWKTWGACFIQAAWRRYCKKKIERTLREAEDKLQDALA----NEEGSTI-SL  670

Query  1838  GATIYASRFAANVLRTVRRNHplsvpklsprlpplllqkpAEPDFSAPEN  1987
             GATIYASRFAANVL+ +R N+     ++  RL PLL  KPAEPDF+A ++
Sbjct  671   GATIYASRFAANVLKNLRENN--RQNRMPQRLLPLLPPKPAEPDFTAQKH  718



>ref|NP_192010.2| cyclic nucleotide-gated channel 13 [Arabidopsis thaliana]
 sp|Q9LD40.2|CNG13_ARATH RecName: Full=Putative cyclic nucleotide-gated ion channel 13; 
AltName: Full=Cyclic nucleotide- and calmodulin-regulated 
ion channel 13 [Arabidopsis thaliana]
 gb|AEE81966.1| cyclic nucleotide-gated channel 13 [Arabidopsis thaliana]
Length=696

 Score =   806 bits (2082),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 396/615 (64%), Positives = 481/615 (78%), Gaps = 8/615 (1%)
 Frame = +2

Query  62    DPQGPFLQRWNRIFVIACILAATVDPLFFYIPVVDDQNKCLGLDRTLEITACILRSVFDF  241
             +PQG FLQ WN+IF+ A ++A  +DPLFFYIP+VD +  CL L R LEI A +LR+  D 
Sbjct  70    NPQGSFLQNWNKIFLFASVIALAIDPLFFYIPIVDGERHCLNLHRNLEIAASVLRTFIDA  129

Query  242   FYIFHIILQFRTGFVPPSSRVFGRGDLIVDPSAIAKRYFFSYFFIDILAVLPLPQVVLFM  421
             FYI HI+ QFRT ++ PSSRVFGRG+L+ DP AIA +Y  SYF ID+L++LPLPQ+V+  
Sbjct  130   FYIIHIVFQFRTAYISPSSRVFGRGELVDDPKAIAIKYLSSYFIIDLLSILPLPQLVVLA  189

Query  422   MIPRADRPFIMVAKDILKVVILVQSVPRLLRIYPLYKEVTRTSGFFTETAWAGAAFNLFL  601
             +IP  ++P  ++ KD L  VI  Q +PR+LRIYPLY EVTRTSG  TETAWAGAA+NL L
Sbjct  190   VIPNVNKPVSLITKDYLITVIFTQYIPRILRIYPLYTEVTRTSGIVTETAWAGAAWNLSL  249

Query  602   YMIASYVAGAIWYITAIERQDKCWRRACEKHGS-CDIDFLYCTKLGRRGGDFSSSFLNTS  778
             YM+AS+V GA+WY+ ++ER+D+CWR ACEK    C+  FLYC           + FL TS
Sbjct  250   YMLASHVFGALWYLISVEREDRCWREACEKIPEVCNFRFLYCDG----NSSVRNDFLTTS  305

Query  779   CALLEPENL-KADDFDFGIFLDALKSNVVEKRYFWSKLFYCFWWGLRNLSSLGQNLKTSN  955
             C  + P+++  +  F+FGIF DALKS +VE   FW K FYCFWWGLRNLS+LGQNL TS 
Sbjct  306   CPFINPDDITNSTVFNFGIFTDALKSGIVESDDFWKKFFYCFWWGLRNLSALGQNLNTSK  365

Query  956   FVGEilfailisiiglilfslligNMQKYLQSITVRVEEMRVKRMDAEQWMSHRMLPDNL  1135
             FVGEI+FA+ I I GL+LF+LLIGNMQKYL+S TVR EEMRV++ DAEQWMSHRMLPD+L
Sbjct  366   FVGEIIFAVSICISGLVLFALLIGNMQKYLESTTVREEEMRVRKRDAEQWMSHRMLPDDL  425

Query  1136  RERIRRYEQYRWQETRGVDEESLISNLPKDLRRDINRHLCWSLLKRVHMFKTMDEQLLDA  1315
             R+RIRRYEQY+WQETRGV+EE+L+ NLPKDLRRDI RH C  LLK+V +F+ MDEQLLDA
Sbjct  426   RKRIRRYEQYKWQETRGVEEENLLRNLPKDLRRDIKRHFCLDLLKKVPLFEIMDEQLLDA  485

Query  1316  ICDRLKPVLYTEKSCIVREGDPVDEMIFVMRGNLLTMTTNGGRTGFLNSDVLNAGDFCGE  1495
             +CD+LKPVLYTE S  +REGDPV+EM+FVMRG L++ TTNGGRTGF N+  L   DFCGE
Sbjct  486   VCDKLKPVLYTENSYAIREGDPVEEMLFVMRGKLMSATTNGGRTGFFNAVYLKPSDFCGE  545

Query  1496  ELLTWALDPNSSSSLPISTRTVQALTDVEAFALTADFLKFFASQYRRLHSKQLQHKFRFY  1675
             +LLTWALDP SSS  PISTRTVQALT+VEAFAL AD LK  ASQ+RRLHSKQLQH FRFY
Sbjct  546   DLLTWALDPQSSSHFPISTRTVQALTEVEAFALAADDLKLVASQFRRLHSKQLQHTFRFY  605

Query  1676  SHQWKTWAACFIQAAWRRHCRNKLEKSLREEEDRLQDALILRMRREEGETTPSLGATIYA  1855
             S QW+TW A FIQAAWRRHCR KL +SL EEEDR ++A+  R R     ++ SL AT+YA
Sbjct  606   SVQWRTWGASFIQAAWRRHCRRKLARSLTEEEDRFRNAITKRER--NAASSSSLVATLYA  663

Query  1856  SRFAANVLRTVRRNH  1900
             SRFA+N LR +R N+
Sbjct  664   SRFASNALRNLRTNN  678



>ref|NP_563625.1| cyclic nucleotide gated channel 10 [Arabidopsis thaliana]
 gb|AAF97331.1|AC023628_12 Putative cyclic nucleotide-regulated ion channel protein [Arabidopsis 
thaliana]
 gb|AAF76224.3|AF272002_1 CaM-regulated potassium ion channel [Arabidopsis thaliana]
 gb|AEE27273.1| cyclic nucleotide gated channel 10 [Arabidopsis thaliana]
Length=706

 Score =   806 bits (2082),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 396/616 (64%), Positives = 486/616 (79%), Gaps = 8/616 (1%)
 Frame = +2

Query  62    DPQGPFLQRWNRIFVIACILAATVDPLFFYIPVVDDQNKCLGLDRTLEITACILRSVFDF  241
             +PQ  FLQ WN+IF+ AC++A  +DPLFFYIP+VD    CL LD  LEI A +LR++ D 
Sbjct  65    NPQDSFLQNWNKIFLFACVVALAIDPLFFYIPIVDSARHCLTLDSKLEIAASLLRTLIDA  124

Query  242   FYIFHIILQFRTGFVPPSSRVFGRGDLIVDPSAIAKRYFFSYFFIDILAVLPLPQVVLFM  421
             FYI HI+ QFRT ++ PSSRVFGRG+L+ D  AIA +Y  SYF ID+L++LPLPQ+V+  
Sbjct  125   FYIIHIVFQFRTAYIAPSSRVFGRGELVDDAKAIALKYLSSYFIIDLLSILPLPQIVVLA  184

Query  422   MIPRADRPFIMVAKDILKVVILVQSVPRLLRIYPLYKEVTRTSGFFTETAWAGAAFNLFL  601
             +IP  ++P  ++ KD LK  I+ Q VPR+LR+YPLY EVTRTSG  TETAWAGAA+NL L
Sbjct  185   VIPSVNQPVSLLTKDYLKFSIIAQYVPRILRMYPLYTEVTRTSGIVTETAWAGAAWNLSL  244

Query  602   YMIASYVAGAIWYITAIERQDKCWRRACEKHGSCDIDFLYCTKLGRRGGDFSSSFLNTSC  781
             YM+AS+V GA+WY+ ++ER+D+CW+ ACEK   C++ FLYC        + S++FL TSC
Sbjct  245   YMLASHVFGALWYLISVEREDRCWQEACEKTKGCNMKFLYC----ENDRNVSNNFLTTSC  300

Query  782   ALLEPENL-KADDFDFGIFLDALKSNVVEKRYFWSKLFYCFWWGLRNLSSLGQNLKTSNF  958
               L+P ++  +  F+FGIF DALKS VVE   FW K FYCFWWGLRNLS+LGQNL+TS F
Sbjct  301   PFLDPGDITNSTIFNFGIFTDALKSGVVESHDFWKKFFYCFWWGLRNLSALGQNLQTSKF  360

Query  959   VGEilfailisiiglilfslligNMQKYLQSITVRVEEMRVKRMDAEQWMSHRMLPDNLR  1138
             VGEI+FAI I I GL+LF+LLIGNMQKYL+S TVR EEMRV++ DAEQWMSHRMLP++LR
Sbjct  361   VGEIIFAISICISGLVLFALLIGNMQKYLESTTVREEEMRVRKRDAEQWMSHRMLPEDLR  420

Query  1139  ERIRRYEQYRWQETRGVDEESLISNLPKDLRRDINRHLCWSLLKRVHMFKTMDEQLLDAI  1318
             +RIRRYEQYRWQETRGV+EE+L+ NLPKDLRRDI RHLC  LLK+V +F+ MDEQLLDA+
Sbjct  421   KRIRRYEQYRWQETRGVEEETLLRNLPKDLRRDIKRHLCLDLLKKVPLFEIMDEQLLDAV  480

Query  1319  CDRLKPVLYTEKSCIVREGDPVDEMIFVMRGNLLTMTTNGGRTGFLNSDVLNAGDFCGEE  1498
             CDRL+PVLYTE S ++REGDPV EM+FVMRG L++ TTNGGR+GF N+  L A DFCGE+
Sbjct  481   CDRLRPVLYTENSYVIREGDPVGEMLFVMRGRLVSATTNGGRSGFFNAVNLKASDFCGED  540

Query  1499  LLTWALDPNSSSSLPISTRTVQALTDVEAFALTADFLKFFASQYRRLHSKQLQHKFRFYS  1678
             LL WALDP SSS  PISTRTVQALT+VEAFALTA+ LK  ASQ+RRLHSKQLQH FRFYS
Sbjct  541   LLPWALDPQSSSHFPISTRTVQALTEVEAFALTAEDLKSVASQFRRLHSKQLQHTFRFYS  600

Query  1679  HQWKTWAACFIQAAWRRHCRNKLEKSLREEEDRLQDALILRMRREEGETTP---SLGATI  1849
              QW+TW+  FIQAAWRR+CR KL KSLR+EEDRL++AL  + +     T     SLG  +
Sbjct  601   VQWRTWSVSFIQAAWRRYCRRKLAKSLRDEEDRLREALASQDKEHNAATVSSSLSLGGAL  660

Query  1850  YASRFAANVLRTVRRN  1897
             YASRFA+N L  +R N
Sbjct  661   YASRFASNALHNLRHN  676



>ref|XP_006306882.1| hypothetical protein CARUB_v10008437mg [Capsella rubella]
 ref|XP_006306883.1| hypothetical protein CARUB_v10008437mg [Capsella rubella]
 gb|EOA39780.1| hypothetical protein CARUB_v10008437mg [Capsella rubella]
 gb|EOA39781.1| hypothetical protein CARUB_v10008437mg [Capsella rubella]
Length=724

 Score =   806 bits (2083),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 399/620 (64%), Positives = 482/620 (78%), Gaps = 7/620 (1%)
 Frame = +2

Query  47    KSKMHDPQGPFLQRWNRIFVIACILAATVDPLFFYIPVVDDQNKCLGLDRTLEITACILR  226
             K  + +PQ  FLQ WN+IF+ AC+LA  +DPLFFYIP+VD    CL LD  LEI A +LR
Sbjct  79    KKNIINPQDLFLQNWNKIFLFACVLALAIDPLFFYIPIVDGTRHCLTLDSELEIAASLLR  138

Query  227   SVFDFFYIFHIILQFRTGFVPPSSRVFGRGDLIVDPSAIAKRYFFSYFFIDILAVLPLPQ  406
             S+ D FYI HI+ QFRT ++ PSSRVFGRG+L+ D  AIA +Y  SYF IDIL++LPLPQ
Sbjct  139   SLIDAFYIIHIVFQFRTAYIAPSSRVFGRGELVDDAKAIALKYLSSYFIIDILSILPLPQ  198

Query  407   VVLFMMIPRADRPFIMVAKDILKVVILVQSVPRLLRIYPLYKEVTRTSGFFTETAWAGAA  586
             +V+  +IP  ++P   + KD LK+VI+ Q VPR++R+YPLY EVTRTSG  TETAWAGAA
Sbjct  199   IVVLAVIPNVNQPGSFLTKDYLKIVIIAQYVPRIIRMYPLYTEVTRTSGIVTETAWAGAA  258

Query  587   FNLFLYMIASYVAGAIWYITAIERQDKCWRRACEKHGSCDIDFLYCTKLGRRGGDFSSSF  766
             +NL LYM+AS+V GA+WY+ ++ER+DKCW+ ACEK   C +  LYC   G    DF    
Sbjct  259   WNLSLYMLASHVFGALWYLISVEREDKCWQEACEKKDGCSLRVLYCDDKGNTRNDF----  314

Query  767   LNTSCALLEPENLKADDFDFGIFLDALKSNVVEKRYFWSKLFYCFWWGLRNLSSLGQNLK  946
             LN SC  L+P+ +    F+FGIF+DALKS VVE   FW+K FYCFWWGLRNLS+LGQNL+
Sbjct  315   LNGSCPFLDPDEITNSTFNFGIFIDALKSGVVESHDFWTKFFYCFWWGLRNLSALGQNLQ  374

Query  947   TSNFVGEilfailisiiglilfslligNMQKYLQSITVRVEEMRVKRMDAEQWMSHRMLP  1126
             TS FVGEI+FAI I I GL+LF+LLIGNMQKYL+S TVR EEMRV++ DAEQWMSHRMLP
Sbjct  375   TSKFVGEIIFAISICIFGLVLFALLIGNMQKYLESTTVREEEMRVRKRDAEQWMSHRMLP  434

Query  1127  DNLRERIRRYEQYRWQETRGVDEESLISNLPKDLRRDINRHLCWSLLKRVHMFKTMDEQL  1306
             ++LR+RIRRYEQYRWQETRGV+EE+L+ NLPKDLRRDI RHLC  LLK+V +F  MDEQL
Sbjct  435   EHLRKRIRRYEQYRWQETRGVEEETLLRNLPKDLRRDIKRHLCLDLLKKVPLFGIMDEQL  494

Query  1307  LDAICDRLKPVLYTEKSCIVREGDPVDEMIFVMRGNLLTMTTNGGRTGFLNSDVLNAGDF  1486
             LDA+CDRL+PVLYTE S ++REGDPV EM+FVMRG L++ TT+GGRTG  N+  L A +F
Sbjct  495   LDAVCDRLRPVLYTENSYVIREGDPVAEMLFVMRGRLISATTDGGRTGVFNAVYLKASEF  554

Query  1487  CGEELLTWALDPNSSSSLPISTRTVQALTDVEAFALTADFLKFFASQYRRLHSKQLQHKF  1666
             CGE+LL WALDP SSS  PISTRTVQALT+VEAFAL A+ LK  ASQ+RRLHSKQLQH  
Sbjct  555   CGEDLLPWALDPQSSSHFPISTRTVQALTEVEAFALRAEDLKSVASQFRRLHSKQLQHTL  614

Query  1667  RFYSHQWKTWAACFIQAAWRRHCRNKLEKSLREEEDRLQDALILRMRREEGETTP---SL  1837
             RFYS QW+TW+  FIQAAWRR+CR KL KSL +EE+RL+DAL  + R     T     SL
Sbjct  615   RFYSVQWRTWSVSFIQAAWRRYCRRKLAKSLCDEEERLRDALASQNRERNAATASSSLSL  674

Query  1838  GATIYASRFAANVLRTVRRN  1897
             GA IYASRFA+N L  +R N
Sbjct  675   GAAIYASRFASNALHNLRHN  694



>ref|XP_006345563.1| PREDICTED: cyclic nucleotide-gated ion channel 1-like [Solanum 
tuberosum]
Length=651

 Score =   803 bits (2075),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 422/644 (66%), Positives = 511/644 (79%), Gaps = 14/644 (2%)
 Frame = +2

Query  53    KMHDPQGPFLQRWNRIFVIACILAATVDPLFFYIPVVDDQNKCLGLDRTLEITACILRSV  232
             K+ DP+G FLQ+WN+ F++A IL+ ++DPLFFYIPV+D+ NKCL LD+TL+ITAC+LRSV
Sbjct  16    KVVDPKGRFLQKWNKAFMLAYILSVSLDPLFFYIPVIDNNNKCLDLDKTLKITACVLRSV  75

Query  233   FDFFYIFHIILQFRTGFVPPSSRVFGRGDLIVDPSAIAKRYFFSYFFIDILAVLPLPQVV  412
              D FY+F+II QFRTGF+ PSSRV+GRG+ I D SAIAKRY  SYF ID++ VLPLPQ+V
Sbjct  76    TDLFYVFNIIFQFRTGFIAPSSRVYGRGEFIEDSSAIAKRYLSSYFMIDVITVLPLPQIV  135

Query  413   LFMMIPRADRPFIMVAKDILKVVILVQSVPRLLRIYPLYKEVTRTSGFFT-ETAWAGAAF  589
             +  + P  + P  +V K +LK+VI  Q VPR  RI PLYKEV RTS FF  E+AW G AF
Sbjct  136   ILFIAPNVNGPIALVTKKMLKIVIFAQYVPRFCRIIPLYKEVERTSIFFNNESAWGGTAF  195

Query  590   NLFLYMIASYVAGAIWYITAIERQDKCWRRACEKHGSCDIDFLYCTKLGRRGGDFSSSFL  769
              +FL+M +S V GA WY+ +IERQ  CWR ACEK  +C  D+LYC   G+  G+  +  L
Sbjct  196   YIFLFMWSSNVIGAFWYLLSIERQYTCWRSACEKIPNCSSDYLYCG--GKMNGN--AFLL  251

Query  770   NTSCALLEPENLK-ADDFDFGIFLDALKSNVVEKRYFWSKLFYCFWWGLRNLSSLGQNLK  946
             N+SC LL+ E++K  +DFDFGI LDAL+  VVEKR F +KL YCFWWGLRNL+SLGQNLK
Sbjct  252   NSSCPLLQQEDMKDPNDFDFGIALDALQFQVVEKRKFRTKLLYCFWWGLRNLNSLGQNLK  311

Query  947   TSNFVGEilfailisiiglilfslligNMQKYLQSITVRVEEMRVKRMDAEQWMSHRMLP  1126
             TS F G+I+FAI+IS+IGLI FSL+IGNMQK +Q   VRVEEMRV+R   EQWMSHRMLP
Sbjct  312   TSTFDGDIIFAIVISLIGLIFFSLIIGNMQKLMQFNLVRVEEMRVRRCAVEQWMSHRMLP  371

Query  1127  DNLRERIRRYEQYRWQETRGVDEESLISNLPKDLRRDINRHLCWSLLKRVHMFKTMDEQL  1306
              NLR+RIRR+EQY+WQETRGV+E+SLI NLP+DLRRD+ RHLCWSLLKRV +F+ MDEQL
Sbjct  372   LNLRQRIRRHEQYKWQETRGVEEDSLIQNLPRDLRRDLKRHLCWSLLKRVPIFEEMDEQL  431

Query  1307  LDAICDRLKPVLYTEKSCIVREGDPVDEMIFVMRGNLLTMTTNGGRTGFLNSDVLNAGDF  1486
             LDA+ DRLKP L+T+KS I+REGDPV+EM F+MRG L +MTTNG RTGF NS  L AGDF
Sbjct  432   LDALSDRLKPALFTQKSFIMREGDPVEEMHFLMRGTLSSMTTNGERTGFFNSVHLKAGDF  491

Query  1487  CGEELLTWALDPNSSS-SLPISTRTVQALTDVEAFALTADFLKFFASQYRRLHSKQLQHK  1663
              G+ELLTWALDP++SS SLPISTR VQA+TD+E FA+TAD LKF ASQ+RRLHSKQLQH 
Sbjct  492   YGDELLTWALDPHTSSNSLPISTRKVQAVTDIEVFAITADDLKFVASQFRRLHSKQLQHT  551

Query  1664  FRFYSHQWKTWAACFIQAAWRRHCRNKLEKSLREEEDRLQDALILRMRREEGETTPSLGA  1843
             ++F+S +W+TWAACFIQ AWRRHCR KLEKSLREEED++Q AL      +E     SLGA
Sbjct  552   YKFFSQEWRTWAACFIQVAWRRHCRKKLEKSLREEEDKVQVALA-----KERTNASSLGA  606

Query  1844  TIYASRFAANVLRTVRRNHplsvpklsprlpplllqkpAEPDFS  1975
             TIYASRFAA VLR++R N+  +    S    PLLL KPAEPDFS
Sbjct  607   TIYASRFAAKVLRSLRCNN--TTGAKSSPTSPLLLHKPAEPDFS  648



>ref|NP_001184885.1| cyclic nucleotide gated channel 10 [Arabidopsis thaliana]
 sp|Q9LNJ0.2|CNG10_ARATH RecName: Full=Probable cyclic nucleotide-gated ion channel 10; 
AltName: Full=CaM-regulated potassium ion channel; AltName: 
Full=Cyclic nucleotide- and calmodulin-regulated ion channel 
10 [Arabidopsis thaliana]
 gb|AEE27274.1| cyclic nucleotide gated channel 10 [Arabidopsis thaliana]
Length=711

 Score =   806 bits (2081),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 396/616 (64%), Positives = 486/616 (79%), Gaps = 8/616 (1%)
 Frame = +2

Query  62    DPQGPFLQRWNRIFVIACILAATVDPLFFYIPVVDDQNKCLGLDRTLEITACILRSVFDF  241
             +PQ  FLQ WN+IF+ AC++A  +DPLFFYIP+VD    CL LD  LEI A +LR++ D 
Sbjct  70    NPQDSFLQNWNKIFLFACVVALAIDPLFFYIPIVDSARHCLTLDSKLEIAASLLRTLIDA  129

Query  242   FYIFHIILQFRTGFVPPSSRVFGRGDLIVDPSAIAKRYFFSYFFIDILAVLPLPQVVLFM  421
             FYI HI+ QFRT ++ PSSRVFGRG+L+ D  AIA +Y  SYF ID+L++LPLPQ+V+  
Sbjct  130   FYIIHIVFQFRTAYIAPSSRVFGRGELVDDAKAIALKYLSSYFIIDLLSILPLPQIVVLA  189

Query  422   MIPRADRPFIMVAKDILKVVILVQSVPRLLRIYPLYKEVTRTSGFFTETAWAGAAFNLFL  601
             +IP  ++P  ++ KD LK  I+ Q VPR+LR+YPLY EVTRTSG  TETAWAGAA+NL L
Sbjct  190   VIPSVNQPVSLLTKDYLKFSIIAQYVPRILRMYPLYTEVTRTSGIVTETAWAGAAWNLSL  249

Query  602   YMIASYVAGAIWYITAIERQDKCWRRACEKHGSCDIDFLYCTKLGRRGGDFSSSFLNTSC  781
             YM+AS+V GA+WY+ ++ER+D+CW+ ACEK   C++ FLYC        + S++FL TSC
Sbjct  250   YMLASHVFGALWYLISVEREDRCWQEACEKTKGCNMKFLYC----ENDRNVSNNFLTTSC  305

Query  782   ALLEPENL-KADDFDFGIFLDALKSNVVEKRYFWSKLFYCFWWGLRNLSSLGQNLKTSNF  958
               L+P ++  +  F+FGIF DALKS VVE   FW K FYCFWWGLRNLS+LGQNL+TS F
Sbjct  306   PFLDPGDITNSTIFNFGIFTDALKSGVVESHDFWKKFFYCFWWGLRNLSALGQNLQTSKF  365

Query  959   VGEilfailisiiglilfslligNMQKYLQSITVRVEEMRVKRMDAEQWMSHRMLPDNLR  1138
             VGEI+FAI I I GL+LF+LLIGNMQKYL+S TVR EEMRV++ DAEQWMSHRMLP++LR
Sbjct  366   VGEIIFAISICISGLVLFALLIGNMQKYLESTTVREEEMRVRKRDAEQWMSHRMLPEDLR  425

Query  1139  ERIRRYEQYRWQETRGVDEESLISNLPKDLRRDINRHLCWSLLKRVHMFKTMDEQLLDAI  1318
             +RIRRYEQYRWQETRGV+EE+L+ NLPKDLRRDI RHLC  LLK+V +F+ MDEQLLDA+
Sbjct  426   KRIRRYEQYRWQETRGVEEETLLRNLPKDLRRDIKRHLCLDLLKKVPLFEIMDEQLLDAV  485

Query  1319  CDRLKPVLYTEKSCIVREGDPVDEMIFVMRGNLLTMTTNGGRTGFLNSDVLNAGDFCGEE  1498
             CDRL+PVLYTE S ++REGDPV EM+FVMRG L++ TTNGGR+GF N+  L A DFCGE+
Sbjct  486   CDRLRPVLYTENSYVIREGDPVGEMLFVMRGRLVSATTNGGRSGFFNAVNLKASDFCGED  545

Query  1499  LLTWALDPNSSSSLPISTRTVQALTDVEAFALTADFLKFFASQYRRLHSKQLQHKFRFYS  1678
             LL WALDP SSS  PISTRTVQALT+VEAFALTA+ LK  ASQ+RRLHSKQLQH FRFYS
Sbjct  546   LLPWALDPQSSSHFPISTRTVQALTEVEAFALTAEDLKSVASQFRRLHSKQLQHTFRFYS  605

Query  1679  HQWKTWAACFIQAAWRRHCRNKLEKSLREEEDRLQDALILRMRREEGETTP---SLGATI  1849
              QW+TW+  FIQAAWRR+CR KL KSLR+EEDRL++AL  + +     T     SLG  +
Sbjct  606   VQWRTWSVSFIQAAWRRYCRRKLAKSLRDEEDRLREALASQDKEHNAATVSSSLSLGGAL  665

Query  1850  YASRFAANVLRTVRRN  1897
             YASRFA+N L  +R N
Sbjct  666   YASRFASNALHNLRHN  681



>ref|XP_010462522.1| PREDICTED: probable cyclic nucleotide-gated ion channel 10 [Camelina 
sativa]
Length=723

 Score =   805 bits (2080),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 408/650 (63%), Positives = 494/650 (76%), Gaps = 8/650 (1%)
 Frame = +2

Query  47    KSKMHDPQGPFLQRWNRIFVIACILAATVDPLFFYIPVVDDQNKCLGLDRTLEITACILR  226
             K  + +PQ  FLQ WN+IF+ AC+LA  +DPLFFYIP+VD    CL +D  LEI A  LR
Sbjct  80    KKNIINPQDSFLQNWNKIFLFACVLALAIDPLFFYIPIVDGTRHCLTMDSKLEIAASFLR  139

Query  227   SVFDFFYIFHIILQFRTGFVPPSSRVFGRGDLIVDPSAIAKRYFFSYFFIDILAVLPLPQ  406
             ++ D FYI HI+ QFRT ++ PSSRVFGRG+L+ D  AIA +Y  SYF ID+L++LPLPQ
Sbjct  140   TLIDAFYIIHIVFQFRTAYIAPSSRVFGRGELVDDAKAIALKYLSSYFIIDVLSILPLPQ  199

Query  407   VVLFMMIPRADRPFIMVAKDILKVVILVQSVPRLLRIYPLYKEVTRTSGFFTETAWAGAA  586
             +V+  +IP    P  ++ KD L  VI+VQ VPR+LR+YPLY EVTRTSG  TETAWAGAA
Sbjct  200   IVVLAVIPSVKEPDSLLTKDYLMSVIIVQYVPRILRLYPLYTEVTRTSGIVTETAWAGAA  259

Query  587   FNLFLYMIASYVAGAIWYITAIERQDKCWRRACEKHGSCDIDFLYCTKLGRRGGDFSSSF  766
             +NL LYM+AS+V GA+WY+ ++ER+D+CW+ ACEK   C +  LYC   G    D+    
Sbjct  260   WNLSLYMLASHVFGALWYLISVEREDRCWQEACEKKNGCSLSSLYCHGNGNAANDY----  315

Query  767   LNTSCALLEPENL-KADDFDFGIFLDALKSNVVEKRYFWSKLFYCFWWGLRNLSSLGQNL  943
             L TSC  L+P ++  +  F+FGIF DALKS VVE   FW K FYCFWWGLRNLS+LGQNL
Sbjct  316   LTTSCPFLDPGDITNSTIFNFGIFTDALKSGVVESHDFWKKFFYCFWWGLRNLSALGQNL  375

Query  944   KTSNFVGEilfailisiiglilfslligNMQKYLQSITVRVEEMRVKRMDAEQWMSHRML  1123
             +TS FVGEI+FAI I I GL+LF+LLIGNMQKYL+S TVR EEMRV++ DAEQWMSHRML
Sbjct  376   QTSKFVGEIVFAISICISGLVLFALLIGNMQKYLESTTVREEEMRVRKRDAEQWMSHRML  435

Query  1124  PDNLRERIRRYEQYRWQETRGVDEESLISNLPKDLRRDINRHLCWSLLKRVHMFKTMDEQ  1303
             P++LR+RIRRYEQYRWQETRGV+EE+L+ NLPKDLRRDI RHLC  LLK+V +F+ MDEQ
Sbjct  436   PEDLRKRIRRYEQYRWQETRGVEEENLLRNLPKDLRRDIKRHLCLDLLKKVPLFEIMDEQ  495

Query  1304  LLDAICDRLKPVLYTEKSCIVREGDPVDEMIFVMRGNLLTMTTNGGRTGFLNSDVLNAGD  1483
             LLDA+CDRLKPVLYTE S ++REGDPV EM+FVMRG L++ TTNGGRTG  N+  L A D
Sbjct  496   LLDAVCDRLKPVLYTENSYVIREGDPVGEMMFVMRGRLISATTNGGRTGVFNAVDLKASD  555

Query  1484  FCGEELLTWALDPNSSSSLPISTRTVQALTDVEAFALTADFLKFFASQYRRLHSKQLQHK  1663
             FCGE+LL WALDP SSS  PISTRTVQALT+VEAFAL A+ LK  ASQ+RRLHSKQLQH 
Sbjct  556   FCGEDLLPWALDPQSSSHFPISTRTVQALTEVEAFALMAEDLKSVASQFRRLHSKQLQHT  615

Query  1664  FRFYSHQWKTWAACFIQAAWRRHCRNKLEKSLREEEDRLQDALILRMRREEGETTPSLGA  1843
             FRFYS QW+TW+  FIQAAWRR+CR KL KSLR+EE+RL+DAL          ++ SLGA
Sbjct  616   FRFYSVQWRTWSVSFIQAAWRRYCRKKLAKSLRDEEERLRDALAREGDGATASSSLSLGA  675

Query  1844  TIYASRFAANVLRTVRRNHplsvpklsprlpplllqkpAEPDFSAPENNN  1993
              +YASRFA+N L  +R N+            PLL QKP EPDF+A    +
Sbjct  676   ALYASRFASNALHNLRHNY---SNLPPRYTLPLLPQKPTEPDFTASHTTD  722



>ref|XP_002872915.1| ATCNGC13 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH49174.1| ATCNGC13 [Arabidopsis lyrata subsp. lyrata]
Length=697

 Score =   804 bits (2077),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 395/620 (64%), Positives = 482/620 (78%), Gaps = 8/620 (1%)
 Frame = +2

Query  47    KSKMHDPQGPFLQRWNRIFVIACILAATVDPLFFYIPVVDDQNKCLGLDRTLEITACILR  226
             K  + +PQG FLQ WN+IF+ A ++A  +DPLFFYIP+VD +  CL L   LE+ A +LR
Sbjct  66    KKNIINPQGSFLQNWNKIFLFASVIALAIDPLFFYIPIVDGERNCLNLHHNLEVAASVLR  125

Query  227   SVFDFFYIFHIILQFRTGFVPPSSRVFGRGDLIVDPSAIAKRYFFSYFFIDILAVLPLPQ  406
             +  D FYI HI+ QFRT ++ PSSRVFGRG+L+ DP AIA +Y  SYF ID+L++LPLPQ
Sbjct  126   TFIDAFYIIHIVFQFRTAYISPSSRVFGRGELVDDPKAIAIKYLSSYFIIDVLSILPLPQ  185

Query  407   VVLFMMIPRADRPFIMVAKDILKVVILVQSVPRLLRIYPLYKEVTRTSGFFTETAWAGAA  586
             +V+  +IP  ++P  ++ KD L  VI  Q +PR+LRIYPLY EVTRTSG  TETAWAGAA
Sbjct  186   LVVLAVIPNVNKPVSLITKDYLITVIFAQYIPRILRIYPLYTEVTRTSGIVTETAWAGAA  245

Query  587   FNLFLYMIASYVAGAIWYITAIERQDKCWRRACEKHGS-CDIDFLYCTKLGRRGGDFSSS  763
             +NL LYM+AS+V GA+WY+ ++ER+D+CWR ACEK    C   FLYC           + 
Sbjct  246   WNLSLYMLASHVFGALWYLISVEREDRCWREACEKIPEVCTFRFLYCDG----NTSVRND  301

Query  764   FLNTSCALLEPENL-KADDFDFGIFLDALKSNVVEKRYFWSKLFYCFWWGLRNLSSLGQN  940
             FL TSC  + P+++  +  F+FGIF DALKS +VE   FW K FYCFWWGLRNLS+LGQN
Sbjct  302   FLTTSCPFINPDDITNSTVFNFGIFTDALKSGIVESDDFWKKFFYCFWWGLRNLSALGQN  361

Query  941   LKTSNFVGEilfailisiiglilfslligNMQKYLQSITVRVEEMRVKRMDAEQWMSHRM  1120
             L TS FVGEI+FA+ I I GL+LF+LLIGNMQKYL+S TVR EEMRV++ DAEQWMSHRM
Sbjct  362   LNTSKFVGEIIFAVSICISGLVLFALLIGNMQKYLESTTVREEEMRVRKRDAEQWMSHRM  421

Query  1121  LPDNLRERIRRYEQYRWQETRGVDEESLISNLPKDLRRDINRHLCWSLLKRVHMFKTMDE  1300
             LPD+LR+RIRRYEQY+WQETRGV+EE+L+ NLPKDLRRDI RH C  LLK+V +F+ MDE
Sbjct  422   LPDDLRKRIRRYEQYKWQETRGVEEENLLRNLPKDLRRDIKRHFCLDLLKKVPLFEIMDE  481

Query  1301  QLLDAICDRLKPVLYTEKSCIVREGDPVDEMIFVMRGNLLTMTTNGGRTGFLNSDVLNAG  1480
             QLLDA+CD+LKPVLYTE S  +REGDPV+EM+FVMRG L++ TTNGGRTGF N+  L   
Sbjct  482   QLLDAVCDKLKPVLYTENSYAIREGDPVEEMLFVMRGKLMSATTNGGRTGFFNAVYLKPS  541

Query  1481  DFCGEELLTWALDPNSSSSLPISTRTVQALTDVEAFALTADFLKFFASQYRRLHSKQLQH  1660
             DFCGE+LLTWALDP SSS  PISTRTVQALT+VEAFAL AD LK  ASQ+RRLHSKQLQH
Sbjct  542   DFCGEDLLTWALDPQSSSHFPISTRTVQALTEVEAFALAADDLKLVASQFRRLHSKQLQH  601

Query  1661  KFRFYSHQWKTWAACFIQAAWRRHCRNKLEKSLREEEDRLQDALILRMRREEGETTPSLG  1840
              FRFYS QW+TW A FIQAAWRRHCR KL +SL EEEDR ++A+  R R  +  ++ SL 
Sbjct  602   TFRFYSVQWRTWGASFIQAAWRRHCRRKLARSLTEEEDRFRNAIAKRER--DAASSSSLV  659

Query  1841  ATIYASRFAANVLRTVRRNH  1900
             AT+YASRFA+N LR +R N+
Sbjct  660   ATLYASRFASNALRNLRTNN  679



>emb|CDY49458.1| BnaA10g06480D [Brassica napus]
Length=720

 Score =   803 bits (2073),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 412/614 (67%), Positives = 495/614 (81%), Gaps = 13/614 (2%)
 Frame = +2

Query  62    DPQGPFLQRWNRIFVIACILAATVDPLFFYIPVVDDQNKCLGLDRTLEITACILRSVFDF  241
             DPQG FLQ+WN+IFV+ACI+A +VDPLFFY+PV+D  N CL +D+ ++ TA +LRSV D 
Sbjct  75    DPQGTFLQKWNKIFVLACIIAVSVDPLFFYVPVLDKANNCLDVDKKMQTTASVLRSVTDI  134

Query  242   FYIFHIILQFRTGFVPPSSRVFGRGDLIVDPSAIAKRYFFSYFFIDILAVLPLPQVVLFM  421
             FY  H++ QFRTGF+ PSSRVFGRG L+ D   IAKRY  S+F IDILAVLPLPQ+V+ +
Sbjct  135   FYAIHMVFQFRTGFIAPSSRVFGRGVLVEDRRKIAKRYLSSHFIIDILAVLPLPQMVISI  194

Query  422   MIPRADRPFIMVAKDILKVVILVQSVPRLLRIYPLYKEVTRTSGFFTETAWAGAAFNLFL  601
             +IPR   P  +  K++LK ++  Q +PR +RIYPLYK+VTRTSG  TETAWAGAAFNLFL
Sbjct  195   IIPRMREPKTLHTKNMLKFIVFFQYIPRFMRIYPLYKQVTRTSGILTETAWAGAAFNLFL  254

Query  602   YMIASYVAGAIWYITAIERQDKCWRRACEKHG--SCDIDFLYCTKLGRRGGDFSSSFLNT  775
             YM+AS+V GA WY+ +IER+  CW++A  + G   CD+  LYC K    G +   +FLN 
Sbjct  255   YMLASHVVGAFWYLFSIERKTVCWKQAWNRDGRSKCDMRSLYC-KPDTVGNN---TFLNG  310

Query  776   SCALLEPENLKADDFDFGIFLDALKSNVVEKRYFWSKLFYCFWWGLRNLSSLGQNLKTSN  955
              C +L+P    A  F FGIFL AL+S VVE   F  K  YCFWWGL+NLSSLGQNLKTS 
Sbjct  311   FCPVLKPN---ATCFQFGIFLGALESGVVESHDFPQKFLYCFWWGLQNLSSLGQNLKTST  367

Query  956   FVGEilfailisiiglilfslligNMQKYLQSITVRVEEMRVKRMDAEQWMSHRMLPDNL  1135
             ++ E  FA+ ISI GL+LFS LIGNMQ YLQS T R+EEMRVKR DAEQWMSHR+LPDNL
Sbjct  368   YIWENCFAVFISISGLVLFSFLIGNMQTYLQSTTTRLEEMRVKRRDAEQWMSHRLLPDNL  427

Query  1136  RERIRRYEQYRWQETRGVDEESLISNLPKDLRRDINRHLCWSLLKRVHMFKTMDEQLLDA  1315
             R+RIRRYEQY+WQETRGV+EE+L+SNLPKDLRRDI RHLC +L+ RV MF+ MDEQLLDA
Sbjct  428   RKRIRRYEQYKWQETRGVNEENLLSNLPKDLRRDIKRHLCLALVMRVPMFEQMDEQLLDA  487

Query  1316  ICDRLKPVLYTEKSCIVREGDPVDEMIFVMRGNLLTMTTNGGRTGFLNSDVLNAGDFCGE  1495
             +CDRL+PVLYTE+S IVREGDPVDEM+F+MRG LLTMTTNGGRTGF NS+ L AGDFCGE
Sbjct  488   LCDRLQPVLYTEESYIVREGDPVDEMLFIMRGKLLTMTTNGGRTGFFNSEHLGAGDFCGE  547

Query  1496  ELLTWALDPNSSSSLPISTRTVQALTDVEAFALTADFLKFFASQYRRLHSKQLQHKFRFY  1675
             ELLTWALDP++S++LPISTRTVQAL +VEAFAL AD LKF ASQ+RRLHSKQL+H FRFY
Sbjct  548   ELLTWALDPHTSTNLPISTRTVQALVEVEAFALKADNLKFVASQFRRLHSKQLRHTFRFY  607

Query  1676  SHQWKTWAACFIQAAWRRHCRNKLEKSLREEEDRLQDALILRMRREEGETTPSLGATIYA  1855
             S QW+TWAACFIQA WRR  + +LE+SLREEE+RLQDAL     +E   ++PS GAT+YA
Sbjct  608   SQQWRTWAACFIQAFWRRCVKKRLEESLREEENRLQDALA----KEACGSSPSFGATVYA  663

Query  1856  SRFAANVLRTVRRN  1897
             SRFAAN+LRT+RR+
Sbjct  664   SRFAANILRTIRRS  677



>ref|XP_002889372.1| ATCNGC10 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH65631.1| ATCNGC10 [Arabidopsis lyrata subsp. lyrata]
Length=706

 Score =   801 bits (2070),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 396/616 (64%), Positives = 483/616 (78%), Gaps = 8/616 (1%)
 Frame = +2

Query  62    DPQGPFLQRWNRIFVIACILAATVDPLFFYIPVVDDQNKCLGLDRTLEITACILRSVFDF  241
             +PQ  FLQ WN+IF+ AC++A  +DPLFFYIP+VD    CL LD+ LEI A  LR++ D 
Sbjct  65    NPQDSFLQNWNKIFLFACVVALAIDPLFFYIPIVDGARHCLTLDKKLEIAASFLRTLIDA  124

Query  242   FYIFHIILQFRTGFVPPSSRVFGRGDLIVDPSAIAKRYFFSYFFIDILAVLPLPQVVLFM  421
             FYI HI+ QFRT ++ PSSRVFGRG+L+ D  AIA +Y  SYF ID+L++LPLPQ+V+  
Sbjct  125   FYIIHIVFQFRTAYIAPSSRVFGRGELVDDAKAIAIKYLSSYFIIDVLSILPLPQIVVLA  184

Query  422   MIPRADRPFIMVAKDILKVVILVQSVPRLLRIYPLYKEVTRTSGFFTETAWAGAAFNLFL  601
             +I   ++P  +  KD LK VI+ Q VPR+LR+YPLY EVTRTSG  TETAWAGAA+NL L
Sbjct  185   VIQSVNQPVSLFTKDYLKYVIIAQYVPRILRMYPLYTEVTRTSGIVTETAWAGAAWNLSL  244

Query  602   YMIASYVAGAIWYITAIERQDKCWRRACEKHGSCDIDFLYCTKLGRRGGDFSSSFLNTSC  781
             YM+AS+V GA+WY+ ++ER+D+CW+ ACEK   CD  FLYC          S++FL TSC
Sbjct  245   YMLASHVFGALWYLISVEREDRCWQEACEKTKGCDKKFLYC----ENDRTVSNNFLTTSC  300

Query  782   ALLEPENL-KADDFDFGIFLDALKSNVVEKRYFWSKLFYCFWWGLRNLSSLGQNLKTSNF  958
               ++P ++  +  F+FGIF DALKS VVE   FW K FYCFWWGLRNLS+LGQNL+TS F
Sbjct  301   PFIDPGDITNSTIFNFGIFTDALKSGVVESHDFWKKFFYCFWWGLRNLSALGQNLQTSKF  360

Query  959   VGEilfailisiiglilfslligNMQKYLQSITVRVEEMRVKRMDAEQWMSHRMLPDNLR  1138
             VGEI+FAI I I GL+LF+LLIGNMQKYL+S TVR EEMRV++ DAEQWMSHRMLP++LR
Sbjct  361   VGEIIFAISICISGLVLFALLIGNMQKYLESTTVREEEMRVRKRDAEQWMSHRMLPEDLR  420

Query  1139  ERIRRYEQYRWQETRGVDEESLISNLPKDLRRDINRHLCWSLLKRVHMFKTMDEQLLDAI  1318
             +RIRRYEQYRWQETRGV+EE+L+ NLPKDLRRDI RHLC  LLK+V +F+ MDEQLLDA+
Sbjct  421   KRIRRYEQYRWQETRGVEEETLLRNLPKDLRRDIKRHLCLDLLKKVPLFEIMDEQLLDAV  480

Query  1319  CDRLKPVLYTEKSCIVREGDPVDEMIFVMRGNLLTMTTNGGRTGFLNSDVLNAGDFCGEE  1498
             CDRLKPVLYTE S ++REGDPV EM+FVMRG L++ TTNGGR+GF N+  L A DFCGE+
Sbjct  481   CDRLKPVLYTENSYVIREGDPVGEMLFVMRGRLVSATTNGGRSGFFNAVNLKASDFCGED  540

Query  1499  LLTWALDPNSSSSLPISTRTVQALTDVEAFALTADFLKFFASQYRRLHSKQLQHKFRFYS  1678
             LL WALDP SSS  PISTRTVQALT+VEAFALTA+ LK  ASQ+RRLHSKQLQH FRFYS
Sbjct  541   LLPWALDPQSSSHFPISTRTVQALTEVEAFALTAEDLKSVASQFRRLHSKQLQHTFRFYS  600

Query  1679  HQWKTWAACFIQAAWRRHCRNKLEKSLREEEDRLQDALILRMRREEGETTP---SLGATI  1849
              QW+TW+  FIQAAWRR+CR KL KSLR+EE+RL++AL  + +     T     SLG  +
Sbjct  601   VQWRTWSVSFIQAAWRRYCRRKLAKSLRDEEERLREALANQDKERNAATVSSSLSLGGAL  660

Query  1850  YASRFAANVLRTVRRN  1897
             YASRFA+N L  +R N
Sbjct  661   YASRFASNALHNLRHN  676



>ref|XP_008233189.1| PREDICTED: cyclic nucleotide-gated ion channel 1-like [Prunus 
mume]
Length=721

 Score =   802 bits (2071),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 413/618 (67%), Positives = 486/618 (79%), Gaps = 9/618 (1%)
 Frame = +2

Query  47    KSKMHDPQGPFLQRWNRIFVIACILAATVDPLFFYIPVVDDQNKCLGLDRTLEITACILR  226
             + K+ DPQG FLQ WN+IFVI C++A ++DPLF Y  VVD ++  +  D+ L+I  C+LR
Sbjct  82    RRKILDPQGSFLQNWNKIFVITCVIAVSLDPLFLYTAVVDGEHMVVDWDQRLQIITCVLR  141

Query  227   SVFDFFYIFHIILQFRTGFVPPSSRVFGRGDLIVDPSAIAKRYFFSYFFIDILAVLPLPQ  406
             S  D F+I HII QFRTGF+ PSSRVFGRG+LI DP AIAKRY  SYF IDILA+ PLPQ
Sbjct  142   SFTDVFHILHIIFQFRTGFIAPSSRVFGRGELIDDPVAIAKRYLSSYFIIDILAIFPLPQ  201

Query  407   VVLFMMIPRADRPFIMVAKDILKVVILVQSVPRLLRIYPLYKEVTRTSGFFTETAWAGAA  586
             +V+F  IP   RP   V KD+L +VI+ Q  PRL RIYPLYKEVTRTSGF TETAWAGAA
Sbjct  202   MVVFFRIP-ISRPVPHVTKDLLLIVIVAQYGPRLWRIYPLYKEVTRTSGFLTETAWAGAA  260

Query  587   FNLFLYMIASYVAGAIWYITAIERQDKCWRRACEKHGSCDIDFLYCTKLGRRGGDFSSSF  766
             +NL LYM+AS+V GA WY+ ++E++  CWR     +  C    LYC    +         
Sbjct  261   YNLLLYMLASHVVGAFWYLFSVEQEYSCWRNQFHGNDFCK-KVLYCDPKYKADSSLIEK-  318

Query  767   LNTSCALLEPENLKADD-FDFGIFLDALKSNVVEKRYFWSKLFYCFWWGLRNLSSLGQNL  943
             LN SC  + P+ +K    F+FGIF DAL+S V+E   F  K  YCFWWGLRNLSS GQNL
Sbjct  319   LNGSCPFIGPDQIKNSTVFNFGIFTDALQSGVLETGDFPKKFLYCFWWGLRNLSSFGQNL  378

Query  944   KTSNFVGEilfailisiiglilfslligNMQKYLQSITVRVEEMRVKRMDAEQWMSHRML  1123
             KTS FV EI+FA+ ISI GL+LFSLLIGNMQK+LQS TVRVEEMRVKR DAEQWMSHRML
Sbjct  379   KTSTFVWEIVFAVFISIFGLVLFSLLIGNMQKFLQSTTVRVEEMRVKRRDAEQWMSHRML  438

Query  1124  PDNLRERIRRYEQYRWQETRGVDEESLISNLPKDLRRDINRHLCWSLLKRVHMFKTMDEQ  1303
             P+NLRERIR Y+QY+WQETRGV+EE+L+ NLPKDLR+DI RHLC +LL RV +F+ MDEQ
Sbjct  439   PENLRERIRCYDQYKWQETRGVEEETLVRNLPKDLRKDIKRHLCLALLNRVPIFEKMDEQ  498

Query  1304  LLDAICDRLKPVLYTEKSCIVREGDPVDEMIFVMRGNLLTMTTNGGRTGFLNSDVLNAGD  1483
             L+DA+CDRLKPVLYT+KS I REGDPVDEM+F+MRG L TMTTNGGRTGF N+  L AGD
Sbjct  499   LMDALCDRLKPVLYTDKSVITREGDPVDEMLFIMRGYLATMTTNGGRTGFFNTADLKAGD  558

Query  1484  FCGEELLTWALDPNSSSSLPISTRTVQALTDVEAFALTADFLKFFASQYRRLHSKQLQHK  1663
             FCGEELLTWALDPNSS++LPISTRTV+A T+VEAFAL AD LKF ASQ+RRLHSKQLQH 
Sbjct  559   FCGEELLTWALDPNSSTNLPISTRTVEAKTEVEAFALMADDLKFVASQFRRLHSKQLQHT  618

Query  1664  FRFYSHQWKTWAACFIQAAWRRHCRNKLEKSLREEEDRLQDALILRMRREEGETTPSLGA  1843
             FRFYS QW+TW+ACFIQAAWRRHC+ KLEKSLRE EDRLQDAL     RE G ++PSL A
Sbjct  619   FRFYSLQWRTWSACFIQAAWRRHCKRKLEKSLREAEDRLQDALT----REAG-SSPSLLA  673

Query  1844  TIYASRFAANVLRTVRRN  1897
             T+YAS+FAA+ LR +R+N
Sbjct  674   TVYASKFAAHALRNLRQN  691



>ref|XP_010522922.1| PREDICTED: putative cyclic nucleotide-gated ion channel 13 [Tarenaya 
hassleriana]
 ref|XP_010522923.1| PREDICTED: putative cyclic nucleotide-gated ion channel 13 [Tarenaya 
hassleriana]
 ref|XP_010522925.1| PREDICTED: putative cyclic nucleotide-gated ion channel 13 [Tarenaya 
hassleriana]
Length=715

 Score =   801 bits (2069),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 403/623 (65%), Positives = 491/623 (79%), Gaps = 13/623 (2%)
 Frame = +2

Query  47    KSKMHDPQGPFLQRWNRIFVIACILAATVDPLFFYIPVVDDQNKCLGLDRTLEITACILR  226
             K  +HDPQG FLQ WN+IF+ AC++A  +DP+FFY+PVVD +  CL LD  LE  AC+LR
Sbjct  75    KKNIHDPQGSFLQNWNKIFLFACVIALAIDPIFFYVPVVDGEKLCLDLDSKLERAACVLR  134

Query  227   SVFDFFYIFHIILQFRTGFVPPSSRVFGRGDLIVDPSAIAKRYFFSYFFIDILAVLPLPQ  406
             S+ D FY+ HI+ QFRT ++ P SR+FGRG+L+ DP AIA +Y  SYF IDIL++LPLPQ
Sbjct  135   SLVDAFYVIHIVFQFRTAYISPFSRIFGRGELVDDPKAIAIKYILSYFIIDILSILPLPQ  194

Query  407   VVLFMMIPRADRPFIMVAKDILKVVILVQSVPRLLRIYPLYKEVTRTSGFFTETAWAGAA  586
             +VL ++IP  +RP  ++ KD LK VI  Q VPR++RIYPLY EV RTSG FTETAWAGAA
Sbjct  195   LVLLVIIPNVNRPVSLITKDYLKSVIFAQYVPRIIRIYPLYSEVKRTSGLFTETAWAGAA  254

Query  587   FNLFLYMIASYVAGAIWYITAIERQDKCWRRACEK-HGSCDIDFLYCTKLGRRGGDFSSS  763
             +NLFLYM+AS+V GA+W++ +IER+D+CWR  C K  G C    LYC    R   DF   
Sbjct  255   WNLFLYMLASHVFGALWFLISIEREDRCWREECGKREGECQFKNLYCDDAHRMSNDF---  311

Query  764   FLNTSCALLEPENL-KADDFDFGIFLDALKSNVVEKRYFWSKLFYCFWWGLRNLSSLGQN  940
              L  SC  + P ++  +  F+FGIF DALKS +VE R FW K FYCFWWGLR+LSSLGQN
Sbjct  312   -LKNSCPFINPGDITNSTVFNFGIFNDALKSGIVESRDFWKKFFYCFWWGLRSLSSLGQN  370

Query  941   LKTSNFVGEilfailisiiglilfslligNMQKYLQSITVRVEEMRVKRMDAEQWMSHRM  1120
             L+TS FVGEI+F +LI + GL+LF+LLIGNMQKYL+S TVR EEMRV++ DAEQWMSHR+
Sbjct  371   LQTSKFVGEIIFVLLICVSGLVLFALLIGNMQKYLESTTVREEEMRVRKRDAEQWMSHRL  430

Query  1121  LPDNLRERIRRYEQYRWQETRGVDEESLISNLPKDLRRDINRHLCWSLLKRVHMFKTMDE  1300
             LP++LR+R+R+YEQY+WQETRGV+EE+L+ NLPKDL+RDI RHLC  LLK+V MF+ MDE
Sbjct  431   LPEDLRKRVRKYEQYKWQETRGVEEETLLRNLPKDLKRDIKRHLCLDLLKKVPMFEIMDE  490

Query  1301  QLLDAICDRLKPVLYTEKSCIVREGDPVDEMIFVMRGNLLTMTTNGGRTGFLNSDVLNAG  1480
             QLLDA+CDRLKPVLYTE S ++REGDPV+EM+FVMRG L++ TTNGGRTGF N+  L A 
Sbjct  491   QLLDAVCDRLKPVLYTENSYVIREGDPVEEMMFVMRGKLMSATTNGGRTGFFNAVYLKAS  550

Query  1481  DFCGEELLTWALDPNSSSSLPISTRTVQALTDVEAFALTADFLKFFASQYRRLHSKQLQH  1660
             DFCGE+LLTWALDP SSS  PISTRTVQALT+VEAFAL A+ LKF ASQ+RRLHSKQLQH
Sbjct  551   DFCGEDLLTWALDPQSSSHYPISTRTVQALTEVEAFALAAEDLKFVASQFRRLHSKQLQH  610

Query  1661  KFRFYSHQWKTWAACFIQAAWRRHCRNKLEKSLREEEDRLQDALILRMRREEG---ETTP  1831
              FRFYS QW+TW ACFIQAAWRRHCR KL +SLREEE++L+DAL     R+ G   E   
Sbjct  611   TFRFYSVQWRTWGACFIQAAWRRHCRRKLARSLREEEEKLRDAL----GRDHGHGQEPRL  666

Query  1832  SLGATIYASRFAANVLRTVRRNH  1900
             SL A +YASRFA N LR +R N+
Sbjct  667   SLRAAVYASRFATNALRNLRHNN  689



>ref|XP_007051571.1| Cyclic nucleotide-gated channel 13 [Theobroma cacao]
 gb|EOX95728.1| Cyclic nucleotide-gated channel 13 [Theobroma cacao]
Length=709

 Score =   801 bits (2068),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 426/648 (66%), Positives = 507/648 (78%), Gaps = 11/648 (2%)
 Frame = +2

Query  47    KSKMHDPQGPFLQRWNRIFVIACILAATVDPLFFYIPVVDDQNKCLGLDRTLEITACILR  226
             +  + +PQ  FLQ WN+IF+++C +A  +DPLFFYIPV+D + KCL LD  LEITAC+LR
Sbjct  72    RKSILNPQEQFLQNWNKIFLLSCTIALALDPLFFYIPVMDGKRKCLNLDEKLEITACVLR  131

Query  227   SVFDFFYIFHIILQFRTGFVPPSSRVFGRGDLIVDPSAIAKRYFFSYFFIDILAVLPLPQ  406
             +  D FYI HII QFRT F+ PSSRVFGRG+LI D  AIAKRY    F IDILA+LP PQ
Sbjct  132   TFMDAFYILHIIFQFRTAFIAPSSRVFGRGELIEDRWAIAKRYLSKNFIIDILAILPFPQ  191

Query  407   VVLFMMIPRADRPFIMVAKDILKVVILVQSVPRLLRIYPLYKEVTRTSGFFTETAWAGAA  586
             +V+ ++IP    P  +V K+ LK +I  Q VPR+LRI+PLYKEVTRTSG  TETAWAGAA
Sbjct  192   MVILIIIPTLKGPISLVTKEWLKYIIFCQYVPRILRIFPLYKEVTRTSGLLTETAWAGAA  251

Query  587   FNLFLYMIASYVAGAIWYITAIERQDKCWRRACEKHGSCDIDFLYCTKLGRRGGDFSSSF  766
              NLFLYM+AS+  GA+WY+ +IER+D+CWR A     S +   LYC        D     
Sbjct  252   LNLFLYMLASHFVGALWYLISIEREDRCWRDATP---SGERVALYCEDKSEINYDLVR-L  307

Query  767   LNTSCALLEPENLKADD-FDFGIFLDALKSNVVEKRYFWSKLFYCFWWGLRNLSSLGQNL  943
             LNTSC    P+++     F+FGIF+DAL+S VVE   F  K FYCFWWGLRNLSSLGQNL
Sbjct  308   LNTSCPFTNPDDITDPKVFNFGIFIDALESGVVETWDFPEKFFYCFWWGLRNLSSLGQNL  367

Query  944   KTSNFVGEilfailisiiglilfslligNMQKYLQSITVRVEEMRVKRMDAEQWMSHRML  1123
             KTS FVGEI+FA+ ISI GLILFSLLIGNMQKYLQS  VR+EEMRVKR DAEQWMSHRML
Sbjct  368   KTSTFVGEIIFAVFISIAGLILFSLLIGNMQKYLQSTGVRIEEMRVKRQDAEQWMSHRML  427

Query  1124  PDNLRERIRRYEQYRWQETRGVDEESLISNLPKDLRRDINRHLCWSLLKRVHMFKTMDEQ  1303
             P +LRERIRRYEQY+WQETRGV EE+LI+NLPKDL+RDI RHLC +LLK+V MF+ MDE+
Sbjct  428   PKSLRERIRRYEQYKWQETRGVVEETLINNLPKDLKRDIKRHLCLALLKKVPMFEKMDER  487

Query  1304  LLDAICDRLKPVLYTEKSCIVREGDPVDEMIFVMRGNLLTMTTNGGRTGFLNSDVLNAGD  1483
             LLDA+CDRLK  LYT+KS IVREGDPV+EM+F++RGNL++ TTNGGRTGF N+  L AG+
Sbjct  488   LLDAMCDRLKLALYTDKSYIVREGDPVEEMLFIIRGNLVSTTTNGGRTGFFNAVHLKAGN  547

Query  1484  FCGEELLTWALDPNSSSSLPISTRTVQALTDVEAFALTADFLKFFASQYRRLHSKQLQHK  1663
             FCG++LLTWALD  SSS+LPISTRTVQAL +VEAFAL AD LKF ASQ+RRLHSKQ QH 
Sbjct  548   FCGDDLLTWALDLQSSSNLPISTRTVQALKEVEAFALMADDLKFVASQFRRLHSKQFQHT  607

Query  1664  FRFYSHQWKTWAACFIQAAWRRHCRNKLEKSLREEEDRLQDALILRMRREEGETTPSLGA  1843
             F+FYS QW+TWAA FIQAAWRRHC+ KL KSLRE ED+LQDAL      +E  T+PSLGA
Sbjct  608   FKFYSVQWQTWAASFIQAAWRRHCKRKLVKSLREAEDKLQDALA-----KESGTSPSLGA  662

Query  1844  TIYASRFAANVLRTVRRNHplsvpklsprlpplllqkpAEPDFSAPEN  1987
             T+YAS+FAAN LR +R ++     +L  RLPPLL QKPAEPDF+A ++
Sbjct  663   TLYASKFAANALRNLRHSN-SQTTRLPQRLPPLLPQKPAEPDFAAEDS  709



>ref|XP_011023191.1| PREDICTED: putative cyclic nucleotide-gated ion channel 13 [Populus 
euphratica]
 ref|XP_011023192.1| PREDICTED: putative cyclic nucleotide-gated ion channel 13 [Populus 
euphratica]
Length=720

 Score =   800 bits (2067),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 408/649 (63%), Positives = 496/649 (76%), Gaps = 15/649 (2%)
 Frame = +2

Query  53    KMHDPQGPFLQRWNRIFVIACILAATVDPLFFYIPVVD--DQNKCLGLDRTLEITACILR  226
             K+ DPQG FLQ WN+IF++ C+LA  +DPLFFYIP V+  D++KCL LD  +E  AC+LR
Sbjct  84    KILDPQGSFLQNWNKIFMLVCVLAVAIDPLFFYIPWVNGTDKDKCLDLDHKMEAAACVLR  143

Query  227   SVFDFFYIFHIILQFRTGFVPPSSRVFGRGDLIVDPSAIAKRYFFSYFFIDILAVLPLPQ  406
             +  D  YI  I  QFRTGF+ PSSRVFGRG+L+ DP  IAK+Y  S+F +DILA+LPLPQ
Sbjct  144   TFIDVVYILRIAFQFRTGFIAPSSRVFGRGELVEDPKVIAKKYLTSHFLVDILAILPLPQ  203

Query  407   VVLFMMIPRADRPFIMVAKDILKVVILVQSVPRLLRIYPLYKEVTRTSGFFTETAWAGAA  586
             VV+ +++P  D P  + AK++L+ VI  Q +PR +RIYPL+KE+TRTSG  TETAWAGA 
Sbjct  204   VVVIIILPSVDGPVSLAAKNLLEFVIFSQYIPRFVRIYPLFKEITRTSGILTETAWAGAV  263

Query  587   FNLFLYMIASYVAGAIWYITAIERQDKCWRRACEKHGSCDIDFLYCTKLGRRGGDFSSSF  766
             FNLFLYM+AS++ GA WY+ +IER+D CWR  C+    CD  + YC    R     + +F
Sbjct  264   FNLFLYMLASHIIGAFWYLFSIEREDSCWREVCKDRAGCDSTYWYCGNHRRE----NYTF  319

Query  767   LNTSCALLEPENL-KADDFDFGIFLDALKSNVVEKRYFWSKLFYCFWWGLRNLSSLGQNL  943
             L  SC  ++P+ +  +  F+FGIF+DAL S VVE  YF  K FYCFWWGLRNLSSLGQNL
Sbjct  320   LTESCPFIQPDQIHNSSVFNFGIFIDALDSGVVESTYFPRKFFYCFWWGLRNLSSLGQNL  379

Query  944   KTSNFVGEilfailisiiglilfslligNMQKYLQSITVRVEEMRVKRMDAEQWMSHRML  1123
             KTS F+GEILFAI ISI GL+LF+LLIGNMQKYL+S TVR+EEMRVKR D+EQWMSHRML
Sbjct  380   KTSTFIGEILFAIFISIAGLVLFALLIGNMQKYLESTTVRIEEMRVKRRDSEQWMSHRML  439

Query  1124  PDNLRERIRRYEQYRWQETRGVDEESLISNLPKDLRRDINRHLCWSLLKRVHMFKTMDEQ  1303
             PDNL+ERIRR+EQY+WQETRGV+E  LI NLPKDLRRDINRHLC  L+K+V +F+ MDEQ
Sbjct  440   PDNLKERIRRHEQYKWQETRGVEERGLIRNLPKDLRRDINRHLCLDLIKKVPIFEKMDEQ  499

Query  1304  LLDAICDRLKPVLYTEKSCIVREGDPVDEMIFVMRGNLLTMTTNGGRTGFLNSDVLNAGD  1483
             +LDA+CDRLK  LYT+ S IVREGDPVDEM+F+MRG+LL++TTNGGRTGF N+  L AGD
Sbjct  500   ILDAVCDRLKATLYTKDSYIVREGDPVDEMLFIMRGHLLSVTTNGGRTGFFNAVSLKAGD  559

Query  1484  FCGEELLTWALDPNSSSSLPISTRTVQALTDVEAFALTADFLKFFASQYRRLHSKQLQHK  1663
             FCGE LLTWALDP  SS+LPISTRTVQAL++VEAFAL A+ LK  ASQ+RRLH K +QH 
Sbjct  560   FCGEGLLTWALDPQ-SSNLPISTRTVQALSEVEAFALEAEDLKTVASQFRRLHHKDIQHT  618

Query  1664  FRFYSHQWKTWAACFIQAAWRRHCRNKLEKSLREEEDRLQDALILRMRREEGETTPSLGA  1843
             FR +S QW+TWAACFIQAAW RHCR K  KSLR+ E++LQD L       E  T PSL  
Sbjct  619   FRLFSVQWRTWAACFIQAAWHRHCRRKQAKSLRQAEEKLQDVLA-----NEASTAPSLDI  673

Query  1844  TIYASRFAANVLRTVRRNHplsvpklsprlpplllqkpAEPDFSAPENN  1990
              IYAS+FAAN LR +R+N   +     P+    L QKP EPDFSA  + 
Sbjct  674   AIYASQFAANALRNLRQN--GTHAARLPQRLSFLPQKPTEPDFSAQHHK  720



>ref|XP_010049315.1| PREDICTED: cyclic nucleotide-gated ion channel 1 [Eucalyptus 
grandis]
 ref|XP_010049323.1| PREDICTED: cyclic nucleotide-gated ion channel 1 [Eucalyptus 
grandis]
 ref|XP_010049330.1| PREDICTED: cyclic nucleotide-gated ion channel 1 [Eucalyptus 
grandis]
 gb|KCW89173.1| hypothetical protein EUGRSUZ_A01488 [Eucalyptus grandis]
Length=712

 Score =   796 bits (2056),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 425/647 (66%), Positives = 513/647 (79%), Gaps = 14/647 (2%)
 Frame = +2

Query  47    KSKMHDPQGPFLQRWNRIFVIACILAATVDPLFFYIPVVDDQNKCLGLDRTLEITACILR  226
             + ++ DPQGPFLQ+WN+IFV++CILA ++DPLF+Y+P++DD  KCL  DR +EITA +LR
Sbjct  80    EKRVLDPQGPFLQKWNKIFVLSCILAVSLDPLFYYVPIIDDDQKCLSFDRKMEITATVLR  139

Query  227   SVFDFFYIFHIILQFRTGFVPPSSRVFGRGDLIVDPSAIAKRYFFSYFFIDILAVLPLPQ  406
             S  D FYI HII QF TGF+ P SRVFGRG L+ D  AIAK+Y  SYF IDILAVLPLPQ
Sbjct  140   SFTDIFYILHIIFQFSTGFIAPDSRVFGRGVLVEDTLAIAKKYIVSYFLIDILAVLPLPQ  199

Query  407   VVLFMMIPRADRPFIMVAKDILKVVILVQSVPRLLRIYPLYKEVTRTSGFFTETAWAGAA  586
             VV++++IP+      +  K++LK V+  Q +PR++RIYPLYKEVTR+SG  TETAWAGAA
Sbjct  200   VVIWIVIPKLSGWRSLNTKNLLKFVVFFQYIPRVIRIYPLYKEVTRSSGILTETAWAGAA  259

Query  587   FNLFLYMIASYVAGAIWYITAIERQDKCWRRACEKHGSCDIDFLYCTKLGRRGGDFSSSF  766
             FNL LYM+AS+V GA WY+ +IER+  CW++AC+++G C+   LYC    +        F
Sbjct  260   FNLILYMLASHVMGAFWYLFSIERETTCWKQACDQNG-CNRASLYC----QDSPHIVYKF  314

Query  767   LNTSCALLEPENLKADDFDFGIFLDALKSNVVEKRYFWSKLFYCFWWGLRNLSSLGQNLK  946
             LNTSC +  P       FDFGIFL+AL + VV+   F  K F+CFWWGL+NLSSLGQNLK
Sbjct  315   LNTSCPIQTPNTTL---FDFGIFLNALDAGVVQSTDFPQKFFFCFWWGLQNLSSLGQNLK  371

Query  947   TSNFVGEilfailisiiglilfslligNMQKYLQSITVRVEEMRVKRMDAEQWMSHRMLP  1126
             TS +V EI FA+ I+I GL+LFSLLIGNMQ YLQS T R+EEMRVKR DAEQWMSHR+LP
Sbjct  372   TSTYVWEICFAVFIAISGLVLFSLLIGNMQTYLQSTTTRLEEMRVKRRDAEQWMSHRLLP  431

Query  1127  DNLRERIRRYEQYRWQETRGVDEESLISNLPKDLRRDINRHLCWSLLKRVHMFKTMDEQL  1306
             +NL+ERIRRYE Y+WQETRGVDEE+L+ NLPKDLRRDI RHLC +LL RV +F+ MD+QL
Sbjct  432   ENLKERIRRYEHYKWQETRGVDEENLLCNLPKDLRRDIKRHLCLALLMRVPIFEKMDDQL  491

Query  1307  LDAICDRLKPVLYTEKSCIVREGDPVDEMIFVMRGNLLTMTTNGGRTGFLNSDVLNAGDF  1486
             LDA+CDRLKPVLYTE S IVREGDPVD M+F+MRG LLT TTNGGRTGF N + L AGDF
Sbjct  492   LDAMCDRLKPVLYTEDSYIVREGDPVDVMLFIMRGRLLTTTTNGGRTGFFNLEYLKAGDF  551

Query  1487  CGEELLTWALDPNSSSSLPISTRTVQALTDVEAFALTADFLKFFASQYRRLHSKQLQHKF  1666
             CGEELLTWALDP+SSS+ PISTRTVQAL +VEAFAL AD LK  ASQ+RRLHSKQL+H F
Sbjct  552   CGEELLTWALDPHSSSNFPISTRTVQALVEVEAFALVADDLKLVASQFRRLHSKQLRHTF  611

Query  1667  RFYSHQWKTWAACFIQAAWRRHCRNKLEKSLREEEDRLQDALILRMRREEGETTPSLGAT  1846
             RFYS QW+TWAACF+QAAWRR+ R KLE+SLREEE+RLQDAL      + G ++PSLGAT
Sbjct  612   RFYSQQWRTWAACFLQAAWRRYTRKKLEESLREEENRLQDALA-----KGGGSSPSLGAT  666

Query  1847  IYASRFAANVLRTVRRNHplsvpklsprlpplllqkpAEPDFSAPEN  1987
             IYASRFAAN LR + R+      ++  R+PP+LLQKPAEPDF+A E 
Sbjct  667   IYASRFAANALRAL-RSKGSRKARIPERIPPMLLQKPAEPDFTAEEQ  712



>ref|XP_010327010.1| PREDICTED: cyclic nucleotide-gated ion channel 1-like isoform 
X2 [Solanum lycopersicum]
Length=649

 Score =   793 bits (2048),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 415/571 (73%), Positives = 471/571 (82%), Gaps = 10/571 (2%)
 Frame = +2

Query  266   QFRTGFVPPSSRVFGRGDLIVDPSAIAKRYFFSYFFIDILAVLPLPQVVLFMMIPRADRP  445
             +FRTGF+ PSSRVFGRG+LI D S IAKRY F YF ID+LAVLPLPQ+VLF++ P  +RP
Sbjct  89    KFRTGFITPSSRVFGRGELIQDSSLIAKRYLFPYFIIDVLAVLPLPQMVLFIIAPNTNRP  148

Query  446   FIMVAKDILKVVILVQSVPRLLRIYPLYKEVTRTSGFFTETAWAGAAFNLFLYMIASYVA  625
               +V +  L +VIL Q +PR LRIYPLYKEVTRT+GF TETAWAGAAFNLFL+MIAS V 
Sbjct  149   ISLVTRKQLVIVILAQYIPRSLRIYPLYKEVTRTTGFLTETAWAGAAFNLFLFMIASNVV  208

Query  626   GAIWYITAIERQDKCWRRACEKHGSCDIDFLYCTKLGRRGGDFSSSFLNTSCALLEPENL  805
             GA WY+  IERQD CWR+ C     C +D + C  LG+     ++ FLN+SC LL+PE++
Sbjct  209   GAFWYLITIERQDDCWRKVCRGIKKCVLDSICCGHLGKA----NTQFLNSSCPLLKPEDV  264

Query  806   KADDFDFGIFLDALKSNVVEKRYFWSKLFYCFWWGLRNLSSLGQNLKTSNFVGEilfail  985
             +  DFDFGIFLDAL S V EKR FWSKL YCFWWGLRNLSSLGQ+LKTSN V EILFA+ 
Sbjct  265   QEHDFDFGIFLDALHSRVAEKRNFWSKLSYCFWWGLRNLSSLGQDLKTSNSVWEILFAVF  324

Query  986   isiiglilfslligNMQKYLQSITVRVEEMRVKRMDAEQWMSHRMLPDNLRERIRRYEQY  1165
             I I+GLILFSLLIGNMQ+YLQSITVRVE MR++R DAEQWMSHRMLP+NLRERIRRYEQY
Sbjct  325   ICIVGLILFSLLIGNMQEYLQSITVRVEGMRLRRRDAEQWMSHRMLPENLRERIRRYEQY  384

Query  1166  RWQETRGVDEESLISNLPKDLRRDINRHLCWSLLKRVHMFKTMDEQLLDAICDRLKPVLY  1345
             +WQETRGVDE+ LISNLPKDL+RD+ RHLCWSLLKRV MF+ MDEQLLDA+CDRLKP L+
Sbjct  385   KWQETRGVDEDYLISNLPKDLKRDVKRHLCWSLLKRVPMFEKMDEQLLDALCDRLKPALF  444

Query  1346  TEKSCIVREGDPVDEMIFVMRGNLLTMTTNGGRTGFLNSDVLNAGDFCGEELLTWALDPN  1525
             TE S I+REGDPV EM+F+MRG LLTMTTNGGRTGF NS  L AGDFCGEELLTWALDP+
Sbjct  445   TENSFIIREGDPVSEMLFLMRGTLLTMTTNGGRTGFFNSASLKAGDFCGEELLTWALDPH  504

Query  1526  SSSSLPISTRTVQALTDVEAFALTADFLKFFASQYRRLHSKQLQHKFRFYSHQWKTWAAC  1705
             SS++LP STRTV+A+ DVEAFALTAD LKF A+Q+RRLHSKQ++H FRFYS  W+TWAAC
Sbjct  505   SSTTLPSSTRTVKAVIDVEAFALTADDLKFVAAQFRRLHSKQIRHTFRFYSQHWRTWAAC  564

Query  1706  FIQAAWRRHCRNKLEKSLREEEDRLQDALILRMRREEGETTPSLGATIYASRFAANVLRT  1885
             FIQAAWRRHCRNKLEKSL+EEEDRLQ AL       E    PSLGATIYASRFAAN LR 
Sbjct  565   FIQAAWRRHCRNKLEKSLKEEEDRLQAALA-----NETANLPSLGATIYASRFAANALRA  619

Query  1886  VRRNHplsvpklsprlpplllqkpAEPDFSA  1978
             +RRNH     K   RL PLLLQKPAEPDFS+
Sbjct  620   LRRNH-PRGSKSFTRLSPLLLQKPAEPDFSS  649



>ref|XP_004494973.1| PREDICTED: cyclic nucleotide-gated ion channel 1-like [Cicer 
arietinum]
Length=716

 Score =   795 bits (2052),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 419/650 (64%), Positives = 502/650 (77%), Gaps = 14/650 (2%)
 Frame = +2

Query  47    KSKMHDPQGPFLQRWNRIFVIACILAATVDPLFFYIPVVDDQNKCLGLDRTLEITACILR  226
             K K+ DPQGP LQ+WN+IFV+ C++A ++DPLFFYIPV+  + KCL LD TL+ TA +LR
Sbjct  78    KRKILDPQGPMLQKWNKIFVLTCVMAISMDPLFFYIPVIVGREKCLDLDGTLQTTASVLR  137

Query  227   SVFDFFYIFHIILQFRTGFVPPSSRVFGRGDLIVDPSAIAKRYFFSYFFIDILAVLPLPQ  406
             + FD FYI  II QFRTGF+ PSSRVFGRG+LI DP AI KRY  S+F IDIL++LP+PQ
Sbjct  138   TFFDLFYILRIIFQFRTGFIAPSSRVFGRGELIDDPVAIIKRYLSSHFIIDILSILPIPQ  197

Query  407   VVLFMMIPRADRPFIMVAKDILKVVILVQSVPRLLRIYPLYKEVTRTSGFFTETAWAGAA  586
             V++  +IP         AKD LK  +L+Q VPRLLRI PL+KEVTRTSG  TETAWAGA 
Sbjct  198   VIVLAIIPHLKNSGPFAAKDWLKYTVLIQYVPRLLRIRPLFKEVTRTSGILTETAWAGAV  257

Query  587   FNLFLYMIASYVAGAIWYITAIERQDKCWRRACEKHGSCDIDFLYCTKLGRRGGDFSSSF  766
             +NL LYM+AS+V GA WY+ ++E Q +CWRR  +        +L C     R  D  S  
Sbjct  258   YNLLLYMLASHVVGANWYLLSVESQVRCWRREMKNASLFHDSYLGCG----RQNDTVSLL  313

Query  767   LNTSCALLEPENLKAD-DFDFGIFLDALKSNVVEKRY-FWSKLFYCFWWGLRNLSSLGQN  940
             LN++C L++P+ +     F+FGIF DA +S V++    F  K FYCFWWGLR LSSLGQN
Sbjct  314   LNSTCLLVDPDQINDSYTFNFGIFFDAQQSRVIDATTDFPQKFFYCFWWGLRGLSSLGQN  373

Query  941   LKTSNFVGEilfailisiiglilfslligNMQKYLQSITVRVEEMRVKRMDAEQWMSHRM  1120
             LKTS +V EI FAI I+I GL LFSLLIGNMQKYL+S TVR EEMRVKR DAE+WMSHRM
Sbjct  374   LKTSTYVPEIAFAIFIAIFGLFLFSLLIGNMQKYLESTTVREEEMRVKRRDAERWMSHRM  433

Query  1121  LPDNLRERIRRYEQYRWQETRGVDEESLISNLPKDLRRDINRHLCWSLLKRVHMFKTMDE  1300
             LPDNL++RIRRYEQY+WQE RGV+EE+LI NLPKDLRRDI RHLC +L+K+V MF+ MD 
Sbjct  434   LPDNLKQRIRRYEQYKWQENRGVEEETLIHNLPKDLRRDIKRHLCLALVKKVPMFEKMDG  493

Query  1301  QLLDAICDRLKPVLYTEKSCIVREGDPVDEMIFVMRGNLLTMTTNGGRTGFLNSDVLNAG  1480
             QLLDA+CDRLKPVLYTEKSCIVRE DPVDEM+F+MRG + TMTTNGGRTGF NS  L  G
Sbjct  494   QLLDAMCDRLKPVLYTEKSCIVREEDPVDEMLFIMRGKVATMTTNGGRTGFFNSLFLMPG  553

Query  1481  DFCGEELLTWALDPNSSSSLPISTRTVQALTDVEAFALTADFLKFFASQYRRL-HSKQLQ  1657
             DFCGEELLTWALDPNSSS+LP STRTV+ +++VEAFAL AD LKF ASQ+RRL +SKQLQ
Sbjct  554   DFCGEELLTWALDPNSSSNLPTSTRTVETISEVEAFALMADDLKFVASQFRRLINSKQLQ  613

Query  1658  HKFRFYSHQWKTWAACFIQAAWRRHCRNKLEKSLREEEDRLQDALILRMRREEGETTPSL  1837
             H FR YS QWKTWAACFIQAAWRR+ + K++++LRE ED+LQ+AL      EEG T  SL
Sbjct  614   HTFRLYSPQWKTWAACFIQAAWRRYRKKKIDRTLREAEDKLQNALA----NEEGSTI-SL  668

Query  1838  GATIYASRFAANVLRTVRRNHplsvpklsprlpplllqkpAEPDFSAPEN  1987
             GATIYASRFAAN LR +R N+     ++  RL PLL  KPAEPDF+A ++
Sbjct  669   GATIYASRFAANALRNLRENN--RHNRMPQRLLPLLPPKPAEPDFTAQKH  716



>ref|XP_004494812.1| PREDICTED: cyclic nucleotide-gated ion channel 1-like [Cicer 
arietinum]
Length=718

 Score =   794 bits (2051),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 419/650 (64%), Positives = 502/650 (77%), Gaps = 14/650 (2%)
 Frame = +2

Query  47    KSKMHDPQGPFLQRWNRIFVIACILAATVDPLFFYIPVVDDQNKCLGLDRTLEITACILR  226
             K K+ DPQGP LQ+WN+IFV+ C++A ++DPLFFYIPV+  + KCL LD TL+ TA +LR
Sbjct  80    KRKILDPQGPMLQKWNKIFVLTCVMAISMDPLFFYIPVIVGREKCLDLDGTLQTTASVLR  139

Query  227   SVFDFFYIFHIILQFRTGFVPPSSRVFGRGDLIVDPSAIAKRYFFSYFFIDILAVLPLPQ  406
             + FD FYI  II QFRTGF+ PSSRVFGRG+LI DP AI KRY  S+F IDIL++LP+PQ
Sbjct  140   TFFDLFYILRIIFQFRTGFIAPSSRVFGRGELIDDPVAIIKRYLSSHFIIDILSILPIPQ  199

Query  407   VVLFMMIPRADRPFIMVAKDILKVVILVQSVPRLLRIYPLYKEVTRTSGFFTETAWAGAA  586
             V++  +IP         AKD LK  +L+Q VPRLLRI PL+KEVTRTSG  TETAWAGA 
Sbjct  200   VIVLAIIPHLKNSGPFAAKDWLKYTVLIQYVPRLLRIRPLFKEVTRTSGILTETAWAGAV  259

Query  587   FNLFLYMIASYVAGAIWYITAIERQDKCWRRACEKHGSCDIDFLYCTKLGRRGGDFSSSF  766
             +NL LYM+AS+V GA WY+ ++E Q +CWRR  +        +L C     R  D  S  
Sbjct  260   YNLLLYMLASHVVGANWYLLSVESQVRCWRREMKNASLFHDSYLGCG----RQNDTVSLL  315

Query  767   LNTSCALLEPENLKAD-DFDFGIFLDALKSNVVEKRY-FWSKLFYCFWWGLRNLSSLGQN  940
             LN++C L++P+ +     F+FGIF DA +S V++    F  K FYCFWWGLR LSSLGQN
Sbjct  316   LNSTCLLVDPDQINDSYTFNFGIFFDAQQSRVIDATTDFPQKFFYCFWWGLRGLSSLGQN  375

Query  941   LKTSNFVGEilfailisiiglilfslligNMQKYLQSITVRVEEMRVKRMDAEQWMSHRM  1120
             LKTS +V EI FAI I+I GL LFSLLIGNMQKYL+S TVR EEMRVKR DAE+WMSHRM
Sbjct  376   LKTSTYVPEIAFAIFIAIFGLFLFSLLIGNMQKYLESTTVREEEMRVKRRDAERWMSHRM  435

Query  1121  LPDNLRERIRRYEQYRWQETRGVDEESLISNLPKDLRRDINRHLCWSLLKRVHMFKTMDE  1300
             LPDNL++RIRRYEQY+WQE RGV+EE+LI NLPKDLRRDI RHLC +L+K+V MF+ MD 
Sbjct  436   LPDNLKQRIRRYEQYKWQENRGVEEETLIHNLPKDLRRDIKRHLCLALVKKVPMFEKMDG  495

Query  1301  QLLDAICDRLKPVLYTEKSCIVREGDPVDEMIFVMRGNLLTMTTNGGRTGFLNSDVLNAG  1480
             QLLDA+CDRLKPVLYTEKSCIVRE DPVDEM+F+MRG + TMTTNGGRTGF NS  L  G
Sbjct  496   QLLDAMCDRLKPVLYTEKSCIVREEDPVDEMLFIMRGKVATMTTNGGRTGFFNSLFLMPG  555

Query  1481  DFCGEELLTWALDPNSSSSLPISTRTVQALTDVEAFALTADFLKFFASQYRRL-HSKQLQ  1657
             DFCGEELLTWALDPNSSS+LP STRTV+ +++VEAFAL AD LKF ASQ+RRL +SKQLQ
Sbjct  556   DFCGEELLTWALDPNSSSNLPTSTRTVETISEVEAFALMADDLKFVASQFRRLINSKQLQ  615

Query  1658  HKFRFYSHQWKTWAACFIQAAWRRHCRNKLEKSLREEEDRLQDALILRMRREEGETTPSL  1837
             H FR YS QWKTWAACFIQAAWRR+ + K++++LRE ED+LQ+AL      EEG T  SL
Sbjct  616   HTFRLYSPQWKTWAACFIQAAWRRYRKKKIDRTLREAEDKLQNALA----NEEGSTI-SL  670

Query  1838  GATIYASRFAANVLRTVRRNHplsvpklsprlpplllqkpAEPDFSAPEN  1987
             GATIYASRFAAN LR +R N+     ++  RL PLL  KPAEPDF+A ++
Sbjct  671   GATIYASRFAANALRNLRENN--RHNRMPQRLLPLLPPKPAEPDFTAQKH  718



>ref|XP_003520870.1| PREDICTED: cyclic nucleotide-gated ion channel 1-like [Glycine 
max]
Length=728

 Score =   794 bits (2050),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 420/658 (64%), Positives = 505/658 (77%), Gaps = 19/658 (3%)
 Frame = +2

Query  47    KSKMHDPQGPFLQRWNRIFVIACILAATVDPLFFYIPVVDDQNKCLGLDRTLEITACILR  226
             + K+ DPQGP LQ+WN+IFVI C++A +VDPLFFYIPV+++  K + LD  L+ITA +LR
Sbjct  79    RKKILDPQGPILQKWNKIFVITCVMAVSVDPLFFYIPVINNARKRVDLDGVLQITASVLR  138

Query  227   SVFDFFYIFHIILQFRTGFVPPSSRVFGRGDLIVDPSAIAKRYFFSYFFIDILAVLPLPQ  406
             + FD FYI  II QF+TGF+ PSSRVFGRG+LI DP AI KRY  S+F ID+L+++PLPQ
Sbjct  139   TFFDLFYILRIIFQFKTGFIAPSSRVFGRGELIDDPMAIMKRYLTSHFIIDVLSIIPLPQ  198

Query  407   VVLFMMIPRADRPFIMVAKDILKVVILVQSVPRLLRIYPLYKEVTRTSGFFTETAWAGAA  586
             V+L  +          VAKD+LK  +L+Q VPRLLRIYPL+KEVTRTSG  TETAWAGAA
Sbjct  199   VILLAINRNLKTSDPFVAKDLLKYSVLIQYVPRLLRIYPLFKEVTRTSGILTETAWAGAA  258

Query  587   FNLFLYMIASYVAGAIWYITAIERQDKCWRRACEKHGSCDIDFLYCTKLGRRG-------  745
              NLFLYM+AS+V GA WY+ ++E + +CWR   +    C  +++ C    ++        
Sbjct  259   SNLFLYMLASHVVGANWYMLSVESEVRCWRE-LKNASLCHREYMSCGDRNQKNFTLLNLL  317

Query  746   --GDFSSSFLNTSCALLEPENLK-ADDFDFGIFLDALKSNVVEKRY-FWSKLFYCFWWGL  913
                  + + LN +C+L++P+ +K    F+FGIF DAL S+VVE    F  K FYCFWWGL
Sbjct  318   NQTLLNQTVLNQTCSLVDPDTIKDPKTFNFGIFSDALDSHVVESTTDFPQKFFYCFWWGL  377

Query  914   RNLSSLGQNLKTSNFVGEilfailisiiglilfslligNMQKYLQSITVRVEEMRVKRMD  1093
             RNLSSLGQNLKTS  V EI FAI I+I GL+LFSLLIGNMQKYLQS TVRVEEMRVKR D
Sbjct  378   RNLSSLGQNLKTSTDVSEIAFAIFIAIFGLVLFSLLIGNMQKYLQSTTVRVEEMRVKRQD  437

Query  1094  AEQWMSHRMLPDNLRERIRRYEQYRWQETRGVDEESLISNLPKDLRRDINRHLCWSLLKR  1273
             AEQWMSHRMLP+NL+ERIR+YEQY+WQE +GV+EE+LI NLPKDLRRDI RHLC +L+K+
Sbjct  438   AEQWMSHRMLPENLKERIRKYEQYQWQENKGVEEEALIRNLPKDLRRDIKRHLCLALVKK  497

Query  1274  VHMFKTMDEQLLDAICDRLKPVLYTEKSCIVREGDPVDEMIFVMRGNLLTMTTNGGRTGF  1453
             V MF+ MDEQLLDA+CDRLKPVLYTEKS IVRE DPVDEM+F+MRG + TMTTNGGRTGF
Sbjct  498   VPMFEKMDEQLLDAMCDRLKPVLYTEKSYIVREEDPVDEMLFIMRGKVSTMTTNGGRTGF  557

Query  1454  LNSDVLNAGDFCGEELLTWALDPNSSSSLPISTRTVQALTDVEAFALTADFLKFFASQYR  1633
              NS  L AGDFCGEELLTWALDPNSSS+LPISTRTV+ +++VEAFAL AD LKF ASQ+R
Sbjct  558   FNSMFLMAGDFCGEELLTWALDPNSSSNLPISTRTVETISEVEAFALMADDLKFVASQFR  617

Query  1634  RLHSKQLQHKFRFYSHQWKTWAACFIQAAWRRHCRNKLEKSLREEEDRLQDALILRMRRE  1813
             RLHSKQLQH FRFYS QWKTWAA FIQAAWRR+ + K+E+SL + E  LQDAL      E
Sbjct  618   RLHSKQLQHAFRFYSSQWKTWAATFIQAAWRRYWKKKIERSLCKAEADLQDALA----NE  673

Query  1814  EGETTPSLGATIYASRFAANVLRTVRRNHplsvpklsprlpplllqkpAEPDFSAPEN  1987
             EG +  SLGATIYASRFA N LR +R N       +  RL  LL  KPAEPDF+A ++
Sbjct  674   EGSSL-SLGATIYASRFAVNALRNLREN--SRHNTMQQRLLSLLPPKPAEPDFTAQKH  728



>gb|KHN35375.1| Cyclic nucleotide-gated ion channel 1 [Glycine soja]
Length=680

 Score =   790 bits (2039),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 421/666 (63%), Positives = 506/666 (76%), Gaps = 27/666 (4%)
 Frame = +2

Query  47    KSKMHDPQGPFLQRWNRIFVIACILAATVDPLFFYIPVVDDQNKCLGLDRTLEITACILR  226
             + K+ DPQGP LQ+WN+IFVI C++A +VDPLFFYIPV+++  K + LD  L+ITA +LR
Sbjct  23    RKKILDPQGPILQKWNKIFVITCVMAVSVDPLFFYIPVINNARKRVDLDGVLQITASVLR  82

Query  227   SVFDFFYIFHIILQFRTGFVPPSSRVFGRGDLIVDPSAIAKRYFFSYFFIDILAVLPLPQ  406
             + FD FYI  II QF+TGF+ PSSRVFGRG+LI DP AI KRY  S+F ID+L+++PLPQ
Sbjct  83    TFFDLFYILRIIFQFKTGFIAPSSRVFGRGELIDDPMAIMKRYLTSHFIIDVLSIIPLPQ  142

Query  407   VVLFMMIPRADRPFIMVAKDILKVVILVQSVPRLLRIYPLYKEVTRTSGFFTETAWAGAA  586
             V+L  +          VAKD+LK  +L+Q VPRLLRIYPL+KEVTRTSG  TETAWAGAA
Sbjct  143   VILLAINRNLKTSDPFVAKDLLKYSVLIQYVPRLLRIYPLFKEVTRTSGILTETAWAGAA  202

Query  587   FNLFLYMIASYVAGAIWYITAIERQDKCWRRACEKHGSCDIDFLYCTKLGRRG-------  745
             FNLFLYM+AS+V GA WY+ ++E + +CWR   +    C  +++ C    ++        
Sbjct  203   FNLFLYMLASHVVGANWYMLSVESEVRCWRE-LKNASLCHREYMSCGDRNQKNFTLLNLL  261

Query  746   --GDFSSSFLNTSCALLEPENLK-ADDFDFGIFLDALKSNVVEKRY-FWSKLFYCFWWGL  913
                  + + LN +C+L++P+ +K    F+FGIF DAL S+VVE    F  K FYCFWWGL
Sbjct  262   NQTLLNQTVLNQTCSLVDPDTIKDPKTFNFGIFSDALDSHVVESTTDFPQKFFYCFWWGL  321

Query  914   RNLSSLGQNLKTSNFVGEilfailisiiglilfslligNMQKYLQSITVRVEEMRVKRMD  1093
             RNLSSLGQNLKTS  V EI FAI I+I GL+LFSLLIGNMQKYLQS TVRVEEMRVKR D
Sbjct  322   RNLSSLGQNLKTSTDVSEIAFAIFIAIFGLVLFSLLIGNMQKYLQSTTVRVEEMRVKRQD  381

Query  1094  AEQWMSHRMLPDNLRERIRRYEQYRWQETRGVDEESLISNLPKDLRRDINRHLCWSLLKR  1273
             AEQWMSHRMLP+NL+ERIR+YEQY+WQE +GV+EE+LI NLPKDLRRDI RHLC +L+K+
Sbjct  382   AEQWMSHRMLPENLKERIRKYEQYQWQENKGVEEEALIRNLPKDLRRDIKRHLCLALVKK  441

Query  1274  VHMFKTMDEQLLDAICDRLKPVLYTEKSCIVREGDPVDEMIFVMRGNLLTMTTNGGRTGF  1453
             V MF+ MDEQLLDA+CDRLKPVLYTEKS IVRE DPVDEM+F+MRG + TMTTNGGRTGF
Sbjct  442   VPMFEKMDEQLLDAMCDRLKPVLYTEKSYIVREEDPVDEMLFIMRGKVSTMTTNGGRTGF  501

Query  1454  LNSDVLNAGDFCGEELLTWALDPNSSSSLPISTRTVQALTDVEAFALTADFLKFFASQYR  1633
              NS  L AGDFCGEELLTWALDPNSSS+LPISTRTV+ +++VEAFAL AD LKF ASQ+R
Sbjct  502   FNSMFLMAGDFCGEELLTWALDPNSSSNLPISTRTVETISEVEAFALMADDLKFVASQFR  561

Query  1634  RLHSKQLQHKFR--------FYSHQWKTWAACFIQAAWRRHCRNKLEKSLREEEDRLQDA  1789
             RLHSKQLQH FR        FYS QWKTWAA FIQAAWRR+ + K+E+SL + E  LQDA
Sbjct  562   RLHSKQLQHAFRQGLIISIMFYSSQWKTWAATFIQAAWRRYWKKKIERSLCKAEADLQDA  621

Query  1790  LILRMRREEGETTPSLGATIYASRFAANVLRTVRRNHplsvpklsprlpplllqkpAEPD  1969
             L      EEG +  SLGATIYASRFA N LR +R N       +  RL  LL  KPAEPD
Sbjct  622   LA----NEEGSSL-SLGATIYASRFAVNALRNLRENS--RHNTMQQRLLSLLPPKPAEPD  674

Query  1970  FSAPEN  1987
             F+A ++
Sbjct  675   FTAQKH  680



>ref|XP_002301407.2| hypothetical protein POPTR_0002s17120g [Populus trichocarpa]
 gb|EEE80680.2| hypothetical protein POPTR_0002s17120g [Populus trichocarpa]
Length=728

 Score =   791 bits (2042),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 409/655 (62%), Positives = 497/655 (76%), Gaps = 23/655 (4%)
 Frame = +2

Query  47    KSKMHDPQGPFLQRWNRIFVIACILAATVDPLFFYIPVVD--DQNKCLGLDRTLEITACI  220
             K K+ DPQG FLQ WN+IF++ C+LA  +DPLFFYIP V+  D++KCL LD  +E  AC+
Sbjct  82    KKKILDPQGSFLQNWNKIFMLVCVLAVAIDPLFFYIPWVNGTDKDKCLDLDHKMEAAACV  141

Query  221   LRSVFDFFYIFHIILQFRTGFVPPSSRVFGRGDLIVDPSAIAKRYFFSYFFIDILAVLPL  400
             LR+  D  YI  I  QFRTGF+ PSSRVFGRG+L+ DP  IAK+Y  S+F +DILA+LPL
Sbjct  142   LRTFIDVVYILRIAFQFRTGFIAPSSRVFGRGELVEDPKVIAKKYLTSHFIVDILAILPL  201

Query  401   PQVVLFMMIPRADRPFIMVAKDILKVVILVQSVPRLLRIYPLYKEVTRTSGFFTETAWAG  580
             PQVV+ +++P  D P  + AK++L++VI  Q +PR +RIYPL+KE+TRTSG  TETAWAG
Sbjct  202   PQVVVIIILPSVDGPVSLAAKNLLEIVIFSQYIPRFVRIYPLFKEITRTSGILTETAWAG  261

Query  581   AAFNLFLYMIASY------VAGAIWYITAIERQDKCWRRACEKHGSCDIDFLYCTKLGRR  742
             A FNLFLYM+AS+      + GA WY+ +IER+D CWR  C+    CD  + YC     R
Sbjct  262   AVFNLFLYMLASHKNVICQIIGAFWYLFSIEREDSCWREVCKDRAGCDSTYWYCG--NHR  319

Query  743   GGDFSSSFLNTSCALLEPENLKADD-FDFGIFLDALKSNVVEKRYFWSKLFYCFWWGLRN  919
               +++  FL  SC  ++P+ ++    F+FGIF+DAL S VVE  YF  K FYCFWWGLRN
Sbjct  320   PENYT--FLTESCPFIQPDQIQNSSVFNFGIFIDALDSGVVESTYFPRKFFYCFWWGLRN  377

Query  920   LSSLGQNLKTSNFVGEilfailisiiglilfslligNMQKYLQSITVRVEEMRVKRMDAE  1099
             LSSLGQNLKTS F+GEILFAI ISI GL+LF+LLIGNMQKYL+S TVR+EEMRVKR D+E
Sbjct  378   LSSLGQNLKTSTFIGEILFAIFISITGLVLFALLIGNMQKYLESTTVRIEEMRVKRRDSE  437

Query  1100  QWMSHRMLPDNLRERIRRYEQYRWQETRGVDEESLISNLPKDLRRDINRHLCWSLLKRVH  1279
             QWMSHRMLPDNL+ERIRR+EQY+WQETRGV+E  LI NLPKDLRRDINRHLC  L+K+V 
Sbjct  438   QWMSHRMLPDNLKERIRRHEQYKWQETRGVEERGLIRNLPKDLRRDINRHLCLDLIKKVP  497

Query  1280  MFKTMDEQLLDAICDRLKPVLYTEKSCIVREGDPVDEMIFVMRGNLLTMTTNGGRTGFLN  1459
             +F+ MDE +LDA+CDRLK  LYT+ S IVREGDPVDEM+F+MRG LL++TTNGGRTGF N
Sbjct  498   IFEKMDEHILDAVCDRLKATLYTKDSYIVREGDPVDEMLFIMRGTLLSVTTNGGRTGFFN  557

Query  1460  SDVLNAGDFCGEELLTWALDPNSSSSLPISTRTVQALTDVEAFALTADFLKFFASQYRRL  1639
             +  L AGDFCGE LLTWALDP  SS+LPISTRTVQAL++VEAFAL A+ LK  ASQ+RRL
Sbjct  558   AVSLKAGDFCGEGLLTWALDPQ-SSNLPISTRTVQALSEVEAFALEAEDLKTVASQFRRL  616

Query  1640  HSKQLQHKFR--FYSHQWKTWAACFIQAAWRRHCRNKLEKSLREEEDRLQDALILRMRRE  1813
             H K +QH FR  F   QW+TWAACFIQAAW RHCR K  KSLR+ E++LQDAL       
Sbjct  617   HHKDIQHTFRQVFRDLQWRTWAACFIQAAWHRHCRRKQAKSLRQAEEKLQDALA-----N  671

Query  1814  EGETTPSLGATIYASRFAANVLRTVRRNHplsvpklsprlpplllqkpAEPDFSA  1978
             E  T+PSL   IYAS+FAAN LR +R+N   +     P+    L QKP EPDFSA
Sbjct  672   EASTSPSLDVAIYASQFAANALRNLRQN--GTHAARLPQRLSFLPQKPTEPDFSA  724



>ref|XP_008677361.1| PREDICTED: LOC100285094 isoform X1 [Zea mays]
 ref|XP_008677362.1| PREDICTED: LOC100285094 isoform X1 [Zea mays]
 gb|AFW65889.1| cyclic nucleotide-gated ion channel 1 isoform 1 [Zea mays]
 gb|AFW65890.1| cyclic nucleotide-gated ion channel 1 isoform 2 [Zea mays]
Length=701

 Score =   789 bits (2038),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 393/618 (64%), Positives = 482/618 (78%), Gaps = 15/618 (2%)
 Frame = +2

Query  47    KSKMHDPQGPFLQRWNRIFVIACILAATVDPLFFYIPVVDDQNKCLGLDRTLEITACILR  226
             K+K+ DPQGPFLQRWN+IFVI+C+ A  VDPLF Y+PV+D  N CL LD+ LE TA ILR
Sbjct  69    KTKVLDPQGPFLQRWNKIFVISCLFAVFVDPLFLYVPVIDGGNNCLYLDKKLETTASILR  128

Query  227   SVFDFFYIFHIILQFRTGFVPPSSRVFGRGDLIVDPSAIAKRYFFSYFFIDILAVLPLPQ  406
                D FY+ HI+ QFRTGF+ PSSRVFGRG L+ D  AIAKRY  + F +D LAVLPLPQ
Sbjct  129   FFTDIFYLLHILFQFRTGFIAPSSRVFGRGALVKDTFAIAKRYLSTLFLVDFLAVLPLPQ  188

Query  407   VVLFMMIPRADRPFIMVAKDILKVVILVQSVPRLLRIYPLYKEVTRTSGFFTETAWAGAA  586
             V + +++P+   P IM AK +L V+I+ Q VPRLLRI PLY ++TR++G  TETAWAGAA
Sbjct  189   VFVLVVLPKLQGPEIMKAKIVLLVIIICQYVPRLLRIIPLYLQITRSAGILTETAWAGAA  248

Query  587   FNLFLYMIASYVAGAIWYITAIERQDKCWRRACEKHGSCDIDFLYCTKLGRRGGDFSSSF  766
             FNL +YM+AS+  GA+WYI +I+R+D CWR+AC     CD   LYC          ++SF
Sbjct  249   FNLIIYMLASHGFGALWYILSIQREDTCWRQACINQTGCDPTSLYCGYHSLA----NNSF  304

Query  767   LNTSCALLEPENLKAD-DFDFGIFLDALKSNVVEKRYFWSKLFYCFWWGLRNLSSLGQNL  943
             L  +C    P N  A+ D  FGIFL AL+ NV +   F+ KLFYCFWWGL+NLSSLGQN+
Sbjct  305   LQNAC----PTNSTANPDPIFGIFLPALQ-NVSQSTSFFEKLFYCFWWGLQNLSSLGQNM  359

Query  944   KTSNFVGEilfailisiiglilfslligNMQKYLQSITVRVEEMRVKRMDAEQWMSHRML  1123
             KTS    E LFA+ +S  GL+LF+LLIGN+Q YLQS +VR+EEMRVKR D EQWM+HR+L
Sbjct  360   KTSTNTLENLFAVFVSTSGLVLFALLIGNVQTYLQSASVRIEEMRVKRRDTEQWMAHRLL  419

Query  1124  PDNLRERIRRYEQYRWQETRGVDEESLISNLPKDLRRDINRHLCWSLLKRVHMFKTMDEQ  1303
             P+NL++RI R+EQYRWQETRGVDEE L+ NLPKDLRR+I RHLC SLL +V MF+ MDEQ
Sbjct  420   PENLKDRIMRHEQYRWQETRGVDEEGLLKNLPKDLRREIKRHLCLSLLMKVPMFENMDEQ  479

Query  1304  LLDAICDRLKPVLYTEKSCIVREGDPVDEMIFVMRGNLLTMTTNGGRTGFLNSDVLNAGD  1483
             LLDA+CDRLKP+LYTE SCI+REGDPV+EM+F+MRG L + TTNGG+TGF NS+VL  GD
Sbjct  480   LLDAMCDRLKPMLYTEGSCIIREGDPVNEMLFIMRGTLESTTTNGGQTGFFNSNVLKGGD  539

Query  1484  FCGEELLTWALDPNSSSSLPISTRTVQALTDVEAFALTADFLKFFASQYRRLHSKQLQHK  1663
             FCGEELLTWALDP S+S+LP STRTV+ L++VEAFAL AD LKF A+Q+RRLHSKQLQH 
Sbjct  540   FCGEELLTWALDPTSASNLPGSTRTVKTLSEVEAFALRADDLKFVATQFRRLHSKQLQHT  599

Query  1664  FRFYSHQWKTWAACFIQAAWRRHCRNKLEKSLREEEDRLQDALILRMRREEGETTPSLGA  1843
             FRFYS QW+TWAACFIQAAW R+CR KLE++L E+E RLQ A++      +G T+ SLGA
Sbjct  600   FRFYSQQWRTWAACFIQAAWHRYCRKKLEEALYEKEKRLQAAIV-----SDGTTSLSLGA  654

Query  1844  TIYASRFAANVLRTVRRN  1897
              +YASRFA N++R +RRN
Sbjct  655   ALYASRFAGNMMRILRRN  672



>ref|NP_001151461.1| LOC100285094 [Zea mays]
 gb|ACG42944.1| cyclic nucleotide-gated ion channel 1 [Zea mays]
Length=701

 Score =   788 bits (2036),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 392/618 (63%), Positives = 482/618 (78%), Gaps = 15/618 (2%)
 Frame = +2

Query  47    KSKMHDPQGPFLQRWNRIFVIACILAATVDPLFFYIPVVDDQNKCLGLDRTLEITACILR  226
             K+K+ DPQGPFLQRWN+IFVI+C+ A  VDPLF Y+PV+D  N CL LD+ LE TA ILR
Sbjct  69    KTKVLDPQGPFLQRWNKIFVISCLFAVFVDPLFLYVPVIDGGNNCLYLDKKLETTASILR  128

Query  227   SVFDFFYIFHIILQFRTGFVPPSSRVFGRGDLIVDPSAIAKRYFFSYFFIDILAVLPLPQ  406
                D FY+ HI+ QFRTGF+ PSSRVFGRG L+ D  AIAKRY  + F +D LAVLPLPQ
Sbjct  129   FFTDIFYLLHILFQFRTGFIAPSSRVFGRGALVKDTFAIAKRYLSTLFLVDFLAVLPLPQ  188

Query  407   VVLFMMIPRADRPFIMVAKDILKVVILVQSVPRLLRIYPLYKEVTRTSGFFTETAWAGAA  586
             V + +++P+   P +M AK +L V+I+ Q VPRLLRI PLY ++TR++G  TETAWAGAA
Sbjct  189   VFVLVVLPKLQGPEVMKAKIVLLVIIICQYVPRLLRIIPLYLQITRSAGILTETAWAGAA  248

Query  587   FNLFLYMIASYVAGAIWYITAIERQDKCWRRACEKHGSCDIDFLYCTKLGRRGGDFSSSF  766
             FNL +YM+AS+  GA+WYI +I+R+D CWR+AC     CD   LYC          ++SF
Sbjct  249   FNLIIYMLASHGFGALWYILSIQREDTCWRQACINQTGCDPTSLYCGYHSLA----NNSF  304

Query  767   LNTSCALLEPENLKAD-DFDFGIFLDALKSNVVEKRYFWSKLFYCFWWGLRNLSSLGQNL  943
             L  +C    P N  A+ D  FGIFL AL+ NV +   F+ KLFYCFWWGL+NLSSLGQN+
Sbjct  305   LQNAC----PTNSTANPDPIFGIFLPALQ-NVSQSTSFFEKLFYCFWWGLQNLSSLGQNM  359

Query  944   KTSNFVGEilfailisiiglilfslligNMQKYLQSITVRVEEMRVKRMDAEQWMSHRML  1123
             KTS    E LFA+ +S  GL+LF+LLIGN+Q YLQS +VR+EEMRVKR D EQWM+HR+L
Sbjct  360   KTSTNTLENLFAVFVSTSGLVLFALLIGNVQTYLQSASVRIEEMRVKRRDTEQWMAHRLL  419

Query  1124  PDNLRERIRRYEQYRWQETRGVDEESLISNLPKDLRRDINRHLCWSLLKRVHMFKTMDEQ  1303
             P+NL++RI R+EQYRWQETRGVDEE L+ NLPKDLRR+I RHLC SLL +V MF+ MDEQ
Sbjct  420   PENLKDRIMRHEQYRWQETRGVDEEGLLKNLPKDLRREIKRHLCLSLLMKVPMFENMDEQ  479

Query  1304  LLDAICDRLKPVLYTEKSCIVREGDPVDEMIFVMRGNLLTMTTNGGRTGFLNSDVLNAGD  1483
             LLDA+CDRLKP+LYTE SCI+REGDPV+EM+F+MRG L + TTNGG+TGF NS+VL  GD
Sbjct  480   LLDAMCDRLKPMLYTEGSCIIREGDPVNEMLFIMRGTLESTTTNGGQTGFFNSNVLKGGD  539

Query  1484  FCGEELLTWALDPNSSSSLPISTRTVQALTDVEAFALTADFLKFFASQYRRLHSKQLQHK  1663
             FCGEELLTWALDP S+S+LP STRTV+ L++VEAFAL AD LKF A+Q+RRLHSKQLQH 
Sbjct  540   FCGEELLTWALDPTSASNLPGSTRTVKTLSEVEAFALRADDLKFVATQFRRLHSKQLQHT  599

Query  1664  FRFYSHQWKTWAACFIQAAWRRHCRNKLEKSLREEEDRLQDALILRMRREEGETTPSLGA  1843
             FRFYS QW+TWAACFIQAAW R+CR KLE++L E+E RLQ A++      +G T+ SLGA
Sbjct  600   FRFYSQQWRTWAACFIQAAWHRYCRKKLEEALYEKEKRLQAAIV-----SDGTTSLSLGA  654

Query  1844  TIYASRFAANVLRTVRRN  1897
              +YASRFA N++R +RRN
Sbjct  655   ALYASRFAGNMMRILRRN  672



>ref|XP_010668155.1| PREDICTED: cyclic nucleotide-gated ion channel 1 [Beta vulgaris 
subsp. vulgaris]
Length=726

 Score =   789 bits (2038),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 401/613 (65%), Positives = 477/613 (78%), Gaps = 14/613 (2%)
 Frame = +2

Query  62    DPQGPFLQRWNRIFVIACILAATVDPLFFYIPVVDDQNKCLGLDRTLEITACILRSVFDF  241
             DPQGPFLQ+WN+IF+I+C  A   DPLFFYIPV+D + KCL LD  LEI ACILR+  D 
Sbjct  98    DPQGPFLQKWNKIFLISCFFAMAWDPLFFYIPVIDGKEKCLKLDGRLEIIACILRTFTDL  157

Query  242   FYIFHIILQFRTGFVPPSSRVFGRGDLIVDPSAIAKRYFFSYFFIDILAVLPLPQVVLFM  421
             FY+ HII QFRTGFV PS+RV GRG++I D  AIA+RY  SYF +DILAVLP PQ+ + +
Sbjct  158   FYLLHIIFQFRTGFVSPSTRVLGRGEIIKDHVAIARRYLSSYFIVDILAVLPFPQMSVLV  217

Query  422   MIPRADRPFIMVAKDILKVVILVQSVPRLLRIYPLYKEVTRTSGFFTETAWAGAAFNLFL  601
             ++P+      + +K +LK+VI  Q VPRL RIYPLYKEVTR SG  TETAWAGAAFNLFL
Sbjct  218   IMPKLMNGGPLTSKGLLKLVIFAQYVPRLFRIYPLYKEVTRASGIITETAWAGAAFNLFL  277

Query  602   YMIASYVAGAIWYITAIERQDKCWRRACEKHGSCDIDFLYCTKLGRRGGDFSSSFLNTSC  781
             YM+AS+VAGA WY+ A++RQ KCW R+C     CD   LYC    +   ++   F  + C
Sbjct  278   YMLASHVAGAAWYLFAVDRQIKCWHRSCI---DCDHLSLYCKIKEKHEENYK--FNISYC  332

Query  782   ALLEPENLK-ADDFDFGIFLDALKSNVVEKRYFWSKLFYCFWWGLRNLSSLGQNLKTSNF  958
              L  P+ +  +  F+FG+F DALKS V++   F  KL YCFWWGLRNLSSLGQ L+TS F
Sbjct  333   TLTNPDEITDSTVFNFGLFYDALKSEVIQSTNFLRKLSYCFWWGLRNLSSLGQGLETSTF  392

Query  959   VGEilfailisiiglilfslligNMQKYLQSITVRVEEMRVKRMDAEQWMSHRMLPDNLR  1138
             +GEILFA  I I GL+LFSLLIGNMQKYLQS TVR E+MR++  DAEQWMSHR+LP++++
Sbjct  393   IGEILFATFICIAGLVLFSLLIGNMQKYLQSTTVREEQMRIRSQDAEQWMSHRLLPEDMK  452

Query  1139  ERIRRYEQYRWQETRGVDEESLISNLPKDLRRDINRHLCWSLLKRVHMFKTMDEQLLDAI  1318
             +RIRRYEQY WQETRGVDEES+I NLP+DLRRDI RHLC SLL +V MF  MDEQL DA+
Sbjct  453   KRIRRYEQYNWQETRGVDEESVIRNLPRDLRRDIKRHLCLSLLMKVPMFAIMDEQLKDAM  512

Query  1319  CDRLKPVLYTEKSCIVREGDPVDEMIFVMRGNLLTMTTNGGRTGFLNSDVLNAGDFCGEE  1498
             CDRLKPVLYTE S IVREGDPV+EM+F+MRG+LLTMTTNGGRT F NS  L AGDFCGEE
Sbjct  513   CDRLKPVLYTETSFIVREGDPVNEMLFIMRGSLLTMTTNGGRTNFFNSGSLKAGDFCGEE  572

Query  1499  LLTWALDPNSSSSLPISTRTVQALTDVEAFALTADFLKFFASQYRRLHSKQLQHKFRFYS  1678
             LLTWALDP+SSS+LPIST TVQ  T+VEAFAL +D LK  ASQ+RRLHSKQL+H FRF+S
Sbjct  573   LLTWALDPHSSSNLPISTSTVQTQTEVEAFALMSDDLKLVASQFRRLHSKQLRHTFRFFS  632

Query  1679  HQWKTWAACFIQAAWRRHCRNKLEKSLREEEDRLQDALILRMRREEGETTPSLGATIYAS  1858
               WK WAACFIQAAWRR+CR K+EKSL+E E+       L M + EG ++PS GATIYAS
Sbjct  633   QHWKRWAACFIQAAWRRYCRRKVEKSLQEAEE-------LAMSK-EGGSSPSFGATIYAS  684

Query  1859  RFAANVLRTVRRN  1897
             +FAAN LR +RRN
Sbjct  685   KFAANALRNLRRN  697



>ref|XP_006647126.1| PREDICTED: cyclic nucleotide-gated ion channel 1-like [Oryza 
brachyantha]
Length=700

 Score =   784 bits (2025),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 387/617 (63%), Positives = 487/617 (79%), Gaps = 13/617 (2%)
 Frame = +2

Query  47    KSKMHDPQGPFLQRWNRIFVIACILAATVDPLFFYIPVVDDQNKCLGLDRTLEITACILR  226
             K+++ DPQGPFLQRWN+IFVI+C++A +VDPLFFYIPVVD  N CL LD+ LE+ A +LR
Sbjct  68    KTRVLDPQGPFLQRWNKIFVISCLIAVSVDPLFFYIPVVDGDNICLYLDKKLEVVASVLR  127

Query  227   SVFDFFYIFHIILQFRTGFVPPSSRVFGRGDLIVDPSAIAKRYFFSYFFIDILAVLPLPQ  406
                D FY+ HII QFRTGF+ PSSRVFGRG L+ D  AIAKRY  +YF ID LAVLPLPQ
Sbjct  128   FFTDIFYLLHIIFQFRTGFIAPSSRVFGRGVLVEDTFAIAKRYLSTYFLIDFLAVLPLPQ  187

Query  407   VVLFMMIPRADRPFIMVAKDILKVVILVQSVPRLLRIYPLYKEVTRTSGFFTETAWAGAA  586
             V++  ++PR     +M+AK+IL ++++ Q VPRL+RI PLY ++TR++G  TETAWAGAA
Sbjct  188   VLVLAVLPRLQGSSVMMAKNILMIIVICQYVPRLIRIIPLYLQITRSAGIITETAWAGAA  247

Query  587   FNLFLYMIASYVAGAIWYITAIERQDKCWRRACEKHGSCDIDFLYCTKLGRRGGDFSSSF  766
             FNL +YM+AS+V GA+WY+ +I+R++ CW++AC     CD+  L+C          ++SF
Sbjct  248   FNLLIYMLASHVLGALWYLLSIQRENSCWKKACSGQPGCDLGSLFCGS----NSSGNNSF  303

Query  767   LNTSCALLEPENLKADDFDFGIFLDALKSNVVEKRYFWSKLFYCFWWGLRNLSSLGQNLK  946
             L  +C     +N    D +FGI+L AL+ NV +   F+ KLFYCFWWGL+NLSSLGQNLK
Sbjct  304   LQINCPTNGTDN---PDRNFGIYLPALQ-NVSQSSSFFEKLFYCFWWGLQNLSSLGQNLK  359

Query  947   TSNFVGEilfailisiiglilfslligNMQKYLQSITVRVEEMRVKRMDAEQWMSHRMLP  1126
             TS    E LFA+ +S  GL+LF+LLIGN+Q YLQS +VR+EEMRVKR D EQWM+HR+LP
Sbjct  360   TSTDTWENLFAVFVSTSGLVLFALLIGNVQTYLQSASVRIEEMRVKRRDTEQWMAHRLLP  419

Query  1127  DNLRERIRRYEQYRWQETRGVDEESLISNLPKDLRRDINRHLCWSLLKRVHMFKTMDEQL  1306
             +NL++RI R+EQYRWQETRGVDEE L++NLPK+LRR+I RHLC SLL RV MF+ MDE+L
Sbjct  420   ENLKDRILRHEQYRWQETRGVDEEGLLTNLPKNLRREIKRHLCLSLLMRVPMFENMDEKL  479

Query  1307  LDAICDRLKPVLYTEKSCIVREGDPVDEMIFVMRGNLLTMTTNGGRTGFLNSDVLNAGDF  1486
             LDA+CDRLKP+LYTE SCI+ EGDPV+EM+F+MRGNL +MTTNGG+TGF NS+VL  GDF
Sbjct  480   LDAMCDRLKPILYTEGSCIINEGDPVNEMLFIMRGNLESMTTNGGQTGFFNSNVLKGGDF  539

Query  1487  CGEELLTWALDPNSSSSLPISTRTVQALTDVEAFALTADFLKFFASQYRRLHSKQLQHKF  1666
             CGEELLTWALDP S+S+LP STRTV+ L++VEAFAL AD LKF A+Q+RRLHSKQLQH F
Sbjct  540   CGEELLTWALDPTSASNLPSSTRTVKTLSEVEAFALRADDLKFVATQFRRLHSKQLQHTF  599

Query  1667  RFYSHQWKTWAACFIQAAWRRHCRNKLEKSLREEEDRLQDALILRMRREEGETTPSLGAT  1846
             RFYS QW+TWAACFIQAAW R+CR KLE SL E+E RLQ A++         ++ SLGA 
Sbjct  600   RFYSQQWRTWAACFIQAAWHRYCRKKLEDSLFEKEKRLQAAIVSDG-----SSSLSLGAA  654

Query  1847  IYASRFAANVLRTVRRN  1897
             +YASRFA N++R +RRN
Sbjct  655   LYASRFAGNMMRILRRN  671



>emb|CDX74369.1| BnaA03g26780D [Brassica napus]
Length=705

 Score =   783 bits (2021),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 391/619 (63%), Positives = 486/619 (79%), Gaps = 7/619 (1%)
 Frame = +2

Query  47    KSKMHDPQGPFLQRWNRIFVIACILAATVDPLFFYIPVVDDQNKCLGLDRTLEITACILR  226
             K  + +PQG FLQ WN+IF+ A ++A  +DPLFFYIP+VD +  CL L  +LEI A +LR
Sbjct  72    KKNIINPQGSFLQNWNKIFLFASVIALAIDPLFFYIPIVDGKKHCLNLHSSLEIAASVLR  131

Query  227   SVFDFFYIFHIILQFRTGFVPPSSRVFGRGDLIVDPSAIAKRYFFSYFFIDILAVLPLPQ  406
             +  D FYI HI+ QFRT +V P SRVFGRG+L+ DP AIA +Y  SYF ID+L++LPLPQ
Sbjct  132   TFVDAFYIIHIVFQFRTAYVSPLSRVFGRGELVEDPKAIALKYISSYFIIDVLSILPLPQ  191

Query  407   VVLFMMIPRADRPFIMVAKDILKVVILVQSVPRLLRIYPLYKEVTRTSGFFTETAWAGAA  586
             +V+  +IP  ++P  ++ KD L  VI  Q +PR+LRIYPLY EVTRTSG  TETAWAGAA
Sbjct  192   LVVLAVIPNVEKPVSLLTKDYLITVIFAQYIPRILRIYPLYSEVTRTSGIVTETAWAGAA  251

Query  587   FNLFLYMIASYVAGAIWYITAIERQDKCWRRACEKHGSCDIDFLYCTKLGRRGGDFSSSF  766
             +NL LYM+AS+V GA+WY+ ++ER+D+CWR AC K   C++ FLYC        +  + +
Sbjct  252   WNLSLYMLASHVFGALWYLISVEREDRCWREACGKRQGCELRFLYCDG----NNNVINDY  307

Query  767   LNTSCALLEPENL-KADDFDFGIFLDALKSNVVEKRYFWSKLFYCFWWGLRNLSSLGQNL  943
             L TSC  + P+++  +  F+FGIF DALKS +VE   FW K FYCFWWGLRNLS+LGQNL
Sbjct  308   LTTSCPFINPDDITNSTTFNFGIFTDALKSGIVESDDFWKKFFYCFWWGLRNLSALGQNL  367

Query  944   KTSNFVGEilfailisiiglilfslligNMQKYLQSITVRVEEMRVKRMDAEQWMSHRML  1123
              TS FVGEI+FA+LI I GL+LF+LLIGNMQKYL+S TVR EEMRV++ DAEQWM+HRML
Sbjct  368   NTSKFVGEIIFAVLICISGLVLFALLIGNMQKYLESTTVREEEMRVRKRDAEQWMAHRML  427

Query  1124  PDNLRERIRRYEQYRWQETRGVDEESLISNLPKDLRRDINRHLCWSLLKRVHMFKTMDEQ  1303
             P++LR+RIRRYEQY+WQETRGV+EE+L+ NLPKDLRRDI RH C  LLK+V +F+ MDEQ
Sbjct  428   PEDLRKRIRRYEQYKWQETRGVEEENLLRNLPKDLRRDIKRHFCLDLLKKVPLFEIMDEQ  487

Query  1304  LLDAICDRLKPVLYTEKSCIVREGDPVDEMIFVMRGNLLTMTTNGGRTGFLNSDVLNAGD  1483
             LLDA+CD+L+PVLYTE S  +REGDPV+EM+FVMRG L++ TTNGGRTGF N+  L A D
Sbjct  488   LLDAVCDKLRPVLYTENSYAIREGDPVEEMLFVMRGKLMSATTNGGRTGFFNAVYLKASD  547

Query  1484  FCGEELLTWALDPNSSSSLPISTRTVQALTDVEAFALTADFLKFFASQYRRLHSKQLQHK  1663
             FCGE+LLTWALDP SSS  PIS RTVQALT+VEAFAL A+ LK  ASQ+RRLHSKQLQH 
Sbjct  548   FCGEDLLTWALDPQSSSHFPISPRTVQALTEVEAFALAAEDLKLVASQFRRLHSKQLQHT  607

Query  1664  FRFYSHQWKTWAACFIQAAWRRHCRNKLEKSLREEEDRLQDALILRMRREEGETTPSLGA  1843
             FRFYS QW+TW A FIQAAWRRHCR +L +SL EEEDR + A+  R RR    ++PSL A
Sbjct  608   FRFYSVQWRTWGASFIQAAWRRHCRRRLARSLTEEEDRFRIAVAKRERR--AASSPSLVA  665

Query  1844  TIYASRFAANVLRTVRRNH  1900
             T+YASRFA+N LR +R+++
Sbjct  666   TLYASRFASNALRNLRQHN  684



>emb|CDP08690.1| unnamed protein product [Coffea canephora]
Length=623

 Score =   780 bits (2013),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 398/542 (73%), Positives = 461/542 (85%), Gaps = 5/542 (1%)
 Frame = +2

Query  47    KSKMHDPQGPFLQRWNRIFVIACILAATVDPLFFYIPVVDDQNKCLGLDRTLEITACILR  226
             + K+ DPQG FLQ+WN+IFV+A I+A ++DPLFFYIPV+D+  KCL +D  L+I ACILR
Sbjct  82    REKVFDPQGAFLQQWNKIFVVASIIAVSLDPLFFYIPVIDNNRKCLDMDNNLKIIACILR  141

Query  227   SVFDFFYIFHIILQFRTGFVPPSSRVFGRGDLIVDPSAIAKRYFFSYFFIDILAVLPLPQ  406
             S+ D FY FHIILQFRTGF+ P+SRVFGRG++I D SAI KRY +SYFF+DILAVLPLPQ
Sbjct  142   SITDLFYTFHIILQFRTGFISPTSRVFGRGEMIQDLSAIVKRYLYSYFFVDILAVLPLPQ  201

Query  407   VVLFMMIPRADRPFIMVAKDILKVVILVQSVPRLLRIYPLYKEVTRTSGFFTETAWAGAA  586
             V++ ++ P+ + P  +V KD+LK+ I  Q VPRL+RIYPLYKEVTR SG FTET WAGAA
Sbjct  202   VIILIISPKVNAPASLVTKDLLKIAIFAQYVPRLIRIYPLYKEVTRNSGIFTETPWAGAA  261

Query  587   FNLFLYMIASYVAGAIWYITAIERQDKCWRRACEKHGSCDIDFLYCTKLGRRGGDFSSSF  766
             FNLFLYM+AS V GA WY+  IER+DKCWR AC K  SCD+D LYC +  +  G++S  F
Sbjct  262   FNLFLYMLASNVLGAFWYLFTIERKDKCWRIACHKQNSCDLDALYCGE--KHKGNYS--F  317

Query  767   LNTSCALLEPENLKA-DDFDFGIFLDALKSNVVEKRYFWSKLFYCFWWGLRNLSSLGQNL  943
             LNTSC LLEPE +K+ +DF+FGIFL+AL+S VVEKR FW KLFYCFWWGLRNLSS+GQNL
Sbjct  318   LNTSCPLLEPEQIKSPNDFNFGIFLEALQSKVVEKRNFWEKLFYCFWWGLRNLSSVGQNL  377

Query  944   KTSNFVGEilfailisiiglilfslligNMQKYLQSITVRVEEMRVKRMDAEQWMSHRML  1123
             KTSNF  E LFAI IS+IGLILFSLLIGNMQKYLQSITVRVEEMRVKR D +QWMSHRML
Sbjct  378   KTSNFTWENLFAIFISVIGLILFSLLIGNMQKYLQSITVRVEEMRVKRRDVDQWMSHRML  437

Query  1124  PDNLRERIRRYEQYRWQETRGVDEESLISNLPKDLRRDINRHLCWSLLKRVHMFKTMDEQ  1303
             P+NLR+RIRRYEQY+WQETRGV+E+SLI NLPKDLRRDINRH CW+LL RV MF+ MD++
Sbjct  438   PENLRQRIRRYEQYKWQETRGVEEDSLIQNLPKDLRRDINRHHCWALLTRVPMFEKMDDR  497

Query  1304  LLDAICDRLKPVLYTEKSCIVREGDPVDEMIFVMRGNLLTMTTNGGRTGFLNSDVLNAGD  1483
             LLDA+CDRLKPVLYTE SCI REGDPVDEM+F+MRG+LLT TTNGGRTGF NS  L AGD
Sbjct  498   LLDALCDRLKPVLYTENSCIYREGDPVDEMLFLMRGSLLTTTTNGGRTGFFNSVYLKAGD  557

Query  1484  FCGEELLTWALDPNSSSSLPISTRTVQALTDVEAFALTADFLKFFASQYRRLHSKQLQHK  1663
             FCGEELLTWALDPNS+SSLP STRTV A+ DVEAFAL AD L+F ASQ+RRLHSKQLQH 
Sbjct  558   FCGEELLTWALDPNSNSSLPTSTRTVLAVKDVEAFALKADDLRFVASQFRRLHSKQLQHT  617

Query  1664  FR  1669
             FR
Sbjct  618   FR  619



>emb|CAB45784.2| cyclic nucleotide gated channel (CNGC4) like protein [Arabidopsis 
thaliana]
 emb|CAB80910.1| cyclic nucleotide gated channel (CNGC4) like protein [Arabidopsis 
thaliana]
Length=689

 Score =   780 bits (2015),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 388/615 (63%), Positives = 473/615 (77%), Gaps = 15/615 (2%)
 Frame = +2

Query  62    DPQGPFLQRWNRIFVIACILAATVDPLFFYIPVVDDQNKCLGLDRTLEITACILRSVFDF  241
             +PQG FLQ WN+IF+ A ++A  +DPLFFYIP+VD +  CL L R LEI A +LR+  D 
Sbjct  70    NPQGSFLQNWNKIFLFASVIALAIDPLFFYIPIVDGERHCLNLHRNLEIAASVLRTFIDA  129

Query  242   FYIFHIILQFRTGFVPPSSRVFGRGDLIVDPSAIAKRYFFSYFFIDILAVLPLPQVVLFM  421
             FYI HI+ QFRT ++ PSSRVFGRG+L+ DP AIA +Y  SYF ID+L++LPLPQ+V+  
Sbjct  130   FYIIHIVFQFRTAYISPSSRVFGRGELVDDPKAIAIKYLSSYFIIDLLSILPLPQLVVLA  189

Query  422   MIPRADRPFIMVAKDILKVVILVQSVPRLLRIYPLYKEVTRTSGFFTETAWAGAAFNLFL  601
             +IP  ++P  ++ KD L  VI  Q +PR+LRIYPLY EVTRTSG  TETAWAGAA+NL L
Sbjct  190   VIPNVNKPVSLITKDYLITVIFTQYIPRILRIYPLYTEVTRTSGIVTETAWAGAAWNLSL  249

Query  602   YMIASYVAGAIWYITAIERQDKCWRRACEKHGS-CDIDFLYCTKLGRRGGDFSSSFLNTS  778
             YM+AS+V GA+WY+ ++ER+D+CWR ACEK    C+  FLYC           + FL TS
Sbjct  250   YMLASHVFGALWYLISVEREDRCWREACEKIPEVCNFRFLYCDG----NSSVRNDFLTTS  305

Query  779   CALLEPENL-KADDFDFGIFLDALKSNVVEKRYFWSKLFYCFWWGLRNLSSLGQNLKTSN  955
             C  + P+++  +  F+FGIF DALKS +VE   FW K FYCF        +LGQNL TS 
Sbjct  306   CPFINPDDITNSTVFNFGIFTDALKSGIVESDDFWKKFFYCF-------CALGQNLNTSK  358

Query  956   FVGEilfailisiiglilfslligNMQKYLQSITVRVEEMRVKRMDAEQWMSHRMLPDNL  1135
             FVGEI+FA+ I I GL+LF+LLIGNMQKYL+S TVR EEMRV++ DAEQWMSHRMLPD+L
Sbjct  359   FVGEIIFAVSICISGLVLFALLIGNMQKYLESTTVREEEMRVRKRDAEQWMSHRMLPDDL  418

Query  1136  RERIRRYEQYRWQETRGVDEESLISNLPKDLRRDINRHLCWSLLKRVHMFKTMDEQLLDA  1315
             R+RIRRYEQY+WQETRGV+EE+L+ NLPKDLRRDI RH C  LLK+V +F+ MDEQLLDA
Sbjct  419   RKRIRRYEQYKWQETRGVEEENLLRNLPKDLRRDIKRHFCLDLLKKVPLFEIMDEQLLDA  478

Query  1316  ICDRLKPVLYTEKSCIVREGDPVDEMIFVMRGNLLTMTTNGGRTGFLNSDVLNAGDFCGE  1495
             +CD+LKPVLYTE S  +REGDPV+EM+FVMRG L++ TTNGGRTGF N+  L   DFCGE
Sbjct  479   VCDKLKPVLYTENSYAIREGDPVEEMLFVMRGKLMSATTNGGRTGFFNAVYLKPSDFCGE  538

Query  1496  ELLTWALDPNSSSSLPISTRTVQALTDVEAFALTADFLKFFASQYRRLHSKQLQHKFRFY  1675
             +LLTWALDP SSS  PISTRTVQALT+VEAFAL AD LK  ASQ+RRLHSKQLQH FRFY
Sbjct  539   DLLTWALDPQSSSHFPISTRTVQALTEVEAFALAADDLKLVASQFRRLHSKQLQHTFRFY  598

Query  1676  SHQWKTWAACFIQAAWRRHCRNKLEKSLREEEDRLQDALILRMRREEGETTPSLGATIYA  1855
             S QW+TW A FIQAAWRRHCR KL +SL EEEDR ++A+  R R     ++ SL AT+YA
Sbjct  599   SVQWRTWGASFIQAAWRRHCRRKLARSLTEEEDRFRNAITKRER--NAASSSSLVATLYA  656

Query  1856  SRFAANVLRTVRRNH  1900
             SRFA+N LR +R N+
Sbjct  657   SRFASNALRNLRTNN  671



>gb|KHN23385.1| Cyclic nucleotide-gated ion channel 1 [Glycine soja]
Length=589

 Score =   776 bits (2004),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 407/600 (68%), Positives = 476/600 (79%), Gaps = 11/600 (2%)
 Frame = +2

Query  188   LDRTLEITACILRSVFDFFYIFHIILQFRTGFVPPSSRVFGRGDLIVDPSAIAKRYFFSY  367
             +DR +EITA +LRS  D FYI HII QFRTGF+ PSSRVFGRG L+ D  AIA RY  SY
Sbjct  1     MDRKMEITATVLRSFSDIFYIIHIIFQFRTGFIAPSSRVFGRGVLVEDAWAIAMRYLSSY  60

Query  368   FFIDILAVLPLPQVVLFMMIPRADRPFIMVAKDILKVVILVQSVPRLLRIYPLYKEVTRT  547
             F IDILAVLPLPQV + ++IP+      +  K +LK ++  Q +PR LRI PLYKEVTRT
Sbjct  61    FLIDILAVLPLPQVAILIIIPKLSGSESLNTKTLLKFIVCFQYIPRFLRIIPLYKEVTRT  120

Query  548   SGFFTETAWAGAAFNLFLYMIASYVAGAIWYITAIERQDKCWRRACEKHGSCDIDFLYCT  727
             SG  TETAWAGAAFNLFLYM+AS+V GA WY+ +IER+  CW+ AC ++ +C+   +YC 
Sbjct  121   SGILTETAWAGAAFNLFLYMLASHVIGAFWYLFSIERETTCWQDACRRNSTCNTTAMYCD  180

Query  728   KLGRRGGDFSSSFLNTSCALLEPENLKADDFDFGIFLDALKSNVVEKRYFWSKLFYCFWW  907
                  G    S+FLN SC +   ++     F+FGIFLDAL+S VVE R F  K FYCFWW
Sbjct  181   NHQVLGT--MSAFLNASCPI---QDQNTTLFNFGIFLDALQSGVVESRDFPQKFFYCFWW  235

Query  908   GLRNLSSLGQNLKTSNFVGEilfailisiiglilfslligNMQKYLQSITVRVEEMRVKR  1087
             GLRNLSSLGQNL TS +V EI FAI ISI GL+LF+ LIGNMQ YLQS T R+EEMRVKR
Sbjct  236   GLRNLSSLGQNLATSTYVWEISFAIFISIAGLVLFAFLIGNMQTYLQSTTTRLEEMRVKR  295

Query  1088  MDAEQWMSHRMLPDNLRERIRRYEQYRWQETRGVDEESLISNLPKDLRRDINRHLCWSLL  1267
              DAEQWMSHR+LPD+LRERIRR+EQY+WQETRGVDE+SLI +LPKDLRRDI RHLC +LL
Sbjct  296   RDAEQWMSHRLLPDSLRERIRRHEQYKWQETRGVDEDSLIRDLPKDLRRDIKRHLCLALL  355

Query  1268  KRVHMFKTMDEQLLDAICDRLKPVLYTEKSCIVREGDPVDEMIFVMRGNLLTMTTNGGRT  1447
              RV MF+ MDEQLLDA+CDRLKPVLYTE+SCI REGDPVDEM+F+MRG LLT+TTNGGRT
Sbjct  356   MRVPMFENMDEQLLDAMCDRLKPVLYTEESCIAREGDPVDEMLFIMRGKLLTVTTNGGRT  415

Query  1448  GFLNSDVLNAGDFCGEELLTWALDPNSSSSLPISTRTVQALTDVEAFALTADFLKFFASQ  1627
             GF NS+ L AGDFCGEELLTWALDP SSS+LPISTRTVQ L++VEAFAL AD LKF ASQ
Sbjct  416   GFFNSEYLKAGDFCGEELLTWALDPQSSSNLPISTRTVQTLSEVEAFALKADDLKFVASQ  475

Query  1628  YRRLHSKQLQHKFRFYSHQWKTWAACFIQAAWRRHCRNKLEKSLREEEDRLQDALILRMR  1807
             +RRLHSKQL+H FRFYS QW+TWAACFIQAAWRR+ + KLE+SLREEE+RLQDAL     
Sbjct  476   FRRLHSKQLRHTFRFYSQQWRTWAACFIQAAWRRYSKKKLEESLREEENRLQDALA----  531

Query  1808  REEGETTPSLGATIYASRFAANVLRTVRRNHplsvpklsprlpplllqkpAEPDFSAPEN  1987
              + G ++PSLGATIYASRFAAN LR +RRN      ++  R+ P+LLQKPAEPDF++ E 
Sbjct  532   -KAGGSSPSLGATIYASRFAANALRLLRRNG-TRKTRVPERISPMLLQKPAEPDFTSEEQ  589



>ref|XP_004951291.1| PREDICTED: cyclic nucleotide-gated ion channel 1-like isoform 
X1 [Setaria italica]
 ref|XP_004951292.1| PREDICTED: cyclic nucleotide-gated ion channel 1-like isoform 
X2 [Setaria italica]
 ref|XP_004951293.1| PREDICTED: cyclic nucleotide-gated ion channel 1-like isoform 
X3 [Setaria italica]
Length=702

 Score =   780 bits (2015),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 384/618 (62%), Positives = 480/618 (78%), Gaps = 15/618 (2%)
 Frame = +2

Query  47    KSKMHDPQGPFLQRWNRIFVIACILAATVDPLFFYIPVVDDQNKCLGLDRTLEITACILR  226
             K+++ DPQGPFLQRWN+IFVI+C++A  VDPLF YIPV++ +  CL LD+ L  TA ILR
Sbjct  70    KTRVLDPQGPFLQRWNKIFVISCLVAVFVDPLFLYIPVINGEKNCLYLDKKLATTASILR  129

Query  227   SVFDFFYIFHIILQFRTGFVPPSSRVFGRGDLIVDPSAIAKRYFFSYFFIDILAVLPLPQ  406
                D FY+ H++ QFRTGF+ PSSRVFGRG L+ +  AI KRY  ++F +D LAVLPLPQ
Sbjct  130   FFTDIFYLLHMMFQFRTGFIAPSSRVFGRGVLVENTFAIGKRYMSTFFLVDFLAVLPLPQ  189

Query  407   VVLFMMIPRADRPFIMVAKDILKVVILVQSVPRLLRIYPLYKEVTRTSGFFTETAWAGAA  586
             V + +++P  +   +M AK +L ++I+ Q VPRLLRI PLY ++TR++G  TETAWAGAA
Sbjct  190   VFVLVVLPHLEGSEVMKAKIVLLIIIICQYVPRLLRIIPLYLQITRSAGILTETAWAGAA  249

Query  587   FNLFLYMIASYVAGAIWYITAIERQDKCWRRACEKHGSCDIDFLYCTKLGRRGGDF-SSS  763
             FNL +YM+AS+  GA+WYI +I+R+D CWR+AC     C    LYC         F +++
Sbjct  250   FNLLIYMLASHGFGALWYILSIQREDSCWRQACSNQIGCHPTLLYC-----ESNTFGNNA  304

Query  764   FLNTSCALLEPENLKADDFDFGIFLDALKSNVVEKRYFWSKLFYCFWWGLRNLSSLGQNL  943
             FL  +CA     N    D  FGIFL AL+ NV E + F+ KLFYCFWWGL+NLSSLGQN+
Sbjct  305   FLQNACATNSSAN---PDPTFGIFLPALQ-NVSESKSFFEKLFYCFWWGLQNLSSLGQNM  360

Query  944   KTSNFVGEilfailisiiglilfslligNMQKYLQSITVRVEEMRVKRMDAEQWMSHRML  1123
             KTS    E LFA+ +S  GL+LF+LLIGN+Q YLQS +VR+EEMRVKR D EQWM+HR+L
Sbjct  361   KTSTNTSENLFAVFVSTSGLVLFALLIGNVQTYLQSASVRIEEMRVKRRDTEQWMAHRLL  420

Query  1124  PDNLRERIRRYEQYRWQETRGVDEESLISNLPKDLRRDINRHLCWSLLKRVHMFKTMDEQ  1303
             P+NL+ERI R+EQYRWQETRGVDEE L++NLPKDLRR+I RHLC SLL +V MF+ MDEQ
Sbjct  421   PENLKERIMRHEQYRWQETRGVDEEGLLTNLPKDLRREIKRHLCLSLLMKVPMFENMDEQ  480

Query  1304  LLDAICDRLKPVLYTEKSCIVREGDPVDEMIFVMRGNLLTMTTNGGRTGFLNSDVLNAGD  1483
             LLDA+CDRLKP+LYTE SC++REGDPV+EM+F+MRG L + TTNGG+TGF NS+VL  GD
Sbjct  481   LLDAMCDRLKPMLYTEGSCMIREGDPVNEMLFIMRGTLESTTTNGGQTGFFNSNVLKGGD  540

Query  1484  FCGEELLTWALDPNSSSSLPISTRTVQALTDVEAFALTADFLKFFASQYRRLHSKQLQHK  1663
             FCGEELLTWALDP  +S+LP STRTV+ LT+VEAFAL AD LKF A+Q+RRLHSKQLQH 
Sbjct  541   FCGEELLTWALDPTQASNLPGSTRTVKTLTEVEAFALRADDLKFVATQFRRLHSKQLQHT  600

Query  1664  FRFYSHQWKTWAACFIQAAWRRHCRNKLEKSLREEEDRLQDALILRMRREEGETTPSLGA  1843
             FRFYS QWKTWAACFIQAAW R+CR KLE++L E+E RLQ A++      +G T+ SLGA
Sbjct  601   FRFYSQQWKTWAACFIQAAWHRYCRKKLEETLYEKEKRLQAAIVC-----DGTTSLSLGA  655

Query  1844  TIYASRFAANVLRTVRRN  1897
              +YASRFA N++R +RRN
Sbjct  656   ALYASRFAGNMMRILRRN  673



>ref|XP_009134501.1| PREDICTED: putative cyclic nucleotide-gated ion channel 13 [Brassica 
rapa]
Length=705

 Score =   780 bits (2014),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 390/619 (63%), Positives = 485/619 (78%), Gaps = 7/619 (1%)
 Frame = +2

Query  47    KSKMHDPQGPFLQRWNRIFVIACILAATVDPLFFYIPVVDDQNKCLGLDRTLEITACILR  226
             K  + +PQG FLQ WN+IF+ A ++A  +DPLFFYIP+VD +  CL L  +LEI A +LR
Sbjct  72    KKNIINPQGSFLQNWNKIFLFASVIALAIDPLFFYIPIVDGKKHCLNLHSSLEIAASVLR  131

Query  227   SVFDFFYIFHIILQFRTGFVPPSSRVFGRGDLIVDPSAIAKRYFFSYFFIDILAVLPLPQ  406
             +  D FYI HI+ QFRT +V P SRVFGRG+L+ DP AIA +Y  SYF ID+L++LPLPQ
Sbjct  132   TFVDAFYIIHIVFQFRTAYVSPLSRVFGRGELVEDPKAIALKYISSYFIIDVLSILPLPQ  191

Query  407   VVLFMMIPRADRPFIMVAKDILKVVILVQSVPRLLRIYPLYKEVTRTSGFFTETAWAGAA  586
             +V+  +IP  D+P  ++ KD L  VI  Q +PR+LRIYPLY EVTRTSG  TETAWAGAA
Sbjct  192   LVVLAVIPNVDKPVSLLTKDYLITVIFAQYIPRILRIYPLYSEVTRTSGIVTETAWAGAA  251

Query  587   FNLFLYMIASYVAGAIWYITAIERQDKCWRRACEKHGSCDIDFLYCTKLGRRGGDFSSSF  766
             +NL LYM+AS+V GA+WY+ ++ER+D+CWR AC K   C++  LYC        +  + +
Sbjct  252   WNLSLYMLASHVFGALWYLISVEREDRCWREACGKRQGCELRDLYCDG----NNNVINDY  307

Query  767   LNTSCALLEPENL-KADDFDFGIFLDALKSNVVEKRYFWSKLFYCFWWGLRNLSSLGQNL  943
             L TSC  + P+++  +  F+FGIF DALKS +V+   FW K FYCFWWGLRNLS+LGQNL
Sbjct  308   LTTSCPFINPDDITNSTTFNFGIFTDALKSGIVKSDDFWKKFFYCFWWGLRNLSALGQNL  367

Query  944   KTSNFVGEilfailisiiglilfslligNMQKYLQSITVRVEEMRVKRMDAEQWMSHRML  1123
              TS FVGEI+FA+LI I GL+LF+LLIGNMQKYL+S TVR EEMRV++ DAEQWM+HRML
Sbjct  368   NTSKFVGEIIFAVLICISGLVLFALLIGNMQKYLESTTVREEEMRVRKRDAEQWMAHRML  427

Query  1124  PDNLRERIRRYEQYRWQETRGVDEESLISNLPKDLRRDINRHLCWSLLKRVHMFKTMDEQ  1303
             P++LR+RIRRYEQY+WQETRGV+EE+L+ NLPKDLRRDI RH C  LLK+V +F+ MDEQ
Sbjct  428   PEDLRKRIRRYEQYKWQETRGVEEENLLRNLPKDLRRDIKRHFCLDLLKKVPLFEIMDEQ  487

Query  1304  LLDAICDRLKPVLYTEKSCIVREGDPVDEMIFVMRGNLLTMTTNGGRTGFLNSDVLNAGD  1483
             LLDA+CD+L+PVLYTE S  +REGDPV+EM+FVMRG L++ TTNGGRTGF N+  L A D
Sbjct  488   LLDAVCDKLRPVLYTENSYAIREGDPVEEMLFVMRGKLMSATTNGGRTGFFNAVYLKASD  547

Query  1484  FCGEELLTWALDPNSSSSLPISTRTVQALTDVEAFALTADFLKFFASQYRRLHSKQLQHK  1663
             FCGE+LLTWALDP SSS  PIS RTVQALT+VEAFAL A+ LK  ASQ+RRLHSKQLQH 
Sbjct  548   FCGEDLLTWALDPQSSSHFPISPRTVQALTEVEAFALAAEDLKLVASQFRRLHSKQLQHT  607

Query  1664  FRFYSHQWKTWAACFIQAAWRRHCRNKLEKSLREEEDRLQDALILRMRREEGETTPSLGA  1843
             FRFYS QW+TW A FIQAAWRRHCR +L +SL EEEDR + A+  R RR    ++PSL A
Sbjct  608   FRFYSVQWRTWGASFIQAAWRRHCRRRLARSLTEEEDRFRIAVAKRERR--AASSPSLVA  665

Query  1844  TIYASRFAANVLRTVRRNH  1900
             T+YASRFA+N LR +R+++
Sbjct  666   TLYASRFASNALRNLRQHN  684



>gb|KHG25326.1| Cyclic nucleotide-gated ion channel 1 -like protein [Gossypium 
arboreum]
Length=582

 Score =   774 bits (1999),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 409/596 (69%), Positives = 478/596 (80%), Gaps = 14/596 (2%)
 Frame = +2

Query  200   LEITACILRSVFDFFYIFHIILQFRTGFVPPSSRVFGRGDLIVDPSAIAKRYFFSYFFID  379
             +E TAC+LRS  D FYI HII QFRTGF+ PSSRVFGRG L+ D  AIAKRY  SYF ID
Sbjct  1     METTACVLRSFTDIFYIIHIIFQFRTGFIAPSSRVFGRGVLVEDSQAIAKRYLRSYFLID  60

Query  380   ILAVLPLPQVVLFMMIPRADRPFIMVAKDILKVVILVQSVPRLLRIYPLYKEVTRTSGFF  559
             +LAVLPLPQ+V+ ++IP       +  K++LK+V+L Q +PR+ RIYPLYKEVTRTSG  
Sbjct  61    VLAVLPLPQLVILIIIPEMSGLKSLNTKNLLKIVVLFQYLPRVFRIYPLYKEVTRTSGIL  120

Query  560   TETAWAGAAFNLFLYMIASYVAGAIWYITAIERQDKCWRRACEKHGSCDIDFLYCTKLGR  739
             TETAWAGAAFNLFLYM+AS+V GA WY+ ++ER+  CW+ AC  + +C   F YC     
Sbjct  121   TETAWAGAAFNLFLYMLASHVFGASWYLFSVEREFTCWKGACGNNTTCHRSF-YCDN---  176

Query  740   RGGDFSSSFLNTSCALLEPENLKADDFDFGIFLDALKSNVVEKRYFWSKLFYCFWWGLRN  919
              G  +  + LN SC +  P       F+FGIFLDAL+S +VE + F  K FYCFWWGL+N
Sbjct  177   -GDSYFRTLLNQSCPIQTPNTTL---FNFGIFLDALQSGIVESKDFPEKFFYCFWWGLQN  232

Query  920   LSSLGQNLKTSNFVGEilfailisiiglilfslligNMQKYLQSITVRVEEMRVKRMDAE  1099
             LSSLGQNL+TS +V EI FA+ ISI GL+LFS LIGNMQ YLQS T R+EEMRVKR DAE
Sbjct  233   LSSLGQNLETSTYVFEICFAVFISISGLVLFSFLIGNMQTYLQSTTTRLEEMRVKRRDAE  292

Query  1100  QWMSHRMLPDNLRERIRRYEQYRWQETRGVDEESLISNLPKDLRRDINRHLCWSLLKRVH  1279
             QWMSHR+LP+NLRERIRRYEQYRWQETRGVDEE+L+ NLPKDLRRDI RHLC +LL RV 
Sbjct  293   QWMSHRLLPENLRERIRRYEQYRWQETRGVDEENLLRNLPKDLRRDIKRHLCLALLMRVP  352

Query  1280  MFKTMDEQLLDAICDRLKPVLYTEKSCIVREGDPVDEMIFVMRGNLLTMTTNGGRTGFLN  1459
             MF+ MDEQLLDA+CDRLKPVLYTE+S IVREGDPVDEM+F+MRG LLT+TTNGGRTGF N
Sbjct  353   MFEKMDEQLLDAMCDRLKPVLYTEESYIVREGDPVDEMLFIMRGKLLTVTTNGGRTGFFN  412

Query  1460  SDVLNAGDFCGEELLTWALDPNSSSSLPISTRTVQALTDVEAFALTADFLKFFASQYRRL  1639
             S+ L AGDFCGEELLTWALDP+SSS+LPISTRTV+ALT+VEAFAL AD LKF ASQ+RRL
Sbjct  413   SEYLGAGDFCGEELLTWALDPHSSSNLPISTRTVRALTEVEAFALMADDLKFVASQFRRL  472

Query  1640  HSKQLQHKFRFYSHQWKTWAACFIQAAWRRHCRNKLEKSLREEEDRLQDALILRMRREEG  1819
             HSKQL+H FRFYS QW+TWAACFIQAAWRR+ + KLE+SLREEE+RLQDAL        G
Sbjct  473   HSKQLRHTFRFYSQQWRTWAACFIQAAWRRYSKKKLEESLREEENRLQDALA-----NAG  527

Query  1820  ETTPSLGATIYASRFAANVLRTVRRNHplsvpklsprlpplllqkpAEPDFSAPEN  1987
              ++PSLGATIYASRFAAN LR +RRN      +++ R+PPLLLQKPAEPDF+A E 
Sbjct  528   GSSPSLGATIYASRFAANALRALRRNR-SRKARVTERVPPLLLQKPAEPDFTAEEQ  582



>ref|XP_010234108.1| PREDICTED: cyclic nucleotide-gated ion channel 1-like isoform 
X2 [Brachypodium distachyon]
Length=676

 Score =   778 bits (2008),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 390/621 (63%), Positives = 481/621 (77%), Gaps = 15/621 (2%)
 Frame = +2

Query  38    RWWKSKMHDPQGPFLQRWNRIFVIACILAATVDPLFFYIPVVDDQNKCLGLDRTLEITAC  217
             R  K+++ DPQGPFLQRWN+IFVI+C++A +VDPLFFYIPV+D    CL LD+ L   A 
Sbjct  41    RKMKTRVLDPQGPFLQRWNKIFVISCLIAVSVDPLFFYIPVIDGIKNCLYLDKKLAKIAS  100

Query  218   ILRSVFDFFYIFHIILQFRTGFVPPSSRVFGRGDLIVDPSAIAKRYFFSYFFIDILAVLP  397
             ILR   D FY+ H+I QFRTGFV PSSRVFGRG L+ D  AIAKRY  +YF +D LAVLP
Sbjct  101   ILRFFTDIFYLLHMIFQFRTGFVAPSSRVFGRGVLVDDTLAIAKRYLSTYFLVDFLAVLP  160

Query  398   LPQVVLFMMIPRADRPFIMVAKDILKVVILVQSVPRLLRIYPLYKEVTRTSGFFTETAWA  577
             +PQV + +++P      +M AKD+L ++I  Q VPRL+RI PLY ++TR++G  TETAWA
Sbjct  161   IPQVFVLIVLPHLQGSEVMRAKDVLMIIITCQYVPRLVRIIPLYLQITRSAGIITETAWA  220

Query  578   GAAFNLFLYMIASYVAGAIWYITAIERQDKCWRRACEKHGSCDIDFLYCTKLGRRGGDFS  757
             GAAFNL +YM+AS+V GA+WY+ +I+R+D CWR  C+    CD+  LYC   G      +
Sbjct  221   GAAFNLLIYMLASHVFGALWYLLSIQREDTCWREKCDNTVGCDLASLYC---GSNTAQ-N  276

Query  758   SSFLNTSCALLEPENLKAD-DFDFGIFLDALKSNVVEKRYFWSKLFYCFWWGLRNLSSLG  934
             +SFL  +C    P N  AD D  FGI++ ALK+ V +   F+ K FYCFWWGL++LSSLG
Sbjct  277   NSFLANAC----PTNGNADIDPIFGIYIRALKT-VSQSTGFFEKFFYCFWWGLQSLSSLG  331

Query  935   QNLKTSNFVGEilfailisiiglilfslligNMQKYLQSITVRVEEMRVKRMDAEQWMSH  1114
             QNLKTS +  E LFA+ +SI GL+LF+LLIGN+Q YLQS +VR+EEMRVKR D EQWM+H
Sbjct  332   QNLKTSTYTCENLFAVFVSISGLVLFALLIGNVQTYLQSASVRIEEMRVKRRDTEQWMAH  391

Query  1115  RMLPDNLRERIRRYEQYRWQETRGVDEESLISNLPKDLRRDINRHLCWSLLKRVHMFKTM  1294
             R+LP+NL+ERI R+EQYRWQETRGVDEE L+ NLPKDLRR+I RHLC SLL RV MF+ M
Sbjct  392   RLLPENLKERILRHEQYRWQETRGVDEEGLLMNLPKDLRREIKRHLCLSLLMRVPMFQNM  451

Query  1295  DEQLLDAICDRLKPVLYTEKSCIVREGDPVDEMIFVMRGNLLTMTTNGGRTGFLNSDVLN  1474
             DEQLLDA+CDRLKP+LYTE SCI+REGDPV+EM+FVMRG L +MTTNGG++GF NS+VL 
Sbjct  452   DEQLLDAMCDRLKPMLYTEDSCIIREGDPVNEMLFVMRGYLESMTTNGGQSGFFNSNVLK  511

Query  1475  AGDFCGEELLTWALDPNSSSSLPISTRTVQALTDVEAFALTADFLKFFASQYRRLHSKQL  1654
              GDFCGEELLTWALDP S S+LP STRTV+ L++VEAF L AD LKF A+Q+R+LHSKQL
Sbjct  512   GGDFCGEELLTWALDPASVSNLPSSTRTVKTLSEVEAFVLRADDLKFVATQFRKLHSKQL  571

Query  1655  QHKFRFYSHQWKTWAACFIQAAWRRHCRNKLEKSLREEEDRLQDALILRMRREEGETTPS  1834
             QH FRFYS QW+TWAACFIQAAW R+CR KLE SL E+E RLQ A++      +  T  S
Sbjct  572   QHTFRFYSQQWRTWAACFIQAAWHRYCRKKLEDSLFEKEKRLQAAIV-----SDDSTKLS  626

Query  1835  LGATIYASRFAANVLRTVRRN  1897
             LGA +YASRFA N++R +RRN
Sbjct  627   LGAALYASRFAGNMMRILRRN  647



>emb|CDX91870.1| BnaC03g31720D [Brassica napus]
Length=704

 Score =   778 bits (2010),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 388/619 (63%), Positives = 485/619 (78%), Gaps = 7/619 (1%)
 Frame = +2

Query  47    KSKMHDPQGPFLQRWNRIFVIACILAATVDPLFFYIPVVDDQNKCLGLDRTLEITACILR  226
             K  + +PQG FLQ WN+ F+ A ++A  +DPLFFYIP+VD +  CL L  +LEI A +LR
Sbjct  73    KKNIINPQGSFLQNWNKTFLFASVIALAIDPLFFYIPIVDGKKHCLNLHSSLEIAASVLR  132

Query  227   SVFDFFYIFHIILQFRTGFVPPSSRVFGRGDLIVDPSAIAKRYFFSYFFIDILAVLPLPQ  406
             +  D FYI HI+ QFRT +V P SRVFGRG+L+ DP AIA +Y  SYF ID+L++LPLPQ
Sbjct  133   TFVDAFYIIHIVFQFRTAYVSPLSRVFGRGELVEDPKAIALKYLSSYFIIDVLSILPLPQ  192

Query  407   VVLFMMIPRADRPFIMVAKDILKVVILVQSVPRLLRIYPLYKEVTRTSGFFTETAWAGAA  586
             +V+  +IP  ++P  ++ KD L  VI  Q +PR+LRIYPLY EVTRTSG  TETAWAGAA
Sbjct  193   LVVLAVIPNVEKPVSLLTKDYLITVIFAQYIPRILRIYPLYSEVTRTSGIVTETAWAGAA  252

Query  587   FNLFLYMIASYVAGAIWYITAIERQDKCWRRACEKHGSCDIDFLYCTKLGRRGGDFSSSF  766
             +NL LYM+AS+V GA+WY+ ++ER+D+CWR ACEK   C++ FLYC        +  + +
Sbjct  253   WNLSLYMLASHVFGALWYLISVEREDRCWREACEKRQGCELRFLYCDG----NNNVINDY  308

Query  767   LNTSCALLEPENL-KADDFDFGIFLDALKSNVVEKRYFWSKLFYCFWWGLRNLSSLGQNL  943
             L TSC  + P+++  +  F+FGIF DALKS +VE   FW K FYCFWWGLRNLS+LGQNL
Sbjct  309   LTTSCPFINPDDITNSTTFNFGIFTDALKSGIVESDDFWKKFFYCFWWGLRNLSALGQNL  368

Query  944   KTSNFVGEilfailisiiglilfslligNMQKYLQSITVRVEEMRVKRMDAEQWMSHRML  1123
              TS FVGEI+FA+LI I GL+LF+LLIGNMQKYL+S TVR EEMRV++ DAEQWM+HRML
Sbjct  369   NTSKFVGEIIFAVLICISGLVLFALLIGNMQKYLESTTVREEEMRVRKRDAEQWMAHRML  428

Query  1124  PDNLRERIRRYEQYRWQETRGVDEESLISNLPKDLRRDINRHLCWSLLKRVHMFKTMDEQ  1303
             P++LR+RIRRYEQY+WQETRGV+EE+L+ NLP DLRRDI RH C  LLK+V +F+ MDEQ
Sbjct  429   PEDLRKRIRRYEQYKWQETRGVEEENLLRNLPNDLRRDIKRHFCLDLLKKVPLFEIMDEQ  488

Query  1304  LLDAICDRLKPVLYTEKSCIVREGDPVDEMIFVMRGNLLTMTTNGGRTGFLNSDVLNAGD  1483
             LLDA+CD+L+PVLYTE S  +REGDPV+EM+FVMRG L++ TTNGGRTGF N+  LNA D
Sbjct  489   LLDAVCDKLRPVLYTENSYAIREGDPVEEMLFVMRGKLMSATTNGGRTGFFNAVYLNASD  548

Query  1484  FCGEELLTWALDPNSSSSLPISTRTVQALTDVEAFALTADFLKFFASQYRRLHSKQLQHK  1663
             FCGE+LLTWALDP SSS  PIS RTVQALT+VEAFAL A+ LK  ASQ+RRLHSKQLQH 
Sbjct  549   FCGEDLLTWALDPQSSSHFPISPRTVQALTEVEAFALAAEDLKLVASQFRRLHSKQLQHT  608

Query  1664  FRFYSHQWKTWAACFIQAAWRRHCRNKLEKSLREEEDRLQDALILRMRREEGETTPSLGA  1843
             FRFYS QW+TW A FIQAAWRRHCR +L +SL +EED+ + A+  R RR    ++ SL A
Sbjct  609   FRFYSVQWRTWGASFIQAAWRRHCRRRLARSLTQEEDQFRIAVAKRERR--AASSSSLVA  666

Query  1844  TIYASRFAANVLRTVRRNH  1900
             T+YASRFA+N LR +R+++
Sbjct  667   TLYASRFASNALRNLRQHN  685



>ref|XP_010544812.1| PREDICTED: probable cyclic nucleotide-gated ion channel 3 isoform 
X1 [Tarenaya hassleriana]
Length=726

 Score =   778 bits (2010),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 389/614 (63%), Positives = 478/614 (78%), Gaps = 11/614 (2%)
 Frame = +2

Query  62    DPQGPFLQRWNRIFVIACILAATVDPLFFYIPVVDDQNKCLGLDRTLEITACILRSVFDF  241
             +P+  FLQ WN++F++ C++A   DPLFFYIPVVD  N CL LD+ L+I A +LR+V D 
Sbjct  93    NPRDSFLQNWNKVFLLLCVIALAFDPLFFYIPVVDRDNFCLNLDKRLQIIASVLRTVIDA  152

Query  242   FYIFHIILQFRTGFVPPSSRVFGRGDLIVDPSAIAKRYFFSYFFIDILAVLPLPQVVLFM  421
             FY+ HI+ QFRTGFVPPSSRVFGRG+LI DP AIAKRY FSYF +DILA+LPLPQVV+  
Sbjct  153   FYVIHIVFQFRTGFVPPSSRVFGRGELIDDPKAIAKRYLFSYFVVDILAILPLPQVVVLA  212

Query  422   MIPRADRPFIMVAKDILKVVILVQSVPRLLRIYPLYKEVTRTSGFFTETAWAGAAFNLFL  601
             +IP+  RP  +V K++LK VI  Q  PR+ RI PL+KEVTR SG  TETAWAGAA NLFL
Sbjct  213   IIPKMKRPASLVTKELLKWVIFCQYAPRITRILPLFKEVTRNSGMVTETAWAGAALNLFL  272

Query  602   YMIASYVAGAIWYITAIERQDKCWRRACEKHGSCDIDFLYCTKLGRRGGDFSSSFLNTSC  781
             Y +AS+V GA WY+ +IER+D+CWR ACEK   C    LYC K     G+ +  FLN++C
Sbjct  273   YTLASHVFGAFWYLISIERKDRCWREACEKIPECIHANLYCEK----SGENNRRFLNSTC  328

Query  782   ALLEPENLKADD-FDFGIFLDALKSNVVEKRYFWSKLFYCFWWGLRNLSSLGQNLKTSNF  958
              L++P  +     F+FGIF DAL+S VVE   F  K  YCFWWGLRNLS++GQNL TS+F
Sbjct  329   PLIDPGQITDPTVFNFGIFTDALQSGVVETMDFPKKFLYCFWWGLRNLSAVGQNLNTSDF  388

Query  959   VGEilfailisiiglilfslligNMQKYLQSITVRVEEMRVKRMDAEQWMSHRMLPDNLR  1138
             VGE++FAI+I + GL+LF+LLIGNMQKYLQS TVRVEEMRV+RMDAEQWMSHRMLP+ +R
Sbjct  389   VGEVIFAIIICVSGLVLFALLIGNMQKYLQSTTVRVEEMRVRRMDAEQWMSHRMLPEEMR  448

Query  1139  ERIRRYEQYRWQETRGVDEESLISNLPKDLRRDINRHLCWSLLKRVHMFKTMDEQLLDAI  1318
             +RIRRYEQYRWQETRGV+EESL+ +LPKDLRRDI  HLC +LLK V  F+ MDE++LDA+
Sbjct  449   KRIRRYEQYRWQETRGVEEESLLRSLPKDLRRDIKSHLCLNLLKSVPWFQAMDERILDAL  508

Query  1319  CDRLKPVLYTEKSCIVREGDPVDEMIFVMRGNLLTMTTNGGRTGFLNSDVLNAGDFCGEE  1498
             CDRLK  LYTE S I REGDPV++M+F+MRGNL++ TT+GGRTGF N+  L AGDFCG +
Sbjct  509   CDRLKTKLYTENSYITREGDPVEDMLFIMRGNLISSTTSGGRTGFYNAIPLKAGDFCG-D  567

Query  1499  LLTWALDPNSSSSLPISTRTVQALTDVEAFALTADFLKFFASQYRRLHSKQLQHKFRFYS  1678
             L TWALDP+SSS+LP ST TVQA+T+VE F L+AD LKF A+QYRR+HSKQL+H FR+YS
Sbjct  568   LFTWALDPHSSSNLPTSTTTVQAITEVEGFVLSADDLKFVATQYRRIHSKQLRHMFRYYS  627

Query  1679  HQWKTWAACFIQAAWRRHCRNKLEKS-LREEEDRLQDALILRMRREEGETTPSLGATIYA  1855
              QW+TWAACFIQ AW+RHC  KL K+ L  EE +LQ  L    + + G     LGATIY 
Sbjct  628   VQWQTWAACFIQVAWKRHCGRKLSKALLAAEEIKLQSTL----QTDSGNPKLKLGATIYV  683

Query  1856  SRFAANVLRTVRRN  1897
             S+FA+N +R +R N
Sbjct  684   SKFASNAIRNLRAN  697



>ref|XP_010544813.1| PREDICTED: probable cyclic nucleotide-gated ion channel 3 isoform 
X2 [Tarenaya hassleriana]
Length=720

 Score =   778 bits (2009),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 389/614 (63%), Positives = 478/614 (78%), Gaps = 11/614 (2%)
 Frame = +2

Query  62    DPQGPFLQRWNRIFVIACILAATVDPLFFYIPVVDDQNKCLGLDRTLEITACILRSVFDF  241
             +P+  FLQ WN++F++ C++A   DPLFFYIPVVD  N CL LD+ L+I A +LR+V D 
Sbjct  87    NPRDSFLQNWNKVFLLLCVIALAFDPLFFYIPVVDRDNFCLNLDKRLQIIASVLRTVIDA  146

Query  242   FYIFHIILQFRTGFVPPSSRVFGRGDLIVDPSAIAKRYFFSYFFIDILAVLPLPQVVLFM  421
             FY+ HI+ QFRTGFVPPSSRVFGRG+LI DP AIAKRY FSYF +DILA+LPLPQVV+  
Sbjct  147   FYVIHIVFQFRTGFVPPSSRVFGRGELIDDPKAIAKRYLFSYFVVDILAILPLPQVVVLA  206

Query  422   MIPRADRPFIMVAKDILKVVILVQSVPRLLRIYPLYKEVTRTSGFFTETAWAGAAFNLFL  601
             +IP+  RP  +V K++LK VI  Q  PR+ RI PL+KEVTR SG  TETAWAGAA NLFL
Sbjct  207   IIPKMKRPASLVTKELLKWVIFCQYAPRITRILPLFKEVTRNSGMVTETAWAGAALNLFL  266

Query  602   YMIASYVAGAIWYITAIERQDKCWRRACEKHGSCDIDFLYCTKLGRRGGDFSSSFLNTSC  781
             Y +AS+V GA WY+ +IER+D+CWR ACEK   C    LYC K     G+ +  FLN++C
Sbjct  267   YTLASHVFGAFWYLISIERKDRCWREACEKIPECIHANLYCEK----SGENNRRFLNSTC  322

Query  782   ALLEPENLKADD-FDFGIFLDALKSNVVEKRYFWSKLFYCFWWGLRNLSSLGQNLKTSNF  958
              L++P  +     F+FGIF DAL+S VVE   F  K  YCFWWGLRNLS++GQNL TS+F
Sbjct  323   PLIDPGQITDPTVFNFGIFTDALQSGVVETMDFPKKFLYCFWWGLRNLSAVGQNLNTSDF  382

Query  959   VGEilfailisiiglilfslligNMQKYLQSITVRVEEMRVKRMDAEQWMSHRMLPDNLR  1138
             VGE++FAI+I + GL+LF+LLIGNMQKYLQS TVRVEEMRV+RMDAEQWMSHRMLP+ +R
Sbjct  383   VGEVIFAIIICVSGLVLFALLIGNMQKYLQSTTVRVEEMRVRRMDAEQWMSHRMLPEEMR  442

Query  1139  ERIRRYEQYRWQETRGVDEESLISNLPKDLRRDINRHLCWSLLKRVHMFKTMDEQLLDAI  1318
             +RIRRYEQYRWQETRGV+EESL+ +LPKDLRRDI  HLC +LLK V  F+ MDE++LDA+
Sbjct  443   KRIRRYEQYRWQETRGVEEESLLRSLPKDLRRDIKSHLCLNLLKSVPWFQAMDERILDAL  502

Query  1319  CDRLKPVLYTEKSCIVREGDPVDEMIFVMRGNLLTMTTNGGRTGFLNSDVLNAGDFCGEE  1498
             CDRLK  LYTE S I REGDPV++M+F+MRGNL++ TT+GGRTGF N+  L AGDFCG +
Sbjct  503   CDRLKTKLYTENSYITREGDPVEDMLFIMRGNLISSTTSGGRTGFYNAIPLKAGDFCG-D  561

Query  1499  LLTWALDPNSSSSLPISTRTVQALTDVEAFALTADFLKFFASQYRRLHSKQLQHKFRFYS  1678
             L TWALDP+SSS+LP ST TVQA+T+VE F L+AD LKF A+QYRR+HSKQL+H FR+YS
Sbjct  562   LFTWALDPHSSSNLPTSTTTVQAITEVEGFVLSADDLKFVATQYRRIHSKQLRHMFRYYS  621

Query  1679  HQWKTWAACFIQAAWRRHCRNKLEKS-LREEEDRLQDALILRMRREEGETTPSLGATIYA  1855
              QW+TWAACFIQ AW+RHC  KL K+ L  EE +LQ  L    + + G     LGATIY 
Sbjct  622   VQWQTWAACFIQVAWKRHCGRKLSKALLAAEEIKLQSTL----QTDSGNPKLKLGATIYV  677

Query  1856  SRFAANVLRTVRRN  1897
             S+FA+N +R +R N
Sbjct  678   SKFASNAIRNLRAN  691



>ref|XP_003572098.1| PREDICTED: cyclic nucleotide-gated ion channel 1-like isoform 
X1 [Brachypodium distachyon]
 ref|XP_010234107.1| PREDICTED: cyclic nucleotide-gated ion channel 1-like isoform 
X1 [Brachypodium distachyon]
Length=700

 Score =   777 bits (2006),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 390/621 (63%), Positives = 481/621 (77%), Gaps = 15/621 (2%)
 Frame = +2

Query  38    RWWKSKMHDPQGPFLQRWNRIFVIACILAATVDPLFFYIPVVDDQNKCLGLDRTLEITAC  217
             R  K+++ DPQGPFLQRWN+IFVI+C++A +VDPLFFYIPV+D    CL LD+ L   A 
Sbjct  65    RKMKTRVLDPQGPFLQRWNKIFVISCLIAVSVDPLFFYIPVIDGIKNCLYLDKKLAKIAS  124

Query  218   ILRSVFDFFYIFHIILQFRTGFVPPSSRVFGRGDLIVDPSAIAKRYFFSYFFIDILAVLP  397
             ILR   D FY+ H+I QFRTGFV PSSRVFGRG L+ D  AIAKRY  +YF +D LAVLP
Sbjct  125   ILRFFTDIFYLLHMIFQFRTGFVAPSSRVFGRGVLVDDTLAIAKRYLSTYFLVDFLAVLP  184

Query  398   LPQVVLFMMIPRADRPFIMVAKDILKVVILVQSVPRLLRIYPLYKEVTRTSGFFTETAWA  577
             +PQV + +++P      +M AKD+L ++I  Q VPRL+RI PLY ++TR++G  TETAWA
Sbjct  185   IPQVFVLIVLPHLQGSEVMRAKDVLMIIITCQYVPRLVRIIPLYLQITRSAGIITETAWA  244

Query  578   GAAFNLFLYMIASYVAGAIWYITAIERQDKCWRRACEKHGSCDIDFLYCTKLGRRGGDFS  757
             GAAFNL +YM+AS+V GA+WY+ +I+R+D CWR  C+    CD+  LYC   G      +
Sbjct  245   GAAFNLLIYMLASHVFGALWYLLSIQREDTCWREKCDNTVGCDLASLYC---GSNTAQ-N  300

Query  758   SSFLNTSCALLEPENLKAD-DFDFGIFLDALKSNVVEKRYFWSKLFYCFWWGLRNLSSLG  934
             +SFL  +C    P N  AD D  FGI++ ALK+ V +   F+ K FYCFWWGL++LSSLG
Sbjct  301   NSFLANAC----PTNGNADIDPIFGIYIRALKT-VSQSTGFFEKFFYCFWWGLQSLSSLG  355

Query  935   QNLKTSNFVGEilfailisiiglilfslligNMQKYLQSITVRVEEMRVKRMDAEQWMSH  1114
             QNLKTS +  E LFA+ +SI GL+LF+LLIGN+Q YLQS +VR+EEMRVKR D EQWM+H
Sbjct  356   QNLKTSTYTCENLFAVFVSISGLVLFALLIGNVQTYLQSASVRIEEMRVKRRDTEQWMAH  415

Query  1115  RMLPDNLRERIRRYEQYRWQETRGVDEESLISNLPKDLRRDINRHLCWSLLKRVHMFKTM  1294
             R+LP+NL+ERI R+EQYRWQETRGVDEE L+ NLPKDLRR+I RHLC SLL RV MF+ M
Sbjct  416   RLLPENLKERILRHEQYRWQETRGVDEEGLLMNLPKDLRREIKRHLCLSLLMRVPMFQNM  475

Query  1295  DEQLLDAICDRLKPVLYTEKSCIVREGDPVDEMIFVMRGNLLTMTTNGGRTGFLNSDVLN  1474
             DEQLLDA+CDRLKP+LYTE SCI+REGDPV+EM+FVMRG L +MTTNGG++GF NS+VL 
Sbjct  476   DEQLLDAMCDRLKPMLYTEDSCIIREGDPVNEMLFVMRGYLESMTTNGGQSGFFNSNVLK  535

Query  1475  AGDFCGEELLTWALDPNSSSSLPISTRTVQALTDVEAFALTADFLKFFASQYRRLHSKQL  1654
              GDFCGEELLTWALDP S S+LP STRTV+ L++VEAF L AD LKF A+Q+R+LHSKQL
Sbjct  536   GGDFCGEELLTWALDPASVSNLPSSTRTVKTLSEVEAFVLRADDLKFVATQFRKLHSKQL  595

Query  1655  QHKFRFYSHQWKTWAACFIQAAWRRHCRNKLEKSLREEEDRLQDALILRMRREEGETTPS  1834
             QH FRFYS QW+TWAACFIQAAW R+CR KLE SL E+E RLQ A++      +  T  S
Sbjct  596   QHTFRFYSQQWRTWAACFIQAAWHRYCRKKLEDSLFEKEKRLQAAIV-----SDDSTKLS  650

Query  1835  LGATIYASRFAANVLRTVRRN  1897
             LGA +YASRFA N++R +RRN
Sbjct  651   LGAALYASRFAGNMMRILRRN  671



>dbj|BAJ97652.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=703

 Score =   776 bits (2005),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 399/643 (62%), Positives = 498/643 (77%), Gaps = 17/643 (3%)
 Frame = +2

Query  65    PQGPFLQRWNRIFVIACILAATVDPLFFYIPVVDDQNKCLGLDRTLEITACILRSVFDFF  244
             PQGPFLQRWN+IFV++CI A +VDPLF YIPV++D+N C  LDR ++ITA +LRS  D F
Sbjct  74    PQGPFLQRWNKIFVLSCIFAVSVDPLFLYIPVINDKNLCWYLDRKMKITASVLRSFTDIF  133

Query  245   YIFHIILQFRTGFVPPSSRVFGRGDLIVDPSAIAKRYFFSYFFIDILAVLPLPQVVLFMM  424
             YI HII QFRTGF+  SS  FGRG L+ D  AIAKRY  +YF ID+ AVLPLPQVV+ ++
Sbjct  134   YILHIIFQFRTGFITSSSTNFGRGVLVEDRYAIAKRYLSTYFLIDVCAVLPLPQVVILIV  193

Query  425   IPRADRPFIMVAKDILKVVILVQSVPRLLRIYPLYKEVTRTSGFFTETAWAGAAFNLFLY  604
             +P       M AK+IL ++++ Q VPR++RI PLY ++TR++G  TETAWAGAAFNL +Y
Sbjct  194   LPTLQVSQFMKAKNILMLIVICQYVPRVIRIRPLYLQITRSAGIITETAWAGAAFNLIIY  253

Query  605   MIASYVAGAIWYITAIERQDKCWRRACEKHGSCDIDFLYCTKLGRRGGDFSSSFLNTSCA  784
             M+AS+V GA+WY+ +I+R+D CW++ C     C+  +LYC   G  G +  ++FL   C 
Sbjct  254   MLASHVLGAVWYLLSIQRKDACWKQNCSLTRDCNPAYLYC---GNGGTNAGNAFLQNVCV  310

Query  785   LLEPENLKADDFD---FGIFLDALKSNVVEKRYFWSKLFYCFWWGLRNLSSLGQNLKTSN  955
                  N+  D+     FGIF+ A+ +NV +   F++KLFYC WWGL+NLSSLGQNLKTS 
Sbjct  311   ----PNITKDNLPDPLFGIFVPAI-NNVSQSTDFFAKLFYCVWWGLQNLSSLGQNLKTST  365

Query  956   FVGEilfailisiiglilfslligNMQKYLQSITVRVEEMRVKRMDAEQWMSHRMLPDNL  1135
             +  E LFA+ +SI GL+LFSLLIGNMQ YLQS T+R+EE RVK  D +QWMS+R+LPDNL
Sbjct  366   YAWENLFAVFVSISGLVLFSLLIGNMQTYLQSATLRIEETRVKSRDTDQWMSYRLLPDNL  425

Query  1136  RERIRRYEQYRWQETRGVDEESLISNLPKDLRRDINRHLCWSLLKRVHMFKTMDEQLLDA  1315
             +ERIRRYEQYRWQET GVDEE L+ NLPKDLRR I RHLC SLLKRV MF+ MD+QLL+A
Sbjct  426   KERIRRYEQYRWQETSGVDEEHLLMNLPKDLRRAIKRHLCLSLLKRVPMFEKMDDQLLNA  485

Query  1316  ICDRLKPVLYTEKSCIVREGDPVDEMIFVMRGNLLTMTTNGGRTGFLNSDVLNAGDFCGE  1495
             +CD LKPVLYTE  CIVREGDPV+EM F+ RGNL++MTTNGG+TGF NSDVL +GDFCGE
Sbjct  486   LCDCLKPVLYTEGGCIVREGDPVNEMFFITRGNLMSMTTNGGKTGFFNSDVLKSGDFCGE  545

Query  1496  ELLTWALDPNSSSSLPISTRTVQALTDVEAFALTADFLKFFASQYRRLHSKQLQHKFRFY  1675
             ELLTWALDPNS++SLP STRTV+++++VEAFAL A+ LKF A Q+RRLHSKQL+H FRFY
Sbjct  546   ELLTWALDPNSATSLPSSTRTVKSMSEVEAFALMAEDLKFVAMQFRRLHSKQLRHTFRFY  605

Query  1676  SHQWKTWAACFIQAAWRRHCRNKLEKSLREEEDRLQDALILRMRREEGETTPSLGATIYA  1855
             S QW+TWAACFIQAAW R CR K+E +LRE+E+RLQ A++      +G T+ S GA IYA
Sbjct  606   SQQWRTWAACFIQAAWHRRCRKKMEDALREKEERLQLAIV-----NDGSTSLSFGAAIYA  660

Query  1856  SRFAANVLRTVRRNHplsvpklsprlpplllqkpAEPDFSAPE  1984
             SRFA N++RT+RRN      +L  R+P  LLQKPAEP+FSA E
Sbjct  661   SRFARNMMRTLRRN-ATRKARLQERVPARLLQKPAEPNFSAEE  702



>ref|XP_010667924.1| PREDICTED: cyclic nucleotide-gated ion channel 1-like [Beta vulgaris 
subsp. vulgaris]
Length=718

 Score =   776 bits (2005),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 399/617 (65%), Positives = 478/617 (77%), Gaps = 15/617 (2%)
 Frame = +2

Query  53    KMHDPQGPFLQRWNRIFVIACILAATVDPLFFYIPVVDDQNKCLGLDRTLEITACILRSV  232
             K+ DPQGPFLQ+WN+IF+I+C+ A  +DPLFFYI V+D + +CL LD  L++ AC LR++
Sbjct  86    KILDPQGPFLQKWNKIFLISCVFAMALDPLFFYILVIDGKKQCLKLDENLKMIACFLRTM  145

Query  233   FDFFYIFHIILQFRTGFVPPSSRVFGRGDLIVDPSAIAKRYFFSYFFIDILAVLPLPQVV  412
              D FY+ HIILQF TGF+ PSSRV G+G+LI D  AIA+RY  SYF +DILAVLPLPQ+ 
Sbjct  146   TDLFYVLHIILQFHTGFISPSSRVLGKGELIKDHRAIARRYLSSYFIVDILAVLPLPQIA  205

Query  413   LFMMIPRADRPFIMVAKDILKVVILVQSVPRLLRIYPLYKEVTRTS-GFFTETAWAGAAF  589
             + ++IPR     ++  K +LK+VI  Q VPR++RIYPLYKEVT+TS G  TETAWAGAA 
Sbjct  206   VLLIIPRLMGGGLLTLKGLLKLVIFTQYVPRIIRIYPLYKEVTKTSLGIITETAWAGAAS  265

Query  590   NLFLYMIASYVAGAIWYITAIERQDKCWRRACEKHGSCDIDFLYCTKLGRRGGDFSSSFL  769
             NLFLYM+AS+V GA+WY+ AI+RQ  CWR++C   G C    LYC    +  G++   F 
Sbjct  266   NLFLYMLASHVFGAVWYMFAIDRQGTCWRKSC-MGGGCHQLSLYCKD--KHEGNYV--FN  320

Query  770   NTSCALLEPENLK-ADDFDFGIFLDALKSNVVEKRYFWSKLFYCFWWGLRNLSSLGQNLK  946
             NT C L+ P+ +  +   +FG+F DAL S V++  + + KLFYCFWWGL+NLSSLGQNL 
Sbjct  321   NTFCKLINPDQITDSTVLNFGLFYDALNSEVLQSTHIFEKLFYCFWWGLQNLSSLGQNLN  380

Query  947   TSNFVGEilfailisiiglilfslligNMQKYLQSITVRVEEMRVKRMDAEQWMSHRMLP  1126
             TS FVGE LFA  I++ GL+LFSLLI NMQK+LQS TVRVEEMR++R DAE WMSHR+LP
Sbjct  381   TSTFVGENLFAAFITVSGLVLFSLLIANMQKFLQSTTVRVEEMRIRRRDAELWMSHRLLP  440

Query  1127  DNLRERIRRYEQYRWQETRGVDEESLISNLPKDLRRDINRHLCWSLLKRVHMFKTMDEQL  1306
              +L+ERIRRY+QY WQ TRGVDEES+I NLP DLRRDI RHLC +LL RV MF  MDEQL
Sbjct  441   ADLKERIRRYDQYNWQVTRGVDEESVIRNLPGDLRRDIKRHLCLALLMRVPMFSKMDEQL  500

Query  1307  LDAICDRLKPVLYTEKSCIVREGDPVDEMIFVMRGNLLTMTTNGGRTGFLNSDVLNAGDF  1486
              DA+CDRLKPVLYTE S IVREGDPV+EM+F+MRGNLLTMTTNGGRTGF NS  L AGDF
Sbjct  501   KDAMCDRLKPVLYTENSFIVREGDPVNEMLFIMRGNLLTMTTNGGRTGFFNSVYLKAGDF  560

Query  1487  CGEELLTWALDPNSSSSLPISTRTVQALTDVEAFALTADFLKFFASQYRRLHSKQLQHKF  1666
             CGE LLTWALDP SS  LPISTR V + T+VEAFALT D L+F ASQ+RRLHSKQL+H F
Sbjct  561   CGEALLTWALDPYSSLHLPISTRIVLSQTEVEAFALTPDDLRFLASQFRRLHSKQLRHTF  620

Query  1667  RFYSHQWKTWAACFIQAAWRRHCRNKLEKSLREEEDRLQDALILRMRREEGETTPSLGAT  1846
             RFYS QW+TWAACFIQAAWRRH R KLEKSL E E+       L M +E G +T SLGAT
Sbjct  621   RFYSQQWRTWAACFIQAAWRRHYRRKLEKSLLEAEE-------LAMAKEGGSST-SLGAT  672

Query  1847  IYASRFAANVLRTVRRN  1897
             IYASRFA N LR ++ N
Sbjct  673   IYASRFAVNALRKLQSN  689



>ref|XP_003529892.1| PREDICTED: cyclic nucleotide-gated ion channel 1-like isoform 
X1 [Glycine max]
 ref|XP_006583243.1| PREDICTED: cyclic nucleotide-gated ion channel 1-like isoform 
X2 [Glycine max]
 ref|XP_006583244.1| PREDICTED: cyclic nucleotide-gated ion channel 1-like isoform 
X3 [Glycine max]
 ref|XP_006583245.1| PREDICTED: cyclic nucleotide-gated ion channel 1-like isoform 
X4 [Glycine max]
Length=689

 Score =   775 bits (2002),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 394/613 (64%), Positives = 477/613 (78%), Gaps = 13/613 (2%)
 Frame = +2

Query  62    DPQGPFLQRWNRIFVIACILAATVDPLFFYIPVVDDQNKCLGLDRTLEITACILRSVFDF  241
             DPQG  LQ+WN+IFVI  ++A +VDPLFFYIP++DD+ +CL LD TL+ITA +LR+ FD 
Sbjct  60    DPQGATLQKWNKIFVITSVMAISVDPLFFYIPMIDDKKQCLALDGTLKITASVLRTFFDL  119

Query  242   FYIFHIILQFRTGFVPPSSRVFGRGDLIVDPSAIAKRYFFSYFFIDILAVLPLPQVVLFM  421
             FYI HII QFRTGF+ PSSRVFGRG+L+ DP AI  RY  SYF IDIL+++PLPQ+V+  
Sbjct  120   FYILHIIFQFRTGFIAPSSRVFGRGELVNDPWAIVMRYLSSYFIIDILSIIPLPQLVILA  179

Query  422   MIPRADRPFIMVAKDILKVVILVQSVPRLLRIYPLYKEVTRTSGFFTETAWAGAAFNLFL  601
             MIP        V KD+LK  I+ Q VPR+LRIYPL+KEVT TSG  TETAWAGAA+NLFL
Sbjct  180   MIPFPKCSVPYVGKDLLKYTIIAQYVPRILRIYPLFKEVTSTSGILTETAWAGAAYNLFL  239

Query  602   YMIASYVAGAIWYITAIERQDKCWRRACEKHGSCDIDFLYCTKLGRRGGDFSSSFLNTSC  781
             YM+AS+V GA WY+ ++E + +CWRR  +        +L C      G     S L +SC
Sbjct  240   YMLASHVVGAFWYLFSVESRLRCWRRRLKNTTFLHESYLSCGS----GNSTVQSLLKSSC  295

Query  782   ALLEPENLKA-DDFDFGIFLDALKSNVVEKRY-FWSKLFYCFWWGLRNLSSLGQNLKTSN  955
              L +P+ ++  + F+FGIF++ALK+ VVE    F  K FYCFWWGLR++SS+GQ L+TS 
Sbjct  296   PLTDPQQIQHLETFNFGIFIEALKARVVESNTDFPHKFFYCFWWGLRSVSSVGQGLETST  355

Query  956   FVGEilfailisiiglilfslligNMQKYLQSITVRVEEMRVKRMDAEQWMSHRMLPDNL  1135
             + GEI+FAI I++ GLILF+ LIGNMQKYLQS TVRVEEMR+KR DAE WMSHRMLPD L
Sbjct  356   YAGEIIFAIFIAVFGLILFASLIGNMQKYLQSTTVRVEEMRIKRRDAELWMSHRMLPDFL  415

Query  1136  RERIRRYEQYRWQETRGVDEESLISNLPKDLRRDINRHLCWSLLKRVHMFKTMDEQLLDA  1315
             +ERIRRYEQY+WQE RGV+EE+LI NLPKDLRRDI RHLC  LLK+V MF+ MD QLLDA
Sbjct  416   KERIRRYEQYKWQENRGVEEETLIRNLPKDLRRDIKRHLCIDLLKKVPMFENMDNQLLDA  475

Query  1316  ICDRLKPVLYTEKSCIVREGDPVDEMIFVMRGNLLTMTTNGGRTGFLNSDVLNAGDFCGE  1495
             +CD+LKPVLYTEKS IVREGDPVDEM+F+MRG L T TTNGGRTGF NS  + AGDFCGE
Sbjct  476   LCDKLKPVLYTEKSYIVREGDPVDEMLFIMRGKLATATTNGGRTGFFNSFEIKAGDFCGE  535

Query  1496  ELLTWALDPNSSSSLPISTRTVQALTDVEAFALTADFLKFFASQYRRL-HSKQLQHKFRF  1672
             ELLTWALDPNSSS+LPISTRTV+ +++VEAFAL  D LK  ASQ+RRL +SKQLQH FRF
Sbjct  536   ELLTWALDPNSSSNLPISTRTVETISEVEAFALMPDDLKCVASQFRRLINSKQLQHTFRF  595

Query  1673  YSHQWKTWAACFIQAAWRRHCRNKLEKSLREEEDRLQDALILRMRREEGETTPSLGATIY  1852
             YS QWKTW ACFIQAAWRR+ + K E+ LRE E+R+Q      +  EEG ++PS  ATIY
Sbjct  596   YSLQWKTWGACFIQAAWRRYKKKKAERLLREAEERIQA-----LENEEG-SSPSFAATIY  649

Query  1853  ASRFAANVLRTVR  1891
             ASRFA++ LR +R
Sbjct  650   ASRFASSGLRHLR  662



>emb|CAA05637.1| putative calmodulin binding transporter protein [Hordeum vulgare 
subsp. vulgare]
Length=702

 Score =   775 bits (2002),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 399/643 (62%), Positives = 499/643 (78%), Gaps = 17/643 (3%)
 Frame = +2

Query  65    PQGPFLQRWNRIFVIACILAATVDPLFFYIPVVDDQNKCLGLDRTLEITACILRSVFDFF  244
             PQGPFLQRWN+IFV++CI A +VDPLF YIPV++D+N C  LDR ++ITA +LRS  D F
Sbjct  73    PQGPFLQRWNKIFVLSCIFAVSVDPLFLYIPVINDKNLCWYLDRKMKITASVLRSFTDIF  132

Query  245   YIFHIILQFRTGFVPPSSRVFGRGDLIVDPSAIAKRYFFSYFFIDILAVLPLPQVVLFMM  424
             YI HII QFRTGF+  SS  FGRG L+ D  AIAKRY  +YF ID+ AVLPLPQVV++++
Sbjct  133   YILHIIFQFRTGFITSSSTNFGRGVLVEDRYAIAKRYLSTYFLIDVCAVLPLPQVVIWIV  192

Query  425   IPRADRPFIMVAKDILKVVILVQSVPRLLRIYPLYKEVTRTSGFFTETAWAGAAFNLFLY  604
             +P       M AK+IL ++++ Q VPR++RI PLY ++TR++G  TETAWAGAAFNL +Y
Sbjct  193   LPTLQVSQFMKAKNILMLIVICQYVPRVIRIRPLYLQITRSAGIITETAWAGAAFNLIIY  252

Query  605   MIASYVAGAIWYITAIERQDKCWRRACEKHGSCDIDFLYCTKLGRRGGDFSSSFLNTSCA  784
             M+AS+V GA+WY+ +I+R+D CW++ C     C+  +LYC   G  G +  ++FL   C 
Sbjct  253   MLASHVLGAVWYLLSIQRKDACWKQNCSLTRDCNPAYLYC---GNGGTNAGNAFLQNVCV  309

Query  785   LLEPENLKADDFD---FGIFLDALKSNVVEKRYFWSKLFYCFWWGLRNLSSLGQNLKTSN  955
                  N+  D+     FGIF+ A+ +NV +   F++KLFYC WWGL+NLSSLGQNLKTS 
Sbjct  310   ----PNITKDNLPDPLFGIFVPAI-NNVSQSTDFFAKLFYCVWWGLQNLSSLGQNLKTST  364

Query  956   FVGEilfailisiiglilfslligNMQKYLQSITVRVEEMRVKRMDAEQWMSHRMLPDNL  1135
             +  E LFA+ +SI GL+LFSLLIGNMQ YLQS T+R+EE RVK  D +QWMS+R+LPDNL
Sbjct  365   YAWENLFAVFVSISGLVLFSLLIGNMQTYLQSATLRIEETRVKSRDTDQWMSYRLLPDNL  424

Query  1136  RERIRRYEQYRWQETRGVDEESLISNLPKDLRRDINRHLCWSLLKRVHMFKTMDEQLLDA  1315
             +ERIRRYEQYRWQET GVDEE L+ NLPKDLRR I RHLC SLLKRV MF+ MD+QLL+A
Sbjct  425   KERIRRYEQYRWQETSGVDEEHLLMNLPKDLRRAIKRHLCLSLLKRVPMFEKMDDQLLNA  484

Query  1316  ICDRLKPVLYTEKSCIVREGDPVDEMIFVMRGNLLTMTTNGGRTGFLNSDVLNAGDFCGE  1495
             +CD LKPVLYTE  CIVREGDPV+EM F+ RGNL++MTTNGG+TGF NSDVL +GDFCGE
Sbjct  485   LCDCLKPVLYTEGGCIVREGDPVNEMFFITRGNLMSMTTNGGKTGFFNSDVLKSGDFCGE  544

Query  1496  ELLTWALDPNSSSSLPISTRTVQALTDVEAFALTADFLKFFASQYRRLHSKQLQHKFRFY  1675
             ELLTWALDPNS++SLP STRTV+++++VEAFAL A+ LKF A Q+RRLHSKQL+H FRFY
Sbjct  545   ELLTWALDPNSATSLPSSTRTVKSMSEVEAFALMAEDLKFVAMQFRRLHSKQLRHTFRFY  604

Query  1676  SHQWKTWAACFIQAAWRRHCRNKLEKSLREEEDRLQDALILRMRREEGETTPSLGATIYA  1855
             S QW+TWAACFIQAAW R CR K+E +LRE+E+RLQ A++      +G T+ S GA IYA
Sbjct  605   SQQWRTWAACFIQAAWHRRCRKKMEDALREKEERLQLAIV-----NDGSTSLSFGAAIYA  659

Query  1856  SRFAANVLRTVRRNHplsvpklsprlpplllqkpAEPDFSAPE  1984
             SRFA N++RT+RRN      +L  R+P  LLQKPAEP+FSA E
Sbjct  660   SRFARNMMRTLRRN-ATRKARLQERVPARLLQKPAEPNFSAEE  701



>gb|KHN44224.1| Cyclic nucleotide-gated ion channel 1 [Glycine soja]
Length=589

 Score =   771 bits (1990),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 407/600 (68%), Positives = 476/600 (79%), Gaps = 11/600 (2%)
 Frame = +2

Query  188   LDRTLEITACILRSVFDFFYIFHIILQFRTGFVPPSSRVFGRGDLIVDPSAIAKRYFFSY  367
             +DR +EITA +LRS  D FYI HII QFRTGF+ PSSRVFGRG L+ D  AIA RY  SY
Sbjct  1     MDRKMEITATVLRSFSDIFYIIHIIFQFRTGFIAPSSRVFGRGVLVEDAWAIAMRYLSSY  60

Query  368   FFIDILAVLPLPQVVLFMMIPRADRPFIMVAKDILKVVILVQSVPRLLRIYPLYKEVTRT  547
             F IDILAVLPLPQV + ++IP+      +  K +LK ++  Q +PR LRI PLYKEVTRT
Sbjct  61    FLIDILAVLPLPQVAILIIIPKLSGSESLNTKTLLKFIVFFQYIPRFLRIIPLYKEVTRT  120

Query  548   SGFFTETAWAGAAFNLFLYMIASYVAGAIWYITAIERQDKCWRRACEKHGSCDIDFLYCT  727
             SG  TETAWAGAAFNLFLYM+AS+V GA WY+ +IER+  CW+  C ++ +C+   +YC 
Sbjct  121   SGILTETAWAGAAFNLFLYMLASHVIGAFWYLFSIERETTCWQDVCRRNSTCNTAAMYCD  180

Query  728   KLGRRGGDFSSSFLNTSCALLEPENLKADDFDFGIFLDALKSNVVEKRYFWSKLFYCFWW  907
                  G    S+FLN SC + + +N     F+FGIFLDAL+S VVE R F  K FYCFWW
Sbjct  181   NHQVLGT--MSAFLNASCPI-QVQNTTL--FNFGIFLDALQSGVVESRDFPQKFFYCFWW  235

Query  908   GLRNLSSLGQNLKTSNFVGEilfailisiiglilfslligNMQKYLQSITVRVEEMRVKR  1087
             GLRNLSSLGQNL TS +V EI FAI ISI GL+LF+ LIGNMQ YLQS T R+EEMRVKR
Sbjct  236   GLRNLSSLGQNLATSTYVWEICFAIFISIAGLVLFAFLIGNMQTYLQSTTTRLEEMRVKR  295

Query  1088  MDAEQWMSHRMLPDNLRERIRRYEQYRWQETRGVDEESLISNLPKDLRRDINRHLCWSLL  1267
              DAEQWMSHR+LPD+LRERIRR+EQY+WQETRGVDE+SLI +LPKDLRRDI RHLC +LL
Sbjct  296   RDAEQWMSHRLLPDSLRERIRRHEQYKWQETRGVDEDSLIRDLPKDLRRDIKRHLCLALL  355

Query  1268  KRVHMFKTMDEQLLDAICDRLKPVLYTEKSCIVREGDPVDEMIFVMRGNLLTMTTNGGRT  1447
              RV MF+ MDEQLLDA+CDRLKPVLYTE+SCIVREGDPV EM+F+MRG LLT+TTNGGRT
Sbjct  356   MRVPMFENMDEQLLDAMCDRLKPVLYTEESCIVREGDPVGEMLFIMRGKLLTVTTNGGRT  415

Query  1448  GFLNSDVLNAGDFCGEELLTWALDPNSSSSLPISTRTVQALTDVEAFALTADFLKFFASQ  1627
             GF NS+ L AGDFCGEELLTWALDP SSS+LPISTRTVQ L++VEAFAL AD LKF ASQ
Sbjct  416   GFFNSEYLKAGDFCGEELLTWALDPQSSSNLPISTRTVQTLSEVEAFALKADDLKFVASQ  475

Query  1628  YRRLHSKQLQHKFRFYSHQWKTWAACFIQAAWRRHCRNKLEKSLREEEDRLQDALILRMR  1807
             +RRLHSKQL+H FRFYS QW+TWAACFIQAAWRR+ + KLE+SLREEE+RLQDAL     
Sbjct  476   FRRLHSKQLRHTFRFYSQQWRTWAACFIQAAWRRYGKKKLEESLREEENRLQDAL-----  530

Query  1808  REEGETTPSLGATIYASRFAANVLRTVRRNHplsvpklsprlpplllqkpAEPDFSAPEN  1987
              + G ++PSLGATIYASRFAAN LR +RRN      ++  R+ P+LLQKPAEPDF++ E 
Sbjct  531   SKAGGSSPSLGATIYASRFAANALRLLRRNG-TRKARVPERISPMLLQKPAEPDFTSEEQ  589



>ref|XP_002277224.2| PREDICTED: cyclic nucleotide-gated ion channel 1 [Vitis vinifera]
 ref|XP_010661921.1| PREDICTED: cyclic nucleotide-gated ion channel 1 [Vitis vinifera]
 ref|XP_010661923.1| PREDICTED: cyclic nucleotide-gated ion channel 1 [Vitis vinifera]
 ref|XP_010661924.1| PREDICTED: cyclic nucleotide-gated ion channel 1 [Vitis vinifera]
Length=721

 Score =   775 bits (2001),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 395/621 (64%), Positives = 478/621 (77%), Gaps = 10/621 (2%)
 Frame = +2

Query  47    KSKMHDPQGPFLQRWNRIFVIACILAATVDPLFFYIPVVDDQNKCLGLDRTLEITACILR  226
             + K+ DPQG FLQ WN++F+I+ +LA  +DP FFYIP++  +  CL LD  L + AC+LR
Sbjct  78    RKKILDPQGSFLQEWNKVFLISTVLAVALDPFFFYIPILHREETCLDLDTKLGVIACVLR  137

Query  227   SVFDFFYIFHIILQFRTGFVPPSSRVFGRGDLIVDPSAIAKRYFFSYFFIDILAVLPLPQ  406
             S+ D FYI HII QF TGF+ PSSRVFGRG+L+  PSAIAKRY  +YF IDIL++LPLPQ
Sbjct  138   SIVDIFYILHIIFQFHTGFIAPSSRVFGRGELVEAPSAIAKRYLSTYFIIDILSILPLPQ  197

Query  407   VVLFMMIPRADRPFIMVAKDILKVVILVQSVPRLLRIYPLYKEVTRTSGFFTETAWAGAA  586
             +V+ ++      P  +  KD+LK VI  Q VPRLLRIYPLYKEVT TSG  T+TAWAGA 
Sbjct  198   LVILIVKAEVKGPVSLNTKDLLKSVIFSQYVPRLLRIYPLYKEVTTTSGIITQTAWAGAV  257

Query  587   FNLFLYMIASYVAGAIWYITAIERQDKCWRRACEKHGSCDIDFLYCTKLGRRGGDFSSSF  766
             FNL LYM+AS+V GA WY+ AIERQ+ CW +     G   +  LYC    RR        
Sbjct  258   FNLCLYMLASHVVGAFWYLFAIERQNTCWVKGSRSCGFNPVG-LYCGAESRRNNITPQVH  316

Query  767   --LNTSCALLEPENL-KADDFDFGIFLDALKSNVVEKRYFWSKLFYCFWWGLRNLSSLGQ  937
               LN +C L++P+++     F+FGIF DAL+S+VVE++ F +K FYCFWWGLRNLSSLGQ
Sbjct  317   DCLNAACPLIDPDDIVNTTTFNFGIFFDALQSHVVERKDFQNKFFYCFWWGLRNLSSLGQ  376

Query  938   NLKTSNFVGEilfailisiiglilfslligNMQKYLQSITVRVEEMRVKRMDAEQWMSHR  1117
             NLKTS F+ EI FA+ ISI GL+LFSLLIGNMQKYLQS TVR+EEMRVKR DAEQWM+HR
Sbjct  377   NLKTSTFIEEIFFAVFISIFGLVLFSLLIGNMQKYLQSTTVRIEEMRVKRQDAEQWMAHR  436

Query  1118  MLPDNLRERIRRYEQYRWQETRGVDEESLISNLPKDLRRDINRHLCWSLLKRVHMFKTMD  1297
             +LPD LR RIRRYEQY+WQETRGV E  LIS+LPKDLRRD+ RHLCW+LL RV MF+ MD
Sbjct  437   LLPDPLRVRIRRYEQYKWQETRGVQEHKLISDLPKDLRRDVRRHLCWNLLMRVPMFEKMD  496

Query  1298  EQLLDAICDRLKPVLYTEKSCIVREGDPVDEMIFVMRGNLLTMTTNGGRTGFLNSDVLNA  1477
              QLLDA+CD LKPVLYTE S I+REGDPVDE+ F+MRG L T+TTNGGRTGF N   L A
Sbjct  497   SQLLDALCDHLKPVLYTENSTILREGDPVDEIFFIMRGKLSTITTNGGRTGFFNETYLKA  556

Query  1478  GDFCGEELLTWALDPNSSSSLPISTRTVQALTDVEAFALTADFLKFFASQ-YRRLHSKQL  1654
             GDFCG+ELLTWAL+  SSS+LPISTRTV+A+T+VEAF L ++ L   ASQ + RLHSKQL
Sbjct  557   GDFCGDELLTWALESKSSSNLPISTRTVKAITEVEAFGLMSNDLITVASQFFYRLHSKQL  616

Query  1655  QHKFRFYSHQWKTWAACFIQAAWRRHCRNKLEKSLREEEDRLQDALILRMRREEGETTPS  1834
             Q+ FRFYS QW+TW ACFIQAAW+R+ R K +K+L+E E+RLQDAL     RE G  +PS
Sbjct  617   QYTFRFYSQQWRTWGACFIQAAWQRYRRRKQDKALQEAEERLQDAL----SREVG-ASPS  671

Query  1835  LGATIYASRFAANVLRTVRRN  1897
             LGAT++ASRFAA +LR +RRN
Sbjct  672   LGATVFASRFAAKLLRALRRN  692



>ref|XP_007147299.1| hypothetical protein PHAVU_006G112200g [Phaseolus vulgaris]
 gb|ESW19293.1| hypothetical protein PHAVU_006G112200g [Phaseolus vulgaris]
Length=705

 Score =   774 bits (1998),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 406/642 (63%), Positives = 497/642 (77%), Gaps = 22/642 (3%)
 Frame = +2

Query  62    DPQGPFLQRWNRIFVIACILAATVDPLFFYIPVVDDQNKCLGLDRTLEITACILRSVFDF  241
             DP+ P LQ+WN+IFVI+C+LA +VDP FFYIPV++D+ KCL +  +L+ITA + R+ FD 
Sbjct  80    DPKDPMLQKWNKIFVISCVLAVSVDPFFFYIPVINDKKKCLDMSGSLQITASVFRTFFDL  139

Query  242   FYIFHIILQFRTGFVPPSSRVFGRGDLIVDPSAIAKRYFFSYFFIDILAVLPLPQVVLFM  421
             FY+ HII QF+TGFV PSSRVFG GDL  DP AI KRY  SYF ID+L+++PLPQV++  
Sbjct  140   FYVLHIIFQFKTGFVSPSSRVFGSGDLNDDPVAITKRYLTSYFIIDVLSIIPLPQVIVLA  199

Query  422   MIPRAD-RPFIMVAKDILKVVILVQSVPRLLRIYPLYKEVTRTSGFFTETAWAGAAFNLF  598
             + P     PF  VAKD+LK  +L+Q VPRLLRI+PL+KEVTRTSG  TETA AGAA+NLF
Sbjct  200   IHPNMKMNPF--VAKDLLKYSVLIQYVPRLLRIHPLFKEVTRTSGILTETAGAGAAYNLF  257

Query  599   LYMIASYVAGAIWYITAIERQDKCWRRACEKHGSCDIDFLYCTKLGRRGGDFSSSFLNTS  778
             LYM+AS++ GA WY+ ++E + +CWR   E         L C    R     + + LN +
Sbjct  258   LYMLASHLVGAFWYLLSVESEVRCWRTKVENGD------LSC----RNRIQETITLLNQT  307

Query  779   CALLEPENLK-ADDFDFGIFLDALKSNVVEKRY-FWSKLFYCFWWGLRNLSSLGQNLKTS  952
             C+L++P+++K  ++++FGIF  AL S VV+    F +K FYCFWWGLR+LSSLGQ+LKTS
Sbjct  308   CSLVDPDDIKDGENYNFGIFFYALHSGVVKSTTEFPNKFFYCFWWGLRSLSSLGQDLKTS  367

Query  953   NFVGEilfailisiiglilfslligNMQKYLQSITVRVEEMRVKRMDAEQWMSHRMLPDN  1132
              +V EI FAI ISI GL+LFS LIGNMQ+YLQS TVRVEEMRVKR DAEQWMSHRMLP+N
Sbjct  368   TYVPEIAFAIFISIFGLVLFSSLIGNMQEYLQSTTVRVEEMRVKRQDAEQWMSHRMLPEN  427

Query  1133  LRERIRRYEQYRWQETRGVDEESLISNLPKDLRRDINRHLCWSLLKRVHMFKTMDEQLLD  1312
             L+ RIR YEQY+WQE RGV+EE+LI NLPKDLRRDI RHLC +L+K+V +FK MDEQLLD
Sbjct  428   LKRRIRHYEQYQWQENRGVEEEALIRNLPKDLRRDIKRHLCLALVKKVPLFKEMDEQLLD  487

Query  1313  AICDRLKPVLYTEKSCIVREGDPVDEMIFVMRGNLLTMTTNGGRTGFLNSDVLNAGDFCG  1492
             AIC RLKPVLYTEKS I REGDPVDEM+F+MRG + T+TTNGGRTGF NS  L AG FCG
Sbjct  488   AICTRLKPVLYTEKSHIFREGDPVDEMLFIMRGQVSTVTTNGGRTGFFNSSFLVAGQFCG  547

Query  1493  EELLTWALDPNSSSSLPISTRTVQALTDVEAFALTADFLKFFASQYRRLHSKQLQHKFRF  1672
             EELLTWALDPNSSS+LPISTRTV+ +++VEAFAL AD  K  ASQ+RRL SKQLQH FRF
Sbjct  548   EELLTWALDPNSSSNLPISTRTVETVSEVEAFALMADDFKIVASQFRRLSSKQLQHAFRF  607

Query  1673  YSHQWKTWAACFIQAAWRRHCRNKLEKSLREEEDRLQDALILRMRREEGETTPSLGATIY  1852
             YS Q++TW ACFIQAAWRR+ + K+E+SL  +ED+LQDAL       +  +T SLGATIY
Sbjct  608   YSLQFRTWGACFIQAAWRRYWKRKIERSLHVKEDKLQDALT-----NDDGSTLSLGATIY  662

Query  1853  ASRFAANVLRTVRRNHplsvpklsprlpplllqkpAEPDFSA  1978
             ASRFAAN LR +R N+     +   RL PLL  KPAEPDF++
Sbjct  663   ASRFAANALRNLRENN--RQNRTQQRLLPLLPPKPAEPDFTS  702



>ref|XP_003563795.1| PREDICTED: cyclic nucleotide-gated ion channel 1-like isoform 
X1 [Brachypodium distachyon]
 ref|XP_010227632.1| PREDICTED: cyclic nucleotide-gated ion channel 1-like isoform 
X1 [Brachypodium distachyon]
 ref|XP_010227633.1| PREDICTED: cyclic nucleotide-gated ion channel 1-like isoform 
X1 [Brachypodium distachyon]
Length=703

 Score =   773 bits (1997),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 397/643 (62%), Positives = 499/643 (78%), Gaps = 11/643 (2%)
 Frame = +2

Query  50    SKMHDPQGPFLQRWNRIFVIACILAATVDPLFFYIPVVDDQNKCLGLDRTLEITACILRS  229
             +K+  PQGPFLQRWN+IFV++CI A +VDPLFFYIPV++DQ  C  LDR L+I A +LRS
Sbjct  69    TKILHPQGPFLQRWNKIFVLSCIFAVSVDPLFFYIPVINDQKSCWYLDRKLKIAASVLRS  128

Query  230   VFDFFYIFHIILQFRTGFVPPSSRVFGRGDLIVDPSAIAKRYFFSYFFIDILAVLPLPQV  409
               D FYI HII QFRTGF+  SS  FGRG L+ DP AIAKRYF +YF ID+ AVLPLPQV
Sbjct  129   FTDIFYILHIIFQFRTGFITSSSTSFGRGVLVEDPHAIAKRYFTTYFLIDVFAVLPLPQV  188

Query  410   VLFMMIPRADRPFIMVAKDILKVVILVQSVPRLLRIYPLYKEVTRTSGFFTETAWAGAAF  589
             ++ +++P      +M AK+ L ++++ Q VPRL+RI PLY ++TR++G  TETAWAGAAF
Sbjct  189   IILVVLPILQGSDVMKAKNTLMLIVICQYVPRLIRIRPLYLQITRSAGIITETAWAGAAF  248

Query  590   NLFLYMIASYVAGAIWYITAIERQDKCWRRACEKHGSCDIDFLYCTKLGRRGGDFSSSFL  769
             NL +Y++AS+V GA+WY+ +I+R+  CWR+ C     C+  +LYC  +     D  ++FL
Sbjct  249   NLVIYILASHVLGAVWYLLSIQRKGACWRQQCLNQRGCNSTYLYCGNIVD-DTDRGNAFL  307

Query  770   NTSCALLEPENLKADDFDFGIFLDALKSNVVEKRYFWSKLFYCFWWGLRNLSSLGQNLKT  949
              T C LL   NL   D  FGI++ ALK NV +      KLFYC WWGL+NLSSLGQNL+T
Sbjct  308   QTVC-LLSANNLP--DPIFGIYVPALK-NVSQSTNLSVKLFYCVWWGLQNLSSLGQNLQT  363

Query  950   SNFVGEilfailisiiglilfslligNMQKYLQSITVRVEEMRVKRMDAEQWMSHRMLPD  1129
             S +  E LFA+ +SI GL+LFSLLIGN+Q YLQS ++R+EE RVK  D +QWMS+R+LP+
Sbjct  364   STYAWENLFAVFVSISGLVLFSLLIGNVQTYLQSASLRIEETRVKSRDTDQWMSYRLLPE  423

Query  1130  NLRERIRRYEQYRWQETRGVDEESLISNLPKDLRRDINRHLCWSLLKRVHMFKTMDEQLL  1309
             NL+ERIRRYEQYRWQET GVDEE+L++NLPKDLRR I RHLC SLL RV MF+ MD+Q+L
Sbjct  424   NLKERIRRYEQYRWQETSGVDEENLLTNLPKDLRRAIKRHLCLSLLMRVPMFENMDDQIL  483

Query  1310  DAICDRLKPVLYTEKSCIVREGDPVDEMIFVMRGNLLTMTTNGGRTGFLNSDVLNAGDFC  1489
             +A+CDRLKPVLYTE  CIVREGDPV+EM F+MRG+L+++TTNGGRTGF NSDVL  GDFC
Sbjct  484   NALCDRLKPVLYTEGGCIVREGDPVNEMFFIMRGDLMSVTTNGGRTGFFNSDVLKGGDFC  543

Query  1490  GEELLTWALDPNSSSSLPISTRTVQALTDVEAFALTADFLKFFASQYRRLHSKQLQHKFR  1669
             GEELLTWALDPNS+SSLP STRTV+++++VEAFAL A+ LKF A+Q+RRLHSKQL+H FR
Sbjct  544   GEELLTWALDPNSTSSLPSSTRTVKSMSEVEAFALMAEDLKFVATQFRRLHSKQLRHTFR  603

Query  1670  FYSHQWKTWAACFIQAAWRRHCRNKLEKSLREEEDRLQDALILRMRREEGETTPSLGATI  1849
             FYS QW+TWAACFIQAAW R CR K+E SLR++E RLQ A++      +G T+ S GA I
Sbjct  604   FYSQQWRTWAACFIQAAWHRRCRKKMEDSLRDKEKRLQLAIV-----NDGSTSLSFGAAI  658

Query  1850  YASRFAANVLRTVRRNHplsvpklsprlpplllqkpAEPDFSA  1978
             +ASRFA N++R +RRN      +L  R+P  LLQKPAEP+FSA
Sbjct  659   HASRFARNMMRILRRN-ATRKARLQERVPARLLQKPAEPNFSA  700



>ref|XP_008380719.1| PREDICTED: cyclic nucleotide-gated ion channel 1-like isoform 
X2 [Malus domestica]
Length=588

 Score =   768 bits (1983),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 410/599 (68%), Positives = 479/599 (80%), Gaps = 14/599 (2%)
 Frame = +2

Query  200   LEITACILRSVFDFFYIFHIILQFRTGFVPPSSRVFGRGDLIVDPSAIAKRYFFSYFFID  379
             +EITA +LRS  D FYI HII QFRTGF+ PSSRVFGRG L+ D  AIA+RY  SYF ID
Sbjct  1     MEITASVLRSFTDIFYIVHIIFQFRTGFIAPSSRVFGRGVLVEDAWAIARRYLSSYFLID  60

Query  380   ILAVLPLPQVVLFMMIPRADRPFIMVAKDILKVVILVQSVPRLLRIYPLYKEVTRTSGFF  559
             ILAVLPLPQVV+ + IP+      +  K++LK V+L Q  PR +RIYPLY+EVTR SG  
Sbjct  61    ILAVLPLPQVVILIFIPKLGGSKTLNTKNLLKFVVLFQYFPRFIRIYPLYREVTRASGIL  120

Query  560   TETAWAGAAFNLFLYMIASYVAGAIWYITAIERQDKCWRRACEKHGS-CDIDFLYCTKLG  736
             TETAWAGAAFNLFLYM+AS+V GA WY+ +IER+ KCW+ AC  + + C    LYC  + 
Sbjct  121   TETAWAGAAFNLFLYMLASHVLGAFWYLFSIERETKCWKAACGNNTTICSHKDLYCDTVS  180

Query  737   RRGGDFSS-SFLNTSCALLEPENLKADDFDFGIFLDALKSNVVEKRY-FWSKLFYCFWWG  910
                  FS  +FLN+SC + + +  +   FDFGIFLDAL+S +VE    F  K FYCFWWG
Sbjct  181   SNA--FSKITFLNSSCPIQDEDKTQ---FDFGIFLDALQSGIVESSTDFPQKFFYCFWWG  235

Query  911   LRNLSSLGQNLKTSNFVGEilfailisiiglilfslligNMQKYLQSITVRVEEMRVKRM  1090
             LRNLSSLGQNL TS +V EI FA+ ISI GL+LFS LIGNMQ YLQS T R+EEMRVKR 
Sbjct  236   LRNLSSLGQNLATSTYVWEICFAVFISIAGLVLFSFLIGNMQTYLQSTTTRLEEMRVKRR  295

Query  1091  DAEQWMSHRMLPDNLRERIRRYEQYRWQETRGVDEESLISNLPKDLRRDINRHLCWSLLK  1270
             DAEQWMSHR+LP+NLRERIRRYEQY+WQETRGVDEE+LI NLPKDLRRDI RHLC +LL 
Sbjct  296   DAEQWMSHRLLPENLRERIRRYEQYKWQETRGVDEENLICNLPKDLRRDIKRHLCLALLM  355

Query  1271  RVHMFKTMDEQLLDAICDRLKPVLYTEKSCIVREGDPVDEMIFVMRGNLLTMTTNGGRTG  1450
             RV MF+ MDEQLLDA+CDRLKPVLYTE+S IVREGDPVDEM+F+MRG LLTMTTNGGRTG
Sbjct  356   RVPMFEKMDEQLLDAMCDRLKPVLYTEESYIVREGDPVDEMLFIMRGRLLTMTTNGGRTG  415

Query  1451  FLNSDVLNAGDFCGEELLTWALDPNSSSSLPISTRTVQALTDVEAFALTADFLKFFASQY  1630
             F NS+ L AGDFCGEELLTWALDP++S++LPISTRTVQAL++VEAFAL AD LKF ASQ+
Sbjct  416   FFNSEYLKAGDFCGEELLTWALDPHTSANLPISTRTVQALSEVEAFALKADDLKFVASQF  475

Query  1631  RRLHSKQLQHKFRFYSHQWKTWAACFIQAAWRRHCRNKLEKSLREEEDRLQDALILRMRR  1810
             RRLHSKQL+H FRFYS QW+TWAA FIQAAWRRH + KLE+SL+EEE+RLQDAL      
Sbjct  476   RRLHSKQLRHTFRFYSQQWRTWAATFIQAAWRRHMKKKLEESLQEEENRLQDALA-----  530

Query  1811  EEGETTPSLGATIYASRFAANVLRTVRRNHplsvpklsprlpplllqkpAEPDFSAPEN  1987
             + G ++PSLGATIYASRFAAN+LRT+RR+      ++  RLP +LLQKPAEPDF+A E 
Sbjct  531   KAGVSSPSLGATIYASRFAANILRTIRRSG-TRKARVPERLPAMLLQKPAEPDFTAEEQ  588



>ref|XP_008380728.1| PREDICTED: cyclic nucleotide-gated ion channel 1-like isoform 
X3 [Malus domestica]
Length=588

 Score =   767 bits (1980),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 409/599 (68%), Positives = 479/599 (80%), Gaps = 14/599 (2%)
 Frame = +2

Query  200   LEITACILRSVFDFFYIFHIILQFRTGFVPPSSRVFGRGDLIVDPSAIAKRYFFSYFFID  379
             +EIT+ +LRS  D FYI HII QFRTGF+ PSSRVFGRG L+ D  AIA+RY  SYF ID
Sbjct  1     MEITSSVLRSFTDIFYIVHIIFQFRTGFIAPSSRVFGRGVLVEDAWAIARRYLSSYFLID  60

Query  380   ILAVLPLPQVVLFMMIPRADRPFIMVAKDILKVVILVQSVPRLLRIYPLYKEVTRTSGFF  559
             ILAVLPLPQVV+ + IP+      +  K++LK V+L Q  PR +RIYPLY+EVTR SG  
Sbjct  61    ILAVLPLPQVVILIFIPKLGGSKTLNTKNLLKFVVLFQYFPRFIRIYPLYREVTRASGIL  120

Query  560   TETAWAGAAFNLFLYMIASYVAGAIWYITAIERQDKCWRRACEKHGS-CDIDFLYCTKLG  736
             TETAWAGAAFNLFLYM+AS+V GA WY+ +IER+ KCW+ AC  + + C    LYC  + 
Sbjct  121   TETAWAGAAFNLFLYMLASHVLGAFWYLFSIERETKCWKAACGNNTTICSHKDLYCDTVS  180

Query  737   RRGGDFSS-SFLNTSCALLEPENLKADDFDFGIFLDALKSNVVEKRY-FWSKLFYCFWWG  910
                  FS  +FLN+SC + + +  +   FDFGIFLDAL+S +VE    F  K FYCFWWG
Sbjct  181   SNA--FSKITFLNSSCPIQDEDKTQ---FDFGIFLDALQSGIVESSTDFPQKFFYCFWWG  235

Query  911   LRNLSSLGQNLKTSNFVGEilfailisiiglilfslligNMQKYLQSITVRVEEMRVKRM  1090
             LRNLSSLGQNL TS +V EI FA+ ISI GL+LFS LIGNMQ YLQS T R+EEMRVKR 
Sbjct  236   LRNLSSLGQNLATSTYVWEICFAVFISIAGLVLFSFLIGNMQTYLQSTTTRLEEMRVKRR  295

Query  1091  DAEQWMSHRMLPDNLRERIRRYEQYRWQETRGVDEESLISNLPKDLRRDINRHLCWSLLK  1270
             DAEQWMSHR+LP+NLRERIRRYEQY+WQETRGVDEE+LI NLPKDLRRDI RHLC +LL 
Sbjct  296   DAEQWMSHRLLPENLRERIRRYEQYKWQETRGVDEENLICNLPKDLRRDIKRHLCLALLM  355

Query  1271  RVHMFKTMDEQLLDAICDRLKPVLYTEKSCIVREGDPVDEMIFVMRGNLLTMTTNGGRTG  1450
             RV MF+ MDEQLLDA+CDRLKPVLYTE+S IVREGDPVDEM+F+MRG LLTMTTNGGRTG
Sbjct  356   RVPMFEKMDEQLLDAMCDRLKPVLYTEESYIVREGDPVDEMLFIMRGRLLTMTTNGGRTG  415

Query  1451  FLNSDVLNAGDFCGEELLTWALDPNSSSSLPISTRTVQALTDVEAFALTADFLKFFASQY  1630
             F NS+ L AGDFCGEELLTWALDP++S++LPISTRTVQAL++VEAFAL AD LKF ASQ+
Sbjct  416   FFNSEYLKAGDFCGEELLTWALDPHTSANLPISTRTVQALSEVEAFALKADDLKFVASQF  475

Query  1631  RRLHSKQLQHKFRFYSHQWKTWAACFIQAAWRRHCRNKLEKSLREEEDRLQDALILRMRR  1810
             RRLHSKQL+H FRFYS QW+TWAA FIQAAWRRH + KLE+SL+EEE+RLQDAL      
Sbjct  476   RRLHSKQLRHTFRFYSQQWRTWAATFIQAAWRRHMKKKLEESLQEEENRLQDALA-----  530

Query  1811  EEGETTPSLGATIYASRFAANVLRTVRRNHplsvpklsprlpplllqkpAEPDFSAPEN  1987
             + G ++PSLGATIYASRFAAN+LRT+RR+      ++  RLP +LLQKPAEPDF+A E 
Sbjct  531   KAGVSSPSLGATIYASRFAANILRTIRRSG-TRKARVPERLPAMLLQKPAEPDFTAEEQ  588



>ref|XP_006397834.1| hypothetical protein EUTSA_v10001335mg [Eutrema salsugineum]
 gb|ESQ39287.1| hypothetical protein EUTSA_v10001335mg [Eutrema salsugineum]
Length=706

 Score =   766 bits (1979),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 384/608 (63%), Positives = 479/608 (79%), Gaps = 10/608 (2%)
 Frame = +2

Query  53    KMHDPQGPFLQRWNRIFVIACILAATVDPLFFYIPVVDDQNKCLGLDRTLEITACILRSV  232
             ++ +P   +LQ WN+IF++ C++A   DPLFFYIPVV+ ++ CL LD  LE  AC+LR+ 
Sbjct  70    RVMNPNDSYLQNWNKIFLLLCVVALAFDPLFFYIPVVNPESFCLNLDEKLEAIACVLRTF  129

Query  233   FDFFYIFHIILQFRTGFVPPSSRVFGRGDLIVDPSAIAKRYFFSYFFIDILAVLPLPQVV  412
              D FY+ H++ QF TGF+ PSSR FGRG+LI +P AIA RY  SYF ID+L++LP+PQVV
Sbjct  130   IDAFYVVHMLFQFHTGFIAPSSRGFGRGELIENPKAIALRYLGSYFIIDVLSILPIPQVV  189

Query  413   LFMMIPRADRPFIMVAKDILKVVILVQSVPRLLRIYPLYKEVTRTSGFFTETAWAGAAFN  592
             +  ++P   RP  +V K++LK VI  Q VPR+ RIYPL+KEVTRTSG  TETAWAGAA N
Sbjct  190   VLAIVPGMKRPASLVTKELLKWVIFCQYVPRIARIYPLFKEVTRTSGLVTETAWAGAALN  249

Query  593   LFLYMIASYVAGAIWYITAIERQDKCWRRACEKHGSCDIDFLYCTKLGRRGGDFSSSFLN  772
             LFLYM+AS+V G+ WY+ +IER+D+CWR AC     C  + LYC+      G  +  FL 
Sbjct  250   LFLYMLASHVFGSFWYLISIERKDRCWREACANISGCKHESLYCSP----NGTDNRQFLI  305

Query  773   TSCALLEPENL-KADDFDFGIFLDALKSNVVEKRYFWSKLFYCFWWGLRNLSSLGQNLKT  949
              SC L++PE +  +  F+FGIF DAL+S VVE R F  K FYCFWWGLRNLS+LGQNLKT
Sbjct  306   GSCPLIDPEEITNSTVFNFGIFADALQSGVVESRDFPKKFFYCFWWGLRNLSALGQNLKT  365

Query  950   SNFVGEilfailisiiglilfslligNMQKYLQSITVRVEEMRVKRMDAEQWMSHRMLPD  1129
             S F GEI+FAI+I I GL+LF+LLIGNMQKYLQS TVRVEEMRVKR DAEQWMSHRMLP+
Sbjct  366   SAFEGEIIFAIVICISGLVLFALLIGNMQKYLQSTTVRVEEMRVKRRDAEQWMSHRMLPE  425

Query  1130  NLRERIRRYEQYRWQETRGVDEESLISNLPKDLRRDINRHLCWSLLKRVHMFKTMDEQLL  1309
             +L++RIR+YEQY+WQETRGV+EE+L+S+LPKDLR+DI RHLC +LLK+V  FK MD++LL
Sbjct  426   DLKKRIRKYEQYKWQETRGVEEEALLSSLPKDLRKDIKRHLCLNLLKKVPWFKAMDDRLL  485

Query  1310  DAICDRLKPVLYTEKSCIVREGDPVDEMIFVMRGNLLTMTTNGGRTGFLNSDVLNAGDFC  1489
             DA+C RLK VLYTE S IVREG+PV++M+FVMRGNL++ TT GG+TGF NS  LNAGDFC
Sbjct  486   DALCARLKTVLYTENSYIVREGEPVEDMLFVMRGNLISTTTYGGKTGFFNSVRLNAGDFC  545

Query  1490  GEELLTWALDPNSSSSLPISTRTVQALTDVEAFALTADFLKFFASQYRRLHSKQLQHKFR  1669
             G +LLTWALDPN +S  PIS+RTVQALT+VE F L+AD LKF ++QYRRLHSKQL+H FR
Sbjct  546   G-DLLTWALDPN-ASHFPISSRTVQALTEVEGFLLSADDLKFVSTQYRRLHSKQLRHMFR  603

Query  1670  FYSHQWKTWAACFIQAAWRRHCRNKLEKSLREEEDRLQDALILRMRREEGETTPSLGATI  1849
             FYS QW+TWAACFIQAAW+RHCR KL ++LREEE +L++ L      + G    +LGA I
Sbjct  604   FYSVQWQTWAACFIQAAWKRHCRRKLSRALREEEGKLRNTL---QNDDSGSNKLNLGAAI  660

Query  1850  YASRFAAN  1873
             YASRFA++
Sbjct  661   YASRFASH  668



>ref|XP_002880240.1| ATCNGC3 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH56499.1| ATCNGC3 [Arabidopsis lyrata subsp. lyrata]
Length=704

 Score =   766 bits (1978),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 386/616 (63%), Positives = 479/616 (78%), Gaps = 10/616 (2%)
 Frame = +2

Query  53    KMHDPQGPFLQRWNRIFVIACILAATVDPLFFYIPVVDDQNKCLGLDRTLEITACILRSV  232
             ++ +P   +LQ WN+IF++  ++A   DPLFFYIPVV+    CL LD  LE  ACI R+ 
Sbjct  69    RVMNPNDSYLQNWNKIFLLLSVVALAFDPLFFYIPVVNPVRFCLNLDTKLEAIACIFRTF  128

Query  233   FDFFYIFHIILQFRTGFVPPSSRVFGRGDLIVDPSAIAKRYFFSYFFIDILAVLPLPQVV  412
              D FY+ H++ QF TGF+ PSSR FGRG+L  +P  IA RY  SYF +D+L++LP+PQVV
Sbjct  129   IDAFYVVHMLFQFHTGFIAPSSRGFGRGELNENPKEIAIRYLSSYFLVDLLSILPIPQVV  188

Query  413   LFMMIPRADRPFIMVAKDILKVVILVQSVPRLLRIYPLYKEVTRTSGFFTETAWAGAAFN  592
             +  ++PR   P  +VAK++LK VI  Q VPR+ RIYPL+KEVTRTSG  TETAWAGAA N
Sbjct  189   VLAIVPRMRVPASLVAKELLKWVIFCQYVPRIARIYPLFKEVTRTSGLVTETAWAGAALN  248

Query  593   LFLYMIASYVAGAIWYITAIERQDKCWRRACEKHGSCDIDFLYCTKLGRRGGDFSSSFLN  772
             LFLYM+AS+V G+ WY+ +IER+D+CWR AC K   C  + LYC+      G+ +  FLN
Sbjct  249   LFLYMLASHVFGSFWYLISIERKDRCWREACAKIVGCSHEKLYCSP----TGEDNRQFLN  304

Query  773   TSCALLEPENLKADD-FDFGIFLDALKSNVVEKRYFWSKLFYCFWWGLRNLSSLGQNLKT  949
              SC L++PE +     F+FGIF DAL+S VVE R F  K FYCFWWGLRNLS+LGQNLKT
Sbjct  305   GSCPLIDPEEISNSTVFNFGIFADALQSGVVESRDFPKKFFYCFWWGLRNLSALGQNLKT  364

Query  950   SNFVGEilfailisiiglilfslligNMQKYLQSITVRVEEMRVKRMDAEQWMSHRMLPD  1129
             S F GEI+FAI+I + GL+LF+LLIGNMQKYLQS TVRVEEMRVKR DAEQWMSHRMLPD
Sbjct  365   STFEGEIIFAIVICVSGLVLFALLIGNMQKYLQSTTVRVEEMRVKRRDAEQWMSHRMLPD  424

Query  1130  NLRERIRRYEQYRWQETRGVDEESLISNLPKDLRRDINRHLCWSLLKRVHMFKTMDEQLL  1309
             +LR+RIR+YEQY+WQET+GV+EE+L+S+LPKDLR+DI RHLC +LLK+V  F+ MD++LL
Sbjct  425   DLRKRIRKYEQYKWQETKGVEEEALLSSLPKDLRKDIKRHLCLNLLKKVPWFQAMDDRLL  484

Query  1310  DAICDRLKPVLYTEKSCIVREGDPVDEMIFVMRGNLLTMTTNGGRTGFLNSDVLNAGDFC  1489
             DA+C RLK VLYTE S IVREG+PV++M+F+MRGNL++ TT GG+TGF NS  L AGDFC
Sbjct  485   DALCARLKTVLYTENSYIVREGEPVEDMLFIMRGNLISTTTYGGKTGFFNSVRLVAGDFC  544

Query  1490  GEELLTWALDPNSSSSLPISTRTVQALTDVEAFALTADFLKFFASQYRRLHSKQLQHKFR  1669
             G +LLTWALDP  SS+ PIS+RTVQALT+VE F L+AD LKF A+QYRRLHSKQL+H FR
Sbjct  545   G-DLLTWALDP-LSSNFPISSRTVQALTEVEGFVLSADDLKFVATQYRRLHSKQLRHMFR  602

Query  1670  FYSHQWKTWAACFIQAAWRRHCRNKLEKSLREEEDRLQDALILRMRREEGETTPSLGATI  1849
             FYS QW+TWAACFIQAAW+RHCR KL K+LREEE +L + L      + G    +LGA I
Sbjct  603   FYSVQWQTWAACFIQAAWKRHCRRKLSKALREEESKLHNTL---QNDDSGGNKLNLGAAI  659

Query  1850  YASRFAANVLRTVRRN  1897
             YASRFA++ LR +R N
Sbjct  660   YASRFASHALRNLRAN  675



>gb|EMT17021.1| Cyclic nucleotide-gated ion channel 1 [Aegilops tauschii]
Length=687

 Score =   765 bits (1975),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 399/650 (61%), Positives = 496/650 (76%), Gaps = 24/650 (4%)
 Frame = +2

Query  44    WKSKMH--DPQGPFLQRWNRIFVIACILAATVDPLFFYIPVVDDQNKCLGLDRTLEITAC  217
             WKS  +   PQGPFLQRWN+IFV++CI A +VDPLF YIPV+ D+N C  LDR ++I A 
Sbjct  58    WKSTQNVFHPQGPFLQRWNKIFVLSCIFAVSVDPLFLYIPVISDKNPCWYLDRKMKIIAS  117

Query  218   ILRSVFDFFYIFHIILQFRTGFVPPSSRVFGRGDLIVDPSAIAKRYFFSYFFIDILAVLP  397
             +LRS  D FY+ HII QFRTGF+  SS  FGRG L+ D  AIAKRY  +YF ID+ AVLP
Sbjct  118   VLRSFTDIFYVLHIIFQFRTGFITSSSTNFGRGVLVEDRYAIAKRYLSTYFLIDVCAVLP  177

Query  398   LPQVVLFMMIPRADRPFIMVAKDILKVVILVQSVPRLLRIYPLYKEVTRTSGFFTETAWA  577
             LPQ   FM            AK+IL ++++ Q VPRL+RI PLY ++TR++G  TETAWA
Sbjct  178   LPQGSKFMK-----------AKNILMIIVICQYVPRLIRIRPLYLQITRSAGIITETAWA  226

Query  578   GAAFNLFLYMIASYVAGAIWYITAIERQDKCWRRACEKHGSCDIDFLYCTKLGRRGGDFS  757
             GAAFNL +YM+AS+V GA+WY+ +I+R+D CW++ C  +  C+  +LYC   G    +  
Sbjct  227   GAAFNLIIYMLASHVLGAVWYLLSIQRKDACWKQKCSLNPDCNPAYLYCGN-GDTNANAG  285

Query  758   SSFLNTSC-ALLEPENLKADDFDFGIFLDALKSNVVEKRYFWSKLFYCFWWGLRNLSSLG  934
             + FL + C   + P+NL   D  FGI+L A+ +NV +   F++KLFYC WWGL+NLSSLG
Sbjct  286   NVFLQSVCIPSITPDNLP--DPLFGIYLPAI-NNVSQSTNFFAKLFYCVWWGLQNLSSLG  342

Query  935   QNLKTSNFVGEilfailisiiglilfslligNMQKYLQSITVRVEEMRVKRMDAEQWMSH  1114
             QNLKTS +  E  FA+ +SI GL+LFSLLIGNMQ YLQS T+R+EE RVK  D +QWMS+
Sbjct  343   QNLKTSTYAWENFFAVFVSISGLVLFSLLIGNMQTYLQSATLRIEETRVKSRDTDQWMSY  402

Query  1115  RMLPDNLRERIRRYEQYRWQETRGVDEESLISNLPKDLRRDINRHLCWSLLKRVHMFKTM  1294
             R+LPDNL+ERIRRYEQYRWQET GVDEE L+ NLPKDLRR I RHLC SLLKRV MF+ M
Sbjct  403   RLLPDNLKERIRRYEQYRWQETSGVDEEHLLMNLPKDLRRAIKRHLCLSLLKRVPMFEKM  462

Query  1295  DEQLLDAICDRLKPVLYTEKSCIVREGDPVDEMIFVMRGNLLTMTTNGGRTGFLNSDVLN  1474
             D+QLL+A+CD LKPVLYTE  CIVREGDPV+EM F+ RGNL++MTTNGG+TGF NSDVL 
Sbjct  463   DDQLLNALCDCLKPVLYTEGGCIVREGDPVNEMFFITRGNLMSMTTNGGKTGFFNSDVLK  522

Query  1475  AGDFCGEELLTWALDPNSSSSLPISTRTVQALTDVEAFALTADFLKFFASQYRRLHSKQL  1654
             +GDFCGEELLTWALDPNS++SLPISTRTV+++++VEAFAL A+ LKF A+Q+RRLHSKQL
Sbjct  523   SGDFCGEELLTWALDPNSATSLPISTRTVKSMSEVEAFALMAEDLKFVATQFRRLHSKQL  582

Query  1655  QHKFRFYSHQWKTWAACFIQAAWRRHCRNKLEKSLREEEDRLQDALILRMRREEGETTPS  1834
             +H FRFYS QW+TWAACFIQAAW R CR K+E +LRE+E+RLQ A++      +G T+ S
Sbjct  583   RHTFRFYSQQWRTWAACFIQAAWHRCCRKKMEDALREKEERLQLAIV-----NDGSTSLS  637

Query  1835  LGATIYASRFAANVLRTVRRNHplsvpklsprlpplllqkpAEPDFSAPE  1984
              GA IYASRFA N++R +RRN      +L  R+P  LLQKPAEP+FSA E
Sbjct  638   FGAAIYASRFARNMMRILRRN-ATRKARLQERVPARLLQKPAEPNFSAEE  686



>gb|EEC72858.1| hypothetical protein OsI_06611 [Oryza sativa Indica Group]
 gb|EEE56678.1| hypothetical protein OsJ_06120 [Oryza sativa Japonica Group]
Length=700

 Score =   765 bits (1975),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 392/617 (64%), Positives = 488/617 (79%), Gaps = 13/617 (2%)
 Frame = +2

Query  47    KSKMHDPQGPFLQRWNRIFVIACILAATVDPLFFYIPVVDDQNKCLGLDRTLEITACILR  226
             K+++ DPQGPFLQRWN+IFVI+C++A +VDPLFFYIPV+D  N CL LD+ LEI A +LR
Sbjct  68    KTRVLDPQGPFLQRWNKIFVISCLIAVSVDPLFFYIPVIDGDNICLYLDKKLEIIASVLR  127

Query  227   SVFDFFYIFHIILQFRTGFVPPSSRVFGRGDLIVDPSAIAKRYFFSYFFIDILAVLPLPQ  406
                D FY+ HII QFRTGF+ PSSRVFGRG L+ D  AIAKRY  +YF ID LAVLPLPQ
Sbjct  128   FFTDIFYLLHIIFQFRTGFIAPSSRVFGRGVLVEDTFAIAKRYLSTYFLIDFLAVLPLPQ  187

Query  407   VVLFMMIPRADRPFIMVAKDILKVVILVQSVPRLLRIYPLYKEVTRTSGFFTETAWAGAA  586
             V++ +++PR     +M AK+IL V+++ Q VPRL+RI PLY ++TR++G  TETAWAGAA
Sbjct  188   VLVLVVLPRLQGSSVMTAKNILMVIVICQYVPRLIRIIPLYLQITRSAGIITETAWAGAA  247

Query  587   FNLFLYMIASYVAGAIWYITAIERQDKCWRRACEKHGSCDIDFLYCTKLGRRGGDFSSSF  766
             FNL +YM+AS+V GA+WY+ +I+R+D CW+ AC +H  CD   L+C     R    ++SF
Sbjct  248   FNLLIYMLASHVLGALWYLLSIQREDTCWKDACSRHDGCDSGSLFCGSNAAR----NNSF  303

Query  767   LNTSCALLEPENLKADDFDFGIFLDALKSNVVEKRYFWSKLFYCFWWGLRNLSSLGQNLK  946
             L   C     +N    D  FGI+L AL+ NV +   F+ KLFYCFWWGL+NLSSLGQNLK
Sbjct  304   LQDFCPTNGTDNA---DPTFGIYLPALQ-NVSQSTSFFEKLFYCFWWGLQNLSSLGQNLK  359

Query  947   TSNFVGEilfailisiiglilfslligNMQKYLQSITVRVEEMRVKRMDAEQWMSHRMLP  1126
             TS +  E LFA+ +S  GL+LF+LLIGN+Q YLQS +VR+EEMRVKR D EQWM+HR+LP
Sbjct  360   TSTYTWENLFAVFVSTSGLVLFALLIGNVQTYLQSASVRIEEMRVKRRDTEQWMAHRLLP  419

Query  1127  DNLRERIRRYEQYRWQETRGVDEESLISNLPKDLRRDINRHLCWSLLKRVHMFKTMDEQL  1306
             DNL+ERI R+EQYRWQETRGVDEE L+SNLPK+LRR+I RHLC SLL RV MF+ MDE+L
Sbjct  420   DNLKERILRHEQYRWQETRGVDEEGLLSNLPKNLRREIKRHLCLSLLMRVPMFENMDEKL  479

Query  1307  LDAICDRLKPVLYTEKSCIVREGDPVDEMIFVMRGNLLTMTTNGGRTGFLNSDVLNAGDF  1486
             LDA+CDRLKP+LYTE SCI+REGDPV+EM+F+MRGNL +MTTNGG+TGF NS+++  GDF
Sbjct  480   LDAMCDRLKPMLYTEGSCIIREGDPVNEMLFIMRGNLESMTTNGGQTGFFNSNIIKGGDF  539

Query  1487  CGEELLTWALDPNSSSSLPISTRTVQALTDVEAFALTADFLKFFASQYRRLHSKQLQHKF  1666
             CGEELLTWALDP S+S+LP STRTV+ L++VEAFAL AD LKF A+Q+RRLHSKQLQH F
Sbjct  540   CGEELLTWALDPTSASNLPSSTRTVKTLSEVEAFALRADDLKFVATQFRRLHSKQLQHTF  599

Query  1667  RFYSHQWKTWAACFIQAAWRRHCRNKLEKSLREEEDRLQDALILRMRREEGETTPSLGAT  1846
             RFYS QW+TWAACFIQAAW R+CR KLE +L E+E RLQ A++         ++ SLGA 
Sbjct  600   RFYSQQWRTWAACFIQAAWHRYCRKKLEDTLFEKEKRLQAAIVSDG-----SSSLSLGAA  654

Query  1847  IYASRFAANVLRTVRRN  1897
             +YASRFA N++R +RRN
Sbjct  655   LYASRFAGNMMRILRRN  671



>ref|XP_004510678.1| PREDICTED: cyclic nucleotide-gated ion channel 1-like isoform 
X1 [Cicer arietinum]
 ref|XP_004510679.1| PREDICTED: cyclic nucleotide-gated ion channel 1-like isoform 
X2 [Cicer arietinum]
Length=699

 Score =   763 bits (1970),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 403/647 (62%), Positives = 484/647 (75%), Gaps = 15/647 (2%)
 Frame = +2

Query  62    DPQGPFLQRWNRIFVIACILAATVDPLFFYIPVVDDQNKCLGLDRTLEITACILRSVFDF  241
             DPQGP LQ+WN+IFVI C++A ++DPLFFYIPV+D++ KCL LD TL+ITA +LR+ FD 
Sbjct  61    DPQGPLLQKWNKIFVITCVMAISMDPLFFYIPVIDEKRKCLKLDGTLKITAGVLRTFFDL  120

Query  242   FYIFHIILQFRTGFVPPSSRVFGRGDLIVDPSAIAKRYFFSYFFIDILAVLPLPQVVLFM  421
             FYI  I+ QFRTGF+ PSSRVFGRG+ + DP AIA RY  S+F IDIL++LPLPQ+V+  
Sbjct  121   FYILRIVFQFRTGFIAPSSRVFGRGEPVDDPFAIAMRYLSSHFIIDILSILPLPQMVMLA  180

Query  422   MIPRADRPFIMVAKDILKVVILVQSVPRLLRIYPLYKEVTRTSGFFTETAWAGAAFNLFL  601
             MIP   R    +AKD LK +I+ Q  PRLLRIYPL+KEVT TSG  TETAWAGAA+NLFL
Sbjct  181   MIPIPQRSVPCIAKDWLKYMIIAQYAPRLLRIYPLFKEVTSTSGILTETAWAGAAYNLFL  240

Query  602   YMIASYVAGAIWYITAIERQDKCWRRACEKHGSCDIDFLYCTKLGRRGGDFSSSFLN--T  775
             YM+AS+V GA WY+ +IE Q +CW R  +     D  +L C   GRR      S LN  T
Sbjct  241   YMLASHVVGAFWYLFSIESQLRCWHRQLKHTAFSDDSYLSC---GRRVNSSVLSLLNNAT  297

Query  776   SCALLEP-ENLKADDFDFGIFLDALKSNVVEKRY-FWSKLFYCFWWGLRNLSSLGQNLKT  949
             +C   +P E +    F+FGIF+D LKS VVE R  F  K FYCFWWGLRNLSS+GQNLKT
Sbjct  298   TCPYTDPDEIIDPMVFNFGIFIDGLKSRVVESRTNFHHKFFYCFWWGLRNLSSVGQNLKT  357

Query  950   SNFVGEilfailisiiglilfslligNMQKYLQSITVRVEEMRVKRMDAEQWMSHRMLPD  1129
             S ++GEI+FAI I++ GL+LF+LLIGNMQKYLQS TVRVEEMR+KR DAEQWM HRMLP+
Sbjct  358   STYIGEIIFAIFIAVFGLVLFALLIGNMQKYLQSTTVRVEEMRIKRRDAEQWMCHRMLPE  417

Query  1130  NLRERIRRYEQYRWQETRGVDEESLISNLPKDLRRDINRHLCWSLLKRVHMFKTMDEQLL  1309
              L++RIRRYEQY+WQE RGV+EE+LI NLPKDLRRDI RHLC  LLK+V +F  MD+QLL
Sbjct  418   YLKQRIRRYEQYKWQENRGVEEETLIRNLPKDLRRDIKRHLCLDLLKKVPIFGNMDKQLL  477

Query  1310  DAICDRLKPVLYTEKSCIVREGDPVDEMIFVMRGNLLTMTTNGGRTGFLNSDVLNAGDFC  1489
             DA+CD+LKPVLYTEKS +V EGDPVDEM+F+MRG L T+TTNGGRTGF NS  L AGDFC
Sbjct  478   DAMCDKLKPVLYTEKSYVVCEGDPVDEMLFIMRGKLATVTTNGGRTGFFNSSELKAGDFC  537

Query  1490  GEELLTWALDPNSSSSLPISTRTVQALTDVEAFALTADFLKFFASQYRRL-HSKQLQHKF  1666
             GEELLTWALDP  SS+LPIST TVQ +++VEAFAL  D LK  ASQ+RRL + KQLQH F
Sbjct  538   GEELLTWALDPTPSSNLPISTSTVQTISEVEAFALLPDDLKIVASQFRRLINRKQLQHTF  597

Query  1667  RFYSHQWKTWAACFIQAAWRRHCRNKLEKSLREEEDRLQDALILRMRREEGETTPSLGAT  1846
             RFYS QW+TW A FIQ  WRR+   + +KSLRE E++ Q         EEG ++PS   T
Sbjct  598   RFYSLQWRTWGARFIQVVWRRNREKRAQKSLREAEEKQQHG---SQNDEEG-SSPSFATT  653

Query  1847  IYASRFAANVLRTVRRNHplsvpklsprlpplllqkpAEPDFSAPEN  1987
             +Y  RFA+N LR +R            R+ PLL  KPAEPDF   +N
Sbjct  654   VYVQRFASNALRHLRSGK---KMPQPKRMLPLLPMKPAEPDFITKKN  697



>ref|XP_010925733.1| PREDICTED: cyclic nucleotide-gated ion channel 1-like isoform 
X2 [Elaeis guineensis]
Length=595

 Score =   759 bits (1959),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 413/610 (68%), Positives = 485/610 (80%), Gaps = 15/610 (2%)
 Frame = +2

Query  158   VVDDQNKCLGLDRTLEITACILRSVFDFFYIFHIILQFRTGFVPPSSRVFGRGDLIVDPS  337
             +V +Q+ CL LDR LEITA +LR   D FYI HII QFRTGF+ PSSRVFGRG L+ DPS
Sbjct  1     MVINQDNCLELDRKLEITASVLRFFTDIFYILHIIFQFRTGFIAPSSRVFGRGVLVEDPS  60

Query  338   AIAKRYFFSYFFIDILAVLPLPQVVLFMMIPRADRPFIMVAKDILKVVILVQSVPRLLRI  517
             AIAKRY  SYF IDILAVLPLPQVV+ ++IP+     ++ AK++L  +++ Q VPRL+RI
Sbjct  61    AIAKRYISSYFLIDILAVLPLPQVVVLIVIPKLQGSALLNAKNVLMFIVICQYVPRLVRI  120

Query  518   YPLYKEVTRTSGFFTETAWAGAAFNLFLYMIASYVAGAIWYITAIERQDKCWRRACEKHG  697
              PLY EVTR++G  TETAWAGAAFNL LYM+AS+V GA+WY+ AIERQD CWR AC K+ 
Sbjct  121   IPLYLEVTRSAGIITETAWAGAAFNLLLYMLASHVFGALWYLLAIERQDTCWRHACSKN-  179

Query  698   SCDIDFLYCTKLGRRGGDFSSSFLNTSCALLEPENLKADDFDFGIFLDALKSNVVEKRYF  877
              C  D LYC   G   G+  + FL+ +C L    +  +D FDFGI+L AL+ N+V+ R F
Sbjct  180   KCTPDSLYCG--GEHKGN--NDFLSVACPL---NDSSSDVFDFGIYLLALQ-NIVQSRNF  231

Query  878   WSKLFYCFWWGLRNLSSLGQNLKTSNFVGEilfailisiiglilfslligNMQKYLQSIT  1057
               KLFYCFWWGL+ LSSLGQNL+TS +  EILFA+ +SI GL+LF+LLIGNMQ YLQS T
Sbjct  232   LEKLFYCFWWGLQTLSSLGQNLQTSTYTWEILFAVFVSISGLVLFALLIGNMQTYLQSTT  291

Query  1058  VRVEEMRVKRMDAEQWMSHRMLPDNLRERIRRYEQYRWQETRGVDEESLISNLPKDLRRD  1237
             VR+EEMRV+R D EQWMSHR+LP++LRERI R+EQYRWQETRGVDEESL+ NLPKDLRRD
Sbjct  292   VRIEEMRVRRRDTEQWMSHRLLPESLRERIHRHEQYRWQETRGVDEESLLRNLPKDLRRD  351

Query  1238  INRHLCWSLLKRVHMFKTMDEQLLDAICDRLKPVLYTEKSCIVREGDPVDEMIFVMRGNL  1417
             I RHLC SLL RV MF+ MD QL+DA+CDRLKPVLYTE SCIVREGDPV EM+F+MRG L
Sbjct  352   IKRHLCLSLLVRVPMFEQMDAQLMDAMCDRLKPVLYTEDSCIVREGDPVTEMLFIMRGKL  411

Query  1418  LTMTTNGGRTGFLNSDVLNAGDFCGEELLTWALDPNSSSSLPISTRTVQALTDVEAFALT  1597
              +MTTNGGRTGF NSD+L AGDFCGEELLTWALDP+SSSSLP STRTV+ L++VEAFAL 
Sbjct  412   ESMTTNGGRTGFFNSDILKAGDFCGEELLTWALDPHSSSSLPSSTRTVRTLSEVEAFALM  471

Query  1598  ADFLKFFASQYRRLHSKQLQHKFRFYSHQWKTWAACFIQAAWRRHCRNKLEKSLREEEDR  1777
             AD LKF ASQ+RRLHSKQLQH FRFYS QW+TWA+CFIQAAWRR+ R KLE SL EEE R
Sbjct  472   ADDLKFVASQFRRLHSKQLQHTFRFYSPQWRTWASCFIQAAWRRYSRKKLEDSLHEEEQR  531

Query  1778  LQDALILRMRREEGETTPSLGATIYASRFAANVLRTVRRNHplsvpklsprlpplllqkp  1957
             LQ A+        G  +PSLGAT+YASRFAA VLRT+RR+      +L  RLP +LLQKP
Sbjct  532   LQAAMA-----SSGANSPSLGATLYASRFAAIVLRTLRRS-GTRKARLQERLPVMLLQKP  585

Query  1958  AEPDFSAPEN  1987
             AEPDFSA E+
Sbjct  586   AEPDFSAEEH  595



>ref|NP_566075.1| cyclic nucleotide gated channel 3 [Arabidopsis thaliana]
 ref|NP_001118537.1| cyclic nucleotide gated channel 3 [Arabidopsis thaliana]
 sp|Q9SKD7.2|CNGC3_ARATH RecName: Full=Probable cyclic nucleotide-gated ion channel 3; 
Short=AtCNGC3; AltName: Full=Cyclic nucleotide- and calmodulin-regulated 
ion channel 3 [Arabidopsis thaliana]
 emb|CAB40128.1| cyclic nucleotide and calmodulin-regulated ion channel [Arabidopsis 
thaliana]
 gb|AAL25581.1| At2g46430/F11C10.12 [Arabidopsis thaliana]
 gb|AAD23045.2| putative cyclic nucleotide-regulated ion channel protein [Arabidopsis 
thaliana]
 gb|AEC10694.1| cyclic nucleotide gated channel 3 [Arabidopsis thaliana]
 gb|AEC10695.1| cyclic nucleotide gated channel 3 [Arabidopsis thaliana]
Length=706

 Score =   760 bits (1963),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 386/616 (63%), Positives = 478/616 (78%), Gaps = 10/616 (2%)
 Frame = +2

Query  53    KMHDPQGPFLQRWNRIFVIACILAATVDPLFFYIPVVDDQNKCLGLDRTLEITACILRSV  232
             ++ +P   +LQ WN+IF++  ++A   DPLFFYIP V  +  CL LD+ L+  AC+ R+ 
Sbjct  71    RVMNPNDSYLQSWNKIFLLLSVVALAFDPLFFYIPYVKPERFCLNLDKKLQTIACVFRTF  130

Query  233   FDFFYIFHIILQFRTGFVPPSSRVFGRGDLIVDPSAIAKRYFFSYFFIDILAVLPLPQVV  412
              D FY+ H++ QF TGF+ PSS  FGRG+L      IA RY  SYF ID+L++LP+PQVV
Sbjct  131   IDAFYVVHMLFQFHTGFITPSSSGFGRGELNEKHKDIALRYLGSYFLIDLLSILPIPQVV  190

Query  413   LFMMIPRADRPFIMVAKDILKVVILVQSVPRLLRIYPLYKEVTRTSGFFTETAWAGAAFN  592
             +  ++PR  RP  +VAK++LK VI  Q VPR+ RIYPL+KEVTRTSG  TETAWAGAA N
Sbjct  191   VLAIVPRMRRPASLVAKELLKWVIFCQYVPRIARIYPLFKEVTRTSGLVTETAWAGAALN  250

Query  593   LFLYMIASYVAGAIWYITAIERQDKCWRRACEKHGSCDIDFLYCTKLGRRGGDFSSSFLN  772
             LFLYM+AS+V G+ WY+ +IER+D+CWR AC K  +C   +LYC+      G+ +  FLN
Sbjct  251   LFLYMLASHVFGSFWYLISIERKDRCWREACAKIQNCTHAYLYCSP----TGEDNRLFLN  306

Query  773   TSCALLEPENL-KADDFDFGIFLDALKSNVVEKRYFWSKLFYCFWWGLRNLSSLGQNLKT  949
              SC L++PE +  +  F+FGIF DAL+S VVE R F  K FYCFWWGLRNLS+LGQNLKT
Sbjct  307   GSCPLIDPEEITNSTVFNFGIFADALQSGVVESRDFPKKFFYCFWWGLRNLSALGQNLKT  366

Query  950   SNFVGEilfailisiiglilfslligNMQKYLQSITVRVEEMRVKRMDAEQWMSHRMLPD  1129
             S F GEI+FAI+I I GL+LF+LLIGNMQKYLQS TVRVEEMRVKR DAEQWMSHRMLPD
Sbjct  367   SAFEGEIIFAIVICISGLVLFALLIGNMQKYLQSTTVRVEEMRVKRRDAEQWMSHRMLPD  426

Query  1130  NLRERIRRYEQYRWQETRGVDEESLISNLPKDLRRDINRHLCWSLLKRVHMFKTMDEQLL  1309
             +LR+RIR+YEQY+WQET+GV+EE+L+S+LPKDLR+DI RHLC  LLK+V  F+ MD++LL
Sbjct  427   DLRKRIRKYEQYKWQETKGVEEEALLSSLPKDLRKDIKRHLCLKLLKKVPWFQAMDDRLL  486

Query  1310  DAICDRLKPVLYTEKSCIVREGDPVDEMIFVMRGNLLTMTTNGGRTGFLNSDVLNAGDFC  1489
             DA+C RLK VLYTEKS IVREG+PV++M+F+MRGNL++ TT GGRTGF NS  L AGDFC
Sbjct  487   DALCARLKTVLYTEKSYIVREGEPVEDMLFIMRGNLISTTTYGGRTGFFNSVDLVAGDFC  546

Query  1490  GEELLTWALDPNSSSSLPISTRTVQALTDVEAFALTADFLKFFASQYRRLHSKQLQHKFR  1669
             G +LLTWALDP  SS  PIS+RTVQALT+VE F L+AD LKF A+QYRRLHSKQL+H FR
Sbjct  547   G-DLLTWALDP-LSSQFPISSRTVQALTEVEGFLLSADDLKFVATQYRRLHSKQLRHMFR  604

Query  1670  FYSHQWKTWAACFIQAAWRRHCRNKLEKSLREEEDRLQDALILRMRREEGETTPSLGATI  1849
             FYS QW+TWAACFIQAAW+RHCR KL K+LREEE +L + L      + G    +LGA I
Sbjct  605   FYSVQWQTWAACFIQAAWKRHCRRKLSKALREEEGKLHNTL---QNDDSGGNKLNLGAAI  661

Query  1850  YASRFAANVLRTVRRN  1897
             YASRFA++ LR +R N
Sbjct  662   YASRFASHALRNLRAN  677



>ref|XP_006843330.1| hypothetical protein AMTR_s00053p00015490 [Amborella trichopoda]
 gb|ERN05005.1| hypothetical protein AMTR_s00053p00015490 [Amborella trichopoda]
Length=711

 Score =   759 bits (1960),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 396/616 (64%), Positives = 473/616 (77%), Gaps = 13/616 (2%)
 Frame = +2

Query  47    KSKMHDPQGPFLQRWNRIFVIACILAATVDPLFFYIPVVDDQNKCLGLDRTLEITACILR  226
             + K+ DPQG FLQ WN+IFV  C+LA +VDPLF YIPV+     CL LD  L+ TAC+LR
Sbjct  79    EKKVLDPQGKFLQTWNKIFVATCVLAVSVDPLFLYIPVISKDANCLDLDNKLQTTACVLR  138

Query  227   SVFDFFYIFHIILQFRTGFVPPSSRVFGRGDLIVDPSAIAKRYFFSYFFIDILAVLPLPQ  406
                D FY+ HI  QFRTGF+ PSSRVFG+G L+ D  AIAKRY   YF ID+LAVLP+PQ
Sbjct  139   FFTDIFYVVHIFFQFRTGFIAPSSRVFGKGILVEDSFAIAKRYLAPYFIIDVLAVLPIPQ  198

Query  407   VVLFMMIPRADRPFIMVAKDILKVVILVQSVPRLLRIYPLYKEVTRTSGFFTETAWAGAA  586
             VV+ ++IP+      +  K++L+ VIL Q +PR++RI PLYKEV + SG  TETAWAGAA
Sbjct  199   VVILLIIPKLSGAVPLNTKNLLRFVILFQYIPRVIRIVPLYKEVIKASGLITETAWAGAA  258

Query  587   FNLFLYMIASYVAGAIWYITAIERQDKCWRRACEKHGSCDIDFLYCTKLGRRGGDFSSSF  766
             FNLFLYM+AS++ GA WY+ AIER D CWR+ C   G   +  +YC   G      ++SF
Sbjct  259   FNLFLYMLASHILGAFWYLLAIERLDACWRKECAPKGC--LSSIYC---GTEQPTQNTSF  313

Query  767   LNTSCALLEPENLKA-DDFDFGIFLDALKSNVVEKRYFWSKLFYCFWWGLRNLSSLGQNL  943
             LN  C    P +L++   FDFGI+  AL S +V+ R F  K+FYCFWWGLRNLSSLGQNL
Sbjct  314   LNAMC----PMSLESTGGFDFGIYSPALSSAIVKSRDFPQKIFYCFWWGLRNLSSLGQNL  369

Query  944   KTSNFVGEilfailisiiglilfslligNMQKYLQSITVRVEEMRVKRMDAEQWMSHRML  1123
              TS +V EI FA+LI+I+GL+LF+LLIGNMQ YLQS TVR+EEMRVKR DAEQWMSHRML
Sbjct  370   ATSTYVWEIAFAVLIAIMGLVLFALLIGNMQTYLQSTTVRLEEMRVKRRDAEQWMSHRML  429

Query  1124  PDNLRERIRRYEQYRWQETRGVDEESLISNLPKDLRRDINRHLCWSLLKRVHMFKTMDEQ  1303
             P++LRERIR YEQY+W E RGV+E+ LI NLPKDLRRDI RHLC  LLKRV MF TMD+Q
Sbjct  430   PESLRERIRTYEQYKWLENRGVEEDVLIRNLPKDLRRDIKRHLCLGLLKRVPMFGTMDDQ  489

Query  1304  LLDAICDRLKPVLYTEKSCIVREGDPVDEMIFVMRGNLLTMTTNGGRTGFLNSDVLNAGD  1483
             LLDA+CD LKP L+T+ S I+REGDPVDEM+F+MRG L T+TTNGGRTGF NSD L  GD
Sbjct  490   LLDALCDCLKPSLFTKGSYIIREGDPVDEMVFIMRGRLETVTTNGGRTGFFNSDFLKEGD  549

Query  1484  FCGEELLTWALDPNSSSSLPISTRTVQALTDVEAFALTADFLKFFASQYRRLHSKQLQHK  1663
             FCGEELLTWALDPNSSS+LP STRTV+AL++VEAFAL AD LKF A+Q+RRLHSKQL+H 
Sbjct  550   FCGEELLTWALDPNSSSNLPSSTRTVKALSEVEAFALMADDLKFVATQFRRLHSKQLRHT  609

Query  1664  FRFYSHQWKTWAACFIQAAWRRHCRNKLEKSLREEEDRLQDALILRMRREEGETTPSLGA  1843
             FRFYS QW+TWAACF+QAAWRRHCR K+E+SL +EEDRL  A    M R+    +PSLGA
Sbjct  610   FRFYSPQWRTWAACFVQAAWRRHCRKKIEESLHKEEDRLMRA---AMARDGSTMSPSLGA  666

Query  1844  TIYASRFAANVLRTVR  1891
              +Y SRFAA  LR  R
Sbjct  667   AVYVSRFAAIALRNAR  682



>ref|XP_004498403.1| PREDICTED: cyclic nucleotide-gated ion channel 1-like [Cicer 
arietinum]
Length=588

 Score =   754 bits (1946),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 402/597 (67%), Positives = 470/597 (79%), Gaps = 10/597 (2%)
 Frame = +2

Query  200   LEITACILRSVFDFFYIFHIILQFRTGFVPPSSRVFGRGDLIVDPSAIAKRYFFSYFFID  379
             +EITA  LR+  D FYI H+I QFRTGF+ PSSRVFGRG L+ D   IAK+Y  SYF +D
Sbjct  1     MEITATFLRTFSDAFYIIHMIFQFRTGFIAPSSRVFGRGVLVEDSWEIAKKYLSSYFLVD  60

Query  380   ILAVLPLPQVVLFMMIPRADRPFIMVAKDILKVVILVQSVPRLLRIYPLYKEVTRTSGFF  559
             ILAVLPLPQVV+ ++IP+      +  K++LK V+  Q VPR+LRI PLYKEVTRTSG  
Sbjct  61    ILAVLPLPQVVILIIIPKMSGFKSLNTKNLLKFVVFFQYVPRVLRIIPLYKEVTRTSGIL  120

Query  560   TETAWAGAAFNLFLYMIASYVAGAIWYITAIERQDKCWRRACEKHGSCDIDFLYCTKLGR  739
             TETAWAGAAFNLFLYM+AS+V GA WY+ +IER+  CW+ AC  +  C+   +YC    R
Sbjct  121   TETAWAGAAFNLFLYMLASHVLGAFWYLFSIERETTCWQEACRSNIMCNKADMYCND-HR  179

Query  740   RGGDFSSSFLNTSCALLEPENLKADDFDFGIFLDALKSNVVEKRYFWSKLFYCFWWGLRN  919
              G    SSFLNTSC + E +      FDFGIFLDAL+S VVE R F  KLFYCFWWGL+N
Sbjct  180   DGFKSISSFLNTSCPIQEEDK---KLFDFGIFLDALQSGVVESRDFPQKLFYCFWWGLKN  236

Query  920   LSSLGQNLKTSNFVGEilfailisiiglilfslligNMQKYLQSITVRVEEMRVKRMDAE  1099
             LSSLGQNL TS    EI FA+ ISI GL+LFS LIGNMQ YLQS T R+EEMRVKR DAE
Sbjct  237   LSSLGQNLATSTDFWEICFAVSISIAGLVLFSFLIGNMQTYLQSTTTRLEEMRVKRRDAE  296

Query  1100  QWMSHRMLPDNLRERIRRYEQYRWQETRGVDEESLISNLPKDLRRDINRHLCWSLLKRVH  1279
             QWMSHR+LPD+LRERIRRY+QY+WQETRGVDE+SLI +LPKDLRRDI RHLC  LL RV 
Sbjct  297   QWMSHRLLPDSLRERIRRYDQYKWQETRGVDEDSLIHDLPKDLRRDIKRHLCLDLLMRVP  356

Query  1280  MFKTMDEQLLDAICDRLKPVLYTEKSCIVREGDPVDEMIFVMRGNLLTMTTNGGRTGFLN  1459
             MF+ MDEQLLDA+CDRLKPVLYTE+S +VREGDPVDEM+F+MRG LLTMTTNGGRTGF N
Sbjct  357   MFEKMDEQLLDAMCDRLKPVLYTEQSYVVREGDPVDEMLFIMRGKLLTMTTNGGRTGFFN  416

Query  1460  SDVLNAGDFCGEELLTWALDPNSSSSLPISTRTVQALTDVEAFALTADFLKFFASQYRRL  1639
             S+ L AGDFCGEELLTWALDP+SSS+LPISTRTVQ + +VEAFAL AD LKF ASQ+RRL
Sbjct  417   SEYLKAGDFCGEELLTWALDPHSSSNLPISTRTVQTIVEVEAFALKADDLKFVASQFRRL  476

Query  1640  HSKQLQHKFRFYSHQWKTWAACFIQAAWRRHCRNKLEKSLREEEDRLQDALILRMRREEG  1819
             HSKQL+H FRFYS QW+TWAACFIQAAWRR+ + KLE+SL EEE+RL+DAL      + G
Sbjct  477   HSKQLRHTFRFYSQQWRTWAACFIQAAWRRYSKKKLEESLVEEENRLKDALA-----KAG  531

Query  1820  ETTPSLGATIYASRFAANVLRTVRRNHplsvpklsprlp-plllqkpAEPDFSAPEN  1987
              ++ SLGATIYASRFAAN LR +RR+      +++ R   P+LLQKPAEPDF+  + 
Sbjct  532   GSSTSLGATIYASRFAANALRLLRRSGTARKIRVAERSIPPMLLQKPAEPDFTVEDQ  588



>gb|EPS70634.1| hypothetical protein M569_04125 [Genlisea aurea]
Length=701

 Score =   758 bits (1957),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 397/645 (62%), Positives = 493/645 (76%), Gaps = 15/645 (2%)
 Frame = +2

Query  47    KSKMHDPQGPFLQRWNRIFVIACILAATVDPLFFYIPVVDDQNKCLGLDRTLEITACILR  226
             K ++ +PQG FLQ+WN+IFV++C++A ++DPLF Y+P ++   KC+ LD+ +E  ACILR
Sbjct  70    KKRILNPQGLFLQKWNKIFVLSCVIAISLDPLFLYVPFINADKKCVDLDQRMEFVACILR  129

Query  227   SVFDFFYIFHIILQFRTGFVPPSSRVFGRGDLIVDPSAIAKRYFFSYFFIDILAVLPLPQ  406
             S+FD FYI HI+ QFRTGF+ P SRVFGRG L+ D   IAK Y  S F +DILAVLP+PQ
Sbjct  130   SLFDAFYIIHIVFQFRTGFIAPPSRVFGRGVLVQDSWEIAKSYLTSNFIVDILAVLPIPQ  189

Query  407   VVLFMMIPRADRPFIMVAKDILKVVILVQSVPRLLRIYPLYKEVTRTSGFFTETAWAGAA  586
             ++L ++ P+  R   + AKD LK V+ +Q +PR+ RI+PLY+EVTRTSG  TETAWAGAA
Sbjct  190   LLLLIVTPKLRRIGSLNAKDFLKSVVAIQYIPRIGRIFPLYREVTRTSGILTETAWAGAA  249

Query  587   FNLFLYMIASYVAGAIWYITAIERQDKCWRRACE-KHGSCDIDFLYCTKLGRRGGDFSSS  763
             FNLFLYM+AS++ G++WY+ AIER+  CW +AC     SC     +C        DF   
Sbjct  250   FNLFLYMLASHMLGSLWYLFAIERETNCWEKACGIPSSSCGNASFFCETNNSGIKDF---  306

Query  764   FLNTSCALLEPENLKADDFDFGIFLDALKSNVVEKRYFWSKLFYCFWWGLRNLSSLGQNL  943
              L+ SC +  P    A  FDFGIFL+AL+S V E  +F  K FYCFWWGL++LSSLGQNL
Sbjct  307   -LDASCPIQNP---NATIFDFGIFLEALQSEVAESNHFAQKFFYCFWWGLQSLSSLGQNL  362

Query  944   KTSNFVGEilfailisiiglilfslligNMQKYLQSITVRVEEMRVKRMDAEQWMSHRML  1123
             +TS +  EI FA+ +SI GL+LFSLLIGNMQ YLQS T R+EEMRVKR DA+QWMSHR+L
Sbjct  363   RTSTYFWEIFFAVTVSISGLVLFSLLIGNMQSYLQSTTKRLEEMRVKRRDAQQWMSHRLL  422

Query  1124  PDNLRERIRRYEQYRWQETRGVDEESLISNLPKDLRRDINRHLCWSLLKRVHMFKTMDEQ  1303
             P++LRERIR+YEQY+WQETRGVDE+SLI +LPKD+RR+I RHLC  LLKRV +F+ MD+Q
Sbjct  423   PESLRERIRKYEQYKWQETRGVDEDSLIRSLPKDIRREIKRHLCIDLLKRVPIFEKMDDQ  482

Query  1304  LLDAICDRLKPVLYTEKSCIVREGDPVDEMIFVMRGNLLTMTTNGGRTGFLNSDVLNAGD  1483
             LLDA+ DRLKPVLYT+ S +VREGDPVDEM+FVMRG L T+TTNGGRTGF NSD L AGD
Sbjct  483   LLDAMSDRLKPVLYTDDSYVVREGDPVDEMLFVMRGKLFTVTTNGGRTGFFNSDYLKAGD  542

Query  1484  FCGEELLTWALDPNSSSSLPISTRTVQALTDVEAFALTADFLKFFASQYRRLHSKQLQHK  1663
             FCGEELLTWALDPNSS++LPISTRTVQ+L+ VEAFAL A  LK  ASQ+R+LHSKQL+H 
Sbjct  543   FCGEELLTWALDPNSSTNLPISTRTVQSLSAVEAFALKAGDLKSVASQFRKLHSKQLRHT  602

Query  1664  FRFYSHQWKTWAACFIQAAWRRHCRNKLEKSLREEEDRLQDALILRMRREEGETTPSLGA  1843
             FRFYS QW+TWAACFIQAAWRR+CR K E++LRE+E RLQ AL       +G    SLGA
Sbjct  603   FRFYSQQWRTWAACFIQAAWRRYCRKKHEEALREQETRLQVALA----EGDGGGHTSLGA  658

Query  1844  TIYASRFAANVLRTVRRNHplsvpklsprlpplllqkpAEPDFSA  1978
             TIYASRFA N+L+++ R       + +        +KPAEPDF+A
Sbjct  659   TIYASRFAKNMLKSLNRES---ARRTAAERTAARPRKPAEPDFTA  700



>gb|KFK37409.1| hypothetical protein AALP_AA4G253100 [Arabis alpina]
Length=703

 Score =   756 bits (1952),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 374/616 (61%), Positives = 478/616 (78%), Gaps = 9/616 (1%)
 Frame = +2

Query  53    KMHDPQGPFLQRWNRIFVIACILAATVDPLFFYIPVVDDQNKCLGLDRTLEITACILRSV  232
             ++ +P   +LQ WN+ F++ C+ A   DPLFFYIPVV+ +  CL LD+ L++ AC  R+ 
Sbjct  67    RVMNPNDSYLQTWNKFFLLLCVGALAFDPLFFYIPVVNPERFCLNLDKKLQVVACAFRTF  126

Query  233   FDFFYIFHIILQFRTGFVPPSSRVFGRGDLIVDPSAIAKRYFFSYFFIDILAVLPLPQVV  412
              D FY+ H++ +F TGF+ PSSR FGRG+LI D   IA RY  SYF ID+L++LP+PQVV
Sbjct  127   IDAFYVVHMLFRFHTGFIAPSSRGFGRGELIDDSKKIAIRYLKSYFIIDVLSILPIPQVV  186

Query  413   LFMMIPRADRPFIMVAKDILKVVILVQSVPRLLRIYPLYKEVTRTSGFFTETAWAGAAFN  592
             +  ++P+  RP  +V K++LK VI  Q VPR+ RIYPL KEVTRTSG  TETAWAGAA N
Sbjct  187   VLAVVPKMSRPASLVTKELLKWVIFCQYVPRIARIYPLSKEVTRTSGLVTETAWAGAALN  246

Query  593   LFLYMIASYVAGAIWYITAIERQDKCWRRACEKHGSCDIDFLYCTKLGRRGGDFSSSFLN  772
             LFLYM+AS+V G+ WY+ +IER+D+CWR ACE    C    LYC+      G+ +  FLN
Sbjct  247   LFLYMLASHVFGSFWYLISIERKDRCWREACENITGCIHANLYCSPT----GEDNRRFLN  302

Query  773   TSCALLEPENL-KADDFDFGIFLDALKSNVVEKRYFWSKLFYCFWWGLRNLSSLGQNLKT  949
              +C L +PE +  +  F+FGIF +AL+S VVE R F  K F+CFWWGLRNLS+LGQNLKT
Sbjct  303   VTCPLTDPEEITNSTVFNFGIFAEALQSGVVESRDFPKKFFFCFWWGLRNLSALGQNLKT  362

Query  950   SNFVGEilfailisiiglilfslligNMQKYLQSITVRVEEMRVKRMDAEQWMSHRMLPD  1129
             S F GEI+FAI+I I GL+LF+LLIGNMQKYLQS TVRVEEMRVKRMDAEQWMSHRMLPD
Sbjct  363   STFEGEIIFAIVICISGLVLFALLIGNMQKYLQSTTVRVEEMRVKRMDAEQWMSHRMLPD  422

Query  1130  NLRERIRRYEQYRWQETRGVDEESLISNLPKDLRRDINRHLCWSLLKRVHMFKTMDEQLL  1309
             ++++RIR+YEQY+WQETRGV+EE+L+S+LPKDLR+DI  HLC  LLK+V  FK MD++LL
Sbjct  423   DMKKRIRKYEQYKWQETRGVEEEALLSSLPKDLRKDIKGHLCLDLLKKVPWFKAMDDRLL  482

Query  1310  DAICDRLKPVLYTEKSCIVREGDPVDEMIFVMRGNLLTMTTNGGRTGFLNSDVLNAGDFC  1489
             DA+C RLK VLYTEKS IVREG+PV++M+F+MRGNL++ TT+GG++GF NS  L+AG FC
Sbjct  483   DALCARLKTVLYTEKSYIVREGEPVEDMLFIMRGNLISTTTDGGKSGFFNSATLSAGGFC  542

Query  1490  GEELLTWALDPNSSSSLPISTRTVQALTDVEAFALTADFLKFFASQYRRLHSKQLQHKFR  1669
             G+ LLTWALDP+ +S  PIS+RTVQA T+VE F L+AD LK  ++QYRRLHSKQL+H FR
Sbjct  543   GDGLLTWALDPH-ASHFPISSRTVQAQTEVEGFVLSADDLKSVSTQYRRLHSKQLRHMFR  601

Query  1670  FYSHQWKTWAACFIQAAWRRHCRNKLEKSLREEEDRLQDALILRMRREEGETTPSLGATI  1849
             ++S QWKTWA+CFIQAAW+RHCR K+ K+LREEE +LQ+ L      + G    ++GA I
Sbjct  602   YHSVQWKTWASCFIQAAWKRHCRRKISKALREEEGKLQNTL---QNDDSGGNKLNIGAAI  658

Query  1850  YASRFAANVLRTVRRN  1897
             YASRFA+N L+ +R N
Sbjct  659   YASRFASNALKNLRAN  674



>ref|XP_011093039.1| PREDICTED: cyclic nucleotide-gated ion channel 1-like [Sesamum 
indicum]
Length=636

 Score =   753 bits (1944),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 380/644 (59%), Positives = 489/644 (76%), Gaps = 15/644 (2%)
 Frame = +2

Query  53    KMHDPQGPFLQRWNRIFVIACILAATVDPLFFYIPVVDDQNKCLGLDRTLEITACILRSV  232
             K+ DPQ P L +WN+IF++ C+++  +DPLFFY PVVD +N CL LD+ LEI+ C+LR+ 
Sbjct  2     KVLDPQDPLLHKWNKIFIVCCVISLFLDPLFFYAPVVDAKNLCLSLDKKLEISVCVLRTF  61

Query  233   FDFFYIFHIILQFRTGFVPPSSRVFGRGDLIVDPSAIAKRYFFSYFFIDILAVLPLPQVV  412
             FD FY+ HI+L+F TGFV PSSRVFGR ++I +  AI  RY +SYF +DIL++LPLPQV 
Sbjct  62    FDIFYVLHIVLEFLTGFVAPSSRVFGRSEIIDNGRAICLRYLYSYFILDILSILPLPQVT  121

Query  413   LFMMIPRADRPFIMVAKDILKVVILVQSVPRLLRIYPLYKEVTRTSGFFTETAWAGAAFN  592
             +  ++   + P  +  KD+LK++I  Q   R+LRIYPLYK V R+S  F+ TAW  A +N
Sbjct  122   VMTIV---NAPISLATKDLLKMLIFAQFFTRILRIYPLYKAVNRSSRRFSRTAWPAAVYN  178

Query  593   LFLYMIASYVAGAIWYITAIERQDKCWRRACEKHGSCDIDFLYCTKLGRRGGDFSSSFLN  772
             L   ++AS+V GA+WY+ AIER+++CWR AC  H  C ++ LYC  +GR  GD  +SFLN
Sbjct  179   LLQCILASHVFGALWYVIAIERKERCWRMACGDHNGCKLEDLYC-GVGR--GD--TSFLN  233

Query  773   TSCALLEPENLKAD-DFDFGIFLDALKSNVVEKRYFWSKLFYCFWWGLRNLSSLGQNLKT  949
             +SC LLEP+ + +  DFDFG+FL ALKS+VVE+  F  K F CFWWG RNLSSLGQNL T
Sbjct  234   SSCPLLEPDQIMSPADFDFGMFLHALKSHVVEQTDFTRKFFNCFWWGWRNLSSLGQNLNT  293

Query  950   SNFVGEil-failisiiglilfslligNMQKYLQSITVRVEEMRVKRMDAEQWMSHRMLP  1126
             SN VGEI+   ++     +++ S++  ++Q+++QSIT R+EE+R+KR D EQWMS RMLP
Sbjct  294   SNSVGEIIFALLMSVTGLVLVASVISSSIQQFVQSITGRLEEVRMKRQDIEQWMSQRMLP  353

Query  1127  DNLRERIRRYEQYRWQETRGVDEESLISNLPKDLRRDINRHLCWSLLKRVHMFKTMDEQL  1306
             + LR RIR+YEQY+WQ+ RGV+EESLISN PKDLRRDI RHLCW+LL RV +F+ +DEQL
Sbjct  354   EGLRARIRQYEQYKWQQKRGVEEESLISNFPKDLRRDIKRHLCWNLLTRVPLFERVDEQL  413

Query  1307  LDAICDRLKPVLYTEKSCIVREGDPVDEMIFVMRGNLLTMTTNGGRTGFLNSDVLNAGDF  1486
             LD +  RLKPVLY E S I R+GDPVDEM+F+M+G++L+M+TNGG TGF NS  L AGDF
Sbjct  414   LDVMYSRLKPVLYVENSYIFRQGDPVDEMLFIMKGSILSMSTNGGTTGFFNSFHLTAGDF  473

Query  1487  CGEELLTWALDPNSSSSLPISTRTVQALTDVEAFALTADFLKFFASQYRRLHSKQLQHKF  1666
             CGEELLTWAL+ NSSSSLP+STRTV+A  DV+ F LT D LK+  SQ++R+H KQLQH +
Sbjct  474   CGEELLTWALEDNSSSSLPVSTRTVRAYRDVDCFCLTPDDLKYVMSQFKRVHGKQLQHTY  533

Query  1667  RFYSHQWKTWAACFIQAAWRRHCRNKLEKSLREEEDRLQDALILRMRREEGETTPSLGAT  1846
             R+YS QW+TW ACFIQAAWRRH R K+EK+LRE EDRLQ+AL     +E   + PSL AT
Sbjct  534   RYYSQQWRTWGACFIQAAWRRHYRRKIEKTLREAEDRLQNALA----KEGSGSLPSLAAT  589

Query  1847  IYASRFAANVLRTVRRNHplsvpklsprlpplllqkpAEPDFSA  1978
             +YASRFA N+L  +RRNH       SP+LPPLLL KPAEPDFSA
Sbjct  590   VYASRFATNMLGNLRRNH-PRNTIPSPKLPPLLLHKPAEPDFSA  632



>ref|XP_004240080.1| PREDICTED: cyclic nucleotide-gated ion channel 1-like isoform 
X1 [Solanum lycopersicum]
Length=719

 Score =   756 bits (1951),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 393/624 (63%), Positives = 485/624 (78%), Gaps = 17/624 (3%)
 Frame = +2

Query  47    KSKMHDP-QGPFLQRWNRIFVIACILAATVDPLFFYIPVVDDQNKCLGLDRTLEITACIL  223
             K K+ DP +G FLQ+WN+I ++ C+ A ++DPLFFYIPV+D++NKCL  D  L+I+AC+L
Sbjct  85    KKKVLDPHEGQFLQKWNKICILVCVFAVSLDPLFFYIPVIDNKNKCLHFDNMLKISACVL  144

Query  224   RSVFDFFYIFHIILQFRTGFVPPSSRVFGRGDLIVDPSAIAKRYFFSYFFIDILAVLPLP  403
             RS  D FYIFHIIL+FRTGF+ PSSRVFGRG+LI D SAIAKRY  SYF ID++AVLPLP
Sbjct  145   RSFTDLFYIFHIILKFRTGFITPSSRVFGRGELIEDSSAIAKRYLSSYFIIDVVAVLPLP  204

Query  404   QVVLFMMIPRADRPFIMVAKDILKVVILVQSVPRLLRIYPLYKEVTRTSGFFTETAWAGA  583
             Q+V+ ++ P  + P I+   ++L VV+  Q  PRL RI PLYKEV RT+GFF+ + W GA
Sbjct  205   QIVILIIAPNTNGPIILATNEMLMVVVFFQYAPRLFRIIPLYKEVERTTGFFSGSTWGGA  264

Query  584   AFNLFLYMIASYVAGAIWYITAIERQDKCWRRACEKHGSCDIDFLYCTKLGRRGGDFSSS  763
              F LFL+M  S V GA WY+ +IERQ+ CWR AC+K  +C  D+L+C      GG+ + +
Sbjct  265   IFYLFLFMWCSNVTGAFWYLFSIERQEACWRSACDKIPNCSSDYLHC------GGNMNGN  318

Query  764   --FLNTSCALLEPENLK-ADDFDFGIFLDALKSNVVEKRYFWSKLFYCFWWGLRNLSSLG  934
                LN+SC LL+ E++K  +DFDFGI LDAL+  VVEKR F +KL YCFWWGLRNLSSLG
Sbjct  319   TLLLNSSCPLLQQEDIKDPNDFDFGIALDALQFQVVEKRKFLTKLLYCFWWGLRNLSSLG  378

Query  935   QNLKTSNFVGEilfailisiiglilfslligNMQKYLQSITVRVEEMRVKRMDAEQWMSH  1114
             QNLKTS F G+I+FAI ISI GLILFSL+IGNMQK LQ   VRVEEMR +R D EQWMS+
Sbjct  379   QNLKTSTFDGDIIFAICISITGLILFSLIIGNMQKLLQFDLVRVEEMRARRWDVEQWMSN  438

Query  1115  RMLPDNLRERIRRYEQYRWQETRGVDEESLISNLPKDLRRDINRHLCWSLLKRVHMFKTM  1294
             RMLPD+LR +IRR+E+Y+WQ+T+G++E+S I NLP+DLRR++ RHLCWSLL RV +F+ M
Sbjct  439   RMLPDSLRLQIRRHEEYKWQQTKGIEEDSFIQNLPRDLRRNLKRHLCWSLLYRVPVFEKM  498

Query  1295  DEQLLDAICDRLKPVLYTEKSCIVREGDPVDEMIFVMRGNLLTMTTNGGRTGFLNSDVLN  1474
             DEQ LD +CDRLKP  +TE S I+REGDPV+EM F+MRG + +MTTNG  TGF NS  L 
Sbjct  499   DEQSLDVLCDRLKPARFTEMSYIIREGDPVEEMHFLMRGAVSSMTTNGEETGFFNSVHLK  558

Query  1475  AGDFCGEELLTWAL-DPNSSSSLPISTRTVQALTDVEAFALTADFLKFFASQYRRLHSK-  1648
             AGD+CG ELL W +   +SSSSLP+STRTV+A+TD+E FALTAD LKF  SQYRRLHSK 
Sbjct  559   AGDYCGNELLAWVISPHSSSSSLPVSTRTVKAVTDIETFALTADDLKFVVSQYRRLHSKR  618

Query  1649  QLQHKFRFYSHQWKTWAACFIQAAWRRHCRNKLEKSLREEEDRLQDALILRMRREEGETT  1828
             QLQ  F++YS QW+ WAACFIQ AWRRHCRNKLEKSLREEED+LQ AL      +E    
Sbjct  619   QLQRTFKYYSQQWRIWAACFIQVAWRRHCRNKLEKSLREEEDKLQVALA-----KESTNA  673

Query  1829  PSLGATIYASRFAANVLRTVRRNH  1900
             PSLGA IYASRFAAN+L  +RRN+
Sbjct  674   PSLGAAIYASRFAANMLCALRRNN  697



>ref|XP_009142642.1| PREDICTED: probable cyclic nucleotide-gated ion channel 3 [Brassica 
rapa]
 ref|XP_009142643.1| PREDICTED: probable cyclic nucleotide-gated ion channel 3 [Brassica 
rapa]
Length=704

 Score =   755 bits (1949),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 377/616 (61%), Positives = 476/616 (77%), Gaps = 10/616 (2%)
 Frame = +2

Query  53    KMHDPQGPFLQRWNRIFVIACILAATVDPLFFYIPVVDDQNKCLGLDRTLEITACILRSV  232
             ++ +P   +LQ WN+IF++ C++A   DPLFF+IPVVD    CL LD+ LE  AC+ R+ 
Sbjct  69    RVMNPNDSYLQNWNKIFLLLCVVALAFDPLFFFIPVVDPDRFCLKLDKKLEAVACVFRTF  128

Query  233   FDFFYIFHIILQFRTGFVPPSSRVFGRGDLIVDPSAIAKRYFFSYFFIDILAVLPLPQVV  412
              D FY+ H++ QF TGF+ PSSR FGRG+L+     IA RY  SYF ID+L++LP+PQVV
Sbjct  129   IDAFYLVHMLFQFNTGFIAPSSRGFGRGELVQSSKKIAVRYLKSYFIIDVLSILPIPQVV  188

Query  413   LFMMIPRADRPFIMVAKDILKVVILVQSVPRLLRIYPLYKEVTRTSGFFTETAWAGAAFN  592
             +  ++P   RP  +V K++LK  I  Q VPR+ RIYPL+KEVTRTSG  TETAWAGAA N
Sbjct  189   VLAVVPSMSRPASLVTKELLKWAIFCQYVPRIARIYPLFKEVTRTSGLVTETAWAGAALN  248

Query  593   LFLYMIASYVAGAIWYITAIERQDKCWRRACEKHGSCDIDFLYCTKLGRRGGDFSSSFLN  772
             LFLYM+AS+V G+ WY+ +IER+D+CWR  C K   C    LYC+     GG+ +S +L 
Sbjct  249   LFLYMLASHVFGSFWYLISIERKDRCWRETCAKIEGCVHGNLYCS-----GGEDNSQYLI  303

Query  773   TSCALLEPENLKADD-FDFGIFLDALKSNVVEKRYFWSKLFYCFWWGLRNLSSLGQNLKT  949
              SC L++PE +K    F+FGIF +AL+S VVE   F  K FYCFWWGLRNLS++GQNLKT
Sbjct  304   GSCPLMDPEEIKNSTVFNFGIFAEALQSGVVESMNFPKKFFYCFWWGLRNLSAVGQNLKT  363

Query  950   SNFVGEilfailisiiglilfslligNMQKYLQSITVRVEEMRVKRMDAEQWMSHRMLPD  1129
             S+F GEI+FAI+I I GL+LF+LLIGNMQKYLQS TVR+EEMRVKR DAEQWMSHRMLPD
Sbjct  364   SDFEGEIIFAIIICISGLVLFALLIGNMQKYLQSTTVRIEEMRVKRRDAEQWMSHRMLPD  423

Query  1130  NLRERIRRYEQYRWQETRGVDEESLISNLPKDLRRDINRHLCWSLLKRVHMFKTMDEQLL  1309
             +LR+R+R YEQY+WQETRGV+EE+L+S+LPKDLR++I RHLC +LLK+V  FK MD++LL
Sbjct  424   DLRKRVREYEQYKWQETRGVEEEALLSSLPKDLRKEIKRHLCLNLLKKVPWFKAMDDRLL  483

Query  1310  DAICDRLKPVLYTEKSCIVREGDPVDEMIFVMRGNLLTMTTNGGRTGFLNSDVLNAGDFC  1489
             DA+C RL  VLYTE S IVREG+PV++M+F+MRG L++ TT GG+TGF N   L AGDFC
Sbjct  484   DALCARLNTVLYTENSYIVREGEPVEDMVFIMRGKLISTTTYGGQTGFFNIAHLEAGDFC  543

Query  1490  GEELLTWALDPNSSSSLPISTRTVQALTDVEAFALTADFLKFFASQYRRLHSKQLQHKFR  1669
             G +LLTWALDPN +S LPISTRTVQA T+VE F L+A+ LKFF++QYRRLHSKQL+H +R
Sbjct  544   G-DLLTWALDPN-TSHLPISTRTVQAETEVEGFVLSAEDLKFFSTQYRRLHSKQLRHTYR  601

Query  1670  FYSHQWKTWAACFIQAAWRRHCRNKLEKSLREEEDRLQDALILRMRREEGETTPSLGATI  1849
              YS QW+TWAACFIQAAW+R+CR KL + LREEE+RLQ+   L+   + G    +LGA I
Sbjct  602   CYSVQWQTWAACFIQAAWKRYCRRKLSRVLREEEERLQNT--LQTTDDSGGNKLNLGAAI  659

Query  1850  YASRFAANVLRTVRRN  1897
             YASRFA++ LR VR N
Sbjct  660   YASRFASHALRNVRAN  675



>ref|XP_004965514.1| PREDICTED: cyclic nucleotide-gated ion channel 1-like isoform 
X1 [Setaria italica]
 ref|XP_004965515.1| PREDICTED: cyclic nucleotide-gated ion channel 1-like isoform 
X2 [Setaria italica]
Length=670

 Score =   754 bits (1946),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 395/641 (62%), Positives = 496/641 (77%), Gaps = 12/641 (2%)
 Frame = +2

Query  65    PQGPFLQRWNRIFVIACILAATVDPLFFYIPVVDDQNKCLGLDRTLEITACILRSVFDFF  244
             PQGPFLQ+WNRIFVI+CILA +VDPLF YIP+++D+  C  LDR LE  A +LR   D F
Sbjct  42    PQGPFLQKWNRIFVISCILAVSVDPLFLYIPIINDEKPCWYLDRKLEKAASVLRFFTDIF  101

Query  245   YIFHIILQFRTGFVPPSSRVFGRGDLIVDPSAIAKRYFFSYFFIDILAVLPLPQVVLFMM  424
             YI HII QFRTGF+  S   FGRG LI D  AI KRY  +YFFID+ A+LP+PQV++ ++
Sbjct  102   YILHIIFQFRTGFIASSPTTFGRGVLIKDRYAIMKRYISTYFFIDVFAILPIPQVIILVV  161

Query  425   IPRADRPFIMVAKDILKVVILVQSVPRLLRIYPLYKEVTRTSGFFTETAWAGAAFNLFLY  604
             +P+     +M AK++L ++I+ Q VPRL+RI PLY+++TR++G  TETA AGAAFNL LY
Sbjct  162   LPKLPDAEVMKAKNVLMIIIICQYVPRLIRIRPLYQQITRSAGVITETARAGAAFNLLLY  221

Query  605   MIASYVAGAIWYITAIERQDKCWRRACEKHGSCDIDFLYCTKLGRRGGDFSSSFLNTSCA  784
             M+AS+V GAIWY+ +I+RQ+ CWR+ C  + +CD  ++YC   G    +  ++FL T C+
Sbjct  222   MLASHVLGAIWYLLSIQRQESCWRQECRNNATCDAKYIYC---GAVNNNEKNAFLKTVCS  278

Query  785   LLEPENLKADDFDFGIFLDALKSNVVEKRYFWSKLFYCFWWGLRNLSSLGQNLKTSNFVG  964
             L  P +L  D F FGI+  A++ N+ + R F+ KLF+C WWGL+NLSSLGQNLKTS +  
Sbjct  279   LSPPNSL-PDPF-FGIYAPAIE-NITQSRSFFVKLFFCVWWGLQNLSSLGQNLKTSTYAW  335

Query  965   EilfailisiiglilfslligNMQKYLQSITVRVEEMRVKRMDAEQWMSHRMLPDNLRER  1144
             E +FA+ +SI GL+LF+LLIGNMQ YLQS ++R+EEMRVK  D +QWMS+R LP+NL+ER
Sbjct  336   ENIFAVFVSISGLVLFALLIGNMQTYLQSASLRIEEMRVKSRDTDQWMSYRHLPENLKER  395

Query  1145  IRRYEQYRWQETRGVDEESLISNLPKDLRRDINRHLCWSLLKRVHMFKTMDEQLLDAICD  1324
             IRRYEQYRWQET GVDEE L+ NLPKDLRRDI RHLC SLL RV MF+ MD+QLLDA+CD
Sbjct  396   IRRYEQYRWQETSGVDEEQLLVNLPKDLRRDIKRHLCLSLLMRVPMFENMDDQLLDAMCD  455

Query  1325  RLKPVLYTEKSCIVREGDPVDEMIFVMRGNLLTMTTNGGRTGFLNSDVLNAGDFCGEELL  1504
              LKP+LYTE SCI+REGDPV EM+F+MRGNL++MTTNGGRTGF NSDVL  GDFCGEELL
Sbjct  456   CLKPILYTEGSCIIREGDPVTEMLFIMRGNLMSMTTNGGRTGFFNSDVLEGGDFCGEELL  515

Query  1505  TWALDPNSSSSLPISTRTVQALTDVEAFALTADFLKFFASQYRRLHSKQLQHKFRFYSHQ  1684
             TWALDP S+SSLP STRTV+ +++VEAFAL A+ L+F A Q+RRLHSKQLQH FRFYS Q
Sbjct  516   TWALDPTSTSSLPSSTRTVKTMSEVEAFALRAEDLRFVAIQFRRLHSKQLQHTFRFYSQQ  575

Query  1685  WKTWAACFIQAAWRRHCRNKLEKSLREEEDRLQDALILRMRREEGETTPSLGATIYASRF  1864
             W+TWAACFIQAAW R+CR K+E SLRE+E RL+ A+       EG T+ S  A +YASRF
Sbjct  576   WRTWAACFIQAAWHRYCRKKIEDSLREKEKRLKFAIA-----TEGSTSLSFMAALYASRF  630

Query  1865  AANVLRTVRRNHplsvpklsprlpplllqkpAEPDFSAPEN  1987
             A N++R +RRN      +L  R+P  +LQKPAEP+FSA E 
Sbjct  631   AGNMVRILRRN-ATRKARLQERVPARMLQKPAEPNFSAEEQ  670



>ref|XP_010321518.1| PREDICTED: cyclic nucleotide-gated ion channel 1-like isoform 
X2 [Solanum lycopersicum]
Length=709

 Score =   755 bits (1949),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 393/624 (63%), Positives = 485/624 (78%), Gaps = 17/624 (3%)
 Frame = +2

Query  47    KSKMHDP-QGPFLQRWNRIFVIACILAATVDPLFFYIPVVDDQNKCLGLDRTLEITACIL  223
             K K+ DP +G FLQ+WN+I ++ C+ A ++DPLFFYIPV+D++NKCL  D  L+I+AC+L
Sbjct  75    KKKVLDPHEGQFLQKWNKICILVCVFAVSLDPLFFYIPVIDNKNKCLHFDNMLKISACVL  134

Query  224   RSVFDFFYIFHIILQFRTGFVPPSSRVFGRGDLIVDPSAIAKRYFFSYFFIDILAVLPLP  403
             RS  D FYIFHIIL+FRTGF+ PSSRVFGRG+LI D SAIAKRY  SYF ID++AVLPLP
Sbjct  135   RSFTDLFYIFHIILKFRTGFITPSSRVFGRGELIEDSSAIAKRYLSSYFIIDVVAVLPLP  194

Query  404   QVVLFMMIPRADRPFIMVAKDILKVVILVQSVPRLLRIYPLYKEVTRTSGFFTETAWAGA  583
             Q+V+ ++ P  + P I+   ++L VV+  Q  PRL RI PLYKEV RT+GFF+ + W GA
Sbjct  195   QIVILIIAPNTNGPIILATNEMLMVVVFFQYAPRLFRIIPLYKEVERTTGFFSGSTWGGA  254

Query  584   AFNLFLYMIASYVAGAIWYITAIERQDKCWRRACEKHGSCDIDFLYCTKLGRRGGDFSSS  763
              F LFL+M  S V GA WY+ +IERQ+ CWR AC+K  +C  D+L+C      GG+ + +
Sbjct  255   IFYLFLFMWCSNVTGAFWYLFSIERQEACWRSACDKIPNCSSDYLHC------GGNMNGN  308

Query  764   --FLNTSCALLEPENLK-ADDFDFGIFLDALKSNVVEKRYFWSKLFYCFWWGLRNLSSLG  934
                LN+SC LL+ E++K  +DFDFGI LDAL+  VVEKR F +KL YCFWWGLRNLSSLG
Sbjct  309   TLLLNSSCPLLQQEDIKDPNDFDFGIALDALQFQVVEKRKFLTKLLYCFWWGLRNLSSLG  368

Query  935   QNLKTSNFVGEilfailisiiglilfslligNMQKYLQSITVRVEEMRVKRMDAEQWMSH  1114
             QNLKTS F G+I+FAI ISI GLILFSL+IGNMQK LQ   VRVEEMR +R D EQWMS+
Sbjct  369   QNLKTSTFDGDIIFAICISITGLILFSLIIGNMQKLLQFDLVRVEEMRARRWDVEQWMSN  428

Query  1115  RMLPDNLRERIRRYEQYRWQETRGVDEESLISNLPKDLRRDINRHLCWSLLKRVHMFKTM  1294
             RMLPD+LR +IRR+E+Y+WQ+T+G++E+S I NLP+DLRR++ RHLCWSLL RV +F+ M
Sbjct  429   RMLPDSLRLQIRRHEEYKWQQTKGIEEDSFIQNLPRDLRRNLKRHLCWSLLYRVPVFEKM  488

Query  1295  DEQLLDAICDRLKPVLYTEKSCIVREGDPVDEMIFVMRGNLLTMTTNGGRTGFLNSDVLN  1474
             DEQ LD +CDRLKP  +TE S I+REGDPV+EM F+MRG + +MTTNG  TGF NS  L 
Sbjct  489   DEQSLDVLCDRLKPARFTEMSYIIREGDPVEEMHFLMRGAVSSMTTNGEETGFFNSVHLK  548

Query  1475  AGDFCGEELLTWAL-DPNSSSSLPISTRTVQALTDVEAFALTADFLKFFASQYRRLHSK-  1648
             AGD+CG ELL W +   +SSSSLP+STRTV+A+TD+E FALTAD LKF  SQYRRLHSK 
Sbjct  549   AGDYCGNELLAWVISPHSSSSSLPVSTRTVKAVTDIETFALTADDLKFVVSQYRRLHSKR  608

Query  1649  QLQHKFRFYSHQWKTWAACFIQAAWRRHCRNKLEKSLREEEDRLQDALILRMRREEGETT  1828
             QLQ  F++YS QW+ WAACFIQ AWRRHCRNKLEKSLREEED+LQ AL      +E    
Sbjct  609   QLQRTFKYYSQQWRIWAACFIQVAWRRHCRNKLEKSLREEEDKLQVALA-----KESTNA  663

Query  1829  PSLGATIYASRFAANVLRTVRRNH  1900
             PSLGA IYASRFAAN+L  +RRN+
Sbjct  664   PSLGAAIYASRFAANMLCALRRNN  687



>emb|CDY19679.1| BnaC09g29350D [Brassica napus]
Length=600

 Score =   749 bits (1933),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 378/567 (67%), Positives = 458/567 (81%), Gaps = 11/567 (2%)
 Frame = +2

Query  200   LEITACILRSVFDFFYIFHIILQFRTGFVPPSSRVFGRGDLIVDPSAIAKRYFFSYFFID  379
             ++ TA +LRS+ D FY  H++ QFRTGF+ PSSRVFGRG L+ +   IAKRY  S+F +D
Sbjct  1     MQTTASVLRSITDIFYAIHMVFQFRTGFIAPSSRVFGRGVLVENRREIAKRYLSSHFIVD  60

Query  380   ILAVLPLPQVVLFMMIPRADRPFIMVAKDILKVVILVQSVPRLLRIYPLYKEVTRTSGFF  559
             ILAVLPLPQ+V+ ++IP    P  +  K++LK ++  Q +PR +RIYPLYK+VTRTSG  
Sbjct  61    ILAVLPLPQMVISIIIPSMREPKTLHTKNMLKFIVFFQYIPRFMRIYPLYKQVTRTSGIL  120

Query  560   TETAWAGAAFNLFLYMIASYVAGAIWYITAIERQDKCWRRACEKHGS-CDIDFLYCTKLG  736
             TETAWAGAAFNLFLYM+AS+V GA WY+ +IER+  CW++ACE+    C+ID LYC +  
Sbjct  121   TETAWAGAAFNLFLYMLASHVFGAFWYLFSIERKTVCWKQACERDRRICEIDSLYCREPP  180

Query  737   RRGGDFSSSFLNTSCALLEPENLKADDFDFGIFLDALKSNVVEKRYFWSKLFYCFWWGLR  916
               G +   +FLN SC +LE     A  F+FGIFL AL+S VVE   F  K FYCFWWGL+
Sbjct  181   TFGDN---TFLNASCPVLE---CNATRFEFGIFLGALQSGVVESHDFPLKFFYCFWWGLQ  234

Query  917   NLSSLGQNLKTSNFVGEilfailisiiglilfslligNMQKYLQSITVRVEEMRVKRMDA  1096
             NLSSLGQNLKTS ++ E  FA+ ISI GL+LFS LIGNMQ YLQS T R+EEMRVKR DA
Sbjct  235   NLSSLGQNLKTSTYIWENCFAVFISISGLVLFSFLIGNMQTYLQSTTTRLEEMRVKRRDA  294

Query  1097  EQWMSHRMLPDNLRERIRRYEQYRWQETRGVDEESLISNLPKDLRRDINRHLCWSLLKRV  1276
             EQWMSHR+LPDNLR+RIRRYEQY+WQETRGV+EE+L+ NLPKDLRRDI RHLC +L+ RV
Sbjct  295   EQWMSHRLLPDNLRKRIRRYEQYKWQETRGVNEENLLRNLPKDLRRDIKRHLCLALVMRV  354

Query  1277  HMFKTMDEQLLDAICDRLKPVLYTEKSCIVREGDPVDEMIFVMRGNLLTMTTNGGRTGFL  1456
              MF+ MDEQLLDA+CDRL+PVLYTE+S IVREGDPVDEM+F+MRG LLTMTTNGGRTGF 
Sbjct  355   PMFEQMDEQLLDALCDRLQPVLYTEESYIVREGDPVDEMLFIMRGKLLTMTTNGGRTGFF  414

Query  1457  NSDVLNAGDFCGEELLTWALDPNSSSSLPISTRTVQALTDVEAFALTADFLKFFASQYRR  1636
             NS+ L AGDFCGEELLTWALDP++S++LPISTRTVQAL +VEAFAL AD LKF ASQ+RR
Sbjct  415   NSEHLGAGDFCGEELLTWALDPHTSTNLPISTRTVQALVEVEAFALKADNLKFVASQFRR  474

Query  1637  LHSKQLQHKFRFYSHQWKTWAACFIQAAWRRHCRNKLEKSLREEEDRLQDALILRMRREE  1816
             LHSKQL+H FRFYS QW+TWAACFIQA WRR  + +LE++LR+EE+RLQDAL     +E 
Sbjct  475   LHSKQLRHTFRFYSQQWRTWAACFIQAFWRRCVKKRLEETLRQEENRLQDALA----KEA  530

Query  1817  GETTPSLGATIYASRFAANVLRTVRRN  1897
               ++PS GAT+YASRFAAN+LRT+RR+
Sbjct  531   CGSSPSFGATMYASRFAANILRTIRRS  557



>ref|NP_001057767.1| Os06g0527100 [Oryza sativa Japonica Group]
 dbj|BAD46122.1| putative cyclic nucleotide-gated calmodulin-binding ion channel 
[Oryza sativa Japonica Group]
 dbj|BAD54193.1| putative cyclic nucleotide-gated calmodulin-binding ion channel 
[Oryza sativa Japonica Group]
 dbj|BAF19681.1| Os06g0527100 [Oryza sativa Japonica Group]
Length=694

 Score =   752 bits (1941),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 386/641 (60%), Positives = 486/641 (76%), Gaps = 18/641 (3%)
 Frame = +2

Query  65    PQGPFLQRWNRIFVIACILAATVDPLFFYIPVVDDQNKCLGLDRTLEITACILRSVFDFF  244
             PQGPFLQ WN+IFV++CI A +VDPLFFYIPV++D N C  LD+ LEITA +LR   D F
Sbjct  70    PQGPFLQSWNKIFVLSCIFAVSVDPLFFYIPVINDNNTCWYLDKKLEITASVLRFFTDIF  129

Query  245   YIFHIILQFRTGFVPPSSRVFGRGDLIVDPSAIAKRYFFSYFFIDILAVLPLPQVVLFMM  424
             YI HII QFRTG++  S   FGRG L+ D  AIAKRY  +YF ID+ AVLPLPQVV+ ++
Sbjct  130   YILHIIFQFRTGYIASSLTTFGRGVLVEDRYAIAKRYLSTYFLIDVFAVLPLPQVVILVV  189

Query  425   IPRADRPFIMVAKDILKVVILVQSVPRLLRIYPLYKEVTRTSGFFTETAWAGAAFNLFLY  604
             +P      +  AK+IL  +++ Q VPRL+RI PLY ++TR++G  TET WAGA  NL +Y
Sbjct  190   LPNLGGSEVTKAKNILMFIVICQYVPRLIRIRPLYLQITRSAGVITETPWAGAVLNLLIY  249

Query  605   MIASYVAGAIWYITAIERQDKCWRRACEKHGS-CDIDFLYCTKLGRRGGDFSSSFLNTSC  781
             ++AS+V GA+WY+ +IER+D CWR  C  + + C+  +LYC       GD  +S L T+C
Sbjct  250   LLASHVLGALWYLLSIERKDACWRDMCSNNSTVCNQAYLYC-------GDKENSILRTAC  302

Query  782   ALLEPENLKADDFDFGIFLDALKSNVVEKRYFWSKLFYCFWWGLRNLSSLGQNLKTSNFV  961
               ++  ++   D +FGI++ AL +NV +   F +KLFYC WWGL+NLSSLGQNLKTS + 
Sbjct  303   LPIDSNDI---DPNFGIYVPAL-NNVSQSTNFLAKLFYCVWWGLQNLSSLGQNLKTSTYA  358

Query  962   GEilfailisiiglilfslligNMQKYLQSITVRVEEMRVKRMDAEQWMSHRMLPDNLRE  1141
              E LFA+ +SI GL+LF+LLIGN+Q YLQS  +R EEMRVK  D +QWMS+R+LP+NL+E
Sbjct  359   WENLFAVFVSISGLVLFALLIGNVQTYLQSAHLREEEMRVKSRDTDQWMSYRLLPENLKE  418

Query  1142  RIRRYEQYRWQETRGVDEESLISNLPKDLRRDINRHLCWSLLKRVHMFKTMDEQLLDAIC  1321
             RIRR+E+YRW +T GVDEE L+ NLPKDLRR I RHLC SLL RV MF+ MD+QLL+A+C
Sbjct  419   RIRRHEKYRWHQTSGVDEELLLMNLPKDLRRAIKRHLCLSLLMRVPMFENMDDQLLNALC  478

Query  1322  DRLKPVLYTEKSCIVREGDPVDEMIFVMRGNLLTMTTNGGRTGFLNSDVLNAGDFCGEEL  1501
             DRLKPVLYTE SCI+RE DPV+EM+F+MRGNL++MTTNGGRTGF NSDVL  GDFCGEEL
Sbjct  479   DRLKPVLYTEGSCIIREEDPVNEMLFIMRGNLMSMTTNGGRTGFFNSDVLKGGDFCGEEL  538

Query  1502  LTWALDPNSSSSLPISTRTVQALTDVEAFALTADFLKFFASQYRRLHSKQLQHKFRFYSH  1681
             LTWALDP S SSLP STRTV+ +++VEAFAL A+ LKF A+Q+RRLHSKQLQH F+FYS 
Sbjct  539   LTWALDPTSVSSLPSSTRTVKTMSEVEAFALRAEDLKFVATQFRRLHSKQLQHTFKFYSQ  598

Query  1682  QWKTWAACFIQAAWRRHCRNKLEKSLREEEDRLQDALILRMRREEGETTPSLGATIYASR  1861
              W+TWAACFIQAAW R+CR K+E SLRE+E RLQ A++      +G TT S  A IYASR
Sbjct  599   HWRTWAACFIQAAWHRYCRKKIEDSLREKEKRLQFAIV-----NDGATTLSFRAAIYASR  653

Query  1862  FAANVLRTVRRNHplsvpklsprlpplllqkpAEPDFSAPE  1984
             FA N++R +RRN      +L   +P  LLQKPAEP+F+A E
Sbjct  654   FAGNMMRILRRN-ATRKARLKESVPARLLQKPAEPNFAAEE  693



>gb|KCW71513.1| hypothetical protein EUGRSUZ_E00063 [Eucalyptus grandis]
Length=651

 Score =   749 bits (1935),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 371/547 (68%), Positives = 454/547 (83%), Gaps = 6/547 (1%)
 Frame = +2

Query  47    KSKMHDPQGPFLQRWNRIFVIACILAATVDPLFFYIPVVDDQNKCLGLDRTLEITACILR  226
             + K+ DPQGPFL++WN+IF+I+C++A  +DPLFFYIPV++    CL  D  ++ITAC+ R
Sbjct  84    EKKILDPQGPFLRKWNKIFLISCVIALALDPLFFYIPVINVDYWCLDSDNIMKITACVFR  143

Query  227   SVFDFFYIFHIILQFRTGFVPPSSRVFGRGDLIVDPSAIAKRYFFSYFFIDILAVLPLPQ  406
             +V D FYIFHIILQFRTGF+ PSSRVFGRG+LI DPSA+++RY  SYFF+DILA+LP+PQ
Sbjct  144   TVIDAFYIFHIILQFRTGFIAPSSRVFGRGELIDDPSAVSQRYLSSYFFLDILAILPIPQ  203

Query  407   VVLFMMIPRADRPFIMVAKDILKVVILVQSVPRLLRIYPLYKEVTRTSGFFTETAWAGAA  586
             +V++++IP    P  +++K+ LK VI  Q VPR+ RIYPLY+E TRTSG   ETAWAGAA
Sbjct  204   LVVYIIIPTLPGPVALMSKESLKFVIYGQYVPRIARIYPLYQETTRTSGILYETAWAGAA  263

Query  587   FNLFLYMIASYVAGAIWYITAIERQDKCWRRACEKHGSCDIDFLYCTKLGRRGGDFSSSF  766
             FNL LYM+AS+V GA WY+ +I+R+ +CW + C K   CD  FLYC+   ++    ++++
Sbjct  264   FNLLLYMLASHVFGATWYLFSIDRKVRCWHQECGKP-VCDSKFLYCSPAHKQ----NNTY  318

Query  767   LNTSCALLEPENLK-ADDFDFGIFLDALKSNVVEKRYFWSKLFYCFWWGLRNLSSLGQNL  943
             LNT+C LLE + +K +  F+FGI +DAL+S VVE + F  KLFYCFWWGLRNLSSLGQNL
Sbjct  319   LNTACPLLEADEIKNSTQFNFGIAIDALQSGVVETKDFPKKLFYCFWWGLRNLSSLGQNL  378

Query  944   KTSNFVGEilfailisiiglilfslligNMQKYLQSITVRVEEMRVKRMDAEQWMSHRML  1123
             KTS +VGEI FA+ I+I GL+LF+LLIGNMQKYLQS TVRVEEMRVKR DAE+WMSHRML
Sbjct  379   KTSTYVGEIFFAVSIAIAGLVLFALLIGNMQKYLQSTTVRVEEMRVKRRDAERWMSHRML  438

Query  1124  PDNLRERIRRYEQYRWQETRGVDEESLISNLPKDLRRDINRHLCWSLLKRVHMFKTMDEQ  1303
             P+ L++RIRRYEQY+WQETRGV+EESLI NLPKDLRRDI RHLC  LL RV MF+ MDEQ
Sbjct  439   PEGLKDRIRRYEQYKWQETRGVEEESLIRNLPKDLRRDIKRHLCLDLLMRVPMFEKMDEQ  498

Query  1304  LLDAICDRLKPVLYTEKSCIVREGDPVDEMIFVMRGNLLTMTTNGGRTGFLNSDVLNAGD  1483
             LLDA+CDRLKPVLYTEKS IVREGDPVDEM+F++RG L+TMTTNGGRTGF NS  L AGD
Sbjct  499   LLDAMCDRLKPVLYTEKSSIVREGDPVDEMLFIIRGKLVTMTTNGGRTGFFNSVYLKAGD  558

Query  1484  FCGEELLTWALDPNSSSSLPISTRTVQALTDVEAFALTADFLKFFASQYRRLHSKQLQHK  1663
             FCGEELLTWALDPNSSS+LP STRTV+A+T+VEAFALTA+ LKF ASQ+RRLHSKQLQH+
Sbjct  559   FCGEELLTWALDPNSSSNLPTSTRTVEAITEVEAFALTANDLKFVASQFRRLHSKQLQHR  618

Query  1664  FRFYSHQ  1684
             FR+   Q
Sbjct  619   FRYICIQ  625



>emb|CBI40508.3| unnamed protein product [Vitis vinifera]
Length=1373

 Score =   774 bits (1999),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 395/621 (64%), Positives = 478/621 (77%), Gaps = 10/621 (2%)
 Frame = +2

Query  47    KSKMHDPQGPFLQRWNRIFVIACILAATVDPLFFYIPVVDDQNKCLGLDRTLEITACILR  226
             + K+ DPQG FLQ WN++F+I+ +LA  +DP FFYIP++  +  CL LD  L + AC+LR
Sbjct  78    RKKILDPQGSFLQEWNKVFLISTVLAVALDPFFFYIPILHREETCLDLDTKLGVIACVLR  137

Query  227   SVFDFFYIFHIILQFRTGFVPPSSRVFGRGDLIVDPSAIAKRYFFSYFFIDILAVLPLPQ  406
             S+ D FYI HII QF TGF+ PSSRVFGRG+L+  PSAIAKRY  +YF IDIL++LPLPQ
Sbjct  138   SIVDIFYILHIIFQFHTGFIAPSSRVFGRGELVEAPSAIAKRYLSTYFIIDILSILPLPQ  197

Query  407   VVLFMMIPRADRPFIMVAKDILKVVILVQSVPRLLRIYPLYKEVTRTSGFFTETAWAGAA  586
             +V+ ++      P  +  KD+LK VI  Q VPRLLRIYPLYKEVT TSG  T+TAWAGA 
Sbjct  198   LVILIVKAEVKGPVSLNTKDLLKSVIFSQYVPRLLRIYPLYKEVTTTSGIITQTAWAGAV  257

Query  587   FNLFLYMIASYVAGAIWYITAIERQDKCWRRACEKHGSCDIDFLYCTKLGRRGGDFSSSF  766
             FNL LYM+AS+V GA WY+ AIERQ+ CW +     G   +  LYC    RR        
Sbjct  258   FNLCLYMLASHVVGAFWYLFAIERQNTCWVKGSRSCGFNPVG-LYCGAESRRNNITPQVH  316

Query  767   --LNTSCALLEPENL-KADDFDFGIFLDALKSNVVEKRYFWSKLFYCFWWGLRNLSSLGQ  937
               LN +C L++P+++     F+FGIF DAL+S+VVE++ F +K FYCFWWGLRNLSSLGQ
Sbjct  317   DCLNAACPLIDPDDIVNTTTFNFGIFFDALQSHVVERKDFQNKFFYCFWWGLRNLSSLGQ  376

Query  938   NLKTSNFVGEilfailisiiglilfslligNMQKYLQSITVRVEEMRVKRMDAEQWMSHR  1117
             NLKTS F+ EI FA+ ISI GL+LFSLLIGNMQKYLQS TVR+EEMRVKR DAEQWM+HR
Sbjct  377   NLKTSTFIEEIFFAVFISIFGLVLFSLLIGNMQKYLQSTTVRIEEMRVKRQDAEQWMAHR  436

Query  1118  MLPDNLRERIRRYEQYRWQETRGVDEESLISNLPKDLRRDINRHLCWSLLKRVHMFKTMD  1297
             +LPD LR RIRRYEQY+WQETRGV E  LIS+LPKDLRRD+ RHLCW+LL RV MF+ MD
Sbjct  437   LLPDPLRVRIRRYEQYKWQETRGVQEHKLISDLPKDLRRDVRRHLCWNLLMRVPMFEKMD  496

Query  1298  EQLLDAICDRLKPVLYTEKSCIVREGDPVDEMIFVMRGNLLTMTTNGGRTGFLNSDVLNA  1477
              QLLDA+CD LKPVLYTE S I+REGDPVDE+ F+MRG L T+TTNGGRTGF N   L A
Sbjct  497   SQLLDALCDHLKPVLYTENSTILREGDPVDEIFFIMRGKLSTITTNGGRTGFFNETYLKA  556

Query  1478  GDFCGEELLTWALDPNSSSSLPISTRTVQALTDVEAFALTADFLKFFASQ-YRRLHSKQL  1654
             GDFCG+ELLTWAL+  SSS+LPISTRTV+A+T+VEAF L ++ L   ASQ + RLHSKQL
Sbjct  557   GDFCGDELLTWALESKSSSNLPISTRTVKAITEVEAFGLMSNDLITVASQFFYRLHSKQL  616

Query  1655  QHKFRFYSHQWKTWAACFIQAAWRRHCRNKLEKSLREEEDRLQDALILRMRREEGETTPS  1834
             Q+ FRFYS QW+TW ACFIQAAW+R+ R K +K+L+E E+RLQDAL     RE G  +PS
Sbjct  617   QYTFRFYSQQWRTWGACFIQAAWQRYRRRKQDKALQEAEERLQDAL----SREVG-ASPS  671

Query  1835  LGATIYASRFAANVLRTVRRN  1897
             LGAT++ASRFAA +LR +RRN
Sbjct  672   LGATVFASRFAAKLLRALRRN  692


 Score =   686 bits (1771),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 371/628 (59%), Positives = 457/628 (73%), Gaps = 18/628 (3%)
 Frame = +2

Query  41    WWKSKMHDPQGPFLQRWNRIFVIACILAATVDPLFFYIPVVDDQNKCLGLDRTLEITACI  220
             W +  + DP+G FLQ WN+IF+++C+LA ++D  FFY PV++  + CL LD  L+I AC+
Sbjct  729   WSRKTILDPEGSFLQTWNKIFLVSCVLAISLDAFFFYAPVINRHSTCLDLDDRLQIVACV  788

Query  221   LRSVFDFFYIFHIILQFRTGFVPPSSRVFGRGDLIVDPSAIAKRYFFSYFFIDILAVLPL  400
             LR++ D FYI HII QFRTGFV PSSRVFG G LI D S IAKRY   YF IDIL++LPL
Sbjct  789   LRTLIDVFYILHIIFQFRTGFVAPSSRVFGDGVLIDDSSVIAKRYL-PYFVIDILSILPL  847

Query  401   PQVVLFMMIPRADRPFIMVAKDILKVVILVQSVPRLLRIYPLYKEVTRTSGFFTETAWAG  580
             PQV +F++ P+   P   + KD LK VIL Q VPRL+RIYPLYKEVT TSG   ETAWAG
Sbjct  848   PQVAVFIVNPQLKSPVSFIRKDFLKFVILSQLVPRLVRIYPLYKEVTTTSGILIETAWAG  907

Query  581   AAFNLFLYMIASYVAGAIWYITAIERQDKCWRRACEKHG-SCDIDFLYCTKLGRRGGDFS  757
             AA NLF YM+AS+V GA WY+ +IERQD+CWR  C  H  SC   +LYC    R   D +
Sbjct  908   AAINLFFYMLASHVVGAFWYLLSIERQDQCWRNWCGAHNVSCS--YLYCGG-DRIHNDLA  964

Query  758   SSF--LNTSCALLEPENLKADD-FDFGIFLDALKSNVVEKRYFWSKLFYCFWWGLRNLSS  928
               +  LN SC L EP+ ++    F+FGIF+ AL+S VVE R F  K  YCFWWGLRN+SS
Sbjct  965   ERYALLNASCPLSEPDGIENSTVFNFGIFIKALQSRVVETRDFPYKFSYCFWWGLRNISS  1024

Query  929   LGQNLKTSNFVGEilfailisiiglilfslligNMQKYLQ---SITVRVEEMRVKRMDAE  1099
             LG NL TS F+GE+LFA+ ISI GLILFSLL+GNMQKYLQ   SI  R+EE R KR + E
Sbjct  1025  LGSNLDTSPFIGEVLFAVFISIFGLILFSLLVGNMQKYLQNLQSIAARIEEEREKRKNTE  1084

Query  1100  QWMSHRMLPDNLRERIRRYEQYRWQETRGVDEESLISNLPKDLRRDINRHLCWSLLKRVH  1279
              WMSHR+LP++LR RIR+Y QY+W++T+GVDE  LI++LPKDLRRDI RHL  +LL R+ 
Sbjct  1085  LWMSHRILPEHLRIRIRQYRQYKWKKTKGVDENGLINDLPKDLRRDIKRHLRLALLMRMP  1144

Query  1280  MFKTMDEQLLDAICDRLKPVLYTEKSCIVREGDPVDEMIFVMRGNLLTMTTNGGRTGFLN  1459
             +F+  DE LLDAICDRLKPVLYTE S IVREGDP+DEM+F++RG L +++T+GGRTGFLN
Sbjct  1145  VFERFDELLLDAICDRLKPVLYTEGSYIVREGDPIDEMLFIVRGKLRSISTDGGRTGFLN  1204

Query  1460  SDVLNAGDFCGEELLTWALDPNSSSSLPISTRTVQALTDVEAFALTADFLKFFASQY--R  1633
                L AGDF GEELL WAL+  SS   PISTRT+ A+T+VEA ALTA  LK   S +   
Sbjct  1205  LIYLEAGDFYGEELLPWALESQSSPFHPISTRTISAVTEVEASALTAHDLKSLISYHFSH  1264

Query  1634  RLHSKQLQHKFRFYSHQWKTWAACFIQAAWRRHCRNKLEKSLREEEDRLQDALILRMRRE  1813
              L  KQL    R +S +W+TWAACFIQ AW R+ + K  K+L+E EDRL+DAL      +
Sbjct  1265  PLPRKQLVQSLRLWSQKWRTWAACFIQVAWWRYQKRKQNKALQEAEDRLRDAL-----SK  1319

Query  1814  EGETTPSLGATIYASRFAANVLRTVRRN  1897
                T+ +LGAT YASRFAAN+LR +RRN
Sbjct  1320  AVGTSTTLGATNYASRFAANMLRILRRN  1347



>ref|XP_010506645.1| PREDICTED: probable cyclic nucleotide-gated ion channel 3 [Camelina 
sativa]
 ref|XP_010506646.1| PREDICTED: probable cyclic nucleotide-gated ion channel 3 [Camelina 
sativa]
 ref|XP_010506648.1| PREDICTED: probable cyclic nucleotide-gated ion channel 3 [Camelina 
sativa]
Length=711

 Score =   751 bits (1938),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 379/616 (62%), Positives = 477/616 (77%), Gaps = 9/616 (1%)
 Frame = +2

Query  53    KMHDPQGPFLQRWNRIFVIACILAATVDPLFFYIPVVDDQNKCLGLDRTLEITACILRSV  232
             ++ +P   +LQ WN+IF++  ++A   DPLFFYIPVV+  + CL LD+ L+  AC+ R+ 
Sbjct  75    RVMNPNDSYLQNWNKIFLLLSVIALAFDPLFFYIPVVNPDSFCLYLDKKLQTIACVFRTF  134

Query  233   FDFFYIFHIILQFRTGFVPPSSRVFGRGDLIVDPSAIAKRYFFSYFFIDILAVLPLPQVV  412
              D FY+ H++ QF TGF+ P+SR FGRG+L  +   IA RY  SYF ID+L++LP+PQVV
Sbjct  135   IDAFYVVHMLFQFHTGFITPASRGFGRGELNENSKDIALRYLRSYFLIDLLSILPIPQVV  194

Query  413   LFMMIPRADRPFIMVAKDILKVVILVQSVPRLLRIYPLYKEVTRTSGFFTETAWAGAAFN  592
             +  ++P+  RP  +VAK++LK VI  Q VPR+ RIYPL+KEVTRTSG  TETAWAGAA N
Sbjct  195   VLAIVPKVARPSALVAKELLKWVIFCQYVPRIARIYPLFKEVTRTSGLVTETAWAGAALN  254

Query  593   LFLYMIASYVAGAIWYITAIERQDKCWRRACEKHGSCDIDFLYCTKLGRRGGDFSSSFLN  772
             LFLYM+AS+V G+ WY+ +IER+D+CWR AC K   C    LYC+      G+ +  FLN
Sbjct  255   LFLYMLASHVFGSFWYLISIERKDRCWREACAKIRECSHANLYCSTT---PGEDNRLFLN  311

Query  773   TSCALLEPENLK-ADDFDFGIFLDALKSNVVEKRYFWSKLFYCFWWGLRNLSSLGQNLKT  949
              SC L++PE +K    F+FGIF DAL+S VVE + F  K+FYCFWWGLRNLS+LGQNLKT
Sbjct  312   GSCPLIDPEEIKDLTVFNFGIFADALQSGVVESKDFPKKIFYCFWWGLRNLSALGQNLKT  371

Query  950   SNFVGEilfailisiiglilfslligNMQKYLQSITVRVEEMRVKRMDAEQWMSHRMLPD  1129
             S F GEI+FAI+I I GL+LF+LLIGNMQKYLQS TVRVEEMRVKR DAEQWMSHRMLPD
Sbjct  372   SAFEGEIIFAIIICISGLVLFALLIGNMQKYLQSTTVRVEEMRVKRRDAEQWMSHRMLPD  431

Query  1130  NLRERIRRYEQYRWQETRGVDEESLISNLPKDLRRDINRHLCWSLLKRVHMFKTMDEQLL  1309
             +L++RIR+YEQY+WQET+GV+EE+L+S+LPKDLR+DI RHLC  LLK+V  F++MD++LL
Sbjct  432   DLKKRIRKYEQYKWQETKGVEEEALLSSLPKDLRKDIKRHLCLKLLKKVPWFQSMDDRLL  491

Query  1310  DAICDRLKPVLYTEKSCIVREGDPVDEMIFVMRGNLLTMTTNGGRTGFLNSDVLNAGDFC  1489
             DA+C RLK VLYTE S IVREG+PV++M+F+MRG L++ TT GG+TGF NS  L AGDFC
Sbjct  492   DALCARLKTVLYTENSYIVREGEPVEDMLFIMRGVLISTTTYGGKTGFFNSVRLVAGDFC  551

Query  1490  GEELLTWALDPNSSSSLPISTRTVQALTDVEAFALTADFLKFFASQYRRLHSKQLQHKFR  1669
             G +LLTWALDP  SS  PIS RTVQA T+VE F L+AD LKF A+QYRRLHSKQ++H FR
Sbjct  552   G-DLLTWALDP-LSSHFPISNRTVQAQTEVEGFVLSADDLKFVATQYRRLHSKQIRHMFR  609

Query  1670  FYSHQWKTWAACFIQAAWRRHCRNKLEKSLREEEDRLQDALILRMRREEGETTPSLGATI  1849
             FYS QW+TWAACFIQAAW+R+CR KL K+LREEE +L   L        G+   +LGA I
Sbjct  610   FYSVQWRTWAACFIQAAWKRYCRRKLSKALREEEGKLHSTL---QNDNSGDNKLNLGAAI  666

Query  1850  YASRFAANVLRTVRRN  1897
             YASRFA++ LR +R N
Sbjct  667   YASRFASHALRNIRAN  682



>ref|XP_004510618.1| PREDICTED: probable cyclic nucleotide-gated ion channel 10-like 
isoform X1 [Cicer arietinum]
Length=699

 Score =   750 bits (1937),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 396/647 (61%), Positives = 482/647 (74%), Gaps = 15/647 (2%)
 Frame = +2

Query  62    DPQGPFLQRWNRIFVIACILAATVDPLFFYIPVVDDQNKCLGLDRTLEITACILRSVFDF  241
             DPQGP LQ+WN+IFVI C++A ++DPLFFYIPV+D++ KCL LD TL++TA +LR+ FD 
Sbjct  61    DPQGPLLQKWNKIFVITCVMAISMDPLFFYIPVIDEKRKCLKLDGTLKVTAGVLRTFFDL  120

Query  242   FYIFHIILQFRTGFVPPSSRVFGRGDLIVDPSAIAKRYFFSYFFIDILAVLPLPQVVLFM  421
             FYI  I+ QFRTGF+ PSSRVFGRG+ + DP AIA RY  S+F IDIL++LPLPQ+V+  
Sbjct  121   FYILRIVFQFRTGFIAPSSRVFGRGEPVDDPFAIAMRYLSSHFIIDILSILPLPQMVMLA  180

Query  422   MIPRADRPFIMVAKDILKVVILVQSVPRLLRIYPLYKEVTRTSGFFTETAWAGAAFNLFL  601
             MIP   R    +AKD LK +I+ Q  PRLLRIYPL+KEVT TSG  TETAWAGAA+NLFL
Sbjct  181   MIPIPQRSVPCIAKDWLKYMIIAQYAPRLLRIYPLFKEVTNTSGILTETAWAGAAYNLFL  240

Query  602   YMIASYVAGAIWYITAIERQDKCWRRACEKHGSCDIDFLYCTKLGRRGGDFSSSFLN--T  775
             YM+AS+V GA WY+ +IE Q +CW R  +     D  +L C   GRR      S LN  T
Sbjct  241   YMLASHVVGAFWYLFSIESQLRCWHRQLKHTAFSDDSYLSC---GRRVNSSVLSLLNNAT  297

Query  776   SCALLEP-ENLKADDFDFGIFLDALKSNVVEKRY-FWSKLFYCFWWGLRNLSSLGQNLKT  949
             +C   +P E +    F+FGIF+D LKS VVE R     K FYCFWWGLRNLSS+GQNLKT
Sbjct  298   TCPYTDPDEIIDPMVFNFGIFIDGLKSRVVESRTNLHHKFFYCFWWGLRNLSSVGQNLKT  357

Query  950   SNFVGEilfailisiiglilfslligNMQKYLQSITVRVEEMRVKRMDAEQWMSHRMLPD  1129
             S ++GEI+FAI I++ GL+LF+LLIGNMQKYLQS TVRVEEMR+KR DAEQWM HRMLP+
Sbjct  358   STYIGEIIFAIFIAVFGLVLFALLIGNMQKYLQSTTVRVEEMRIKRRDAEQWMCHRMLPE  417

Query  1130  NLRERIRRYEQYRWQETRGVDEESLISNLPKDLRRDINRHLCWSLLKRVHMFKTMDEQLL  1309
              L++RIRRYEQY+WQE RGV+EE+LI NLPKDLRRDI RHLC  LLK+V +F  MD+QLL
Sbjct  418   YLKQRIRRYEQYKWQENRGVEEETLIRNLPKDLRRDIKRHLCLDLLKKVPIFGNMDKQLL  477

Query  1310  DAICDRLKPVLYTEKSCIVREGDPVDEMIFVMRGNLLTMTTNGGRTGFLNSDVLNAGDFC  1489
             DA+CD+LKPVLYTEKS +V EGDPVDEM+F+MRG L T++TNGGRTGF NS  L AGDFC
Sbjct  478   DAMCDKLKPVLYTEKSYVVCEGDPVDEMLFIMRGKLATVSTNGGRTGFFNSSELKAGDFC  537

Query  1490  GEELLTWALDPNSSSSLPISTRTVQALTDVEAFALTADFLKFFASQYRRL-HSKQLQHKF  1666
             GEELLTWAL P  SS+LPIST TVQ +++VEAFAL  D LK  ASQ+RRL ++KQL+H F
Sbjct  538   GEELLTWALYPTPSSNLPISTSTVQTISEVEAFALLPDDLKIVASQFRRLINTKQLKHTF  597

Query  1667  RFYSHQWKTWAACFIQAAWRRHCRNKLEKSLREEEDRLQDALILRMRREEGETTPSLGAT  1846
             RF S +W+TW A FIQ  WRR+   + +KSLRE E++ Q         EEG ++PS   T
Sbjct  598   RFSSWKWRTWGARFIQVVWRRNREKRAQKSLREAEEKQQHG---SQNDEEG-SSPSFATT  653

Query  1847  IYASRFAANVLRTVRRNHplsvpklsprlpplllqkpAEPDFSAPEN  1987
             +Y  RFA+N LR +R            R+ PLL  KPAEPDF   +N
Sbjct  654   VYVQRFASNALRHLRSGK---KMPQPKRMLPLLPMKPAEPDFLTKKN  697



>ref|XP_007135246.1| hypothetical protein PHAVU_010G113100g [Phaseolus vulgaris]
 ref|XP_007135247.1| hypothetical protein PHAVU_010G113100g [Phaseolus vulgaris]
 gb|ESW07240.1| hypothetical protein PHAVU_010G113100g [Phaseolus vulgaris]
 gb|ESW07241.1| hypothetical protein PHAVU_010G113100g [Phaseolus vulgaris]
Length=693

 Score =   748 bits (1930),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 399/649 (61%), Positives = 497/649 (77%), Gaps = 24/649 (4%)
 Frame = +2

Query  65    PQGPFLQRWNRIFVIACILAATVDPLFFYIPVVDDQNKCLGLDRTLEITACILRSVFDFF  244
             PQGP LQ+WN+IFVI  ++A +VDPLFFYIPV+DD  KCL LD TL+ITA +LR+ FD F
Sbjct  61    PQGPTLQKWNKIFVITSVMAISVDPLFFYIPVIDDDKKCLDLDGTLKITASVLRTFFDLF  120

Query  245   YIFHIILQFRTGFVPPSSRVFGRGDLIVDPSAIAKRYFFSYFFIDILAVLPLPQVVLFMM  424
             YI HII QFRTGF+ PSSRVFGRG+L+ D SAI ++Y  SYF IDIL+++PLPQ+V+  M
Sbjct  121   YILHIIFQFRTGFIAPSSRVFGRGELVADTSAIVRKYLSSYFSIDILSIIPLPQMVILAM  180

Query  425   I--PRADRPFIMVAKDILKVVILVQSVPRLLRIYPLYKEVTRTSGFFTETAWAGAAFNLF  598
             I  P    P+  V KD+LK  ++ Q VPRLLRIYPL+KEVT TSG  TETAWAGAA+NLF
Sbjct  181   ILFPTCSAPY--VGKDLLKYAVIAQYVPRLLRIYPLFKEVTSTSGILTETAWAGAAYNLF  238

Query  599   LYMIASYVAGAIWYITAIERQDKCWRRACEKHGSCDIDFLYCTKLGRRGGDFSS---SFL  769
             LYM+AS+V GA WY+ ++E + +CWR+  +        +L C       G ++S   S L
Sbjct  239   LYMLASHVVGAFWYLFSVESRVRCWRKQLKNTTFFHESYLSC-------GSYNSTVQSLL  291

Query  770   NTSCALLEPENL-KADDFDFGIFLDALKSNVVEKRY-FWSKLFYCFWWGLRNLSSLGQNL  943
             N SC + + +N+   + F+FG+F++A+KS V+E    F  K FYCFWWGLR+LSS+GQ L
Sbjct  292   NHSCPINDLQNIGDLEPFNFGMFIEAIKSRVLESTTDFHHKFFYCFWWGLRSLSSVGQGL  351

Query  944   KTSNFVGEilfailisiiglilfslligNMQKYLQSITVRVEEMRVKRMDAEQWMSHRML  1123
             +TS +VGEI+FAI I++ GL+LF+ LIGNMQKYLQS TVRVEEMR+KR DAE WMSHRML
Sbjct  352   ETSTYVGEIIFAISIAVSGLVLFASLIGNMQKYLQSTTVRVEEMRIKRRDAELWMSHRML  411

Query  1124  PDNLRERIRRYEQYRWQETRGVDEESLISNLPKDLRRDINRHLCWSLLKRVHMFKTMDEQ  1303
             PD L+ERIRRYEQY+WQE RGV+EE+LI NLPKDLRRDI RHLC  LLK+V +F++MD Q
Sbjct  412   PDFLKERIRRYEQYKWQENRGVEEETLIRNLPKDLRRDIKRHLCLDLLKKVPLFESMDNQ  471

Query  1304  LLDAICDRLKPVLYTEKSCIVREGDPVDEMIFVMRGNLLTMTTNGGRTGFLNSDVLNAGD  1483
             LLDA+CD+LKPVLYTEKS IVREGDPVDEM+F+MRG L T TTNGGRTGF NS  + AGD
Sbjct  472   LLDALCDKLKPVLYTEKSHIVREGDPVDEMLFIMRGTLATATTNGGRTGFFNSSEIKAGD  531

Query  1484  FCGEELLTWALDPNSSSSLPISTRTVQALTDVEAFALTADFLKFFASQYRRL-HSKQLQH  1660
             FCGEELLTWALDPN SS+LPISTRTV+ +++VEAFAL  + LK  ASQ+RRL ++KQLQH
Sbjct  532   FCGEELLTWALDPNYSSNLPISTRTVETISEVEAFALMPEDLKCVASQFRRLINNKQLQH  591

Query  1661  KFRFYSHQWKTWAACFIQAAWRRHCRNKLEKSLREEEDRLQDALILRMRREEGETTPSLG  1840
              FRFYS QWKTW ACFIQAAWRR+ + K E+ LRE E+R+Q+     +  EEG + PS  
Sbjct  592   TFRFYSLQWKTWGACFIQAAWRRYRKKKAERLLREAEERIQN-----LENEEG-SAPSFA  645

Query  1841  ATIYASRFAANVLRTVRRNHplsvpklsprlpplllqkpAEPDFSAPEN  1987
             A ++ASRFA+  LR +R     +      +L PL+  KP+EPDF+A +N
Sbjct  646   AILHASRFASTALRHLRSGK-RTRVPQPQKLLPLMPPKPSEPDFTALKN  693



>emb|CDX80018.1| BnaA05g01380D [Brassica napus]
Length=702

 Score =   746 bits (1926),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 375/616 (61%), Positives = 474/616 (77%), Gaps = 12/616 (2%)
 Frame = +2

Query  53    KMHDPQGPFLQRWNRIFVIACILAATVDPLFFYIPVVDDQNKCLGLDRTLEITACILRSV  232
             ++ +P   +LQ WN+IF++ C++A   DPLFF+IPVVD    CL LD+ LE  AC+ R+ 
Sbjct  69    RVMNPNDSYLQNWNKIFLLLCVVALAFDPLFFFIPVVDPDRFCLKLDKKLEAVACVFRTF  128

Query  233   FDFFYIFHIILQFRTGFVPPSSRVFGRGDLIVDPSAIAKRYFFSYFFIDILAVLPLPQVV  412
              D FY+ H++ QF TGF+ PSSR FGRG+L+     IA RY  SYF ID+L++LP+PQVV
Sbjct  129   IDAFYLVHMLFQFNTGFIAPSSRGFGRGELVQSSKKIAVRYLKSYFIIDVLSILPIPQVV  188

Query  413   LFMMIPRADRPFIMVAKDILKVVILVQSVPRLLRIYPLYKEVTRTSGFFTETAWAGAAFN  592
             +  ++P   RP  +V K++LK  I  Q VPR+ RIYPL+KEVTRTSG  TETAWAGAA N
Sbjct  189   VLAVVPSMSRPASLVTKELLKWAIFCQYVPRIARIYPLFKEVTRTSGLVTETAWAGAALN  248

Query  593   LFLYMIASYVAGAIWYITAIERQDKCWRRACEKHGSCDIDFLYCTKLGRRGGDFSSSFLN  772
             LFLYM+AS+V G+ WY+ +IER+D+CWR  C K   C    LYC+     GG+ +S +L 
Sbjct  249   LFLYMLASHVFGSFWYLISIERKDRCWRETCAKIEGCVHGNLYCS-----GGEDNSQYLI  303

Query  773   TSCALLEPENLKADD-FDFGIFLDALKSNVVEKRYFWSKLFYCFWWGLRNLSSLGQNLKT  949
              SC L++PE +K    F+FGIF +AL+S VVE   F  K FYCFWWGLRNLS++GQNLKT
Sbjct  304   GSCPLMDPEEIKNSTVFNFGIFAEALQSGVVESMNFPKKFFYCFWWGLRNLSAVGQNLKT  363

Query  950   SNFVGEilfailisiiglilfslligNMQKYLQSITVRVEEMRVKRMDAEQWMSHRMLPD  1129
             S+F GEI+FAI+I I GL+LF+LLIGNMQKYLQS TVR+EEMRVKR DAEQWMSHRMLPD
Sbjct  364   SDFEGEIIFAIIICISGLVLFALLIGNMQKYLQSTTVRIEEMRVKRRDAEQWMSHRMLPD  423

Query  1130  NLRERIRRYEQYRWQETRGVDEESLISNLPKDLRRDINRHLCWSLLKRVHMFKTMDEQLL  1309
             +LR+R+R YEQY+WQETRGV+EE+L+S+LPKDLR++I RHLC +LLK+V  FK MD++LL
Sbjct  424   DLRKRVREYEQYKWQETRGVEEEALLSSLPKDLRKEIKRHLCLNLLKKVPWFKAMDDRLL  483

Query  1310  DAICDRLKPVLYTEKSCIVREGDPVDEMIFVMRGNLLTMTTNGGRTGFLNSDVLNAGDFC  1489
             DA+C RL  VLYTE S IVREG+PV++M+F+MRG L++ TT GG+TGF N   L AGDFC
Sbjct  484   DALCARLNTVLYTENSYIVREGEPVEDMVFIMRGKLISTTTYGGQTGFFNIAHLEAGDFC  543

Query  1490  GEELLTWALDPNSSSSLPISTRTVQALTDVEAFALTADFLKFFASQYRRLHSKQLQHKFR  1669
             G +LLTWALDPN +S LPISTRTVQA T+VE F L+A+ LKFF++QYRRLHSKQL+H   
Sbjct  544   G-DLLTWALDPN-TSHLPISTRTVQAETEVEGFVLSAEDLKFFSTQYRRLHSKQLRHT--  599

Query  1670  FYSHQWKTWAACFIQAAWRRHCRNKLEKSLREEEDRLQDALILRMRREEGETTPSLGATI  1849
              YS QW+TWAACFIQAAW+R+CR KL ++LREEE+RLQ+   L+   + G    +L A I
Sbjct  600   CYSVQWQTWAACFIQAAWKRYCRRKLSRALREEEERLQNT--LQTTDDSGGNKLNLSAAI  657

Query  1850  YASRFAANVLRTVRRN  1897
             YASRFA++ LR VR N
Sbjct  658   YASRFASHALRNVRAN  673



>ref|XP_010518315.1| PREDICTED: probable cyclic nucleotide-gated ion channel 3 [Camelina 
sativa]
 ref|XP_010518316.1| PREDICTED: probable cyclic nucleotide-gated ion channel 3 [Camelina 
sativa]
Length=713

 Score =   746 bits (1925),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 379/618 (61%), Positives = 478/618 (77%), Gaps = 11/618 (2%)
 Frame = +2

Query  53    KMHDPQGPFLQRWNRIFVIACILAATVDPLFFYIPVVDDQNKCLGLDRTLEITACILRSV  232
             ++ +P   +LQ WN+IF++  ++A   DPLFFYIPVV+  + CL LD+ L+  AC+ R+ 
Sbjct  75    RVMNPNDSYLQNWNKIFLLLSVIALAFDPLFFYIPVVNPDSFCLYLDKKLQTIACVFRTF  134

Query  233   FDFFYIFHIILQFRTGFVPPSSRVFGRGDLIVDPSAIAKRYFFSYFFIDILAVLPLPQVV  412
              D FY+ H++ QF TGF+ P+SR FGRG+L  +   IA RY  SYF ID+L++LP+PQVV
Sbjct  135   IDAFYVVHMLFQFHTGFITPASRGFGRGELNENSKDIALRYLRSYFLIDLLSILPIPQVV  194

Query  413   LFMMIPRADRPFI--MVAKDILKVVILVQSVPRLLRIYPLYKEVTRTSGFFTETAWAGAA  586
             +  ++P+  RP I  +VAK++LK VI  Q VPR+ RIYPL+KEVTRTSG  TETAWAGAA
Sbjct  195   VLAIVPKVARPSISALVAKELLKWVIFCQYVPRIARIYPLFKEVTRTSGLVTETAWAGAA  254

Query  587   FNLFLYMIASYVAGAIWYITAIERQDKCWRRACEKHGSCDIDFLYCTKLGRRGGDFSSSF  766
              NLFLYM+AS+V G+ WY+ +IER+D+CWR AC K   C    LYC+      G+ +  F
Sbjct  255   LNLFLYMLASHVFGSFWYLISIERKDRCWREACAKILGCTHAHLYCSTTP---GEDNRLF  311

Query  767   LNTSCALLEPENLK-ADDFDFGIFLDALKSNVVEKRYFWSKLFYCFWWGLRNLSSLGQNL  943
             LN SC L++PE +K    F+FGIF DAL+S VVE + F  K+FYCFWWGLRNLS+LGQNL
Sbjct  312   LNGSCPLIDPEEIKDLTVFNFGIFADALQSGVVESKDFPKKIFYCFWWGLRNLSALGQNL  371

Query  944   KTSNFVGEilfailisiiglilfslligNMQKYLQSITVRVEEMRVKRMDAEQWMSHRML  1123
             KTS F GEI+FAI+I I GL+LF+LLIGNMQKYLQS TVRVEEMRVKR DAEQWMSHRML
Sbjct  372   KTSAFEGEIIFAIIICISGLVLFALLIGNMQKYLQSTTVRVEEMRVKRRDAEQWMSHRML  431

Query  1124  PDNLRERIRRYEQYRWQETRGVDEESLISNLPKDLRRDINRHLCWSLLKRVHMFKTMDEQ  1303
             PD+L++RIR+YEQY+WQET+GV+EE+L+S+LPKDLR+DI RHLC+ LLK V  F++MD++
Sbjct  432   PDDLKKRIRKYEQYKWQETKGVEEEALLSSLPKDLRKDIKRHLCFKLLKEVPWFQSMDDR  491

Query  1304  LLDAICDRLKPVLYTEKSCIVREGDPVDEMIFVMRGNLLTMTTNGGRTGFLNSDVLNAGD  1483
             LLDA+C RLK VLYTE S IVREG+PV++M+F+MRG L++ TT GG+TGF NS  L AGD
Sbjct  492   LLDALCARLKTVLYTENSYIVREGEPVEDMLFIMRGILISTTTYGGKTGFFNSVSLVAGD  551

Query  1484  FCGEELLTWALDPNSSSSLPISTRTVQALTDVEAFALTADFLKFFASQYRRLHSKQLQHK  1663
             FCG +LLTWALDP  SS  PIS RTVQA T+VE F L+AD LKF A+QYRRLHSKQ++H 
Sbjct  552   FCG-DLLTWALDP-LSSHFPISNRTVQAQTEVEGFVLSADDLKFVATQYRRLHSKQIRHM  609

Query  1664  FRFYSHQWKTWAACFIQAAWRRHCRNKLEKSLREEEDRLQDALILRMRREEGETTPSLGA  1843
             FRFYS QW+TWAACFIQAAW+R+CR KL K+LREEE +L   L      + G    +LGA
Sbjct  610   FRFYSVQWRTWAACFIQAAWKRYCRRKLSKALREEEGKLHSTL---QNDDSGGNKLNLGA  666

Query  1844  TIYASRFAANVLRTVRRN  1897
              +YASRFA++ LR +R N
Sbjct  667   AVYASRFASHALRNLRAN  684



>ref|XP_004163084.1| PREDICTED: cyclic nucleotide-gated ion channel 1-like [Cucumis 
sativus]
Length=637

 Score =   743 bits (1917),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 390/651 (60%), Positives = 482/651 (74%), Gaps = 24/651 (4%)
 Frame = +2

Query  47    KSKMHDPQGPFLQRWNRIFVIACILAATVDPLFFYIPVVDDQNKCLGLDRTLEITACILR  226
             + K+ DPQGPFLQ WN++FV++C+++ ++DPLFFY+PV+D +  CL LD  +E   CILR
Sbjct  8     EKKILDPQGPFLQSWNKLFVLSCVISVSLDPLFFYVPVIDMRKMCLRLDGKVETVVCILR  67

Query  227   SVFDFFYIFHIILQFRTGFVPPSSRVFGRGDLIVDPSAIAKRYFFSYFFIDILAVLPLPQ  406
                D FY+ HI+ QFRTGF+ PSSRVFGRG L  D   IA RY  SYF IDI +VLPLPQ
Sbjct  68    FFTDLFYVVHIVFQFRTGFISPSSRVFGRGVLEEDSLRIATRYLSSYFLIDISSVLPLPQ  127

Query  407   VVLFMMIPRADRPFIMVAKDILKVVILVQSVPRLLRIYPLYKEVTRTSGFFTETAWAGAA  586
             VV+ +M  R+ R   M  KD+LK  +L Q VPR LRIYPLYKEVTRTSG   ETAWAG A
Sbjct  128   VVILIM--RSSRS--MNTKDLLKYAVLCQFVPRFLRIYPLYKEVTRTSGILIETAWAGVA  183

Query  587   FNLFLYMIASYVAGAIWYITAIERQDKCWRRACEKHGSCDIDFLYCTKLGRRGGDFSSSF  766
             FNLFLYM+A +V GA+WY+ +I+R  +CW+ AC KH  C    LYC       G+    F
Sbjct  184   FNLFLYMLAGHVFGAVWYLCSIQRVGQCWQEACTKHLGCSFTSLYCDHNYINEGN---QF  240

Query  767   LNTSCALLEPENLKADDFDFGIFLDALKSNVVEKRYFWSKLFYCFWWGLRNLSSLGQNLK  946
             L   C + + +N+  + F+FGIF+ AL+ ++VE   F  K  YCFWWGLRNLSSLGQNL 
Sbjct  241   LTDMCPV-KKKNI--EPFNFGIFIQALQPDIVESD-FSKKFLYCFWWGLRNLSSLGQNLT  296

Query  947   TSNFVGEilfailisiiglilfslligNMQKYLQSITVRVEEMRVKRMDAEQWMSHRMLP  1126
             TS  + E  FAI + I GL+LF+ L+GNMQ Y +S   R E+MRV+R D EQWMSHR+LP
Sbjct  297   TSPCIWENCFAISVCISGLVLFAFLLGNMQMYWRSSNAREEKMRVRRNDVEQWMSHRLLP  356

Query  1127  DNLRERIRRYEQYRWQETRGVDEESLISNLPKDLRRDINRHLCWSLLKRVHMFKTMDEQL  1306
             +N RER+RRYE Y WQETRGVDE SL+ NLP+D++R   RHLC +LL +V MF+ MDEQL
Sbjct  357   ENPRERVRRYEHYTWQETRGVDEHSLLHNLPRDIQRHYKRHLCLALLMQVPMFEKMDEQL  416

Query  1307  LDAICDRLKPVLYTEKSCIVREGDPVDEMIFVMRGNLLTMTTNGGRTGFLNSDVLNAGDF  1486
             LDA+C RLKPVLYTE+SCIVREGDPVDEM+F+MRG LLTMTTNGGRT F NSD L +GDF
Sbjct  417   LDAMCARLKPVLYTEESCIVREGDPVDEMLFIMRGKLLTMTTNGGRTIFFNSDFLMSGDF  476

Query  1487  CGEELLTWALDPNSSSSLPISTRTVQALTDVEAFALTADFLKFFASQYRRLHSKQLQHKF  1666
             CGEELLTWALDP+SS++LP+STRTV++LT+VEAF+  ++ LKF ASQYR+LHSKQL+  F
Sbjct  477   CGEELLTWALDPHSSTNLPLSTRTVRSLTEVEAFSFESNDLKFVASQYRKLHSKQLRQIF  536

Query  1667  RFYSHQWKTWAACFIQAA--WRRHCRNKLEKSLREEEDRLQDALILRMRREEGETTPSLG  1840
             RFYS QW+TWAACFIQA   WRRH R KL++SL+EEE RL++AL         + + SLG
Sbjct  537   RFYSQQWRTWAACFIQATWRWRRHQRKKLKESLKEEESRLKNALA-----SLEDQSLSLG  591

Query  1841  ATIYASRFAANVLRTVRRNHplsvpklsprlpplllqkpAEPDFSAPENNN  1993
              T+YA+RFAAN+LR+VRRN              +LLQKPAEPDF   E+NN
Sbjct  592   TTVYAARFAANMLRSVRRN------STRRATIAILLQKPAEPDFLTLEDNN  636



>ref|XP_004150319.1| PREDICTED: cyclic nucleotide-gated ion channel 1-like [Cucumis 
sativus]
Length=651

 Score =   742 bits (1916),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 390/651 (60%), Positives = 481/651 (74%), Gaps = 24/651 (4%)
 Frame = +2

Query  47    KSKMHDPQGPFLQRWNRIFVIACILAATVDPLFFYIPVVDDQNKCLGLDRTLEITACILR  226
             + K+ DPQGPFLQ WN++FV++C+++ ++DPLFFY+PV+D +  CL LD  +E   CILR
Sbjct  19    EKKILDPQGPFLQSWNKLFVLSCVISVSLDPLFFYVPVIDMRKMCLRLDGKVETVVCILR  78

Query  227   SVFDFFYIFHIILQFRTGFVPPSSRVFGRGDLIVDPSAIAKRYFFSYFFIDILAVLPLPQ  406
                D FY+ HI+ QFRTGF+ PSSRVFGRG L  D   IA RY  SYF IDI +VLPLPQ
Sbjct  79    FFTDLFYVVHIVFQFRTGFISPSSRVFGRGVLEEDSLRIATRYLSSYFLIDISSVLPLPQ  138

Query  407   VVLFMMIPRADRPFIMVAKDILKVVILVQSVPRLLRIYPLYKEVTRTSGFFTETAWAGAA  586
             VV+ +M  R+ R   M  KD+LK  +L Q VPR LRIYPLYKEVTRTSG   ETAWAG A
Sbjct  139   VVILIM--RSSRS--MNTKDLLKYAVLCQFVPRFLRIYPLYKEVTRTSGILIETAWAGVA  194

Query  587   FNLFLYMIASYVAGAIWYITAIERQDKCWRRACEKHGSCDIDFLYCTKLGRRGGDFSSSF  766
             FNLFLYM+A +V GA+WY+ +I+R  +CW+ AC KH  C    LYC       G+    F
Sbjct  195   FNLFLYMLAGHVFGAVWYLCSIQRVGQCWQEACTKHLGCSFTSLYCDHNYINEGN---QF  251

Query  767   LNTSCALLEPENLKADDFDFGIFLDALKSNVVEKRYFWSKLFYCFWWGLRNLSSLGQNLK  946
             L   C + + +N+  + F+FGIF+ AL+ ++VE   F  K  YCFWWGLRNLSS GQNL 
Sbjct  252   LTDMCPV-KKKNI--EPFNFGIFIQALQPDIVESD-FSKKFLYCFWWGLRNLSSSGQNLT  307

Query  947   TSNFVGEilfailisiiglilfslligNMQKYLQSITVRVEEMRVKRMDAEQWMSHRMLP  1126
             TS  + E  FAI + I GL+LF+ L+GNMQ Y +S   R E+MRV+R D EQWMSHR+LP
Sbjct  308   TSPCIWENCFAISVCISGLVLFAFLLGNMQMYWRSSNAREEKMRVRRNDVEQWMSHRLLP  367

Query  1127  DNLRERIRRYEQYRWQETRGVDEESLISNLPKDLRRDINRHLCWSLLKRVHMFKTMDEQL  1306
             +N RER+RRYE Y WQETRGVDE SL+ NLP+D++R   RHLC +LL RV MF+ MDEQL
Sbjct  368   ENPRERVRRYEHYTWQETRGVDEHSLLHNLPRDIQRHYKRHLCLALLMRVPMFEKMDEQL  427

Query  1307  LDAICDRLKPVLYTEKSCIVREGDPVDEMIFVMRGNLLTMTTNGGRTGFLNSDVLNAGDF  1486
             LDA+C RLKPVLYTE+SCIVREGDPVDEM+F+MRG LLTMTTNGGRT F NSD L +GDF
Sbjct  428   LDAMCARLKPVLYTEESCIVREGDPVDEMLFIMRGKLLTMTTNGGRTIFFNSDFLMSGDF  487

Query  1487  CGEELLTWALDPNSSSSLPISTRTVQALTDVEAFALTADFLKFFASQYRRLHSKQLQHKF  1666
             CGEELLTWALDP+SS++LP+STRTV++LT+VEAF+  ++ LKF ASQYR+LHSKQL+  F
Sbjct  488   CGEELLTWALDPHSSTNLPLSTRTVRSLTEVEAFSFESNDLKFVASQYRKLHSKQLRQIF  547

Query  1667  RFYSHQWKTWAACFIQAA--WRRHCRNKLEKSLREEEDRLQDALILRMRREEGETTPSLG  1840
             RFYS QW+TWAACFIQA   WRRH R KL++SL+EEE RL++AL         + + SLG
Sbjct  548   RFYSQQWRTWAACFIQATWRWRRHQRKKLKESLKEEESRLKNALA-----SLEDQSLSLG  602

Query  1841  ATIYASRFAANVLRTVRRNHplsvpklsprlpplllqkpAEPDFSAPENNN  1993
              T+YA+RFAAN+LR+VRRN              +LLQKPAEPDF   E+NN
Sbjct  603   TTVYAARFAANMLRSVRRN------STRRATIAILLQKPAEPDFLTLEDNN  647



>gb|AAD19610.1| cyclic nucleotide gated channel [Arabidopsis thaliana]
Length=707

 Score =   744 bits (1922),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 381/617 (62%), Positives = 475/617 (77%), Gaps = 11/617 (2%)
 Frame = +2

Query  53    KMHDPQGPFLQRWNRIFVIACILAATVDPLFFYIPVVDDQNKCLGLDRTLEITACILRSV  232
             ++ +P   +LQ WN+IF++  ++A   DPLFFYIP V  +  CL LD+ L+  AC+ R+ 
Sbjct  71    RVMNPNDSYLQSWNKIFLLLSVVALAFDPLFFYIPYVKPERFCLNLDKKLQTIACVFRTF  130

Query  233   FDFFYIFHIILQFRTGFVPPSSRVFGRGDLIVDPSAIAKRYFFSYFFIDILAVLPLPQVV  412
              D FY+ H++ QF TGF+ PSS  FGRG+L      IA RY  SYF ID+L++LP+PQVV
Sbjct  131   IDAFYVVHMLFQFHTGFITPSSSGFGRGELNEKHKDIALRYLGSYFLIDLLSILPIPQVV  190

Query  413   LFMMIPRADRPFIMVAKDILKVVILVQSVPRLLRIYPLYKEVTRTSGFFTETAWAGAAFN  592
             +  ++PR  RP  +VAK++LK VI  Q VPR+ RIYPL+KEVTRTSG  TETAWAGAA N
Sbjct  191   VLAIVPRMRRPASLVAKELLKWVIFCQYVPRIARIYPLFKEVTRTSGLVTETAWAGAALN  250

Query  593   LFLYMIASYVAGAIWYITAIERQDKCWRRACEKHGSCDIDFLYCTKLGRRGGDFSSSFLN  772
             LFLYM+AS+V G+ WY+ +IER+D+CWR AC     C  + LYC+      G+ +  FLN
Sbjct  251   LFLYMLASHVFGSFWYLISIERKDRCWREACANIQDCSHEKLYCSP----TGEDNRLFLN  306

Query  773   TSCALLEPENL-KADDFDFGIFLDALKSNVVEKRYFWSKLFYCFWWGLRNLSSLGQNLKT  949
              SC L++PE +  +  F+FGIF DAL+S VVE R F  K FYCFWWGLRNLS+LGQNLKT
Sbjct  307   GSCPLIDPEEITNSTVFNFGIFADALQSGVVESRDFPKKFFYCFWWGLRNLSALGQNLKT  366

Query  950   SNFVGEilfailisiiglilfslligNMQKYLQSITVRVEEMRVKRMDAEQWMSHRMLPD  1129
             S+F GEI+FAI+I I GL+LF+LLIGNMQKYLQS TVRVEEMRVKR DAEQWMSHRMLPD
Sbjct  367   SSFEGEIIFAIVICISGLVLFALLIGNMQKYLQSTTVRVEEMRVKRRDAEQWMSHRMLPD  426

Query  1130  NLRERIRRYEQYRWQETRGVDEESLISNLPKDLRRDINRHLCWSLLKRVHMFKTMDEQLL  1309
             +LR+RIR+YEQY+WQET+GV+EE+L+S+LPKDLR+DI RHLC  LLK+V  F+ MD++LL
Sbjct  427   DLRKRIRKYEQYKWQETKGVEEEALLSSLPKDLRKDIKRHLCLKLLKKVPWFQAMDDRLL  486

Query  1310  DAICDRLKPVLYTEKSCIVREGDPVDEMIFVMRGNLLTMTTNGGRTGFLNSDVLNAGDFC  1489
             DA+C RLK VLYTEKS IVREG+ V++M+F+MRGNL++ TT GG+TGF NS  L AGDFC
Sbjct  487   DALCARLKTVLYTEKSYIVREGEAVEDMLFIMRGNLISTTTYGGKTGFFNSVDLVAGDFC  546

Query  1490  GEELLTWALDPNSSSSLPISTRTVQALTDVEAFALTADFLKFFASQYRRLHSKQLQHKFR  1669
             G +LLTWALDP  SS  PIS+RTVQALT+VE F L+AD LKF A+QYRRLHSKQL+H FR
Sbjct  547   G-DLLTWALDP-LSSQFPISSRTVQALTEVEGFVLSADDLKFVATQYRRLHSKQLRHMFR  604

Query  1670  FYSHQWKTWAACFIQAAWRRHCRNKLEKSLREEE-DRLQDALILRMRREEGETTPSLGAT  1846
             FYS QW+TWAACFIQAAW+RHCR KL K+LR+EE  +L + L      + G    +LGA 
Sbjct  605   FYSVQWQTWAACFIQAAWKRHCRRKLSKALRQEEGGKLHNTL---QNDDSGGNKLNLGAA  661

Query  1847  IYASRFAANVLRTVRRN  1897
             I ASRFA++ LR +R N
Sbjct  662   INASRFASHALRNLRAN  678



>ref|XP_006293455.1| hypothetical protein CARUB_v10022736mg [Capsella rubella]
 gb|EOA26353.1| hypothetical protein CARUB_v10022736mg [Capsella rubella]
Length=716

 Score =   744 bits (1922),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 379/619 (61%), Positives = 477/619 (77%), Gaps = 12/619 (2%)
 Frame = +2

Query  53    KMHDPQGPFLQRWNRIFVIACILAATVDPLFFYIPVVDDQNKCLGLDRTLEITACILRSV  232
             ++ +P   +LQ WN+IF++  ++A   DPLFFYIPVV+    CL LD  L+  AC+ R+ 
Sbjct  77    RVMNPNDSYLQNWNKIFLLLSVVALAFDPLFFYIPVVNPDKFCLSLDDKLQTIACVFRTF  136

Query  233   FDFFYIFHIILQFRTGFVPPSSRVFGRGDLIVDPSAIAKRYFFSYFFIDILAVLPLPQVV  412
              D FY+ H++ QF TGF+ P+SR FGRG+L V+   IA RY  SYF ID+L++LP+PQ+V
Sbjct  137   IDAFYVVHMLFQFHTGFITPASRGFGRGELNVNSKDIALRYLRSYFLIDLLSILPIPQIV  196

Query  413   LFMMIPRADRPFIMVAKDILKVVILVQSVPRLLRIYPLYKEVTRTSGFFTETAWAGAAFN  592
             +  ++P+  RP  +VAK++LK VI  Q +PR+ RIYPL KEVTRTSG  TETAWAGAA N
Sbjct  197   VLAIVPKVARPSSLVAKEMLKWVIFCQYIPRIARIYPLSKEVTRTSGLVTETAWAGAALN  256

Query  593   LFLYMIASYVAGAIWYITAIERQDKCWRRAC---EKHGSCDIDFLYCTKLGRRGGDFSSS  763
             LFLYM+AS+V G+ WY+ +IER+D+CWR AC   E+ G C    LYC    +  G+ +  
Sbjct  257   LFLYMLASHVFGSFWYLISIERKDRCWREACKEKEREG-CIHALLYC----KPTGENNHL  311

Query  764   FLNTSCALLEPENLKADD-FDFGIFLDALKSNVVEKRYFWSKLFYCFWWGLRNLSSLGQN  940
             FLN SC +++PE +K    F+FGIF DAL+S +VE R F  K  YCFWWGLRNLS+LGQN
Sbjct  312   FLNGSCNVIDPEEIKDPTIFNFGIFADALQSRIVETRDFPKKFSYCFWWGLRNLSALGQN  371

Query  941   LKTSNFVGEilfailisiiglilfslligNMQKYLQSITVRVEEMRVKRMDAEQWMSHRM  1120
             LKTS F GEI+FAI+I + GL+LF+LLIGNMQKYLQS TVRVEEMRVKR DAEQWMSHRM
Sbjct  372   LKTSTFEGEIIFAIIICVSGLVLFALLIGNMQKYLQSTTVRVEEMRVKRRDAEQWMSHRM  431

Query  1121  LPDNLRERIRRYEQYRWQETRGVDEESLISNLPKDLRRDINRHLCWSLLKRVHMFKTMDE  1300
             LPD+L++RIR+YEQY+WQET+GV+EE+L+S+LPKDLR+DI RHLC  LLK+V  F+ MD+
Sbjct  432   LPDDLKDRIRKYEQYKWQETKGVEEEALLSSLPKDLRKDIKRHLCLKLLKKVSWFQAMDD  491

Query  1301  QLLDAICDRLKPVLYTEKSCIVREGDPVDEMIFVMRGNLLTMTTNGGRTGFLNSDVLNAG  1480
             +LLDA+CDRLK VLYTE S IVREG+PV++M+F+MRGNL++ TT GGRTGF NS  L AG
Sbjct  492   RLLDALCDRLKTVLYTENSYIVREGEPVEDMLFIMRGNLISATTYGGRTGFFNSVTLVAG  551

Query  1481  DFCGEELLTWALDPNSSSSLPISTRTVQALTDVEAFALTADFLKFFASQYRRLHSKQLQH  1660
             DFCG +LLTWALDP  SS LPIS+RTVQA T+VE F L+AD LKF A+QYRRLHSKQ++ 
Sbjct  552   DFCG-DLLTWALDP-LSSHLPISSRTVQAKTEVEGFVLSADDLKFVATQYRRLHSKQIRQ  609

Query  1661  KFRFYSHQWKTWAACFIQAAWRRHCRNKLEKSLREEEDRLQDALILRMRREEGETTPSLG  1840
              FR+YS QW+TWAACFIQAAW+RHCR KL K+LREEE +L + L        G    +LG
Sbjct  610   MFRYYSVQWQTWAACFIQAAWKRHCRRKLSKALREEEGKLHNTLQNDADSGCGNKL-NLG  668

Query  1841  ATIYASRFAANVLRTVRRN  1897
             A IYASRFA++ LR +R N
Sbjct  669   AAIYASRFASHALRNLRAN  687



>ref|XP_003602214.1| Cyclic nucleotide-gated ion channel [Medicago truncatula]
Length=770

 Score =   746 bits (1925),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 412/704 (59%), Positives = 498/704 (71%), Gaps = 68/704 (10%)
 Frame = +2

Query  47    KSKMHDPQGPFLQRWNRIFVIACILAATVDPLFFYIPVVDDQNKCLGLDRTLEITACILR  226
             ++K+ DPQGPFLQ+WN+IFV++C++A ++DPLFFYIPV+DD  KCL  D+ +E TA +LR
Sbjct  78    RNKILDPQGPFLQKWNKIFVLSCLIAVSIDPLFFYIPVIDDGKKCLSRDKKMETTATVLR  137

Query  227   SVFDFFYIFHIILQFRTGFVPPSSRVFGRGDLIVDPSAIAKRYFFSYFFIDILAVLPLPQ  406
             S  D FYI HII QFRTGF+ PSSRVFGRG L+ D  AIAKRY  SYF +DILAVLPLPQ
Sbjct  138   SFSDIFYIIHIIFQFRTGFIAPSSRVFGRGVLVQDAWAIAKRYMSSYFLVDILAVLPLPQ  197

Query  407   VVLFMMIPRADRPFIMVAKDILKVVILVQSVPRLLRIYPLYKEVTRTSGFFTETAWAGAA  586
             VV+  +IP+      +  K++LK ++  Q VPR +RI PLYKEVTRTSG  TETAWAGAA
Sbjct  198   VVILFIIPKMTGSESLNTKNLLKFIVFFQYVPRFIRIAPLYKEVTRTSGILTETAWAGAA  257

Query  587   FNLFLYMIASYVAGAIWYITAIERQDKCWRRACEKHGSCDIDFLYCTKLGRRGGDFSSSF  766
             FNLFLYM+AS+V GA WY+ +IER+  CW+RAC+K+ +C    LYC      G    ++F
Sbjct  258   FNLFLYMLASHVLGAFWYLFSIERETTCWQRACQKNTTCIKAELYCDD--HHGLSTITTF  315

Query  767   LNTSCALLEPENLKADDFDFGIFLDALKSNVVEKRYFWSKLFYCFWWGLRNLSSLGQNLK  946
             LN SC +  P+      FDFGIFLDAL+S VV    F  K FYCFWWGL+NLSSLGQNL 
Sbjct  316   LNASCPIQNPDK---KLFDFGIFLDALQSGVVGSMDFPQKFFYCFWWGLKNLSSLGQNLA  372

Query  947   TSNFVGEilfailisiiglilfslligNMQKYLQSIT-VRVEEMRVKRMDAEQWMSHRML  1123
             TS FV EI FAI ISI GL+LF+ LIGNMQ  L   T   V + R   +    W S   +
Sbjct  373   TSTFVWEICFAIFISIAGLVLFAFLIGNMQYVLLGSTFASVSKTRALIVPPLCWSSFWGV  432

Query  1124  PDNL----------------------------------RERIRRYEQYRW----------  1171
              + L                                    R++R +  +W          
Sbjct  433   DEKLLRNYFLGLSWGSSDHCCIMTWGVTYLQSTTTRLEEMRVKRRDAEQWMSHRLLPDHL  492

Query  1172  ------------QETRGVDEESLISNLPKDLRRDINRHLCWSLLKRVHMFKTMDEQLLDA  1315
                         QETRGVDE++LI NLPKDLRRDI RHLC +LL RV +F+ MDEQLLDA
Sbjct  493   RERIRRHEQYKWQETRGVDEDNLIRNLPKDLRRDIKRHLCLALLMRVPIFEKMDEQLLDA  552

Query  1316  ICDRLKPVLYTEKSCIVREGDPVDEMIFVMRGNLLTMTTNGGRTGFLNSDVLNAGDFCGE  1495
             +CD LKPVLYT++SCIVREGDPVDEM+F+MRG LLT+TTNGGRTGF NS+ L AGDFCGE
Sbjct  553   VCDCLKPVLYTKESCIVREGDPVDEMLFIMRGKLLTVTTNGGRTGFFNSEYLKAGDFCGE  612

Query  1496  ELLTWALDPNSSSSLPISTRTVQALTDVEAFALTADFLKFFASQYRRLHSKQLQHKFRFY  1675
             ELLTWALDP S+S+LPISTRTVQ L++VEAFAL A+ LKF ASQ+RRLHSKQL+H FRFY
Sbjct  613   ELLTWALDPRSASNLPISTRTVQTLSEVEAFALKAEDLKFVASQFRRLHSKQLRHTFRFY  672

Query  1676  SHQWKTWAACFIQAAWRRHCRNKLEKSLREEEDRLQDALILRMRREEGETTPSLGATIYA  1855
             S QW+TWAACFIQAAWRR+C+ KLE+SLREEE+RLQDAL      +EG ++PSLGATIYA
Sbjct  673   SQQWRTWAACFIQAAWRRYCKKKLEESLREEENRLQDALA-----KEGGSSPSLGATIYA  727

Query  1856  SRFAANVLRTVRRNHplsvpklsprlpplllqkpAEPDFSAPEN  1987
             SRFAANVLR +R+N     P++  RLPP++LQKP EPDF+A E 
Sbjct  728   SRFAANVLRAIRKNG-SRKPRVPERLPPMMLQKPTEPDFTAEEQ  770



>gb|KHN06303.1| Putative cyclic nucleotide-gated ion channel 13 [Glycine soja]
Length=669

 Score =   742 bits (1915),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 380/612 (62%), Positives = 461/612 (75%), Gaps = 31/612 (5%)
 Frame = +2

Query  62    DPQGPFLQRWNRIFVIACILAATVDPLFFYIPVVDDQNKCLGLDRTLEITACILRSVFDF  241
             DPQG  LQ+WN+IFVI  ++A +VDPLFFYIP++DD+ +CL LD TL+ITA +LR+ FD 
Sbjct  60    DPQGATLQKWNKIFVITSVMAISVDPLFFYIPMIDDKKQCLALDGTLKITASVLRTFFDL  119

Query  242   FYIFHIILQFRTGFVPPSSRVFGRGDLIVDPSAIAKRYFFSYFFIDILAVLPLPQVVLFM  421
             FYI HII QFRTGF+ PSSRVFGRG+L+ DP AI  RY  SYF IDIL+++PLPQ+V+  
Sbjct  120   FYILHIIFQFRTGFIAPSSRVFGRGELVNDPWAIVMRYLSSYFIIDILSIIPLPQLVILA  179

Query  422   MIPRADRPFIMVAKDILKVVILVQSVPRLLRIYPLYKEVTRTSGFFTETAWAGAAFNLFL  601
             MIP        V KD+LK  I+ Q VPR+LRIYPL+KEVT TSG  TETAWAGAA+NLFL
Sbjct  180   MIPFPKCSVPYVGKDLLKYTIIAQYVPRILRIYPLFKEVTSTSGILTETAWAGAAYNLFL  239

Query  602   YMIASYVAGAIWYITAIERQDKCWRRACEKHGSCDIDFLYCTKLGRRGGDFSSSFLNTSC  781
             YM+AS+V GA WY+ ++E + +CWRR  +        +L C      G     S L +SC
Sbjct  240   YMLASHVVGAFWYLFSVESRLRCWRRRLKNTTFLHESYLSCGS----GNSTVQSLLKSSC  295

Query  782   ALLEPENLKA-DDFDFGIFLDALKSNVVEKRY-FWSKLFYCFWWGLRNLSSLGQNLKTSN  955
              L +P+ ++  + F+FGIF++ALK+ VVE    F  K FYCFWWGLR++SS+GQ L+TS 
Sbjct  296   PLTDPQQIQHLETFNFGIFIEALKARVVESNTDFPHKFFYCFWWGLRSVSSVGQGLETST  355

Query  956   FVGEilfailisiiglilfslligNMQKYLQSITVRVEEMRVKRMDAEQWMSHRMLPDNL  1135
             + GEI+FAI I++ GLILF+ LIGNMQKYLQS TVRVEEMR+KR DAE WMSHRMLPD L
Sbjct  356   YAGEIIFAIFIAVFGLILFASLIGNMQKYLQSTTVRVEEMRIKRRDAELWMSHRMLPDFL  415

Query  1136  RERIRRYEQYRWQETRGVDEESLISNLPKDLRRDINRHLCWSLLKRVHMFKTMDEQLLDA  1315
             +ERIRRYEQY+WQE RGV+EE+LI NLPKDLRRDI RHLC  LLK+V MF+ MD QLLDA
Sbjct  416   KERIRRYEQYKWQENRGVEEETLIRNLPKDLRRDIKRHLCIDLLKKVPMFENMDNQLLDA  475

Query  1316  ICDRLKPVLYTEKSCIVREGDPVDEMIFVMRGNLLTMTTNGGRTGFLNSDVLNAGDFCGE  1495
             +CD+LKPVLYTEKS IVREGDPVDEM+F+MRG L T TTNGGRTGF NS  + AGDFCGE
Sbjct  476   LCDKLKPVLYTEKSYIVREGDPVDEMLFIMRGKLATATTNGGRTGFFNSFEIKAGDFCGE  535

Query  1496  ELLTWALDPNSSSSLPISTRTVQALTDVEAFALTADFLKFFASQYRRLHSKQLQHKFRFY  1675
             ELLTWALDPNSSS+LPISTRTV+ +++VEAFAL  D LK                   FY
Sbjct  536   ELLTWALDPNSSSNLPISTRTVETISEVEAFALMPDDLK-------------------FY  576

Query  1676  SHQWKTWAACFIQAAWRRHCRNKLEKSLREEEDRLQDALILRMRREEGETTPSLGATIYA  1855
             S QWKTW ACFIQAAWRR+ + K E+ LRE E+R+Q      +  EEG ++PS  ATIYA
Sbjct  577   SLQWKTWGACFIQAAWRRYKKKKAERLLREAEERIQ-----ALENEEG-SSPSFAATIYA  630

Query  1856  SRFAANVLRTVR  1891
             SRFA++ LR +R
Sbjct  631   SRFASSGLRHLR  642



>ref|XP_008439332.1| PREDICTED: cyclic nucleotide-gated ion channel 1-like isoform 
X1 [Cucumis melo]
 ref|XP_008439333.1| PREDICTED: cyclic nucleotide-gated ion channel 1-like isoform 
X1 [Cucumis melo]
 ref|XP_008439335.1| PREDICTED: cyclic nucleotide-gated ion channel 1-like isoform 
X1 [Cucumis melo]
 ref|XP_008439336.1| PREDICTED: cyclic nucleotide-gated ion channel 1-like isoform 
X1 [Cucumis melo]
Length=661

 Score =   741 bits (1914),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 394/652 (60%), Positives = 482/652 (74%), Gaps = 24/652 (4%)
 Frame = +2

Query  47    KSKMHDPQGPFLQRWNRIFVIACILAATVDPLFFYIPVVDDQNKCLGLDRTLEITACILR  226
             + K+ DPQGPFLQ WN++FV++C+++ ++DPLFFY+PV+D +  CL LD  +E   CILR
Sbjct  32    EKKILDPQGPFLQSWNKLFVLSCVISVSLDPLFFYVPVIDMRKMCLRLDGKVETVVCILR  91

Query  227   SVFDFFYIFHIILQFRTGFVPPSSRVFGRGDLIVDPSAIAKRYFFSYFFIDILAVLPLPQ  406
                D FY+ HI+ QFRTGF+ PSSRVFGRG L  D   IA RY  SYF IDI +VLPLPQ
Sbjct  92    FFTDLFYVVHIVFQFRTGFISPSSRVFGRGVLEEDSLRIATRYLSSYFLIDISSVLPLPQ  151

Query  407   VVLFMMIPRADRPFIMVAKDILKVVILVQSVPRLLRIYPLYKEVTRTSGFFTETAWAGAA  586
             V + +M  R  R   M  KD+LK  +L Q VPR LRIYPLYKEV RTSG   ETAWAG A
Sbjct  152   VAILIM--RGSRS--MNTKDLLKYAVLFQFVPRFLRIYPLYKEVMRTSGILIETAWAGVA  207

Query  587   FNLFLYMIASYVAGAIWYITAIERQDKCWRRACEKHGSCDIDFLYCTKLGRRGGDFSSSF  766
             FNLFLYM+A +V GAIWY+ +I+R  +CW+ AC KH  C    LYC       G+    F
Sbjct  208   FNLFLYMLAGHVFGAIWYLCSIQRVGQCWQEACTKHLGCIFTSLYCDHNYINEGN---QF  264

Query  767   LNTSCALLEPENLKADDFDFGIFLDALKSNVVEKRYFWSKLFYCFWWGLRNLSSLGQNLK  946
             L   C + + +N+  + F+FGIF+ AL+ ++VE   F  K  +CFWWGLRN+SSLGQNL 
Sbjct  265   LTEMCPV-KKKNI--EPFNFGIFIQALQPDIVESD-FPKKFLHCFWWGLRNISSLGQNLT  320

Query  947   TSNFVGEilfailisiiglilfslligNMQKYLQSITVRVEEMRVKRMDAEQWMSHRMLP  1126
             TS  + E  FAI + I GL+LF+ L+GNMQ Y +S   R EEMRV+R DAEQWMSHR+LP
Sbjct  321   TSPCIWENCFAIFVCISGLVLFAFLLGNMQMYWRSSNAREEEMRVRRNDAEQWMSHRLLP  380

Query  1127  DNLRERIRRYEQYRWQETRGVDEESLISNLPKDLRRDINRHLCWSLLKRVHMFKTMDEQL  1306
             +NLR+R+RRYE Y WQETRGVDE SL+ NLP+D++R   RHLC +LL RV MF+ MDE+L
Sbjct  381   ENLRKRVRRYEHYTWQETRGVDEHSLLRNLPRDIQRYYKRHLCLALLMRVPMFEKMDERL  440

Query  1307  LDAICDRLKPVLYTEKSCIVREGDPVDEMIFVMRGNLLTMTTNGGRTGFLNSDVLNAGDF  1486
             LDA+C  LKPVLYTE+SCIVREGDPVDEM+F+MRG LLTMTTNGGRT F NSD L AGDF
Sbjct  441   LDAMCVHLKPVLYTEESCIVREGDPVDEMLFIMRGKLLTMTTNGGRTIFFNSDFLMAGDF  500

Query  1487  CGEELLTWALDPNSSSSLPISTRTVQALTDVEAFALTADFLKFFASQYRRLHSKQLQHKF  1666
             CGEELLTWALDP+SS++LPISTRTV++LT+VEAF+  ++ LKF ASQYR+LHSKQL+  F
Sbjct  501   CGEELLTWALDPHSSTNLPISTRTVRSLTEVEAFSFESNDLKFVASQYRKLHSKQLRQVF  560

Query  1667  RFYSHQWKTWAACFIQAA--WRRHCRNKLEKSLREEEDRLQDALILRMRREEGETTPSLG  1840
             RFYS QW+TWAACFIQA   WRRH R KL++SL+EEE RL++AL       EG++  SLG
Sbjct  561   RFYSQQWRTWAACFIQATWRWRRHQRKKLKESLKEEESRLKNALA----SLEGQSL-SLG  615

Query  1841  ATIYASRFAANVLRTVRRNHplsvpklsprlpplllqkpAEPDFSAPENNNA  1996
              TIYA+RFAAN+LRTVRRN              +LLQKPAEPDF   E+NN 
Sbjct  616   TTIYAARFAANMLRTVRRN------STRRATIAILLQKPAEPDFLTLEDNNT  661



>ref|XP_006656134.1| PREDICTED: cyclic nucleotide-gated ion channel 1-like isoform 
X1 [Oryza brachyantha]
 ref|XP_006656135.1| PREDICTED: cyclic nucleotide-gated ion channel 1-like isoform 
X2 [Oryza brachyantha]
 ref|XP_006656136.1| PREDICTED: cyclic nucleotide-gated ion channel 1-like isoform 
X3 [Oryza brachyantha]
Length=694

 Score =   739 bits (1908),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 387/646 (60%), Positives = 483/646 (75%), Gaps = 19/646 (3%)
 Frame = +2

Query  50    SKMHDPQGPFLQRWNRIFVIACILAATVDPLFFYIPVVDDQNKCLGLDRTLEITACILRS  229
             S +H PQGPFLQ WN+IFV++CI A +VDPLFFYIPV++D N C  LD+ LEITA +LR 
Sbjct  66    STLH-PQGPFLQSWNKIFVLSCIFAVSVDPLFFYIPVINDNNTCWYLDKKLEITASVLRF  124

Query  230   VFDFFYIFHIILQFRTGFVPPSSRVFGRGDLIVDPSAIAKRYFFSYFFIDILAVLPLPQV  409
               D FYI HII QFRTG++  S    GRG L+ D  AIAKRY  +YF IDI AVLPLPQV
Sbjct  125   FTDIFYILHIIFQFRTGYIASSPTTSGRGVLVEDRYAIAKRYLSTYFLIDIFAVLPLPQV  184

Query  410   VLFMMIPRADRPFIMVAKDILKVVILVQSVPRLLRIYPLYKEVTRTSGFFTETAWAGAAF  589
             V+ +++P      +  AK+IL  +++ Q VPRL+RI PLY ++TR++G  TET WAGA  
Sbjct  185   VILVVLPNLRGSEVAKAKNILMFIVICQYVPRLIRIRPLYLQITRSAGVITETPWAGAFL  244

Query  590   NLFLYMIASYVAGAIWYITAIERQDKCWRRACEKH-GSCDIDFLYCTKLGRRGGDFSSSF  766
             NL +YM+AS+V GA+WY+ +IER+D CWR  C  +  +C+  +LYC       G   ++F
Sbjct  245   NLLIYMLASHVLGALWYLLSIERKDACWRDKCSNNTANCNSTYLYC-------GIKENTF  297

Query  767   LNTSCALLEPENLKADDFDFGIFLDALKSNVVEKRYFWSKLFYCFWWGLRNLSSLGQNLK  946
             L   C    P N    D  FGI++ AL +NV +   F++KLFYC WWGL+NLSSLGQNLK
Sbjct  298   LGNVCL---PINSNGIDPYFGIYVPAL-NNVSQSSSFFAKLFYCIWWGLQNLSSLGQNLK  353

Query  947   TSNFVGEilfailisiiglilfslligNMQKYLQSITVRVEEMRVKRMDAEQWMSHRMLP  1126
             TS +  E LFA+ +SI GL+LF+LLIGN+Q YLQS  +R EEMRVK  D +QWM++R+LP
Sbjct  354   TSTYAWENLFAVFVSISGLVLFALLIGNVQTYLQSAHLREEEMRVKSRDTDQWMTYRLLP  413

Query  1127  DNLRERIRRYEQYRWQETRGVDEESLISNLPKDLRRDINRHLCWSLLKRVHMFKTMDEQL  1306
             +NL+ERIRR+E+YRW +T GVDEE L+ NLPKDLRR I RHLC SLL RV MF+ MD+QL
Sbjct  414   ENLKERIRRHEKYRWHQTSGVDEELLLMNLPKDLRRAIKRHLCLSLLMRVPMFENMDDQL  473

Query  1307  LDAICDRLKPVLYTEKSCIVREGDPVDEMIFVMRGNLLTMTTNGGRTGFLNSDVLNAGDF  1486
             L+A+CDRLKPVLYTE SCI+ E DPV+EM+F+MRG+L++MTTNGGRTGF NSDVL  GDF
Sbjct  474   LNALCDRLKPVLYTEGSCIILEEDPVNEMLFIMRGSLMSMTTNGGRTGFFNSDVLKGGDF  533

Query  1487  CGEELLTWALDPNSSSSLPISTRTVQALTDVEAFALTADFLKFFASQYRRLHSKQLQHKF  1666
             CGEELLTWALDP S SSLP STRTV+ +++VEAFAL A+ LKF A+Q+RRLHSK+LQH F
Sbjct  534   CGEELLTWALDPTSVSSLPSSTRTVKTISEVEAFALRAEDLKFVATQFRRLHSKELQHTF  593

Query  1667  RFYSHQWKTWAACFIQAAWRRHCRNKLEKSLREEEDRLQDALILRMRREEGETTPSLGAT  1846
             RFYS  W+TWAACFIQAAW R CR K+E SLRE+E RLQ  ++      EG ++ SL A 
Sbjct  594   RFYSQHWRTWAACFIQAAWHRFCRKKIEDSLREKEKRLQFTIV-----NEGTSSLSLRAA  648

Query  1847  IYASRFAANVLRTVRRNHplsvpklsprlpplllqkpAEPDFSAPE  1984
             IYASRFA N++R +RRN      +L  R+P  LLQKPAEP+FSA E
Sbjct  649   IYASRFAGNMMRILRRN-ATRKARLQERVPARLLQKPAEPNFSAEE  693



>ref|XP_010656612.1| PREDICTED: probable cyclic nucleotide-gated ion channel 5 isoform 
X2 [Vitis vinifera]
Length=730

 Score =   739 bits (1909),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 378/658 (57%), Positives = 490/658 (74%), Gaps = 19/658 (3%)
 Frame = +2

Query  47    KSKMHDPQGPFLQRWNRIFVIACILAATVDPLFFYIPVVDDQNKCLGLDRTLEITACILR  226
             + K+ DPQ  FLQ WN++FVI+CILA +VDPLFFY+PV+D  +KCLG+DR L ITA  LR
Sbjct  82    EKKIFDPQHKFLQLWNKLFVISCILAVSVDPLFFYLPVIDSSSKCLGIDRKLAITATTLR  141

Query  227   SVFDFFYIFHIILQFRTGFVPPSSRVFGRGDLIVDPSAIAKRYFFSYFFIDILAVLPLPQ  406
             ++ D FY+ H+ LQFRT ++ PSSRVFGRG+L++DP+ IAKRY  +YF ID LAVLPLPQ
Sbjct  142   TIIDAFYLIHMALQFRTAYIAPSSRVFGRGELVIDPARIAKRYLRTYFIIDFLAVLPLPQ  201

Query  407   VVLFMMIPRADRPFIMVAKDILKVVILVQSVPRLLRIYPLYKEVTRTSGFFTETAWAGAA  586
             +V++  +  +D   ++  K  L  ++L+Q +PRL R+ PL  E+ RTSG F ETAWAGAA
Sbjct  202   IVVWRFLHSSDGSDVLSTKQALFFIVLLQYIPRLFRMLPLSSELKRTSGVFAETAWAGAA  261

Query  587   FNLFLYMIASYVAGAIWYITAIERQDKCWRRACEKHGSCDIDFLYCTKLGRRGGDF----  754
             + L LYM+AS++ GA WY+ A+ER D CW+RAC   G+C  DFLYC+     G D     
Sbjct  262   YYLLLYMLASHIVGAFWYLLAVERNDSCWQRACAHSGNCKTDFLYCSNRHTEGYDAWLID  321

Query  755   SSSFLNTSCALLEPENLKADDFDFGIFLDALKSNVVEKRYFWSKLFYCFWWGLRNLSSLG  934
             S + LN++C++ E +N     F++GI+ +AL S +V  + F SK  YC WWGL+NLS+LG
Sbjct  322   SDNVLNSNCSV-EGDN---PPFNYGIYTNALSSGIVSSKKFLSKYCYCLWWGLQNLSTLG  377

Query  935   QNLKTSNFVGEilfailisiiglilfslligNMQKYLQSITVRVEEMRVKRMDAEQWMSH  1114
             Q L+TS + GE++F+I ++I+GLILF+LLIGNMQ YLQS+T+R+EEMRVKR D+EQWM H
Sbjct  378   QGLQTSIYPGEVIFSIALAILGLILFALLIGNMQTYLQSLTIRLEEMRVKRRDSEQWMHH  437

Query  1115  RMLPDNLRERIRRYEQYRWQETRGVDEESLISNLPKDLRRDINRHLCWSLLKRVHMFKTM  1294
             R+LP  LRER+RRY+QY+W ETRGVDEE+L+ +LPKDLRRDI RHLC +L++RV +F+ M
Sbjct  438   RLLPQELRERVRRYDQYKWLETRGVDEENLVQSLPKDLRRDIKRHLCLALVRRVPLFENM  497

Query  1295  DEQLLDAICDRLKPVLYTEKSCIVREGDPVDEMIFVMRGNLLTMTTNGGRTGFLNSDVLN  1474
             DE+LLDAIC+RLKP L+TE + IVREGDPVDEM+F++RG L ++TT GGR+GF N  +L 
Sbjct  498   DERLLDAICERLKPSLFTENTFIVREGDPVDEMLFIIRGRLESVTTGGGRSGFFNRSLLK  557

Query  1475  AGDFCGEELLTWALDPNSSSSLPISTRTVQALTDVEAFALTADFLKFFASQYRRLHSKQL  1654
              GDFCGEELLTWALDP S S+LP STRTV+ALT+VEAFAL A+ LKF ASQ+RRLHS+Q+
Sbjct  558   EGDFCGEELLTWALDPKSGSNLPSSTRTVKALTEVEAFALIAEELKFVASQFRRLHSRQV  617

Query  1655  QHKFRFYSHQWKTWAACFIQAAWRRHCRNKLEKSLREEEDRLQDALILRMRREEGET---  1825
             QH FRFYS QW+TWAACFIQAAWRR+ + K+ +  R+EE+  + A         G     
Sbjct  618   QHTFRFYSQQWRTWAACFIQAAWRRYSKRKILELRRKEEEEEEAAAAAAAEGLSGTNNNV  677

Query  1826  ---TPSLGATIYASRFAANVLRTVRRNHplsvpklsprlpplllqkpAEPDFSAPENN  1990
                + SLGATI ASRFAAN LR V RN              + LQKP EPDFSA + +
Sbjct  678   RGGSYSLGATILASRFAANALRGVHRNR-----ITKSARELVKLQKPPEPDFSADDAD  730



>ref|XP_010321517.1| PREDICTED: cyclic nucleotide-gated ion channel 1 isoform X3 [Solanum 
lycopersicum]
Length=648

 Score =   736 bits (1901),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 372/549 (68%), Positives = 458/549 (83%), Gaps = 7/549 (1%)
 Frame = +2

Query  47    KSKMHDPQGPFLQRWNRIFVIACILAATVDPLFFYIPVVDDQNKCLGLDRTLEITACILR  226
             K K+HDPQG FLQ+WN++FV+ CI+A ++DPLFFYIPV+D+  KCL LDRTL+ITAC+LR
Sbjct  85    KKKVHDPQGRFLQQWNKVFVLICIIAVSLDPLFFYIPVIDNDRKCLDLDRTLKITACVLR  144

Query  227   SVFDFFYIFHIILQFRTGFVPPSSRVFGRGDLIVDPSAIAKRYFFSYFFIDILAVLPLPQ  406
             S+ D FYIFHIILQFRTG++ P SR+FGRG+L+ D   IAKRY  SYF +D++AVLPLPQ
Sbjct  145   SITDLFYIFHIILQFRTGYIAPPSRIFGRGELVEDSYDIAKRYLLSYFIVDVVAVLPLPQ  204

Query  407   VVLFMMIPRADRPFIMVAKDILKVVILVQSVPRLLRIYPLYKEVTRTSGFFTETAWAGAA  586
             +V+ ++ P A+    +  K++LK+VI  Q  PR+ RIYPLYKEVTRTSG FTE+AW GA 
Sbjct  205   IVILVITPNANGSIALATKEMLKIVIFAQYFPRIFRIYPLYKEVTRTSGLFTESAWGGAV  264

Query  587   FNLFLYMIASYVAGAIWYITAIERQDKCWRRACEKHGSCDIDFLYCTKLGRRGGDFSSSF  766
             FNL LYM+AS V GA+WY+ ++ERQD CWR AC+K   C  ++LYC K        ++S 
Sbjct  265   FNLSLYMLASNVIGALWYLFSVERQDTCWRDACDKISGCSSNYLYCNK----SSIGNASL  320

Query  767   LNTSCALLEPENLKADD-FDFGIFLDALKSNVVEKRYFWSKLFYCFWWGLRNLSSLGQNL  943
             LN+SC L++ E++K    FDFGI LDAL+  +VEKR FW+KLFYCFWWGLRNLSSLGQNL
Sbjct  321   LNSSCPLVKQEDIKDPHVFDFGIALDALQFRIVEKRNFWTKLFYCFWWGLRNLSSLGQNL  380

Query  944   KTSNFVGEilfailisiiglilfslligNMQKYLQSITVRVEEMRVKRMDAEQWMSHRML  1123
             KTS F+GEILFA+ ISIIGLILFSLLIGNMQKYLQSITVRVEEMRV+R DAEQWMSHRML
Sbjct  381   KTSTFIGEILFAVFISIIGLILFSLLIGNMQKYLQSITVRVEEMRVRRRDAEQWMSHRML  440

Query  1124  PDNLRERIRRYEQYRWQETRGVDEESLISNLPKDLRRDINRHLCWSLLKRVHMFKTMDEQ  1303
             PD L+ERIRR+EQY+WQETRGV+E+ L+ +LP+DLRRD+ RHLCWS LK+V +F+ MD+Q
Sbjct  441   PDILKERIRRHEQYKWQETRGVEEDLLLQDLPRDLRRDLKRHLCWSFLKKVPIFEKMDDQ  500

Query  1304  LLDAICDRLKPVLYTEKSCIVREGDPVDEMIFVMRGNLLTMTTNGGRTGFLNSDVLNAGD  1483
             LLDA+CDRLKP L+T+KS I+REGDPV+EM+F+MRG LLTMTTNGGRTGF NS  L AG 
Sbjct  501   LLDALCDRLKPALFTDKSFIIREGDPVEEMLFLMRGTLLTMTTNGGRTGFFNSVYLKAGG  560

Query  1484  FCGEELLTWALDPNSSS-SLPISTRTVQALTDVEAFALTADFLKFFASQYRRLHSKQLQH  1660
             FCG+ELLTWALDPN+SS SLP+STRTVQA+TD+EAFA+TAD LKF A+Q+RRL+SKQ+QH
Sbjct  561   FCGDELLTWALDPNTSSGSLPLSTRTVQAVTDIEAFAVTADDLKFVAAQFRRLNSKQIQH  620

Query  1661  KFRFYSHQW  1687
              F+ ++  W
Sbjct  621   TFK-HTRSW  628



>ref|XP_002278464.1| PREDICTED: probable cyclic nucleotide-gated ion channel 5 isoform 
X1 [Vitis vinifera]
 ref|XP_010656611.1| PREDICTED: probable cyclic nucleotide-gated ion channel 5 isoform 
X1 [Vitis vinifera]
 emb|CBI36531.3| unnamed protein product [Vitis vinifera]
Length=743

 Score =   740 bits (1910),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 378/658 (57%), Positives = 490/658 (74%), Gaps = 19/658 (3%)
 Frame = +2

Query  47    KSKMHDPQGPFLQRWNRIFVIACILAATVDPLFFYIPVVDDQNKCLGLDRTLEITACILR  226
             + K+ DPQ  FLQ WN++FVI+CILA +VDPLFFY+PV+D  +KCLG+DR L ITA  LR
Sbjct  95    EKKIFDPQHKFLQLWNKLFVISCILAVSVDPLFFYLPVIDSSSKCLGIDRKLAITATTLR  154

Query  227   SVFDFFYIFHIILQFRTGFVPPSSRVFGRGDLIVDPSAIAKRYFFSYFFIDILAVLPLPQ  406
             ++ D FY+ H+ LQFRT ++ PSSRVFGRG+L++DP+ IAKRY  +YF ID LAVLPLPQ
Sbjct  155   TIIDAFYLIHMALQFRTAYIAPSSRVFGRGELVIDPARIAKRYLRTYFIIDFLAVLPLPQ  214

Query  407   VVLFMMIPRADRPFIMVAKDILKVVILVQSVPRLLRIYPLYKEVTRTSGFFTETAWAGAA  586
             +V++  +  +D   ++  K  L  ++L+Q +PRL R+ PL  E+ RTSG F ETAWAGAA
Sbjct  215   IVVWRFLHSSDGSDVLSTKQALFFIVLLQYIPRLFRMLPLSSELKRTSGVFAETAWAGAA  274

Query  587   FNLFLYMIASYVAGAIWYITAIERQDKCWRRACEKHGSCDIDFLYCTKLGRRGGDF----  754
             + L LYM+AS++ GA WY+ A+ER D CW+RAC   G+C  DFLYC+     G D     
Sbjct  275   YYLLLYMLASHIVGAFWYLLAVERNDSCWQRACAHSGNCKTDFLYCSNRHTEGYDAWLID  334

Query  755   SSSFLNTSCALLEPENLKADDFDFGIFLDALKSNVVEKRYFWSKLFYCFWWGLRNLSSLG  934
             S + LN++C++ E +N     F++GI+ +AL S +V  + F SK  YC WWGL+NLS+LG
Sbjct  335   SDNVLNSNCSV-EGDN---PPFNYGIYTNALSSGIVSSKKFLSKYCYCLWWGLQNLSTLG  390

Query  935   QNLKTSNFVGEilfailisiiglilfslligNMQKYLQSITVRVEEMRVKRMDAEQWMSH  1114
             Q L+TS + GE++F+I ++I+GLILF+LLIGNMQ YLQS+T+R+EEMRVKR D+EQWM H
Sbjct  391   QGLQTSIYPGEVIFSIALAILGLILFALLIGNMQTYLQSLTIRLEEMRVKRRDSEQWMHH  450

Query  1115  RMLPDNLRERIRRYEQYRWQETRGVDEESLISNLPKDLRRDINRHLCWSLLKRVHMFKTM  1294
             R+LP  LRER+RRY+QY+W ETRGVDEE+L+ +LPKDLRRDI RHLC +L++RV +F+ M
Sbjct  451   RLLPQELRERVRRYDQYKWLETRGVDEENLVQSLPKDLRRDIKRHLCLALVRRVPLFENM  510

Query  1295  DEQLLDAICDRLKPVLYTEKSCIVREGDPVDEMIFVMRGNLLTMTTNGGRTGFLNSDVLN  1474
             DE+LLDAIC+RLKP L+TE + IVREGDPVDEM+F++RG L ++TT GGR+GF N  +L 
Sbjct  511   DERLLDAICERLKPSLFTENTFIVREGDPVDEMLFIIRGRLESVTTGGGRSGFFNRSLLK  570

Query  1475  AGDFCGEELLTWALDPNSSSSLPISTRTVQALTDVEAFALTADFLKFFASQYRRLHSKQL  1654
              GDFCGEELLTWALDP S S+LP STRTV+ALT+VEAFAL A+ LKF ASQ+RRLHS+Q+
Sbjct  571   EGDFCGEELLTWALDPKSGSNLPSSTRTVKALTEVEAFALIAEELKFVASQFRRLHSRQV  630

Query  1655  QHKFRFYSHQWKTWAACFIQAAWRRHCRNKLEKSLREEEDRLQDALILRMRREEGET---  1825
             QH FRFYS QW+TWAACFIQAAWRR+ + K+ +  R+EE+  + A         G     
Sbjct  631   QHTFRFYSQQWRTWAACFIQAAWRRYSKRKILELRRKEEEEEEAAAAAAAEGLSGTNNNV  690

Query  1826  ---TPSLGATIYASRFAANVLRTVRRNHplsvpklsprlpplllqkpAEPDFSAPENN  1990
                + SLGATI ASRFAAN LR V RN              + LQKP EPDFSA + +
Sbjct  691   RGGSYSLGATILASRFAANALRGVHRNR-----ITKSARELVKLQKPPEPDFSADDAD  743



>gb|KEH18669.1| cyclic nucleotide-gated ion channel-like protein [Medicago truncatula]
Length=722

 Score =   737 bits (1902),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 391/646 (61%), Positives = 480/646 (74%), Gaps = 14/646 (2%)
 Frame = +2

Query  62    DPQGPFLQRWNRIFVIACILAATVDPLFFYIPVVDDQNKCLGLDRTLEITACILRSVFDF  241
             DPQGP LQ+WN+IFVI C++A ++DPLFFYIPV+DDQ KCL L+ TL+ITA +LR+ FD 
Sbjct  87    DPQGPLLQKWNKIFVITCVMAVSMDPLFFYIPVIDDQRKCLNLNGTLKITASVLRTFFDL  146

Query  242   FYIFHIILQFRTGFVPPSSRVFGRGDLIVDPSAIAKRYFFSYFFIDILAVLPLPQVVLFM  421
             FYI  I+ QFRTGF+ PSSR+FGRG+ + DP AIA RY  S+F IDIL++LPLPQ+V+  
Sbjct  147   FYIIRIVFQFRTGFIAPSSRIFGRGEPVDDPFAIAMRYLSSHFIIDILSILPLPQMVILA  206

Query  422   MIPRADRPFIMVAKDILKVVILVQSVPRLLRIYPLYKEVTRTSGFFTETAWAGAAFNLFL  601
             MIP        + KD LK  I+ Q  PRL+RIY L+ EVT TSG  TETAWAGAA+NLFL
Sbjct  207   MIPIPQGSVPYITKDWLKYTIITQYAPRLMRIYTLFNEVTSTSGILTETAWAGAAYNLFL  266

Query  602   YMIASYVAGAIWYITAIERQDKCWRRACEKHGSCDIDFLYCTKLGRRGGDFSSSFLNT-S  778
             YM+AS+V GA WY+ +IE + +CWRR  +     D  +L C   GR      S   N+ +
Sbjct  267   YMLASHVVGAFWYLFSIESELRCWRRRLKNTPFFDDSYLSC---GRVNSTLFSILNNSAT  323

Query  779   CALLEPENL-KADDFDFGIFLDALKSNVVE-KRYFWSKLFYCFWWGLRNLSSLGQNLKTS  952
             C   +P+++     F+FGIF+DAL S VVE    F  K FYCFWWGLRNLSS+GQNLKTS
Sbjct  324   CPYKDPDDIIDPTVFNFGIFMDALTSRVVELNTNFHHKFFYCFWWGLRNLSSVGQNLKTS  383

Query  953   NFVGEilfailisiiglilfslligNMQKYLQSITVRVEEMRVKRMDAEQWMSHRMLPDN  1132
              ++GEI+FAI I++ GL+LF+LLIGNMQKYLQS TVRVEEMR+KR DAEQWM HRMLPD+
Sbjct  384   TYIGEIIFAIFIAVFGLVLFALLIGNMQKYLQSTTVRVEEMRIKRRDAEQWMCHRMLPDH  443

Query  1133  LRERIRRYEQYRWQETRGVDEESLISNLPKDLRRDINRHLCWSLLKRVHMFKTMDEQLLD  1312
             +++RIRRYEQY+WQE RGV+EE LI NLPKDLRRDI RHLC  LLK+V +F  MD+QLLD
Sbjct  444   MKQRIRRYEQYKWQENRGVEEEKLICNLPKDLRRDIRRHLCLDLLKKVPIFSNMDKQLLD  503

Query  1313  AICDRLKPVLYTEKSCIVREGDPVDEMIFVMRGNLLTMTTNGGRTGFLNSDVLNAGDFCG  1492
             A+CD+LKPVLYTEKS +VREGDPVDEM+F+MRG L T TTNGGRTGF NS  L AGDFCG
Sbjct  504   AMCDKLKPVLYTEKSFVVREGDPVDEMLFIMRGKLKTATTNGGRTGFFNSTELKAGDFCG  563

Query  1493  EELLTWALDPNSSSSLPISTRTVQALTDVEAFALTADFLKFFASQYRRL-HSKQLQHKFR  1669
             EELLTWALDP +SS+LPIST TV+ +T+VEAFAL  D LK  ASQ+RRL + KQLQH FR
Sbjct  564   EELLTWALDPTTSSNLPISTSTVETITEVEAFALMHDDLKIVASQFRRLINRKQLQHTFR  623

Query  1670  FYSHQWKTWAACFIQAAWRRHCRNKLEKSLREEEDRLQDALILRMRREEGETTPSLGATI  1849
             FYS QW+TW A FIQ  WRR+   + +K LRE E R ++A           ++PS+G+TI
Sbjct  624   FYSLQWRTWGARFIQVVWRRYREKRAQKLLRESEKRQENASENEEE----SSSPSIGSTI  679

Query  1850  YASRFAANVLRTVRRNHplsvpklsprlpplllqkpAEPDFSAPEN  1987
             Y  RFA+N L+ +R          + +  PLL +KPAEPDF   +N
Sbjct  680   YVQRFASNALKHLRSGK---RVTQTKKFLPLLPRKPAEPDFITGKN  722



>gb|EEE65813.1| hypothetical protein OsJ_21543 [Oryza sativa Japonica Group]
Length=723

 Score =   736 bits (1901),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 386/670 (58%), Positives = 486/670 (73%), Gaps = 47/670 (7%)
 Frame = +2

Query  65    PQGPFLQRWNRIFVIACILAATVDPLFFYIPVVDDQNKCLGLDRTLEITACILRSVFDFF  244
             PQGPFLQ WN+IFV++CI A +VDPLFFYIPV++D N C  LD+ LEITA +LR   D F
Sbjct  70    PQGPFLQSWNKIFVLSCIFAVSVDPLFFYIPVINDNNTCWYLDKKLEITASVLRFFTDIF  129

Query  245   YIFHIILQFRTGFVPPSSRVFGRGDLIVDPSAIAKRYFFSYFFIDILAVLPLPQVVLFMM  424
             YI HII QFRTG++  S   FGRG L+ D  AIAKRY  +YF ID+ AVLPLPQVV+ ++
Sbjct  130   YILHIIFQFRTGYIASSLTTFGRGVLVEDRYAIAKRYLSTYFLIDVFAVLPLPQVVILVV  189

Query  425   IPRADRPFIMVAKDILKVVILVQSVPRLLRIYPLYKEVTRTSGFFTETAWAGAAFNLFLY  604
             +P      +  AK+IL  +++ Q VPRL+RI PLY ++TR++G  TET WAGA  NL +Y
Sbjct  190   LPNLGGSEVTKAKNILMFIVICQYVPRLIRIRPLYLQITRSAGVITETPWAGAVLNLLIY  249

Query  605   MIASYVAGAIWYITAIERQDKCWRRACEKHGS-CDIDFLYCTKLGRRGGDFSSSFLNTSC  781
             ++AS+V GA+WY+ +IER+D CWR  C  + + C+  +LYC       GD  +S L T+C
Sbjct  250   LLASHVLGALWYLLSIERKDACWRDMCSNNSTVCNQAYLYC-------GDKENSILRTAC  302

Query  782   ALLEPENLKADDFDFGIFLDALKSNVVEKRYFWSKLFYCFWWGLRNLSSLGQNLKTSNFV  961
               ++  ++   D +FGI++ AL +NV +   F +KLFYC WWGL+NLSSLGQNLKTS + 
Sbjct  303   LPIDSNDI---DPNFGIYVPAL-NNVSQSTNFLAKLFYCVWWGLQNLSSLGQNLKTSTYA  358

Query  962   GEilfailisiiglilfslligNMQ-----------------------------KYLQSI  1054
              E LFA+ +SI GL+LF+LLIGN+Q                              YLQS 
Sbjct  359   WENLFAVFVSISGLVLFALLIGNVQGYETKDMEPCARFRVFIPIPFGDKTSIILTYLQSA  418

Query  1055  TVRVEEMRVKRMDAEQWMSHRMLPDNLRERIRRYEQYRWQETRGVDEESLISNLPKDLRR  1234
              +R EEMRVK  D +QWMS+R+LP+NL+ERIRR+E+YRW +T GVDEE L+ NLPKDLRR
Sbjct  419   HLREEEMRVKSRDTDQWMSYRLLPENLKERIRRHEKYRWHQTSGVDEELLLMNLPKDLRR  478

Query  1235  DINRHLCWSLLKRVHMFKTMDEQLLDAICDRLKPVLYTEKSCIVREGDPVDEMIFVMRGN  1414
              I RHLC SLL RV MF+ MD+QLL+A+CDRLKPVLYTE SCI+RE DPV+EM+F+MRGN
Sbjct  479   AIKRHLCLSLLMRVPMFENMDDQLLNALCDRLKPVLYTEGSCIIREEDPVNEMLFIMRGN  538

Query  1415  LLTMTTNGGRTGFLNSDVLNAGDFCGEELLTWALDPNSSSSLPISTRTVQALTDVEAFAL  1594
             L++MTTNGGRTGF NSDVL  GDFCGEELLTWALDP S SSLP STRTV+ +++VEAFAL
Sbjct  539   LMSMTTNGGRTGFFNSDVLKGGDFCGEELLTWALDPTSVSSLPSSTRTVKTMSEVEAFAL  598

Query  1595  TADFLKFFASQYRRLHSKQLQHKFRFYSHQWKTWAACFIQAAWRRHCRNKLEKSLREEED  1774
              A+ LKF A+Q+RRLHSKQLQH F+FYS  W+TWAACFIQAAW R+CR K+E SLRE+E 
Sbjct  599   RAEDLKFVATQFRRLHSKQLQHTFKFYSQHWRTWAACFIQAAWHRYCRKKIEDSLREKEK  658

Query  1775  RLQDALILRMRREEGETTPSLGATIYASRFAANVLRTVRRNHplsvpklsprlpplllqk  1954
             RLQ A++      +G TT S  A IYASRFA N++R +RRN      +L   +P  LLQK
Sbjct  659   RLQFAIV-----NDGATTLSFRAAIYASRFAGNMMRILRRN-ATRKARLKESVPARLLQK  712

Query  1955  pAEPDFSAPE  1984
             PAEP+F+A E
Sbjct  713   PAEPNFAAEE  722



>gb|KDO86447.1| hypothetical protein CISIN_1g004940mg [Citrus sinensis]
Length=628

 Score =   732 bits (1890),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 369/548 (67%), Positives = 439/548 (80%), Gaps = 15/548 (3%)
 Frame = +2

Query  47    KSKMHDPQGPFLQRWNRIFVIACILAATVDPLFFYIPVVDDQNKCLGLDRTLEITACILR  226
             + ++ DPQGPFLQ WN+IFV++C++A ++DPLFFY+PV+D + KCLGLD+TLEITAC+LR
Sbjct  81    EKRILDPQGPFLQWWNKIFVLSCVIALSIDPLFFYMPVIDGKRKCLGLDKTLEITACVLR  140

Query  227   SVFDFFYIFHIILQFRTGFVPPSSRVFGRGDLIVDPSAIAKRYFFSYFFIDILAVLPLPQ  406
             S  D FYI  II QFRTGF+  SSRVFGRG+L+ DP AIAKRY  SYF +DILA+LPLPQ
Sbjct  141   SFIDTFYILRIIFQFRTGFIARSSRVFGRGELVDDPKAIAKRYLMSYFIVDILAILPLPQ  200

Query  407   VVLFMMIPRADRPFIMVAKDILKVVILVQSVPRLLRIYPLYKEVTRTSGFFTETAWAGAA  586
             +V+ +++P    P  +VAK++LK +I  Q VPR+ RIYPLY +V RTSG  TETAWAGAA
Sbjct  201   LVVLIIVPAVKGPVPLVAKEMLKTIIFCQYVPRIARIYPLYNDVKRTSGILTETAWAGAA  260

Query  587   FNLFLYMIASYVAGAIWYITAIERQDKCWRRACEK---HGSCDIDFLYCTKLGRRGGDFS  757
              NLFLYM+AS++ GA WY+ +IERQD CWR  C K     +C  + LYC       G+F 
Sbjct  261   LNLFLYMLASHIFGACWYLYSIERQDSCWRDVCRKLNDTSNCTTN-LYC-------GEFH  312

Query  758   SS---FLNTSCALLEPENLKADD-FDFGIFLDALKSNVVEKRYFWSKLFYCFWWGLRNLS  925
              S    L+ SC  + P+ +K    F+FGI +DAL+S VVE+  F  K FYCFWWGLRNLS
Sbjct  313   GSNNTLLHGSCPFISPDEIKNSSMFNFGISIDALQSRVVEEHDFPKKFFYCFWWGLRNLS  372

Query  926   SLGQNLKTSNFVGEilfailisiiglilfslligNMQKYLQSITVRVEEMRVKRMDAEQW  1105
             SLGQNLKTS FVGE+ FAI ISI GL+LF+LLIGNMQKYL+S TVR+EEMRVKR DAEQW
Sbjct  373   SLGQNLKTSTFVGEVFFAIFISISGLVLFALLIGNMQKYLESTTVRLEEMRVKRQDAEQW  432

Query  1106  MSHRMLPDNLRERIRRYEQYRWQETRGVDEESLISNLPKDLRRDINRHLCWSLLKRVHMF  1285
             MSHRMLP+NLR+RIRRYEQY+WQETRGV+EE L+ NLPKDLRRDI RHLCW LL RV MF
Sbjct  433   MSHRMLPENLRDRIRRYEQYKWQETRGVEEEGLLRNLPKDLRRDIKRHLCWDLLMRVPMF  492

Query  1286  KTMDEQLLDAICDRLKPVLYTEKSCIVREGDPVDEMIFVMRGNLLTMTTNGGRTGFLNSD  1465
             + MD+QLLDA+CD LKPVLYTEKS IVREGDPV+EM+FVMRGNL++ TT GGRTGF N+ 
Sbjct  493   EKMDDQLLDAMCDHLKPVLYTEKSFIVREGDPVEEMLFVMRGNLVSTTTYGGRTGFFNAV  552

Query  1466  VLNAGDFCGEELLTWALDPNSSSSLPISTRTVQALTDVEAFALTADFLKFFASQYRRLHS  1645
              L AGDFCGE LLTWALDP SSS+ P+STRTVQALT+VEAF+L AD LK  ASQ+RRLHS
Sbjct  553   YLKAGDFCGEALLTWALDPQSSSNRPLSTRTVQALTEVEAFSLMADDLKSVASQFRRLHS  612

Query  1646  KQLQHKFR  1669
             KQLQH FR
Sbjct  613   KQLQHAFR  620



>ref|XP_006598906.1| PREDICTED: putative cyclic nucleotide-gated ion channel 13-like 
[Glycine max]
Length=656

 Score =   729 bits (1883),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 372/581 (64%), Positives = 453/581 (78%), Gaps = 11/581 (2%)
 Frame = +2

Query  47    KSKMHDPQGPFLQRWNRIFVIACILAATVDPLFFYIPVVDDQNKCLGLDRTLEITACILR  226
             +S + DPQG  LQ+WN+IFVI  ++A +VDPLFFYIP++DD+ +CL LD TL+ITA +LR
Sbjct  54    QSHVLDPQGATLQKWNKIFVITSVMAVSVDPLFFYIPMIDDKKQCLALDGTLKITASVLR  113

Query  227   SVFDFFYIFHIILQFRTGFVPPSSRVFGRGDLIVDPSAIAKRYFFSYFFIDILAVLPLPQ  406
             + FD FYI HII QFRTGF+ PSSRV GRG+L+ DP AI  RY  SYF IDIL+++PLPQ
Sbjct  114   TFFDLFYILHIIFQFRTGFIAPSSRVLGRGELVNDPWAIVMRYLSSYFIIDILSIIPLPQ  173

Query  407   VVLF--MMIPRADRPFIMVAKDILKVVILVQSVPRLLRIYPLYKEVTRTSGFFTETAWAG  580
             +V+   + IP+   P+  V KD+LK  I+ Q VPRLLRIYPL+KEVTRTSG  TETAWAG
Sbjct  174   MVILATVSIPKCSVPY--VGKDLLKYTIITQYVPRLLRIYPLFKEVTRTSGILTETAWAG  231

Query  581   AAFNLFLYMIASYVAGAIWYITAIERQDKCWRRACEKHGSCDIDFLYCTKLGRRGGDFSS  760
             AAFNLFLYM+AS+V GA WY+ ++E + +CWRR  +        +L C     R      
Sbjct  232   AAFNLFLYMLASHVVGAFWYLFSVESRLRCWRRQLKTTMIFHESYLSCG----RNNPIVL  287

Query  761   SFLNTSCALLEPENLKA-DDFDFGIFLDALKSNVVEKRY-FWSKLFYCFWWGLRNLSSLG  934
             S L  SC  ++PE+++    F+FG+F++ALKS VVE    F  K FYCFWWGLR++SS+G
Sbjct  288   SLLKYSCPYIDPESIENLATFNFGMFVEALKSRVVESTTDFTHKFFYCFWWGLRSVSSVG  347

Query  935   QNLKTSNFVGEilfailisiiglilfslligNMQKYLQSITVRVEEMRVKRMDAEQWMSH  1114
             Q L+TS++VGEI+FAILI++ GL+LF+ LI NMQKYLQS +VRVEEMRVKR DAE WMSH
Sbjct  348   QGLETSSYVGEIIFAILIAVFGLVLFASLIANMQKYLQSTSVRVEEMRVKRRDAELWMSH  407

Query  1115  RMLPDNLRERIRRYEQYRWQETRGVDEESLISNLPKDLRRDINRHLCWSLLKRVHMFKTM  1294
             RMLPD L+ERIRRYEQY+WQE +G +EE+LI NLPKDLRRDI RHLC  LL++V MF+ M
Sbjct  408   RMLPDLLKERIRRYEQYKWQENKGAEEETLIRNLPKDLRRDIKRHLCLELLRKVPMFEDM  467

Query  1295  DEQLLDAICDRLKPVLYTEKSCIVREGDPVDEMIFVMRGNLLTMTTNGGRTGFLNSDVLN  1474
             D QLLDA+CDRLKPVLYTEKS IVREGDPVDEM+F+MRG L T TTNGGRTGF NS  + 
Sbjct  468   DNQLLDALCDRLKPVLYTEKSYIVREGDPVDEMLFIMRGKLATATTNGGRTGFFNSFEIK  527

Query  1475  AGDFCGEELLTWALDPNSSSSLPISTRTVQALTDVEAFALTADFLKFFASQYRR-LHSKQ  1651
             AGDFCGEELLTWALDPNSSS+LPISTRTVQ ++ VEAFAL +D L F ASQ+RR L+SKQ
Sbjct  528   AGDFCGEELLTWALDPNSSSNLPISTRTVQTISTVEAFALMSDDLMFVASQFRRLLNSKQ  587

Query  1652  LQHKFRFYSHQWKTWAACFIQAAWRRHCRNKLEKSLREEED  1774
             LQH FRFYS QW+TWAA F+QAAWRR+ + K   + R   D
Sbjct  588   LQHTFRFYSLQWRTWAARFLQAAWRRYRKRKESTTHRSFTD  628



>ref|XP_004951290.1| PREDICTED: cyclic nucleotide-gated ion channel 1-like [Setaria 
italica]
Length=636

 Score =   726 bits (1874),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 364/619 (59%), Positives = 463/619 (75%), Gaps = 19/619 (3%)
 Frame = +2

Query  50    SKMHDPQGPFLQRWNRIFVIACILAATVDPLFFYIPVVDDQNKCLGLDRTLEITACILRS  229
             +++ DPQGPFLQ WN+IFVI+C+++ +VD LFFY P VD  N CL LD  L+  A ILRS
Sbjct  5     ARVLDPQGPFLQTWNKIFVISCLVSVSVDSLFFYAPAVDGDNNCLYLDDKLDKIASILRS  64

Query  230   VFDFFYIFHIILQFRTGFVPPSSRVFGRGDLIVDPSAIAKRYFFSYFFIDILAVLPLPQV  409
             + D FY+  +I QFRTGF   SSRVFG G L+ D   IAK+YF +YF +D LAVLPLPQV
Sbjct  65    LTDIFYLLRMIFQFRTGFTASSSRVFGHGVLVDDTFEIAKQYFTTYFLVDFLAVLPLPQV  124

Query  410   VLFMMIPRADRPFIMVAKDILKVVILVQSVPRLLRIYPLYKEVTRTSGFFTETAWAGAAF  589
              + ++ P      +M  K+IL ++++ Q VPRL+RI PLY ++TR++G   +TAW GAAF
Sbjct  125   FVLLVRPHLRGSEVMTEKNILTLIVICQYVPRLIRIIPLYIQITRSAGTVMDTAWPGAAF  184

Query  590   NLFLYMIASYVAGAIWYITAIERQDKCWRRACEKHGSCDIDFLYCTKLGRRGGDF--SSS  763
             NL +Y++AS+V GA+WYI AI+RQD CWR AC     CD+  LYC      G     +++
Sbjct  185   NLLVYILASHVLGALWYILAIQRQDICWREACNGQDGCDLASLYC------GSSVYGNNT  238

Query  764   FLNTSCALLEPENLKAD-DFDFGIFLDALKSNVVEKRYFWSKLFYCFWWGLRNLSSLGQN  940
             FL  +C    P N  AD D  FGI+L  L+ NV +   F+ KLFYCFWWGL+NL S GQN
Sbjct  239   FLQDAC----PTNGDADIDPIFGIYLPVLQ-NVSQSTGFFEKLFYCFWWGLQNLCSYGQN  293

Query  941   LKTSNFVGEilfailisiiglilfslligNMQKYLQSITVRVEEMRVKRMDAEQWMSHRM  1120
             LKTS ++ E LFA+ +S  GL+LF+LLIGN+Q YLQS +  +EEMRVKR D EQWM+ R+
Sbjct  294   LKTSTYIWENLFAVFVSTSGLVLFALLIGNVQTYLQSASGHIEEMRVKRRDTEQWMAQRL  353

Query  1121  LPDNLRERIRRYEQYRWQETRGVDEESLISNLPKDLRRDINRHLCWSLLKRVHMFKTMDE  1300
             LP++++ERI R++QY+WQET+GVDEE LI NLPKDLRRD+ RHLC  LL RV MF+ MD+
Sbjct  354   LPEDIKERILRHDQYKWQETQGVDEEDLIINLPKDLRRDVKRHLCLLLLMRVPMFENMDD  413

Query  1301  QLLDAICDRLKPVLYTEKSCIVREGDPVDEMIFVMRGNLLTMTTNGGRTGFLNSDVLNAG  1480
             QLLDA+CDRLKP+L TE SCI+REGDPV+EM+F+MRG L +MTTNGGR GF NS+VL  G
Sbjct  414   QLLDAMCDRLKPMLCTEGSCIIREGDPVNEMLFIMRGTLESMTTNGGRMGFFNSNVLKGG  473

Query  1481  DFCGEELLTWALDPNSSSSLPISTRTVQALTDVEAFALTADFLKFFASQYRRLHSKQLQH  1660
             DFCGEELLTWALDP S S+LP STRTV+ L++VE FAL AD L+F A+QYRRLHSKQL+H
Sbjct  474   DFCGEELLTWALDPTSGSNLPSSTRTVKTLSEVEGFALRADQLRFVATQYRRLHSKQLRH  533

Query  1661  KFRFYSHQWKTWAACFIQAAWRRHCRNKLEKSLREEEDRLQDALILRMRREEGETTPSLG  1840
              FRFYS QW+TWAACFIQAAW R+CR K+E SL E+E R Q A++      +G ++ SLG
Sbjct  534   TFRFYSQQWRTWAACFIQAAWHRYCRKKMEDSLYEKERRFQAAIV-----SDGSSSRSLG  588

Query  1841  ATIYASRFAANVLRTVRRN  1897
             A +YA+ FA N++R +RRN
Sbjct  589   AALYAAHFACNMVRVLRRN  607



>emb|CDP10239.1| unnamed protein product [Coffea canephora]
Length=739

 Score =   730 bits (1885),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 375/652 (58%), Positives = 483/652 (74%), Gaps = 19/652 (3%)
 Frame = +2

Query  47    KSKMHDPQGPFLQRWNRIFVIACILAATVDPLFFYIPVVDDQNKCLGLDRTLEITACILR  226
             + K+ DPQ  FL +WNR FVI+CILA +VDP+FFY+PV D++  CLG+ R+L I A  LR
Sbjct  96    EKKIFDPQDKFLLQWNRFFVISCILAVSVDPIFFYLPVFDNKANCLGIHRSLAIIATTLR  155

Query  227   SVFDFFYIFHIILQFRTGFVPPSSRVFGRGDLIVDPSAIAKRYFFSYFFIDILAVLPLPQ  406
             +V D FY+ H++LQFRT F+ PSSRVFGRG+L++DP+ IAKRY  SYF ID L+VLPLPQ
Sbjct  156   TVIDAFYLIHMVLQFRTAFIAPSSRVFGRGELVIDPAQIAKRYVRSYFIIDFLSVLPLPQ  215

Query  407   VVLFMMIPRADRPFIMVAKDILKVVILVQSVPRLLRIYPLYKEVTRTSGFFTETAWAGAA  586
             +V++  + +++   +   K  L V+I++Q +PR +R+ PL  E+ RT+G F +TAWAGA 
Sbjct  216   IVVWRFLQKSEGSDVYTTKQALLVIIILQYIPRFIRVLPLTSELKRTTGVFAQTAWAGAV  275

Query  587   FNLFLYMIASYVAGAIWYITAIERQDKCWRRACE-KHGSCDIDFLYCTKLGRRGGDFSS-  760
             + L LYM+AS++ GA+WY+ ++ER D CW++AC+ + G C+ +FLYC     +  DF+S 
Sbjct  276   YYLLLYMLASHIVGALWYLLSVERNDYCWQKACKTRLGQCNTNFLYCGNQNMK--DFNSW  333

Query  761   -----SFLNTSCALLEPENLKADDFDFGIFLDALKSNVVEKRYFWSKLFYCFWWGLRNLS  925
                  S LN SC +     ++   FDFGIF  AL S ++  + F SK  YC WWGL+NLS
Sbjct  334   SGISESVLNASCGV----GVENPPFDFGIFEQALSSGIIYSKKFISKYCYCLWWGLQNLS  389

Query  926   SLGQNLKTSNFVGEilfailisiiglilfslligNMQKYLQSITVRVEEMRVKRMDAEQW  1105
             +LGQ L+TS + GE LF+I ++I GLILF+LLIGNMQ YLQS+T+R+EEMRVKR D+EQW
Sbjct  390   TLGQGLQTSTYPGESLFSIALAIFGLILFALLIGNMQTYLQSLTIRLEEMRVKRRDSEQW  449

Query  1106  MSHRMLPDNLRERIRRYEQYRWQETRGVDEESLISNLPKDLRRDINRHLCWSLLKRVHMF  1285
             M HR+LP +LRER+RRY+QY+W ETRGVDEESL+ +LPKDLRRDI RHLC +L+KRV +F
Sbjct  450   MHHRLLPQDLRERVRRYDQYKWLETRGVDEESLVQSLPKDLRRDIKRHLCLALVKRVPLF  509

Query  1286  KTMDEQLLDAICDRLKPVLYTEKSCIVREGDPVDEMIFVMRGNLLTMTTNGGRTGFLNSD  1465
             + MDE+LLDAIC+RLKP LYTE + IVREGDPVDEM+F++RG L ++TT+GGR+GF N  
Sbjct  510   ENMDERLLDAICERLKPCLYTENTYIVREGDPVDEMLFIIRGRLESVTTDGGRSGFFNRS  569

Query  1466  VLNAGDFCGEELLTWALDPNSSSSLPISTRTVQALTDVEAFALTADFLKFFASQYRRLHS  1645
             +L  GDFCGEELLTWALDP S S+LP STRTV+AL +VEAFALTAD LKF A Q+RRLHS
Sbjct  570   LLKEGDFCGEELLTWALDPKSGSNLPSSTRTVKALMEVEAFALTADELKFVAGQFRRLHS  629

Query  1646  KQLQHKFRFYSHQWKTWAACFIQAAWRRHCRNKLEKSLREEEDRLQDALILRMRREEGET  1825
             +Q+QH FRFYS QW+TWAACFIQAAWRR+C+ KL +  R+EE+    A            
Sbjct  630   RQVQHTFRFYSQQWRTWAACFIQAAWRRYCKRKLMELRRKEEEEEAAAAAAAGGSNNAGG  689

Query  1826  TP-SLGATIYASRFAANVLRTVRRNHplsvpklsprlpplllqkpAEPDFSA  1978
                SLGAT  ASRFAAN LR V RN       L      + LQKP EPDF+A
Sbjct  690   GSYSLGATFLASRFAANALRGVHRNR-----NLRSARELMKLQKPPEPDFTA  736



>ref|XP_008367750.1| PREDICTED: probable cyclic nucleotide-gated ion channel 5 [Malus 
domestica]
Length=674

 Score =   726 bits (1873),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 374/647 (58%), Positives = 479/647 (74%), Gaps = 15/647 (2%)
 Frame = +2

Query  53    KMHDPQGPFLQRWNRIFVIACILAATVDPLFFYIPVVDDQNKCLGLDRTLEITACILRSV  232
             K++DPQ  FL  WNR FVI+CILA +VDPLFFY+PV++  + CLG+DR L ITA  LR +
Sbjct  34    KIYDPQDKFLLLWNRFFVISCILAVSVDPLFFYLPVINSSSNCLGIDRRLAITATTLRMI  93

Query  233   FDFFYIFHIILQFRTGFVPPSSRVFGRGDLIVDPSAIAKRYFFSYFFIDILAVLPLPQVV  412
              D FY+ H+ LQFRT ++ PSSRVFGRG+L++DP+ IAKRY  SYF ID L+VLPLPQ+V
Sbjct  94    VDAFYLIHMALQFRTAYIAPSSRVFGRGELVIDPARIAKRYLRSYFIIDFLSVLPLPQIV  153

Query  413   LFMMIPRADRPFIMVAKDILKVVILVQSVPRLLRIYPLYKEVTRTSGFFTETAWAGAAFN  592
             ++  + R+    ++  K  L  ++L Q +PRL R+YPL  E+ RT+G F ETAWAGAA+ 
Sbjct  154   VWRFLQRSKGSDVLATKQALLYIVLFQYIPRLFRVYPLTSELKRTAGVFAETAWAGAAYY  213

Query  593   LFLYMIASYVAGAIWYITAIERQDKCWRRACEKHGS-CDIDFLYCTKLGRRGGDFSSSFL  769
             L LYM+AS++ GA WY+ A+ER D CW+ AC   G  CD + LYC   G +    ++++ 
Sbjct  214   LLLYMLASHIVGAFWYLLALERNDTCWQMACSDFGKXCDKNLLYC---GNQNNLDNATWS  270

Query  770   NTSCALLEPENLKADD----FDFGIFLDALKSNVVEKRYFWSKLFYCFWWGLRNLSSLGQ  937
             N +  +L      ADD    FDFGIF  AL S VV  + F  K  YC WWGL+NLS+LGQ
Sbjct  271   NVTGNILS--KCSADDNNTYFDFGIFNSALSSGVVSSKKFIVKYCYCLWWGLQNLSTLGQ  328

Query  938   NLKTSNFVGEilfailisiiglilfslligNMQKYLQSITVRVEEMRVKRMDAEQWMSHR  1117
              L TS + GE++F+I ++I GLILF+LLIGNMQ YLQS+T+R+EEMRVKR D+EQWM HR
Sbjct  329   GLATSTYPGEVIFSISLAIFGLILFALLIGNMQTYLQSLTIRLEEMRVKRRDSEQWMHHR  388

Query  1118  MLPDNLRERIRRYEQYRWQETRGVDEESLISNLPKDLRRDINRHLCWSLLKRVHMFKTMD  1297
             +LP +LRER+RRY+QY+W ETRGVDE+SL+ +LPKDLRRDI RHLC +L++RV +F+ MD
Sbjct  389   LLPQDLRERVRRYDQYKWLETRGVDEQSLVQSLPKDLRRDIKRHLCLALVRRVPLFENMD  448

Query  1298  EQLLDAICDRLKPVLYTEKSCIVREGDPVDEMIFVMRGNLLTMTTNGGRTGFLNSDVLNA  1477
             E+LLDAIC+RLKP L+TE + IVREGDPVDEM+F++RG L ++TT+GGR+GF N  +L  
Sbjct  449   ERLLDAICERLKPSLFTESTYIVREGDPVDEMLFIIRGRLESVTTDGGRSGFFNRSLLKE  508

Query  1478  GDFCGEELLTWALDPNSSSSLPISTRTVQALTDVEAFALTADFLKFFASQYRRLHSKQLQ  1657
             GDFCGEELLTWALDP S ++LP STRTV+ALT+VEAFAL A+ LKF ASQ+RRLHS+Q+Q
Sbjct  509   GDFCGEELLTWALDPKSGANLPSSTRTVKALTEVEAFALVAEELKFVASQFRRLHSRQVQ  568

Query  1658  HKFRFYSHQWKTWAACFIQAAWRRHCRNKLEKSLREEEDRLQDALILRMRREEGETTPSL  1837
             H FRFYS QW+TWAACFIQAAWRR+ + K+ +  R+EE+   +A  L   R     + S+
Sbjct  569   HTFRFYSQQWRTWAACFIQAAWRRYSKRKILELRRKEEEEEAEAEALGGARSNAGGSYSI  628

Query  1838  GATIYASRFAANVLRTVRRNHplsvpklsprlpplllqkpAEPDFSA  1978
             GAT  ASRFAAN LR V RN       L      + LQKP EPDFSA
Sbjct  629   GATFLASRFAANALRGVHRNR-----NLKSARELVKLQKPPEPDFSA  670



>ref|XP_006293366.1| hypothetical protein CARUB_v10022706mg [Capsella rubella]
 gb|EOA26264.1| hypothetical protein CARUB_v10022706mg [Capsella rubella]
Length=745

 Score =   727 bits (1877),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 366/653 (56%), Positives = 487/653 (75%), Gaps = 11/653 (2%)
 Frame = +2

Query  47    KSKMHDPQGPFLQRWNRIFVIACILAATVDPLFFYIPVVDDQNKCLGLDRTLEITACILR  226
             + K+ DPQ  FL   N++FV +CILA +VDPLF Y+P ++D+ KC+G+DR L I A  +R
Sbjct  99    EKKIFDPQDKFLLLCNKLFVASCILAVSVDPLFLYLPFINDKAKCVGIDRKLAIIATTIR  158

Query  227   SVFDFFYIFHIILQFRTGFVPPSSRVFGRGDLIVDPSAIAKRYFFSYFFIDILAVLPLPQ  406
             +V D FY+FH+ L+FRT +V PSSRVFGRG+L++DP+ IAKRY   YF ID+L+VLP+PQ
Sbjct  159   TVIDSFYLFHMALRFRTAYVAPSSRVFGRGELVIDPAQIAKRYLQQYFIIDLLSVLPVPQ  218

Query  407   VVLFMMIPRADRPFIMVAKDILKVVILVQSVPRLLRIYPLYKEVTRTSGFFTETAWAGAA  586
             +V++  +  +    ++  K  L+ ++LVQ +PR LR+YPL  E+ RT+G F ETAWAGAA
Sbjct  219   IVVWRFLINSKGANVLATKQALRYIVLVQYIPRFLRMYPLSSELKRTAGVFAETAWAGAA  278

Query  587   FNLFLYMIASYVAGAIWYITAIERQDKCWRRACEKHGSCDIDFLYCTKLGRRG----GDF  754
             + L LYM+AS++ GA+WY+ A+ER + CW +AC  + +C  +FL+C      G       
Sbjct  279   YYLLLYMLASHIVGALWYLLALERNNDCWSKACHDNTTCARNFLFCGNQNMPGYAAWDKI  338

Query  755   SSSFLNTSCALLEPENLKADDFDFGIFLDALKSNVVEKRYFWSKLFYCFWWGLRNLSSLG  934
               S L   C +  PE+ +   FDFGI+L AL S +V  + F SK F+C WWGL+NLS+LG
Sbjct  339   KDSVLQAHCPVNVPED-EEPPFDFGIYLRALSSGIVANKNFVSKYFFCLWWGLQNLSTLG  397

Query  935   QNLKTSNFVGEilfailisiiglilfslligNMQKYLQSITVRVEEMRVKRMDAEQWMSH  1114
             Q L+TS + GE++F+I ++I GL+LF+LLIGNMQ YLQS+T+R+EEMRVKR D+EQWM H
Sbjct  398   QGLETSTYPGEVIFSITLAIAGLLLFALLIGNMQTYLQSLTIRLEEMRVKRRDSEQWMHH  457

Query  1115  RMLPDNLRERIRRYEQYRWQETRGVDEESLISNLPKDLRRDINRHLCWSLLKRVHMFKTM  1294
             RMLP  LRER+RRY+QY+W ETRGVDEE+L+ NLPKDLRRDI RHLC +L++RV +F+ M
Sbjct  458   RMLPPELRERVRRYDQYKWLETRGVDEENLVQNLPKDLRRDIKRHLCLALVRRVPLFENM  517

Query  1295  DEQLLDAICDRLKPVLYTEKSCIVREGDPVDEMIFVMRGNLLTMTTNGGRTGFLNSDVLN  1474
             DE+LLDAIC+RLKP L+TEKS +VREGDPV+EM+F++RG L ++TT+GGR+GF N  +L 
Sbjct  518   DERLLDAICERLKPCLFTEKSYLVREGDPVNEMLFIIRGRLESVTTDGGRSGFYNRSLLK  577

Query  1475  AGDFCGEELLTWALDPNSSSSLPISTRTVQALTDVEAFALTADFLKFFASQYRRLHSKQL  1654
              GDFCG+ELLTWALDP S S+LP STRTV+ALT+VEAFAL AD LKF ASQ+RRLHS+Q+
Sbjct  578   EGDFCGDELLTWALDPKSGSNLPSSTRTVKALTEVEAFALIADELKFVASQFRRLHSRQV  637

Query  1655  QHKFRFYSHQWKTWAACFIQAAWRRHC-RNKLEKSLREEEDRLQDALILRMRREEGETTP  1831
             QH FRFYS QW+TWAACFIQAAWRR+  R KLE+  +EEE+  + A ++      G +  
Sbjct  638   QHTFRFYSQQWRTWAACFIQAAWRRYTKRKKLEQLRKEEEEEEESASVI-----AGGSPY  692

Query  1832  SLGATIYASRFAANVLRTVRRNHplsvpklsprlpplllqkpAEPDFSAPENN  1990
             S+ AT  AS+FAAN LR+V +N       LS     +  QKP EPDFSA +++
Sbjct  693   SIRATFLASKFAANALRSVHKNRTAKSALLSSTKELVKFQKPPEPDFSAEDHH  745



>ref|XP_004251749.1| PREDICTED: probable cyclic nucleotide-gated ion channel 5 [Solanum 
lycopersicum]
 ref|XP_010313820.1| PREDICTED: probable cyclic nucleotide-gated ion channel 5 [Solanum 
lycopersicum]
 ref|XP_010313821.1| PREDICTED: probable cyclic nucleotide-gated ion channel 5 [Solanum 
lycopersicum]
Length=692

 Score =   724 bits (1870),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 359/621 (58%), Positives = 458/621 (74%), Gaps = 10/621 (2%)
 Frame = +2

Query  47    KSKMHDPQGPFLQRWNRIFVIACILAATVDPLFFYIPVVDDQNKCLGLDRTLEITACILR  226
             + K+ DPQ  FL  WN++FVI+CILA +VDPLFFY+PV DD++ CL +DR L + A  LR
Sbjct  53    EKKIFDPQDKFLLLWNKLFVISCILAVSVDPLFFYLPVFDDKSNCLQIDRKLAVIATTLR  112

Query  227   SVFDFFYIFHIILQFRTGFVPPSSRVFGRGDLIVDPSAIAKRYFFSYFFIDILAVLPLPQ  406
             +V D FY+ H+ LQFRT ++ PSSRVFGRG+L++DP  IAKRY  SYF ID+LAV+PLPQ
Sbjct  113   TVVDAFYLIHMALQFRTAYIAPSSRVFGRGELVIDPGQIAKRYLRSYFIIDLLAVVPLPQ  172

Query  407   VVLFMMIPRADRPFIMVAKDILKVVILVQSVPRLLRIYPLYKEVTRTSGFFTETAWAGAA  586
             +V    + R+    ++  K  L  +IL+Q +PR +R+ PL  E+ RT+G F ETAWAGAA
Sbjct  173   IVAGRFLQRSTGSDVLATKQALLYIILLQYIPRFVRVIPLTSELKRTTGVFAETAWAGAA  232

Query  587   FNLFLYMIASYVAGAIWYITAIERQDKCWRRACEKHGSCDIDFLYCTKLGRRG----GDF  754
               L LYM+AS++ G+ WY+ ++ER D CW RAC  + +C  DFLYC   G  G     + 
Sbjct  233   SYLLLYMLASHIVGSFWYLLSVERYDTCWERACSHNTTCQTDFLYCGNQGMTGYNAWSNI  292

Query  755   SSSFLNTSCALLEPENLKADDFDFGIFLDALKSNVVEKRYFWSKLFYCFWWGLRNLSSLG  934
             S S LN +C    P +     FDFGIF  AL S +V    F +K  YC WWGL+NLS+LG
Sbjct  293   SESVLNGAC----PRSGDNPPFDFGIFAQALSSGIVFSMKFVTKYCYCLWWGLQNLSTLG  348

Query  935   QNLKTSNFVGEilfailisiiglilfslligNMQKYLQSITVRVEEMRVKRMDAEQWMSH  1114
             Q L+TS + GE LF+I ++I+GLILF+LLIGNMQ YLQS+T+R+EEMRV+R D+EQWM H
Sbjct  349   QGLQTSTYPGESLFSIALAILGLILFALLIGNMQTYLQSLTIRLEEMRVRRRDSEQWMHH  408

Query  1115  RMLPDNLRERIRRYEQYRWQETRGVDEESLISNLPKDLRRDINRHLCWSLLKRVHMFKTM  1294
             R+LP  LRER+R Y+QY+WQETRGVDEE+++ NLPKDLRRDI RHLC +L+KRV +F  M
Sbjct  409   RLLPQELRERVRGYDQYKWQETRGVDEENIVQNLPKDLRRDIKRHLCLALVKRVPLFANM  468

Query  1295  DEQLLDAICDRLKPVLYTEKSCIVREGDPVDEMIFVMRGNLLTMTTNGGRTGFLNSDVLN  1474
             +E+LLDAIC+ LKP LY E + +VREGDPVDEM+FV+RG L ++TT+GGR+GF N  +L 
Sbjct  469   EERLLDAICEHLKPCLYIENTYLVREGDPVDEMLFVIRGRLESVTTDGGRSGFFNRSLLK  528

Query  1475  AGDFCGEELLTWALDPNSSSSLPISTRTVQALTDVEAFALTADFLKFFASQYRRLHSKQL  1654
               DFCGEELLTWALDP S S+LP STRTV+ALT+VEAFAL AD LKF ASQ+R+LHS+Q+
Sbjct  529   ESDFCGEELLTWALDPKSGSNLPSSTRTVKALTEVEAFALIADELKFVASQFRKLHSRQV  588

Query  1655  QHKFRFYSHQWKTWAACFIQAAWRRHCRNKLEKSLREEEDRLQDALILRMRREEGETTPS  1834
             QH FRFYS  W+TWAACFIQAAWRR  + KL + L+ +ED   +AL        G  + S
Sbjct  589   QHTFRFYSQHWRTWAACFIQAAWRRFTKRKLME-LQRKEDEEAEALA-GASSNSGGASFS  646

Query  1835  LGATIYASRFAANVLRTVRRN  1897
             +GAT  ASRFAAN LR V +N
Sbjct  647   IGATFLASRFAANALRGVHKN  667



>ref|XP_002529385.1| Cyclic nucleotide-gated ion channel, putative [Ricinus communis]
 gb|EEF32981.1| Cyclic nucleotide-gated ion channel, putative [Ricinus communis]
Length=735

 Score =   725 bits (1872),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 367/652 (56%), Positives = 483/652 (74%), Gaps = 17/652 (3%)
 Frame = +2

Query  47    KSKMHDPQGPFLQRWNRIFVIACILAATVDPLFFYIPVVDDQNKCLGLDRTLEITACILR  226
             + K+ DPQ  FL   NR+FVI+CIL  +VDPLFFY+PV +D   CLG+DR L I A  LR
Sbjct  97    EKKIFDPQDKFLLLCNRLFVISCILGVSVDPLFFYLPVFNDPAHCLGIDRKLAIIATTLR  156

Query  227   SVFDFFYIFHIILQFRTGFVPPSSRVFGRGDLIVDPSAIAKRYFFSYFFIDILAVLPLPQ  406
             +V D FY+  + LQFRT ++ PSSRVFGRG+L++DP+ IAKRY   YF ID L+VLPLPQ
Sbjct  157   TVIDAFYLIRMALQFRTAYIAPSSRVFGRGELVIDPAQIAKRYLRQYFIIDFLSVLPLPQ  216

Query  407   VVLFMMIPRADRPFIMVAKDILKVVILVQSVPRLLRIYPLYKEVTRTSGFFTETAWAGAA  586
             +V++  + R++   ++  K  L  ++L+Q +PR LRI+PL+ E+ RT+G F ETAWAGAA
Sbjct  217   IVVWRFLQRSNGSDVLATKQALLFIVLLQYIPRFLRIFPLFSEMKRTTGVFAETAWAGAA  276

Query  587   FNLFLYMIASYVAGAIWYITAIERQDKCWRRACEKHGSCDIDFLYCTKLGRRGGDFSSSF  766
               L +YM+AS++ GA WY+ A+ERQD CW++AC     C+ +FLYC+   +   D++S +
Sbjct  277   CYLLMYMLASHIVGAFWYLLAVERQDTCWQKACHDTEKCNKNFLYCSN--QHMSDYAS-W  333

Query  767   LNTSCALLEPENLKADD---FDFGIFLDALKSNVVEKRYFWSKLFYCFWWGLRNLSSLGQ  937
              N S  +L+ +    D+   FD+GI+ +AL S +     F SK  YC WWGL+NLS+LGQ
Sbjct  334   ANISSNVLQSKCEAKDEDGPFDYGIYTNALSSGIASSMKFISKYCYCLWWGLQNLSTLGQ  393

Query  938   NLKTSNFVGEilfailisiiglilfslligNMQKYLQSITVRVEEMRVKRMDAEQWMSHR  1117
              L+TS + GE++F+I ++I GLILF+LLIGNMQ YLQS+T+R+EEMRVKR D+EQWM HR
Sbjct  394   GLQTSTYPGEVIFSISLAIFGLILFALLIGNMQTYLQSLTIRLEEMRVKRRDSEQWMHHR  453

Query  1118  MLPDNLRERIRRYEQYRWQETRGVDEESLISNLPKDLRRDINRHLCWSLLKRVHMFKTMD  1297
             +LP +LRER+RRY+QY+W ETRGVDEESL+ +LPKDLRRDI RHLC +L++RV +F+ MD
Sbjct  454   LLPQDLRERVRRYDQYKWLETRGVDEESLVQSLPKDLRRDIKRHLCLALVRRVPLFENMD  513

Query  1298  EQLLDAICDRLKPVLYTEKSCIVREGDPVDEMIFVMRGNLLTMTTNGGRTGFLNSDVLNA  1477
             E+LLDAIC+RLKP L+TE++ IVREGDPVDEM+F++RG L ++TT+GGR+GF N  +L  
Sbjct  514   ERLLDAICERLKPCLFTERTYIVREGDPVDEMLFIIRGRLESVTTDGGRSGFFNRSLLKE  573

Query  1478  GDFCGEELLTWALDPNSSSSLPISTRTVQALTDVEAFALTADFLKFFASQYRRLHSKQLQ  1657
             GDFCGEELLTWALDP S  +LP STRTV+ALT+VEAFAL A+ LKF ASQ+RRLHS+Q+Q
Sbjct  574   GDFCGEELLTWALDPKSGVNLPSSTRTVKALTEVEAFALIAEELKFVASQFRRLHSRQVQ  633

Query  1658  HKFRFYSHQWKTWAACFIQAAWRRHCRNK-LEKSLREEEDRLQDALILRMRREEGETTPS  1834
             H FRFYS QW+TWAACFIQAAWRR+ + K +E   +EEED + +      R   G  + S
Sbjct  634   HTFRFYSQQWRTWAACFIQAAWRRYSKRKNMELRRKEEEDEVDET-----RSNAGGGSYS  688

Query  1835  LGATIYASRFAANVLRTVRRNHplsvpklsprlpplllqkpAEPDFSAPENN  1990
             +GAT  A+RFAAN LR V RN              + LQKP EPDFSA + +
Sbjct  689   IGATFLATRFAANALRGVHRNR-----NAKTARELVKLQKPPEPDFSAEDAD  735



>ref|XP_011079403.1| PREDICTED: probable cyclic nucleotide-gated ion channel 5 [Sesamum 
indicum]
Length=735

 Score =   724 bits (1870),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 371/648 (57%), Positives = 471/648 (73%), Gaps = 15/648 (2%)
 Frame = +2

Query  47    KSKMHDPQGPFLQRWNRIFVIACILAATVDPLFFYIPVVDDQNKCLGLDRTLEITACILR  226
             + K+ DPQ   L  WN++FV +CIL  +VDPLFF++PV +  + CL +DR L ITA  LR
Sbjct  96    EKKIFDPQDKLLTFWNKLFVTSCILGVSVDPLFFFLPVFNQSSNCLDIDRKLAITATTLR  155

Query  227   SVFDFFYIFHIILQFRTGFVPPSSRVFGRGDLIVDPSAIAKRYFFSYFFIDILAVLPLPQ  406
             ++ D FY+ H+ LQFRT ++ PSSRVFGRG+L++DP+ IAKRY   YF ID LAVLPLPQ
Sbjct  156   TIVDAFYLIHMALQFRTAYIAPSSRVFGRGELVIDPAQIAKRYLKCYFIIDFLAVLPLPQ  215

Query  407   VVLFMMIPRADRPFIMVAKDILKVVILVQSVPRLLRIYPLYKEVTRTSGFFTETAWAGAA  586
             +V++  + R+    ++  K  L  +I +Q +PR  R++PL  E+ RTSG F ETAWAGA 
Sbjct  216   IVVWRFLQRSKGSDVLGTKQALFYIIWLQYIPRFARVFPLTSELKRTSGVFAETAWAGAV  275

Query  587   FNLFLYMIASYVAGAIWYITAIERQDKCWRRACEKHGSCDIDFLYCTKLGRRGGDF----  754
               L LYM+AS++ GA WY+ ++ER D CW+RAC   G C  +FLYC      G D     
Sbjct  276   SYLLLYMLASHIVGAFWYLLSVERNDTCWQRACRHSGKCITNFLYCGNQNMPGYDIWSNI  335

Query  755   SSSFLNTSCALLEPENLKADDFDFGIFLDALKSNVVEKRYFWSKLFYCFWWGLRNLSSLG  934
             S S L ++C + + +N+    FDFGIF  AL S +V  R F SK  YC WWGL+NLS+LG
Sbjct  336   SVSVLTSACPVDDEKNMP---FDFGIFRQALSSGIVSSRKFLSKYCYCLWWGLQNLSTLG  392

Query  935   QNLKTSNFVGEilfailisiiglilfslligNMQKYLQSITVRVEEMRVKRMDAEQWMSH  1114
             Q L+TS F GE +F+I ++I+GLILF+LLIGNMQ YLQS+T+R+EEMRVKR D+EQWM H
Sbjct  393   QGLQTSTFPGESIFSIALAILGLILFALLIGNMQTYLQSLTIRLEEMRVKRRDSEQWMHH  452

Query  1115  RMLPDNLRERIRRYEQYRWQETRGVDEESLISNLPKDLRRDINRHLCWSLLKRVHMFKTM  1294
             R+LP +LRER+RRY+QY+W ETRGVDEESL+ +LPKDLRRDI RHLC +L+KRV +F+ M
Sbjct  453   RLLPPDLRERVRRYDQYKWLETRGVDEESLVQSLPKDLRRDIKRHLCLALVKRVPLFENM  512

Query  1295  DEQLLDAICDRLKPVLYTEKSCIVREGDPVDEMIFVMRGNLLTMTTNGGRTGFLNSDVLN  1474
             DE+LLDAIC+RLKP LYTE + IVREGDPVDEMIF++RG L ++TT+GGR+GF N  +L 
Sbjct  513   DERLLDAICERLKPCLYTENTYIVREGDPVDEMIFLIRGRLESVTTDGGRSGFFNRSLLK  572

Query  1475  AGDFCGEELLTWALDPNSSSSLPISTRTVQALTDVEAFALTADFLKFFASQYRRLHSKQL  1654
              GDFCGEELLTWALDP S S+LP STRTV+ALT+VEAFALTAD LKF ASQ+RRLHS+Q+
Sbjct  573   EGDFCGEELLTWALDPKSGSNLPSSTRTVKALTEVEAFALTADELKFVASQFRRLHSRQV  632

Query  1655  QHKFRFYSHQWKTWAACFIQAAWRRHCRNKLEKSLREEEDRLQDALILRMRREEGETTPS  1834
             QH FRFYS QW+TWAACFIQAAWRR+ + KL   +  +    +   +       G  + S
Sbjct  633   QHTFRFYSQQWRTWAACFIQAAWRRYSKRKL---MELKRKEEEAEELAGASSNAGGGSYS  689

Query  1835  LGATIYASRFAANVLRTVRRNHplsvpklsprlpplllqkpAEPDFSA  1978
             +GAT  ASRFAAN LR V RN       L      + LQKP EPDF+A
Sbjct  690   IGATFLASRFAANALRGVHRNR-----NLKSARELVKLQKPPEPDFTA  732



>emb|CDY42047.1| BnaC04g01250D [Brassica napus]
Length=701

 Score =   723 bits (1866),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 371/616 (60%), Positives = 471/616 (76%), Gaps = 13/616 (2%)
 Frame = +2

Query  53    KMHDPQGPFLQRWNRIFVIACILAATVDPLFFYIPVVDDQNKCLGLDRTLEITACILRSV  232
             ++ +P   +LQ WN+IF++ C++A   DPLFF+IPVVD    CL LD+ LE  AC+ R+ 
Sbjct  69    RVMNPNDSYLQNWNKIFLLLCVVALAFDPLFFFIPVVDPGRFCLKLDKKLEAVACVFRTF  128

Query  233   FDFFYIFHIILQFRTGFVPPSSRVFGRGDLIVDPSAIAKRYFFSYFFIDILAVLPLPQVV  412
              D FY+ H++ QF TGF+ PSSR FGRG+L+     IA RY  SYF ID+L++LP+PQVV
Sbjct  129   IDAFYVVHMLFQFNTGFIAPSSRGFGRGELVQSYKKIAVRYLKSYFIIDVLSILPIPQVV  188

Query  413   LFMMIPRADRPFIMVAKDILKVVILVQSVPRLLRIYPLYKEVTRTSGFFTETAWAGAAFN  592
             +  ++P   RP  +V K++LK VI  Q VPR+ RIYPL+KEVTRTSG  TETAWAGAA N
Sbjct  189   VLAVVPSMGRPASLVTKELLKWVIFCQYVPRIARIYPLFKEVTRTSGLVTETAWAGAALN  248

Query  593   LFLYMIASYVAGAIWYITAIERQDKCWRRACEKHGSCDIDFLYCTKLGRRGGDFSSSFLN  772
             LFLYM+AS+V G+ WY+ +IER+D+CWR  C K   C   +LYC+     GG+ +S +L 
Sbjct  249   LFLYMLASHVFGSFWYLISIERKDRCWRETCAKIKGCIHAYLYCS-----GGEDNSQYLI  303

Query  773   TSCALLEPENLKADD-FDFGIFLDALKSNVVEKRYFWSKLFYCFWWGLRNLSSLGQNLKT  949
              SC L++PE +K    F+FGIF +AL+S VVE   F  K FYCFWWGLRNLS+LGQNLKT
Sbjct  304   GSCPLMDPEEIKNSTVFNFGIFAEALQSGVVESMDFPKKFFYCFWWGLRNLSALGQNLKT  363

Query  950   SNFVGEilfailisiiglilfslligNMQKYLQSITVRVEEMRVKRMDAEQWMSHRMLPD  1129
             S F GEI+FA++I I GL+LF+LLIGNMQKYLQS TVRVEEMRVKR DAEQWMSHRMLPD
Sbjct  364   SAFEGEIIFAVIICISGLVLFALLIGNMQKYLQSTTVRVEEMRVKRRDAEQWMSHRMLPD  423

Query  1130  NLRERIRRYEQYRWQETRGVDEESLISNLPKDLRRDINRHLCWSLLKRVHMFKTMDEQLL  1309
             +LR+R+R+YEQY+WQETRGV+EE L+S+LPKDLR+DI RHLC ++LK V  FK MD++LL
Sbjct  424   DLRKRVRKYEQYKWQETRGVEEEVLLSSLPKDLRKDIKRHLCLNMLKTVPWFKAMDDRLL  483

Query  1310  DAICDRLKPVLYTEKSCIVREGDPVDEMIFVMRGNLLTMTTNGGRTGFLNSDVLNAGDFC  1489
             DA+C RLKP LYTE S IVREG+P+++M+F+MRG L + TT GG++GF NS  L  G FC
Sbjct  484   DALCARLKPALYTENSYIVREGEPLEDMVFIMRGKLTSTTTYGGKSGFFNSVSLGVGQFC  543

Query  1490  GEELLTWALDPNSSSSLPISTRTVQALTDVEAFALTADFLKFFASQYRRLHSKQLQHKFR  1669
             G +LLTWALDPN +S  PIST TVQA T+VE F L+AD LKF A+QYRR++SKQL+H   
Sbjct  544   G-DLLTWALDPN-TSHFPISTSTVQAQTEVEGFVLSADDLKFVATQYRRINSKQLRH--M  599

Query  1670  FYSHQWKTWAACFIQAAWRRHCRNKLEKSLREEEDRLQDALILRMRREEGETTPSLGATI  1849
             ++S QW+TWAACFIQAAW+R+CR KL ++LREEE+RL++ L      + G    +LGA I
Sbjct  600   YHSVQWRTWAACFIQAAWKRYCRKKLSRALREEEERLENTL---QTDDSGGNKLNLGAAI  656

Query  1850  YASRFAANVLRTVRRN  1897
             YASRFA++ LR VR N
Sbjct  657   YASRFASHALRNVRAN  672



>ref|XP_010941336.1| PREDICTED: probable cyclic nucleotide-gated ion channel 6 [Elaeis 
guineensis]
 ref|XP_010941343.1| PREDICTED: probable cyclic nucleotide-gated ion channel 6 [Elaeis 
guineensis]
 ref|XP_010941351.1| PREDICTED: probable cyclic nucleotide-gated ion channel 6 [Elaeis 
guineensis]
 ref|XP_010941359.1| PREDICTED: probable cyclic nucleotide-gated ion channel 6 [Elaeis 
guineensis]
 ref|XP_010941369.1| PREDICTED: probable cyclic nucleotide-gated ion channel 6 [Elaeis 
guineensis]
 ref|XP_010941377.1| PREDICTED: probable cyclic nucleotide-gated ion channel 6 [Elaeis 
guineensis]
 ref|XP_010941385.1| PREDICTED: probable cyclic nucleotide-gated ion channel 6 [Elaeis 
guineensis]
 ref|XP_010941394.1| PREDICTED: probable cyclic nucleotide-gated ion channel 6 [Elaeis 
guineensis]
 ref|XP_010941403.1| PREDICTED: probable cyclic nucleotide-gated ion channel 6 [Elaeis 
guineensis]
 ref|XP_010941411.1| PREDICTED: probable cyclic nucleotide-gated ion channel 6 [Elaeis 
guineensis]
 ref|XP_010941421.1| PREDICTED: probable cyclic nucleotide-gated ion channel 6 [Elaeis 
guineensis]
 ref|XP_010941425.1| PREDICTED: probable cyclic nucleotide-gated ion channel 6 [Elaeis 
guineensis]
 ref|XP_010941429.1| PREDICTED: probable cyclic nucleotide-gated ion channel 6 [Elaeis 
guineensis]
 ref|XP_010941435.1| PREDICTED: probable cyclic nucleotide-gated ion channel 6 [Elaeis 
guineensis]
 ref|XP_010941438.1| PREDICTED: probable cyclic nucleotide-gated ion channel 6 [Elaeis 
guineensis]
 ref|XP_010941442.1| PREDICTED: probable cyclic nucleotide-gated ion channel 6 [Elaeis 
guineensis]
 ref|XP_010941447.1| PREDICTED: probable cyclic nucleotide-gated ion channel 6 [Elaeis 
guineensis]
 ref|XP_010941450.1| PREDICTED: probable cyclic nucleotide-gated ion channel 6 [Elaeis 
guineensis]
 ref|XP_010941460.1| PREDICTED: probable cyclic nucleotide-gated ion channel 6 [Elaeis 
guineensis]
 ref|XP_010941467.1| PREDICTED: probable cyclic nucleotide-gated ion channel 6 [Elaeis 
guineensis]
 ref|XP_010941475.1| PREDICTED: probable cyclic nucleotide-gated ion channel 6 [Elaeis 
guineensis]
 ref|XP_010941483.1| PREDICTED: probable cyclic nucleotide-gated ion channel 6 [Elaeis 
guineensis]
Length=726

 Score =   723 bits (1866),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 360/618 (58%), Positives = 465/618 (75%), Gaps = 13/618 (2%)
 Frame = +2

Query  47    KSKMHDPQGPFLQRWNRIFVIACILAATVDPLFFYIPVVDDQNKCLGLDRTLEITACILR  226
             + K+ DPQ  FL R NR+FV++CI+A  +DPLFFY+PVVD +  C+GLDR L IT   LR
Sbjct  94    EKKILDPQDKFLLRMNRLFVVSCIIAIALDPLFFYLPVVDKEAVCIGLDRKLAITTTTLR  153

Query  227   SVFDFFYIFHIILQFRTGFVPPSSRVFGRGDLIVDPSAIAKRYFFSYFFIDILAVLPLPQ  406
             ++ D FY+  + LQFRT ++ PSSRVFGRG+L++DP+ IA+RY   YF ID LAVLPLPQ
Sbjct  154   TLNDAFYLLRMALQFRTAYIAPSSRVFGRGELVIDPAQIAQRYLRRYFMIDFLAVLPLPQ  213

Query  407   VVLFMMIPRADRPFIMVAKDILKVVILVQSVPRLLRIYPLYKEVTRTSGFFTETAWAGAA  586
             ++++  +  +  P +MVAK+ L  ++++Q VPR  RI PL  E+ RT+G F ETAWAGAA
Sbjct  214   IIVWKFLSTSKGPDVMVAKNALLAIVVLQLVPRFFRIIPLTSELKRTAGVFAETAWAGAA  273

Query  587   FNLFLYMIASYVAGAIWYITAIERQDKCWRRACEKHGSCDIDFLYCTKLGRRGGDFSSSF  766
             + L  YM+AS++ GA WY  A+ER++ CWR AC+    CD+ +LYC   G    +  + +
Sbjct  274   YYLLWYMLASHIVGAFWYYLAVERENDCWRLACKNVKGCDVLYLYC---GSEDLELFAGW  330

Query  767   LNTSCALLEPENLKADD--FDFGIFLDALKSNVVEKRYFWSKLFYCFWWGLRNLSSLGQN  940
              N S  + + +    DD  F+FGI+  AL+S +V    F SK FYC WWGLRNLS+LGQ 
Sbjct  331   KNVSSNVTDEQCSLDDDSPFNFGIYQQALQSGIVSSYKFVSKFFYCLWWGLRNLSTLGQG  390

Query  941   LKTSNFVGEilfailisiiglilfslligNMQKYLQSITVRVEEMRVKRMDAEQWMSHRM  1120
             L+TS F GE++F+I ++I+GLILF+LLIGNMQ YLQS+T+R+EEMRVKR D+EQWM HR+
Sbjct  391   LQTSTFPGEVIFSIALAILGLILFALLIGNMQTYLQSLTLRLEEMRVKRRDSEQWMHHRL  450

Query  1121  LPDNLRERIRRYEQYRWQETRGVDEESLISNLPKDLRRDINRHLCWSLLKRVHMFKTMDE  1300
             LP +LRER+RRY+QY+W ETRGVDEESL+  LPKDLRRDI RHLC +L+KRV +F+ MDE
Sbjct  451   LPRDLRERVRRYDQYKWLETRGVDEESLVQCLPKDLRRDIKRHLCLALVKRVPLFENMDE  510

Query  1301  QLLDAICDRLKPVLYTEKSCIVREGDPVDEMIFVMRGNLLTMTTNGGRTGFLNSDVLNAG  1480
             +LLDAIC+RLKP LYTE + IVREGDPVDEM+F++RG L ++TT+GGR+GF N  +L   
Sbjct  511   RLLDAICERLKPSLYTENTYIVREGDPVDEMLFIIRGRLESVTTDGGRSGFFNRGLLKEA  570

Query  1481  DFCGEELLTWALDPNSSSSLPISTRTVQALTDVEAFALTADFLKFFASQYRRLHSKQLQH  1660
             DFCGEELLTWALDP S S+LP STRTV+ALT+VEAFAL AD LKF ASQ+RRLHS+Q+QH
Sbjct  571   DFCGEELLTWALDPKSGSNLPTSTRTVKALTEVEAFALVADELKFVASQFRRLHSRQVQH  630

Query  1661  KFRFYSHQWKTWAACFIQAAWRRHCRNKLEKSLREEEDRLQDALILRMRREEGETTPSLG  1840
              FRFYS QW+TWAACFIQAAWRR+ + K+ +  R+EE        +    ++     SLG
Sbjct  631   TFRFYSQQWRTWAACFIQAAWRRYSKRKMAELRRKEE--------MVGVGDQMTGGSSLG  682

Query  1841  ATIYASRFAANVLRTVRR  1894
             ATIYASRFAAN LR V +
Sbjct  683   ATIYASRFAANALRGVHK  700



>ref|XP_010251499.1| PREDICTED: probable cyclic nucleotide-gated ion channel 5 isoform 
X3 [Nelumbo nucifera]
Length=671

 Score =   720 bits (1859),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 366/653 (56%), Positives = 484/653 (74%), Gaps = 20/653 (3%)
 Frame = +2

Query  47    KSKMHDPQGPFLQRWNRIFVIACILAATVDPLFFYIPVVDDQNKCLGLDRTLEITACILR  226
             + K+ DPQ  FLQ WNR+FVI+CILA +VDPLFFY+PV++  + CL +DR L IT   LR
Sbjct  34    EKKIFDPQDKFLQIWNRLFVISCILAVSVDPLFFYLPVINSDSTCLSIDRKLAITVTTLR  93

Query  227   SVFDFFYIFHIILQFRTGFVPPSSRVFGRGDLIVDPSAIAKRYFFSYFFIDILAVLPLPQ  406
             ++ D FY+ H+ LQFRT ++ PSSRVFGRG+L++DP+ IAKRY   YF +D LAVLP+PQ
Sbjct  94    TIIDAFYVIHMALQFRTAYIAPSSRVFGRGELVIDPAQIAKRYLRWYFIVDFLAVLPIPQ  153

Query  407   VVLFMMIPRADRPFIMVAKDILKVVILVQSVPRLLRIYPLYKEVTRTSGFFTETAWAGAA  586
             +V++  + ++D   ++  K  L  ++++Q +PR  RI PL  E+ RT+G F E+A+AGAA
Sbjct  154   IVVWKFLQKSD---VLATKQALLFIVMLQYIPRFYRILPLTSELKRTAGVFAESAFAGAA  210

Query  587   FNLFLYMIASYVAGAIWYITAIERQDKCWRRACEKHGS--CDIDFLYCTKLGRRGGDFSS  760
             + L  YM+AS++ GA WY+ A+ER D CW+ AC +  +  CD ++LYC   G   G   S
Sbjct  211   YYLLWYMLASHIVGAFWYLLAVERNDACWQEACTESNAIKCDTNYLYC---GNWNGPSYS  267

Query  761   SFLNTSCALLE---PENLKADDFDFGIFLDALKSNVVEKRYFWSKLFYCFWWGLRNLSSL  931
             ++L  S A+L    P       FDFGI+  AL S +V+ + F SK  YC WWGL+NLS+L
Sbjct  268   NWLTVSKAVLSNKCPAEGDNPPFDFGIYQQALSSGIVKSKKFLSKYCYCLWWGLQNLSTL  327

Query  932   GQNLKTSNFVGEilfailisiiglilfslligNMQKYLQSITVRVEEMRVKRMDAEQWMS  1111
             GQ L+TS + GE++F+I ++I+GLILF+LLIGNMQ YLQS+T+R+EEMR+KR D+EQWM 
Sbjct  328   GQGLETSTYPGEVIFSIALAILGLILFALLIGNMQTYLQSLTIRLEEMRIKRRDSEQWMH  387

Query  1112  HRMLPDNLRERIRRYEQYRWQETRGVDEESLISNLPKDLRRDINRHLCWSLLKRVHMFKT  1291
             HR+LP +LRER+RRY+QY+W ETRGVDEE+L+ +LPKDLRRDI RHLC +L++RV +F+ 
Sbjct  388   HRLLPQDLRERVRRYDQYKWLETRGVDEENLVQSLPKDLRRDIKRHLCLALVRRVPLFEK  447

Query  1292  MDEQLLDAICDRLKPVLYTEKSCIVREGDPVDEMIFVMRGNLLTMTTNGGRTGFLNSDVL  1471
             MDE+LLDAIC+RLKP LYTE++ IVREGDPVDEM+F++RG L ++TT+GGR+GF N  +L
Sbjct  448   MDERLLDAICERLKPSLYTERTYIVREGDPVDEMLFIIRGRLESVTTDGGRSGFFNRSLL  507

Query  1472  NAGDFCGEELLTWALDPNSSSSLPISTRTVQALTDVEAFALTADFLKFFASQYRRLHSKQ  1651
               GDFCGEELLTWALDP S S+LP STRTV+ALT+VEAFAL A+ LKF ASQ+RRLHS+Q
Sbjct  508   KEGDFCGEELLTWALDPKSGSNLPSSTRTVKALTEVEAFALIAEELKFVASQFRRLHSRQ  567

Query  1652  LQHKFRFYSHQWKTWAACFIQAAWRRHCRNKLEKSLREEEDRLQDALILRMRREEGETTP  1831
             +QH FRFYS QW+TWAACFIQAAWRR+ + KL +  R++E+   D          G T  
Sbjct  568   VQHTFRFYSQQWRTWAACFIQAAWRRYTKRKLAELRRKDEE--SDGAGSESATAVGST--  623

Query  1832  SLGATIYASRFAANVLRTVRRNHplsvpklsprlpplllqkpAEPDFSAPENN  1990
             SLGATI+ASRFAAN +R V R     +         + LQKP EPDFSA + +
Sbjct  624   SLGATIFASRFAANAMRGVHR-----LRNSKGTRELVKLQKPPEPDFSADDAD  671



>ref|XP_006350103.1| PREDICTED: probable cyclic nucleotide-gated ion channel 5-like 
isoform X1 [Solanum tuberosum]
 ref|XP_006350104.1| PREDICTED: probable cyclic nucleotide-gated ion channel 5-like 
isoform X2 [Solanum tuberosum]
 ref|XP_006350105.1| PREDICTED: probable cyclic nucleotide-gated ion channel 5-like 
isoform X3 [Solanum tuberosum]
Length=692

 Score =   720 bits (1858),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 357/621 (57%), Positives = 456/621 (73%), Gaps = 10/621 (2%)
 Frame = +2

Query  47    KSKMHDPQGPFLQRWNRIFVIACILAATVDPLFFYIPVVDDQNKCLGLDRTLEITACILR  226
             + K+ DPQ  FL  WN++FVI+CILA +VDPLFFY+PV DD++ CL +DR L + A  LR
Sbjct  53    EKKIFDPQDKFLLLWNKLFVISCILAVSVDPLFFYLPVFDDKSNCLQIDRKLAVIATTLR  112

Query  227   SVFDFFYIFHIILQFRTGFVPPSSRVFGRGDLIVDPSAIAKRYFFSYFFIDILAVLPLPQ  406
             +V D FY+ H+ LQFRT ++ PSSRVFGRG+L++DP  IAKRY  SYF ID+LAV+PLPQ
Sbjct  113   TVVDAFYLIHMALQFRTAYIAPSSRVFGRGELVIDPGQIAKRYLRSYFIIDLLAVVPLPQ  172

Query  407   VVLFMMIPRADRPFIMVAKDILKVVILVQSVPRLLRIYPLYKEVTRTSGFFTETAWAGAA  586
             +V    + R+    ++  K  L  +IL+Q +PR +R+ PL  E+ RT+G F ETAWAGA 
Sbjct  173   IVAGRFLQRSTGSDVLATKQALLYIILLQYIPRFVRVIPLTSELKRTTGVFAETAWAGAV  232

Query  587   FNLFLYMIASYVAGAIWYITAIERQDKCWRRACEKHGSCDIDFLYCTKLGRRG----GDF  754
               L LYM+AS++ G+ WY+ ++ER D CW RAC  + +C  DFLYC      G     + 
Sbjct  233   SYLLLYMLASHIVGSFWYLLSVERYDTCWERACSHNATCQTDFLYCGNQDMTGYNAWSNI  292

Query  755   SSSFLNTSCALLEPENLKADDFDFGIFLDALKSNVVEKRYFWSKLFYCFWWGLRNLSSLG  934
             S S LN +C    P +     FDFGIF  AL S +V    F +K  YC WWGL+NLS+LG
Sbjct  293   SESVLNGAC----PRSGDNPPFDFGIFGQALSSGIVFSMKFVTKYCYCLWWGLQNLSTLG  348

Query  935   QNLKTSNFVGEilfailisiiglilfslligNMQKYLQSITVRVEEMRVKRMDAEQWMSH  1114
             Q L+TS + GE LF+I ++I+GLILF+LLIGNMQ YLQS+T+R+EEMRV+R D+EQWM H
Sbjct  349   QGLQTSTYPGESLFSIALAILGLILFALLIGNMQTYLQSLTIRLEEMRVRRRDSEQWMHH  408

Query  1115  RMLPDNLRERIRRYEQYRWQETRGVDEESLISNLPKDLRRDINRHLCWSLLKRVHMFKTM  1294
             R+LP  LRER+R Y+QY+WQETRGVDEE+++ NLPKDLRRDI RHLC +L+KRV +F  M
Sbjct  409   RLLPQELRERVRGYDQYKWQETRGVDEENIVQNLPKDLRRDIKRHLCLALVKRVPLFANM  468

Query  1295  DEQLLDAICDRLKPVLYTEKSCIVREGDPVDEMIFVMRGNLLTMTTNGGRTGFLNSDVLN  1474
             +E+LLDAIC+ LKP LY E + +VREGDPVDEM+FV+RG L ++TT+GGR+GF N  +L 
Sbjct  469   EERLLDAICEHLKPCLYIENTYLVREGDPVDEMLFVIRGRLESVTTDGGRSGFFNRSLLK  528

Query  1475  AGDFCGEELLTWALDPNSSSSLPISTRTVQALTDVEAFALTADFLKFFASQYRRLHSKQL  1654
               DFCGEELLTWALDP S S+LP STRTV+ALT+VEAFAL AD LKF ASQ+R+LHS+Q+
Sbjct  529   ESDFCGEELLTWALDPKSGSNLPSSTRTVKALTEVEAFALIADELKFVASQFRKLHSRQV  588

Query  1655  QHKFRFYSHQWKTWAACFIQAAWRRHCRNKLEKSLREEEDRLQDALILRMRREEGETTPS  1834
             QH FRFYS  W+TWAACFIQAAWRR  + KL + L+ +ED   +AL        G  + S
Sbjct  589   QHTFRFYSQHWRTWAACFIQAAWRRFTKRKLME-LQRKEDEEAEALA-GASSNSGGASFS  646

Query  1835  LGATIYASRFAANVLRTVRRN  1897
             +GAT  ASRFAAN LR V +N
Sbjct  647   IGATFLASRFAANALRGVHKN  667



>gb|KHG13117.1| putative cyclic nucleotide-gated ion channel 5 -like protein 
[Gossypium arboreum]
Length=738

 Score =   721 bits (1860),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 364/653 (56%), Positives = 478/653 (73%), Gaps = 14/653 (2%)
 Frame = +2

Query  47    KSKMHDPQGPFLQRWNRIFVIACILAATVDPLFFYIPVVDDQNKCLGLDRTLEITACILR  226
             + K+ DPQ  FL   N++F I+CILA +VDPLFFY+PV++D  KCL +DR L ++A  LR
Sbjct  95    EKKIFDPQDKFLLLCNKLFFISCILAVSVDPLFFYLPVINDLQKCLTIDRKLAVSATTLR  154

Query  227   SVFDFFYIFHIILQFRTGFVPPSSRVFGRGDLIVDPSAIAKRYFFSYFFIDILAVLPLPQ  406
             ++ D FY+  + LQFRT ++ PSSRVFGRG+L++DP+ IAKRY   YF ID LAV PLPQ
Sbjct  155   TIIDAFYLIRMALQFRTAYIAPSSRVFGRGELVIDPAQIAKRYLQRYFIIDFLAVAPLPQ  214

Query  407   VVLFMMIPRADRPFIMVAKDILKVVILVQSVPRLLRIYPLYKEVTRTSGFFTETAWAGAA  586
             +V++  +  ++   ++  K  L  V+L+Q +PR LR+ PL  E+ RT+G F ETAWAGAA
Sbjct  215   IVVWRFLQSSNGSDVLATKQALFFVVLLQYIPRFLRVLPLTSEMKRTAGVFAETAWAGAA  274

Query  587   FNLFLYMIASYVAGAIWYITAIERQDKCWRRACEKHGS-CDIDFLYCTKLGRRGGD----  751
             + L LYM+ S++ GA WY+ A+ER D CW+ AC+  GS C+ DFLYC     +G +    
Sbjct  275   YYLLLYMLCSHIVGAFWYLVAVERNDTCWQNACKDIGSDCNKDFLYCGNQQMKGYNIWKG  334

Query  752   FSSSFLNTSCALLEPENLKADDFDFGIFLDALKSNVVEKRYFWSKLFYCFWWGLRNLSSL  931
                S LN  C     EN     FDFGIF  AL S +V    F+SK  YC WWGL+NLS+L
Sbjct  335   MRDSVLNEKCP--ADENDDNPPFDFGIFTQALSSGIVSSTKFFSKYLYCLWWGLQNLSTL  392

Query  932   GQNLKTSNFVGEilfailisiiglilfslligNMQKYLQSITVRVEEMRVKRMDAEQWMS  1111
             GQ L+TS + GE++F+I ++I GLILF+LLIGNMQ YLQS+T+R+EEMR+KR D+EQWM 
Sbjct  393   GQGLQTSTYPGEVIFSIALAIFGLILFALLIGNMQTYLQSLTIRLEEMRIKRRDSEQWMH  452

Query  1112  HRMLPDNLRERIRRYEQYRWQETRGVDEESLISNLPKDLRRDINRHLCWSLLKRVHMFKT  1291
             HRMLP +LRER+RRY+QY+W ETRGVDEESL+ +LPKDLRRDI RHLC +L++RV +F+ 
Sbjct  453   HRMLPQDLRERVRRYDQYKWLETRGVDEESLVQSLPKDLRRDIKRHLCLALVRRVPLFEN  512

Query  1292  MDEQLLDAICDRLKPVLYTEKSCIVREGDPVDEMIFVMRGNLLTMTTNGGRTGFLNSDVL  1471
             MDE+LLDAIC+RLKP L+T+++ IVREGDPVDEM+F++RG L ++TT+GGR+GF N  +L
Sbjct  513   MDERLLDAICERLKPCLFTDRTYIVREGDPVDEMLFIIRGRLESVTTDGGRSGFFNHSLL  572

Query  1472  NAGDFCGEELLTWALDPNSSSSLPISTRTVQALTDVEAFALTADFLKFFASQYRRLHSKQ  1651
               GDFCGEELLTWALDP S ++LP STRTV+ALT+VEAFAL A+ LKF ASQ+RRLHS+Q
Sbjct  573   KEGDFCGEELLTWALDPKSGANLPTSTRTVKALTEVEAFALIAEELKFVASQFRRLHSRQ  632

Query  1652  LQHKFRFYSHQWKTWAACFIQAAWRRHCRNKLEKSLREEEDRLQDALILRMRREEGETTP  1831
             +QH FRF+S QW+TWAACFIQAAWRR+ + K+ +  R+EE+  + +     R   G  + 
Sbjct  633   VQHTFRFHSQQWRTWAACFIQAAWRRYSKRKIMELHRKEEEEAEGS--DGNRSNSGGGSY  690

Query  1832  SLGATIYASRFAANVLRTVRRNHplsvpklsprlpplllqkpAEPDFSAPENN  1990
             SLGAT  AS+FAAN LR + RN              + LQKP EPDF+A + +
Sbjct  691   SLGATFLASKFAANALRGIHRNR-----NAKSAKELVKLQKPPEPDFAAEDAD  738



>ref|XP_009616554.1| PREDICTED: probable cyclic nucleotide-gated ion channel 5 [Nicotiana 
tomentosiformis]
Length=732

 Score =   720 bits (1858),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 368/648 (57%), Positives = 472/648 (73%), Gaps = 15/648 (2%)
 Frame = +2

Query  47    KSKMHDPQGPFLQRWNRIFVIACILAATVDPLFFYIPVVDDQNKCLGLDRTLEITACILR  226
             + K+ DPQ  FL  WN++FV++CILA +VDPLFFY+PV D+++ CL +DR L + A  LR
Sbjct  93    EKKIFDPQDKFLLLWNKLFVVSCILAVSVDPLFFYLPVFDNKSNCLQIDRKLTVIATTLR  152

Query  227   SVFDFFYIFHIILQFRTGFVPPSSRVFGRGDLIVDPSAIAKRYFFSYFFIDILAVLPLPQ  406
             +V D FY+ H+ LQFRT ++ PSSRVFGRG+L++DP  IAKRY   YF ID LAV+PLPQ
Sbjct  153   TVIDAFYLIHMTLQFRTAYIAPSSRVFGRGELVIDPGQIAKRYLRFYFIIDFLAVIPLPQ  212

Query  407   VVLFMMIPRADRPFIMVAKDILKVVILVQSVPRLLRIYPLYKEVTRTSGFFTETAWAGAA  586
             +V++  +  +    ++  K  L  +IL+Q +PR +R+ PL  E+ RT+G F ETAWAGAA
Sbjct  213   IVVWRFLQSSTGSDVLATKQALLYIILLQYIPRFVRVIPLTSELKRTTGVFAETAWAGAA  272

Query  587   FNLFLYMIASYVAGAIWYITAIERQDKCWRRACEKHGSCDIDFLYCTKLGRRG----GDF  754
               L LYM+AS++ G+ WY+ ++ER D CW++AC  + +C+ DFLYC      G       
Sbjct  273   SYLLLYMLASHIVGSFWYLLSVERYDTCWQQACTHNATCNTDFLYCGNQYMTGYNSWSSI  332

Query  755   SSSFLNTSCALLEPENLKADDFDFGIFLDALKSNVVEKRYFWSKLFYCFWWGLRNLSSLG  934
             S   LN +C    P N     FDFGIF  AL S ++    F SK  YC WWGL+NLS+LG
Sbjct  333   SDKVLNDAC----PANSDDSPFDFGIFDQALSSGIIYSMKFVSKYCYCLWWGLQNLSTLG  388

Query  935   QNLKTSNFVGEilfailisiiglilfslligNMQKYLQSITVRVEEMRVKRMDAEQWMSH  1114
             Q L+TS + GE +F+I ++I+GLILF+LLIGNMQ YLQS+T+R+EEMRVKR D+EQWM H
Sbjct  389   QGLQTSTYPGESIFSIGLAILGLILFALLIGNMQTYLQSLTIRLEEMRVKRRDSEQWMHH  448

Query  1115  RMLPDNLRERIRRYEQYRWQETRGVDEESLISNLPKDLRRDINRHLCWSLLKRVHMFKTM  1294
             R+LP +LRER+RRY+QY+WQETRGVDEE+++ +LPKDLRRDI RHLC +L+KRV +F+ M
Sbjct  449   RLLPQDLRERVRRYDQYKWQETRGVDEENIVQSLPKDLRRDIKRHLCLALVKRVPLFENM  508

Query  1295  DEQLLDAICDRLKPVLYTEKSCIVREGDPVDEMIFVMRGNLLTMTTNGGRTGFLNSDVLN  1474
             DE+LLDAIC+RLKP LY E + IVREGDPVDEM+F++RG L ++TT+GGR+GF N  +L 
Sbjct  509   DERLLDAICERLKPCLYIENTYIVREGDPVDEMLFIIRGRLESVTTDGGRSGFFNRSLLK  568

Query  1475  AGDFCGEELLTWALDPNSSSSLPISTRTVQALTDVEAFALTADFLKFFASQYRRLHSKQL  1654
              GDFCGEELLTWALDP S S+LP STRTV+ALT+VEAFALTAD LKF ASQ+RRLHS+Q+
Sbjct  569   EGDFCGEELLTWALDPKSGSNLPSSTRTVKALTEVEAFALTADELKFVASQFRRLHSRQV  628

Query  1655  QHKFRFYSHQWKTWAACFIQAAWRRHCRNKLEKSLREEEDRLQDALILRMRREEGETTPS  1834
             QH FRFYS QW+TWAA FIQAAWRR+ + KL +  R+EE   +   +       G  T S
Sbjct  629   QHTFRFYSQQWRTWAAIFIQAAWRRYTKRKLMELQRKEE--EEAEALAAASGNSGGATYS  686

Query  1835  LGATIYASRFAANVLRTVRRNHplsvpklsprlpplllqkpAEPDFSA  1978
             + AT  ASRFAAN LR V RN       L      + LQKP EPDFSA
Sbjct  687   IRATFLASRFAANALRGVHRNR-----NLKSARELVKLQKPPEPDFSA  729



>ref|XP_010251498.1| PREDICTED: probable cyclic nucleotide-gated ion channel 5 isoform 
X2 [Nelumbo nucifera]
Length=733

 Score =   719 bits (1857),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 366/653 (56%), Positives = 484/653 (74%), Gaps = 20/653 (3%)
 Frame = +2

Query  47    KSKMHDPQGPFLQRWNRIFVIACILAATVDPLFFYIPVVDDQNKCLGLDRTLEITACILR  226
             + K+ DPQ  FLQ WNR+FVI+CILA +VDPLFFY+PV++  + CL +DR L IT   LR
Sbjct  96    EKKIFDPQDKFLQIWNRLFVISCILAVSVDPLFFYLPVINSDSTCLSIDRKLAITVTTLR  155

Query  227   SVFDFFYIFHIILQFRTGFVPPSSRVFGRGDLIVDPSAIAKRYFFSYFFIDILAVLPLPQ  406
             ++ D FY+ H+ LQFRT ++ PSSRVFGRG+L++DP+ IAKRY   YF +D LAVLP+PQ
Sbjct  156   TIIDAFYVIHMALQFRTAYIAPSSRVFGRGELVIDPAQIAKRYLRWYFIVDFLAVLPIPQ  215

Query  407   VVLFMMIPRADRPFIMVAKDILKVVILVQSVPRLLRIYPLYKEVTRTSGFFTETAWAGAA  586
             +V++  + ++D   ++  K  L  ++++Q +PR  RI PL  E+ RT+G F E+A+AGAA
Sbjct  216   IVVWKFLQKSD---VLATKQALLFIVMLQYIPRFYRILPLTSELKRTAGVFAESAFAGAA  272

Query  587   FNLFLYMIASYVAGAIWYITAIERQDKCWRRACEKHGS--CDIDFLYCTKLGRRGGDFSS  760
             + L  YM+AS++ GA WY+ A+ER D CW+ AC +  +  CD ++LYC   G   G   S
Sbjct  273   YYLLWYMLASHIVGAFWYLLAVERNDACWQEACTESNAIKCDTNYLYC---GNWNGPSYS  329

Query  761   SFLNTSCALLE---PENLKADDFDFGIFLDALKSNVVEKRYFWSKLFYCFWWGLRNLSSL  931
             ++L  S A+L    P       FDFGI+  AL S +V+ + F SK  YC WWGL+NLS+L
Sbjct  330   NWLTVSKAVLSNKCPAEGDNPPFDFGIYQQALSSGIVKSKKFLSKYCYCLWWGLQNLSTL  389

Query  932   GQNLKTSNFVGEilfailisiiglilfslligNMQKYLQSITVRVEEMRVKRMDAEQWMS  1111
             GQ L+TS + GE++F+I ++I+GLILF+LLIGNMQ YLQS+T+R+EEMR+KR D+EQWM 
Sbjct  390   GQGLETSTYPGEVIFSIALAILGLILFALLIGNMQTYLQSLTIRLEEMRIKRRDSEQWMH  449

Query  1112  HRMLPDNLRERIRRYEQYRWQETRGVDEESLISNLPKDLRRDINRHLCWSLLKRVHMFKT  1291
             HR+LP +LRER+RRY+QY+W ETRGVDEE+L+ +LPKDLRRDI RHLC +L++RV +F+ 
Sbjct  450   HRLLPQDLRERVRRYDQYKWLETRGVDEENLVQSLPKDLRRDIKRHLCLALVRRVPLFEK  509

Query  1292  MDEQLLDAICDRLKPVLYTEKSCIVREGDPVDEMIFVMRGNLLTMTTNGGRTGFLNSDVL  1471
             MDE+LLDAIC+RLKP LYTE++ IVREGDPVDEM+F++RG L ++TT+GGR+GF N  +L
Sbjct  510   MDERLLDAICERLKPSLYTERTYIVREGDPVDEMLFIIRGRLESVTTDGGRSGFFNRSLL  569

Query  1472  NAGDFCGEELLTWALDPNSSSSLPISTRTVQALTDVEAFALTADFLKFFASQYRRLHSKQ  1651
               GDFCGEELLTWALDP S S+LP STRTV+ALT+VEAFAL A+ LKF ASQ+RRLHS+Q
Sbjct  570   KEGDFCGEELLTWALDPKSGSNLPSSTRTVKALTEVEAFALIAEELKFVASQFRRLHSRQ  629

Query  1652  LQHKFRFYSHQWKTWAACFIQAAWRRHCRNKLEKSLREEEDRLQDALILRMRREEGETTP  1831
             +QH FRFYS QW+TWAACFIQAAWRR+ + KL +  R++E+   D          G T  
Sbjct  630   VQHTFRFYSQQWRTWAACFIQAAWRRYTKRKLAELRRKDEE--SDGAGSESATAVGST--  685

Query  1832  SLGATIYASRFAANVLRTVRRNHplsvpklsprlpplllqkpAEPDFSAPENN  1990
             SLGATI+ASRFAAN +R V R     +         + LQKP EPDFSA + +
Sbjct  686   SLGATIFASRFAANAMRGVHR-----LRNSKGTRELVKLQKPPEPDFSADDAD  733



>ref|XP_010251495.1| PREDICTED: probable cyclic nucleotide-gated ion channel 5 isoform 
X1 [Nelumbo nucifera]
 ref|XP_010251496.1| PREDICTED: probable cyclic nucleotide-gated ion channel 5 isoform 
X1 [Nelumbo nucifera]
 ref|XP_010251497.1| PREDICTED: probable cyclic nucleotide-gated ion channel 5 isoform 
X1 [Nelumbo nucifera]
Length=736

 Score =   720 bits (1858),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 366/653 (56%), Positives = 484/653 (74%), Gaps = 20/653 (3%)
 Frame = +2

Query  47    KSKMHDPQGPFLQRWNRIFVIACILAATVDPLFFYIPVVDDQNKCLGLDRTLEITACILR  226
             + K+ DPQ  FLQ WNR+FVI+CILA +VDPLFFY+PV++  + CL +DR L IT   LR
Sbjct  99    EKKIFDPQDKFLQIWNRLFVISCILAVSVDPLFFYLPVINSDSTCLSIDRKLAITVTTLR  158

Query  227   SVFDFFYIFHIILQFRTGFVPPSSRVFGRGDLIVDPSAIAKRYFFSYFFIDILAVLPLPQ  406
             ++ D FY+ H+ LQFRT ++ PSSRVFGRG+L++DP+ IAKRY   YF +D LAVLP+PQ
Sbjct  159   TIIDAFYVIHMALQFRTAYIAPSSRVFGRGELVIDPAQIAKRYLRWYFIVDFLAVLPIPQ  218

Query  407   VVLFMMIPRADRPFIMVAKDILKVVILVQSVPRLLRIYPLYKEVTRTSGFFTETAWAGAA  586
             +V++  + ++D   ++  K  L  ++++Q +PR  RI PL  E+ RT+G F E+A+AGAA
Sbjct  219   IVVWKFLQKSD---VLATKQALLFIVMLQYIPRFYRILPLTSELKRTAGVFAESAFAGAA  275

Query  587   FNLFLYMIASYVAGAIWYITAIERQDKCWRRACEKHGS--CDIDFLYCTKLGRRGGDFSS  760
             + L  YM+AS++ GA WY+ A+ER D CW+ AC +  +  CD ++LYC   G   G   S
Sbjct  276   YYLLWYMLASHIVGAFWYLLAVERNDACWQEACTESNAIKCDTNYLYC---GNWNGPSYS  332

Query  761   SFLNTSCALLE---PENLKADDFDFGIFLDALKSNVVEKRYFWSKLFYCFWWGLRNLSSL  931
             ++L  S A+L    P       FDFGI+  AL S +V+ + F SK  YC WWGL+NLS+L
Sbjct  333   NWLTVSKAVLSNKCPAEGDNPPFDFGIYQQALSSGIVKSKKFLSKYCYCLWWGLQNLSTL  392

Query  932   GQNLKTSNFVGEilfailisiiglilfslligNMQKYLQSITVRVEEMRVKRMDAEQWMS  1111
             GQ L+TS + GE++F+I ++I+GLILF+LLIGNMQ YLQS+T+R+EEMR+KR D+EQWM 
Sbjct  393   GQGLETSTYPGEVIFSIALAILGLILFALLIGNMQTYLQSLTIRLEEMRIKRRDSEQWMH  452

Query  1112  HRMLPDNLRERIRRYEQYRWQETRGVDEESLISNLPKDLRRDINRHLCWSLLKRVHMFKT  1291
             HR+LP +LRER+RRY+QY+W ETRGVDEE+L+ +LPKDLRRDI RHLC +L++RV +F+ 
Sbjct  453   HRLLPQDLRERVRRYDQYKWLETRGVDEENLVQSLPKDLRRDIKRHLCLALVRRVPLFEK  512

Query  1292  MDEQLLDAICDRLKPVLYTEKSCIVREGDPVDEMIFVMRGNLLTMTTNGGRTGFLNSDVL  1471
             MDE+LLDAIC+RLKP LYTE++ IVREGDPVDEM+F++RG L ++TT+GGR+GF N  +L
Sbjct  513   MDERLLDAICERLKPSLYTERTYIVREGDPVDEMLFIIRGRLESVTTDGGRSGFFNRSLL  572

Query  1472  NAGDFCGEELLTWALDPNSSSSLPISTRTVQALTDVEAFALTADFLKFFASQYRRLHSKQ  1651
               GDFCGEELLTWALDP S S+LP STRTV+ALT+VEAFAL A+ LKF ASQ+RRLHS+Q
Sbjct  573   KEGDFCGEELLTWALDPKSGSNLPSSTRTVKALTEVEAFALIAEELKFVASQFRRLHSRQ  632

Query  1652  LQHKFRFYSHQWKTWAACFIQAAWRRHCRNKLEKSLREEEDRLQDALILRMRREEGETTP  1831
             +QH FRFYS QW+TWAACFIQAAWRR+ + KL +  R++E+   D          G T  
Sbjct  633   VQHTFRFYSQQWRTWAACFIQAAWRRYTKRKLAELRRKDEE--SDGAGSESATAVGST--  688

Query  1832  SLGATIYASRFAANVLRTVRRNHplsvpklsprlpplllqkpAEPDFSAPENN  1990
             SLGATI+ASRFAAN +R V R     +         + LQKP EPDFSA + +
Sbjct  689   SLGATIFASRFAANAMRGVHR-----LRNSKGTRELVKLQKPPEPDFSADDAD  736



>ref|XP_009787244.1| PREDICTED: probable cyclic nucleotide-gated ion channel 5 [Nicotiana 
sylvestris]
Length=732

 Score =   719 bits (1857),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 368/648 (57%), Positives = 473/648 (73%), Gaps = 15/648 (2%)
 Frame = +2

Query  47    KSKMHDPQGPFLQRWNRIFVIACILAATVDPLFFYIPVVDDQNKCLGLDRTLEITACILR  226
             + K+ DPQ  FL  WN++FV++CILA +VDPLFFY+PV D+++ CL +DR L + A  LR
Sbjct  93    EKKIFDPQDKFLLLWNKLFVVSCILAVSVDPLFFYLPVFDNKSNCLQIDRKLAVIATTLR  152

Query  227   SVFDFFYIFHIILQFRTGFVPPSSRVFGRGDLIVDPSAIAKRYFFSYFFIDILAVLPLPQ  406
             +V D FY+ H+ LQFRT ++ PSSRVFGRG+L++DP+ IAKRY   YF ID LAV+PLPQ
Sbjct  153   TVIDAFYLIHMALQFRTAYIAPSSRVFGRGELVIDPAQIAKRYLRFYFIIDFLAVIPLPQ  212

Query  407   VVLFMMIPRADRPFIMVAKDILKVVILVQSVPRLLRIYPLYKEVTRTSGFFTETAWAGAA  586
             +V++  +  +    ++  K  L  +IL+Q +PR +R+ PL  E+ RT+G F ETAWAGAA
Sbjct  213   IVVWRFLQSSTGSDVLATKQALLYIILLQYIPRFVRVIPLTSELKRTTGVFAETAWAGAA  272

Query  587   FNLFLYMIASYVAGAIWYITAIERQDKCWRRACEKHGSCDIDFLYCTKLGRRG----GDF  754
               L LYM+AS++ G+ WY+ ++ER D CW++AC  + +C+ DFLYC      G       
Sbjct  273   SYLLLYMLASHIVGSFWYLLSVERYDTCWQQACTHNATCNTDFLYCGNQYMTGYNSWSSI  332

Query  755   SSSFLNTSCALLEPENLKADDFDFGIFLDALKSNVVEKRYFWSKLFYCFWWGLRNLSSLG  934
             S   LN +C    P N     FDFGIF  AL S ++    F SK  YC WWGL+NLS+LG
Sbjct  333   SDKVLNDAC----PANSDDSPFDFGIFDQALSSGIIYSMKFVSKYCYCLWWGLQNLSTLG  388

Query  935   QNLKTSNFVGEilfailisiiglilfslligNMQKYLQSITVRVEEMRVKRMDAEQWMSH  1114
             Q L+TS + GE +F+I ++I+GLILF+LLIGNMQ YLQS+T+R+EEMRVKR D+EQWM H
Sbjct  389   QGLQTSTYPGESIFSIGLAILGLILFALLIGNMQTYLQSLTIRLEEMRVKRRDSEQWMHH  448

Query  1115  RMLPDNLRERIRRYEQYRWQETRGVDEESLISNLPKDLRRDINRHLCWSLLKRVHMFKTM  1294
             R+LP +LRER+RRY+QY+WQETRGVDEE+++ +LPKDLRRDI RHLC +L+KRV +F+ M
Sbjct  449   RLLPQDLRERVRRYDQYKWQETRGVDEENIVQSLPKDLRRDIKRHLCLALVKRVPLFENM  508

Query  1295  DEQLLDAICDRLKPVLYTEKSCIVREGDPVDEMIFVMRGNLLTMTTNGGRTGFLNSDVLN  1474
             DE+LLDAIC+RLKP LY E + IVREGDPVDEM+F++RG L ++TT+GGR+GF N  +L 
Sbjct  509   DERLLDAICERLKPCLYIENTYIVREGDPVDEMLFIIRGRLESVTTDGGRSGFFNRSLLK  568

Query  1475  AGDFCGEELLTWALDPNSSSSLPISTRTVQALTDVEAFALTADFLKFFASQYRRLHSKQL  1654
              GDFCGEELLTWALDP S S+LP STRTV+ALT+VEAFALTAD LKF ASQ+RRLHS+Q+
Sbjct  569   EGDFCGEELLTWALDPKSGSNLPSSTRTVKALTEVEAFALTADELKFVASQFRRLHSRQV  628

Query  1655  QHKFRFYSHQWKTWAACFIQAAWRRHCRNKLEKSLREEEDRLQDALILRMRREEGETTPS  1834
             QH FRFYS QW+TWAA FIQAAWRR+ + KL +  R+EE   +   +       G  T S
Sbjct  629   QHTFRFYSQQWRTWAAIFIQAAWRRYTKRKLMELQRKEE--EEAEALAAASGNSGGATYS  686

Query  1835  LGATIYASRFAANVLRTVRRNHplsvpklsprlpplllqkpAEPDFSA  1978
             + AT  ASRFAAN LR V RN       L      + LQKP EPDFSA
Sbjct  687   IRATFLASRFAANALRGVHRNR-----NLKSARELVKLQKPPEPDFSA  729



>gb|AHN53203.1| cyclic nucleotide-gated ion channel 5 [Cocos nucifera]
Length=726

 Score =   719 bits (1856),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 360/618 (58%), Positives = 461/618 (75%), Gaps = 13/618 (2%)
 Frame = +2

Query  47    KSKMHDPQGPFLQRWNRIFVIACILAATVDPLFFYIPVVDDQNKCLGLDRTLEITACILR  226
             + K+ DPQ  FL R N++FVI+CI+A  +DPLFFY+PVVD +  C+GLDR L IT   LR
Sbjct  94    EKKIFDPQDKFLLRMNKLFVISCIIAVALDPLFFYLPVVDKEAVCIGLDRKLAITTTTLR  153

Query  227   SVFDFFYIFHIILQFRTGFVPPSSRVFGRGDLIVDPSAIAKRYFFSYFFIDILAVLPLPQ  406
             ++ D FY+  + LQFRT ++ PSSRVFGRG+L++DP+ IA+RY   YF ID LAVLPLPQ
Sbjct  154   TLNDAFYLLRMALQFRTAYIAPSSRVFGRGELVIDPAQIAQRYLRRYFTIDFLAVLPLPQ  213

Query  407   VVLFMMIPRADRPFIMVAKDILKVVILVQSVPRLLRIYPLYKEVTRTSGFFTETAWAGAA  586
             ++++  +  +  P +MVAK+ L  ++L+Q VPR  RI PL  E+ RT+G F ETAWAGAA
Sbjct  214   IIVWKFLGTSKGPDVMVAKNALLAIVLLQLVPRFFRIIPLTSELKRTAGVFAETAWAGAA  273

Query  587   FNLFLYMIASYVAGAIWYITAIERQDKCWRRACEKHGSCDIDFLYCTKLGRRGGDFSSSF  766
             + L  YM+AS++ GA WY  A+ER++ CWR AC     CD+ +LYC   G    +  + +
Sbjct  274   YYLLWYMLASHIVGAFWYYLAVERENDCWRSACNNSQGCDVLYLYC---GSGDLELFAGW  330

Query  767   LNTSCALLEPENLKADD--FDFGIFLDALKSNVVEKRYFWSKLFYCFWWGLRNLSSLGQN  940
              N S  + + +    D+  F+FGI+ DAL S +V    F SK FYC WWGLRNLS+LGQ 
Sbjct  331   KNVSSEVTDKQCSLDDNSPFNFGIYEDALTSGIVSSYKFVSKFFYCLWWGLRNLSTLGQG  390

Query  941   LKTSNFVGEilfailisiiglilfslligNMQKYLQSITVRVEEMRVKRMDAEQWMSHRM  1120
             L+TS F GE++F+I ++I+GLILF+LLIGNMQ YLQS+T+R+EEMRVKR D+EQWM HR+
Sbjct  391   LETSTFPGEVIFSIALAILGLILFALLIGNMQTYLQSLTLRLEEMRVKRRDSEQWMHHRL  450

Query  1121  LPDNLRERIRRYEQYRWQETRGVDEESLISNLPKDLRRDINRHLCWSLLKRVHMFKTMDE  1300
             LP +LRER+RRY+QY+W ETRGVDEESL+  LPKDLRRDI RHLC +L+KRV +F+ MDE
Sbjct  451   LPHDLRERVRRYDQYKWLETRGVDEESLVQCLPKDLRRDIKRHLCLALVKRVPLFENMDE  510

Query  1301  QLLDAICDRLKPVLYTEKSCIVREGDPVDEMIFVMRGNLLTMTTNGGRTGFLNSDVLNAG  1480
             +LLDAIC+RLKP LYTE + IVREGDPVDEMIF++RG L ++TT+GGR+GF N  +L   
Sbjct  511   RLLDAICERLKPSLYTENTYIVREGDPVDEMIFIIRGRLESVTTDGGRSGFFNRGLLKEA  570

Query  1481  DFCGEELLTWALDPNSSSSLPISTRTVQALTDVEAFALTADFLKFFASQYRRLHSKQLQH  1660
             DFCGEELLTWALDP S S+LP STRTV+ALT+VEAFAL AD LKF ASQ+RRLHS+Q+QH
Sbjct  571   DFCGEELLTWALDPKSGSNLPSSTRTVKALTEVEAFALVADELKFVASQFRRLHSRQVQH  630

Query  1661  KFRFYSHQWKTWAACFIQAAWRRHCRNKLEKSLREEEDRLQDALILRMRREEGETTPSLG  1840
              FR YS QW+TWAACFIQAAWRR+ + K  +  R+EE        +    ++     SLG
Sbjct  631   TFRLYSQQWRTWAACFIQAAWRRYSKRKTAELRRKEE--------MVGVGDQMTGGSSLG  682

Query  1841  ATIYASRFAANVLRTVRR  1894
             ATIYASRFA N LR V +
Sbjct  683   ATIYASRFATNALRGVHK  700



>ref|XP_008242994.1| PREDICTED: probable cyclic nucleotide-gated ion channel 5 isoform 
X2 [Prunus mume]
Length=671

 Score =   717 bits (1850),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 367/643 (57%), Positives = 473/643 (74%), Gaps = 10/643 (2%)
 Frame = +2

Query  53    KMHDPQGPFLQRWNRIFVIACILAATVDPLFFYIPVVDDQNKCLGLDRTLEITACILRSV  232
             K+ DPQ  FL  WNR+FVI+CILA +VDPLFFY+PV+++ + CLG+DR L I A  LR +
Sbjct  34    KIFDPQDKFLLLWNRLFVISCILAVSVDPLFFYLPVINNSS-CLGIDRRLAIIATTLRMI  92

Query  233   FDFFYIFHIILQFRTGFVPPSSRVFGRGDLIVDPSAIAKRYFFSYFFIDILAVLPLPQVV  412
              D FY+ H+ LQFRT ++ PSSRVFGRG+L++DP+ IAKRY  SYF ID LAVLPLPQ++
Sbjct  93    VDAFYLIHMALQFRTAYIAPSSRVFGRGELVIDPARIAKRYLRSYFIIDFLAVLPLPQII  152

Query  413   LFMMIPRADRPFIMVAKDILKVVILVQSVPRLLRIYPLYKEVTRTSGFFTETAWAGAAFN  592
             ++  + R+    ++  K  L  ++L+Q +PRL+R+ PL  E+ RT+G F ETAWAGAA  
Sbjct  153   VWRFLQRSKGSDVLATKQALLFIVLLQYIPRLVRVLPLTSELKRTAGVFAETAWAGAACY  212

Query  593   LFLYMIASYVAGAIWYITAIERQDKCWRRACEKHGS-CDIDFLYCTKLGRRGGDFSSSFL  769
             L LYM+AS++ GA WY+ A+ER D CW++AC   G  CD +FLYC           S+  
Sbjct  213   LLLYMLASHIVGAFWYLLALERNDTCWQKACTHFGKLCDKNFLYCGNQNILDTGTWSNVT  272

Query  770   NTSCALLEPENLKADDFDFGIFLDALKSNVVEKRYFWSKLFYCFWWGLRNLSSLGQNLKT  949
                 +   P++ +   FDFGI+  AL S VV  + F  K  YC WWGL+NLS+LGQ L T
Sbjct  273   GNIQSKCSPDD-QNTYFDFGIYKSALSSGVVSSKKFLPKYCYCLWWGLQNLSTLGQGLAT  331

Query  950   SNFVGEilfailisiiglilfslligNMQKYLQSITVRVEEMRVKRMDAEQWMSHRMLPD  1129
             S + GE++F+I ++I GLILF+LLIGNMQ YLQS+T+R+EEMRVKR D+EQWM HR+LP 
Sbjct  332   STYPGEVIFSISLAIFGLILFALLIGNMQTYLQSLTIRLEEMRVKRRDSEQWMHHRLLPQ  391

Query  1130  NLRERIRRYEQYRWQETRGVDEESLISNLPKDLRRDINRHLCWSLLKRVHMFKTMDEQLL  1309
             +LRER+RRY+QY+W ETRGVDE+SL+ +LPKDLRRDI RHLC +L++RV +F+ MDE+LL
Sbjct  392   DLRERVRRYDQYKWLETRGVDEQSLVQSLPKDLRRDIKRHLCLALVRRVPLFENMDERLL  451

Query  1310  DAICDRLKPVLYTEKSCIVREGDPVDEMIFVMRGNLLTMTTNGGRTGFLNSDVLNAGDFC  1489
             DAIC+RLKP L+TE + IVREGDPVDEM+F++RG L ++TT+GGR+GF N  +L  GDFC
Sbjct  452   DAICERLKPSLFTESTYIVREGDPVDEMLFIIRGRLESVTTDGGRSGFFNRSLLKEGDFC  511

Query  1490  GEELLTWALDPNSSSSLPISTRTVQALTDVEAFALTADFLKFFASQYRRLHSKQLQHKFR  1669
             GEELLTWALDP S S+LP STRTV+ALT+VEAFAL A+ LKF ASQ+RRLHS+Q+QH FR
Sbjct  512   GEELLTWALDPKSGSNLPSSTRTVRALTEVEAFALVAEELKFVASQFRRLHSRQVQHTFR  571

Query  1670  FYSHQWKTWAACFIQAAWRRHCRNKLEKSLREEEDRLQDALILRMRREEGETTPSLGATI  1849
             FYS QW+TWAACFIQAAWRR+ + K    LR +E+  +  +   +R   G +  S+GAT 
Sbjct  572   FYSQQWRTWAACFIQAAWRRYSKRK-NMELRRKEEEGETEVFGGVRSNAGGSY-SIGATF  629

Query  1850  YASRFAANVLRTVRRNHplsvpklsprlpplllqkpAEPDFSA  1978
              ASRFAAN LR V RN              + LQKP EPDFSA
Sbjct  630   LASRFAANALRGVHRNR-----TAKSARELVKLQKPPEPDFSA  667



>ref|NP_565560.1| cyclic nucleotide-gated channel 6 [Arabidopsis thaliana]
 sp|O82226.2|CNGC6_ARATH RecName: Full=Probable cyclic nucleotide-gated ion channel 6; 
Short=AtCNGC6; AltName: Full=Cyclic nucleotide- and calmodulin-regulated 
ion channel 6 [Arabidopsis thaliana]
 emb|CAB40131.1| cyclic nucleotide and calmodulin-regulated ion channel [Arabidopsis 
thaliana]
 gb|AAC63666.2| cyclic nucleotide and calmodulin-regulated ion channel [Arabidopsis 
thaliana]
 gb|AEC07510.1| cyclic nucleotide-gated channel 6 [Arabidopsis thaliana]
Length=747

 Score =   719 bits (1856),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 361/652 (55%), Positives = 486/652 (75%), Gaps = 9/652 (1%)
 Frame = +2

Query  47    KSKMHDPQGPFLQRWNRIFVIACILAATVDPLFFYIPVVDDQNKCLGLDRTLEITACILR  226
             + K+ DPQ  FL   N++FV +CILA +VDPLF Y+P ++D+ KC+G+DR L I    +R
Sbjct  100   EKKIFDPQDKFLLLCNKLFVASCILAVSVDPLFLYLPFINDKAKCVGIDRKLAIIVTTIR  159

Query  227   SVFDFFYIFHIILQFRTGFVPPSSRVFGRGDLIVDPSAIAKRYFFSYFFIDILAVLPLPQ  406
             +V D FY+FH+ L+FRT +V PSSRVFGRG+L++DP+ IAKRY   YF ID+L+VLP+PQ
Sbjct  160   TVIDSFYLFHMALRFRTAYVAPSSRVFGRGELVIDPAQIAKRYLQQYFIIDLLSVLPVPQ  219

Query  407   VVLFMMIPRADRPFIMVAKDILKVVILVQSVPRLLRIYPLYKEVTRTSGFFTETAWAGAA  586
             ++++  +  +    ++  K  L+ ++LVQ +PR LR+YPL  E+ RT+G F ETAWAGAA
Sbjct  220   IIVWRFLYTSRGANVLATKQALRYIVLVQYIPRFLRMYPLSSELKRTAGVFAETAWAGAA  279

Query  587   FNLFLYMIASYVAGAIWYITAIERQDKCWRRACEKHGSCDIDFLYCTKLGRRG----GDF  754
             + L LYM+AS++ GA+WY+ A+ER + CW +AC  + +C  +FL+C     +G     + 
Sbjct  280   YYLLLYMLASHIVGALWYLLALERNNDCWSKACHNNQNCTRNFLFCGNQNMKGYAAWDNI  339

Query  755   SSSFLNTSCALLEPENLKADDFDFGIFLDALKSNVVEKRYFWSKLFYCFWWGLRNLSSLG  934
               S+L   C +  PE+ +   FDFGI+L AL S +V  + F SK F+C WWGL+NLS+LG
Sbjct  340   KVSYLQLKCPVNVPED-EEPPFDFGIYLRALSSGIVSSKNFVSKYFFCLWWGLQNLSTLG  398

Query  935   QNLKTSNFVGEilfailisiiglilfslligNMQKYLQSITVRVEEMRVKRMDAEQWMSH  1114
             Q L+TS + GE++F+I ++I GL+LF+LLIGNMQ YLQS+T+R+EEMRVKR D+EQWM H
Sbjct  399   QGLETSTYPGEVIFSITLAIAGLLLFALLIGNMQTYLQSLTIRLEEMRVKRRDSEQWMHH  458

Query  1115  RMLPDNLRERIRRYEQYRWQETRGVDEESLISNLPKDLRRDINRHLCWSLLKRVHMFKTM  1294
             RMLP  LRER+RRY+QY+W ETRGVDEE+L+ NLPKDLRRDI RHLC +L++RV +F+ M
Sbjct  459   RMLPPELRERVRRYDQYKWLETRGVDEENLVQNLPKDLRRDIKRHLCLALVRRVPLFENM  518

Query  1295  DEQLLDAICDRLKPVLYTEKSCIVREGDPVDEMIFVMRGNLLTMTTNGGRTGFLNSDVLN  1474
             DE+LLDAIC+RLKP L+TEKS +VREGDPV+EM+F++RG L ++TT+GGR+GF N  +L 
Sbjct  519   DERLLDAICERLKPCLFTEKSYLVREGDPVNEMLFIIRGRLESVTTDGGRSGFYNRSLLK  578

Query  1475  AGDFCGEELLTWALDPNSSSSLPISTRTVQALTDVEAFALTADFLKFFASQYRRLHSKQL  1654
              GDFCG+ELLTWALDP S S+LP STRTV+ALT+VEAFAL AD LKF ASQ+RRLHS+Q+
Sbjct  579   EGDFCGDELLTWALDPKSGSNLPSSTRTVKALTEVEAFALIADELKFVASQFRRLHSRQV  638

Query  1655  QHKFRFYSHQWKTWAACFIQAAWRRHCRNKLEKSLREEEDRLQDALILRMRREEGETTPS  1834
             QH FRFYS QW+TWAACF+QAAWRR+ + K  + LR+EE+  + A    +    G +  S
Sbjct  639   QHTFRFYSQQWRTWAACFMQAAWRRYIKRKKLEQLRKEEEEEEAAAASVI---AGGSPYS  695

Query  1835  LGATIYASRFAANVLRTVRRNHplsvpklsprlpplll-qkpAEPDFSAPEN  1987
             + AT  AS+FAAN LR+V +N       L      L+  QKP EPDFSA ++
Sbjct  696   IRATFLASKFAANALRSVHKNRTAKSTLLLSSTKELVKFQKPPEPDFSAEDH  747



>ref|XP_002867341.1| ATCNGC9 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH43600.1| ATCNGC9 [Arabidopsis lyrata subsp. lyrata]
Length=733

 Score =   718 bits (1854),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 366/650 (56%), Positives = 473/650 (73%), Gaps = 26/650 (4%)
 Frame = +2

Query  47    KSKMHDPQGPFLQRWNRIFVIACILAATVDPLFFYIPVVDDQNKCLGLDRTLEITACILR  226
             + K+ DPQ  FL   N++FV +CILA +VDPLF Y+P V D  KC+G+DR L I A  LR
Sbjct  100   EKKIFDPQDKFLLLCNKLFVTSCILAVSVDPLFLYLPFVKDNEKCIGIDRRLAIIATTLR  159

Query  227   SVFDFFYIFHIILQFRTGFVPPSSRVFGRGDLIVDPSAIAKRYFFSYFFIDILAVLPLPQ  406
             +V D FY+FH+ L+FRT FV PSSRVFGRG+L++DP+ IAKRY   YF ID L+VLPLPQ
Sbjct  160   TVIDAFYLFHMALRFRTAFVAPSSRVFGRGELVIDPAQIAKRYLQQYFIIDFLSVLPLPQ  219

Query  407   VVLFMMIPRADRPFIMVAKDILKVVILVQSVPRLLRIYPLYKEVTRTSGFFTETAWAGAA  586
             +V++  +  +    ++  K  L+ +IL+Q +PR +R+YPL  E+ RT+G F ETAWAGAA
Sbjct  220   IVVWRFLGISGGASVLATKRALRSIILLQYIPRFIRLYPLSSELKRTAGVFAETAWAGAA  279

Query  587   FNLFLYMIASYVAGAIWYITAIERQDKCWRRACEKHG-SCDIDFLYCTKLGRRG----GD  751
             + L LYM+AS++ GA+WY+ A+ER + CW +AC  +   C  +FL+C      G      
Sbjct  280   YYLLLYMLASHIVGALWYLLALERYNGCWSKACGNNSLDCQRNFLFCGNENMDGYAAWST  339

Query  752   FSSSFLNTSCALLEPENLKADDFDFGIFLDALKSNVVEKRYFWSKLFYCFWWGLRNLSSL  931
                S L T+C +   +N     FDFGI+L AL S +V  + F SK F+C WWGL+NLS+L
Sbjct  340   IKDSVLQTNCPVNTTDN---PPFDFGIYLRALSSGIVSSKSFVSKYFFCLWWGLQNLSTL  396

Query  932   GQNLKTSNFVGEilfailisiiglilfslligNMQKYLQSITVRVEEMRVKRMDAEQWMS  1111
             GQ L+TS + GE++F+I ++I GL+LF+LLIGNMQ YLQS+T+R+EEMRVKR D+EQWM 
Sbjct  397   GQGLQTSTYPGEVIFSIALAIAGLLLFALLIGNMQTYLQSLTIRLEEMRVKRRDSEQWMH  456

Query  1112  HRMLPDNLRERIRRYEQYRWQETRGVDEESLISNLPKDLRRDINRHLCWSLLKRVHMFKT  1291
             HRMLP  LRER+RRY+QY+W ETRGVDEE+L+ NLPKDLRRDI RHLC +L++RV +F+ 
Sbjct  457   HRMLPPELRERVRRYDQYKWLETRGVDEENLVQNLPKDLRRDIKRHLCLALVRRVPLFEN  516

Query  1292  MDEQLLDAICDRLKPVLYTEKSCIVREGDPVDEMIFVMRGNLLTMTTNGGRTGFLNSDVL  1471
             MDE+LLDAIC+RLKP LYTE S +VREGDPV+EM+F++RG L ++TT+GGR+GF N  +L
Sbjct  517   MDERLLDAICERLKPCLYTESSYLVREGDPVNEMLFIIRGRLESVTTDGGRSGFFNRSLL  576

Query  1472  NAGDFCGEELLTWALDPNSSSSLPISTRTVQALTDVEAFALTADFLKFFASQYRRLHSKQ  1651
               GDFCGEELLTWALDP S S+LP STRT +ALT+VEAFAL AD LKF ASQ+RRLHS+Q
Sbjct  577   KEGDFCGEELLTWALDPKSGSNLPSSTRTAKALTEVEAFALIADELKFVASQFRRLHSRQ  636

Query  1652  LQHKFRFYSHQWKTWAACFIQAAWRRHCRNKLEKSLREEEDRLQDALILRMRREEGE-TT  1828
             +QH FRFYS QW+TWAA FIQAAWRR+ + K  + LR+EE             EEGE + 
Sbjct  637   VQHTFRFYSQQWRTWAAIFIQAAWRRYVKKKKLEQLRKEE-------------EEGEGSV  683

Query  1829  PSLGATIYASRFAANVLRTVRRNHplsvpklsprlpplllqkpAEPDFSA  1978
              S+ AT  AS+FAAN LR V +N      +       +  QKP+EPDFSA
Sbjct  684   TSIRATFLASKFAANALRKVHKNR----IEAKSTKELVKYQKPSEPDFSA  729



>ref|XP_007204256.1| hypothetical protein PRUPE_ppa001993mg [Prunus persica]
 gb|EMJ05455.1| hypothetical protein PRUPE_ppa001993mg [Prunus persica]
Length=732

 Score =   718 bits (1853),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 369/647 (57%), Positives = 474/647 (73%), Gaps = 17/647 (3%)
 Frame = +2

Query  53    KMHDPQGPFLQRWNRIFVIACILAATVDPLFFYIPVVDDQNKCLGLDRTLEITACILRSV  232
             K+ DPQ  FL  WNR+FVI+CILA +VDPLFFY+PV+++ + CLG+DR L I A  LR +
Sbjct  94    KIFDPQDKFLLLWNRLFVISCILAVSVDPLFFYLPVINNSSSCLGIDRRLAIIATTLRMI  153

Query  233   FDFFYIFHIILQFRTGFVPPSSRVFGRGDLIVDPSAIAKRYFFSYFFIDILAVLPLPQVV  412
              D FY+ H+ LQFRT ++ PSSRVFGRG+L++DP+ IAKRY   YF ID LAVLPLPQ++
Sbjct  154   VDAFYLIHMALQFRTAYIAPSSRVFGRGELVIDPARIAKRYLRRYFIIDFLAVLPLPQII  213

Query  413   LFMMIPRADRPFIMVAKDILKVVILVQSVPRLLRIYPLYKEVTRTSGFFTETAWAGAAFN  592
             ++  + R+    ++  K  L  ++L+Q +PRL+R+ PL  E+ RT+G F ETAWAGAA  
Sbjct  214   VWRFLQRSKGSDVLATKQALLFIVLLQYIPRLVRVLPLTSELKRTAGVFAETAWAGAACY  273

Query  593   LFLYMIASYVAGAIWYITAIERQDKCWRRACEKHGS-CDIDFLYCTKLGRRGGDFSSSFL  769
             L LYM+AS++ GA WY+ A+ER D CW+RAC   G  CD +FLYC   G +    + ++ 
Sbjct  274   LLLYMLASHIVGAFWYLLALERNDTCWQRACTDIGKPCDKNFLYC---GNQNILDAGTWS  330

Query  770   NTSCALLEPENLKADD----FDFGIFLDALKSNVVEKRYFWSKLFYCFWWGLRNLSSLGQ  937
             N +  +        DD    FDFGI+  AL S VV  + F  K  YC WWGL+NLS+LGQ
Sbjct  331   NVTGNI--QSKCSTDDQNAYFDFGIYKSALSSGVVSSKKFLPKYCYCLWWGLQNLSTLGQ  388

Query  938   NLKTSNFVGEilfailisiiglilfslligNMQKYLQSITVRVEEMRVKRMDAEQWMSHR  1117
              L TS + GE++F+I ++I GLILF+LLIGNMQ YLQS+T+R+EEMRVKR D+EQWM HR
Sbjct  389   GLATSTYPGEVIFSISLAIFGLILFALLIGNMQTYLQSLTIRLEEMRVKRRDSEQWMHHR  448

Query  1118  MLPDNLRERIRRYEQYRWQETRGVDEESLISNLPKDLRRDINRHLCWSLLKRVHMFKTMD  1297
             +LP +LRER+RRY+QY+W ETRGVDE+SL+ +LPKDLRRDI RHLC +L++RV +F+ MD
Sbjct  449   LLPQDLRERVRRYDQYKWLETRGVDEQSLVQSLPKDLRRDIKRHLCLALVRRVPLFENMD  508

Query  1298  EQLLDAICDRLKPVLYTEKSCIVREGDPVDEMIFVMRGNLLTMTTNGGRTGFLNSDVLNA  1477
             E+LLDAIC+RLKP L+TE + IVREGDPVDEM+F++RG L ++TT+GGR+GF N  +L  
Sbjct  509   ERLLDAICERLKPSLFTESTYIVREGDPVDEMLFIIRGRLESVTTDGGRSGFFNRSLLKE  568

Query  1478  GDFCGEELLTWALDPNSSSSLPISTRTVQALTDVEAFALTADFLKFFASQYRRLHSKQLQ  1657
             GDFCGEELLTWALDP S S+LP STRTV+ALT+VEAFAL A+ LKF ASQ+RRLHS+Q+Q
Sbjct  569   GDFCGEELLTWALDPKSGSNLPSSTRTVRALTEVEAFALVAEELKFVASQFRRLHSRQVQ  628

Query  1658  HKFRFYSHQWKTWAACFIQAAWRRHCRNKLEKSLREEEDRLQDALILRMRREEGETTPSL  1837
             H FRFYS QW+TWAACFIQAAWRR  + K    LR +E+  +  +   +R   G +  S+
Sbjct  629   HTFRFYSQQWRTWAACFIQAAWRRSSKRK-NMELRRKEEEGETEVFGGVRSNAGGSY-SI  686

Query  1838  GATIYASRFAANVLRTVRRNHplsvpklsprlpplllqkpAEPDFSA  1978
             GAT  ASRFAAN LR V RN              + LQKP EPDFSA
Sbjct  687   GATFLASRFAANALRGVHRNR-----NAKSARELVKLQKPPEPDFSA  728



>ref|XP_009614625.1| PREDICTED: probable cyclic nucleotide-gated ion channel 5 [Nicotiana 
tomentosiformis]
 ref|XP_009614626.1| PREDICTED: probable cyclic nucleotide-gated ion channel 5 [Nicotiana 
tomentosiformis]
 ref|XP_009614627.1| PREDICTED: probable cyclic nucleotide-gated ion channel 5 [Nicotiana 
tomentosiformis]
 ref|XP_009614628.1| PREDICTED: probable cyclic nucleotide-gated ion channel 5 [Nicotiana 
tomentosiformis]
Length=693

 Score =   716 bits (1848),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 357/621 (57%), Positives = 461/621 (74%), Gaps = 9/621 (1%)
 Frame = +2

Query  47    KSKMHDPQGPFLQRWNRIFVIACILAATVDPLFFYIPVVDDQNKCLGLDRTLEITACILR  226
             ++K+ DPQ  FL  WN++FV++CILA +VDPLFFY+PV ++   CL +DR L + A  LR
Sbjct  53    ENKIFDPQDKFLLLWNKLFVVSCILAVSVDPLFFYLPVFNNTANCLQIDRKLAVIATTLR  112

Query  227   SVFDFFYIFHIILQFRTGFVPPSSRVFGRGDLIVDPSAIAKRYFFSYFFIDILAVLPLPQ  406
             +V D FY+ H+ LQFRT ++ PSSRVFGRG+L++D   IAKRY   YF ID+L+VLPLPQ
Sbjct  113   TVVDAFYLIHMALQFRTAYIAPSSRVFGRGELVIDSGQIAKRYLRFYFIIDLLSVLPLPQ  172

Query  407   VVLFMMIPRADRPFIMVAKDILKVVILVQSVPRLLRIYPLYKEVTRTSGFFTETAWAGAA  586
             +V+   + R+    ++  K  L  +IL+Q +PR  R+ PL  E+ RT+G F ETAWAGAA
Sbjct  173   IVVGRFLQRSAGSDVLATKQALLYIILLQYIPRFGRVIPLTSELKRTTGVFAETAWAGAA  232

Query  587   FNLFLYMIASYVAGAIWYITAIERQDKCWRRACEKHGSCDIDFLYCTKLGRRGGD----F  754
               L LYM+AS++ G+ WY+ ++ER D CW+ AC+ +G+C+ DFLYC   G +G +     
Sbjct  233   SYLLLYMLASHIVGSFWYLLSVERYDTCWQEACKHNGTCNTDFLYCGNQGMKGYNAWSII  292

Query  755   SSSFLNTSCALLEPENLKADDFDFGIFLDALKSNVVEKRYFWSKLFYCFWWGLRNLSSLG  934
             S S LN +C +   +N     FDFGIF  AL S +V    F +K  YC WWGL+NLS+LG
Sbjct  293   SDSVLNEACPVDSDDN---QPFDFGIFKQALSSGIVFSMKFVTKYCYCLWWGLQNLSTLG  349

Query  935   QNLKTSNFVGEilfailisiiglilfslligNMQKYLQSITVRVEEMRVKRMDAEQWMSH  1114
             Q L+TS F GE LF+I ++I+GLILF+LLIGNMQ YLQS+T+R+EEMRVKR D+EQWM H
Sbjct  350   QGLQTSTFPGESLFSIALAILGLILFALLIGNMQTYLQSLTIRLEEMRVKRRDSEQWMHH  409

Query  1115  RMLPDNLRERIRRYEQYRWQETRGVDEESLISNLPKDLRRDINRHLCWSLLKRVHMFKTM  1294
             R+LP +LRER+R Y+QY+WQETRGVDEE+++ NLPKDLRRDI RHLC +L+KRV +F  M
Sbjct  410   RLLPQDLRERVRGYDQYKWQETRGVDEENIVQNLPKDLRRDIKRHLCLALVKRVPLFANM  469

Query  1295  DEQLLDAICDRLKPVLYTEKSCIVREGDPVDEMIFVMRGNLLTMTTNGGRTGFLNSDVLN  1474
             +E+LLDAIC+RLKP LY E + +VREGDPVDEM+FV+RG L ++TT+GGR+GF N  +L 
Sbjct  470   EERLLDAICERLKPCLYIENTYLVREGDPVDEMLFVIRGRLESVTTDGGRSGFFNRSLLK  529

Query  1475  AGDFCGEELLTWALDPNSSSSLPISTRTVQALTDVEAFALTADFLKFFASQYRRLHSKQL  1654
               DFCGEELLTWALDP S S+LP STRTV+ALT+VEAFAL AD LKF ASQ+R+LHS+Q+
Sbjct  530   ESDFCGEELLTWALDPKSGSNLPSSTRTVKALTEVEAFALIADELKFVASQFRKLHSRQV  589

Query  1655  QHKFRFYSHQWKTWAACFIQAAWRRHCRNKLEKSLREEEDRLQDALILRMRREEGETTPS  1834
             QH FRFYS  W+TWAACFIQAAWRR  + KL + L+ +ED   +AL        G +  S
Sbjct  590   QHTFRFYSQHWRTWAACFIQAAWRRFTKRKLME-LQRKEDEEAEALA-GASSTLGGSPYS  647

Query  1835  LGATIYASRFAANVLRTVRRN  1897
             + AT  ASRFAAN LR V RN
Sbjct  648   IRATFLASRFAANALRGVHRN  668



>ref|XP_006474002.1| PREDICTED: probable cyclic nucleotide-gated ion channel 5-like 
isoform X1 [Citrus sinensis]
 ref|XP_006474003.1| PREDICTED: probable cyclic nucleotide-gated ion channel 5-like 
isoform X2 [Citrus sinensis]
 ref|XP_006474004.1| PREDICTED: probable cyclic nucleotide-gated ion channel 5-like 
isoform X3 [Citrus sinensis]
 ref|XP_006474005.1| PREDICTED: probable cyclic nucleotide-gated ion channel 5-like 
isoform X4 [Citrus sinensis]
 ref|XP_006474006.1| PREDICTED: probable cyclic nucleotide-gated ion channel 5-like 
isoform X5 [Citrus sinensis]
Length=733

 Score =   717 bits (1852),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 368/653 (56%), Positives = 479/653 (73%), Gaps = 17/653 (3%)
 Frame = +2

Query  47    KSKMHDPQGPFLQRWNRIFVIACILAATVDPLFFYIPVVDDQNKCLGLDRTLEITACILR  226
             + K+ DPQ   L   N++FVI+CILA +VDPLFFY+PV++D +KCLG+DR L ITA  LR
Sbjct  93    EKKIFDPQDKLLLFCNKLFVISCILAVSVDPLFFYLPVINDSSKCLGIDRKLAITATTLR  152

Query  227   SVFDFFYIFHIILQFRTGFVPPSSRVFGRGDLIVDPSAIAKRYFFSYFFIDILAVLPLPQ  406
             ++ D FY+ H+ LQFRT F+ PSSRVFGRG+L++DP+ IAKRY   YF ID LAVLPLPQ
Sbjct  153   TIVDVFYLLHMALQFRTAFIAPSSRVFGRGELVIDPAQIAKRYMRRYFIIDFLAVLPLPQ  212

Query  407   VVLFMMIPRADRPFIMVAKDILKVVILVQSVPRLLRIYPLYKEVTRTSGFFTETAWAGAA  586
             +V++  + R++   ++  K  L  ++L Q  PR  RI PL  E+ RT+G F ETAWAGA 
Sbjct  213   IVVWRFLLRSNGSDVLATKQALFFIVLFQYFPRFFRILPLTSELKRTAGVFAETAWAGAV  272

Query  587   FNLFLYMIASYVAGAIWYITAIERQDKCWRRACEKHGSCDIDFLYCTKLGRRG----GDF  754
             + L LYM+AS+V GA+WY+ A+ER D CWR+AC    +C  DFLYC      G     D 
Sbjct  273   YYLLLYMLASHVVGALWYLLALERNDTCWRKACSVTANCTKDFLYCGNQDMTGYAAWHDI  332

Query  755   SSSFLNTSCALLEPENLKADDFDFGIFLDALKSNVVEKRYFWSKLFYCFWWGLRNLSSLG  934
             S++ L + C+  E +      FDFGI+  AL S +V  + F+SK  YC WWGL+NLS+LG
Sbjct  333   SNTTLESKCSADEDD----PPFDFGIYSQALSSGIVSSKKFFSKYCYCLWWGLQNLSTLG  388

Query  935   QNLKTSNFVGEilfailisiiglilfslligNMQKYLQSITVRVEEMRVKRMDAEQWMSH  1114
             Q L+TS F GE++F+I ++I GLILF+LLIGNMQ YLQS+T+R+EEMR+KR D+EQWM H
Sbjct  389   QGLQTSTFPGEVIFSIALAIFGLILFALLIGNMQTYLQSLTIRLEEMRIKRRDSEQWMHH  448

Query  1115  RMLPDNLRERIRRYEQYRWQETRGVDEESLISNLPKDLRRDINRHLCWSLLKRVHMFKTM  1294
             R+LP +LRER+RRY+QY+W ETRGVDEE+L+ +LPKDLRRDI RHLC +L++RV +F+ M
Sbjct  449   RLLPPDLRERVRRYDQYKWLETRGVDEENLVQSLPKDLRRDIKRHLCLALVRRVPLFENM  508

Query  1295  DEQLLDAICDRLKPVLYTEKSCIVREGDPVDEMIFVMRGNLLTMTTNGGRTGFLNSDVLN  1474
             DE+LLDAIC+RLKP L+T+ + IVREGDPVDEM+F++RG L ++TT+GGR+GF N   L 
Sbjct  509   DERLLDAICERLKPCLFTDSTYIVREGDPVDEMLFIIRGRLESVTTDGGRSGFFNRGFLK  568

Query  1475  AGDFCGEELLTWALDPNSSSSLPISTRTVQALTDVEAFALTADFLKFFASQYRRLHSKQL  1654
              GDFCGEELLTWALDP S  +LP STRTV+AL +VEAFAL A+ LKF ASQ+RRLHS+Q+
Sbjct  569   EGDFCGEELLTWALDPKSGVNLPSSTRTVRALKEVEAFALMAEELKFVASQFRRLHSRQV  628

Query  1655  QHKFRFYSHQWKTWAACFIQAAWRRHC-RNKLEKSLREEEDRLQDALILRMRREEGETTP  1831
             QH FRFYS QW+TWAACFIQAAWRR+  R K+E++ +EEE+      +   +   G  + 
Sbjct  629   QHTFRFYSQQWRTWAACFIQAAWRRYSKRKKMEQTRKEEEEEEASEGV---QSSTGGGSY  685

Query  1832  SLGATIYASRFAANVLRTVRRNHplsvpklsprlpplllqkpAEPDFSAPENN  1990
             S+GAT  A+RFAAN LR V RN              + LQKP EPDF+A + +
Sbjct  686   SIGATFLATRFAANALRGVHRNR-----NAKSARELVKLQKPPEPDFTAEDAD  733



>gb|EYU34343.1| hypothetical protein MIMGU_mgv1a001946mg [Erythranthe guttata]
Length=735

 Score =   717 bits (1852),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 371/648 (57%), Positives = 475/648 (73%), Gaps = 15/648 (2%)
 Frame = +2

Query  47    KSKMHDPQGPFLQRWNRIFVIACILAATVDPLFFYIPVVDDQNKCLGLDRTLEITACILR  226
             + K+ DPQ   L  WN++FV++CILA +VDPLFF++PV +  + CL +DR L ITA  LR
Sbjct  96    EKKIFDPQDKLLTLWNKLFVMSCILAVSVDPLFFFLPVFNKSSNCLDIDRKLAITATTLR  155

Query  227   SVFDFFYIFHIILQFRTGFVPPSSRVFGRGDLIVDPSAIAKRYFFSYFFIDILAVLPLPQ  406
             ++ D FY+ H+ LQFRT ++ PSSRVFGRG+L++DP+ IAKRY   YF ID LAVLPLPQ
Sbjct  156   TIVDAFYLIHMALQFRTAYIAPSSRVFGRGELVIDPAQIAKRYLKYYFIIDFLAVLPLPQ  215

Query  407   VVLFMMIPRADRPFIMVAKDILKVVILVQSVPRLLRIYPLYKEVTRTSGFFTETAWAGAA  586
             ++++  + R+    ++  K  L  +IL+Q +PR  RI PL  E+ RTSG F ETAWAGA 
Sbjct  216   IIVWRFLQRSKGSDVLTTKQALFFIILLQYIPRFARIMPLTSELKRTSGVFAETAWAGAV  275

Query  587   FNLFLYMIASYVAGAIWYITAIERQDKCWRRACEKHGSCDIDFLYCTKLGRRGGDF----  754
               L LYM+AS++ GA WY+ ++ER D CW+RAC++ G C   FLYC        D     
Sbjct  276   SYLLLYMLASHIVGAFWYLLSVERNDTCWQRACKRSGKCVTGFLYCGNQNMNDYDIWSNI  335

Query  755   SSSFLNTSCALLEPENLKADDFDFGIFLDALKSNVVEKRYFWSKLFYCFWWGLRNLSSLG  934
             S S L+T+C + +  N     FDFGIF  AL + +V  R F SK  YC WWGL+NLS+LG
Sbjct  336   SDSVLSTACPVDDQNN---PPFDFGIFRQALAAEIVSSRKFLSKYCYCLWWGLQNLSTLG  392

Query  935   QNLKTSNFVGEilfailisiiglilfslligNMQKYLQSITVRVEEMRVKRMDAEQWMSH  1114
             Q L+TS + GE +F+I ++I GLILF+LLIGNMQ YLQS+T+R+EEMRVKR D+EQWM H
Sbjct  393   QGLQTSTYPGESIFSIALAIFGLILFALLIGNMQTYLQSLTIRLEEMRVKRRDSEQWMHH  452

Query  1115  RMLPDNLRERIRRYEQYRWQETRGVDEESLISNLPKDLRRDINRHLCWSLLKRVHMFKTM  1294
             R+LP +LR+R+RRY+QY+W ETRGVDE+SL+ +LPKDLRRDI RHLC +L+KRV +F+ M
Sbjct  453   RLLPPDLRDRVRRYDQYKWLETRGVDEQSLVESLPKDLRRDIKRHLCLALVKRVPLFENM  512

Query  1295  DEQLLDAICDRLKPVLYTEKSCIVREGDPVDEMIFVMRGNLLTMTTNGGRTGFLNSDVLN  1474
             DE+LLDAIC+RLKP LYTE + IVREGDPVDEMIF++RG L ++TT+GGR+GF N  +L 
Sbjct  513   DERLLDAICERLKPCLYTENTYIVREGDPVDEMIFLIRGRLESVTTDGGRSGFFNRSLLK  572

Query  1475  AGDFCGEELLTWALDPNSSSSLPISTRTVQALTDVEAFALTADFLKFFASQYRRLHSKQL  1654
              GDFCGEELLTWALDP S S+LP STRTV+ALT+VEAFALTAD LKF ASQ+RRLHS+Q+
Sbjct  573   EGDFCGEELLTWALDPKSGSNLPSSTRTVKALTEVEAFALTADELKFVASQFRRLHSRQV  632

Query  1655  QHKFRFYSHQWKTWAACFIQAAWRRHCRNKLEKSLREEEDRLQDALILRMRREEGETTPS  1834
             QH FRFYS QW+TWAACFIQAAWRR+ + K+ +  R+EE   ++A  L     +   + S
Sbjct  633   QHTFRFYSQQWRTWAACFIQAAWRRYSKRKVIEMKRKEE---EEAEGLLAGPADATGSYS  689

Query  1835  LGATIYASRFAANVLRTVRRNHplsvpklsprlpplllqkpAEPDFSA  1978
             +GAT   SRFAAN LR V RN       L      + LQKP EPDF+A
Sbjct  690   IGATFLVSRFAANALRGVHRNR-----NLKITRELVKLQKPPEPDFTA  732



>ref|XP_010438163.1| PREDICTED: putative cyclic nucleotide-gated ion channel 9 [Camelina 
sativa]
Length=736

 Score =   717 bits (1852),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 365/651 (56%), Positives = 475/651 (73%), Gaps = 22/651 (3%)
 Frame = +2

Query  47    KSKMHDPQGPFLQRWNRIFVIACILAATVDPLFFYIPVVDDQNKCLGLDRTLEITACILR  226
             + K+ DPQ  FL   N++FV +CILA +VDPLF Y+P V D +KC+G+DR L I A  LR
Sbjct  101   EKKIFDPQDKFLLLCNKLFVTSCILAVSVDPLFLYLPFVKDNDKCIGIDRRLAIIATTLR  160

Query  227   SVFDFFYIFHIILQFRTGFVPPSSRVFGRGDLIVDPSAIAKRYFFSYFFIDILAVLPLPQ  406
             +V D FY+FH+ L+FRT FV PSSRVFGRG+L++DP+ IAKRY   YF ID L+VLPLPQ
Sbjct  161   TVIDVFYLFHMALRFRTAFVAPSSRVFGRGELVIDPAQIAKRYLQQYFIIDFLSVLPLPQ  220

Query  407   VVLFMMIPRADRPFIMVAKDILKVVILVQSVPRLLRIYPLYKEVTRTSGFFTETAWAGAA  586
             +V++  +  +    ++  K  L+ +IL+Q +PR +R+YPL  E+ RT+G F ETAWAGAA
Sbjct  221   IVVWRFLYTSKGASVLATKRALRSIILLQYIPRFIRLYPLSSELKRTAGVFAETAWAGAA  280

Query  587   FNLFLYMIASYVAGAIWYITAIERQDKCWRRACE-KHGSCDIDFLYCTKLGRRGGDFSSS  763
             + L LYM+AS++ GA+WY+ A+ER + CW +AC     +C  +FL+C      G    S+
Sbjct  281   YYLLLYMLASHIVGALWYLLALERYNGCWSKACSISENNCTRNFLFCGNEKMDGYAAWST  340

Query  764   FLNTSCALLEPENLKADD---FDFGIFLDALKSNVVEKRYFWSKLFYCFWWGLRNLSSLG  934
               ++   +  P N    D   FDFGI+L AL S +V  + F SK F+C WWGL+NLS+LG
Sbjct  341   IKDSVFQINCPVNTTDGDNPPFDFGIYLRALSSGIVSSKSFVSKYFFCLWWGLQNLSTLG  400

Query  935   QNLKTSNFVGEilfailisiiglilfslligNMQKYLQSITVRVEEMRVKRMDAEQWMSH  1114
             Q L+TS + GE++F+I ++I GL+LF+LLIGNMQ YLQS+T+R+EEMRVKR D+EQWM H
Sbjct  401   QGLETSTYPGEVIFSIALAIAGLLLFALLIGNMQTYLQSLTIRLEEMRVKRRDSEQWMHH  460

Query  1115  RMLPDNLRERIRRYEQYRWQETRGVDEESLISNLPKDLRRDINRHLCWSLLKRVHMFKTM  1294
             RMLP  LRER+RRY+QY+W ETRGVDEE+L+ NLPKDLRRDI RHLC +L++RV +F+ M
Sbjct  461   RMLPPELRERVRRYDQYKWLETRGVDEENLVQNLPKDLRRDIKRHLCLALVRRVPLFENM  520

Query  1295  DEQLLDAICDRLKPVLYTEKSCIVREGDPVDEMIFVMRGNLLTMTTNGGRTGFLNSDVLN  1474
             DE+LLDAIC+RLKP LYTE S +VREGDPV+EM+F++RG L ++TT+GGR+GF N  +L 
Sbjct  521   DERLLDAICERLKPCLYTENSYLVREGDPVNEMLFIIRGRLESVTTDGGRSGFFNRSLLK  580

Query  1475  AGDFCGEELLTWALDPNSSSSLPISTRTVQALTDVEAFALTADFLKFFASQYRRLHSKQL  1654
              GDFCGEELLTWALDP S S+LP STRT +ALT+VEAFAL AD LKF ASQ+RRLHS+Q+
Sbjct  581   EGDFCGEELLTWALDPKSGSNLPSSTRTAKALTEVEAFALIADELKFVASQFRRLHSRQV  640

Query  1655  QHKFRFYSHQWKTWAACFIQAAWRRHCRNKLEKSLREEEDRLQDALILRMRREEGE-TTP  1831
             QH FRFYS QW+TWAA FIQAAWRR+ + K  + LR+EE             EEGE +  
Sbjct  641   QHTFRFYSQQWRTWAAIFIQAAWRRYVKKKKLEQLRKEE-------------EEGEGSVT  687

Query  1832  SLGATIYASRFAANVLRTVRRNHplsvpklsprlpplllqkpAEPDFSAPE  1984
             S+ AT  AS+FAAN LR V +N      +       +  QKP+EPDFSA +
Sbjct  688   SIRATFLASKFAANALRKVHKNR----IEAKSTKELVKYQKPSEPDFSADD  734



>ref|XP_004510619.1| PREDICTED: probable cyclic nucleotide-gated ion channel 10-like 
isoform X2 [Cicer arietinum]
Length=620

 Score =   713 bits (1840),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 382/628 (61%), Positives = 465/628 (74%), Gaps = 15/628 (2%)
 Frame = +2

Query  119   LAATVDPLFFYIPVVDDQNKCLGLDRTLEITACILRSVFDFFYIFHIILQFRTGFVPPSS  298
             +A ++DPLFFYIPV+D++ KCL LD TL++TA +LR+ FD FYI  I+ QFRTGF+ PSS
Sbjct  1     MAISMDPLFFYIPVIDEKRKCLKLDGTLKVTAGVLRTFFDLFYILRIVFQFRTGFIAPSS  60

Query  299   RVFGRGDLIVDPSAIAKRYFFSYFFIDILAVLPLPQVVLFMMIPRADRPFIMVAKDILKV  478
             RVFGRG+ + DP AIA RY  S+F IDIL++LPLPQ+V+  MIP   R    +AKD LK 
Sbjct  61    RVFGRGEPVDDPFAIAMRYLSSHFIIDILSILPLPQMVMLAMIPIPQRSVPCIAKDWLKY  120

Query  479   VILVQSVPRLLRIYPLYKEVTRTSGFFTETAWAGAAFNLFLYMIASYVAGAIWYITAIER  658
             +I+ Q  PRLLRIYPL+KEVT TSG  TETAWAGAA+NLFLYM+AS+V GA WY+ +IE 
Sbjct  121   MIIAQYAPRLLRIYPLFKEVTNTSGILTETAWAGAAYNLFLYMLASHVVGAFWYLFSIES  180

Query  659   QDKCWRRACEKHGSCDIDFLYCTKLGRRGGDFSSSFLN--TSCALLEP-ENLKADDFDFG  829
             Q +CW R  +     D  +L C   GRR      S LN  T+C   +P E +    F+FG
Sbjct  181   QLRCWHRQLKHTAFSDDSYLSC---GRRVNSSVLSLLNNATTCPYTDPDEIIDPMVFNFG  237

Query  830   IFLDALKSNVVEKRY-FWSKLFYCFWWGLRNLSSLGQNLKTSNFVGEilfailisiigli  1006
             IF+D LKS VVE R     K FYCFWWGLRNLSS+GQNLKTS ++GEI+FAI I++ GL+
Sbjct  238   IFIDGLKSRVVESRTNLHHKFFYCFWWGLRNLSSVGQNLKTSTYIGEIIFAIFIAVFGLV  297

Query  1007  lfslligNMQKYLQSITVRVEEMRVKRMDAEQWMSHRMLPDNLRERIRRYEQYRWQETRG  1186
             LF+LLIGNMQKYLQS TVRVEEMR+KR DAEQWM HRMLP+ L++RIRRYEQY+WQE RG
Sbjct  298   LFALLIGNMQKYLQSTTVRVEEMRIKRRDAEQWMCHRMLPEYLKQRIRRYEQYKWQENRG  357

Query  1187  VDEESLISNLPKDLRRDINRHLCWSLLKRVHMFKTMDEQLLDAICDRLKPVLYTEKSCIV  1366
             V+EE+LI NLPKDLRRDI RHLC  LLK+V +F  MD+QLLDA+CD+LKPVLYTEKS +V
Sbjct  358   VEEETLIRNLPKDLRRDIKRHLCLDLLKKVPIFGNMDKQLLDAMCDKLKPVLYTEKSYVV  417

Query  1367  REGDPVDEMIFVMRGNLLTMTTNGGRTGFLNSDVLNAGDFCGEELLTWALDPNSSSSLPI  1546
              EGDPVDEM+F+MRG L T++TNGGRTGF NS  L AGDFCGEELLTWAL P  SS+LPI
Sbjct  418   CEGDPVDEMLFIMRGKLATVSTNGGRTGFFNSSELKAGDFCGEELLTWALYPTPSSNLPI  477

Query  1547  STRTVQALTDVEAFALTADFLKFFASQYRRL-HSKQLQHKFRFYSHQWKTWAACFIQAAW  1723
             ST TVQ +++VEAFAL  D LK  ASQ+RRL ++KQL+H FRF S +W+TW A FIQ  W
Sbjct  478   STSTVQTISEVEAFALLPDDLKIVASQFRRLINTKQLKHTFRFSSWKWRTWGARFIQVVW  537

Query  1724  RRHCRNKLEKSLREEEDRLQDALILRMRREEGETTPSLGATIYASRFAANVLRTVRRNHp  1903
             RR+   + +KSLRE E++ Q         EEG ++PS   T+Y  RFA+N LR +R    
Sbjct  538   RRNREKRAQKSLREAEEKQQHG---SQNDEEG-SSPSFATTVYVQRFASNALRHLRSGK-  592

Query  1904  lsvpklsprlpplllqkpAEPDFSAPEN  1987
                     R+ PLL  KPAEPDF   +N
Sbjct  593   --KMPQPKRMLPLLPMKPAEPDFLTKKN  618



>ref|NP_194785.1| cyclic nucleotide gated channel 9 [Arabidopsis thaliana]
 sp|Q9M0A4.1|CNGC9_ARATH RecName: Full=Putative cyclic nucleotide-gated ion channel 9; 
AltName: Full=Cyclic nucleotide- and calmodulin-regulated ion 
channel 9 [Arabidopsis thaliana]
 emb|CAB79774.1| cyclic nucleotide and calmodulin-regulated ion channel-like protein 
[Arabidopsis thaliana]
 gb|AEE85780.1| cyclic nucleotide gated channel 9 [Arabidopsis thaliana]
Length=733

 Score =   717 bits (1851),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 366/654 (56%), Positives = 473/654 (72%), Gaps = 26/654 (4%)
 Frame = +2

Query  47    KSKMHDPQGPFLQRWNRIFVIACILAATVDPLFFYIPVVDDQNKCLGLDRTLEITACILR  226
             + K+ DPQ  FL   N++FV +CILA +VDPLF Y+P V D  KC+G+DR L I A  LR
Sbjct  100   EKKIFDPQDKFLLLCNKLFVTSCILAVSVDPLFLYLPFVKDNEKCIGIDRKLAIIATTLR  159

Query  227   SVFDFFYIFHIILQFRTGFVPPSSRVFGRGDLIVDPSAIAKRYFFSYFFIDILAVLPLPQ  406
             +V D FY+FH+ L+FRT FV PSSRVFGRG+L++DP+ IAKRY   YF ID L+VLPLPQ
Sbjct  160   TVIDAFYLFHMALRFRTAFVAPSSRVFGRGELVIDPAQIAKRYLQQYFIIDFLSVLPLPQ  219

Query  407   VVLFMMIPRADRPFIMVAKDILKVVILVQSVPRLLRIYPLYKEVTRTSGFFTETAWAGAA  586
             +V++  +  +    ++  K  L+ +ILVQ +PR +R+YPL  E+ RT+G F ETAWAGAA
Sbjct  220   IVVWRFLYISKGASVLATKRALRSIILVQYIPRFIRLYPLSSELKRTAGVFAETAWAGAA  279

Query  587   FNLFLYMIASYVAGAIWYITAIERQDKCWRRACEKHG-SCDIDFLYCTKLGRRG----GD  751
             + L LYM+AS++ GAIWY+ A+ER + CW + C      C  +FL+C      G      
Sbjct  280   YYLLLYMLASHIVGAIWYLLALERYNGCWTKVCSNSSLDCHRNFLFCGNEKMDGYAAWTT  339

Query  752   FSSSFLNTSCALLEPENLKADDFDFGIFLDALKSNVVEKRYFWSKLFYCFWWGLRNLSSL  931
                S L  +C +   +N     FDFGI+L AL S +V  + F SK F+C WWGL+NLS+L
Sbjct  340   IKDSVLQLNCPVNTTDN---PPFDFGIYLRALSSGIVSSKSFVSKYFFCLWWGLQNLSTL  396

Query  932   GQNLKTSNFVGEilfailisiiglilfslligNMQKYLQSITVRVEEMRVKRMDAEQWMS  1111
             GQ L+TS + GE++F+I ++I GL+LF+LLIGNMQ YLQS+T+R+EEMRVKR D+EQWM 
Sbjct  397   GQGLETSTYPGEVIFSIALAIAGLLLFALLIGNMQTYLQSLTIRLEEMRVKRRDSEQWMH  456

Query  1112  HRMLPDNLRERIRRYEQYRWQETRGVDEESLISNLPKDLRRDINRHLCWSLLKRVHMFKT  1291
             HRMLP  LRER+RRY+QY+W ETRGVDEE+L+ NLPKDLRRDI RHLC +L++RV +F+ 
Sbjct  457   HRMLPPELRERVRRYDQYKWLETRGVDEENLVQNLPKDLRRDIKRHLCLALVRRVPLFEN  516

Query  1292  MDEQLLDAICDRLKPVLYTEKSCIVREGDPVDEMIFVMRGNLLTMTTNGGRTGFLNSDVL  1471
             MDE+LLDAIC+RLKP LYTE S +VREGDPV+EM+F++RG L ++TT+GGR+GF N  +L
Sbjct  517   MDERLLDAICERLKPCLYTESSYLVREGDPVNEMLFIIRGRLESVTTDGGRSGFFNRSLL  576

Query  1472  NAGDFCGEELLTWALDPNSSSSLPISTRTVQALTDVEAFALTADFLKFFASQYRRLHSKQ  1651
               GDFCGEELLTWALDP S S+LP STRT +ALT+VEAFAL AD LKF ASQ+RRLHS+Q
Sbjct  577   KEGDFCGEELLTWALDPKSGSNLPSSTRTAKALTEVEAFALIADELKFVASQFRRLHSRQ  636

Query  1652  LQHKFRFYSHQWKTWAACFIQAAWRRHCRNKLEKSLREEEDRLQDALILRMRREEGE-TT  1828
             +QH FRFYS QW+TWAA FIQAAWRR+ + K  + LR+EE             EEGE + 
Sbjct  637   VQHTFRFYSQQWRTWAAIFIQAAWRRYVKKKKLEQLRKEE-------------EEGEGSV  683

Query  1829  PSLGATIYASRFAANVLRTVRRNHplsvpklsprlpplllqkpAEPDFSAPENN  1990
              S+ AT  AS+FAAN LR V +N      +    +  +  QKP+EPDFSA + +
Sbjct  684   TSIRATFLASKFAANALRKVHKNR----IEAKSTIELVKYQKPSEPDFSADDTS  733



>ref|NP_001190873.1| cyclic nucleotide gated channel 9 [Arabidopsis thaliana]
 gb|AEE85781.1| cyclic nucleotide gated channel 9 [Arabidopsis thaliana]
Length=707

 Score =   716 bits (1848),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 366/654 (56%), Positives = 473/654 (72%), Gaps = 26/654 (4%)
 Frame = +2

Query  47    KSKMHDPQGPFLQRWNRIFVIACILAATVDPLFFYIPVVDDQNKCLGLDRTLEITACILR  226
             + K+ DPQ  FL   N++FV +CILA +VDPLF Y+P V D  KC+G+DR L I A  LR
Sbjct  74    EKKIFDPQDKFLLLCNKLFVTSCILAVSVDPLFLYLPFVKDNEKCIGIDRKLAIIATTLR  133

Query  227   SVFDFFYIFHIILQFRTGFVPPSSRVFGRGDLIVDPSAIAKRYFFSYFFIDILAVLPLPQ  406
             +V D FY+FH+ L+FRT FV PSSRVFGRG+L++DP+ IAKRY   YF ID L+VLPLPQ
Sbjct  134   TVIDAFYLFHMALRFRTAFVAPSSRVFGRGELVIDPAQIAKRYLQQYFIIDFLSVLPLPQ  193

Query  407   VVLFMMIPRADRPFIMVAKDILKVVILVQSVPRLLRIYPLYKEVTRTSGFFTETAWAGAA  586
             +V++  +  +    ++  K  L+ +ILVQ +PR +R+YPL  E+ RT+G F ETAWAGAA
Sbjct  194   IVVWRFLYISKGASVLATKRALRSIILVQYIPRFIRLYPLSSELKRTAGVFAETAWAGAA  253

Query  587   FNLFLYMIASYVAGAIWYITAIERQDKCWRRACEKHG-SCDIDFLYCTKLGRRG----GD  751
             + L LYM+AS++ GAIWY+ A+ER + CW + C      C  +FL+C      G      
Sbjct  254   YYLLLYMLASHIVGAIWYLLALERYNGCWTKVCSNSSLDCHRNFLFCGNEKMDGYAAWTT  313

Query  752   FSSSFLNTSCALLEPENLKADDFDFGIFLDALKSNVVEKRYFWSKLFYCFWWGLRNLSSL  931
                S L  +C +   +N     FDFGI+L AL S +V  + F SK F+C WWGL+NLS+L
Sbjct  314   IKDSVLQLNCPVNTTDN---PPFDFGIYLRALSSGIVSSKSFVSKYFFCLWWGLQNLSTL  370

Query  932   GQNLKTSNFVGEilfailisiiglilfslligNMQKYLQSITVRVEEMRVKRMDAEQWMS  1111
             GQ L+TS + GE++F+I ++I GL+LF+LLIGNMQ YLQS+T+R+EEMRVKR D+EQWM 
Sbjct  371   GQGLETSTYPGEVIFSIALAIAGLLLFALLIGNMQTYLQSLTIRLEEMRVKRRDSEQWMH  430

Query  1112  HRMLPDNLRERIRRYEQYRWQETRGVDEESLISNLPKDLRRDINRHLCWSLLKRVHMFKT  1291
             HRMLP  LRER+RRY+QY+W ETRGVDEE+L+ NLPKDLRRDI RHLC +L++RV +F+ 
Sbjct  431   HRMLPPELRERVRRYDQYKWLETRGVDEENLVQNLPKDLRRDIKRHLCLALVRRVPLFEN  490

Query  1292  MDEQLLDAICDRLKPVLYTEKSCIVREGDPVDEMIFVMRGNLLTMTTNGGRTGFLNSDVL  1471
             MDE+LLDAIC+RLKP LYTE S +VREGDPV+EM+F++RG L ++TT+GGR+GF N  +L
Sbjct  491   MDERLLDAICERLKPCLYTESSYLVREGDPVNEMLFIIRGRLESVTTDGGRSGFFNRSLL  550

Query  1472  NAGDFCGEELLTWALDPNSSSSLPISTRTVQALTDVEAFALTADFLKFFASQYRRLHSKQ  1651
               GDFCGEELLTWALDP S S+LP STRT +ALT+VEAFAL AD LKF ASQ+RRLHS+Q
Sbjct  551   KEGDFCGEELLTWALDPKSGSNLPSSTRTAKALTEVEAFALIADELKFVASQFRRLHSRQ  610

Query  1652  LQHKFRFYSHQWKTWAACFIQAAWRRHCRNKLEKSLREEEDRLQDALILRMRREEGE-TT  1828
             +QH FRFYS QW+TWAA FIQAAWRR+ + K  + LR+EE             EEGE + 
Sbjct  611   VQHTFRFYSQQWRTWAAIFIQAAWRRYVKKKKLEQLRKEE-------------EEGEGSV  657

Query  1829  PSLGATIYASRFAANVLRTVRRNHplsvpklsprlpplllqkpAEPDFSAPENN  1990
              S+ AT  AS+FAAN LR V +N      +    +  +  QKP+EPDFSA + +
Sbjct  658   TSIRATFLASKFAANALRKVHKNR----IEAKSTIELVKYQKPSEPDFSADDTS  707



>ref|XP_004242592.1| PREDICTED: probable cyclic nucleotide-gated ion channel 5 [Solanum 
lycopersicum]
 ref|XP_010323184.1| PREDICTED: probable cyclic nucleotide-gated ion channel 5 [Solanum 
lycopersicum]
Length=735

 Score =   717 bits (1851),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 367/648 (57%), Positives = 472/648 (73%), Gaps = 15/648 (2%)
 Frame = +2

Query  47    KSKMHDPQGPFLQRWNRIFVIACILAATVDPLFFYIPVVDDQNKCLGLDRTLEITACILR  226
             + K+ DPQ  FL  WN++FV++CILA +VDPLFFY+PV D+++ CL +DR L + A  LR
Sbjct  96    EKKIFDPQDKFLLLWNKLFVVSCILAVSVDPLFFYLPVFDNKSNCLQIDRKLAVIATTLR  155

Query  227   SVFDFFYIFHIILQFRTGFVPPSSRVFGRGDLIVDPSAIAKRYFFSYFFIDILAVLPLPQ  406
             +V D FY+ H+ LQFRT ++ PSSRVFGRG+L++DP+ IAKRY   YF ID LAVLPLPQ
Sbjct  156   TVIDAFYLIHMALQFRTAYIAPSSRVFGRGELVIDPAQIAKRYLRFYFIIDFLAVLPLPQ  215

Query  407   VVLFMMIPRADRPFIMVAKDILKVVILVQSVPRLLRIYPLYKEVTRTSGFFTETAWAGAA  586
             +V++  +  +    +   K  L  +IL+Q +PR  R+ PL  E+ RT+G F ETAWAGAA
Sbjct  216   IVVWRFLKSSTGSDVFTTKQALLYIILLQYIPRFARVVPLTSELKRTTGVFAETAWAGAA  275

Query  587   FNLFLYMIASYVAGAIWYITAIERQDKCWRRACEKHGSCDIDFLYCTKLGRRG----GDF  754
               L LYM+AS++ G+ WY+ A+ER D CW++AC+ + +C+ DFLYC      G       
Sbjct  276   SYLLLYMLASHIVGSFWYLLAVERYDTCWQQACKHNATCNTDFLYCGNQYMTGYNRWSSI  335

Query  755   SSSFLNTSCALLEPENLKADDFDFGIFLDALKSNVVEKRYFWSKLFYCFWWGLRNLSSLG  934
             S S LN +C    P +     FDFGIF  AL S ++    F +K  YC WWGL+NLS+LG
Sbjct  336   SESVLNNAC----PADSDNSPFDFGIFDQALSSGIIYSMKFVAKYCYCLWWGLQNLSTLG  391

Query  935   QNLKTSNFVGEilfailisiiglilfslligNMQKYLQSITVRVEEMRVKRMDAEQWMSH  1114
             Q L+TS + GE +F+I ++I+GLILF+LLIGNMQ YLQS+T+R+EEMRVKR D+EQWM H
Sbjct  392   QGLQTSTYPGESIFSIGLAILGLILFALLIGNMQTYLQSLTIRLEEMRVKRRDSEQWMHH  451

Query  1115  RMLPDNLRERIRRYEQYRWQETRGVDEESLISNLPKDLRRDINRHLCWSLLKRVHMFKTM  1294
             R+LP +LRER+RRY+QY+WQETRGVDEE+++ +LPKDLRRDI RHLC +L+KRV +F+ M
Sbjct  452   RLLPQDLRERVRRYDQYKWQETRGVDEENIVQSLPKDLRRDIKRHLCLALVKRVPLFENM  511

Query  1295  DEQLLDAICDRLKPVLYTEKSCIVREGDPVDEMIFVMRGNLLTMTTNGGRTGFLNSDVLN  1474
             DE+LLDAIC+RLKP LY E + IVREGDPVDEM+F++RG L ++TT+GGR+GF N  +L 
Sbjct  512   DERLLDAICERLKPCLYIENTHIVREGDPVDEMLFIIRGRLESVTTDGGRSGFFNRSLLK  571

Query  1475  AGDFCGEELLTWALDPNSSSSLPISTRTVQALTDVEAFALTADFLKFFASQYRRLHSKQL  1654
               DFCGEELLTWALDP S S+LP STRTV+ALT+VEAFALTAD LKF ASQ+RRLHS+Q+
Sbjct  572   DSDFCGEELLTWALDPKSGSNLPSSTRTVKALTEVEAFALTADELKFVASQFRRLHSRQV  631

Query  1655  QHKFRFYSHQWKTWAACFIQAAWRRHCRNKLEKSLREEEDRLQDALILRMRREEGETTPS  1834
             QH FRFYS QW+TW ACFIQAAWRR+ + KL +  R+EE   +   +       G  T S
Sbjct  632   QHTFRFYSQQWRTWGACFIQAAWRRYTKRKLMELQRKEE--EEAEALAAGSGSSGGPTYS  689

Query  1835  LGATIYASRFAANVLRTVRRNHplsvpklsprlpplllqkpAEPDFSA  1978
             + AT  AS+FAAN LR V RN       L      + LQKP EPDFSA
Sbjct  690   IRATFLASKFAANALRGVHRNR-----NLKSARELVKLQKPPEPDFSA  732



>ref|XP_007011917.1| Cyclic nucleotide gated channel 5 isoform 1 [Theobroma cacao]
 gb|EOY29536.1| Cyclic nucleotide gated channel 5 isoform 1 [Theobroma cacao]
Length=739

 Score =   716 bits (1849),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 361/654 (55%), Positives = 477/654 (73%), Gaps = 15/654 (2%)
 Frame = +2

Query  47    KSKMHDPQGPFLQRWNRIFVIACILAATVDPLFFYIPVVDDQNKCLGLDRTLEITACILR  226
             + ++ DPQ  FL   N++F ++CILA +VDPLFFY+PV+++   CL +D+ L +TA  LR
Sbjct  95    EKRIFDPQDKFLLLCNKLFFVSCILAVSVDPLFFYLPVINNSENCLMMDKKLAVTATTLR  154

Query  227   SVFDFFYIFHIILQFRTGFVPPSSRVFGRGDLIVDPSAIAKRYFFSYFFIDILAVLPLPQ  406
             ++ D FY+  + LQFRT ++ PSSRVFGRG+L++DP+ IAKRY   YF ID LAVLPLPQ
Sbjct  155   TIIDAFYLMRMALQFRTAYIAPSSRVFGRGELVIDPAQIAKRYLQRYFIIDFLAVLPLPQ  214

Query  407   VVLFMMIPRADRPFIMVAKDILKVVILVQSVPRLLRIYPLYKEVTRTSGFFTETAWAGAA  586
             ++++  +  ++   ++  K  L  V+L+Q +PR LR+ PL  E+ RT+G F ETAWAGAA
Sbjct  215   IIVWRFLHSSNGSDVLATKQALFFVVLLQYIPRFLRVVPLTSEMKRTTGVFAETAWAGAA  274

Query  587   FNLFLYMIASYVAGAIWYITAIERQDKCWRRACEKHGS--CDIDFLYCTKLGRRG----G  748
             + L LYM+ S++ GA WY+ A+ER D CWRRAC   GS  C+ DFLYC      G     
Sbjct  275   YYLLLYMLCSHIVGAFWYLLAVERNDTCWRRACRDSGSDKCNKDFLYCGNQQMEGYSTWA  334

Query  749   DFSSSFLNTSCALLEPENLKADDFDFGIFLDALKSNVVEKRYFWSKLFYCFWWGLRNLSS  928
                SS L+  C     +N     FDFGIF +AL S +V    F+SK  YC WWGL+NLS+
Sbjct  335   GIRSSVLSDKCP--ADDNNDNPPFDFGIFTNALSSGIVSSTNFFSKYCYCLWWGLQNLST  392

Query  929   LGQNLKTSNFVGEilfailisiiglilfslligNMQKYLQSITVRVEEMRVKRMDAEQWM  1108
             LGQ L+TS + GE++F+I ++I GLILF+LLIGNMQ YLQS+T+R+EEMR+KR D+EQWM
Sbjct  393   LGQGLQTSTYPGEVIFSIALAIFGLILFALLIGNMQTYLQSLTIRLEEMRIKRRDSEQWM  452

Query  1109  SHRMLPDNLRERIRRYEQYRWQETRGVDEESLISNLPKDLRRDINRHLCWSLLKRVHMFK  1288
              HRMLP +LRER+RRY+QY+W ETRGVDEE+L+ +LPKDLRRDI RHLC +L++RV +F+
Sbjct  453   HHRMLPQDLRERVRRYDQYKWLETRGVDEENLVQSLPKDLRRDIKRHLCLALVRRVPLFE  512

Query  1289  TMDEQLLDAICDRLKPVLYTEKSCIVREGDPVDEMIFVMRGNLLTMTTNGGRTGFLNSDV  1468
             +MDE+LLDAIC+RLKP L+TE + IVREGDPVDEM+F++RG L ++TT+GGR+GF N  +
Sbjct  513   SMDERLLDAICERLKPCLFTESTYIVREGDPVDEMLFIIRGRLESVTTDGGRSGFFNRSL  572

Query  1469  LNAGDFCGEELLTWALDPNSSSSLPISTRTVQALTDVEAFALTADFLKFFASQYRRLHSK  1648
             L  GDFCGEELLTWALDP S ++LP STRTV+ALT+VEAFAL A+ LKF ASQ+RRLHS+
Sbjct  573   LKEGDFCGEELLTWALDPKSGANLPSSTRTVKALTEVEAFALIAEELKFVASQFRRLHSR  632

Query  1649  QLQHKFRFYSHQWKTWAACFIQAAWRRHCRNKLEKSLREEEDRLQDALILRMRREEGETT  1828
             Q+QH FRF+S QW+TWAACFIQAAWRR+ + K  +  R+EE+  +   +   R   G  +
Sbjct  633   QVQHTFRFHSQQWRTWAACFIQAAWRRYSKRKNMELRRKEEEEAEG--MDGTRNNSGGGS  690

Query  1829  PSLGATIYASRFAANVLRTVRRNHplsvpklsprlpplllqkpAEPDFSAPENN  1990
              SLGAT  AS+FAAN LR + RN              + LQKP EPDF+A + +
Sbjct  691   YSLGATFLASKFAANALRGIHRNR-----NAKSAKELVKLQKPPEPDFTAEDAD  739



>ref|XP_010447700.1| PREDICTED: putative cyclic nucleotide-gated ion channel 9 isoform 
X2 [Camelina sativa]
Length=710

 Score =   715 bits (1846),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 364/649 (56%), Positives = 473/649 (73%), Gaps = 22/649 (3%)
 Frame = +2

Query  47    KSKMHDPQGPFLQRWNRIFVIACILAATVDPLFFYIPVVDDQNKCLGLDRTLEITACILR  226
             + K+ DPQ  FL   N++FV +CILA +VDPLF Y+P V D +KC+G+DR L I A  LR
Sbjct  75    EKKIFDPQDKFLLLCNKLFVTSCILAVSVDPLFLYLPFVKDNDKCIGIDRRLAIIATTLR  134

Query  227   SVFDFFYIFHIILQFRTGFVPPSSRVFGRGDLIVDPSAIAKRYFFSYFFIDILAVLPLPQ  406
             +V D FY+FH+ L+FRT FV PSSRVFGRG+L++DP+ IAKRY   YF ID L+VLPLPQ
Sbjct  135   TVIDVFYLFHMALRFRTAFVAPSSRVFGRGELVIDPAQIAKRYLQQYFIIDFLSVLPLPQ  194

Query  407   VVLFMMIPRADRPFIMVAKDILKVVILVQSVPRLLRIYPLYKEVTRTSGFFTETAWAGAA  586
             +V++  +  +    ++  K  L+ +IL+Q +PR +R+YPL  E+ RT+G F ETAWAGAA
Sbjct  195   IVVWRFLYTSKGASVLATKRALRSIILLQYIPRFIRLYPLSSELKRTAGVFAETAWAGAA  254

Query  587   FNLFLYMIASYVAGAIWYITAIERQDKCWRRACE-KHGSCDIDFLYCTKLGRRGGDFSSS  763
             + L LYM+AS++ GA+WY+ A+ER + CW +AC     +C  +FL+C      G    S+
Sbjct  255   YYLLLYMLASHIVGALWYLLALERYNGCWSKACSISQNNCTRNFLFCGNENMDGYAAWST  314

Query  764   FLNTSCALLEPENLKADD---FDFGIFLDALKSNVVEKRYFWSKLFYCFWWGLRNLSSLG  934
               ++   +  P N    D   FDFGI+L AL S +V  + F SK F+C WWGL+NLS+LG
Sbjct  315   IKDSVLQINCPVNTTDGDTPPFDFGIYLRALSSGIVSSKSFVSKYFFCLWWGLQNLSTLG  374

Query  935   QNLKTSNFVGEilfailisiiglilfslligNMQKYLQSITVRVEEMRVKRMDAEQWMSH  1114
             Q L+TS + GE++F+I ++I GL+LF+LLIGNMQ YLQS+T+R+EEMRVKR D+EQWM H
Sbjct  375   QGLETSTYPGEVIFSIALAIAGLLLFALLIGNMQTYLQSLTIRLEEMRVKRRDSEQWMHH  434

Query  1115  RMLPDNLRERIRRYEQYRWQETRGVDEESLISNLPKDLRRDINRHLCWSLLKRVHMFKTM  1294
             RMLP  LRER+RRY+QY+W ETRGVDEE+L+ NLPKDLRRDI RHLC +L++RV +F+ M
Sbjct  435   RMLPPELRERVRRYDQYKWLETRGVDEENLVQNLPKDLRRDIKRHLCLALVRRVPLFENM  494

Query  1295  DEQLLDAICDRLKPVLYTEKSCIVREGDPVDEMIFVMRGNLLTMTTNGGRTGFLNSDVLN  1474
             DE+LLDAIC+RLKP LYTE S +VREGDPV+EM+F++RG L ++TT+GGR+GF N  +L 
Sbjct  495   DERLLDAICERLKPCLYTENSYLVREGDPVNEMLFIIRGRLESVTTDGGRSGFFNRSLLK  554

Query  1475  AGDFCGEELLTWALDPNSSSSLPISTRTVQALTDVEAFALTADFLKFFASQYRRLHSKQL  1654
              GDFCGEELLTWALDP S S+LP STRT +ALT+VEAFAL AD LKF ASQ+RRLHS+Q+
Sbjct  555   EGDFCGEELLTWALDPKSGSNLPSSTRTAKALTEVEAFALIADELKFVASQFRRLHSRQV  614

Query  1655  QHKFRFYSHQWKTWAACFIQAAWRRHCRNKLEKSLREEEDRLQDALILRMRREEGE-TTP  1831
             QH FRFYS QW+TWAA FIQAAWRR+ + K  + LR+EE             EEGE +  
Sbjct  615   QHTFRFYSQQWRTWAAIFIQAAWRRYVKKKKLEQLRKEE-------------EEGEGSVT  661

Query  1832  SLGATIYASRFAANVLRTVRRNHplsvpklsprlpplllqkpAEPDFSA  1978
             S+ AT  AS+FAAN L  V +N      +       +  QKP+EPDFSA
Sbjct  662   SIRATFLASKFAANALLKVHKNR----IEAKSTKELVKYQKPSEPDFSA  706



>ref|XP_010447699.1| PREDICTED: putative cyclic nucleotide-gated ion channel 9 isoform 
X1 [Camelina sativa]
Length=736

 Score =   716 bits (1849),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 364/649 (56%), Positives = 473/649 (73%), Gaps = 22/649 (3%)
 Frame = +2

Query  47    KSKMHDPQGPFLQRWNRIFVIACILAATVDPLFFYIPVVDDQNKCLGLDRTLEITACILR  226
             + K+ DPQ  FL   N++FV +CILA +VDPLF Y+P V D +KC+G+DR L I A  LR
Sbjct  101   EKKIFDPQDKFLLLCNKLFVTSCILAVSVDPLFLYLPFVKDNDKCIGIDRRLAIIATTLR  160

Query  227   SVFDFFYIFHIILQFRTGFVPPSSRVFGRGDLIVDPSAIAKRYFFSYFFIDILAVLPLPQ  406
             +V D FY+FH+ L+FRT FV PSSRVFGRG+L++DP+ IAKRY   YF ID L+VLPLPQ
Sbjct  161   TVIDVFYLFHMALRFRTAFVAPSSRVFGRGELVIDPAQIAKRYLQQYFIIDFLSVLPLPQ  220

Query  407   VVLFMMIPRADRPFIMVAKDILKVVILVQSVPRLLRIYPLYKEVTRTSGFFTETAWAGAA  586
             +V++  +  +    ++  K  L+ +IL+Q +PR +R+YPL  E+ RT+G F ETAWAGAA
Sbjct  221   IVVWRFLYTSKGASVLATKRALRSIILLQYIPRFIRLYPLSSELKRTAGVFAETAWAGAA  280

Query  587   FNLFLYMIASYVAGAIWYITAIERQDKCWRRACE-KHGSCDIDFLYCTKLGRRGGDFSSS  763
             + L LYM+AS++ GA+WY+ A+ER + CW +AC     +C  +FL+C      G    S+
Sbjct  281   YYLLLYMLASHIVGALWYLLALERYNGCWSKACSISQNNCTRNFLFCGNENMDGYAAWST  340

Query  764   FLNTSCALLEPENLKADD---FDFGIFLDALKSNVVEKRYFWSKLFYCFWWGLRNLSSLG  934
               ++   +  P N    D   FDFGI+L AL S +V  + F SK F+C WWGL+NLS+LG
Sbjct  341   IKDSVLQINCPVNTTDGDTPPFDFGIYLRALSSGIVSSKSFVSKYFFCLWWGLQNLSTLG  400

Query  935   QNLKTSNFVGEilfailisiiglilfslligNMQKYLQSITVRVEEMRVKRMDAEQWMSH  1114
             Q L+TS + GE++F+I ++I GL+LF+LLIGNMQ YLQS+T+R+EEMRVKR D+EQWM H
Sbjct  401   QGLETSTYPGEVIFSIALAIAGLLLFALLIGNMQTYLQSLTIRLEEMRVKRRDSEQWMHH  460

Query  1115  RMLPDNLRERIRRYEQYRWQETRGVDEESLISNLPKDLRRDINRHLCWSLLKRVHMFKTM  1294
             RMLP  LRER+RRY+QY+W ETRGVDEE+L+ NLPKDLRRDI RHLC +L++RV +F+ M
Sbjct  461   RMLPPELRERVRRYDQYKWLETRGVDEENLVQNLPKDLRRDIKRHLCLALVRRVPLFENM  520

Query  1295  DEQLLDAICDRLKPVLYTEKSCIVREGDPVDEMIFVMRGNLLTMTTNGGRTGFLNSDVLN  1474
             DE+LLDAIC+RLKP LYTE S +VREGDPV+EM+F++RG L ++TT+GGR+GF N  +L 
Sbjct  521   DERLLDAICERLKPCLYTENSYLVREGDPVNEMLFIIRGRLESVTTDGGRSGFFNRSLLK  580

Query  1475  AGDFCGEELLTWALDPNSSSSLPISTRTVQALTDVEAFALTADFLKFFASQYRRLHSKQL  1654
              GDFCGEELLTWALDP S S+LP STRT +ALT+VEAFAL AD LKF ASQ+RRLHS+Q+
Sbjct  581   EGDFCGEELLTWALDPKSGSNLPSSTRTAKALTEVEAFALIADELKFVASQFRRLHSRQV  640

Query  1655  QHKFRFYSHQWKTWAACFIQAAWRRHCRNKLEKSLREEEDRLQDALILRMRREEGE-TTP  1831
             QH FRFYS QW+TWAA FIQAAWRR+ + K  + LR+EE             EEGE +  
Sbjct  641   QHTFRFYSQQWRTWAAIFIQAAWRRYVKKKKLEQLRKEE-------------EEGEGSVT  687

Query  1832  SLGATIYASRFAANVLRTVRRNHplsvpklsprlpplllqkpAEPDFSA  1978
             S+ AT  AS+FAAN L  V +N      +       +  QKP+EPDFSA
Sbjct  688   SIRATFLASKFAANALLKVHKNR----IEAKSTKELVKYQKPSEPDFSA  732



>ref|XP_009117262.1| PREDICTED: probable cyclic nucleotide-gated ion channel 6 [Brassica 
rapa]
 emb|CDY34808.1| BnaA09g41750D [Brassica napus]
Length=737

 Score =   716 bits (1849),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 368/650 (57%), Positives = 490/650 (75%), Gaps = 9/650 (1%)
 Frame = +2

Query  47    KSKMHDPQGPFLQRWNRIFVIACILAATVDPLFFYIPVVDDQNKCLGLDRTLEITACILR  226
             + K+ DPQ  FL   N++FV +CILA +VDPLF ++P ++D+ KC+G+DR L I    LR
Sbjct  89    EKKIFDPQDKFLLLCNKLFVASCILAVSVDPLFLFLPFINDKAKCVGIDRKLAIVTTTLR  148

Query  227   SVFDFFYIFHIILQFRTGFVPPSSRVFGRGDLIVDPSAIAKRYFFSYFFIDILAVLPLPQ  406
             +V D FY+FH+ L+FRT +V PSSRVFGRG+L++DP+ IAKRY   YF ID+L+VLP+PQ
Sbjct  149   TVIDSFYLFHMALRFRTAYVAPSSRVFGRGELVIDPAQIAKRYLQQYFIIDLLSVLPVPQ  208

Query  407   VVLFMMIPRADRPFIMVAKDILKVVILVQSVPRLLRIYPLYKEVTRTSGFFTETAWAGAA  586
             ++++  +  +    ++  K  L+ ++LVQ +PR LR+YPL  E+ RT+G F ETAWAGAA
Sbjct  209   IIVWRFLYSSRGANVLATKQALRYIVLVQYIPRFLRMYPLSSELKRTAGVFAETAWAGAA  268

Query  587   FNLFLYMIASYVAGAIWYITAIERQDKCWRRACEKHGSCDIDFLYCTKLGRRG----GDF  754
             + L LYM+AS++ GA+WY+ A+ER + CW +AC+ + +C  +FL+C     +G     D 
Sbjct  269   YYLLLYMLASHIVGALWYLLALERNNDCWSKACKDNDNCTRNFLFCGNQNMKGYDAWDDV  328

Query  755   SSSFLNTSCALLEPENLKADDFDFGIFLDALKSNVVEKRYFWSKLFYCFWWGLRNLSSLG  934
                FL   C +   E  +   FDFGI+L AL S +V  + F SK F+C WWGL+NLS+LG
Sbjct  329   KDPFLQLRCPVNVTEG-EEPPFDFGIYLRALSSGIVSSKKFVSKYFFCLWWGLQNLSTLG  387

Query  935   QNLKTSNFVGEilfailisiiglilfslligNMQKYLQSITVRVEEMRVKRMDAEQWMSH  1114
             Q L+TS + GE++F+I+++I GL+LF+LLIGNMQ YLQS+T+R+EEMRVKR D+EQWM H
Sbjct  388   QGLETSTYPGEVIFSIVLAIAGLLLFALLIGNMQTYLQSLTIRLEEMRVKRRDSEQWMHH  447

Query  1115  RMLPDNLRERIRRYEQYRWQETRGVDEESLISNLPKDLRRDINRHLCWSLLKRVHMFKTM  1294
             RMLP  LRER+RRY+QY+W ETRGVDEE+L+SNLPKDLRRDI RHLC +L++RV +F+ M
Sbjct  448   RMLPPELRERVRRYDQYKWLETRGVDEENLVSNLPKDLRRDIKRHLCLALVRRVPLFENM  507

Query  1295  DEQLLDAICDRLKPVLYTEKSCIVREGDPVDEMIFVMRGNLLTMTTNGGRTGFLNSDVLN  1474
             DE+LLDAIC+RLKP LYTEKS +VREGDPV+EM+F++RG L ++TT+GGR+GF N  +L 
Sbjct  508   DERLLDAICERLKPCLYTEKSFLVREGDPVNEMLFIIRGRLESVTTDGGRSGFYNRSLLK  567

Query  1475  AGDFCGEELLTWALDPNSSSSLPISTRTVQALTDVEAFALTADFLKFFASQYRRLHSKQL  1654
              GDFCG+ELLTWALDP S S+LP STRTV+ALT+VEAFAL AD LKF ASQ+RRLHS+Q+
Sbjct  568   EGDFCGDELLTWALDPKSGSNLPSSTRTVKALTEVEAFALIADELKFVASQFRRLHSRQV  627

Query  1655  QHKFRFYSHQWKTWAACFIQAAWRRHCRNKLEKSLREEEDRLQDALILRMRREEGETTP-  1831
             QH FRFYS QW+TWAACFIQAAWRR+ + K  + LR+EE+  +++   R+    G ++P 
Sbjct  628   QHTFRFYSQQWRTWAACFIQAAWRRYTKRKKLEELRKEEEMEEESSTARL--IAGGSSPF  685

Query  1832  SLGATIYASRFAANVLRTVRRNHplsvpklsp-rlpplllqkpAEPDFSA  1978
             S+ AT  ASRFAAN LR VR+N    +  LS      L +QKP EPDFSA
Sbjct  686   SIRATFLASRFAANALRGVRKNRTAKLLALSQPTKELLKVQKPPEPDFSA  735



>ref|XP_008242993.1| PREDICTED: probable cyclic nucleotide-gated ion channel 5 isoform 
X1 [Prunus mume]
Length=731

 Score =   716 bits (1847),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 367/643 (57%), Positives = 473/643 (74%), Gaps = 10/643 (2%)
 Frame = +2

Query  53    KMHDPQGPFLQRWNRIFVIACILAATVDPLFFYIPVVDDQNKCLGLDRTLEITACILRSV  232
             K+ DPQ  FL  WNR+FVI+CILA +VDPLFFY+PV+++ + CLG+DR L I A  LR +
Sbjct  94    KIFDPQDKFLLLWNRLFVISCILAVSVDPLFFYLPVINNSS-CLGIDRRLAIIATTLRMI  152

Query  233   FDFFYIFHIILQFRTGFVPPSSRVFGRGDLIVDPSAIAKRYFFSYFFIDILAVLPLPQVV  412
              D FY+ H+ LQFRT ++ PSSRVFGRG+L++DP+ IAKRY  SYF ID LAVLPLPQ++
Sbjct  153   VDAFYLIHMALQFRTAYIAPSSRVFGRGELVIDPARIAKRYLRSYFIIDFLAVLPLPQII  212

Query  413   LFMMIPRADRPFIMVAKDILKVVILVQSVPRLLRIYPLYKEVTRTSGFFTETAWAGAAFN  592
             ++  + R+    ++  K  L  ++L+Q +PRL+R+ PL  E+ RT+G F ETAWAGAA  
Sbjct  213   VWRFLQRSKGSDVLATKQALLFIVLLQYIPRLVRVLPLTSELKRTAGVFAETAWAGAACY  272

Query  593   LFLYMIASYVAGAIWYITAIERQDKCWRRACEKHGS-CDIDFLYCTKLGRRGGDFSSSFL  769
             L LYM+AS++ GA WY+ A+ER D CW++AC   G  CD +FLYC           S+  
Sbjct  273   LLLYMLASHIVGAFWYLLALERNDTCWQKACTHFGKLCDKNFLYCGNQNILDTGTWSNVT  332

Query  770   NTSCALLEPENLKADDFDFGIFLDALKSNVVEKRYFWSKLFYCFWWGLRNLSSLGQNLKT  949
                 +   P++ +   FDFGI+  AL S VV  + F  K  YC WWGL+NLS+LGQ L T
Sbjct  333   GNIQSKCSPDD-QNTYFDFGIYKSALSSGVVSSKKFLPKYCYCLWWGLQNLSTLGQGLAT  391

Query  950   SNFVGEilfailisiiglilfslligNMQKYLQSITVRVEEMRVKRMDAEQWMSHRMLPD  1129
             S + GE++F+I ++I GLILF+LLIGNMQ YLQS+T+R+EEMRVKR D+EQWM HR+LP 
Sbjct  392   STYPGEVIFSISLAIFGLILFALLIGNMQTYLQSLTIRLEEMRVKRRDSEQWMHHRLLPQ  451

Query  1130  NLRERIRRYEQYRWQETRGVDEESLISNLPKDLRRDINRHLCWSLLKRVHMFKTMDEQLL  1309
             +LRER+RRY+QY+W ETRGVDE+SL+ +LPKDLRRDI RHLC +L++RV +F+ MDE+LL
Sbjct  452   DLRERVRRYDQYKWLETRGVDEQSLVQSLPKDLRRDIKRHLCLALVRRVPLFENMDERLL  511

Query  1310  DAICDRLKPVLYTEKSCIVREGDPVDEMIFVMRGNLLTMTTNGGRTGFLNSDVLNAGDFC  1489
             DAIC+RLKP L+TE + IVREGDPVDEM+F++RG L ++TT+GGR+GF N  +L  GDFC
Sbjct  512   DAICERLKPSLFTESTYIVREGDPVDEMLFIIRGRLESVTTDGGRSGFFNRSLLKEGDFC  571

Query  1490  GEELLTWALDPNSSSSLPISTRTVQALTDVEAFALTADFLKFFASQYRRLHSKQLQHKFR  1669
             GEELLTWALDP S S+LP STRTV+ALT+VEAFAL A+ LKF ASQ+RRLHS+Q+QH FR
Sbjct  572   GEELLTWALDPKSGSNLPSSTRTVRALTEVEAFALVAEELKFVASQFRRLHSRQVQHTFR  631

Query  1670  FYSHQWKTWAACFIQAAWRRHCRNKLEKSLREEEDRLQDALILRMRREEGETTPSLGATI  1849
             FYS QW+TWAACFIQAAWRR+ + K    LR +E+  +  +   +R   G +  S+GAT 
Sbjct  632   FYSQQWRTWAACFIQAAWRRYSKRK-NMELRRKEEEGETEVFGGVRSNAGGSY-SIGATF  689

Query  1850  YASRFAANVLRTVRRNHplsvpklsprlpplllqkpAEPDFSA  1978
              ASRFAAN LR V RN              + LQKP EPDFSA
Sbjct  690   LASRFAANALRGVHRNR-----TAKSARELVKLQKPPEPDFSA  727



>ref|XP_006343649.1| PREDICTED: probable cyclic nucleotide-gated ion channel 5-like 
isoform X1 [Solanum tuberosum]
 ref|XP_006343650.1| PREDICTED: probable cyclic nucleotide-gated ion channel 5-like 
isoform X2 [Solanum tuberosum]
Length=735

 Score =   715 bits (1846),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 367/648 (57%), Positives = 470/648 (73%), Gaps = 15/648 (2%)
 Frame = +2

Query  47    KSKMHDPQGPFLQRWNRIFVIACILAATVDPLFFYIPVVDDQNKCLGLDRTLEITACILR  226
             + K+ DPQ  FL  WN++FV++CILA +VDPLFFY+PV D+++ CL +DR L + A  LR
Sbjct  96    EKKIFDPQDKFLLLWNKLFVVSCILAVSVDPLFFYLPVFDNKSNCLQIDRKLAVIATTLR  155

Query  227   SVFDFFYIFHIILQFRTGFVPPSSRVFGRGDLIVDPSAIAKRYFFSYFFIDILAVLPLPQ  406
             +V D FY+ H+ LQFRT ++ PSSRVFGRG+L++DP+ IAKRY   YF ID LAVLPLPQ
Sbjct  156   TVIDAFYLIHMALQFRTAYIAPSSRVFGRGELVIDPAQIAKRYLRFYFIIDFLAVLPLPQ  215

Query  407   VVLFMMIPRADRPFIMVAKDILKVVILVQSVPRLLRIYPLYKEVTRTSGFFTETAWAGAA  586
             +V++  +  +    +   K  L  +IL+Q +PR  R+ PL  E+ RT+G F ETAWAGAA
Sbjct  216   IVVWRFLKSSTGSDVFTTKQALLYIILLQYIPRFARVIPLTSELKRTTGVFAETAWAGAA  275

Query  587   FNLFLYMIASYVAGAIWYITAIERQDKCWRRACEKHGSCDIDFLYCTKLGRRG----GDF  754
               L LYM+AS++ G+ WY+ A+ER D CW+ AC+ + +C+ DFLYC      G       
Sbjct  276   SYLLLYMLASHIVGSFWYLLAVERYDTCWQEACKHNATCNTDFLYCGNQYMTGYNSWSSI  335

Query  755   SSSFLNTSCALLEPENLKADDFDFGIFLDALKSNVVEKRYFWSKLFYCFWWGLRNLSSLG  934
             S S LN +C    P +     FDFGIF  AL S ++    F  K  YC WWGL+NLS+LG
Sbjct  336   SDSVLNNAC----PADSDNSPFDFGIFDQALSSGIIYSMKFVVKYCYCLWWGLQNLSTLG  391

Query  935   QNLKTSNFVGEilfailisiiglilfslligNMQKYLQSITVRVEEMRVKRMDAEQWMSH  1114
             Q L+TS + GE +F+I ++I+GLILF+LLIGNMQ YLQS+T+R+EEMRVKR D+EQWM H
Sbjct  392   QGLQTSTYPGESIFSIGLAILGLILFALLIGNMQTYLQSLTIRLEEMRVKRRDSEQWMHH  451

Query  1115  RMLPDNLRERIRRYEQYRWQETRGVDEESLISNLPKDLRRDINRHLCWSLLKRVHMFKTM  1294
             R+LP +LRER+RRY+QY+WQETRGVDEE+++ +LPKDLRRDI RHLC +L+KRV +F+ M
Sbjct  452   RLLPQDLRERVRRYDQYKWQETRGVDEENIVQSLPKDLRRDIKRHLCLALVKRVPLFENM  511

Query  1295  DEQLLDAICDRLKPVLYTEKSCIVREGDPVDEMIFVMRGNLLTMTTNGGRTGFLNSDVLN  1474
             DE+LLDAIC+RLKP LY E + IVREGDPVDEM+F++RG L ++TT+GGR+GF N  +L 
Sbjct  512   DERLLDAICERLKPCLYIENTHIVREGDPVDEMLFIIRGRLESVTTDGGRSGFFNRSLLK  571

Query  1475  AGDFCGEELLTWALDPNSSSSLPISTRTVQALTDVEAFALTADFLKFFASQYRRLHSKQL  1654
               DFCGEELLTWALDP S S+LP STRTV+ALT+VEAFALTAD LKF ASQ+RRLHS+Q+
Sbjct  572   DSDFCGEELLTWALDPKSGSNLPSSTRTVKALTEVEAFALTADELKFVASQFRRLHSRQV  631

Query  1655  QHKFRFYSHQWKTWAACFIQAAWRRHCRNKLEKSLREEEDRLQDALILRMRREEGETTPS  1834
             QH FRFYS QW+TW ACFIQAAWRR+ + KL +  R+EE   +   +       G  T S
Sbjct  632   QHTFRFYSQQWRTWGACFIQAAWRRYTKRKLMELQRKEE--EEAEALAAGSGSSGGPTYS  689

Query  1835  LGATIYASRFAANVLRTVRRNHplsvpklsprlpplllqkpAEPDFSA  1978
             + AT  AS+FAAN LR V RN       L      + LQKP EPDFSA
Sbjct  690   IRATFLASKFAANALRGVHRNR-----NLKSARELVKLQKPPEPDFSA  732



>ref|XP_008343895.1| PREDICTED: probable cyclic nucleotide-gated ion channel 5 [Malus 
domestica]
Length=728

 Score =   715 bits (1846),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 369/646 (57%), Positives = 476/646 (74%), Gaps = 16/646 (2%)
 Frame = +2

Query  53    KMHDPQGPFLQRWNRIFVIACILAATVDPLFFYIPVVDDQNKCLGLDRTLEITACILRSV  232
             K++DPQ  FL  WN+ FVI+CILA +VDPLFFY+PV++  + CLG+DR L I A  LR +
Sbjct  94    KIYDPQDKFLLLWNKFFVISCILAVSVDPLFFYLPVINSSSTCLGIDRRLAIIATTLRMI  153

Query  233   FDFFYIFHIILQFRTGFVPPSSRVFGRGDLIVDPSAIAKRYFFSYFFIDILAVLPLPQVV  412
              D FY+ H+ LQFRT ++ PSSRVFGRG+L++DP+ IAKRY  SYF ID L+VLPLPQ+V
Sbjct  154   VDAFYLIHMALQFRTAYIAPSSRVFGRGELVIDPARIAKRYLRSYFIIDFLSVLPLPQIV  213

Query  413   LFMMIPRADRPFIMVAKDILKVVILVQSVPRLLRIYPLYKEVTRTSGFFTETAWAGAAFN  592
             ++  + R+    ++  K  L  ++L Q +PRLLR++PL  E+ RT+G   ETAWAGAA+ 
Sbjct  214   VWRFLQRSKSSDVLATKQALLFIVLFQYIPRLLRVHPLTSELKRTAGVLAETAWAGAAYY  273

Query  593   LFLYMIASYVAGAIWYITAIERQDKCWRRACEKHGSCDIDFLYCTKLGRRGGDFSSSFLN  772
             L LYM+AS++ GA WY+ A+ER D CW++AC + G CD   LYC   G +     +++ N
Sbjct  274   LLLYMLASHIVGAFWYLLALERNDTCWQKACTEIGKCDKKILYC---GNQYILDPATWSN  330

Query  773   TSCALLEPENLKADD----FDFGIFLDALKSNVVEKRYFWSKLFYCFWWGLRNLSSLGQN  940
              +  +L      ADD    FDFGI+  AL S VV    F  K  YC WWGL+NLS+LGQ 
Sbjct  331   VTKTILS--KCTADDQNTFFDFGIYNSALSSGVVSSNKFIVKYCYCLWWGLQNLSTLGQG  388

Query  941   LKTSNFVGEilfailisiiglilfslligNMQKYLQSITVRVEEMRVKRMDAEQWMSHRM  1120
             L TS + GE++F+I ++I GLILF+LLIGNMQ YLQS+T+R+EEMRVKR D+EQWM HR+
Sbjct  389   LATSTYPGEVIFSIALAIFGLILFALLIGNMQTYLQSLTIRLEEMRVKRRDSEQWMHHRL  448

Query  1121  LPDNLRERIRRYEQYRWQETRGVDEESLISNLPKDLRRDINRHLCWSLLKRVHMFKTMDE  1300
             LP +LRER+RRY+QY+W ETRGVDE+SL+ +LPKDLRRDI RHLC +L++RV +F+ MDE
Sbjct  449   LPQDLRERVRRYDQYKWLETRGVDEQSLVQSLPKDLRRDIKRHLCLALVRRVPLFEDMDE  508

Query  1301  QLLDAICDRLKPVLYTEKSCIVREGDPVDEMIFVMRGNLLTMTTNGGRTGFLNSDVLNAG  1480
             +LLDAIC+RLKP L+TE + IVREGDPVDEM+F++RG L ++TT+GGR+GF N  +L  G
Sbjct  509   RLLDAICERLKPSLFTESTYIVREGDPVDEMLFIIRGRLESITTDGGRSGFFNRSLLKEG  568

Query  1481  DFCGEELLTWALDPNSSSSLPISTRTVQALTDVEAFALTADFLKFFASQYRRLHSKQLQH  1660
             DFCGEELLTWALDP S ++LP STRTV+ALT+VEAFAL A+ LKF ASQ+RRLHS+Q+QH
Sbjct  569   DFCGEELLTWALDPKSGANLPSSTRTVKALTEVEAFALVAEELKFVASQFRRLHSRQVQH  628

Query  1661  KFRFYSHQWKTWAACFIQAAWRRHCRNKLEKSLREEEDRLQDALILRMRREEGETTPSLG  1840
              FRFYS QW+TWAACFIQAAWRR+ + K+   LR +E+  +   +   R   G +  S+G
Sbjct  629   TFRFYSQQWRTWAACFIQAAWRRYSKRKI-LDLRRKEEEAEAEALGGARSNAGGSY-SIG  686

Query  1841  ATIYASRFAANVLRTVRRNHplsvpklsprlpplllqkpAEPDFSA  1978
             AT  ASRFAAN LR V RN       L      + LQKP EPDFSA
Sbjct  687   ATFLASRFAANALRGVHRNR-----NLKSARELVKLQKPPEPDFSA  727



>ref|XP_009366181.1| PREDICTED: probable cyclic nucleotide-gated ion channel 5 isoform 
X2 [Pyrus x bretschneideri]
Length=669

 Score =   712 bits (1839),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 369/647 (57%), Positives = 475/647 (73%), Gaps = 20/647 (3%)
 Frame = +2

Query  53    KMHDPQGPFLQRWNRIFVIACILAATVDPLFFYIPVVDDQNKCLGLDRTLEITACILRSV  232
             K++DPQ  FL  WN+ FVI+CILA +VDPLFFY+PV++  + CLG+DR L I A  LR +
Sbjct  34    KIYDPQDKFLLLWNKFFVISCILAVSVDPLFFYLPVINSSSTCLGIDRRLAIIATTLRMI  93

Query  233   FDFFYIFHIILQFRTGFVPPSSRVFGRGDLIVDPSAIAKRYFFSYFFIDILAVLPLPQVV  412
              D FY+ H+ LQFRT ++ PSSRVFGRG+L++DP+ IAKRY  SYF ID L+VLPLPQ+V
Sbjct  94    VDAFYLIHMALQFRTAYIAPSSRVFGRGELVIDPARIAKRYLRSYFIIDFLSVLPLPQIV  153

Query  413   LFMMIPRADRPFIMVAKDILKVVILVQSVPRLLRIYPLYKEVTRTSGFFTETAWAGAAFN  592
             ++  + R+    ++  K  L  ++L Q +PRLLR++PL  E+ RT+G F ETAW GAA+ 
Sbjct  154   VWRFLQRSKSSDVLATKQALLFIVLFQYIPRLLRVHPLTSELKRTAGVFAETAWEGAAYY  213

Query  593   LFLYMIASYVAGAIWYITAIERQDKCWRRACEKHG-SCDIDFLYCTKLGRRGGDFSSSFL  769
             L LYM+AS++ GA WY+ A+ER D CW++AC + G SCD   LYC      G  + ++  
Sbjct  214   LLLYMLASHIVGAFWYLLALERNDTCWQKACTEIGKSCDKKILYC------GNQYIATQS  267

Query  770   NTSCALLEPENLKADD----FDFGIFLDALKSNVVEKRYFWSKLFYCFWWGLRNLSSLGQ  937
             N +  +L      ADD    FDFGI+  AL S VV    F  K  YC WWGL+NLS+LGQ
Sbjct  268   NVTETILS--KCTADDQNTFFDFGIYNSALSSGVVSSNKFIVKYCYCLWWGLQNLSTLGQ  325

Query  938   NLKTSNFVGEilfailisiiglilfslligNMQKYLQSITVRVEEMRVKRMDAEQWMSHR  1117
              L TS + GE++F+I ++I GLILF+LLIGNMQ YLQS+T+R+EEMRVKR D+EQWM HR
Sbjct  326   GLATSTYPGEVIFSIALAIFGLILFALLIGNMQTYLQSLTIRLEEMRVKRRDSEQWMHHR  385

Query  1118  MLPDNLRERIRRYEQYRWQETRGVDEESLISNLPKDLRRDINRHLCWSLLKRVHMFKTMD  1297
             +LP +LRER+RRY+QY+W ETRGVDE+SL+ +LPKDLRRDI RHLC +L++RV +F+ M+
Sbjct  386   LLPQDLRERVRRYDQYKWLETRGVDEQSLVQSLPKDLRRDIKRHLCLALVRRVPLFENME  445

Query  1298  EQLLDAICDRLKPVLYTEKSCIVREGDPVDEMIFVMRGNLLTMTTNGGRTGFLNSDVLNA  1477
             E+LLDAIC+RLKP L TE + IVREGDPVDEM+F++RG L ++TT+GGR+GF N  +L  
Sbjct  446   ERLLDAICERLKPSLCTESTYIVREGDPVDEMLFIIRGRLESVTTDGGRSGFFNRSLLKE  505

Query  1478  GDFCGEELLTWALDPNSSSSLPISTRTVQALTDVEAFALTADFLKFFASQYRRLHSKQLQ  1657
             GDFCGEELLTWALDP S ++LP STRTV+A+T+VEAFAL A+ LKF ASQ+RRLHS+Q+Q
Sbjct  506   GDFCGEELLTWALDPKSGANLPSSTRTVKAVTEVEAFALVAEELKFVASQFRRLHSRQVQ  565

Query  1658  HKFRFYSHQWKTWAACFIQAAWRRHCRNKLEKSLREEEDRLQDALILRMRREEGETTPSL  1837
             H FRFYS QW+TWAACFIQAAWRR+ + K+ +  R+EE    +A  L   R     + S+
Sbjct  566   HTFRFYSQQWRTWAACFIQAAWRRYSKRKILELHRKEE--EAEAEALGGARSNAGGSYSI  623

Query  1838  GATIYASRFAANVLRTVRRNHplsvpklsprlpplllqkpAEPDFSA  1978
             GAT  ASRFAAN LR V RN       L      + LQKP EPDFSA
Sbjct  624   GATFLASRFAANALRGVHRNR-----NLKSARELVKLQKPPEPDFSA  665



>ref|XP_008787797.1| PREDICTED: probable cyclic nucleotide-gated ion channel 6 [Phoenix 
dactylifera]
 ref|XP_008787798.1| PREDICTED: probable cyclic nucleotide-gated ion channel 6 [Phoenix 
dactylifera]
 ref|XP_008787799.1| PREDICTED: probable cyclic nucleotide-gated ion channel 6 [Phoenix 
dactylifera]
 ref|XP_008787800.1| PREDICTED: probable cyclic nucleotide-gated ion channel 6 [Phoenix 
dactylifera]
Length=727

 Score =   715 bits (1845),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 359/622 (58%), Positives = 463/622 (74%), Gaps = 20/622 (3%)
 Frame = +2

Query  47    KSKMHDPQGPFLQRWNRIFVIACILAATVDPLFFYIPVVDDQNKCLGLDRTLEITACILR  226
             + K+ DPQ  FL R NR+FV++CI+A  +DPLFFY+PVVD+   C+GLDR L IT   LR
Sbjct  94    EKKIFDPQDKFLLRMNRLFVVSCIIAVALDPLFFYLPVVDEAAVCIGLDRKLAITTTTLR  153

Query  227   SVFDFFYIFHIILQFRTGFVPPSSRVFGRGDLIVDPSAIAKRYFFSYFFIDILAVLPLPQ  406
             ++ D FY+  + LQFRT ++ PSSRVFGRG+L++DP+ IA+RY   YF ID LAVLPLPQ
Sbjct  154   TLNDAFYLLRMALQFRTAYIAPSSRVFGRGELVIDPAQIAQRYLRRYFTIDFLAVLPLPQ  213

Query  407   VVLFMMIPRADRPFIMVAKDILKVVILVQSVPRLLRIYPLYKEVTRTSGFFTETAWAGAA  586
             ++++  +     P +M AK+ L  ++++Q +PR  RI PL  E+ RT+G F ETAWAGAA
Sbjct  214   IIVWKFLSTLKGPDVMTAKNALLTIVMLQLLPRFFRIVPLTSELKRTAGVFAETAWAGAA  273

Query  587   FNLFLYMIASYVAGAIWYITAIERQDKCWRRACEKHGSCDIDFLYCTKLGRRGGDFSSSF  766
             + L  YM+AS++ GA WY  A+ER++ CWR AC+  G CD  +LYC      G + S SF
Sbjct  274   YYLLWYMLASHIVGAFWYYLAVERENDCWRLACKNFGGCDALYLYC------GSEDSESF  327

Query  767   L---NTSCALLEPENLKADD---FDFGIFLDALKSNVVEKRYFWSKLFYCFWWGLRNLSS  928
                 N S    + +    DD   F+FGI+  AL S +V    F SK FYC WWGL+NLS+
Sbjct  328   AKWKNVSQEFTDKQCSLDDDNPPFNFGIYKLALTSGIVSSYKFVSKFFYCLWWGLQNLST  387

Query  929   LGQNLKTSNFVGEilfailisiiglilfslligNMQKYLQSITVRVEEMRVKRMDAEQWM  1108
             LGQ L+TS F GE++F+I ++I+GLILF+LLIGNMQ YLQS+T+R+EEMRVKR D+EQWM
Sbjct  388   LGQGLQTSTFPGEVIFSIALAILGLILFALLIGNMQTYLQSLTLRLEEMRVKRRDSEQWM  447

Query  1109  SHRMLPDNLRERIRRYEQYRWQETRGVDEESLISNLPKDLRRDINRHLCWSLLKRVHMFK  1288
              HR+LP +LRER+RRY+QY+W ET+GVDEESL+ +LPKDLRRDI RHLC +L+KRV +F+
Sbjct  448   HHRLLPHDLRERVRRYDQYKWLETQGVDEESLVQSLPKDLRRDIKRHLCLALVKRVPLFE  507

Query  1289  TMDEQLLDAICDRLKPVLYTEKSCIVREGDPVDEMIFVMRGNLLTMTTNGGRTGFLNSDV  1468
              MDE+LLDAIC RLKP LYTE + IVREG+PVDEM+F++RG L ++TT+GGR+GF N  +
Sbjct  508   NMDERLLDAICGRLKPSLYTENTYIVREGEPVDEMLFIIRGRLESVTTDGGRSGFFNRGL  567

Query  1469  LNAGDFCGEELLTWALDPNSSSSLPISTRTVQALTDVEAFALTADFLKFFASQYRRLHSK  1648
             L   DFCGEELLTWALDP S S+LP STRTV+ALT+VEAFAL AD LKF ASQ+RRLHS+
Sbjct  568   LKEADFCGEELLTWALDPKSGSNLPSSTRTVKALTEVEAFALVADELKFVASQFRRLHSR  627

Query  1649  QLQHKFRFYSHQWKTWAACFIQAAWRRHCRNKLEKSLREEEDRLQDALILRMRREEGETT  1828
             Q+QH FRFYS QW+TWAACFIQAAWRR+ + K+ +  R+EE        +    ++   +
Sbjct  628   QVQHTFRFYSQQWRTWAACFIQAAWRRYSKRKMAELRRKEE--------MAGVGDQMTGS  679

Query  1829  PSLGATIYASRFAANVLRTVRR  1894
              SLGAT+YASRFAAN LR V R
Sbjct  680   SSLGATLYASRFAANALRGVHR  701



>ref|XP_008384360.1| PREDICTED: probable cyclic nucleotide-gated ion channel 5 [Malus 
domestica]
Length=728

 Score =   714 bits (1844),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 368/646 (57%), Positives = 475/646 (74%), Gaps = 16/646 (2%)
 Frame = +2

Query  53    KMHDPQGPFLQRWNRIFVIACILAATVDPLFFYIPVVDDQNKCLGLDRTLEITACILRSV  232
             K++DPQ  FL  WN+ FV +CILA +VDPLFFY+PV++  + CLG+DR L I A  LR +
Sbjct  94    KIYDPQDKFLLLWNKFFVJSCILAVSVDPLFFYLPVINSSSTCLGIDRRLAIIATTLRMI  153

Query  233   FDFFYIFHIILQFRTGFVPPSSRVFGRGDLIVDPSAIAKRYFFSYFFIDILAVLPLPQVV  412
              D FY+ H+ LQFRT ++ PSSRVFGRG+L++DP+ IAKRY  SYF ID L+VLPLPQ+V
Sbjct  154   VDAFYLIHMALQFRTAYIAPSSRVFGRGELVIDPARIAKRYLRSYFIIDFLSVLPLPQIV  213

Query  413   LFMMIPRADRPFIMVAKDILKVVILVQSVPRLLRIYPLYKEVTRTSGFFTETAWAGAAFN  592
             ++  + R+    ++  K  L  ++L Q +PRLLR++PL  E+ RT+G   ETAWAGAA+ 
Sbjct  214   VWRFLQRSKSSDVLATKQALLFIVLFQYIPRLLRVHPLTSELKRTAGVLAETAWAGAAYY  273

Query  593   LFLYMIASYVAGAIWYITAIERQDKCWRRACEKHGSCDIDFLYCTKLGRRGGDFSSSFLN  772
             L LYM+AS++ GA WY+ A+ER D CW++AC + G CD   LYC   G +     +++ N
Sbjct  274   LLLYMLASHIVGAFWYLLALERNDTCWQKACTEIGKCDKKILYC---GNQYILDPATWSN  330

Query  773   TSCALLEPENLKADD----FDFGIFLDALKSNVVEKRYFWSKLFYCFWWGLRNLSSLGQN  940
              +  +L      ADD    FDFGI+  AL S VV    F  K  YC WWGL+NLS+LGQ 
Sbjct  331   VTKTILS--KCTADDQNTFFDFGIYNSALSSGVVSSNKFIVKYCYCLWWGLQNLSTLGQG  388

Query  941   LKTSNFVGEilfailisiiglilfslligNMQKYLQSITVRVEEMRVKRMDAEQWMSHRM  1120
             L TS + GE++F+I ++I GLILF+LLIGNMQ YLQS+T+R+EEMRVKR D+EQWM HR+
Sbjct  389   LATSTYPGEVIFSIALAIFGLILFALLIGNMQTYLQSLTIRLEEMRVKRRDSEQWMHHRL  448

Query  1121  LPDNLRERIRRYEQYRWQETRGVDEESLISNLPKDLRRDINRHLCWSLLKRVHMFKTMDE  1300
             LP +LRER+RRY+QY+W ETRGVDE+SL+ +LPKDLRRDI RHLC +L++RV +F+ MDE
Sbjct  449   LPQDLRERVRRYDQYKWLETRGVDEQSLVQSLPKDLRRDIKRHLCLALVRRVPLFEDMDE  508

Query  1301  QLLDAICDRLKPVLYTEKSCIVREGDPVDEMIFVMRGNLLTMTTNGGRTGFLNSDVLNAG  1480
             +LLDAIC+RLKP L+TE + IVREGDPVDEM+F++RG L ++TT+GGR+GF N  +L  G
Sbjct  509   RLLDAICERLKPSLFTESTYIVREGDPVDEMLFIIRGRLESITTDGGRSGFFNRSLLKEG  568

Query  1481  DFCGEELLTWALDPNSSSSLPISTRTVQALTDVEAFALTADFLKFFASQYRRLHSKQLQH  1660
             DFCGEELLTWALDP S ++LP STRTV+ALT+VEAFAL A+ LKF ASQ+RRLHS+Q+QH
Sbjct  569   DFCGEELLTWALDPKSGANLPSSTRTVKALTEVEAFALVAEELKFVASQFRRLHSRQVQH  628

Query  1661  KFRFYSHQWKTWAACFIQAAWRRHCRNKLEKSLREEEDRLQDALILRMRREEGETTPSLG  1840
              FRFYS QW+TWAACFIQAAWRR+ + K+   LR +E+  +   +   R   G +  S+G
Sbjct  629   TFRFYSQQWRTWAACFIQAAWRRYSKRKI-LDLRRKEEEAEAEALGGARSNAGGSY-SIG  686

Query  1841  ATIYASRFAANVLRTVRRNHplsvpklsprlpplllqkpAEPDFSA  1978
             AT  ASRFAAN LR V RN       L      + LQKP EPDFSA
Sbjct  687   ATFLASRFAANALRGVHRNR-----NLKSARELVKLQKPPEPDFSA  727



>ref|XP_006404894.1| hypothetical protein EUTSA_v10000059mg [Eutrema salsugineum]
 gb|ESQ46347.1| hypothetical protein EUTSA_v10000059mg [Eutrema salsugineum]
Length=745

 Score =   715 bits (1845),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 364/653 (56%), Positives = 483/653 (74%), Gaps = 16/653 (2%)
 Frame = +2

Query  47    KSKMHDPQGPFLQRWNRIFVIACILAATVDPLFFYIPVVDDQNKCLGLDRTLEITACILR  226
             + K+ DPQ  FL   N++FV +CILA +VDPLF Y+P ++D+ KC+G+DR L I A  LR
Sbjct  98    EKKIFDPQDKFLLLCNKLFVASCILAVSVDPLFLYLPFINDKVKCVGIDRKLAIVATTLR  157

Query  227   SVFDFFYIFHIILQFRTGFVPPSSRVFGRGDLIVDPSAIAKRYFFSYFFIDILAVLPLPQ  406
             +V D FY+FH+ L+FRT +V PSSRVFGRG+L++DP  IAKRY   YF ID+L+VLP+PQ
Sbjct  158   TVIDSFYLFHMALRFRTAYVAPSSRVFGRGELVIDPGQIAKRYLQQYFIIDLLSVLPVPQ  217

Query  407   VVLFMMIPRADRPFIMVAKDILKVVILVQSVPRLLRIYPLYKEVTRTSGFFTETAWAGAA  586
             ++++  +  +    ++  K  L+ ++LVQ +PR LR+YPL  E+ RT+G F ETAWAGAA
Sbjct  218   IIVWRFLYTSRGASVLATKQALRYIVLVQYIPRFLRMYPLSSELKRTAGVFAETAWAGAA  277

Query  587   FNLFLYMIASYVAGAIWYITAIERQDKCWRRACEKHGSCDIDFLYCTKLGRRG----GDF  754
             + L LYM+AS++ GA+WY+ A+ER + CW +AC  + +C  +FL+C     +G       
Sbjct  278   YYLLLYMLASHIVGALWYLLALERNNDCWSKACHGNQTCTRNFLFCGNQNMKGYAAWDTM  337

Query  755   SSSFLNTSCALLEPENLKADD---FDFGIFLDALKSNVVEKRYFWSKLFYCFWWGLRNLS  925
               SFL   C    P N+   +   FDFGI+L AL S +V  + F SK F+C WWGL+NLS
Sbjct  338   KDSFLQLHC----PVNVTDGEEPPFDFGIYLRALSSGIVSSKNFVSKYFFCLWWGLQNLS  393

Query  926   SLGQNLKTSNFVGEilfailisiiglilfslligNMQKYLQSITVRVEEMRVKRMDAEQW  1105
             +LGQ L+TS + GE++F+I ++I GL+LF+LLIGNMQ YLQS+T+R+EEMRVKR D+EQW
Sbjct  394   TLGQGLETSTYPGEVIFSITLAIAGLLLFALLIGNMQTYLQSLTIRLEEMRVKRRDSEQW  453

Query  1106  MSHRMLPDNLRERIRRYEQYRWQETRGVDEESLISNLPKDLRRDINRHLCWSLLKRVHMF  1285
             M HRMLP  LRER+RRY+QY+W ETRGVDEE+L+SNLPKDLRRDI RHLC +L++RV +F
Sbjct  454   MHHRMLPPQLRERVRRYDQYKWLETRGVDEENLVSNLPKDLRRDIKRHLCLALVRRVPLF  513

Query  1286  KTMDEQLLDAICDRLKPVLYTEKSCIVREGDPVDEMIFVMRGNLLTMTTNGGRTGFLNSD  1465
             + MDE+LLDAIC+RLKP L+TEKS +VREGDPV+EM+F++RG L ++TT+GGR+GF N  
Sbjct  514   ENMDERLLDAICERLKPCLFTEKSFLVREGDPVNEMLFIIRGRLESVTTDGGRSGFYNRS  573

Query  1466  VLNAGDFCGEELLTWALDPNSSSSLPISTRTVQALTDVEAFALTADFLKFFASQYRRLHS  1645
             +L  GDFCG+ELLTWALDP S  +LP STRTV+ALT+VEAFAL AD LKF ASQ+RRLHS
Sbjct  574   LLKEGDFCGDELLTWALDPKSGVNLPSSTRTVKALTEVEAFALIADELKFVASQFRRLHS  633

Query  1646  KQLQHKFRFYSHQWKTWAACFIQAAWRRHCRNKLEKSLREEEDRLQDALILRMRREEGET  1825
             +Q+QH FRFYS QW+TWAACFIQAAWRR+ + K  + LR+EE+  ++     +    G +
Sbjct  634   RQVQHTFRFYSQQWRTWAACFIQAAWRRYTKRKKLEQLRKEEEEEEEEASSVI---AGGS  690

Query  1826  TPSLGATIYASRFAANVLRTVRRNHplsvpklsprlpplll--qkpAEPDFSA  1978
               S+ AT  AS+FAAN LR+V +N        +P     L+  QKP EPDFSA
Sbjct  691   PYSIRATFLASKFAANALRSVHKNRTAKSALSAPTKELELVKFQKPPEPDFSA  743



>ref|XP_009795112.1| PREDICTED: probable cyclic nucleotide-gated ion channel 5 [Nicotiana 
sylvestris]
 ref|XP_009795113.1| PREDICTED: probable cyclic nucleotide-gated ion channel 5 [Nicotiana 
sylvestris]
 ref|XP_009795114.1| PREDICTED: probable cyclic nucleotide-gated ion channel 5 [Nicotiana 
sylvestris]
Length=693

 Score =   713 bits (1840),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 357/621 (57%), Positives = 461/621 (74%), Gaps = 9/621 (1%)
 Frame = +2

Query  47    KSKMHDPQGPFLQRWNRIFVIACILAATVDPLFFYIPVVDDQNKCLGLDRTLEITACILR  226
             ++K+ DPQ  FL  WN++FV++CILA +VDPLFFY+PV ++   CL +DR L + A  LR
Sbjct  53    ENKIFDPQDKFLLLWNKLFVVSCILAVSVDPLFFYLPVFNNTANCLQIDRKLAVIATTLR  112

Query  227   SVFDFFYIFHIILQFRTGFVPPSSRVFGRGDLIVDPSAIAKRYFFSYFFIDILAVLPLPQ  406
             ++ D FY+ HI LQFRT ++ PSSRVFGRG+L++D   IAKRY   YF ID+L+VLPLPQ
Sbjct  113   TIVDAFYLIHIALQFRTAYIAPSSRVFGRGELVIDSGQIAKRYLRFYFIIDLLSVLPLPQ  172

Query  407   VVLFMMIPRADRPFIMVAKDILKVVILVQSVPRLLRIYPLYKEVTRTSGFFTETAWAGAA  586
             +V+   + R+    ++  K  L  +IL+Q +PR  R+ PL  E+ RT+G F ETAWAGAA
Sbjct  173   IVVGRFLQRSAGSDVLATKQALLYIILLQYIPRFARVIPLTAELKRTTGVFAETAWAGAA  232

Query  587   FNLFLYMIASYVAGAIWYITAIERQDKCWRRACEKHGSCDIDFLYCTKLGRRG----GDF  754
               L LYM+AS++ G+ WY+ ++ER D CW+ AC+ +G+C+ DFLYC   G  G       
Sbjct  233   SYLLLYMLASHIVGSFWYLLSVERYDTCWQEACKHNGTCNPDFLYCGNQGMTGYNAWSSI  292

Query  755   SSSFLNTSCALLEPENLKADDFDFGIFLDALKSNVVEKRYFWSKLFYCFWWGLRNLSSLG  934
             S S LN +C + + +N +   FDFGIF  AL S +V    F +K  YC WWGL+NLS+LG
Sbjct  293   SESVLNEACPV-DSDNDRP--FDFGIFKQALSSGIVFSMKFVTKYCYCLWWGLQNLSTLG  349

Query  935   QNLKTSNFVGEilfailisiiglilfslligNMQKYLQSITVRVEEMRVKRMDAEQWMSH  1114
             Q L+TS F GE LF+I ++I+GLILF+LLIGNMQ YLQS+T+R+EEMRVKR D+EQWM H
Sbjct  350   QGLQTSTFPGESLFSIALAILGLILFALLIGNMQTYLQSLTIRLEEMRVKRRDSEQWMHH  409

Query  1115  RMLPDNLRERIRRYEQYRWQETRGVDEESLISNLPKDLRRDINRHLCWSLLKRVHMFKTM  1294
             R+LP +LRER+R Y+QY+WQETRGVDEE+++ NLPKDLRRDI RHLC +L+KRV +F  M
Sbjct  410   RLLPQDLRERVRGYDQYKWQETRGVDEENIVQNLPKDLRRDIKRHLCLALVKRVPLFANM  469

Query  1295  DEQLLDAICDRLKPVLYTEKSCIVREGDPVDEMIFVMRGNLLTMTTNGGRTGFLNSDVLN  1474
             +E+LLDAIC+RLKP LY E + +VREGDPVDEM+FV+RG L ++TT+GGR+GF N  +L 
Sbjct  470   EERLLDAICERLKPCLYIENTYLVREGDPVDEMLFVIRGRLESVTTDGGRSGFFNRSLLK  529

Query  1475  AGDFCGEELLTWALDPNSSSSLPISTRTVQALTDVEAFALTADFLKFFASQYRRLHSKQL  1654
               DFCGEELLTWALDP S S+LP STRTV+ALT+VEAFAL AD LKF ASQ+R+LHS+Q+
Sbjct  530   ESDFCGEELLTWALDPKSGSNLPSSTRTVKALTEVEAFALIADELKFVASQFRKLHSRQV  589

Query  1655  QHKFRFYSHQWKTWAACFIQAAWRRHCRNKLEKSLREEEDRLQDALILRMRREEGETTPS  1834
             QH FRFYS  W+TWAACFIQAAWRR  + KL + L+ +ED   +AL        G +  S
Sbjct  590   QHTFRFYSQHWRTWAACFIQAAWRRFTKRKLME-LQRKEDEEAEALA-GASSTPGGSPYS  647

Query  1835  LGATIYASRFAANVLRTVRRN  1897
             + AT  ASRFAAN LR V RN
Sbjct  648   IRATFLASRFAANALRGVHRN  668



>gb|EPS68056.1| hypothetical protein M569_06716 [Genlisea aurea]
Length=728

 Score =   714 bits (1842),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 366/653 (56%), Positives = 474/653 (73%), Gaps = 15/653 (2%)
 Frame = +2

Query  47    KSKMHDPQGPFLQRWNRIFVIACILAATVDPLFFYIPVVDDQNKCLGLDRTLEITACILR  226
             + K+ DPQ   L  WN++FV++CIL  +VDPLF+Y+PV D  + CL +DR L ITA  LR
Sbjct  79    EKKIFDPQDKTLTFWNKLFVMSCILGVSVDPLFYYLPVFDQSSNCLDIDRNLAITATTLR  138

Query  227   SVFDFFYIFHIILQFRTGFVPPSSRVFGRGDLIVDPSAIAKRYFFSYFFIDILAVLPLPQ  406
             ++ D FY+ H+ LQFRT ++ PSSRVFGRG+L++DP  IAKRY   YF +D L+VLPLPQ
Sbjct  139   TLIDAFYLLHMALQFRTAYIAPSSRVFGRGELVIDPKQIAKRYLKYYFIVDFLSVLPLPQ  198

Query  407   VVLFMMIPRADRPFIMVAKDILKVVILVQSVPRLLRIYPLYKEVTRTSGFFTETAWAGAA  586
             +V++  I R+    ++  K  L ++IL+Q +PR  RI PL  E+ RTSG F ETAWAGA 
Sbjct  199   IVVWRFIQRSRGSDVLATKQALFLIILLQYIPRFARILPLSSELKRTSGVFAETAWAGAV  258

Query  587   FNLFLYMIASYVAGAIWYITAIERQDKCWRRACEKHGSCDIDFLYCTKLGRRG----GDF  754
               L LYM+AS++ GA+WY+ ++ER D CW +ACE +G+CD +FLYC      G       
Sbjct  259   SYLLLYMLASHIVGALWYLLSVERNDYCWTKACESNGNCDTNFLYCGNQYMNGYATWSGI  318

Query  755   SSSFLNTSCALLEPENLKADDFDFGIFLDALKSNVVEKRYFWSKLFYCFWWGLRNLSSLG  934
             S+S ++++C++    N     FDFGIF  AL S +V  R F SK  YC WWGL+NLS+LG
Sbjct  319   SNSVISSACSV--GGNSNNASFDFGIFTQALSSGIVSSRNFLSKYCYCLWWGLQNLSTLG  376

Query  935   QNLKTSNFVGEilfailisiiglilfslligNMQKYLQSITVRVEEMRVKRMDAEQWMSH  1114
             Q L+TS + GE LF+I ++I GLILF+LLIGNMQ YLQS+T+R+EEMRVKR D+EQWM H
Sbjct  377   QGLQTSTWPGESLFSIALAIFGLILFALLIGNMQTYLQSLTIRLEEMRVKRRDSEQWMRH  436

Query  1115  RMLPDNLRERIRRYEQYRWQETRGVDEESLISNLPKDLRRDINRHLCWSLLKRVHMFKTM  1294
             R+LP +LR+R+RRY+QY+W ETRGVDE+SL+ +LPKDLRRDI RHLC +L+KRV +F+ M
Sbjct  437   RLLPPDLRDRVRRYDQYKWLETRGVDEQSLVQSLPKDLRRDIKRHLCLALVKRVPLFENM  496

Query  1295  DEQLLDAICDRLKPVLYTEKSCIVREGDPVDEMIFVMRGNLLTMTTNGGRTGFLNSDVLN  1474
             DE+LLDAIC+RLKP L+TE + IVREGDPVDEMIF++RG L ++TT+GGR+GF N  +L 
Sbjct  497   DERLLDAICERLKPCLFTESTYIVREGDPVDEMIFLIRGRLESVTTDGGRSGFFNRSLLK  556

Query  1475  AGDFCGEELLTWALDPNSSSSLPISTRTVQALTDVEAFALTADFLKFFASQYRRLHSKQL  1654
              GDFCGEELLTWALDP S S+LP STRTV+A T+VEAFALTAD LKF A Q+RRLHS+Q+
Sbjct  557   EGDFCGEELLTWALDPKSGSNLPSSTRTVRAFTEVEAFALTADELKFVAGQFRRLHSRQV  616

Query  1655  QHKFRFYSHQWKTWAACFIQAAWRRHCRNKLEKSLREEEDRLQDALILRMRREE-----G  1819
             QH FRF+S QW+TWAACFIQAAWRR+ + K  ++ R EE+  ++      +         
Sbjct  617   QHTFRFHSQQWRTWAACFIQAAWRRYVKRKTTETRRREEEEEEEEEEEEEQGSRRHVVVA  676

Query  1820  ETTPSLGATIYASRFAANVLRTVRRNHplsvpklsprlpplllqkpAEPDFSA  1978
               + S+GAT  AS+FAAN LR V RN              + LQKP EPDFSA
Sbjct  677   GVSYSIGATFLASKFAANALRGVHRNR----NLKKSAKELVKLQKPPEPDFSA  725



>ref|XP_002880536.1| ATCNGC6 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH56795.1| ATCNGC6 [Arabidopsis lyrata subsp. lyrata]
Length=746

 Score =   714 bits (1843),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 359/652 (55%), Positives = 484/652 (74%), Gaps = 9/652 (1%)
 Frame = +2

Query  47    KSKMHDPQGPFLQRWNRIFVIACILAATVDPLFFYIPVVDDQNKCLGLDRTLEITACILR  226
             + K+ DPQ  FL   N+ FV +CILA +VDPLF Y+P ++D+ KC+G+D+ L I    +R
Sbjct  99    EKKIFDPQDKFLLLCNKFFVASCILAVSVDPLFLYLPFINDKAKCVGIDQKLAIIVTTIR  158

Query  227   SVFDFFYIFHIILQFRTGFVPPSSRVFGRGDLIVDPSAIAKRYFFSYFFIDILAVLPLPQ  406
             +V D FY+FH+ L+FRT +V PSSRVFGRG+L++DP+ IAKRY   YF ID+L+VLP+PQ
Sbjct  159   TVIDSFYLFHMALRFRTAYVAPSSRVFGRGELVIDPAQIAKRYLQQYFIIDLLSVLPVPQ  218

Query  407   VVLFMMIPRADRPFIMVAKDILKVVILVQSVPRLLRIYPLYKEVTRTSGFFTETAWAGAA  586
             ++++  +  +    ++  K  L+ ++LVQ +PR LR+YPL  E+ RT+G F ETAWAGAA
Sbjct  219   IIVWRFLYTSRGANVLATKQALRYIVLVQYIPRFLRMYPLSSELKRTAGVFAETAWAGAA  278

Query  587   FNLFLYMIASYVAGAIWYITAIERQDKCWRRACEKHGSCDIDFLYCTKLGRRG----GDF  754
             + L LYM+AS++ GA+WY+ A+ER + CW +AC  + +C  +FL+C     +G     + 
Sbjct  279   YYLLLYMLASHIVGALWYLLALERNNDCWSKACNNNQNCTRNFLFCGNQNMQGYAAWDNI  338

Query  755   SSSFLNTSCALLEPENLKADDFDFGIFLDALKSNVVEKRYFWSKLFYCFWWGLRNLSSLG  934
               S+L   C +  PE+ +   FDFGI+L AL S +V  + F SK F+C WWGL+NLS+LG
Sbjct  339   KVSYLQLKCPVNVPED-EEPPFDFGIYLRALSSGIVSSKNFVSKYFFCLWWGLQNLSTLG  397

Query  935   QNLKTSNFVGEilfailisiiglilfslligNMQKYLQSITVRVEEMRVKRMDAEQWMSH  1114
             Q L+TS + GE++F+I ++I GL+LF+LLIGNMQ YLQS+T+R+EEMRVKR D+EQWM H
Sbjct  398   QGLETSTYPGEVIFSITLAIAGLLLFALLIGNMQTYLQSLTIRLEEMRVKRRDSEQWMHH  457

Query  1115  RMLPDNLRERIRRYEQYRWQETRGVDEESLISNLPKDLRRDINRHLCWSLLKRVHMFKTM  1294
             RMLP  LRER+RRY+QY+W ETRGVDEE+L+ NLPKDLRRDI RHLC +L++RV +F+ M
Sbjct  458   RMLPPELRERVRRYDQYKWLETRGVDEENLVQNLPKDLRRDIKRHLCLALVRRVPLFENM  517

Query  1295  DEQLLDAICDRLKPVLYTEKSCIVREGDPVDEMIFVMRGNLLTMTTNGGRTGFLNSDVLN  1474
             DE+LLDAIC+RLKP L+TEKS +VREGDPV+EM+F++RG L ++TT+GGR+GF N  +L 
Sbjct  518   DERLLDAICERLKPCLFTEKSYLVREGDPVNEMLFIIRGRLESVTTDGGRSGFYNRSLLK  577

Query  1475  AGDFCGEELLTWALDPNSSSSLPISTRTVQALTDVEAFALTADFLKFFASQYRRLHSKQL  1654
              GDFCG+ELLTWALDP S S+LP STRTV+ALT+VEAFAL AD LKF ASQ+RRLHS+Q+
Sbjct  578   EGDFCGDELLTWALDPKSGSNLPSSTRTVKALTEVEAFALIADELKFVASQFRRLHSRQV  637

Query  1655  QHKFRFYSHQWKTWAACFIQAAWRRHCRNKLEKSLREEEDRLQDALILRMRREEGETTPS  1834
             QH FRFYS QW+TWAACF+QAAWRR+ + K  + LR+EE+  + A    +    G +  S
Sbjct  638   QHTFRFYSQQWRTWAACFMQAAWRRYIKRKKLEQLRKEEEEEEAAAASVI---AGGSPYS  694

Query  1835  LGATIYASRFAANVLRTVRRNHplsvpklsprlpplll-qkpAEPDFSAPEN  1987
             + AT  AS+FAAN LR+V +N       L      L+  QKP EPDFS  ++
Sbjct  695   IRATFLASKFAANALRSVHKNRTAKSTLLLSSTKELVKFQKPPEPDFSVEDH  746



>ref|XP_010472393.1| PREDICTED: probable cyclic nucleotide-gated ion channel 6 [Camelina 
sativa]
 ref|XP_010472394.1| PREDICTED: probable cyclic nucleotide-gated ion channel 6 [Camelina 
sativa]
Length=748

 Score =   714 bits (1843),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 362/653 (55%), Positives = 486/653 (74%), Gaps = 9/653 (1%)
 Frame = +2

Query  47    KSKMHDPQGPFLQRWNRIFVIACILAATVDPLFFYIPVVDDQNKCLGLDRTLEITACILR  226
             + K+ DPQ  FL   N++FV +CILA +VDPLF Y+P ++D+ KC+G+DR L I A  +R
Sbjct  99    EKKIFDPQDKFLLLCNKLFVASCILAVSVDPLFLYLPFINDKAKCVGIDRKLAIIATTIR  158

Query  227   SVFDFFYIFHIILQFRTGFVPPSSRVFGRGDLIVDPSAIAKRYFFSYFFIDILAVLPLPQ  406
             +V D FY+FH+ L+FRT +V PSSRVFGRG+L++DP+ IAKRY   YF ID+L+VLP+PQ
Sbjct  159   TVIDSFYLFHMALRFRTAYVAPSSRVFGRGELVIDPAQIAKRYLQQYFIIDLLSVLPVPQ  218

Query  407   VVLFMMIPRADRPFIMVAKDILKVVILVQSVPRLLRIYPLYKEVTRTSGFFTETAWAGAA  586
             +V++  +  +    ++  K  L+ ++LVQ +PR LR+YPL  E+ RT+G F ETAWAGAA
Sbjct  219   IVVWRFLFNSMGENVLATKQALRYIVLVQYIPRFLRMYPLSSELKRTAGVFAETAWAGAA  278

Query  587   FNLFLYMIASYVAGAIWYITAIERQDKCWRRACE-KHGSCDIDFLYCTKLGRRG----GD  751
             + L LYM+AS++ GA+WY+ A+ER + CW +AC   + +C  +FL+C     +G      
Sbjct  279   YYLLLYMLASHIVGALWYLLALERNNDCWSKACHFNNQTCARNFLFCGNQNMKGYAAWDK  338

Query  752   FSSSFLNTSCALLEPENLKADDFDFGIFLDALKSNVVEKRYFWSKLFYCFWWGLRNLSSL  931
                S L   C +  PE+ +   FDFGI+L AL S +V  + F SK F+C WWGL+NLS+L
Sbjct  339   IKVSVLQQYCPVDVPED-EEPPFDFGIYLRALSSGIVSSKNFVSKYFFCLWWGLQNLSTL  397

Query  932   GQNLKTSNFVGEilfailisiiglilfslligNMQKYLQSITVRVEEMRVKRMDAEQWMS  1111
             GQ L+TS + GE++F+I ++I GL+LF+LLIGNMQ YLQS+T+R+EEMRVKR D+EQWM 
Sbjct  398   GQGLETSTYPGEVIFSITLAIAGLLLFALLIGNMQTYLQSLTIRLEEMRVKRRDSEQWMH  457

Query  1112  HRMLPDNLRERIRRYEQYRWQETRGVDEESLISNLPKDLRRDINRHLCWSLLKRVHMFKT  1291
             HRMLP  LRER+RRY+QY+W ETRGVDEE+L+ NLPKDLRRDI RHLC +L++RV +F+ 
Sbjct  458   HRMLPPELRERVRRYDQYKWLETRGVDEENLVQNLPKDLRRDIKRHLCLALVRRVPLFEN  517

Query  1292  MDEQLLDAICDRLKPVLYTEKSCIVREGDPVDEMIFVMRGNLLTMTTNGGRTGFLNSDVL  1471
             MDE+LLDAIC+RLKP L+TEKS +VREGDPV+EM+F++RG L ++TT+GGR+GF N  +L
Sbjct  518   MDERLLDAICERLKPCLFTEKSYLVREGDPVNEMLFIIRGRLESVTTDGGRSGFFNRSLL  577

Query  1472  NAGDFCGEELLTWALDPNSSSSLPISTRTVQALTDVEAFALTADFLKFFASQYRRLHSKQ  1651
               GDFCG+ELLTWALDP S ++LP STRTV+ALT+VEAFAL AD LKF ASQ+RRLHS+Q
Sbjct  578   KEGDFCGDELLTWALDPKSGANLPSSTRTVKALTEVEAFALIADELKFVASQFRRLHSRQ  637

Query  1652  LQHKFRFYSHQWKTWAACFIQAAWRRHCRNKLEKSLREEEDRLQDALILRMRREEGETTP  1831
             +QH FRFYS QW+TWAACFIQAAWRR+ + K  + LR+EE+  +++    +    G +  
Sbjct  638   VQHTFRFYSQQWRTWAACFIQAAWRRYTKRKKLEQLRKEEEEEEESAAASV--IAGGSPY  695

Query  1832  SLGATIYASRFAANVLRTVRRNHplsvpklsprlpplll-qkpAEPDFSAPEN  1987
             S+ AT  AS+FAAN LR+V +N       L      L+  QKP EPDFSA ++
Sbjct  696   SIRATFLASKFAANALRSVHKNRTAKSALLLSSTKELVKFQKPPEPDFSAEDH  748



>ref|XP_010417136.1| PREDICTED: probable cyclic nucleotide-gated ion channel 6 [Camelina 
sativa]
Length=748

 Score =   714 bits (1843),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 362/653 (55%), Positives = 486/653 (74%), Gaps = 9/653 (1%)
 Frame = +2

Query  47    KSKMHDPQGPFLQRWNRIFVIACILAATVDPLFFYIPVVDDQNKCLGLDRTLEITACILR  226
             + K+ DPQ  FL   N++FV +CILA +VDPLF Y+P ++D+ KC+G+DR L I A  +R
Sbjct  99    EKKIFDPQDKFLLLCNKLFVASCILAVSVDPLFLYLPFINDKAKCVGIDRKLAIIATTIR  158

Query  227   SVFDFFYIFHIILQFRTGFVPPSSRVFGRGDLIVDPSAIAKRYFFSYFFIDILAVLPLPQ  406
             +V D FY+FH+ L+FRT +V PSSRVFGRG+L++DP+ IAKRY   YF ID+L+VLP+PQ
Sbjct  159   TVIDSFYLFHMALRFRTAYVAPSSRVFGRGELVIDPAQIAKRYLQQYFIIDLLSVLPVPQ  218

Query  407   VVLFMMIPRADRPFIMVAKDILKVVILVQSVPRLLRIYPLYKEVTRTSGFFTETAWAGAA  586
             +V++  +  +    ++  K  L+ ++LVQ +PR LR+YPL  E+ RT+G F ETAWAGAA
Sbjct  219   IVVWRFLFNSMGANVLATKQALRYIVLVQYIPRFLRMYPLSSELKRTAGVFAETAWAGAA  278

Query  587   FNLFLYMIASYVAGAIWYITAIERQDKCWRRACE-KHGSCDIDFLYCTKLGRRG----GD  751
             + L LYM+AS++ GA+WY+ A+ER + CW +AC   + +C  +FL+C     +G      
Sbjct  279   YYLLLYMLASHIVGALWYLLALERNNDCWSKACHFNNQTCARNFLFCGNQNMKGYAAWDK  338

Query  752   FSSSFLNTSCALLEPENLKADDFDFGIFLDALKSNVVEKRYFWSKLFYCFWWGLRNLSSL  931
                S L   C +  PE+ +   FDFGI+L AL S +V  + F SK F+C WWGL+NLS+L
Sbjct  339   IKVSVLQQYCPVDVPED-EEPPFDFGIYLRALSSGIVSSKNFVSKYFFCLWWGLQNLSTL  397

Query  932   GQNLKTSNFVGEilfailisiiglilfslligNMQKYLQSITVRVEEMRVKRMDAEQWMS  1111
             GQ L+TS + GE++F+I ++I GL+LF+LLIGNMQ YLQS+T+R+EEMRVKR D+EQWM 
Sbjct  398   GQGLETSTYPGEVIFSITLAIAGLLLFALLIGNMQTYLQSLTIRLEEMRVKRRDSEQWMH  457

Query  1112  HRMLPDNLRERIRRYEQYRWQETRGVDEESLISNLPKDLRRDINRHLCWSLLKRVHMFKT  1291
             HRMLP  LRER+RRY+QY+W ETRGVDEE+L+ NLPKDLRRDI RHLC +L++RV +F+ 
Sbjct  458   HRMLPPELRERVRRYDQYKWLETRGVDEENLVQNLPKDLRRDIKRHLCLALVRRVPLFEN  517

Query  1292  MDEQLLDAICDRLKPVLYTEKSCIVREGDPVDEMIFVMRGNLLTMTTNGGRTGFLNSDVL  1471
             MDE+LLDAIC+RLKP L+TEKS +VREGDPV+EM+F++RG L ++TT+GGR+GF N  +L
Sbjct  518   MDERLLDAICERLKPCLFTEKSYLVREGDPVNEMLFIIRGRLESVTTDGGRSGFFNRSLL  577

Query  1472  NAGDFCGEELLTWALDPNSSSSLPISTRTVQALTDVEAFALTADFLKFFASQYRRLHSKQ  1651
               GDFCG+ELLTWALDP S ++LP STRTV+ALT+VEAFAL AD LKF ASQ+RRLHS+Q
Sbjct  578   KEGDFCGDELLTWALDPKSGANLPSSTRTVKALTEVEAFALIADELKFVASQFRRLHSRQ  637

Query  1652  LQHKFRFYSHQWKTWAACFIQAAWRRHCRNKLEKSLREEEDRLQDALILRMRREEGETTP  1831
             +QH FRFYS QW+TWAACFIQAAWRR+ + K  + LR+EE+  +++    +    G +  
Sbjct  638   VQHTFRFYSQQWRTWAACFIQAAWRRYTKRKKLEQLRKEEEEEEESAAASV--IAGGSPY  695

Query  1832  SLGATIYASRFAANVLRTVRRNHplsvpklsprlpplll-qkpAEPDFSAPEN  1987
             S+ AT  AS+FAAN LR+V +N       L      L+  QKP EPDFSA ++
Sbjct  696   SIRATFLASKFAANALRSVHKNRTAKSALLLSSTKELVKFQKPPEPDFSAEDH  748



>gb|EEC80737.1| hypothetical protein OsI_23212 [Oryza sativa Indica Group]
Length=964

 Score =   722 bits (1863),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 381/671 (57%), Positives = 479/671 (71%), Gaps = 47/671 (7%)
 Frame = +2

Query  65    PQGPFLQRWNRIFVIACILAATVDPLFFYIPVVDDQNKCLGLDRTLEITACILRSVFDFF  244
             PQGPFLQ WN+IFV++CI A +VDPLFFYIPV+++ N C  LD+ LEITA +LR   D F
Sbjct  311   PQGPFLQSWNKIFVLSCIFAVSVDPLFFYIPVINENNTCWYLDKKLEITASVLRFFTDIF  370

Query  245   YIFHIILQFRTGFVPPSSRVFGRGDLIVDPSAIAKRYFFSYFFIDILAVLPLPQVVLFMM  424
             YI HII QFRTG++  S   F RG L+ D  AIAKRY  +YF ID+ AVLPLPQVV+ ++
Sbjct  371   YILHIIFQFRTGYIASSPTTFDRGVLVEDRYAIAKRYLSTYFLIDVFAVLPLPQVVILVV  430

Query  425   IPRADRPFIMVAKDILKVVILVQSVPRLLRIYPLYKEVTRTSGFFTETAWAGAAFNLFLY  604
             +P      +  AK+IL  ++L Q VPRL+RI PLY ++TR++G  TET W GA   L +Y
Sbjct  431   LPNLRSSEVAKAKNILMFIVLCQYVPRLIRIRPLYLQITRSAGVITETPWPGAVLILLIY  490

Query  605   MIASYVAGAIWYITAIERQDKCWRRACEKHGS-CDIDFLYCTKLGRRGGDFSSSFLNTSC  781
             ++AS+V GA+WY+ +IER+D CWR  C  + + C+  +LYC       GD  + FL T+C
Sbjct  491   LLASHVLGALWYLLSIERKDACWRDVCRNNSTGCNQAYLYC-------GDKENIFLQTAC  543

Query  782   ALLEPENLKADDFDFGIFLDALKSNVVEKRYFWSKLFYCFWWGLRNLSSLGQNLKTSNFV  961
               +   N+   D +FGI++ AL +NV +   F +KLFYC  WGL+NLSS GQNLKTS + 
Sbjct  544   LPINSNNI---DPNFGIYVPAL-NNVSQSTDFLAKLFYCVCWGLQNLSSRGQNLKTSTYA  599

Query  962   GEilfailisiiglilfslligNMQ-----------------------------KYLQSI  1054
              E LFA+ +SI GL+LF+LLI N+Q                              YLQS 
Sbjct  600   WENLFALFVSISGLVLFALLIANVQGYETKDMEPCARFRVFIPIPFGDKTSIILTYLQSA  659

Query  1055  TVRVEEMRVKRMDAEQWMSHRMLPDNLRERIRRYEQYRWQETRGVDEESLISNLPKDLRR  1234
              +R EEMRVK  D +QWMS+R+LP+NL+ERIRR+E+YRW +T GVDEE L+ NLPKDLRR
Sbjct  660   HLREEEMRVKSRDTDQWMSYRLLPENLKERIRRHEKYRWHQTSGVDEELLLMNLPKDLRR  719

Query  1235  DINRHLCWSLLKRVHMFKTMDEQLLDAICDRLKPVLYTEKSCIVREGDPVDEMIFVMRGN  1414
              I RHLC SLL RV MF+ MD+QLL+A+CDRLKPVLYTE SCI+RE DPV+EM+F+MRGN
Sbjct  720   AIKRHLCLSLLMRVPMFENMDDQLLNALCDRLKPVLYTEGSCIIREEDPVNEMLFIMRGN  779

Query  1415  LLTMTTNGGRTGFLNSDVLNAGDFCGEELLTWALDPNSSSSLPISTRTVQALTDVEAFAL  1594
             L++MTTNGGRTGF NSDVL  GDFCGEELLTWALDP S SSLP STRTV+ +++VEAFAL
Sbjct  780   LMSMTTNGGRTGFFNSDVLKGGDFCGEELLTWALDPTSVSSLPSSTRTVKTMSEVEAFAL  839

Query  1595  TADFLKFFASQYRRLHSKQLQHKFRFYSHQWKTWAACFIQAAWRRHCRNKLEKSLREEED  1774
              A+ LKF A+Q+RRLHSKQLQH F+FYS  W+TWAACFIQAAW R+CR K+E SLRE+E 
Sbjct  840   RAEDLKFVATQFRRLHSKQLQHTFKFYSQHWRTWAACFIQAAWHRYCRKKIEDSLREKEK  899

Query  1775  RLQDALILRMRREEGETTPSLGATIYASRFAANVLRTVRRNHplsvpklsprlpplllqk  1954
             RLQ A++      +G TT S  A IYASRFA N++R +RRN      +L   +P  LLQK
Sbjct  900   RLQFAIV-----NDGATTLSFRAAIYASRFAGNMMRILRRN-ATRKARLKESVPARLLQK  953

Query  1955  pAEPDFSAPEN  1987
             PAEP+F+A E 
Sbjct  954   PAEPNFAAEEQ  964


 Score =   230 bits (587),  Expect = 8e-59, Method: Compositional matrix adjust.
 Identities = 105/185 (57%), Positives = 136/185 (74%), Gaps = 0/185 (0%)
 Frame = +2

Query  65   PQGPFLQRWNRIFVIACILAATVDPLFFYIPVVDDQNKCLGLDRTLEITACILRSVFDFF  244
            PQGPFLQ WN+IFV++CI A +VDPLFFYIPV++D N C  LD+ LEITA +LR   D F
Sbjct  70   PQGPFLQSWNKIFVLSCIFAVSVDPLFFYIPVINDNNTCWYLDKKLEITASVLRFFTDIF  129

Query  245  YIFHIILQFRTGFVPPSSRVFGRGDLIVDPSAIAKRYFFSYFFIDILAVLPLPQVVLFMM  424
            YI HII QFRTG++  S   FGRG L+ D  AIAKRY  +YF ID+ AVLPLPQVV+ ++
Sbjct  130  YILHIIFQFRTGYIASSLTTFGRGVLVEDRYAIAKRYLSTYFLIDVFAVLPLPQVVILVV  189

Query  425  IPRADRPFIMVAKDILKVVILVQSVPRLLRIYPLYKEVTRTSGFFTETAWAGAAFNLFLY  604
            +P      +  AK+IL  +++ Q VPRL+RI PLY ++TR++G  TET WAGA  NL +Y
Sbjct  190  LPNLGGSEVTKAKNILMFIVICQYVPRLIRIRPLYLQITRSAGVITETPWAGAVLNLLIY  249

Query  605  MIASY  619
            ++AS+
Sbjct  250  LLASH  254



>ref|XP_006286176.1| hypothetical protein CARUB_v10007740mg [Capsella rubella]
 gb|EOA19074.1| hypothetical protein CARUB_v10007740mg [Capsella rubella]
Length=733

 Score =   713 bits (1840),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 365/648 (56%), Positives = 473/648 (73%), Gaps = 18/648 (3%)
 Frame = +2

Query  47    KSKMHDPQGPFLQRWNRIFVIACILAATVDPLFFYIPVVDDQNKCLGLDRTLEITACILR  226
             + K+ DPQ  FL   N++FV +CILA +VDPLF Y+P V D  KC+G+DR L + A  LR
Sbjct  96    EKKIFDPQDKFLLLCNKLFVTSCILAVSVDPLFLYLPFVKDNEKCIGIDRRLAVIATTLR  155

Query  227   SVFDFFYIFHIILQFRTGFVPPSSRVFGRGDLIVDPSAIAKRYFFSYFFIDILAVLPLPQ  406
             +V D FY+FH+ L+FRT FV PSSRVFGRG+L++DP+ IAKRY   YF ID L+VLPLPQ
Sbjct  156   TVTDAFYLFHMALRFRTAFVAPSSRVFGRGELVIDPAQIAKRYLQQYFIIDFLSVLPLPQ  215

Query  407   VVLFMMIPRADRPFIMVAKDILKVVILVQSVPRLLRIYPLYKEVTRTSGFFTETAWAGAA  586
             +V++  +  +  P ++  K  L+ +ILVQ +PR +R+YPL  E+ RT+G F ETAWAGAA
Sbjct  216   IVVWRFLHISKGPSVLATKRALRSIILVQYIPRFIRLYPLSSELKRTAGVFAETAWAGAA  275

Query  587   FNLFLYMIASYVAGAIWYITAIERQDKCWRRACE-KHGSCDIDFLYCTKLGRRGGDFSSS  763
             + L LYM+AS++ GAIWY+ A+ER + CW RAC     +C  +FL+C      G    S+
Sbjct  276   YYLLLYMLASHIVGAIWYLLALERYNGCWSRACGISQNNCTRNFLFCGNEDMPGYAAWST  335

Query  764   FLNTSCALLEPENLKADD---FDFGIFLDALKSNVVEKRYFWSKLFYCFWWGLRNLSSLG  934
               ++   +  P N    D   FDFGI+L AL S +V  + F SK F+C WWGL+NLS+LG
Sbjct  336   IKDSVLQINCPVNTTDGDNPPFDFGIYLRALSSGIVSSKSFVSKYFFCLWWGLKNLSTLG  395

Query  935   QNLKTSNFVGEilfailisiiglilfslligNMQKYLQSITVRVEEMRVKRMDAEQWMSH  1114
             Q L+TS + GE++F+I ++I GL+LF+LLIGNMQ YLQS+T+R+EEMRVKR D+EQWM H
Sbjct  396   QGLETSTYPGEVIFSITLAIAGLLLFALLIGNMQTYLQSLTIRLEEMRVKRRDSEQWMHH  455

Query  1115  RMLPDNLRERIRRYEQYRWQETRGVDEESLISNLPKDLRRDINRHLCWSLLKRVHMFKTM  1294
             RMLP  LRER+RRY+QY+W ETRGVDEE+L+ NLPKDLRRDI RHLC +L++RV +F+ M
Sbjct  456   RMLPPELRERVRRYDQYKWLETRGVDEENLVQNLPKDLRRDIKRHLCLALVRRVPLFENM  515

Query  1295  DEQLLDAICDRLKPVLYTEKSCIVREGDPVDEMIFVMRGNLLTMTTNGGRTGFLNSDVLN  1474
             DE+LLDAIC+RLKP LYTEKS +VREGDPV+EM+F++RG L ++TT+GGR+GF N  +L 
Sbjct  516   DERLLDAICERLKPCLYTEKSYLVREGDPVNEMLFIIRGRLESVTTDGGRSGFFNRSLLK  575

Query  1475  AGDFCGEELLTWALDPNSSSSLPISTRTVQALTDVEAFALTADFLKFFASQYRRLHSKQL  1654
              GDFCGEELLTWALDP S S+LP STRT +ALT+VEAFAL AD LKF ASQ+RRLHS+Q+
Sbjct  576   EGDFCGEELLTWALDPKSGSNLPSSTRTAKALTEVEAFALIADELKFVASQFRRLHSRQV  635

Query  1655  QHKFRFYSHQWKTWAACFIQAAWRRHCRNKLEKSLREEEDRLQDALILRMRREEGETTPS  1834
             QH FRFYS QW+TWAA FIQAAWRR+ + K  + LR+EE+  +             +  S
Sbjct  636   QHTFRFYSQQWRTWAAIFIQAAWRRYVKKKKLEQLRKEEEEEEGE----------GSVTS  685

Query  1835  LGATIYASRFAANVLRTVRRNHplsvpklsprlpplllqkpAEPDFSA  1978
             + AT  AS+FAAN LR V +N      +       +  QKP+EPDFSA
Sbjct  686   IRATFLASKFAANALRKVHKNR----IEAKATKELVKYQKPSEPDFSA  729



>ref|XP_003540100.1| PREDICTED: probable cyclic nucleotide-gated ion channel 5-like 
isoform X1 [Glycine max]
 ref|XP_006592597.1| PREDICTED: probable cyclic nucleotide-gated ion channel 5-like 
isoform X2 [Glycine max]
 gb|KHN10384.1| Putative cyclic nucleotide-gated ion channel 5 [Glycine soja]
Length=732

 Score =   713 bits (1840),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 364/652 (56%), Positives = 480/652 (74%), Gaps = 18/652 (3%)
 Frame = +2

Query  47    KSKMHDPQGPFLQRWNRIFVIACILAATVDPLFFYIPVVDDQNKCLGLDRTLEITACILR  226
             + K+ DPQ  FL  WN++FVI+CILA +VDPLFFY+PV++D   CLG+DR L IT   LR
Sbjct  95    EKKIFDPQDKFLLTWNKLFVISCILAVSVDPLFFYLPVINDSFHCLGIDRKLAITVTTLR  154

Query  227   SVFDFFYIFHIILQFRTGFVPPSSRVFGRGDLIVDPSAIAKRYFFSYFFIDILAVLPLPQ  406
             +  D FY+ H+ LQFRT ++ PSSRVFGRG+L++DP+ IAKRY   YF +D L+VLPLPQ
Sbjct  155   TFIDAFYLVHMALQFRTAYIAPSSRVFGRGELVIDPAQIAKRYLRRYFIVDFLSVLPLPQ  214

Query  407   VVLFMMIPRADRPFIMVAKDILKVVILVQSVPRLLRIYPLYKEVTRTSGFFTETAWAGAA  586
             +V++  + R+    ++  K  L  +IL Q +PR  R+ PL  E+ RT+G F ETAWAGAA
Sbjct  215   IVVWRFLQRSKGSVVLATKRALLFIILHQYIPRFFRMVPLTSELKRTAGVFAETAWAGAA  274

Query  587   FNLFLYMIASYVAGAIWYITAIERQDKCWRRACEKHGSCDIDFLYCTKLGRRGGDFSSSF  766
             + L L+M+AS++ G+ WY+ A+ER D CW++AC  +G  + +FLYC   G +  +  S++
Sbjct  275   YYLLLFMLASHIVGSFWYLLAVERNDFCWQKACSGNGY-NKNFLYC---GNQYMEGYSAW  330

Query  767   LNTSCALLEPENLKADD---FDFGIFLDALKSNVVEKRYFWSKLFYCFWWGLRNLSSLGQ  937
              N S  +L  +    +D   FD+GIF  AL S +V  + F+SK  YC WWGL+NLS+LGQ
Sbjct  331   QNRSKDILTSQCSVDNDNSPFDYGIFKQALSSRIVSSKKFFSKYCYCLWWGLQNLSTLGQ  390

Query  938   NLKTSNFVGEilfailisiiglilfslligNMQKYLQSITVRVEEMRVKRMDAEQWMSHR  1117
              L+TS + GE++F+I ++I GLILF+LLIGNMQ YLQS+T+R+EEMRVKR D+EQWM HR
Sbjct  391   GLETSTYTGEVVFSIALAIAGLILFALLIGNMQTYLQSLTIRLEEMRVKRRDSEQWMHHR  450

Query  1118  MLPDNLRERIRRYEQYRWQETRGVDEESLISNLPKDLRRDINRHLCWSLLKRVHMFKTMD  1297
             +LP  LRER+RRY+QY+W  TRGVDEESL+ +LPKDLRRDI RHLC +L++RV +F++MD
Sbjct  451   LLPQELRERVRRYDQYKWLATRGVDEESLVQSLPKDLRRDIKRHLCLALVRRVPLFESMD  510

Query  1298  EQLLDAICDRLKPVLYTEKSCIVREGDPVDEMIFVMRGNLLTMTTNGGRTGFLNSDVLNA  1477
             E+LLDAIC+RLKP L+TE + IVREGDPVDEM+F++RG L ++TT+GGR+GF N   L  
Sbjct  511   ERLLDAICERLKPCLFTESTYIVREGDPVDEMLFIIRGRLESVTTDGGRSGFFNRGFLKE  570

Query  1478  GDFCGEELLTWALDPNSSSSLPISTRTVQALTDVEAFALTADFLKFFASQYRRLHSKQLQ  1657
              DFCGEELLTWALDP S S+LP STRTV+ALT+VEAFALTA+ LKF ASQ+RRLHS+Q+Q
Sbjct  571   ADFCGEELLTWALDPKSGSNLPSSTRTVKALTEVEAFALTAEELKFVASQFRRLHSRQVQ  630

Query  1658  HKFRFYSHQWKTWAACFIQAAWRRHCRNK-LEKSLREEEDRLQDALILRMRREEGETTPS  1834
             H FRFYS QW+TWAACFIQAAWRR+ + K +E S ++E +  +       R     ++ S
Sbjct  631   HTFRFYSQQWRTWAACFIQAAWRRYSKRKTMELSQKDEPEESEGT-----RGNASGSSYS  685

Query  1835  LGATIYASRFAANVLRTVRRNHplsvpklsprlpplllqkpAEPDFSAPENN  1990
             LGAT  ASRFAAN LR V RN      +       + LQKP EPDF+A + +
Sbjct  686   LGATFLASRFAANALRGVHRNR-----EAKSARELVKLQKPPEPDFTADDAD  732



>ref|XP_006453609.1| hypothetical protein CICLE_v10007576mg [Citrus clementina]
 gb|ESR66849.1| hypothetical protein CICLE_v10007576mg [Citrus clementina]
Length=735

 Score =   712 bits (1839),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 368/652 (56%), Positives = 478/652 (73%), Gaps = 13/652 (2%)
 Frame = +2

Query  47    KSKMHDPQGPFLQRWNRIFVIACILAATVDPLFFYIPVVDDQNKCLGLDRTLEITACILR  226
             + K+ DPQ   L   N++FVI+CILA +VDPLFFY+PV++D +KCLG+DR L ITA  LR
Sbjct  93    EKKIFDPQDKLLLFCNKLFVISCILAVSVDPLFFYLPVINDSSKCLGIDRKLAITATTLR  152

Query  227   SVFDFFYIFHIILQFRTGFVPPSSRVFGRGDLIVDPSAIAKRYFFSYFFIDILAVLPLPQ  406
             ++ D FY+ H+ LQFRT F+ PSSRVFGRG+L++DP+ IAKRY   YF ID LAVLPLPQ
Sbjct  153   TIVDVFYLLHMALQFRTAFIAPSSRVFGRGELVIDPAQIAKRYMRRYFIIDFLAVLPLPQ  212

Query  407   VVLFMMIPRADRPFIMVAKDILKVVILVQSVPRLLRIYPLYKEVTRTSGFFTETAWAGAA  586
             +V++  + R++   ++  K  L  ++L Q  PR  RI PL  E+ RT+G F ETAWAGAA
Sbjct  213   IVVWRFLLRSNGSDVLATKQALFFIVLFQYFPRFFRILPLTSELKRTAGVFAETAWAGAA  272

Query  587   FNLFLYMIASYVAGAIWYITAIERQDKCWRRACEKHGSCDIDFLYCTKLGRRG----GDF  754
             + L LYM+AS+V GA+WY+ A+ER D CWR+AC    +C  DFLYC      G     D 
Sbjct  273   YYLLLYMLASHVVGALWYLLALERNDTCWRKACSVTANCTKDFLYCGNQDMTGYAAWHDI  332

Query  755   SSSFLNTSCALLEPENLKADDFDFGIFLDALKSNVVEKRYFWSKLFYCFWWGLRNLSSLG  934
             S++ L + C+  E +      FDFGI+  AL S +V  + F+SK  YC WWGL+NLS+LG
Sbjct  333   SNTTLESKCSADEDD----PPFDFGIYSQALSSGIVSSKKFFSKYCYCLWWGLQNLSTLG  388

Query  935   QNLKTSNFVGEilfailisiiglilfslligNMQKYLQSITVRVEEMRVKRMDAEQWMSH  1114
             Q L+TS F GE++F+I ++I GLILF+LLIGNMQ YLQS+T+R+EEMR+KR D+EQWM H
Sbjct  389   QGLQTSTFPGEVIFSIALAIFGLILFALLIGNMQTYLQSLTIRLEEMRIKRRDSEQWMHH  448

Query  1115  RMLPDNLRERIRRYEQYRWQETRGVDEESLISNLPKDLRRDINRHLCWSLLKRVHMFKTM  1294
             R+LP +LRER+RRY+QY+W ETRGVDEE+L+ +LPKDLRRDI RHLC +L++RV +F+ M
Sbjct  449   RLLPPDLRERVRRYDQYKWLETRGVDEENLVQSLPKDLRRDIKRHLCLALVRRVPLFENM  508

Query  1295  DEQLLDAICDRLKPVLYTEKSCIVREGDPVDEMIFVMRGNLLTMTTNGGRTGFLNSDVLN  1474
             DE+LLDAIC+RLKP L+T+ + IVREGDPVDEM+F++RG L ++TT+GGR+GF N   L 
Sbjct  509   DERLLDAICERLKPCLFTDSTYIVREGDPVDEMLFIIRGRLESVTTDGGRSGFFNRGFLK  568

Query  1475  AGDFCGEELLTWALDPNSSSSLPISTRTVQALTDVEAFALTADFLKFFASQYRRLHSKQL  1654
              GDFCGEELLTWALDP S  +LP STRTV+AL +VEAFAL A+ LKF ASQ+RRLHS+Q+
Sbjct  569   EGDFCGEELLTWALDPKSGVNLPSSTRTVRALKEVEAFALMAEELKFVASQFRRLHSRQV  628

Query  1655  QHKFRFYSHQWKTWAACFIQAAWRRHCRNKLEKSLREEEDRLQDALILRMRREEGETTPS  1834
             QH FRFYS QW+TWAACFIQAAWRR+ + K  +  R+EE+  ++A         G  + S
Sbjct  629   QHTFRFYSQQWRTWAACFIQAAWRRYSKRKKMEQTRKEEEEEEEASEGVQSSSTGGGSYS  688

Query  1835  LGATIYASRFAANVLRTVRRNHplsvpklsprlpplllqkpAEPDFSAPENN  1990
             +GAT  A+RFAAN LR V RN              + LQKP EPDF+A + +
Sbjct  689   IGATFLATRFAANALRGVHRNR-----NAKSARELVKLQKPPEPDFTAEDAD  735



>ref|XP_009366180.1| PREDICTED: probable cyclic nucleotide-gated ion channel 5 isoform 
X1 [Pyrus x bretschneideri]
Length=729

 Score =   712 bits (1838),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 369/647 (57%), Positives = 475/647 (73%), Gaps = 20/647 (3%)
 Frame = +2

Query  53    KMHDPQGPFLQRWNRIFVIACILAATVDPLFFYIPVVDDQNKCLGLDRTLEITACILRSV  232
             K++DPQ  FL  WN+ FVI+CILA +VDPLFFY+PV++  + CLG+DR L I A  LR +
Sbjct  94    KIYDPQDKFLLLWNKFFVISCILAVSVDPLFFYLPVINSSSTCLGIDRRLAIIATTLRMI  153

Query  233   FDFFYIFHIILQFRTGFVPPSSRVFGRGDLIVDPSAIAKRYFFSYFFIDILAVLPLPQVV  412
              D FY+ H+ LQFRT ++ PSSRVFGRG+L++DP+ IAKRY  SYF ID L+VLPLPQ+V
Sbjct  154   VDAFYLIHMALQFRTAYIAPSSRVFGRGELVIDPARIAKRYLRSYFIIDFLSVLPLPQIV  213

Query  413   LFMMIPRADRPFIMVAKDILKVVILVQSVPRLLRIYPLYKEVTRTSGFFTETAWAGAAFN  592
             ++  + R+    ++  K  L  ++L Q +PRLLR++PL  E+ RT+G F ETAW GAA+ 
Sbjct  214   VWRFLQRSKSSDVLATKQALLFIVLFQYIPRLLRVHPLTSELKRTAGVFAETAWEGAAYY  273

Query  593   LFLYMIASYVAGAIWYITAIERQDKCWRRACEKHG-SCDIDFLYCTKLGRRGGDFSSSFL  769
             L LYM+AS++ GA WY+ A+ER D CW++AC + G SCD   LYC      G  + ++  
Sbjct  274   LLLYMLASHIVGAFWYLLALERNDTCWQKACTEIGKSCDKKILYC------GNQYIATQS  327

Query  770   NTSCALLEPENLKADD----FDFGIFLDALKSNVVEKRYFWSKLFYCFWWGLRNLSSLGQ  937
             N +  +L      ADD    FDFGI+  AL S VV    F  K  YC WWGL+NLS+LGQ
Sbjct  328   NVTETILS--KCTADDQNTFFDFGIYNSALSSGVVSSNKFIVKYCYCLWWGLQNLSTLGQ  385

Query  938   NLKTSNFVGEilfailisiiglilfslligNMQKYLQSITVRVEEMRVKRMDAEQWMSHR  1117
              L TS + GE++F+I ++I GLILF+LLIGNMQ YLQS+T+R+EEMRVKR D+EQWM HR
Sbjct  386   GLATSTYPGEVIFSIALAIFGLILFALLIGNMQTYLQSLTIRLEEMRVKRRDSEQWMHHR  445

Query  1118  MLPDNLRERIRRYEQYRWQETRGVDEESLISNLPKDLRRDINRHLCWSLLKRVHMFKTMD  1297
             +LP +LRER+RRY+QY+W ETRGVDE+SL+ +LPKDLRRDI RHLC +L++RV +F+ M+
Sbjct  446   LLPQDLRERVRRYDQYKWLETRGVDEQSLVQSLPKDLRRDIKRHLCLALVRRVPLFENME  505

Query  1298  EQLLDAICDRLKPVLYTEKSCIVREGDPVDEMIFVMRGNLLTMTTNGGRTGFLNSDVLNA  1477
             E+LLDAIC+RLKP L TE + IVREGDPVDEM+F++RG L ++TT+GGR+GF N  +L  
Sbjct  506   ERLLDAICERLKPSLCTESTYIVREGDPVDEMLFIIRGRLESVTTDGGRSGFFNRSLLKE  565

Query  1478  GDFCGEELLTWALDPNSSSSLPISTRTVQALTDVEAFALTADFLKFFASQYRRLHSKQLQ  1657
             GDFCGEELLTWALDP S ++LP STRTV+A+T+VEAFAL A+ LKF ASQ+RRLHS+Q+Q
Sbjct  566   GDFCGEELLTWALDPKSGANLPSSTRTVKAVTEVEAFALVAEELKFVASQFRRLHSRQVQ  625

Query  1658  HKFRFYSHQWKTWAACFIQAAWRRHCRNKLEKSLREEEDRLQDALILRMRREEGETTPSL  1837
             H FRFYS QW+TWAACFIQAAWRR+ + K+ +  R+EE    +A  L   R     + S+
Sbjct  626   HTFRFYSQQWRTWAACFIQAAWRRYSKRKILELHRKEE--EAEAEALGGARSNAGGSYSI  683

Query  1838  GATIYASRFAANVLRTVRRNHplsvpklsprlpplllqkpAEPDFSA  1978
             GAT  ASRFAAN LR V RN       L      + LQKP EPDFSA
Sbjct  684   GATFLASRFAANALRGVHRNR-----NLKSARELVKLQKPPEPDFSA  725



>ref|XP_009358434.1| PREDICTED: probable cyclic nucleotide-gated ion channel 5 [Pyrus 
x bretschneideri]
 ref|XP_009358435.1| PREDICTED: probable cyclic nucleotide-gated ion channel 5 [Pyrus 
x bretschneideri]
Length=733

 Score =   712 bits (1839),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 371/647 (57%), Positives = 476/647 (74%), Gaps = 17/647 (3%)
 Frame = +2

Query  53    KMHDPQGPFLQRWNRIFVIACILAATVDPLFFYIPVVDDQNKCLGLDRTLEITACILRSV  232
             K++DPQ  FL  WNR FVI+CILA +VDPLFFY+PV++  + CLG+DR L ITA  LR +
Sbjct  95    KIYDPQDKFLLLWNRFFVISCILAVSVDPLFFYLPVINSSSNCLGIDRRLAITATTLRMI  154

Query  233   FDFFYIFHIILQFRTGFVPPSSRVFGRGDLIVDPSAIAKRYFFSYFFIDILAVLPLPQVV  412
              D FY+ H+ LQFRT ++ PSSRVFGRG+L++DP+ IAKRY  SYF ID L+VLPLPQ+V
Sbjct  155   VDAFYLIHMALQFRTAYIAPSSRVFGRGELVIDPARIAKRYLRSYFIIDFLSVLPLPQIV  214

Query  413   LFMMIPRADRPFIMVAKDILKVVILVQSVPRLLRIYPLYKEVTRTSGFFTETAWAGAAFN  592
             ++  + R+    ++  K  L  ++L Q +PRL R+YPL  E+ RT+G F ETAWAGAA+ 
Sbjct  215   VWRFLQRSKGSDVLATKQALLFIVLFQYIPRLFRVYPLTSELKRTAGVFAETAWAGAAYY  274

Query  593   LFLYMIASYVAGAIWYITAIERQDKCWRRACEKHGS-CDIDFLYCTKLGRRGGDFSSSFL  769
             L LYM+AS++ GA WY+ A+ER D CW+ AC   G  CD   LYC   G +    ++++ 
Sbjct  275   LLLYMLASHIVGAFWYLLALERNDTCWQMACTDIGKPCDKTLLYC---GNQNNLDNATWS  331

Query  770   NTSCALLEPENLKADD----FDFGIFLDALKSNVVEKRYFWSKLFYCFWWGLRNLSSLGQ  937
             N +  +L      ADD    FDFGIF  AL S VV  + F  K  YC WWGL+NLS+LGQ
Sbjct  332   NVTGNILS--KCSADDNNTYFDFGIFNSALSSGVVSSKKFIVKYCYCLWWGLQNLSTLGQ  389

Query  938   NLKTSNFVGEilfailisiiglilfslligNMQKYLQSITVRVEEMRVKRMDAEQWMSHR  1117
              L TS + GE++F+I ++I GLILF+LLIGNMQ YLQS+T+R+EEMRVKR D+EQWM HR
Sbjct  390   GLATSTYPGEVIFSISLAIFGLILFALLIGNMQTYLQSLTIRLEEMRVKRRDSEQWMHHR  449

Query  1118  MLPDNLRERIRRYEQYRWQETRGVDEESLISNLPKDLRRDINRHLCWSLLKRVHMFKTMD  1297
             +LP +LRER+RRY+QY+W ETRGVDE+SL+ +LPKDLRRDI RHLC +L++RV +F  MD
Sbjct  450   LLPQDLRERVRRYDQYKWLETRGVDEQSLVQSLPKDLRRDIKRHLCLALVRRVPLFDNMD  509

Query  1298  EQLLDAICDRLKPVLYTEKSCIVREGDPVDEMIFVMRGNLLTMTTNGGRTGFLNSDVLNA  1477
             E+LLDAIC+RLKP L+TE + IVREGDPVDEM+F++RG L ++TT+GGR+GF N  +L  
Sbjct  510   ERLLDAICERLKPSLFTESTYIVREGDPVDEMLFIIRGRLESVTTDGGRSGFFNRSLLKE  569

Query  1478  GDFCGEELLTWALDPNSSSSLPISTRTVQALTDVEAFALTADFLKFFASQYRRLHSKQLQ  1657
             GDFCGEELLTWALDP S ++LP STRTV+ALT+VEAFAL A+ LKF ASQ+RRLHS+++Q
Sbjct  570   GDFCGEELLTWALDPKSGANLPSSTRTVKALTEVEAFALVAEELKFVASQFRRLHSRRVQ  629

Query  1658  HKFRFYSHQWKTWAACFIQAAWRRHCRNKLEKSLREEEDRLQDALILRMRREEGETTPSL  1837
               FRFYS QW+TWAACFIQAAWRR+ + K+ + LR +E+  +   +   R   G +  S+
Sbjct  630   PPFRFYSQQWRTWAACFIQAAWRRYSKRKILE-LRRKEEEAEAEALGGARSNAGGSY-SI  687

Query  1838  GATIYASRFAANVLRTVRRNHplsvpklsprlpplllqkpAEPDFSA  1978
             GAT  ASRFAAN LR V RN       L      + LQKP EPDFSA
Sbjct  688   GATFLASRFAANALRGVHRNR-----NLKSARELIKLQKPPEPDFSA  729



>emb|CDY20267.1| BnaC04g36890D [Brassica napus]
Length=745

 Score =   713 bits (1840),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 365/650 (56%), Positives = 481/650 (74%), Gaps = 11/650 (2%)
 Frame = +2

Query  47    KSKMHDPQGPFLQRWNRIFVIACILAATVDPLFFYIPVVDDQNKCLGLDRTLEITACILR  226
             + K+ DPQ  FL   N++FV +CILA +VDPLF Y+P ++D+ KC+G+DR L I A  LR
Sbjct  99    EKKIFDPQDKFLLLCNKLFVASCILAVSVDPLFLYLPFINDKAKCIGIDRKLAIVATTLR  158

Query  227   SVFDFFYIFHIILQFRTGFVPPSSRVFGRGDLIVDPSAIAKRYFFSYFFIDILAVLPLPQ  406
             +V D FY+FH+ L+FRT +V PSSRVFGRG+L++DP  IAKRY   YF ID+L+VLPLPQ
Sbjct  159   TVIDSFYLFHMALRFRTAYVAPSSRVFGRGELVIDPKQIAKRYLQQYFIIDLLSVLPLPQ  218

Query  407   VVLFMMIPRADRPFIMVAKDILKVVILVQSVPRLLRIYPLYKEVTRTSGFFTETAWAGAA  586
             + ++  +  +    ++  K  L+ ++LVQ +PR LR+YPL  E+ RT+G F ETAWAGAA
Sbjct  219   ITVWRFLYTSKGANVLATKQALRYIVLVQYIPRFLRMYPLSSELKRTAGVFAETAWAGAA  278

Query  587   FNLFLYMIASYVAGAIWYITAIERQDKCWRRACEKHGSCDIDFLYCTKLGRRGGDFSSSF  766
             + L LYM+AS++ GA+WY+ A+ER + CW +AC K  +C  +FL+C      G  +++ +
Sbjct  279   YYLLLYMLASHIVGALWYLLALERNNDCWSKACVKKDNCTRNFLFCGNQNMEG--YAAWY  336

Query  767   LNTSCALLE--PENLKADD---FDFGIFLDALKSNVVEKRYFWSKLFYCFWWGLRNLSSL  931
                S  L E  P N+   +   FDFGI+  AL S +V  + F SK F+C WWGL+NLS+L
Sbjct  337   TAKSSVLQEKCPVNVTEGEEPPFDFGIYSRALSSGIVSSKKFVSKYFFCLWWGLQNLSTL  396

Query  932   GQNLKTSNFVGEilfailisiiglilfslligNMQKYLQSITVRVEEMRVKRMDAEQWMS  1111
             GQ L+TS + GE++F+I ++I GL+LF+LLIGNMQ YLQS+T+R+EEMRVKR D+EQWM 
Sbjct  397   GQGLETSTYPGEVIFSIALAIAGLLLFALLIGNMQTYLQSLTIRLEEMRVKRRDSEQWMH  456

Query  1112  HRMLPDNLRERIRRYEQYRWQETRGVDEESLISNLPKDLRRDINRHLCWSLLKRVHMFKT  1291
             HRMLP  LRER+RRY+QY+W ETRGVDEE+++SNLPKDLRRDI RHLC +L++RV +F+ 
Sbjct  457   HRMLPPELRERVRRYDQYKWLETRGVDEENIVSNLPKDLRRDIKRHLCLALVRRVPLFEN  516

Query  1292  MDEQLLDAICDRLKPVLYTEKSCIVREGDPVDEMIFVMRGNLLTMTTNGGRTGFLNSDVL  1471
             MDE+LLDAIC RLKP LYTEKS +VREGDPV+EM+F++RG L ++TT+GGR+GF N  +L
Sbjct  517   MDERLLDAICMRLKPCLYTEKSFLVREGDPVNEMLFIIRGRLESVTTDGGRSGFYNRSLL  576

Query  1472  NAGDFCGEELLTWALDPNSSSSLPISTRTVQALTDVEAFALTADFLKFFASQYRRLHSKQ  1651
               GDFCG+ELLTWALDP S S+LP STRTV+ALT+VEAFAL AD LKF ASQ+RRLHS+Q
Sbjct  577   KEGDFCGDELLTWALDPKSGSNLPSSTRTVKALTEVEAFALIADELKFVASQFRRLHSRQ  636

Query  1652  LQHKFRFYSHQWKTWAACFIQAAWRRHCRNKLEKSLREEEDRLQDALILRMRREEGETTP  1831
             +QH FRFYS QW+TWAACFIQAAWRR+ + K  + LR+EE+  ++      R   G +  
Sbjct  637   VQHTFRFYSQQWRTWAACFIQAAWRRYTKRKKLEQLRKEEEEEEETA---ARLIAGGSPY  693

Query  1832  SLGATIYASRFAANVLRTVRRNHplsvpklsprlpplll-qkpAEPDFSA  1978
             S+ AT  AS+FAAN L +V +N         P    L+  QKP EPDFSA
Sbjct  694   SIRATFLASKFAANALCSVHKNRIRKSNLAPPSTKELVKFQKPPEPDFSA  743



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 12294363554984