BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c25566_g1_i3 len=475 path=[3199:0-234 3433:235-416 6378:417-421
6133:422-474]

Length=475
                                                                      Score     E

ref|XP_011082238.1|  PREDICTED: carotenoid 9,10(9',10')-cleavage ...    152   4e-40   
ref|XP_011019809.1|  PREDICTED: carotenoid 9,10(9',10')-cleavage ...    148   1e-38   
ref|XP_006340422.1|  PREDICTED: carotenoid 9,10(9',10')-cleavage ...    145   1e-37   
ref|XP_006340421.1|  PREDICTED: carotenoid 9,10(9',10')-cleavage ...    143   6e-37   
ref|XP_002516496.1|  9-cis-epoxycarotenoid dioxygenase, putative        142   9e-37   Ricinus communis
gb|KDP34146.1|  hypothetical protein JCGZ_07717                         142   1e-36   
ref|XP_004251419.1|  PREDICTED: carotenoid 9,10(9',10')-cleavage ...    142   2e-36   
ref|XP_004251418.2|  PREDICTED: carotenoid 9,10(9',10')-cleavage ...    141   3e-36   
ref|XP_010095201.1|  hypothetical protein L484_008739                   140   5e-36   
ref|XP_009601557.1|  PREDICTED: carotenoid 9,10(9',10')-cleavage ...    140   7e-36   
ref|XP_010095202.1|  hypothetical protein L484_008741                   140   8e-36   
ref|XP_009350949.1|  PREDICTED: carotenoid 9,10(9',10')-cleavage ...    140   9e-36   
ref|XP_007012118.1|  Carotenoid 9,10(9',10')-cleavage dioxygenase...    139   1e-35   
ref|XP_007012117.1|  Carotenoid 9,10(9',10')-cleavage dioxygenase...    139   3e-35   
ref|XP_011019620.1|  PREDICTED: carotenoid 9,10(9',10')-cleavage ...    138   3e-35   
ref|XP_009804285.1|  PREDICTED: carotenoid 9,10(9',10')-cleavage ...    138   4e-35   
ref|XP_006656671.1|  PREDICTED: carotenoid 9,10(9',10')-cleavage ...    133   4e-35   
emb|CBI20858.3|  unnamed protein product                                140   5e-35   
ref|XP_006359778.1|  PREDICTED: carotenoid 9,10(9',10')-cleavage ...    137   6e-35   
emb|CDP16199.1|  unnamed protein product                                137   7e-35   
ref|XP_006382050.1|  hypothetical protein POPTR_0006s25580g             137   9e-35   
ref|XP_007012115.1|  Carotenoid 9,10(9',10')-cleavage dioxygenase...    137   9e-35   
ref|XP_007012114.1|  Carotenoid 9,10(9',10')-cleavage dioxygenase...    137   9e-35   
emb|CAN66950.1|  hypothetical protein VITISV_020097                     139   2e-34   Vitis vinifera
ref|XP_010102387.1|  hypothetical protein L484_010699                   136   2e-34   
ref|XP_011012510.1|  PREDICTED: carotenoid 9,10(9',10')-cleavage ...    136   2e-34   
gb|EYU20441.1|  hypothetical protein MIMGU_mgv1a003485mg                135   4e-34   
ref|XP_006388365.1|  hypothetical protein POPTR_0209s00220g             135   5e-34   
ref|XP_010648499.1|  PREDICTED: carotenoid 9,10(9',10')-cleavage ...    135   8e-34   
ref|XP_006359779.1|  PREDICTED: carotenoid 9,10(9',10')-cleavage ...    134   9e-34   
ref|XP_011081798.1|  PREDICTED: carotenoid 9,10(9',10')-cleavage ...    134   1e-33   
gb|KCW81564.1|  hypothetical protein EUGRSUZ_C02923                     133   1e-33   
ref|XP_007012116.1|  Carotenoid 9,10(9',10')-cleavage dioxygenase...    133   2e-33   
gb|KDO79810.1|  hypothetical protein CISIN_1g008275mg                   133   2e-33   
gb|EYU29275.1|  hypothetical protein MIMGU_mgv1a003094mg                133   2e-33   
ref|XP_010049103.1|  PREDICTED: carotenoid 9,10(9',10')-cleavage ...    133   2e-33   
ref|XP_006476133.1|  PREDICTED: carotenoid 9,10(9',10')-cleavage ...    133   2e-33   
ref|XP_002324226.2|  hypothetical protein POPTR_0018s00310g             132   3e-33   Populus trichocarpa [western balsam poplar]
ref|XP_006450677.1|  hypothetical protein CICLE_v10010551mg             133   3e-33   
ref|XP_002437881.1|  hypothetical protein SORBIDRAFT_10g004370          132   4e-33   Sorghum bicolor [broomcorn]
ref|XP_006382051.1|  hypothetical protein POPTR_0006s25590g             132   5e-33   
ref|XP_008220072.1|  PREDICTED: carotenoid 9,10(9',10')-cleavage ...    132   6e-33   
gb|EEC80067.1|  hypothetical protein OsI_21783                          132   1e-32   Oryza sativa Indica Group [Indian rice]
ref|XP_010648503.1|  PREDICTED: carotenoid 9,10(9',10')-cleavage ...    131   1e-32   
ref|XP_010648502.1|  PREDICTED: carotenoid 9,10(9',10')-cleavage ...    130   2e-32   
emb|CBI20860.3|  unnamed protein product                                130   2e-32   
ref|XP_006359777.1|  PREDICTED: carotenoid 9,10(9',10')-cleavage ...    130   2e-32   
ref|XP_010648501.1|  PREDICTED: carotenoid 9,10(9',10')-cleavage ...    130   2e-32   
ref|XP_006359776.1|  PREDICTED: carotenoid 9,10(9',10')-cleavage ...    130   3e-32   
ref|XP_004245397.1|  PREDICTED: carotenoid 9,10(9',10')-cleavage ...    129   5e-32   
ref|XP_004966710.1|  PREDICTED: carotenoid 9,10(9',10')-cleavage ...    124   9e-32   
ref|XP_010049102.1|  PREDICTED: carotenoid 9,10(9',10')-cleavage ...    129   1e-31   
ref|XP_004292848.1|  PREDICTED: carotenoid 9,10(9',10')-cleavage ...    128   1e-31   
ref|XP_008659260.1|  PREDICTED: carotenoid 9,10(9',10')-cleavage ...    128   2e-31   
ref|XP_004136407.1|  PREDICTED: carotenoid 9,10(9',10')-cleavage ...    128   2e-31   
gb|EEE65142.1|  hypothetical protein OsJ_20224                          129   2e-31   Oryza sativa Japonica Group [Japonica rice]
ref|XP_007226913.1|  hypothetical protein PRUPE_ppa016014mg             126   4e-31   
ref|XP_006371700.1|  hypothetical protein POPTR_0018s00350g             123   4e-31   
gb|EMT26925.1|  hypothetical protein F775_21549                         119   6e-31   
gb|KCW79101.1|  hypothetical protein EUGRSUZ_C00545                     126   6e-31   
ref|XP_011005228.1|  PREDICTED: carotenoid 9,10(9',10')-cleavage ...    125   9e-31   
ref|XP_010918681.1|  PREDICTED: carotenoid 9,10(9',10')-cleavage ...    125   9e-31   
ref|XP_008651589.1|  PREDICTED: carotenoid cleavage dioxygenase i...    125   1e-30   
tpg|DAA61023.1|  TPA: carotenoid cleavage dioxygenase                   126   1e-30   
ref|XP_008220103.1|  PREDICTED: carotenoid 9,10(9',10')-cleavage ...    125   1e-30   
ref|XP_006853602.1|  hypothetical protein AMTR_s00056p00035370          119   1e-30   
ref|XP_007137213.1|  hypothetical protein PHAVU_009G1091001g            124   3e-30   
ref|XP_009804287.1|  PREDICTED: carotenoid 9,10(9',10')-cleavage ...    124   4e-30   
ref|XP_011011911.1|  PREDICTED: carotenoid 9,10(9',10')-cleavage ...    122   5e-30   
ref|XP_008466060.1|  PREDICTED: carotenoid 9,10(9',10')-cleavage ...    124   6e-30   
ref|XP_010235077.1|  PREDICTED: carotenoid 9,10(9',10')-cleavage ...    124   6e-30   
ref|XP_002516497.1|  9-cis-epoxycarotenoid dioxygenase, putative        122   7e-30   Ricinus communis
gb|AFW85704.1|  hypothetical protein ZEAMMB73_647031                    124   1e-29   
dbj|BAJ99584.1|  predicted protein                                      122   3e-29   
gb|EAZ06780.1|  hypothetical protein OsI_29024                          121   4e-29   Oryza sativa Indica Group [Indian rice]
gb|EAZ42528.1|  hypothetical protein OsJ_27094                          121   4e-29   Oryza sativa Japonica Group [Japonica rice]
ref|XP_004501162.1|  PREDICTED: carotenoid 9,10(9',10')-cleavage ...    120   7e-29   
dbj|BAD03492.1|  putative Lignostilbene-alpha,beta-dioxygenase an...    121   8e-29   Oryza sativa Japonica Group [Japonica rice]
ref|XP_007224472.1|  hypothetical protein PRUPE_ppa022654mg             120   9e-29   
ref|XP_009367500.1|  PREDICTED: carotenoid 9,10(9',10')-cleavage ...    120   2e-28   
ref|XP_004300716.1|  PREDICTED: carotenoid 9,10(9',10')-cleavage ...    119   2e-28   
ref|XP_004292849.1|  PREDICTED: carotenoid 9,10(9',10')-cleavage ...    119   3e-28   
ref|XP_004501163.1|  PREDICTED: carotenoid 9,10(9',10')-cleavage ...    119   3e-28   
gb|KGN60324.1|  hypothetical protein Csa_3G895700                       111   3e-28   
ref|XP_006581448.1|  PREDICTED: carotenoid 9,10(9',10')-cleavage ...    119   4e-28   
ref|XP_003576413.2|  PREDICTED: carotenoid 9,10(9',10')-cleavage ...    119   4e-28   
gb|KHN18174.1|  Carotenoid 9,10(9',10')-cleavage dioxygenase            119   6e-28   
ref|XP_006581447.1|  PREDICTED: carotenoid 9,10(9',10')-cleavage ...    118   6e-28   
ref|XP_008466059.1|  PREDICTED: carotenoid 9,10(9',10')-cleavage ...    119   7e-28   
gb|KEH36059.1|  retinal pigment epithelial membrane protein             118   8e-28   
ref|XP_003523739.1|  PREDICTED: carotenoid 9,10(9',10')-cleavage ...    117   1e-27   
ref|XP_003527837.1|  PREDICTED: carotenoid 9,10(9',10')-cleavage ...    117   1e-27   
emb|CBI20857.3|  unnamed protein product                                117   1e-27   
gb|KHN18175.1|  Carotenoid 9,10(9',10')-cleavage dioxygenase 1          117   1e-27   
ref|XP_010051226.1|  PREDICTED: carotenoid 9,10(9',10')-cleavage ...    118   1e-27   
ref|XP_006853598.1|  hypothetical protein AMTR_s00056p00029160          114   2e-27   
ref|XP_009389962.1|  PREDICTED: carotenoid 9,10(9',10')-cleavage ...    117   2e-27   
ref|XP_009804286.1|  PREDICTED: carotenoid 9,10(9',10')-cleavage ...    117   2e-27   
ref|XP_007012120.1|  Carotenoid cleavage dioxygenase 1-like protein     114   5e-27   
emb|CDP16200.1|  unnamed protein product                                116   5e-27   
gb|KCW81562.1|  hypothetical protein EUGRSUZ_C02920                     115   1e-26   
ref|XP_004956566.1|  PREDICTED: carotenoid 9,10(9',10')-cleavage ...    114   2e-26   
gb|KHN10199.1|  Carotenoid 9,10(9',10')-cleavage dioxygenase 1          115   3e-26   
ref|XP_007137216.1|  hypothetical protein PHAVU_009G109200g             113   4e-26   
ref|XP_006661114.1|  PREDICTED: carotenoid 9,10(9',10')-cleavage ...    112   2e-25   
ref|XP_006371697.1|  hypothetical protein POPTR_0018s00320g             105   4e-24   
ref|XP_002462199.1|  hypothetical protein SORBIDRAFT_02g021480          105   5e-24   Sorghum bicolor [broomcorn]
ref|XP_002991041.1|  hypothetical protein SELMODRAFT_132803           99.0    4e-21   
gb|KCW81561.1|  hypothetical protein EUGRSUZ_C02919                   97.8    9e-21   
ref|WP_009783644.1|  Retinal pigment epithelial membrane protein      95.1    6e-20   
ref|XP_007226181.1|  hypothetical protein PRUPE_ppa015590mg           95.1    1e-19   
ref|XP_002437880.1|  hypothetical protein SORBIDRAFT_10g004360        94.7    2e-19   Sorghum bicolor [broomcorn]
ref|NP_001062856.2|  Os09g0321200                                     94.0    3e-19   Oryza sativa Japonica Group [Japonica rice]
ref|WP_023064357.1|  carotenoid 9,10(9',10')-cleavage dioxygenase     92.0    8e-19   
gb|KCW79131.1|  hypothetical protein EUGRSUZ_C005781                  86.3    1e-18   
emb|CDY34748.1|  BnaA09g41150D                                        90.5    4e-18   
gb|EMT19111.1|  hypothetical protein F775_00763                       90.9    4e-18   
ref|XP_009117091.1|  PREDICTED: carotenoid 9,10(9',10')-cleavage ...  90.9    4e-18   
gb|EMS46219.1|  hypothetical protein TRIUR3_11060                     90.1    6e-18   
gb|EMT19110.1|  hypothetical protein F775_23086                       89.7    9e-18   
gb|KCW78867.1|  hypothetical protein EUGRSUZ_C00308                   83.6    1e-17   
gb|KEH19092.1|  carotenoid 9,10(9',10')-cleavage dioxygenase          89.7    1e-17   
gb|ABK21471.1|  unknown                                               86.7    2e-17   Picea sitchensis
gb|KEH19087.1|  carotenoid 9,10(9',10')-cleavage dioxygenase          87.8    4e-17   
gb|EMS66522.1|  hypothetical protein TRIUR3_03973                     87.4    5e-17   
gb|AIX87509.1|  carotenoid cleavage dioxygenase 1A                    87.4    6e-17   
ref|XP_004158236.1|  PREDICTED: carotenoid 9,10(9',10')-cleavage ...  85.9    6e-17   
ref|WP_012409393.1|  carotenoid oxygenase                             86.7    7e-17   
ref|XP_010413132.1|  PREDICTED: carotenoid 9,10(9',10')-cleavage ...  86.7    7e-17   
gb|AAN64277.1|  carotenoid cleavage dioxygenase 1                     81.6    8e-17   Zea mays [maize]
gb|ABB82946.1|  carotenoid cleavage dioxygenase                       86.7    1e-16   Cucumis melo [Oriental melon]
ref|XP_009589880.1|  PREDICTED: carotenoid 9,10(9',10')-cleavage ...  86.3    1e-16   
ref|XP_008461300.1|  PREDICTED: carotenoid 9,10(9',10')-cleavage ...  86.3    1e-16   
ref|XP_004135934.1|  PREDICTED: carotenoid 9,10(9',10')-cleavage ...  86.3    1e-16   
gb|AIL30506.1|  carotenoid cleavage dioxygenase 1-1                   86.3    1e-16   
ref|XP_009589879.1|  PREDICTED: carotenoid 9,10(9',10')-cleavage ...  86.3    1e-16   
ref|XP_002876727.1|  hypothetical protein ARALYDRAFT_486866           86.3    1e-16   
ref|XP_010413131.1|  PREDICTED: carotenoid 9,10(9',10')-cleavage ...  86.3    1e-16   
gb|AHH25650.1|  carotenoid cleavage dioxygenase 1-2                   86.3    2e-16   
ref|XP_006402261.1|  hypothetical protein EUTSA_v10005877mg           85.5    2e-16   
gb|AEW08177.1|  hypothetical protein 2_2194_01                        80.1    2e-16   
gb|KDO83431.1|  hypothetical protein CISIN_1g007605mg                 84.0    2e-16   
sp|Q8LP17.1|CCD1_PEA  RecName: Full=Carotenoid 9,10(9',10')-cleav...  85.9    2e-16   Pisum sativum [garden pea]
ref|XP_009589878.1|  PREDICTED: carotenoid 9,10(9',10')-cleavage ...  85.9    2e-16   
gb|AFW89635.1|  white cap1                                            83.2    2e-16   
ref|WP_009546963.1|  MULTISPECIES: 9-cis-epoxycarotenoid dioxygenase  85.5    2e-16   
ref|WP_017745616.1|  Retinal pigment epithelial membrane protein      85.1    2e-16   
gb|ABB29859.1|  carotene cleavage dioxygenase                         83.6    2e-16   Nicotiana langsdorffii x Nicotiana sanderae
gb|KDO83430.1|  hypothetical protein CISIN_1g007605mg                 84.3    3e-16   
gb|KDO83429.1|  hypothetical protein CISIN_1g007605mg                 84.7    3e-16   
gb|AGS79172.1|  carotenoid cleavage dioxygenase 1                     83.2    3e-16   
gb|KCW66082.1|  hypothetical protein EUGRSUZ_G03362                   85.1    3e-16   
ref|XP_010067847.1|  PREDICTED: carotenoid 9,10(9',10')-cleavage ...  85.5    4e-16   
emb|CDY53711.1|  BnaAnng12520D                                        85.1    4e-16   
ref|XP_006402264.1|  hypothetical protein EUTSA_v10005877mg           85.1    4e-16   
sp|C3VEQ4.1|CCD1_ONCHC  RecName: Full=Carotenoid 9,10(9',10')-cle...  85.1    4e-16   
ref|XP_009138676.1|  PREDICTED: carotenoid 9,10(9',10')-cleavage ...  85.1    4e-16   
ref|XP_010512783.1|  PREDICTED: carotenoid 9,10(9',10')-cleavage ...  85.1    4e-16   
gb|KCW66083.1|  hypothetical protein EUGRSUZ_G03362                   85.1    4e-16   
gb|KEH19090.1|  carotenoid 9,10(9',10')-cleavage dioxygenase          85.1    5e-16   
ref|XP_009784266.1|  PREDICTED: carotenoid 9,10(9',10')-cleavage ...  84.3    5e-16   
ref|XP_009589877.1|  PREDICTED: carotenoid 9,10(9',10')-cleavage ...  84.3    5e-16   
ref|XP_006439106.1|  hypothetical protein CICLE_v10031014mg           84.7    5e-16   
ref|XP_010067867.1|  PREDICTED: carotenoid 9,10(9',10')-cleavage ...  84.7    6e-16   
ref|XP_011087743.1|  PREDICTED: LOW QUALITY PROTEIN: carotenoid 9...  84.7    6e-16   
dbj|BAF32138.1|  putative 9-cis-epoxycarotenoid dioxygenase           84.7    6e-16   Taxodium distichum [bald cypress]
gb|KCW66101.1|  hypothetical protein EUGRSUZ_G03374                   84.7    6e-16   
gb|AIX87533.1|  carotenoid cleavage dioxygenase 1A                    84.3    7e-16   
ref|XP_006482869.1|  PREDICTED: carotenoid 9,10(9',10')-cleavage ...  84.0    7e-16   
ref|XP_009784260.1|  PREDICTED: carotenoid 9,10(9',10')-cleavage ...  84.3    7e-16   
gb|AGT17077.1|  carotenoid cleavage dioxygenase                       84.3    7e-16   
ref|XP_008375177.1|  PREDICTED: carotenoid 9,10(9',10')-cleavage ...  84.3    8e-16   
gb|AEN94904.1|  carotenoid cleavage dioxygenase                       83.6    8e-16   
ref|XP_010241261.1|  PREDICTED: carotenoid 9,10(9',10')-cleavage ...  83.6    8e-16   
gb|AFU91489.1|  carotenoid cleavage dioxygenase 1                     84.3    8e-16   
ref|XP_009589876.1|  PREDICTED: carotenoid 9,10(9',10')-cleavage ...  84.0    8e-16   
gb|KDO83428.1|  hypothetical protein CISIN_1g007605mg                 84.3    8e-16   
gb|AGN03859.1|  carotenoid cleavage dioxygenase 1                     84.0    8e-16   
ref|XP_008666862.1|  PREDICTED: carotenoid 9,10(9',10')-cleavage ...  80.5    8e-16   
ref|WP_015202538.1|  9-cis-epoxycarotenoid dioxygenase                84.0    8e-16   
gb|AHE41421.1|  carotenoid cleavage dioxygenase 1                     83.2    9e-16   
emb|CDX76782.1|  BnaC08g33680D                                        84.3    9e-16   
emb|CAA06712.1|  carotenoid cleavage dioxygenase 1                    84.0    9e-16   Arabidopsis thaliana [mouse-ear cress]
ref|NP_191911.1|  carotenoid 9,10(9',10')-cleavage dioxygenase 1      84.0    9e-16   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006482868.1|  PREDICTED: carotenoid 9,10(9',10')-cleavage ...  84.3    9e-16   
emb|CAC79644.1|  dioxygenase                                          84.0    9e-16   Capsicum annuum
gb|AFK46945.1|  unknown                                               81.6    1e-15   
gb|AFW89636.1|  white cap1                                            83.6    1e-15   
ref|WP_015956780.1|  carotenoid oxygenase                             83.6    1e-15   
ref|XP_010088225.1|  hypothetical protein L484_012507                 84.0    1e-15   
gb|EYU37495.1|  hypothetical protein MIMGU_mgv1a006785mg              83.2    1e-15   
gb|AAN17413.1|  neoxanthin cleavage enzyme nc1                        83.6    1e-15   Arabidopsis thaliana [mouse-ear cress]
ref|WP_006099204.1|  Retinal pigment epithelial membrane protein      83.6    1e-15   
gb|AAT68189.1|  carotenoid cleavage dioxygenase 1                     84.0    1e-15   Petunia x hybrida [garden petunia]
ref|WP_008274084.1|  Retinal pigment epithelial membrane protein      83.2    1e-15   
ref|XP_002465882.1|  hypothetical protein SORBIDRAFT_01g047540        84.0    1e-15   Sorghum bicolor [broomcorn]
emb|CDX93902.1|  BnaC04g20610D                                        83.6    1e-15   
ref|XP_010088226.1|  hypothetical protein L484_012508                 84.0    1e-15   
ref|XP_010241260.1|  PREDICTED: carotenoid 9,10(9',10')-cleavage ...  83.6    1e-15   
gb|EYU37493.1|  hypothetical protein MIMGU_mgv1a023345mg              83.6    1e-15   
ref|XP_006878604.1|  hypothetical protein AMTR_s00011p00256590        81.3    1e-15   
ref|XP_011087733.1|  PREDICTED: carotenoid 9,10(9',10')-cleavage ...  83.6    1e-15   
ref|XP_006345500.1|  PREDICTED: carotenoid 9,10(9',10')-cleavage ...  83.6    1e-15   
gb|AFK39230.1|  unknown                                               81.3    2e-15   
gb|KFK35504.1|  hypothetical protein AALP_AA5G293200                  83.2    2e-15   
dbj|BAF31898.1|  putative 9-cis-epoxycarotenoid dioxygenase           83.6    2e-15   Cryptomeria japonica
gb|AHH25649.1|  carotenoid cleavage dioxygenase 1-1                   83.2    2e-15   
ref|XP_009760607.1|  PREDICTED: carotenoid 9,10(9',10')-cleavage ...  83.2    2e-15   
gb|AHA43413.1|  carotenoid cleavage dioxygenase                       83.2    2e-15   
dbj|BAF31899.1|  putative 9-cis-epoxycarotenoid dioxygenase           83.6    2e-15   Cryptomeria japonica
dbj|BAF31922.1|  putative 9-cis-epoxycarotenoid dioxygenase           83.6    2e-15   Cryptomeria japonica
gb|AFV15390.1|  carotenoid cleavage dioxygenase 1                     83.2    2e-15   
dbj|BAF31905.1|  putative 9-cis-epoxycarotenoid dioxygenase           83.6    2e-15   Cryptomeria japonica
dbj|BAF31903.1|  putative 9-cis-epoxycarotenoid dioxygenase           83.6    2e-15   Cryptomeria japonica
dbj|BAF31929.1|  putative 9-cis-epoxycarotenoid dioxygenase           83.6    2e-15   Cryptomeria japonica
dbj|BAF31900.1|  putative 9-cis-epoxycarotenoid dioxygenase           83.6    2e-15   Cryptomeria japonica
ref|XP_004963348.1|  PREDICTED: carotenoid 9,10(9',10')-cleavage ...  83.2    2e-15   
dbj|BAJ05401.1|  carotenoid cleavage dioxygenase 1                    83.2    2e-15   
dbj|BAF31906.1|  putative 9-cis-epoxycarotenoid dioxygenase           83.6    2e-15   Cryptomeria japonica
gb|ADN65332.1|  carotenoid cleavage dioxygenase 1                     83.2    2e-15   
gb|ABF85668.1|  carotenoid cleavage dioxyganase 1                     83.2    2e-15   Zea mays [maize]
ref|XP_006853601.1|  hypothetical protein AMTR_s00056p00032600        82.0    2e-15   
ref|NP_001105286.1|  carotenoid cleavage dioxygenase                  82.8    2e-15   Zea mays [maize]
gb|ACF79397.1|  unknown                                               82.8    2e-15   Zea mays [maize]
ref|NP_001234542.1|  carotenoid cleavage dioxygenase 1-1              82.8    2e-15   
gb|AAY21819.1|  carotenoid cleavage dioxygenase                       82.8    2e-15   Suaeda salsa
ref|XP_006293242.1|  hypothetical protein CARUB_v10019573mg           82.8    2e-15   
ref|XP_006301637.1|  hypothetical protein CARUB_v10022080mg           82.8    3e-15   
sp|Q94IR2.1|CCD1_PHAVU  RecName: Full=Carotenoid 9,10(9',10')-cle...  82.4    3e-15   Phaseolus vulgaris [French bean]
emb|CAD33264.1|  carotenoid cleavage oxygenase                        82.4    3e-15   Solanum lycopersicum
ref|XP_010241258.1|  PREDICTED: carotenoid 9,10(9',10')-cleavage ...  82.4    3e-15   
gb|KCW81563.1|  hypothetical protein EUGRSUZ_C02921                   82.8    3e-15   
ref|XP_006850220.1|  hypothetical protein AMTR_s00022p00253450        82.4    3e-15   
ref|XP_006345443.1|  PREDICTED: carotenoid 9,10(9',10')-cleavage ...  82.4    3e-15   
ref|XP_006664795.1|  PREDICTED: carotenoid 9,10(9',10')-cleavage ...  82.4    3e-15   
ref|XP_006345441.1|  PREDICTED: carotenoid 9,10(9',10')-cleavage ...  82.4    3e-15   
ref|XP_009365068.1|  PREDICTED: carotenoid 9,10(9',10')-cleavage ...  82.0    3e-15   
ref|NP_001233838.1|  carotenoid cleavage dioxygenase 1-2              82.4    3e-15   
ref|XP_010324092.1|  PREDICTED: carotenoid cleavage dioxygenase 1...  82.4    4e-15   
gb|AFG30025.1|  carotenoid cleavage dioxygenase 1                     82.0    4e-15   
ref|WP_015153132.1|  Carotenoid oxygenase                             81.6    4e-15   
ref|XP_006345442.1|  PREDICTED: carotenoid 9,10(9',10')-cleavage ...  82.0    4e-15   
ref|XP_007133813.1|  hypothetical protein PHAVU_011G211200g           82.0    4e-15   
gb|ABA43904.1|  carotenoid cleavage dioxygenase 1                     82.0    5e-15   Coffea arabica [arabica coffee]
emb|CDX76783.1|  BnaC08g33690D                                        82.0    5e-15   
ref|XP_007052518.1|  Carotenoid cleavage dioxygenase 1 isoform 1      82.0    5e-15   
ref|NP_001105815.1|  white cap1                                       82.0    5e-15   Zea mays [maize]
gb|EMT18015.1|  hypothetical protein F775_06220                       81.6    5e-15   
gb|ABA43900.1|  carotenoid cleavage dioxygenase 1                     81.6    5e-15   Coffea canephora [robusta coffee]
ref|XP_007052519.1|  Carotenoid cleavage dioxygenase 1 isoform 2      81.6    5e-15   
emb|CAR57918.1|  carotenoid cleavage dioxygenase 1                    81.6    5e-15   Medicago truncatula
ref|WP_039716095.1|  9-cis-epoxycarotenoid dioxygenase                81.3    6e-15   
gb|ABS19630.2|  carotenoid cleavage dioxygenase                       81.6    7e-15   Bixa orellana [achiote]
ref|WP_028090825.1|  9-cis-epoxycarotenoid dioxygenase                80.9    7e-15   
ref|XP_004510991.1|  PREDICTED: carotenoid 9,10(9',10')-cleavage ...  81.3    7e-15   
gb|EMS57571.1|  hypothetical protein TRIUR3_09265                     81.3    7e-15   
ref|XP_002517824.1|  9-cis-epoxycarotenoid dioxygenase, putative      81.3    8e-15   Ricinus communis
emb|CAN66948.1|  hypothetical protein VITISV_020095                   82.0    8e-15   Vitis vinifera
ref|XP_009394395.1|  PREDICTED: carotenoid 9,10(9',10')-cleavage ...  81.3    8e-15   
gb|EEC69751.1|  hypothetical protein OsI_39285                        80.9    9e-15   Oryza sativa Indica Group [Indian rice]
ref|XP_004306539.1|  PREDICTED: carotenoid 9,10(9',10')-cleavage ...  80.9    1e-14   
ref|XP_003577313.1|  PREDICTED: LOW QUALITY PROTEIN: carotenoid 9...  80.9    1e-14   
ref|WP_028084014.1|  9-cis-epoxycarotenoid dioxygenase                80.5    1e-14   
gb|ABY47994.1|  carotenoid cleavage dioxygenase 1                     80.9    1e-14   Rosa x damascena [damask rose]
ref|XP_010695196.1|  PREDICTED: carotenoid 9,10(9',10')-cleavage ...  81.3    1e-14   
ref|NP_001067395.2|  Os12g0640600                                     80.9    1e-14   Oryza sativa Japonica Group [Japonica rice]
ref|XP_003577349.1|  PREDICTED: carotenoid 9,10(9',10')-cleavage ...  80.9    1e-14   
gb|ABK24523.1|  unknown                                               80.9    1e-14   Picea sitchensis
gb|ABR17001.1|  unknown                                               80.9    1e-14   Picea sitchensis
ref|WP_006197241.1|  Retinal pigment epithelial membrane protein      80.5    1e-14   
ref|XP_003516508.1|  PREDICTED: probable carotenoid cleavage diox...  80.9    1e-14   
gb|ACA13522.1|  dioxygenase                                           80.9    1e-14   Fragaria x ananassa
ref|WP_015227792.1|  9-cis-epoxycarotenoid dioxygenase                80.5    1e-14   
gb|AFC88468.1|  9-cis-epoxycarotenoid deoxygenase                     80.5    1e-14   
gb|ACO87672.1|  carotenoid cleavage dioxygenase                       80.5    1e-14   Brachypodium sylvaticum
gb|ACO87673.1|  carotenoid cleavage dioxygenase                       80.5    2e-14   Brachypodium sylvaticum
gb|ABA99624.2|  9,10-9',10' carotenoid cleavage dioxygenase 1, pu...  80.5    2e-14   Oryza sativa Japonica Group [Japonica rice]
ref|XP_008801952.1|  PREDICTED: carotenoid 9,10(9',10')-cleavage ...  80.5    2e-14   
ref|XP_010235076.1|  PREDICTED: 9-cis-epoxycarotenoid dioxygenase...  80.5    2e-14   
gb|ABA99623.2|  9,10-9',10' carotenoid cleavage dioxygenase 1, pu...  80.1    2e-14   
sp|Q84KG5.1|CCD_CROSA  RecName: Full=Carotenoid 9,10(9',10')-clea...  80.1    2e-14   
ref|XP_004510990.1|  PREDICTED: carotenoid 9,10(9',10')-cleavage ...  80.1    2e-14   
gb|KCW66099.1|  hypothetical protein EUGRSUZ_G03374                   80.1    2e-14   
ref|XP_008231253.1|  PREDICTED: carotenoid 9,10(9',10')-cleavage ...  80.1    2e-14   
ref|XP_007220659.1|  hypothetical protein PRUPE_ppa003814mg           80.1    2e-14   
gb|ACD62475.1|  carotenoid cleavage dioxygenase 2                     80.1    2e-14   
ref|WP_015079490.1|  carotenoid oxygenase                             79.7    2e-14   
emb|CDP07182.1|  unnamed protein product                              80.1    2e-14   
gb|ABY60886.1|  carotenoid cleavage dioxygenase 4                     79.7    3e-14   
gb|KDP43480.1|  hypothetical protein JCGZ_16767                       79.7    3e-14   
gb|AFJ94678.1|  carotenoid cleavage dioxygenase 1                     79.7    3e-14   
gb|AGT63320.1|  carotenoid cleavage dioxygenase 1                     79.7    3e-14   
gb|AFJ94677.1|  carotenoid cleavage dioxygenase 1                     79.7    3e-14   
gb|AAX48772.1|  9,10[9',10']carotenoid cleavage dioxygenase           79.7    3e-14   
ref|XP_003542847.1|  PREDICTED: carotenoid 9,10(9',10')-cleavage ...  79.7    3e-14   
gb|ACF75911.1|  carotenoid cleavage dioxygenases                      79.3    3e-14   
gb|EYU37496.1|  hypothetical protein MIMGU_mgv1a0034972mg             76.6    3e-14   
emb|CAN79030.1|  hypothetical protein VITISV_032896                   79.0    3e-14   
gb|KHN37625.1|  Carotenoid 9,10(9',10')-cleavage dioxygenase 1        79.3    4e-14   
gb|AFJ94680.1|  carotenoid cleavage dioxygenase 1                     79.3    4e-14   
ref|WP_013689843.1|  carotenoid 9,10-9',10' cleavage dioxygenase      78.6    4e-14   
ref|NP_001267844.1|  9,10[9',10']carotenoid cleavage dioxygenase      79.3    4e-14   
ref|WP_006196763.1|  Retinal pigment epithelial membrane protein      78.6    4e-14   
ref|XP_004134911.1|  PREDICTED: 9-cis-epoxycarotenoid dioxygenase...  79.3    5e-14   
gb|AIY62758.1|  carotenoid cleavage dioxygenase                       79.0    5e-14   
ref|WP_015183663.1|  lignostilbene-alpha,beta-dioxygenase-like pr...  78.6    5e-14   
gb|AIG94929.1|  carotenoid cleavage dioxygenase 2                     79.0    5e-14   
gb|ADR78340.1|  9-cis-epoxycarotenoid dioxygenase                     78.6    5e-14   
gb|KEH38404.1|  9-cis-epoxycarotenoid dioxygenase                     79.0    5e-14   
ref|XP_002300210.2|  hypothetical protein POPTR_0001s27290g           79.0    5e-14   
gb|ABB52081.1|  putative carotenoid cleavage dioxygenase              79.0    5e-14   
ref|WP_015118911.1|  lignostilbene-alpha,beta-dioxygenase-like pr...  78.6    5e-14   
ref|XP_010050397.1|  PREDICTED: uncharacterized protein LOC104438953  74.3    6e-14   
ref|WP_015140676.1|  lignostilbene-alpha,beta-dioxygenase-like pr...  78.6    6e-14   
ref|XP_002969641.1|  hypothetical protein SELMODRAFT_11287            78.6    6e-14   
ref|XP_008363317.1|  PREDICTED: carotenoid 9,10(9',10')-cleavage ...  78.6    6e-14   
ref|XP_002298429.2|  hypothetical protein POPTR_0001s27260g           78.6    6e-14   
gb|KDO36461.1|  hypothetical protein CISIN_1g044599mg                 78.6    6e-14   
ref|WP_025100849.1|  carotenoid oxygenase                             78.2    6e-14   
ref|WP_036056745.1|  carotenoid oxygenase                             78.2    6e-14   
dbj|GAJ30685.1|  carotenoid oxygenase                                 78.2    7e-14   
ref|XP_006484631.1|  PREDICTED: probable carotenoid cleavage diox...  79.0    7e-14   
ref|XP_010662172.1|  PREDICTED: zeaxanthin 7,8(7',8')-cleavage di...  75.9    7e-14   
ref|XP_006850221.1|  hypothetical protein AMTR_s00022p00253640        77.8    7e-14   
gb|AFC90006.1|  carotenoid cleavage dioxygenase 1                     78.2    8e-14   
ref|WP_013324698.1|  9-cis-epoxycarotenoid dioxygenase                77.8    9e-14   
gb|AGK38338.1|  lignostilbene-alpha,beta-dioxygenase-like protein     77.8    9e-14   
ref|XP_011047393.1|  PREDICTED: carotenoid 9,10(9',10')-cleavage ...  78.2    9e-14   
ref|WP_038074680.1|  9-cis-epoxycarotenoid dioxygenase                77.8    9e-14   
ref|WP_015111403.1|  9-cis-epoxycarotenoid dioxygenase                77.8    9e-14   
ref|XP_002278628.1|  PREDICTED: carotenoid 9,10(9',10')-cleavage ...  78.2    1e-13   
gb|ABO69703.1|  9-cis-epoxycarotenoid dioxygenase                     78.2    1e-13   
ref|WP_017319350.1|  Retinal pigment epithelial membrane protein      77.8    1e-13   
gb|ADG03462.1|  9-cis-epoxycarotenoid dioxygenase                     78.2    1e-13   
ref|XP_006437482.1|  hypothetical protein CICLE_v10031003mg           78.2    1e-13   
ref|WP_026399058.1|  hypothetical protein                             77.4    1e-13   
ref|XP_010088227.1|  hypothetical protein L484_012509                 77.8    1e-13   
gb|KHN19457.1|  Carotenoid 9,10(9',10')-cleavage dioxygenase 1        77.8    1e-13   
ref|XP_003612460.1|  Carotenoid cleavage dioxygenase 4a               77.8    1e-13   
ref|XP_011019808.1|  PREDICTED: carotenoid 9,10(9',10')-cleavage ...  76.6    1e-13   
gb|AEK99290.1|  9-cis-epoxycarotenoid dioxygenase                     77.0    1e-13   
ref|XP_002298430.2|  carotenoid 9 family protein                      77.4    1e-13   
ref|XP_011092645.1|  PREDICTED: probable carotenoid cleavage diox...  77.8    2e-13   
gb|KDP27683.1|  hypothetical protein JCGZ_19722                       77.8    2e-13   
ref|WP_037749153.1|  hypothetical protein                             77.4    2e-13   
ref|WP_027744482.1|  hypothetical protein                             77.4    2e-13   
ref|WP_018841674.1|  hypothetical protein                             77.4    2e-13   
ref|XP_006379094.1|  carotenoid cleavage dioxygenase 1 family pro...  77.4    2e-13   
ref|XP_006853600.1|  hypothetical protein AMTR_s00056p00031380        77.0    2e-13   
ref|XP_011025444.1|  PREDICTED: carotenoid 9,10(9',10')-cleavage ...  77.4    2e-13   
ref|WP_035937727.1|  hypothetical protein                             77.0    2e-13   
ref|WP_018834436.1|  hypothetical protein                             77.0    2e-13   
ref|WP_011613170.1|  carotenoid oxygenase                             77.0    2e-13   
ref|XP_008439625.1|  PREDICTED: 9-cis-epoxycarotenoid dioxygenase...  77.4    2e-13   
ref|WP_015213082.1|  9-cis-epoxycarotenoid dioxygenase                77.0    2e-13   
ref|XP_006302006.1|  hypothetical protein CARUB_v10019983mg           77.4    2e-13   
ref|WP_011320410.1|  retinal pigment epithelial membrane protein      77.0    2e-13   
ref|WP_003167273.1|  retinal pigment epithelial membrane protein      77.0    2e-13   
ref|XP_002963376.1|  hypothetical protein SELMODRAFT_80651            77.0    2e-13   
gb|KDO83427.1|  hypothetical protein CISIN_1g015522mg                 75.5    2e-13   
ref|XP_007040858.1|  Nine-cis-epoxycarotenoid dioxygenase 4           77.0    2e-13   
gb|EYU26442.1|  hypothetical protein MIMGU_mgv1a0237752mg             72.8    3e-13   
ref|XP_007158058.1|  hypothetical protein PHAVU_002G120600g           77.0    3e-13   
ref|WP_016952678.1|  Retinal pigment epithelial membrane protein      76.3    3e-13   
ref|XP_008361586.1|  PREDICTED: probable carotenoid cleavage diox...  73.2    3e-13   
ref|XP_002962877.1|  hypothetical protein SELMODRAFT_165469           76.6    3e-13   
ref|WP_026262914.1|  hypothetical protein                             76.3    3e-13   
emb|CBI24897.3|  unnamed protein product                              76.3    3e-13   
ref|WP_020584093.1|  hypothetical protein                             76.3    3e-13   
ref|WP_010995279.1|  hypothetical protein                             76.3    3e-13   
gb|AAQ54506.1|  9-cis-epoxycarotenoid dioxygenase                     72.8    3e-13   
dbj|BAE72092.1|  Lactuca sativa 9-cis-epoxycarotenoid dioxygenase 3   76.6    4e-13   
gb|AEW91475.1|  9-cis-epoxycarotenoid dioxygenase                     76.6    4e-13   
ref|XP_006836449.1|  hypothetical protein AMTR_s00092p00172590        76.6    4e-13   
ref|XP_002989455.1|  hypothetical protein SELMODRAFT_272067           76.3    4e-13   
ref|WP_029637704.1|  9-cis-epoxycarotenoid dioxygenase [              75.9    4e-13   
gb|KDO83426.1|  hypothetical protein CISIN_1g015522mg                 75.9    4e-13   
ref|XP_011047392.1|  PREDICTED: carotenoid 9,10(9',10')-cleavage ...  76.3    4e-13   
ref|WP_016870978.1|  hypothetical protein                             75.9    5e-13   
ref|XP_010275132.1|  PREDICTED: probable carotenoid cleavage diox...  76.3    5e-13   
ref|WP_016860197.1|  hypothetical protein                             75.9    5e-13   
gb|AIT98183.1|  nine-cis-epoxycarotenoid dioxygenase 4                73.2    5e-13   
ref|XP_006482870.1|  PREDICTED: carotenoid 9,10(9',10')-cleavage ...  75.9    5e-13   
ref|XP_002969646.1|  hypothetical protein SELMODRAFT_91815            75.9    5e-13   
gb|AFJ94675.1|  carotenoid cleavage dioxygenase 4a                    76.3    5e-13   
gb|AGT63321.1|  carotenoid cleavage dioxygenase 4a                    76.3    6e-13   
ref|XP_002268404.1|  PREDICTED: probable carotenoid cleavage diox...  75.9    6e-13   
ref|WP_039708772.1|  hypothetical protein                             75.5    6e-13   
dbj|BAE72094.1|  Lactuca sativa carotenoid cleavage dioxygenase 1     75.9    6e-13   
gb|ADU85829.1|  9-cis-epoxycarotenoid dioxygenase                     75.9    6e-13   
ref|XP_002969420.1|  hypothetical protein SELMODRAFT_11289            75.5    7e-13   
ref|WP_015439650.1|  putative dioxygenase                             75.5    7e-13   
ref|XP_006439108.1|  hypothetical protein CICLE_v10031039mg           75.9    7e-13   
ref|XP_004293530.1|  PREDICTED: 9-cis-epoxycarotenoid dioxygenase...  75.9    7e-13   
ref|XP_008451876.1|  PREDICTED: probable carotenoid cleavage diox...  75.9    7e-13   
gb|AFA26703.1|  carotenoid cleavage dioxygenase 4                     72.8    7e-13   
ref|WP_019489052.1|  Retinal pigment epithelial membrane protein      75.1    7e-13   
dbj|BAE92957.1|  carotenoid cleavage dioxygenase1                     75.5    7e-13   
dbj|BAH20347.1|  AT4G19170                                            74.7    8e-13   
gb|ACH58414.1|  9-cis-epoxycarotenoid dioxygenase                     72.0    8e-13   
ref|WP_015127264.1|  9-cis-epoxycarotenoid dioxygenase                75.1    8e-13   
ref|XP_002970756.1|  hypothetical protein SELMODRAFT_94523            75.5    8e-13   
gb|AEK99069.1|  9-cis-epoxycarotenoid dioxygenase                     74.7    1e-12   
ref|WP_027767729.1|  hypothetical protein                             74.7    1e-12   
ref|WP_018853975.1|  hypothetical protein                             74.7    1e-12   
ref|XP_002963374.1|  hypothetical protein SELMODRAFT_79628            75.1    1e-12   
ref|XP_010552740.1|  PREDICTED: carotenoid 9,10(9',10')-cleavage ...  74.7    1e-12   
ref|WP_015440512.1|  putative dioxygenase                             74.7    1e-12   
gb|AEI61930.1|  carotenoid cleavage dioxygenase 4                     75.1    1e-12   
dbj|BAC10550.1|  nine-cis-epoxycarotenoid dioxygenase2                75.1    1e-12   
ref|XP_009623499.1|  PREDICTED: probable carotenoid cleavage diox...  75.1    1e-12   
gb|AAV35466.1|  9-cis-epoxycarotenoid dioxygenase                     75.1    1e-12   
gb|AAS68632.2|  putative 9-cis-epoxycarotenoid dioxygenase            75.1    1e-12   
ref|WP_013324558.1|  carotenoid oxygenase                             74.7    1e-12   
ref|WP_009784690.1|  hypothetical protein                             74.7    1e-12   
ref|XP_008362355.1|  PREDICTED: LOW QUALITY PROTEIN: probable car...  74.3    1e-12   
ref|XP_011078014.1|  PREDICTED: probable carotenoid cleavage diox...  74.7    1e-12   
gb|AES95419.2|  carotenoid cleavage dioxygenase 4a-6                  74.7    1e-12   
ref|WP_023067218.1|  retinal pigment epithelial membrane family p...  74.3    1e-12   
ref|XP_001754114.1|  predicted protein                                74.7    2e-12   
ref|XP_005644307.1|  carotenoid oxygenase                             74.7    2e-12   
dbj|BAF36656.2|  putative carotenoid cleavage dioxygenase             74.7    2e-12   
gb|ABK78686.1|  neoxanthin cleavage enzyme-like protein               72.0    2e-12   
ref|XP_006282800.1|  hypothetical protein CARUB_v10006410mg           74.7    2e-12   
ref|WP_009543931.1|  MULTISPECIES: 9-cis-epoxycarotenoid dioxygenase  74.3    2e-12   
gb|ACU86971.1|  9-cis-epoxycarotenoid dioxygenase                     74.7    2e-12   
ref|XP_010552741.1|  PREDICTED: carotenoid 9,10(9',10')-cleavage ...  74.3    2e-12   
ref|XP_010552739.1|  PREDICTED: carotenoid 9,10(9',10')-cleavage ...  74.3    2e-12   
ref|XP_001765996.1|  predicted protein                                73.9    2e-12   
ref|XP_003612461.1|  50S ribosomal protein L14                        74.7    2e-12   
ref|XP_002970755.1|  hypothetical protein SELMODRAFT_11304            73.9    2e-12   
gb|AIG92852.1|  9-cis-epoxycarotenoid dioxygenase                     74.3    2e-12   
ref|WP_012796762.1|  Carotenoid oxygenase                             73.9    2e-12   
ref|XP_002519944.1|  9-cis-epoxycarotenoid dioxygenase, putative      74.3    2e-12   
ref|WP_012593727.1|  Carotenoid oxygenase                             73.9    2e-12   
ref|XP_004147771.1|  PREDICTED: probable carotenoid cleavage diox...  73.9    2e-12   
ref|XP_003612459.1|  Nine-cis-epoxycarotenoid dioxygenase4            73.9    3e-12   
ref|WP_016874878.1|  Retinal pigment epithelial membrane protein      73.6    3e-12   
ref|WP_008274255.1|  hypothetical protein                             73.6    3e-12   
ref|XP_002981140.1|  hypothetical protein SELMODRAFT_113788           74.3    3e-12   
ref|XP_002982621.1|  hypothetical protein SELMODRAFT_116420           74.3    3e-12   
ref|XP_008367435.1|  PREDICTED: probable carotenoid cleavage diox...  73.9    3e-12   
ref|WP_015198082.1|  9-cis-epoxycarotenoid dioxygenase                73.6    3e-12   
ref|XP_010108103.1|  hypothetical protein L484_023189                 73.9    3e-12   
gb|AGI98130.1|  9-cis-epoxycarotenoid dioxygenase                     73.9    3e-12   
ref|XP_004161563.1|  PREDICTED: probable carotenoid cleavage diox...  73.6    3e-12   
ref|WP_015210868.1|  lignostilbene-alpha,beta-dioxygenase-like en...  73.2    3e-12   
ref|XP_008378396.1|  PREDICTED: 9-cis-epoxycarotenoid dioxygenase...  73.6    4e-12   
dbj|BAE72095.1|  Lactuca sativa carotenoid cleavage dioxygenase 2     73.6    4e-12   
ref|NP_193652.1|  nine-cis-epoxycarotenoid dioxygenase 4              73.6    4e-12   
ref|XP_002945665.1|  hypothetical protein VOLCADRAFT_85861            73.2    4e-12   
gb|ENX00088.1|  hypothetical protein F899_02275                       69.7    4e-12   
gb|AAY82458.1|  9-cis-epoxycarotenoid dioxygenase 1                   73.6    4e-12   
ref|XP_002989454.1|  hypothetical protein SELMODRAFT_447678           73.6    4e-12   
ref|XP_002970754.1|  hypothetical protein SELMODRAFT_11293            73.2    4e-12   
ref|XP_002869997.1|  nine-cis-epoxycarotenoid dioxygenase 4           73.6    4e-12   
ref|XP_007040842.1|  Nine-cis-epoxycarotenoid dioxygenase 4           73.6    4e-12   
dbj|BAD31592.1|  putative viviparous-14 protein                       73.6    4e-12   
gb|ABK24456.1|  unknown                                               73.6    5e-12   
ref|NP_001058913.1|  Os07g0154100                                     73.6    5e-12   
ref|XP_009376527.1|  PREDICTED: probable carotenoid cleavage diox...  73.2    5e-12   
ref|XP_010434441.1|  PREDICTED: probable carotenoid cleavage diox...  73.2    5e-12   
ref|WP_017329556.1|  hypothetical protein                             72.8    5e-12   
ref|XP_002970759.1|  hypothetical protein SELMODRAFT_94524            69.3    5e-12   
gb|AFG30026.1|  carotenoid cleavage dioxygenase 4                     72.8    5e-12   
ref|XP_010247741.1|  PREDICTED: 9-cis-epoxycarotenoid dioxygenase...  73.2    5e-12   
gb|AEG78287.1|  9-cis-epoxycarotenoid dioxygenase                     73.2    5e-12   
ref|XP_006377601.1|  hypothetical protein POPTR_0011s08240g           73.2    5e-12   
ref|XP_002316710.2|  hypothetical protein POPTR_0011s02230g           73.2    5e-12   
ref|WP_035116230.1|  hypothetical protein                             72.8    5e-12   
ref|WP_012948590.1|  dioxygenase                                      72.8    5e-12   
ref|XP_007222433.1|  hypothetical protein PRUPE_ppa006109mg           72.4    5e-12   
gb|EAZ02812.1|  hypothetical protein OsI_24937                        72.8    6e-12   
gb|ENX31710.1|  hypothetical protein F890_00905                       69.3    6e-12   
ref|WP_039743349.1|  9-cis-epoxycarotenoid dioxygenase                72.8    6e-12   
ref|XP_002326037.2|  hypothetical protein POPTR_0019s12320g           73.2    6e-12   
gb|AEH41591.1|  9-cis-epoxycarotenoid dioxygenase 1                   73.2    6e-12   
ref|XP_007214657.1|  hypothetical protein PRUPE_ppa002804mg           73.2    6e-12   
ref|XP_004300667.1|  PREDICTED: 9-cis-epoxycarotenoid dioxygenase...  72.8    6e-12   
emb|CDY57471.1|  BnaCnng32080D                                        72.0    7e-12   
emb|CDX82482.1|  BnaA03g33390D                                        72.0    7e-12   
ref|XP_002970910.1|  hypothetical protein SELMODRAFT_11292            72.4    7e-12   
ref|XP_010050361.1|  PREDICTED: putative disease resistance RPP13...  70.1    7e-12   
ref|XP_008466058.1|  PREDICTED: carotenoid 9,10(9',10')-cleavage ...  72.8    7e-12   
ref|XP_001771028.1|  predicted protein                                72.8    7e-12   
gb|ABY60887.1|  carotenoid cleavage dioxygenase 4                     72.8    7e-12   
ref|WP_036478419.1|  9-cis-epoxycarotenoid dioxygenase                72.4    8e-12   
gb|AEN94304.1|  9-cis-epoxycarotenoid dioxygenase                     72.8    8e-12   
ref|XP_009611128.1|  PREDICTED: probable carotenoid cleavage diox...  72.8    8e-12   
gb|AFM77567.1|  9-cis-epoxycarotenoid dioxygenase                     72.0    8e-12   
ref|XP_009354854.1|  PREDICTED: 9-cis-epoxycarotenoid dioxygenase...  72.8    8e-12   
gb|AGT28471.1|  9-cis-epoxycarotenoid dioxygenase                     72.8    8e-12   
dbj|BAM63316.1|  carotenoid cleavage dioxygenase                      72.4    8e-12   
dbj|BAF36654.1|  carotenoid cleavage dioxygenase                      72.4    8e-12   
ref|XP_010439749.1|  PREDICTED: probable carotenoid cleavage diox...  72.4    8e-12   
ref|XP_010439748.1|  PREDICTED: probable carotenoid cleavage diox...  72.4    8e-12   
ref|XP_009367762.1|  PREDICTED: 9-cis-epoxycarotenoid dioxygenase...  72.4    9e-12   
gb|AFW73001.1|  hypothetical protein ZEAMMB73_627312                  72.8    9e-12   
ref|XP_008646127.1|  PREDICTED: zeaxanthin 7,8(7',8')-cleavage di...  72.8    9e-12   
ref|XP_008221785.1|  PREDICTED: probable carotenoid cleavage diox...  72.4    9e-12   



>ref|XP_011082238.1| PREDICTED: carotenoid 9,10(9',10')-cleavage dioxygenase 1-like 
[Sesamum indicum]
Length=599

 Score =   152 bits (384),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 67/99 (68%), Positives = 83/99 (84%), Gaps = 0/99 (0%)
 Frame = -1

Query  421  GMAKYGGIGKLHLEEGEAKELINVEYHMLPQNTFCTGAVFVAKADNTEEDDGWIVTFVHD  242
            GMAKYGG+ KL+ EE E +ELI VEYH  P+NTFC+GA FVAK+   EEDDGWI+T+VH+
Sbjct  497  GMAKYGGLAKLYFEEMELEELIKVEYHKFPENTFCSGAAFVAKSGGVEEDDGWIITYVHN  556

Query  241  ENTNKSQVYMIDAKHFSKEPIATITLPCRVPYGFHGTFI  125
            E++N SQVY++DAK+FS EP+A ITLP RVPYGFHG F+
Sbjct  557  EDSNLSQVYIVDAKNFSHEPVAKITLPRRVPYGFHGAFM  595



>ref|XP_011019809.1| PREDICTED: carotenoid 9,10(9',10')-cleavage dioxygenase 1-like 
[Populus euphratica]
Length=615

 Score =   148 bits (373),  Expect = 1e-38, Method: Composition-based stats.
 Identities = 66/112 (59%), Positives = 79/112 (71%), Gaps = 13/112 (12%)
 Frame = -1

Query  421  GMAKYGGIGKLHLEE-------------GEAKELINVEYHMLPQNTFCTGAVFVAKADNT  281
            GMAKYGG+ KLH EE             G+ +ELI V+YH   QNTFCTGA FV K  + 
Sbjct  492  GMAKYGGLAKLHFEEPDTDYFVSVNQKDGQYEELIKVDYHKFEQNTFCTGAAFVPKPGSH  551

Query  280  EEDDGWIVTFVHDENTNKSQVYMIDAKHFSKEPIATITLPCRVPYGFHGTFI  125
            EEDDGWI+TFVH+E TN S+ Y+ID + F+ EP+A ITLPCRVPYGFHG F+
Sbjct  552  EEDDGWIITFVHNEETNMSKAYIIDTRRFTSEPVAKITLPCRVPYGFHGAFM  603



>ref|XP_006340422.1| PREDICTED: carotenoid 9,10(9',10')-cleavage dioxygenase 1-like 
[Solanum tuberosum]
Length=593

 Score =   145 bits (366),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 66/108 (61%), Positives = 82/108 (76%), Gaps = 5/108 (5%)
 Frame = -1

Query  421  GMAKYGGIGKLHLEE-----GEAKELINVEYHMLPQNTFCTGAVFVAKADNTEEDDGWIV  257
            G AK+GG+ KLH EE      E ++LI VEYH+ P+NTFC+GA FV K D  +EDDGWI+
Sbjct  486  GFAKFGGLAKLHFEEISKDIKEEEDLIKVEYHIFPKNTFCSGATFVPKLDGVDEDDGWIL  545

Query  256  TFVHDENTNKSQVYMIDAKHFSKEPIATITLPCRVPYGFHGTFITQNL  113
            TF H+ENTN+SQVY++DA++F  EPIA I LP RVPYGFHG F+  NL
Sbjct  546  TFTHNENTNQSQVYIVDAENFESEPIAIILLPNRVPYGFHGAFMPFNL  593



>ref|XP_006340421.1| PREDICTED: carotenoid 9,10(9',10')-cleavage dioxygenase 1-like 
[Solanum tuberosum]
Length=627

 Score =   143 bits (361),  Expect = 6e-37, Method: Compositional matrix adjust.
 Identities = 65/107 (61%), Positives = 80/107 (75%), Gaps = 4/107 (4%)
 Frame = -1

Query  421  GMAKYGGIGKLHLEE----GEAKELINVEYHMLPQNTFCTGAVFVAKADNTEEDDGWIVT  254
            G AK+GG+ KLH EE     E ++LI VEYH+ P+NTFC+GA FV K D  +EDDGWIV 
Sbjct  519  GFAKFGGLAKLHFEERHDNKEEEDLIKVEYHIFPKNTFCSGATFVPKLDGVDEDDGWIVA  578

Query  253  FVHDENTNKSQVYMIDAKHFSKEPIATITLPCRVPYGFHGTFITQNL  113
            F H+ENTN+SQVY+IDAK F  E +A I LP RVPYGFHG F++ N+
Sbjct  579  FTHNENTNQSQVYIIDAKKFESEAVAIIILPSRVPYGFHGAFMSFNI  625



>ref|XP_002516496.1| 9-cis-epoxycarotenoid dioxygenase, putative [Ricinus communis]
 gb|EEF45837.1| 9-cis-epoxycarotenoid dioxygenase, putative [Ricinus communis]
Length=577

 Score =   142 bits (359),  Expect = 9e-37, Method: Compositional matrix adjust.
 Identities = 68/106 (64%), Positives = 81/106 (76%), Gaps = 3/106 (3%)
 Frame = -1

Query  421  GMAKYGGIGKLHLEEGEAK--ELINVEYHMLPQNTFCTGAVFVAKADNT-EEDDGWIVTF  251
            GMAKYGG+ KL+ EEGE K  E+I VEYH   +NTFCTGA FV K  +T EEDDGWI+TF
Sbjct  468  GMAKYGGLAKLYFEEGENKFDEVIKVEYHKFEKNTFCTGAAFVPKTASTPEEDDGWIITF  527

Query  250  VHDENTNKSQVYMIDAKHFSKEPIATITLPCRVPYGFHGTFITQNL  113
            VH+E+TN S+ Y+IDAK F+ EP+A  TLP RVPYGFHG F+   L
Sbjct  528  VHNEDTNVSKAYIIDAKKFTAEPVAKFTLPSRVPYGFHGVFLPTQL  573



>gb|KDP34146.1| hypothetical protein JCGZ_07717 [Jatropha curcas]
Length=552

 Score =   142 bits (357),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 65/100 (65%), Positives = 78/100 (78%), Gaps = 1/100 (1%)
 Frame = -1

Query  421  GMAKYGGIGKLHLEE-GEAKELINVEYHMLPQNTFCTGAVFVAKADNTEEDDGWIVTFVH  245
            G+AKYGG+ KL+L+E  E  ELI VEYH   +NTFC+GA FV K  + EEDDGWI+TFVH
Sbjct  446  GIAKYGGLAKLYLQERDELVELIKVEYHKFERNTFCSGAAFVPKNGSVEEDDGWIITFVH  505

Query  244  DENTNKSQVYMIDAKHFSKEPIATITLPCRVPYGFHGTFI  125
            +E+TN SQ Y+ID K F  EP+A ITLPCRVPYGFHG F+
Sbjct  506  NEDTNISQAYIIDTKKFRNEPVAKITLPCRVPYGFHGAFM  545



>ref|XP_004251419.1| PREDICTED: carotenoid 9,10(9',10')-cleavage dioxygenase 1-like 
[Solanum lycopersicum]
Length=598

 Score =   142 bits (357),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 65/107 (61%), Positives = 80/107 (75%), Gaps = 4/107 (4%)
 Frame = -1

Query  421  GMAKYGGIGKLHLEE----GEAKELINVEYHMLPQNTFCTGAVFVAKADNTEEDDGWIVT  254
            G AK+GG+ KL+ EE     +  +LI VEYH+ P+NTFC+GA FV K D  +EDDGWIV 
Sbjct  492  GFAKFGGLAKLNFEEISKDDKKGDLIKVEYHIFPKNTFCSGATFVPKLDGVDEDDGWIVA  551

Query  253  FVHDENTNKSQVYMIDAKHFSKEPIATITLPCRVPYGFHGTFITQNL  113
            F H+ENTN+SQVY++DAK+F  EPIA I LP RVPYGFHG F+  NL
Sbjct  552  FTHNENTNQSQVYILDAKNFENEPIAIILLPNRVPYGFHGVFMLFNL  598



>ref|XP_004251418.2| PREDICTED: carotenoid 9,10(9',10')-cleavage dioxygenase 1-like 
[Solanum lycopersicum]
Length=603

 Score =   141 bits (355),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 64/107 (60%), Positives = 79/107 (74%), Gaps = 5/107 (5%)
 Frame = -1

Query  421  GMAKYGGIGKLHLEE-----GEAKELINVEYHMLPQNTFCTGAVFVAKADNTEEDDGWIV  257
            G AK+GG+ KL+ EE      E ++LI VEYH+ P+NTFC+GA FV K D  +EDDGWIV
Sbjct  497  GFAKFGGLAKLNFEEISKDFKEEEDLIKVEYHIFPKNTFCSGATFVPKLDGVDEDDGWIV  556

Query  256  TFVHDENTNKSQVYMIDAKHFSKEPIATITLPCRVPYGFHGTFITQN  116
             F H+ENTN+SQVY+IDAK F  E +A I LP RVPYGFHG F++ N
Sbjct  557  AFTHNENTNQSQVYIIDAKKFESEAVAIIILPSRVPYGFHGAFMSSN  603



>ref|XP_010095201.1| hypothetical protein L484_008739 [Morus notabilis]
 gb|EXB58585.1| hypothetical protein L484_008739 [Morus notabilis]
Length=538

 Score =   140 bits (353),  Expect = 5e-36, Method: Compositional matrix adjust.
 Identities = 69/117 (59%), Positives = 80/117 (68%), Gaps = 10/117 (9%)
 Frame = -1

Query  445  FLTSIKPLGMAKYGGIGKLHLEEGEAK----------ELINVEYHMLPQNTFCTGAVFVA  296
            F+ S     M K+GG+ KLH E+ + K          E+I VEYHM  +NTFC+GA FV 
Sbjct  418  FVPSSNADNMFKFGGLAKLHFEKLDKKVSSTTREIDEEVIKVEYHMFEENTFCSGAAFVP  477

Query  295  KADNTEEDDGWIVTFVHDENTNKSQVYMIDAKHFSKEPIATITLPCRVPYGFHGTFI  125
            K    EEDDGWI+TFVHDE+TN SQVY+ID K FS EPI  ITLPCRVPYGFHG FI
Sbjct  478  KKGGLEEDDGWIITFVHDEDTNISQVYVIDTKKFSHEPIFKITLPCRVPYGFHGAFI  534



>ref|XP_009601557.1| PREDICTED: carotenoid 9,10(9',10')-cleavage dioxygenase 1-like 
[Nicotiana tomentosiformis]
Length=579

 Score =   140 bits (352),  Expect = 7e-36, Method: Compositional matrix adjust.
 Identities = 62/99 (63%), Positives = 78/99 (79%), Gaps = 2/99 (2%)
 Frame = -1

Query  421  GMAKYGGIGKLHLEEGEAKELINVEYHMLPQNTFCTGAVFVAKADNTEEDDGWIVTFVHD  242
            G+AKYGG+ KLH +E E  EL  VEYHM P+ TFC+GA FV K   T+EDDGW+VTF H+
Sbjct  481  GLAKYGGLAKLHFKEDE--ELAKVEYHMFPKGTFCSGATFVPKTQGTDEDDGWVVTFTHN  538

Query  241  ENTNKSQVYMIDAKHFSKEPIATITLPCRVPYGFHGTFI  125
            E+TN SQVY++DA +F+ + +ATITLP RVPYGFHG F+
Sbjct  539  ESTNVSQVYVVDANNFATQSVATITLPSRVPYGFHGAFM  577



>ref|XP_010095202.1| hypothetical protein L484_008741 [Morus notabilis]
 gb|EXB58586.1| hypothetical protein L484_008741 [Morus notabilis]
Length=570

 Score =   140 bits (352),  Expect = 8e-36, Method: Compositional matrix adjust.
 Identities = 65/107 (61%), Positives = 78/107 (73%), Gaps = 9/107 (8%)
 Frame = -1

Query  418  MAKYGGIGKLHLEE---------GEAKELINVEYHMLPQNTFCTGAVFVAKADNTEEDDG  266
            M ++ G+ KLH E+          E +E++ VEYHM  +NTFCTGA FVAK    EEDDG
Sbjct  460  MPRFSGLAKLHFEQLDERFSTTTREIEEVLKVEYHMFEENTFCTGAAFVAKKGGLEEDDG  519

Query  265  WIVTFVHDENTNKSQVYMIDAKHFSKEPIATITLPCRVPYGFHGTFI  125
            WIVTFVH+E TN SQV++IDA+ FS EP+A ITLPCRVPYGFHG FI
Sbjct  520  WIVTFVHNEATNISQVFLIDAQKFSGEPVARITLPCRVPYGFHGAFI  566



>ref|XP_009350949.1| PREDICTED: carotenoid 9,10(9',10')-cleavage dioxygenase-like 
[Pyrus x bretschneideri]
Length=572

 Score =   140 bits (352),  Expect = 9e-36, Method: Composition-based stats.
 Identities = 64/108 (59%), Positives = 77/108 (71%), Gaps = 9/108 (8%)
 Frame = -1

Query  421  GMAKYGGIGKLHLEE---------GEAKELINVEYHMLPQNTFCTGAVFVAKADNTEEDD  269
            GM KY G+ KLH EE         G+ +E I VE HM  +N+FCTGA FV K    EEDD
Sbjct  459  GMLKYNGLAKLHFEEPDDVSLRSKGQLEEAIKVETHMFEENSFCTGASFVPKEGGFEEDD  518

Query  268  GWIVTFVHDENTNKSQVYMIDAKHFSKEPIATITLPCRVPYGFHGTFI  125
            GW++TFVH+E+TN SQVY+I+ K FS EP+A ITLPCRVPYGFHG F+
Sbjct  519  GWLITFVHNEDTNISQVYVIETKKFSNEPVAKITLPCRVPYGFHGAFM  566



>ref|XP_007012118.1| Carotenoid 9,10(9',10')-cleavage dioxygenase 1, putative isoform 
2 [Theobroma cacao]
 gb|EOY29737.1| Carotenoid 9,10(9',10')-cleavage dioxygenase 1, putative isoform 
2 [Theobroma cacao]
Length=608

 Score =   139 bits (351),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 66/110 (60%), Positives = 78/110 (71%), Gaps = 7/110 (6%)
 Frame = -1

Query  421  GMAKYGGIGKLHLEE-------GEAKELINVEYHMLPQNTFCTGAVFVAKADNTEEDDGW  263
            GMAKYGG+ KL  EE        + + L   EYHM  +NTFCTGA FV K    EEDDGW
Sbjct  484  GMAKYGGLVKLSFEEPNTGISSRQVEGLTKGEYHMFKENTFCTGAAFVPKEGGVEEDDGW  543

Query  262  IVTFVHDENTNKSQVYMIDAKHFSKEPIATITLPCRVPYGFHGTFITQNL  113
            I+TFVH+E+TN SQVY+ID ++FS EP+A ITLPCRVPYGFHG +I   L
Sbjct  544  IITFVHNEDTNISQVYIIDTRNFSGEPVAKITLPCRVPYGFHGAYIPMQL  593



>ref|XP_007012117.1| Carotenoid 9,10(9',10')-cleavage dioxygenase 1, putative isoform 
1 [Theobroma cacao]
 gb|EOY29736.1| Carotenoid 9,10(9',10')-cleavage dioxygenase 1, putative isoform 
1 [Theobroma cacao]
Length=610

 Score =   139 bits (349),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 66/112 (59%), Positives = 78/112 (70%), Gaps = 9/112 (8%)
 Frame = -1

Query  421  GMAKYGGIGKLHLEE---------GEAKELINVEYHMLPQNTFCTGAVFVAKADNTEEDD  269
            GMAKYGG+ KL  EE          + + L   EYHM  +NTFCTGA FV K    EEDD
Sbjct  484  GMAKYGGLVKLSFEEPNTGISSRQRQVEGLTKGEYHMFKENTFCTGAAFVPKEGGVEEDD  543

Query  268  GWIVTFVHDENTNKSQVYMIDAKHFSKEPIATITLPCRVPYGFHGTFITQNL  113
            GWI+TFVH+E+TN SQVY+ID ++FS EP+A ITLPCRVPYGFHG +I   L
Sbjct  544  GWIITFVHNEDTNISQVYIIDTRNFSGEPVAKITLPCRVPYGFHGAYIPMQL  595



>ref|XP_011019620.1| PREDICTED: carotenoid 9,10(9',10')-cleavage dioxygenase 1-like 
[Populus euphratica]
Length=605

 Score =   138 bits (348),  Expect = 3e-35, Method: Composition-based stats.
 Identities = 61/105 (58%), Positives = 78/105 (74%), Gaps = 6/105 (6%)
 Frame = -1

Query  421  GMAKYGGIGKLHLEEGEAKE------LINVEYHMLPQNTFCTGAVFVAKADNTEEDDGWI  260
            GM K+GG+ KL+ ++  +KE       I VEYH    NTFCTG+ FV K    +EDDGWI
Sbjct  495  GMPKFGGLAKLYFDDTSSKEGEQSDGHIKVEYHEFEGNTFCTGSAFVPKEGGLQEDDGWI  554

Query  259  VTFVHDENTNKSQVYMIDAKHFSKEPIATITLPCRVPYGFHGTFI  125
            +TFVHDE+TN S+VY+ID+K+F+ EP+A ITLPCRVPYGFHG F+
Sbjct  555  ITFVHDEDTNTSKVYIIDSKNFTSEPVAKITLPCRVPYGFHGAFM  599



>ref|XP_009804285.1| PREDICTED: carotenoid 9,10(9',10')-cleavage dioxygenase 1-like 
isoform X1 [Nicotiana sylvestris]
Length=600

 Score =   138 bits (348),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 65/110 (59%), Positives = 77/110 (70%), Gaps = 5/110 (5%)
 Frame = -1

Query  439  TSIKPLGMAKYGGIGKLHLEEG-----EAKELINVEYHMLPQNTFCTGAVFVAKADNTEE  275
            T I   G  ++GG+ KLH EE      E  ELI  EYHMLPQNTFC+GA FV K    +E
Sbjct  487  TEISGSGFTRFGGVAKLHFEEKRIPTEEEDELIKAEYHMLPQNTFCSGASFVPKPGGVDE  546

Query  274  DDGWIVTFVHDENTNKSQVYMIDAKHFSKEPIATITLPCRVPYGFHGTFI  125
            DDG I+TF H+EN N SQVY++DAK F+ EP+A ITLP RVPYGFHG F+
Sbjct  547  DDGSIITFTHNENENISQVYIVDAKKFTNEPVAIITLPSRVPYGFHGAFM  596



>ref|XP_006656671.1| PREDICTED: carotenoid 9,10(9',10')-cleavage dioxygenase-like 
[Oryza brachyantha]
Length=241

 Score =   133 bits (335),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 62/102 (61%), Positives = 79/102 (77%), Gaps = 2/102 (2%)
 Frame = -1

Query  424  LGMAKYGGIGKLH--LEEGEAKELINVEYHMLPQNTFCTGAVFVAKADNTEEDDGWIVTF  251
            +G+ KY  I K+H  +E+ E +EL  VEYH+LP+ +FC+G  FVAK +  +EDDGWIVT+
Sbjct  138  IGLFKYNMIAKVHFDMEDKENQELKLVEYHVLPEKSFCSGVQFVAKKNGIDEDDGWIVTY  197

Query  250  VHDENTNKSQVYMIDAKHFSKEPIATITLPCRVPYGFHGTFI  125
            VHDE TN SQVY+IDAK FS+EP+  ITLP RVPYGFHG F+
Sbjct  198  VHDELTNISQVYIIDAKRFSEEPVVKITLPQRVPYGFHGNFV  239



>emb|CBI20858.3| unnamed protein product [Vitis vinifera]
Length=1054

 Score =   140 bits (353),  Expect = 5e-35, Method: Composition-based stats.
 Identities = 62/108 (57%), Positives = 78/108 (72%), Gaps = 9/108 (8%)
 Frame = -1

Query  421   GMAKYGGIGKLHLEE---------GEAKELINVEYHMLPQNTFCTGAVFVAKADNTEEDD  269
             GMAKYGG+ KL+ EE         G+  +LI VEYH   +N FC+G+ FV K    EEDD
Sbjct  941   GMAKYGGLAKLYFEEQDKTLPARDGKKGQLIKVEYHRFEENNFCSGSAFVPKQGGVEEDD  1000

Query  268   GWIVTFVHDENTNKSQVYMIDAKHFSKEPIATITLPCRVPYGFHGTFI  125
             GWI++FVH+E+TN SQV++IDA+ F  +P+A ITLP RVPYGFHGTFI
Sbjct  1001  GWIISFVHNEDTNISQVHIIDARKFDSKPVAKITLPQRVPYGFHGTFI  1048



>ref|XP_006359778.1| PREDICTED: carotenoid 9,10(9',10')-cleavage dioxygenase 1-like 
[Solanum tuberosum]
Length=588

 Score =   137 bits (346),  Expect = 6e-35, Method: Compositional matrix adjust.
 Identities = 62/99 (63%), Positives = 75/99 (76%), Gaps = 2/99 (2%)
 Frame = -1

Query  421  GMAKYGGIGKLHLEEGEAKELINVEYHMLPQNTFCTGAVFVAKADNTEEDDGWIVTFVHD  242
            G+ KY G+ KL  EE    ELI VEYHMLP+  FC+G  FV K+   +EDDGW+VTF H+
Sbjct  490  GLVKYRGLAKLQFEED--VELIKVEYHMLPEGNFCSGTTFVPKSQGVDEDDGWLVTFTHN  547

Query  241  ENTNKSQVYMIDAKHFSKEPIATITLPCRVPYGFHGTFI  125
            ENTN SQVY++DAK+F+  PIATITLP RVPYGFHG F+
Sbjct  548  ENTNVSQVYIVDAKNFATHPIATITLPSRVPYGFHGAFM  586



>emb|CDP16199.1| unnamed protein product [Coffea canephora]
Length=573

 Score =   137 bits (345),  Expect = 7e-35, Method: Compositional matrix adjust.
 Identities = 64/109 (59%), Positives = 78/109 (72%), Gaps = 9/109 (8%)
 Frame = -1

Query  421  GMAKYGGIGKLHLEEG---------EAKELINVEYHMLPQNTFCTGAVFVAKADNTEEDD  269
            GMAKYGG+ KLHLEE          + +ELI VEYH  P+ TFC+GA FV K  + EE+D
Sbjct  462  GMAKYGGLAKLHLEEKTSEFCQADQQPEELIKVEYHKFPEGTFCSGATFVPKFGSLEEED  521

Query  268  GWIVTFVHDENTNKSQVYMIDAKHFSKEPIATITLPCRVPYGFHGTFIT  122
            GWI  FVHDE +N SQVY++DAK+ S +PIA I LP RVPYGFHG F++
Sbjct  522  GWITAFVHDEKSNISQVYILDAKNISSKPIAKIKLPSRVPYGFHGAFLS  570



>ref|XP_006382050.1| hypothetical protein POPTR_0006s25580g [Populus trichocarpa]
 gb|ERP59847.1| hypothetical protein POPTR_0006s25580g [Populus trichocarpa]
Length=595

 Score =   137 bits (345),  Expect = 9e-35, Method: Compositional matrix adjust.
 Identities = 63/108 (58%), Positives = 78/108 (72%), Gaps = 6/108 (6%)
 Frame = -1

Query  430  KPLGMAKYGGIGKLHLEEGEAKE------LINVEYHMLPQNTFCTGAVFVAKADNTEEDD  269
            +P  M K+GG+ KL+ +E  +KE       I VEYH    NTFCTG+ FV K    EEDD
Sbjct  482  EPASMPKFGGLAKLYFDETSSKEGEQSEGHIKVEYHEFEGNTFCTGSAFVPKEGGLEEDD  541

Query  268  GWIVTFVHDENTNKSQVYMIDAKHFSKEPIATITLPCRVPYGFHGTFI  125
            GWI+TFVHDE+TN S+VY+ID K+F+ EP+A ITLPCRVPYGFHG F+
Sbjct  542  GWIITFVHDEDTNTSKVYIIDTKNFTSEPVAKITLPCRVPYGFHGAFM  589



>ref|XP_007012115.1| Carotenoid 9,10(9',10')-cleavage dioxygenase 1, putative isoform 
2 [Theobroma cacao]
 gb|EOY29734.1| Carotenoid 9,10(9',10')-cleavage dioxygenase 1, putative isoform 
2 [Theobroma cacao]
Length=613

 Score =   137 bits (345),  Expect = 9e-35, Method: Composition-based stats.
 Identities = 67/112 (60%), Positives = 79/112 (71%), Gaps = 9/112 (8%)
 Frame = -1

Query  421  GMAKYGGIGKLHLEE-------GEAKE--LINVEYHMLPQNTFCTGAVFVAKADNTEEDD  269
            GMAKYGG+ KL+ EE       GE +E  LI VEYHM  +NTF TGA FV K    EEDD
Sbjct  473  GMAKYGGLAKLYFEEQNTGFSLGENQEKGLIKVEYHMFGKNTFGTGAAFVPKEGGAEEDD  532

Query  268  GWIVTFVHDENTNKSQVYMIDAKHFSKEPIATITLPCRVPYGFHGTFITQNL  113
            GW++TF H+E+TN SQV +I+AK+FS EP+A ITLP RVPYGFHG F    L
Sbjct  533  GWVITFAHNEDTNISQVLVIEAKNFSSEPVAKITLPFRVPYGFHGAFAPMQL  584



>ref|XP_007012114.1| Carotenoid 9,10(9',10')-cleavage dioxygenase 1, putative isoform 
1 [Theobroma cacao]
 gb|EOY29733.1| Carotenoid 9,10(9',10')-cleavage dioxygenase 1, putative isoform 
1 [Theobroma cacao]
Length=634

 Score =   137 bits (346),  Expect = 9e-35, Method: Composition-based stats.
 Identities = 67/112 (60%), Positives = 79/112 (71%), Gaps = 9/112 (8%)
 Frame = -1

Query  421  GMAKYGGIGKLHLEE-------GEAKE--LINVEYHMLPQNTFCTGAVFVAKADNTEEDD  269
            GMAKYGG+ KL+ EE       GE +E  LI VEYHM  +NTF TGA FV K    EEDD
Sbjct  494  GMAKYGGLAKLYFEEQNTGFSLGENQEKGLIKVEYHMFGKNTFGTGAAFVPKEGGAEEDD  553

Query  268  GWIVTFVHDENTNKSQVYMIDAKHFSKEPIATITLPCRVPYGFHGTFITQNL  113
            GW++TF H+E+TN SQV +I+AK+FS EP+A ITLP RVPYGFHG F    L
Sbjct  554  GWVITFAHNEDTNISQVLVIEAKNFSSEPVAKITLPFRVPYGFHGAFAPMQL  605



>emb|CAN66950.1| hypothetical protein VITISV_020097 [Vitis vinifera]
Length=1199

 Score =   139 bits (350),  Expect = 2e-34, Method: Composition-based stats.
 Identities = 62/108 (57%), Positives = 78/108 (72%), Gaps = 9/108 (8%)
 Frame = -1

Query  421   GMAKYGGIGKLHLEE---------GEAKELINVEYHMLPQNTFCTGAVFVAKADNTEEDD  269
             GMAKYGG+ KL+ EE         G+  +LI VEYH   +N FC+G+ FV K    EEDD
Sbjct  1086  GMAKYGGLAKLYFEEQDKTPPARDGKKGQLIKVEYHRFEENNFCSGSAFVPKQGGVEEDD  1145

Query  268   GWIVTFVHDENTNKSQVYMIDAKHFSKEPIATITLPCRVPYGFHGTFI  125
             GWI++FVH+E+TN SQV++IDA+ F  +P+A ITLP RVPYGFHGTFI
Sbjct  1146  GWIISFVHNEDTNISQVHIIDARKFDSKPVAKITLPQRVPYGFHGTFI  1193



>ref|XP_010102387.1| hypothetical protein L484_010699 [Morus notabilis]
 gb|EXB93372.1| hypothetical protein L484_010699 [Morus notabilis]
Length=593

 Score =   136 bits (342),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 63/109 (58%), Positives = 76/109 (70%), Gaps = 9/109 (8%)
 Frame = -1

Query  412  KYGGIGKLHLEE---------GEAKELINVEYHMLPQNTFCTGAVFVAKADNTEEDDGWI  260
            K+GG+ KLH ++          E+KE I VEYHM  +NTFCTGA FV +    EEDDGWI
Sbjct  485  KFGGLAKLHFDQLDTRYSSTKSESKEAIKVEYHMFEKNTFCTGASFVPQEGGVEEDDGWI  544

Query  259  VTFVHDENTNKSQVYMIDAKHFSKEPIATITLPCRVPYGFHGTFITQNL  113
            VTFVH+E+TN SQV +I  K FS EP+A  TLPCRVPYGFHG FI+  +
Sbjct  545  VTFVHNEDTNTSQVLVISTKKFSSEPVAKFTLPCRVPYGFHGAFISATI  593



>ref|XP_011012510.1| PREDICTED: carotenoid 9,10(9',10')-cleavage dioxygenase-like 
[Populus euphratica]
Length=606

 Score =   136 bits (342),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 64/105 (61%), Positives = 76/105 (72%), Gaps = 6/105 (6%)
 Frame = -1

Query  421  GMAKYGGIGKLHLEEGEAKEL------INVEYHMLPQNTFCTGAVFVAKADNTEEDDGWI  260
            GM K+GG+ KL+ EE   KE       I VEYH    NTFCTGA FV K    EE+DGWI
Sbjct  496  GMPKFGGLAKLYFEETANKEWEESEGHIKVEYHEFEGNTFCTGAAFVPKEGGLEENDGWI  555

Query  259  VTFVHDENTNKSQVYMIDAKHFSKEPIATITLPCRVPYGFHGTFI  125
            +TFVHDE+TN S+VY+ID K+F+ EP+A ITLPCRVPYGFHG F+
Sbjct  556  ITFVHDEDTNTSKVYIIDTKNFTSEPVAKITLPCRVPYGFHGAFM  600



>gb|EYU20441.1| hypothetical protein MIMGU_mgv1a003485mg [Erythranthe guttata]
Length=582

 Score =   135 bits (340),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 59/101 (58%), Positives = 81/101 (80%), Gaps = 6/101 (6%)
 Frame = -1

Query  421  GMAKYGGIGKLHLEEGEAKELINVEYHMLPQNTFCTGAVFVAKA-DNTEEDDGWIVTFVH  245
            GMAKYGG+ KL+ EE        V+YH  P+NT+C+GA +VAK+ ++ +EDDGWI+T+VH
Sbjct  486  GMAKYGGLAKLYFEE-----TTKVDYHEFPENTYCSGAAYVAKSGEDADEDDGWIITYVH  540

Query  244  DENTNKSQVYMIDAKHFSKEPIATITLPCRVPYGFHGTFIT  122
            +E+TN SQVY++DAK+F+ EP+A +TLP RVPYGFHG F+T
Sbjct  541  NEDTNTSQVYIVDAKNFTSEPVAIVTLPSRVPYGFHGAFVT  581



>ref|XP_006388365.1| hypothetical protein POPTR_0209s00220g [Populus trichocarpa]
 gb|ERP47279.1| hypothetical protein POPTR_0209s00220g [Populus trichocarpa]
Length=563

 Score =   135 bits (339),  Expect = 5e-34, Method: Compositional matrix adjust.
 Identities = 64/105 (61%), Positives = 76/105 (72%), Gaps = 6/105 (6%)
 Frame = -1

Query  421  GMAKYGGIGKLHLEEGEAKEL------INVEYHMLPQNTFCTGAVFVAKADNTEEDDGWI  260
            GM K+GG+ KL+ EE   KE       I VEYH    NTFCTGA FV K    EEDDGWI
Sbjct  450  GMPKFGGLAKLYFEETANKEWEESEGHIKVEYHEFVGNTFCTGAAFVPKEGWLEEDDGWI  509

Query  259  VTFVHDENTNKSQVYMIDAKHFSKEPIATITLPCRVPYGFHGTFI  125
            +TFVHDE+T+ S+VY+ID K+F+ EP+A ITLPCRVPYGFHG F+
Sbjct  510  ITFVHDEDTDTSKVYIIDTKNFTSEPVAKITLPCRVPYGFHGAFM  554



>ref|XP_010648499.1| PREDICTED: carotenoid 9,10(9',10')-cleavage dioxygenase 1-like 
[Vitis vinifera]
 ref|XP_010648500.1| PREDICTED: carotenoid 9,10(9',10')-cleavage dioxygenase 1-like 
[Vitis vinifera]
Length=625

 Score =   135 bits (339),  Expect = 8e-34, Method: Compositional matrix adjust.
 Identities = 62/108 (57%), Positives = 78/108 (72%), Gaps = 9/108 (8%)
 Frame = -1

Query  421  GMAKYGGIGKLHLEE---------GEAKELINVEYHMLPQNTFCTGAVFVAKADNTEEDD  269
            GMAKYGG+ KL+ EE         G+  +LI VEYH   +N FC+G+ FV K    EEDD
Sbjct  512  GMAKYGGLAKLYFEEQDKTLPARDGKKGQLIKVEYHRFEENNFCSGSAFVPKQGGVEEDD  571

Query  268  GWIVTFVHDENTNKSQVYMIDAKHFSKEPIATITLPCRVPYGFHGTFI  125
            GWI++FVH+E+TN SQV++IDA+ F  +P+A ITLP RVPYGFHGTFI
Sbjct  572  GWIISFVHNEDTNISQVHIIDARKFDSKPVAKITLPQRVPYGFHGTFI  619



>ref|XP_006359779.1| PREDICTED: carotenoid 9,10(9',10')-cleavage dioxygenase 1-like 
[Solanum tuberosum]
Length=588

 Score =   134 bits (337),  Expect = 9e-34, Method: Compositional matrix adjust.
 Identities = 61/99 (62%), Positives = 74/99 (75%), Gaps = 2/99 (2%)
 Frame = -1

Query  421  GMAKYGGIGKLHLEEGEAKELINVEYHMLPQNTFCTGAVFVAKADNTEEDDGWIVTFVHD  242
            G+ KYGG+ KL  EE    ELI VEYHMLP+  FC+   FV K    +EDDGW+VTF+H+
Sbjct  490  GLVKYGGLVKLQFEED--MELIKVEYHMLPEGNFCSRTTFVPKPQGVDEDDGWLVTFIHN  547

Query  241  ENTNKSQVYMIDAKHFSKEPIATITLPCRVPYGFHGTFI  125
            ENTN S VY++DAK+F+  PIATITLP RVPYGFHG F+
Sbjct  548  ENTNVSHVYIVDAKNFATHPIATITLPSRVPYGFHGAFM  586



>ref|XP_011081798.1| PREDICTED: carotenoid 9,10(9',10')-cleavage dioxygenase 1-like 
[Sesamum indicum]
Length=612

 Score =   134 bits (338),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 61/112 (54%), Positives = 78/112 (70%), Gaps = 13/112 (12%)
 Frame = -1

Query  421  GMAKYGGIGKLHLE-------------EGEAKELINVEYHMLPQNTFCTGAVFVAKADNT  281
            GM KYGG+ KL L+             EG  +E   +EYHM P+NTFCTGA FVAK  + 
Sbjct  498  GMVKYGGLAKLCLQDNNVQFLEGTQNGEGSGEEYRKIEYHMFPENTFCTGASFVAKQGSV  557

Query  280  EEDDGWIVTFVHDENTNKSQVYMIDAKHFSKEPIATITLPCRVPYGFHGTFI  125
            +EDDGW++TFVH+E+TN S+VY++DAK  S E +A I LPCRVPYGFHG ++
Sbjct  558  DEDDGWLITFVHNEDTNTSEVYIVDAKKISSEAVAKIRLPCRVPYGFHGAYM  609



>gb|KCW81564.1| hypothetical protein EUGRSUZ_C02923 [Eucalyptus grandis]
Length=468

 Score =   133 bits (335),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 63/110 (57%), Positives = 79/110 (72%), Gaps = 9/110 (8%)
 Frame = -1

Query  421  GMAKYGGIGKLHLE---------EGEAKELINVEYHMLPQNTFCTGAVFVAKADNTEEDD  269
            GM KYGG+ KL+L+         E   K+ I ++YH   +N FCTGA FV K +  EEDD
Sbjct  351  GMPKYGGLAKLYLDQPRTGISLKENRFKDAIMLDYHEFGENIFCTGAAFVPKENGFEEDD  410

Query  268  GWIVTFVHDENTNKSQVYMIDAKHFSKEPIATITLPCRVPYGFHGTFITQ  119
            GWI+TFVH+E+ + SQVY+ID K+FS EP+A ITLP RVPYGFHGTFI+Q
Sbjct  411  GWIITFVHNESIDTSQVYLIDCKNFSGEPVAKITLPYRVPYGFHGTFISQ  460



>ref|XP_007012116.1| Carotenoid 9,10(9',10')-cleavage dioxygenase 1, putative isoform 
3, partial [Theobroma cacao]
 gb|EOY29735.1| Carotenoid 9,10(9',10')-cleavage dioxygenase 1, putative isoform 
3, partial [Theobroma cacao]
Length=473

 Score =   133 bits (334),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 67/112 (60%), Positives = 79/112 (71%), Gaps = 9/112 (8%)
 Frame = -1

Query  421  GMAKYGGIGKLHLEE-------GEAKE--LINVEYHMLPQNTFCTGAVFVAKADNTEEDD  269
            GMAKYGG+ KL+ EE       GE +E  LI VEYHM  +NTF TGA FV K    EEDD
Sbjct  332  GMAKYGGLAKLYFEEQNTGFSLGENQEKGLIKVEYHMFGKNTFGTGAAFVPKEGGAEEDD  391

Query  268  GWIVTFVHDENTNKSQVYMIDAKHFSKEPIATITLPCRVPYGFHGTFITQNL  113
            GW++TF H+E+TN SQV +I+AK+FS EP+A ITLP RVPYGFHG F    L
Sbjct  392  GWVITFAHNEDTNISQVLVIEAKNFSSEPVAKITLPFRVPYGFHGAFAPMQL  443



>gb|KDO79810.1| hypothetical protein CISIN_1g008275mg [Citrus sinensis]
Length=571

 Score =   133 bits (334),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 62/103 (60%), Positives = 75/103 (73%), Gaps = 3/103 (3%)
 Frame = -1

Query  421  GMAKYGGIGKLHLEE---GEAKELINVEYHMLPQNTFCTGAVFVAKADNTEEDDGWIVTF  251
            GM KYGG+ KL  EE    E++ELI VEYH   +N FCTG  FV K    EEDDGWI+TF
Sbjct  456  GMPKYGGLAKLSFEEPDNTESEELIKVEYHKFEENIFCTGGAFVPKGRGVEEDDGWIITF  515

Query  250  VHDENTNKSQVYMIDAKHFSKEPIATITLPCRVPYGFHGTFIT  122
            +H+E+TN SQVY+ID K F+ EP+A ITL  RVPYGFHG F++
Sbjct  516  LHNEDTNISQVYIIDTKKFTDEPVAKITLSHRVPYGFHGAFMS  558



>gb|EYU29275.1| hypothetical protein MIMGU_mgv1a003094mg [Erythranthe guttata]
Length=608

 Score =   133 bits (335),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 65/110 (59%), Positives = 78/110 (71%), Gaps = 11/110 (10%)
 Frame = -1

Query  421  GMAKYGGIGKLHLEEG---------EAKELINVEYHMLPQNTFCTGAVFVAK-ADN-TEE  275
            GM+KY G+ KL +EE          +  E   VEYHM  +NTFCTG+ FV K  DN  EE
Sbjct  495  GMSKYNGLAKLFIEEKNLNLAEGTKDGDEFTKVEYHMFRENTFCTGSAFVPKNGDNIVEE  554

Query  274  DDGWIVTFVHDENTNKSQVYMIDAKHFSKEPIATITLPCRVPYGFHGTFI  125
            DDGWI+TFVH+E T+ SQVY++DAK FS EP+A ITLPCRVPYGFHG F+
Sbjct  555  DDGWIITFVHNETTDISQVYIVDAKKFSSEPVAKITLPCRVPYGFHGAFM  604



>ref|XP_010049103.1| PREDICTED: carotenoid 9,10(9',10')-cleavage dioxygenase 1-like 
[Eucalyptus grandis]
Length=583

 Score =   133 bits (334),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 63/110 (57%), Positives = 79/110 (72%), Gaps = 9/110 (8%)
 Frame = -1

Query  421  GMAKYGGIGKLHLE---------EGEAKELINVEYHMLPQNTFCTGAVFVAKADNTEEDD  269
            GM KYGG+ KL+L+         E   K+ I ++YH   +N FCTGA FV K +  EEDD
Sbjct  466  GMPKYGGLAKLYLDQPRTGISLKENRFKDAIMLDYHEFGENIFCTGAAFVPKENGFEEDD  525

Query  268  GWIVTFVHDENTNKSQVYMIDAKHFSKEPIATITLPCRVPYGFHGTFITQ  119
            GWI+TFVH+E+ + SQVY+ID K+FS EP+A ITLP RVPYGFHGTFI+Q
Sbjct  526  GWIITFVHNESIDTSQVYLIDCKNFSGEPVAKITLPYRVPYGFHGTFISQ  575



>ref|XP_006476133.1| PREDICTED: carotenoid 9,10(9',10')-cleavage dioxygenase 1-like 
[Citrus sinensis]
Length=606

 Score =   133 bits (335),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 62/103 (60%), Positives = 75/103 (73%), Gaps = 3/103 (3%)
 Frame = -1

Query  421  GMAKYGGIGKLHLEE---GEAKELINVEYHMLPQNTFCTGAVFVAKADNTEEDDGWIVTF  251
            GM KYGG+ KL  EE    E++ELI VEYH   +N FCTG  FV K    EEDDGWI+TF
Sbjct  491  GMPKYGGLAKLSFEEPDNTESEELIKVEYHKFEENIFCTGGAFVPKGRGVEEDDGWIITF  550

Query  250  VHDENTNKSQVYMIDAKHFSKEPIATITLPCRVPYGFHGTFIT  122
            +H+E+TN SQVY+ID K F+ EP+A ITL  RVPYGFHG F++
Sbjct  551  LHNEDTNISQVYIIDTKKFTDEPVAKITLSHRVPYGFHGAFMS  593



>ref|XP_002324226.2| hypothetical protein POPTR_0018s00310g [Populus trichocarpa]
 gb|EEF02791.2| hypothetical protein POPTR_0018s00310g [Populus trichocarpa]
Length=554

 Score =   132 bits (333),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 63/105 (60%), Positives = 75/105 (71%), Gaps = 6/105 (6%)
 Frame = -1

Query  421  GMAKYGGIGKLHLEEGEAKEL------INVEYHMLPQNTFCTGAVFVAKADNTEEDDGWI  260
            GM K+GG+ KL+ EE   KE       I VEYH    NTFCTGA FV K    EED GWI
Sbjct  444  GMPKFGGLAKLYFEETANKEWEESEGHIKVEYHEFVGNTFCTGAAFVPKEGGLEEDHGWI  503

Query  259  VTFVHDENTNKSQVYMIDAKHFSKEPIATITLPCRVPYGFHGTFI  125
            +TFVHDE+T+ S+VY+ID K+F+ EP+A ITLPCRVPYGFHG F+
Sbjct  504  ITFVHDEDTDTSKVYIIDTKNFTSEPVAKITLPCRVPYGFHGAFM  548



>ref|XP_006450677.1| hypothetical protein CICLE_v10010551mg, partial [Citrus clementina]
 gb|ESR63917.1| hypothetical protein CICLE_v10010551mg, partial [Citrus clementina]
Length=611

 Score =   133 bits (334),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 62/103 (60%), Positives = 75/103 (73%), Gaps = 3/103 (3%)
 Frame = -1

Query  421  GMAKYGGIGKLHLEE---GEAKELINVEYHMLPQNTFCTGAVFVAKADNTEEDDGWIVTF  251
            GM KYGG+ KL  EE    E++ELI VEYH   +N FCTG  FV K    EEDDGWI+TF
Sbjct  496  GMPKYGGLAKLSFEEPDNTESEELIKVEYHKFEENIFCTGGAFVPKGRGVEEDDGWIITF  555

Query  250  VHDENTNKSQVYMIDAKHFSKEPIATITLPCRVPYGFHGTFIT  122
            +H+E+TN SQVY+ID K F+ EP+A ITL  RVPYGFHG F++
Sbjct  556  LHNEDTNISQVYIIDTKKFTDEPVAKITLSHRVPYGFHGAFMS  598



>ref|XP_002437881.1| hypothetical protein SORBIDRAFT_10g004370 [Sorghum bicolor]
 gb|EER89248.1| hypothetical protein SORBIDRAFT_10g004370 [Sorghum bicolor]
Length=544

 Score =   132 bits (332),  Expect = 4e-33, Method: Composition-based stats.
 Identities = 61/100 (61%), Positives = 76/100 (76%), Gaps = 2/100 (2%)
 Frame = -1

Query  421  GMAKYGGIGKLH--LEEGEAKELINVEYHMLPQNTFCTGAVFVAKADNTEEDDGWIVTFV  248
            G+ K+  I KLH  + + E KELI+VEYH L +  FC+G  FVAK +  +EDDGW+VT+V
Sbjct  438  GLFKFKMIAKLHFNMPDKENKELISVEYHTLKEKQFCSGVQFVAKKNGIDEDDGWVVTYV  497

Query  247  HDENTNKSQVYMIDAKHFSKEPIATITLPCRVPYGFHGTF  128
            HDE TN SQV++IDAK FS+EP+A ITLP RVPYGFHG F
Sbjct  498  HDEGTNVSQVHIIDAKRFSEEPVAKITLPQRVPYGFHGNF  537



>ref|XP_006382051.1| hypothetical protein POPTR_0006s25590g [Populus trichocarpa]
 gb|ERP59848.1| hypothetical protein POPTR_0006s25590g [Populus trichocarpa]
Length=508

 Score =   132 bits (331),  Expect = 5e-33, Method: Composition-based stats.
 Identities = 58/96 (60%), Positives = 72/96 (75%), Gaps = 4/96 (4%)
 Frame = -1

Query  412  KYGGIGKLHLEEGEAKELINVEYHMLPQNTFCTGAVFVAKADNTEEDDGWIVTFVHDENT  233
            KYG   K    +G+ +ELI V+YH   QNTFCTGA FV K  + EEDDGWI+TFVH+E+T
Sbjct  408  KYGYTQK----DGQYEELIKVDYHKFEQNTFCTGAAFVPKPGSHEEDDGWIITFVHNEDT  463

Query  232  NKSQVYMIDAKHFSKEPIATITLPCRVPYGFHGTFI  125
            N S+ Y+ID + F+ EP+A ITLPCRVPYGFHG F+
Sbjct  464  NMSKAYIIDTRRFTSEPVAKITLPCRVPYGFHGAFM  499



>ref|XP_008220072.1| PREDICTED: carotenoid 9,10(9',10')-cleavage dioxygenase 1-like 
[Prunus mume]
Length=607

 Score =   132 bits (332),  Expect = 6e-33, Method: Composition-based stats.
 Identities = 61/104 (59%), Positives = 71/104 (68%), Gaps = 5/104 (5%)
 Frame = -1

Query  421  GMAKYGGIGKLHLEEGEAKELIN-----VEYHMLPQNTFCTGAVFVAKADNTEEDDGWIV  257
             M KYGG+ KLH EE     L N     VE HM  + +FC+GA FV K    EEDD W +
Sbjct  501  AMLKYGGLAKLHFEEPADVSLRNESQLEVETHMFEEKSFCSGAAFVPKQGGLEEDDVWAI  560

Query  256  TFVHDENTNKSQVYMIDAKHFSKEPIATITLPCRVPYGFHGTFI  125
            TFVH+E+TN SQVY+ID K FS EP+A ITLPCRVPYGFHG F+
Sbjct  561  TFVHNEDTNVSQVYVIDTKKFSDEPVAKITLPCRVPYGFHGAFM  604



>gb|EEC80067.1| hypothetical protein OsI_21783 [Oryza sativa Indica Group]
Length=745

 Score =   132 bits (333),  Expect = 1e-32, Method: Composition-based stats.
 Identities = 59/101 (58%), Positives = 77/101 (76%), Gaps = 2/101 (2%)
 Frame = -1

Query  424  LGMAKYGGIGKLHL--EEGEAKELINVEYHMLPQNTFCTGAVFVAKADNTEEDDGWIVTF  251
            +G+ KY  I K+H   ++ E K+L +VEYH+L + TFC+G  FVAK +  +EDDGWI+T+
Sbjct  642  IGLFKYNRIAKVHFDRQDKENKQLKSVEYHVLKEKTFCSGVQFVAKENGIDEDDGWIITY  701

Query  250  VHDENTNKSQVYMIDAKHFSKEPIATITLPCRVPYGFHGTF  128
            VHDE TN SQVY+IDAK F++EP+  ITLP RVPYGFHG F
Sbjct  702  VHDELTNVSQVYIIDAKRFAEEPVLKITLPQRVPYGFHGNF  742



>ref|XP_010648503.1| PREDICTED: carotenoid 9,10(9',10')-cleavage dioxygenase 1-like 
isoform X3 [Vitis vinifera]
Length=583

 Score =   131 bits (329),  Expect = 1e-32, Method: Composition-based stats.
 Identities = 61/109 (56%), Positives = 80/109 (73%), Gaps = 9/109 (8%)
 Frame = -1

Query  421  GMAKYGGIGKLHLEE---------GEAKELINVEYHMLPQNTFCTGAVFVAKADNTEEDD  269
            GM+KYG + KL+ EE         G+ + LI VEY+   +N FC+G+VFV K  ++EEDD
Sbjct  470  GMSKYGSLAKLYFEESDSKLSVKEGKGEHLIKVEYNRFAENNFCSGSVFVPKGGSSEEDD  529

Query  268  GWIVTFVHDENTNKSQVYMIDAKHFSKEPIATITLPCRVPYGFHGTFIT  122
             WIV+FVH+E+T+ SQV++IDA+ FS +PIA ITLP RVPYGFHG FIT
Sbjct  530  SWIVSFVHNEDTDVSQVHIIDAQKFSSKPIAKITLPQRVPYGFHGIFIT  578



>ref|XP_010648502.1| PREDICTED: carotenoid 9,10(9',10')-cleavage dioxygenase 1-like 
isoform X2 [Vitis vinifera]
Length=590

 Score =   130 bits (328),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 61/109 (56%), Positives = 80/109 (73%), Gaps = 9/109 (8%)
 Frame = -1

Query  421  GMAKYGGIGKLHLEEGEAK---------ELINVEYHMLPQNTFCTGAVFVAKADNTEEDD  269
            GM+KYG + KL+ EE ++K          LI VEY+   +N FC+G+VFV K  ++EEDD
Sbjct  477  GMSKYGSLAKLYFEESDSKLSVKEGKGEHLIKVEYNRFAENNFCSGSVFVPKGGSSEEDD  536

Query  268  GWIVTFVHDENTNKSQVYMIDAKHFSKEPIATITLPCRVPYGFHGTFIT  122
             WIV+FVH+E+T+ SQV++IDA+ FS +PIA ITLP RVPYGFHG FIT
Sbjct  537  SWIVSFVHNEDTDVSQVHIIDAQKFSSKPIAKITLPQRVPYGFHGIFIT  585



>emb|CBI20860.3| unnamed protein product [Vitis vinifera]
Length=567

 Score =   130 bits (328),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 61/109 (56%), Positives = 80/109 (73%), Gaps = 9/109 (8%)
 Frame = -1

Query  421  GMAKYGGIGKLHLEEGEAK---------ELINVEYHMLPQNTFCTGAVFVAKADNTEEDD  269
            GM+KYG + KL+ EE ++K          LI VEY+   +N FC+G+VFV K  ++EEDD
Sbjct  454  GMSKYGSLAKLYFEESDSKLSVKEGKGEHLIKVEYNRFAENNFCSGSVFVPKGGSSEEDD  513

Query  268  GWIVTFVHDENTNKSQVYMIDAKHFSKEPIATITLPCRVPYGFHGTFIT  122
             WIV+FVH+E+T+ SQV++IDA+ FS +PIA ITLP RVPYGFHG FIT
Sbjct  514  SWIVSFVHNEDTDVSQVHIIDAQKFSSKPIAKITLPQRVPYGFHGIFIT  562



>ref|XP_006359777.1| PREDICTED: carotenoid 9,10(9',10')-cleavage dioxygenase 1-like 
[Solanum tuberosum]
Length=606

 Score =   130 bits (328),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 62/111 (56%), Positives = 77/111 (69%), Gaps = 6/111 (5%)
 Frame = -1

Query  439  TSIKPLGMAKYGGIGKLHLEE------GEAKELINVEYHMLPQNTFCTGAVFVAKADNTE  278
            T +   G +K+GG+ K+H EE       E  ELI  EYHM P+NTFC+GA FV K    +
Sbjct  492  TEVSGSGFSKFGGLIKVHYEEKKTFNMDEEDELIKAEYHMFPKNTFCSGASFVPKLGGID  551

Query  277  EDDGWIVTFVHDENTNKSQVYMIDAKHFSKEPIATITLPCRVPYGFHGTFI  125
            EDDGWI+TF H+EN N SQV +IDAK F++EP+A ITL  RVPYGFHG F+
Sbjct  552  EDDGWIITFTHNENENISQVCIIDAKKFTEEPVAIITLSSRVPYGFHGAFM  602



>ref|XP_010648501.1| PREDICTED: carotenoid 9,10(9',10')-cleavage dioxygenase 1-like 
isoform X1 [Vitis vinifera]
Length=604

 Score =   130 bits (328),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 61/109 (56%), Positives = 80/109 (73%), Gaps = 9/109 (8%)
 Frame = -1

Query  421  GMAKYGGIGKLHLEEGEAK---------ELINVEYHMLPQNTFCTGAVFVAKADNTEEDD  269
            GM+KYG + KL+ EE ++K          LI VEY+   +N FC+G+VFV K  ++EEDD
Sbjct  491  GMSKYGSLAKLYFEESDSKLSVKEGKGEHLIKVEYNRFAENNFCSGSVFVPKGGSSEEDD  550

Query  268  GWIVTFVHDENTNKSQVYMIDAKHFSKEPIATITLPCRVPYGFHGTFIT  122
             WIV+FVH+E+T+ SQV++IDA+ FS +PIA ITLP RVPYGFHG FIT
Sbjct  551  SWIVSFVHNEDTDVSQVHIIDAQKFSSKPIAKITLPQRVPYGFHGIFIT  599



>ref|XP_006359776.1| PREDICTED: carotenoid 9,10(9',10')-cleavage dioxygenase 1-like 
[Solanum tuberosum]
Length=607

 Score =   130 bits (327),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 61/111 (55%), Positives = 75/111 (68%), Gaps = 6/111 (5%)
 Frame = -1

Query  439  TSIKPLGMAKYGGIGKLHLEE------GEAKELINVEYHMLPQNTFCTGAVFVAKADNTE  278
            T +   G  ++ G+ KLH EE       E  ELI  EYHM P+NTFC+G  FV K +  +
Sbjct  493  TELSGSGFTRFSGLVKLHFEEKKTFNMDEEDELIKAEYHMFPKNTFCSGTSFVPKPEGID  552

Query  277  EDDGWIVTFVHDENTNKSQVYMIDAKHFSKEPIATITLPCRVPYGFHGTFI  125
            EDDGWI+TF H+EN N SQV +IDAK F+KEP+A ITL  RVPYGFHG F+
Sbjct  553  EDDGWIITFTHNENENISQVCIIDAKKFTKEPVAIITLSSRVPYGFHGAFM  603



>ref|XP_004245397.1| PREDICTED: carotenoid 9,10(9',10')-cleavage dioxygenase 1-like 
[Solanum lycopersicum]
Length=588

 Score =   129 bits (325),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 58/99 (59%), Positives = 71/99 (72%), Gaps = 2/99 (2%)
 Frame = -1

Query  421  GMAKYGGIGKLHLEEGEAKELINVEYHMLPQNTFCTGAVFVAKADNTEEDDGWIVTFVHD  242
            G+ KYGG+ K   E+    ELI VEYHML +  FC+G  FV K    +EDDGW+VTF+H+
Sbjct  490  GLVKYGGLAKFQFEDD--MELIKVEYHMLAEGNFCSGTTFVPKPQGVDEDDGWLVTFLHN  547

Query  241  ENTNKSQVYMIDAKHFSKEPIATITLPCRVPYGFHGTFI  125
            ENTN S VY++DAK F+  PI TITLP RVPYGFHG F+
Sbjct  548  ENTNVSHVYIVDAKKFATHPITTITLPSRVPYGFHGAFM  586



>ref|XP_004966710.1| PREDICTED: carotenoid 9,10(9',10')-cleavage dioxygenase 1-like 
[Setaria italica]
Length=244

 Score =   124 bits (312),  Expect = 9e-32, Method: Compositional matrix adjust.
 Identities = 57/101 (56%), Positives = 74/101 (73%), Gaps = 2/101 (2%)
 Frame = -1

Query  421  GMAKYGGIGKLHLE--EGEAKELINVEYHMLPQNTFCTGAVFVAKADNTEEDDGWIVTFV  248
            G+ K+  I KLH +  + E K+ I+V+YH L +  FC+G  FVA+    +EDDGW+VT+V
Sbjct  139  GLFKFKMIAKLHFDMPDKENKQFISVQYHDLKEEQFCSGVQFVARESGIDEDDGWVVTYV  198

Query  247  HDENTNKSQVYMIDAKHFSKEPIATITLPCRVPYGFHGTFI  125
            H+E TN SQVY+IDAK FS+EP+A ITLP RVPYGFHG F 
Sbjct  199  HEEGTNISQVYIIDAKRFSEEPVAKITLPQRVPYGFHGNFF  239



>ref|XP_010049102.1| PREDICTED: carotenoid 9,10(9',10')-cleavage dioxygenase-like 
[Eucalyptus grandis]
Length=626

 Score =   129 bits (323),  Expect = 1e-31, Method: Composition-based stats.
 Identities = 58/110 (53%), Positives = 77/110 (70%), Gaps = 9/110 (8%)
 Frame = -1

Query  421  GMAKYGGIGKLHLEEGEA---------KELINVEYHMLPQNTFCTGAVFVAKADNTEEDD  269
            GM K+GG+ KL+L+E  A         ++ I V+YH   +N FC+GA FV K +  EEDD
Sbjct  494  GMPKFGGLAKLYLDEPVAAVSSKEEPSEDTIKVKYHKFGENIFCSGAAFVPKENGFEEDD  553

Query  268  GWIVTFVHDENTNKSQVYMIDAKHFSKEPIATITLPCRVPYGFHGTFITQ  119
            GWI+TFVHDE+T+ SQV+++D + F  EP+A ITLP RVPYGFHG F +Q
Sbjct  554  GWIITFVHDESTDISQVHIVDTRSFCGEPVAKITLPSRVPYGFHGAFFSQ  603



>ref|XP_004292848.1| PREDICTED: carotenoid 9,10(9',10')-cleavage dioxygenase 1-like 
[Fragaria vesca subsp. vesca]
Length=614

 Score =   128 bits (322),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 63/115 (55%), Positives = 74/115 (64%), Gaps = 16/115 (14%)
 Frame = -1

Query  421  GMAKYGGIGKLHLEE------GEAKELINVEYHMLPQNTFCTGAVFVAKADNT-------  281
            G  KY GI KLH EE      G   E I VE HM  +NTFC+GA FV K  ++       
Sbjct  494  GSLKYSGIAKLHFEEPAEREGGLENEEIKVERHMFEENTFCSGAAFVPKQSDSSRAGTSF  553

Query  280  ---EEDDGWIVTFVHDENTNKSQVYMIDAKHFSKEPIATITLPCRVPYGFHGTFI  125
               EEDDGW++TFVH+E+TN SQVY+ID K F  EP+A I LPCRVPYGFHG F+
Sbjct  554  EEVEEDDGWVITFVHNEDTNISQVYVIDTKEFCSEPVAKIALPCRVPYGFHGAFM  608



>ref|XP_008659260.1| PREDICTED: carotenoid 9,10(9',10')-cleavage dioxygenase 1-like 
[Zea mays]
Length=624

 Score =   128 bits (322),  Expect = 2e-31, Method: Composition-based stats.
 Identities = 59/100 (59%), Positives = 74/100 (74%), Gaps = 2/100 (2%)
 Frame = -1

Query  421  GMAKYGGIGKLHLE--EGEAKELINVEYHMLPQNTFCTGAVFVAKADNTEEDDGWIVTFV  248
            G+ K+  I KLH +  + E ++LI VEYH L +  FC+G  FV K +  +EDDGW+VT+V
Sbjct  518  GLFKFNMIAKLHFDTPDKENEQLIFVEYHTLQEQQFCSGVQFVVKENGIDEDDGWLVTYV  577

Query  247  HDENTNKSQVYMIDAKHFSKEPIATITLPCRVPYGFHGTF  128
            HDE TN SQVY+IDAK FS+EP+A ITLP RVPYGFHG F
Sbjct  578  HDERTNISQVYIIDAKRFSEEPVAKITLPQRVPYGFHGNF  617



>ref|XP_004136407.1| PREDICTED: carotenoid 9,10(9',10')-cleavage dioxygenase 1-like 
[Cucumis sativus]
 ref|XP_004165657.1| PREDICTED: carotenoid 9,10(9',10')-cleavage dioxygenase 1-like 
[Cucumis sativus]
Length=625

 Score =   128 bits (322),  Expect = 2e-31, Method: Composition-based stats.
 Identities = 60/105 (57%), Positives = 75/105 (71%), Gaps = 6/105 (6%)
 Frame = -1

Query  421  GMAKYGGIGKLHLE------EGEAKELINVEYHMLPQNTFCTGAVFVAKADNTEEDDGWI  260
            GM K+GG+ KLH +      E    E I VE HML +N++C+GA FV + +  EEDDGWI
Sbjct  516  GMFKFGGLAKLHFQLRTSNDEFSLDEEIKVERHMLEENSYCSGASFVPRENGEEEDDGWI  575

Query  259  VTFVHDENTNKSQVYMIDAKHFSKEPIATITLPCRVPYGFHGTFI  125
            +  VH+E TN SQVY+IDA+ FS+EPIA ITLP RVPYG+HG FI
Sbjct  576  IAHVHNEITNTSQVYIIDARKFSEEPIAKITLPQRVPYGYHGAFI  620



>gb|EEE65142.1| hypothetical protein OsJ_20224 [Oryza sativa Japonica Group]
Length=772

 Score =   129 bits (324),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 59/101 (58%), Positives = 77/101 (76%), Gaps = 2/101 (2%)
 Frame = -1

Query  424  LGMAKYGGIGKLHL--EEGEAKELINVEYHMLPQNTFCTGAVFVAKADNTEEDDGWIVTF  251
            +G+ KY  I K+H   ++ E K+L +VEYH+L + TFC+G  FVAK +  +EDDGWI+T+
Sbjct  669  IGLFKYNRIAKVHFDRQDKENKQLKSVEYHVLKEKTFCSGVQFVAKENGIDEDDGWIITY  728

Query  250  VHDENTNKSQVYMIDAKHFSKEPIATITLPCRVPYGFHGTF  128
            VHDE TN SQVY+IDAK F++EP+  ITLP RVPYGFHG F
Sbjct  729  VHDELTNVSQVYIIDAKRFAEEPVLKITLPQRVPYGFHGNF  769



>ref|XP_007226913.1| hypothetical protein PRUPE_ppa016014mg [Prunus persica]
 gb|EMJ28112.1| hypothetical protein PRUPE_ppa016014mg [Prunus persica]
Length=501

 Score =   126 bits (317),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 61/111 (55%), Positives = 78/111 (70%), Gaps = 11/111 (10%)
 Frame = -1

Query  421  GMAKYGGIGKLHLEE---------GEAKELINVEYHMLPQNTFCTGAVFVAK--ADNTEE  275
            GM KYG + KL+LEE         G+ ++LI VEYH   +  FC+G+VFVA+      EE
Sbjct  386  GMGKYGSLAKLYLEESNSTSFVQEGKCEDLIKVEYHKFEEKNFCSGSVFVARHGGKGMEE  445

Query  274  DDGWIVTFVHDENTNKSQVYMIDAKHFSKEPIATITLPCRVPYGFHGTFIT  122
            DDGWIVTFVH+E T+ +QV++IDAK F  EPIA +TLP RVPYGFH TF++
Sbjct  446  DDGWIVTFVHNEETDVTQVHVIDAKKFESEPIAKLTLPQRVPYGFHATFVS  496



>ref|XP_006371700.1| hypothetical protein POPTR_0018s00350g, partial [Populus trichocarpa]
 gb|ERP49497.1| hypothetical protein POPTR_0018s00350g, partial [Populus trichocarpa]
Length=274

 Score =   123 bits (309),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 59/115 (51%), Positives = 74/115 (64%), Gaps = 8/115 (7%)
 Frame = -1

Query  442  LTSIKPLGMAKYGGIGKLHL--------EEGEAKELINVEYHMLPQNTFCTGAVFVAKAD  287
            LT     G+ KYG + KLH         +EG  ++ +  EYH  P+NTFCTG+ FV K  
Sbjct  155  LTFFHASGICKYGSVAKLHFNEEMSAFSKEGSNEQPVKAEYHKFPENTFCTGSTFVPKQG  214

Query  286  NTEEDDGWIVTFVHDENTNKSQVYMIDAKHFSKEPIATITLPCRVPYGFHGTFIT  122
              EEDDG I+TFVH+E  N SQVY+IDAK F  +PIA +TLP RVPYG HG F++
Sbjct  215  GVEEDDGLIITFVHNEERNVSQVYIIDAKKFESDPIAILTLPQRVPYGHHGVFVS  269



>gb|EMT26925.1| hypothetical protein F775_21549 [Aegilops tauschii]
Length=138

 Score =   119 bits (299),  Expect = 6e-31, Method: Compositional matrix adjust.
 Identities = 57/107 (53%), Positives = 74/107 (69%), Gaps = 8/107 (7%)
 Frame = -1

Query  412  KYGGIGKLHLEEGE--------AKELINVEYHMLPQNTFCTGAVFVAKADNTEEDDGWIV  257
            K+GG  K  L E E         ++ I V+YH L +N FC+GA FV K + T EDDGWIV
Sbjct  31   KFGGFAKFCLHEKEDATTKNKGREDRIKVKYHHLARNQFCSGATFVPKVNGTNEDDGWIV  90

Query  256  TFVHDENTNKSQVYMIDAKHFSKEPIATITLPCRVPYGFHGTFITQN  116
            +FVHDE TNKS+V++I+A+ F  EPIA I LP RVPYGFHG F++++
Sbjct  91   SFVHDEGTNKSKVHIINAQTFEYEPIAKIALPQRVPYGFHGAFVSKS  137



>gb|KCW79101.1| hypothetical protein EUGRSUZ_C00545 [Eucalyptus grandis]
Length=553

 Score =   126 bits (316),  Expect = 6e-31, Method: Composition-based stats.
 Identities = 59/110 (54%), Positives = 75/110 (68%), Gaps = 11/110 (10%)
 Frame = -1

Query  421  GMAKYGGIGKLHLEE-----------GEAKELINVEYHMLPQNTFCTGAVFVAKADNTEE  275
            G+AKYGG+ KL+ +E           G+ K  + VEYH   + +FC+G+VFV K D   E
Sbjct  440  GVAKYGGLAKLYFDEPCPSLSDSEGRGQGKNSVKVEYHNFQKGSFCSGSVFVPKKDGAGE  499

Query  274  DDGWIVTFVHDENTNKSQVYMIDAKHFSKEPIATITLPCRVPYGFHGTFI  125
            D GWIVT+VH+E T+ SQV++IDA+ F  EPIA ITLP RVPYGFHG FI
Sbjct  500  DSGWIVTWVHNEETDVSQVHVIDAQKFESEPIAKITLPQRVPYGFHGAFI  549



>ref|XP_011005228.1| PREDICTED: carotenoid 9,10(9',10')-cleavage dioxygenase 1-like 
[Populus euphratica]
Length=545

 Score =   125 bits (315),  Expect = 9e-31, Method: Compositional matrix adjust.
 Identities = 56/100 (56%), Positives = 70/100 (70%), Gaps = 0/100 (0%)
 Frame = -1

Query  421  GMAKYGGIGKLHLEEGEAKELINVEYHMLPQNTFCTGAVFVAKADNTEEDDGWIVTFVHD  242
            G+ KYG + KLH  E   ++ +  EYH  P+NTFCTG+ FV K    EEDDG I+TFVH+
Sbjct  441  GICKYGSVAKLHFNEEINEQPVKAEYHKFPENTFCTGSTFVPKQGGVEEDDGLIITFVHN  500

Query  241  ENTNKSQVYMIDAKHFSKEPIATITLPCRVPYGFHGTFIT  122
            E  N SQVY+IDAK F  +PIA +TLP RVPYG HG F++
Sbjct  501  EERNVSQVYIIDAKKFESDPIAILTLPQRVPYGHHGVFVS  540



>ref|XP_010918681.1| PREDICTED: carotenoid 9,10(9',10')-cleavage dioxygenase 1-like 
[Elaeis guineensis]
Length=531

 Score =   125 bits (314),  Expect = 9e-31, Method: Compositional matrix adjust.
 Identities = 58/111 (52%), Positives = 77/111 (69%), Gaps = 9/111 (8%)
 Frame = -1

Query  421  GMAKYGGIGKLHLEE---------GEAKELINVEYHMLPQNTFCTGAVFVAKADNTEEDD  269
             + KYG + K +LEE            + L+ VE+H L +N FC+GA FV+K  + +EDD
Sbjct  418  ALPKYGSLAKFYLEEQVNGITELEKHYEHLVKVEHHQLGRNQFCSGAAFVSKRGDCDEDD  477

Query  268  GWIVTFVHDENTNKSQVYMIDAKHFSKEPIATITLPCRVPYGFHGTFITQN  116
            GWIV+FVH+E+TN SQVY+ID K F  +PI  ITLP RVPYGFHGTFI+++
Sbjct  478  GWIVSFVHNEDTNASQVYIIDTKSFESDPIVKITLPQRVPYGFHGTFISRS  528



>ref|XP_008651589.1| PREDICTED: carotenoid cleavage dioxygenase isoform X1 [Zea mays]
Length=593

 Score =   125 bits (315),  Expect = 1e-30, Method: Composition-based stats.
 Identities = 54/105 (51%), Positives = 73/105 (70%), Gaps = 5/105 (5%)
 Frame = -1

Query  412  KYGGIGKLHLEEGEAKE-----LINVEYHMLPQNTFCTGAVFVAKADNTEEDDGWIVTFV  248
            KYGG  K +L+E    E     L+  +YH L ++ FC+GA FV +A  + EDDGW+V+FV
Sbjct  485  KYGGFAKFYLDERSNAEIPGASLVKTQYHWLGKHEFCSGASFVPRAGGSHEDDGWVVSFV  544

Query  247  HDENTNKSQVYMIDAKHFSKEPIATITLPCRVPYGFHGTFITQNL  113
            HDE TN SQV+++DAK F   P+A IT P RVPYGFHGTF+++ +
Sbjct  545  HDEETNTSQVHIVDAKRFEDAPVAKITFPRRVPYGFHGTFVSKKM  589



>tpg|DAA61023.1| TPA: carotenoid cleavage dioxygenase [Zea mays]
Length=611

 Score =   126 bits (316),  Expect = 1e-30, Method: Composition-based stats.
 Identities = 54/105 (51%), Positives = 73/105 (70%), Gaps = 5/105 (5%)
 Frame = -1

Query  412  KYGGIGKLHLEEGEAKE-----LINVEYHMLPQNTFCTGAVFVAKADNTEEDDGWIVTFV  248
            KYGG  K +L+E    E     L+  +YH L ++ FC+GA FV +A  + EDDGW+V+FV
Sbjct  503  KYGGFAKFYLDERSNAEIPGASLVKTQYHWLGKHEFCSGASFVPRAGGSHEDDGWVVSFV  562

Query  247  HDENTNKSQVYMIDAKHFSKEPIATITLPCRVPYGFHGTFITQNL  113
            HDE TN SQV+++DAK F   P+A IT P RVPYGFHGTF+++ +
Sbjct  563  HDEETNTSQVHIVDAKRFEDAPVAKITFPRRVPYGFHGTFVSKKM  607



>ref|XP_008220103.1| PREDICTED: carotenoid 9,10(9',10')-cleavage dioxygenase 1-like 
[Prunus mume]
Length=617

 Score =   125 bits (315),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 61/110 (55%), Positives = 77/110 (70%), Gaps = 10/110 (9%)
 Frame = -1

Query  421  GMAKYGGIGKLHLEE--------GEAKELINVEYHMLPQNTFCTGAVFVAK--ADNTEED  272
            GM K+G + KL+LEE        G+ +ELI VEYH   +N FC G+VFVA+      EED
Sbjct  503  GMGKFGSLAKLYLEESYTTTSAEGKCEELIKVEYHKFEENNFCNGSVFVARHGGKGMEED  562

Query  271  DGWIVTFVHDENTNKSQVYMIDAKHFSKEPIATITLPCRVPYGFHGTFIT  122
            DGWIVTFVH+E T+ +QV++IDA  F  E IA +TLP RVPYGFHGTF++
Sbjct  563  DGWIVTFVHNEETDVTQVHVIDASRFGSEAIAKLTLPQRVPYGFHGTFVS  612



>ref|XP_006853602.1| hypothetical protein AMTR_s00056p00035370 [Amborella trichopoda]
 gb|ERN15069.1| hypothetical protein AMTR_s00056p00035370 [Amborella trichopoda]
Length=151

 Score =   119 bits (297),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 55/108 (51%), Positives = 73/108 (68%), Gaps = 7/108 (6%)
 Frame = -1

Query  421  GMAKYGGIGKLHLE-------EGEAKELINVEYHMLPQNTFCTGAVFVAKADNTEEDDGW  263
            G+A Y    KL+ E       +G  +  I +EYH L +N  C+GAVFV++   T+EDDGW
Sbjct  35   GLATYNMFAKLNFEDLEESHVQGAEERRIKIEYHRLEENQHCSGAVFVSRPGGTDEDDGW  94

Query  262  IVTFVHDENTNKSQVYMIDAKHFSKEPIATITLPCRVPYGFHGTFITQ  119
            IV + H+ENTN S+V MI AK F++ P+A  T+PCRVPYGFHGTFI +
Sbjct  95   IVCYAHNENTNISEVQMIAAKKFTEAPVAKTTIPCRVPYGFHGTFICK  142



>ref|XP_007137213.1| hypothetical protein PHAVU_009G1091001g, partial [Phaseolus vulgaris]
 gb|ESW09207.1| hypothetical protein PHAVU_009G1091001g, partial [Phaseolus vulgaris]
Length=462

 Score =   124 bits (310),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 59/108 (55%), Positives = 74/108 (69%), Gaps = 9/108 (8%)
 Frame = -1

Query  418  MAKYGGIGKLHLEE-------GEAK--ELINVEYHMLPQNTFCTGAVFVAKADNTEEDDG  266
            + KYG + KL+  E       GE +  ELI VEYH   +N FCTG+ FV K    EEDDG
Sbjct  352  IPKYGALAKLYFGEPCSESPMGETRREELIRVEYHRFERNVFCTGSAFVRKEGGVEEDDG  411

Query  265  WIVTFVHDENTNKSQVYMIDAKHFSKEPIATITLPCRVPYGFHGTFIT  122
            WI+TFVH+E+T  SQV++IDAK FS E +A I +PCRVPYGFHG F++
Sbjct  412  WIITFVHNEDTGISQVHIIDAKKFSGEAVAKIAIPCRVPYGFHGAFVS  459



>ref|XP_009804287.1| PREDICTED: carotenoid 9,10(9',10')-cleavage dioxygenase 1-like 
[Nicotiana sylvestris]
Length=581

 Score =   124 bits (311),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 59/99 (60%), Positives = 76/99 (77%), Gaps = 2/99 (2%)
 Frame = -1

Query  421  GMAKYGGIGKLHLEEGEAKELINVEYHMLPQNTFCTGAVFVAKADNTEEDDGWIVTFVHD  242
            G+AKYGG+ KLH +E E      VEYHM P+ TFC+GA FV K   T+E+DGW+VTF H+
Sbjct  483  GLAKYGGLAKLHFQEYEELVE--VEYHMFPKGTFCSGATFVPKTQGTDENDGWVVTFTHN  540

Query  241  ENTNKSQVYMIDAKHFSKEPIATITLPCRVPYGFHGTFI  125
            E+TN SQVY++DAK+F+ +P+A  TLP RVPYGFHG F+
Sbjct  541  ESTNVSQVYVVDAKNFATQPVAIFTLPSRVPYGFHGAFM  579



>ref|XP_011011911.1| PREDICTED: carotenoid 9,10(9',10')-cleavage dioxygenase 1-like, 
partial [Populus euphratica]
Length=345

 Score =   122 bits (305),  Expect = 5e-30, Method: Compositional matrix adjust.
 Identities = 55/100 (55%), Positives = 69/100 (69%), Gaps = 0/100 (0%)
 Frame = -1

Query  421  GMAKYGGIGKLHLEEGEAKELINVEYHMLPQNTFCTGAVFVAKADNTEEDDGWIVTFVHD  242
            G+ KYG + KLH  E   ++ +  EYH  P+NTFCTG+ FV K    EEDDG I+TFVH+
Sbjct  241  GICKYGSVAKLHFNEEINEQPVKAEYHKFPENTFCTGSTFVPKQGGVEEDDGLIITFVHN  300

Query  241  ENTNKSQVYMIDAKHFSKEPIATITLPCRVPYGFHGTFIT  122
            E  N SQVY+IDAK F  + IA +TLP RVPYG HG F++
Sbjct  301  EERNVSQVYIIDAKKFESDSIAILTLPQRVPYGHHGVFVS  340



>ref|XP_008466060.1| PREDICTED: carotenoid 9,10(9',10')-cleavage dioxygenase 1-like 
isoform X3 [Cucumis melo]
Length=614

 Score =   124 bits (311),  Expect = 6e-30, Method: Composition-based stats.
 Identities = 57/106 (54%), Positives = 75/106 (71%), Gaps = 7/106 (7%)
 Frame = -1

Query  421  GMAKYGGIGKLHLEEGEAK-------ELINVEYHMLPQNTFCTGAVFVAKADNTEEDDGW  263
            GM K+GG+ KL  ++  +        E I VE HML +N++C+GA FV + +  EEDDGW
Sbjct  504  GMFKFGGLAKLQFQQHTSNDEFSLDDEEIKVECHMLEENSYCSGASFVPRENGEEEDDGW  563

Query  262  IVTFVHDENTNKSQVYMIDAKHFSKEPIATITLPCRVPYGFHGTFI  125
            I+  VH+E TN SQVY++DA+ FS+EPIA ITLP RVPYGFHG F+
Sbjct  564  IIAHVHNEITNTSQVYVLDARKFSEEPIAKITLPQRVPYGFHGAFM  609



>ref|XP_010235077.1| PREDICTED: carotenoid 9,10(9',10')-cleavage dioxygenase 1-like 
isoform X2 [Brachypodium distachyon]
Length=589

 Score =   124 bits (310),  Expect = 6e-30, Method: Compositional matrix adjust.
 Identities = 59/107 (55%), Positives = 74/107 (69%), Gaps = 8/107 (7%)
 Frame = -1

Query  412  KYGGIGKLHLEEG--------EAKELINVEYHMLPQNTFCTGAVFVAKADNTEEDDGWIV  257
            K+GG  KL+LEE         E ++LINVEYH L  N FC+GA FV   +   ED GWI+
Sbjct  482  KFGGFAKLYLEEAVSKYSELAEKEDLINVEYHHLNANQFCSGATFVPNVNGGHEDHGWII  541

Query  256  TFVHDENTNKSQVYMIDAKHFSKEPIATITLPCRVPYGFHGTFITQN  116
            +FVHDE+TN SQ ++I+ + F  E IA ITLP RVPYGFHGTFI++N
Sbjct  542  SFVHDEDTNISQAHIINTRRFESEAIAKITLPQRVPYGFHGTFISKN  588



>ref|XP_002516497.1| 9-cis-epoxycarotenoid dioxygenase, putative [Ricinus communis]
 gb|EEF45838.1| 9-cis-epoxycarotenoid dioxygenase, putative [Ricinus communis]
Length=469

 Score =   122 bits (307),  Expect = 7e-30, Method: Compositional matrix adjust.
 Identities = 59/99 (60%), Positives = 71/99 (72%), Gaps = 4/99 (4%)
 Frame = -1

Query  421  GMAKYGGIGKLHLEEGEAKELINVEYHMLPQNTFCTGAVFVAKADNTEEDDGWIVTFVHD  242
            G+ K+G + KLH   G A E   VEYH     TFCTGA F+AK     EDDGWIVTFVH+
Sbjct  369  GLPKFGALAKLHFR-GTATE---VEYHKFEVKTFCTGATFIAKEGGLAEDDGWIVTFVHN  424

Query  241  ENTNKSQVYMIDAKHFSKEPIATITLPCRVPYGFHGTFI  125
            E+T  S+V +IDAK+FS +P+A ITLPCRVPYGFHG F+
Sbjct  425  EDTELSEVCIIDAKNFSDKPVAKITLPCRVPYGFHGAFM  463



>gb|AFW85704.1| hypothetical protein ZEAMMB73_647031 [Zea mays]
Length=648

 Score =   124 bits (310),  Expect = 1e-29, Method: Composition-based stats.
 Identities = 59/110 (54%), Positives = 73/110 (66%), Gaps = 12/110 (11%)
 Frame = -1

Query  421  GMAKYGGIGKLHLEE------------GEAKELINVEYHMLPQNTFCTGAVFVAKADNTE  278
            G+ K+  I KLH +              E ++LI VEYH L +  FC+G  FV K +  +
Sbjct  497  GLFKFNMIAKLHFDTPDKYKLKYQKNLQENEQLIFVEYHTLQEQQFCSGVQFVVKENGID  556

Query  277  EDDGWIVTFVHDENTNKSQVYMIDAKHFSKEPIATITLPCRVPYGFHGTF  128
            EDDGW+VT+VHDE TN SQVY+IDAK FS+EP+A ITLP RVPYGFHG F
Sbjct  557  EDDGWLVTYVHDERTNISQVYIIDAKRFSEEPVAKITLPQRVPYGFHGNF  606



>dbj|BAJ99584.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=620

 Score =   122 bits (306),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 56/107 (52%), Positives = 75/107 (70%), Gaps = 5/107 (5%)
 Frame = -1

Query  418  MAKYGGIGKLHLEEGE-----AKELINVEYHMLPQNTFCTGAVFVAKADNTEEDDGWIVT  254
            + KYGG  KL L+E E     A++LI +E H L ++ FC+GA FV +   + EDDGWI++
Sbjct  500  LPKYGGFAKLCLDERENTETWAEDLIKMEIHRLSEDEFCSGASFVPRVGGSHEDDGWIIS  559

Query  253  FVHDENTNKSQVYMIDAKHFSKEPIATITLPCRVPYGFHGTFITQNL  113
            FVH+E TN SQV++ID + F   P+A ITLP RVPYGFHGTF+  N+
Sbjct  560  FVHNERTNTSQVHIIDTQKFEGAPVAKITLPQRVPYGFHGTFVHDNI  606



>gb|EAZ06780.1| hypothetical protein OsI_29024 [Oryza sativa Indica Group]
Length=574

 Score =   121 bits (304),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 60/114 (53%), Positives = 74/114 (65%), Gaps = 7/114 (6%)
 Frame = -1

Query  436  SIKPLGMAKYGGIGKLHLEEGE-------AKELINVEYHMLPQNTFCTGAVFVAKADNTE  278
            S+      K+ G  KL LEE +        ++LI VEYH L +N FC+G  FV KA    
Sbjct  460  SLNLAARPKFIGFAKLCLEEKQNIATKIDREDLIKVEYHQLAKNQFCSGVTFVPKAAGAH  519

Query  277  EDDGWIVTFVHDENTNKSQVYMIDAKHFSKEPIATITLPCRVPYGFHGTFITQN  116
            EDDGWIV+FVHDE TN S+V++IDA++F  EPIA I LP RVPYG HG FIT+ 
Sbjct  520  EDDGWIVSFVHDEETNISKVHIIDARNFESEPIAKIILPQRVPYGLHGAFITKR  573



>gb|EAZ42528.1| hypothetical protein OsJ_27094 [Oryza sativa Japonica Group]
Length=574

 Score =   121 bits (304),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 60/114 (53%), Positives = 74/114 (65%), Gaps = 7/114 (6%)
 Frame = -1

Query  436  SIKPLGMAKYGGIGKLHLEEGE-------AKELINVEYHMLPQNTFCTGAVFVAKADNTE  278
            S+      K+ G  KL LEE +        ++LI VEYH L +N FC+G  FV KA    
Sbjct  460  SLNLAARPKFIGFAKLCLEEKQNIATKIDREDLIKVEYHQLAKNQFCSGVTFVPKAAGAH  519

Query  277  EDDGWIVTFVHDENTNKSQVYMIDAKHFSKEPIATITLPCRVPYGFHGTFITQN  116
            EDDGWIV+FVHDE TN S+V++IDA++F  EPIA I LP RVPYG HG FIT+ 
Sbjct  520  EDDGWIVSFVHDEETNISKVHIIDARNFESEPIAKIILPQRVPYGLHGAFITKR  573



>ref|XP_004501162.1| PREDICTED: carotenoid 9,10(9',10')-cleavage dioxygenase 1-like 
isoform X1 [Cicer arietinum]
Length=590

 Score =   120 bits (302),  Expect = 7e-29, Method: Composition-based stats.
 Identities = 54/105 (51%), Positives = 72/105 (69%), Gaps = 9/105 (9%)
 Frame = -1

Query  412  KYGGIGKLHLEEG---------EAKELINVEYHMLPQNTFCTGAVFVAKADNTEEDDGWI  260
            KY G+ KL+ EE          +  E I +EYHM  +NTFC G+ FV +    EEDDGWI
Sbjct  479  KYRGLAKLYFEESSTDICLSIRDKDEPIRMEYHMFEKNTFCNGSTFVPRDGGVEEDDGWI  538

Query  259  VTFVHDENTNKSQVYMIDAKHFSKEPIATITLPCRVPYGFHGTFI  125
            +TFVH+E+TNKS+V++ID ++ + E IA I +PCRVPYGFHG F+
Sbjct  539  ITFVHNEDTNKSEVHIIDTQNLTGEAIAKIGMPCRVPYGFHGAFM  583



>dbj|BAD03492.1| putative Lignostilbene-alpha,beta-dioxygenase and related enzymes 
[Oryza sativa Japonica Group]
 dbj|BAD03543.1| putative Lignostilbene-alpha,beta-dioxygenase and related enzymes 
[Oryza sativa Japonica Group]
Length=663

 Score =   121 bits (304),  Expect = 8e-29, Method: Compositional matrix adjust.
 Identities = 60/114 (53%), Positives = 74/114 (65%), Gaps = 7/114 (6%)
 Frame = -1

Query  436  SIKPLGMAKYGGIGKLHLEEGE-------AKELINVEYHMLPQNTFCTGAVFVAKADNTE  278
            S+      K+ G  KL LEE +        ++LI VEYH L +N FC+G  FV KA    
Sbjct  549  SLNLAARPKFIGFAKLCLEEKQNIATKIDREDLIKVEYHQLAKNQFCSGVTFVPKAAGAH  608

Query  277  EDDGWIVTFVHDENTNKSQVYMIDAKHFSKEPIATITLPCRVPYGFHGTFITQN  116
            EDDGWIV+FVHDE TN S+V++IDA++F  EPIA I LP RVPYG HG FIT+ 
Sbjct  609  EDDGWIVSFVHDEETNISKVHIIDARNFESEPIAKIILPQRVPYGLHGAFITKR  662



>ref|XP_007224472.1| hypothetical protein PRUPE_ppa022654mg [Prunus persica]
 gb|EMJ25671.1| hypothetical protein PRUPE_ppa022654mg [Prunus persica]
Length=545

 Score =   120 bits (301),  Expect = 9e-29, Method: Compositional matrix adjust.
 Identities = 58/104 (56%), Positives = 73/104 (70%), Gaps = 4/104 (4%)
 Frame = -1

Query  421  GMAKYGGIGKLHLEEGEA--KELINVEYHMLPQNTFCTGAVFVAK--ADNTEEDDGWIVT  254
            GM K+G + KL+LEE  A    LI VEYH   +N FC G+VFVA+      EEDDGWIVT
Sbjct  437  GMGKFGSLAKLYLEESYATTSALIKVEYHKFEENNFCNGSVFVARHGGKGMEEDDGWIVT  496

Query  253  FVHDENTNKSQVYMIDAKHFSKEPIATITLPCRVPYGFHGTFIT  122
             VH+E T+ +QV++IDA  F  + IA +TLP RVPYGFHGTF++
Sbjct  497  LVHNEETDVTQVHVIDASRFGSDAIAKLTLPQRVPYGFHGTFVS  540



>ref|XP_009367500.1| PREDICTED: carotenoid 9,10(9',10')-cleavage dioxygenase 1-like 
[Pyrus x bretschneideri]
 ref|XP_009368017.1| PREDICTED: carotenoid 9,10(9',10')-cleavage dioxygenase 1-like 
[Pyrus x bretschneideri]
Length=615

 Score =   120 bits (300),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 57/113 (50%), Positives = 74/113 (65%), Gaps = 13/113 (12%)
 Frame = -1

Query  421  GMAKYGGIGKLHL-------------EEGEAKELINVEYHMLPQNTFCTGAVFVAKADNT  281
            G+ K+G + KL+L             E    ++ I VEYH   +N FC+G+VFV +    
Sbjct  500  GLGKFGALAKLYLDDQSHSTPSGDQEERCSDQQWIKVEYHKFEENNFCSGSVFVPRHGGI  559

Query  280  EEDDGWIVTFVHDENTNKSQVYMIDAKHFSKEPIATITLPCRVPYGFHGTFIT  122
            EEDDGWIVTFVH+ENT+ +QV++IDA  F  EPI  ITLP RVPYGFHGTF++
Sbjct  560  EEDDGWIVTFVHNENTHVTQVHVIDAMKFQSEPIVKITLPQRVPYGFHGTFLS  612



>ref|XP_004300716.1| PREDICTED: carotenoid 9,10(9',10')-cleavage dioxygenase 1-like 
[Fragaria vesca subsp. vesca]
Length=563

 Score =   119 bits (298),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 55/102 (54%), Positives = 74/102 (73%), Gaps = 3/102 (3%)
 Frame = -1

Query  421  GMAKYGGIGKLHLEEGE---AKELINVEYHMLPQNTFCTGAVFVAKADNTEEDDGWIVTF  251
            GMAK+G + KL+LEE      +  I VEYH   +N FC+G+VFV +    +EDDGWI++F
Sbjct  455  GMAKFGSLAKLYLEESNPTYQEGRIKVEYHKFEENNFCSGSVFVPRNGGIKEDDGWIISF  514

Query  250  VHDENTNKSQVYMIDAKHFSKEPIATITLPCRVPYGFHGTFI  125
            VH+E T+++QV++IDA++F  E IA ITLP RVPYGFHG F 
Sbjct  515  VHNEETDETQVHIIDAQNFEGEAIAKITLPQRVPYGFHGNFF  556



>ref|XP_004292849.1| PREDICTED: carotenoid 9,10(9',10')-cleavage dioxygenase 1-like 
[Fragaria vesca subsp. vesca]
Length=569

 Score =   119 bits (298),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 54/109 (50%), Positives = 75/109 (69%), Gaps = 9/109 (8%)
 Frame = -1

Query  421  GMAKYGGIGKLHLEEGEAKELI---------NVEYHMLPQNTFCTGAVFVAKADNTEEDD  269
            GMAKYG + K++LEE  + + +          VEYH    N FC+G+VFV +    +EDD
Sbjct  455  GMAKYGSLAKIYLEESNSTKFVEGRGGNLFPKVEYHKFEDNNFCSGSVFVPRNGGIKEDD  514

Query  268  GWIVTFVHDENTNKSQVYMIDAKHFSKEPIATITLPCRVPYGFHGTFIT  122
            GWI+TFVH+E T+ +QV++IDA+ F  E IA +T+P RVPYGFHGTF++
Sbjct  515  GWIITFVHNEGTDVTQVHIIDAQDFEGETIAKLTMPQRVPYGFHGTFVS  563



>ref|XP_004501163.1| PREDICTED: carotenoid 9,10(9',10')-cleavage dioxygenase 1-like 
isoform X2 [Cicer arietinum]
Length=543

 Score =   119 bits (297),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 54/105 (51%), Positives = 72/105 (69%), Gaps = 9/105 (9%)
 Frame = -1

Query  412  KYGGIGKLHLEEG---------EAKELINVEYHMLPQNTFCTGAVFVAKADNTEEDDGWI  260
            KY G+ KL+ EE          +  E I +EYHM  +NTFC G+ FV +    EEDDGWI
Sbjct  432  KYRGLAKLYFEESSTDICLSIRDKDEPIRMEYHMFEKNTFCNGSTFVPRDGGVEEDDGWI  491

Query  259  VTFVHDENTNKSQVYMIDAKHFSKEPIATITLPCRVPYGFHGTFI  125
            +TFVH+E+TNKS+V++ID ++ + E IA I +PCRVPYGFHG F+
Sbjct  492  ITFVHNEDTNKSEVHIIDTQNLTGEAIAKIGMPCRVPYGFHGAFM  536



>gb|KGN60324.1| hypothetical protein Csa_3G895700 [Cucumis sativus]
Length=91

 Score =   111 bits (277),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 52/85 (61%), Positives = 64/85 (75%), Gaps = 1/85 (1%)
 Frame = -1

Query  376  GEAKELINVEYHMLPQNTFCTGAVFVAKADNTEEDDGWIVTFVHDENTNKS-QVYMIDAK  200
            G   E I VE HML +N++C+GA FV + +  EEDDGWI+  VH+E TN S QVY+IDA+
Sbjct  2    GMQDEEIKVERHMLEENSYCSGASFVPRENGEEEDDGWIIAHVHNEITNTSQQVYIIDAR  61

Query  199  HFSKEPIATITLPCRVPYGFHGTFI  125
             FS+EPIA ITLP RVPYG+HG FI
Sbjct  62   KFSEEPIAKITLPQRVPYGYHGAFI  86



>ref|XP_006581448.1| PREDICTED: carotenoid 9,10(9',10')-cleavage dioxygenase-like 
isoform X2 [Glycine max]
Length=586

 Score =   119 bits (297),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 58/108 (54%), Positives = 73/108 (68%), Gaps = 10/108 (9%)
 Frame = -1

Query  418  MAKYGGIGKLHLEEGEAK----------ELINVEYHMLPQNTFCTGAVFVAKADNTEEDD  269
            + KYGG+ KL+ EE  AK          E I VE HM  +NTFC+GA FV +    EEDD
Sbjct  472  VPKYGGLAKLYFEESCAKFSMRNREQPEEPIRVECHMFEKNTFCSGAAFVPRDGGLEEDD  531

Query  268  GWIVTFVHDENTNKSQVYMIDAKHFSKEPIATITLPCRVPYGFHGTFI  125
            GWI+ FVH+E+TN S+V++ID K FS E +A IT+P RVPYGFHG F+
Sbjct  532  GWIIAFVHNEDTNISEVHIIDTKKFSGETVAKITMPRRVPYGFHGAFM  579



>ref|XP_003576413.2| PREDICTED: carotenoid 9,10(9',10')-cleavage dioxygenase-like 
[Brachypodium distachyon]
Length=628

 Score =   119 bits (298),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 55/109 (50%), Positives = 74/109 (68%), Gaps = 7/109 (6%)
 Frame = -1

Query  418  MAKYGGIGKLHL-------EEGEAKELINVEYHMLPQNTFCTGAVFVAKADNTEEDDGWI  260
            + KYGG  K+ L       +E   ++LI +E H L ++ FC+GA FV +   + EDDGWI
Sbjct  520  LPKYGGFAKICLADRQNVNKETSEEDLIKMEKHWLGEDQFCSGASFVPRVGGSHEDDGWI  579

Query  259  VTFVHDENTNKSQVYMIDAKHFSKEPIATITLPCRVPYGFHGTFITQNL  113
            ++FVH+E TNKSQV++ID + F   P+A ITLP RVPYGFHGTF+  NL
Sbjct  580  ISFVHNERTNKSQVHIIDTRRFEGAPVAKITLPQRVPYGFHGTFVHTNL  628



>gb|KHN18174.1| Carotenoid 9,10(9',10')-cleavage dioxygenase, partial [Glycine 
soja]
Length=638

 Score =   119 bits (297),  Expect = 6e-28, Method: Compositional matrix adjust.
 Identities = 58/108 (54%), Positives = 73/108 (68%), Gaps = 10/108 (9%)
 Frame = -1

Query  418  MAKYGGIGKLHLEEGEAK----------ELINVEYHMLPQNTFCTGAVFVAKADNTEEDD  269
            + KYGG+ KL+ EE  AK          E I VE HM  +NTFC+GA FV +    EEDD
Sbjct  524  VPKYGGLAKLYFEESCAKFSMRNREQPEEPIRVECHMFEKNTFCSGAAFVPRDGGLEEDD  583

Query  268  GWIVTFVHDENTNKSQVYMIDAKHFSKEPIATITLPCRVPYGFHGTFI  125
            GWI+ FVH+E+TN S+V++ID K FS E +A IT+P RVPYGFHG F+
Sbjct  584  GWIIAFVHNEDTNISEVHIIDTKKFSGETVAKITMPRRVPYGFHGAFM  631



>ref|XP_006581447.1| PREDICTED: carotenoid 9,10(9',10')-cleavage dioxygenase-like 
isoform X1 [Glycine max]
Length=587

 Score =   118 bits (296),  Expect = 6e-28, Method: Compositional matrix adjust.
 Identities = 58/109 (53%), Positives = 73/109 (67%), Gaps = 11/109 (10%)
 Frame = -1

Query  418  MAKYGGIGKLHLEEGEAK-----------ELINVEYHMLPQNTFCTGAVFVAKADNTEED  272
            + KYGG+ KL+ EE  AK           E I VE HM  +NTFC+GA FV +    EED
Sbjct  472  VPKYGGLAKLYFEESCAKFSMQRNREQPEEPIRVECHMFEKNTFCSGAAFVPRDGGLEED  531

Query  271  DGWIVTFVHDENTNKSQVYMIDAKHFSKEPIATITLPCRVPYGFHGTFI  125
            DGWI+ FVH+E+TN S+V++ID K FS E +A IT+P RVPYGFHG F+
Sbjct  532  DGWIIAFVHNEDTNISEVHIIDTKKFSGETVAKITMPRRVPYGFHGAFM  580



>ref|XP_008466059.1| PREDICTED: carotenoid 9,10(9',10')-cleavage dioxygenase 1-like 
isoform X2 [Cucumis melo]
Length=650

 Score =   119 bits (297),  Expect = 7e-28, Method: Composition-based stats.
 Identities = 55/102 (54%), Positives = 72/102 (71%), Gaps = 7/102 (7%)
 Frame = -1

Query  421  GMAKYGGIGKLHLEEGEAK-------ELINVEYHMLPQNTFCTGAVFVAKADNTEEDDGW  263
            GM K+GG+ KL  ++  +        E I VE HML +N++C+GA FV + +  EEDDGW
Sbjct  504  GMFKFGGLAKLQFQQHTSNDEFSLDDEEIKVECHMLEENSYCSGASFVPRENGEEEDDGW  563

Query  262  IVTFVHDENTNKSQVYMIDAKHFSKEPIATITLPCRVPYGFH  137
            I+  VH+E TN SQVY++DA+ FS+EPIA ITLP RVPYGFH
Sbjct  564  IIAHVHNEITNTSQVYVLDARKFSEEPIAKITLPQRVPYGFH  605



>gb|KEH36059.1| retinal pigment epithelial membrane protein [Medicago truncatula]
Length=586

 Score =   118 bits (295),  Expect = 8e-28, Method: Compositional matrix adjust.
 Identities = 60/114 (53%), Positives = 75/114 (66%), Gaps = 9/114 (8%)
 Frame = -1

Query  439  TSIKPLGMAKYGGIGKLHLEE---------GEAKELINVEYHMLPQNTFCTGAVFVAKAD  287
            TS     + KY GI KL+LEE          E +E I +EYHM  +NTFC GA FV +  
Sbjct  465  TSSTTQDVPKYRGIAKLYLEETCAEFSMSKREKEEPIRMEYHMFEKNTFCNGAAFVPRDG  524

Query  286  NTEEDDGWIVTFVHDENTNKSQVYMIDAKHFSKEPIATITLPCRVPYGFHGTFI  125
              EEDDG I+TFVH+E+TN SQV++ID K+FS E +A I +P RVPYGFHG F+
Sbjct  525  GVEEDDGLIITFVHNEDTNTSQVHIIDTKNFSGETVAKIEIPFRVPYGFHGAFM  578



>ref|XP_003523739.1| PREDICTED: carotenoid 9,10(9',10')-cleavage dioxygenase 1-like 
[Glycine max]
Length=569

 Score =   117 bits (294),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 55/104 (53%), Positives = 71/104 (68%), Gaps = 2/104 (2%)
 Frame = -1

Query  418  MAKYGGIGKLHLEE--GEAKELINVEYHMLPQNTFCTGAVFVAKADNTEEDDGWIVTFVH  245
            + KYG + KL+  E   E  + I VEYH   +N FCTG+ FV K    EEDDGWI+TFVH
Sbjct  466  IPKYGALAKLYFREPCSEFPKPIRVEYHRFERNVFCTGSAFVPKEGGIEEDDGWIITFVH  525

Query  244  DENTNKSQVYMIDAKHFSKEPIATITLPCRVPYGFHGTFITQNL  113
            +E+T  SQV++I+ K FS E +A IT+P RVPYGFHG F+  +L
Sbjct  526  NEDTGISQVHIIETKKFSGEAVAKITMPFRVPYGFHGAFMPLSL  569



>ref|XP_003527837.1| PREDICTED: carotenoid 9,10(9',10')-cleavage dioxygenase 1-like 
[Glycine max]
Length=577

 Score =   117 bits (293),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 58/107 (54%), Positives = 72/107 (67%), Gaps = 9/107 (8%)
 Frame = -1

Query  418  MAKYGGIGKLHLEE-------GEAK--ELINVEYHMLPQNTFCTGAVFVAKADNTEEDDG  266
            + KYG + KL+  E       GE +  ELI VEYH   +N FCTG+ FV K    EEDDG
Sbjct  467  IPKYGALAKLYFGEPCSEFPVGETQQEELIRVEYHTFERNVFCTGSAFVPKEGGIEEDDG  526

Query  265  WIVTFVHDENTNKSQVYMIDAKHFSKEPIATITLPCRVPYGFHGTFI  125
            WI+TFVH+E+T  SQV++ID K FS E +A IT+P RVPYGFHG F+
Sbjct  527  WIITFVHNEDTGISQVHIIDTKKFSGEAVAKITMPFRVPYGFHGAFM  573



>emb|CBI20857.3| unnamed protein product [Vitis vinifera]
Length=556

 Score =   117 bits (293),  Expect = 1e-27, Method: Composition-based stats.
 Identities = 55/103 (53%), Positives = 72/103 (70%), Gaps = 5/103 (5%)
 Frame = -1

Query  418  MAKYGGIGKLHLEEGEAK-----ELINVEYHMLPQNTFCTGAVFVAKADNTEEDDGWIVT  254
            + K GGI K+  EE ++      + + V+ H   +N+FCTG+ F +K  +  EDDGWIV+
Sbjct  448  LPKCGGIAKIFFEEQDSMLPKNGQRMKVKCHSFGENSFCTGSAFASKVGSCVEDDGWIVS  507

Query  253  FVHDENTNKSQVYMIDAKHFSKEPIATITLPCRVPYGFHGTFI  125
            FVH ENT+ SQV++IDA  F+ EPIA ITLP RVPYGFHGTFI
Sbjct  508  FVHIENTDVSQVHIIDASKFNCEPIAKITLPQRVPYGFHGTFI  550



>gb|KHN18175.1| Carotenoid 9,10(9',10')-cleavage dioxygenase 1 [Glycine soja]
Length=581

 Score =   117 bits (293),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 58/107 (54%), Positives = 72/107 (67%), Gaps = 9/107 (8%)
 Frame = -1

Query  418  MAKYGGIGKLHLEE-------GEAK--ELINVEYHMLPQNTFCTGAVFVAKADNTEEDDG  266
            + KYG + KL+  E       GE +  ELI VEYH   +N FCTG+ FV K    EEDDG
Sbjct  471  IPKYGALAKLYFGEPCSEFPVGETQQEELIRVEYHTFERNVFCTGSAFVPKEGGIEEDDG  530

Query  265  WIVTFVHDENTNKSQVYMIDAKHFSKEPIATITLPCRVPYGFHGTFI  125
            WI+TFVH+E+T  SQV++ID K FS E +A IT+P RVPYGFHG F+
Sbjct  531  WIITFVHNEDTGISQVHIIDTKKFSGEAVAKITMPFRVPYGFHGAFM  577



>ref|XP_010051226.1| PREDICTED: carotenoid 9,10(9',10')-cleavage dioxygenase 1-like 
[Eucalyptus grandis]
Length=870

 Score =   118 bits (296),  Expect = 1e-27, Method: Composition-based stats.
 Identities = 55/113 (49%), Positives = 77/113 (68%), Gaps = 14/113 (12%)
 Frame = -1

Query  421  GMAKYGGIGKLHLEE-----------GEAKELINVEYHMLPQNTFCTGAVFVAKADNTEE  275
            G+AKYGG+ KL+L+E           GE ++ + V+YHM  ++ FC+G+VF+AK D  E 
Sbjct  752  GLAKYGGLAKLYLDEPHVEQSTVSIEGENEQAVKVKYHMFGESNFCSGSVFIAKNDGGEG  811

Query  274  ---DDGWIVTFVHDENTNKSQVYMIDAKHFSKEPIATITLPCRVPYGFHGTFI  125
               D GWI TFVH+E ++++QV++ID K F  EP+  I LP RVPYGFHGTF+
Sbjct  812  EGEDSGWIATFVHNEVSDETQVHIIDVKDFEGEPVTKIKLPQRVPYGFHGTFM  864



>ref|XP_006853598.1| hypothetical protein AMTR_s00056p00029160 [Amborella trichopoda]
 gb|ERN15065.1| hypothetical protein AMTR_s00056p00029160 [Amborella trichopoda]
Length=313

 Score =   114 bits (286),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 53/105 (50%), Positives = 72/105 (69%), Gaps = 5/105 (5%)
 Frame = -1

Query  418  MAKYGGIGKLHLEEGEAKE-----LINVEYHMLPQNTFCTGAVFVAKADNTEEDDGWIVT  254
            + KYG   KL  EE + K+     +I +EYH L +N FC+G  FVAK    +ED+GW+++
Sbjct  202  ILKYGKFAKLCFEEIQEKQRGSENMIKIEYHELEENQFCSGLAFVAKPGQGKEDEGWLIS  261

Query  253  FVHDENTNKSQVYMIDAKHFSKEPIATITLPCRVPYGFHGTFITQ  119
            FVH+E+ N SQVY+ID K+F   P+A ITLP RVPYGFH  FI++
Sbjct  262  FVHNEDANLSQVYIIDVKNFCGGPVAKITLPKRVPYGFHSAFISK  306



>ref|XP_009389962.1| PREDICTED: carotenoid 9,10(9',10')-cleavage dioxygenase 1-like 
[Musa acuminata subsp. malaccensis]
Length=620

 Score =   117 bits (293),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 55/103 (53%), Positives = 76/103 (74%), Gaps = 3/103 (3%)
 Frame = -1

Query  424  LGMAKYGGIGKLH--LEEGEAKELINVEYHMLPQNTFCTGAVFVAKADNTEE-DDGWIVT  254
            LG++KY  + KLH  L++ + +EL  VEYH L    +CTGA FV K + TEE DDGW++ 
Sbjct  516  LGLSKYNMLAKLHFGLQDEDDEELAKVEYHELGDGEYCTGAQFVQKQEGTEEEDDGWLLC  575

Query  253  FVHDENTNKSQVYMIDAKHFSKEPIATITLPCRVPYGFHGTFI  125
            +VHDE +N S+VY+IDAK F++EP+A I+LP RVPYGFH  ++
Sbjct  576  YVHDERSNISKVYVIDAKRFTEEPVAKISLPRRVPYGFHAYYV  618



>ref|XP_009804286.1| PREDICTED: carotenoid 9,10(9',10')-cleavage dioxygenase 1-like 
isoform X2 [Nicotiana sylvestris]
Length=584

 Score =   117 bits (292),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 55/105 (52%), Positives = 68/105 (65%), Gaps = 11/105 (10%)
 Frame = -1

Query  439  TSIKPLGMAKYGGIGKLHLEEGEAKELINVEYHMLPQNTFCTGAVFVAKADNTEEDDGWI  260
            T I   G  ++GG+ KLH EE             +P NTFC+GA FV K    +EDDG I
Sbjct  487  TEISGSGFTRFGGVAKLHFEEKR-----------IPTNTFCSGASFVPKPGGVDEDDGSI  535

Query  259  VTFVHDENTNKSQVYMIDAKHFSKEPIATITLPCRVPYGFHGTFI  125
            +TF H+EN N SQVY++DAK F+ EP+A ITLP RVPYGFHG F+
Sbjct  536  ITFTHNENENISQVYIVDAKKFTNEPVAIITLPSRVPYGFHGAFM  580



>ref|XP_007012120.1| Carotenoid cleavage dioxygenase 1-like protein [Theobroma cacao]
 gb|EOY29739.1| Carotenoid cleavage dioxygenase 1-like protein [Theobroma cacao]
Length=361

 Score =   114 bits (284),  Expect = 5e-27, Method: Compositional matrix adjust.
 Identities = 54/90 (60%), Positives = 64/90 (71%), Gaps = 4/90 (4%)
 Frame = -1

Query  382  EEGEAKELINVEYHMLPQNTFCTGAVFVAKADNTEEDDGWIVTFVHDENTNKSQVYMIDA  203
            EEG    LI VEYHM  +NT+CTGA FV K    EEDDGWI+TF+H E+TN SQ Y+ID 
Sbjct  255  EEG----LIKVEYHMFEENTYCTGAAFVPKEGGAEEDDGWIITFLHHEDTNISQAYIIDT  310

Query  202  KHFSKEPIATITLPCRVPYGFHGTFITQNL  113
            ++FS E +A  TLPCRVP GFHG F+   L
Sbjct  311  ENFSSEAVAKTTLPCRVPDGFHGAFMPIQL  340



>emb|CDP16200.1| unnamed protein product [Coffea canephora]
Length=616

 Score =   116 bits (290),  Expect = 5e-27, Method: Compositional matrix adjust.
 Identities = 57/109 (52%), Positives = 71/109 (65%), Gaps = 10/109 (9%)
 Frame = -1

Query  421  GMAKYGGIGKLHLEEG---------EAKELINVEYHMLPQNTFCTGAVFVAKADNTEEDD  269
            GMAKYGG+ KL+ E+          + +E + VE H   +NTFC+GA FV  +   EEDD
Sbjct  502  GMAKYGGLAKLYFEDKAFDLSLLDYQPEESMKVERHKFQENTFCSGATFVPNSVGVEEDD  561

Query  268  GWIVTFVHDENTNKSQV-YMIDAKHFSKEPIATITLPCRVPYGFHGTFI  125
            GWI+ FVH+E TN SQ  Y+   K F+ EPIA ITLP RVPYGFHG F+
Sbjct  562  GWIIAFVHNERTNISQASYITFTKKFASEPIAKITLPSRVPYGFHGAFL  610



>gb|KCW81562.1| hypothetical protein EUGRSUZ_C02920 [Eucalyptus grandis]
Length=595

 Score =   115 bits (287),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 55/111 (50%), Positives = 77/111 (69%), Gaps = 11/111 (10%)
 Frame = -1

Query  421  GMAKYGGIGKLHLEE--------GEAKELINVEYHMLPQNTFCTGAVFVAKADNTEE---  275
            G+AKYGG+ KL+L+E        GE ++ + V+YHM  ++ FC+G+VF+AK D  E    
Sbjct  480  GLAKYGGLAKLYLDEPHVEQSTEGENEQAVKVKYHMFGESNFCSGSVFIAKNDGGEGEGE  539

Query  274  DDGWIVTFVHDENTNKSQVYMIDAKHFSKEPIATITLPCRVPYGFHGTFIT  122
            D GWI TFVH+E ++++QV++ID K F  EP+  I LP RVPYGFHGTF+ 
Sbjct  540  DSGWIATFVHNEVSDETQVHIIDVKDFEGEPVTKIKLPQRVPYGFHGTFMA  590



>ref|XP_004956566.1| PREDICTED: carotenoid 9,10(9',10')-cleavage dioxygenase-like 
[Setaria italica]
Length=610

 Score =   114 bits (285),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 53/101 (52%), Positives = 69/101 (68%), Gaps = 5/101 (5%)
 Frame = -1

Query  412  KYGGIGKLHLEEGEAKE-----LINVEYHMLPQNTFCTGAVFVAKADNTEEDDGWIVTFV  248
            KY G  K  L++  + E     LI + YH L ++ FC+GA FV +   + EDDGWI++FV
Sbjct  508  KYRGFAKFFLKKRNSTEIAGSSLIKMHYHWLGKDQFCSGAAFVPRVGGSHEDDGWIISFV  567

Query  247  HDENTNKSQVYMIDAKHFSKEPIATITLPCRVPYGFHGTFI  125
            H+E TN SQV++IDA+ F   P+A ITLP RVPYGFHGTFI
Sbjct  568  HNEKTNTSQVHIIDAQRFEDAPVAKITLPRRVPYGFHGTFI  608



>gb|KHN10199.1| Carotenoid 9,10(9',10')-cleavage dioxygenase 1 [Glycine soja]
Length=905

 Score =   115 bits (287),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 56/110 (51%), Positives = 74/110 (67%), Gaps = 8/110 (7%)
 Frame = -1

Query  418  MAKYGGIGKLHLEE-------GEAKEL-INVEYHMLPQNTFCTGAVFVAKADNTEEDDGW  263
            + KYG + KL+  E       G+ ++  I VEYH   +N FCTG+ FV K    EEDDGW
Sbjct  796  IPKYGALVKLYFREPCSEFPKGDTQQKPIRVEYHRFERNVFCTGSAFVPKEGGIEEDDGW  855

Query  262  IVTFVHDENTNKSQVYMIDAKHFSKEPIATITLPCRVPYGFHGTFITQNL  113
            I+TFVH+E+T  SQV++ID+K FS E +A IT+P RVPYGFHG F+  +L
Sbjct  856  IITFVHNEDTGISQVHIIDSKKFSGEAVAKITMPFRVPYGFHGAFMPLSL  905



>ref|XP_007137216.1| hypothetical protein PHAVU_009G109200g [Phaseolus vulgaris]
 gb|ESW09210.1| hypothetical protein PHAVU_009G109200g [Phaseolus vulgaris]
Length=596

 Score =   113 bits (283),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 54/110 (49%), Positives = 73/110 (66%), Gaps = 10/110 (9%)
 Frame = -1

Query  412  KYGGIGKLHLE----------EGEAKELINVEYHMLPQNTFCTGAVFVAKADNTEEDDGW  263
            KYGG+ KL++E          + + +E I VE HM  +NTFC+GA FV +    EEDDGW
Sbjct  473  KYGGLAKLYVEGSCTEFSMGVKEQPEEPIRVECHMFEKNTFCSGAAFVPREGGLEEDDGW  532

Query  262  IVTFVHDENTNKSQVYMIDAKHFSKEPIATITLPCRVPYGFHGTFITQNL  113
            I+ FVH+E+TN S+V++IDAK F  E +  IT+P RVPYGFHG F+  + 
Sbjct  533  IIAFVHNEDTNISEVHIIDAKKFCGEMVTKITMPRRVPYGFHGAFMQNSF  582



>ref|XP_006661114.1| PREDICTED: carotenoid 9,10(9',10')-cleavage dioxygenase 1-like 
[Oryza brachyantha]
Length=597

 Score =   112 bits (279),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 55/108 (51%), Positives = 70/108 (65%), Gaps = 16/108 (15%)
 Frame = -1

Query  418  MAKYGGIGKLHLEEGE------AKELINVEYHMLPQNTFCTGAVFVAKADNTEEDDGWIV  257
            + KYGG+ KL+LEE +      +K+LI  EYH L ++ FC+GAVFV +   T EDDGWI+
Sbjct  496  ILKYGGLAKLYLEERDNVTTETSKDLIKAEYHWLGKDEFCSGAVFVPRVGGTHEDDGWII  555

Query  256  TFVHDENTNKSQVYMIDAKHFSKEPIATITLPCRVPYGFHGTFITQNL  113
            +FVH          +IDA+ F   P+A I LP RVPYGFHGTFIT  L
Sbjct  556  SFVH----------IIDAQRFEGAPVAKIILPRRVPYGFHGTFITNKL  593



>ref|XP_006371697.1| hypothetical protein POPTR_0018s00320g, partial [Populus trichocarpa]
 gb|ERP49494.1| hypothetical protein POPTR_0018s00320g, partial [Populus trichocarpa]
Length=293

 Score =   105 bits (261),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 52/100 (52%), Positives = 67/100 (67%), Gaps = 12/100 (12%)
 Frame = -1

Query  421  GMAKYGGIGKLHLEE----------GEAKELINVEYHMLPQNTFCTGAVFVAKADNTEED  272
            G+ KYGG+ KL+ EE          G+++ELI VEYH   QNTFCT A  V K  + EED
Sbjct  194  GVPKYGGLAKLYFEEPETNKINSQGGQSEELIKVEYHKSEQNTFCTEAALVPKQGSHEED  253

Query  271  DGWIVTFVHDENTN--KSQVYMIDAKHFSKEPIATITLPC  158
            DGWI+TFVH+E+T+    + Y+ID K F+ EP+A ITLPC
Sbjct  254  DGWIITFVHNEDTSICPKKAYIIDTKKFTSEPVAKITLPC  293



>ref|XP_002462199.1| hypothetical protein SORBIDRAFT_02g021480 [Sorghum bicolor]
 gb|EER98720.1| hypothetical protein SORBIDRAFT_02g021480 [Sorghum bicolor]
Length=293

 Score =   105 bits (261),  Expect = 5e-24, Method: Compositional matrix adjust.
 Identities = 54/122 (44%), Positives = 69/122 (57%), Gaps = 24/122 (20%)
 Frame = -1

Query  412  KYGGIGKLHLEEGEAKE-----LINVEYHMLPQNTFCTGAVFVAKADNTEEDDGWIVTFV  248
            KY G  K  L++    E     LI  +YH L ++ FC+GA FV +   + EDDGWI++FV
Sbjct  172  KYRGFAKFLLDKRNNTEISGANLIKTQYHWLSKDEFCSGATFVPRVSGSHEDDGWIISFV  231

Query  247  HDENTNKS-------------------QVYMIDAKHFSKEPIATITLPCRVPYGFHGTFI  125
            HDE TN S                   QV++IDA+ F   P+A I LP RVPYGFHGTFI
Sbjct  232  HDETTNTSQASVVYFIYISDPICPTSIQVHIIDAQRFEDAPVAKIALPQRVPYGFHGTFI  291

Query  124  TQ  119
            T+
Sbjct  292  TK  293



>ref|XP_002991041.1| hypothetical protein SELMODRAFT_132803, partial [Selaginella 
moellendorffii]
 ref|XP_002991692.1| hypothetical protein SELMODRAFT_133910, partial [Selaginella 
moellendorffii]
 gb|EFJ07263.1| hypothetical protein SELMODRAFT_133910, partial [Selaginella 
moellendorffii]
 gb|EFJ07849.1| hypothetical protein SELMODRAFT_132803, partial [Selaginella 
moellendorffii]
Length=499

 Score = 99.0 bits (245),  Expect = 4e-21, Method: Composition-based stats.
 Identities = 44/81 (54%), Positives = 60/81 (74%), Gaps = 0/81 (0%)
 Frame = -1

Query  370  AKELINVEYHMLPQNTFCTGAVFVAKADNTEEDDGWIVTFVHDENTNKSQVYMIDAKHFS  191
            AK+ I+V+YH L  N + +  +FVA+  +T+EDDGWIV++VHDE TNKS+VY+ DA+ F 
Sbjct  417  AKDEIDVKYHDLGANRYGSEPLFVARPHSTDEDDGWIVSYVHDEETNKSEVYIFDAQKFQ  476

Query  190  KEPIATITLPCRVPYGFHGTF  128
             + +A I LP RVPYGFH  F
Sbjct  477  DQAVARIGLPQRVPYGFHSDF  497



>gb|KCW81561.1| hypothetical protein EUGRSUZ_C02919, partial [Eucalyptus grandis]
Length=486

 Score = 97.8 bits (242),  Expect = 9e-21, Method: Compositional matrix adjust.
 Identities = 46/96 (48%), Positives = 68/96 (71%), Gaps = 5/96 (5%)
 Frame = -1

Query  421  GMAKYGGIGKLHLEEGEAKEL--INVEYHMLPQNTFCTGAVFVAKA---DNTEEDDGWIV  257
            G+ K+G + KL+ +E +A++   + VEYH   ++ FC+G+VFVAK     + +EDDGWIV
Sbjct  391  GLPKFGSLAKLYFDEPQAEQFMAVKVEYHKFGESKFCSGSVFVAKNGSFKDEDEDDGWIV  450

Query  256  TFVHDENTNKSQVYMIDAKHFSKEPIATITLPCRVP  149
            TFVHDE ++++ V++ID K F  EP+A I LP RVP
Sbjct  451  TFVHDEVSDETHVHIIDVKDFEGEPVAKIRLPQRVP  486



>ref|WP_009783644.1| Retinal pigment epithelial membrane protein [Lyngbya sp. PCC 
8106]
 gb|EAW37771.1| Retinal pigment epithelial membrane protein [Lyngbya sp. PCC 
8106]
Length=461

 Score = 95.1 bits (235),  Expect = 6e-20, Method: Compositional matrix adjust.
 Identities = 45/106 (42%), Positives = 68/106 (64%), Gaps = 8/106 (8%)
 Frame = -1

Query  412  KYGGIGKLHLEEGEAKELIN--------VEYHMLPQNTFCTGAVFVAKADNTEEDDGWIV  257
            +YG  GK    E    E IN         + H   +  F   AVFV ++D++ ED+GW+V
Sbjct  352  RYGYTGKTAKTELPKLEGINKYDFEKNTCQVHRFGEGRFGGEAVFVPRSDDSAEDEGWLV  411

Query  256  TFVHDENTNKSQVYMIDAKHFSKEPIATITLPCRVPYGFHGTFITQ  119
            TFVHDEN N+S++ ++DA++ + EP+A + +P RVPYGFHGT+++Q
Sbjct  412  TFVHDENQNQSELVIVDAQNITSEPVARVIIPQRVPYGFHGTWVSQ  457



>ref|XP_007226181.1| hypothetical protein PRUPE_ppa015590mg [Prunus persica]
 gb|EMJ27380.1| hypothetical protein PRUPE_ppa015590mg [Prunus persica]
Length=531

 Score = 95.1 bits (235),  Expect = 1e-19, Method: Composition-based stats.
 Identities = 46/83 (55%), Positives = 55/83 (66%), Gaps = 5/83 (6%)
 Frame = -1

Query  424  LGMAKYGGIGKLHLEEGEAKELIN-----VEYHMLPQNTFCTGAVFVAKADNTEEDDGWI  260
            LGM KYGG+ +LH EE     L N     VE  M  + +FC+GA FVAK    EEDDGW 
Sbjct  448  LGMLKYGGLARLHFEEPADVSLRNESQFEVETRMFEEKSFCSGAAFVAKQGGLEEDDGWA  507

Query  259  VTFVHDENTNKSQVYMIDAKHFS  191
            +TFVH+E+TN SQVY+ID K FS
Sbjct  508  ITFVHNEDTNISQVYVIDTKKFS  530



>ref|XP_002437880.1| hypothetical protein SORBIDRAFT_10g004360 [Sorghum bicolor]
 gb|EER89247.1| hypothetical protein SORBIDRAFT_10g004360 [Sorghum bicolor]
Length=524

 Score = 94.7 bits (234),  Expect = 2e-19, Method: Composition-based stats.
 Identities = 41/56 (73%), Positives = 47/56 (84%), Gaps = 0/56 (0%)
 Frame = -1

Query  295  KADNTEEDDGWIVTFVHDENTNKSQVYMIDAKHFSKEPIATITLPCRVPYGFHGTF  128
            K +  +EDDGWIVT+VHDE TN SQVY+IDAK FS+EP+A ITLP RVPYGFHG F
Sbjct  462  KKNGIDEDDGWIVTYVHDEGTNSSQVYIIDAKRFSEEPVAKITLPQRVPYGFHGNF  517



>ref|NP_001062856.2| Os09g0321200 [Oryza sativa Japonica Group]
 dbj|BAF24770.2| Os09g0321200 [Oryza sativa Japonica Group]
Length=595

 Score = 94.0 bits (232),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 47/103 (46%), Positives = 63/103 (61%), Gaps = 16/103 (16%)
 Frame = -1

Query  418  MAKYGGIGKLHLEEGE------AKELINVEYHMLPQNTFCTGAVFVAKADNTEEDDGWIV  257
            + KYGG+ KL LEE +      +++LI  EYH   ++ F +GA FV +   + EDDGWI+
Sbjct  494  ILKYGGLAKLCLEEADNVIAETSEDLIKTEYHGFGEDQFFSGAAFVPRVGGSHEDDGWII  553

Query  256  TFVHDENTNKSQVYMIDAKHFSKEPIATITLPCRVPYGFHGTF  128
            +FVH          +IDA+ F   P+A I LP RVPYGFHGTF
Sbjct  554  SFVH----------IIDAQTFEGAPVAKIVLPQRVPYGFHGTF  586



>ref|WP_023064357.1| carotenoid 9,10(9',10')-cleavage dioxygenase [Lyngbya aestuarii]
 gb|ERT09477.1| carotenoid 9,10(9',10')-cleavage dioxygenase [Lyngbya aestuarii 
BL J]
Length=461

 Score = 92.0 bits (227),  Expect = 8e-19, Method: Compositional matrix adjust.
 Identities = 45/107 (42%), Positives = 66/107 (62%), Gaps = 8/107 (7%)
 Frame = -1

Query  412  KYGGIGKLHLEEGEAKELIN--------VEYHMLPQNTFCTGAVFVAKADNTEEDDGWIV  257
            +YG IGK    E    E IN         + H   +  F   AVFV + D++ ED GW+V
Sbjct  352  RYGYIGKTAQTELPKFEGINKYDFDKNSCQVHHFGEGRFGGEAVFVPRPDDSAEDAGWLV  411

Query  256  TFVHDENTNKSQVYMIDAKHFSKEPIATITLPCRVPYGFHGTFITQN  116
            TFVHDEN  +S++ ++DA++ + EP+A + +P RVPYGFHGT++ Q+
Sbjct  412  TFVHDENEQQSELVIVDAQNITSEPVARVIIPQRVPYGFHGTWVPQS  458



>gb|KCW79131.1| hypothetical protein EUGRSUZ_C005781, partial [Eucalyptus grandis]
Length=92

 Score = 86.3 bits (212),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 40/79 (51%), Positives = 53/79 (67%), Gaps = 0/79 (0%)
 Frame = -1

Query  361  LINVEYHMLPQNTFCTGAVFVAKADNTEEDDGWIVTFVHDENTNKSQVYMIDAKHFSKEP  182
            L+ VEYH   +++FC G V V K D    D GWIV+++H+E    SQV++IDA+ F  EP
Sbjct  10   LMKVEYHNFEKDSFCDGCVSVLKKDGATVDRGWIVSWMHNEEIVVSQVHVIDAQKFEGEP  69

Query  181  IATITLPCRVPYGFHGTFI  125
            +A ITLP RVP  F GTF+
Sbjct  70   VAKITLPQRVPRRFLGTFV  88



>emb|CDY34748.1| BnaA09g41150D [Brassica napus]
Length=483

 Score = 90.5 bits (223),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 47/109 (43%), Positives = 69/109 (63%), Gaps = 8/109 (7%)
 Frame = -1

Query  421  GMAKYGGIGKL--HLEEGEAKELINVE-----YHMLPQNTFCTGAVFVAKADNTEEDDGW  263
            G++K  GI KL  H E    K ++ V       + L Q  +C+ A++V + ++ EEDDG+
Sbjct  368  GISKVTGIIKLDLHAEAETGKRILQVGGNIKGIYKLGQGIYCSDAIYVPR-ESAEEDDGY  426

Query  262  IVTFVHDENTNKSQVYMIDAKHFSKEPIATITLPCRVPYGFHGTFITQN  116
            ++ F HDENT KS V++IDA+  S EP+A + LP RVPYGFH  F+T+ 
Sbjct  427  LIFFFHDENTGKSCVHVIDARTMSAEPVAIVELPHRVPYGFHALFVTER  475



>gb|EMT19111.1| hypothetical protein F775_00763 [Aegilops tauschii]
Length=560

 Score = 90.9 bits (224),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 52/117 (44%), Positives = 71/117 (61%), Gaps = 11/117 (9%)
 Frame = -1

Query  439  TSIKPLGMAKYGGIGK--LHLEEGEAKELINVE------YHMLPQNTFCTGAVFVAKADN  284
            +++K  G+ K  GI K  LH E    KE + V       Y + P   FC+ AVFV K  +
Sbjct  436  STVKVTGILKMTGIIKFDLHAEPESDKEQLEVGGNVRGIYDLGP-GRFCSEAVFVPKEPS  494

Query  283  T--EEDDGWIVTFVHDENTNKSQVYMIDAKHFSKEPIATITLPCRVPYGFHGTFITQ  119
               EEDDG+++ FVHDENT KS++ +IDAK  S +P+A + LP RVPYGFH  F+ +
Sbjct  495  VLGEEDDGYLIFFVHDENTGKSEINVIDAKTMSADPVAVVELPSRVPYGFHAFFVNE  551



>ref|XP_009117091.1| PREDICTED: carotenoid 9,10(9',10')-cleavage dioxygenase 1-like 
[Brassica rapa]
Length=607

 Score = 90.9 bits (224),  Expect = 4e-18, Method: Composition-based stats.
 Identities = 47/108 (44%), Positives = 68/108 (63%), Gaps = 8/108 (7%)
 Frame = -1

Query  421  GMAKYGGIGKL--HLEEGEAKELINVE-----YHMLPQNTFCTGAVFVAKADNTEEDDGW  263
            G++K  GI KL  H E      ++ V       + L Q  +C+ A++V + ++ EEDDG+
Sbjct  492  GISKVTGIIKLDLHAEAETGNRILQVGGNIKGIYKLGQGIYCSDAIYVPR-ESAEEDDGY  550

Query  262  IVTFVHDENTNKSQVYMIDAKHFSKEPIATITLPCRVPYGFHGTFITQ  119
            ++ FVHDENT KS V +IDA+  S EP+A + LP RVPYGFH  F+T+
Sbjct  551  LIFFVHDENTGKSCVNVIDARTMSAEPVAIVELPHRVPYGFHALFVTE  598



>gb|EMS46219.1| hypothetical protein TRIUR3_11060 [Triticum urartu]
Length=543

 Score = 90.1 bits (222),  Expect = 6e-18, Method: Compositional matrix adjust.
 Identities = 52/117 (44%), Positives = 72/117 (62%), Gaps = 11/117 (9%)
 Frame = -1

Query  439  TSIKPLGMAKYGGIGK--LHLEEGEAKELINVE------YHMLPQNTFCTGAVFVAKADN  284
            +++K  G+ K  GI K  LH +   +KE + V       Y + P  TFC+ AVFV K   
Sbjct  419  STVKVTGILKMTGIIKFDLHAKPERSKEHLEVGGNVTGIYDLAP-GTFCSEAVFVPKEHG  477

Query  283  T--EEDDGWIVTFVHDENTNKSQVYMIDAKHFSKEPIATITLPCRVPYGFHGTFITQ  119
               EEDDG+++ FVHDENT KS+V +I+AK  S +P+A + LP RVPYGFH  F+ +
Sbjct  478  VSGEEDDGYLIFFVHDENTGKSEVNVIEAKTMSADPVAVVELPSRVPYGFHAFFVNE  534



>gb|EMT19110.1| hypothetical protein F775_23086 [Aegilops tauschii]
Length=509

 Score = 89.7 bits (221),  Expect = 9e-18, Method: Compositional matrix adjust.
 Identities = 52/117 (44%), Positives = 71/117 (61%), Gaps = 11/117 (9%)
 Frame = -1

Query  439  TSIKPLGMAKYGGIGK--LHLEEGEAKELINVE------YHMLPQNTFCTGAVFVAKADN  284
            +++K  G+ K  GI K  LH +   +KE + V       Y + P   FC+ AVFV K   
Sbjct  385  STVKVNGILKMTGIIKFDLHAKPERSKEHLEVGGNVTGIYDLSP-GMFCSEAVFVPKEPG  443

Query  283  T--EEDDGWIVTFVHDENTNKSQVYMIDAKHFSKEPIATITLPCRVPYGFHGTFITQ  119
               EEDDG+++ FVHDENT KS+V +IDAK  S +P+A + LP RVPYGFH  F+ +
Sbjct  444  VSGEEDDGYLIFFVHDENTGKSEVNVIDAKTMSADPVAVVELPSRVPYGFHAFFVNE  500



>gb|KCW78867.1| hypothetical protein EUGRSUZ_C00308 [Eucalyptus grandis]
Length=81

 Score = 83.6 bits (205),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 39/79 (49%), Positives = 52/79 (66%), Gaps = 1/79 (1%)
 Frame = -1

Query  358  INVEYHMLPQNTFCTGAVFVAKADNTEEDDGWIVTFVHDENTNKSQVYMIDAKHFSKEPI  179
            + V YH   ++ FC   V V K D   ED GWIV++VH+E T+ SQV +I+A  F  EP+
Sbjct  1    MKVGYHNFGKDNFCNRCV-VPKKDGLGEDSGWIVSWVHNEETDVSQVLVIEAHKFKGEPM  59

Query  178  ATITLPCRVPYGFHGTFIT  122
              +TLP R PYGFHGTF++
Sbjct  60   EKMTLPQRAPYGFHGTFVS  78



>gb|KEH19092.1| carotenoid 9,10(9',10')-cleavage dioxygenase [Medicago truncatula]
Length=575

 Score = 89.7 bits (221),  Expect = 1e-17, Method: Composition-based stats.
 Identities = 46/96 (48%), Positives = 64/96 (67%), Gaps = 6/96 (6%)
 Frame = -1

Query  397  GKLHLEEGEAKELINVEYHMLPQNTFCTGAVFVAKADNTE--EDDGWIVTFVHDENTNKS  224
            GK  LE G     I+  Y + P  TFC+ A++V +   T+  EDDG+++ FVHDENT KS
Sbjct  476  GKTKLEVGGN---IHGLYDLGP-GTFCSDAIYVPRVPGTDSDEDDGYLIFFVHDENTRKS  531

Query  223  QVYMIDAKHFSKEPIATITLPCRVPYGFHGTFITQN  116
             V++IDAK  S +P+A + LP RVPYGFH  F+T++
Sbjct  532  SVHVIDAKTMSADPVAVVELPQRVPYGFHAFFVTED  567



>gb|ABK21471.1| unknown [Picea sitchensis]
Length=326

 Score = 86.7 bits (213),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 50/118 (42%), Positives = 70/118 (59%), Gaps = 9/118 (8%)
 Frame = -1

Query  445  FLTSIKPLGMAKYGGIGK--LHLEEGEAKELINVEYHM-----LPQNTFCTGAVFVAKAD  287
            F+ + +   +AK  GI K  L LE    KE I V  ++          + + A+FV +  
Sbjct  202  FVYATRLDSLAKVEGIVKFDLQLEPEVGKEQIEVGGNVKGIFQFGHGRYGSEAIFVPRES  261

Query  286  NT--EEDDGWIVTFVHDENTNKSQVYMIDAKHFSKEPIATITLPCRVPYGFHGTFITQ  119
            +   EEDDG+++ FVHDENT KS+V +IDAK  S EP+A + LP RVPYGFH  F+T+
Sbjct  262  DVGLEEDDGYLICFVHDENTRKSEVNVIDAKTMSSEPVAVVPLPARVPYGFHAFFVTE  319



>gb|KEH19087.1| carotenoid 9,10(9',10')-cleavage dioxygenase [Medicago truncatula]
Length=575

 Score = 87.8 bits (216),  Expect = 4e-17, Method: Composition-based stats.
 Identities = 48/111 (43%), Positives = 67/111 (60%), Gaps = 11/111 (10%)
 Frame = -1

Query  427  PLGMAKYG-----GIGKLHLEEGEAKELINVEYHMLPQNTFCTGAVFVAKADNTE--EDD  269
            P G+ K+        GK  LE G     I    + L Q TFC+  ++V +   T+  EDD
Sbjct  461  PTGIVKFDLSAKPDFGKTKLEIGGNVHGI----YDLGQGTFCSDPIYVPRVPGTDSDEDD  516

Query  268  GWIVTFVHDENTNKSQVYMIDAKHFSKEPIATITLPCRVPYGFHGTFITQN  116
            G+++ FVHDENT KS V++IDAK  S +P+A + LP RVPYGFH  F+T++
Sbjct  517  GYLIFFVHDENTRKSFVHVIDAKTMSADPVAVVELPQRVPYGFHSFFMTED  567



>gb|EMS66522.1| hypothetical protein TRIUR3_03973 [Triticum urartu]
Length=519

 Score = 87.4 bits (215),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 51/117 (44%), Positives = 69/117 (59%), Gaps = 11/117 (9%)
 Frame = -1

Query  439  TSIKPLGMAKYGGIGK--LHLEEGEAKELINVE------YHMLPQNTFCTGAVFVAKADN  284
            +++K  G+ K  GI K  LH E    KE + V       Y + P   FC+ AVFV K   
Sbjct  395  STVKVTGILKMIGIIKFDLHAEPESDKEQLEVGGNVRGIYDLGP-GRFCSEAVFVPKEPG  453

Query  283  T--EEDDGWIVTFVHDENTNKSQVYMIDAKHFSKEPIATITLPCRVPYGFHGTFITQ  119
               EEDDG+++ FVHDENT KS++ +IDAK    +P+A + LP RVPYGFH  F+ +
Sbjct  454  VLGEEDDGYLIFFVHDENTGKSEINVIDAKTMCADPVAVVELPSRVPYGFHAFFVNE  510



>gb|AIX87509.1| carotenoid cleavage dioxygenase 1A [Lycium barbarum]
Length=540

 Score = 87.4 bits (215),  Expect = 6e-17, Method: Compositional matrix adjust.
 Identities = 52/109 (48%), Positives = 66/109 (61%), Gaps = 9/109 (8%)
 Frame = -1

Query  418  MAKYGGIGK--LHLEEGEAKELINVEYHM-----LPQNTFCTGAVFVAKADNTE--EDDG  266
            +AK  GI K  LH E G  K  + V  ++     L    F + AVFV +   TE  EDDG
Sbjct  423  IAKVTGIIKFDLHAEPGTGKSQLEVGGNVQGIFDLGPGRFGSEAVFVPRQPGTECEEDDG  482

Query  265  WIVTFVHDENTNKSQVYMIDAKHFSKEPIATITLPCRVPYGFHGTFITQ  119
            +++ FVHDENT KS V +IDAK  S EP+A + LP RVPYGFH  F+T+
Sbjct  483  YLIFFVHDENTGKSAVNVIDAKTMSTEPVAVVELPKRVPYGFHAFFVTE  531



>ref|XP_004158236.1| PREDICTED: carotenoid 9,10(9',10')-cleavage dioxygenase 1-like 
[Cucumis sativus]
Length=379

 Score = 85.9 bits (211),  Expect = 6e-17, Method: Compositional matrix adjust.
 Identities = 51/111 (46%), Positives = 65/111 (59%), Gaps = 11/111 (10%)
 Frame = -1

Query  421  GMAKYGGIGK--LHLEEGEAKELINVE------YHMLPQNTFCTGAVFVAKADNT--EED  272
             +AK  GI K  LH E    K  I V       Y + P   F + A+FV +   T  EED
Sbjct  261  SIAKVTGIAKFDLHAEPETGKTKIEVGGNVQGLYDLGP-GRFGSEAIFVPRVPGTTSEED  319

Query  271  DGWIVTFVHDENTNKSQVYMIDAKHFSKEPIATITLPCRVPYGFHGTFITQ  119
            DG+++ FVHDENT KS V ++DAK  S EP+A + LP RVPYGFH  F+T+
Sbjct  320  DGYLILFVHDENTGKSAVNVVDAKTMSSEPVAVVELPHRVPYGFHAFFVTE  370



>ref|WP_012409393.1| carotenoid oxygenase [Nostoc punctiforme]
 ref|YP_001866345.1| carotenoid oxygenase [Nostoc punctiforme PCC 73102]
 gb|ACC81402.1| Carotenoid oxygenase [Nostoc punctiforme PCC 73102]
Length=460

 Score = 86.7 bits (213),  Expect = 7e-17, Method: Compositional matrix adjust.
 Identities = 39/97 (40%), Positives = 60/97 (62%), Gaps = 6/97 (6%)
 Frame = -1

Query  409  YGGIGKLHLEEGEAKELINVEYHMLPQNTFCTGAVFVAKADNTEEDDGWIVTFVHDENTN  230
            + GI K     G+++       H   Q  + + AVF  +     EDDGW+VTFVHDEN+N
Sbjct  369  FEGIIKYDFSSGKSQT------HKFGQGRYGSEAVFAPRPGAIAEDDGWLVTFVHDENSN  422

Query  229  KSQVYMIDAKHFSKEPIATITLPCRVPYGFHGTFITQ  119
             S++ +++A+  + EP+A + +P RVPYGFHGT++ Q
Sbjct  423  TSELVVVNAQDVTAEPVARVIIPQRVPYGFHGTWVAQ  459



>ref|XP_010413132.1| PREDICTED: carotenoid 9,10(9',10')-cleavage dioxygenase 1-like 
isoform X2 [Camelina sativa]
Length=437

 Score = 86.7 bits (213),  Expect = 7e-17, Method: Compositional matrix adjust.
 Identities = 49/108 (45%), Positives = 67/108 (62%), Gaps = 8/108 (7%)
 Frame = -1

Query  421  GMAKYGGIGK--LHLEEGEAKELINVEYHM-----LPQNTFCTGAVFVAKADNTEEDDGW  263
             +AK  GI K  LH E    K ++ V  ++     L Q  F + A++V + +  EEDDG+
Sbjct  322  SIAKVTGIIKFDLHAEAETGKRMLEVGGNIKGIYDLGQGKFGSEAIYVPR-EAAEEDDGY  380

Query  262  IVTFVHDENTNKSQVYMIDAKHFSKEPIATITLPCRVPYGFHGTFITQ  119
            ++ FVHDENT KS V +IDAK  S EP+A + LP RVPYGFH  F+T+
Sbjct  381  LIFFVHDENTGKSCVNVIDAKTMSAEPVAVVELPHRVPYGFHALFVTE  428



>gb|AAN64277.1| carotenoid cleavage dioxygenase 1 [Zea mays]
Length=103

 Score = 81.6 bits (200),  Expect = 8e-17, Method: Compositional matrix adjust.
 Identities = 40/79 (51%), Positives = 54/79 (68%), Gaps = 3/79 (4%)
 Frame = -1

Query  346  YHMLPQNTFCTGAVFVAK--ADNTEEDDGWIVTFVHDENTNKSQVYMIDAKHFSKEPIAT  173
            Y + P   F + A+FV K    + EEDDG+++ FVHDENT KS+V +IDAK  S +P+A 
Sbjct  17   YDLGP-GRFGSEAIFVPKHPGVSGEEDDGYLIFFVHDENTGKSEVNVIDAKTMSADPVAV  75

Query  172  ITLPCRVPYGFHGTFITQN  116
            + LP RVPYGFH  F T++
Sbjct  76   VELPNRVPYGFHAFFATED  94



>gb|ABB82946.1| carotenoid cleavage dioxygenase [Cucumis melo]
Length=543

 Score = 86.7 bits (213),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 51/110 (46%), Positives = 65/110 (59%), Gaps = 11/110 (10%)
 Frame = -1

Query  418  MAKYGGIGK--LHLEEGEAKELINVE------YHMLPQNTFCTGAVFVAKADNT--EEDD  269
            +AK  GI K  LH E    K  I V       Y + P   F + A+FV +   T  EEDD
Sbjct  426  IAKVTGIAKFDLHAEPETGKTKIEVGGNVQGLYDLGP-GRFGSEAIFVPRVPGTTSEEDD  484

Query  268  GWIVTFVHDENTNKSQVYMIDAKHFSKEPIATITLPCRVPYGFHGTFITQ  119
            G+++ FVHDENT KS V ++DAK  S EP+A + LP RVPYGFH  F+T+
Sbjct  485  GYLILFVHDENTGKSAVNVVDAKTMSSEPVAVVELPHRVPYGFHAFFVTE  534



>ref|XP_009589880.1| PREDICTED: carotenoid 9,10(9',10')-cleavage dioxygenase-like 
isoform X3 [Nicotiana tomentosiformis]
 ref|XP_009589881.1| PREDICTED: carotenoid 9,10(9',10')-cleavage dioxygenase-like 
isoform X3 [Nicotiana tomentosiformis]
Length=494

 Score = 86.3 bits (212),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 51/109 (47%), Positives = 65/109 (60%), Gaps = 9/109 (8%)
 Frame = -1

Query  418  MAKYGGIGK--LHLEEGEAKELINVEYHMLP-----QNTFCTGAVFVAKADNTE--EDDG  266
            MAK  GI K  LH E    K  + V  ++L         F + A+FV +   TE  EDDG
Sbjct  377  MAKITGIVKFDLHAEPETGKTKLEVGGNVLGIFDLGPGRFGSEAIFVPRQPGTECEEDDG  436

Query  265  WIVTFVHDENTNKSQVYMIDAKHFSKEPIATITLPCRVPYGFHGTFITQ  119
            +++ FVHDENT KS V +IDAK  S EP+A + LP RVPYGFH  F+T+
Sbjct  437  YLILFVHDENTGKSSVNVIDAKTMSAEPVAVVELPKRVPYGFHAFFVTE  485



>ref|XP_008461300.1| PREDICTED: carotenoid 9,10(9',10')-cleavage dioxygenase 1 [Cucumis 
melo]
Length=547

 Score = 86.3 bits (212),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 51/110 (46%), Positives = 65/110 (59%), Gaps = 11/110 (10%)
 Frame = -1

Query  418  MAKYGGIGK--LHLEEGEAKELINVE------YHMLPQNTFCTGAVFVAKADNT--EEDD  269
            +AK  GI K  LH E    K  I V       Y + P   F + A+FV +   T  EEDD
Sbjct  430  IAKVTGIAKFDLHAEPETGKTKIEVGGNVQGLYDLGP-GRFGSEAIFVPRVPGTTSEEDD  488

Query  268  GWIVTFVHDENTNKSQVYMIDAKHFSKEPIATITLPCRVPYGFHGTFITQ  119
            G+++ FVHDENT KS V ++DAK  S EP+A + LP RVPYGFH  F+T+
Sbjct  489  GYLILFVHDENTGKSAVNVVDAKTMSSEPVAVVELPHRVPYGFHAFFVTE  538



>ref|XP_004135934.1| PREDICTED: carotenoid 9,10(9',10')-cleavage dioxygenase 1-like 
[Cucumis sativus]
 gb|KGN45124.1| hypothetical protein Csa_7G428120 [Cucumis sativus]
Length=547

 Score = 86.3 bits (212),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 51/110 (46%), Positives = 65/110 (59%), Gaps = 11/110 (10%)
 Frame = -1

Query  418  MAKYGGIGK--LHLEEGEAKELINVE------YHMLPQNTFCTGAVFVAKADNT--EEDD  269
            +AK  GI K  LH E    K  I V       Y + P   F + A+FV +   T  EEDD
Sbjct  430  IAKVTGIAKFDLHAEPETGKTKIEVGGNVQGLYDLGP-GRFGSEAIFVPRVPGTTSEEDD  488

Query  268  GWIVTFVHDENTNKSQVYMIDAKHFSKEPIATITLPCRVPYGFHGTFITQ  119
            G+++ FVHDENT KS V ++DAK  S EP+A + LP RVPYGFH  F+T+
Sbjct  489  GYLILFVHDENTGKSAVNVVDAKTMSSEPVAVVELPHRVPYGFHAFFVTE  538



>gb|AIL30506.1| carotenoid cleavage dioxygenase 1-1 [Nicotiana tabacum]
Length=547

 Score = 86.3 bits (212),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 51/109 (47%), Positives = 65/109 (60%), Gaps = 9/109 (8%)
 Frame = -1

Query  418  MAKYGGIGK--LHLEEGEAKELINVEYHMLP-----QNTFCTGAVFVAKADNTE--EDDG  266
            MAK  GI K  LH E    K  + V  ++L         F + A+FV +   TE  EDDG
Sbjct  430  MAKITGIVKFDLHAEPETGKTKLGVGGNVLGIFDLGPGRFGSEAIFVPRQPGTECEEDDG  489

Query  265  WIVTFVHDENTNKSQVYMIDAKHFSKEPIATITLPCRVPYGFHGTFITQ  119
            +++ FVHDENT KS V +IDAK  S EP+A + LP RVPYGFH  F+T+
Sbjct  490  YLILFVHDENTGKSSVNVIDAKTMSAEPVAVVELPKRVPYGFHAFFVTE  538



>ref|XP_009589879.1| PREDICTED: carotenoid 9,10(9',10')-cleavage dioxygenase 1-like 
isoform X2 [Nicotiana tomentosiformis]
 gb|AHH25652.1| carotenoid cleavage dioxygenase 1 [Nicotiana tomentosiformis]
Length=548

 Score = 86.3 bits (212),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 51/109 (47%), Positives = 65/109 (60%), Gaps = 9/109 (8%)
 Frame = -1

Query  418  MAKYGGIGK--LHLEEGEAKELINVEYHMLP-----QNTFCTGAVFVAKADNTE--EDDG  266
            MAK  GI K  LH E    K  + V  ++L         F + A+FV +   TE  EDDG
Sbjct  431  MAKITGIVKFDLHAEPETGKTKLEVGGNVLGIFDLGPGRFGSEAIFVPRQPGTECEEDDG  490

Query  265  WIVTFVHDENTNKSQVYMIDAKHFSKEPIATITLPCRVPYGFHGTFITQ  119
            +++ FVHDENT KS V +IDAK  S EP+A + LP RVPYGFH  F+T+
Sbjct  491  YLILFVHDENTGKSSVNVIDAKTMSAEPVAVVELPKRVPYGFHAFFVTE  539



>ref|XP_002876727.1| hypothetical protein ARALYDRAFT_486866 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH52986.1| hypothetical protein ARALYDRAFT_486866 [Arabidopsis lyrata subsp. 
lyrata]
Length=550

 Score = 86.3 bits (212),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 48/108 (44%), Positives = 68/108 (63%), Gaps = 8/108 (7%)
 Frame = -1

Query  421  GMAKYGGIGK--LHLEEGEAKELINVEYHM-----LPQNTFCTGAVFVAKADNTEEDDGW  263
             +AK  GI K  LH E    K ++ V  ++     L Q  + + A++V + +  EEDDG+
Sbjct  435  SIAKVTGIIKFDLHAEAETGKRMLEVGGNIKGIYDLGQGRYGSEAIYVPR-EAAEEDDGY  493

Query  262  IVTFVHDENTNKSQVYMIDAKHFSKEPIATITLPCRVPYGFHGTFITQ  119
            ++ FVHDENT KS V++IDAK  S EP+A + LP RVPYGFH  F+T+
Sbjct  494  LIFFVHDENTGKSCVHVIDAKTMSAEPVAVVELPHRVPYGFHALFVTE  541



>ref|XP_010413131.1| PREDICTED: carotenoid 9,10(9',10')-cleavage dioxygenase 1-like 
isoform X1 [Camelina sativa]
Length=538

 Score = 86.3 bits (212),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 49/107 (46%), Positives = 67/107 (63%), Gaps = 8/107 (7%)
 Frame = -1

Query  418  MAKYGGIGK--LHLEEGEAKELINVEYHM-----LPQNTFCTGAVFVAKADNTEEDDGWI  260
            +AK  GI K  LH E    K ++ V  ++     L Q  F + A++V + +  EEDDG++
Sbjct  424  IAKVTGIIKFDLHAEAETGKRMLEVGGNIKGIYDLGQGKFGSEAIYVPR-EAAEEDDGYL  482

Query  259  VTFVHDENTNKSQVYMIDAKHFSKEPIATITLPCRVPYGFHGTFITQ  119
            + FVHDENT KS V +IDAK  S EP+A + LP RVPYGFH  F+T+
Sbjct  483  IFFVHDENTGKSCVNVIDAKTMSAEPVAVVELPHRVPYGFHALFVTE  529



>gb|AHH25650.1| carotenoid cleavage dioxygenase 1-2 [Nicotiana tabacum]
Length=548

 Score = 86.3 bits (212),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 51/109 (47%), Positives = 65/109 (60%), Gaps = 9/109 (8%)
 Frame = -1

Query  418  MAKYGGIGK--LHLEEGEAKELINVEYHMLP-----QNTFCTGAVFVAKADNTE--EDDG  266
            MAK  GI K  LH E    K  + V  ++L         F + A+FV +   TE  EDDG
Sbjct  431  MAKITGIVKFDLHAEPETGKTKLEVGGNVLGIFDLGPGRFGSEAIFVPRQPGTECEEDDG  490

Query  265  WIVTFVHDENTNKSQVYMIDAKHFSKEPIATITLPCRVPYGFHGTFITQ  119
            +++ FVHDENT KS V +IDAK  S EP+A + LP RVPYGFH  F+T+
Sbjct  491  YLILFVHDENTGKSSVNVIDAKTMSAEPVAVVELPKRVPYGFHAFFVTE  539



>ref|XP_006402261.1| hypothetical protein EUTSA_v10005877mg [Eutrema salsugineum]
 gb|ESQ43714.1| hypothetical protein EUTSA_v10005877mg [Eutrema salsugineum]
Length=437

 Score = 85.5 bits (210),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 48/108 (44%), Positives = 68/108 (63%), Gaps = 8/108 (7%)
 Frame = -1

Query  421  GMAKYGGIGK--LHLEEGEAKELINVEYHM-----LPQNTFCTGAVFVAKADNTEEDDGW  263
             +AK  GI K  LH E    K+++ V  ++     L Q  + + A++V + +  EEDDG+
Sbjct  322  SIAKVTGIIKFDLHAEAETGKKMLEVGGNIKGIYELGQGRYGSEAIYVPR-EAAEEDDGY  380

Query  262  IVTFVHDENTNKSQVYMIDAKHFSKEPIATITLPCRVPYGFHGTFITQ  119
            ++ FVHDENT KS V +IDAK  S EP+A + LP RVPYGFH  F+T+
Sbjct  381  LIFFVHDENTGKSCVNVIDAKTMSAEPVAVVELPHRVPYGFHALFVTE  428



>gb|AEW08177.1| hypothetical protein 2_2194_01, partial [Pinus radiata]
 gb|AFG50239.1| hypothetical protein 2_2194_01, partial [Pinus taeda]
 gb|AFG50240.1| hypothetical protein 2_2194_01, partial [Pinus taeda]
 gb|AFG50241.1| hypothetical protein 2_2194_01, partial [Pinus taeda]
 gb|AFG50242.1| hypothetical protein 2_2194_01, partial [Pinus taeda]
 gb|AFG50243.1| hypothetical protein 2_2194_01, partial [Pinus taeda]
 gb|AFG50244.1| hypothetical protein 2_2194_01, partial [Pinus taeda]
 gb|AFG50245.1| hypothetical protein 2_2194_01, partial [Pinus taeda]
 gb|AFG50246.1| hypothetical protein 2_2194_01, partial [Pinus taeda]
 gb|AFG50247.1| hypothetical protein 2_2194_01, partial [Pinus taeda]
 gb|AFG50248.1| hypothetical protein 2_2194_01, partial [Pinus taeda]
 gb|AFG50249.1| hypothetical protein 2_2194_01, partial [Pinus taeda]
 gb|AFG50250.1| hypothetical protein 2_2194_01, partial [Pinus taeda]
 gb|AFG50251.1| hypothetical protein 2_2194_01, partial [Pinus taeda]
 gb|AFG50252.1| hypothetical protein 2_2194_01, partial [Pinus taeda]
 gb|AFG50253.1| hypothetical protein 2_2194_01, partial [Pinus taeda]
 gb|AFG50254.1| hypothetical protein 2_2194_01, partial [Pinus taeda]
Length=75

 Score = 80.1 bits (196),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 34/64 (53%), Positives = 50/64 (78%), Gaps = 2/64 (3%)
 Frame = -1

Query  304  FVAKADN--TEEDDGWIVTFVHDENTNKSQVYMIDAKHFSKEPIATITLPCRVPYGFHGT  131
            FV ++ +    EDDG+I+TF+H+E T+KS++ ++DA+  + EP+AT+ LP RVPYGFHGT
Sbjct  4    FVPRSSDPAAPEDDGYILTFMHNEETSKSELLILDARSPTLEPVATVKLPSRVPYGFHGT  63

Query  130  FITQ  119
            FIT 
Sbjct  64   FITS  67



>gb|KDO83431.1| hypothetical protein CISIN_1g007605mg [Citrus sinensis]
Length=335

 Score = 84.0 bits (206),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 40/75 (53%), Positives = 53/75 (71%), Gaps = 2/75 (3%)
 Frame = -1

Query  337  LPQNTFCTGAVFVAK--ADNTEEDDGWIVTFVHDENTNKSQVYMIDAKHFSKEPIATITL  164
            L    F + AVFV +  +  +EEDDG+++  VHDENT KS VY+IDAK  S +P+A I L
Sbjct  252  LGPGRFGSEAVFVPREPSSTSEEDDGYLIFHVHDENTGKSAVYVIDAKTMSADPVAVIEL  311

Query  163  PCRVPYGFHGTFITQ  119
            P RVPYGFHG F+++
Sbjct  312  PHRVPYGFHGIFLSE  326



>sp|Q8LP17.1|CCD1_PEA RecName: Full=Carotenoid 9,10(9',10')-cleavage dioxygenase 1; 
AltName: Full=PsCCD1; AltName: Full=PsNCED1 [Pisum sativum]
 dbj|BAC10549.1| nine-cis-epoxycarotenoid dioxygenase1 [Pisum sativum]
Length=541

 Score = 85.9 bits (211),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 51/111 (46%), Positives = 67/111 (60%), Gaps = 11/111 (10%)
 Frame = -1

Query  418  MAKYGGIGK--LHLEEGEAKELINVE------YHMLPQNTFCTGAVFVAKADNT--EEDD  269
            +AK  GI K  LH E    K  + V       Y + P   F + AV+V +   T  EEDD
Sbjct  424  IAKVTGIIKFDLHAEPDSGKTKLEVGGNVQGLYDLGP-GRFGSEAVYVPRVPGTDSEEDD  482

Query  268  GWIVTFVHDENTNKSQVYMIDAKHFSKEPIATITLPCRVPYGFHGTFITQN  116
            G+++ FVHDENT KS V++IDAK  S EP+A + LP RVPYGFH  F+T++
Sbjct  483  GYLIFFVHDENTGKSFVHVIDAKRMSAEPVAVVELPQRVPYGFHAFFVTED  533



>ref|XP_009589878.1| PREDICTED: carotenoid 9,10(9',10')-cleavage dioxygenase 1-like 
isoform X1 [Nicotiana tomentosiformis]
Length=549

 Score = 85.9 bits (211),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 51/109 (47%), Positives = 65/109 (60%), Gaps = 9/109 (8%)
 Frame = -1

Query  418  MAKYGGIGK--LHLEEGEAKELINVEYHMLP-----QNTFCTGAVFVAKADNTE--EDDG  266
            MAK  GI K  LH E    K  + V  ++L         F + A+FV +   TE  EDDG
Sbjct  432  MAKITGIVKFDLHAEPETGKTKLEVGGNVLGIFDLGPGRFGSEAIFVPRQPGTECEEDDG  491

Query  265  WIVTFVHDENTNKSQVYMIDAKHFSKEPIATITLPCRVPYGFHGTFITQ  119
            +++ FVHDENT KS V +IDAK  S EP+A + LP RVPYGFH  F+T+
Sbjct  492  YLILFVHDENTGKSSVNVIDAKTMSAEPVAVVELPKRVPYGFHAFFVTE  540



>gb|AFW89635.1| white cap1 [Zea mays]
Length=250

 Score = 83.2 bits (204),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 54/111 (49%), Positives = 71/111 (64%), Gaps = 11/111 (10%)
 Frame = -1

Query  418  MAKYGGIGK--LHLE-EGEAKELI---NVE--YHMLPQNTFCTGAVFVAK--ADNTEEDD  269
            +AK  GI K  LH E E   KEL    NV+  Y + P   F + A+FV K    + EEDD
Sbjct  132  IAKVTGIIKFDLHAEPESGVKELEVGGNVQGIYDLGP-GRFGSEAIFVPKHPGVSGEEDD  190

Query  268  GWIVTFVHDENTNKSQVYMIDAKHFSKEPIATITLPCRVPYGFHGTFITQN  116
            G+++ FVHDENT KS+V +IDAK  S +P+A + LP RVPYGFH  F+T++
Sbjct  191  GYLIFFVHDENTGKSEVNVIDAKTMSADPVAVVELPNRVPYGFHAFFVTED  241



>ref|WP_009546963.1| MULTISPECIES: 9-cis-epoxycarotenoid dioxygenase [Cyanothece]
 ref|YP_001803631.1| retinal pigment epithelial membrane protein [Cyanothece sp. ATCC 
51142]
 gb|ACB51565.1| probable retinal pigment epithelial membrane protein [Cyanothece 
sp. ATCC 51142]
Length=459

 Score = 85.5 bits (210),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 40/99 (40%), Positives = 59/99 (60%), Gaps = 6/99 (6%)
 Frame = -1

Query  415  AKYGGIGKLHLEEGEAKELINVEYHMLPQNTFCTGAVFVAKADNTEEDDGWIVTFVHDEN  236
             K+ GI K   E+G        + H    + +    +F    D  +EDDGW++TFVHDE 
Sbjct  367  PKFNGIIKHDFEKG------GFDIHHFGSHKYGGEPIFAPNPDADKEDDGWLLTFVHDEG  420

Query  235  TNKSQVYMIDAKHFSKEPIATITLPCRVPYGFHGTFITQ  119
            +N S++ +IDA+ F+  P+ATI +P RVPYGFHG ++ Q
Sbjct  421  SNTSELVIIDAQDFTASPVATIQIPQRVPYGFHGMWLAQ  459



>ref|WP_017745616.1| Retinal pigment epithelial membrane protein [Scytonema hofmanni]
Length=467

 Score = 85.1 bits (209),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 46/106 (43%), Positives = 64/106 (60%), Gaps = 8/106 (8%)
 Frame = -1

Query  412  KYGGIGK-----LHLEEGEAKELINV---EYHMLPQNTFCTGAVFVAKADNTEEDDGWIV  257
            +YG  GK     L L EG  K  +N    E H   Q  +   AVFV +   T EDDGW+V
Sbjct  353  RYGYTGKIAQSSLPLFEGIIKYDLNTGKSETHKFGQGRYGGEAVFVPRPGATAEDDGWLV  412

Query  256  TFVHDENTNKSQVYMIDAKHFSKEPIATITLPCRVPYGFHGTFITQ  119
            TFV+D N + S++ +++A+  + EPIA + LP RVPYGFHG +I++
Sbjct  413  TFVYDTNEDASELVVVNAQDITGEPIARVLLPQRVPYGFHGAWISE  458



>gb|ABB29859.1| carotene cleavage dioxygenase, partial [Nicotiana langsdorffii 
x Nicotiana sanderae]
Length=328

 Score = 83.6 bits (205),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 49/109 (45%), Positives = 65/109 (60%), Gaps = 9/109 (8%)
 Frame = -1

Query  418  MAKYGGIGK--LHLEEGEAKELINVEYHMLP-----QNTFCTGAVFVAKADNTE--EDDG  266
            +AK  G+ K  LH E    K  + V  ++L         F + A+FV +   TE  EDDG
Sbjct  211  VAKITGVVKFDLHAEPETGKTKLEVGGNVLGIFDLGPGRFGSEAIFVPRQPGTECEEDDG  270

Query  265  WIVTFVHDENTNKSQVYMIDAKHFSKEPIATITLPCRVPYGFHGTFITQ  119
            +++ FVHDENT KS V +IDAK  S EP+A + LP RVPYGFH  F+T+
Sbjct  271  YLILFVHDENTGKSSVNVIDAKTMSAEPVAVVELPKRVPYGFHAFFVTE  319



>gb|KDO83430.1| hypothetical protein CISIN_1g007605mg [Citrus sinensis]
Length=408

 Score = 84.3 bits (207),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 40/75 (53%), Positives = 53/75 (71%), Gaps = 2/75 (3%)
 Frame = -1

Query  337  LPQNTFCTGAVFVAK--ADNTEEDDGWIVTFVHDENTNKSQVYMIDAKHFSKEPIATITL  164
            L    F + AVFV +  +  +EEDDG+++  VHDENT KS VY+IDAK  S +P+A I L
Sbjct  325  LGPGRFGSEAVFVPREPSSTSEEDDGYLIFHVHDENTGKSAVYVIDAKTMSADPVAVIEL  384

Query  163  PCRVPYGFHGTFITQ  119
            P RVPYGFHG F+++
Sbjct  385  PHRVPYGFHGIFLSE  399



>gb|KDO83429.1| hypothetical protein CISIN_1g007605mg [Citrus sinensis]
Length=441

 Score = 84.7 bits (208),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 40/75 (53%), Positives = 53/75 (71%), Gaps = 2/75 (3%)
 Frame = -1

Query  337  LPQNTFCTGAVFVAK--ADNTEEDDGWIVTFVHDENTNKSQVYMIDAKHFSKEPIATITL  164
            L    F + AVFV +  +  +EEDDG+++  VHDENT KS VY+IDAK  S +P+A I L
Sbjct  358  LGPGRFGSEAVFVPREPSSTSEEDDGYLIFHVHDENTGKSAVYVIDAKTMSADPVAVIEL  417

Query  163  PCRVPYGFHGTFITQ  119
            P RVPYGFHG F+++
Sbjct  418  PHRVPYGFHGIFLSE  432



>gb|AGS79172.1| carotenoid cleavage dioxygenase 1, partial [Fagopyrum tataricum]
Length=284

 Score = 83.2 bits (204),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 39/76 (51%), Positives = 52/76 (68%), Gaps = 1/76 (1%)
 Frame = -1

Query  346  YHMLPQNTFCTGAVFVAKADNTEEDDGWIVTFVHDENTNKSQVYMIDAKHFSKEPIATIT  167
            +H+ P   F + AVFV    +TEEDDG++  F HDEN+ KS VY+IDA+  S +P+A I 
Sbjct  201  FHLGP-GRFGSEAVFVPSQSSTEEDDGYLFFFSHDENSGKSFVYVIDARTMSADPVAVIE  259

Query  166  LPCRVPYGFHGTFITQ  119
            LP RVPYG H  F+T+
Sbjct  260  LPHRVPYGIHAFFVTE  275



>gb|KCW66082.1| hypothetical protein EUGRSUZ_G03362 [Eucalyptus grandis]
Length=541

 Score = 85.1 bits (209),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 50/109 (46%), Positives = 68/109 (62%), Gaps = 9/109 (8%)
 Frame = -1

Query  418  MAKYGGIGK--LHLEEGEAKELINVEYHM-----LPQNTFCTGAVFVAKAD--NTEEDDG  266
            +AK  GI K  LH E  E K+ I V  ++     L    F + AVFV +     +EEDDG
Sbjct  424  IAKVTGIVKFDLHAEPEEGKKKIEVGGNVAGVFDLGPGRFGSEAVFVPRESGITSEEDDG  483

Query  265  WIVTFVHDENTNKSQVYMIDAKHFSKEPIATITLPCRVPYGFHGTFITQ  119
            +++ FVHDE+T KS V +IDAK+ S +P+A + LP RVPYGFH  F+T+
Sbjct  484  YLIFFVHDESTGKSAVNVIDAKNMSSDPVAVVELPHRVPYGFHAFFVTE  532



>ref|XP_010067847.1| PREDICTED: carotenoid 9,10(9',10')-cleavage dioxygenase 1-like 
[Eucalyptus grandis]
Length=613

 Score = 85.5 bits (210),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 50/109 (46%), Positives = 68/109 (62%), Gaps = 9/109 (8%)
 Frame = -1

Query  418  MAKYGGIGK--LHLEEGEAKELINVEYHM-----LPQNTFCTGAVFVAKADN--TEEDDG  266
            +AK  GI K  LH E  E K+ I V  ++     L    F + AVFV +     +EEDDG
Sbjct  496  IAKVTGIVKFDLHAEPEEGKKKIEVGGNVAGVFDLGPGRFGSEAVFVPRESGITSEEDDG  555

Query  265  WIVTFVHDENTNKSQVYMIDAKHFSKEPIATITLPCRVPYGFHGTFITQ  119
            +++ FVHDE+T KS V +IDAK+ S +P+A + LP RVPYGFH  F+T+
Sbjct  556  YLIFFVHDESTGKSAVNVIDAKNMSSDPVAVVELPHRVPYGFHAFFVTE  604



>emb|CDY53711.1| BnaAnng12520D [Brassica napus]
Length=525

 Score = 85.1 bits (209),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 49/108 (45%), Positives = 68/108 (63%), Gaps = 8/108 (7%)
 Frame = -1

Query  421  GMAKYGGIGK--LHLEEGEAKELINVEYHM-----LPQNTFCTGAVFVAKADNTEEDDGW  263
             +AK  GI K  LH E    KE++ V  ++     L Q  + + A++V + +  EEDDG+
Sbjct  410  SIAKVTGIIKFDLHAEAETGKEILEVGGNIKGIYELGQGRYGSEAIYVPR-EAGEEDDGY  468

Query  262  IVTFVHDENTNKSQVYMIDAKHFSKEPIATITLPCRVPYGFHGTFITQ  119
            ++ FVHDENT KS V +IDAK  S EP+A + LP RVPYGFH  F+T+
Sbjct  469  LIFFVHDENTGKSCVNVIDAKTMSAEPVAVVELPHRVPYGFHAFFVTE  516



>ref|XP_006402264.1| hypothetical protein EUTSA_v10005877mg [Eutrema salsugineum]
 gb|ESQ43717.1| hypothetical protein EUTSA_v10005877mg [Eutrema salsugineum]
Length=537

 Score = 85.1 bits (209),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 48/107 (45%), Positives = 68/107 (64%), Gaps = 8/107 (7%)
 Frame = -1

Query  418  MAKYGGIGK--LHLEEGEAKELINVEYHM-----LPQNTFCTGAVFVAKADNTEEDDGWI  260
            +AK  GI K  LH E    K+++ V  ++     L Q  + + A++V + +  EEDDG++
Sbjct  423  IAKVTGIIKFDLHAEAETGKKMLEVGGNIKGIYELGQGRYGSEAIYVPR-EAAEEDDGYL  481

Query  259  VTFVHDENTNKSQVYMIDAKHFSKEPIATITLPCRVPYGFHGTFITQ  119
            + FVHDENT KS V +IDAK  S EP+A + LP RVPYGFH  F+T+
Sbjct  482  IFFVHDENTGKSCVNVIDAKTMSAEPVAVVELPHRVPYGFHALFVTE  528



>sp|C3VEQ4.1|CCD1_ONCHC RecName: Full=Carotenoid 9,10(9',10')-cleavage dioxygenase 1; 
AltName: Full=Carotenoid cleavage dioxygenase 1; Short=OgCCD1 
[Oncidium hybrid cultivar]
 gb|ACP27629.1| carotenoid cleavage dioxygenase [Oncidium hybrid cultivar]
Length=562

 Score = 85.1 bits (209),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 48/107 (45%), Positives = 66/107 (62%), Gaps = 9/107 (8%)
 Frame = -1

Query  412  KYGGIGK--LHLEEGEAKELINVEYHMLP-----QNTFCTGAVFVAKADNT--EEDDGWI  260
            K  GI K  LH E    K+++ V  ++L         F + AVFV +   T  EEDDG++
Sbjct  446  KVNGIVKFDLHAEPETGKKVLEVGGNVLGIFDLGPGRFGSEAVFVPREAGTRVEEDDGYL  505

Query  259  VTFVHDENTNKSQVYMIDAKHFSKEPIATITLPCRVPYGFHGTFITQ  119
            + FV+DE T +S+VY+IDAK  S EP+A + LPCRVPYGFH  F+ +
Sbjct  506  IFFVYDETTGESKVYVIDAKTMSPEPVAVVDLPCRVPYGFHAFFVNE  552



>ref|XP_009138676.1| PREDICTED: carotenoid 9,10(9',10')-cleavage dioxygenase 1 [Brassica 
rapa]
 gb|AEN94300.1| carotenoid cleavage dioxygenase [Brassica napus]
 gb|AEN94301.1| carotenoid cleavage dioxygenase [Brassica napus]
Length=534

 Score = 85.1 bits (209),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 49/108 (45%), Positives = 68/108 (63%), Gaps = 8/108 (7%)
 Frame = -1

Query  421  GMAKYGGIGK--LHLEEGEAKELINVEYHM-----LPQNTFCTGAVFVAKADNTEEDDGW  263
             +AK  GI K  LH E    KE++ V  ++     L Q  + + A++V + +  EEDDG+
Sbjct  419  SIAKVTGIIKFDLHAEAETGKEILEVGGNIKGIYELGQGRYGSEAIYVPR-EAGEEDDGY  477

Query  262  IVTFVHDENTNKSQVYMIDAKHFSKEPIATITLPCRVPYGFHGTFITQ  119
            ++ FVHDENT KS V +IDAK  S EP+A + LP RVPYGFH  F+T+
Sbjct  478  LIFFVHDENTGKSCVNVIDAKTMSAEPVAVVELPHRVPYGFHAFFVTE  525



>ref|XP_010512783.1| PREDICTED: carotenoid 9,10(9',10')-cleavage dioxygenase 1 [Camelina 
sativa]
Length=538

 Score = 85.1 bits (209),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 48/107 (45%), Positives = 67/107 (63%), Gaps = 8/107 (7%)
 Frame = -1

Query  418  MAKYGGIGK--LHLEEGEAKELINVEYHM-----LPQNTFCTGAVFVAKADNTEEDDGWI  260
            +AK  GI K  LH E    K ++ V  ++     L Q  + + A++V + +  EEDDG++
Sbjct  424  IAKVTGIIKFDLHAEAETGKRMLEVGGNIKGIYDLGQGRYGSEAIYVPR-EAAEEDDGYL  482

Query  259  VTFVHDENTNKSQVYMIDAKHFSKEPIATITLPCRVPYGFHGTFITQ  119
            + FVHDENT KS V +IDAK  S EP+A + LP RVPYGFH  F+T+
Sbjct  483  IFFVHDENTGKSCVNVIDAKTMSAEPVAVVELPHRVPYGFHALFVTE  529



>gb|KCW66083.1| hypothetical protein EUGRSUZ_G03362 [Eucalyptus grandis]
Length=564

 Score = 85.1 bits (209),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 50/109 (46%), Positives = 68/109 (62%), Gaps = 9/109 (8%)
 Frame = -1

Query  418  MAKYGGIGK--LHLEEGEAKELINVEYHM-----LPQNTFCTGAVFVAKAD--NTEEDDG  266
            +AK  GI K  LH E  E K+ I V  ++     L    F + AVFV +     +EEDDG
Sbjct  424  IAKVTGIVKFDLHAEPEEGKKKIEVGGNVAGVFDLGPGRFGSEAVFVPRESGITSEEDDG  483

Query  265  WIVTFVHDENTNKSQVYMIDAKHFSKEPIATITLPCRVPYGFHGTFITQ  119
            +++ FVHDE+T KS V +IDAK+ S +P+A + LP RVPYGFH  F+T+
Sbjct  484  YLIFFVHDESTGKSAVNVIDAKNMSSDPVAVVELPHRVPYGFHAFFVTE  532



>gb|KEH19090.1| carotenoid 9,10(9',10')-cleavage dioxygenase [Medicago truncatula]
Length=575

 Score = 85.1 bits (209),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 46/110 (42%), Positives = 65/110 (59%), Gaps = 6/110 (5%)
 Frame = -1

Query  439  TSIKPLGMAKYGGIGKLHLEEGEAKELINVEYHMLPQNTFCTGAVFVAKADNT--EEDDG  266
            T I    ++     GK  LE G     I    + L + TFC+  ++V +   T  EEDDG
Sbjct  462  TGIVKFDLSAKPDFGKTKLEVGGNVHGI----YDLGRGTFCSDPIYVPRVPGTDSEEDDG  517

Query  265  WIVTFVHDENTNKSQVYMIDAKHFSKEPIATITLPCRVPYGFHGTFITQN  116
            +++ FVHDEN  KS V++IDAK  S +P+A + LP RVPYGFH  F+T++
Sbjct  518  YLIFFVHDENIRKSFVHVIDAKTMSADPVAVVELPQRVPYGFHAFFLTED  567



>ref|XP_009784266.1| PREDICTED: carotenoid 9,10(9',10')-cleavage dioxygenase 1-like 
isoform X2 [Nicotiana sylvestris]
Length=440

 Score = 84.3 bits (207),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 51/109 (47%), Positives = 65/109 (60%), Gaps = 9/109 (8%)
 Frame = -1

Query  418  MAKYGGIGK--LHLEEGEAKELINVEYHM-----LPQNTFCTGAVFVAKADNTE--EDDG  266
            +AK  GI K  LH E    K  + V  ++     L    F + AVFV +   TE  EDDG
Sbjct  323  IAKVTGIIKFDLHAEPETGKAQLEVGGNVQGIFDLGPGRFGSEAVFVPRQPGTECEEDDG  382

Query  265  WIVTFVHDENTNKSQVYMIDAKHFSKEPIATITLPCRVPYGFHGTFITQ  119
            +++ FVHDENT KS V +IDAK  S EP+A + LP RVPYGFH  F+T+
Sbjct  383  YLIFFVHDENTGKSAVNVIDAKTMSAEPVAVVELPKRVPYGFHAFFVTE  431



>ref|XP_009589877.1| PREDICTED: carotenoid 9,10(9',10')-cleavage dioxygenase 1-like 
isoform X2 [Nicotiana tomentosiformis]
Length=440

 Score = 84.3 bits (207),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 50/109 (46%), Positives = 65/109 (60%), Gaps = 9/109 (8%)
 Frame = -1

Query  418  MAKYGGIGK--LHLEEGEAKELINVEYHM-----LPQNTFCTGAVFVAKADNTE--EDDG  266
            +AK  G+ K  LH E    K  + V  ++     L    F + AVFV +   TE  EDDG
Sbjct  323  IAKVTGVIKFDLHAEPETGKAQLEVGGNVQGIFDLGSGRFGSEAVFVPRQPGTESEEDDG  382

Query  265  WIVTFVHDENTNKSQVYMIDAKHFSKEPIATITLPCRVPYGFHGTFITQ  119
            +++ FVHDENT KS V +IDAK  S EP+A + LP RVPYGFH  F+T+
Sbjct  383  YLIFFVHDENTGKSAVNVIDAKTMSTEPVAVVELPKRVPYGFHAFFVTE  431



>ref|XP_006439106.1| hypothetical protein CICLE_v10031014mg [Citrus clementina]
 gb|ESR52346.1| hypothetical protein CICLE_v10031014mg [Citrus clementina]
Length=597

 Score = 84.7 bits (208),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 50/109 (46%), Positives = 67/109 (61%), Gaps = 9/109 (8%)
 Frame = -1

Query  418  MAKYGGIGK--LHLEEGEAKELINVEYHM-----LPQNTFCTGAVFVAK--ADNTEEDDG  266
            +AK  GI K  LH E    K  + V  ++     L    F + AVFV +  +  +EEDDG
Sbjct  480  IAKVTGIIKFDLHAEPETGKTKLEVGGNVKGIFDLGPGRFGSEAVFVPREPSSTSEEDDG  539

Query  265  WIVTFVHDENTNKSQVYMIDAKHFSKEPIATITLPCRVPYGFHGTFITQ  119
            +++  VHDENT KS VY+IDAK  S +P+A I LP RVPYGFHG F+++
Sbjct  540  YLIFHVHDENTGKSAVYVIDAKTMSADPVAVIELPHRVPYGFHGIFLSE  588



>ref|XP_010067867.1| PREDICTED: carotenoid 9,10(9',10')-cleavage dioxygenase 1-like 
[Eucalyptus grandis]
 gb|KCW66100.1| hypothetical protein EUGRSUZ_G03374 [Eucalyptus grandis]
Length=553

 Score = 84.7 bits (208),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 50/109 (46%), Positives = 68/109 (62%), Gaps = 9/109 (8%)
 Frame = -1

Query  418  MAKYGGIGK--LHLEEGEAKELINVEYHM-----LPQNTFCTGAVFVAKAD--NTEEDDG  266
            +AK  GI K  LH E  E K+ I V  ++     L    F + AVFV +     +EEDDG
Sbjct  436  IAKVTGIVKFDLHAEPEEGKKKIEVGGNVAGVFDLGPGRFGSEAVFVPREPGITSEEDDG  495

Query  265  WIVTFVHDENTNKSQVYMIDAKHFSKEPIATITLPCRVPYGFHGTFITQ  119
            +++ FVHDE+T KS V +IDAK+ S +P+A + LP RVPYGFH  F+T+
Sbjct  496  YLIFFVHDESTGKSAVNVIDAKNMSSDPVAVVELPHRVPYGFHAFFVTE  544



>ref|XP_011087743.1| PREDICTED: LOW QUALITY PROTEIN: carotenoid 9,10(9',10')-cleavage 
dioxygenase 1-like [Sesamum indicum]
Length=547

 Score = 84.7 bits (208),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 50/109 (46%), Positives = 66/109 (61%), Gaps = 9/109 (8%)
 Frame = -1

Query  418  MAKYGGIGK--LHLEEGEAKELINVEYHM-----LPQNTFCTGAVFVAKADNT--EEDDG  266
            +AK  GI K  LH E    KE + V  ++     L    F + A+FV +   T  EEDDG
Sbjct  430  IAKVTGIIKFDLHAEPETGKEKLEVGGNVIGIFDLGPGRFGSEAIFVPRQPGTTSEEDDG  489

Query  265  WIVTFVHDENTNKSQVYMIDAKHFSKEPIATITLPCRVPYGFHGTFITQ  119
            +++ FVHDENT KS V +IDAK  S +P+A + LP RVPYGFH  F+T+
Sbjct  490  YLIFFVHDENTGKSAVNVIDAKTMSADPVAVVELPKRVPYGFHAFFVTE  538



>dbj|BAF32138.1| putative 9-cis-epoxycarotenoid dioxygenase [Taxodium distichum]
Length=631

 Score = 84.7 bits (208),  Expect = 6e-16, Method: Composition-based stats.
 Identities = 43/100 (43%), Positives = 64/100 (64%), Gaps = 6/100 (6%)
 Frame = -1

Query  412  KYGGIGKLHLEEGEAKELI-NVEYHMLPQNTFCTGAVFVAKADNTE--EDDGWIVTFVHD  242
            K  GI K+ LE    + ++  +EY    Q  +     FV +  N E  EDDG+++TF+H+
Sbjct  526  KVSGIAKVDLEAESPESVVGKIEYK---QGCYGGEPFFVPRTSNPEAPEDDGYVLTFMHN  582

Query  241  ENTNKSQVYMIDAKHFSKEPIATITLPCRVPYGFHGTFIT  122
            E T +S++ ++DAK  + EP+A++ LP RVPYGFHGTFIT
Sbjct  583  EETWQSELLILDAKSPTLEPVASVKLPSRVPYGFHGTFIT  622



>gb|KCW66101.1| hypothetical protein EUGRSUZ_G03374 [Eucalyptus grandis]
Length=576

 Score = 84.7 bits (208),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 50/109 (46%), Positives = 68/109 (62%), Gaps = 9/109 (8%)
 Frame = -1

Query  418  MAKYGGIGK--LHLEEGEAKELINVEYHM-----LPQNTFCTGAVFVAKAD--NTEEDDG  266
            +AK  GI K  LH E  E K+ I V  ++     L    F + AVFV +     +EEDDG
Sbjct  436  IAKVTGIVKFDLHAEPEEGKKKIEVGGNVAGVFDLGPGRFGSEAVFVPREPGITSEEDDG  495

Query  265  WIVTFVHDENTNKSQVYMIDAKHFSKEPIATITLPCRVPYGFHGTFITQ  119
            +++ FVHDE+T KS V +IDAK+ S +P+A + LP RVPYGFH  F+T+
Sbjct  496  YLIFFVHDESTGKSAVNVIDAKNMSSDPVAVVELPHRVPYGFHAFFVTE  544



>gb|AIX87533.1| carotenoid cleavage dioxygenase 1A [Lycium ruthenicum]
Length=540

 Score = 84.3 bits (207),  Expect = 7e-16, Method: Compositional matrix adjust.
 Identities = 51/109 (47%), Positives = 65/109 (60%), Gaps = 9/109 (8%)
 Frame = -1

Query  418  MAKYGGIGK--LHLEEGEAKELINVEYHM-----LPQNTFCTGAVFVAKADNTE--EDDG  266
            +AK  GI K  LH E    K  + V  ++     L    F + AVFV +   TE  EDDG
Sbjct  423  IAKVTGIIKFDLHAEPETGKSQLEVGGNVQGIFDLGPGRFGSEAVFVPRQPGTECEEDDG  482

Query  265  WIVTFVHDENTNKSQVYMIDAKHFSKEPIATITLPCRVPYGFHGTFITQ  119
            +++ FVHDENT KS V +IDAK  S EP+A + LP RVPYGFH  F+T+
Sbjct  483  YLIFFVHDENTGKSAVNVIDAKTMSAEPVAVVELPKRVPYGFHAFFVTE  531



>ref|XP_006482869.1| PREDICTED: carotenoid 9,10(9',10')-cleavage dioxygenase 1-like 
isoform X2 [Citrus sinensis]
Length=485

 Score = 84.0 bits (206),  Expect = 7e-16, Method: Compositional matrix adjust.
 Identities = 39/70 (56%), Positives = 52/70 (74%), Gaps = 2/70 (3%)
 Frame = -1

Query  322  FCTGAVFVAK--ADNTEEDDGWIVTFVHDENTNKSQVYMIDAKHFSKEPIATITLPCRVP  149
            F + AVFV +  +  +EEDDG+++  VHDENT KS VY+IDAK  S +P+A I LP RVP
Sbjct  407  FGSEAVFVPREPSSTSEEDDGYLIFHVHDENTGKSAVYVIDAKTMSADPVAVIELPHRVP  466

Query  148  YGFHGTFITQ  119
            YGFHG F+++
Sbjct  467  YGFHGIFLSE  476



>ref|XP_009784260.1| PREDICTED: carotenoid 9,10(9',10')-cleavage dioxygenase 1-like 
isoform X1 [Nicotiana sylvestris]
Length=546

 Score = 84.3 bits (207),  Expect = 7e-16, Method: Compositional matrix adjust.
 Identities = 51/109 (47%), Positives = 65/109 (60%), Gaps = 9/109 (8%)
 Frame = -1

Query  418  MAKYGGIGK--LHLEEGEAKELINVEYHM-----LPQNTFCTGAVFVAKADNTE--EDDG  266
            +AK  GI K  LH E    K  + V  ++     L    F + AVFV +   TE  EDDG
Sbjct  429  IAKVTGIIKFDLHAEPETGKAQLEVGGNVQGIFDLGPGRFGSEAVFVPRQPGTECEEDDG  488

Query  265  WIVTFVHDENTNKSQVYMIDAKHFSKEPIATITLPCRVPYGFHGTFITQ  119
            +++ FVHDENT KS V +IDAK  S EP+A + LP RVPYGFH  F+T+
Sbjct  489  YLIFFVHDENTGKSAVNVIDAKTMSAEPVAVVELPKRVPYGFHAFFVTE  537



>gb|AGT17077.1| carotenoid cleavage dioxygenase [Saccharum hybrid cultivar R570]
Length=543

 Score = 84.3 bits (207),  Expect = 7e-16, Method: Compositional matrix adjust.
 Identities = 53/111 (48%), Positives = 69/111 (62%), Gaps = 11/111 (10%)
 Frame = -1

Query  418  MAKYGGIGK--LHLE-EGEAKEL-----INVEYHMLPQNTFCTGAVFVAKADNT--EEDD  269
            +AK  GI K  LH E E   KEL     I   Y++ P   F + A+FV K      EEDD
Sbjct  425  IAKVTGIIKFDLHAEPESGKKELEVGGNIQGIYNLGP-GRFGSEAIFVPKQPGVSGEEDD  483

Query  268  GWIVTFVHDENTNKSQVYMIDAKHFSKEPIATITLPCRVPYGFHGTFITQN  116
            G+++ FVHDENT KS+V +IDAK  S +P+A + LP RVPYGFH  F+T++
Sbjct  484  GYLIFFVHDENTGKSEVNVIDAKTMSADPVAVVELPNRVPYGFHAFFVTED  534



>ref|XP_008375177.1| PREDICTED: carotenoid 9,10(9',10')-cleavage dioxygenase 1-like 
[Malus domestica]
Length=582

 Score = 84.3 bits (207),  Expect = 8e-16, Method: Compositional matrix adjust.
 Identities = 49/110 (45%), Positives = 66/110 (60%), Gaps = 11/110 (10%)
 Frame = -1

Query  418  MAKYGGIGK--LHLEEGEAKELINVE------YHMLPQNTFCTGAVFVAKAD--NTEEDD  269
            +AK  G+ K  LH E    K  I V       Y + P   F + A+FV +     +EEDD
Sbjct  465  IAKVTGVAKFDLHAEPEVGKTKIEVGGNVQGLYDLGP-GRFGSEAIFVPRIPGVTSEEDD  523

Query  268  GWIVTFVHDENTNKSQVYMIDAKHFSKEPIATITLPCRVPYGFHGTFITQ  119
            G+++ FVHDENT KS V+++DAK  S EP+A + LP RVPYGFH  F+T+
Sbjct  524  GYLILFVHDENTGKSAVHVVDAKTMSXEPVAVVELPHRVPYGFHAFFVTE  573



>gb|AEN94904.1| carotenoid cleavage dioxygenase, partial [Cucurbita moschata]
Length=442

 Score = 83.6 bits (205),  Expect = 8e-16, Method: Compositional matrix adjust.
 Identities = 50/110 (45%), Positives = 66/110 (60%), Gaps = 11/110 (10%)
 Frame = -1

Query  418  MAKYGGIGKLHL----EEGEAKELI--NVE--YHMLPQNTFCTGAVFVAKADNT--EEDD  269
            +AK  GI K  L    E G  K  +  NV   Y + P   F + A+FV +   T  EEDD
Sbjct  325  IAKVTGIAKFDLHAKRETGRTKIEVGGNVRGLYDLGP-GRFGSEAIFVPRIPGTTSEEDD  383

Query  268  GWIVTFVHDENTNKSQVYMIDAKHFSKEPIATITLPCRVPYGFHGTFITQ  119
            G+++ FVHDENT KS V ++DAK  S EP+A + LP RVPYGFH  F+++
Sbjct  384  GYLILFVHDENTGKSAVNVVDAKTMSSEPVAVVELPHRVPYGFHAFFVSE  433



>ref|XP_010241261.1| PREDICTED: carotenoid 9,10(9',10')-cleavage dioxygenase 1-like 
isoform X2 [Nelumbo nucifera]
Length=442

 Score = 83.6 bits (205),  Expect = 8e-16, Method: Compositional matrix adjust.
 Identities = 39/69 (57%), Positives = 50/69 (72%), Gaps = 1/69 (1%)
 Frame = -1

Query  322  FCTGAVFVAK-ADNTEEDDGWIVTFVHDENTNKSQVYMIDAKHFSKEPIATITLPCRVPY  146
            F + A+F+ +  D  EEDDG+++ FVHDENT KS V +IDAK  S +PIA I LP RVPY
Sbjct  365  FGSEAIFIPREPDACEEDDGYLIFFVHDENTGKSTVNVIDAKSMSSDPIAVIELPDRVPY  424

Query  145  GFHGTFITQ  119
            GFH  F+T+
Sbjct  425  GFHALFVTE  433



>gb|AFU91489.1| carotenoid cleavage dioxygenase 1 [Momordica charantia]
Length=547

 Score = 84.3 bits (207),  Expect = 8e-16, Method: Compositional matrix adjust.
 Identities = 51/109 (47%), Positives = 66/109 (61%), Gaps = 9/109 (8%)
 Frame = -1

Query  418  MAKYGGIGKLHL----EEGEAKELI--NVEYHMLP-QNTFCTGAVFVAKADNT--EEDDG  266
            +AK  GI K  L    E G+ K  +  NV+    P    F + A+FV +   T  EEDDG
Sbjct  430  IAKVTGIAKFDLNAKPETGKTKIEVGGNVQGLYDPGPGRFGSEAIFVPRIPGTTSEEDDG  489

Query  265  WIVTFVHDENTNKSQVYMIDAKHFSKEPIATITLPCRVPYGFHGTFITQ  119
            +++ FVHDENT KS V +IDAK  S EP+A + LP RVPYGFH  F+T+
Sbjct  490  YLIFFVHDENTGKSSVNVIDAKTMSTEPVAVVELPHRVPYGFHAFFVTE  538



>ref|XP_009589876.1| PREDICTED: carotenoid 9,10(9',10')-cleavage dioxygenase 1-like 
isoform X1 [Nicotiana tomentosiformis]
Length=546

 Score = 84.0 bits (206),  Expect = 8e-16, Method: Compositional matrix adjust.
 Identities = 50/109 (46%), Positives = 65/109 (60%), Gaps = 9/109 (8%)
 Frame = -1

Query  418  MAKYGGIGK--LHLEEGEAKELINVEYHM-----LPQNTFCTGAVFVAKADNTE--EDDG  266
            +AK  G+ K  LH E    K  + V  ++     L    F + AVFV +   TE  EDDG
Sbjct  429  IAKVTGVIKFDLHAEPETGKAQLEVGGNVQGIFDLGSGRFGSEAVFVPRQPGTESEEDDG  488

Query  265  WIVTFVHDENTNKSQVYMIDAKHFSKEPIATITLPCRVPYGFHGTFITQ  119
            +++ FVHDENT KS V +IDAK  S EP+A + LP RVPYGFH  F+T+
Sbjct  489  YLIFFVHDENTGKSAVNVIDAKTMSTEPVAVVELPKRVPYGFHAFFVTE  537



>gb|KDO83428.1| hypothetical protein CISIN_1g007605mg [Citrus sinensis]
Length=596

 Score = 84.3 bits (207),  Expect = 8e-16, Method: Compositional matrix adjust.
 Identities = 40/75 (53%), Positives = 53/75 (71%), Gaps = 2/75 (3%)
 Frame = -1

Query  337  LPQNTFCTGAVFVAK--ADNTEEDDGWIVTFVHDENTNKSQVYMIDAKHFSKEPIATITL  164
            L    F + AVFV +  +  +EEDDG+++  VHDENT KS VY+IDAK  S +P+A I L
Sbjct  513  LGPGRFGSEAVFVPREPSSTSEEDDGYLIFHVHDENTGKSAVYVIDAKTMSADPVAVIEL  572

Query  163  PCRVPYGFHGTFITQ  119
            P RVPYGFHG F+++
Sbjct  573  PHRVPYGFHGIFLSE  587



>gb|AGN03859.1| carotenoid cleavage dioxygenase 1 [Scutellaria baicalensis]
Length=544

 Score = 84.0 bits (206),  Expect = 8e-16, Method: Compositional matrix adjust.
 Identities = 48/109 (44%), Positives = 67/109 (61%), Gaps = 9/109 (8%)
 Frame = -1

Query  418  MAKYGGIGK--LHLEEGEAKELINVEYHM-----LPQNTFCTGAVFVAKADNT--EEDDG  266
            +AK  GI K  LH+E    K+ + V  ++     L    F + AVFV +   T  EEDDG
Sbjct  427  IAKVTGIVKFDLHMEPESGKDKLEVGGNVSGLFDLGPGRFGSEAVFVPREPGTTSEEDDG  486

Query  265  WIVTFVHDENTNKSQVYMIDAKHFSKEPIATITLPCRVPYGFHGTFITQ  119
            +++ FVHDENT KS V ++DAK  S +P+A + LP RVPYGFH  F+++
Sbjct  487  YLIFFVHDENTGKSAVNVLDAKTMSSDPVAVVELPRRVPYGFHAFFVSE  535



>ref|XP_008666862.1| PREDICTED: carotenoid 9,10(9',10')-cleavage dioxygenase-like 
[Zea mays]
Length=159

 Score = 80.5 bits (197),  Expect = 8e-16, Method: Compositional matrix adjust.
 Identities = 51/114 (45%), Positives = 72/114 (63%), Gaps = 13/114 (11%)
 Frame = -1

Query  433  IKPLGMAKYGGIGKLHLE-EGEAKELI---NVE--YHMLPQNTFCTGAVFVAK--ADNTE  278
            +K  G+ K+     LH+E E   KEL    NV+  Y + P + F + A+FV K    + E
Sbjct  42   VKVTGIIKF----DLHVEPESGRKELEVGGNVQGIYDLGP-DIFGSEAIFVPKHPGVSGE  96

Query  277  EDDGWIVTFVHDENTNKSQVYMIDAKHFSKEPIATITLPCRVPYGFHGTFITQN  116
            EDD +++ FVHDENT KS+V +IDAK  S +P+A + LP RVPYGFH  F+T++
Sbjct  97   EDDDYLIFFVHDENTGKSEVNVIDAKTMSADPVAVVELPNRVPYGFHAFFVTED  150



>ref|WP_015202538.1| 9-cis-epoxycarotenoid dioxygenase [Crinalium epipsammum]
 ref|YP_007141927.1| 9-cis-epoxycarotenoid dioxygenase [Crinalium epipsammum PCC 9333]
 gb|AFZ12417.1| 9-cis-epoxycarotenoid dioxygenase [Crinalium epipsammum PCC 9333]
Length=495

 Score = 84.0 bits (206),  Expect = 8e-16, Method: Composition-based stats.
 Identities = 34/77 (44%), Positives = 53/77 (69%), Gaps = 0/77 (0%)
 Frame = -1

Query  349  EYHMLPQNTFCTGAVFVAKADNTEEDDGWIVTFVHDENTNKSQVYMIDAKHFSKEPIATI  170
            E H      +   AVFV + D T EDDGW++TFV+DE +N S++ +++A+  + EP+A +
Sbjct  412  ETHTFGHGRYGGEAVFVPRPDATNEDDGWLITFVYDEESNSSELVVVNAEDVTGEPVARV  471

Query  169  TLPCRVPYGFHGTFITQ  119
             +P RVPYGFHG +I++
Sbjct  472  IIPQRVPYGFHGIWISE  488



>gb|AHE41421.1| carotenoid cleavage dioxygenase 1, partial [Lycium chinense]
Length=407

 Score = 83.2 bits (204),  Expect = 9e-16, Method: Compositional matrix adjust.
 Identities = 50/109 (46%), Positives = 65/109 (60%), Gaps = 9/109 (8%)
 Frame = -1

Query  418  MAKYGGIGK--LHLEEGEAKELINVEYHM-----LPQNTFCTGAVFVAKADNTE--EDDG  266
            +AK  GI K  LH E    K  + V  ++     L    F + AVFV +   +E  EDDG
Sbjct  290  IAKVTGIIKFDLHAEPETGKSQLEVGGNVQGIFDLGPGRFGSEAVFVPRQPGSECEEDDG  349

Query  265  WIVTFVHDENTNKSQVYMIDAKHFSKEPIATITLPCRVPYGFHGTFITQ  119
            +++ FVHDENT KS V +IDAK  S EP+A + LP RVPYGFH  F+T+
Sbjct  350  YLIFFVHDENTGKSAVNVIDAKTMSAEPVAVVELPKRVPYGFHAFFVTE  398



>emb|CDX76782.1| BnaC08g33680D [Brassica napus]
Length=612

 Score = 84.3 bits (207),  Expect = 9e-16, Method: Composition-based stats.
 Identities = 45/108 (42%), Positives = 66/108 (61%), Gaps = 8/108 (7%)
 Frame = -1

Query  421  GMAKYGGIGK--LHLEEGEAKELINVE-----YHMLPQNTFCTGAVFVAKADNTEEDDGW  263
            G++K  GI K  LH E   +K ++ +       + +    + +  V+V + +  EEDDG+
Sbjct  497  GISKVTGIIKFDLHAEAETSKTMLQIGGNIKGIYKMGHGIYGSDPVYVPR-ETAEEDDGY  555

Query  262  IVTFVHDENTNKSQVYMIDAKHFSKEPIATITLPCRVPYGFHGTFITQ  119
            ++ FVHDENT KS V +IDAK  S EP+A + LP RVPYGFH  F+T+
Sbjct  556  LIFFVHDENTGKSCVNVIDAKTMSSEPVAVVELPHRVPYGFHALFVTE  603



>emb|CAA06712.1| carotenoid cleavage dioxygenase 1 [Arabidopsis thaliana]
Length=538

 Score = 84.0 bits (206),  Expect = 9e-16, Method: Compositional matrix adjust.
 Identities = 47/107 (44%), Positives = 67/107 (63%), Gaps = 8/107 (7%)
 Frame = -1

Query  418  MAKYGGIGK--LHLEEGEAKELINVEYHM-----LPQNTFCTGAVFVAKADNTEEDDGWI  260
            +AK  GI K  LH E    K ++ V  ++     L +  + + A++V + +  EEDDG++
Sbjct  424  IAKVTGIIKFDLHAEAETGKRMLEVGGNIKGIYDLGEGRYGSEAIYVPR-ETAEEDDGYL  482

Query  259  VTFVHDENTNKSQVYMIDAKHFSKEPIATITLPCRVPYGFHGTFITQ  119
            + FVHDENT KS V +IDAK  S EP+A + LP RVPYGFH  F+T+
Sbjct  483  IFFVHDENTGKSCVTVIDAKTMSAEPVAVVELPHRVPYGFHALFVTE  529



>ref|NP_191911.1| carotenoid 9,10(9',10')-cleavage dioxygenase 1 [Arabidopsis thaliana]
 sp|O65572.2|CCD1_ARATH RecName: Full=Carotenoid 9,10(9',10')-cleavage dioxygenase 1; 
AltName: Full=AtCCD1; AltName: Full=Neoxanthin cleavage enzyme 
NC1; Short=AtNCED1 [Arabidopsis thaliana]
 emb|CAB87805.1| neoxanthin cleavage enzyme nc1 [Arabidopsis thaliana]
 gb|AEE80498.1| carotenoid 9,10(9',10')-cleavage dioxygenase 1 [Arabidopsis thaliana]
Length=538

 Score = 84.0 bits (206),  Expect = 9e-16, Method: Compositional matrix adjust.
 Identities = 47/107 (44%), Positives = 67/107 (63%), Gaps = 8/107 (7%)
 Frame = -1

Query  418  MAKYGGIGK--LHLEEGEAKELINVEYHM-----LPQNTFCTGAVFVAKADNTEEDDGWI  260
            +AK  GI K  LH E    K ++ V  ++     L +  + + A++V + +  EEDDG++
Sbjct  424  IAKVTGIIKFDLHAEAETGKRMLEVGGNIKGIYDLGEGRYGSEAIYVPR-ETAEEDDGYL  482

Query  259  VTFVHDENTNKSQVYMIDAKHFSKEPIATITLPCRVPYGFHGTFITQ  119
            + FVHDENT KS V +IDAK  S EP+A + LP RVPYGFH  F+T+
Sbjct  483  IFFVHDENTGKSCVTVIDAKTMSAEPVAVVELPHRVPYGFHALFVTE  529



>ref|XP_006482868.1| PREDICTED: carotenoid 9,10(9',10')-cleavage dioxygenase 1-like 
isoform X1 [Citrus sinensis]
Length=597

 Score = 84.3 bits (207),  Expect = 9e-16, Method: Compositional matrix adjust.
 Identities = 39/70 (56%), Positives = 52/70 (74%), Gaps = 2/70 (3%)
 Frame = -1

Query  322  FCTGAVFVAK--ADNTEEDDGWIVTFVHDENTNKSQVYMIDAKHFSKEPIATITLPCRVP  149
            F + AVFV +  +  +EEDDG+++  VHDENT KS VY+IDAK  S +P+A I LP RVP
Sbjct  519  FGSEAVFVPREPSSTSEEDDGYLIFHVHDENTGKSAVYVIDAKTMSADPVAVIELPHRVP  578

Query  148  YGFHGTFITQ  119
            YGFHG F+++
Sbjct  579  YGFHGIFLSE  588



>emb|CAC79644.1| dioxygenase [Capsicum annuum]
Length=547

 Score = 84.0 bits (206),  Expect = 9e-16, Method: Compositional matrix adjust.
 Identities = 51/109 (47%), Positives = 65/109 (60%), Gaps = 9/109 (8%)
 Frame = -1

Query  418  MAKYGGIGK--LHLEEGEAKELINVEYHM-----LPQNTFCTGAVFVAKADNTE--EDDG  266
            +AK  GI K  LH E    K  + V  ++     L    F + AVFV    +TE  EDDG
Sbjct  430  IAKVTGIIKFDLHAEPKTGKSQLEVGGNVQGIFDLGPGRFGSEAVFVPSQPDTECEEDDG  489

Query  265  WIVTFVHDENTNKSQVYMIDAKHFSKEPIATITLPCRVPYGFHGTFITQ  119
            +++ FVHDENT KS V +IDAK  S EP+A + LP RVPYGFH  F+T+
Sbjct  490  FLIFFVHDENTGKSAVNVIDAKTMSAEPVAVVELPKRVPYGFHAFFVTE  538



>gb|AFK46945.1| unknown [Medicago truncatula]
Length=287

 Score = 81.6 bits (200),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 47/110 (43%), Positives = 67/110 (61%), Gaps = 9/110 (8%)
 Frame = -1

Query  421  GMAKYGGIGKLHL----EEGEAKELIN---VEYHMLPQNTFCTGAVFVAKADNT--EEDD  269
             +AK  GI K  L    + G+ K  +    V ++ L    F + AV+V +   T  EEDD
Sbjct  169  SIAKVTGIVKFDLHAKPDSGKTKLEVGGNVVGHYDLGPGRFGSEAVYVPRVPGTDSEEDD  228

Query  268  GWIVTFVHDENTNKSQVYMIDAKHFSKEPIATITLPCRVPYGFHGTFITQ  119
            G+++ FVHDENT KS V+++DAK  S +P+A + LP RVPYGFH  F+T+
Sbjct  229  GYLIFFVHDENTGKSFVHVLDAKTMSADPVAVVELPQRVPYGFHAFFVTE  278



>gb|AFW89636.1| white cap1 [Zea mays]
Length=467

 Score = 83.6 bits (205),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 54/111 (49%), Positives = 71/111 (64%), Gaps = 11/111 (10%)
 Frame = -1

Query  418  MAKYGGIGK--LHLE-EGEAKELI---NVE--YHMLPQNTFCTGAVFVAK--ADNTEEDD  269
            +AK  GI K  LH E E   KEL    NV+  Y + P   F + A+FV K    + EEDD
Sbjct  349  IAKVTGIIKFDLHAEPESGVKELEVGGNVQGIYDLGP-GRFGSEAIFVPKHPGVSGEEDD  407

Query  268  GWIVTFVHDENTNKSQVYMIDAKHFSKEPIATITLPCRVPYGFHGTFITQN  116
            G+++ FVHDENT KS+V +IDAK  S +P+A + LP RVPYGFH  F+T++
Sbjct  408  GYLIFFVHDENTGKSEVNVIDAKTMSADPVAVVELPNRVPYGFHAFFVTED  458



>ref|WP_015956780.1| carotenoid oxygenase [Cyanothece sp. PCC 7424]
 ref|YP_002380066.1| carotenoid oxygenase [Cyanothece sp. PCC 7424]
 gb|ACK73198.1| Carotenoid oxygenase [Cyanothece sp. PCC 7424]
Length=464

 Score = 83.6 bits (205),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 41/109 (38%), Positives = 64/109 (59%), Gaps = 6/109 (6%)
 Frame = -1

Query  445  FLTSIKPLGMAKYGGIGKLHLEEGEAKELINVEYHMLPQNTFCTGAVFVAKADNTEEDDG  266
            +  S+KP  +  + G+ K  LE GE      +  +      +    VF A  D   EDDG
Sbjct  360  YTASMKPDIVPLFDGVIKYDLETGE------ISRYYYGSGRYGGEVVFAANPDGNGEDDG  413

Query  265  WIVTFVHDENTNKSQVYMIDAKHFSKEPIATITLPCRVPYGFHGTFITQ  119
            W++TFV+DE+ N S++ ++ A++ + EPIA I +P RVPYGFHG +++Q
Sbjct  414  WLMTFVYDESDNSSELVILSAQNLNSEPIARIPIPRRVPYGFHGVWVSQ  462



>ref|XP_010088225.1| hypothetical protein L484_012507 [Morus notabilis]
 gb|EXB32777.1| hypothetical protein L484_012507 [Morus notabilis]
Length=544

 Score = 84.0 bits (206),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 50/110 (45%), Positives = 69/110 (63%), Gaps = 11/110 (10%)
 Frame = -1

Query  418  MAKYGGIGKLHL----EEGEAKELI--NVE--YHMLPQNTFCTGAVFVAKAD--NTEEDD  269
            +AK  GI K  L    E G+ +  +  NV+  Y + P   F + A+FV K     +EEDD
Sbjct  407  IAKVTGIVKFDLHGKPESGKTRIEVGGNVQGLYELGP-GRFGSEAIFVPKVPGITSEEDD  465

Query  268  GWIVTFVHDENTNKSQVYMIDAKHFSKEPIATITLPCRVPYGFHGTFITQ  119
            G+++ FVHDENT KS V++IDAK  S +P+A + LP RVPYGFH  F+T+
Sbjct  466  GYLIFFVHDENTGKSAVHVIDAKTMSPDPVAVVELPHRVPYGFHAFFVTE  515



>gb|EYU37495.1| hypothetical protein MIMGU_mgv1a006785mg [Erythranthe guttata]
Length=432

 Score = 83.2 bits (204),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 37/78 (47%), Positives = 52/78 (67%), Gaps = 0/78 (0%)
 Frame = -1

Query  352  VEYHMLPQNTFCTGAVFVAKADNTEEDDGWIVTFVHDENTNKSQVYMIDAKHFSKEPIAT  173
            V  H+ P   +     FV KA   EEDDG++V++VHDEN N+S+  ++DAK  + E +A+
Sbjct  346  VARHLFPPGCYGGEPFFVPKAAAAEEDDGYLVSYVHDENRNESKFIVMDAKSPNLEIVAS  405

Query  172  ITLPCRVPYGFHGTFITQ  119
            + LP RVPYGFHG F+ Q
Sbjct  406  VKLPQRVPYGFHGIFVPQ  423



>gb|AAN17413.1| neoxanthin cleavage enzyme nc1 [Arabidopsis thaliana]
 gb|AAN72113.1| neoxanthin cleavage enzyme nc1 [Arabidopsis thaliana]
Length=501

 Score = 83.6 bits (205),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 47/107 (44%), Positives = 67/107 (63%), Gaps = 8/107 (7%)
 Frame = -1

Query  418  MAKYGGIGK--LHLEEGEAKELINVEYHM-----LPQNTFCTGAVFVAKADNTEEDDGWI  260
            +AK  GI K  LH E    K ++ V  ++     L +  + + A++V + +  EEDDG++
Sbjct  387  IAKVTGIIKFDLHAEAETGKRMLEVGGNIKGIYDLGEGRYGSEAIYVPR-ETAEEDDGYL  445

Query  259  VTFVHDENTNKSQVYMIDAKHFSKEPIATITLPCRVPYGFHGTFITQ  119
            + FVHDENT KS V +IDAK  S EP+A + LP RVPYGFH  F+T+
Sbjct  446  IFFVHDENTGKSCVTVIDAKTMSAEPVAVVELPHRVPYGFHALFVTE  492



>ref|WP_006099204.1| Retinal pigment epithelial membrane protein [Coleofasciculus 
chthonoplastes]
 gb|EDX77091.1| Retinal pigment epithelial membrane protein [Coleofasciculus 
chthonoplastes PCC 7420]
Length=466

 Score = 83.6 bits (205),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 31/64 (48%), Positives = 50/64 (78%), Gaps = 0/64 (0%)
 Frame = -1

Query  310  AVFVAKADNTEEDDGWIVTFVHDENTNKSQVYMIDAKHFSKEPIATITLPCRVPYGFHGT  131
            AVF  + + T EDDGW++TFVHD N++ S++ +++A+  + EP+A + +P RVPYGFHGT
Sbjct  396  AVFAPRPNGTAEDDGWLITFVHDHNSDTSELVVLNAQDLTAEPVARVLMPQRVPYGFHGT  455

Query  130  FITQ  119
            +++Q
Sbjct  456  WVSQ  459



>gb|AAT68189.1| carotenoid cleavage dioxygenase 1 [Petunia x hybrida]
Length=546

 Score = 84.0 bits (206),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 51/109 (47%), Positives = 65/109 (60%), Gaps = 9/109 (8%)
 Frame = -1

Query  418  MAKYGGIGK--LHLEEGEAKELINVEYHM-----LPQNTFCTGAVFVAKADNTE--EDDG  266
            +AK  GI K  LH E    K+ + V  ++     L    F + AVFV     TE  EDDG
Sbjct  429  IAKVTGIIKFDLHAEPETGKKQLEVGGNVQGIFDLGPGRFGSEAVFVPSQPGTECEEDDG  488

Query  265  WIVTFVHDENTNKSQVYMIDAKHFSKEPIATITLPCRVPYGFHGTFITQ  119
            +++ FVHDENT KS V +IDAK  S EP+A + LP RVPYGFH  F+T+
Sbjct  489  YLIFFVHDENTGKSAVNVIDAKTMSAEPVAVVELPKRVPYGFHAFFVTE  537



>ref|WP_008274084.1| Retinal pigment epithelial membrane protein [Cyanothece sp. CCY0110]
 gb|EAZ92937.1| Retinal pigment epithelial membrane protein [Cyanothece sp. CCY0110]
Length=459

 Score = 83.2 bits (204),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 38/98 (39%), Positives = 60/98 (61%), Gaps = 6/98 (6%)
 Frame = -1

Query  412  KYGGIGKLHLEEGEAKELINVEYHMLPQNTFCTGAVFVAKADNTEEDDGWIVTFVHDENT  233
            K+ GI K   E+G        + H   ++ + +  +F    D  +ED+GW++TF+HDE +
Sbjct  368  KFNGIIKHDFEKG------GFDIHHFGRHRYGSEPIFAPNPDAEKEDEGWLLTFIHDEGS  421

Query  232  NKSQVYMIDAKHFSKEPIATITLPCRVPYGFHGTFITQ  119
            N S++ +IDA+ F+  PIA I +P RVPYGFHG ++ Q
Sbjct  422  NTSELVIIDAQDFTASPIAKIQIPQRVPYGFHGMWLAQ  459



>ref|XP_002465882.1| hypothetical protein SORBIDRAFT_01g047540 [Sorghum bicolor]
 gb|EER92880.1| hypothetical protein SORBIDRAFT_01g047540 [Sorghum bicolor]
Length=549

 Score = 84.0 bits (206),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 49/110 (45%), Positives = 67/110 (61%), Gaps = 9/110 (8%)
 Frame = -1

Query  418  MAKYGGIGK--LHLEEGEAKELINVEYHM-----LPQNTFCTGAVFVAKADNT--EEDDG  266
            +AK  GI K  LH E    K+ + V  ++     L    F + A+FV K      EEDDG
Sbjct  431  IAKVTGIIKFDLHAEPESGKKELEVGGNIQGIYDLGPGRFGSEAIFVPKQPGVSGEEDDG  490

Query  265  WIVTFVHDENTNKSQVYMIDAKHFSKEPIATITLPCRVPYGFHGTFITQN  116
            +++ FVHDENT KS+V +IDAK  S +P+A + LP RVPYGFH  F+T++
Sbjct  491  YLIFFVHDENTGKSEVNVIDAKTMSADPVAVVELPNRVPYGFHAFFVTED  540



>emb|CDX93902.1| BnaC04g20610D [Brassica napus]
Length=525

 Score = 83.6 bits (205),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 48/108 (44%), Positives = 68/108 (63%), Gaps = 8/108 (7%)
 Frame = -1

Query  421  GMAKYGGIGK--LHLEEGEAKELINVEYHM-----LPQNTFCTGAVFVAKADNTEEDDGW  263
             +AK  GI K  LH E    K+++ V  ++     L Q  + + A++V + +  EEDDG+
Sbjct  410  SIAKVTGIIKFDLHAEAETGKKILEVGGNIKGIYELGQGRYGSEAIYVPR-EAGEEDDGY  468

Query  262  IVTFVHDENTNKSQVYMIDAKHFSKEPIATITLPCRVPYGFHGTFITQ  119
            ++ FVHDENT KS V +IDAK  S EP+A + LP RVPYGFH  F+T+
Sbjct  469  LIFFVHDENTGKSCVNVIDAKTMSAEPVAVVELPHRVPYGFHAFFVTE  516



>ref|XP_010088226.1| hypothetical protein L484_012508 [Morus notabilis]
 gb|EXB32778.1| hypothetical protein L484_012508 [Morus notabilis]
Length=581

 Score = 84.0 bits (206),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 50/109 (46%), Positives = 65/109 (60%), Gaps = 9/109 (8%)
 Frame = -1

Query  418  MAKYGGIGK--LHLEEGEAKELI----NVEYHMLP-QNTFCTGAVFVAKAD--NTEEDDG  266
            +AK  GI K  LH E    K  I    NV+    P    F + A+FV K     +EEDDG
Sbjct  417  IAKVSGIVKFDLHAEPESGKTCIEVGGNVQGLYDPGPGRFGSEAIFVPKVPGITSEEDDG  476

Query  265  WIVTFVHDENTNKSQVYMIDAKHFSKEPIATITLPCRVPYGFHGTFITQ  119
            +++ F HDENT KS V++IDAK  S +P+A + LP RVPYGFH  F+T+
Sbjct  477  YLIFFAHDENTGKSSVHVIDAKTMSPDPVAVVDLPHRVPYGFHALFVTE  525



>ref|XP_010241260.1| PREDICTED: carotenoid 9,10(9',10')-cleavage dioxygenase 1-like 
isoform X1 [Nelumbo nucifera]
Length=535

 Score = 83.6 bits (205),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 39/69 (57%), Positives = 50/69 (72%), Gaps = 1/69 (1%)
 Frame = -1

Query  322  FCTGAVFVAK-ADNTEEDDGWIVTFVHDENTNKSQVYMIDAKHFSKEPIATITLPCRVPY  146
            F + A+F+ +  D  EEDDG+++ FVHDENT KS V +IDAK  S +PIA I LP RVPY
Sbjct  458  FGSEAIFIPREPDACEEDDGYLIFFVHDENTGKSTVNVIDAKSMSSDPIAVIELPDRVPY  517

Query  145  GFHGTFITQ  119
            GFH  F+T+
Sbjct  518  GFHALFVTE  526



>gb|EYU37493.1| hypothetical protein MIMGU_mgv1a023345mg, partial [Erythranthe 
guttata]
Length=522

 Score = 83.6 bits (205),  Expect = 1e-15, Method: Composition-based stats.
 Identities = 37/78 (47%), Positives = 52/78 (67%), Gaps = 0/78 (0%)
 Frame = -1

Query  352  VEYHMLPQNTFCTGAVFVAKADNTEEDDGWIVTFVHDENTNKSQVYMIDAKHFSKEPIAT  173
            V  H+ P   +     FV KA   EEDDG++V++VHDEN N+S+  ++DAK  + E +A+
Sbjct  436  VARHLFPPGCYGGEPFFVPKAAAAEEDDGYLVSYVHDENRNESKFIVMDAKSPNLEIVAS  495

Query  172  ITLPCRVPYGFHGTFITQ  119
            + LP RVPYGFHG F+ Q
Sbjct  496  VKLPQRVPYGFHGIFVPQ  513



>ref|XP_006878604.1| hypothetical protein AMTR_s00011p00256590 [Amborella trichopoda]
 gb|ERM94749.1| hypothetical protein AMTR_s00011p00256590 [Amborella trichopoda]
Length=266

 Score = 81.3 bits (199),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 46/110 (42%), Positives = 66/110 (60%), Gaps = 2/110 (2%)
 Frame = -1

Query  448  FFLTSIKPLGMAKYGGIGKLHLEEGEAKELINVEYHMLPQNTFCTGAVFVAKADNTEEDD  269
            F   SI  L M K  G+ KL LE  E K    V   +  +  F + A FVAK+++  EDD
Sbjct  140  FVYVSIGGL-MPKSTGVVKLDLER-EGKGECVVAQRVYEEGWFGSEAAFVAKSESESEDD  197

Query  268  GWIVTFVHDENTNKSQVYMIDAKHFSKEPIATITLPCRVPYGFHGTFITQ  119
            G++V F+H+E T ++   ++DA     E +A++TLP RVPYGFHG F+T+
Sbjct  198  GYVVAFLHEEATGEAGFVVMDAASSDLEIVASVTLPQRVPYGFHGCFLTE  247



>ref|XP_011087733.1| PREDICTED: carotenoid 9,10(9',10')-cleavage dioxygenase 1-like 
[Sesamum indicum]
Length=540

 Score = 83.6 bits (205),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 50/108 (46%), Positives = 65/108 (60%), Gaps = 9/108 (8%)
 Frame = -1

Query  415  AKYGGIGK--LHLEEGEAKELINVEYHM-----LPQNTFCTGAVFVAKADNT--EEDDGW  263
            AK  GI K  LH E    KE + V  ++     L    F + AVFV +   T  +EDDG+
Sbjct  424  AKVTGIIKFDLHAEPETGKEKLEVGGNITGIFDLGPGKFGSEAVFVPRQPGTASDEDDGY  483

Query  262  IVTFVHDENTNKSQVYMIDAKHFSKEPIATITLPCRVPYGFHGTFITQ  119
            ++ FVHDENT KS V +IDAK  S +P+A + LP RVPYGFH  F+T+
Sbjct  484  LIFFVHDENTGKSAVNVIDAKTMSADPVAVVELPKRVPYGFHALFVTE  531



>ref|XP_006345500.1| PREDICTED: carotenoid 9,10(9',10')-cleavage dioxygenase 1-like 
[Solanum tuberosum]
Length=576

 Score = 83.6 bits (205),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 40/70 (57%), Positives = 50/70 (71%), Gaps = 2/70 (3%)
 Frame = -1

Query  322  FCTGAVFVAKADNTE--EDDGWIVTFVHDENTNKSQVYMIDAKHFSKEPIATITLPCRVP  149
            F + AVFV +   TE  EDDG+++ FVHDENT KS V +IDAK  S EP+A + LP RVP
Sbjct  468  FGSEAVFVPRQPGTECEEDDGYLILFVHDENTGKSSVNVIDAKTMSAEPVAVVELPKRVP  527

Query  148  YGFHGTFITQ  119
            YGFH  F+T+
Sbjct  528  YGFHAFFVTE  537



>gb|AFK39230.1| unknown [Lotus japonicus]
Length=331

 Score = 81.3 bits (199),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 49/112 (44%), Positives = 69/112 (62%), Gaps = 11/112 (10%)
 Frame = -1

Query  421  GMAKYGGIGKLHL----EEGEAKELI--NVE--YHMLPQNTFCTGAVFVAKADNT--EED  272
             +AK  G+ K  L    + G+ K  +  NV+  Y + P   F + AV+V +   T  EED
Sbjct  213  SIAKVTGVVKFDLHAKPDSGKTKLEVGGNVQGLYDLGP-GKFGSEAVYVPRVPGTDSEED  271

Query  271  DGWIVTFVHDENTNKSQVYMIDAKHFSKEPIATITLPCRVPYGFHGTFITQN  116
            DG+++ F HDENT KS V++IDAK  S +PIA + LP RVPYGFH  F+T++
Sbjct  272  DGYLILFAHDENTGKSFVHVIDAKTMSADPIAVVELPHRVPYGFHAFFVTED  323



>gb|KFK35504.1| hypothetical protein AALP_AA5G293200 [Arabis alpina]
Length=532

 Score = 83.2 bits (204),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 48/107 (45%), Positives = 68/107 (64%), Gaps = 8/107 (7%)
 Frame = -1

Query  418  MAKYGGIGK--LHLEEGEAKELINVEYHM-----LPQNTFCTGAVFVAKADNTEEDDGWI  260
            +AK  GI K  LH E    K+++ V  ++     L +  + + AV+V + D  EEDDG++
Sbjct  418  IAKITGIIKFDLHAEAETDKKMLEVGGNIKGIYELGEGRYGSEAVYVPR-DAAEEDDGYL  476

Query  259  VTFVHDENTNKSQVYMIDAKHFSKEPIATITLPCRVPYGFHGTFITQ  119
            + FVHDENT KS V +I+AK  S EP+A + LP RVPYGFH  F+T+
Sbjct  477  IFFVHDENTGKSCVNVINAKTMSAEPVAVVELPHRVPYGFHALFVTE  523



>dbj|BAF31898.1| putative 9-cis-epoxycarotenoid dioxygenase [Cryptomeria japonica]
 dbj|BAF31901.1| putative 9-cis-epoxycarotenoid dioxygenase [Cryptomeria japonica]
 dbj|BAF31924.1| putative 9-cis-epoxycarotenoid dioxygenase [Cryptomeria japonica]
 dbj|BAF31926.1| putative 9-cis-epoxycarotenoid dioxygenase [Cryptomeria japonica]
Length=625

 Score = 83.6 bits (205),  Expect = 2e-15, Method: Composition-based stats.
 Identities = 42/100 (42%), Positives = 64/100 (64%), Gaps = 6/100 (6%)
 Frame = -1

Query  412  KYGGIGKLHLEEGEAKELI-NVEYHMLPQNTFCTGAVFVAKADNTE--EDDGWIVTFVHD  242
            K  GI K+ LE    + ++  +EY    +  +     FV +  N E  EDDG+++TF+H+
Sbjct  520  KVSGIAKVDLEAESPERVVGKIEYK---KGCYGGEPFFVPRTSNPEAPEDDGYVLTFMHN  576

Query  241  ENTNKSQVYMIDAKHFSKEPIATITLPCRVPYGFHGTFIT  122
            E T +S++ ++DAK  + EP+A++ LP RVPYGFHGTFIT
Sbjct  577  EETWQSELLILDAKSPTLEPVASVKLPSRVPYGFHGTFIT  616



>gb|AHH25649.1| carotenoid cleavage dioxygenase 1-1 [Nicotiana tabacum]
Length=544

 Score = 83.2 bits (204),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 50/109 (46%), Positives = 64/109 (59%), Gaps = 9/109 (8%)
 Frame = -1

Query  418  MAKYGGIGK--LHLEEGEAKELINVEYHMLP-----QNTFCTGAVFVAKADNTE--EDDG  266
            MAK  G+ K  LH E    K  + V  ++L         F + A+FV     TE  EDDG
Sbjct  427  MAKITGVVKFDLHAEPETGKTKLEVGGNVLGIFDLGPGRFGSEAIFVPCQPGTECEEDDG  486

Query  265  WIVTFVHDENTNKSQVYMIDAKHFSKEPIATITLPCRVPYGFHGTFITQ  119
            +++ FVHDENT KS V +IDAK  S EP+A + LP RVPYGFH  F+T+
Sbjct  487  YLILFVHDENTGKSSVNVIDAKTMSAEPVAVVELPKRVPYGFHAFFVTE  535



>ref|XP_009760607.1| PREDICTED: carotenoid 9,10(9',10')-cleavage dioxygenase 1-like 
[Nicotiana sylvestris]
 gb|AHH25651.1| carotenoid cleavage dioxygenase 1 [Nicotiana sylvestris]
Length=544

 Score = 83.2 bits (204),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 50/109 (46%), Positives = 64/109 (59%), Gaps = 9/109 (8%)
 Frame = -1

Query  418  MAKYGGIGK--LHLEEGEAKELINVEYHMLP-----QNTFCTGAVFVAKADNTE--EDDG  266
            MAK  G+ K  LH E    K  + V  ++L         F + A+FV     TE  EDDG
Sbjct  427  MAKITGVVKFDLHAEPETGKTKLEVGGNVLGIFDLGPGRFGSEAIFVPCQPGTECEEDDG  486

Query  265  WIVTFVHDENTNKSQVYMIDAKHFSKEPIATITLPCRVPYGFHGTFITQ  119
            +++ FVHDENT KS V +IDAK  S EP+A + LP RVPYGFH  F+T+
Sbjct  487  YLILFVHDENTGKSSVNVIDAKTMSAEPVAVVELPKRVPYGFHAFFVTE  535



>gb|AHA43413.1| carotenoid cleavage dioxygenase [Solanum nigrum]
Length=545

 Score = 83.2 bits (204),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 51/109 (47%), Positives = 64/109 (59%), Gaps = 9/109 (8%)
 Frame = -1

Query  418  MAKYGGIGK--LHLEEGEAKELINVEYHM-----LPQNTFCTGAVFVAKADNTE--EDDG  266
            +AK  GI K  LH E    K  + V  ++     L    F + AVFV     TE  EDDG
Sbjct  428  IAKVTGIIKFDLHAEPETGKSQLEVGGNVQGIFDLGPGRFGSEAVFVPSQPGTECEEDDG  487

Query  265  WIVTFVHDENTNKSQVYMIDAKHFSKEPIATITLPCRVPYGFHGTFITQ  119
            +++ FVHDENT KS V +IDAK  S EP+A + LP RVPYGFH  F+T+
Sbjct  488  YLIFFVHDENTGKSAVNVIDAKTMSAEPVAVVELPKRVPYGFHAFFVTE  536



>dbj|BAF31899.1| putative 9-cis-epoxycarotenoid dioxygenase [Cryptomeria japonica]
 dbj|BAF31917.1| putative 9-cis-epoxycarotenoid dioxygenase [Cryptomeria japonica]
 dbj|BAF31919.1| putative 9-cis-epoxycarotenoid dioxygenase [Cryptomeria japonica]
 dbj|BAF31920.1| putative 9-cis-epoxycarotenoid dioxygenase [Cryptomeria japonica]
 dbj|BAF31921.1| putative 9-cis-epoxycarotenoid dioxygenase [Cryptomeria japonica]
 dbj|BAF31930.1| putative 9-cis-epoxycarotenoid dioxygenase [Cryptomeria japonica]
 dbj|BAF31933.1| putative 9-cis-epoxycarotenoid dioxygenase [Cryptomeria japonica]
 dbj|BAF31937.1| putative 9-cis-epoxycarotenoid dioxygenase [Cryptomeria japonica]
 dbj|BAF31943.1| putative 9-cis-epoxycarotenoid dioxygenase [Cryptomeria japonica]
Length=625

 Score = 83.6 bits (205),  Expect = 2e-15, Method: Composition-based stats.
 Identities = 42/100 (42%), Positives = 64/100 (64%), Gaps = 6/100 (6%)
 Frame = -1

Query  412  KYGGIGKLHLEEGEAKELI-NVEYHMLPQNTFCTGAVFVAKADNTE--EDDGWIVTFVHD  242
            K  GI K+ LE    + ++  +EY    +  +     FV +  N E  EDDG+++TF+H+
Sbjct  520  KVSGIAKVDLEAESPERVVGKIEYK---KGCYGGEPFFVPRTSNPEAPEDDGYVLTFMHN  576

Query  241  ENTNKSQVYMIDAKHFSKEPIATITLPCRVPYGFHGTFIT  122
            E T +S++ ++DAK  + EP+A++ LP RVPYGFHGTFIT
Sbjct  577  EETWQSELLILDAKSPTLEPVASVKLPSRVPYGFHGTFIT  616



>dbj|BAF31922.1| putative 9-cis-epoxycarotenoid dioxygenase [Cryptomeria japonica]
Length=625

 Score = 83.6 bits (205),  Expect = 2e-15, Method: Composition-based stats.
 Identities = 42/100 (42%), Positives = 64/100 (64%), Gaps = 6/100 (6%)
 Frame = -1

Query  412  KYGGIGKLHLEEGEAKELI-NVEYHMLPQNTFCTGAVFVAKADNTE--EDDGWIVTFVHD  242
            K  GI K+ LE    + ++  +EY    +  +     FV +  N E  EDDG+++TF+H+
Sbjct  520  KVSGIAKVDLEAESPERVVGKIEYK---KGCYGGEPFFVPRTSNPEAPEDDGYVLTFMHN  576

Query  241  ENTNKSQVYMIDAKHFSKEPIATITLPCRVPYGFHGTFIT  122
            E T +S++ ++DAK  + EP+A++ LP RVPYGFHGTFIT
Sbjct  577  EETWQSELLILDAKSPTLEPVASVKLPSRVPYGFHGTFIT  616



>gb|AFV15390.1| carotenoid cleavage dioxygenase 1 [Tanacetum cinerariifolium]
Length=539

 Score = 83.2 bits (204),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 51/119 (43%), Positives = 70/119 (59%), Gaps = 11/119 (9%)
 Frame = -1

Query  445  FLTSIKPLGMAKYGGIGK--LHLEEGEAKELINVE------YHMLPQNTFCTGAVFVAKA  290
            F+ + +   +AK  GI K  LH E    KE I V       Y + P   + + A+FV K 
Sbjct  413  FVYATRLDSIAKVTGIVKFDLHAEPEAGKEKIEVGGNVQGIYDLGP-GRYGSEAIFVPKQ  471

Query  289  D--NTEEDDGWIVTFVHDENTNKSQVYMIDAKHFSKEPIATITLPCRVPYGFHGTFITQ  119
               ++EEDDG+++ F HDENT KS V +IDAK  S +P+A + LP RVPYGFH  F+T+
Sbjct  472  PGVDSEEDDGYLIFFTHDENTGKSTVTVIDAKTMSPDPVAVVPLPHRVPYGFHAFFVTE  530



>dbj|BAF31905.1| putative 9-cis-epoxycarotenoid dioxygenase [Cryptomeria japonica]
Length=625

 Score = 83.6 bits (205),  Expect = 2e-15, Method: Composition-based stats.
 Identities = 42/100 (42%), Positives = 64/100 (64%), Gaps = 6/100 (6%)
 Frame = -1

Query  412  KYGGIGKLHLEEGEAKELI-NVEYHMLPQNTFCTGAVFVAKADNTE--EDDGWIVTFVHD  242
            K  GI K+ LE    + ++  +EY    +  +     FV +  N E  EDDG+++TF+H+
Sbjct  520  KVSGIAKVDLEAESPERVVGKIEYK---KGCYGGEPFFVPRTSNPEAPEDDGYVLTFMHN  576

Query  241  ENTNKSQVYMIDAKHFSKEPIATITLPCRVPYGFHGTFIT  122
            E T +S++ ++DAK  + EP+A++ LP RVPYGFHGTFIT
Sbjct  577  EETWQSELLILDAKSPTLEPVASVKLPSRVPYGFHGTFIT  616



>dbj|BAF31903.1| putative 9-cis-epoxycarotenoid dioxygenase [Cryptomeria japonica]
 dbj|BAF31908.1| putative 9-cis-epoxycarotenoid dioxygenase [Cryptomeria japonica]
Length=625

 Score = 83.6 bits (205),  Expect = 2e-15, Method: Composition-based stats.
 Identities = 42/100 (42%), Positives = 64/100 (64%), Gaps = 6/100 (6%)
 Frame = -1

Query  412  KYGGIGKLHLEEGEAKELI-NVEYHMLPQNTFCTGAVFVAKADNTE--EDDGWIVTFVHD  242
            K  GI K+ LE    + ++  +EY    +  +     FV +  N E  EDDG+++TF+H+
Sbjct  520  KVSGIAKVDLEAESPERVVGKIEYK---KGCYGGEPFFVPRTSNPEAPEDDGYVLTFMHN  576

Query  241  ENTNKSQVYMIDAKHFSKEPIATITLPCRVPYGFHGTFIT  122
            E T +S++ ++DAK  + EP+A++ LP RVPYGFHGTFIT
Sbjct  577  EETWQSELLILDAKSPTLEPVASVKLPSRVPYGFHGTFIT  616



>dbj|BAF31929.1| putative 9-cis-epoxycarotenoid dioxygenase [Cryptomeria japonica]
Length=625

 Score = 83.6 bits (205),  Expect = 2e-15, Method: Composition-based stats.
 Identities = 42/100 (42%), Positives = 64/100 (64%), Gaps = 6/100 (6%)
 Frame = -1

Query  412  KYGGIGKLHLEEGEAKELI-NVEYHMLPQNTFCTGAVFVAKADNTE--EDDGWIVTFVHD  242
            K  GI K+ LE    + ++  +EY    +  +     FV +  N E  EDDG+++TF+H+
Sbjct  520  KVSGIAKVDLEAESPERVVGKIEYK---KGCYGGEPFFVPRTSNPEAPEDDGYVLTFMHN  576

Query  241  ENTNKSQVYMIDAKHFSKEPIATITLPCRVPYGFHGTFIT  122
            E T +S++ ++DAK  + EP+A++ LP RVPYGFHGTFIT
Sbjct  577  EETWQSELLILDAKSPTLEPVASVKLPSRVPYGFHGTFIT  616



>dbj|BAF31900.1| putative 9-cis-epoxycarotenoid dioxygenase [Cryptomeria japonica]
 dbj|BAF31902.1| putative 9-cis-epoxycarotenoid dioxygenase [Cryptomeria japonica]
 dbj|BAF31904.1| putative 9-cis-epoxycarotenoid dioxygenase [Cryptomeria japonica]
 dbj|BAF31907.1| putative 9-cis-epoxycarotenoid dioxygenase [Cryptomeria japonica]
 dbj|BAF31909.1| putative 9-cis-epoxycarotenoid dioxygenase [Cryptomeria japonica]
 dbj|BAF31910.1| putative 9-cis-epoxycarotenoid dioxygenase [Cryptomeria japonica]
 dbj|BAF31911.1| putative 9-cis-epoxycarotenoid dioxygenase [Cryptomeria japonica]
 dbj|BAF31912.1| putative 9-cis-epoxycarotenoid dioxygenase [Cryptomeria japonica]
 dbj|BAF31914.1| putative 9-cis-epoxycarotenoid dioxygenase [Cryptomeria japonica]
 dbj|BAF31915.1| putative 9-cis-epoxycarotenoid dioxygenase [Cryptomeria japonica]
 dbj|BAF31916.1| putative 9-cis-epoxycarotenoid dioxygenase [Cryptomeria japonica]
 dbj|BAF31923.1| putative 9-cis-epoxycarotenoid dioxygenase [Cryptomeria japonica]
 dbj|BAF31925.1| putative 9-cis-epoxycarotenoid dioxygenase [Cryptomeria japonica]
 dbj|BAF31927.1| putative 9-cis-epoxycarotenoid dioxygenase [Cryptomeria japonica]
 dbj|BAF31928.1| putative 9-cis-epoxycarotenoid dioxygenase [Cryptomeria japonica]
 dbj|BAF31932.1| putative 9-cis-epoxycarotenoid dioxygenase [Cryptomeria japonica]
 dbj|BAF31934.1| putative 9-cis-epoxycarotenoid dioxygenase [Cryptomeria japonica]
 dbj|BAF31935.1| putative 9-cis-epoxycarotenoid dioxygenase [Cryptomeria japonica]
 dbj|BAF31936.1| putative 9-cis-epoxycarotenoid dioxygenase [Cryptomeria japonica]
 dbj|BAF31938.1| putative 9-cis-epoxycarotenoid dioxygenase [Cryptomeria japonica]
 dbj|BAF31939.1| putative 9-cis-epoxycarotenoid dioxygenase [Cryptomeria japonica]
 dbj|BAF31940.1| putative 9-cis-epoxycarotenoid dioxygenase [Cryptomeria japonica]
 dbj|BAF31941.1| putative 9-cis-epoxycarotenoid dioxygenase [Cryptomeria japonica]
 dbj|BAF31942.1| putative 9-cis-epoxycarotenoid dioxygenase [Cryptomeria japonica]
 dbj|BAF31944.1| putative 9-cis-epoxycarotenoid dioxygenase [Cryptomeria japonica]
 dbj|BAF31945.1| putative 9-cis-epoxycarotenoid dioxygenase [Cryptomeria japonica]
Length=625

 Score = 83.6 bits (205),  Expect = 2e-15, Method: Composition-based stats.
 Identities = 42/100 (42%), Positives = 64/100 (64%), Gaps = 6/100 (6%)
 Frame = -1

Query  412  KYGGIGKLHLEEGEAKELI-NVEYHMLPQNTFCTGAVFVAKADNTE--EDDGWIVTFVHD  242
            K  GI K+ LE    + ++  +EY    +  +     FV +  N E  EDDG+++TF+H+
Sbjct  520  KVSGIAKVDLEAESPERVVGKIEYK---KGCYGGEPFFVPRTSNPEAPEDDGYVLTFMHN  576

Query  241  ENTNKSQVYMIDAKHFSKEPIATITLPCRVPYGFHGTFIT  122
            E T +S++ ++DAK  + EP+A++ LP RVPYGFHGTFIT
Sbjct  577  EETWQSELLILDAKSPTLEPVASVKLPSRVPYGFHGTFIT  616



>ref|XP_004963348.1| PREDICTED: carotenoid 9,10(9',10')-cleavage dioxygenase-like 
[Setaria italica]
Length=545

 Score = 83.2 bits (204),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 49/109 (45%), Positives = 66/109 (61%), Gaps = 9/109 (8%)
 Frame = -1

Query  418  MAKYGGIGK--LHLEEGEAKELINVEYHM-----LPQNTFCTGAVFVAKADNT--EEDDG  266
            +AK  GI K  LH E    K+ + V  ++     L    F + A+FV K      EEDDG
Sbjct  426  IAKVTGIIKFDLHAEPESGKKELEVGGNIQGIYDLGPGRFGSEAIFVPKQPGVSGEEDDG  485

Query  265  WIVTFVHDENTNKSQVYMIDAKHFSKEPIATITLPCRVPYGFHGTFITQ  119
            +++ FVHDENT KS+V +IDAK  S +P+A + LP RVPYGFH  F+T+
Sbjct  486  YLIFFVHDENTGKSEVNVIDAKTMSADPVAVVELPNRVPYGFHAFFVTE  534



>dbj|BAJ05401.1| carotenoid cleavage dioxygenase 1 [Osmanthus fragrans]
Length=543

 Score = 83.2 bits (204),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 49/110 (45%), Positives = 67/110 (61%), Gaps = 9/110 (8%)
 Frame = -1

Query  418  MAKYGGIGK--LHLEEGEAKELINVEYHM-----LPQNTFCTGAVFVAK--ADNTEEDDG  266
            +AK  GI K  LH E    KE + +  ++     L    F + AVFV +     +EEDDG
Sbjct  426  IAKVTGIIKFDLHAEPETGKEKLELGGNVKGIFDLGPGRFGSEAVFVPRHPGITSEEDDG  485

Query  265  WIVTFVHDENTNKSQVYMIDAKHFSKEPIATITLPCRVPYGFHGTFITQN  116
            +++ FVHDENT KS V +IDAK  S +P+A + LP RVPYGFH  F+T++
Sbjct  486  YLIFFVHDENTGKSAVNVIDAKTMSPDPVAVVELPKRVPYGFHAFFVTED  535



>dbj|BAF31906.1| putative 9-cis-epoxycarotenoid dioxygenase [Cryptomeria japonica]
 dbj|BAF31913.1| putative 9-cis-epoxycarotenoid dioxygenase [Cryptomeria japonica]
 dbj|BAF31918.1| putative 9-cis-epoxycarotenoid dioxygenase [Cryptomeria japonica]
 dbj|BAF31931.1| putative 9-cis-epoxycarotenoid dioxygenase [Cryptomeria japonica]
Length=625

 Score = 83.6 bits (205),  Expect = 2e-15, Method: Composition-based stats.
 Identities = 42/100 (42%), Positives = 64/100 (64%), Gaps = 6/100 (6%)
 Frame = -1

Query  412  KYGGIGKLHLEEGEAKELI-NVEYHMLPQNTFCTGAVFVAKADNTE--EDDGWIVTFVHD  242
            K  GI K+ LE    + ++  +EY    +  +     FV +  N E  EDDG+++TF+H+
Sbjct  520  KVSGIAKVDLEAESPERVVGKIEYK---KGCYGGEPFFVPRTSNPEAPEDDGYVLTFMHN  576

Query  241  ENTNKSQVYMIDAKHFSKEPIATITLPCRVPYGFHGTFIT  122
            E T +S++ ++DAK  + EP+A++ LP RVPYGFHGTFIT
Sbjct  577  EETWQSELLILDAKSPTLEPVASVKLPSRVPYGFHGTFIT  616



>gb|ADN65332.1| carotenoid cleavage dioxygenase 1 [Manihot esculenta]
Length=552

 Score = 83.2 bits (204),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 49/109 (45%), Positives = 65/109 (60%), Gaps = 9/109 (8%)
 Frame = -1

Query  418  MAKYGGIGK--LHLEEGEAKELINVEYHM-----LPQNTFCTGAVFVAKADNT--EEDDG  266
            +AK  GI K  LH E  + K  + V  ++     L    F + AVFV +   T  EEDDG
Sbjct  435  IAKVTGIIKFDLHAEPQQGKTKLEVGGNIKGIFDLGPGRFGSEAVFVPREPGTSSEEDDG  494

Query  265  WIVTFVHDENTNKSQVYMIDAKHFSKEPIATITLPCRVPYGFHGTFITQ  119
            +++ F HDENT KS V +IDAK  S +P+A + LP RVPYGFH  F+T+
Sbjct  495  YLIFFTHDENTGKSSVNVIDAKTMSSDPVAVVELPHRVPYGFHAFFVTE  543



>gb|ABF85668.1| carotenoid cleavage dioxyganase 1 [Zea mays]
Length=541

 Score = 83.2 bits (204),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 54/111 (49%), Positives = 70/111 (63%), Gaps = 11/111 (10%)
 Frame = -1

Query  418  MAKYGGIGK--LHLE-EGEAKELI---NVE--YHMLPQNTFCTGAVFVAKADNT--EEDD  269
            +AK  GI K  LH E E   KEL    NV+  Y + P   F + A+FV K      EEDD
Sbjct  423  IAKVTGIIKFDLHAEPESGVKELEVGGNVQGIYDLGP-GRFGSEAIFVPKHPGVSGEEDD  481

Query  268  GWIVTFVHDENTNKSQVYMIDAKHFSKEPIATITLPCRVPYGFHGTFITQN  116
            G+++ FVHDENT KS+V +IDAK  S +P+A + LP RVPYGFH  F+T++
Sbjct  482  GYLIFFVHDENTGKSEVNVIDAKTMSADPVAVVELPNRVPYGFHAFFVTED  532



>ref|XP_006853601.1| hypothetical protein AMTR_s00056p00032600 [Amborella trichopoda]
 gb|ERN15068.1| hypothetical protein AMTR_s00056p00032600 [Amborella trichopoda]
Length=416

 Score = 82.0 bits (201),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 41/76 (54%), Positives = 50/76 (66%), Gaps = 7/76 (9%)
 Frame = -1

Query  424  LGMAKYGGIGKLHLEEGEA-------KELINVEYHMLPQNTFCTGAVFVAKADNTEEDDG  266
            +G+AKY    KLH EE  A       K+ I VEYH L +N FC G VFVA+  +TEEDDG
Sbjct  316  IGLAKYNMFAKLHFEELGASHLQKGGKKRIKVEYHRLEKNEFCDGVVFVARPGSTEEDDG  375

Query  265  WIVTFVHDENTNKSQV  218
            WI+ F+H+ENTN S V
Sbjct  376  WILCFIHNENTNTSHV  391



>ref|NP_001105286.1| carotenoid cleavage dioxygenase [Zea mays]
 gb|AAV39613.1| carotenoid cleavage dioxygenase [Zea mays]
Length=541

 Score = 82.8 bits (203),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 54/111 (49%), Positives = 70/111 (63%), Gaps = 11/111 (10%)
 Frame = -1

Query  418  MAKYGGIGK--LHLE-EGEAKELI---NVE--YHMLPQNTFCTGAVFVAKADNT--EEDD  269
            +AK  GI K  LH E E   KEL    NV+  Y + P   F + A+FV K      EEDD
Sbjct  423  IAKVTGIIKFDLHAEPESGVKELEVGGNVQGIYDLGP-GRFGSEAIFVPKHPGVSGEEDD  481

Query  268  GWIVTFVHDENTNKSQVYMIDAKHFSKEPIATITLPCRVPYGFHGTFITQN  116
            G+++ FVHDENT KS+V +IDAK  S +P+A + LP RVPYGFH  F+T++
Sbjct  482  GYLIFFVHDENTGKSEVNVIDAKTMSADPVAVVELPNRVPYGFHAFFVTED  532



>gb|ACF79397.1| unknown [Zea mays]
 gb|ACG46084.1| 9,10-9,10 carotenoid cleavage dioxygenase 1 [Zea mays]
 gb|AFW89638.1| white cap1 [Zea mays]
Length=550

 Score = 82.8 bits (203),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 54/111 (49%), Positives = 70/111 (63%), Gaps = 11/111 (10%)
 Frame = -1

Query  418  MAKYGGIGK--LHLE-EGEAKELI---NVE--YHMLPQNTFCTGAVFVAKADNT--EEDD  269
            +AK  GI K  LH E E   KEL    NV+  Y + P   F + A+FV K      EEDD
Sbjct  432  IAKVTGIIKFDLHAEPESGVKELEVGGNVQGIYDLGP-GRFGSEAIFVPKHPGVSGEEDD  490

Query  268  GWIVTFVHDENTNKSQVYMIDAKHFSKEPIATITLPCRVPYGFHGTFITQN  116
            G+++ FVHDENT KS+V +IDAK  S +P+A + LP RVPYGFH  F+T++
Sbjct  491  GYLIFFVHDENTGKSEVNVIDAKTMSADPVAVVELPNRVPYGFHAFFVTED  541



>ref|NP_001234542.1| carotenoid cleavage dioxygenase 1-1 [Solanum lycopersicum]
 gb|AAT68187.1| carotenoid cleavage dioxygenase 1A [Solanum lycopersicum]
Length=545

 Score = 82.8 bits (203),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 50/109 (46%), Positives = 64/109 (59%), Gaps = 9/109 (8%)
 Frame = -1

Query  418  MAKYGGIGK--LHLEEGEAKELINVEYHM-----LPQNTFCTGAVFVAKADNTE--EDDG  266
            +AK  G+ K  LH E    K  + V  ++     L    F + AVFV     TE  EDDG
Sbjct  428  IAKVTGVIKFDLHAEPETGKSQLEVGGNVQGIFDLGPGRFGSEAVFVPSRPGTEREEDDG  487

Query  265  WIVTFVHDENTNKSQVYMIDAKHFSKEPIATITLPCRVPYGFHGTFITQ  119
            +++ FVHDENT KS V +IDAK  S EP+A + LP RVPYGFH  F+T+
Sbjct  488  YLIFFVHDENTGKSAVNVIDAKTMSAEPVAVVELPKRVPYGFHAFFVTE  536



>gb|AAY21819.1| carotenoid cleavage dioxygenase [Suaeda salsa]
Length=556

 Score = 82.8 bits (203),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 48/110 (44%), Positives = 68/110 (62%), Gaps = 11/110 (10%)
 Frame = -1

Query  418  MAKYGGIGK--LHLEEGEAKELINVE------YHMLPQNTFCTGAVFVAKADNT--EEDD  269
            +AK  GI K  LH E   +++ + V       + + P+  F + A+FV +   T  EEDD
Sbjct  439  IAKVKGIVKFDLHAEPDPSQKKLEVGGSVQGIFDLGPER-FGSEAIFVPREQGTSSEEDD  497

Query  268  GWIVTFVHDENTNKSQVYMIDAKHFSKEPIATITLPCRVPYGFHGTFITQ  119
            G+++ FVHDENT KS V +IDAK  S +P+A + LP RVPYGFH  F+T+
Sbjct  498  GYLIFFVHDENTGKSFVNVIDAKTMSADPVAVVELPSRVPYGFHAFFVTE  547



>ref|XP_006293242.1| hypothetical protein CARUB_v10019573mg [Capsella rubella]
 gb|EOA26140.1| hypothetical protein CARUB_v10019573mg [Capsella rubella]
Length=533

 Score = 82.8 bits (203),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 47/108 (44%), Positives = 67/108 (62%), Gaps = 8/108 (7%)
 Frame = -1

Query  421  GMAKYGGIGK--LHLEEGEAKELINVEYHM-----LPQNTFCTGAVFVAKADNTEEDDGW  263
             +AK  GI K  LH E    K+++ V  ++     L    + + A++V + +  EEDDG+
Sbjct  418  SIAKVTGIIKFDLHAEAETGKKMLEVGGNINGIYDLGHGRYGSEAIYVPR-EPAEEDDGY  476

Query  262  IVTFVHDENTNKSQVYMIDAKHFSKEPIATITLPCRVPYGFHGTFITQ  119
            ++ FVHDENT KS V +IDAK  S EP+A + LP RVPYGFH  F+T+
Sbjct  477  LIFFVHDENTGKSCVNVIDAKTMSAEPVAVVELPHRVPYGFHALFVTE  524



>ref|XP_006301637.1| hypothetical protein CARUB_v10022080mg, partial [Capsella rubella]
 gb|EOA34535.1| hypothetical protein CARUB_v10022080mg, partial [Capsella rubella]
Length=547

 Score = 82.8 bits (203),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 45/110 (41%), Positives = 68/110 (62%), Gaps = 9/110 (8%)
 Frame = -1

Query  433  IKPLGMAKYGGIGKLHLEEGEAKELINVEYHM-----LPQNTFCTGAVFVAKADNTEEDD  269
            +K +G+ K+     LH E  E K+++ V  ++     L Q  + + AV+V +    EEDD
Sbjct  433  LKVIGVIKF----DLHAEAEEGKKMLEVGGNIKGIYELGQGRYGSEAVYVPRGAAEEEDD  488

Query  268  GWIVTFVHDENTNKSQVYMIDAKHFSKEPIATITLPCRVPYGFHGTFITQ  119
            G+++ FVHDEN+ KS + +IDAK  S E +A + LP RVPYGFH  F+T+
Sbjct  489  GYLLFFVHDENSGKSCLKVIDAKTMSDETVAVVELPHRVPYGFHAFFLTE  538



>sp|Q94IR2.1|CCD1_PHAVU RecName: Full=Carotenoid 9,10(9',10')-cleavage dioxygenase 1; 
AltName: Full=Neoxanthin cleavage enzyme NC2; AltName: Full=PvCCD1; 
AltName: Full=PvNCED2 [Phaseolus vulgaris]
 gb|AAK38744.1| carotenoid 9,10-9',10' cleavage dioxygenase [Phaseolus vulgaris]
Length=543

 Score = 82.4 bits (202),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 48/109 (44%), Positives = 66/109 (61%), Gaps = 9/109 (8%)
 Frame = -1

Query  418  MAKYGGIGK--LHLEEGEAKELINVEYHM-----LPQNTFCTGAVFVAKADN--TEEDDG  266
            +AK  GI K  LH E    KE + V  ++     L    F + AV++ +     +EEDDG
Sbjct  426  IAKVTGIIKFDLHAEPDHGKEKLEVGGNVQGLYDLGPGKFGSEAVYIPRVPGIESEEDDG  485

Query  265  WIVTFVHDENTNKSQVYMIDAKHFSKEPIATITLPCRVPYGFHGTFITQ  119
            ++V FVHDEN  KS V++IDAK  S +P+A + LP RVPYGFH  F+T+
Sbjct  486  YLVLFVHDENAGKSFVHVIDAKTMSADPVAVVELPNRVPYGFHAFFVTE  534



>emb|CAD33264.1| carotenoid cleavage oxygenase [Solanum lycopersicum]
Length=546

 Score = 82.4 bits (202),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 39/75 (52%), Positives = 51/75 (68%), Gaps = 2/75 (3%)
 Frame = -1

Query  337  LPQNTFCTGAVFVAKADNTE--EDDGWIVTFVHDENTNKSQVYMIDAKHFSKEPIATITL  164
            L    F + A+FV +   TE  EDDG+++ FVHDENT KS V +IDAK  S EP+A + L
Sbjct  463  LGPGRFGSEAIFVPRQPGTECEEDDGYLILFVHDENTGKSSVNVIDAKTMSAEPVAVVEL  522

Query  163  PCRVPYGFHGTFITQ  119
            P RVP+GFH  F+T+
Sbjct  523  PKRVPFGFHAFFVTE  537



>ref|XP_010241258.1| PREDICTED: carotenoid 9,10(9',10')-cleavage dioxygenase 1 [Nelumbo 
nucifera]
Length=543

 Score = 82.4 bits (202),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 47/109 (43%), Positives = 63/109 (58%), Gaps = 9/109 (8%)
 Frame = -1

Query  418  MAKYGGIGKLHLEEGEAKELINVEYHMLPQNTFCTG-------AVFVAKAD--NTEEDDG  266
            +AK  GI K  L     K+   +E     Q  F  G       A+FV +    ++EEDDG
Sbjct  426  IAKVTGIVKFDLHAQPEKDRTKLEVGGNVQGIFDLGPGRFGSEAIFVPREPGISSEEDDG  485

Query  265  WIVTFVHDENTNKSQVYMIDAKHFSKEPIATITLPCRVPYGFHGTFITQ  119
            +++ FVHDENT KS V +IDAK  S +P+A + LP RVPYGFH  F+T+
Sbjct  486  YLIFFVHDENTGKSAVNVIDAKTMSADPVAVVELPHRVPYGFHAFFVTE  534



>gb|KCW81563.1| hypothetical protein EUGRSUZ_C02921 [Eucalyptus grandis]
Length=611

 Score = 82.8 bits (203),  Expect = 3e-15, Method: Composition-based stats.
 Identities = 39/77 (51%), Positives = 52/77 (68%), Gaps = 9/77 (12%)
 Frame = -1

Query  421  GMAKYGGIGKLHLEEGEA---------KELINVEYHMLPQNTFCTGAVFVAKADNTEEDD  269
            GM K+GG+ KL+L+E  A         ++ I V+YH   +N FC+GA FV K +  EEDD
Sbjct  533  GMPKFGGLAKLYLDEPVAAVSSKEEPSEDTIKVKYHKFGENIFCSGAAFVPKENGFEEDD  592

Query  268  GWIVTFVHDENTNKSQV  218
            GWI+TFVHDE+T+ SQV
Sbjct  593  GWIITFVHDESTDISQV  609



>ref|XP_006850220.1| hypothetical protein AMTR_s00022p00253450 [Amborella trichopoda]
 gb|ERN11801.1| hypothetical protein AMTR_s00022p00253450 [Amborella trichopoda]
Length=538

 Score = 82.4 bits (202),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 43/95 (45%), Positives = 63/95 (66%), Gaps = 6/95 (6%)
 Frame = -1

Query  397  GKLHLEEGEAKELINVEYHMLPQNTFCTGAVFVAKADNT--EEDDGWIVTFVHDENTNKS  224
            GK  LE G   + I   + + P+  + + A+FV +   T  EEDDG+++ FVHDENT KS
Sbjct  441  GKTRLEVGGNVQGI---FELGPRR-YGSEAIFVPREPGTTSEEDDGYLIFFVHDENTGKS  496

Query  223  QVYMIDAKHFSKEPIATITLPCRVPYGFHGTFITQ  119
            ++ +IDAK  S+EP+A + LP RVPYGFH  F+++
Sbjct  497  EINVIDAKTMSQEPVAVVELPKRVPYGFHAFFVSE  531



>ref|XP_006345443.1| PREDICTED: carotenoid 9,10(9',10')-cleavage dioxygenase 1-like 
[Solanum tuberosum]
Length=545

 Score = 82.4 bits (202),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 50/109 (46%), Positives = 64/109 (59%), Gaps = 9/109 (8%)
 Frame = -1

Query  418  MAKYGGIGK--LHLEEGEAKELINVEYHM-----LPQNTFCTGAVFVAKADNTE--EDDG  266
            +AK  G+ K  LH E    K  + V  ++     L    F + AVFV     TE  EDDG
Sbjct  428  IAKVTGVIKFDLHAEPETGKSQLEVGGNVQGIFDLGPGRFGSEAVFVPSQPGTECEEDDG  487

Query  265  WIVTFVHDENTNKSQVYMIDAKHFSKEPIATITLPCRVPYGFHGTFITQ  119
            +++ FVHDENT KS V +IDAK  S EP+A + LP RVPYGFH  F+T+
Sbjct  488  YLIFFVHDENTGKSAVNVIDAKTMSMEPVAVVELPKRVPYGFHAFFVTE  536



>ref|XP_006664795.1| PREDICTED: carotenoid 9,10(9',10')-cleavage dioxygenase-like 
[Oryza brachyantha]
Length=548

 Score = 82.4 bits (202),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 49/110 (45%), Positives = 65/110 (59%), Gaps = 11/110 (10%)
 Frame = -1

Query  418  MAKYGGIGK--LHLEEGEAKELINVE------YHMLPQNTFCTGAVFVAKADNT--EEDD  269
            +AK  GI K  LH E    K+ + V       Y + P   F + A+FV K      EEDD
Sbjct  430  IAKVTGIVKFDLHAEPESGKKQLEVGGTVKGIYDLGP-GRFGSEAIFVPKEPGVSGEEDD  488

Query  268  GWIVTFVHDENTNKSQVYMIDAKHFSKEPIATITLPCRVPYGFHGTFITQ  119
            G+++ FVHDE T KSQV++IDAK  S +P+A + LP RVPYGFH  F+ +
Sbjct  489  GYLIFFVHDEKTGKSQVHVIDAKTMSADPVAVVELPNRVPYGFHAFFVNE  538



>ref|XP_006345441.1| PREDICTED: carotenoid 9,10(9',10')-cleavage dioxygenase 1-like 
isoform X1 [Solanum tuberosum]
Length=546

 Score = 82.4 bits (202),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 38/70 (54%), Positives = 50/70 (71%), Gaps = 2/70 (3%)
 Frame = -1

Query  322  FCTGAVFVAKADNTE--EDDGWIVTFVHDENTNKSQVYMIDAKHFSKEPIATITLPCRVP  149
            F + A+FV +   TE  EDDG+++ FVHDENT KS V +IDAK  S EP+A + LP RVP
Sbjct  468  FGSEAIFVPRQPGTECEEDDGYLILFVHDENTGKSSVNVIDAKTMSAEPVAVVELPKRVP  527

Query  148  YGFHGTFITQ  119
            +GFH  F+T+
Sbjct  528  FGFHAFFVTE  537



>ref|XP_009365068.1| PREDICTED: carotenoid 9,10(9',10')-cleavage dioxygenase 1-like 
[Pyrus x bretschneideri]
Length=474

 Score = 82.0 bits (201),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 44/98 (45%), Positives = 63/98 (64%), Gaps = 10/98 (10%)
 Frame = -1

Query  400  IGKLHLEEGEAKELINVE--YHMLPQNTFCTGAVFVAKAD--NTEEDDGWIVTFVHDENT  233
            +GK  +E G      NV+  Y + P   F + A+FV +     +EEDDG+++ FVHDENT
Sbjct  374  VGKTQIEVGG-----NVQGLYDLGP-GRFGSEAIFVPRIPGVTSEEDDGYLILFVHDENT  427

Query  232  NKSQVYMIDAKHFSKEPIATITLPCRVPYGFHGTFITQ  119
             KS ++++DAK  S EP+A + LP RVPYGFH  F+T+
Sbjct  428  GKSAIHVVDAKTMSPEPVAVVELPHRVPYGFHAFFVTE  465



>ref|NP_001233838.1| carotenoid cleavage dioxygenase 1-2 [Solanum lycopersicum]
 gb|AAT68188.2| carotenoid cleavage dioxygenase 1B [Solanum lycopersicum]
Length=545

 Score = 82.4 bits (202),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 38/70 (54%), Positives = 50/70 (71%), Gaps = 2/70 (3%)
 Frame = -1

Query  322  FCTGAVFVAKADNTE--EDDGWIVTFVHDENTNKSQVYMIDAKHFSKEPIATITLPCRVP  149
            F + A+FV +   TE  EDDG+++ FVHDENT KS V +IDAK  S EP+A + LP RVP
Sbjct  467  FGSEAIFVPRQPGTECEEDDGYLILFVHDENTGKSSVNVIDAKTMSAEPVAVVELPKRVP  526

Query  148  YGFHGTFITQ  119
            +GFH  F+T+
Sbjct  527  FGFHAFFVTE  536



>ref|XP_010324092.1| PREDICTED: carotenoid cleavage dioxygenase 1-2 isoform X1 [Solanum 
lycopersicum]
Length=550

 Score = 82.4 bits (202),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 38/70 (54%), Positives = 50/70 (71%), Gaps = 2/70 (3%)
 Frame = -1

Query  322  FCTGAVFVAKADNTE--EDDGWIVTFVHDENTNKSQVYMIDAKHFSKEPIATITLPCRVP  149
            F + A+FV +   TE  EDDG+++ FVHDENT KS V +IDAK  S EP+A + LP RVP
Sbjct  472  FGSEAIFVPRQPGTECEEDDGYLILFVHDENTGKSSVNVIDAKTMSAEPVAVVELPKRVP  531

Query  148  YGFHGTFITQ  119
            +GFH  F+T+
Sbjct  532  FGFHAFFVTE  541



>gb|AFG30025.1| carotenoid cleavage dioxygenase 1, partial [Eriobotrya japonica]
Length=501

 Score = 82.0 bits (201),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 48/110 (44%), Positives = 65/110 (59%), Gaps = 11/110 (10%)
 Frame = -1

Query  418  MAKYGGIGK--LHLEEGEAKELINVE------YHMLPQNTFCTGAVFVAKAD--NTEEDD  269
            +AK  G+ K  LH E    K  I V       Y + P   F + A+FV       +EEDD
Sbjct  384  IAKVTGVVKFDLHAEPEVGKTQIEVGGNVQGLYDLGP-GRFGSEAIFVPPISGVTSEEDD  442

Query  268  GWIVTFVHDENTNKSQVYMIDAKHFSKEPIATITLPCRVPYGFHGTFITQ  119
            G+++ FVHDENT KS ++++DAK  S EP+A + LP RVPYGFH  F+T+
Sbjct  443  GYLILFVHDENTGKSAIHVVDAKTMSSEPVAVVELPHRVPYGFHAFFVTE  492



>ref|WP_015153132.1| Carotenoid oxygenase [Chroococcidiopsis thermalis]
 ref|YP_007090452.1| Carotenoid oxygenase [Chroococcidiopsis thermalis PCC 7203]
 gb|AFY86583.1| Carotenoid oxygenase [Chroococcidiopsis thermalis PCC 7203]
Length=464

 Score = 81.6 bits (200),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 40/107 (37%), Positives = 65/107 (61%), Gaps = 8/107 (7%)
 Frame = -1

Query  412  KYGGIGK-----LHLEEGEAKELINVEY---HMLPQNTFCTGAVFVAKADNTEEDDGWIV  257
            +YG +GK     L L +G  K  +   Y   +   +  +   AVFV + D T EDDGW+V
Sbjct  352  RYGYVGKMAPTPLPLFDGSIKYDLQAGYSQTYEYGKGRYGGEAVFVPRPDATIEDDGWLV  411

Query  256  TFVHDENTNKSQVYMIDAKHFSKEPIATITLPCRVPYGFHGTFITQN  116
            T+V+D +   S++ +++A+  S +P+A + +P RVPYGFHGT+++Q 
Sbjct  412  TYVYDTDAGTSELLVLNARDLSSDPVARVLIPQRVPYGFHGTWVSQQ  458



>ref|XP_006345442.1| PREDICTED: carotenoid 9,10(9',10')-cleavage dioxygenase 1-like 
isoform X2 [Solanum tuberosum]
Length=550

 Score = 82.0 bits (201),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 38/70 (54%), Positives = 50/70 (71%), Gaps = 2/70 (3%)
 Frame = -1

Query  322  FCTGAVFVAKADNTE--EDDGWIVTFVHDENTNKSQVYMIDAKHFSKEPIATITLPCRVP  149
            F + A+FV +   TE  EDDG+++ FVHDENT KS V +IDAK  S EP+A + LP RVP
Sbjct  472  FGSEAIFVPRQPGTECEEDDGYLILFVHDENTGKSSVNVIDAKTMSAEPVAVVELPKRVP  531

Query  148  YGFHGTFITQ  119
            +GFH  F+T+
Sbjct  532  FGFHAFFVTE  541



>ref|XP_007133813.1| hypothetical protein PHAVU_011G211200g [Phaseolus vulgaris]
 gb|ESW05807.1| hypothetical protein PHAVU_011G211200g [Phaseolus vulgaris]
Length=543

 Score = 82.0 bits (201),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 49/110 (45%), Positives = 66/110 (60%), Gaps = 11/110 (10%)
 Frame = -1

Query  418  MAKYGGIGK--LHLEEGEAKELINVE------YHMLPQNTFCTGAVFVAKADN--TEEDD  269
            +AK  GI K  LH E    KE + V       Y + P   F + AV++ +     +EEDD
Sbjct  426  IAKVTGIIKFDLHAEPDHEKEKLEVGGNVQGLYDLGP-GKFGSEAVYIPRVPGIESEEDD  484

Query  268  GWIVTFVHDENTNKSQVYMIDAKHFSKEPIATITLPCRVPYGFHGTFITQ  119
            G++V FVHDEN  KS V++IDAK  S +P+A + LP RVPYGFH  F+T+
Sbjct  485  GYLVLFVHDENAGKSFVHVIDAKTMSADPVAVVELPNRVPYGFHAFFVTE  534



>gb|ABA43904.1| carotenoid cleavage dioxygenase 1 [Coffea arabica]
Length=548

 Score = 82.0 bits (201),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 48/109 (44%), Positives = 65/109 (60%), Gaps = 9/109 (8%)
 Frame = -1

Query  418  MAKYGGIGK--LHLEEGEAKELINVEYHM-----LPQNTFCTGAVFVAKAD--NTEEDDG  266
            +AK  GI K  LH E    K  I V  ++     L    F + A+FV +     +EEDDG
Sbjct  431  IAKVTGIAKFDLHAEPETGKTKIEVGGNVQGVFDLGPGRFGSEAIFVPRQPGITSEEDDG  490

Query  265  WIVTFVHDENTNKSQVYMIDAKHFSKEPIATITLPCRVPYGFHGTFITQ  119
            +++ FVHDE+T KS V +IDAK  S +P+A + LP RVPYGFH  F+T+
Sbjct  491  YLIFFVHDESTGKSAVNVIDAKTLSADPVAVVELPNRVPYGFHAFFVTE  539



>emb|CDX76783.1| BnaC08g33690D [Brassica napus]
Length=611

 Score = 82.0 bits (201),  Expect = 5e-15, Method: Composition-based stats.
 Identities = 46/108 (43%), Positives = 64/108 (59%), Gaps = 8/108 (7%)
 Frame = -1

Query  421  GMAKYGGIGK--LHLEEGEAKELINVEYHM-----LPQNTFCTGAVFVAKADNTEEDDGW  263
            G+ +  GI K  LH E    K  + V  ++     + Q T+   A++V  A   EEDDG+
Sbjct  496  GIPRVKGIIKFDLHAEAETGKTKLRVGGNIKGIYEMGQGTYGPDAIYVPGA-TAEEDDGY  554

Query  262  IVTFVHDENTNKSQVYMIDAKHFSKEPIATITLPCRVPYGFHGTFITQ  119
            ++ + HDENT KS V +IDAK  S EP+A + LP RVPYGFH  F+T+
Sbjct  555  LIFYAHDENTGKSCVNVIDAKTMSSEPVAVVELPHRVPYGFHALFVTE  602



>ref|XP_007052518.1| Carotenoid cleavage dioxygenase 1 isoform 1 [Theobroma cacao]
 gb|EOX96675.1| Carotenoid cleavage dioxygenase 1 isoform 1 [Theobroma cacao]
Length=549

 Score = 82.0 bits (201),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 38/70 (54%), Positives = 50/70 (71%), Gaps = 2/70 (3%)
 Frame = -1

Query  322  FCTGAVFVAKADNT--EEDDGWIVTFVHDENTNKSQVYMIDAKHFSKEPIATITLPCRVP  149
            F + A+FV +   T  EEDDG+++ FVHDENT KS V +IDAK  S +P+A + LP RVP
Sbjct  472  FGSEAIFVPREPGTTSEEDDGYLIFFVHDENTGKSSVNVIDAKTMSADPVAVVELPHRVP  531

Query  148  YGFHGTFITQ  119
            YGFH  F+T+
Sbjct  532  YGFHAFFVTE  541



>ref|NP_001105815.1| white cap1 [Zea mays]
 gb|AAZ22348.1| carotenoid cleavage dioxygenase 1 [Zea mays]
 gb|AAZ22349.1| 9,10-9',10' carotenoid cleavage dioxygenase 1 [Zea mays]
Length=550

 Score = 82.0 bits (201),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 49/111 (44%), Positives = 67/111 (60%), Gaps = 11/111 (10%)
 Frame = -1

Query  418  MAKYGGIGK--LHLEEGEAKELINVE------YHMLPQNTFCTGAVFVAKADNT--EEDD  269
            +AK  GI K  LH E     +++ V       Y + P   F + A+FV K      EEDD
Sbjct  432  IAKVTGIIKFDLHAEPESGVKVLEVGGNVQGIYDLGP-GRFGSEAIFVPKHPGVSGEEDD  490

Query  268  GWIVTFVHDENTNKSQVYMIDAKHFSKEPIATITLPCRVPYGFHGTFITQN  116
            G+++ FVHDENT KS+V +IDAK  S +P+A + LP RVPYGFH  F+T++
Sbjct  491  GYLIFFVHDENTGKSEVNVIDAKTMSADPVAVVELPNRVPYGFHAFFVTED  541



>gb|EMT18015.1| hypothetical protein F775_06220 [Aegilops tauschii]
Length=515

 Score = 81.6 bits (200),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 50/111 (45%), Positives = 65/111 (59%), Gaps = 11/111 (10%)
 Frame = -1

Query  418  MAKYGGIGK--LHLEEGEAKELINVE------YHMLPQNTFCTGAVFVAKADNT--EEDD  269
            +AK  GI K  LH E    K+ + V       Y + P   F + AVFV K      EEDD
Sbjct  356  IAKVTGIIKFDLHAEPESGKKQLEVGGNVMGIYDLGP-GRFGSEAVFVPKEPGVSGEEDD  414

Query  268  GWIVTFVHDENTNKSQVYMIDAKHFSKEPIATITLPCRVPYGFHGTFITQN  116
            G+++ FVHDENT KS+V +IDAK  S +P+A + LP RVPYGFH  F+ + 
Sbjct  415  GYLIFFVHDENTGKSEVNVIDAKTMSPDPVAVVELPNRVPYGFHAFFVNEQ  465



>gb|ABA43900.1| carotenoid cleavage dioxygenase 1 [Coffea canephora]
 emb|CDP07788.1| unnamed protein product [Coffea canephora]
Length=548

 Score = 81.6 bits (200),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 48/109 (44%), Positives = 65/109 (60%), Gaps = 9/109 (8%)
 Frame = -1

Query  418  MAKYGGIGK--LHLEEGEAKELINVEYHM-----LPQNTFCTGAVFVAKAD--NTEEDDG  266
            +AK  GI K  LH E    K  I V  ++     L    F + A+FV +     +EEDDG
Sbjct  431  IAKVTGIAKFDLHAEPETGKTKIEVGGNVQGVFDLGPGRFGSEAIFVPRQPGITSEEDDG  490

Query  265  WIVTFVHDENTNKSQVYMIDAKHFSKEPIATITLPCRVPYGFHGTFITQ  119
            +++ FVHDE+T KS V +IDAK  S +P+A + LP RVPYGFH  F+T+
Sbjct  491  YLIFFVHDESTGKSAVNVIDAKTMSADPVAVVELPNRVPYGFHAFFVTE  539



>ref|XP_007052519.1| Carotenoid cleavage dioxygenase 1 isoform 2 [Theobroma cacao]
 gb|EOX96676.1| Carotenoid cleavage dioxygenase 1 isoform 2 [Theobroma cacao]
Length=541

 Score = 81.6 bits (200),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 38/70 (54%), Positives = 50/70 (71%), Gaps = 2/70 (3%)
 Frame = -1

Query  322  FCTGAVFVAKADNT--EEDDGWIVTFVHDENTNKSQVYMIDAKHFSKEPIATITLPCRVP  149
            F + A+FV +   T  EEDDG+++ FVHDENT KS V +IDAK  S +P+A + LP RVP
Sbjct  464  FGSEAIFVPREPGTTSEEDDGYLIFFVHDENTGKSSVNVIDAKTMSADPVAVVELPHRVP  523

Query  148  YGFHGTFITQ  119
            YGFH  F+T+
Sbjct  524  YGFHAFFVTE  533



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 508381126058