BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c25565_g9_i2 len=994 path=[51877:0-454 47948:455-499 46937:500-540
50451:541-618 50529:619-632 50543:633-656 50567:657-670
50581:671-711 50621:712-889 22442:890-993]

Length=994
                                                                      Score     E

emb|CAD62568.1|  putative tropinone reductase                           387   2e-131   Calystegia sepium
ref|XP_006355361.1|  PREDICTED: tropinone reductase homolog             304   8e-99    
ref|XP_009621668.1|  PREDICTED: tropinone reductase homolog             303   2e-98    
ref|XP_004237405.1|  PREDICTED: tropinone reductase homolog             303   4e-98    
ref|XP_009794560.1|  PREDICTED: tropinone reductase homolog             302   5e-98    
ref|XP_010920509.1|  PREDICTED: tropinone reductase homolog             293   4e-94    
ref|XP_008801625.1|  PREDICTED: tropinone reductase homolog At1g0...    292   5e-93    
ref|XP_009772417.1|  PREDICTED: tropinone reductase homolog             287   4e-92    
ref|XP_006341201.1|  PREDICTED: tropinone reductase homolog             286   9e-92    
ref|XP_009630417.1|  PREDICTED: tropinone reductase 1-like              286   1e-91    
ref|XP_006493569.1|  PREDICTED: tropinone reductase homolog isofo...    286   1e-91    
ref|XP_006493561.1|  PREDICTED: tropinone reductase homolog             285   2e-91    
sp|P50165.1|TRNH_DATST  RecName: Full=Tropinone reductase homolog...    286   2e-91    Datura stramonium [common thornapple]
ref|XP_002299847.1|  tropinone reductase family protein                 285   3e-91    Populus trichocarpa [western balsam poplar]
ref|XP_011006388.1|  PREDICTED: tropinone reductase homolog             285   4e-91    
ref|XP_006429154.1|  hypothetical protein CICLE_v10012494mg             284   9e-91    
ref|XP_009375951.1|  PREDICTED: tropinone reductase homolog At1g0...    283   1e-90    
ref|XP_006493560.1|  PREDICTED: tropinone reductase homolog             283   1e-90    
ref|XP_006429155.1|  hypothetical protein CICLE_v10012221mg             285   2e-90    
ref|XP_003558258.1|  PREDICTED: tropinone reductase homolog At1g0...    283   2e-90    
ref|XP_011035255.1|  PREDICTED: tropinone reductase homolog At1g0...    283   2e-90    
ref|XP_010650985.1|  PREDICTED: tropinone reductase homolog At1g0...    282   5e-90    
ref|XP_006424908.1|  hypothetical protein CICLE_v10029047mg             282   6e-90    
emb|CBI30506.3|  unnamed protein product                                281   9e-90    
ref|XP_006493568.1|  PREDICTED: tropinone reductase homolog isofo...    281   9e-90    
gb|KEH34737.1|  NAD(P)-binding rossmann-fold protein                    281   2e-89    
ref|XP_002271837.2|  PREDICTED: tropinone reductase homolog             281   2e-89    Vitis vinifera
ref|XP_006493567.1|  PREDICTED: tropinone reductase homolog             280   2e-89    
ref|XP_010654243.1|  PREDICTED: tropinone reductase homolog             281   2e-89    
ref|XP_008223763.1|  PREDICTED: tropinone reductase homolog At1g0...    280   2e-89    
ref|XP_006493570.1|  PREDICTED: tropinone reductase homolog             280   3e-89    
emb|CBI30508.3|  unnamed protein product                                280   3e-89    
ref|XP_006429157.1|  hypothetical protein CICLE_v10012496mg             280   4e-89    
ref|XP_003632186.1|  PREDICTED: tropinone reductase homolog At1g0...    279   6e-89    
ref|XP_010256814.1|  PREDICTED: tropinone reductase homolog At1g0...    279   7e-89    
ref|XP_006429160.1|  hypothetical protein CICLE_v10012493mg             278   1e-88    
ref|XP_010650989.1|  PREDICTED: tropinone reductase homolog At1g0...    278   1e-88    
ref|XP_007016318.1|  Senescence-associated gene 13 isoform 1            279   2e-88    
ref|NP_001049677.1|  Os03g0269100                                       278   2e-88    Oryza sativa Japonica Group [Japonica rice]
ref|XP_006846355.1|  hypothetical protein AMTR_s00012p00260970          278   2e-88    
ref|XP_010650991.1|  PREDICTED: tropinone reductase homolog At1g0...    277   4e-88    
emb|CAN69507.1|  hypothetical protein VITISV_016037                     277   5e-88    Vitis vinifera
ref|XP_004246864.1|  PREDICTED: tropinone reductase homolog             276   5e-88    
ref|XP_010650992.1|  PREDICTED: tropinone reductase homolog At1g0...    277   6e-88    
gb|KDO52384.1|  hypothetical protein CISIN_1g024752mg                   276   6e-88    
emb|CAN63543.1|  hypothetical protein VITISV_035429                     276   6e-88    Vitis vinifera
ref|XP_010654244.1|  PREDICTED: tropinone reductase homolog             276   7e-88    
emb|CBI16073.3|  unnamed protein product                                276   8e-88    
ref|XP_010650983.1|  PREDICTED: tropinone reductase homolog At1g0...    276   1e-87    
ref|XP_010685684.1|  PREDICTED: tropinone reductase homolog At1g0...    276   1e-87    
ref|XP_010650984.1|  PREDICTED: tropinone reductase homolog At1g0...    276   1e-87    
ref|XP_008221978.1|  PREDICTED: tropinone reductase homolog At1g0...    276   1e-87    
ref|XP_007140482.1|  hypothetical protein PHAVU_008G116300g             276   1e-87    
ref|XP_004503172.1|  PREDICTED: tropinone reductase homolog At1g0...    276   2e-87    
ref|XP_010033096.1|  PREDICTED: tropinone reductase homolog At1g0...    276   2e-87    
ref|XP_002308174.2|  hypothetical protein POPTR_0006s09080g             276   2e-87    Populus trichocarpa [western balsam poplar]
ref|XP_007205718.1|  hypothetical protein PRUPE_ppa009959mg             275   2e-87    
ref|XP_008222026.1|  PREDICTED: tropinone reductase homolog At1g0...    275   3e-87    
ref|XP_004246428.1|  PREDICTED: tropinone reductase homolog isofo...    275   3e-87    
gb|AFK38962.1|  unknown                                                 275   3e-87    
ref|XP_006838385.1|  hypothetical protein AMTR_s00002p00066940          275   4e-87    
gb|AFD23289.1|  tropinone reductase II                                  274   6e-87    
ref|XP_007205726.1|  hypothetical protein PRUPE_ppa010064mg             274   6e-87    
ref|XP_007009277.1|  NAD(P)-binding Rossmann-fold superfamily pro...    274   7e-87    
ref|XP_009421329.1|  PREDICTED: tropinone reductase homolog             274   8e-87    
ref|XP_009364346.1|  PREDICTED: tropinone reductase homolog At1g0...    274   8e-87    
ref|XP_007163456.1|  hypothetical protein PHAVU_001G235700g             273   1e-86    
ref|XP_008356736.1|  PREDICTED: tropinone reductase homolog At1g0...    273   2e-86    
ref|XP_002532998.1|  tropinone reductase, putative                      273   2e-86    Ricinus communis
ref|XP_006290197.1|  hypothetical protein CARUB_v10003882mg             272   2e-86    
ref|XP_009603003.1|  PREDICTED: tropinone reductase homolog isofo...    273   2e-86    
gb|EYU19938.1|  hypothetical protein MIMGU_mgv1a012090mg                272   3e-86    
ref|XP_008356743.1|  PREDICTED: tropinone reductase homolog At1g0...    272   3e-86    
ref|XP_004293354.1|  PREDICTED: tropinone reductase homolog At1g0...    272   3e-86    
gb|KFK24998.1|  hypothetical protein AALP_AA8G053200                    272   3e-86    
ref|XP_010033094.1|  PREDICTED: tropinone reductase homolog At1g0...    273   3e-86    
ref|XP_007218806.1|  hypothetical protein PRUPE_ppa009941mg             272   3e-86    
ref|XP_006341200.1|  PREDICTED: tropinone reductase homolog             272   4e-86    
ref|XP_010033099.1|  PREDICTED: tropinone reductase homolog At1g0...    272   4e-86    
ref|XP_008222016.1|  PREDICTED: tropinone reductase homolog At1g0...    272   4e-86    
gb|KDP35685.1|  hypothetical protein JCGZ_09123                         272   4e-86    
gb|KDO69163.1|  hypothetical protein CISIN_1g024125mg                   272   5e-86    
gb|ABK94587.1|  unknown                                                 271   5e-86    Populus trichocarpa [western balsam poplar]
ref|XP_010452515.1|  PREDICTED: tropinone reductase homolog At1g0...    271   8e-86    
ref|XP_004235263.1|  PREDICTED: tropinone reductase homolog             271   9e-86    
ref|XP_006435623.1|  hypothetical protein CICLE_v10032389mg             271   1e-85    
ref|XP_007205714.1|  hypothetical protein PRUPE_ppa009944mg             271   1e-85    
ref|XP_010650990.1|  PREDICTED: tropinone reductase homolog isofo...    279   1e-85    
ref|XP_010256821.1|  PREDICTED: tropinone reductase homolog             271   1e-85    
ref|XP_006341006.1|  PREDICTED: tropinone reductase 1-like              271   1e-85    
ref|XP_002319562.1|  hypothetical protein POPTR_0013s02690g             270   1e-85    Populus trichocarpa [western balsam poplar]
ref|XP_010067433.1|  PREDICTED: tropinone reductase homolog At1g0...    271   2e-85    
ref|XP_004294665.1|  PREDICTED: tropinone reductase homolog At1g0...    271   2e-85    
ref|XP_008221969.1|  PREDICTED: tropinone reductase homolog At1g0...    270   2e-85    
ref|XP_010542632.1|  PREDICTED: tropinone reductase homolog At1g0...    270   2e-85    
gb|KCW65561.1|  hypothetical protein EUGRSUZ_G02957                     270   2e-85    
ref|XP_011076794.1|  PREDICTED: tropinone reductase homolog             270   2e-85    
ref|XP_004984926.1|  PREDICTED: tropinone reductase homolog At1g0...    270   2e-85    
ref|XP_009343858.1|  PREDICTED: tropinone reductase homolog At1g0...    270   3e-85    
emb|CAD20555.1|  tropinone reductase I                                  270   3e-85    Calystegia sepium
gb|KDP44893.1|  hypothetical protein JCGZ_01393                         270   3e-85    
gb|KCW65560.1|  hypothetical protein EUGRSUZ_G02957                     270   4e-85    
gb|EMT31236.1|  Tropinone reductase-like protein                        271   4e-85    
ref|XP_002520507.1|  tropinone reductase, putative                      270   4e-85    Ricinus communis
ref|XP_006424907.1|  hypothetical protein CICLE_v10029040mg             270   4e-85    
ref|XP_008375982.1|  PREDICTED: tropinone reductase homolog At1g0...    269   5e-85    
gb|ABF95188.1|  Tropinone reductase, putative, expressed                269   5e-85    Oryza sativa Japonica Group [Japonica rice]
gb|KEH34749.1|  NAD(P)-binding rossmann-fold protein                    269   7e-85    
ref|XP_007016329.1|  NAD(P)-binding Rossmann-fold superfamily pro...    271   7e-85    
ref|XP_011023546.1|  PREDICTED: tropinone reductase homolog At1g0...    268   7e-85    
ref|XP_008387076.1|  PREDICTED: tropinone reductase homolog At1g0...    268   7e-85    
ref|XP_004307471.1|  PREDICTED: tropinone reductase homolog             269   8e-85    
ref|XP_010096620.1|  Tropinone reductase-like protein                   269   8e-85    
ref|XP_008233480.1|  PREDICTED: tropinone reductase homolog At1g0...    268   1e-84    
ref|XP_010491151.1|  PREDICTED: tropinone reductase homolog At1g0...    268   1e-84    
ref|XP_006488386.1|  PREDICTED: tropinone reductase homolog At1g0...    268   1e-84    
ref|XP_006488387.1|  PREDICTED: tropinone reductase homolog At1g0...    268   1e-84    
ref|XP_011023547.1|  PREDICTED: tropinone reductase homolog At1g0...    268   1e-84    
ref|XP_010067438.1|  PREDICTED: tropinone reductase homolog At1g0...    268   1e-84    
ref|XP_008349592.1|  PREDICTED: tropinone reductase homolog At1g0...    268   2e-84    
ref|XP_002311182.2|  tropinone reductase family protein                 268   2e-84    Populus trichocarpa [western balsam poplar]
ref|XP_007163457.1|  hypothetical protein PHAVU_001G235800g             268   2e-84    
emb|CDP14238.1|  unnamed protein product                                268   2e-84    
gb|KHN17906.1|  Tropinone reductase like                                268   2e-84    
gb|ABW81118.1|  putative tropinone reductase                            269   2e-84    Boechera divaricarpa
emb|CDX86486.1|  BnaC08g02170D                                          267   2e-84    
ref|XP_011048910.1|  PREDICTED: tropinone reductase homolog At1g0...    268   2e-84    
gb|KHG18782.1|  hypothetical protein F383_24463                         268   2e-84    
emb|CDY14094.1|  BnaC02g02110D                                          267   3e-84    
gb|AFK36242.1|  unknown                                                 268   3e-84    
ref|XP_011033874.1|  PREDICTED: tropinone reductase homolog At1g0...    267   3e-84    
emb|CDY04977.1|  BnaAnng01590D                                          267   3e-84    
ref|XP_002277835.1|  PREDICTED: tropinone reductase homolog At1g0...    267   4e-84    Vitis vinifera
ref|XP_003537468.1|  PREDICTED: tropinone reductase homolog At1g0...    267   4e-84    
ref|NP_196225.1|  putative tropine dehydrogenase                        267   4e-84    Arabidopsis thaliana [mouse-ear cress]
ref|XP_002319563.2|  tropinone reductase family protein                 266   5e-84    Populus trichocarpa [western balsam poplar]
ref|XP_006352698.1|  PREDICTED: tropinone reductase homolog             266   6e-84    
ref|XP_010685685.1|  PREDICTED: tropinone reductase homolog At1g0...    266   6e-84    
ref|XP_002465494.1|  hypothetical protein SORBIDRAFT_01g039880          266   6e-84    Sorghum bicolor [broomcorn]
emb|CDX98899.1|  BnaC09g49360D                                          266   7e-84    
gb|KCW52641.1|  hypothetical protein EUGRSUZ_J02019                     266   7e-84    
gb|KEH22973.1|  NAD(P)-binding rossmann-fold protein                    266   8e-84    
ref|XP_009125632.1|  PREDICTED: tropinone reductase homolog At1g0...    266   8e-84    
ref|XP_008358998.1|  PREDICTED: tropinone reductase homolog At1g0...    266   8e-84    
ref|NP_001242650.1|  uncharacterized protein LOC100819646               266   8e-84    
ref|XP_010228815.1|  PREDICTED: tropinone reductase homolog At1g0...    266   1e-83    
ref|XP_007206475.1|  hypothetical protein PRUPE_ppa018984mg             266   1e-83    
gb|AIX10937.1|  putative tropinone reductase                            266   1e-83    
gb|EAY89400.1|  hypothetical protein OsI_10905                          266   1e-83    Oryza sativa Indica Group [Indian rice]
ref|XP_004303414.1|  PREDICTED: tropinone reductase homolog             265   1e-83    
gb|AGH24753.1|  tropinone reductase-II                                  265   2e-83    
gb|AFP55030.1|  tropinone reductase I                                   265   2e-83    
emb|CDY68057.1|  BnaAnng26060D                                          265   2e-83    
ref|XP_010542627.1|  PREDICTED: tropinone reductase homolog At1g0...    265   2e-83    
ref|XP_010423393.1|  PREDICTED: tropinone reductase homolog At1g0...    265   2e-83    
ref|XP_007016327.1|  Senescence-associated gene 13, putative isof...    266   2e-83    
ref|XP_006649826.1|  PREDICTED: tropinone reductase homolog At1g0...    265   2e-83    
dbj|BAJ87177.1|  predicted protein                                      265   2e-83    
emb|CAC19810.1|  tropinone reductase II                                 265   2e-83    Solanum tuberosum [potatoes]
ref|XP_006288477.1|  hypothetical protein CARUB_v10001737mg             265   2e-83    
ref|XP_006352700.1|  PREDICTED: tropinone reductase homolog             265   2e-83    
gb|KDO38494.1|  hypothetical protein CISIN_1g024551mg                   265   2e-83    
emb|CAQ19732.1|  tropinone reductase II                                 265   2e-83    Solanum dulcamara [climbing nightshade]
ref|NP_001275240.1|  tropinone reductase 2-like                         265   2e-83    
emb|CBI16074.3|  unnamed protein product                                264   2e-83    
ref|XP_004235264.1|  PREDICTED: tropinone reductase homolog isofo...    265   3e-83    
ref|XP_009375950.1|  PREDICTED: tropinone reductase homolog At1g0...    265   3e-83    
ref|XP_011048908.1|  PREDICTED: tropinone reductase homolog At1g0...    267   3e-83    
emb|CBI30509.3|  unnamed protein product                                264   3e-83    
ref|XP_009110944.1|  PREDICTED: tropinone reductase homolog At1g0...    264   3e-83    
ref|XP_003538423.1|  PREDICTED: tropinone reductase homolog At1g0...    264   4e-83    
ref|XP_007016320.1|  NAD(P)-binding Rossmann-fold superfamily pro...    265   5e-83    
ref|XP_004302758.1|  PREDICTED: tropinone reductase homolog             264   5e-83    
ref|XP_002873234.1|  hypothetical protein ARALYDRAFT_487407             264   5e-83    
gb|KCW49544.1|  hypothetical protein EUGRSUZ_K03064                     264   5e-83    
gb|ACU16743.1|  unknown                                                 264   5e-83    Glycine max [soybeans]
ref|XP_011089795.1|  PREDICTED: tropinone reductase homolog isofo...    266   6e-83    
ref|XP_002282755.1|  PREDICTED: tropinone reductase homolog At1g0...    264   6e-83    Vitis vinifera
ref|XP_010542622.1|  PREDICTED: tropinone reductase homolog At1g0...    264   6e-83    
emb|CDX86485.1|  BnaC08g02180D                                          263   7e-83    
ref|XP_011089796.1|  PREDICTED: tropinone reductase homolog isofo...    265   7e-83    
gb|AIN39992.1|  tropinone reductase I                                   264   7e-83    
ref|NP_001149071.1|  LOC100282692                                       264   7e-83    Zea mays [maize]
ref|XP_003552193.1|  PREDICTED: tropinone reductase homolog isofo...    263   7e-83    
gb|AAM61117.1|  short chain alcohol dehydrogenase-like                  263   8e-83    Arabidopsis thaliana [mouse-ear cress]
ref|XP_007016314.1|  NAD(P)-binding Rossmann-fold superfamily pro...    265   9e-83    
emb|CDP00133.1|  unnamed protein product                                264   9e-83    
ref|XP_004503163.1|  PREDICTED: tropinone reductase homolog             263   9e-83    
ref|XP_009375952.1|  PREDICTED: tropinone reductase homolog At1g0...    263   1e-82    
ref|XP_011048912.1|  PREDICTED: tropinone reductase homolog At1g0...    263   1e-82    
ref|XP_006424909.1|  hypothetical protein CICLE_v10029051mg             263   1e-82    
ref|XP_006399065.1|  hypothetical protein EUTSA_v10014421mg             263   1e-82    
ref|XP_010037803.1|  PREDICTED: tropinone reductase 1-like              265   1e-82    
ref|XP_011094903.1|  PREDICTED: tropinone reductase homolog             263   1e-82    
ref|XP_011023548.1|  PREDICTED: tropinone reductase homolog At1g0...    263   1e-82    
ref|XP_007206210.1|  hypothetical protein PRUPE_ppa015172mg             262   2e-82    
ref|XP_006344593.1|  PREDICTED: tropinone reductase homolog             264   2e-82    
gb|KEH34736.1|  NAD(P)-binding rossmann-fold protein                    263   2e-82    
gb|KHN04080.1|  Tropinone reductase like                                263   2e-82    
ref|XP_010033100.1|  PREDICTED: tropinone reductase homolog At1g0...    263   2e-82    
ref|XP_010040245.1|  PREDICTED: tropinone reductase homolog At1g0...    263   2e-82    
emb|CAN69508.1|  hypothetical protein VITISV_016038                     263   2e-82    Vitis vinifera
gb|KEH22981.1|  NAD(P)-binding rossmann-fold protein                    262   2e-82    
ref|XP_004294666.1|  PREDICTED: tropinone reductase homolog At1g0...    262   3e-82    
ref|XP_004137775.1|  PREDICTED: tropinone reductase homolog             262   3e-82    
ref|XP_010067435.1|  PREDICTED: tropinone reductase homolog At1g0...    262   3e-82    
ref|XP_009346407.1|  PREDICTED: tropinone reductase homolog isofo...    262   3e-82    
gb|AGY46257.1|  tropinone reductase I                                   262   3e-82    
ref|XP_002308173.1|  hypothetical protein POPTR_0006s09070g             262   3e-82    Populus trichocarpa [western balsam poplar]
ref|XP_006649828.1|  PREDICTED: tropinone reductase homolog At1g0...    262   3e-82    
ref|XP_010521885.1|  PREDICTED: tropinone reductase homolog At1g0...    262   3e-82    
ref|XP_007026941.1|  NAD(P)-binding Rossmann-fold superfamily pro...    262   3e-82    
gb|KEH22972.1|  NAD(P)-binding rossmann-fold protein                    262   3e-82    
ref|XP_004302763.1|  PREDICTED: tropinone reductase homolog             261   3e-82    
ref|XP_006295594.1|  hypothetical protein CARUB_v10024703mg             262   4e-82    
ref|XP_008442514.1|  PREDICTED: tropinone reductase homolog             261   4e-82    
gb|AFK36946.1|  unknown                                                 261   4e-82    
ref|XP_008461702.1|  PREDICTED: tropinone reductase homolog             262   5e-82    
ref|XP_009140979.1|  PREDICTED: tropinone reductase homolog At1g0...    263   5e-82    
ref|XP_004291519.1|  PREDICTED: tropinone reductase homolog At1g0...    261   5e-82    
ref|XP_003552795.1|  PREDICTED: tropinone reductase homolog             261   6e-82    
ref|XP_004150641.1|  PREDICTED: tropinone reductase homolog At1g0...    261   6e-82    
ref|XP_009623489.1|  PREDICTED: tropinone reductase 1-like isofor...    261   6e-82    
emb|CAN69103.1|  hypothetical protein VITISV_027298                     261   6e-82    Vitis vinifera
gb|AFK34899.1|  unknown                                                 261   6e-82    
sp|P50162.1|TRN1_DATST  RecName: Full=Tropinone reductase 1; AltN...    261   7e-82    Datura stramonium [common thornapple]
ref|XP_003529117.1|  PREDICTED: tropinone reductase homolog isofo...    261   8e-82    
emb|CDY09823.1|  BnaC09g43380D                                          261   8e-82    
emb|CBI16068.3|  unnamed protein product                                260   8e-82    
ref|XP_010033102.1|  PREDICTED: tropinone reductase homolog At1g0...    261   8e-82    
ref|XP_011023544.1|  PREDICTED: tropinone reductase homolog At1g0...    261   8e-82    
gb|ABW81146.1|  TRL26                                                   261   9e-82    Capsella rubella
ref|XP_006294815.1|  hypothetical protein CARUB_v10023866mg             261   9e-82    
ref|XP_006429149.1|  hypothetical protein CICLE_v10012479mg             261   9e-82    
gb|ABW81158.1|  TRL13                                                   262   1e-81    Capsella rubella
sp|P50164.1|TRN2_HYONI  RecName: Full=Tropinone reductase 2; AltN...    260   1e-81    Hyoscyamus niger [black henbane]
gb|KHG18781.1|  Tropinone reductase                                     262   1e-81    
ref|XP_010452516.1|  PREDICTED: tropinone reductase homolog At1g0...    260   1e-81    
gb|KHN40273.1|  Tropinone reductase like                                260   1e-81    
ref|XP_011010114.1|  PREDICTED: tropinone reductase homolog At1g0...    260   1e-81    
ref|XP_006846356.1|  hypothetical protein AMTR_s00012p00261070          260   1e-81    
emb|CDY09824.1|  BnaC09g43370D                                          260   1e-81    
ref|XP_010557240.1|  PREDICTED: tropinone reductase homolog At1g0...    262   1e-81    
emb|CDP11659.1|  unnamed protein product                                260   2e-81    
ref|XP_007016316.1|  NAD(P)-binding Rossmann-fold superfamily pro...    260   2e-81    
ref|XP_002282638.2|  PREDICTED: tropinone reductase homolog At1g0...    262   2e-81    Vitis vinifera
ref|XP_010040250.1|  PREDICTED: tropinone reductase homolog At1g0...    261   2e-81    
ref|XP_006429152.1|  hypothetical protein CICLE_v10012433mg             260   2e-81    
ref|XP_008349700.1|  PREDICTED: uncharacterized protein LOC103412975    273   2e-81    
ref|XP_010510523.1|  PREDICTED: tropinone reductase homolog At1g0...    260   2e-81    
gb|ACJ84726.1|  unknown                                                 260   2e-81    Medicago truncatula
ref|XP_011048909.1|  PREDICTED: tropinone reductase homolog At1g0...    262   2e-81    
ref|XP_006846352.1|  hypothetical protein AMTR_s00012p00260130          260   2e-81    
ref|XP_008363884.1|  PREDICTED: tropinone reductase homolog             259   2e-81    
ref|XP_006409971.1|  hypothetical protein EUTSA_v10017105mg             259   2e-81    
ref|NP_001275290.1|  tropinone reductase 1-like                         259   2e-81    
gb|KEH30187.1|  enoyl-(acyl carrier) reductase                          260   2e-81    
ref|NP_180489.1|  NAD(P)-binding Rossmann-fold superfamily protein      261   2e-81    Arabidopsis thaliana [mouse-ear cress]
ref|XP_010510510.1|  PREDICTED: tropinone reductase homolog At1g0...    261   2e-81    
ref|XP_002314932.1|  tropinone reductase family protein                 259   3e-81    Populus trichocarpa [western balsam poplar]
ref|XP_004302760.1|  PREDICTED: tropinone reductase homolog             259   3e-81    
gb|ABW81054.1|  tropinone-reductase-like39                              261   3e-81    Arabidopsis lyrata subsp. lyrata
ref|XP_006488391.1|  PREDICTED: tropinone reductase homolog At1g0...    259   3e-81    
gb|ADE77494.1|  unknown                                                 259   3e-81    
gb|AGL76990.1|  tropinone reductase II                                  259   3e-81    
emb|CDX70101.1|  BnaA10g24500D                                          259   3e-81    
gb|ABW81126.1|  short chain dehydrogenase-21                            259   4e-81    Boechera divaricarpa
ref|XP_009796888.1|  PREDICTED: tropinone reductase homolog             259   4e-81    
ref|XP_004240378.1|  PREDICTED: tropinone reductase homolog             260   4e-81    
gb|ABW81120.1|  putative tropinone reductase-14                         259   5e-81    Boechera divaricarpa
emb|CDP12723.1|  unnamed protein product                                259   5e-81    
ref|XP_010106552.1|  Tropinone reductase-like protein                   259   5e-81    
ref|XP_010423394.1|  PREDICTED: tropinone reductase homolog At1g0...    259   5e-81    
ref|XP_010033103.1|  PREDICTED: tropinone reductase homolog At1g0...    259   6e-81    
ref|XP_004137777.1|  PREDICTED: tropinone reductase homolog             259   6e-81    
gb|ACB71203.1|  tropinone reductase II                                  258   6e-81    Anisodus acutangulus
gb|AGL76989.1|  tropinone reductase I                                   259   6e-81    
ref|XP_006590970.1|  PREDICTED: tropinone reductase homolog At1g0...    260   7e-81    
ref|XP_004236988.1|  PREDICTED: tropinone reductase 2                   258   7e-81    
ref|XP_010521558.1|  PREDICTED: tropinone reductase homolog At1g0...    258   8e-81    
gb|KEH22982.1|  enoyl-(acyl carrier) reductase                          258   9e-81    
gb|ADE76974.1|  unknown                                                 258   9e-81    
emb|CDY31776.1|  BnaA04g17120D                                          258   1e-80    
gb|EYU41758.1|  hypothetical protein MIMGU_mgv1a011856mg                258   1e-80    
gb|KHG29311.1|  Tropinone reductase                                     259   1e-80    
ref|XP_009122209.1|  PREDICTED: tropinone reductase homolog At1g0...    258   1e-80    
ref|XP_010414423.1|  PREDICTED: tropinone reductase homolog At1g0...    258   1e-80    
ref|XP_006344583.1|  PREDICTED: tropinone reductase homolog             258   1e-80    
gb|AGB56644.1|  tropinone reductase I                                   258   1e-80    
ref|XP_010650986.1|  PREDICTED: tropinone reductase homolog At1g0...    258   1e-80    
gb|ABW81156.1|  TRL15                                                   258   1e-80    
gb|KDP30781.1|  hypothetical protein JCGZ_13724                         258   1e-80    
ref|XP_010475505.1|  PREDICTED: tropinone reductase homolog At1g0...    258   1e-80    
gb|AAO42159.1|  putative tropinone reductase                            259   1e-80    
ref|XP_009358760.1|  PREDICTED: tropinone reductase homolog             257   1e-80    
ref|XP_010414393.1|  PREDICTED: tropinone reductase homolog At1g0...    258   1e-80    
ref|XP_011023549.1|  PREDICTED: tropinone reductase homolog At1g0...    258   1e-80    
ref|XP_007140480.1|  hypothetical protein PHAVU_008G116200g             258   2e-80    
gb|KEH34739.1|  NAD(P)-binding rossmann-fold protein                    258   2e-80    
ref|XP_008359743.1|  PREDICTED: tropinone reductase homolog isofo...    257   2e-80    
ref|XP_009346409.1|  PREDICTED: tropinone reductase homolog             257   2e-80    
gb|ACB71202.1|  tropinone reductase I                                   258   2e-80    
ref|XP_010650987.1|  PREDICTED: tropinone reductase homolog At1g0...    257   2e-80    
ref|XP_011006389.1|  PREDICTED: tropinone reductase homolog isofo...    257   2e-80    
ref|XP_010469976.1|  PREDICTED: tropinone reductase homolog At1g0...    259   2e-80    
ref|XP_008363883.1|  PREDICTED: tropinone reductase 1-like              257   2e-80    
ref|XP_006846351.1|  hypothetical protein AMTR_s00012p00260070          258   3e-80    
ref|XP_003539556.1|  PREDICTED: tropinone reductase homolog At1g0...    257   3e-80    
gb|EAY89401.1|  hypothetical protein OsI_10906                          258   3e-80    
ref|XP_007140477.1|  hypothetical protein PHAVU_008G115900g             257   3e-80    
gb|AAP06907.1|  hypothetical protein                                    258   3e-80    
ref|XP_006409970.1|  hypothetical protein EUTSA_v10016944mg             259   3e-80    
ref|XP_009358758.1|  PREDICTED: tropinone reductase homolog             256   3e-80    
ref|XP_009611893.1|  PREDICTED: tropinone reductase homolog At1g0...    257   3e-80    
ref|NP_001237661.1|  uncharacterized protein LOC100306108               257   3e-80    
ref|XP_002524214.1|  tropinone reductase, putative                      257   3e-80    
ref|XP_010691207.1|  PREDICTED: tropinone reductase homolog At1g0...    256   4e-80    
ref|XP_010487469.1|  PREDICTED: tropinone reductase homolog At1g0...    256   4e-80    
ref|XP_010658532.1|  PREDICTED: tropinone reductase homolog At1g0...    257   4e-80    
ref|XP_006358703.1|  PREDICTED: tropinone reductase homolog At1g0...    258   4e-80    
ref|XP_009358754.1|  PREDICTED: tropinone reductase homolog isofo...    256   4e-80    
ref|XP_007026940.1|  NAD(P)-binding Rossmann-fold superfamily pro...    259   4e-80    
sp|P50163.1|TRN2_DATST  RecName: Full=Tropinone reductase 2; AltN...    256   4e-80    
ref|XP_008387806.1|  PREDICTED: tropinone reductase homolog             256   4e-80    
gb|KDP35687.1|  hypothetical protein JCGZ_09125                         256   5e-80    
ref|XP_002976988.1|  hypothetical protein SELMODRAFT_416905             265   5e-80    
ref|NP_180497.1|  tropinone reductase-like protein                      256   5e-80    
ref|XP_009346408.1|  PREDICTED: tropinone reductase homolog isofo...    256   5e-80    
gb|ABI78943.1|  tropinone reductase                                     256   5e-80    
gb|AIN39993.1|  tropinone reductase I                                   256   5e-80    
ref|XP_003539545.1|  PREDICTED: tropinone reductase homolog At1g0...    256   5e-80    
ref|XP_010475501.1|  PREDICTED: tropinone reductase homolog At1g0...    257   5e-80    
gb|ABW74557.1|  tropinone-reductase-like protein                        257   6e-80    
gb|KDP42205.1|  hypothetical protein JCGZ_02935                         258   6e-80    
gb|ABW81127.1|  putative tropinone reductase-22                         256   6e-80    
ref|XP_010256816.1|  PREDICTED: tropinone reductase homolog At1g0...    258   6e-80    
gb|KHN25230.1|  Tropinone reductase like                                256   7e-80    
ref|XP_010665941.1|  PREDICTED: tropinone reductase homolog At1g0...    256   7e-80    
ref|XP_006488388.1|  PREDICTED: tropinone reductase homolog isofo...    258   8e-80    
ref|XP_011070195.1|  PREDICTED: tropinone reductase 1-like              256   8e-80    
ref|XP_007132036.1|  hypothetical protein PHAVU_011G061400g             257   8e-80    
gb|AAC95218.1|  putative tropinone reductase                            256   8e-80    
ref|XP_010510518.1|  PREDICTED: tropinone reductase homolog At1g0...    257   8e-80    
ref|XP_002879211.1|  hypothetical protein ARALYDRAFT_481852             256   8e-80    
gb|ABK96466.1|  unknown                                                 256   9e-80    
ref|XP_010487481.1|  PREDICTED: tropinone reductase homolog At1g0...    256   9e-80    
ref|XP_007206734.1|  hypothetical protein PRUPE_ppa024823mg             256   1e-79    
dbj|BAA13547.1|  tropinone reductase-I                                  256   1e-79    
gb|AFK33539.1|  unknown                                                 256   1e-79    
ref|NP_001049675.1|  Os03g0268900                                       256   1e-79    
gb|KHN17894.1|  Tropinone reductase like                                255   1e-79    
ref|XP_009358752.1|  PREDICTED: tropinone reductase homolog isofo...    255   1e-79    
ref|XP_010106548.1|  hypothetical protein L484_025308                   255   1e-79    
ref|XP_002282875.1|  PREDICTED: tropinone reductase homolog At1g0...    255   1e-79    
ref|XP_002892399.1|  hypothetical protein ARALYDRAFT_470766             255   1e-79    
ref|XP_009407503.1|  PREDICTED: tropinone reductase homolog             255   2e-79    
ref|XP_002980725.1|  hypothetical protein SELMODRAFT_444601             263   2e-79    
ref|XP_010469989.1|  PREDICTED: tropinone reductase homolog At1g0...    255   2e-79    
ref|XP_010521549.1|  PREDICTED: tropinone reductase homolog At1g0...    254   2e-79    
ref|XP_010557238.1|  PREDICTED: tropinone reductase homolog At1g0...    255   2e-79    
ref|XP_010521894.1|  PREDICTED: tropinone reductase homolog At1g0...    255   2e-79    
ref|XP_009603002.1|  PREDICTED: tropinone reductase homolog isofo...    257   2e-79    
ref|XP_004249378.1|  PREDICTED: tropinone reductase 1 isoform X2        254   2e-79    
ref|XP_008359746.1|  PREDICTED: tropinone reductase homolog             254   2e-79    
ref|XP_010106549.1|  hypothetical protein L484_025309                   254   2e-79    
gb|ABW81066.1|  tropinone-reductase-like53                              254   3e-79    
gb|AFK34404.1|  unknown                                                 254   3e-79    
ref|XP_010931228.1|  PREDICTED: tropinone reductase homolog At1g0...    254   3e-79    
emb|CAQ19734.1|  putative tropinone reductase I                         254   3e-79    
gb|ABW81080.1|  TRL3                                                    255   3e-79    
ref|XP_009113419.1|  PREDICTED: tropinone reductase homolog At1g0...    254   3e-79    
pdb|1IPE|A  Chain A, Tropinone Reductase-Ii Complexed With Nadph        254   4e-79    
ref|XP_009600097.1|  PREDICTED: tropinone reductase homolog isofo...    255   4e-79    
ref|XP_006294711.1|  hypothetical protein CARUB_v10023749mg             255   4e-79    
gb|AFK35677.1|  unknown                                                 254   4e-79    
ref|XP_009773607.1|  PREDICTED: tropinone reductase homolog             254   5e-79    
gb|AFK45411.1|  unknown                                                 254   5e-79    
gb|EPS58365.1|  hypothetical protein M569_16448                         254   5e-79    
ref|XP_009118438.1|  PREDICTED: tropinone reductase homolog At1g0...    254   5e-79    
ref|NP_172224.1|  NAD(P)-binding Rossmann-fold superfamily protein      254   5e-79    
ref|XP_008221957.1|  PREDICTED: tropinone reductase homolog At1g0...    254   5e-79    
ref|XP_004507158.1|  PREDICTED: tropinone reductase homolog             255   5e-79    
ref|XP_010469962.1|  PREDICTED: tropinone reductase homolog At1g0...    254   5e-79    
ref|XP_008442511.1|  PREDICTED: tropinone reductase homolog             254   6e-79    
ref|XP_010521893.1|  PREDICTED: tropinone reductase homolog At1g0...    253   6e-79    
emb|CDY06260.1|  BnaA09g49430D                                          253   6e-79    
emb|CDY51372.1|  BnaA04g28660D                                          254   7e-79    
gb|KFK43068.1|  hypothetical protein AALP_AA1G074500                    253   7e-79    
ref|XP_004492175.1|  PREDICTED: tropinone reductase homolog             253   8e-79    
emb|CAN74482.1|  hypothetical protein VITISV_028249                     254   8e-79    
emb|CAB88214.1|  putative tropinone reductase                           253   8e-79    
gb|KHF98968.1|  hypothetical protein F383_10254                         253   9e-79    
emb|CDY09917.1|  BnaC08g45340D                                          253   9e-79    
ref|XP_010034592.1|  PREDICTED: tropinone reductase homolog At1g0...    254   9e-79    
ref|XP_007205761.1|  hypothetical protein PRUPE_ppa010313mg             253   9e-79    
gb|AAM63669.1|  putative tropinone reductase                            253   1e-78    
ref|XP_006349492.1|  PREDICTED: tropinone reductase homolog             253   1e-78    
ref|XP_004249635.1|  PREDICTED: tropinone reductase homolog isofo...    253   1e-78    
ref|XP_010469814.1|  PREDICTED: tropinone reductase homolog At1g0...    252   2e-78    
ref|XP_009140995.1|  PREDICTED: tropinone reductase homolog At1g0...    253   2e-78    
ref|XP_009760666.1|  PREDICTED: LOW QUALITY PROTEIN: tropinone re...    254   2e-78    
ref|XP_010418801.1|  PREDICTED: tropinone reductase homolog At1g0...    252   2e-78    
ref|XP_010521889.1|  PREDICTED: tropinone reductase homolog At1g0...    252   2e-78    
gb|ABW81165.1|  TRL5                                                    252   2e-78    
ref|XP_010557237.1|  PREDICTED: tropinone reductase homolog At1g0...    252   2e-78    
gb|ABW81178.1|  tropinone reductase-like protein 16                     252   2e-78    
ref|XP_009358759.1|  PREDICTED: tropinone reductase homolog             252   3e-78    
ref|XP_006294819.1|  hypothetical protein CARUB_v10023870mg             252   3e-78    
gb|ABW81147.1|  TRL24                                                   252   3e-78    
ref|XP_002520511.1|  tropinone reductase, putative                      261   3e-78    
ref|XP_010475502.1|  PREDICTED: tropinone reductase homolog At1g0...    253   3e-78    
ref|NP_172225.1|  NAD(P)-binding Rossmann-fold superfamily protein      251   3e-78    
ref|XP_008349591.1|  PREDICTED: tropinone reductase homolog At1g0...    252   4e-78    
ref|XP_002879210.1|  hypothetical protein ARALYDRAFT_481850             251   4e-78    
ref|XP_006417804.1|  hypothetical protein EUTSA_v10008362mg             252   4e-78    
ref|XP_009416162.1|  PREDICTED: tropinone reductase homolog At1g0...    251   4e-78    
ref|XP_010521883.1|  PREDICTED: tropinone reductase homolog At1g0...    251   4e-78    
ref|XP_006369543.1|  hypothetical protein POPTR_0001s25180g             250   4e-78    
gb|AAP06917.1|  unknown protein                                         253   6e-78    
emb|CDY14610.1|  BnaC02g25030D                                          251   6e-78    
ref|XP_007132035.1|  hypothetical protein PHAVU_011G061300g             251   6e-78    
ref|XP_006429148.1|  hypothetical protein CICLE_v10012479mg             250   6e-78    
ref|XP_008369937.1|  PREDICTED: tropinone reductase homolog             251   6e-78    
ref|XP_009416161.1|  PREDICTED: tropinone reductase homolog At1g0...    251   7e-78    
ref|XP_010414428.1|  PREDICTED: tropinone reductase homolog At1g0...    251   7e-78    
gb|KHG25916.1|  hypothetical protein F383_01801                         251   8e-78    
ref|XP_010106547.1|  Tropinone reductase-like protein                   250   9e-78    
emb|CBI16078.3|  unnamed protein product                                250   9e-78    
ref|XP_009622919.1|  PREDICTED: tropinone reductase homolog             251   1e-77    
ref|XP_010088522.1|  Tropinone reductase-like protein                   251   1e-77    
ref|XP_010685687.1|  PREDICTED: tropinone reductase homolog At1g0...    253   1e-77    
ref|XP_010910872.1|  PREDICTED: tropinone reductase homolog At1g0...    251   1e-77    
dbj|BAC65128.2|  short chain alcohol dehydrogenase-like protein         251   1e-77    
ref|XP_009127473.1|  PREDICTED: tropinone reductase homolog At1g0...    250   1e-77    
ref|NP_180496.1|  senescence-associated protein 13                      250   1e-77    
ref|XP_009118960.1|  PREDICTED: tropinone reductase homolog At1g0...    250   1e-77    
ref|XP_006293509.1|  hypothetical protein CARUB_v10023815mg             251   1e-77    
ref|XP_010469963.1|  PREDICTED: tropinone reductase homolog At1g0...    250   1e-77    
gb|KDO66642.1|  hypothetical protein CISIN_1g019370mg                   253   1e-77    
ref|XP_009804542.1|  PREDICTED: tropinone reductase homolog isofo...    253   1e-77    
ref|XP_006649825.1|  PREDICTED: tropinone reductase homolog At1g0...    250   2e-77    
gb|AFK36108.1|  unknown                                                 249   2e-77    
ref|XP_010685686.1|  PREDICTED: tropinone reductase homolog At1g0...    253   2e-77    
emb|CDY52942.1|  BnaCnng23860D                                          250   2e-77    
emb|CDO98530.1|  unnamed protein product                                249   2e-77    
ref|NP_001118408.1|  tropinone reductase-like protein                   249   2e-77    
gb|KHG00112.1|  Tropinone reductase                                     250   2e-77    
ref|XP_010510310.1|  PREDICTED: tropinone reductase homolog At1g0...    249   2e-77    
ref|XP_003538424.1|  PREDICTED: tropinone reductase homolog At1g0...    249   2e-77    
ref|XP_008457446.1|  PREDICTED: tropinone reductase homolog At1g0...    251   2e-77    
ref|NP_180625.1|  NAD(P)-binding Rossmann-fold superfamily protein      249   2e-77    
gb|AAP06906.1|  putative pfam00106, adh_short, short chain dehydr...    250   3e-77    
ref|XP_008777412.1|  PREDICTED: tropinone reductase homolog At1g0...    249   3e-77    
gb|KHN40275.1|  Tropinone reductase like                                249   4e-77    
ref|XP_010558920.1|  PREDICTED: tropinone reductase homolog At1g0...    254   4e-77    
ref|XP_006583599.1|  PREDICTED: tropinone reductase homolog             249   4e-77    
emb|CDY40175.1|  BnaC04g14030D                                          248   4e-77    
ref|XP_010675701.1|  PREDICTED: tropinone reductase homolog At1g0...    249   5e-77    
ref|XP_010414392.1|  PREDICTED: tropinone reductase homolog At1g0...    249   5e-77    
gb|KDP35675.1|  hypothetical protein JCGZ_09113                         248   5e-77    
ref|XP_010457924.1|  PREDICTED: tropinone reductase homolog At1g0...    248   5e-77    
ref|XP_010510516.1|  PREDICTED: tropinone reductase homolog At1g0...    249   5e-77    
ref|XP_007140484.1|  hypothetical protein PHAVU_008G116500g             248   5e-77    
ref|XP_002879208.1|  hypothetical protein ARALYDRAFT_481843             248   6e-77    
gb|KDO52375.1|  hypothetical protein CISIN_1g024994mg                   248   6e-77    
gb|KFK38265.1|  hypothetical protein AALP_AA3G091300                    248   6e-77    
ref|NP_180479.1|  tropinone reductase-like protein                      248   7e-77    
emb|CDP12722.1|  unnamed protein product                                248   7e-77    
ref|XP_002881032.1|  hypothetical protein ARALYDRAFT_481835             248   8e-77    
ref|NP_850132.2|  tropinone reductase-like protein                      248   9e-77    
ref|XP_010543921.1|  PREDICTED: tropinone reductase homolog At1g0...    247   9e-77    
ref|XP_010658533.1|  PREDICTED: tropinone reductase homolog At1g0...    248   1e-76    
ref|XP_010510314.1|  PREDICTED: tropinone reductase homolog At1g0...    248   1e-76    
gb|KHN17893.1|  Tropinone reductase like                                248   1e-76    
emb|CAO02390.1|  tropinone reductase                                    248   1e-76    
ref|XP_007140479.1|  hypothetical protein PHAVU_008G116100g             248   1e-76    
ref|XP_010034595.1|  PREDICTED: tropinone reductase homolog At1g0...    247   1e-76    
ref|XP_010510309.1|  PREDICTED: tropinone reductase homolog At1g0...    247   2e-76    
ref|XP_006409994.1|  hypothetical protein EUTSA_v10017057mg             248   2e-76    
ref|XP_010469961.1|  PREDICTED: tropinone reductase homolog At1g0...    247   2e-76    
ref|XP_010521892.1|  PREDICTED: tropinone reductase homolog At1g0...    247   2e-76    
emb|CDY40182.1|  BnaC04g14100D                                          247   2e-76    
ref|XP_008777402.1|  PREDICTED: tropinone reductase homolog At1g0...    247   2e-76    
ref|XP_010043492.1|  PREDICTED: tropinone reductase homolog             249   2e-76    
ref|XP_004145328.1|  PREDICTED: tropinone reductase homolog At1g0...    249   2e-76    
ref|XP_007140493.1|  hypothetical protein PHAVU_008G117200g             246   3e-76    
ref|XP_010414408.1|  PREDICTED: tropinone reductase homolog At1g0...    246   3e-76    
gb|ABW81047.1|  tropinone-reductase-like32                              246   3e-76    
gb|ABW81087.1|  TRL11                                                   247   4e-76    
gb|KFK41763.1|  hypothetical protein AALP_AA2G169000                    246   4e-76    
ref|XP_010088596.1|  Tropinone reductase-like protein                   246   4e-76    
ref|XP_003540716.1|  PREDICTED: tropinone reductase homolog             248   5e-76    
gb|ABW81067.1|  Tropinon-reductase-like54                               246   5e-76    
ref|XP_009144383.1|  PREDICTED: tropinone reductase homolog At1g0...    246   5e-76    
gb|KDO38492.1|  hypothetical protein CISIN_1g0356422mg                  245   7e-76    
emb|CDO98523.1|  unnamed protein product                                245   7e-76    
ref|NP_001239850.1|  uncharacterized protein LOC100785449               246   7e-76    
gb|AAF79553.1|AC022464_11  F22G5.20                                     253   7e-76    
ref|XP_010414424.1|  PREDICTED: tropinone reductase homolog At1g0...    245   8e-76    
ref|XP_002892400.1|  hypothetical protein ARALYDRAFT_470767             245   9e-76    



>emb|CAD62568.1| putative tropinone reductase [Calystegia sepium]
Length=258

 Score =   387 bits (994),  Expect = 2e-131, Method: Compositional matrix adjust.
 Identities = 199/258 (77%), Positives = 222/258 (86%), Gaps = 1/258 (0%)
 Frame = -1

Query  922  MAGRWSLHGMTALVTGGTRGLGHAIVEELACLGATVYTCSRTEKELEECIQNWKAKGYKV  743
            MAGRWSL GMTALVTGGTRGLGHAIVEEL+ LGA  YTCSR +KEL+EC++NWK KGY V
Sbjct  1    MAGRWSLQGMTALVTGGTRGLGHAIVEELSSLGAIAYTCSRNQKELDECLKNWKEKGYPV  60

Query  742  FGSVCDILQPSQRENLIQLVSKQFDGKLTILVNNVAILIPKETLKSDGQDFSNTIGTNLE  563
            FGS CDI Q S+RENLIQLV KQFDGKL ILVN+ A +IPKETL  + +D S  IGTNL 
Sbjct  61   FGSTCDISQQSERENLIQLVCKQFDGKLHILVNSAATIIPKETLNLNAEDNSIVIGTNLM  120

Query  562  ASLNLCQLAHPLLKATGNGsivfisscssfVYAPFHTIYASTKGAINSLVKNLACEWAND  383
             SLN  QLAHPLLKA+GNGSIVFISSC+SFV+ P HT+YA+TKGAINSL KNLACEWAND
Sbjct  121  TSLNFSQLAHPLLKASGNGSIVFISSCASFVFVPVHTVYAATKGAINSLAKNLACEWAND  180

Query  382  NIRVNAVAPWLMRTSLTESSRGEFGA-VIEALIRRTLQHRLVEPKEASAAVAFLCFPAAS  206
            NIRVNAVAPW MRTSLTE++R E G  ++EALI+RT QHRLVEPKEASAAVAFLCFPA+S
Sbjct  181  NIRVNAVAPWAMRTSLTEAAREEAGGEILEALIQRTPQHRLVEPKEASAAVAFLCFPASS  240

Query  205  FVTGQIISVDGGGSIYGL  152
            FVTGQ+I VDGG + YGL
Sbjct  241  FVTGQVICVDGGATSYGL  258



>ref|XP_006355361.1| PREDICTED: tropinone reductase homolog [Solanum tuberosum]
Length=263

 Score =   304 bits (779),  Expect = 8e-99, Method: Compositional matrix adjust.
 Identities = 152/256 (59%), Positives = 193/256 (75%), Gaps = 1/256 (0%)
 Frame = -1

Query  916  GRWSLHGMTALVTGGTRGLGHAIVEELACLGATVYTCSRTEKELEECIQNWKAKGYKVFG  737
            GRWSLHGMTALVTGGTRG+G+AIVEELA  GA++YTCSR +K+L+EC++ W+ KGYKV G
Sbjct  7    GRWSLHGMTALVTGGTRGIGYAIVEELASFGASIYTCSRNKKDLDECLEKWQTKGYKVNG  66

Query  736  SVCDILQPSQRENLIQLVSKQFDGKLTILVNNVAILIPKETLKSDGQDFSNTIGTNLEAS  557
            S CD+    QR  LI   ++ F+GKL ILVNN AI +PKET +    D S  +GTN EAS
Sbjct  67   STCDLFLEDQRIELIDKATQHFNGKLDILVNNAAICVPKETAQITSADCSLMMGTNFEAS  126

Query  556  LNLCQLAHPLLKATGNGsivfisscssfVYAPFHTIYASTKGAINSLVKNLACEWANDNI  377
             NLCQLA+P LK +G  SIVFISS S  +  PF ++YA+TKGAIN L KNLACEW  DNI
Sbjct  127  YNLCQLAYPYLKGSGKASIVFISSISGIMAIPFVSLYAATKGAINQLTKNLACEWGKDNI  186

Query  376  RVNAVAPWLMRTSLTESSRGEF-GAVIEALIRRTLQHRLVEPKEASAAVAFLCFPAASFV  200
            RVNAVAPW++ T+LT++   +F  + +E LI+RT   R+ +P E S+ VA+LCFPAA+++
Sbjct  187  RVNAVAPWIIDTALTDTVAEDFESSDVEKLIKRTPISRMGKPNEVSSLVAYLCFPAAAYI  246

Query  199  TGQIISVDGGGSIYGL  152
            TGQII VDGG ++ G 
Sbjct  247  TGQIICVDGGKTVSGF  262



>ref|XP_009621668.1| PREDICTED: tropinone reductase homolog [Nicotiana tomentosiformis]
Length=267

 Score =   303 bits (777),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 151/256 (59%), Positives = 193/256 (75%), Gaps = 1/256 (0%)
 Frame = -1

Query  916  GRWSLHGMTALVTGGTRGLGHAIVEELACLGATVYTCSRTEKELEECIQNWKAKGYKVFG  737
            GRWSLHGMTALVTGGTRG+GHAIVEELA  GAT++TCSR +K+L+EC++ W+ KGYKV G
Sbjct  11   GRWSLHGMTALVTGGTRGIGHAIVEELASFGATIFTCSRNKKDLDECLEKWQKKGYKVNG  70

Query  736  SVCDILQPSQRENLIQLVSKQFDGKLTILVNNVAILIPKETLKSDGQDFSNTIGTNLEAS  557
            S CD+    QR  LI+  ++ F+G+L ILVNN  + +PKET K    D S  +GTN EAS
Sbjct  71   STCDLFSEDQRNQLIEKATEYFNGRLDILVNNAGVCVPKETTKITSGDCSLMMGTNFEAS  130

Query  556  LNLCQLAHPLLKATGNGsivfisscssfVYAPFHTIYASTKGAINSLVKNLACEWANDNI  377
             +LCQLA+P LK +G  SIVFISS S  +  PF ++YA+TKGAIN L KNLACEW  DNI
Sbjct  131  YHLCQLAYPFLKVSGKASIVFISSISGIMAIPFVSLYAATKGAINQLTKNLACEWGKDNI  190

Query  376  RVNAVAPWLMRTSLTESSRGEFGAV-IEALIRRTLQHRLVEPKEASAAVAFLCFPAASFV  200
            RVNAVAPW++ T+LT+S   +F +  +E LI+RT   R+ +P E S+ VA+LCFPAA+++
Sbjct  191  RVNAVAPWIIDTALTDSVAEDFESKDVENLIKRTPISRMGKPNEVSSLVAYLCFPAAAYI  250

Query  199  TGQIISVDGGGSIYGL  152
            TGQII VDGG ++ G 
Sbjct  251  TGQIICVDGGKTVCGF  266



>ref|XP_004237405.1| PREDICTED: tropinone reductase homolog [Solanum lycopersicum]
Length=263

 Score =   303 bits (775),  Expect = 4e-98, Method: Compositional matrix adjust.
 Identities = 150/256 (59%), Positives = 193/256 (75%), Gaps = 1/256 (0%)
 Frame = -1

Query  916  GRWSLHGMTALVTGGTRGLGHAIVEELACLGATVYTCSRTEKELEECIQNWKAKGYKVFG  737
            GRWSLHGMTALVTGGTRG+G+AIVEELA  GA++YTCSR +K+L+EC++ W+ KGYKV G
Sbjct  7    GRWSLHGMTALVTGGTRGIGYAIVEELASFGASIYTCSRNKKDLDECLEKWQTKGYKVNG  66

Query  736  SVCDILQPSQRENLIQLVSKQFDGKLTILVNNVAILIPKETLKSDGQDFSNTIGTNLEAS  557
            S CD+    QR  LI   ++ F+G+L ILVNN AI +PKET +    D S  +GTN EAS
Sbjct  67   STCDLFLEDQRIELIGKATQHFNGELDILVNNAAICVPKETTQITSADCSLMMGTNFEAS  126

Query  556  LNLCQLAHPLLKATGNGsivfisscssfVYAPFHTIYASTKGAINSLVKNLACEWANDNI  377
             NLCQLA+P LK +G  S+VFISS S  +  PF ++YA+TKGAIN L KNLACEW  DNI
Sbjct  127  YNLCQLAYPFLKGSGKASVVFISSISGIMAIPFVSLYAATKGAINQLTKNLACEWGKDNI  186

Query  376  RVNAVAPWLMRTSLTESSRGEF-GAVIEALIRRTLQHRLVEPKEASAAVAFLCFPAASFV  200
            RVNAVAPW++ T+LT++   +F  + +E LI+RT   R+ +P E S+ VA+LCFPAA+++
Sbjct  187  RVNAVAPWIIDTALTDTVAEDFESSDVEKLIKRTPISRMGKPNEVSSLVAYLCFPAAAYI  246

Query  199  TGQIISVDGGGSIYGL  152
            TGQII VDGG ++ G 
Sbjct  247  TGQIICVDGGKTVSGF  262



>ref|XP_009794560.1| PREDICTED: tropinone reductase homolog [Nicotiana sylvestris]
Length=268

 Score =   302 bits (774),  Expect = 5e-98, Method: Compositional matrix adjust.
 Identities = 150/264 (57%), Positives = 193/264 (73%), Gaps = 2/264 (1%)
 Frame = -1

Query  937  QQHNIMAGRWSLHGMTALVTGGTRGLGHAIVEELACLGATVYTCSRTEKELEECIQNWKA  758
             ++N   GRWSLHGMTALVTGGTRG+GHAIVEELA  GAT++TCSR +K+L EC++ W+ 
Sbjct  4    NENNNGDGRWSLHGMTALVTGGTRGIGHAIVEELASFGATIFTCSRNKKDLIECLEKWQK  63

Query  757  KGYKVFGSVCDILQPSQRENLIQLVSKQFDGKLTILVNNVAILIPKETLKSDGQDFSNTI  578
            KGYKV GS CD+    +R  LI+  ++ F+GKL ILVNN  I +PKET K+   D S  I
Sbjct  64   KGYKVNGSTCDLFSEDERNQLIEKATEYFNGKLDILVNNAGICVPKETTKTTSGDCSLMI  123

Query  577  GTNLEASLNLCQLAHPLLKATGNGsivfisscssfVYA-PFHTIYASTKGAINSLVKNLA  401
            GTN EAS +LCQLA+P LK +G  S +   S  S + A PF ++YA+TKGAIN L KNLA
Sbjct  124  GTNFEASYHLCQLAYPFLKVSGKASSIVFISSISGIMAIPFVSLYAATKGAINQLTKNLA  183

Query  400  CEWANDNIRVNAVAPWLMRTSLTESSRGEFGAV-IEALIRRTLQHRLVEPKEASAAVAFL  224
            CEW  DNIRVNAVAPW++ T+LT++   +F +  +E LI+RT   R+ +P E S+ VA+L
Sbjct  184  CEWGKDNIRVNAVAPWIIDTALTDTVAEDFESKDVENLIKRTPISRMGKPNEVSSLVAYL  243

Query  223  CFPAASFVTGQIISVDGGGSIYGL  152
            CFPAAS++TGQII VDGG ++ G 
Sbjct  244  CFPAASYITGQIICVDGGKTVCGF  267



>ref|XP_010920509.1| PREDICTED: tropinone reductase homolog [Elaeis guineensis]
Length=272

 Score =   293 bits (749),  Expect = 4e-94, Method: Compositional matrix adjust.
 Identities = 151/257 (59%), Positives = 191/257 (74%), Gaps = 5/257 (2%)
 Frame = -1

Query  916  GRWSLHGMTALVTGGTRGLGHAIVEELACLGATVYTCSRTEKELEECIQNWKAKGYKVFG  737
            GRWSL GMTALVTGGTRG+GHA+VEELA  GATV+TCSR E EL EC++ W+A+G +V G
Sbjct  14   GRWSLQGMTALVTGGTRGIGHAVVEELAGFGATVHTCSRKEGELSECLKKWEAQGLRVTG  73

Query  736  SVCDILQPSQRENLIQLVSKQFDGKLTILVNNVAILIPKETLKSDGQDFSNTIGTNLEAS  557
            SVCD+  P +RE+L++ VS  FDGKL IL+NN    I K+ ++   +++S+ + TNLE++
Sbjct  74   SVCDVSIPDRREDLMREVSSLFDGKLNILINNAGTNIRKKAVEYTAEEYSSIMATNLESA  133

Query  556  LNLCQLAHPLLKATGNGsivfisscssfVYAPFHTIYASTKGAINSLVKNLACEWANDNI  377
             +LCQLAHP LKA G GSIVFISS +  V  P  TIYA+TKGAIN L KN ACEWA DNI
Sbjct  134  FHLCQLAHPFLKAAGRGSIVFISSVAGVVAVPSGTIYAATKGAINQLTKNFACEWAKDNI  193

Query  376  RVNAVAPWLMRTSLTES--SRGEFGAVIEALIRRTLQHRLVEPKEASAAVAFLCFPAASF  203
            R N VAPW +RTSL E+   + EF   +E L+ RT   R+ EP+E S+ VAFLC PAAS+
Sbjct  194  RTNCVAPWYIRTSLVENVIKQEEF---MERLVDRTPLGRVGEPEEVSSLVAFLCLPAASY  250

Query  202  VTGQIISVDGGGSIYGL  152
            ++GQ+I VDGG S+ G 
Sbjct  251  ISGQVICVDGGMSVNGF  267



>ref|XP_008801625.1| PREDICTED: tropinone reductase homolog At1g07440-like [Phoenix 
dactylifera]
Length=332

 Score =   292 bits (747),  Expect = 5e-93, Method: Compositional matrix adjust.
 Identities = 152/257 (59%), Positives = 190/257 (74%), Gaps = 5/257 (2%)
 Frame = -1

Query  916  GRWSLHGMTALVTGGTRGLGHAIVEELACLGATVYTCSRTEKELEECIQNWKAKGYKVFG  737
            GRWSL GMTALVTGGTRG+GHA+VEELA LGATV+TCSR E EL EC+  W+A+G +V G
Sbjct  77   GRWSLQGMTALVTGGTRGIGHAVVEELAGLGATVHTCSRKEGELSECLNKWEAQGLRVTG  136

Query  736  SVCDILQPSQRENLIQLVSKQFDGKLTILVNNVAILIPKETLKSDGQDFSNTIGTNLEAS  557
            SVCD+  P QR++L++ VS  FDGKL IL+NNV   I K+ ++   +++S  + TNLE++
Sbjct  137  SVCDLSVPDQRDDLMRKVSSLFDGKLNILINNVGTNIRKKAIEYTAEEYSFIMATNLESA  196

Query  556  LNLCQLAHPLLKATGNGsivfisscssfVYAPFHTIYASTKGAINSLVKNLACEWANDNI  377
             +LCQLAHPLLKA+G GSIVFISS +  V  P  TIYA+TKGAIN L KN ACEWA DNI
Sbjct  197  FHLCQLAHPLLKASGRGSIVFISSVAGVVAVPSGTIYAATKGAINQLTKNFACEWAKDNI  256

Query  376  RVNAVAPWLMRTSLTES--SRGEFGAVIEALIRRTLQHRLVEPKEASAAVAFLCFPAASF  203
            R N+VAPW +RTSL E+     EF   +E  + RT   R+ EP+E S+ VAFLC PAAS+
Sbjct  257  RTNSVAPWYIRTSLVENVIKDEEF---MERFVHRTPLGRVGEPEEVSSLVAFLCLPAASY  313

Query  202  VTGQIISVDGGGSIYGL  152
            + GQ+I  DGG S+ G 
Sbjct  314  INGQVIIADGGMSVNGF  330



>ref|XP_009772417.1| PREDICTED: tropinone reductase homolog [Nicotiana sylvestris]
Length=263

 Score =   287 bits (735),  Expect = 4e-92, Method: Compositional matrix adjust.
 Identities = 151/255 (59%), Positives = 186/255 (73%), Gaps = 3/255 (1%)
 Frame = -1

Query  916  GRWSLHGMTALVTGGTRGLGHAIVEELACLGATVYTCSRTEKELEECIQNWKAKGYKVFG  737
            GRWSL G TA+VTGGTRG+GHAIVEELA  GA VYTCSR + EL+EC++ WK KG KV G
Sbjct  5    GRWSLQGTTAIVTGGTRGIGHAIVEELASFGANVYTCSRNQMELDECLRQWKTKGSKVEG  64

Query  736  SVCDILQPSQRENLIQLVSKQFDGKLTILVNNVAILIPKETLKSDGQDFSNTIGTNLEAS  557
            SVCD+L  SQRE  +  VS  FDGK+ IL+NN A+ I K T +   +D++  +G N EAS
Sbjct  65   SVCDLLSRSQREKFMDTVSSYFDGKINILINNAAVAIAKLTTEFTHEDYNTMMGINFEAS  124

Query  556  LNLCQLAHPLLKATGNGsivfisscssfVYAPFHTIYASTKGAINSLVKNLACEWANDNI  377
             +L QLAHP LKA+GNGSIVFISS +  V  P  +IY+++KGA+N L ++LACEWA DNI
Sbjct  125  YHLSQLAHPFLKASGNGSIVFISSVAGLVSLPLCSIYSASKGAMNQLARSLACEWAKDNI  184

Query  376  RVNAVAPWLMRTSLTE--SSRGEFGAVIEALIRRT-LQHRLVEPKEASAAVAFLCFPAAS  206
            RVNAVAPW++RTSL +  S        I  L  RT +  R+ EPKE SA VAFLCFP AS
Sbjct  185  RVNAVAPWIIRTSLIDAASQNPVHKENINKLTSRTPIGGRVGEPKEVSAMVAFLCFPCAS  244

Query  205  FVTGQIISVDGGGSI  161
            ++TGQI+ VDGG +I
Sbjct  245  YITGQIMCVDGGITI  259



>ref|XP_006341201.1| PREDICTED: tropinone reductase homolog [Solanum tuberosum]
Length=263

 Score =   286 bits (732),  Expect = 9e-92, Method: Compositional matrix adjust.
 Identities = 148/257 (58%), Positives = 190/257 (74%), Gaps = 3/257 (1%)
 Frame = -1

Query  916  GRWSLHGMTALVTGGTRGLGHAIVEELACLGATVYTCSRTEKELEECIQNWKAKGYKVFG  737
            GRW+L G TA+VTGGTRG+G+AIVEELA  GA VYTCSR + EL+EC++ WKAKG+KV G
Sbjct  5    GRWTLQGNTAIVTGGTRGIGYAIVEELASFGANVYTCSRNQMELDECLRKWKAKGFKVGG  64

Query  736  SVCDILQPSQRENLIQLVSKQFDGKLTILVNNVAILIPKETLKSDGQDFSNTIGTNLEAS  557
            S+CD+L  +QR+  +  VS  FDGK+ IL+NN A+++     +S  +D++  +GTN EAS
Sbjct  65   SMCDLLSRTQRQKFMDNVSSYFDGKINILINNAAVIVSNLATESTHEDYNTMMGTNFEAS  124

Query  556  LNLCQLAHPLLKATGNGsivfisscssfVYAPFHTIYASTKGAINSLVKNLACEWANDNI  377
             +L QLAHP LKA+ NG IVFISS + FV  PF +IY++ KGA+N L ++LACEWA DNI
Sbjct  125  YHLSQLAHPFLKASKNGRIVFISSVAGFVSLPFCSIYSAAKGAMNQLTRSLACEWAMDNI  184

Query  376  RVNAVAPWLMRTSLTE--SSRGEFGAVIEALIRRT-LQHRLVEPKEASAAVAFLCFPAAS  206
            RVNAVAPW+++TSL E  S   E    I  L+ RT +  R  EPKE SA VAFLCFP AS
Sbjct  185  RVNAVAPWVIKTSLIEAASQDSEVKKRINKLVSRTPIGGRPGEPKEVSAMVAFLCFPCAS  244

Query  205  FVTGQIISVDGGGSIYG  155
            ++TGQI+ VDGG +I G
Sbjct  245  YITGQIMCVDGGITING  261



>ref|XP_009630417.1| PREDICTED: tropinone reductase 1-like [Nicotiana tomentosiformis]
Length=263

 Score =   286 bits (731),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 149/255 (58%), Positives = 186/255 (73%), Gaps = 3/255 (1%)
 Frame = -1

Query  916  GRWSLHGMTALVTGGTRGLGHAIVEELACLGATVYTCSRTEKELEECIQNWKAKGYKVFG  737
            GRWSL G TA+VTGGTRG+GHAIVEELA  GA VYTCSR + EL+EC++ WK KG+KV G
Sbjct  5    GRWSLQGTTAIVTGGTRGIGHAIVEELASFGANVYTCSRNQMELDECLRQWKTKGFKVEG  64

Query  736  SVCDILQPSQRENLIQLVSKQFDGKLTILVNNVAILIPKETLKSDGQDFSNTIGTNLEAS  557
            SVCD+L  SQRE  +  VS  FDGK+ IL+NN  + I K T +   +D++  +G N EAS
Sbjct  65   SVCDLLSRSQREKFMDTVSNYFDGKINILINNAGVAIAKLTTEFTHEDYNTMMGINFEAS  124

Query  556  LNLCQLAHPLLKATGNGsivfisscssfVYAPFHTIYASTKGAINSLVKNLACEWANDNI  377
             +L QLAHP L+A+GNGSIVFISS +  V  P  +IY+++KGA+N L ++LACEWA DNI
Sbjct  125  YHLSQLAHPFLQASGNGSIVFISSVAGLVSLPLCSIYSASKGAMNQLTRSLACEWAKDNI  184

Query  376  RVNAVAPWLMRTSLTE--SSRGEFGAVIEAL-IRRTLQHRLVEPKEASAAVAFLCFPAAS  206
            RVNAVAPW++RTSL +  S        I  L IR  +  R+ EPKE SA VAFLCFP AS
Sbjct  185  RVNAVAPWIIRTSLIDVASQNPVHKENINKLTIRTPIGGRVGEPKEVSAMVAFLCFPCAS  244

Query  205  FVTGQIISVDGGGSI  161
            ++TGQI+ VDGG +I
Sbjct  245  YITGQIMCVDGGITI  259



>ref|XP_006493569.1| PREDICTED: tropinone reductase homolog isoform X2 [Citrus sinensis]
Length=261

 Score =   286 bits (731),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 145/254 (57%), Positives = 183/254 (72%), Gaps = 0/254 (0%)
 Frame = -1

Query  913  RWSLHGMTALVTGGTRGLGHAIVEELACLGATVYTCSRTEKELEECIQNWKAKGYKVFGS  734
            RWSL GMTALVTGGT+G+G+A+VEELA  GA V+TCSR E EL + IQ WK+KG +V G+
Sbjct  8    RWSLKGMTALVTGGTKGIGYAVVEELAAFGAIVHTCSRNETELNQRIQEWKSKGLQVSGN  67

Query  733  VCDILQPSQRENLIQLVSKQFDGKLTILVNNVAILIPKETLKSDGQDFSNTIGTNLEASL  554
             CD+   +QRE L++ VS QFDGKL IL+NN    IPKET +   +DFS  + TN E++ 
Sbjct  68   ACDVKIRAQREKLMETVSSQFDGKLNILINNAGTFIPKETTEFTEEDFSTVMTTNFESAY  127

Query  553  NLCQLAHPLLKATGNGsivfisscssfVYAPFHTIYASTKGAINSLVKNLACEWANDNIR  374
            ++ QLAHPLLK++GNG+I+FISS +  +  P  +I AS+KGA+N L KNLACEWA D IR
Sbjct  128  HVSQLAHPLLKSSGNGNIIFISSVAGVIAIPMCSIAASSKGAMNQLTKNLACEWAKDKIR  187

Query  373  VNAVAPWLMRTSLTESSRGEFGAVIEALIRRTLQHRLVEPKEASAAVAFLCFPAASFVTG  194
            VN+VAPW++RT L +     F      +I RT   R  EP E S+ VAFLCFPAAS+VTG
Sbjct  188  VNSVAPWIIRTPLIDKKDSTFLEQANRMILRTPIPRPGEPTEVSSVVAFLCFPAASYVTG  247

Query  193  QIISVDGGGSIYGL  152
            Q+I VDGG SI G 
Sbjct  248  QVICVDGGYSITGF  261



>ref|XP_006493561.1| PREDICTED: tropinone reductase homolog [Citrus sinensis]
Length=263

 Score =   285 bits (730),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 149/256 (58%), Positives = 183/256 (71%), Gaps = 2/256 (1%)
 Frame = -1

Query  913  RWSLHGMTALVTGGTRGLGHAIVEELACLGATVYTCSRTEKELEECIQNWKAKGYKVFGS  734
            RWSL GMTALVTGGTRG+GHAIVEEL   GA V+TCSR E EL E IQ WK+KG KV GS
Sbjct  8    RWSLKGMTALVTGGTRGIGHAIVEELTAFGAIVHTCSRNETELNERIQEWKSKGLKVSGS  67

Query  733  VCDILQPSQRENLIQLVSKQFDGKLTILVNNVAILIPKETLKSDGQDFSNTIGTNLEASL  554
             CD+   ++R+ L++ V  +FDGKL ILVNN    IPKE  +   +DFS  + TN E++ 
Sbjct  68   ACDLKIRAERQKLMEAVCSEFDGKLNILVNNAGTTIPKEATEFTMEDFSTIMTTNFESAY  127

Query  553  NLCQLAHPLLKATGNGsivfisscssfVYAPFHTIYASTKGAINSLVKNLACEWANDNIR  374
            +L QLA+PLLKA+GNG+I+FISS +  +  P  +IYASTKGA+N L KNLACEW  DNIR
Sbjct  128  HLSQLAYPLLKASGNGNIIFISSVTGVIAVPLSSIYASTKGAMNQLTKNLACEWGKDNIR  187

Query  373  VNAVAPWLMRTSLTESSRGEFGAVIEA--LIRRTLQHRLVEPKEASAAVAFLCFPAASFV  200
            VNAVAPW++RTSL +S   +   +  A  LI RT   R  EP E S+ VAFLC PAAS+V
Sbjct  188  VNAVAPWIIRTSLIDSIEKDPRVMEHASRLIPRTPIPRPGEPNEVSSVVAFLCLPAASYV  247

Query  199  TGQIISVDGGGSIYGL  152
            TGQ+  +DGG S+ G 
Sbjct  248  TGQVFCIDGGYSVNGF  263



>sp|P50165.1|TRNH_DATST RecName: Full=Tropinone reductase homolog; AltName: Full=P29X 
[Datura stramonium]
 gb|AAA33280.1| 29kDa protein; high homology to aa sequence of tropinone reductases 
[Datura stramonium]
Length=268

 Score =   286 bits (731),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 143/256 (56%), Positives = 184/256 (72%), Gaps = 2/256 (1%)
 Frame = -1

Query  913  RWSLHGMTALVTGGTRGLGHAIVEELACLGATVYTCSRTEKELEECIQNWKAKGYKVFGS  734
            RWSL GMTALVTGGTRG+G+AIVEELA  GA VYTCSR++ +L+EC++ W+ KG+KV G 
Sbjct  12   RWSLRGMTALVTGGTRGIGYAIVEELANFGAEVYTCSRSQNDLDECLEKWRRKGFKVSGP  71

Query  733  VCDILQPSQRENLIQLVSKQFDGKLTILVNNVAILIPKETLKSDGQDFSNTIGTNLEASL  554
            VCD+   SQR+ L++ V+  F+GKL IL+NN    IPKE      +D+S  +GTN EAS 
Sbjct  72   VCDVSSISQRQTLMESVTSSFNGKLNILINNAGTTIPKEATNFTAEDYSIIMGTNFEASY  131

Query  553  NLCQLAHPLLKATGNGsivfisscssfVYAPFHTIYASTKGAINSLVKNLACEWANDNIR  374
            NLCQLAHPLLKA+GN SIVF SS +  +  P  +IYA++KGAIN + K+LACEWA D+IR
Sbjct  132  NLCQLAHPLLKASGNASIVFNSSAAGVIAVPLSSIYAASKGAINQVTKSLACEWAKDSIR  191

Query  373  VNAVAPWLMRTSLTESS--RGEFGAVIEALIRRTLQHRLVEPKEASAAVAFLCFPAASFV  200
            VNAVAPW++ T + E++         IE+LI R    R  EP E S+ V +LC P AS++
Sbjct  192  VNAVAPWIINTPIIEAACQVPSQKKNIESLIGRAPMKRAGEPSEVSSLVTYLCLPTASYI  251

Query  199  TGQIISVDGGGSIYGL  152
            TGQII VDGG ++ G 
Sbjct  252  TGQIICVDGGYTVNGF  267



>ref|XP_002299847.1| tropinone reductase family protein [Populus trichocarpa]
 gb|ABK94936.1| unknown [Populus trichocarpa]
 gb|EEE84652.1| tropinone reductase family protein [Populus trichocarpa]
Length=266

 Score =   285 bits (729),  Expect = 3e-91, Method: Compositional matrix adjust.
 Identities = 152/254 (60%), Positives = 187/254 (74%), Gaps = 2/254 (1%)
 Frame = -1

Query  913  RWSLHGMTALVTGGTRGLGHAIVEELACLGATVYTCSRTEKELEECIQNWKAKGYKVFGS  734
            RW LHGMTALVTGG++GLGHAIVEELA LGAT++TC+RTE  L EC+Q WK KG+KV GS
Sbjct  13   RWLLHGMTALVTGGSKGLGHAIVEELAGLGATIHTCARTESVLNECLQEWKMKGFKVTGS  72

Query  733  VCDILQPSQRENLIQLVSKQFDGKLTILVNNVAILIPKETLKSDGQDFSNTIGTNLEASL  554
            VCD+   ++RE L+  VS QFDGKL ILVNNV IL  + T+    +D S  + TN E++ 
Sbjct  73   VCDVSSRTEREKLMSTVSSQFDGKLNILVNNVGILYFQRTIDVTPEDISLYLSTNFESAY  132

Query  553  NLCQLAHPLLKATGNGsivfisscssfVYAPFHTIYASTKGAINSLVKNLACEWANDNIR  374
            +LCQLAHPLLK +G G+IVF+SS S  V     ++Y +TKGAIN L KNLACEWA DNIR
Sbjct  133  HLCQLAHPLLKNSGAGNIVFMSSVSGVVSV-SVSLYGATKGAINQLTKNLACEWAKDNIR  191

Query  373  VNAVAPWLMRTSLTESSRGEFGAVIEALIRRTLQHRLVEPKEASAAVAFLCFPAASFVTG  194
             N+VAPWL+RT L E    E    ++A+  RT   RL EPKE S+ VAFLC PAAS++TG
Sbjct  192  ANSVAPWLIRTPLVERDL-ENELFLKAVEARTPMGRLGEPKEVSSLVAFLCMPAASYITG  250

Query  193  QIISVDGGGSIYGL  152
            Q+I VDGG ++ GL
Sbjct  251  QVICVDGGFTVNGL  264



>ref|XP_011006388.1| PREDICTED: tropinone reductase homolog [Populus euphratica]
Length=275

 Score =   285 bits (729),  Expect = 4e-91, Method: Compositional matrix adjust.
 Identities = 147/252 (58%), Positives = 189/252 (75%), Gaps = 4/252 (2%)
 Frame = -1

Query  913  RWSLHGMTALVTGGTRGLGHAIVEELACLGATVYTCSRTEKELEECIQNWKAKGYKVFGS  734
            RWSL GMTALVTGGTRG+G AIVEELA  GA V+TCSR E +L+ECI+ W++KG++V GS
Sbjct  12   RWSLKGMTALVTGGTRGIGFAIVEELAGFGAAVHTCSRNETKLDECIREWESKGFRVTGS  71

Query  733  VCDILQPSQRENLIQLVSKQFDGKLTILVNNVAILIPKETLKSDGQDFSNTIGTNLEASL  554
            VCD+   +QRE LI+ VS  F GKL ILVNN A ++ K + K   +D +NT+GTN+EAS 
Sbjct  72   VCDVSCRTQREKLIEKVSSTFQGKLNILVNNAAAVVSKNSTKVTAEDMANTLGTNVEASY  131

Query  553  NLCQLAHPLLKATGNGsivfisscssfVYAPFHTIYASTKGAINSLVKNLACEWANDNIR  374
            +LCQLAHPLLKA+GNGSIVFISS ++ V  P  + Y ++KGA+N L K+LACEWA D IR
Sbjct  132  HLCQLAHPLLKASGNGSIVFISSVAAVVALPTLSFYGASKGALNQLTKSLACEWAQDKIR  191

Query  373  VNAVAPWLMRTSLTES----SRGEFGAVIEALIRRTLQHRLVEPKEASAAVAFLCFPAAS  206
             NAV+PW+++T L ++    S  E  A +  ++ +T  +RL EP E S+ VAFLC P AS
Sbjct  192  ANAVSPWIIKTPLLDASLAKSASEQRAGMSRIVSQTPINRLGEPTEISSLVAFLCLPTAS  251

Query  205  FVTGQIISVDGG  170
            ++TGQIISVDGG
Sbjct  252  YITGQIISVDGG  263



>ref|XP_006429154.1| hypothetical protein CICLE_v10012494mg [Citrus clementina]
 gb|ESR42394.1| hypothetical protein CICLE_v10012494mg [Citrus clementina]
Length=263

 Score =   284 bits (726),  Expect = 9e-91, Method: Compositional matrix adjust.
 Identities = 148/256 (58%), Positives = 184/256 (72%), Gaps = 2/256 (1%)
 Frame = -1

Query  913  RWSLHGMTALVTGGTRGLGHAIVEELACLGATVYTCSRTEKELEECIQNWKAKGYKVFGS  734
            RWSL GMTALVTGGTRG+G+AIVEEL   GA V+TCSR E EL E IQ WK+KG KV GS
Sbjct  8    RWSLKGMTALVTGGTRGIGYAIVEELTAFGAIVHTCSRNETELNERIQEWKSKGLKVSGS  67

Query  733  VCDILQPSQRENLIQLVSKQFDGKLTILVNNVAILIPKETLKSDGQDFSNTIGTNLEASL  554
             CD+   ++R+ L++ V  +FDGKL ILVNN    IPKE  +   +DFS  + TN E++ 
Sbjct  68   ACDLKIRAERQKLMETVCSEFDGKLNILVNNAGTTIPKEATEFTMEDFSTIMTTNFESAY  127

Query  553  NLCQLAHPLLKATGNGsivfisscssfVYAPFHTIYASTKGAINSLVKNLACEWANDNIR  374
            +L QLA+PLLKA+GNG+I+FISS +  +  P  +IYASTKGA+N L KNLACEW  DNIR
Sbjct  128  HLSQLAYPLLKASGNGNIIFISSVTGVIAVPLCSIYASTKGAMNQLTKNLACEWGKDNIR  187

Query  373  VNAVAPWLMRTSLTESSRGEFGAVIEA--LIRRTLQHRLVEPKEASAAVAFLCFPAASFV  200
            VNAVAPW++RTSL +S   +   +  A  LI RT   R  EP E S+ VAFLC PAAS++
Sbjct  188  VNAVAPWIIRTSLIDSIEKDPRVLEHASRLIARTPIPRPGEPNEVSSVVAFLCLPAASYI  247

Query  199  TGQIISVDGGGSIYGL  152
            TGQ+I +DGG S+ G 
Sbjct  248  TGQVICIDGGYSVTGF  263



>ref|XP_009375951.1| PREDICTED: tropinone reductase homolog At1g07440-like [Pyrus 
x bretschneideri]
Length=264

 Score =   283 bits (725),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 149/260 (57%), Positives = 186/260 (72%), Gaps = 3/260 (1%)
 Frame = -1

Query  928  NIMAGRWSLHGMTALVTGGTRGLGHAIVEELACLGATVYTCSRTEKELEECIQNWKAKGY  749
            N   GRWSL GMTALVTGGT+G+G+AIVEELA LGA V+TCSR E +L +C   WK KG+
Sbjct  2    NSREGRWSLRGMTALVTGGTKGIGYAIVEELAGLGAIVHTCSRNEVDLNDCQSQWKKKGF  61

Query  748  KVFGSVCDILQPSQRENLIQLVSKQFDGKLTILVNNVAILIPKETLKSDGQDFSNTIGTN  569
            +V GSVCD++  +QRE LI  VS  FDGKL I +NNV  ++PK TL+   +D+S  + TN
Sbjct  62   QVTGSVCDVVSKTQREELINKVSSLFDGKLNIFINNVGTVVPKATLEYTAEDYSFMMSTN  121

Query  568  LEASLNLCQLAHPLLKATGNGsivfisscssfVYAPFHTIYASTKGAINSLVKNLACEWA  389
            LE++ NLCQL HPLLKA+G  +IVF+SS +  V A   +IY++TKGA+N L KNLACEWA
Sbjct  122  LESAYNLCQLTHPLLKASGVANIVFVSSVAGVVSASVGSIYSATKGAMNQLAKNLACEWA  181

Query  388  NDNIRVNAVAPWLMRTSLTESS-RGEFGAVIEALIRRTLQHRLVEPKEASAAVAFLCFPA  212
             DNIR N+VAPW +RT L E   R E    +E +  R    R  EPKE S+ VAFLC PA
Sbjct  182  KDNIRTNSVAPWFIRTPLVEPFLRDE--KKLEMINSRCPLGRPGEPKEVSSLVAFLCLPA  239

Query  211  ASFVTGQIISVDGGGSIYGL  152
            AS++TGQ I VDGG ++ GL
Sbjct  240  ASYITGQTIIVDGGVTVNGL  259



>ref|XP_006493560.1| PREDICTED: tropinone reductase homolog [Citrus sinensis]
Length=263

 Score =   283 bits (725),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 148/256 (58%), Positives = 184/256 (72%), Gaps = 2/256 (1%)
 Frame = -1

Query  913  RWSLHGMTALVTGGTRGLGHAIVEELACLGATVYTCSRTEKELEECIQNWKAKGYKVFGS  734
            RWSL GMTALVTGGTRG+G+AIVEEL   GA V+TCSR E EL E IQ WK+KG KV GS
Sbjct  8    RWSLKGMTALVTGGTRGIGYAIVEELTAFGAIVHTCSRNETELNERIQEWKSKGLKVSGS  67

Query  733  VCDILQPSQRENLIQLVSKQFDGKLTILVNNVAILIPKETLKSDGQDFSNTIGTNLEASL  554
             CD+   ++R+ L++ V  +FDGKL ILVNN    IPKE  +   +DFS  + TN E++ 
Sbjct  68   ACDLKIRAERQKLMEAVCSEFDGKLNILVNNAGTTIPKEATEFTMEDFSTIMTTNFESAY  127

Query  553  NLCQLAHPLLKATGNGsivfisscssfVYAPFHTIYASTKGAINSLVKNLACEWANDNIR  374
            +L QLA+PLLKA+GNG+I+FISS +  +  P  +IYASTKGA+N L KNLACEW  DNIR
Sbjct  128  HLSQLAYPLLKASGNGNIIFISSVTGVIAVPLCSIYASTKGAMNQLTKNLACEWGKDNIR  187

Query  373  VNAVAPWLMRTSLTESSRGEFGAVIEA--LIRRTLQHRLVEPKEASAAVAFLCFPAASFV  200
            VNAVAPW++RTSL +S   +   +  A  LI RT   R  EP E S+ VAFLC PAAS++
Sbjct  188  VNAVAPWIIRTSLIDSIEKDPRVLEHASRLIARTPIPRPGEPNEVSSVVAFLCLPAASYI  247

Query  199  TGQIISVDGGGSIYGL  152
            TGQ+I +DGG S+ G 
Sbjct  248  TGQVICIDGGYSVTGF  263



>ref|XP_006429155.1| hypothetical protein CICLE_v10012221mg [Citrus clementina]
 gb|ESR42395.1| hypothetical protein CICLE_v10012221mg [Citrus clementina]
Length=320

 Score =   285 bits (729),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 149/256 (58%), Positives = 183/256 (71%), Gaps = 2/256 (1%)
 Frame = -1

Query  913  RWSLHGMTALVTGGTRGLGHAIVEELACLGATVYTCSRTEKELEECIQNWKAKGYKVFGS  734
            RWSL GMTALVTGGTRG+GHAIVEEL   GA V+TCSR E EL E IQ WK+KG KV GS
Sbjct  65   RWSLKGMTALVTGGTRGIGHAIVEELTAFGAIVHTCSRNETELNERIQEWKSKGLKVSGS  124

Query  733  VCDILQPSQRENLIQLVSKQFDGKLTILVNNVAILIPKETLKSDGQDFSNTIGTNLEASL  554
             CD+   ++R+ L++ V  +FDGKL ILVNN    IPKE  +   +DFS  + TN E++ 
Sbjct  125  ACDLKIRAERQKLMEAVCSEFDGKLNILVNNAGTTIPKEATEFTMEDFSTIMTTNFESAY  184

Query  553  NLCQLAHPLLKATGNGsivfisscssfVYAPFHTIYASTKGAINSLVKNLACEWANDNIR  374
            +L QLA+PLLKA+GNG+I+FISS +  +  P  +IYASTKGA+N L KNLACEW  DNIR
Sbjct  185  HLSQLAYPLLKASGNGNIIFISSVTGVIAVPLSSIYASTKGAMNQLTKNLACEWGKDNIR  244

Query  373  VNAVAPWLMRTSLTESSRGEFGAVIEA--LIRRTLQHRLVEPKEASAAVAFLCFPAASFV  200
            VNAVAPW++RTSL +S   +   +  A  LI RT   R  EP E S+ VAFLC PAAS+V
Sbjct  245  VNAVAPWIIRTSLIDSIEKDPRVMEHASRLIPRTPIPRPGEPNEVSSVVAFLCLPAASYV  304

Query  199  TGQIISVDGGGSIYGL  152
            TGQ+  +DGG S+ G 
Sbjct  305  TGQVFCIDGGYSVNGF  320



>ref|XP_003558258.1| PREDICTED: tropinone reductase homolog At1g07440-like [Brachypodium 
distachyon]
Length=270

 Score =   283 bits (725),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 150/258 (58%), Positives = 191/258 (74%), Gaps = 5/258 (2%)
 Frame = -1

Query  919  AGRWSLHGMTALVTGGTRGLGHAIVEELACLGATVYTCSRTEKELEECIQNWKAKGYKVF  740
            A RWSLHG TALVTGGTRG+G A+VEELA LGA V+TCSR E EL E ++ W+AKG++V 
Sbjct  11   AARWSLHGKTALVTGGTRGIGRAVVEELAALGAAVHTCSRKESELRERLKEWEAKGFRVT  70

Query  739  GSVCDILQPSQRENLIQLVSKQFDGKLTILVNNVAILIPKETLKSDGQDFSNTIGTNLEA  560
            GSVCD+    QRE L++ V+ +F GKL ILVNNV     K T +    D+S  + TNLE+
Sbjct  71   GSVCDVSVRDQRELLLRDVAGRFAGKLDILVNNVGTNFTKPTTEYSADDYSFIMTTNLES  130

Query  559  SLNLCQLAHPLLKATGNGsivfisscssfVYAPFHTIYASTKGAINSLVKNLACEWANDN  380
            + +LCQLAHPLLKA+G+ SIVFISS S  V     +IYA TKGA+N L KNLAC+WA DN
Sbjct  131  AYHLCQLAHPLLKASGSASIVFISSVSGVVAISSGSIYAMTKGAMNQLAKNLACDWAKDN  190

Query  379  IRVNAVAPWLMRTSLTES--SRGEFGAVIEALIRRTLQHRLVEPKEASAAVAFLCFPAAS  206
            IR N+VAPW ++TSLTE   +R +F   +++++RRT   R+ EP+E S+ VAFLC PA+S
Sbjct  191  IRTNSVAPWYIKTSLTEENLAREDF---VDSIVRRTPMRRVGEPEEVSSLVAFLCMPASS  247

Query  205  FVTGQIISVDGGGSIYGL  152
            ++TGQ ISVDGG +I GL
Sbjct  248  YITGQTISVDGGMTINGL  265



>ref|XP_011035255.1| PREDICTED: tropinone reductase homolog At1g07440-like [Populus 
euphratica]
Length=266

 Score =   283 bits (723),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 151/254 (59%), Positives = 186/254 (73%), Gaps = 2/254 (1%)
 Frame = -1

Query  913  RWSLHGMTALVTGGTRGLGHAIVEELACLGATVYTCSRTEKELEECIQNWKAKGYKVFGS  734
            RW L GMTALVTGG++GLGHAIVEELA LGAT++TC+RTE  L EC+Q WK KG+KV GS
Sbjct  13   RWLLLGMTALVTGGSKGLGHAIVEELAGLGATIHTCARTESVLNECLQEWKMKGFKVTGS  72

Query  733  VCDILQPSQRENLIQLVSKQFDGKLTILVNNVAILIPKETLKSDGQDFSNTIGTNLEASL  554
            VCD+   ++RE L+  VS QFDGKL ILVNNV IL  + T+    +D S  + TN E++ 
Sbjct  73   VCDVTSRTEREKLMSTVSSQFDGKLNILVNNVGILYFQRTIDVTPEDISRYLSTNFESAY  132

Query  553  NLCQLAHPLLKATGNGsivfisscssfVYAPFHTIYASTKGAINSLVKNLACEWANDNIR  374
            +LCQLAHPLLK +G G+IVF+SS S  V     ++Y +TKGAIN L KNLACEWA DNIR
Sbjct  133  HLCQLAHPLLKNSGAGNIVFMSSVSGVVSV-SVSLYGATKGAINQLTKNLACEWAKDNIR  191

Query  373  VNAVAPWLMRTSLTESSRGEFGAVIEALIRRTLQHRLVEPKEASAAVAFLCFPAASFVTG  194
             N+VAPWL+RT L E    E    ++A+  RT   RL EPKE S+ VAFLC PAAS++TG
Sbjct  192  ANSVAPWLIRTPLVERDL-ENELFLKAVEARTPMGRLGEPKEVSSLVAFLCMPAASYITG  250

Query  193  QIISVDGGGSIYGL  152
            Q+I VDGG ++ GL
Sbjct  251  QVICVDGGFTVNGL  264



>ref|XP_010650985.1| PREDICTED: tropinone reductase homolog At1g07440-like isoform 
X3 [Vitis vinifera]
 ref|XP_010650988.1| PREDICTED: tropinone reductase homolog At1g07440-like isoform 
X6 [Vitis vinifera]
Length=270

 Score =   282 bits (721),  Expect = 5e-90, Method: Compositional matrix adjust.
 Identities = 146/256 (57%), Positives = 187/256 (73%), Gaps = 5/256 (2%)
 Frame = -1

Query  913  RWSLHGMTALVTGGTRGLGHAIVEELACLGATVYTCSRTEKELEECIQNWKAKGYKVFGS  734
            RWSL GMTALVTGGT+G+GHAIVEELA LGAT++TCSR E EL EC+++WKAKG+ V GS
Sbjct  13   RWSLKGMTALVTGGTKGIGHAIVEELAGLGATIHTCSRKETELNECLKDWKAKGFGVSGS  72

Query  733  VCDILQPSQRENLIQLVSKQFDGKLTILVNNVAILIPKETLKSDGQDFSNTIGTNLEASL  554
            VCD+  P+QRE L++ VS  F GKL ILVNN AI+I K T++   ++FS  +  N E+  
Sbjct  73   VCDVSSPAQREKLMETVSSVFKGKLNILVNNAAIVIQKPTVEVTAEEFSTIMAINFESVY  132

Query  553  NLCQLAHPLLKATGNGsivfisscssfVYAPFHTIYASTKGAINSLVKNLACEWANDNIR  374
            +L QLAHPLLKA+G GSIVFISS +  V   + + Y++TKGA+N L KNLACEWA DNIR
Sbjct  133  HLSQLAHPLLKASGAGSIVFISSVAGVVSLKYLSAYSATKGAMNQLTKNLACEWAEDNIR  192

Query  373  VNAVAPWLMRTSLTES--SRGEFGAVIEALIRRTLQHRLVEPKEASAAVAFLCFPAASFV  200
             NAVAPW ++T + +   S   F   +E +I R    R+ +PKE S+ VAFLC PA+S++
Sbjct  193  SNAVAPWYIKTPMVDQMLSNKTF---LEGVINRAPLRRVGDPKEVSSLVAFLCLPASSYI  249

Query  199  TGQIISVDGGGSIYGL  152
            TGQ I VDGG ++ G 
Sbjct  250  TGQTICVDGGVTVNGF  265



>ref|XP_006424908.1| hypothetical protein CICLE_v10029047mg [Citrus clementina]
 ref|XP_006488390.1| PREDICTED: tropinone reductase homolog At1g07440-like [Citrus 
sinensis]
 gb|ESR38148.1| hypothetical protein CICLE_v10029047mg [Citrus clementina]
 gb|KDO66644.1| hypothetical protein CISIN_1g024230mg [Citrus sinensis]
Length=270

 Score =   282 bits (721),  Expect = 6e-90, Method: Compositional matrix adjust.
 Identities = 145/254 (57%), Positives = 181/254 (71%), Gaps = 1/254 (0%)
 Frame = -1

Query  913  RWSLHGMTALVTGGTRGLGHAIVEELACLGATVYTCSRTEKELEECIQNWKAKGYKVFGS  734
            RWSL GMTALVTGGT+GLG A+VEEL+ LGATV+TCSRTE EL ECI + + KG KV GS
Sbjct  15   RWSLQGMTALVTGGTKGLGLAVVEELSMLGATVHTCSRTETELNECIHHLQMKGLKVTGS  74

Query  733  VCDILQPSQRENLIQLVSKQFDGKLTILVNNVAILIPKETLKSDGQDFSNTIGTNLEASL  554
            VCD+    QR+ LI  VS  F+GKL I VNNV   + K TL+ + +DFS  + TN E++ 
Sbjct  75   VCDVSSRPQRQTLINTVSSLFNGKLNIFVNNVGTSVLKPTLEYNAEDFSLVMSTNFESAF  134

Query  553  NLCQLAHPLLKATGNGsivfisscssfVYAPFHTIYASTKGAINSLVKNLACEWANDNIR  374
            +LCQLAHPLL+A+G  SIV +SS    V A   T+Y++TKGA+N L KNLACEWA DNIR
Sbjct  135  HLCQLAHPLLRASGAASIVLMSSALGIVSANVGTVYSATKGAMNQLAKNLACEWAKDNIR  194

Query  373  VNAVAPWLMRTSLTESSRGEFGAVIEALIRRTLQHRLVEPKEASAAVAFLCFPAASFVTG  194
             N+VAPW +RT  TE   G  G  ++ +  RT   RL EPKE S+ VAFLC PAAS++TG
Sbjct  195  TNSVAPWYIRTPFTEPLLGN-GKFVDEVKSRTPMGRLGEPKEVSSLVAFLCMPAASYITG  253

Query  193  QIISVDGGGSIYGL  152
            Q + +DGG ++ G 
Sbjct  254  QTVCIDGGFTVNGF  267



>emb|CBI30506.3| unnamed protein product [Vitis vinifera]
Length=267

 Score =   281 bits (719),  Expect = 9e-90, Method: Compositional matrix adjust.
 Identities = 145/256 (57%), Positives = 182/256 (71%), Gaps = 2/256 (1%)
 Frame = -1

Query  913  RWSLHGMTALVTGGTRGLGHAIVEELACLGATVYTCSRTEKELEECIQNWKAKGYKVFGS  734
            RWSL GMTALVTGG+RG+GHAIVEELA  GATV+TCSR ++EL++ +Q WK KG+KV  S
Sbjct  12   RWSLEGMTALVTGGSRGIGHAIVEELAAFGATVHTCSRNQEELDQRLQEWKNKGFKVSAS  71

Query  733  VCDILQPSQRENLIQLVSKQFDGKLTILVNNVAILIPKETLKSDGQDFSNTIGTNLEASL  554
            +CD+   SQR  L++ VS  FDGKL+ILVNN   +I KE  +   +DFS  +GTN E++ 
Sbjct  72   LCDVSSRSQRTQLMETVSSIFDGKLSILVNNAGTIILKEATECTAEDFSTIMGTNFESAY  131

Query  553  NLCQLAHPLLKATGNGsivfisscssfVYAPFHTIYASTKGAINSLVKNLACEWANDNIR  374
            +LCQL HPLLKA+GNGSIVFISS S  +  P  +IYA++KGA+N + KNLACEWA D IR
Sbjct  132  HLCQLGHPLLKASGNGSIVFISSISGLLAFPASSIYAASKGAMNQVTKNLACEWAKDGIR  191

Query  373  VNAVAPWLMRTSLTE--SSRGEFGAVIEALIRRTLQHRLVEPKEASAAVAFLCFPAASFV  200
            VN +APW+++TSL             +  LI RT   R  EP E S  VAFLCFP AS++
Sbjct  192  VNTIAPWIIKTSLLHVIDDHPNIKENMSRLISRTPISRPGEPDEVSPLVAFLCFPVASYI  251

Query  199  TGQIISVDGGGSIYGL  152
            TGQ+I VDGG  + G 
Sbjct  252  TGQVICVDGGYKVTGF  267



>ref|XP_006493568.1| PREDICTED: tropinone reductase homolog isoform X1 [Citrus sinensis]
Length=263

 Score =   281 bits (719),  Expect = 9e-90, Method: Compositional matrix adjust.
 Identities = 145/256 (57%), Positives = 186/256 (73%), Gaps = 2/256 (1%)
 Frame = -1

Query  913  RWSLHGMTALVTGGTRGLGHAIVEELACLGATVYTCSRTEKELEECIQNWKAKGYKVFGS  734
            RWSL GMTALVTGGT+G+G+A+VEELA  GA V+TCSR E EL + IQ WK+KG +V G+
Sbjct  8    RWSLKGMTALVTGGTKGIGYAVVEELAAFGAIVHTCSRNETELNQRIQEWKSKGLQVSGN  67

Query  733  VCDILQPSQRENLIQLVSKQFDGKLTILVNNVAILIPKETLKSDGQDFSNTIGTNLEASL  554
             CD+   +QRE L++ VS QFDGKL IL+NN    IPKET +   +DFS  + TN E++ 
Sbjct  68   ACDVKIRAQREKLMETVSSQFDGKLNILINNAGTFIPKETTEFTEEDFSTVMTTNFESAY  127

Query  553  NLCQLAHPLLKATGNGsivfisscssfVYAPFHTIYASTKGAINSLVKNLACEWANDNIR  374
            ++ QLAHPLLK++GNG+I+FISS +  +  P  +I AS+KGA+N L KNLACEWA D IR
Sbjct  128  HVSQLAHPLLKSSGNGNIIFISSVAGVIAIPMCSIAASSKGAMNQLTKNLACEWAKDKIR  187

Query  373  VNAVAPWLMRTSLTESSRGEFGAVIEA--LIRRTLQHRLVEPKEASAAVAFLCFPAASFV  200
            VN+VAPW++RT L +    +   + +A  +I RT   R  EP E S+ VAFLCFPAAS+V
Sbjct  188  VNSVAPWIIRTPLIDKVLKDSTFLEQANRMILRTPIPRPGEPTEVSSVVAFLCFPAASYV  247

Query  199  TGQIISVDGGGSIYGL  152
            TGQ+I VDGG SI G 
Sbjct  248  TGQVICVDGGYSITGF  263



>gb|KEH34737.1| NAD(P)-binding rossmann-fold protein [Medicago truncatula]
Length=269

 Score =   281 bits (718),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 145/264 (55%), Positives = 187/264 (71%), Gaps = 5/264 (2%)
 Frame = -1

Query  937  QQHNIMAGRWSLHGMTALVTGGTRGLGHAIVEELACLGATVYTCSRTEKELEECIQNWKA  758
            Q+ ++   RWSL G TALVTGGTRG+GHA+VEELA  GATV+TCSR E+EL +C+  WK 
Sbjct  4    QESSMRGSRWSLKGTTALVTGGTRGIGHAVVEELAEFGATVFTCSRNEEELNKCLNEWKE  63

Query  757  KGYKVFGSVCDILQPSQRENLIQLVSKQFDGKLTILVNNVAILIPKETLKSDGQDFSNTI  578
            KG+ V+GSVCD   PSQRE LI+ V+  F+GKL ILVNN    + K T++   +D+S  +
Sbjct  64   KGFSVYGSVCDASSPSQREELIRQVASAFNGKLNILVNNAGTNVRKPTIEYTAEDYSKVM  123

Query  577  GTNLEASLNLCQLAHPLLKATGNGsivfisscssfVYAPFHTIYASTKGAINSLVKNLAC  398
             TNL+++ +LCQLA+PLLK +GNGSIVFISS +S +     +IYA +K AIN L KNLAC
Sbjct  124  TTNLDSAYHLCQLAYPLLKESGNGSIVFISSVASLISVGTGSIYAVSKAAINQLTKNLAC  183

Query  397  EWANDNIRVNAVAPWLMRTSLTES--SRGEFGAVIEALIRRTLQHRLVEPKEASAAVAFL  224
            EWA DNIR N VAPW  +TSL E   +  EF   ++ ++ RT   R+ E  E SA V FL
Sbjct  184  EWAKDNIRSNCVAPWYTKTSLVEQFIANKEF---VDEVLSRTPIKRIAETHEVSALVTFL  240

Query  223  CFPAASFVTGQIISVDGGGSIYGL  152
            C PAAS++TGQ +SVDGG ++ G 
Sbjct  241  CLPAASYITGQTVSVDGGFTVNGF  264



>ref|XP_002271837.2| PREDICTED: tropinone reductase homolog [Vitis vinifera]
Length=291

 Score =   281 bits (720),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 145/256 (57%), Positives = 182/256 (71%), Gaps = 2/256 (1%)
 Frame = -1

Query  913  RWSLHGMTALVTGGTRGLGHAIVEELACLGATVYTCSRTEKELEECIQNWKAKGYKVFGS  734
            RWSL GMTALVTGG+RG+GHAIVEELA  GATV+TCSR ++EL++ +Q WK KG+KV  S
Sbjct  36   RWSLEGMTALVTGGSRGIGHAIVEELAAFGATVHTCSRNQEELDQRLQEWKNKGFKVSAS  95

Query  733  VCDILQPSQRENLIQLVSKQFDGKLTILVNNVAILIPKETLKSDGQDFSNTIGTNLEASL  554
            +CD+   SQR  L++ VS  FDGKL+ILVNN   +I KE  +   +DFS  +GTN E++ 
Sbjct  96   LCDVSSRSQRTQLMETVSSIFDGKLSILVNNAGTIILKEATECTAEDFSTIMGTNFESAY  155

Query  553  NLCQLAHPLLKATGNGsivfisscssfVYAPFHTIYASTKGAINSLVKNLACEWANDNIR  374
            +LCQL HPLLKA+GNGSIVFISS S  +  P  +IYA++KGA+N + KNLACEWA D IR
Sbjct  156  HLCQLGHPLLKASGNGSIVFISSISGLLAFPASSIYAASKGAMNQVTKNLACEWAKDGIR  215

Query  373  VNAVAPWLMRTSLTE--SSRGEFGAVIEALIRRTLQHRLVEPKEASAAVAFLCFPAASFV  200
            VN +APW+++TSL             +  LI RT   R  EP E S  VAFLCFP AS++
Sbjct  216  VNTIAPWIIKTSLLHVIDDHPNIKENMSRLISRTPISRPGEPDEVSPLVAFLCFPVASYI  275

Query  199  TGQIISVDGGGSIYGL  152
            TGQ+I VDGG  + G 
Sbjct  276  TGQVICVDGGYKVTGF  291



>ref|XP_006493567.1| PREDICTED: tropinone reductase homolog [Citrus sinensis]
Length=263

 Score =   280 bits (717),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 148/256 (58%), Positives = 186/256 (73%), Gaps = 2/256 (1%)
 Frame = -1

Query  913  RWSLHGMTALVTGGTRGLGHAIVEELACLGATVYTCSRTEKELEECIQNWKAKGYKVFGS  734
            RWSL  MTALVTGGT+G+G+AIV+ELA  GA V+TCSR E EL + +Q WK+ G KV GS
Sbjct  8    RWSLKDMTALVTGGTKGIGYAIVKELAAFGAIVHTCSRNEAELNQRVQEWKSMGLKVSGS  67

Query  733  VCDILQPSQRENLIQLVSKQFDGKLTILVNNVAILIPKETLKSDGQDFSNTIGTNLEASL  554
            VCD+   +Q+E L++ VS  FDGKL ILVNN  I IPKE  +   +DFS  I TN E++ 
Sbjct  68   VCDLKVRAQQEKLMETVSSLFDGKLNILVNNAGISIPKEATEFTMEDFSTIITTNFESAY  127

Query  553  NLCQLAHPLLKATGNGsivfisscssfVYAPFHTIYASTKGAINSLVKNLACEWANDNIR  374
            +L Q+AHPLLKA+GNG+I+FISS +  +  P  +IYAS+KGA+N L KNLACEWA D IR
Sbjct  128  HLSQIAHPLLKASGNGNIIFISSVAGVIALPMCSIYASSKGAMNELTKNLACEWAKDKIR  187

Query  373  VNAVAPWLMRTSLTESSRGEFGAVIEA--LIRRTLQHRLVEPKEASAAVAFLCFPAASFV  200
            VN+VAPW++RT L ++   +   + +A  LI RT   R  EP E S+ VAFLCFPAAS+V
Sbjct  188  VNSVAPWMIRTPLLDNFEKDSTFLEQANRLILRTPIPRPREPNEVSSVVAFLCFPAASYV  247

Query  199  TGQIISVDGGGSIYGL  152
            TGQ+I VDGG SI G 
Sbjct  248  TGQVICVDGGYSITGF  263



>ref|XP_010654243.1| PREDICTED: tropinone reductase homolog [Vitis vinifera]
Length=269

 Score =   281 bits (718),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 145/256 (57%), Positives = 186/256 (73%), Gaps = 2/256 (1%)
 Frame = -1

Query  913  RWSLHGMTALVTGGTRGLGHAIVEELACLGATVYTCSRTEKELEECIQNWKAKGYKVFGS  734
            RWSL G TALVTGGTRG+GHAIVEELA  GATV+TCSR +KEL+E +Q WK+KG+KV GS
Sbjct  14   RWSLQGTTALVTGGTRGIGHAIVEELAAFGATVHTCSRNQKELDEMLQVWKSKGFKVSGS  73

Query  733  VCDILQPSQRENLIQLVSKQFDGKLTILVNNVAILIPKETLKSDGQDFSNTIGTNLEASL  554
            VCD+    QR  L+  VS  FDGKL ILVNN   +I K T +   +D S  +GTN E++ 
Sbjct  74   VCDVSSRPQRTQLMDTVSSLFDGKLNILVNNAGTVISKRTEEYTVEDVSIIMGTNFESAY  133

Query  553  NLCQLAHPLLKATGNGsivfisscssfVYAPFHTIYASTKGAINSLVKNLACEWANDNIR  374
            +L QL +PLLKA+G GSIVFISS +  +  P  +IYA++KGA+N + +NLACEWA DNIR
Sbjct  134  HLSQLGYPLLKASGRGSIVFISSVAGVMALPVISIYAASKGAMNQVTRNLACEWAEDNIR  193

Query  373  VNAVAPWLMRTSLTESSRGEFGA--VIEALIRRTLQHRLVEPKEASAAVAFLCFPAASFV  200
            VN +APW++ TSL   ++ +  +   I+ +I RT   R+ EP E S+ VAFLCFPAAS++
Sbjct  194  VNTIAPWVINTSLIHKAKDDPSSEEKIKRIISRTPICRMGEPDEVSSLVAFLCFPAASYI  253

Query  199  TGQIISVDGGGSIYGL  152
            TGQ+I VDGG S+ G 
Sbjct  254  TGQVICVDGGYSVTGF  269



>ref|XP_008223763.1| PREDICTED: tropinone reductase homolog At1g07440-like [Prunus 
mume]
Length=270

 Score =   280 bits (717),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 150/257 (58%), Positives = 188/257 (73%), Gaps = 6/257 (2%)
 Frame = -1

Query  913  RWSLHGMTALVTGGTRGLGHAIVEELACLGATVYTCSRTEKELEECIQNWKAKGY-KVFG  737
            RWSLHGMTALVTGGT+G+G+AIVEELA LGATV+TCSR E +L +C+  WK KG+ +V G
Sbjct  12   RWSLHGMTALVTGGTKGIGYAIVEELAGLGATVHTCSRNEVQLNDCLSQWKIKGFDQVTG  71

Query  736  SVCDILQPSQRENLIQLVSKQFDGKLTILVNNVAILIPKETLKSDGQDFSNTIGTNLEAS  557
            SVCD++  +QRE LI  VS  F GKL IL+NNV     K  ++S  +D+S  + TNLE++
Sbjct  72   SVCDVVSKAQREELINKVSSLFHGKLNILINNVGTFKIKPAIESTTEDYSFIMSTNLESA  131

Query  556  LNLCQLAHPLLKATGNGsivfisscssfVYAPFHTIYASTKGAINSLVKNLACEWANDNI  377
             +  QLAHPLLKA+G G+I+F+SS +  V     TIYA+TKGA+N L KNLACEWA DNI
Sbjct  132  YHFSQLAHPLLKASGAGNIIFMSSVAGVVSVGTATIYAATKGAMNQLAKNLACEWAKDNI  191

Query  376  RVNAVAPWLMRTSLTES--SRGEFGAVIEALIRRTLQHRLVEPKEASAAVAFLCFPAASF  203
            R N+VAPW +RT LTE   S  +F   +EA+  R    R+ EPKE SA VAFLCFPAAS+
Sbjct  192  RTNSVAPWFIRTPLTEPLLSDQKF---MEAINSRCPLGRIGEPKEVSALVAFLCFPAASY  248

Query  202  VTGQIISVDGGGSIYGL  152
            +TGQ I VDGG ++ GL
Sbjct  249  ITGQTICVDGGFTVNGL  265



>ref|XP_006493570.1| PREDICTED: tropinone reductase homolog [Citrus sinensis]
Length=263

 Score =   280 bits (716),  Expect = 3e-89, Method: Compositional matrix adjust.
 Identities = 144/256 (56%), Positives = 183/256 (71%), Gaps = 2/256 (1%)
 Frame = -1

Query  913  RWSLHGMTALVTGGTRGLGHAIVEELACLGATVYTCSRTEKELEECIQNWKAKGYKVFGS  734
            RWSL GMTALVTGGT+G+G+A+VEELA  GA V+TCSR E EL + IQ WK+KG +V GS
Sbjct  8    RWSLKGMTALVTGGTKGIGYAVVEELAAFGAIVHTCSRNETELNQRIQEWKSKGLQVSGS  67

Query  733  VCDILQPSQRENLIQLVSKQFDGKLTILVNNVAILIPKETLKSDGQDFSNTIGTNLEASL  554
            VCD+   +QRE L++ VS QFDGKL IL+NN    IPKET +   +DFS  + TN E++ 
Sbjct  68   VCDLKIRAQREKLMETVSSQFDGKLNILINNAGTFIPKETTEFTEEDFSTVMTTNFESAY  127

Query  553  NLCQLAHPLLKATGNGsivfisscssfVYAPFHTIYASTKGAINSLVKNLACEWANDNIR  374
            +L QLAHPLLK+ GNG+I+FISS +  +  P  +IYAS+KGA+N L KNLACEWA D IR
Sbjct  128  HLSQLAHPLLKSAGNGNIIFISSVAGVIAIPMCSIYASSKGAMNQLTKNLACEWAKDKIR  187

Query  373  VNAVAPWLMRTSLTESSRGEFGAVIEA--LIRRTLQHRLVEPKEASAAVAFLCFPAASFV  200
            VN VAPW++RT L ++   +   +  A  ++ RT   R  EP E S+ VAFLC  A S+V
Sbjct  188  VNTVAPWVIRTPLLDTVEKDSNFLEHANRMVLRTPMLRPGEPNEVSSVVAFLCLSATSYV  247

Query  199  TGQIISVDGGGSIYGL  152
            TGQ+I VDGG S+ G 
Sbjct  248  TGQVICVDGGYSVTGF  263



>emb|CBI30508.3| unnamed protein product [Vitis vinifera]
Length=277

 Score =   280 bits (717),  Expect = 3e-89, Method: Compositional matrix adjust.
 Identities = 145/256 (57%), Positives = 186/256 (73%), Gaps = 2/256 (1%)
 Frame = -1

Query  913  RWSLHGMTALVTGGTRGLGHAIVEELACLGATVYTCSRTEKELEECIQNWKAKGYKVFGS  734
            RWSL G TALVTGGTRG+GHAIVEELA  GATV+TCSR +KEL+E +Q WK+KG+KV GS
Sbjct  7    RWSLQGTTALVTGGTRGIGHAIVEELAAFGATVHTCSRNQKELDEMLQVWKSKGFKVSGS  66

Query  733  VCDILQPSQRENLIQLVSKQFDGKLTILVNNVAILIPKETLKSDGQDFSNTIGTNLEASL  554
            VCD+    QR  L+  VS  FDGKL ILVNN   +I K T +   +D S  +GTN E++ 
Sbjct  67   VCDVSSRPQRTQLMDTVSSLFDGKLNILVNNAGTVISKRTEEYTVEDVSIIMGTNFESAY  126

Query  553  NLCQLAHPLLKATGNGsivfisscssfVYAPFHTIYASTKGAINSLVKNLACEWANDNIR  374
            +L QL +PLLKA+G GSIVFISS +  +  P  +IYA++KGA+N + +NLACEWA DNIR
Sbjct  127  HLSQLGYPLLKASGRGSIVFISSVAGVMALPVISIYAASKGAMNQVTRNLACEWAEDNIR  186

Query  373  VNAVAPWLMRTSLTESSRGEFGA--VIEALIRRTLQHRLVEPKEASAAVAFLCFPAASFV  200
            VN +APW++ TSL   ++ +  +   I+ +I RT   R+ EP E S+ VAFLCFPAAS++
Sbjct  187  VNTIAPWVINTSLIHKAKDDPSSEEKIKRIISRTPICRMGEPDEVSSLVAFLCFPAASYI  246

Query  199  TGQIISVDGGGSIYGL  152
            TGQ+I VDGG S+ G 
Sbjct  247  TGQVICVDGGYSVTGF  262



>ref|XP_006429157.1| hypothetical protein CICLE_v10012496mg [Citrus clementina]
 gb|ESR42397.1| hypothetical protein CICLE_v10012496mg [Citrus clementina]
Length=263

 Score =   280 bits (715),  Expect = 4e-89, Method: Compositional matrix adjust.
 Identities = 145/256 (57%), Positives = 183/256 (71%), Gaps = 2/256 (1%)
 Frame = -1

Query  913  RWSLHGMTALVTGGTRGLGHAIVEELACLGATVYTCSRTEKELEECIQNWKAKGYKVFGS  734
            RWSL GMTALVTGGT+G+G+A+VEELA  GA V+TCSR E EL + IQ WK+KG +V GS
Sbjct  8    RWSLKGMTALVTGGTKGIGYAVVEELAAFGAIVHTCSRNETELNQRIQEWKSKGLQVSGS  67

Query  733  VCDILQPSQRENLIQLVSKQFDGKLTILVNNVAILIPKETLKSDGQDFSNTIGTNLEASL  554
            VCD+   +QRE L+  VS QFDGKL IL+NN    IPKET +   +DFS  + TN E++ 
Sbjct  68   VCDLKIRAQREKLMLTVSSQFDGKLNILINNAGTFIPKETTEFTEEDFSTVMTTNFESAY  127

Query  553  NLCQLAHPLLKATGNGsivfisscssfVYAPFHTIYASTKGAINSLVKNLACEWANDNIR  374
            +L QLAHPLLK+ GNG+I+FISS +  +  P  +IYAS+KGA+N L KNLACEWA D IR
Sbjct  128  HLSQLAHPLLKSAGNGNIIFISSVAGVIAIPMCSIYASSKGAMNQLTKNLACEWAKDKIR  187

Query  373  VNAVAPWLMRTSLTESSRGEFGAVIEA--LIRRTLQHRLVEPKEASAAVAFLCFPAASFV  200
            VN VAPW++RT L ++   +   +  A  ++ RT   R  EP E S+ VAFLC  AAS+V
Sbjct  188  VNTVAPWVIRTPLLDTVEKDSNFLEHANRMVLRTPMLRPGEPNEVSSVVAFLCLSAASYV  247

Query  199  TGQIISVDGGGSIYGL  152
            TGQ+I VDGG S+ G 
Sbjct  248  TGQVICVDGGYSVTGF  263



>ref|XP_003632186.1| PREDICTED: tropinone reductase homolog At1g07440 [Vitis vinifera]
 emb|CBI16071.3| unnamed protein product [Vitis vinifera]
Length=270

 Score =   279 bits (714),  Expect = 6e-89, Method: Compositional matrix adjust.
 Identities = 146/254 (57%), Positives = 185/254 (73%), Gaps = 1/254 (0%)
 Frame = -1

Query  913  RWSLHGMTALVTGGTRGLGHAIVEELACLGATVYTCSRTEKELEECIQNWKAKGYKVFGS  734
            RWSL GMTALVTGGT+G+GHAIVEELA LGAT++TCSR E EL EC+++WKAKG+ V GS
Sbjct  13   RWSLKGMTALVTGGTKGIGHAIVEELAGLGATIHTCSRKETELNECLKDWKAKGFGVSGS  72

Query  733  VCDILQPSQRENLIQLVSKQFDGKLTILVNNVAILIPKETLKSDGQDFSNTIGTNLEASL  554
            VCD+   +QRE L+Q +S  F+GKL IL+NN AI I K T++   ++FS  + TN E+  
Sbjct  73   VCDVSSRAQREKLMQTISSVFNGKLNILINNAAISIQKPTIEVTAEEFSTIMATNFESVY  132

Query  553  NLCQLAHPLLKATGNGsivfisscssfVYAPFHTIYASTKGAINSLVKNLACEWANDNIR  374
            +L Q+AHPLLKA+G GSIVFISS S  V     + Y+ TKGA+N L KNLACEWA DNIR
Sbjct  133  HLSQIAHPLLKASGAGSIVFISSVSGIVAHKNISAYSVTKGAMNQLTKNLACEWAKDNIR  192

Query  373  VNAVAPWLMRTSLTESSRGEFGAVIEALIRRTLQHRLVEPKEASAAVAFLCFPAASFVTG  194
             NAVAPW ++T + E       A +E +I R    R+ +PKE S+ VAFLC PA+S++TG
Sbjct  193  SNAVAPWYIKTPMVEQMLTN-QAFLEEVINRAPLRRVGDPKEVSSLVAFLCLPASSYITG  251

Query  193  QIISVDGGGSIYGL  152
            QII VDGG ++ G 
Sbjct  252  QIICVDGGMTVNGF  265



>ref|XP_010256814.1| PREDICTED: tropinone reductase homolog At1g07440-like isoform 
X1 [Nelumbo nucifera]
Length=269

 Score =   279 bits (714),  Expect = 7e-89, Method: Compositional matrix adjust.
 Identities = 149/256 (58%), Positives = 184/256 (72%), Gaps = 5/256 (2%)
 Frame = -1

Query  913  RWSLHGMTALVTGGTRGLGHAIVEELACLGATVYTCSRTEKELEECIQNWKAKGYKVFGS  734
            RW L GMTALVTGGTRG+GHAIVEELA LGATV+TCSR E EL  C+++W +KG++V GS
Sbjct  12   RWYLKGMTALVTGGTRGIGHAIVEELAGLGATVHTCSRKEDELNGCLRDWASKGFRVSGS  71

Query  733  VCDILQPSQRENLIQLVSKQFDGKLTILVNNVAILIPKETLKSDGQDFSNTIGTNLEASL  554
            VCD+    QRE LI+ VS  F GKL IL+NN    I K T++   ++FS  I TNLE++ 
Sbjct  72   VCDVSSRPQREKLIETVSSVFSGKLNILINNAGTNIRKPTIEYTAEEFSTLIATNLESAY  131

Query  553  NLCQLAHPLLKATGNGsivfisscssfVYAPFHTIYASTKGAINSLVKNLACEWANDNIR  374
            +LCQLA+PLLK +G GSIVFISS +  V     T+Y ++KGAIN L KNLACEWA DNIR
Sbjct  132  HLCQLAYPLLKLSGVGSIVFISSVAGVVALGSGTVYGASKGAINQLTKNLACEWAKDNIR  191

Query  373  VNAVAPWLMRTSLTES--SRGEFGAVIEALIRRTLQHRLVEPKEASAAVAFLCFPAASFV  200
             N VAPW +RTSL E      EF   ++ +I RT   R  EPKE S+ VAFLC PA+S++
Sbjct  192  TNCVAPWYIRTSLVEHLLDNKEF---LDTVIARTPLRRPGEPKEVSSLVAFLCLPASSYI  248

Query  199  TGQIISVDGGGSIYGL  152
            TGQ+ISVDGG ++ G 
Sbjct  249  TGQVISVDGGMTVNGF  264



>ref|XP_006429160.1| hypothetical protein CICLE_v10012493mg [Citrus clementina]
 gb|ESR42400.1| hypothetical protein CICLE_v10012493mg [Citrus clementina]
Length=263

 Score =   278 bits (712),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 144/256 (56%), Positives = 185/256 (72%), Gaps = 2/256 (1%)
 Frame = -1

Query  913  RWSLHGMTALVTGGTRGLGHAIVEELACLGATVYTCSRTEKELEECIQNWKAKGYKVFGS  734
            RWSL GMTALVTGGT+G+G+A+VEELA  GA V+TCSR E EL + IQ WK+KG +V G+
Sbjct  8    RWSLKGMTALVTGGTKGIGYAVVEELAAFGAIVHTCSRNETELNQRIQEWKSKGLQVSGN  67

Query  733  VCDILQPSQRENLIQLVSKQFDGKLTILVNNVAILIPKETLKSDGQDFSNTIGTNLEASL  554
             CD+   +QRE L++ VS QFDG L IL+NN    IPKET +   +DFS  + TN E++ 
Sbjct  68   ACDLKIRAQREKLMETVSSQFDGMLNILINNAGTFIPKETTEFTEEDFSTVMTTNFESAY  127

Query  553  NLCQLAHPLLKATGNGsivfisscssfVYAPFHTIYASTKGAINSLVKNLACEWANDNIR  374
            ++ QLAHPLLK++GNG+I+FISS +  +  P  +I AS+KGA+N L KNLACEWA D IR
Sbjct  128  HVSQLAHPLLKSSGNGNIIFISSVAGVIAIPMCSIAASSKGAMNQLTKNLACEWAKDKIR  187

Query  373  VNAVAPWLMRTSLTESSRGEFGAVIEA--LIRRTLQHRLVEPKEASAAVAFLCFPAASFV  200
            VN+VAPW++RT L +    +   + +A  +I RT   R  EP E S+ VAFLCFPAAS+V
Sbjct  188  VNSVAPWIIRTPLIDKVLKDSTFLEQANRMILRTPIPRPGEPTEVSSVVAFLCFPAASYV  247

Query  199  TGQIISVDGGGSIYGL  152
            TGQ+I VDGG SI G 
Sbjct  248  TGQVICVDGGYSITGF  263



>ref|XP_010650989.1| PREDICTED: tropinone reductase homolog At1g07440 isoform X1 [Vitis 
vinifera]
 emb|CBI16066.3| unnamed protein product [Vitis vinifera]
Length=270

 Score =   278 bits (712),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 146/256 (57%), Positives = 185/256 (72%), Gaps = 5/256 (2%)
 Frame = -1

Query  913  RWSLHGMTALVTGGTRGLGHAIVEELACLGATVYTCSRTEKELEECIQNWKAKGYKVFGS  734
            RWSL GMTALVTGGT+G+GHAIVEELA LGAT++TCSR E EL EC+++WKAKG+ V GS
Sbjct  13   RWSLKGMTALVTGGTKGIGHAIVEELAGLGATIHTCSRKETELNECLKDWKAKGFGVSGS  72

Query  733  VCDILQPSQRENLIQLVSKQFDGKLTILVNNVAILIPKETLKSDGQDFSNTIGTNLEASL  554
            VCD+   +QRE L++ VS  F GKL ILVNN AI+I K T++   ++FS  +  N E+  
Sbjct  73   VCDVSSRAQREKLMETVSSVFKGKLNILVNNAAIVIQKPTVEVTAEEFSTIMAINFESVY  132

Query  553  NLCQLAHPLLKATGNGsivfisscssfVYAPFHTIYASTKGAINSLVKNLACEWANDNIR  374
            +L QLAHPLLKA+G GSIVFISS +  V   + + YA TKGA+N L KNLACEWA DNIR
Sbjct  133  HLSQLAHPLLKASGAGSIVFISSVAGVVSVKYLSAYAVTKGAMNQLTKNLACEWAEDNIR  192

Query  373  VNAVAPWLMRTSLTES--SRGEFGAVIEALIRRTLQHRLVEPKEASAAVAFLCFPAASFV  200
             NAVAPW ++T + +   S   F   +E +I R    R+ +PKE S+ VAFLC PA+S++
Sbjct  193  SNAVAPWCIKTPMVDQMLSNKTF---LEGVINRAPLRRVGDPKEVSSLVAFLCLPASSYI  249

Query  199  TGQIISVDGGGSIYGL  152
            TGQ I VDGG ++ G 
Sbjct  250  TGQTICVDGGVTVNGF  265



>ref|XP_007016318.1| Senescence-associated gene 13 isoform 1 [Theobroma cacao]
 gb|EOY33937.1| Senescence-associated gene 13 isoform 1 [Theobroma cacao]
Length=283

 Score =   279 bits (713),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 145/267 (54%), Positives = 189/267 (71%), Gaps = 7/267 (3%)
 Frame = -1

Query  961  KLAKNAKYQQHNIMAGRWSLHGMTALVTGGTRGLGHAIVEELACLGATVYTCSRTEKELE  782
            ++A++   ++ N    RWSL GMTALVTGGT+G+GHAI+EELA L A ++TCSRTE +L 
Sbjct  4    RMAQSDNSRKDN----RWSLQGMTALVTGGTKGIGHAIIEELAGLRARIHTCSRTETDLN  59

Query  781  ECIQNWKAKGYKVFGSVCDILQPSQRENLIQLVSKQFDGKLTILVNNVAILIPKETLKSD  602
            +C+ +W AKG++V GSVCD+   +QRE LI  VS +F GKL IL+NNV   I K T    
Sbjct  60   KCLLDWAAKGFQVTGSVCDVSSQAQREKLINTVSSEFGGKLNILINNVGTAILKPTPDIT  119

Query  601  GQDFSNTIGTNLEASLNLCQLAHPLLKATGNGsivfisscssfVYAPFHTIYASTKGAIN  422
             +DFS  +GTN E++ NLCQLA+PLLKA+G GSIVF+SS +  V   F ++Y  TKGA+N
Sbjct  120  TEDFSFMMGTNFESAYNLCQLAYPLLKASGAGSIVFLSSIAGVVSVSFGSLYGVTKGAMN  179

Query  421  SLVKNLACEWANDNIRVNAVAPWLMRTSLTESSRGEFGAVIEALIRRTLQHRLVEPKEAS  242
             L K LACEWA DNIRVN+VAPW +RT LTE    +F    E +I RT   R+ EP+E S
Sbjct  180  HLAKYLACEWAKDNIRVNSVAPWFIRTPLTEDYIQKFS---ENIISRTPMGRIGEPEEVS  236

Query  241  AAVAFLCFPAASFVTGQIISVDGGGSI  161
            + V FLC PA+S++TGQ   +DGG S+
Sbjct  237  SLVGFLCLPASSYITGQTFCIDGGMSV  263



>ref|NP_001049677.1| Os03g0269100 [Oryza sativa Japonica Group]
 gb|ABF95192.1| Tropinone reductase, putative, expressed [Oryza sativa Japonica 
Group]
 dbj|BAF11591.1| Os03g0269100 [Oryza sativa Japonica Group]
 dbj|BAG86765.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEE58768.1| hypothetical protein OsJ_10279 [Oryza sativa Japonica Group]
Length=269

 Score =   278 bits (711),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 145/258 (56%), Positives = 189/258 (73%), Gaps = 5/258 (2%)
 Frame = -1

Query  919  AGRWSLHGMTALVTGGTRGLGHAIVEELACLGATVYTCSRTEKELEECIQNWKAKGYKVF  740
            AGRW+L G TALVTGGTRG+GHA+V+ELA LGA V+TCSR E EL E ++ W+ KG++V 
Sbjct  10   AGRWTLRGKTALVTGGTRGIGHAVVDELAALGAAVHTCSRKEAELGERLREWEGKGFRVT  69

Query  739  GSVCDILQPSQRENLIQLVSKQFDGKLTILVNNVAILIPKETLKSDGQDFSNTIGTNLEA  560
            GSVCD+    QRE +++ V+  + GKL ILVNNV     K+T +    D+S  + TNLE+
Sbjct  70   GSVCDVSVREQRERMLREVAGLYGGKLDILVNNVGTNFSKQTTEYSADDYSFIMATNLES  129

Query  559  SLNLCQLAHPLLKATGNGsivfisscssfVYAPFHTIYASTKGAINSLVKNLACEWANDN  380
            + +LCQLAHPLLK++G+GS+VFISS S  V     ++YA TKGA+N L KNLACEWA DN
Sbjct  130  AYHLCQLAHPLLKSSGSGSVVFISSVSGVVAVSSGSVYAMTKGAMNQLAKNLACEWAKDN  189

Query  379  IRVNAVAPWLMRTSLTES--SRGEFGAVIEALIRRTLQHRLVEPKEASAAVAFLCFPAAS  206
            IR N+VAPW M+TSL E   +R +F    ++++RRT   R+ EP+E S+ VAFLC P AS
Sbjct  190  IRTNSVAPWYMKTSLVEDELARKDFA---DSVVRRTALKRVGEPEEVSSLVAFLCMPGAS  246

Query  205  FVTGQIISVDGGGSIYGL  152
            ++TGQ ISVDGG +I GL
Sbjct  247  YITGQTISVDGGMTINGL  264



>ref|XP_006846355.1| hypothetical protein AMTR_s00012p00260970 [Amborella trichopoda]
 gb|ERN08030.1| hypothetical protein AMTR_s00012p00260970 [Amborella trichopoda]
Length=268

 Score =   278 bits (710),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 143/250 (57%), Positives = 184/250 (74%), Gaps = 1/250 (0%)
 Frame = -1

Query  904  LHGMTALVTGGTRGLGHAIVEELACLGATVYTCSRTEKELEECIQNWKAKGYKVFGSVCD  725
            LHGM+ALVTGGT+G+G+AIVEELA LGA++YTC+RTE +L +C+  WK +G+ V GSVCD
Sbjct  17   LHGMSALVTGGTKGIGYAIVEELAGLGASIYTCARTEVDLNKCLNEWKGQGFSVHGSVCD  76

Query  724  ILQPSQRENLIQLVSKQFDGKLTILVNNVAILIPKETLKSDGQDFSNTIGTNLEASLNLC  545
            +     RENLI+ VS  F+GKL ILVNNV   IPK+T+    +DFS  + TNLE++ ++C
Sbjct  77   LSSRPHRENLIEAVSAHFNGKLNILVNNVGTNIPKQTVDYTAEDFSFLVSTNLESAFHMC  136

Query  544  QLAHPLLKATGNGsivfisscssfVYAPFHTIYASTKGAINSLVKNLACEWANDNIRVNA  365
            QL+HPLLKA+G GSIVFISS +  V     +IY +TKGAIN L KNLACEWA DNIR N+
Sbjct  137  QLSHPLLKASGAGSIVFISSVAGVVALQVGSIYGATKGAINQLTKNLACEWAKDNIRTNS  196

Query  364  VAPWLMRTSLTESSRGEFGAVIEALIRRTLQHRLVEPKEASAAVAFLCFPAASFVTGQII  185
            V PW +RT L E   G      + ++ RT   R+ EP+E S+ VA+LC PAAS++TGQ+I
Sbjct  197  VTPWFIRTPLAELILGN-EEHYKQIVARTPLKRVGEPEEVSSLVAYLCLPAASYITGQVI  255

Query  184  SVDGGGSIYG  155
            SVDGG S+ G
Sbjct  256  SVDGGVSVNG  265



>ref|XP_010650991.1| PREDICTED: tropinone reductase homolog At1g07440-like isoform 
X1 [Vitis vinifera]
 emb|CBI16061.3| unnamed protein product [Vitis vinifera]
Length=270

 Score =   277 bits (709),  Expect = 4e-88, Method: Compositional matrix adjust.
 Identities = 145/257 (56%), Positives = 185/257 (72%), Gaps = 5/257 (2%)
 Frame = -1

Query  916  GRWSLHGMTALVTGGTRGLGHAIVEELACLGATVYTCSRTEKELEECIQNWKAKGYKVFG  737
            GRWSL GMTALVTGGT+G+GHAIVEELA LGAT++TCSR E EL EC+++WKAKG+ V G
Sbjct  12   GRWSLKGMTALVTGGTKGIGHAIVEELAGLGATIHTCSRKETELNECLKDWKAKGFGVSG  71

Query  736  SVCDILQPSQRENLIQLVSKQFDGKLTILVNNVAILIPKETLKSDGQDFSNTIGTNLEAS  557
            SVCD+   +QRE L+Q +S  F+GKL IL+NN AI I K T++   ++FS  +  N E+ 
Sbjct  72   SVCDVSSRAQREKLMQTISSVFNGKLNILINNAAITIQKPTVEVTAEEFSTIMAINFESV  131

Query  556  LNLCQLAHPLLKATGNGsivfisscssfVYAPFHTIYASTKGAINSLVKNLACEWANDNI  377
             +L Q+AHPLLKA+G GSIVFISS    V     + Y+ TKGA+N L KNLACEWA DNI
Sbjct  132  YHLSQIAHPLLKASGAGSIVFISSVCGIVAHKNISAYSVTKGAMNQLTKNLACEWAEDNI  191

Query  376  RVNAVAPWLMRTSLTES--SRGEFGAVIEALIRRTLQHRLVEPKEASAAVAFLCFPAASF  203
            R NAVAPW ++T + +   S   F   +E +I RT   R+ +PKE S+ VAFLC PA+S+
Sbjct  192  RSNAVAPWYIKTPMVDQMLSNKTF---LEGVINRTPLRRVGDPKEVSSVVAFLCLPASSY  248

Query  202  VTGQIISVDGGGSIYGL  152
            +TGQ I VDGG ++ G 
Sbjct  249  ITGQTICVDGGMTVNGF  265



>emb|CAN69507.1| hypothetical protein VITISV_016037 [Vitis vinifera]
Length=270

 Score =   277 bits (708),  Expect = 5e-88, Method: Compositional matrix adjust.
 Identities = 144/256 (56%), Positives = 184/256 (72%), Gaps = 5/256 (2%)
 Frame = -1

Query  913  RWSLHGMTALVTGGTRGLGHAIVEELACLGATVYTCSRTEKELEECIQNWKAKGYKVFGS  734
            RWSL GMTALVTGGT+G+GHAIVEELA LGAT++TCSR E EL EC+++WKAKG+ V GS
Sbjct  13   RWSLKGMTALVTGGTKGIGHAIVEELAGLGATIHTCSRKETELNECLKDWKAKGFGVSGS  72

Query  733  VCDILQPSQRENLIQLVSKQFDGKLTILVNNVAILIPKETLKSDGQDFSNTIGTNLEASL  554
            VCD+   +QRE L++ VS  F GKL ILVNN AI+I K T++   ++FS  +  N E+  
Sbjct  73   VCDVSSRAQREKLMETVSSVFKGKLNILVNNAAIVIQKPTVEVTAEEFSTIMAINFESVY  132

Query  553  NLCQLAHPLLKATGNGsivfisscssfVYAPFHTIYASTKGAINSLVKNLACEWANDNIR  374
            +L QLAHPLLKA+G GSIVFISS +      + + Y+ TKGA+N L KNLACEWA DNIR
Sbjct  133  HLSQLAHPLLKASGAGSIVFISSVAGVASIKYLSAYSVTKGAMNQLTKNLACEWAEDNIR  192

Query  373  VNAVAPWLMRTSLTES--SRGEFGAVIEALIRRTLQHRLVEPKEASAAVAFLCFPAASFV  200
             NAVAPW ++T + +   S   F   +E +I R    R+ +PKE S+ VAFLC PA+S++
Sbjct  193  SNAVAPWYIKTPMVDQMLSNKTF---LEEVINRAPLRRVGDPKEVSSLVAFLCLPASSYI  249

Query  199  TGQIISVDGGGSIYGL  152
            TGQ I VDGG ++ G 
Sbjct  250  TGQTICVDGGVTVNGF  265



>ref|XP_004246864.1| PREDICTED: tropinone reductase homolog [Solanum lycopersicum]
Length=263

 Score =   276 bits (707),  Expect = 5e-88, Method: Compositional matrix adjust.
 Identities = 145/257 (56%), Positives = 185/257 (72%), Gaps = 3/257 (1%)
 Frame = -1

Query  916  GRWSLHGMTALVTGGTRGLGHAIVEELACLGATVYTCSRTEKELEECIQNWKAKGYKVFG  737
            GRW+L G TA+VTGGTRG+GHAIVEELA  GA VYTCSR + EL+EC++ WKAKGY V G
Sbjct  5    GRWTLQGNTAIVTGGTRGIGHAIVEELASFGANVYTCSRNQMELDECLRQWKAKGYTVGG  64

Query  736  SVCDILQPSQRENLIQLVSKQFDGKLTILVNNVAILIPKETLKSDGQDFSNTIGTNLEAS  557
            S+CD+   SQR   +  VS  F+GK+ IL+NN A+++     +   +D++  +GTN EAS
Sbjct  65   SMCDLQSRSQRLKFMDNVSSYFEGKINILINNAAVVVSNIATEYTHEDYNTMMGTNFEAS  124

Query  556  LNLCQLAHPLLKATGNGsivfisscssfVYAPFHTIYASTKGAINSLVKNLACEWANDNI  377
             +L QLAHP LKA+ NG IVFISS + FV  P  +IY++ KGAIN L ++LACEWA DNI
Sbjct  125  YHLSQLAHPFLKASKNGRIVFISSVAGFVSLPLCSIYSAAKGAINQLTRSLACEWAMDNI  184

Query  376  RVNAVAPWLMRTSLTESSRG--EFGAVIEALIRRT-LQHRLVEPKEASAAVAFLCFPAAS  206
            RVNAVAPW+++TSL E++    E    I  L+ RT +  R  EPKE SA VAFLC P AS
Sbjct  185  RVNAVAPWVIKTSLIEAASKDLEMNKRINKLVSRTPIGGRAGEPKEVSAMVAFLCLPCAS  244

Query  205  FVTGQIISVDGGGSIYG  155
            ++TGQI+ VDGG +I G
Sbjct  245  YITGQIMCVDGGITING  261



>ref|XP_010650992.1| PREDICTED: tropinone reductase homolog At1g07440-like isoform 
X2 [Vitis vinifera]
Length=270

 Score =   277 bits (708),  Expect = 6e-88, Method: Compositional matrix adjust.
 Identities = 145/257 (56%), Positives = 185/257 (72%), Gaps = 5/257 (2%)
 Frame = -1

Query  916  GRWSLHGMTALVTGGTRGLGHAIVEELACLGATVYTCSRTEKELEECIQNWKAKGYKVFG  737
            GRWSL GMTALVTGGT+G+GHAIVEELA LGAT++TCSR E EL EC+++WKAKG+ V G
Sbjct  12   GRWSLKGMTALVTGGTKGIGHAIVEELAGLGATIHTCSRKETELNECLKDWKAKGFGVSG  71

Query  736  SVCDILQPSQRENLIQLVSKQFDGKLTILVNNVAILIPKETLKSDGQDFSNTIGTNLEAS  557
            SVCD+   +QRE L+Q +S  F+GKL IL+NN AI I K T++   ++FS  +  N E+ 
Sbjct  72   SVCDVSSRAQREKLMQTISSVFNGKLNILINNAAITIQKPTVEVTAEEFSTIMAINFESV  131

Query  556  LNLCQLAHPLLKATGNGsivfisscssfVYAPFHTIYASTKGAINSLVKNLACEWANDNI  377
             +L Q+AHPLLKA+G GSIVFISS    V     + Y+ TKGA+N L KNLACEWA DNI
Sbjct  132  YHLSQIAHPLLKASGAGSIVFISSVCGIVAHKNISAYSVTKGAMNQLTKNLACEWAEDNI  191

Query  376  RVNAVAPWLMRTSLTES--SRGEFGAVIEALIRRTLQHRLVEPKEASAAVAFLCFPAASF  203
            R NAVAPW ++T + +   S   F   +E +I RT   R+ +PKE S+ VAFLC PA+S+
Sbjct  192  RSNAVAPWYIKTPMVDQMLSNKTF---LEGVINRTPLRRVGDPKEVSSVVAFLCLPASSY  248

Query  202  VTGQIISVDGGGSIYGL  152
            +TGQ I VDGG ++ G 
Sbjct  249  ITGQTICVDGGMTVNGF  265



>gb|KDO52384.1| hypothetical protein CISIN_1g024752mg [Citrus sinensis]
Length=263

 Score =   276 bits (707),  Expect = 6e-88, Method: Compositional matrix adjust.
 Identities = 143/256 (56%), Positives = 182/256 (71%), Gaps = 2/256 (1%)
 Frame = -1

Query  913  RWSLHGMTALVTGGTRGLGHAIVEELACLGATVYTCSRTEKELEECIQNWKAKGYKVFGS  734
            RWSL GMTALVTGGT+G+G+A+VEELA  GA V+TCSR E EL + IQ WK+KG +V GS
Sbjct  8    RWSLKGMTALVTGGTKGIGYAVVEELAAFGAIVHTCSRNETELNQRIQEWKSKGLQVSGS  67

Query  733  VCDILQPSQRENLIQLVSKQFDGKLTILVNNVAILIPKETLKSDGQDFSNTIGTNLEASL  554
            VCD+   +QRE L++ VS QFDGKL IL+NN    IPKET +   +DFS  + TN E++ 
Sbjct  68   VCDLKIRAQREKLMETVSSQFDGKLNILINNAGTFIPKETTEFTEEDFSTVMTTNFESAY  127

Query  553  NLCQLAHPLLKATGNGsivfisscssfVYAPFHTIYASTKGAINSLVKNLACEWANDNIR  374
            +L QLAHPLLK+ GNG+I+FISS +  +  P  +IYAS+K A+N L KNLACEWA D IR
Sbjct  128  HLSQLAHPLLKSAGNGNIIFISSVAGVIAIPMCSIYASSKVAMNQLTKNLACEWAKDKIR  187

Query  373  VNAVAPWLMRTSLTESSRGEFGAVIEA--LIRRTLQHRLVEPKEASAAVAFLCFPAASFV  200
            VN VAPW++RT L ++   +   +  A  ++ RT   R  EP E S+ VAFLC  A S+V
Sbjct  188  VNTVAPWVIRTPLLDTVEKDSNFLEHANRMVLRTPMLRPGEPNEVSSVVAFLCLSATSYV  247

Query  199  TGQIISVDGGGSIYGL  152
            TGQ+I VDGG S+ G 
Sbjct  248  TGQVICVDGGYSVTGF  263



>emb|CAN63543.1| hypothetical protein VITISV_035429 [Vitis vinifera]
Length=270

 Score =   276 bits (707),  Expect = 6e-88, Method: Compositional matrix adjust.
 Identities = 144/256 (56%), Positives = 186/256 (73%), Gaps = 5/256 (2%)
 Frame = -1

Query  913  RWSLHGMTALVTGGTRGLGHAIVEELACLGATVYTCSRTEKELEECIQNWKAKGYKVFGS  734
            RWSL GMTALVTGGT+G+GHAIVEELA LGA ++TCSR E EL EC+++WKAKG+ V GS
Sbjct  13   RWSLKGMTALVTGGTKGIGHAIVEELAGLGAAIHTCSRKETELNECLKDWKAKGFGVSGS  72

Query  733  VCDILQPSQRENLIQLVSKQFDGKLTILVNNVAILIPKETLKSDGQDFSNTIGTNLEASL  554
            VCD+   +QRE L++ VS  F+GKL ILVNN AI+I K T++   ++FS  +  N E+  
Sbjct  73   VCDVSSRAQREKLMETVSSVFNGKLNILVNNAAIVIQKPTVEVTAEEFSTIMAINFESVY  132

Query  553  NLCQLAHPLLKATGNGsivfisscssfVYAPFHTIYASTKGAINSLVKNLACEWANDNIR  374
            +L QLAHPLLKA+G GSIVFISS +  V   + + Y++TKGA+N L KNLACEWA DNIR
Sbjct  133  HLSQLAHPLLKASGAGSIVFISSVAGVVSLKYLSAYSATKGAMNQLTKNLACEWAEDNIR  192

Query  373  VNAVAPWLMRTSLTES--SRGEFGAVIEALIRRTLQHRLVEPKEASAAVAFLCFPAASFV  200
             NAVAPW ++T + +   S   F   +E +I R    R+ +PKE S+ VAFLC PA+S++
Sbjct  193  SNAVAPWYIKTPMVDQMLSNKTF---LEXVINRAPLRRVGDPKEVSSLVAFLCLPASSYI  249

Query  199  TGQIISVDGGGSIYGL  152
            TGQ I VDGG ++ G 
Sbjct  250  TGQTICVDGGVTVNGF  265



>ref|XP_010654244.1| PREDICTED: tropinone reductase homolog [Vitis vinifera]
Length=267

 Score =   276 bits (707),  Expect = 7e-88, Method: Compositional matrix adjust.
 Identities = 144/258 (56%), Positives = 179/258 (69%), Gaps = 2/258 (1%)
 Frame = -1

Query  919  AGRWSLHGMTALVTGGTRGLGHAIVEELACLGATVYTCSRTEKELEECIQNWKAKGYKVF  740
            A RWSL GMTAL+TGGTRG+G+AIVEELA LGA V+TCSR + EL E +Q W+ KG++V 
Sbjct  10   AKRWSLKGMTALITGGTRGIGYAIVEELAELGAIVHTCSRNQTELNERLQEWEGKGFRVS  69

Query  739  GSVCDILQPSQRENLIQLVSKQFDGKLTILVNNVAILIPKETLKSDGQDFSNTIGTNLEA  560
            GSVCD+   +QRE L + VS  F+GKL ILVNN A +  K       +D S+ + TN E+
Sbjct  70   GSVCDLTSRAQREKLTETVSSLFEGKLNILVNNAATVALKAPTNYTAEDCSSILQTNFES  129

Query  559  SLNLCQLAHPLLKATGNGsivfisscssfVYAPFHTIYASTKGAINSLVKNLACEWANDN  380
              +LCQLAHPLLKA+G GSI+FISS +  +  P  ++YA+TKGAIN + KNLACEWA DN
Sbjct  130  PYHLCQLAHPLLKASGRGSIIFISSVAGLISLPHMSVYAATKGAINQVTKNLACEWAKDN  189

Query  379  IRVNAVAPWLMRTSLTE--SSRGEFGAVIEALIRRTLQHRLVEPKEASAAVAFLCFPAAS  206
            IR NAVAPW +RTS+                L+ RT  HR+ EP E S  VAFLC PAAS
Sbjct  190  IRTNAVAPWTVRTSVRPILEPDNPMATAYPQLLARTPLHRIAEPDEVSPLVAFLCLPAAS  249

Query  205  FVTGQIISVDGGGSIYGL  152
            ++TGQ+I VDGG S+ G 
Sbjct  250  YITGQVICVDGGFSVNGF  267



>emb|CBI16073.3| unnamed protein product [Vitis vinifera]
Length=270

 Score =   276 bits (707),  Expect = 8e-88, Method: Compositional matrix adjust.
 Identities = 145/256 (57%), Positives = 185/256 (72%), Gaps = 5/256 (2%)
 Frame = -1

Query  913  RWSLHGMTALVTGGTRGLGHAIVEELACLGATVYTCSRTEKELEECIQNWKAKGYKVFGS  734
            RWSL GMTALVTGGT+G+GHAIVEELA LGAT++TCSR E EL EC+++WKAKG+ V GS
Sbjct  13   RWSLKGMTALVTGGTKGIGHAIVEELAGLGATIHTCSRKETELNECLKDWKAKGFGVSGS  72

Query  733  VCDILQPSQRENLIQLVSKQFDGKLTILVNNVAILIPKETLKSDGQDFSNTIGTNLEASL  554
            VCD+   +QRE L++ VS  F GKL ILVNN AI+I K T++   ++FS  +  N E+  
Sbjct  73   VCDVSSRAQREKLMETVSSVFKGKLNILVNNAAIVIQKPTVEVTAEEFSTIMAINFESVY  132

Query  553  NLCQLAHPLLKATGNGsivfisscssfVYAPFHTIYASTKGAINSLVKNLACEWANDNIR  374
            +L QLAHPLLKA+G GSIVFISS +  V   + + Y+ TKGA+N L KNLACEWA DNIR
Sbjct  133  HLSQLAHPLLKASGAGSIVFISSVAGVVSIKYLSAYSVTKGAMNQLTKNLACEWAEDNIR  192

Query  373  VNAVAPWLMRTSLTES--SRGEFGAVIEALIRRTLQHRLVEPKEASAAVAFLCFPAASFV  200
             NAVAPW ++T + +   S   F   +E +I R    R+ +PKE S+ VAFLC PA+S++
Sbjct  193  SNAVAPWYIKTPMVDQMFSNKTF---LEEVINRAPLRRVGDPKEVSSLVAFLCLPASSYI  249

Query  199  TGQIISVDGGGSIYGL  152
            TGQ I VDGG ++ G 
Sbjct  250  TGQTICVDGGVTVNGF  265



>ref|XP_010650983.1| PREDICTED: tropinone reductase homolog At1g07440-like isoform 
X1 [Vitis vinifera]
Length=270

 Score =   276 bits (706),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 144/256 (56%), Positives = 187/256 (73%), Gaps = 5/256 (2%)
 Frame = -1

Query  913  RWSLHGMTALVTGGTRGLGHAIVEELACLGATVYTCSRTEKELEECIQNWKAKGYKVFGS  734
            RWSL GMTALVTGGT+G+GHAIVEELA L AT++TCSR E EL+EC+++WKAKG+ V GS
Sbjct  13   RWSLKGMTALVTGGTKGIGHAIVEELAGLVATIHTCSRKETELDECLKDWKAKGFGVSGS  72

Query  733  VCDILQPSQRENLIQLVSKQFDGKLTILVNNVAILIPKETLKSDGQDFSNTIGTNLEASL  554
            VCD+   +QRE L++ VS  F+GKL ILVNN AI+I K T++   ++FS  +  N E+  
Sbjct  73   VCDVSSRAQREKLMETVSSVFNGKLNILVNNAAIVIQKPTVEVTAEEFSTIMAINFESVY  132

Query  553  NLCQLAHPLLKATGNGsivfisscssfVYAPFHTIYASTKGAINSLVKNLACEWANDNIR  374
            +L QLAHPLLKA+G GSIVFISS +  V   + + Y++TKGA+N L KNLACEWA DNIR
Sbjct  133  HLSQLAHPLLKASGAGSIVFISSVAGVVSLKYLSAYSATKGAMNQLTKNLACEWAEDNIR  192

Query  373  VNAVAPWLMRTSLTES--SRGEFGAVIEALIRRTLQHRLVEPKEASAAVAFLCFPAASFV  200
             NAVAPW ++T + +   S   F   +E +I R    R+ +PKE S+ VAFLC PA+S++
Sbjct  193  SNAVAPWYIKTPMVDQMLSNKTF---LEGVINRAPLRRVGDPKEVSSLVAFLCLPASSYI  249

Query  199  TGQIISVDGGGSIYGL  152
            TGQ I VDGG ++ G 
Sbjct  250  TGQTICVDGGVTVNGF  265



>ref|XP_010685684.1| PREDICTED: tropinone reductase homolog At1g07440-like [Beta vulgaris 
subsp. vulgaris]
Length=267

 Score =   276 bits (706),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 145/260 (56%), Positives = 188/260 (72%), Gaps = 5/260 (2%)
 Frame = -1

Query  925  IMAGRWSLHGMTALVTGGTRGLGHAIVEELACLGATVYTCSRTEKELEECIQNWKAKGYK  746
            +M  RWSL GMTALVTGGT+GLGHAIVEELA LGA V+TC+R E ELE C +NW+ KG+ 
Sbjct  10   MMNKRWSLVGMTALVTGGTKGLGHAIVEELAGLGARVHTCARNETELEACKRNWETKGFH  69

Query  745  VFGSVCDILQPSQRENLIQLVSKQFDGKLTILVNNVAILIPKETLKSDGQDFSNTIGTNL  566
            V  SVCD+   +QRENL+++VS +F+GKL ILVNNV   + K T +   ++++  + TNL
Sbjct  70   VTASVCDVTSRAQRENLMEIVSSEFNGKLNILVNNVGTYVKKPTTELTAEEYATVMTTNL  129

Query  565  EASLNLCQLAHPLLKATGNGsivfisscssfVYAPFHTIYASTKGAINSLVKNLACEWAN  386
            E++ + CQLAHPLLKA+G  SI+F+SS +  V     ++Y +TKGA+N L KNLACEWA 
Sbjct  130  ESAYHFCQLAHPLLKASGFASIIFMSSVAGVVALDVGSVYGTTKGAMNQLAKNLACEWAK  189

Query  385  DNIRVNAVAPWLMRTSLTES--SRGEFGAVIEALIRRTLQHRLVEPKEASAAVAFLCFPA  212
            DNIR N+VAPW +RT LTE   S  E+ A ++    RT   R  E +E S+ VAFLC PA
Sbjct  190  DNIRTNSVAPWYIRTPLTEVVLSDKEYLAKVK---ERTPLGRTGEVEEVSSLVAFLCMPA  246

Query  211  ASFVTGQIISVDGGGSIYGL  152
            AS++TGQ I VDGG +I+GL
Sbjct  247  ASYITGQTICVDGGFTIHGL  266



>ref|XP_010650984.1| PREDICTED: tropinone reductase homolog At1g07440-like isoform 
X2 [Vitis vinifera]
Length=270

 Score =   276 bits (705),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 144/256 (56%), Positives = 187/256 (73%), Gaps = 5/256 (2%)
 Frame = -1

Query  913  RWSLHGMTALVTGGTRGLGHAIVEELACLGATVYTCSRTEKELEECIQNWKAKGYKVFGS  734
            RWSL GMTALVTGGT+G+GHAIVEELA L AT++TCSR E EL+EC+++WKAKG+ V GS
Sbjct  13   RWSLKGMTALVTGGTKGIGHAIVEELAGLVATIHTCSRKETELDECLKDWKAKGFGVSGS  72

Query  733  VCDILQPSQRENLIQLVSKQFDGKLTILVNNVAILIPKETLKSDGQDFSNTIGTNLEASL  554
            VCD+   +QRE L++ VS  F+GKL ILVNN AI+I K T++   ++FS  +  N E+  
Sbjct  73   VCDVSSRAQREKLMETVSSVFNGKLNILVNNAAIVIQKPTVEVTAEEFSTIMAINFESVY  132

Query  553  NLCQLAHPLLKATGNGsivfisscssfVYAPFHTIYASTKGAINSLVKNLACEWANDNIR  374
            +L QLAHPLLKA+G GSIVFISS +  V   + + Y++TKGA+N L KNLACEWA DNIR
Sbjct  133  HLSQLAHPLLKASGAGSIVFISSVAGVVSLKYLSAYSATKGAMNQLTKNLACEWAEDNIR  192

Query  373  VNAVAPWLMRTSLTES--SRGEFGAVIEALIRRTLQHRLVEPKEASAAVAFLCFPAASFV  200
             NAVAPW ++T + +   S   F   +E +I R    R+ +PKE S+ VAFLC PA+S++
Sbjct  193  SNAVAPWYIKTPMVDQMFSNKTF---LEEVINRAPLRRVGDPKEVSSLVAFLCLPASSYI  249

Query  199  TGQIISVDGGGSIYGL  152
            TGQ I VDGG ++ G 
Sbjct  250  TGQTICVDGGVTVNGF  265



>ref|XP_008221978.1| PREDICTED: tropinone reductase homolog At1g07440-like [Prunus 
mume]
Length=270

 Score =   276 bits (705),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 148/257 (58%), Positives = 187/257 (73%), Gaps = 6/257 (2%)
 Frame = -1

Query  913  RWSLHGMTALVTGGTRGLGHAIVEELACLGATVYTCSRTEKELEECIQNWKAKGY-KVFG  737
            RWSL GMTALVTGGT+G+G+AIVEELA LGAT++TCSR E +L +C+  WK KG+ +V G
Sbjct  12   RWSLRGMTALVTGGTKGIGYAIVEELAGLGATIHTCSRNEVQLNDCLSQWKMKGFDQVTG  71

Query  736  SVCDILQPSQRENLIQLVSKQFDGKLTILVNNVAILIPKETLKSDGQDFSNTIGTNLEAS  557
            SVCD++  +QRE LI  VS  F+GKL IL+NNV     K  ++S  +D+S  + TNLE++
Sbjct  72   SVCDVVSKAQREELINKVSSLFNGKLNILINNVGTAEIKPAIESTTEDYSFIMSTNLESA  131

Query  556  LNLCQLAHPLLKATGNGsivfisscssfVYAPFHTIYASTKGAINSLVKNLACEWANDNI  377
             +  QLAHPLLKA+G G+I+F+SS +  V     +IYA+TKGA+N L KNLACEWA DNI
Sbjct  132  YHFSQLAHPLLKASGAGNIIFMSSVAGVVSLGTASIYAATKGAMNQLAKNLACEWAKDNI  191

Query  376  RVNAVAPWLMRTSLTES--SRGEFGAVIEALIRRTLQHRLVEPKEASAAVAFLCFPAASF  203
            R N+VAPW +RT LTE   S   F   +EA+  R    R  EPKE SA VAFLCFPAAS+
Sbjct  192  RTNSVAPWFIRTPLTEPLLSNQNF---LEAVNSRCPLGRTGEPKEVSALVAFLCFPAASY  248

Query  202  VTGQIISVDGGGSIYGL  152
            +TGQII VDGG ++ GL
Sbjct  249  ITGQIICVDGGFTVNGL  265



>ref|XP_007140482.1| hypothetical protein PHAVU_008G116300g [Phaseolus vulgaris]
 gb|ESW12476.1| hypothetical protein PHAVU_008G116300g [Phaseolus vulgaris]
Length=266

 Score =   276 bits (705),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 134/254 (53%), Positives = 183/254 (72%), Gaps = 3/254 (1%)
 Frame = -1

Query  913  RWSLHGMTALVTGGTRGLGHAIVEELACLGATVYTCSRTEKELEECIQNWKAKGYKVFGS  734
            +WSLHGMTALVTGGTRG+G+A+ EELA  GA+V+ C+R ++++++C++ W  KG+ + GS
Sbjct  13   KWSLHGMTALVTGGTRGIGYAVAEELAEFGASVHICARKQQDIDKCLEEWNRKGFSITGS  72

Query  733  VCDILQPSQRENLIQLVSKQFDGKLTILVNNVAILIPKETLKSDGQDFSNTIGTNLEASL  554
             CD+L   QRENL++ V+  FDGKL IL+NN    +PK  +    +D S  +GTN E+S 
Sbjct  73   SCDVLSRDQRENLMRDVASIFDGKLNILINNAGTTVPKNLIDYTAEDISTIMGTNFESSY  132

Query  553  NLCQLAHPLLKATGNGsivfisscssfVYAPFHTIYASTKGAINSLVKNLACEWANDNIR  374
            +LCQLAHPLLKA+G G+IVFISS +     PF ++YAS+KGA+N   KN+A EWA DNIR
Sbjct  133  HLCQLAHPLLKASGYGNIVFISSIAGLKSFPFSSVYASSKGAMNQFTKNVALEWAKDNIR  192

Query  373  VNAVAPWLMRTSLTE---SSRGEFGAVIEALIRRTLQHRLVEPKEASAAVAFLCFPAASF  203
             NAVAP  ++T L +    S  E   +IEA   +T+  R+ EPK+ S  VAFLC PAAS+
Sbjct  193  ANAVAPGFVKTELLDFILESLDEGSKIIEATKAKTMAGRIGEPKDISGMVAFLCLPAASY  252

Query  202  VTGQIISVDGGGSI  161
            +TGQII++DGG +I
Sbjct  253  ITGQIITIDGGYTI  266



>ref|XP_004503172.1| PREDICTED: tropinone reductase homolog At1g07440-like [Cicer 
arietinum]
Length=269

 Score =   276 bits (705),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 143/262 (55%), Positives = 188/262 (72%), Gaps = 5/262 (2%)
 Frame = -1

Query  913  RWSLHGMTALVTGGTRGLGHAIVEELACLGATVYTCSRTEKELEECIQNWKAKGYKVFGS  734
            RWSL GMTALVTGGTRG+GHAIV +LA  GATV+TCSRTE EL +C+Q W+++G+ V GS
Sbjct  10   RWSLTGMTALVTGGTRGIGHAIVNDLAAFGATVHTCSRTESELNKCLQEWQSQGFLVTGS  69

Query  733  VCDILQPSQRENLIQLVSKQFDGKLTILVNNVAILIPKETLKSDGQDFSNTIGTNLEASL  554
            VCD+    QRENL+Q V+  F+GKL I VNNV   I K T++  G+++S  +  NL+++ 
Sbjct  70   VCDVASRPQRENLVQQVTSTFNGKLNIFVNNVGTNIRKPTVEYTGEEYSELMAINLDSAF  129

Query  553  NLCQLAHPLLKATGNGsivfisscssfVYAPFHTIYASTKGAINSLVKNLACEWANDNIR  374
            +LCQLA+PLLKA+G GSIVFISS +  V     ++YA++K AIN L KNLACEWA DNIR
Sbjct  130  HLCQLAYPLLKASGIGSIVFISSVAGVVSLGTGSVYAASKAAINQLTKNLACEWAKDNIR  189

Query  373  VNAVAPWLMRTSLTES--SRGEFGAVIEALIRRTLQHRLVEPKEASAAVAFLCFPAASFV  200
             N V PW  RT L E      +F   ++ ++ RT   R+ EP+E S+ V FLC PAAS++
Sbjct  190  SNCVVPWATRTPLVEHLFQNQKF---VDDIMSRTPLKRIAEPEEVSSLVTFLCLPAASYI  246

Query  199  TGQIISVDGGGSIYGL*TSVWI  134
            TGQ+ISVDGG +++G   S+ I
Sbjct  247  TGQVISVDGGLTVFGFQPSMRI  268



>ref|XP_010033096.1| PREDICTED: tropinone reductase homolog At1g07440-like [Eucalyptus 
grandis]
 gb|KCW52638.1| hypothetical protein EUGRSUZ_J02011 [Eucalyptus grandis]
Length=279

 Score =   276 bits (705),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 148/265 (56%), Positives = 185/265 (70%), Gaps = 5/265 (2%)
 Frame = -1

Query  940  YQQHNIMAGRWSLHGMTALVTGGTRGLGHAIVEELACLGATVYTCSRTEKELEECIQNWK  761
            +   N    RWSLHGMTALVTGGT+G+GHAIVEELA LGATV+TCSR E E+ EC+++WK
Sbjct  13   HSSSNDNKNRWSLHGMTALVTGGTKGIGHAIVEELARLGATVHTCSRNEAEINECLKDWK  72

Query  760  AKGYKVFGSVCDILQPSQRENLIQLVSKQFDGKLTILVNNVAILIPKETLKSDGQDFSNT  581
            +KG++V GS CD+   S+RE L+  VS  FDGKL IL+NNV     K T+    +DFS  
Sbjct  73   SKGFRVSGSTCDVSSRSEREKLMLTVSSVFDGKLNILINNVGTNTLKSTMDYTAEDFSFI  132

Query  580  IGTNLEASLNLCQLAHPLLKATGNGsivfisscssfVYAPFHTIYASTKGAINSLVKNLA  401
            + TN E++ +L QLAHPLLKA+G GSIVF+SS    V     +IY++TKGA+N L KNLA
Sbjct  133  MTTNFESAYHLSQLAHPLLKASGAGSIVFLSSVCGVVSINVGSIYSATKGAMNQLTKNLA  192

Query  400  CEWANDNIRVNAVAPWLMRTSLTES--SRGEFGAVIEALIRRTLQHRLVEPKEASAAVAF  227
            CEWA DNIR N+VAPW + T L E   S  +F    E +I RT   R  EP+E S+ VAF
Sbjct  193  CEWAKDNIRSNSVAPWFILTPLAEPLLSDKKFH---EEVIARTPLGRTGEPEEVSSLVAF  249

Query  226  LCFPAASFVTGQIISVDGGGSIYGL  152
            LC PAAS++TGQ I VDGG ++ G 
Sbjct  250  LCLPAASYITGQTICVDGGFTVNGF  274



>ref|XP_002308174.2| hypothetical protein POPTR_0006s09080g [Populus trichocarpa]
 gb|EEE91697.2| hypothetical protein POPTR_0006s09080g [Populus trichocarpa]
Length=275

 Score =   276 bits (705),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 143/252 (57%), Positives = 187/252 (74%), Gaps = 4/252 (2%)
 Frame = -1

Query  913  RWSLHGMTALVTGGTRGLGHAIVEELACLGATVYTCSRTEKELEECIQNWKAKGYKVFGS  734
            RWSL GMTALVTGGTRG+G AIVEELA  GA V+TCSR E +L+ECI+ W++KG++V GS
Sbjct  12   RWSLKGMTALVTGGTRGIGFAIVEELAGFGAAVHTCSRNETKLDECIREWESKGFRVTGS  71

Query  733  VCDILQPSQRENLIQLVSKQFDGKLTILVNNVAILIPKETLKSDGQDFSNTIGTNLEASL  554
            VCD+   +QR+ LI+ VS  F GKL ILVNN A ++ K + K   +D + T+GTN+EAS 
Sbjct  72   VCDVSCRTQRDKLIEKVSSTFQGKLNILVNNAAAVVSKNSTKVTAEDMAYTLGTNVEASY  131

Query  553  NLCQLAHPLLKATGNGsivfisscssfVYAPFHTIYASTKGAINSLVKNLACEWANDNIR  374
            +LCQLAHPLLKA+GNGSIVFISS ++ V  P  + Y ++KGA+N L K+LACEWA+D IR
Sbjct  132  HLCQLAHPLLKASGNGSIVFISSVAAVVALPTLSFYGASKGALNQLTKSLACEWAHDKIR  191

Query  373  VNAVAPWLMRTSLTESSRG----EFGAVIEALIRRTLQHRLVEPKEASAAVAFLCFPAAS  206
             NAV+PW+++T L ++S      E  A +  ++ +T   RL E  E S+ VAFLC P A+
Sbjct  192  ANAVSPWIIKTPLLDASLAKSPSEQRAGMSRIVAQTPISRLGEASEISSLVAFLCLPTAA  251

Query  205  FVTGQIISVDGG  170
            ++TGQIISVDGG
Sbjct  252  YITGQIISVDGG  263



>ref|XP_007205718.1| hypothetical protein PRUPE_ppa009959mg [Prunus persica]
 gb|EMJ06917.1| hypothetical protein PRUPE_ppa009959mg [Prunus persica]
Length=270

 Score =   275 bits (704),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 148/257 (58%), Positives = 187/257 (73%), Gaps = 6/257 (2%)
 Frame = -1

Query  913  RWSLHGMTALVTGGTRGLGHAIVEELACLGATVYTCSRTEKELEECIQNWKAKGY-KVFG  737
            RWSLHGMTALVTGGT+G+G+AIVEELA LGAT++TCSR E +L +C+  WK KG+ +V G
Sbjct  12   RWSLHGMTALVTGGTKGIGYAIVEELAGLGATIHTCSRNEVQLNDCLSQWKMKGFDQVTG  71

Query  736  SVCDILQPSQRENLIQLVSKQFDGKLTILVNNVAILIPKETLKSDGQDFSNTIGTNLEAS  557
            SVCD++  +QRE LI  VS  F GKL ILVNNV     K  +++  +D+S  + TNLE++
Sbjct  72   SVCDVVSKAQREELINKVSSLFHGKLNILVNNVGTAEIKPAIENTTEDYSFIMSTNLESA  131

Query  556  LNLCQLAHPLLKATGNGsivfisscssfVYAPFHTIYASTKGAINSLVKNLACEWANDNI  377
             +  QLAHPLLKA+G G+I+F+SS +  V     +IYA+TKGA+N L KNLACEWA DNI
Sbjct  132  YHFSQLAHPLLKASGAGNIIFMSSVAGVVSLGTASIYAATKGAMNQLAKNLACEWAKDNI  191

Query  376  RVNAVAPWLMRTSLTES--SRGEFGAVIEALIRRTLQHRLVEPKEASAAVAFLCFPAASF  203
            R N+VAPW +RT LTE   S  +F   +EA+  R    R  EPKE SA VAFLCFPAAS+
Sbjct  192  RTNSVAPWFIRTPLTEPLLSNQKF---LEAVNSRCPLGRTGEPKEVSALVAFLCFPAASY  248

Query  202  VTGQIISVDGGGSIYGL  152
            +TGQ I VDGG ++ GL
Sbjct  249  ITGQTICVDGGFTVNGL  265



>ref|XP_008222026.1| PREDICTED: tropinone reductase homolog At1g07440-like [Prunus 
mume]
Length=264

 Score =   275 bits (703),  Expect = 3e-87, Method: Compositional matrix adjust.
 Identities = 142/253 (56%), Positives = 184/253 (73%), Gaps = 1/253 (0%)
 Frame = -1

Query  913  RWSLHGMTALVTGGTRGLGHAIVEELACLGATVYTCSRTEKELEECIQNWKAKGYKVFGS  734
            RWSL G+TALVTGGT+G+G+AIVEELA LGAT++TC+R E +L +C+  W  KG+KV GS
Sbjct  7    RWSLEGLTALVTGGTKGIGYAIVEELAGLGATIHTCARNEVDLNDCLSQWGKKGFKVTGS  66

Query  733  VCDILQPSQRENLIQLVSKQFDGKLTILVNNVAILIPKETLKSDGQDFSNTIGTNLEASL  554
            VCD++  +QRE LI  VS  FDGKL IL+NNV   IPK T +   +D++  + TNLE++ 
Sbjct  67   VCDVVSKTQREELINKVSSLFDGKLNILINNVGTNIPKPTTEYTAEDYTFLMSTNLESAY  126

Query  553  NLCQLAHPLLKATGNGsivfisscssfVYAPFHTIYASTKGAINSLVKNLACEWANDNIR  374
            +LCQLAHPLLKA+G G+IVF+SS +  V     TIY++TKGA+N L KNLACEWA DNIR
Sbjct  127  HLCQLAHPLLKASGAGNIVFLSSVAGVVSLEIGTIYSATKGAMNQLAKNLACEWAKDNIR  186

Query  373  VNAVAPWLMRTSLTESSRGEFGAVIEALIRRTLQHRLVEPKEASAAVAFLCFPAASFVTG  194
             N+VAPW ++T L +   G     ++ +  RT   R  EP+E SA VAFLC PAAS++TG
Sbjct  187  TNSVAPWFIKTLLGDHFLGH-EKTLKIINSRTPLGRPGEPEEVSALVAFLCLPAASYITG  245

Query  193  QIISVDGGGSIYG  155
            Q I VDGG ++ G
Sbjct  246  QTICVDGGVTVNG  258



>ref|XP_004246428.1| PREDICTED: tropinone reductase homolog isoform X1 [Solanum lycopersicum]
Length=270

 Score =   275 bits (703),  Expect = 3e-87, Method: Compositional matrix adjust.
 Identities = 147/265 (55%), Positives = 191/265 (72%), Gaps = 2/265 (1%)
 Frame = -1

Query  943  KYQQHNIMAGRWSLHGMTALVTGGTRGLGHAIVEELACLGATVYTCSRTEKELEECIQNW  764
            K + +N   GRW+L G TALVTGGT+G+GHAIVEELA  GATVYTC R +++L+EC++ W
Sbjct  4    KNESNNSEDGRWTLQGKTALVTGGTKGIGHAIVEELAGFGATVYTCCRNQEQLDECLEKW  63

Query  763  KAKGYKVFGSVCDILQPSQRENLIQLVSKQFDGKLTILVNNVAILIPKETLKSDGQDFSN  584
            + KGYKV G VCD+   SQRE L++ V   F GKL IL+NN  ILI K   +    D+S 
Sbjct  64   RGKGYKVEGCVCDLTLRSQREMLMEKVINFFQGKLNILINNAGILIVKPATEFTEDDYSI  123

Query  583  TIGTNLEASLNLCQLAHPLLKATGNGsivfisscssfVYAPFHTIYASTKGAINSLVKNL  404
             + TN EAS ++ Q+AHP+LKA+ +G+IVFISS +  V  P ++IYA+TKGA+N L ++L
Sbjct  124  LMKTNFEASHHISQIAHPILKASESGNIVFISSIAGLVALPTNSIYAATKGAMNQLTRSL  183

Query  403  ACEWANDNIRVNAVAPWLMRTSLTESSRGE--FGAVIEALIRRTLQHRLVEPKEASAAVA  230
            A EWA DNIRVNAVAPW++ T L E+++ +     +IE  I RT   R  EPKE SA VA
Sbjct  184  AYEWAKDNIRVNAVAPWIINTPLIEAAKKDSLTKELIERSISRTPICRAGEPKEVSAMVA  243

Query  229  FLCFPAASFVTGQIISVDGGGSIYG  155
            FLCFPAAS++TGQ+I VDGG +I G
Sbjct  244  FLCFPAASYITGQVICVDGGHTING  268



>gb|AFK38962.1| unknown [Medicago truncatula]
Length=269

 Score =   275 bits (703),  Expect = 3e-87, Method: Compositional matrix adjust.
 Identities = 143/264 (54%), Positives = 186/264 (70%), Gaps = 5/264 (2%)
 Frame = -1

Query  937  QQHNIMAGRWSLHGMTALVTGGTRGLGHAIVEELACLGATVYTCSRTEKELEECIQNWKA  758
            Q+ ++   RWSL G TALVTGGTRG+GHA+VEELA  GATV+TCSR E+EL +C+  WK 
Sbjct  4    QESSMRGSRWSLKGTTALVTGGTRGIGHAVVEELAEFGATVFTCSRNEEELNKCLNEWKE  63

Query  757  KGYKVFGSVCDILQPSQRENLIQLVSKQFDGKLTILVNNVAILIPKETLKSDGQDFSNTI  578
            KG+ V+GSVCD   PSQRE LI+ V+  F+GKL ILV+N    + K T++   +D+S  +
Sbjct  64   KGFSVYGSVCDASSPSQREELIRQVASAFNGKLNILVSNAGTNVRKPTIEYTAEDYSKVM  123

Query  577  GTNLEASLNLCQLAHPLLKATGNGsivfisscssfVYAPFHTIYASTKGAINSLVKNLAC  398
             TNL+++ +LCQLA+PLLK +GNGSIVFISS +S +     +IYA +K AIN L KNLAC
Sbjct  124  TTNLDSAYHLCQLAYPLLKESGNGSIVFISSVASLISVGTGSIYAVSKAAINQLTKNLAC  183

Query  397  EWANDNIRVNAVAPWLMRTSLTES--SRGEFGAVIEALIRRTLQHRLVEPKEASAAVAFL  224
            EWA DNI  N VAPW  +TSL E   +  EF   ++ ++ RT   R+ E  E SA V FL
Sbjct  184  EWAKDNIGSNCVAPWYTKTSLVEQFIANKEF---VDEVLSRTPIKRIAETHEVSALVTFL  240

Query  223  CFPAASFVTGQIISVDGGGSIYGL  152
            C PAAS++TGQ +SVDGG ++ G 
Sbjct  241  CLPAASYITGQTVSVDGGFTVNGF  264



>ref|XP_006838385.1| hypothetical protein AMTR_s00002p00066940 [Amborella trichopoda]
 gb|ERN00954.1| hypothetical protein AMTR_s00002p00066940 [Amborella trichopoda]
Length=270

 Score =   275 bits (702),  Expect = 4e-87, Method: Compositional matrix adjust.
 Identities = 143/253 (57%), Positives = 178/253 (70%), Gaps = 1/253 (0%)
 Frame = -1

Query  913  RWSLHGMTALVTGGTRGLGHAIVEELACLGATVYTCSRTEKELEECIQNWKAKGYKVFGS  734
            RWSL+GMTALVTGGT+G+GHA VEE+A LGA+VYTCSR E +L +C+  WK  G    GS
Sbjct  16   RWSLNGMTALVTGGTKGIGHATVEEIASLGASVYTCSRNEDDLNKCLNEWKGMGLDAHGS  75

Query  733  VCDILQPSQRENLIQLVSKQFDGKLTILVNNVAILIPKETLKSDGQDFSNTIGTNLEASL  554
            VCD+     RE LI  VS  F GKL ILVNNV   I K T++    +FS  + TNLE++ 
Sbjct  76   VCDLSSRPDREKLIDAVSSHFKGKLNILVNNVGTNIRKPTMQYTAAEFSFLMATNLESAY  135

Query  553  NLCQLAHPLLKATGNGsivfisscssfVYAPFHTIYASTKGAINSLVKNLACEWANDNIR  374
            ++CQL HPLLKA+G GSIVFISS +  V     TIYA+TKGA+N + KNLACEWA DNIR
Sbjct  136  HMCQLTHPLLKASGVGSIVFISSVAGVVALHTGTIYAATKGALNQITKNLACEWAKDNIR  195

Query  373  VNAVAPWLMRTSLTESSRGEFGAVIEALIRRTLQHRLVEPKEASAAVAFLCFPAASFVTG  194
             N+VAPW ++T L E    +   + E +I RT   R+ EP+E S+ VAFLC PAAS++TG
Sbjct  196  TNSVAPWFIKTPLVEDFL-QVKGITEGIIARTPMRRMGEPEEVSSLVAFLCLPAASYITG  254

Query  193  QIISVDGGGSIYG  155
            QII VDGG ++ G
Sbjct  255  QIICVDGGMTVNG  267



>gb|AFD23289.1| tropinone reductase II, partial [Dendrobium nobile]
Length=272

 Score =   274 bits (701),  Expect = 6e-87, Method: Compositional matrix adjust.
 Identities = 143/257 (56%), Positives = 186/257 (72%), Gaps = 1/257 (0%)
 Frame = -1

Query  922  MAGRWSLHGMTALVTGGTRGLGHAIVEELACLGATVYTCSRTEKELEECIQNWKAKGYKV  743
            +AGRWSL GMTALVTGGTRG+G+A+VEELA LGA VYTCSR E EL +C++ W+  G +V
Sbjct  11   IAGRWSLEGMTALVTGGTRGIGNAVVEELAELGAVVYTCSRKESELNDCLKKWEGLGLRV  70

Query  742  FGSVCDILQPSQRENLIQLVSKQFDGKLTILVNNVAILIPKETLKSDGQDFSNTIGTNLE  563
             GS+CD+    QR +LIQ VS  FDGKL IL+NNV   I K T+    +D+S  + TN +
Sbjct  71   SGSICDLSVREQRVDLIQKVSSAFDGKLNILINNVGTNIRKPTVDYSEEDYSFIMKTNFD  130

Query  562  ASLNLCQLAHPLLKATGNGsivfisscssfVYAPFHTIYASTKGAINSLVKNLACEWAND  383
            A+ ++CQLAHPLLKA+GNGSIVFISS +  V      IYA+TK A+N + KNLACEWA D
Sbjct  131  AAFHICQLAHPLLKASGNGSIVFISSVAGVVAISSGVIYAATKAAMNQITKNLACEWAKD  190

Query  382  NIRVNAVAPWLMRTSLTESSRGEFGAVIEALIRRTLQHRLVEPKEASAAVAFLCFPAASF  203
            NIR+N+V+PW ++TSL      E    + +++ RT  +R+ E +E S+ VAFLC P AS+
Sbjct  191  NIRINSVSPWYIKTSLVNHLL-EKENFLNSVVSRTPLNRVGEAEEVSSLVAFLCMPCASY  249

Query  202  VTGQIISVDGGGSIYGL  152
            +TGQIISVDGG ++ G 
Sbjct  250  ITGQIISVDGGMTVNGF  266



>ref|XP_007205726.1| hypothetical protein PRUPE_ppa010064mg [Prunus persica]
 gb|EMJ06925.1| hypothetical protein PRUPE_ppa010064mg [Prunus persica]
Length=266

 Score =   274 bits (700),  Expect = 6e-87, Method: Compositional matrix adjust.
 Identities = 142/255 (56%), Positives = 186/255 (73%), Gaps = 3/255 (1%)
 Frame = -1

Query  913  RWSLHGMTALVTGGTRGLGHAIVEELACLGATVYTCSRTEKELEECIQNWKAKGYKVFGS  734
            RWSL G+TALVTGGT+G+GHAIVEELA LGAT++TC+R E +L +C+  W+ KG++V GS
Sbjct  9    RWSLEGLTALVTGGTKGIGHAIVEELAGLGATIHTCARNEVDLNDCLSQWEKKGFQVTGS  68

Query  733  VCDILQPSQRENLIQLVSKQFDGKLTILVNNVAILIPKETLKSDGQDFSNTIGTNLEASL  554
            VCD++  +QRE LI  VS  FDGKL IL+NNV   I K T++   +D++  + TNLE++ 
Sbjct  69   VCDVVSRAQREELINKVSSLFDGKLNILINNVGTSILKPTMEFTAEDYTFLMSTNLESAY  128

Query  553  NLCQLAHPLLKATGNGsivfisscssfVYAPFHTIYASTKGAINSLVKNLACEWANDNIR  374
            + CQLAHPLLKA+G G+IVF+SS +  V     + Y++TKGAIN L KNLACEWA DNIR
Sbjct  129  HFCQLAHPLLKASGAGNIVFLSSVAGVVSVEVGSAYSATKGAINQLAKNLACEWAKDNIR  188

Query  373  VNAVAPWLMRTSLTESS-RGEFGAVIEALIRRTLQHRLVEPKEASAAVAFLCFPAASFVT  197
            +N+VAPW ++T L E     EF   ++ +  RT   R  EP+E SA VAFLC PAAS++T
Sbjct  189  INSVAPWFIKTPLAEHFLSDEF--FLKIINSRTPLGRPGEPEEVSALVAFLCLPAASYIT  246

Query  196  GQIISVDGGGSIYGL  152
            GQ I VDGG ++ GL
Sbjct  247  GQTICVDGGMTVNGL  261



>ref|XP_007009277.1| NAD(P)-binding Rossmann-fold superfamily protein [Theobroma cacao]
 gb|EOY18087.1| NAD(P)-binding Rossmann-fold superfamily protein [Theobroma cacao]
Length=273

 Score =   274 bits (701),  Expect = 7e-87, Method: Compositional matrix adjust.
 Identities = 145/258 (56%), Positives = 184/258 (71%), Gaps = 1/258 (0%)
 Frame = -1

Query  925  IMAGRWSLHGMTALVTGGTRGLGHAIVEELACLGATVYTCSRTEKELEECIQNWKAKGYK  746
            I   RWSL+GMTALVTGGTRG+GHAIVEELA LGA VYTCSR E EL +C++ W+ KG+ 
Sbjct  10   IKTSRWSLNGMTALVTGGTRGIGHAIVEELAGLGAAVYTCSRNEAELNKCLKEWEGKGFL  69

Query  745  VFGSVCDILQPSQRENLIQLVSKQFDGKLTILVNNVAILIPKETLKSDGQDFSNTIGTNL  566
            V GSVCD     QR+ L++ V+  F+G+L ILVNNV   I K T++   +++S  I TN 
Sbjct  70   VSGSVCDASSKDQRQKLVENVASLFNGRLNILVNNVGTNIRKPTIEYSAEEYSKLITTNF  129

Query  565  EASLNLCQLAHPLLKATGNGsivfisscssfVYAPFHTIYASTKGAINSLVKNLACEWAN  386
            E+S +LCQLAHPLLKA+  GSIVFISS +  ++    +IY  TK AIN L KNLACEWA 
Sbjct  130  ESSYHLCQLAHPLLKASQVGSIVFISSVAGVMHIGSGSIYGPTKAAINQLTKNLACEWAK  189

Query  385  DNIRVNAVAPWLMRTSLTESSRGEFGAVIEALIRRTLQHRLVEPKEASAAVAFLCFPAAS  206
            DNIR N VAPW +RTSL E    +   + + + R  LQ R+ EP+E S+ VAFLC PA+S
Sbjct  190  DNIRTNCVAPWYIRTSLVEHLLEKKELLEKIITRTPLQ-RVGEPEEVSSIVAFLCLPASS  248

Query  205  FVTGQIISVDGGGSIYGL  152
            ++TGQ+ISVDGG ++  L
Sbjct  249  YITGQVISVDGGLTVNAL  266



>ref|XP_009421329.1| PREDICTED: tropinone reductase homolog [Musa acuminata subsp. 
malaccensis]
Length=271

 Score =   274 bits (700),  Expect = 8e-87, Method: Compositional matrix adjust.
 Identities = 142/254 (56%), Positives = 187/254 (74%), Gaps = 1/254 (0%)
 Frame = -1

Query  913  RWSLHGMTALVTGGTRGLGHAIVEELACLGATVYTCSRTEKELEECIQNWKAKGYKVFGS  734
            RWSL GMTALVTGGTRG+GHA+VEELA LGA+V+TCSR E +L EC++ W AKG++V GS
Sbjct  15   RWSLGGMTALVTGGTRGIGHAVVEELAGLGASVHTCSRKEADLTECLRKWAAKGFRVTGS  74

Query  733  VCDILQPSQRENLIQLVSKQFDGKLTILVNNVAILIPKETLKSDGQDFSNTIGTNLEASL  554
            VCD+    QR+ LI+ VS  F+GKL ILVNNV   I K T++   +++S  + TNLE++ 
Sbjct  75   VCDLSSREQRDQLIREVSATFNGKLNILVNNVGTNIRKPTVEYSAEEYSFLMATNLESAY  134

Query  553  NLCQLAHPLLKATGNGsivfisscssfVYAPFHTIYASTKGAINSLVKNLACEWANDNIR  374
            +LCQLAHPLLKA+G GSIVFISS +  V     +IYA+ K A+N + KNLACEWA DNIR
Sbjct  135  HLCQLAHPLLKASGMGSIVFISSVAGVVALSSGSIYAAAKAAMNQMTKNLACEWAKDNIR  194

Query  373  VNAVAPWLMRTSLTESSRGEFGAVIEALIRRTLQHRLVEPKEASAAVAFLCFPAASFVTG  194
             N+V+PW ++T L E    +  + ++ +I RT   R+ EP+E S+ V +LC PAAS++TG
Sbjct  195  TNSVSPWYIKTKLVEHLLNDKDS-LQRIIDRTPLGRVGEPEEVSSLVGYLCLPAASYITG  253

Query  193  QIISVDGGGSIYGL  152
            QIISVDGG ++ G 
Sbjct  254  QIISVDGGMTVNGF  267



>ref|XP_009364346.1| PREDICTED: tropinone reductase homolog At1g07440-like [Pyrus 
x bretschneideri]
Length=264

 Score =   274 bits (700),  Expect = 8e-87, Method: Compositional matrix adjust.
 Identities = 142/254 (56%), Positives = 185/254 (73%), Gaps = 1/254 (0%)
 Frame = -1

Query  913  RWSLHGMTALVTGGTRGLGHAIVEELACLGATVYTCSRTEKELEECIQNWKAKGYKVFGS  734
            RWSL GMTALVTGGT+G+G+AIVEELA LGA V+TC+RTE +L +C+  W+ KG++V GS
Sbjct  7    RWSLEGMTALVTGGTKGIGYAIVEELAGLGAIVHTCARTEVDLNDCLSQWEKKGFQVTGS  66

Query  733  VCDILQPSQRENLIQLVSKQFDGKLTILVNNVAILIPKETLKSDGQDFSNTIGTNLEASL  554
            VCD++  +QRE LI  VS  FDGKL IL+NNV    PK TL+   +D+S  + TNLE++ 
Sbjct  67   VCDVVSKTQREELINKVSSLFDGKLNILINNVGANRPKATLEYTAEDYSFLMSTNLESAY  126

Query  553  NLCQLAHPLLKATGNGsivfisscssfVYAPFHTIYASTKGAINSLVKNLACEWANDNIR  374
            +LCQL+HPLLKA+G+ +IV +SS +  V     TIY++TKGAIN L +NLACEWA DNIR
Sbjct  127  HLCQLSHPLLKASGSANIVLLSSIAGVVSLNIGTIYSATKGAINQLARNLACEWAKDNIR  186

Query  373  VNAVAPWLMRTSLTESSRGEFGAVIEALIRRTLQHRLVEPKEASAAVAFLCFPAASFVTG  194
             N+VAPW + T L +   G+  A +E +  R    R  EP+E S+ VAFLC PAAS++TG
Sbjct  187  TNSVAPWFIATPLGDMFLGKEKA-LEMINSRCPLGRPGEPEEVSSLVAFLCLPAASYITG  245

Query  193  QIISVDGGGSIYGL  152
            Q I VDGG S+ G+
Sbjct  246  QTILVDGGVSVNGI  259



>ref|XP_007163456.1| hypothetical protein PHAVU_001G235700g [Phaseolus vulgaris]
 gb|ESW35450.1| hypothetical protein PHAVU_001G235700g [Phaseolus vulgaris]
Length=273

 Score =   273 bits (699),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 143/261 (55%), Positives = 182/261 (70%), Gaps = 1/261 (0%)
 Frame = -1

Query  916  GRWSLHGMTALVTGGTRGLGHAIVEELACLGATVYTCSRTEKELEECIQNWKAKGYKVFG  737
            GRWSL GMTALVTGGTRG+GHAIV +LA  GA V+TCSRT+ EL +C++ W+  G+KV G
Sbjct  13   GRWSLSGMTALVTGGTRGIGHAIVSDLAAFGAAVHTCSRTQTELNKCLEEWQNLGFKVTG  72

Query  736  SVCDILQPSQRENLIQLVSKQFDGKLTILVNNVAILIPKETLKSDGQDFSNTIGTNLEAS  557
            SVCD+  P QRENLIQ V+  F+G+L I VNNV I   K T++    ++S  +  NL++S
Sbjct  73   SVCDVSSPPQRENLIQEVASTFNGRLNIYVNNVGINFRKPTIEYSTDEYSQLMAVNLDSS  132

Query  556  LNLCQLAHPLLKATGNGsivfisscssfVYAPFHTIYASTKGAINSLVKNLACEWANDNI  377
             +LCQLA+PLLKA+G GSIVFISS +  V      +YA++K AIN L KNLACEWA DNI
Sbjct  133  FHLCQLAYPLLKASGKGSIVFISSVAGVVSLGTGAVYAASKAAINQLTKNLACEWAKDNI  192

Query  376  RVNAVAPWLMRTSLTESSRGEFGAVIEALIRRTLQHRLVEPKEASAAVAFLCFPAASFVT  197
            R N V PW  RTSL E    +   V E ++ RT   R+ EP+E S+ V FLC P AS++T
Sbjct  193  RSNCVVPWATRTSLVEHLLKDLKFVDE-ILSRTPIKRIAEPEEVSSLVTFLCLPGASYIT  251

Query  196  GQIISVDGGGSIYGL*TSVWI  134
            GQ+I VDGG ++ G   S+ I
Sbjct  252  GQVICVDGGLTVNGFQPSIRI  272



>ref|XP_008356736.1| PREDICTED: tropinone reductase homolog At1g07440-like isoform 
X1 [Malus domestica]
Length=264

 Score =   273 bits (697),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 141/254 (56%), Positives = 184/254 (72%), Gaps = 1/254 (0%)
 Frame = -1

Query  913  RWSLHGMTALVTGGTRGLGHAIVEELACLGATVYTCSRTEKELEECIQNWKAKGYKVFGS  734
            RWSL GMTALVTGGT+G+G+AIVEELA LGA V+TC+RTE +L +C+  W+ KG++V GS
Sbjct  7    RWSLEGMTALVTGGTKGIGYAIVEELAGLGAIVHTCARTEXDLNDCLSQWEKKGFQVTGS  66

Query  733  VCDILQPSQRENLIQLVSKQFDGKLTILVNNVAILIPKETLKSDGQDFSNTIGTNLEASL  554
            VCD++  +QRE LI  VS  FDGKL IL+NNV    PK TL+   +D+S  + TNLE++ 
Sbjct  67   VCDVVSKTQREELINKVSSLFDGKLNILINNVGANRPKATLEYTAEDYSFLMSTNLESAY  126

Query  553  NLCQLAHPLLKATGNGsivfisscssfVYAPFHTIYASTKGAINSLVKNLACEWANDNIR  374
            +LCQL+HPLLKA+G+ +IV +SS +  V     TIY++TKGAIN L +NLACEWA DNIR
Sbjct  127  HLCQLSHPLLKASGSANIVLLSSIAGVVSLNIGTIYSATKGAINQLARNLACEWAKDNIR  186

Query  373  VNAVAPWLMRTSLTESSRGEFGAVIEALIRRTLQHRLVEPKEASAAVAFLCFPAASFVTG  194
             N+VAPW + T L +   G   A +E +  R    R  EP+E S+ VAFLC PAAS++TG
Sbjct  187  TNSVAPWFIATPLGDMFLGNEKA-LEMINSRCPLGRPGEPEEVSSLVAFLCLPAASYITG  245

Query  193  QIISVDGGGSIYGL  152
            Q + VDGG S+ G+
Sbjct  246  QTLLVDGGVSVNGV  259



>ref|XP_002532998.1| tropinone reductase, putative [Ricinus communis]
 gb|EEF29390.1| tropinone reductase, putative [Ricinus communis]
Length=266

 Score =   273 bits (697),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 147/257 (57%), Positives = 184/257 (72%), Gaps = 6/257 (2%)
 Frame = -1

Query  913  RWSLHGMTALVTGGTRGLGHAIVEELACLGATVYTCSRTEKELEECIQNWKAKGYKVFGS  734
            RWSL GMTALVTGGTRG+G+A+VEELA  GA VYTCSR EKEL E I+ W+ KG+ V GS
Sbjct  13   RWSLQGMTALVTGGTRGIGYAVVEELAGFGAKVYTCSRNEKELNERIKEWEIKGFNVCGS  72

Query  733  VCDILQPSQRENLIQLVSKQFDGKLTILVNNVAILIPKETLKSDGQDFSNTIGTNLEASL  554
            VCD++   QR+NLI  VS  F+GKL ILVNN   +  K T+    +D+S+ + TNLE+  
Sbjct  73   VCDLICRDQRQNLIDTVSSSFEGKLNILVNNAGTIKHKNTVDYTLEDYSSIMSTNLESPY  132

Query  553  NLCQLAHPLLKATGNGsivfisscssfVYAPFHTIYASTKGAINSLVKNLACEWANDNIR  374
            +LCQLA+PLLKA+GNGSIVF+SS + F+  P  ++YA+TKGAIN L KNLACEWA DNIR
Sbjct  133  HLCQLAYPLLKASGNGSIVFLSSVAGFIALPLISVYAATKGAINQLTKNLACEWAKDNIR  192

Query  373  VNAVAPWLMRTSLTESSRGEFGAVIEA---LIRRTLQHRLVEPKEASAAVAFLCFPAASF  203
             NAVAP   RT++ +       AVIEA   +I R     + EP E S+ VAFLC PAAS+
Sbjct  193  TNAVAPSGTRTTILQEPD---PAVIEAYAGIIPRNPIRPIAEPNEVSSLVAFLCLPAASY  249

Query  202  VTGQIISVDGGGSIYGL  152
            + GQ+I VDGG ++ G 
Sbjct  250  INGQVICVDGGFTVNGF  266



>ref|XP_006290197.1| hypothetical protein CARUB_v10003882mg [Capsella rubella]
 gb|EOA23095.1| hypothetical protein CARUB_v10003882mg [Capsella rubella]
Length=261

 Score =   272 bits (696),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 145/254 (57%), Positives = 188/254 (74%), Gaps = 2/254 (1%)
 Frame = -1

Query  913  RWSLHGMTALVTGGTRGLGHAIVEELACLGATVYTCSRTEKELEECIQNWKAKGYKVFGS  734
            RWSL G TALVTGGTRG+G A+VEELA  GA VYTCSR+++EL+ C+ +WK+ G  V GS
Sbjct  6    RWSLAGKTALVTGGTRGIGRAVVEELAKFGAKVYTCSRSQEELDACLDDWKSSGLVVSGS  65

Query  733  VCDILQPSQRENLIQLVSKQFDGKLTILVNNVAILIPKETLKSDGQDFSNTIGTNLEASL  554
            VCD    +QR+ LIQ VS  F GKL IL+NNV I I K T+   G++++N + TNLE++ 
Sbjct  66   VCDASVRNQRDKLIQEVSSTFSGKLNILINNVGINIRKPTVDYSGEEYANIMTTNLESAF  125

Query  553  NLCQLAHPLLKATGNGsivfisscssfVYAPFHTIYASTKGAINSLVKNLACEWANDNIR  374
            +L Q+AHPLLKA+G G+IVFISS +  V     +IYA+TKGA+N L +NLACEWA+DNIR
Sbjct  126  HLSQIAHPLLKASGVGNIVFISSVAGLVRCS-GSIYAATKGALNQLARNLACEWASDNIR  184

Query  373  VNAVAPWLMRTSLTESSRGEFGAVIEALIRRTLQHRLVEPKEASAAVAFLCFPAASFVTG  194
             N VAPW ++TSL ES   E    +EA++ RT   R+ EP+E ++ VAFLC PAAS++TG
Sbjct  185  TNCVAPWYIKTSLVESLL-EKQDYLEAVVSRTPLGRVGEPEEVASLVAFLCLPAASYITG  243

Query  193  QIISVDGGGSIYGL  152
            Q+ISVDGG +I G 
Sbjct  244  QVISVDGGFTINGF  257



>ref|XP_009603003.1| PREDICTED: tropinone reductase homolog isoform X2 [Nicotiana 
tomentosiformis]
Length=269

 Score =   273 bits (697),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 144/254 (57%), Positives = 181/254 (71%), Gaps = 1/254 (0%)
 Frame = -1

Query  913  RWSLHGMTALVTGGTRGLGHAIVEELACLGATVYTCSRTEKELEECIQNWKAKGYKVFGS  734
            RWSL G TALVTGGTRG+GHA+VEELA LGATVYTCSR + EL E +Q W  KG +V GS
Sbjct  12   RWSLSGFTALVTGGTRGIGHAVVEELAELGATVYTCSRNQAELNERLQEWAVKGLQVKGS  71

Query  733  VCDILQPSQRENLIQLVSKQFDGKLTILVNNVAILIPKETLKSDGQDFSNTIGTNLEASL  554
            VCD     QR  L++ VS  FDGKL ILVNNV   I K T     ++++  + TNLE++ 
Sbjct  72   VCDASSREQRVQLMENVSSAFDGKLNILVNNVGTNIRKPTTDYSAEEYARLLSTNLESAY  131

Query  553  NLCQLAHPLLKATGNGsivfisscssfVYAPFHTIYASTKGAINSLVKNLACEWANDNIR  374
            +LCQLAHPLLKA+GNGS+VFISS +  V+    +IY +TKGA+N L +NLACEWAND+IR
Sbjct  132  HLCQLAHPLLKASGNGSVVFISSVAGLVHLSSGSIYGATKGAMNQLTRNLACEWANDSIR  191

Query  373  VNAVAPWLMRTSLTESSRGEFGAVIEALIRRTLQHRLVEPKEASAAVAFLCFPAASFVTG  194
            VN VAPW +RTSL E    E    ++ +I RT   R  E +E S+ VA+LC P AS++TG
Sbjct  192  VNGVAPWYIRTSLVEHLL-ENKTFLDGVISRTPLRRPGESQEVSSLVAYLCLPGASYITG  250

Query  193  QIISVDGGGSIYGL  152
            Q+I+VDGG ++ G 
Sbjct  251  QVIAVDGGFTVNGF  264



>gb|EYU19938.1| hypothetical protein MIMGU_mgv1a012090mg [Erythranthe guttata]
Length=262

 Score =   272 bits (696),  Expect = 3e-86, Method: Compositional matrix adjust.
 Identities = 146/257 (57%), Positives = 187/257 (73%), Gaps = 5/257 (2%)
 Frame = -1

Query  925  IMAGRWSLHGMTALVTGGTRGLGHAIVEELACLGATVYTCSRTEKELEECIQNWKAKGYK  746
            I + RWSL G TALVTGGTRG+G+A VEELA +GATVYTCSR ++EL + +Q W +KG+K
Sbjct  4    IGSSRWSLSGTTALVTGGTRGIGYATVEELAEMGATVYTCSRNQEELTQRLQEWSSKGFK  63

Query  745  VFGSVCDILQPSQRENLIQLVSKQFDGKLTILVNNVAILIPKETLKSDGQDFSNTIGTNL  566
            V GSVCD     QR  L++ VS  F+GKL IL+NNV   I K T++   +++S+ + TNL
Sbjct  64   VSGSVCDASSREQRVQLMEKVSSSFNGKLNILINNVGTNIRKPTVEYTAEEYSSIMTTNL  123

Query  565  EASLNLCQLAHPLLKATGNGsivfisscssfVYAPFHTIYASTKGAINSLVKNLACEWAN  386
            E+S +LCQLAHPLLKA+ N SIVFISS +  V+    +IY +TKGAIN L KNLACEWA 
Sbjct  124  ESSYHLCQLAHPLLKASANSSIVFISSVAGLVHLYTGSIYGATKGAINQLTKNLACEWAK  183

Query  385  DNIRVNAVAPWLMRTSLTES--SRGEFGAVIEALIRRTLQHRLVEPKEASAAVAFLCFPA  212
            DNIRVN VAPW ++TSL +      EF   +E ++ RT   R  EP+E S+ VAFLC PA
Sbjct  184  DNIRVNCVAPWYIKTSLVKHLLENEEF---LEHVVSRTPLKRPGEPQEVSSLVAFLCLPA  240

Query  211  ASFVTGQIISVDGGGSI  161
            AS++TGQ+ISVDGG ++
Sbjct  241  ASYITGQVISVDGGFTV  257



>ref|XP_008356743.1| PREDICTED: tropinone reductase homolog At1g07440-like isoform 
X2 [Malus domestica]
Length=264

 Score =   272 bits (696),  Expect = 3e-86, Method: Compositional matrix adjust.
 Identities = 141/254 (56%), Positives = 184/254 (72%), Gaps = 1/254 (0%)
 Frame = -1

Query  913  RWSLHGMTALVTGGTRGLGHAIVEELACLGATVYTCSRTEKELEECIQNWKAKGYKVFGS  734
            RWSL GMTALVTGGT+G+G+AIVEELA LGA V+TC+RTE +L +C+  W+ KG++V GS
Sbjct  7    RWSLEGMTALVTGGTKGIGYAIVEELAGLGAIVHTCARTEXDLNDCLSQWEKKGFQVTGS  66

Query  733  VCDILQPSQRENLIQLVSKQFDGKLTILVNNVAILIPKETLKSDGQDFSNTIGTNLEASL  554
            VCD++  +QRE LI  VS  FDGKL IL+NNV    PK TL+   +D+S  + TNLE++ 
Sbjct  67   VCDVVSKTQREELINKVSSLFDGKLNILINNVGANRPKATLEYTAEDYSFLMSTNLESAY  126

Query  553  NLCQLAHPLLKATGNGsivfisscssfVYAPFHTIYASTKGAINSLVKNLACEWANDNIR  374
            +LCQL+HPLLKA+G+ +IV +SS +  V     TIY++TKGAIN L +NLACEWA DNIR
Sbjct  127  HLCQLSHPLLKASGSANIVLLSSIAGVVSLNIGTIYSATKGAINQLARNLACEWAKDNIR  186

Query  373  VNAVAPWLMRTSLTESSRGEFGAVIEALIRRTLQHRLVEPKEASAAVAFLCFPAASFVTG  194
             N+VAPW + T L +   G   A +E +  R    R  EP+E S+ VAFLC PAAS++TG
Sbjct  187  TNSVAPWFIATPLGDMFLGNEKA-LEMINSRCPLGRPGEPEEVSSLVAFLCLPAASYITG  245

Query  193  QIISVDGGGSIYGL  152
            Q + VDGG S+ G+
Sbjct  246  QTLLVDGGVSVNGV  259



>ref|XP_004293354.1| PREDICTED: tropinone reductase homolog At1g07440-like [Fragaria 
vesca subsp. vesca]
Length=268

 Score =   272 bits (696),  Expect = 3e-86, Method: Compositional matrix adjust.
 Identities = 147/258 (57%), Positives = 184/258 (71%), Gaps = 4/258 (2%)
 Frame = -1

Query  913  RWSLHGMTALVTGGTRGLGHAIVEELACLGATVYTCSRTEKELEECIQNWKAKGY-KVFG  737
            RWSL GMTALVTGGT+G+G+AIVEELA LGA+VYTCSR E +L EC+  WK KGY +V G
Sbjct  9    RWSLEGMTALVTGGTKGIGYAIVEELAGLGASVYTCSRNEAQLHECLNQWKKKGYHQVTG  68

Query  736  SVCDILQPSQRENLIQLVSKQFDGKLTILVNNVAILI-PKETLKSDGQDFSNTIGTNLEA  560
            SVCD+    QRE LI  VS  F GKL ILVNNV     P  T +   +++S+ + TNLE+
Sbjct  69   SVCDVASKIQREELIHKVSSLFHGKLNILVNNVGTAHGPTPTTECTAEEYSSIMSTNLES  128

Query  559  SLNLCQLAHPLLKATGNGsivfisscssfVYA-PFHTIYASTKGAINSLVKNLACEWAND  383
            + NLCQLAHPLLK +G G+IVF+SS +  +      ++Y +TKGA+N L KNLACEWA D
Sbjct  129  TYNLCQLAHPLLKTSGAGNIVFMSSVAGVLSTWGGGSVYGATKGAMNQLAKNLACEWAKD  188

Query  382  NIRVNAVAPWLMRTSLTESSRGEFG-AVIEALIRRTLQHRLVEPKEASAAVAFLCFPAAS  206
            NIR+N+VAPW +RT   E    + G ++IEA+I RT   R+ EP+E SA VAFLC PAAS
Sbjct  189  NIRINSVAPWFIRTPFVEPMFNDDGKSLIEAVISRTPLGRIGEPEEVSALVAFLCLPAAS  248

Query  205  FVTGQIISVDGGGSIYGL  152
            ++TGQ   VDGG +I G 
Sbjct  249  YITGQTFCVDGGMTINGF  266



>gb|KFK24998.1| hypothetical protein AALP_AA8G053200 [Arabis alpina]
Length=262

 Score =   272 bits (696),  Expect = 3e-86, Method: Compositional matrix adjust.
 Identities = 142/256 (55%), Positives = 184/256 (72%), Gaps = 5/256 (2%)
 Frame = -1

Query  913  RWSLHGMTALVTGGTRGLGHAIVEELACLGATVYTCSRTEKELEECIQNWKAKGYKVFGS  734
            RWSL G TALVTGGTRG+G A+VEELA  GA VYTCSR E+EL+ C+ +WK+ G  V+GS
Sbjct  6    RWSLAGKTALVTGGTRGIGRAVVEELARFGAKVYTCSRNEEELKACLADWKSNGLVVYGS  65

Query  733  VCDILQPSQRENLIQLVSKQFDGKLTILVNNVAILIPKETLKSDGQDFSNTIGTNLEASL  554
            VCD     QRE L+Q VS  F GKL ILVNNV   I K T+    ++++  + TNLE++ 
Sbjct  66   VCDASVKDQREQLMQEVSAMFSGKLNILVNNVGTNIRKPTVDYSSEEYAKIMSTNLESAF  125

Query  553  NLCQLAHPLLKATGNGsivfisscssfVYAPFHTIYASTKGAINSLVKNLACEWANDNIR  374
            +L QLAHPLLKA+G GS+VFISS +  V+    +IY +TKGA+N L +NLACEWA DNIR
Sbjct  126  HLSQLAHPLLKASGVGSVVFISSVAGLVHVRTGSIYGATKGALNQLTRNLACEWAGDNIR  185

Query  373  VNAVAPWLMRTSLTES--SRGEFGAVIEALIRRTLQHRLVEPKEASAAVAFLCFPAASFV  200
             N VAPW ++TSL E    + +F   +EA++ RT   R+ EP+E S+ VAFLC PA+S++
Sbjct  186  TNCVAPWYIKTSLVEPLLEKKDF---VEAVVSRTPLGRVGEPEEVSSLVAFLCLPASSYI  242

Query  199  TGQIISVDGGGSIYGL  152
            TGQ+ISVDGG ++ G 
Sbjct  243  TGQVISVDGGFTVNGF  258



>ref|XP_010033094.1| PREDICTED: tropinone reductase homolog At1g07440-like [Eucalyptus 
grandis]
 gb|KCW52634.1| hypothetical protein EUGRSUZ_J02006 [Eucalyptus grandis]
Length=279

 Score =   273 bits (697),  Expect = 3e-86, Method: Compositional matrix adjust.
 Identities = 146/265 (55%), Positives = 183/265 (69%), Gaps = 5/265 (2%)
 Frame = -1

Query  940  YQQHNIMAGRWSLHGMTALVTGGTRGLGHAIVEELACLGATVYTCSRTEKELEECIQNWK  761
            Y   N    RWSLHGMTALVTGGT+G+GHAIVEEL  LG+TV+TCSR E E+ EC+++WK
Sbjct  13   YSSSNDNKNRWSLHGMTALVTGGTKGIGHAIVEELGGLGSTVHTCSRNEAEINECLKDWK  72

Query  760  AKGYKVFGSVCDILQPSQRENLIQLVSKQFDGKLTILVNNVAILIPKETLKSDGQDFSNT  581
            +KG++V GS CD+   S+RE L+  VS  FDGKL IL+NNV     K T+    +DFS  
Sbjct  73   SKGFRVSGSTCDVSSRSEREKLMLTVSSVFDGKLNILINNVGTNTLKSTMDYTAEDFSFI  132

Query  580  IGTNLEASLNLCQLAHPLLKATGNGsivfisscssfVYAPFHTIYASTKGAINSLVKNLA  401
            +  N E++ +L QLAHPLLKA+G GSIVF+SS    V     +IY++TKGA+N L KNLA
Sbjct  133  MTINFESAYHLSQLAHPLLKASGAGSIVFLSSVCGVVSINVGSIYSATKGAMNQLTKNLA  192

Query  400  CEWANDNIRVNAVAPWLMRTSLTES--SRGEFGAVIEALIRRTLQHRLVEPKEASAAVAF  227
            CEWA DNIR N+VAPW + T L E   S  +F    E +I RT   R  EP+E S+ VAF
Sbjct  193  CEWAKDNIRSNSVAPWFILTPLAEPVLSDEKFH---EEVIARTPLGRTGEPEEVSSLVAF  249

Query  226  LCFPAASFVTGQIISVDGGGSIYGL  152
            LC PAAS++TGQ I VDGG ++ G 
Sbjct  250  LCLPAASYITGQTICVDGGFTVNGF  274



>ref|XP_007218806.1| hypothetical protein PRUPE_ppa009941mg [Prunus persica]
 gb|EMJ20005.1| hypothetical protein PRUPE_ppa009941mg [Prunus persica]
Length=271

 Score =   272 bits (696),  Expect = 3e-86, Method: Compositional matrix adjust.
 Identities = 145/250 (58%), Positives = 181/250 (72%), Gaps = 5/250 (2%)
 Frame = -1

Query  913  RWSLHGMTALVTGGTRGLGHAIVEELACLGATVYTCSRTEKELEECIQNWKAKGYKVFGS  734
            RWSL GMTALVTGGTRG+G+A+VEELA  GA V+TCSR E EL +C++ W+AKG+ V GS
Sbjct  12   RWSLKGMTALVTGGTRGIGYAVVEELAGFGAAVHTCSRKEAELHKCLKEWEAKGFLVTGS  71

Query  733  VCDILQPSQRENLIQLVSKQFDGKLTILVNNVAILIPKETLKSDGQDFSNTIGTNLEASL  554
            VCD    ++RE L+Q V+  F+GKL ILVNNV   I K T +   +++S  + TNLE++ 
Sbjct  72   VCDASSKTEREKLVQQVASSFNGKLNILVNNVGTNIRKPTTEYTSEEYSIVMATNLESTY  131

Query  553  NLCQLAHPLLKATGNGsivfisscssfVYAPFHTIYASTKGAINSLVKNLACEWANDNIR  374
            +L QLAHPLL+A+G GSIVFISS +  V     TIYA++K AIN L KNLACEWA DNIR
Sbjct  132  HLSQLAHPLLRASGAGSIVFISSVAGLVSIGSGTIYAASKAAINQLTKNLACEWAKDNIR  191

Query  373  VNAVAPWLMRTSLTES--SRGEFGAVIEALIRRTLQHRLVEPKEASAAVAFLCFPAASFV  200
            +N+V PW  RTSL E      EF   +E +  RT   R+ EP+E S+ VAFLC PAAS++
Sbjct  192  INSVCPWYTRTSLVEHLLDNKEF---LEEITSRTPIDRVAEPEEVSSLVAFLCLPAASYI  248

Query  199  TGQIISVDGG  170
            TGQIISVDGG
Sbjct  249  TGQIISVDGG  258



>ref|XP_006341200.1| PREDICTED: tropinone reductase homolog [Solanum tuberosum]
Length=270

 Score =   272 bits (696),  Expect = 4e-86, Method: Compositional matrix adjust.
 Identities = 147/265 (55%), Positives = 190/265 (72%), Gaps = 2/265 (1%)
 Frame = -1

Query  943  KYQQHNIMAGRWSLHGMTALVTGGTRGLGHAIVEELACLGATVYTCSRTEKELEECIQNW  764
            K + +N   GRW+L G TALVTGGT+G+GHAIVEELA  GA VYTC R +++L++C+  W
Sbjct  4    KKESNNSEDGRWTLQGKTALVTGGTKGIGHAIVEELAEFGAIVYTCCRNQEQLDQCLMKW  63

Query  763  KAKGYKVFGSVCDILQPSQRENLIQLVSKQFDGKLTILVNNVAILIPKETLKSDGQDFSN  584
            + K YKV G VCD+    QRE L++ V+  F GKL IL+NNV I I K   +   + +S 
Sbjct  64   RGKDYKVEGCVCDLTLRLQREMLMEKVTNFFQGKLNILINNVGIQIGKPATEYTEEVYSI  123

Query  583  TIGTNLEASLNLCQLAHPLLKATGNGsivfisscssfVYAPFHTIYASTKGAINSLVKNL  404
             + TN EAS ++ Q+AHP+LKA+G+GSIVFISS   FV  P ++IY++TKGAIN L +NL
Sbjct  124  IMKTNFEASYHISQIAHPILKASGSGSIVFISSVVGFVALPANSIYSATKGAINQLTRNL  183

Query  403  ACEWANDNIRVNAVAPWLMRTSLTESSRGE--FGAVIEALIRRTLQHRLVEPKEASAAVA  230
            A EWA DNIRVNAVAPW+++TSLTE+ +       ++E  I RT   R  EPKE SA VA
Sbjct  184  AYEWAKDNIRVNAVAPWIIKTSLTEALKQNPLVKELMEKNISRTPISRAGEPKEVSAMVA  243

Query  229  FLCFPAASFVTGQIISVDGGGSIYG  155
            FLCFPAAS++TGQ+I VDGG +I G
Sbjct  244  FLCFPAASYITGQVICVDGGLTING  268



>ref|XP_010033099.1| PREDICTED: tropinone reductase homolog At1g07440-like [Eucalyptus 
grandis]
Length=279

 Score =   272 bits (696),  Expect = 4e-86, Method: Compositional matrix adjust.
 Identities = 147/265 (55%), Positives = 183/265 (69%), Gaps = 5/265 (2%)
 Frame = -1

Query  940  YQQHNIMAGRWSLHGMTALVTGGTRGLGHAIVEELACLGATVYTCSRTEKELEECIQNWK  761
            Y   N    RW LHGMT LVTGGT+G+GHAIVEELA LGATV+TCSR E E+ EC+++WK
Sbjct  13   YSSSNNNKNRWLLHGMTTLVTGGTKGIGHAIVEELARLGATVHTCSRNEAEINECLKDWK  72

Query  760  AKGYKVFGSVCDILQPSQRENLIQLVSKQFDGKLTILVNNVAILIPKETLKSDGQDFSNT  581
            +KG++V GS CD+   S+RE L+  VS  FDGKL IL+NNV     K T+    +DFS  
Sbjct  73   SKGFRVSGSTCDVSSRSEREKLMLTVSSVFDGKLNILINNVGTNTLKSTMDYTAEDFSFI  132

Query  580  IGTNLEASLNLCQLAHPLLKATGNGsivfisscssfVYAPFHTIYASTKGAINSLVKNLA  401
            + TN E++ +L QLAHPLLKA+G GSIVF+SS    V     +IY++TKGA+N L KNLA
Sbjct  133  MTTNFESAYHLSQLAHPLLKASGAGSIVFLSSVCGVVSINVGSIYSATKGAMNQLTKNLA  192

Query  400  CEWANDNIRVNAVAPWLMRTSLTES--SRGEFGAVIEALIRRTLQHRLVEPKEASAAVAF  227
            CEWA DNIR N+VAPW + T  TE   S  +F    E +I RT   R  EP+E S+ VAF
Sbjct  193  CEWAKDNIRSNSVAPWFILTPQTEPVLSDKKFH---EEVIARTPLGRTGEPEEVSSLVAF  249

Query  226  LCFPAASFVTGQIISVDGGGSIYGL  152
            LC PAAS++TGQ I VDGG ++ G 
Sbjct  250  LCLPAASYITGQTICVDGGFTVNGF  274



>ref|XP_008222016.1| PREDICTED: tropinone reductase homolog At1g07440-like [Prunus 
mume]
Length=264

 Score =   272 bits (695),  Expect = 4e-86, Method: Compositional matrix adjust.
 Identities = 139/254 (55%), Positives = 183/254 (72%), Gaps = 1/254 (0%)
 Frame = -1

Query  913  RWSLHGMTALVTGGTRGLGHAIVEELACLGATVYTCSRTEKELEECIQNWKAKGYKVFGS  734
            RWSL G+TALVTGGT+G+G+AIVEELA  GAT++TC+R E +L +C+  W+ KG+KV GS
Sbjct  7    RWSLEGLTALVTGGTKGIGYAIVEELAGFGATIHTCARNEVDLNDCLSQWENKGFKVTGS  66

Query  733  VCDILQPSQRENLIQLVSKQFDGKLTILVNNVAILIPKETLKSDGQDFSNTIGTNLEASL  554
            VCD++  SQRE LI  +S  FDGKL IL++NV   I K T +   +D++  + TNLE++ 
Sbjct  67   VCDVVSKSQREELINKLSSLFDGKLNILISNVGTNITKPTTEFTAEDYTFLMSTNLESAY  126

Query  553  NLCQLAHPLLKATGNGsivfisscssfVYAPFHTIYASTKGAINSLVKNLACEWANDNIR  374
            NLCQLAHPLLKA+G G+IVF+SS +        +IY++ KGAIN L KNLACEWA DNIR
Sbjct  127  NLCQLAHPLLKASGAGNIVFVSSVAGVTSLEVGSIYSAAKGAINQLAKNLACEWAKDNIR  186

Query  373  VNAVAPWLMRTSLTESSRGEFGAVIEALIRRTLQHRLVEPKEASAAVAFLCFPAASFVTG  194
             N+VAPW + T L +   G   + ++ +  RT   R  EP+E S+ VAFLC PAAS++TG
Sbjct  187  TNSVAPWFITTPLADHFLGNEKS-LKIIKSRTPLRRPGEPEEVSSLVAFLCLPAASYITG  245

Query  193  QIISVDGGGSIYGL  152
            Q ISVDGG ++ GL
Sbjct  246  QTISVDGGVTVNGL  259



>gb|KDP35685.1| hypothetical protein JCGZ_09123 [Jatropha curcas]
Length=268

 Score =   272 bits (695),  Expect = 4e-86, Method: Compositional matrix adjust.
 Identities = 151/258 (59%), Positives = 184/258 (71%), Gaps = 8/258 (3%)
 Frame = -1

Query  913  RWSLHGMTALVTGGTRGLGHAIVEELACLGATVYTCSRTEKELEECIQNWKAKGYKVFGS  734
            RWSL GMTALVTGGT+G+G AIVEELA  GA V+TCSR EK+  E ++ WKAKGY+V  S
Sbjct  12   RWSLKGMTALVTGGTKGIGRAIVEELAGFGARVHTCSRNEKDFNERVKEWKAKGYQVSFS  71

Query  733  VCDILQPSQRENLIQLVSKQFDGKLTILVNNVAILIPKETLKSDGQDFSNTIGTNLEASL  554
            VCD+   +QRE LI  VS  FDGKL ILVNN  I+  K+ L    +++SN + TNLEA  
Sbjct  72   VCDLTCRTQREKLIDTVSSVFDGKLNILVNNAGIVALKDCLNYTSEEYSNIMSTNLEAPY  131

Query  553  NLCQLAHPLLKATGNGsivfisscssfVYAPFHTIYASTKGAINSLVKNLACEWANDNIR  374
            ++ QLAHPLLK +GNGSIVFISS +  V  P  ++YA+TKGAIN L KNLACEWA DNIR
Sbjct  132  HISQLAHPLLKTSGNGSIVFISSIAGIVSLPIISVYAATKGAINQLTKNLACEWAKDNIR  191

Query  373  VNAVAPWLMRTS-LTESSRGEFGAVIEA---LIRRTLQHRLVEPKEASAAVAFLCFPAAS  206
             N VAP  ++T  LTE       AVI+A   ++ RT   R+ EP E S+ VAFLC PAAS
Sbjct  192  TNTVAPSGVKTEILTEPDL----AVIKAYGGVLDRTPMGRMAEPNEVSSVVAFLCLPAAS  247

Query  205  FVTGQIISVDGGGSIYGL  152
            ++TGQII VDGG ++ GL
Sbjct  248  YITGQIICVDGGITVNGL  265



>gb|KDO69163.1| hypothetical protein CISIN_1g024125mg [Citrus sinensis]
Length=272

 Score =   272 bits (695),  Expect = 5e-86, Method: Compositional matrix adjust.
 Identities = 142/263 (54%), Positives = 184/263 (70%), Gaps = 5/263 (2%)
 Frame = -1

Query  934  QHNIMAGRWSLHGMTALVTGGTRGLGHAIVEELACLGATVYTCSRTEKELEECIQNWKAK  755
            + +  + RWSL GMTALVTGGTRG+G A VEELA LGA V+TCSR E EL +C++ W++K
Sbjct  5    ESSFKSSRWSLKGMTALVTGGTRGIGQATVEELAGLGAVVHTCSRNEVELNKCLKEWQSK  64

Query  754  GYKVFGSVCDILQPSQRENLIQLVSKQFDGKLTILVNNVAILIPKETLKSDGQDFSNTIG  575
            G+ V GSVCD   P QRE LIQ V  +F+GKL ILVNNV   I K T++   +++S  + 
Sbjct  65   GFVVSGSVCDAASPDQREKLIQEVGSKFNGKLNILVNNVGTNIRKPTIEYSAEEYSKIMT  124

Query  574  TNLEASLNLCQLAHPLLKATGNGsivfisscssfVYAPFHTIYASTKGAINSLVKNLACE  395
            TN E++ +LCQL +PLLKA+G GSIVFISS     +    +IY +TK A+N L +NLACE
Sbjct  125  TNFESTYHLCQLVYPLLKASGVGSIVFISSVGGLSHVGSGSIYGATKAAMNQLTRNLACE  184

Query  394  WANDNIRVNAVAPWLMRTSLTES--SRGEFGAVIEALIRRTLQHRLVEPKEASAAVAFLC  221
            WA DNIR N+VAPW  +TSL E      EF   ++ +I RT   R+ EP+E ++ VA+LC
Sbjct  185  WAKDNIRTNSVAPWYTKTSLVERLLENKEF---VDKVIARTPLQRVGEPEEVASLVAYLC  241

Query  220  FPAASFVTGQIISVDGGGSIYGL  152
             PAAS++TGQIISVDGG +  G 
Sbjct  242  LPAASYITGQIISVDGGFTANGF  264



>gb|ABK94587.1| unknown [Populus trichocarpa]
Length=267

 Score =   271 bits (694),  Expect = 5e-86, Method: Compositional matrix adjust.
 Identities = 136/255 (53%), Positives = 180/255 (71%), Gaps = 2/255 (1%)
 Frame = -1

Query  913  RWSLHGMTALVTGGTRGLGHAIVEELACLGATVYTCSRTEKELEECIQNWKAKGYKVFGS  734
            RW L GMTALVTGGT+GLG+AIVEELA LGA V+TC+R + ++ E ++ WK KG+KV GS
Sbjct  11   RWGLQGMTALVTGGTKGLGYAIVEELAALGAIVHTCARNQDQINERVREWKEKGFKVTGS  70

Query  733  VCDILQPSQRENLIQLVSKQFDGKLTILVNNVAILIPKETLKSDGQDFSNTIGTNLEASL  554
            VCD+   ++RE L++ VS  FDGKL ILVNN    I K TL    +DF++ + TNL+++ 
Sbjct  71   VCDVSSNAEREKLMKEVSSLFDGKLNILVNNAGTNIYKATLDYTAEDFTSLMNTNLQSAF  130

Query  553  NLCQLAHPLLKATGNGsiv-fisscssfVYAPFHTIYASTKGAINSLVKNLACEWANDNI  377
            +L QLAHPLLKA+G G IV   S  S     P + +Y+++KGA+N L +NLACEWA DNI
Sbjct  131  HLSQLAHPLLKASGAGKIVFMSSIISVVSMNPQYPLYSASKGAMNQLTRNLACEWAKDNI  190

Query  376  RVNAVAPWLMRTSLTESSRGEFGAVIEALIRRTLQHRLVEPKEASAAVAFLCFPAASFVT  197
            RVNAVAPW +RT LT  S  +  ++++ +  RT   R+ EP E S+ VAFLC PA  F+T
Sbjct  191  RVNAVAPWFIRTPLTAHSLDD-ESIVKEVFNRTPMRRVGEPGEVSSVVAFLCLPAPGFLT  249

Query  196  GQIISVDGGGSIYGL  152
            GQ+I +DGG S+ G 
Sbjct  250  GQVICIDGGMSVNGF  264



>ref|XP_010452515.1| PREDICTED: tropinone reductase homolog At1g07440-like [Camelina 
sativa]
Length=262

 Score =   271 bits (693),  Expect = 8e-86, Method: Compositional matrix adjust.
 Identities = 140/256 (55%), Positives = 185/256 (72%), Gaps = 5/256 (2%)
 Frame = -1

Query  913  RWSLHGMTALVTGGTRGLGHAIVEELACLGATVYTCSRTEKELEECIQNWKAKGYKVFGS  734
            RW+L G TALVTGGTRG+G A+VEELA  GA V+TCSR + EL  C+ NWK+ G+ V GS
Sbjct  6    RWTLAGKTALVTGGTRGIGRAVVEELARFGAKVHTCSRNQDELNSCLNNWKSNGFVVSGS  65

Query  733  VCDILQPSQRENLIQLVSKQFDGKLTILVNNVAILIPKETLKSDGQDFSNTIGTNLEASL  554
            VCD     QR+ LIQ VS  F GKL IL+NNV   I K T++   +D++  + TNLE++ 
Sbjct  66   VCDASLKDQRDKLIQDVSSAFSGKLNILINNVGTNIRKPTVEYSSEDYAKIMSTNLESAF  125

Query  553  NLCQLAHPLLKATGNGsivfisscssfVYAPFHTIYASTKGAINSLVKNLACEWANDNIR  374
            +L Q+AHPLLKA+G G+IVFISS +  V+    +IY +TKGA+N L +NLACEWA+DNIR
Sbjct  126  HLSQIAHPLLKASGVGNIVFISSVAGLVHLSSGSIYGATKGALNQLTRNLACEWASDNIR  185

Query  373  VNAVAPWLMRTSLTES--SRGEFGAVIEALIRRTLQHRLVEPKEASAAVAFLCFPAASFV  200
             N VAPW ++TSL ES   + EF   ++A++ RT   R+ EP+E ++ VAFLC PAAS++
Sbjct  186  TNCVAPWYIKTSLVESLLEKKEF---VDAVVSRTPLGRVGEPEEVASLVAFLCLPAASYI  242

Query  199  TGQIISVDGGGSIYGL  152
            TGQ+ISVDGG ++ G 
Sbjct  243  TGQVISVDGGFTVNGF  258



>ref|XP_004235263.1| PREDICTED: tropinone reductase homolog [Solanum lycopersicum]
Length=268

 Score =   271 bits (693),  Expect = 9e-86, Method: Compositional matrix adjust.
 Identities = 144/254 (57%), Positives = 180/254 (71%), Gaps = 1/254 (0%)
 Frame = -1

Query  913  RWSLHGMTALVTGGTRGLGHAIVEELACLGATVYTCSRTEKELEECIQNWKAKGYKVFGS  734
            RWSL G TALVTGGTRG+GHA+VEELA LGATVYTCSR E EL E +Q W  KG +V GS
Sbjct  11   RWSLSGFTALVTGGTRGIGHAVVEELAELGATVYTCSRNEAELNERLQEWAVKGLQVKGS  70

Query  733  VCDILQPSQRENLIQLVSKQFDGKLTILVNNVAILIPKETLKSDGQDFSNTIGTNLEASL  554
            VCD     QR  L++ VS  FDGKL IL+NNV   I K T     +++++   TNLE++ 
Sbjct  71   VCDASSREQRIQLMENVSAAFDGKLNILINNVGTNIRKPTTDYTAEEYAHLFSTNLESAY  130

Query  553  NLCQLAHPLLKATGNGsivfisscssfVYAPFHTIYASTKGAINSLVKNLACEWANDNIR  374
            +LCQLAHPLLKA+GNGS+VFISS +  V+    +IY +TKGAIN L +NLACEWA DNIR
Sbjct  131  HLCQLAHPLLKASGNGSVVFISSVAGLVHLSSGSIYGATKGAINQLTRNLACEWAKDNIR  190

Query  373  VNAVAPWLMRTSLTESSRGEFGAVIEALIRRTLQHRLVEPKEASAAVAFLCFPAASFVTG  194
            VN VAPW ++TSL E    E    ++ +I RT   R  E +E S+ VA+LC P AS++TG
Sbjct  191  VNGVAPWYIKTSLVEHLL-ENKTFLDGVISRTPLRRPGESQEVSSLVAYLCLPGASYITG  249

Query  193  QIISVDGGGSIYGL  152
            Q+I+VDGG ++ G 
Sbjct  250  QVIAVDGGFTVNGF  263



>ref|XP_006435623.1| hypothetical protein CICLE_v10032389mg [Citrus clementina]
 ref|XP_006486406.1| PREDICTED: tropinone reductase homolog At1g07440-like [Citrus 
sinensis]
 gb|ESR48863.1| hypothetical protein CICLE_v10032389mg [Citrus clementina]
Length=272

 Score =   271 bits (693),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 142/263 (54%), Positives = 184/263 (70%), Gaps = 5/263 (2%)
 Frame = -1

Query  934  QHNIMAGRWSLHGMTALVTGGTRGLGHAIVEELACLGATVYTCSRTEKELEECIQNWKAK  755
            + +  + RWSL GMTALVTGGTRG+G A VEELA LGA V+TCSR E EL +C++ W++K
Sbjct  5    ESSFKSSRWSLKGMTALVTGGTRGIGQATVEELAGLGAVVHTCSRNEVELNKCLKEWQSK  64

Query  754  GYKVFGSVCDILQPSQRENLIQLVSKQFDGKLTILVNNVAILIPKETLKSDGQDFSNTIG  575
            G+ V GSVCD   P QRE LIQ V  +F+GKL ILVNNV   I K T++   +++S  + 
Sbjct  65   GFVVSGSVCDAASPDQREKLIQEVGSKFNGKLNILVNNVGTNIRKPTIEYSAEEYSKIMT  124

Query  574  TNLEASLNLCQLAHPLLKATGNGsivfisscssfVYAPFHTIYASTKGAINSLVKNLACE  395
            TN E++ +LCQL +PLLKA+G GSIVFISS     +    +IY +TK A+N L +NLACE
Sbjct  125  TNFESTYHLCQLVYPLLKASGVGSIVFISSVGGLSHIGSGSIYGATKAAMNQLTRNLACE  184

Query  394  WANDNIRVNAVAPWLMRTSLTES--SRGEFGAVIEALIRRTLQHRLVEPKEASAAVAFLC  221
            WA DNIR N+VAPW  +TSL E      EF   ++ +I RT   R+ EP+E ++ VA+LC
Sbjct  185  WAKDNIRTNSVAPWYTKTSLVEHLLENKEF---VDKVIARTPLQRVGEPEEVASLVAYLC  241

Query  220  FPAASFVTGQIISVDGGGSIYGL  152
             PAAS++TGQIISVDGG +  G 
Sbjct  242  LPAASYITGQIISVDGGFTANGF  264



>ref|XP_007205714.1| hypothetical protein PRUPE_ppa009944mg [Prunus persica]
 gb|EMJ06913.1| hypothetical protein PRUPE_ppa009944mg [Prunus persica]
Length=271

 Score =   271 bits (692),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 147/258 (57%), Positives = 184/258 (71%), Gaps = 7/258 (3%)
 Frame = -1

Query  913  RWSLHGMTALVTGGTRGLGHAIVEELACLGATVYTCSRTEKELEECIQNWKAKGY-KVFG  737
            RWSLHGMTALVTGGT+G+G+AIVEELA LGAT++TCSR E +L +C+  WK KG+ +V G
Sbjct  12   RWSLHGMTALVTGGTKGIGYAIVEELAGLGATIHTCSRNEVQLNDCLSQWKMKGFDQVTG  71

Query  736  SVCDILQPSQRENLIQLVSKQFDGKLTILVNNVAILIPKETLKSDGQDFSNTIGTNLEAS  557
            SVCD++  +QRE LI  VS  F GKL IL+NNV     K  ++S  +D+S  + TNLE++
Sbjct  72   SVCDVVSKAQREELINKVSSLFHGKLNILINNVGTTDLKPAIESTTEDYSFIMSTNLESA  131

Query  556  LNLCQLAHPLLKATGNGsivfisscs-sfVYAPFHTIYASTKGAINSLVKNLACEWANDN  380
             +  QLAHPLLKA+G G+I+F+SS +         +IYA+TKGAIN L KNLACEWA DN
Sbjct  132  YHFSQLAHPLLKASGAGNIIFLSSVAGVVSVGEGGSIYAATKGAINQLAKNLACEWAKDN  191

Query  379  IRVNAVAPWLMRTSLTES--SRGEFGAVIEALIRRTLQHRLVEPKEASAAVAFLCFPAAS  206
            IR N+VAPW +RT L E   S   F   +EA+  R    R  EPKE SA VAFLCFPAAS
Sbjct  192  IRTNSVAPWFIRTPLVEPLLSNQNF---LEAVNSRCPLGRTGEPKEVSALVAFLCFPAAS  248

Query  205  FVTGQIISVDGGGSIYGL  152
            ++TGQ I VDGG ++ GL
Sbjct  249  YITGQTICVDGGFTVNGL  266



>ref|XP_010650990.1| PREDICTED: tropinone reductase homolog isoform X2 [Vitis vinifera]
Length=519

 Score =   279 bits (713),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 147/259 (57%), Positives = 186/259 (72%), Gaps = 5/259 (2%)
 Frame = -1

Query  922  MAGRWSLHGMTALVTGGTRGLGHAIVEELACLGATVYTCSRTEKELEECIQNWKAKGYKV  743
            M  RWSL GMTALVTGGT+G+GHAIVEELA LGAT++TCSR E EL EC+++WKAKG+ V
Sbjct  259  MNSRWSLKGMTALVTGGTKGIGHAIVEELAGLGATIHTCSRKETELNECLKDWKAKGFGV  318

Query  742  FGSVCDILQPSQRENLIQLVSKQFDGKLTILVNNVAILIPKETLKSDGQDFSNTIGTNLE  563
             GSVCD+   +QRE L++ VS  F GKL ILVNN AI+I K T++   ++FS  +  N E
Sbjct  319  SGSVCDVSSRAQREKLMETVSSVFKGKLNILVNNAAIVIQKPTVEVTAEEFSTIMAINFE  378

Query  562  ASLNLCQLAHPLLKATGNGsivfisscssfVYAPFHTIYASTKGAINSLVKNLACEWAND  383
            +  +L QLAHPLLKA+G GSIVFISS +  V   + + YA TKGA+N L KNLACEWA D
Sbjct  379  SVYHLSQLAHPLLKASGAGSIVFISSVAGVVSVKYLSAYAVTKGAMNQLTKNLACEWAED  438

Query  382  NIRVNAVAPWLMRTSLTES--SRGEFGAVIEALIRRTLQHRLVEPKEASAAVAFLCFPAA  209
            NIR NAVAPW ++T + +   S   F   +E +I R    R+ +PKE S+ VAFLC PA+
Sbjct  439  NIRSNAVAPWCIKTPMVDQMLSNKTF---LEGVINRAPLRRVGDPKEVSSLVAFLCLPAS  495

Query  208  SFVTGQIISVDGGGSIYGL  152
            S++TGQ I VDGG ++ G 
Sbjct  496  SYITGQTICVDGGVTVNGF  514


 Score =   270 bits (691),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 137/250 (55%), Positives = 181/250 (72%), Gaps = 5/250 (2%)
 Frame = -1

Query  913  RWSLHGMTALVTGGTRGLGHAIVEELACLGATVYTCSRTEKELEECIQNWKAKGYKVFGS  734
            RWSL GMTALVTGGTRG+GHA+VEEL  LGA ++TCSRTE EL E +++W+ KG++V GS
Sbjct  12   RWSLKGMTALVTGGTRGIGHAVVEELTGLGARIHTCSRTETELNEYLRDWEGKGFEVTGS  71

Query  733  VCDILQPSQRENLIQLVSKQFDGKLTILVNNVAILIPKETLKSDGQDFSNTIGTNLEASL  554
            VCD+   +QRE L++ VS +F+GKL IL+NN     P  T++   ++FS+ +  N E   
Sbjct  72   VCDVSSRAQREKLMETVSSKFNGKLNILINNAGTGKPGRTVEFTAEEFSSIMAVNFEFVY  131

Query  553  NLCQLAHPLLKATGNGsivfisscssfVYAPFHTIYASTKGAINSLVKNLACEWANDNIR  374
            +LCQLAHPLLKA+G GSIV +SS +  V   + + Y +TKGA+N L K+LACEWA DNIR
Sbjct  132  HLCQLAHPLLKASGAGSIVLMSSVAGVVSLKYLSAYGATKGALNQLAKSLACEWAQDNIR  191

Query  373  VNAVAPWLMRTSLTES--SRGEFGAVIEALIRRTLQHRLVEPKEASAAVAFLCFPAASFV  200
             N++APW ++TSL E   S+  F    E +IRRT   R+ +PKE S+ VAFLC PA+S++
Sbjct  192  ANSIAPWFIKTSLVEPFLSKKSF---TEEVIRRTPLGRVGDPKEVSSLVAFLCLPASSYI  248

Query  199  TGQIISVDGG  170
            TGQ I VDGG
Sbjct  249  TGQTICVDGG  258



>ref|XP_010256821.1| PREDICTED: tropinone reductase homolog [Nelumbo nucifera]
Length=273

 Score =   271 bits (692),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 141/255 (55%), Positives = 185/255 (73%), Gaps = 1/255 (0%)
 Frame = -1

Query  916  GRWSLHGMTALVTGGTRGLGHAIVEELACLGATVYTCSRTEKELEECIQNWKAKGYKVFG  737
            GRWSL GMTALVTGGTRG+GHA+VEEL  LGA +YTC R E EL E +Q W  KG++V G
Sbjct  15   GRWSLKGMTALVTGGTRGIGHAVVEELGGLGAIIYTCCRNETELSERLQEWTRKGFQVTG  74

Query  736  SVCDILQPSQRENLIQLVSKQFDGKLTILVNNVAILIPKETLKSDGQDFSNTIGTNLEAS  557
            SVCDI     RE L++ VS  F+GKL I VNN A ++ K+ L+S  +D ++T+  N E++
Sbjct  75   SVCDISSRQGREKLMESVSSAFNGKLHIFVNNPATVVMKQILESTAEDLTSTMAVNFESA  134

Query  556  LNLCQLAHPLLKATGNGsivfisscssfVYAPFHTIYASTKGAINSLVKNLACEWANDNI  377
             +LCQLA+PLLKA+G GSIVFISS SS V  P+ ++Y ++KGAIN + K+LACEWA DNI
Sbjct  135  YHLCQLAYPLLKASGMGSIVFISSLSSVVALPYMSVYGASKGAINQVTKSLACEWAKDNI  194

Query  376  RVNAVAPWLMRTSLTESSRGEFGAVIEALIRRTLQHRLVEPKEASAAVAFLCFPAASFVT  197
            R N+VAP ++RTS  E    E   ++E +I R    R+ EP+E S+ VAFLC P+AS++T
Sbjct  195  RTNSVAPSIIRTSSVEPYL-ENKELVERVISRAPITRIGEPQEVSSLVAFLCLPSASYIT  253

Query  196  GQIISVDGGGSIYGL  152
            GQ+I VDGG ++ G 
Sbjct  254  GQVICVDGGYAVNGF  268



>ref|XP_006341006.1| PREDICTED: tropinone reductase 1-like [Solanum tuberosum]
Length=270

 Score =   271 bits (692),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 145/265 (55%), Positives = 186/265 (70%), Gaps = 2/265 (1%)
 Frame = -1

Query  943  KYQQHNIMAGRWSLHGMTALVTGGTRGLGHAIVEELACLGATVYTCSRTEKELEECIQNW  764
            K + +N   GRW+L G TALVTGGT+G+GHAIVEELA  GA VYTC R +++L++C++ W
Sbjct  4    KNESNNSEDGRWTLQGKTALVTGGTKGIGHAIVEELAGFGAIVYTCCRNQEQLDQCLERW  63

Query  763  KAKGYKVFGSVCDILQPSQRENLIQLVSKQFDGKLTILVNNVAILIPKETLKSDGQDFSN  584
            + KGYKV G VCD+    QRE L++ V   F GKL IL+NN  ILI K   +    D+S 
Sbjct  64   RGKGYKVEGCVCDLTLRPQREMLMEKVINFFQGKLNILINNAGILIVKAATEFTEDDYSL  123

Query  583  TIGTNLEASLNLCQLAHPLLKATGNGsivfisscssfVYAPFHTIYASTKGAINSLVKNL  404
             + TN EAS ++ Q+AHP+LKA+ NG+IVFISS +  V  P  +IYA+TKGA+N L +NL
Sbjct  124  IMKTNFEASHHISQIAHPILKASENGNIVFISSVAGLVALPISSIYAATKGAMNQLTRNL  183

Query  403  ACEWANDNIRVNAVAPWLMRTSLTESSRGE--FGAVIEALIRRTLQHRLVEPKEASAAVA  230
            A EWA DNIRVNAVAPW++ T L E+++        +E  I RT   R  EPKE SA VA
Sbjct  184  AYEWAKDNIRVNAVAPWIINTPLIEAAKKNPLTKERMEKSISRTPICRAGEPKEVSAMVA  243

Query  229  FLCFPAASFVTGQIISVDGGGSIYG  155
            FLCFPAAS++TGQ+I VDGG +I G
Sbjct  244  FLCFPAASYITGQVICVDGGLTING  268



>ref|XP_002319562.1| hypothetical protein POPTR_0013s02690g [Populus trichocarpa]
 gb|EEE95485.1| hypothetical protein POPTR_0013s02690g [Populus trichocarpa]
Length=260

 Score =   270 bits (691),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 139/258 (54%), Positives = 183/258 (71%), Gaps = 2/258 (1%)
 Frame = -1

Query  922  MAGRWSLHGMTALVTGGTRGLGHAIVEELACLGATVYTCSRTEKELEECIQNWKAKGYKV  743
            M  RWSL GMTALVTGGT+G+G+A+V+ELA LGA V+TC+R + +L E I+ W  KG+KV
Sbjct  1    MEKRWSLQGMTALVTGGTKGIGYAVVDELAALGAIVHTCARNQDQLNERIREWNEKGFKV  60

Query  742  FGSVCDILQPSQRENLIQLVSKQFDGKLTILVNNVAILIPKETLKSDGQDFSNTIGTNLE  563
             GSVCD+   ++RE L++ VS +FDGKL ILVNN    I K TL    +DF++ + TNL+
Sbjct  61   TGSVCDVSSDAEREKLMEEVSSRFDGKLNILVNNAGTNIYKATLDYTAEDFTSLMNTNLQ  120

Query  562  ASLNLCQLAHPLLKATGNGsivfissc-ssfVYAPFHTIYASTKGAINSLVKNLACEWAN  386
            ++ +L QLAHPLLKA+G G IVF+SS  S     P + +Y+++KGA+N L +NLACEWA 
Sbjct  121  SAFHLSQLAHPLLKASGAGKIVFMSSIGSVVSVNPQYPLYSASKGAMNQLTRNLACEWAK  180

Query  385  DNIRVNAVAPWLMRTSLTESSRGEFGAVIEALIRRTLQHRLVEPKEASAAVAFLCFPAAS  206
            DNIRVN VAPW +RT LT  S  +  ++ + +  RT   R+ EP E S+ VAFLC PA  
Sbjct  181  DNIRVNGVAPWFVRTPLTAHSLDD-ESIAKEVFSRTPMRRVGEPGEVSSVVAFLCLPAPG  239

Query  205  FVTGQIISVDGGGSIYGL  152
            F+TGQII VDGG S+ G 
Sbjct  240  FLTGQIICVDGGMSVNGF  257



>ref|XP_010067433.1| PREDICTED: tropinone reductase homolog At1g07440 [Eucalyptus 
grandis]
Length=272

 Score =   271 bits (692),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 141/267 (53%), Positives = 187/267 (70%), Gaps = 5/267 (2%)
 Frame = -1

Query  946  AKYQQHNIMAGRWSLHGMTALVTGGTRGLGHAIVEELACLGATVYTCSRTEKELEECIQN  767
            A   Q N    RW+L G TALVTGGTRG+GHAIVEEL+  GATV+TCSR  +EL +C++ 
Sbjct  2    AAAAQKNDRESRWTLRGTTALVTGGTRGIGHAIVEELSGFGATVHTCSRNGEELSKCLKE  61

Query  766  WKAKGYKVFGSVCDILQPSQRENLIQLVSKQFDGKLTILVNNVAILIPKETLKSDGQDFS  587
            W+ KG  V GSVCD+    QRE+LI+ VS +F G+L IL+NN  +   K T+    ++FS
Sbjct  62   WEGKGLAVTGSVCDLSSRDQRESLIKEVSSKFGGRLNILINNAGMNFRKPTVDYTVEEFS  121

Query  586  NTIGTNLEASLNLCQLAHPLLKATGNGsivfisscssfVYAPFHTIYASTKGAINSLVKN  407
              + TN +++ +LCQ+AHPLLKA+G GSI+FISS +  V     ++YA+TKGAIN + KN
Sbjct  122  KIMATNFDSAYHLCQIAHPLLKASGAGSIIFISSVAGVVSLGTGSVYAATKGAINQITKN  181

Query  406  LACEWANDNIRVNAVAPWLMRTSLTES--SRGEFGAVIEALIRRTLQHRLVEPKEASAAV  233
            LACEWA DNIR N++APW +RTSL E+     EF    + +I RT   R+ EPKE ++  
Sbjct  182  LACEWAKDNIRSNSIAPWYIRTSLVENLLKNKEF---YDGIIARTPLQRVGEPKEVASLA  238

Query  232  AFLCFPAASFVTGQIISVDGGGSIYGL  152
            AFLC PAAS++TGQ+ISVDGG ++ G 
Sbjct  239  AFLCLPAASYITGQVISVDGGMTVNGF  265



>ref|XP_004294665.1| PREDICTED: tropinone reductase homolog At1g07440-like [Fragaria 
vesca subsp. vesca]
Length=272

 Score =   271 bits (692),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 148/258 (57%), Positives = 185/258 (72%), Gaps = 4/258 (2%)
 Frame = -1

Query  913  RWSLHGMTALVTGGTRGLGHAIVEELACLGATVYTCSRTEKELEECIQNWKAKGY-KVFG  737
            RWSL GMTALVTGGT+G+G+AIVEELA LGA+VYTCSR E +L EC+  WK KGY +V G
Sbjct  9    RWSLEGMTALVTGGTKGIGYAIVEELAGLGASVYTCSRNEAQLHECLNQWKKKGYHQVTG  68

Query  736  SVCDILQPSQRENLIQLVSKQFDGKLTILVNNVAILI-PKETLKSDGQDFSNTIGTNLEA  560
            SVCD+    QRE LI  VS  F GKL ILVNNV     P  T +   +++S+ + TNLE+
Sbjct  69   SVCDVASKIQREELIHKVSSLFHGKLNILVNNVGTSHGPTPTTECTAEEYSSIMNTNLES  128

Query  559  SLNLCQLAHPLLKATGNGsivfisscssfVYA-PFHTIYASTKGAINSLVKNLACEWAND  383
            + NLCQLAHPLLK +G G+IVF+SS +  V      ++Y  TKGA+N L KNLACEWA D
Sbjct  129  TYNLCQLAHPLLKTSGAGNIVFMSSVAGVVSTWGGGSVYGVTKGAMNQLAKNLACEWAKD  188

Query  382  NIRVNAVAPWLMRTSLTESSRGEFG-AVIEALIRRTLQHRLVEPKEASAAVAFLCFPAAS  206
            NIR+N+VAPW++RT L E    + G +++EA+I RT   R+ EP+E SA VAFLC PAAS
Sbjct  189  NIRINSVAPWVVRTPLAEPMFTDDGKSLLEAVISRTPLGRIGEPEEVSALVAFLCLPAAS  248

Query  205  FVTGQIISVDGGGSIYGL  152
            ++TGQ   VDGG +I G 
Sbjct  249  YITGQTFCVDGGMTINGF  266



>ref|XP_008221969.1| PREDICTED: tropinone reductase homolog At1g07440-like [Prunus 
mume]
Length=271

 Score =   270 bits (691),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 144/258 (56%), Positives = 180/258 (70%), Gaps = 7/258 (3%)
 Frame = -1

Query  913  RWSLHGMTALVTGGTRGLGHAIVEELACLGATVYTCSRTEKELEECIQNWKAKGY-KVFG  737
            RWSLHGMTALVTGGT+G+G+AIVEELA LGAT++TCSR E +L +C+  WK KG+ +V G
Sbjct  12   RWSLHGMTALVTGGTKGIGYAIVEELAGLGATIHTCSRNEVQLNDCLSQWKTKGFDQVTG  71

Query  736  SVCDILQPSQRENLIQLVSKQFDGKLTILVNNVAILIPKETLKSDGQDFSNTIGTNLEAS  557
            SVCD++  +QRE LI  VS  F GKL IL+NNV     K  ++S  +D+S  + TNLE++
Sbjct  72   SVCDVVSNAQREELINKVSSLFQGKLNILINNVGTAELKPAIESTTEDYSCIMSTNLESA  131

Query  556  LNLCQLAHPLLKATGNGsiv-fisscssfVYAPFHTIYASTKGAINSLVKNLACEWANDN  380
             +  QLAHPLLKA+G G+I+   S           +IY +TKGA+N L KNLACEWA DN
Sbjct  132  YHFSQLAHPLLKASGAGNIIFLSSVAGVVSVGTAGSIYGATKGAMNQLAKNLACEWAKDN  191

Query  379  IRVNAVAPWLMRTSLTES--SRGEFGAVIEALIRRTLQHRLVEPKEASAAVAFLCFPAAS  206
            IR N+VAPW +RT LTE   S   F   +EA+  R    R  EPKE SA VAFLCFPAAS
Sbjct  192  IRTNSVAPWFIRTPLTEPLLSNQNF---LEAVNSRCPLGRTGEPKEVSALVAFLCFPAAS  248

Query  205  FVTGQIISVDGGGSIYGL  152
            ++TGQ I VDGG ++ GL
Sbjct  249  YITGQTICVDGGFTVNGL  266



>ref|XP_010542632.1| PREDICTED: tropinone reductase homolog At1g07440 [Tarenaya hassleriana]
Length=262

 Score =   270 bits (690),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 141/257 (55%), Positives = 185/257 (72%), Gaps = 1/257 (0%)
 Frame = -1

Query  922  MAGRWSLHGMTALVTGGTRGLGHAIVEELACLGATVYTCSRTEKELEECIQNWKAKGYKV  743
            M  RWSL GMTALVTGGT+G+G A+VEELA  GA ++TC+R E  L  C++ W++KG++V
Sbjct  1    MDNRWSLRGMTALVTGGTKGIGQAVVEELAGFGAKIHTCARDEALLNRCLREWQSKGFQV  60

Query  742  FGSVCDILQPSQRENLIQLVSKQFDGKLTILVNNVAILIPKETLKSDGQDFSNTIGTNLE  563
             GSVCD+    +R+ L+Q VS QF GKL IL+NNV   I K  ++   +DFS ++ TNLE
Sbjct  61   TGSVCDLSSRPERQRLMQDVSSQFHGKLNILINNVGTFILKPAVECTEEDFSISMATNLE  120

Query  562  ASLNLCQLAHPLLKATGNGsivfisscssfVYAPFHTIYASTKGAINSLVKNLACEWAND  383
            ++ +LCQL HPLLKA+G GSIVFISS S  V A   +IY  TKGA+N L +NLACEWA+D
Sbjct  121  SAYHLCQLGHPLLKASGYGSIVFISSASGVVSALNTSIYGPTKGAMNQLARNLACEWASD  180

Query  382  NIRVNAVAPWLMRTSLTESSRGEFGAVIEALIRRTLQHRLVEPKEASAAVAFLCFPAASF  203
            NIR N+VAPWL  T L E+   E   ++EA+I RT   R+ EP++ S+ VAF+C PAAS+
Sbjct  181  NIRANSVAPWLTVTPLVENLL-EDEKLMEAIISRTPLGRVAEPRDVSSLVAFMCLPAASY  239

Query  202  VTGQIISVDGGGSIYGL  152
            +TGQ I VDGG ++ G 
Sbjct  240  ITGQTICVDGGYTVNGF  256



>gb|KCW65561.1| hypothetical protein EUGRSUZ_G02957 [Eucalyptus grandis]
Length=271

 Score =   270 bits (691),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 140/263 (53%), Positives = 186/263 (71%), Gaps = 5/263 (2%)
 Frame = -1

Query  934  QHNIMAGRWSLHGMTALVTGGTRGLGHAIVEELACLGATVYTCSRTEKELEECIQNWKAK  755
            Q N    RW+L G TALVTGGTRG+GHAIVEEL+  GATV+TCSR  +EL +C++ W+ K
Sbjct  5    QKNDRESRWTLRGTTALVTGGTRGIGHAIVEELSGFGATVHTCSRNGEELSKCLKEWEGK  64

Query  754  GYKVFGSVCDILQPSQRENLIQLVSKQFDGKLTILVNNVAILIPKETLKSDGQDFSNTIG  575
            G  V GSVCD+    QRE+LI+ VS +F G+L IL+NN  +   K T+    ++FS  + 
Sbjct  65   GLAVTGSVCDLSSRDQRESLIKEVSSKFGGRLNILINNAGMNFRKPTVDYTVEEFSKIMA  124

Query  574  TNLEASLNLCQLAHPLLKATGNGsivfisscssfVYAPFHTIYASTKGAINSLVKNLACE  395
            TN +++ +LCQ+AHPLLKA+G GSI+FISS +  V     ++YA+TKGAIN + KNLACE
Sbjct  125  TNFDSAYHLCQIAHPLLKASGAGSIIFISSVAGVVSLGTGSVYAATKGAINQITKNLACE  184

Query  394  WANDNIRVNAVAPWLMRTSLTES--SRGEFGAVIEALIRRTLQHRLVEPKEASAAVAFLC  221
            WA DNIR N++APW +RTSL E+     EF    + +I RT   R+ EPKE ++  AFLC
Sbjct  185  WAKDNIRSNSIAPWYIRTSLVENLLKNKEF---YDGIIARTPLQRVGEPKEVASLAAFLC  241

Query  220  FPAASFVTGQIISVDGGGSIYGL  152
             PAAS++TGQ+ISVDGG ++ G 
Sbjct  242  LPAASYITGQVISVDGGMTVNGF  264



>ref|XP_011076794.1| PREDICTED: tropinone reductase homolog [Sesamum indicum]
Length=266

 Score =   270 bits (691),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 148/258 (57%), Positives = 186/258 (72%), Gaps = 5/258 (2%)
 Frame = -1

Query  922  MAG----RWSLHGMTALVTGGTRGLGHAIVEELACLGATVYTCSRTEKELEECIQNWKAK  755
            MAG    RWSL GMTALVTGGTRG+G A VEELA +GATVYTCSR E+EL + +Q W +K
Sbjct  1    MAGSSNSRWSLSGMTALVTGGTRGIGQATVEELAEMGATVYTCSRNEEELNQRLQEWNSK  60

Query  754  GYKVFGSVCDILQPSQRENLIQLVSKQFDGKLTILVNNVAILIPKETLKSDGQDFSNTIG  575
            G+KV GSVCD     +R  L++ VS  F+ KL IL+NNV   I K T+    +++S  + 
Sbjct  61   GFKVSGSVCDASSREERVQLMEKVSSVFNAKLDILINNVGTNIRKPTVDFTAEEYSTIMA  120

Query  574  TNLEASLNLCQLAHPLLKATGNGsivfisscssfVYAPFHTIYASTKGAINSLVKNLACE  395
            TNLE+S +L QLAHPLLKA+G  SIVFISS +  V+    +IY +TKGAIN L KNLACE
Sbjct  121  TNLESSYHLSQLAHPLLKASGTSSIVFISSVAGLVHLFSGSIYGATKGAINQLTKNLACE  180

Query  394  WANDNIRVNAVAPWLMRTSLTESSRGEFGAVIEALIRRTLQHRLVEPKEASAAVAFLCFP  215
            WA DNIRVN+VAPW ++TSLT+S   E    ++ +I RT   R  EP+E S+ VAFLC P
Sbjct  181  WAKDNIRVNSVAPWYIKTSLTKSLL-ENTKFLDNVISRTPLKRPGEPQEVSSLVAFLCLP  239

Query  214  AASFVTGQIISVDGGGSI  161
            AAS++TGQII+VDGG ++
Sbjct  240  AASYITGQIIAVDGGMTV  257



>ref|XP_004984926.1| PREDICTED: tropinone reductase homolog At1g07440-like [Setaria 
italica]
Length=274

 Score =   270 bits (691),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 145/256 (57%), Positives = 185/256 (72%), Gaps = 1/256 (0%)
 Frame = -1

Query  919  AGRWSLHGMTALVTGGTRGLGHAIVEELACLGATVYTCSRTEKELEECIQNWKAKGYKVF  740
            +GRW+LHG TALVTGGTRG+G A+VEELA LGA V+TCSR E+EL E I+ W+A+G++V 
Sbjct  14   SGRWALHGKTALVTGGTRGIGRAVVEELAALGAAVHTCSRKEEELGERIKEWEARGFRVT  73

Query  739  GSVCDILQPSQRENLIQLVSKQFDGKLTILVNNVAILIPKETLKSDGQDFSNTIGTNLEA  560
            GSVCD+    QRE L++ V+ +F GKL ILVNNV   I K T +   +++S  + TNLE+
Sbjct  74   GSVCDLSARDQRERLLREVADRFGGKLDILVNNVGTNIRKPTTEFSAEEYSFLMATNLES  133

Query  559  SLNLCQLAHPLLKATGNGsivfisscssfVYAPFHTIYASTKGAINSLVKNLACEWANDN  380
            + +LCQ+AHPLLK +G+GSIVFISS +  V     TIYA TKGAIN L K LACEWA DN
Sbjct  134  AYHLCQIAHPLLKLSGSGSIVFISSVAGVVSVFSGTIYAMTKGAINQLTKTLACEWARDN  193

Query  379  IRVNAVAPWLMRTSLTESSRGEFGAVIEALIRRTLQHRLVEPKEASAAVAFLCFPAASFV  200
            IR N+VAPW + TSLTE    E  +  E ++ RT   R+ EP E SA VAFLC P ++++
Sbjct  194  IRANSVAPWYITTSLTEKLL-ESNSFKEQVVSRTPLGRVGEPGEISALVAFLCMPGSTYI  252

Query  199  TGQIISVDGGGSIYGL  152
            TGQ ISVDGG ++ G 
Sbjct  253  TGQTISVDGGTTVNGF  268



>ref|XP_009343858.1| PREDICTED: tropinone reductase homolog At1g07440-like [Pyrus 
x bretschneideri]
Length=271

 Score =   270 bits (690),  Expect = 3e-85, Method: Compositional matrix adjust.
 Identities = 143/260 (55%), Positives = 180/260 (69%), Gaps = 5/260 (2%)
 Frame = -1

Query  934  QHNIMAGRWSLHGMTALVTGGTRGLGHAIVEELACLGATVYTCSRTEKELEECIQNWKAK  755
            + N    RWSLHG  ALVTGGTRG+G+A+VEELA  GA V+TCSR E EL +C++ WKAK
Sbjct  5    ESNYPNARWSLHGGAALVTGGTRGIGYAVVEELAGFGAAVHTCSRNEAELSKCLEQWKAK  64

Query  754  GYKVFGSVCDILQPSQRENLIQLVSKQFDGKLTILVNNVAILIPKETLKSDGQDFSNTIG  575
            G+ V GSVCD    ++RE L+  V+  F+GKL ILVNNV   I K T +   +++S  + 
Sbjct  65   GFSVTGSVCDTSSTTEREKLMDQVASTFNGKLNILVNNVGTNIRKPTTEYASEEYSLLMA  124

Query  574  TNLEASLNLCQLAHPLLKATGNGsivfisscssfVYAPFHTIYASTKGAINSLVKNLACE  395
            TNLE++ +L QLAHPLLKA+G GSIVFISS +        +IY ++K AIN L KNLACE
Sbjct  125  TNLESTYHLSQLAHPLLKASGRGSIVFISSVAGVASIASGSIYGASKAAINQLTKNLACE  184

Query  394  WANDNIRVNAVAPWLMRTSLTES--SRGEFGAVIEALIRRTLQHRLVEPKEASAAVAFLC  221
            WA DNIR NAV PW  RTSL E      EF   +E +  RT   R+ EP+E S+ VAFLC
Sbjct  185  WAKDNIRSNAVCPWYTRTSLVEHLLDNKEF---LEEITSRTPLERVAEPEEVSSLVAFLC  241

Query  220  FPAASFVTGQIISVDGGGSI  161
             PAAS++TGQ+ISVDGG ++
Sbjct  242  LPAASYITGQVISVDGGMTV  261



>emb|CAD20555.1| tropinone reductase I [Calystegia sepium]
Length=263

 Score =   270 bits (689),  Expect = 3e-85, Method: Compositional matrix adjust.
 Identities = 143/257 (56%), Positives = 181/257 (70%), Gaps = 2/257 (1%)
 Frame = -1

Query  916  GRWSLHGMTALVTGGTRGLGHAIVEELACLGATVYTCSRTEKELEECIQNWKAKGYKVFG  737
            G+WSL GMTALVTGGTRG+G+ IVEELA  GA VY CSR + E++EC+  W+ KG+KV G
Sbjct  6    GKWSLQGMTALVTGGTRGIGYGIVEELAGFGAEVYICSRKQNEVDECVGKWREKGFKVAG  65

Query  736  SVCDILQPSQRENLIQLVSKQFDGKLTILVNNVAILIPKETLKSDGQDFSNTIGTNLEAS  557
            S CDI   +QRE LI+ V+  F+GKL ILVNN   ++PK+  +   +D++  +GTN EAS
Sbjct  66   SACDISSRTQREELIKNVAHHFNGKLNILVNNAGTILPKDATEFKAEDYTLIMGTNFEAS  125

Query  556  LNLCQLAHPLLKATGNGsivfisscssfVYAPFHTIYASTKGAINSLVKNLACEWANDNI  377
             +LCQLAHP LKA+  G+IVF SS +  +     T+YA++KGAIN + KNLACEWA DNI
Sbjct  126  FHLCQLAHPFLKASSMGTIVFNSSVAGIIPVFKTTLYAASKGAINQVTKNLACEWAKDNI  185

Query  376  RVNAVAPWLMRTSLTE--SSRGEFGAVIEALIRRTLQHRLVEPKEASAAVAFLCFPAASF  203
            RVN+VAPW++RT L     S  E    IE +IRRT   R  E  E S+ VAFLC PAAS+
Sbjct  186  RVNSVAPWVIRTKLVNDFDSESEGSEEIERMIRRTPISRPGEVGEVSSLVAFLCLPAASY  245

Query  202  VTGQIISVDGGGSIYGL  152
            +TGQ I VDGG +I G 
Sbjct  246  ITGQTICVDGGYTITGF  262



>gb|KDP44893.1| hypothetical protein JCGZ_01393 [Jatropha curcas]
Length=274

 Score =   270 bits (690),  Expect = 3e-85, Method: Compositional matrix adjust.
 Identities = 143/250 (57%), Positives = 179/250 (72%), Gaps = 5/250 (2%)
 Frame = -1

Query  913  RWSLHGMTALVTGGTRGLGHAIVEELACLGATVYTCSRTEKELEECIQNWKAKGYKVFGS  734
            RWSL G+TALVTGGTRG+G+A VEELA LGA V+TCSR E EL +C++ W+AKG+ V GS
Sbjct  12   RWSLQGLTALVTGGTRGIGYATVEELAGLGARVHTCSRNEAELSKCLKEWEAKGFLVTGS  71

Query  733  VCDILQPSQRENLIQLVSKQFDGKLTILVNNVAILIPKETLKSDGQDFSNTIGTNLEASL  554
            VCD     QRENLI+ V   F G L ILVNNV   I K T++   ++F+  + TNLE + 
Sbjct  72   VCDASSREQRENLIREVGSAFSGSLNILVNNVGTNIRKPTIEYSAEEFAKLMTTNLETTY  131

Query  553  NLCQLAHPLLKATGNGsivfisscssfVYAPFHTIYASTKGAINSLVKNLACEWANDNIR  374
            +LCQLAHPLLKA+G GSIVFISS     +    +IY ++KGAIN L KNLACEWA DNIR
Sbjct  132  HLCQLAHPLLKASGVGSIVFISSVGGLAHIGSGSIYGASKGAINQLTKNLACEWAKDNIR  191

Query  373  VNAVAPWLMRTSLTES--SRGEFGAVIEALIRRTLQHRLVEPKEASAAVAFLCFPAASFV  200
             N VAPW ++TSL E+     EF   ++ ++ RT   R+ E KE S+ VAFLC PAAS++
Sbjct  192  SNCVAPWYIKTSLVENLLDNKEF---LDKVVSRTPLQRVGEAKEVSSLVAFLCLPAASYI  248

Query  199  TGQIISVDGG  170
            TGQ+I+VDGG
Sbjct  249  TGQVIAVDGG  258



>gb|KCW65560.1| hypothetical protein EUGRSUZ_G02957 [Eucalyptus grandis]
Length=271

 Score =   270 bits (689),  Expect = 4e-85, Method: Compositional matrix adjust.
 Identities = 139/263 (53%), Positives = 186/263 (71%), Gaps = 5/263 (2%)
 Frame = -1

Query  934  QHNIMAGRWSLHGMTALVTGGTRGLGHAIVEELACLGATVYTCSRTEKELEECIQNWKAK  755
            Q N    RW+L G TALVTGGTRG+GHAIVEEL+  GATV+TCSR  +EL +C++ W+ K
Sbjct  5    QKNDRESRWTLRGTTALVTGGTRGIGHAIVEELSGFGATVHTCSRNGEELSKCLKEWEGK  64

Query  754  GYKVFGSVCDILQPSQRENLIQLVSKQFDGKLTILVNNVAILIPKETLKSDGQDFSNTIG  575
            G  V GSVCD+    QRE+LI+ VS +F G+L IL+NN  +   K T+    ++FS  + 
Sbjct  65   GLAVTGSVCDLSSRDQRESLIKEVSSKFGGRLNILINNAGMNFRKPTVDYTVEEFSKIMA  124

Query  574  TNLEASLNLCQLAHPLLKATGNGsivfisscssfVYAPFHTIYASTKGAINSLVKNLACE  395
            TN +++ +LCQ+AHPLLKA+G GSI+FISS +  V     ++YA+TKGAIN + KNLACE
Sbjct  125  TNFDSAYHLCQIAHPLLKASGAGSIIFISSVAGVVSLGTGSVYAATKGAINQITKNLACE  184

Query  394  WANDNIRVNAVAPWLMRTSLTES--SRGEFGAVIEALIRRTLQHRLVEPKEASAAVAFLC  221
            WA DNIR N++APW +RTSL E+     EF    + +I RT   R+ EP+E ++  AFLC
Sbjct  185  WAKDNIRSNSIAPWYIRTSLVENLLKNKEF---YDGIIARTPLQRVGEPREVASLAAFLC  241

Query  220  FPAASFVTGQIISVDGGGSIYGL  152
             PAAS++TGQ+ISVDGG ++ G 
Sbjct  242  LPAASYITGQVISVDGGMTVNGF  264



>gb|EMT31236.1| Tropinone reductase-like protein [Aegilops tauschii]
Length=317

 Score =   271 bits (693),  Expect = 4e-85, Method: Compositional matrix adjust.
 Identities = 145/258 (56%), Positives = 187/258 (72%), Gaps = 5/258 (2%)
 Frame = -1

Query  919  AGRWSLHGMTALVTGGTRGLGHAIVEELACLGATVYTCSRTEKELEECIQNWKAKGYKVF  740
            AGRWSLHG  ALVTGGTRG+G A+VEELA LGA V+TCSR E EL E ++ W+AKG++V 
Sbjct  58   AGRWSLHGRRALVTGGTRGIGRAVVEELAALGAAVHTCSRKEAELGERLKEWEAKGFRVT  117

Query  739  GSVCDILQPSQRENLIQLVSKQFDGKLTILVNNVAILIPKETLKSDGQDFSNTIGTNLEA  560
            GSVCD+    QRE L+Q V+ +F GKL IL+NNV     K T +    ++S  + TNLE+
Sbjct  118  GSVCDVSVRDQRELLLQDVAGRFAGKLDILINNVGTNHRKPTTEYSADEYSFIMATNLES  177

Query  559  SLNLCQLAHPLLKATGNGsivfisscssfVYAPFHTIYASTKGAINSLVKNLACEWANDN  380
            + +LCQLAHPLLKA+G  SIVFISS S  V     +IY  TKGA+N L KNLACEWA DN
Sbjct  178  AYHLCQLAHPLLKASGVASIVFISSVSGVVAISSGSIYGMTKGAMNQLAKNLACEWAKDN  237

Query  379  IRVNAVAPWLMRTSLTES--SRGEFGAVIEALIRRTLQHRLVEPKEASAAVAFLCFPAAS  206
            IR+N+VAPW ++TSL E   ++ +F   ++++ RRT   R+ EP+E S+ VAFLC P +S
Sbjct  238  IRINSVAPWYIKTSLVEEDLAKEDF---VDSIARRTPMRRVGEPEEVSSLVAFLCMPGSS  294

Query  205  FVTGQIISVDGGGSIYGL  152
            ++TGQ ISVDGG +I G+
Sbjct  295  YITGQTISVDGGMTINGM  312



>ref|XP_002520507.1| tropinone reductase, putative [Ricinus communis]
 gb|EEF41920.1| tropinone reductase, putative [Ricinus communis]
Length=268

 Score =   270 bits (689),  Expect = 4e-85, Method: Compositional matrix adjust.
 Identities = 146/256 (57%), Positives = 177/256 (69%), Gaps = 5/256 (2%)
 Frame = -1

Query  913  RWSLHGMTALVTGGTRGLGHAIVEELACLGATVYTCSRTEKELEECIQNWKAKGYKVFGS  734
            RWSL GMTALVTGGT+G+GHAIVEELA LGA VYTCSR E +L ECI  WKAKG+KV GS
Sbjct  9    RWSLEGMTALVTGGTKGIGHAIVEELAGLGAEVYTCSRNEVQLNECIHKWKAKGFKVTGS  68

Query  733  VCDILQPSQRENLIQLVSKQFDGKLTILVNNVAILIPKETLKSDGQDFSNTIGTNLEASL  554
            VCD+   + RE+L+  +S  F+ KL IL+NNV   I K T+K   +DFS  + TN E++ 
Sbjct  69   VCDVSSRANREDLMNRISSLFNRKLNILINNVGTNIGKPTVKYTAEDFSYLVNTNFESAY  128

Query  553  NLCQLAHPLLKATGNGsivfisscssfVYAPFHTIYASTKGAINSLVKNLACEWANDNIR  374
            +L QLA PLLK +G GSIVF+SS S  +     TIY +TK A+N L KNLACEWA DNIR
Sbjct  129  HLSQLAQPLLKGSGAGSIVFMSSVSGVLSVNVGTIYGATKAAMNQLTKNLACEWAKDNIR  188

Query  373  VNAVAPWLMRTSLTES--SRGEFGAVIEALIRRTLQHRLVEPKEASAAVAFLCFPAASFV  200
             N VAPW +RT LTE   +   F   I A   RT   R+ E +E S+ VAFLC PAAS++
Sbjct  189  TNCVAPWFIRTPLTEQDLNHERFSNSIAA---RTPMGRVGEAEEVSSLVAFLCLPAASYI  245

Query  199  TGQIISVDGGGSIYGL  152
            TGQ I VDGG ++ G 
Sbjct  246  TGQTICVDGGMTVNGF  261



>ref|XP_006424907.1| hypothetical protein CICLE_v10029040mg [Citrus clementina]
 gb|ESR38147.1| hypothetical protein CICLE_v10029040mg [Citrus clementina]
Length=272

 Score =   270 bits (689),  Expect = 4e-85, Method: Compositional matrix adjust.
 Identities = 139/255 (55%), Positives = 177/255 (69%), Gaps = 2/255 (1%)
 Frame = -1

Query  913  RWSLHGMTALVTGGTRGLGHAIVEELACLGATVYTCSRTEKELEECIQNWKAKGYKVFGS  734
            RW++HGMTALVTGGT+GLGHA+VEELA LGA V+TCSR E +L ECI++WK KG+K+ GS
Sbjct  14   RWTVHGMTALVTGGTKGLGHAVVEELAELGAAVHTCSRNEADLSECIRDWKTKGFKLTGS  73

Query  733  VCDILQPSQRENLIQLVSKQFDGKLTILVNNVAILIPKETLKSDGQDFSNTIGTNLEASL  554
            VCD+    +RE LI  VS  FDGKL IL+NNV   I K T++   +DFS  + TN E++ 
Sbjct  74   VCDVSSRIEREKLINQVSSLFDGKLNILINNVGTTIRKATVEYTAEDFSFLMATNFESAY  133

Query  553  NLCQLAHPLLKATGNGs-ivfisscssfVYAPFHTIYASTKGAINSLVKNLACEWANDNI  377
            NLCQLAHPLLKA+G  S ++  S C         +IY +TKGA+N L + LACEWA DNI
Sbjct  134  NLCQLAHPLLKASGAASIVLMSSVCGVVSVVDAGSIYGATKGAMNHLARILACEWAQDNI  193

Query  376  RVNAVAPWLMRTSLTESSRGEFGAVIEALIRRTLQHRLVEPKEASAAVAFLCFPAASFVT  197
            R N+V PW + T LTES   +  A ++ +  RT   R  +P E S+ VAFLC PAAS++T
Sbjct  194  RTNSVTPWFVATPLTESFLND-EAFLKEVEGRTPMRRTGKPNEISSLVAFLCMPAASYIT  252

Query  196  GQIISVDGGGSIYGL  152
            GQ IS DGG ++ G 
Sbjct  253  GQTISADGGFTVNGF  267



>ref|XP_008375982.1| PREDICTED: tropinone reductase homolog At1g07440-like isoform 
X1 [Malus domestica]
Length=264

 Score =   269 bits (688),  Expect = 5e-85, Method: Compositional matrix adjust.
 Identities = 143/256 (56%), Positives = 185/256 (72%), Gaps = 5/256 (2%)
 Frame = -1

Query  913  RWSLHGMTALVTGGTRGLGHAIVEELACLGATVYTCSRTEKELEECIQNWKAKGYKVFGS  734
            RWSL+GMTALVTGGT+G+G+AIVEELA LGA V+TCSR E +L +C+  W+ KG++V GS
Sbjct  7    RWSLNGMTALVTGGTKGIGYAIVEELAGLGAIVHTCSRNEVDLNDCLSQWEKKGFQVTGS  66

Query  733  VCDILQPSQRENLIQLVSKQFDGKLTILVNNVAILIPKETLKSDGQDFSNTIGTNLEASL  554
            VCD++  +QRE LI  VS  FDGKL IL+NNV    PK TL+   +D+S  +  NLE++ 
Sbjct  67   VCDVVSKTQREELINKVSSLFDGKLNILINNVGANRPKATLEYTAEDYSFMMSINLESAY  126

Query  553  NLCQLAHPLLKATGNGsivfisscssfVYAPFHTIYASTKGAINSLVKNLACEWANDNIR  374
            +LCQL+HPLLKA+G+ +IVF+SS +  V     +IY++TKGAIN L KNLACEWA D IR
Sbjct  127  HLCQLSHPLLKASGSANIVFLSSVAGVVSLEVGSIYSATKGAINQLAKNLACEWAKDKIR  186

Query  373  VNAVAPWLMRTSLTESSRG--EFGAVIEALIRRTLQHRLVEPKEASAAVAFLCFPAASFV  200
             N+VAPW + T L E   G  +  AVI +   R    R  EP+E S+ VAFLC PAAS++
Sbjct  187  TNSVAPWFITTPLGEMFLGNKKKSAVINS---RCPLGRPGEPEEVSSLVAFLCLPAASYI  243

Query  199  TGQIISVDGGGSIYGL  152
            TGQ I+VDGG ++ GL
Sbjct  244  TGQTITVDGGVTVNGL  259



>gb|ABF95188.1| Tropinone reductase, putative, expressed [Oryza sativa Japonica 
Group]
Length=271

 Score =   269 bits (688),  Expect = 5e-85, Method: Compositional matrix adjust.
 Identities = 145/256 (57%), Positives = 186/256 (73%), Gaps = 5/256 (2%)
 Frame = -1

Query  913  RWSLHGMTALVTGGTRGLGHAIVEELACLGATVYTCSRTEKELEECIQNWKAKGYKVFGS  734
            RWSL G TALVTGGTRG+G A+VEELA LGATV+TCSR E+EL E ++ W+A+G++V  S
Sbjct  16   RWSLQGKTALVTGGTRGIGRAVVEELAALGATVHTCSRKEEELSERLKEWEARGFRVTTS  75

Query  733  VCDILQPSQRENLIQLVSKQFDGKLTILVNNVAILIPKETLKSDGQDFSNTIGTNLEASL  554
            VCD+    QRE L++ V+  F GKL ILVNNV   I K T +   +++S  + TNLE++ 
Sbjct  76   VCDLSVRDQRERLLRQVADLFGGKLDILVNNVGTNIRKPTTEFSAEEYSFMMATNLESAY  135

Query  553  NLCQLAHPLLKATGNGsivfisscssfVYAPFHTIYASTKGAINSLVKNLACEWANDNIR  374
            +LCQL+HPLLKA+G+GSIVFISS    V     ++YA TKGAIN L KNLACEWA DNIR
Sbjct  136  HLCQLSHPLLKASGSGSIVFISSVCGLVAVFSGSLYAMTKGAINQLTKNLACEWARDNIR  195

Query  373  VNAVAPWLMRTSLTES--SRGEFGAVIEALIRRTLQHRLVEPKEASAAVAFLCFPAASFV  200
             N++APW +RTSLTE   +  +F     A++ RT   R+ EP+E S+ VAFLC P +S++
Sbjct  196  SNSIAPWYIRTSLTEGLLANKDFEG---AVVSRTPLRRVGEPEEVSSLVAFLCMPGSSYI  252

Query  199  TGQIISVDGGGSIYGL  152
            TGQ ISVDGG +I GL
Sbjct  253  TGQTISVDGGMTINGL  268



>gb|KEH34749.1| NAD(P)-binding rossmann-fold protein [Medicago truncatula]
Length=275

 Score =   269 bits (688),  Expect = 7e-85, Method: Compositional matrix adjust.
 Identities = 140/262 (53%), Positives = 184/262 (70%), Gaps = 5/262 (2%)
 Frame = -1

Query  913  RWSLHGMTALVTGGTRGLGHAIVEELACLGATVYTCSRTEKELEECIQNWKAKGYKVFGS  734
            RWSL GMTALVTGGTRG+GHAIV +L   GA V+TCSRTE EL +C+Q W++KG+ V GS
Sbjct  16   RWSLTGMTALVTGGTRGIGHAIVNDLVAFGAAVHTCSRTESELSKCLQEWQSKGFSVTGS  75

Query  733  VCDILQPSQRENLIQLVSKQFDGKLTILVNNVAILIPKETLKSDGQDFSNTIGTNLEASL  554
            VCD+   SQRE+L+Q V+  F+GKL I VNNV     K T++   +++S  +  NL++S 
Sbjct  76   VCDVSSRSQRESLVQEVASTFNGKLNIFVNNVGSNFRKPTIEYTAEEYSELMTINLDSSF  135

Query  553  NLCQLAHPLLKATGNGsivfisscssfVYAPFHTIYASTKGAINSLVKNLACEWANDNIR  374
            +LCQL+HPLLK +GNGSIVFISS +  V     ++YA++K AIN L KNLACEWA DNIR
Sbjct  136  HLCQLSHPLLKESGNGSIVFISSVAGVVSLGTGSVYAASKAAINQLTKNLACEWAIDNIR  195

Query  373  VNAVAPWLMRTSLTES--SRGEFGAVIEALIRRTLQHRLVEPKEASAAVAFLCFPAASFV  200
             N V PW  RT L E      +F   ++ ++ RT   R+ EP+E S+ V FLC PAAS++
Sbjct  196  SNCVVPWATRTPLVEHLFQNQKF---VDDILSRTPLKRIAEPEEVSSLVTFLCLPAASYI  252

Query  199  TGQIISVDGGGSIYGL*TSVWI  134
            TGQ+I VDGG +++G   S+ I
Sbjct  253  TGQVICVDGGLTVFGFQPSMRI  274



>ref|XP_007016329.1| NAD(P)-binding Rossmann-fold superfamily protein [Theobroma cacao]
 gb|EOY33948.1| NAD(P)-binding Rossmann-fold superfamily protein [Theobroma cacao]
Length=320

 Score =   271 bits (692),  Expect = 7e-85, Method: Compositional matrix adjust.
 Identities = 145/268 (54%), Positives = 184/268 (69%), Gaps = 5/268 (2%)
 Frame = -1

Query  949  NAKYQQHNIMAGRWSLHGMTALVTGGTRGLGHAIVEELACLGATVYTCSRTEKELEECIQ  770
            N      N  + RWSL GMTALVTGGTRG+G AIVEELA LGA VYTCSR E EL++C+ 
Sbjct  51   NQSMAPRNTKSNRWSLQGMTALVTGGTRGVGRAIVEELAGLGARVYTCSRNENELDKCLV  110

Query  769  NWKAKGYKVFGSVCDILQPSQRENLIQLVSKQFDGKLTILVNNVAILIPKETLKSDGQDF  590
            +WK+ G++V GS+CD+    +RE L++ VS  FD KL IL+NNV   I K  ++   ++ 
Sbjct  111  DWKSLGFEVSGSICDVSMGVERERLMENVSSLFDSKLNILINNVGTNIRKPMVEFTAEEV  170

Query  589  SNTIGTNLEASLNLCQLAHPLLKATGNGsivfisscssfVYAPFHTIYASTKGAINSLVK  410
            S  + TN E+  NLCQLA+PLLKA+G GS+VF SS S FV     ++  +TKGAIN L +
Sbjct  171  STLLATNFESVFNLCQLAYPLLKASGVGSVVFTSSVSGFVSLKSMSLQGATKGAINQLTR  230

Query  409  NLACEWANDNIRVNAVAPWLMRTSLTES--SRGEFGAVIEALIRRTLQHRLVEPKEASAA  236
            NLACEWA DNIR NAVAPW +RTS+ E   S  E+   +E +  RT   RL +P E S+ 
Sbjct  231  NLACEWAKDNIRSNAVAPWYIRTSMVEQVLSNQEY---LEEVYSRTPLQRLGDPTEVSSL  287

Query  235  VAFLCFPAASFVTGQIISVDGGGSIYGL  152
            VAFLC PA+S++TGQII VDGG S+ G 
Sbjct  288  VAFLCLPASSYITGQIICVDGGMSVNGF  315



>ref|XP_011023546.1| PREDICTED: tropinone reductase homolog At1g07440-like [Populus 
euphratica]
Length=260

 Score =   268 bits (686),  Expect = 7e-85, Method: Compositional matrix adjust.
 Identities = 135/258 (52%), Positives = 181/258 (70%), Gaps = 2/258 (1%)
 Frame = -1

Query  922  MAGRWSLHGMTALVTGGTRGLGHAIVEELACLGATVYTCSRTEKELEECIQNWKAKGYKV  743
            M  RWSL GMTALVTGGT+G+G+A+V+ELA LGA V+TC+R +++L E I+ W  KG+KV
Sbjct  1    MEKRWSLQGMTALVTGGTKGIGYAVVDELAALGAIVHTCARNQEQLNERIREWNEKGFKV  60

Query  742  FGSVCDILQPSQRENLIQLVSKQFDGKLTILVNNVAILIPKETLKSDGQDFSNTIGTNLE  563
             GSVCD+   ++RE L++ VS +FDGKL ILVNN    I K TL    +DF++ + TNL+
Sbjct  61   TGSVCDVSSDAEREKLMEEVSSRFDGKLNILVNNAGTNIYKATLDYTAEDFTSLMNTNLQ  120

Query  562  ASLNLCQLAHPLLKATGNGsiv-fisscssfVYAPFHTIYASTKGAINSLVKNLACEWAN  386
            ++ +L QLAHPLLKA+G G IV   S  S       + +Y+++KGA+N L +NLACEWA 
Sbjct  121  SAFHLSQLAHPLLKASGAGKIVFMSSITSVVSINTQYPLYSASKGAMNQLTRNLACEWAK  180

Query  385  DNIRVNAVAPWLMRTSLTESSRGEFGAVIEALIRRTLQHRLVEPKEASAAVAFLCFPAAS  206
            DNIRVNAVAPW +RT LT  S  +   +++ +  RT   R+ EP E S+ VAFLC PA  
Sbjct  181  DNIRVNAVAPWFIRTPLTTPSLDDEN-ILKEVFNRTPMKRVGEPGEVSSVVAFLCLPAPG  239

Query  205  FVTGQIISVDGGGSIYGL  152
            F+TGQ+I +DGG S+ G 
Sbjct  240  FLTGQVICIDGGMSVNGF  257



>ref|XP_008387076.1| PREDICTED: tropinone reductase homolog At1g07440-like isoform 
X1 [Malus domestica]
Length=264

 Score =   268 bits (686),  Expect = 7e-85, Method: Compositional matrix adjust.
 Identities = 143/256 (56%), Positives = 184/256 (72%), Gaps = 5/256 (2%)
 Frame = -1

Query  913  RWSLHGMTALVTGGTRGLGHAIVEELACLGATVYTCSRTEKELEECIQNWKAKGYKVFGS  734
            RWSL GMTALVTGGT+G+G+AIVEELA LGA V+TCSR E +L +C+  W+ KG++V GS
Sbjct  7    RWSLKGMTALVTGGTKGIGYAIVEELAGLGAIVHTCSRNEVDLNDCLSQWEKKGFQVTGS  66

Query  733  VCDILQPSQRENLIQLVSKQFDGKLTILVNNVAILIPKETLKSDGQDFSNTIGTNLEASL  554
            VCD++  +QRE LI  VS  FDGKL IL+NNV    PK TL+   +D+S  +  NLE++ 
Sbjct  67   VCDVVSKTQREELINKVSSLFDGKLNILINNVGANRPKATLEYTAEDYSFMMSINLESAY  126

Query  553  NLCQLAHPLLKATGNGsivfisscssfVYAPFHTIYASTKGAINSLVKNLACEWANDNIR  374
            +LCQL+HPLLKA+G+ +IVF+SS +  V     +IY++TKGAIN L KNLACEWA D IR
Sbjct  127  HLCQLSHPLLKASGSANIVFLSSVAGVVSLEVGSIYSATKGAINQLAKNLACEWAKDKIR  186

Query  373  VNAVAPWLMRTSLTESSRG--EFGAVIEALIRRTLQHRLVEPKEASAAVAFLCFPAASFV  200
             N+VAPW + T L E   G  +  AVI +   R    R  EP+E S+ VAFLC PAAS++
Sbjct  187  TNSVAPWFITTPLGEMFLGNKKKSAVINS---RCPLGRPGEPEEVSSLVAFLCLPAASYI  243

Query  199  TGQIISVDGGGSIYGL  152
            TGQ I+VDGG ++ GL
Sbjct  244  TGQTITVDGGVTVNGL  259



>ref|XP_004307471.1| PREDICTED: tropinone reductase homolog [Fragaria vesca subsp. 
vesca]
Length=271

 Score =   269 bits (687),  Expect = 8e-85, Method: Compositional matrix adjust.
 Identities = 141/254 (56%), Positives = 179/254 (70%), Gaps = 1/254 (0%)
 Frame = -1

Query  931  HNIMAGRWSLHGMTALVTGGTRGLGHAIVEELACLGATVYTCSRTEKELEECIQNWKAKG  752
             N+   RWSL G TALVTGGTRG+G+A+VEELA LGA V+TCSR  +ELE C++ W AKG
Sbjct  6    RNLATPRWSLTGTTALVTGGTRGIGYAVVEELASLGAYVFTCSRNAEELERCLKEWSAKG  65

Query  751  YKVFGSVCDILQPSQRENLIQLVSKQFDGKLTILVNNVAILIPKETLKSDGQDFSNTIGT  572
            +++ G VCD+   S+RE L++ V   F G+L I VNNV   I K T +   +++S  + T
Sbjct  66   FRITGIVCDVSVKSEREKLMEQVGVSFAGRLNIFVNNVGTNIRKPTTEYTFEEYSKVMST  125

Query  571  NLEASLNLCQLAHPLLKATGNGsivfisscssfVYAPFHTIYASTKGAINSLVKNLACEW  392
            NLE++ +LCQ+AHPLLK +G GS+VFISS +  V     TIYA++K AIN L KNLACEW
Sbjct  126  NLESTYHLCQIAHPLLKGSGAGSVVFISSVAGLVSLGSGTIYAASKAAINQLTKNLACEW  185

Query  391  ANDNIRVNAVAPWLMRTSLTESSRGEFGAVIEALIRRTLQHRLVEPKEASAAVAFLCFPA  212
            A DNIR NAVAPW  RTSL E    E    +E +  RT  +R+ EP+E S+ VAFLC PA
Sbjct  186  AKDNIRSNAVAPWYTRTSLVEHML-EDKKFLEEVTSRTPLNRVAEPEEVSSLVAFLCLPA  244

Query  211  ASFVTGQIISVDGG  170
            AS++TGQII VDGG
Sbjct  245  ASYITGQIICVDGG  258



>ref|XP_010096620.1| Tropinone reductase-like protein [Morus notabilis]
 gb|EXB65288.1| Tropinone reductase-like protein [Morus notabilis]
Length=275

 Score =   269 bits (687),  Expect = 8e-85, Method: Compositional matrix adjust.
 Identities = 142/258 (55%), Positives = 182/258 (71%), Gaps = 5/258 (2%)
 Frame = -1

Query  919  AGRWSLHGMTALVTGGTRGLGHAIVEELACLGATVYTCSRTEKELEECIQNWKAKGYKVF  740
            + RWSL G TA+VTGGTRG+G A+VEELA  GA V+TCSR E+EL+ C++ W+ KG  V 
Sbjct  14   SSRWSLKGTTAVVTGGTRGIGRAVVEELAEFGAAVHTCSRNEEELKRCLKEWEGKGLLVS  73

Query  739  GSVCDILQPSQRENLIQLVSKQFDGKLTILVNNVAILIPKETLKSDGQDFSNTIGTNLEA  560
            GSVCD    +QRE LIQ V+  F+GKL I+VNNV   I K TL+   ++++  + TN E+
Sbjct  74   GSVCDASSKTQREKLIQEVASAFNGKLNIIVNNVGTNIRKPTLEYTAEEYTLLLSTNFES  133

Query  559  SLNLCQLAHPLLKATGNGsivfisscssfVYAPFHTIYASTKGAINSLVKNLACEWANDN  380
            + +LCQLAHPLLKA+G GSIVFISS +  +     +IYA++K AIN L KNLACEWA DN
Sbjct  134  TYHLCQLAHPLLKASGGGSIVFISSVAGLLNISSGSIYAASKAAINQLTKNLACEWAKDN  193

Query  379  IRVNAVAPWLMRTSLTES--SRGEFGAVIEALIRRTLQHRLVEPKEASAAVAFLCFPAAS  206
            IR N VAPW  RTSL E      EF   +E +I +T  HR+ EP+E S+ V +LC PAAS
Sbjct  194  IRSNCVAPWYTRTSLVEHLLDNKEF---LEEIIDKTPLHRVAEPEEVSSLVTYLCLPAAS  250

Query  205  FVTGQIISVDGGGSIYGL  152
            ++TGQ+ISVDGG  + G 
Sbjct  251  YITGQVISVDGGMIVNGF  268



>ref|XP_008233480.1| PREDICTED: tropinone reductase homolog At1g07440-like [Prunus 
mume]
Length=271

 Score =   268 bits (686),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 145/253 (57%), Positives = 182/253 (72%), Gaps = 5/253 (2%)
 Frame = -1

Query  913  RWSLHGMTALVTGGTRGLGHAIVEELACLGATVYTCSRTEKELEECIQNWKAKGYKVFGS  734
            RWSL GMTALVTGGTRG+G+A+VEELA  GA V+TCSR E EL +C++ W+AKG+ V GS
Sbjct  12   RWSLKGMTALVTGGTRGIGYAVVEELAGFGAAVHTCSRNEAELHKCLKEWEAKGFLVTGS  71

Query  733  VCDILQPSQRENLIQLVSKQFDGKLTILVNNVAILIPKETLKSDGQDFSNTIGTNLEASL  554
            VCD    ++RE L+Q V+  F+GKL ILVNNV   I K T +   +++S  + TNLE++ 
Sbjct  72   VCDASSKTEREKLVQQVASSFNGKLNILVNNVGTNIRKPTTEYTSEEYSIVMATNLESTY  131

Query  553  NLCQLAHPLLKATGNGsivfisscssfVYAPFHTIYASTKGAINSLVKNLACEWANDNIR  374
            +L QLAHPLL+A+G GSIVFISS +  V     TIYA++K AIN L KNLACEWA DNIR
Sbjct  132  HLSQLAHPLLRASGAGSIVFISSVAGLVGIGSGTIYAASKAAINQLTKNLACEWAKDNIR  191

Query  373  VNAVAPWLMRTSLTESSRG--EFGAVIEALIRRTLQHRLVEPKEASAAVAFLCFPAASFV  200
             N+V PW  RTSL     G  EF   +E +  RT   R+ EP+E S+ VAFLC PAAS++
Sbjct  192  SNSVCPWYTRTSLVGHLLGNKEF---LEEITSRTPIDRVAEPEEVSSLVAFLCLPAASYI  248

Query  199  TGQIISVDGGGSI  161
            TGQIISVDGG ++
Sbjct  249  TGQIISVDGGMTV  261



>ref|XP_010491151.1| PREDICTED: tropinone reductase homolog At1g07440-like [Camelina 
sativa]
Length=262

 Score =   268 bits (685),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 137/256 (54%), Positives = 185/256 (72%), Gaps = 5/256 (2%)
 Frame = -1

Query  913  RWSLHGMTALVTGGTRGLGHAIVEELACLGATVYTCSRTEKELEECIQNWKAKGYKVFGS  734
            RW+L G TALVTGGTRG+G A+VEELA  GA V+TCSR + EL  C+ +WK+ G+ V GS
Sbjct  6    RWTLAGKTALVTGGTRGIGRAVVEELARFGAKVHTCSRNQDELNACLNDWKSNGFVVSGS  65

Query  733  VCDILQPSQRENLIQLVSKQFDGKLTILVNNVAILIPKETLKSDGQDFSNTIGTNLEASL  554
            VCD     QR+ LIQ VS  F GKL IL+NNV   I K T++   +D++  + TNLE++ 
Sbjct  66   VCDASVKDQRDKLIQDVSSAFSGKLNILINNVGTNIRKPTVEYSSEDYAKIMSTNLESAF  125

Query  553  NLCQLAHPLLKATGNGsivfisscssfVYAPFHTIYASTKGAINSLVKNLACEWANDNIR  374
            +L Q+AHPLLKA+G G++VFISS +  V+    +IY +TKGA+N L +NLACEWA+DNIR
Sbjct  126  HLSQIAHPLLKASGVGNVVFISSVAGLVHLSSGSIYGATKGALNQLTRNLACEWASDNIR  185

Query  373  VNAVAPWLMRTSLTES--SRGEFGAVIEALIRRTLQHRLVEPKEASAAVAFLCFPAASFV  200
             N VAPW ++TSL E+   + EF   ++A++ RT   R+ EP+E ++ VAFLC PAAS++
Sbjct  186  TNCVAPWYIKTSLVETLLEKKEF---VDAVVSRTPLGRVGEPEEVASLVAFLCLPAASYI  242

Query  199  TGQIISVDGGGSIYGL  152
            TGQ+ISVDGG ++ G 
Sbjct  243  TGQVISVDGGFTVNGF  258



>ref|XP_006488386.1| PREDICTED: tropinone reductase homolog At1g07440-like isoform 
X1 [Citrus sinensis]
 ref|XP_006488389.1| PREDICTED: tropinone reductase homolog At1g07440-like [Citrus 
sinensis]
Length=272

 Score =   268 bits (686),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 141/255 (55%), Positives = 176/255 (69%), Gaps = 2/255 (1%)
 Frame = -1

Query  913  RWSLHGMTALVTGGTRGLGHAIVEELACLGATVYTCSRTEKELEECIQNWKAKGYKVFGS  734
            RW++ GMTALVTGGT+GLGHA+VEELA LGA V+TCSR E +L ECI++WK KG+KV GS
Sbjct  14   RWTVQGMTALVTGGTKGLGHAVVEELAELGAAVHTCSRNEADLSECIRDWKTKGFKVTGS  73

Query  733  VCDILQPSQRENLIQLVSKQFDGKLTILVNNVAILIPKETLKSDGQDFSNTIGTNLEASL  554
            VCD+    +RE LI  VS  FDGKL IL+NNV   I K T++   +DFS  + TN E++ 
Sbjct  74   VCDVSSRIEREKLINQVSSLFDGKLNILINNVGTTIRKATVEYTAEDFSFLMATNFESAY  133

Query  553  NLCQLAHPLLKATGNGsiv-fisscssfVYAPFHTIYASTKGAINSLVKNLACEWANDNI  377
            NLCQLAHPLLKA+G  SIV   S C         +IY +TKGA+N L + LACEWA DNI
Sbjct  134  NLCQLAHPLLKASGAASIVLMSSVCGVVSVVDAGSIYGATKGAMNHLARILACEWAQDNI  193

Query  376  RVNAVAPWLMRTSLTESSRGEFGAVIEALIRRTLQHRLVEPKEASAAVAFLCFPAASFVT  197
            R N+V PW + T LTES   +  A ++ +  RT   R  +P E S+ VAFLC PAAS++T
Sbjct  194  RTNSVTPWFVATPLTESFLND-EAFLKEVEGRTPMRRTGKPNEISSLVAFLCMPAASYIT  252

Query  196  GQIISVDGGGSIYGL  152
            GQ IS DGG ++ G 
Sbjct  253  GQTISADGGFTVNGF  267



>ref|XP_006488387.1| PREDICTED: tropinone reductase homolog At1g07440-like isoform 
X2 [Citrus sinensis]
Length=272

 Score =   268 bits (686),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 141/255 (55%), Positives = 176/255 (69%), Gaps = 2/255 (1%)
 Frame = -1

Query  913  RWSLHGMTALVTGGTRGLGHAIVEELACLGATVYTCSRTEKELEECIQNWKAKGYKVFGS  734
            RW++ GMTALVTGGT+GLGHA+VEELA LGA V+TCSR E +L ECI++WK KG+KV GS
Sbjct  14   RWTVQGMTALVTGGTKGLGHAVVEELAELGAAVHTCSRNEADLSECIRDWKTKGFKVTGS  73

Query  733  VCDILQPSQRENLIQLVSKQFDGKLTILVNNVAILIPKETLKSDGQDFSNTIGTNLEASL  554
            VCD+    +RE LI  VS  FDGKL IL+NNV   I K T++   +DFS  + TN E++ 
Sbjct  74   VCDVSSRIEREKLINQVSSLFDGKLNILINNVGTTIRKATVEYTAEDFSFLMATNFESAY  133

Query  553  NLCQLAHPLLKATGNGsiv-fisscssfVYAPFHTIYASTKGAINSLVKNLACEWANDNI  377
            NLCQLAHPLLKA+G  SIV   S C         +IY +TKGA+N L + LACEWA DNI
Sbjct  134  NLCQLAHPLLKASGAASIVLMSSVCGVVSVVDAGSIYGATKGAMNHLARILACEWAQDNI  193

Query  376  RVNAVAPWLMRTSLTESSRGEFGAVIEALIRRTLQHRLVEPKEASAAVAFLCFPAASFVT  197
            R N+V PW + T LTES   +  A ++ +  RT   R  +P E S+ VAFLC PAAS++T
Sbjct  194  RTNSVTPWFVATPLTESFLND-EAFLKEVEGRTPMRRTGKPNEISSLVAFLCMPAASYIT  252

Query  196  GQIISVDGGGSIYGL  152
            GQ IS DGG ++ G 
Sbjct  253  GQTISADGGFTVNGF  267



>ref|XP_011023547.1| PREDICTED: tropinone reductase homolog At1g07440-like [Populus 
euphratica]
Length=260

 Score =   268 bits (684),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 138/258 (53%), Positives = 184/258 (71%), Gaps = 2/258 (1%)
 Frame = -1

Query  922  MAGRWSLHGMTALVTGGTRGLGHAIVEELACLGATVYTCSRTEKELEECIQNWKAKGYKV  743
            M  RWSL GMTALVTGGT+G+G+A+V+ELA LGA V+TC+R + +L E I+ W  KG+KV
Sbjct  1    MEKRWSLQGMTALVTGGTKGIGYAVVDELAALGAIVHTCARNKDQLNERIREWNEKGFKV  60

Query  742  FGSVCDILQPSQRENLIQLVSKQFDGKLTILVNNVAILIPKETLKSDGQDFSNTIGTNLE  563
             GSVCD+   ++RE L++ VS +FDGKL ILVNN    I K TL    +DF++ + TNL+
Sbjct  61   TGSVCDVSSDAEREKLMEEVSSRFDGKLNILVNNAGTNIYKATLDYTAEDFTSLMNTNLQ  120

Query  562  ASLNLCQLAHPLLKATGNGsivfisscssfVYAPF-HTIYASTKGAINSLVKNLACEWAN  386
            ++ +L QLAHPLLKA+G G IVF+SS  S V     + +Y+++KGA+N L +NLACEWA 
Sbjct  121  SAFHLSQLAHPLLKASGAGKIVFMSSIGSVVSVNTQYPVYSASKGAMNQLTRNLACEWAK  180

Query  385  DNIRVNAVAPWLMRTSLTESSRGEFGAVIEALIRRTLQHRLVEPKEASAAVAFLCFPAAS  206
            DNIRVNAVAPW +RT LT  S  +   +++ +  RT   R+ EP E S+ VAFLC PA  
Sbjct  181  DNIRVNAVAPWFIRTPLTTPSLDDEN-ILKEVFNRTPMKRVGEPGEVSSVVAFLCLPAPG  239

Query  205  FVTGQIISVDGGGSIYGL  152
            F+TGQ+I +DGG S+ G 
Sbjct  240  FLTGQVICIDGGMSVNGF  257



>ref|XP_010067438.1| PREDICTED: tropinone reductase homolog At1g07440-like [Eucalyptus 
grandis]
 gb|KCW65563.1| hypothetical protein EUGRSUZ_G02959 [Eucalyptus grandis]
Length=271

 Score =   268 bits (685),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 138/261 (53%), Positives = 183/261 (70%), Gaps = 1/261 (0%)
 Frame = -1

Query  934  QHNIMAGRWSLHGMTALVTGGTRGLGHAIVEELACLGATVYTCSRTEKELEECIQNWKAK  755
            Q N    RW+L G TALVTGGTRG+GHAIVEEL+  GATV+TCSR  +EL +C++ W+ K
Sbjct  5    QKNDRESRWTLRGTTALVTGGTRGIGHAIVEELSGFGATVHTCSRNGEELSKCLKEWEGK  64

Query  754  GYKVFGSVCDILQPSQRENLIQLVSKQFDGKLTILVNNVAILIPKETLKSDGQDFSNTIG  575
            G  V GSVCD+    QRENLI+ VS +F G+L IL+NN      K T+    ++FS  + 
Sbjct  65   GLAVTGSVCDLSSRDQRENLIKEVSSKFGGRLNILINNAGTNFRKPTVDYTVEEFSKIMA  124

Query  574  TNLEASLNLCQLAHPLLKATGNGsivfisscssfVYAPFHTIYASTKGAINSLVKNLACE  395
            TN +++ +LCQ+AHPLLKA+G GSI+FISS +  V     ++YA+TKGAIN + KNLACE
Sbjct  125  TNFDSAYHLCQIAHPLLKASGAGSIIFISSVAGVVSLGTGSVYAATKGAINQITKNLACE  184

Query  394  WANDNIRVNAVAPWLMRTSLTESSRGEFGAVIEALIRRTLQHRLVEPKEASAAVAFLCFP  215
            WA DNIR N++APW  RTS  E+   +   + + +I RT   R+ EPKE ++  AFLC P
Sbjct  185  WAKDNIRSNSIAPWYTRTSFVENLL-KNKELYDGIIARTPLQRVGEPKEVASLAAFLCLP  243

Query  214  AASFVTGQIISVDGGGSIYGL  152
            AAS++TGQ+ISVDGG ++ G 
Sbjct  244  AASYITGQVISVDGGMTVNGF  264



>ref|XP_008349592.1| PREDICTED: tropinone reductase homolog At1g07440-like isoform 
X1 [Malus domestica]
 ref|XP_008358999.1| PREDICTED: tropinone reductase homolog At1g07440-like isoform 
X1 [Malus domestica]
Length=264

 Score =   268 bits (684),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 143/255 (56%), Positives = 180/255 (71%), Gaps = 3/255 (1%)
 Frame = -1

Query  913  RWSLHGMTALVTGGTRGLGHAIVEELACLGATVYTCSRTEKELEECIQNWKAKGYKVFGS  734
            RWSL GMTALVTGGT+G+G+AIVEELA LGA V+TCSR E +L +C   W+ KG++V GS
Sbjct  7    RWSLRGMTALVTGGTKGIGYAIVEELAGLGAIVHTCSRNEVDLNDCQSQWEKKGFQVTGS  66

Query  733  VCDILQPSQRENLIQLVSKQFDGKLTILVNNVAILIPKETLKSDGQDFSNTIGTNLEASL  554
            VCD++  +QRE LI  VS  FDGKL IL+NNV   + K TL+   +D+S  + TNLE++ 
Sbjct  67   VCDVVSKTQREELINKVSSLFDGKLNILINNVGTSLTKATLEYTAEDYSFIMSTNLESAY  126

Query  553  NLCQLAHPLLKATGNGsivfisscssfVYAPFHTIYASTKGAINSLVKNLACEWANDNIR  374
            N CQL+HPLLKA G  SIVF+SS +  V     +IY++TKGA+N L KNLACEWA DNIR
Sbjct  127  NFCQLSHPLLKAAGAASIVFLSSTAGVVSIDGESIYSATKGAMNQLAKNLACEWAKDNIR  186

Query  373  VNAVAPWLMRTSLTESS-RGEFGAVIEALIRRTLQHRLVEPKEASAAVAFLCFPAASFVT  197
             N+VAPW + T L E   R E    +E +  R    R  EP+E S+ VAFLC PAAS++T
Sbjct  187  TNSVAPWFITTPLAEPFLRNE--KKLEMINSRCPLGRPGEPEEVSSLVAFLCLPAASYIT  244

Query  196  GQIISVDGGGSIYGL  152
            GQ I VDGG ++ GL
Sbjct  245  GQTIIVDGGVTVNGL  259



>ref|XP_002311182.2| tropinone reductase family protein [Populus trichocarpa]
 gb|EEE88549.2| tropinone reductase family protein [Populus trichocarpa]
Length=266

 Score =   268 bits (684),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 140/254 (55%), Positives = 179/254 (70%), Gaps = 1/254 (0%)
 Frame = -1

Query  913  RWSLHGMTALVTGGTRGLGHAIVEELACLGATVYTCSRTEKELEECIQNWKAKGYKVFGS  734
            RWSLHGMTALVTGGTRG+G+A VEELA  GA V+TCSR E+EL +C++ W+AKG+ V GS
Sbjct  11   RWSLHGMTALVTGGTRGIGNATVEELAGFGARVHTCSRNEEELNKCLKEWEAKGFVVTGS  70

Query  733  VCDILQPSQRENLIQLVSKQFDGKLTILVNNVAILIPKETLKSDGQDFSNTIGTNLEASL  554
            VCD     QRE LI+ V   F GKL  LVNNV   I K T     ++FSN + TN E++ 
Sbjct  71   VCDASSRVQREKLIEEVGSVFHGKLNSLVNNVGTNIRKPTTGYSAEEFSNLLATNFESAY  130

Query  553  NLCQLAHPLLKATGNGsivfisscssfVYAPFHTIYASTKGAINSLVKNLACEWANDNIR  374
            +L Q+AHPLLK +G GS+VFISS +  ++    +IY ++KGAIN L KNLACEWA DNIR
Sbjct  131  HLSQIAHPLLKESGAGSVVFISSVAGLLHIGSGSIYGASKGAINQLTKNLACEWAKDNIR  190

Query  373  VNAVAPWLMRTSLTESSRGEFGAVIEALIRRTLQHRLVEPKEASAAVAFLCFPAASFVTG  194
             N VAPW +RTSL E    +    ++ +I RT   R+ +PKE S+ V FLC PAA+++TG
Sbjct  191  TNCVAPWYIRTSLVEHLLDD-KVFLDKIISRTPLQRVGDPKEVSSLVGFLCLPAAAYITG  249

Query  193  QIISVDGGGSIYGL  152
            Q+ISVDGG ++ G 
Sbjct  250  QVISVDGGFTVNGF  263



>ref|XP_007163457.1| hypothetical protein PHAVU_001G235800g [Phaseolus vulgaris]
 gb|ESW35451.1| hypothetical protein PHAVU_001G235800g [Phaseolus vulgaris]
Length=273

 Score =   268 bits (684),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 133/261 (51%), Positives = 182/261 (70%), Gaps = 1/261 (0%)
 Frame = -1

Query  916  GRWSLHGMTALVTGGTRGLGHAIVEELACLGATVYTCSRTEKELEECIQNWKAKGYKVFG  737
            GRW L GMTALV+GGTRG+GHAIV +LA  GA V+TCSRT+ EL++C++ WK++G++V G
Sbjct  13   GRWCLKGMTALVSGGTRGIGHAIVSDLAAFGAAVHTCSRTQTELKKCLEKWKSEGFQVTG  72

Query  736  SVCDILQPSQRENLIQLVSKQFDGKLTILVNNVAILIPKETLKSDGQDFSNTIGTNLEAS  557
            SVCD+  P  RE L++ V+  F+GKL I VNNV     K T++  G+++S  +  NL++S
Sbjct  73   SVCDVTSPQDREKLLEEVASTFNGKLNIYVNNVGTNFRKPTIEYSGEEYSQLMTVNLDSS  132

Query  556  LNLCQLAHPLLKATGNGsivfisscssfVYAPFHTIYASTKGAINSLVKNLACEWANDNI  377
             +LCQLA+PLLKA+G G IVF+SS +        ++YA++K AIN L KNLACEWA DNI
Sbjct  133  FHLCQLAYPLLKASGKGCIVFLSSVAGVTSMGTGSVYAASKAAINQLTKNLACEWAKDNI  192

Query  376  RVNAVAPWLMRTSLTESSRGEFGAVIEALIRRTLQHRLVEPKEASAAVAFLCFPAASFVT  197
            R N V PW  RT L E    +    ++ ++ RT   R+ EP+E S+ V FLC PAAS++T
Sbjct  193  RSNCVVPWTTRTPLVEHLL-QNQTFVDDVMSRTPLKRIAEPEEVSSLVTFLCLPAASYIT  251

Query  196  GQIISVDGGGSIYGL*TSVWI  134
            GQ+I VDGG ++ G   S+ I
Sbjct  252  GQVICVDGGVTVNGFQPSIRI  272



>emb|CDP14238.1| unnamed protein product [Coffea canephora]
Length=271

 Score =   268 bits (684),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 142/257 (55%), Positives = 179/257 (70%), Gaps = 2/257 (1%)
 Frame = -1

Query  934  QHNIMAGRWSLHGMTALVTGGTRGLGHAIVEELACLGATVYTCSRTEKELEECIQNWKAK  755
            +  I   RWSL G TALVTGGTRG+GHAIVEELA  GA V+TCSR + EL + ++ WKAK
Sbjct  5    EPRISEQRWSLKGQTALVTGGTRGIGHAIVEELAGFGARVHTCSRNQTELNDRLKEWKAK  64

Query  754  GYKVFGSVCDILQPSQRENLIQLVSKQFDGKLTILVNNVAILIPKETLKSDGQDFSNTIG  575
            G++V GSVCD+L  +QRE L++ VS +FD KL ILVNN A    K    S  +D+S  + 
Sbjct  65   GFQVSGSVCDLLSRTQREELMKTVSSEFDAKLNILVNNAATTKMKRAENSTSEDYSFLMS  124

Query  574  TNLEASLNLCQLAHPLLKATGNGsivfisscssfVYAPFHTIYASTKGAINSLVKNLACE  395
            TNLE+S +L QLA+PLLKA+ NG+IVFISS +     P  +IY++TKGAIN L KNLACE
Sbjct  125  TNLESSFHLSQLAYPLLKASANGNIVFISSVAGATALPGLSIYSATKGAINQLTKNLACE  184

Query  394  WANDNIRVNAVAPWLMRTSL--TESSRGEFGAVIEALIRRTLQHRLVEPKEASAAVAFLC  221
            WA D+IRVN VAPW +RT++   E +      +   L+ RT   R+ E  E S  VAFLC
Sbjct  185  WAKDSIRVNTVAPWAVRTTVLKPEEADESLLRMFFPLVNRTPLRRIAEANEISPLVAFLC  244

Query  220  FPAASFVTGQIISVDGG  170
             PAAS++TGQ+I VDGG
Sbjct  245  LPAASYITGQVICVDGG  261



>gb|KHN17906.1| Tropinone reductase like [Glycine soja]
Length=271

 Score =   268 bits (684),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 145/260 (56%), Positives = 177/260 (68%), Gaps = 1/260 (0%)
 Frame = -1

Query  913  RWSLHGMTALVTGGTRGLGHAIVEELACLGATVYTCSRTEKELEECIQNWKAKGYKVFGS  734
            RWSL G TALVTGGTRG+GHA+VEELA  GATVYTCSR E+EL  C++ WK KG+ V G 
Sbjct  12   RWSLKGTTALVTGGTRGIGHAVVEELAEFGATVYTCSRNEEELNACLKEWKEKGFSVSGL  71

Query  733  VCDILQPSQRENLIQLVSKQFDGKLTILVNNVAILIPKETLKSDGQDFSNTIGTNLEASL  554
            VCD   P  RENLIQ V+  F+GKL ILVNNV   + K T++   +++S  + TNL+++ 
Sbjct  72   VCDASSPPHRENLIQQVASAFNGKLNILVNNVGTNVRKPTIEYTAEEYSKLMATNLDSAY  131

Query  553  NLCQLAHPLLKATGNGsivfisscssfVYAPFHTIYASTKGAINSLVKNLACEWANDNIR  374
            +LCQLA+PLLKA+GNGSIV ISS +S        IYA+TK AI+ L K  ACEWA DNIR
Sbjct  132  HLCQLAYPLLKASGNGSIVSISSVASQTSVGSGAIYAATKAAIDQLTKYFACEWAKDNIR  191

Query  373  VNAVAPWLMRTSLTESSRGEFGAVIEALIRRTLQHRLVEPKEASAAVAFLCFPAASFVTG  194
             N VAPW   TSL E        V E +I RT   R+ E  E S+ V FLC PAAS++TG
Sbjct  192  SNGVAPWYTITSLVEPLLANKQLVSE-IISRTPIKRMAETHEVSSLVTFLCLPAASYITG  250

Query  193  QIISVDGGGSIYGL*TSVWI  134
            QI+SVDGG +  G   S+ I
Sbjct  251  QIVSVDGGFTANGFQPSMRI  270



>gb|ABW81118.1| putative tropinone reductase [Boechera divaricarpa]
Length=318

 Score =   269 bits (688),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 144/283 (51%), Positives = 195/283 (69%), Gaps = 5/283 (2%)
 Frame = -1

Query  994  LRFADHQSSKSKLAKNAKYQQHNIMAGRWSLHGMTALVTGGTRGLGHAIVEELACLGATV  815
            ++     +S S L + A     ++ + +WSL GM+ALVTGGTRG+G AIVEELA LGA V
Sbjct  34   IKLQPQTTSSSVLIRCASQSSISVTSKKWSLQGMSALVTGGTRGIGRAIVEELAGLGAEV  93

Query  814  YTCSRTEKELEECIQNWKAKGYKVFGSVCDILQPSQRENLIQLVSKQFDGKLTILVNNVA  635
            +TC+R E ELE C+++W + G+++ GSVCD+   +QRE L+++VS  FDGKL ILVNNV 
Sbjct  94   HTCARNESELENCLRDWNSSGFRIAGSVCDVSDQAQREALMEIVSSVFDGKLHILVNNVG  153

Query  634  ILIPKETLKSDGQDFSNTIGTNLEASLNLCQLAHPLLKATGNGsivfisscssfVYAPFH  455
              I K  ++    +FS  + TN E   NLCQLA+PLL+A+  GS+V ISS S FV     
Sbjct  154  TNIRKPMVEFTAGEFSTLMSTNFEPVFNLCQLAYPLLRASEAGSVVSISSVSGFVSLKNM  213

Query  454  TIYASTKGAINSLVKNLACEWANDNIRVNAVAPWLMRTSLTES--SRGEFGAVIEALIRR  281
            ++ ++TKGAIN L ++LACEWA DNIR+NAVAPW ++TS+ E   S  ++   +E +   
Sbjct  214  SVQSATKGAINQLTRSLACEWAKDNIRINAVAPWYIKTSMVEQVLSNKDY---LEEVYSV  270

Query  280  TLQHRLVEPKEASAAVAFLCFPAASFVTGQIISVDGGGSIYGL  152
            T   RL EP+E S+AVAFLC PA+S++TGQII VDGG SI G 
Sbjct  271  TPLGRLGEPREVSSAVAFLCLPASSYITGQIICVDGGMSINGF  313



>emb|CDX86486.1| BnaC08g02170D [Brassica napus]
Length=262

 Score =   267 bits (683),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 137/257 (53%), Positives = 178/257 (69%), Gaps = 1/257 (0%)
 Frame = -1

Query  922  MAGRWSLHGMTALVTGGTRGLGHAIVEELACLGATVYTCSRTEKELEECIQNWKAKGYKV  743
            M  RWSL GMTALVTGG RG+G+AIVEELA  GA ++TC R +  L+EC+  WKAKG++V
Sbjct  1    MDSRWSLQGMTALVTGGARGIGYAIVEELAGFGAKIHTCDRDQTLLDECLSEWKAKGFQV  60

Query  742  FGSVCDILQPSQRENLIQLVSKQFDGKLTILVNNVAILIPKETLKSDGQDFSNTIGTNLE  563
             GSVCD+    QR+ L++ VS  F GKL IL+NNV  L+ K T +   QDFS  I TNLE
Sbjct  61   TGSVCDVSSRPQRDGLMKTVSSLFSGKLNILINNVGTLVSKPTTEFTAQDFSGQIATNLE  120

Query  562  ASLNLCQLAHPLLKATGNGsivfisscssfVYAPFHTIYASTKGAINSLVKNLACEWAND  383
            ++ +  QLAHPLLKA+G GSIVF+SS    V + F +IY+ TKG +N L +NLACEWA+D
Sbjct  121  SAYHFSQLAHPLLKASGFGSIVFLSSVCGVVSSGFVSIYSLTKGGMNQLARNLACEWASD  180

Query  382  NIRVNAVAPWLMRTSLTESSRGEFGAVIEALIRRTLQHRLVEPKEASAAVAFLCFPAASF  203
             IR N+VAPW+ +T L +  R +     EA+  RT   R  EP+E ++ V FLC PAAS+
Sbjct  181  GIRANSVAPWMTKTPLVQ-KRLDDEKFAEAIFSRTPLGRACEPREVASLVTFLCLPAASY  239

Query  202  VTGQIISVDGGGSIYGL  152
            +TGQ I +DGG ++ G 
Sbjct  240  ITGQTICIDGGFTVNGF  256



>ref|XP_011048910.1| PREDICTED: tropinone reductase homolog At1g07440-like isoform 
X3 [Populus euphratica]
Length=268

 Score =   268 bits (684),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 140/263 (53%), Positives = 183/263 (70%), Gaps = 2/263 (1%)
 Frame = -1

Query  937  QQHNIMAGRWSLHGMTALVTGGTRGLGHAIVEELACLGATVYTCSRTEKELEECIQNWKA  758
            Q+++    +WSL GMTALVTGGT+GLG+AIV ELA LGA V+TC R++ +L E ++ WKA
Sbjct  4    QENSSRDKKWSLQGMTALVTGGTKGLGYAIVGELAALGAIVHTCGRSQDQLNENLREWKA  63

Query  757  KGYKVFGSVCDILQPSQRENLIQLVSKQFDGKLTILVNNVAILIPKETLKSDGQDFSNTI  578
            KG+KV GSVCD+   ++RE L++ VS  FDGKL IL+NN    I K +L    +DF + +
Sbjct  64   KGFKVTGSVCDLSSNAEREKLMEEVSSFFDGKLDILINNAGGNIHKGSLDYTSEDFVSIL  123

Query  577  GTNLEASLNLCQLAHPLLKATGNGsiv-fisscssfVYAPFHTIYASTKGAINSLVKNLA  401
             TNL ++ +L QLAHPLLKA+G G IV   S  S     P + IY++TKGA+N L +NLA
Sbjct  124  NTNLGSAFHLSQLAHPLLKASGAGRIVFMSSIASVVSVNPQYPIYSATKGAMNQLTRNLA  183

Query  400  CEWANDNIRVNAVAPWLMRTSLTESSRGEFGAVIEALIRRTLQHRLVEPKEASAAVAFLC  221
            CEWA DNIRVNAVAPW +RT LTE    +   + + ++ RT   RL EP + S+ VAFLC
Sbjct  184  CEWAKDNIRVNAVAPWAVRTPLTEQFL-DVEKIRKDVVDRTPMKRLGEPGDVSSVVAFLC  242

Query  220  FPAASFVTGQIISVDGGGSIYGL  152
            FPA  F+TGQ+I VDGG S+ G 
Sbjct  243  FPAPGFLTGQVICVDGGMSVNGF  265



>gb|KHG18782.1| hypothetical protein F383_24463 [Gossypium arboreum]
Length=270

 Score =   268 bits (684),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 142/257 (55%), Positives = 178/257 (69%), Gaps = 5/257 (2%)
 Frame = -1

Query  916  GRWSLHGMTALVTGGTRGLGHAIVEELACLGATVYTCSRTEKELEECIQNWKAKGYKVFG  737
            GRWSL G TALVTGGT+G+G A+VEELA LGATVYTCSR + +L EC++ WK KG++VFG
Sbjct  10   GRWSLKGTTALVTGGTKGIGLAVVEELAALGATVYTCSRNQDQLNECLKEWKMKGFQVFG  69

Query  736  SVCDILQPSQRENLIQLVSKQFDGKLTILVNNVAILIPKETLKSDGQDFSNTIGTNLEAS  557
            SVCD   P+QRE LI  VS  F+ +L IL+NNV     K T +    + S  + TN E++
Sbjct  70   SVCDATSPAQREALINNVSSMFNAQLNILINNVGTNDWKPTAEYTNTELSTLLSTNFESA  129

Query  556  LNLCQLAHPLLKATGNGsivfisscssfVYAPFHTIYASTKGAINSLVKNLACEWANDNI  377
             +  QLA+PLLKA+G GSIVF+SS +        +IY STKGA+N L K LACEWA DNI
Sbjct  130  YHFSQLAYPLLKASGRGSIVFVSSVAGVFSINVGSIYGSTKGAMNQLTKELACEWAKDNI  189

Query  376  RVNAVAPWLMRTSLTES--SRGEFGAVIEALIRRTLQHRLVEPKEASAAVAFLCFPAASF  203
            R N VAPW +RT LTE   S  +F   +EA++ RT   R+ EP+E +  VAFLC PA+SF
Sbjct  190  RTNCVAPWFIRTPLTEQVLSSSKF---MEAVVSRTPLGRVGEPEEVAHLVAFLCLPASSF  246

Query  202  VTGQIISVDGGGSIYGL  152
            +TGQII VDGG +  G 
Sbjct  247  ITGQIICVDGGLTANGF  263



>emb|CDY14094.1| BnaC02g02110D [Brassica napus]
Length=263

 Score =   267 bits (683),  Expect = 3e-84, Method: Compositional matrix adjust.
 Identities = 140/254 (55%), Positives = 182/254 (72%), Gaps = 1/254 (0%)
 Frame = -1

Query  913  RWSLHGMTALVTGGTRGLGHAIVEELACLGATVYTCSRTEKELEECIQNWKAKGYKVFGS  734
            RWSL G TALVTGGTRG+G A+VEELA  GATV+TCSR ++ELE C+ +WK+ G  V GS
Sbjct  7    RWSLAGKTALVTGGTRGIGRAVVEELARFGATVHTCSRNQEELESCLDDWKSNGLVVTGS  66

Query  733  VCDILQPSQRENLIQLVSKQFDGKLTILVNNVAILIPKETLKSDGQDFSNTIGTNLEASL  554
            VCD     QRE LIQ VS  F GKL IL+NNV   + K T++   +D++  + TNLE++ 
Sbjct  67   VCDASVRDQREKLIQEVSSAFSGKLNILINNVGTNLRKPTVEYSSEDYAKIMSTNLESAF  126

Query  553  NLCQLAHPLLKATGNGsivfisscssfVYAPFHTIYASTKGAINSLVKNLACEWANDNIR  374
            +  Q+AHPLLKA+G GSIVFISS +  V+    ++Y +TKGA+N L +NLACEWA DNIR
Sbjct  127  HFSQIAHPLLKASGVGSIVFISSVAGLVHVSSGSVYGATKGALNQLTRNLACEWAGDNIR  186

Query  373  VNAVAPWLMRTSLTESSRGEFGAVIEALIRRTLQHRLVEPKEASAAVAFLCFPAASFVTG  194
             N VAPW ++TSL +    + G   EA++ RT   R+ EP+E S+ VAFLC PAAS++TG
Sbjct  187  TNCVAPWYIKTSLVKPLLEKEG-FEEAIVSRTPLGRVGEPEEVSSLVAFLCLPAASYITG  245

Query  193  QIISVDGGGSIYGL  152
            Q+ISVDGG ++ G 
Sbjct  246  QVISVDGGFTVNGF  259



>gb|AFK36242.1| unknown [Medicago truncatula]
Length=275

 Score =   268 bits (684),  Expect = 3e-84, Method: Compositional matrix adjust.
 Identities = 138/260 (53%), Positives = 182/260 (70%), Gaps = 1/260 (0%)
 Frame = -1

Query  913  RWSLHGMTALVTGGTRGLGHAIVEELACLGATVYTCSRTEKELEECIQNWKAKGYKVFGS  734
            RWSL GMTALVTGGTRG+GHAIV +L   GA V+TCSRTE EL +C+Q W++KG+ V GS
Sbjct  16   RWSLTGMTALVTGGTRGIGHAIVNDLVAFGAAVHTCSRTESELSKCLQEWQSKGFSVTGS  75

Query  733  VCDILQPSQRENLIQLVSKQFDGKLTILVNNVAILIPKETLKSDGQDFSNTIGTNLEASL  554
            VCD+   SQRE+L+Q V+  F+GKL I VNNV     K T++   +++S  +  NL++S 
Sbjct  76   VCDVSSRSQRESLVQEVASTFNGKLNIFVNNVGSNFRKPTIEYTAEEYSELMTINLDSSF  135

Query  553  NLCQLAHPLLKATGNGsivfisscssfVYAPFHTIYASTKGAINSLVKNLACEWANDNIR  374
            +LCQL+HPLLK +GNGSIVFISS +  V     ++Y ++K AIN L KNLACEWA DNIR
Sbjct  136  HLCQLSHPLLKESGNGSIVFISSVAGVVSLGTGSVYTASKAAINQLTKNLACEWAIDNIR  195

Query  373  VNAVAPWLMRTSLTESSRGEFGAVIEALIRRTLQHRLVEPKEASAAVAFLCFPAASFVTG  194
             N V PW  RT L E    +    ++ ++ RT   R+ EP+E S+ V FLC PAAS++TG
Sbjct  196  SNCVVPWATRTPLVE-HLFQNQKFVDDILSRTPLKRIAEPEEVSSLVTFLCLPAASYITG  254

Query  193  QIISVDGGGSIYGL*TSVWI  134
            Q+I VDGG +++G   S+ I
Sbjct  255  QVICVDGGLTVFGFQPSMRI  274



>ref|XP_011033874.1| PREDICTED: tropinone reductase homolog At1g07440-like [Populus 
euphratica]
Length=266

 Score =   267 bits (682),  Expect = 3e-84, Method: Compositional matrix adjust.
 Identities = 140/254 (55%), Positives = 181/254 (71%), Gaps = 1/254 (0%)
 Frame = -1

Query  913  RWSLHGMTALVTGGTRGLGHAIVEELACLGATVYTCSRTEKELEECIQNWKAKGYKVFGS  734
            RWSLHGMTALVTGGTRG+G+A V ELA  GA V+TCSR E+EL +C++ W+AKG+ V GS
Sbjct  11   RWSLHGMTALVTGGTRGIGNATVVELAGFGARVHTCSRNEEELNKCLKEWEAKGFVVTGS  70

Query  733  VCDILQPSQRENLIQLVSKQFDGKLTILVNNVAILIPKETLKSDGQDFSNTIGTNLEASL  554
            VCD     QRE LI+ V   F GKL ILVNNV   I K T     ++FSN + TN E++ 
Sbjct  71   VCDASSHVQREKLIEEVDSVFHGKLNILVNNVGTNIRKPTTGYSAEEFSNLLATNFESAY  130

Query  553  NLCQLAHPLLKATGNGsivfisscssfVYAPFHTIYASTKGAINSLVKNLACEWANDNIR  374
            +L Q+AHPLLKA+G GSIVFISS +  ++    +IY ++KGAIN L KNLACEWA DNIR
Sbjct  131  HLSQIAHPLLKASGAGSIVFISSVAGLLHIGSGSIYGASKGAINQLTKNLACEWAKDNIR  190

Query  373  VNAVAPWLMRTSLTESSRGEFGAVIEALIRRTLQHRLVEPKEASAAVAFLCFPAASFVTG  194
             N VAPW ++TSL ++   +    ++ +I RT   R+ +PKE S+ V FLC PAA+++TG
Sbjct  191  TNCVAPWYIKTSLVKNLLDD-KVFLDKIISRTPLQRIGDPKEVSSLVGFLCLPAAAYITG  249

Query  193  QIISVDGGGSIYGL  152
            Q+ISVDGG ++ G 
Sbjct  250  QVISVDGGFTVNGF  263



>emb|CDY04977.1| BnaAnng01590D [Brassica napus]
Length=263

 Score =   267 bits (682),  Expect = 3e-84, Method: Compositional matrix adjust.
 Identities = 140/254 (55%), Positives = 183/254 (72%), Gaps = 1/254 (0%)
 Frame = -1

Query  913  RWSLHGMTALVTGGTRGLGHAIVEELACLGATVYTCSRTEKELEECIQNWKAKGYKVFGS  734
            RWSL G TALVTGGTRG+G A+VEELA  GATV+TCSR+++EL+ C+ +WK+ G  V GS
Sbjct  7    RWSLAGKTALVTGGTRGIGRAVVEELARFGATVHTCSRSQEELKSCLDDWKSNGLVVTGS  66

Query  733  VCDILQPSQRENLIQLVSKQFDGKLTILVNNVAILIPKETLKSDGQDFSNTIGTNLEASL  554
            VCD     QRE LIQ VS  F GK+ ILVNNV   + K T++   +D++  + TNLE++ 
Sbjct  67   VCDASDRDQREKLIQEVSSAFSGKINILVNNVGTNLRKPTVEYSSEDYAKIMSTNLESAF  126

Query  553  NLCQLAHPLLKATGNGsivfisscssfVYAPFHTIYASTKGAINSLVKNLACEWANDNIR  374
            +  QLAHPLLKA+G GSIVFISS +  V+    ++Y +TKGA+N L +NLACEWA DNIR
Sbjct  127  HFSQLAHPLLKASGVGSIVFISSVAGLVHLSSGSVYGATKGALNQLTRNLACEWAGDNIR  186

Query  373  VNAVAPWLMRTSLTESSRGEFGAVIEALIRRTLQHRLVEPKEASAAVAFLCFPAASFVTG  194
             N VAPW ++TSL +    + G   EA++ RT   R+ EP+E S+ VAFLC PAAS++TG
Sbjct  187  TNCVAPWYIKTSLVKPLLEKKG-FEEAIVSRTPLGRVGEPEEVSSLVAFLCLPAASYITG  245

Query  193  QIISVDGGGSIYGL  152
            Q+ISVDGG ++ G 
Sbjct  246  QVISVDGGFTVNGF  259



>ref|XP_002277835.1| PREDICTED: tropinone reductase homolog At1g07440 [Vitis vinifera]
 emb|CBI31630.3| unnamed protein product [Vitis vinifera]
Length=268

 Score =   267 bits (682),  Expect = 4e-84, Method: Compositional matrix adjust.
 Identities = 142/255 (56%), Positives = 184/255 (72%), Gaps = 5/255 (2%)
 Frame = -1

Query  910  WSLHGMTALVTGGTRGLGHAIVEELACLGATVYTCSRTEKELEECIQNWKAKGYKVFGSV  731
            WSL G TALVTGGTRG+G+A+VEELA LG+TV+TCSR E EL++C++ W AKG+ V GSV
Sbjct  13   WSLRGTTALVTGGTRGIGYAVVEELAGLGSTVHTCSRNEAELDKCLREWHAKGFAVTGSV  72

Query  730  CDILQPSQRENLIQLVSKQFDGKLTILVNNVAILIPKETLKSDGQDFSNTIGTNLEASLN  551
            CD    +QRE L++ VS  F+GKL IL+NNV   I K T+     ++S  + TNLE++ +
Sbjct  73   CDGSDRAQREQLMEKVSSIFNGKLNILINNVGTNIRKPTVDFTAAEYSTIMTTNLESAYH  132

Query  550  LCQLAHPLLKATGNGsivfisscssfVYAPFHTIYASTKGAINSLVKNLACEWANDNIRV  371
            LCQLAHPLLKA+G GSIVFISS +  +     +IYA+TK A+N L KNL+CEWA DNIR 
Sbjct  133  LCQLAHPLLKASGAGSIVFISSVAGVLSLGTGSIYAATKAAMNQLTKNLSCEWAKDNIRS  192

Query  370  NAVAPWLMRTSLTES--SRGEFGAVIEALIRRTLQHRLVEPKEASAAVAFLCFPAASFVT  197
            N+VAPW ++TSL E    + +F    E++I RT   R  EPKE S+ VAFLC P AS++T
Sbjct  193  NSVAPWYIKTSLVEHLLQKQDF---FESVISRTPLRRPGEPKEVSSLVAFLCLPVASYIT  249

Query  196  GQIISVDGGGSIYGL  152
            GQ+I VDGG ++ G 
Sbjct  250  GQVICVDGGMTVNGF  264



>ref|XP_003537468.1| PREDICTED: tropinone reductase homolog At1g07440-like [Glycine 
max]
Length=277

 Score =   267 bits (683),  Expect = 4e-84, Method: Compositional matrix adjust.
 Identities = 135/260 (52%), Positives = 181/260 (70%), Gaps = 1/260 (0%)
 Frame = -1

Query  913  RWSLHGMTALVTGGTRGLGHAIVEELACLGATVYTCSRTEKELEECIQNWKAKGYKVFGS  734
            RWSL+GMTALVTGGTRG+GHAIV +LA  GA V+TCSR + EL +C+Q W+++G++V GS
Sbjct  18   RWSLNGMTALVTGGTRGIGHAIVNDLAAFGAAVHTCSRNQTELNKCLQEWQSQGFEVTGS  77

Query  733  VCDILQPSQRENLIQLVSKQFDGKLTILVNNVAILIPKETLKSDGQDFSNTIGTNLEASL  554
            VCD+  P QRE LIQ  +  F+GKL I VNNV +   K T++   +++S  +  NL ++ 
Sbjct  78   VCDVSSPPQREKLIQEAASTFNGKLNIYVNNVGVNYRKPTIEYSAEEYSEMMTVNLNSAF  137

Query  553  NLCQLAHPLLKATGNGsivfisscssfVYAPFHTIYASTKGAINSLVKNLACEWANDNIR  374
            +LCQLA+PLLKA+G GSIVF+SS +        ++YA++K AIN L KNLACEWA DNIR
Sbjct  138  HLCQLAYPLLKASGKGSIVFLSSVAGVTSMGTGSVYAASKAAINQLTKNLACEWAKDNIR  197

Query  373  VNAVAPWLMRTSLTESSRGEFGAVIEALIRRTLQHRLVEPKEASAAVAFLCFPAASFVTG  194
             N V PW  RT L E    +    +E ++ RT   R+ EP+E S+ VAFLC PAAS++TG
Sbjct  198  SNCVVPWTTRTPLIEHLL-QNQTFVEDVMSRTPLKRIAEPEEVSSLVAFLCLPAASYITG  256

Query  193  QIISVDGGGSIYGL*TSVWI  134
            Q+I  DGG ++ G   S+ I
Sbjct  257  QVICADGGVTVNGFQPSMRI  276



>ref|NP_196225.1| putative tropine dehydrogenase [Arabidopsis thaliana]
 dbj|BAA98195.1| short chain alcohol dehydrogenase-like [Arabidopsis thaliana]
 gb|AAO22710.1| putative short chain alcohol dehydrogenase [Arabidopsis thaliana]
 gb|AAO42448.1| putative short chain alcohol dehydrogenase [Arabidopsis thaliana]
 gb|AED90960.1| putative tropine dehydrogenase [Arabidopsis thaliana]
Length=264

 Score =   267 bits (682),  Expect = 4e-84, Method: Compositional matrix adjust.
 Identities = 140/256 (55%), Positives = 184/256 (72%), Gaps = 5/256 (2%)
 Frame = -1

Query  913  RWSLHGMTALVTGGTRGLGHAIVEELACLGATVYTCSRTEKELEECIQNWKAKGYKVFGS  734
            RWSL G TALVTGGTRG+G A+VEELA  GA V+TCSR ++EL  C+ +WKA G  V GS
Sbjct  6    RWSLAGKTALVTGGTRGIGRAVVEELAKFGAKVHTCSRNQEELNACLNDWKANGLVVSGS  65

Query  733  VCDILQPSQRENLIQLVSKQFDGKLTILVNNVAILIPKETLKSDGQDFSNTIGTNLEASL  554
            VCD     QRE LIQ  S  F GKL IL+NNV   + K T++   ++++  + TNLE++ 
Sbjct  66   VCDASVRDQREKLIQEASSAFSGKLNILINNVGTNVRKPTVEYSSEEYAKIMSTNLESAF  125

Query  553  NLCQLAHPLLKATGNGsivfisscssfVYAPFHTIYASTKGAINSLVKNLACEWANDNIR  374
            +L Q+AHPLLKA+G GSIVFISS +  V+    +IY +TKGA+N L +NLACEWA+DNIR
Sbjct  126  HLSQIAHPLLKASGVGSIVFISSVAGLVHLSSGSIYGATKGALNQLTRNLACEWASDNIR  185

Query  373  VNAVAPWLMRTSLTES--SRGEFGAVIEALIRRTLQHRLVEPKEASAAVAFLCFPAASFV  200
             N VAPW ++TSL E+   + EF   +EA++ RT   R+ EP+E S+ VAFLC PA+S++
Sbjct  186  TNCVAPWYIKTSLVETLLEKKEF---VEAVVSRTPLGRVGEPEEVSSLVAFLCLPASSYI  242

Query  199  TGQIISVDGGGSIYGL  152
            TGQ+ISVDGG ++ G 
Sbjct  243  TGQVISVDGGFTVNGF  258



>ref|XP_002319563.2| tropinone reductase family protein [Populus trichocarpa]
 gb|EEE95486.2| tropinone reductase family protein [Populus trichocarpa]
Length=267

 Score =   266 bits (681),  Expect = 5e-84, Method: Compositional matrix adjust.
 Identities = 137/255 (54%), Positives = 177/255 (69%), Gaps = 2/255 (1%)
 Frame = -1

Query  913  RWSLHGMTALVTGGTRGLGHAIVEELACLGATVYTCSRTEKELEECIQNWKAKGYKVFGS  734
            RW L GMTALVTGGT+GLG AIVEELA LGA V+TC+R + ++ E ++ WK KG+KV GS
Sbjct  11   RWGLQGMTALVTGGTKGLGCAIVEELAALGAIVHTCARNQDQINERVREWKEKGFKVTGS  70

Query  733  VCDILQPSQRENLIQLVSKQFDGKLTILVNNVAILIPKETLKSDGQDFSNTIGTNLEASL  554
            VCD+   ++RE L++ VS  FDGKL ILVNN    I K TL    +DF++ + TNL+++ 
Sbjct  71   VCDVSSNAEREKLMKEVSSLFDGKLNILVNNAGTNIYKATLDYTAEDFTSLMNTNLQSAF  130

Query  553  NLCQLAHPLLKATGNGsiv-fisscssfVYAPFHTIYASTKGAINSLVKNLACEWANDNI  377
            +L QLAHPLLKA+G G IV   S  S     P + +Y+++KGA+N L +NLACEWA DNI
Sbjct  131  HLSQLAHPLLKASGAGKIVFMSSIISVVSMNPQYPLYSASKGAMNQLTRNLACEWAKDNI  190

Query  376  RVNAVAPWLMRTSLTESSRGEFGAVIEALIRRTLQHRLVEPKEASAAVAFLCFPAASFVT  197
            RVN VAPW +RT LT  S  +  ++ + +  RT   R+ EP E S+ VAFLC PA  F+T
Sbjct  191  RVNGVAPWFVRTPLTAHSLDD-ESIAKEVFSRTPMRRVGEPGEVSSVVAFLCLPAPGFLT  249

Query  196  GQIISVDGGGSIYGL  152
            GQII VDGG S+ G 
Sbjct  250  GQIICVDGGMSVNGF  264



>ref|XP_006352698.1| PREDICTED: tropinone reductase homolog [Solanum tuberosum]
Length=265

 Score =   266 bits (681),  Expect = 6e-84, Method: Compositional matrix adjust.
 Identities = 138/254 (54%), Positives = 181/254 (71%), Gaps = 1/254 (0%)
 Frame = -1

Query  913  RWSLHGMTALVTGGTRGLGHAIVEELACLGATVYTCSRTEKELEECIQNWKAKGYKVFGS  734
            RWSL+G+ ALVTGGT G+GHAIVEEL   GA VYTCSR E  L EC++ W  KG +V G 
Sbjct  8    RWSLNGLVALVTGGTYGIGHAIVEELCEFGAKVYTCSRNESVLNECLKKWTDKGLQVKGC  67

Query  733  VCDILQPSQRENLIQLVSKQFDGKLTILVNNVAILIPKETLKSDGQDFSNTIGTNLEASL  554
            VCD+    QR  L++ VS +FDGKL IL+NNV   I K T +  G+++++ + TNLE+S 
Sbjct  68   VCDVSSKEQRVQLMEKVSLEFDGKLNILINNVGTNIWKPTTEYTGEEYAHIMATNLESSF  127

Query  553  NLCQLAHPLLKATGNGsivfisscssfVYAPFHTIYASTKGAINSLVKNLACEWANDNIR  374
            +LCQLAHPLLK++G+GSIVF+SS +  V+    +IY +TKGA+N L +NLACEWA D IR
Sbjct  128  HLCQLAHPLLKSSGSGSIVFLSSVAGLVHLSGTSIYGATKGAMNQLTRNLACEWAKDGIR  187

Query  373  VNAVAPWLMRTSLTESSRGEFGAVIEALIRRTLQHRLVEPKEASAAVAFLCFPAASFVTG  194
            VN VAPW + T L E   G+    +E ++ RT   R  E +E S+ VA+LC PAAS+VTG
Sbjct  188  VNGVAPWYINTPLVEHVLGD-KEFMEGVVSRTPLKRPGEVEEVSSMVAYLCLPAASYVTG  246

Query  193  QIISVDGGGSIYGL  152
            Q+I+VDGG ++YG 
Sbjct  247  QVIAVDGGFTVYGF  260



>ref|XP_010685685.1| PREDICTED: tropinone reductase homolog At1g07440-like [Beta vulgaris 
subsp. vulgaris]
Length=258

 Score =   266 bits (680),  Expect = 6e-84, Method: Compositional matrix adjust.
 Identities = 140/260 (54%), Positives = 185/260 (71%), Gaps = 5/260 (2%)
 Frame = -1

Query  925  IMAGRWSLHGMTALVTGGTRGLGHAIVEELACLGATVYTCSRTEKELEECIQNWKAKGYK  746
            +M  RWSL GMTALVTGGT+G+GHAIVEELA LGA V+TC+R E ELE C +NW+ KG+ 
Sbjct  1    MMNKRWSLVGMTALVTGGTKGIGHAIVEELAGLGARVHTCARNETELEACKRNWETKGFH  60

Query  745  VFGSVCDILQPSQRENLIQLVSKQFDGKLTILVNNVAILIPKETLKSDGQDFSNTIGTNL  566
            V  S+CD+    QRENL+++VS +F GKL ILVNNV   + K T +   ++++  + TNL
Sbjct  61   VTASICDVTSRVQRENLMEIVSSEFKGKLNILVNNVGAYMKKPTTEFTAEEYATVMTTNL  120

Query  565  EASLNLCQLAHPLLKATGNGsivfisscssfVYAPFHTIYASTKGAINSLVKNLACEWAN  386
            E++ + CQLAHPLLKA+G  SI+F+SS +  V     ++Y + KGA+N L KNLACEWA 
Sbjct  121  ESAYHFCQLAHPLLKASGFASIIFMSSVAGVVAVDVGSLYGTAKGAMNQLAKNLACEWAK  180

Query  385  DNIRVNAVAPWLMRTSLTES--SRGEFGAVIEALIRRTLQHRLVEPKEASAAVAFLCFPA  212
            DNIR N++AP+ +RT LTE   S  E+ A ++    RT   R  E +E S+ VAFLC PA
Sbjct  181  DNIRTNSIAPFYIRTPLTEVVLSDKEYLAKVK---ERTPLGRTGEVEEVSSLVAFLCMPA  237

Query  211  ASFVTGQIISVDGGGSIYGL  152
            AS++TGQ I VDGG +I+GL
Sbjct  238  ASYITGQTICVDGGFTIHGL  257



>ref|XP_002465494.1| hypothetical protein SORBIDRAFT_01g039880 [Sorghum bicolor]
 gb|EER92492.1| hypothetical protein SORBIDRAFT_01g039880 [Sorghum bicolor]
Length=273

 Score =   266 bits (681),  Expect = 6e-84, Method: Compositional matrix adjust.
 Identities = 142/258 (55%), Positives = 186/258 (72%), Gaps = 5/258 (2%)
 Frame = -1

Query  919  AGRWSLHGMTALVTGGTRGLGHAIVEELACLGATVYTCSRTEKELEECIQNWKAKGYKVF  740
            +GRW+LHG TALVTGGTRG+G A+VEELA LGA V+TCSR  +EL E I+ W+A+G++V 
Sbjct  14   SGRWALHGKTALVTGGTRGIGRAVVEELAALGAAVHTCSRKAEELGERIKEWEARGFRVT  73

Query  739  GSVCDILQPSQRENLIQLVSKQFDGKLTILVNNVAILIPKETLKSDGQDFSNTIGTNLEA  560
            GSVCD+ +  QRE L++ V  +F GKL ILVNNV   I K T +   +++S  + TNLE+
Sbjct  74   GSVCDLSERDQRERLLREVGNRFGGKLNILVNNVGTNIRKPTTEFTAEEYSFVMATNLES  133

Query  559  SLNLCQLAHPLLKATGNGsivfisscssfVYAPFHTIYASTKGAINSLVKNLACEWANDN  380
            + +LCQ+AHPLLK +G+GSI+FISS    V     TIYA TKGAIN L KN+ACEWA DN
Sbjct  134  AYHLCQIAHPLLKLSGSGSIIFISSVCGMVGVFSGTIYAMTKGAINQLTKNIACEWAKDN  193

Query  379  IRVNAVAPWLMRTSLTES--SRGEFGAVIEALIRRTLQHRLVEPKEASAAVAFLCFPAAS  206
            IR N+VAPW + TSLTE   +  +F    E ++ RT   R+ EP+E SA VAFLC P ++
Sbjct  194  IRANSVAPWYITTSLTERLLANKDFE---EQVVSRTPLGRVGEPEEISALVAFLCMPGST  250

Query  205  FVTGQIISVDGGGSIYGL  152
            ++TGQ I+VDGG ++ G 
Sbjct  251  YITGQTIAVDGGMTVNGF  268



>emb|CDX98899.1| BnaC09g49360D [Brassica napus]
Length=262

 Score =   266 bits (680),  Expect = 7e-84, Method: Compositional matrix adjust.
 Identities = 139/254 (55%), Positives = 183/254 (72%), Gaps = 1/254 (0%)
 Frame = -1

Query  913  RWSLHGMTALVTGGTRGLGHAIVEELACLGATVYTCSRTEKELEECIQNWKAKGYKVFGS  734
            RWSL G  ALVTGGTRG+G AIVEELA LGA V+TCSR ++EL+ C+ +WK+ G  V GS
Sbjct  6    RWSLAGKAALVTGGTRGIGRAIVEELARLGAKVHTCSRNQEELKACLDDWKSNGLVVSGS  65

Query  733  VCDILQPSQRENLIQLVSKQFDGKLTILVNNVAILIPKETLKSDGQDFSNTIGTNLEASL  554
            VCD     QRE LIQ VS  F GKL ILVNNV   + K T++   +D++  + TNLE++ 
Sbjct  66   VCDASDRDQREKLIQEVSSAFSGKLNILVNNVGTSVRKPTVEYTSEDYAKIMSTNLESAF  125

Query  553  NLCQLAHPLLKATGNGsivfisscssfVYAPFHTIYASTKGAINSLVKNLACEWANDNIR  374
            ++ Q+AHPLLKA+G GSIVFISS +  V     +IY +TKGA+N L +NLACEWA DNIR
Sbjct  126  HISQIAHPLLKASGVGSIVFISSVAGLVRLSTASIYGATKGALNQLTRNLACEWAGDNIR  185

Query  373  VNAVAPWLMRTSLTESSRGEFGAVIEALIRRTLQHRLVEPKEASAAVAFLCFPAASFVTG  194
             N+VAPW ++TSL E    + G  ++A++ RT   R+ EP+E ++ VAFLC PAAS++TG
Sbjct  186  TNSVAPWYIKTSLVEPLLEKKG-FVDAVVDRTPLGRVGEPEEVASLVAFLCLPAASYITG  244

Query  193  QIISVDGGGSIYGL  152
            Q+I+VDGG ++ G 
Sbjct  245  QVIAVDGGFTVNGF  258



>gb|KCW52641.1| hypothetical protein EUGRSUZ_J02019 [Eucalyptus grandis]
Length=279

 Score =   266 bits (681),  Expect = 7e-84, Method: Compositional matrix adjust.
 Identities = 143/256 (56%), Positives = 181/256 (71%), Gaps = 5/256 (2%)
 Frame = -1

Query  913  RWSLHGMTALVTGGTRGLGHAIVEELACLGATVYTCSRTEKELEECIQNWKAKGYKVFGS  734
            +W LHGMTALVTG T+G+GHAIV+ELA LGATV+TCSR E E+ EC+++WK+KG++V GS
Sbjct  22   KWLLHGMTALVTGRTKGIGHAIVKELARLGATVHTCSRNEAEINECLKDWKSKGFRVSGS  81

Query  733  VCDILQPSQRENLIQLVSKQFDGKLTILVNNVAILIPKETLKSDGQDFSNTIGTNLEASL  554
             CD+   S+RE L+  VS  FDGKL IL+NNV     K T+    +DFS  + TN E++ 
Sbjct  82   TCDVSSRSEREKLMLTVSSVFDGKLNILINNVGTNTLKSTMDYTAEDFSFIMTTNFESTY  141

Query  553  NLCQLAHPLLKATGNGsivfisscssfVYAPFHTIYASTKGAINSLVKNLACEWANDNIR  374
            +L QLAHPLLKA+G GSIVF+SS    V     +IY++TKGA+N L KNLACEWA DNIR
Sbjct  142  HLSQLAHPLLKASGAGSIVFLSSVCGVVSINVGSIYSATKGAMNQLTKNLACEWAKDNIR  201

Query  373  VNAVAPWLMRTSLTES--SRGEFGAVIEALIRRTLQHRLVEPKEASAAVAFLCFPAASFV  200
             N+VAPW + T L E   S  +F    E +I RT   R  EP+E S+ VAFLC PAAS++
Sbjct  202  SNSVAPWFILTPLAEPVLSDEKFH---EEVIARTPLGRTGEPEEVSSLVAFLCLPAASYI  258

Query  199  TGQIISVDGGGSIYGL  152
            TGQ I VDGG ++ G 
Sbjct  259  TGQTICVDGGFTVNGF  274



>gb|KEH22973.1| NAD(P)-binding rossmann-fold protein [Medicago truncatula]
Length=265

 Score =   266 bits (680),  Expect = 8e-84, Method: Compositional matrix adjust.
 Identities = 135/250 (54%), Positives = 179/250 (72%), Gaps = 2/250 (1%)
 Frame = -1

Query  913  RWSLHGMTALVTGGTRGLGHAIVEELACLGATVYTCSRTEKELEECIQNWKAKGYKVFGS  734
            RWSLHGMTALVTGGTRG+G+AIVEELA  GA V+ C+R E+++ +C++ WK KG+ V GS
Sbjct  13   RWSLHGMTALVTGGTRGIGYAIVEELAEFGAAVHVCARNEEDINKCLEEWKNKGFNVTGS  72

Query  733  VCDILQPSQRENLIQLVSKQFDGKLTILVNNVAILIPKETLKSDGQDFSNTIGTNLEASL  554
            VCDIL   QR+ L++ VS  F GKL ILVNN A    K+ + +  +D + T+GTN  +  
Sbjct  73   VCDILFHEQRKRLMETVSSIFHGKLNILVNNAAKPTSKKIIDNTDEDINTTLGTNFVSGY  132

Query  553  NLCQLAHPLLKATGNGsivfisscssfVYAPFHTIYASTKGAINSLVKNLACEWANDNIR  374
            +LCQLAHPLLK +G GSIVF SS +     P  ++YA+TKGA+N   KNLA EWA DNIR
Sbjct  133  HLCQLAHPLLKQSGYGSIVFTSSVAGLKAIPVLSVYAATKGAVNQFTKNLALEWAKDNIR  192

Query  373  VNAVAPWLMRTSLTES--SRGEFGAVIEALIRRTLQHRLVEPKEASAAVAFLCFPAASFV  200
             NAVAP  ++TSL +S  +  E    ++ ++ +T   R+ EPKE S+ VAFLC PAAS++
Sbjct  193  ANAVAPGPVKTSLLQSITNDNEGDEAVDGVVSQTPMGRMGEPKEISSLVAFLCLPAASYI  252

Query  199  TGQIISVDGG  170
            TGQ+I++DGG
Sbjct  253  TGQVIAIDGG  262



>ref|XP_009125632.1| PREDICTED: tropinone reductase homolog At1g07440-like [Brassica 
rapa]
Length=263

 Score =   266 bits (680),  Expect = 8e-84, Method: Compositional matrix adjust.
 Identities = 139/254 (55%), Positives = 184/254 (72%), Gaps = 1/254 (0%)
 Frame = -1

Query  913  RWSLHGMTALVTGGTRGLGHAIVEELACLGATVYTCSRTEKELEECIQNWKAKGYKVFGS  734
            RWSL G TALVTGGTRG+G A+VEELA  GATV+TCSR+++EL+ C+ +WK+ G  + GS
Sbjct  7    RWSLAGKTALVTGGTRGIGRAVVEELARFGATVHTCSRSQEELKSCLDDWKSNGLVITGS  66

Query  733  VCDILQPSQRENLIQLVSKQFDGKLTILVNNVAILIPKETLKSDGQDFSNTIGTNLEASL  554
            VCD     QRENLIQ VS  F GK+ ILVNNV   + K T++   +D++  + TNLE++ 
Sbjct  67   VCDASVRDQRENLIQEVSSVFSGKINILVNNVGTNLRKPTVEYTSEDYAKIMSTNLESAF  126

Query  553  NLCQLAHPLLKATGNGsivfisscssfVYAPFHTIYASTKGAINSLVKNLACEWANDNIR  374
            +  Q+AHPLLKA+G GSIVFISS +  V+    ++Y +TKGA+N L +NLACEWA DNIR
Sbjct  127  HFSQIAHPLLKASGVGSIVFISSVAGLVHLSSGSVYGATKGALNQLTRNLACEWAGDNIR  186

Query  373  VNAVAPWLMRTSLTESSRGEFGAVIEALIRRTLQHRLVEPKEASAAVAFLCFPAASFVTG  194
             N VAPW ++TSL +    + G   EA++ RT   R+ EP+E S+ VAFLC PAAS++TG
Sbjct  187  TNCVAPWYIKTSLVKPLLEKKG-FEEAIVSRTPLGRVGEPEEVSSLVAFLCLPAASYITG  245

Query  193  QIISVDGGGSIYGL  152
            Q+ISVDGG ++ G 
Sbjct  246  QVISVDGGFTVNGF  259



>ref|XP_008358998.1| PREDICTED: tropinone reductase homolog At1g07440-like [Malus 
domestica]
Length=264

 Score =   266 bits (680),  Expect = 8e-84, Method: Compositional matrix adjust.
 Identities = 140/254 (55%), Positives = 181/254 (71%), Gaps = 3/254 (1%)
 Frame = -1

Query  910  WSLHGMTALVTGGTRGLGHAIVEELACLGATVYTCSRTEKELEECIQNWKAKGYKVFGSV  731
            WSL GMTALVTGGT+G+G+AIVEELA LGA V+TCSR E +L +C+  W+ KG++V GSV
Sbjct  8    WSLRGMTALVTGGTKGIGYAIVEELAGLGAIVHTCSRNEVDLNDCLSQWEKKGFQVTGSV  67

Query  730  CDILQPSQRENLIQLVSKQFDGKLTILVNNVAILIPKETLKSDGQDFSNTIGTNLEASLN  551
            CD++  +QRE LI  VS  FDGKL IL+NNV I+  K T++   +D+S  + TNLE++ N
Sbjct  68   CDVVSKTQREELINKVSSLFDGKLNILINNVGIVEAKATVEYTAEDYSFIMSTNLESAYN  127

Query  550  LCQLAHPLLKATGNGsivfisscssfVYAPFHTIYASTKGAINSLVKNLACEWANDNIRV  371
             CQL+HPLLKA G  +IVF+SS +  V     +IY++ KGA+N L KNLACEWA DNIR 
Sbjct  128  FCQLSHPLLKAAGAANIVFLSSTAGVVSINGASIYSAAKGAMNQLAKNLACEWAKDNIRT  187

Query  370  NAVAPWLMRTSLTESS-RGEFGAVIEALIRRTLQHRLVEPKEASAAVAFLCFPAASFVTG  194
            N+VAPW + T L+E   R E    +E +  R    R  EP+E S+ VAFLC PAAS++TG
Sbjct  188  NSVAPWFITTPLSEPVLRNE--KKLEMINSRCPLRRPGEPEEVSSLVAFLCLPAASYITG  245

Query  193  QIISVDGGGSIYGL  152
            Q I VDGG ++ GL
Sbjct  246  QTIIVDGGVTVNGL  259



>ref|NP_001242650.1| uncharacterized protein LOC100819646 [Glycine max]
 gb|ACU21266.1| unknown [Glycine max]
Length=271

 Score =   266 bits (680),  Expect = 8e-84, Method: Compositional matrix adjust.
 Identities = 144/260 (55%), Positives = 176/260 (68%), Gaps = 1/260 (0%)
 Frame = -1

Query  913  RWSLHGMTALVTGGTRGLGHAIVEELACLGATVYTCSRTEKELEECIQNWKAKGYKVFGS  734
            RWSL G TALVTGGTRG+GHA+VEELA  GATVYTCSR E+EL  C++ WK KG+ V G 
Sbjct  12   RWSLKGTTALVTGGTRGIGHAVVEELAEFGATVYTCSRNEEELNACLKEWKEKGFSVSGL  71

Query  733  VCDILQPSQRENLIQLVSKQFDGKLTILVNNVAILIPKETLKSDGQDFSNTIGTNLEASL  554
            VCD   P  RENLIQ V+  F+GKL ILVNNV   + K T++   +++S  + TNL+++ 
Sbjct  72   VCDASSPPHRENLIQQVASAFNGKLNILVNNVGTNVRKPTIEYTAEEYSKLMATNLDSTY  131

Query  553  NLCQLAHPLLKATGNGsivfisscssfVYAPFHTIYASTKGAINSLVKNLACEWANDNIR  374
            +LCQLA+PLLKA+GNGSIV ISS +S        IYA+TK AI+ L K  ACEWA DNIR
Sbjct  132  HLCQLAYPLLKASGNGSIVSISSVASQTSVGSGAIYAATKAAIDQLTKYFACEWAKDNIR  191

Query  373  VNAVAPWLMRTSLTESSRGEFGAVIEALIRRTLQHRLVEPKEASAAVAFLCFPAASFVTG  194
             N VAPW   TSL E        V E +I RT   R+ E  E S+ V FLC PAA ++TG
Sbjct  192  SNGVAPWYTITSLVEPLLANKQLVSE-IISRTPIKRMAETHEVSSLVTFLCLPAAPYITG  250

Query  193  QIISVDGGGSIYGL*TSVWI  134
            QI+SVDGG +  G   S+ I
Sbjct  251  QIVSVDGGFTANGFQPSMRI  270



>ref|XP_010228815.1| PREDICTED: tropinone reductase homolog At1g07440-like [Brachypodium 
distachyon]
Length=270

 Score =   266 bits (680),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 146/257 (57%), Positives = 182/257 (71%), Gaps = 5/257 (2%)
 Frame = -1

Query  916  GRWSLHGMTALVTGGTRGLGHAIVEELACLGATVYTCSRTEKELEECIQNWKAKGYKVFG  737
            GRWSLHG TALVTGGTRG+G A+VEELA LGA V+TCSR E EL E ++ W+AKG++V  
Sbjct  14   GRWSLHGKTALVTGGTRGIGRAVVEELAALGAAVHTCSRKESELGERLKEWEAKGFRVTT  73

Query  736  SVCDILQPSQRENLIQLVSKQFDGKLTILVNNVAILIPKETLKSDGQDFSNTIGTNLEAS  557
            SVCD+    QR+ L   V+++F GKL ILVNNV   I K T +   +D+S  + TNLE+ 
Sbjct  74   SVCDLSVRDQRDRLAGEVAERFGGKLDILVNNVGTNIRKPTTEYSSEDYSFVMATNLESG  133

Query  556  LNLCQLAHPLLKATGNGsivfisscssfVYAPFHTIYASTKGAINSLVKNLACEWANDNI  377
             +LCQLAHPLLKA+G+GSIVF+SS    V     TIYA TKGAIN L KNLACEWA D I
Sbjct  134  YHLCQLAHPLLKASGSGSIVFVSSVCGVVAVFSGTIYAMTKGAINQLTKNLACEWAKDGI  193

Query  376  RVNAVAPWLMRTSLTES--SRGEFGAVIEALIRRTLQHRLVEPKEASAAVAFLCFPAASF  203
            R N+VAPW + TSLTE   +  EF A   +++  T   R+ EP E S+ VAFLC P +++
Sbjct  194  RANSVAPWYITTSLTEGLLANKEFEA---SVVNCTPLRRVGEPGEVSSLVAFLCMPGSTY  250

Query  202  VTGQIISVDGGGSIYGL  152
            +TGQ ISVDGG ++ GL
Sbjct  251  ITGQTISVDGGMTVKGL  267



>ref|XP_007206475.1| hypothetical protein PRUPE_ppa018984mg [Prunus persica]
 gb|EMJ07674.1| hypothetical protein PRUPE_ppa018984mg [Prunus persica]
Length=271

 Score =   266 bits (679),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 143/258 (55%), Positives = 183/258 (71%), Gaps = 7/258 (3%)
 Frame = -1

Query  913  RWSLHGMTALVTGGTRGLGHAIVEELACLGATVYTCSRTEKELEECIQNWKAKGY-KVFG  737
            RWSLHGMTALVTGGT+G+G+AIVEELA LGAT++TCSR E +L +C+  WK KG+ +V G
Sbjct  12   RWSLHGMTALVTGGTKGIGYAIVEELAGLGATIHTCSRNEVQLNDCLSQWKMKGFDQVTG  71

Query  736  SVCDILQPSQRENLIQLVSKQFDGKLTILVNNVAILIPKETLKSDGQDFSNTIGTNLEAS  557
            SVCD++  +QRE LI  VS  F GKL I +NNV     K  ++S  +D+S  + TNLE++
Sbjct  72   SVCDVVSKAQREELINKVSSLFHGKLNIFINNVGTAELKPAIESTTEDYSCIMSTNLESA  131

Query  556  LNLCQLAHPLLKATGNGsivfisscs-sfVYAPFHTIYASTKGAINSLVKNLACEWANDN  380
             +  QLA+PLLK +G G+I+F+SS +         +IY +TKGA+N L KNLACEWA DN
Sbjct  132  YHFSQLAYPLLKVSGAGNIIFMSSVAGVVSVGTAGSIYGATKGAMNQLAKNLACEWAKDN  191

Query  379  IRVNAVAPWLMRTSLTES--SRGEFGAVIEALIRRTLQHRLVEPKEASAAVAFLCFPAAS  206
            IR N+VAPW +RT LTE   S  +F   +EA+  R    R  EPKE SA VAFLCFPAAS
Sbjct  192  IRTNSVAPWFIRTPLTEPLLSNQKF---LEAVNSRCPLGRTGEPKEVSALVAFLCFPAAS  248

Query  205  FVTGQIISVDGGGSIYGL  152
            ++TGQ I VDGG ++ GL
Sbjct  249  YITGQTICVDGGFTVNGL  266



>gb|AIX10937.1| putative tropinone reductase [Gardenia jasminoides]
Length=274

 Score =   266 bits (679),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 142/256 (55%), Positives = 183/256 (71%), Gaps = 5/256 (2%)
 Frame = -1

Query  913  RWSLHGMTALVTGGTRGLGHAIVEELACLGATVYTCSRTEKELEECIQNWKAKGYKVFGS  734
            RWSL G TALVTGGTRG+G A+VEELA LGAT++TCSR E EL E +Q W +KG+KV GS
Sbjct  12   RWSLAGKTALVTGGTRGIGLAVVEELAELGATIHTCSRNEVELNERLQEWASKGFKVTGS  71

Query  733  VCDILQPSQRENLIQLVSKQFDGKLTILVNNVAILIPKETLKSDGQDFSNTIGTNLEASL  554
            VCD     QRE L+  VS  FDGKL +L+NNV   I K T     +++   + TNLE++ 
Sbjct  72   VCDASSREQREQLMGKVSSVFDGKLNLLINNVGTNIRKPTTDYTAEEYCRIMATNLESAY  131

Query  553  NLCQLAHPLLKATGNGsivfisscssfVYAPFHTIYASTKGAINSLVKNLACEWANDNIR  374
            +L QLA+PLLKA+G GS VFISS +  V+    +IY +TKGA+N L +NLACEWA DNIR
Sbjct  132  HLSQLAYPLLKASGVGSTVFISSVAGLVHLSSGSIYGATKGAMNQLTRNLACEWAKDNIR  191

Query  373  VNAVAPWLMRTSLTES--SRGEFGAVIEALIRRTLQHRLVEPKEASAAVAFLCFPAASFV  200
            VN VAPW +RTSL E+  +  EF   ++ +I RT   R  EPKE S+ VA+ C PAAS++
Sbjct  192  VNCVAPWYIRTSLVENLLNNKEF---LDMVISRTPLGRPGEPKEVSSLVAYFCLPAASYI  248

Query  199  TGQIISVDGGGSIYGL  152
            TGQ+++VDGG +++GL
Sbjct  249  TGQVVAVDGGMTVFGL  264



>gb|EAY89400.1| hypothetical protein OsI_10905 [Oryza sativa Indica Group]
Length=277

 Score =   266 bits (679),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 142/250 (57%), Positives = 182/250 (73%), Gaps = 5/250 (2%)
 Frame = -1

Query  913  RWSLHGMTALVTGGTRGLGHAIVEELACLGATVYTCSRTEKELEECIQNWKAKGYKVFGS  734
            RWSL G TALVTGGTRG+G A+VEELA LGATV+TCSR E+EL E ++ W+A+G++V  S
Sbjct  16   RWSLQGKTALVTGGTRGIGRAVVEELAALGATVHTCSRKEEELSERLKEWEARGFRVTTS  75

Query  733  VCDILQPSQRENLIQLVSKQFDGKLTILVNNVAILIPKETLKSDGQDFSNTIGTNLEASL  554
            VCD+    QRE L++ V+  F GKL ILVNNV   I K T +   +++S  + TNLE++ 
Sbjct  76   VCDLSVRDQRERLLRQVADLFGGKLDILVNNVGTNIRKPTTEFSAEEYSFMMATNLESAY  135

Query  553  NLCQLAHPLLKATGNGsivfisscssfVYAPFHTIYASTKGAINSLVKNLACEWANDNIR  374
            +LCQL+HPLLKA+G+GSIVFISS    V     ++YA TKGAIN L KNLACEWA DNIR
Sbjct  136  HLCQLSHPLLKASGSGSIVFISSVCGLVAVFSGSLYAMTKGAINQLTKNLACEWARDNIR  195

Query  373  VNAVAPWLMRTSLTES--SRGEFGAVIEALIRRTLQHRLVEPKEASAAVAFLCFPAASFV  200
             N++APW +RTSLTE   +  +F     A++ RT   R+ EP+E S+ VAFLC P +S++
Sbjct  196  SNSIAPWYIRTSLTEGLLANKDFEG---AVVSRTPLRRVGEPEEVSSLVAFLCMPGSSYI  252

Query  199  TGQIISVDGG  170
            TGQ ISVDGG
Sbjct  253  TGQTISVDGG  262



>ref|XP_004303414.1| PREDICTED: tropinone reductase homolog [Fragaria vesca subsp. 
vesca]
Length=249

 Score =   265 bits (677),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 137/254 (54%), Positives = 175/254 (69%), Gaps = 12/254 (5%)
 Frame = -1

Query  913  RWSLHGMTALVTGGTRGLGHAIVEELACLGATVYTCSRTEKELEECIQNWKAKGYKVFGS  734
            RWSL GMTALVT GTRG+G+AIVEELA LGATV+TC+R +  ++E +Q WK KG+ V GS
Sbjct  8    RWSLKGMTALVTSGTRGIGYAIVEELAGLGATVHTCARNKALIDERVQEWKIKGFTVSGS  67

Query  733  VCDILQPSQRENLIQLVSKQFDGKLTILVNNVAILIPKETLKSDGQDFSNTIGTNLEASL  554
            VCD+   SQRE LI+ VS  FDGKL+ILVNN AI+  + T     +DFS+ + +N+E+  
Sbjct  68   VCDLTSKSQREELIKTVSSAFDGKLSILVNNAAIVTLRGTTDYSLEDFSSMMSSNVESPY  127

Query  553  NLCQLAHPLLKATGNGsivfisscssfVYAPFHTIYASTKGAINSLVKNLACEWANDNIR  374
            +LCQLAHPLLKA+GNGSI+F+SS +  +  P  + YA+TKGAI  + KNLACEWA D IR
Sbjct  128  HLCQLAHPLLKASGNGSIIFVSSIAGVIALPKLSAYAATKGAIIQISKNLACEWAKDKIR  187

Query  373  VNAVAPWLMRTSLTESSRGEFGAVIEALIRRTLQHRLVEPKEASAAVAFLCFPAASFVTG  194
             N VAPW  R                 LI RT   RL +P E S+ V FLC PAAS++ G
Sbjct  188  TNTVAPWAQRDDFRR------------LIARTPIRRLADPNEISSLVTFLCLPAASYING  235

Query  193  QIISVDGGGSIYGL  152
            Q++S+DGG ++ G 
Sbjct  236  QVVSIDGGFTVSGF  249



>gb|AGH24753.1| tropinone reductase-II [Atropa belladonna]
Length=260

 Score =   265 bits (677),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 139/253 (55%), Positives = 176/253 (70%), Gaps = 2/253 (1%)
 Frame = -1

Query  922  MAGRWSLHGMTALVTGGTRGLGHAIVEELACLGATVYTCSRTEKELEECIQNWKAKGYKV  743
            MAGRW+L G TALVTGG+RG+G+ IVEELA LGA+VYTCSR +KEL EC+  W++KG+ V
Sbjct  1    MAGRWNLEGCTALVTGGSRGIGYGIVEELASLGASVYTCSRNQKELNECLTQWRSKGFNV  60

Query  742  FGSVCDILQPSQRENLIQLVSKQFDGKLTILVNNVAILIPKETLKSDGQDFSNTIGTNLE  563
              SVCD+   S+RE  ++ VS  FDGKL ILVNN  I+I KE      +D+S  +  N E
Sbjct  61   EASVCDLSSRSEREEFMKTVSNHFDGKLNILVNNAGIVIYKEAKDYTMEDYSLIMSINFE  120

Query  562  ASLNLCQLAHPLLKATGNGsivfisscssfVYAPFHTIYASTKGAINSLVKNLACEWAND  383
            A+ +L  LAHP LKA+  G++VFISS S     P+  +Y +TKGA++ L + LA EWA D
Sbjct  121  AAYHLSVLAHPFLKASERGNVVFISSISGASALPYEAVYGATKGALDQLTRCLAFEWAKD  180

Query  382  NIRVNAVAPWLMRTSLTESS--RGEFGAVIEALIRRTLQHRLVEPKEASAAVAFLCFPAA  209
            NIRVN V P ++ TSL E +    E    ++ LI R   HR+ EPKE +A VAFLCFPAA
Sbjct  181  NIRVNGVGPGVIATSLVEMTIQDPEQKENLDKLIDRCALHRMGEPKELAAVVAFLCFPAA  240

Query  208  SFVTGQIISVDGG  170
            S+VTGQII VDGG
Sbjct  241  SYVTGQIIYVDGG  253



>gb|AFP55030.1| tropinone reductase I [Atropa belladonna]
Length=272

 Score =   265 bits (678),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 137/252 (54%), Positives = 181/252 (72%), Gaps = 3/252 (1%)
 Frame = -1

Query  916  GRWSLHGMTALVTGGTRGLGHAIVEELACLGATVYTCSRTEKELEECIQNWKAKGYKVFG  737
            GRWSL G TALVTGG++G+G+AIVEELA  GATVYTCSR E EL+ECI NW+  G KV G
Sbjct  14   GRWSLKGTTALVTGGSKGIGYAIVEELAGFGATVYTCSRNENELQECIDNWRKNGLKVEG  73

Query  736  SVCDILQPSQRENLIQLVSKQFDGKLTILVNNVAILIPKETLKSDGQDFSNTIGTNLEAS  557
            SVCD+L  ++RE L+Q V   F+GKL+ILVNN  ++I KE      +D++  +GTN EA+
Sbjct  74   SVCDLLLRTEREKLMQTVGDAFNGKLSILVNNAGVVIHKEAKDFTAEDYNIVMGTNFEAA  133

Query  556  LNLCQLAHPLLKATGNGsivfisscssfVYAPFHTIYASTKGAINSLVKNLACEWANDNI  377
             +L Q+A+PLLKA+ NG+++F+SS + F   P  ++Y+++K AIN + KNLACEWA DNI
Sbjct  134  YHLSQIAYPLLKASENGNVIFLSSIAGFSALPSVSLYSASKAAINQMTKNLACEWAKDNI  193

Query  376  RVNAVAPWLMRTSLTESS---RGEFGAVIEALIRRTLQHRLVEPKEASAAVAFLCFPAAS  206
            RVN+VAP ++ T L E++          I+  I +T   R   PKE SA +AFLCFPAAS
Sbjct  194  RVNSVAPGVILTPLVETAIKKNPHQKEEIDNFIVKTPMGRAGNPKEVSALIAFLCFPAAS  253

Query  205  FVTGQIISVDGG  170
            ++TGQII  DGG
Sbjct  254  YITGQIIWADGG  265



>emb|CDY68057.1| BnaAnng26060D [Brassica napus]
Length=262

 Score =   265 bits (677),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 136/257 (53%), Positives = 179/257 (70%), Gaps = 1/257 (0%)
 Frame = -1

Query  922  MAGRWSLHGMTALVTGGTRGLGHAIVEELACLGATVYTCSRTEKELEECIQNWKAKGYKV  743
            M  RWSL GMTALVTGGT+G+G+AIVEELA  GA V+TC+R +  L+EC+  WK KG++V
Sbjct  1    MDSRWSLRGMTALVTGGTKGIGYAIVEELAGFGARVHTCARDQTLLDECLSEWKEKGFQV  60

Query  742  FGSVCDILQPSQRENLIQLVSKQFDGKLTILVNNVAILIPKETLKSDGQDFSNTIGTNLE  563
             GSVCD+    QR+ L++ VS  F GKL IL+NNV  L+ K T +   QDFS  I TNL+
Sbjct  61   TGSVCDVSSRPQRDELMKTVSSLFSGKLNILINNVGTLVSKPTTEFTAQDFSGQIATNLD  120

Query  562  ASLNLCQLAHPLLKATGNGsivfisscssfVYAPFHTIYASTKGAINSLVKNLACEWAND  383
            ++ +  QLAHPLLKA+G GSIVF+SS    V + F +IY+ TKG +N L +NLACEWA+D
Sbjct  121  SAYHFSQLAHPLLKASGFGSIVFLSSVCGVVSSGFVSIYSLTKGCMNQLARNLACEWASD  180

Query  382  NIRVNAVAPWLMRTSLTESSRGEFGAVIEALIRRTLQHRLVEPKEASAAVAFLCFPAASF  203
             IR N+VAPW+ +T L +  R +     EA+  RT   R  EP+E ++ V FLC PAAS+
Sbjct  181  GIRANSVAPWMTKTPLVQ-KRLDDEKFAEAIFSRTPLGRACEPREVASLVTFLCLPAASY  239

Query  202  VTGQIISVDGGGSIYGL  152
            +TGQ I +DGG ++ G 
Sbjct  240  ITGQTICIDGGFTVNGF  256



>ref|XP_010542627.1| PREDICTED: tropinone reductase homolog At1g07440-like isoform 
X1 [Tarenaya hassleriana]
Length=273

 Score =   265 bits (678),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 140/254 (55%), Positives = 184/254 (72%), Gaps = 1/254 (0%)
 Frame = -1

Query  913  RWSLHGMTALVTGGTRGLGHAIVEELACLGATVYTCSRTEKELEECIQNWKAKGYKVFGS  734
            RWSL GMTALVTGGT+G+G+AIVEELA  GA V+TC+R +  L EC++ W+ KG++V GS
Sbjct  12   RWSLEGMTALVTGGTKGIGYAIVEELAGFGARVHTCARNQSLLNECLRKWQTKGFQVTGS  71

Query  733  VCDILQPSQRENLIQLVSKQFDGKLTILVNNVAILIPKETLKSDGQDFSNTIGTNLEASL  554
            VCD+   S+RE L+Q VS  FDGKL+IL+NNV   I K T +   +DFS  I TNLE++ 
Sbjct  72   VCDVSSRSEREKLMQTVSSTFDGKLSILINNVGTSIVKPTTEYTAEDFSFHITTNLESAY  131

Query  553  NLCQLAHPLLKATGNGsivfisscssfVYAPFHTIYASTKGAINSLVKNLACEWANDNIR  374
            +L QLAHPLLKA+G+G+IVFISS +  V     +I  +TKGA+N L +NLACEWA+DNIR
Sbjct  132  HLSQLAHPLLKASGSGNIVFISSIAGIVSTSVGSICNATKGAVNQLARNLACEWASDNIR  191

Query  373  VNAVAPWLMRTSLTESSRGEFGAVIEALIRRTLQHRLVEPKEASAAVAFLCFPAASFVTG  194
            VN+VAP  + T + E+  G+    ++A+I R    R+ EP+E S+ V FLC PAAS++TG
Sbjct  192  VNSVAPGFIATPMAETVLGD-DNFLKAVISRKPLGRVGEPREVSSMVVFLCLPAASYITG  250

Query  193  QIISVDGGGSIYGL  152
            Q I VDGG +I G 
Sbjct  251  QTICVDGGLTINGF  264



>ref|XP_010423393.1| PREDICTED: tropinone reductase homolog At1g07440-like [Camelina 
sativa]
Length=262

 Score =   265 bits (677),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 137/256 (54%), Positives = 184/256 (72%), Gaps = 5/256 (2%)
 Frame = -1

Query  913  RWSLHGMTALVTGGTRGLGHAIVEELACLGATVYTCSRTEKELEECIQNWKAKGYKVFGS  734
            RW+L G TALVTGGTRG+G A+VEELA  GA V+TCSR + EL  C+ +WK+ G+ V GS
Sbjct  6    RWTLAGKTALVTGGTRGIGRAVVEELARFGAKVHTCSRNQDELNACLDDWKSNGFVVSGS  65

Query  733  VCDILQPSQRENLIQLVSKQFDGKLTILVNNVAILIPKETLKSDGQDFSNTIGTNLEASL  554
            VCD     QR+ LIQ VS  F GKL IL+NNV   I K  ++   ++++  + TNLE++ 
Sbjct  66   VCDASVKDQRDQLIQDVSSAFSGKLNILINNVGTNIRKPAVEYSSEEYAKIMSTNLESAF  125

Query  553  NLCQLAHPLLKATGNGsivfisscssfVYAPFHTIYASTKGAINSLVKNLACEWANDNIR  374
            +L Q+AHPLLKA+G G+IVFISS +  V+    +IY +TKGA+N L +NLACEWA+DNIR
Sbjct  126  HLSQIAHPLLKASGVGNIVFISSVAGLVHLSSGSIYGATKGALNQLTRNLACEWASDNIR  185

Query  373  VNAVAPWLMRTSLTES--SRGEFGAVIEALIRRTLQHRLVEPKEASAAVAFLCFPAASFV  200
             N VAPW ++TSL ES   + EF   ++A++ RT   R+ EP+E ++ VAFLC PAAS++
Sbjct  186  TNCVAPWYIKTSLVESLLEKKEF---VDAVVSRTPLGRVGEPEEVASLVAFLCLPAASYI  242

Query  199  TGQIISVDGGGSIYGL  152
            TGQ+ISVDGG ++ G 
Sbjct  243  TGQVISVDGGFTVNGF  258



>ref|XP_007016327.1| Senescence-associated gene 13, putative isoform 1 [Theobroma 
cacao]
 gb|EOY33946.1| Senescence-associated gene 13, putative isoform 1 [Theobroma 
cacao]
Length=298

 Score =   266 bits (680),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 142/266 (53%), Positives = 181/266 (68%), Gaps = 12/266 (5%)
 Frame = -1

Query  913  RWSLHGMTALVTGGTRGLGHAIVEELACLGATVYTCSRTEKELEECIQNWKAKGYKVFGS  734
            RWSLH MTALVTGGT+G+G+AIVEELA LGA ++TCSR E +L +C+ +W AKG++V GS
Sbjct  16   RWSLHAMTALVTGGTKGIGYAIVEELAALGARIHTCSRNETDLNKCLLDWDAKGFQVTGS  75

Query  733  VCDILQPSQRENLIQLVSKQFDGKLTILVNNVAILIPKETLKSDGQDFSNTIGTNLEASL  554
            VCD+   +QRE LI  VS +F GKL IL+NNV   + K T     +DFS  +GTN E++ 
Sbjct  76   VCDVSSQAQREKLINTVSSEFGGKLNILINNVGTSVLKPTPDFTAEDFSFIMGTNFESAY  135

Query  553  NLCQLAHPLLKATGNGsivfisscssfVYAPFHTIYASTKGAINSLVKNLACEWANDNIR  374
            NLCQLA+PLLKA+G GSIVF+SS S  V   F ++Y +TKGA+N L K LACEWA DNIR
Sbjct  136  NLCQLAYPLLKASGAGSIVFLSSVSGVVSVSFGSLYGATKGAMNHLAKYLACEWAKDNIR  195

Query  373  VNAVAPWLMRTSLTESSRGEFGAVI------------EALIRRTLQHRLVEPKEASAAVA  230
            VN+VAPW ++T LTE                      E +I RT   R+ EP+E S+ V 
Sbjct  196  VNSVAPWFIQTPLTEDCCSSIYNCCPSPCLQYIQKFSEIIISRTPLGRIGEPEEVSSLVG  255

Query  229  FLCFPAASFVTGQIISVDGGGSIYGL  152
            FLC PA+S++TGQ   +DGG S+ G 
Sbjct  256  FLCLPASSYITGQTFCIDGGMSVNGF  281



>ref|XP_006649826.1| PREDICTED: tropinone reductase homolog At1g07440-like isoform 
X1 [Oryza brachyantha]
Length=271

 Score =   265 bits (678),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 142/257 (55%), Positives = 185/257 (72%), Gaps = 5/257 (2%)
 Frame = -1

Query  916  GRWSLHGMTALVTGGTRGLGHAIVEELACLGATVYTCSRTEKELEECIQNWKAKGYKVFG  737
            GRWSL G TAL+TGGTRG+G A+VEELA LGA V+TCSR E EL E ++ W+A+G++V  
Sbjct  15   GRWSLQGKTALITGGTRGIGRAVVEELAALGAIVHTCSRKEAELGERLREWEARGFRVTT  74

Query  736  SVCDILQPSQRENLIQLVSKQFDGKLTILVNNVAILIPKETLKSDGQDFSNTIGTNLEAS  557
            SVCD+    QRE L++ V+  F GKL ILVNNV   I K T +   +++S  + TNLE++
Sbjct  75   SVCDLSVRDQRERLLRQVADLFGGKLDILVNNVGTNIRKPTTEFSAEEYSFMMATNLESA  134

Query  556  LNLCQLAHPLLKATGNGsivfisscssfVYAPFHTIYASTKGAINSLVKNLACEWANDNI  377
             +LCQL+HPLLKA+G+G+IVFISS    V     ++YA TKGAIN L KNLACEWA DNI
Sbjct  135  YHLCQLSHPLLKASGSGNIVFISSVCGLVAVFSGSLYAMTKGAINQLTKNLACEWARDNI  194

Query  376  RVNAVAPWLMRTSLTES--SRGEFGAVIEALIRRTLQHRLVEPKEASAAVAFLCFPAASF  203
            R N+VAPW +RTSLT+   +  EF    + ++ RT   R+ EP+E S+ VAFLC P +S+
Sbjct  195  RTNSVAPWYIRTSLTQGLLANKEFE---DTVVNRTPLKRVGEPEEVSSLVAFLCMPGSSY  251

Query  202  VTGQIISVDGGGSIYGL  152
            +TGQ ISVDGG ++ GL
Sbjct  252  ITGQTISVDGGMTVNGL  268



>dbj|BAJ87177.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=270

 Score =   265 bits (678),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 142/258 (55%), Positives = 185/258 (72%), Gaps = 5/258 (2%)
 Frame = -1

Query  919  AGRWSLHGMTALVTGGTRGLGHAIVEELACLGATVYTCSRTEKELEECIQNWKAKGYKVF  740
            AGRWSLHG TALVTGGTRG+G A+VEELA LGA V+TCSR E EL + ++ W+AKG++V 
Sbjct  11   AGRWSLHGRTALVTGGTRGIGRAVVEELAALGAAVHTCSRKEAELGDRLKEWEAKGFRVT  70

Query  739  GSVCDILQPSQRENLIQLVSKQFDGKLTILVNNVAILIPKETLKSDGQDFSNTIGTNLEA  560
            GSVCD+    QRE L++ V+ +F GKL IL+NNV     K T +    ++S  + TNLE+
Sbjct  71   GSVCDVSVRGQRELLLRDVADRFAGKLDILINNVGTNRRKPTTEYSADEYSFIMATNLES  130

Query  559  SLNLCQLAHPLLKATGNGsivfisscssfVYAPFHTIYASTKGAINSLVKNLACEWANDN  380
            + +LCQLAHPLLKA+   SIVFISS S  V     +IY  TKGA+N L KNLACEWA DN
Sbjct  131  AYHLCQLAHPLLKASAVASIVFISSVSGVVAISSGSIYGMTKGAMNQLAKNLACEWAKDN  190

Query  379  IRVNAVAPWLMRTSLTES--SRGEFGAVIEALIRRTLQHRLVEPKEASAAVAFLCFPAAS  206
            IR+N+VAPW ++TSL E   ++ +F   ++ + RRT   R+ EP+E S+ VAFLC   +S
Sbjct  191  IRINSVAPWYIKTSLVEEDLAKKDF---VDIIARRTPMRRVGEPEEVSSLVAFLCMRGSS  247

Query  205  FVTGQIISVDGGGSIYGL  152
            ++TGQ ISVDGG +I G+
Sbjct  248  YITGQTISVDGGMTINGM  265



>emb|CAC19810.1| tropinone reductase II [Solanum tuberosum]
Length=261

 Score =   265 bits (677),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 139/254 (55%), Positives = 179/254 (70%), Gaps = 2/254 (1%)
 Frame = -1

Query  925  IMAGRWSLHGMTALVTGGTRGLGHAIVEELACLGATVYTCSRTEKELEECIQNWKAKGYK  746
            + AGRW+L G TALVTGG+RG+G+ IVEELA LGA+VYTCSR +KEL EC+  W++KG+K
Sbjct  1    MAAGRWNLEGCTALVTGGSRGIGYGIVEELASLGASVYTCSRNQKELNECLTQWRSKGFK  60

Query  745  VFGSVCDILQPSQRENLIQLVSKQFDGKLTILVNNVAILIPKETLKSDGQDFSNTIGTNL  566
            V  SVCD+   S+RE  I+ V+  FDGKL ILVNN  I+I KE      +D+S  +  N 
Sbjct  61   VEASVCDLSSRSEREEFIKNVANHFDGKLNILVNNAGIVIYKEAKDYTMEDYSLIMSINF  120

Query  565  EASLNLCQLAHPLLKATGNGsivfisscssfVYAPFHTIYASTKGAINSLVKNLACEWAN  386
            EA+ +L  LAHPLLKA+  G++VFISS S     P+  +Y +TKGA++ L + LA EWA 
Sbjct  121  EAAYHLSVLAHPLLKASQRGNVVFISSISGASALPYEAVYGATKGAMDQLTRCLAFEWAK  180

Query  385  DNIRVNAVAPWLMRTSLTESS--RGEFGAVIEALIRRTLQHRLVEPKEASAAVAFLCFPA  212
            DNIRVN VAP ++ +S+ E +    E    ++ LI R   HR+ EPKE +A VAFLCFPA
Sbjct  181  DNIRVNGVAPGVIASSMVEMTIQDPEQKENLDKLIDRCALHRMGEPKELAAVVAFLCFPA  240

Query  211  ASFVTGQIISVDGG  170
            AS+VTGQII VDGG
Sbjct  241  ASYVTGQIIYVDGG  254



>ref|XP_006288477.1| hypothetical protein CARUB_v10001737mg [Capsella rubella]
 gb|EOA21375.1| hypothetical protein CARUB_v10001737mg [Capsella rubella]
Length=263

 Score =   265 bits (677),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 137/256 (54%), Positives = 183/256 (71%), Gaps = 5/256 (2%)
 Frame = -1

Query  913  RWSLHGMTALVTGGTRGLGHAIVEELACLGATVYTCSRTEKELEECIQNWKAKGYKVFGS  734
            RW+L G TALVTGGTRG+G A+VEELA  GA V+TCSR ++EL  C+ +WK+ G+ V GS
Sbjct  7    RWTLAGKTALVTGGTRGIGRAVVEELARFGAKVHTCSRNQEELNACLNDWKSNGFVVTGS  66

Query  733  VCDILQPSQRENLIQLVSKQFDGKLTILVNNVAILIPKETLKSDGQDFSNTIGTNLEASL  554
            VCD     QR+ LIQ VS  F GKL IL+NNV   I K  +    ++++  + TNLE++ 
Sbjct  67   VCDASVRDQRDKLIQDVSSAFSGKLNILINNVGTNIRKPAIDYSSEEYAKIMSTNLESAF  126

Query  553  NLCQLAHPLLKATGNGsivfisscssfVYAPFHTIYASTKGAINSLVKNLACEWANDNIR  374
            ++ Q+AHPLLKA+G G+IVFISS +  V+     IY +TKGA+N L +NLACEWA+DNIR
Sbjct  127  HISQIAHPLLKASGVGNIVFISSVAGLVHLSSGAIYGATKGALNQLTRNLACEWASDNIR  186

Query  373  VNAVAPWLMRTSLTES--SRGEFGAVIEALIRRTLQHRLVEPKEASAAVAFLCFPAASFV  200
             N VAPW ++TSL ES   + EF   +EA++ RT   R+ EP+E ++ VAFLC PAAS++
Sbjct  187  TNCVAPWYIKTSLVESLLEKKEF---VEAIVSRTPLGRVGEPEEVASLVAFLCLPAASYI  243

Query  199  TGQIISVDGGGSIYGL  152
            TGQ+ISVDGG ++ G 
Sbjct  244  TGQVISVDGGFTVNGF  259



>ref|XP_006352700.1| PREDICTED: tropinone reductase homolog [Solanum tuberosum]
Length=265

 Score =   265 bits (677),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 137/254 (54%), Positives = 180/254 (71%), Gaps = 1/254 (0%)
 Frame = -1

Query  913  RWSLHGMTALVTGGTRGLGHAIVEELACLGATVYTCSRTEKELEECIQNWKAKGYKVFGS  734
            RWSL+G+ ALVTGGT G+GHAIVEEL   GA VYTCSR E  L EC++ W  KG +V G 
Sbjct  8    RWSLNGLVALVTGGTCGIGHAIVEELCEFGAKVYTCSRNESVLNECLKKWTDKGLQVKGC  67

Query  733  VCDILQPSQRENLIQLVSKQFDGKLTILVNNVAILIPKETLKSDGQDFSNTIGTNLEASL  554
            VCD+    QR  L++ VS +FDGKL IL+NNV   I K T +   +D+++ + TNLE+S 
Sbjct  68   VCDVSSKEQRVQLMEKVSLEFDGKLNILINNVGTNIWKPTTEYTSEDYAHMMATNLESSF  127

Query  553  NLCQLAHPLLKATGNGsivfisscssfVYAPFHTIYASTKGAINSLVKNLACEWANDNIR  374
            +LCQLAHPLLK++G+G+IVF+SS +  V+    +IY +TKGA+N L +NLACEWA D IR
Sbjct  128  HLCQLAHPLLKSSGSGTIVFLSSVAGLVHLSGTSIYGATKGAMNQLTRNLACEWAKDGIR  187

Query  373  VNAVAPWLMRTSLTESSRGEFGAVIEALIRRTLQHRLVEPKEASAAVAFLCFPAASFVTG  194
            VN VAPW + T L E   G+    +E ++ RT   R  E +E S+ VA+LC PAAS+VTG
Sbjct  188  VNGVAPWYINTPLVEHVLGD-KEFMEGVVSRTPLKRPGEVEEVSSMVAYLCLPAASYVTG  246

Query  193  QIISVDGGGSIYGL  152
            Q+I+VDGG ++YG 
Sbjct  247  QVIAVDGGFTVYGF  260



>gb|KDO38494.1| hypothetical protein CISIN_1g024551mg [Citrus sinensis]
Length=266

 Score =   265 bits (677),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 139/250 (56%), Positives = 181/250 (72%), Gaps = 3/250 (1%)
 Frame = -1

Query  913  RWSLHGMTALVTGGTRGLGHAIVEELACLGATVYTCSRTEKELEECIQNWKAKGYKVFGS  734
            +WSL GMTALVTGGTRG+G+AIVEELA  GA+V+TC R +  + E IQ W++KG+KV GS
Sbjct  13   KWSLRGMTALVTGGTRGIGYAIVEELARFGASVHTCGRDQNMINERIQEWESKGFKVTGS  72

Query  733  VCDILQPSQRENLIQLVSKQFDGKLTILVNNVAILIPKETLKSDGQDFSNTIGTNLEASL  554
            VCD+    QRE LI+ VS  FDGKL ILVNN A+++ K   +   +++S+ + TN+E+S 
Sbjct  73   VCDLSFGDQREKLIETVSSVFDGKLNILVNNAALVVMKRATEYTLEEYSSVMSTNVESSY  132

Query  553  NLCQLAHPLLKATGNGsivfisscssfVYAPFHTIYASTKGAINSLVKNLACEWANDNIR  374
            +LCQLAHPLLKA+GN SIVF+SS +  +  P  + YA++KGAIN L KNLACEWA D+IR
Sbjct  133  HLCQLAHPLLKASGNASIVFMSSVAGAISIPRLSAYAASKGAINQLTKNLACEWATDSIR  192

Query  373  VNAVAPWLMRTSLTESSRGEFGAVIE--ALIRRTLQHRLVEPKEASAAVAFLCFPAASFV  200
            VNAV+PW + T ++     +   V E   LI +T   R  EP E S  VAFLC PAAS++
Sbjct  193  VNAVSPWAVNTQISPPDLNDL-LVQEYVKLIAKTPLARSAEPNEISPLVAFLCLPAASYI  251

Query  199  TGQIISVDGG  170
            TGQ+IS+DGG
Sbjct  252  TGQVISIDGG  261



>emb|CAQ19732.1| tropinone reductase II [Solanum dulcamara]
Length=261

 Score =   265 bits (676),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 138/254 (54%), Positives = 178/254 (70%), Gaps = 2/254 (1%)
 Frame = -1

Query  925  IMAGRWSLHGMTALVTGGTRGLGHAIVEELACLGATVYTCSRTEKELEECIQNWKAKGYK  746
            + AGRW+L G TALVTGG+RG+G+ IVEELA LGA+VYTCSR +KEL EC+  W++KG+K
Sbjct  1    MAAGRWNLEGCTALVTGGSRGIGYGIVEELASLGASVYTCSRNQKELNECLSQWRSKGFK  60

Query  745  VFGSVCDILQPSQRENLIQLVSKQFDGKLTILVNNVAILIPKETLKSDGQDFSNTIGTNL  566
            V  SVCD+   S+RE  I+ V+  FDGKL ILVNN  I+I KE      +D+S  +  N 
Sbjct  61   VEASVCDLSSRSEREEFIKTVANHFDGKLNILVNNAGIVIYKEAKDYTMEDYSLIMSINF  120

Query  565  EASLNLCQLAHPLLKATGNGsivfisscssfVYAPFHTIYASTKGAINSLVKNLACEWAN  386
            EA+ +L  LAHP LKA+  G++VFISS S     P+  +Y +TKGA++ L + LA EWA 
Sbjct  121  EAAYHLSVLAHPFLKASERGNVVFISSISGAAALPYEAVYGATKGAMDQLARCLAFEWAK  180

Query  385  DNIRVNAVAPWLMRTSLTESS--RGEFGAVIEALIRRTLQHRLVEPKEASAAVAFLCFPA  212
            DNIRVN VAP ++ +S+ E +    E    ++ LI R   HR+ EPKE +A VAFLCFPA
Sbjct  181  DNIRVNGVAPGVIASSMVEMTIQDPEQKENLDKLIDRCALHRMGEPKELAAVVAFLCFPA  240

Query  211  ASFVTGQIISVDGG  170
            AS+VTGQII VDGG
Sbjct  241  ASYVTGQIIYVDGG  254



>ref|NP_001275240.1| tropinone reductase 2-like [Solanum tuberosum]
 emb|CAB52307.1| tropinone reductase II [Solanum tuberosum]
Length=261

 Score =   265 bits (676),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 138/254 (54%), Positives = 178/254 (70%), Gaps = 2/254 (1%)
 Frame = -1

Query  925  IMAGRWSLHGMTALVTGGTRGLGHAIVEELACLGATVYTCSRTEKELEECIQNWKAKGYK  746
            + AGRW+L G TALVTGG+RG+G+ IVEELA LGA+VYTCSR +KEL EC+  W++KG+K
Sbjct  1    MAAGRWNLEGCTALVTGGSRGIGYGIVEELASLGASVYTCSRNQKELNECLTQWRSKGFK  60

Query  745  VFGSVCDILQPSQRENLIQLVSKQFDGKLTILVNNVAILIPKETLKSDGQDFSNTIGTNL  566
            V  SVCD+   S+RE  I+ V+  FDGKL ILVNN  I+I KE      +D+S  +  N 
Sbjct  61   VEASVCDLSSRSEREEFIKTVANHFDGKLNILVNNAGIVIYKEAKDYTMEDYSLIMSINF  120

Query  565  EASLNLCQLAHPLLKATGNGsivfisscssfVYAPFHTIYASTKGAINSLVKNLACEWAN  386
            EA+ +L  LAHP LKA+  G++VFISS S     P+  +Y +TKGA++ L + LA EWA 
Sbjct  121  EAAYHLSVLAHPFLKASQRGNVVFISSISGASALPYEAVYGATKGAMDQLTRCLAFEWAK  180

Query  385  DNIRVNAVAPWLMRTSLTESS--RGEFGAVIEALIRRTLQHRLVEPKEASAAVAFLCFPA  212
            DNIRVN VAP ++ +S+ E +    E    ++ LI R   HR+ EPKE +A VAFLCFPA
Sbjct  181  DNIRVNGVAPGVIASSMVEMTIQDQEQKENLDKLIDRCALHRMGEPKELAAVVAFLCFPA  240

Query  211  ASFVTGQIISVDGG  170
            AS+VTGQII VDGG
Sbjct  241  ASYVTGQIIYVDGG  254



>emb|CBI16074.3| unnamed protein product [Vitis vinifera]
Length=252

 Score =   264 bits (675),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 139/250 (56%), Positives = 182/250 (73%), Gaps = 5/250 (2%)
 Frame = -1

Query  895  MTALVTGGTRGLGHAIVEELACLGATVYTCSRTEKELEECIQNWKAKGYKVFGSVCDILQ  716
            MTALVTGGT+G+GHAIVEELA L AT++TCSR E EL+EC+++WKAKG+ V GSVCD+  
Sbjct  1    MTALVTGGTKGIGHAIVEELAGLVATIHTCSRKETELDECLKDWKAKGFGVSGSVCDVSS  60

Query  715  PSQRENLIQLVSKQFDGKLTILVNNVAILIPKETLKSDGQDFSNTIGTNLEASLNLCQLA  536
             +QRE L++ VS  F+GKL ILVNN AI+I K T++   ++FS  +  N E+  +L QLA
Sbjct  61   RAQREKLMETVSSVFNGKLNILVNNAAIVIQKPTVEVTAEEFSTIMAINFESVYHLSQLA  120

Query  535  HPLLKATGNGsivfisscssfVYAPFHTIYASTKGAINSLVKNLACEWANDNIRVNAVAP  356
            HPLLKA+G GSIVFISS +  V   + + Y++TKGA+N L KNLACEWA DNIR NAVAP
Sbjct  121  HPLLKASGAGSIVFISSVAGVVSLKYLSAYSATKGAMNQLTKNLACEWAEDNIRSNAVAP  180

Query  355  WLMRTSLTES--SRGEFGAVIEALIRRTLQHRLVEPKEASAAVAFLCFPAASFVTGQIIS  182
            W ++T + +   S   F   +E +I R    R+ +PKE S+ VAFLC PA+S++TGQ I 
Sbjct  181  WYIKTPMVDQMLSNKTF---LEGVINRAPLRRVGDPKEVSSLVAFLCLPASSYITGQTIC  237

Query  181  VDGGGSIYGL  152
            VDGG ++ G 
Sbjct  238  VDGGVTVNGF  247



>ref|XP_004235264.1| PREDICTED: tropinone reductase homolog isoform X1 [Solanum lycopersicum]
Length=264

 Score =   265 bits (676),  Expect = 3e-83, Method: Compositional matrix adjust.
 Identities = 138/256 (54%), Positives = 181/256 (71%), Gaps = 1/256 (0%)
 Frame = -1

Query  919  AGRWSLHGMTALVTGGTRGLGHAIVEELACLGATVYTCSRTEKELEECIQNWKAKGYKVF  740
            + RW+L GMTALVTGGTRG+GHA+VEELA LGATVYTCSR E  L +C+Q W  KG+KV 
Sbjct  5    SSRWTLSGMTALVTGGTRGIGHAVVEELAELGATVYTCSRNENALNKCLQEWSVKGFKVN  64

Query  739  GSVCDILQPSQRENLIQLVSKQFDGKLTILVNNVAILIPKETLKSDGQDFSNTIGTNLEA  560
            G VCD+    QR  LIQ VS  F GKL IL+NN    I K T+   G+++++  GTNLE+
Sbjct  65   GCVCDVSSRPQRVKLIQNVSSAFHGKLNILINNAGTNIRKPTIDYTGEEYAHLFGTNLES  124

Query  559  SLNLCQLAHPLLKATGNGsivfisscssfVYAPFHTIYASTKGAINSLVKNLACEWANDN  380
              ++CQLAHPLLKA+  GS+VFISS +  V+    +IYA+TKGA+N L ++LACEWA DN
Sbjct  125  GYHICQLAHPLLKASEVGSVVFISSVAGLVHLSTSSIYAATKGAMNQLTRDLACEWAKDN  184

Query  379  IRVNAVAPWLMRTSLTESSRGEFGAVIEALIRRTLQHRLVEPKEASAAVAFLCFPAASFV  200
            IRVN VAPW ++TS  E    +   +++ +  RT   R  E +E S+ VA+LC P AS++
Sbjct  185  IRVNGVAPWYIKTSSVEYVI-KNKTLLDGIKSRTPLMRPGEAQEVSSLVAYLCLPGASYI  243

Query  199  TGQIISVDGGGSIYGL  152
            TGQ+I+VDGG ++ G 
Sbjct  244  TGQVIAVDGGFTVNGF  259



>ref|XP_009375950.1| PREDICTED: tropinone reductase homolog At1g07440-like [Pyrus 
x bretschneideri]
Length=263

 Score =   265 bits (676),  Expect = 3e-83, Method: Compositional matrix adjust.
 Identities = 142/255 (56%), Positives = 183/255 (72%), Gaps = 4/255 (2%)
 Frame = -1

Query  913  RWSLHGMTALVTGGTRGLGHAIVEELACLGATVYTCSRTEKELEECIQNWKAKGYKVFGS  734
            RWSL GMTALVTGGT+G+G+AIVEELA LGA V+TCSR E +L +C+  W+ KG++V GS
Sbjct  7    RWSLRGMTALVTGGTKGIGYAIVEELAGLGAIVHTCSRNEVDLNDCLSQWE-KGFQVTGS  65

Query  733  VCDILQPSQRENLIQLVSKQFDGKLTILVNNVAILIPKETLKSDGQDFSNTIGTNLEASL  554
            VCD++  +QR+ LI  VS  F+GKL IL+NNV   I K TL+   +D+S  + TNLE+  
Sbjct  66   VCDVMYKTQRDKLINKVSSLFEGKLNILINNVGTSILKATLEYTAEDYSFVMSTNLESVY  125

Query  553  NLCQLAHPLLKATGNGsivfisscssfVYAPFHTIYASTKGAINSLVKNLACEWANDNIR  374
            +LCQL+HPLLKA+G  +IVF+SS +  V     +IY++TKGAIN L KNLACEWA DNIR
Sbjct  126  HLCQLSHPLLKASGAANIVFLSSTAGVVSIDVGSIYSATKGAINQLAKNLACEWAKDNIR  185

Query  373  VNAVAPWLMRTSLTESS-RGEFGAVIEALIRRTLQHRLVEPKEASAAVAFLCFPAASFVT  197
             N+VAPW + T LT+   R E    +E +  R    R  EPKE S+ VAFLC PAAS++T
Sbjct  186  TNSVAPWFITTPLTDPVLRNE--KKLEMINSRCPLGRPGEPKEVSSLVAFLCLPAASYIT  243

Query  196  GQIISVDGGGSIYGL  152
            GQ I +DGG ++ GL
Sbjct  244  GQTIIIDGGVTVNGL  258



>ref|XP_011048908.1| PREDICTED: tropinone reductase homolog At1g07440-like isoform 
X1 [Populus euphratica]
Length=331

 Score =   267 bits (682),  Expect = 3e-83, Method: Compositional matrix adjust.
 Identities = 143/263 (54%), Positives = 187/263 (71%), Gaps = 2/263 (1%)
 Frame = -1

Query  937  QQHNIMAGRWSLHGMTALVTGGTRGLGHAIVEELACLGATVYTCSRTEKELEECIQNWKA  758
            Q+++    +WSL GMTALVTGGT+GLG+AIV ELA LGA V+TC R++ +L E ++ WKA
Sbjct  67   QENSSRDKKWSLQGMTALVTGGTKGLGYAIVGELAALGAIVHTCGRSQDQLNENLREWKA  126

Query  757  KGYKVFGSVCDILQPSQRENLIQLVSKQFDGKLTILVNNVAILIPKETLKSDGQDFSNTI  578
            KG+KV GSVCD+   ++RE L++ VS  FDGKL IL+NN    I K +L    +DF + +
Sbjct  127  KGFKVTGSVCDLSSNAEREKLMEEVSSFFDGKLDILINNAGGNIHKGSLDYTSEDFVSIL  186

Query  577  GTNLEASLNLCQLAHPLLKATGNGsivfisscssfVYA-PFHTIYASTKGAINSLVKNLA  401
             TNL ++ +L QLAHPLLKA+G G IVF+SS +S V   P + IY++TKGA+N L +NLA
Sbjct  187  NTNLGSAFHLSQLAHPLLKASGAGRIVFMSSIASVVSVNPQYPIYSATKGAMNQLTRNLA  246

Query  400  CEWANDNIRVNAVAPWLMRTSLTESSRGEFGAVIEALIRRTLQHRLVEPKEASAAVAFLC  221
            CEWA DNIRVNAVAPW +RT LTE    +   + + +  RT   RL EP + S+ VAFLC
Sbjct  247  CEWAKDNIRVNAVAPWAVRTPLTEQFL-DVEKIRKDVFNRTPMKRLGEPGDVSSVVAFLC  305

Query  220  FPAASFVTGQIISVDGGGSIYGL  152
            FPA  F+TGQ+I VDGG S+ G 
Sbjct  306  FPAPGFLTGQVICVDGGMSVNGF  328



>emb|CBI30509.3| unnamed protein product [Vitis vinifera]
Length=250

 Score =   264 bits (674),  Expect = 3e-83, Method: Compositional matrix adjust.
 Identities = 138/250 (55%), Positives = 173/250 (69%), Gaps = 2/250 (1%)
 Frame = -1

Query  895  MTALVTGGTRGLGHAIVEELACLGATVYTCSRTEKELEECIQNWKAKGYKVFGSVCDILQ  716
            MTAL+TGGTRG+G+AIVEELA LGA V+TCSR + EL E +Q W+ KG++V GSVCD+  
Sbjct  1    MTALITGGTRGIGYAIVEELAELGAIVHTCSRNQTELNERLQEWEGKGFRVSGSVCDLTS  60

Query  715  PSQRENLIQLVSKQFDGKLTILVNNVAILIPKETLKSDGQDFSNTIGTNLEASLNLCQLA  536
             +QRE L + VS  F+GKL ILVNN A +  K       +D S+ + TN E+  +LCQLA
Sbjct  61   RAQREKLTETVSSLFEGKLNILVNNAATVALKAPTNYTAEDCSSILQTNFESPYHLCQLA  120

Query  535  HPLLKATGNGsivfisscssfVYAPFHTIYASTKGAINSLVKNLACEWANDNIRVNAVAP  356
            HPLLKA+G GSI+FISS +  +  P  ++YA+TKGAIN + KNLACEWA DNIR NAVAP
Sbjct  121  HPLLKASGRGSIIFISSVAGLISLPHMSVYAATKGAINQVTKNLACEWAKDNIRTNAVAP  180

Query  355  WLMRTSLTE--SSRGEFGAVIEALIRRTLQHRLVEPKEASAAVAFLCFPAASFVTGQIIS  182
            W +RTS+                L+ RT  HR+ EP E S  VAFLC PAAS++TGQ+I 
Sbjct  181  WTVRTSVRPILEPDNPMATAYPQLLARTPLHRIAEPDEVSPLVAFLCLPAASYITGQVIC  240

Query  181  VDGGGSIYGL  152
            VDGG S+ G 
Sbjct  241  VDGGFSVNGF  250



>ref|XP_009110944.1| PREDICTED: tropinone reductase homolog At1g07440-like [Brassica 
rapa]
Length=262

 Score =   264 bits (675),  Expect = 3e-83, Method: Compositional matrix adjust.
 Identities = 136/257 (53%), Positives = 179/257 (70%), Gaps = 1/257 (0%)
 Frame = -1

Query  922  MAGRWSLHGMTALVTGGTRGLGHAIVEELACLGATVYTCSRTEKELEECIQNWKAKGYKV  743
            M  RWSL GMTALVTGGT+G+G+AIVEELA  GA V+TC+R +  L+EC+  WK KG++V
Sbjct  1    MDSRWSLRGMTALVTGGTKGIGYAIVEELAGFGARVHTCARDQTLLDECLSEWKEKGFQV  60

Query  742  FGSVCDILQPSQRENLIQLVSKQFDGKLTILVNNVAILIPKETLKSDGQDFSNTIGTNLE  563
             GSVCD+   +QR+ L++ VS  F GKL IL+NNV  L+ K T +   QDFS  I TNL+
Sbjct  61   TGSVCDVSSRAQRDELMKTVSSLFSGKLNILINNVGTLVSKPTTEFTAQDFSGQIATNLD  120

Query  562  ASLNLCQLAHPLLKATGNGsivfisscssfVYAPFHTIYASTKGAINSLVKNLACEWAND  383
            ++ +  QLAHPLLKA+G GSIVF+SS    V + F +IY+ TKG +N L +NLACEWA+D
Sbjct  121  SAYHFSQLAHPLLKASGFGSIVFLSSVCGVVSSGFVSIYSLTKGCMNQLARNLACEWASD  180

Query  382  NIRVNAVAPWLMRTSLTESSRGEFGAVIEALIRRTLQHRLVEPKEASAAVAFLCFPAASF  203
             IR N+VAPW+ +T L +  R +     EA+  RT   R  EP E ++ V FLC PAAS+
Sbjct  181  GIRANSVAPWMTKTPLVQ-KRLDDEKFAEAIFSRTPLGRACEPGEVASLVTFLCLPAASY  239

Query  202  VTGQIISVDGGGSIYGL  152
            +TGQ I +DGG ++ G 
Sbjct  240  ITGQTICIDGGFTVNGF  256



>ref|XP_003538423.1| PREDICTED: tropinone reductase homolog At1g07440 [Glycine max]
Length=270

 Score =   264 bits (675),  Expect = 4e-83, Method: Compositional matrix adjust.
 Identities = 136/260 (52%), Positives = 184/260 (71%), Gaps = 1/260 (0%)
 Frame = -1

Query  913  RWSLHGMTALVTGGTRGLGHAIVEELACLGATVYTCSRTEKELEECIQNWKAKGYKVFGS  734
            RWSL+GMTALVTGGTRG+GH+IV +LA  GA V+TCSRT+ EL +C+Q W+++G++V GS
Sbjct  11   RWSLNGMTALVTGGTRGIGHSIVSDLAAFGAAVHTCSRTQTELNKCLQEWQSQGFQVTGS  70

Query  733  VCDILQPSQRENLIQLVSKQFDGKLTILVNNVAILIPKETLKSDGQDFSNTIGTNLEASL  554
            +CD+  P QRE LIQ V+  F+GKL I VNNV I I K T++   +++S  +  NL++S 
Sbjct  71   LCDVSSPPQREKLIQEVASTFNGKLNIYVNNVGINIRKPTIEYTAEEYSQIMTVNLDSSF  130

Query  553  NLCQLAHPLLKATGNGsivfisscssfVYAPFHTIYASTKGAINSLVKNLACEWANDNIR  374
            +LCQLA+PLLKA+  GSIVFISS +  V      ++A++K AIN L KNLAC+WA DNIR
Sbjct  131  HLCQLAYPLLKASEKGSIVFISSVAGVVSLGTGAVFAASKAAINQLTKNLACDWAKDNIR  190

Query  373  VNAVAPWLMRTSLTESSRGEFGAVIEALIRRTLQHRLVEPKEASAAVAFLCFPAASFVTG  194
             N V PW  RT + E    +    ++ ++ RT   R+ EP+E S+ V FLC PAASF+TG
Sbjct  191  SNCVVPWATRTPVVEHLFKD-QKFVDDIMSRTPIKRIAEPEEVSSLVNFLCLPAASFITG  249

Query  193  QIISVDGGGSIYGL*TSVWI  134
            Q+I VDGG ++ G   S+ I
Sbjct  250  QVICVDGGLTVNGFQPSMRI  269



>ref|XP_007016320.1| NAD(P)-binding Rossmann-fold superfamily protein isoform 1 [Theobroma 
cacao]
 ref|XP_007016321.1| NAD(P)-binding Rossmann-fold superfamily protein isoform 1 [Theobroma 
cacao]
 gb|EOY33939.1| NAD(P)-binding Rossmann-fold superfamily protein isoform 1 [Theobroma 
cacao]
 gb|EOY33940.1| NAD(P)-binding Rossmann-fold superfamily protein isoform 1 [Theobroma 
cacao]
Length=298

 Score =   265 bits (678),  Expect = 5e-83, Method: Compositional matrix adjust.
 Identities = 140/256 (55%), Positives = 176/256 (69%), Gaps = 5/256 (2%)
 Frame = -1

Query  913  RWSLHGMTALVTGGTRGLGHAIVEELACLGATVYTCSRTEKELEECIQNWKAKGYKVFGS  734
            RWSLHGMTALVTGGT+G+GHAIVEELA LGA ++TCSRTE EL +C+  W+AKG++V GS
Sbjct  39   RWSLHGMTALVTGGTKGIGHAIVEELAGLGARIHTCSRTETELNKCLLEWQAKGFQVTGS  98

Query  733  VCDILQPSQRENLIQLVSKQFDGKLTILVNNVAILIPKETLKSDGQDFSNTIGTNLEASL  554
             CD+   +Q E LI   S  F+GKL IL+NNV  ++ K   +   ++ S  +GTN E++ 
Sbjct  99   ACDVSSKAQGEKLINTASSVFNGKLDILINNVGTIVAKPISEETAEEVSFLMGTNFESAH  158

Query  553  NLCQLAHPLLKATGNGsivfisscssfVYAPFHTI--YASTKGAINSLVKNLACEWANDN  380
            NL  LAHPLLKA+G G    +   S     P  T+  Y +TKGA+N L K+LACEWA DN
Sbjct  159  NLSLLAHPLLKASGAG--SIVLLSSIAGLTPVRTLPTYGATKGAMNQLAKHLACEWAGDN  216

Query  379  IRVNAVAPWLMRTSLTESSRGEFGAVIEALIRRTLQHRLVEPKEASAAVAFLCFPAASFV  200
            IRVNAVAP L+RT L E    +  A +EA I +    R  EPKE S+ VAFLC PAAS++
Sbjct  217  IRVNAVAPSLIRTPLAEPVFHDEKA-LEAFITKIPMGRAGEPKEVSSLVAFLCLPAASYI  275

Query  199  TGQIISVDGGGSIYGL  152
            TGQII VDGG ++ GL
Sbjct  276  TGQIIYVDGGITLNGL  291



>ref|XP_004302758.1| PREDICTED: tropinone reductase homolog [Fragaria vesca subsp. 
vesca]
Length=262

 Score =   264 bits (674),  Expect = 5e-83, Method: Compositional matrix adjust.
 Identities = 139/254 (55%), Positives = 177/254 (70%), Gaps = 1/254 (0%)
 Frame = -1

Query  913  RWSLHGMTALVTGGTRGLGHAIVEELACLGATVYTCSRTEKELEECIQNWKAKGYKVFGS  734
            RWSL G TALVTGGT+G+G+AIVEELA LGATV+TC+R E  L + IQ W++KG+KV GS
Sbjct  10   RWSLKGKTALVTGGTKGIGYAIVEELAGLGATVHTCARNEALLNQRIQEWESKGFKVSGS  69

Query  733  VCDILQPSQRENLIQLVSKQFDGKLTILVNNVAILIPKETLKSDGQDFSNTIGTNLEASL  554
            VCD+   SQRE L++ VS  FDGKL ILVNN A    + T     +DFS+ + TN+E+  
Sbjct  70   VCDLTSKSQREELLETVSSVFDGKLNILVNNAATCTLRTTTDYSLEDFSSMMSTNVESPY  129

Query  553  NLCQLAHPLLKATGNGsivfisscssfVYAPFHTIYASTKGAINSLVKNLACEWANDNIR  374
            +LCQLAHPLLKA+GNGSIVFI+S +     P  + YA+TK AI  + KNLACEWA D+IR
Sbjct  130  HLCQLAHPLLKASGNGSIVFIASIAGIKALPRLSAYAATKSAIIQISKNLACEWAQDSIR  189

Query  373  VNAVAPWLMRTSLTESSRGEFGAVIEALIRRTLQHRLVEPKEASAAVAFLCFPAASFVTG  194
             N VAPW + T   +    +  A    LI RT   R+ EP E S+ V FLC PAAS++TG
Sbjct  190  TNTVAPWAVNTG-AKPDNDDHSADYRRLIGRTPIRRVAEPNEISSLVTFLCLPAASYITG  248

Query  193  QIISVDGGGSIYGL  152
            Q++S+DGG ++ G 
Sbjct  249  QVVSIDGGFTVSGF  262



>ref|XP_002873234.1| hypothetical protein ARALYDRAFT_487407 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH49493.1| hypothetical protein ARALYDRAFT_487407 [Arabidopsis lyrata subsp. 
lyrata]
Length=262

 Score =   264 bits (674),  Expect = 5e-83, Method: Compositional matrix adjust.
 Identities = 139/256 (54%), Positives = 183/256 (71%), Gaps = 5/256 (2%)
 Frame = -1

Query  913  RWSLHGMTALVTGGTRGLGHAIVEELACLGATVYTCSRTEKELEECIQNWKAKGYKVFGS  734
            RWSL G TALVTGGTRG+G A+VEELA  GA V+TCSR ++EL  C+ +WK+ G  V GS
Sbjct  6    RWSLAGKTALVTGGTRGIGRAVVEELAKFGAKVHTCSRNQEELNACLNDWKSNGLVVSGS  65

Query  733  VCDILQPSQRENLIQLVSKQFDGKLTILVNNVAILIPKETLKSDGQDFSNTIGTNLEASL  554
            VCD     QRE LIQ  S  F GKL ILVNNV   + K T++   ++++  + TNLE++ 
Sbjct  66   VCDASVRDQREKLIQEASSAFSGKLNILVNNVGTNVRKPTVEYSSEEYAKIMTTNLESAF  125

Query  553  NLCQLAHPLLKATGNGsivfisscssfVYAPFHTIYASTKGAINSLVKNLACEWANDNIR  374
            +L Q+AHPLLKA+G GSIVFISS +  V+    +IY +TKGA+N L +NLACEWA DNIR
Sbjct  126  HLSQIAHPLLKASGVGSIVFISSVAGLVHLQSGSIYGATKGALNQLTRNLACEWARDNIR  185

Query  373  VNAVAPWLMRTSLTES--SRGEFGAVIEALIRRTLQHRLVEPKEASAAVAFLCFPAASFV  200
             N VAPW ++TSL E+   + +F   +EA++ RT   R+ EP+E ++ VAFLC PAAS++
Sbjct  186  TNCVAPWYIKTSLVETLLEKKDF---VEAVVSRTPLGRVGEPEEVASLVAFLCLPAASYI  242

Query  199  TGQIISVDGGGSIYGL  152
            TGQ+ISVDGG ++ G 
Sbjct  243  TGQVISVDGGFTVNGF  258



>gb|KCW49544.1| hypothetical protein EUGRSUZ_K03064 [Eucalyptus grandis]
Length=263

 Score =   264 bits (674),  Expect = 5e-83, Method: Compositional matrix adjust.
 Identities = 140/251 (56%), Positives = 181/251 (72%), Gaps = 1/251 (0%)
 Frame = -1

Query  913  RWSLHGMTALVTGGTRGLGHAIVEELACLGATVYTCSRTEKELEECIQNWKAKGYKVFGS  734
            RWSL G TALVTGGTRG+G+AIV ELA LGA+V+TCSR EKEL E ++ W+ KG +V GS
Sbjct  12   RWSLKGKTALVTGGTRGIGYAIVAELAGLGASVHTCSRNEKELNERVEEWRGKGLQVSGS  71

Query  733  VCDILQPSQRENLIQLVSKQFDGKLTILVNNVAILIPKETLKSDGQDFSNTIGTNLEASL  554
            VCD+   +Q+E L++ VS  FDGKL ILVNN A ++ K  L    +D S  +  NLE+  
Sbjct  72   VCDLTCNTQKEALVKTVSSVFDGKLNILVNNAATVVLKGVLDHTLEDCSYVLKANLESPY  131

Query  553  NLCQLAHPLLKATGNGsivfisscssfVYAPFHTIYASTKGAINSLVKNLACEWANDNIR  374
            +LCQLAHPLLKA+G+G+IVF+SS +  V  P  +IY+++KGAIN L KNLACEWA DNIR
Sbjct  132  HLCQLAHPLLKASGDGNIVFLSSIAGEVALPALSIYSASKGAINQLTKNLACEWAKDNIR  191

Query  373  VNAVAPWLMRTSLTESSRGEFGAVIEALIRRTLQHRLVEPKEASAAVAFLCFPAASFVTG  194
            +N VAP  ++T++ +    E       ++ R   HRL EP E S+ VAFLC PAAS+VTG
Sbjct  192  INTVAPGPVKTTIAKPEP-EIKEKFLKMLARMPLHRLGEPNEISSVVAFLCLPAASYVTG  250

Query  193  QIISVDGGGSI  161
            Q+ISVDGG ++
Sbjct  251  QVISVDGGYTV  261



>gb|ACU16743.1| unknown [Glycine max]
Length=269

 Score =   264 bits (675),  Expect = 5e-83, Method: Compositional matrix adjust.
 Identities = 134/254 (53%), Positives = 181/254 (71%), Gaps = 1/254 (0%)
 Frame = -1

Query  913  RWSLHGMTALVTGGTRGLGHAIVEELACLGATVYTCSRTEKELEECIQNWKAKGYKVFGS  734
            RWSL+GMTALVTGGTRG+GH+IV +LA  GA V+TCSRT+ EL +C+Q W+++G++V GS
Sbjct  11   RWSLNGMTALVTGGTRGIGHSIVSDLAAFGAAVHTCSRTQTELNKCLQEWQSQGFQVTGS  70

Query  733  VCDILQPSQRENLIQLVSKQFDGKLTILVNNVAILIPKETLKSDGQDFSNTIGTNLEASL  554
            +CD+  P QRE LIQ V+  F+GKL I VNNV I I K T++   +++S  +  NL++S 
Sbjct  71   LCDVSSPPQREKLIQEVASTFNGKLNIYVNNVGINIRKPTIEYTAEEYSQIMTVNLDSSF  130

Query  553  NLCQLAHPLLKATGNGsivfisscssfVYAPFHTIYASTKGAINSLVKNLACEWANDNIR  374
            +LCQLA+PLLKA+  GSIVFISS +  V      ++A++K AIN L KNLAC+WA DNIR
Sbjct  131  HLCQLAYPLLKASEKGSIVFISSVAGVVSLGTGAVFAASKAAINQLTKNLACDWAKDNIR  190

Query  373  VNAVAPWLMRTSLTESSRGEFGAVIEALIRRTLQHRLVEPKEASAAVAFLCFPAASFVTG  194
             N V PW  RT + E    +    ++ ++ RT   R+ EP+E S+ V FLC PAASF+TG
Sbjct  191  SNCVVPWATRTPVVEHLFKD-QKFVDDIMSRTPIKRIAEPEEVSSLVNFLCLPAASFITG  249

Query  193  QIISVDGGGSIYGL  152
            Q+I VDGG ++ G 
Sbjct  250  QVICVDGGLTVNGF  263



>ref|XP_011089795.1| PREDICTED: tropinone reductase homolog isoform X1 [Sesamum indicum]
Length=316

 Score =   266 bits (679),  Expect = 6e-83, Method: Compositional matrix adjust.
 Identities = 136/256 (53%), Positives = 184/256 (72%), Gaps = 5/256 (2%)
 Frame = -1

Query  913  RWSLHGMTALVTGGTRGLGHAIVEELACLGATVYTCSRTEKELEECIQNWKAKGYKVFGS  734
            RWSLHG TALVTGGTRG+GHAIVEELA LGA V+TC+R++ EL++C++ W+ +G+ + GS
Sbjct  59   RWSLHGSTALVTGGTRGIGHAIVEELAGLGAAVHTCARSKDELDKCLRGWEDEGFGITGS  118

Query  733  VCDILQPSQRENLIQLVSKQFDGKLTILVNNVAILIPKETLKSDGQDFSNTIGTNLEASL  554
            VCD+   + RE L+  VS  F+ KL IL+NNV   I K  +    ++ S  +GTN E++ 
Sbjct  119  VCDVSSQADREKLLDSVSSIFNQKLNILINNVGTNIRKPMVDFTSEEVSMLMGTNFESAF  178

Query  553  NLCQLAHPLLKATGNGsivfisscssfVYAPFHTIYASTKGAINSLVKNLACEWANDNIR  374
            ++CQLA+PLLKA+G GS+VF SS S FV   + +++ ++KGAIN L KNLACEWA D IR
Sbjct  179  HMCQLAYPLLKASGAGSVVFTSSVSGFVSLKYMSVHGASKGAINQLTKNLACEWARDGIR  238

Query  373  VNAVAPWLMRTSLTES--SRGEFGAVIEALIRRTLQHRLVEPKEASAAVAFLCFPAASFV  200
            VNAVAPW ++TS+ E   S  ++   +E +  RT   RL +P E S+ VAFLC PA+SF+
Sbjct  239  VNAVAPWYIKTSMVEQVLSNKKY---LEEVYDRTPMRRLGDPTEVSSMVAFLCLPASSFI  295

Query  199  TGQIISVDGGGSIYGL  152
            TGQI+ VDGG S+ G 
Sbjct  296  TGQIVCVDGGMSVNGF  311



>ref|XP_002282755.1| PREDICTED: tropinone reductase homolog At1g07440 [Vitis vinifera]
 emb|CBI31629.3| unnamed protein product [Vitis vinifera]
Length=268

 Score =   264 bits (674),  Expect = 6e-83, Method: Compositional matrix adjust.
 Identities = 140/255 (55%), Positives = 180/255 (71%), Gaps = 5/255 (2%)
 Frame = -1

Query  910  WSLHGMTALVTGGTRGLGHAIVEELACLGATVYTCSRTEKELEECIQNWKAKGYKVFGSV  731
            WSL G TALVTGGTRG+G+A+VEELA LGATV+TCSR E EL++C++ W AKG+ V  S+
Sbjct  13   WSLRGTTALVTGGTRGIGYAVVEELAGLGATVHTCSRNEAELDKCLREWHAKGFSVTASI  72

Query  730  CDILQPSQRENLIQLVSKQFDGKLTILVNNVAILIPKETLKSDGQDFSNTIGTNLEASLN  551
            CD    +QRE L++ VS  F+GKL ILVNNV     K T+     ++S  + TNLE++ +
Sbjct  73   CDGSDRAQREKLMEKVSSIFNGKLNILVNNVGTSFRKPTVDYTAAEYSTIMTTNLESAYH  132

Query  550  LCQLAHPLLKATGNGsivfisscssfVYAPFHTIYASTKGAINSLVKNLACEWANDNIRV  371
            LCQLAHPLLKA+G GSIVF+SS +  V     +IYA+TK AIN L KN ACEWA DNIR 
Sbjct  133  LCQLAHPLLKASGAGSIVFVSSVAGVVSLGTGSIYAATKAAINQLTKNFACEWAKDNIRS  192

Query  370  NAVAPWLMRTSLTES--SRGEFGAVIEALIRRTLQHRLVEPKEASAAVAFLCFPAASFVT  197
            N+VAPW ++TSL E    + +F    E ++ RT   R  EPKE ++ VAFLC P AS++T
Sbjct  193  NSVAPWYIKTSLVEHLLQKKDF---FEGIVSRTPLGRPGEPKEVASLVAFLCLPVASYIT  249

Query  196  GQIISVDGGGSIYGL  152
            GQ+I VDGG ++ G 
Sbjct  250  GQVICVDGGMTVNGF  264



>ref|XP_010542622.1| PREDICTED: tropinone reductase homolog At1g07440-like [Tarenaya 
hassleriana]
Length=271

 Score =   264 bits (674),  Expect = 6e-83, Method: Compositional matrix adjust.
 Identities = 139/254 (55%), Positives = 183/254 (72%), Gaps = 0/254 (0%)
 Frame = -1

Query  913  RWSLHGMTALVTGGTRGLGHAIVEELACLGATVYTCSRTEKELEECIQNWKAKGYKVFGS  734
            RWSL GMTALVTGGT+G+G+AIVEELA  GA V+TC+R +  L++C++ W+ KG++V GS
Sbjct  12   RWSLRGMTALVTGGTQGIGYAIVEELAGFGARVHTCARNQSLLDQCLREWQTKGFQVTGS  71

Query  733  VCDILQPSQRENLIQLVSKQFDGKLTILVNNVAILIPKETLKSDGQDFSNTIGTNLEASL  554
            VCD+    +RE L+Q VS  FDGKL IL+NNV   I K T +   +DFS  I TNLE++ 
Sbjct  72   VCDVSSRPEREKLMQTVSSAFDGKLNILINNVGTSIVKPTTEYTAEDFSFHITTNLESAY  131

Query  553  NLCQLAHPLLKATGNGsivfisscssfVYAPFHTIYASTKGAINSLVKNLACEWANDNIR  374
            +L QLAHPL+KATG G+IVFISS +  V     +IY +TKGAIN L +NLACEWA+D+IR
Sbjct  132  HLSQLAHPLVKATGFGNIVFISSIAGIVSTSVGSIYNATKGAINQLARNLACEWASDDIR  191

Query  373  VNAVAPWLMRTSLTESSRGEFGAVIEALIRRTLQHRLVEPKEASAAVAFLCFPAASFVTG  194
            VN+VAP  + T + E++       ++A+I R    R+ EP+E S+ VAFLC PAAS++TG
Sbjct  192  VNSVAPGFIATPMAETAVLGDDNFLKAVISRKPLARVGEPREVSSLVAFLCLPAASYITG  251

Query  193  QIISVDGGGSIYGL  152
            Q I VDGG +I G 
Sbjct  252  QTICVDGGLTINGF  265



>emb|CDX86485.1| BnaC08g02180D [Brassica napus]
Length=262

 Score =   263 bits (673),  Expect = 7e-83, Method: Compositional matrix adjust.
 Identities = 139/257 (54%), Positives = 177/257 (69%), Gaps = 1/257 (0%)
 Frame = -1

Query  922  MAGRWSLHGMTALVTGGTRGLGHAIVEELACLGATVYTCSRTEKELEECIQNWKAKGYKV  743
            M  RWSL GMT LVTGGT+G+G+AIVEELA  GA V+TC+R +  L+EC+  WKAKGY+V
Sbjct  1    MDSRWSLRGMTGLVTGGTKGIGYAIVEELAGFGARVHTCARDQTLLDECLNEWKAKGYQV  60

Query  742  FGSVCDILQPSQRENLIQLVSKQFDGKLTILVNNVAILIPKETLKSDGQDFSNTIGTNLE  563
             GSVCD+    QR+ L++ VS  F GKL IL+NNV  L  K   +   QDFS+ I TNLE
Sbjct  61   TGSVCDVSSRPQRDELMKTVSSLFSGKLNILINNVGTLTSKPATEFTAQDFSSQIATNLE  120

Query  562  ASLNLCQLAHPLLKATGNGsivfisscssfVYAPFHTIYASTKGAINSLVKNLACEWAND  383
            ++ +L QLAHPLLKA+G GSIVF+SS    V A   +IY+ TKG +N L +NLACEWA+D
Sbjct  121  SAYHLSQLAHPLLKASGFGSIVFMSSVCGVVSAGTVSIYSLTKGGMNQLARNLACEWASD  180

Query  382  NIRVNAVAPWLMRTSLTESSRGEFGAVIEALIRRTLQHRLVEPKEASAAVAFLCFPAASF  203
             IR N+VAPW+ RT L +  R +     EA+  RT   R  EP E ++ V FLC PAAS+
Sbjct  181  GIRANSVAPWVTRTPLAQ-DRLDDKKYAEAICSRTPLGRTCEPSEVASLVTFLCLPAASY  239

Query  202  VTGQIISVDGGGSIYGL  152
            +TGQ I +DGG ++ G 
Sbjct  240  ITGQTIFIDGGLTVNGF  256



>ref|XP_011089796.1| PREDICTED: tropinone reductase homolog isoform X2 [Sesamum indicum]
Length=297

 Score =   265 bits (676),  Expect = 7e-83, Method: Compositional matrix adjust.
 Identities = 136/256 (53%), Positives = 184/256 (72%), Gaps = 5/256 (2%)
 Frame = -1

Query  913  RWSLHGMTALVTGGTRGLGHAIVEELACLGATVYTCSRTEKELEECIQNWKAKGYKVFGS  734
            RWSLHG TALVTGGTRG+GHAIVEELA LGA V+TC+R++ EL++C++ W+ +G+ + GS
Sbjct  40   RWSLHGSTALVTGGTRGIGHAIVEELAGLGAAVHTCARSKDELDKCLRGWEDEGFGITGS  99

Query  733  VCDILQPSQRENLIQLVSKQFDGKLTILVNNVAILIPKETLKSDGQDFSNTIGTNLEASL  554
            VCD+   + RE L+  VS  F+ KL IL+NNV   I K  +    ++ S  +GTN E++ 
Sbjct  100  VCDVSSQADREKLLDSVSSIFNQKLNILINNVGTNIRKPMVDFTSEEVSMLMGTNFESAF  159

Query  553  NLCQLAHPLLKATGNGsivfisscssfVYAPFHTIYASTKGAINSLVKNLACEWANDNIR  374
            ++CQLA+PLLKA+G GS+VF SS S FV   + +++ ++KGAIN L KNLACEWA D IR
Sbjct  160  HMCQLAYPLLKASGAGSVVFTSSVSGFVSLKYMSVHGASKGAINQLTKNLACEWARDGIR  219

Query  373  VNAVAPWLMRTSLTES--SRGEFGAVIEALIRRTLQHRLVEPKEASAAVAFLCFPAASFV  200
            VNAVAPW ++TS+ E   S  ++   +E +  RT   RL +P E S+ VAFLC PA+SF+
Sbjct  220  VNAVAPWYIKTSMVEQVLSNKKY---LEEVYDRTPMRRLGDPTEVSSMVAFLCLPASSFI  276

Query  199  TGQIISVDGGGSIYGL  152
            TGQI+ VDGG S+ G 
Sbjct  277  TGQIVCVDGGMSVNGF  292



>gb|AIN39992.1| tropinone reductase I [Datura inoxia]
Length=273

 Score =   264 bits (674),  Expect = 7e-83, Method: Compositional matrix adjust.
 Identities = 136/252 (54%), Positives = 184/252 (73%), Gaps = 3/252 (1%)
 Frame = -1

Query  916  GRWSLHGMTALVTGGTRGLGHAIVEELACLGATVYTCSRTEKELEECIQNWKAKGYKVFG  737
            GRWSL G TALVTGG++G+G+AIVEELA LGA VYTCSR EKEL+EC++ W+ KG  V G
Sbjct  15   GRWSLKGTTALVTGGSKGIGYAIVEELAGLGARVYTCSRNEKELDECLEIWRKKGLNVEG  74

Query  736  SVCDILQPSQRENLIQLVSKQFDGKLTILVNNVAILIPKETLKSDGQDFSNTIGTNLEAS  557
            SVCD+L  ++R+ L+Q V+  FDGKL ILVNN  ++I KE      +D++  +GTN EA+
Sbjct  75   SVCDLLSRTERDKLMQTVAHVFDGKLNILVNNAGVVIHKEAKDFTEEDYNIIMGTNFEAA  134

Query  556  LNLCQLAHPLLKATGNGsivfisscssfVYAPFHTIYASTKGAINSLVKNLACEWANDNI  377
             +L Q+A+PLLKA+ NG+++F+SS + F   P  ++Y+++KGAIN + KNLACEWA DNI
Sbjct  135  YHLSQIAYPLLKASQNGNVIFLSSIAGFSALPSVSLYSASKGAINQMTKNLACEWAKDNI  194

Query  376  RVNAVAPWLMRTSLTESS---RGEFGAVIEALIRRTLQHRLVEPKEASAAVAFLCFPAAS  206
            RVN+VAP ++ T L E++          I+  I +T   R  +P+E SA +AFLCFPAAS
Sbjct  195  RVNSVAPGVILTPLVETAIKKNPHQKEEIDNFIVKTPMGRAGKPQEVSALIAFLCFPAAS  254

Query  205  FVTGQIISVDGG  170
            ++TGQII  DGG
Sbjct  255  YITGQIIWADGG  266



>ref|NP_001149071.1| LOC100282692 [Zea mays]
 gb|ACG34080.1| tropinone reductase [Zea mays]
 tpg|DAA44601.1| TPA: tropinone reductase [Zea mays]
Length=273

 Score =   264 bits (674),  Expect = 7e-83, Method: Compositional matrix adjust.
 Identities = 141/258 (55%), Positives = 185/258 (72%), Gaps = 5/258 (2%)
 Frame = -1

Query  919  AGRWSLHGMTALVTGGTRGLGHAIVEELACLGATVYTCSRTEKELEECIQNWKAKGYKVF  740
            +GRW+LHG TALVTGGTRG+G A+VEELA LGA V+TCSR  +EL E I+ W+A+G+ V 
Sbjct  14   SGRWALHGKTALVTGGTRGIGRAVVEELAALGAAVHTCSRKAEELGERIKEWEARGFSVT  73

Query  739  GSVCDILQPSQRENLIQLVSKQFDGKLTILVNNVAILIPKETLKSDGQDFSNTIGTNLEA  560
            GSVCD+ +  QRE L++ V+ +F GKL ILVNNV   I K T +   +++S  + TNLE+
Sbjct  74   GSVCDLSERDQRERLLREVADRFGGKLNILVNNVGTNIRKPTTEFTAEEYSFLMATNLES  133

Query  559  SLNLCQLAHPLLKATGNGsivfisscssfVYAPFHTIYASTKGAINSLVKNLACEWANDN  380
            + +LCQ+AHPLLK +G+GSI+FISS +  +     TIYA TKGAIN L KNLACEWA DN
Sbjct  134  AYHLCQIAHPLLKLSGSGSIIFISSVAGAIGIFSGTIYAMTKGAINQLTKNLACEWAKDN  193

Query  379  IRVNAVAPWLMRTSLTES--SRGEFGAVIEALIRRTLQHRLVEPKEASAAVAFLCFPAAS  206
            IR N+VAPW + TSLTE   +   F    E ++ RT   R+ EP E SA VAFLC P ++
Sbjct  194  IRANSVAPWYITTSLTEGILANKNFE---EQVVSRTPLGRVGEPGEVSALVAFLCMPGST  250

Query  205  FVTGQIISVDGGGSIYGL  152
            +++GQ I+VDGG ++ G 
Sbjct  251  YISGQTIAVDGGMTVNGF  268



>ref|XP_003552193.1| PREDICTED: tropinone reductase homolog isoform 1 [Glycine max]
Length=264

 Score =   263 bits (673),  Expect = 7e-83, Method: Compositional matrix adjust.
 Identities = 137/250 (55%), Positives = 176/250 (70%), Gaps = 2/250 (1%)
 Frame = -1

Query  913  RWSLHGMTALVTGGTRGLGHAIVEELACLGATVYTCSRTEKELEECIQNWKAKGYKVFGS  734
            RWSLHGMTALVTGGTRG+GHAIVEELA  GATV+ C+R + ++++C++ WK+KG  V GS
Sbjct  12   RWSLHGMTALVTGGTRGIGHAIVEELAEFGATVHICARNQDDIDKCLEEWKSKGLNVTGS  71

Query  733  VCDILQPSQRENLIQLVSKQFDGKLTILVNNVAILIPKETLKSDGQDFSNTIGTNLEASL  554
            VCD+L   QR+ L+++V   F GKL ILVNN A  I K+      +D S  +GTN E+  
Sbjct  72   VCDLLCSDQRKRLMEIVGSIFHGKLNILVNNAATNITKKITDYTAEDISAIMGTNFESVY  131

Query  553  NLCQLAHPLLKATGNGsivfisscssfVYAPFHTIYASTKGAINSLVKNLACEWANDNIR  374
            +LCQ+AHPLLK +GNGSIVFISS +     P  ++YA++KGA+N   KNLA EWA DNIR
Sbjct  132  HLCQVAHPLLKDSGNGSIVFISSVAGLKALPVFSVYAASKGAMNQFTKNLALEWAKDNIR  191

Query  373  VNAVAPWLMRTSLTES--SRGEFGAVIEALIRRTLQHRLVEPKEASAAVAFLCFPAASFV  200
             NAVAP  ++T L E   +  E    I  ++ +T   R+ E KE SA VAFLC PAAS++
Sbjct  192  ANAVAPGPVKTKLLECIVNSSEGNESINGVVSQTFVGRMGETKEISALVAFLCLPAASYI  251

Query  199  TGQIISVDGG  170
            TGQ+I VDGG
Sbjct  252  TGQVICVDGG  261



>gb|AAM61117.1| short chain alcohol dehydrogenase-like [Arabidopsis thaliana]
Length=264

 Score =   263 bits (673),  Expect = 8e-83, Method: Compositional matrix adjust.
 Identities = 139/256 (54%), Positives = 183/256 (71%), Gaps = 5/256 (2%)
 Frame = -1

Query  913  RWSLHGMTALVTGGTRGLGHAIVEELACLGATVYTCSRTEKELEECIQNWKAKGYKVFGS  734
            RWSL G TALVTGGTRG+G A+VEELA   A V+TCSR ++EL  C+ +WKA G  V GS
Sbjct  6    RWSLAGKTALVTGGTRGIGRAVVEELAKFCAKVHTCSRNQEELNACLNDWKANGLVVSGS  65

Query  733  VCDILQPSQRENLIQLVSKQFDGKLTILVNNVAILIPKETLKSDGQDFSNTIGTNLEASL  554
            VCD     QRE LIQ  S  F GKL IL+NNV   + K T++   ++++  + TNLE++ 
Sbjct  66   VCDASVRDQREKLIQEASSAFSGKLNILINNVGTNVRKPTVEYSSEEYAKIMSTNLESAF  125

Query  553  NLCQLAHPLLKATGNGsivfisscssfVYAPFHTIYASTKGAINSLVKNLACEWANDNIR  374
            +L Q+AHPLLKA+G GSIVFISS +  V+    +IY +TKGA+N L +NLACEWA+DNIR
Sbjct  126  HLSQIAHPLLKASGVGSIVFISSVAGLVHLSSGSIYGATKGALNQLTRNLACEWASDNIR  185

Query  373  VNAVAPWLMRTSLTES--SRGEFGAVIEALIRRTLQHRLVEPKEASAAVAFLCFPAASFV  200
             N VAPW ++TSL E+   + EF   +EA++ RT   R+ EP+E S+ VAFLC PA+S++
Sbjct  186  TNCVAPWYIKTSLVETLLEKKEF---VEAVVSRTPLGRVGEPEEVSSLVAFLCLPASSYI  242

Query  199  TGQIISVDGGGSIYGL  152
            TGQ+ISVDGG ++ G 
Sbjct  243  TGQVISVDGGFTVNGF  258



>ref|XP_007016314.1| NAD(P)-binding Rossmann-fold superfamily protein isoform 1 [Theobroma 
cacao]
 gb|EOY33933.1| NAD(P)-binding Rossmann-fold superfamily protein isoform 1 [Theobroma 
cacao]
Length=298

 Score =   265 bits (676),  Expect = 9e-83, Method: Compositional matrix adjust.
 Identities = 141/254 (56%), Positives = 178/254 (70%), Gaps = 1/254 (0%)
 Frame = -1

Query  913  RWSLHGMTALVTGGTRGLGHAIVEELACLGATVYTCSRTEKELEECIQNWKAKGYKVFGS  734
            RWSLHGMTALVTGGT+G+GHAIVEELA LGA ++TCSRTE EL +C+  W+AKG++V GS
Sbjct  39   RWSLHGMTALVTGGTKGIGHAIVEELAGLGARIHTCSRTETELNKCLLEWQAKGFQVTGS  98

Query  733  VCDILQPSQRENLIQLVSKQFDGKLTILVNNVAILIPKETLKSDGQDFSNTIGTNLEASL  554
             CD+   +QRE LI   S  F+GKL IL+NNV  +  K   +   ++ S  +GTN E++ 
Sbjct  99   ACDVSSKAQREKLINTASSVFNGKLDILINNVGTVFAKPISEETAEEVSFLMGTNFESAH  158

Query  553  NLCQLAHPLLKATGNGsivfisscssfVYAPFHTIYASTKGAINSLVKNLACEWANDNIR  374
            NL  LAHPLLKA+G GS+V +SS +  +       Y +TKGA+N L K LACEWA DNIR
Sbjct  159  NLSLLAHPLLKASGAGSVVLLSSIAGLIPLRTAPTYGATKGAMNQLAKYLACEWAGDNIR  218

Query  373  VNAVAPWLMRTSLTESSRGEFGAVIEALIRRTLQHRLVEPKEASAAVAFLCFPAASFVTG  194
            VNAVAP ++RT L E    +  A +EA I +    R  EPKE S+ VAFLC PAAS++TG
Sbjct  219  VNAVAPSVIRTPLVEPFFHDEKA-LEAFITKIPMGRTGEPKEVSSLVAFLCLPAASYITG  277

Query  193  QIISVDGGGSIYGL  152
            QII VDGG ++ GL
Sbjct  278  QIIYVDGGITLNGL  291



>emb|CDP00133.1| unnamed protein product [Coffea canephora]
Length=274

 Score =   264 bits (674),  Expect = 9e-83, Method: Compositional matrix adjust.
 Identities = 140/256 (55%), Positives = 181/256 (71%), Gaps = 5/256 (2%)
 Frame = -1

Query  913  RWSLHGMTALVTGGTRGLGHAIVEELACLGATVYTCSRTEKELEECIQNWKAKGYKVFGS  734
            RWSL G TALVTGGTRG+G A+VEELA LGAT++TCSR   +L E +Q W +KG KV GS
Sbjct  12   RWSLAGKTALVTGGTRGIGFAVVEELAELGATIHTCSRNAAQLNERLQEWASKGLKVTGS  71

Query  733  VCDILQPSQRENLIQLVSKQFDGKLTILVNNVAILIPKETLKSDGQDFSNTIGTNLEASL  554
            VCD+     RE L+Q VS  FDGKL IL+NNV   I K T     +++S  + TNLE++ 
Sbjct  72   VCDVSSRELREQLMQKVSSVFDGKLNILINNVGTNIRKPTTDYIPEEYSRIMATNLESAY  131

Query  553  NLCQLAHPLLKATGNGsivfisscssfVYAPFHTIYASTKGAINSLVKNLACEWANDNIR  374
            +L QLA+PLLKA+G GS VF+SS S  V++   +IY + KGA+N L +NLACEWA DNIR
Sbjct  132  HLSQLAYPLLKASGVGSTVFVSSISGLVHSSSGSIYGAAKGAMNQLTRNLACEWAKDNIR  191

Query  373  VNAVAPWLMRTSLTES--SRGEFGAVIEALIRRTLQHRLVEPKEASAAVAFLCFPAASFV  200
            VN VAPW +RT L E+  S  EF   ++ +I RT   R  EPKE S+ VA+ C PAAS++
Sbjct  192  VNCVAPWYIRTPLVENLLSNKEF---LDMVISRTPLQRPGEPKEVSSLVAYFCLPAASYI  248

Query  199  TGQIISVDGGGSIYGL  152
            TGQ+++VDGG +++G 
Sbjct  249  TGQVVAVDGGMTVFGF  264



>ref|XP_004503163.1| PREDICTED: tropinone reductase homolog [Cicer arietinum]
Length=272

 Score =   263 bits (673),  Expect = 9e-83, Method: Compositional matrix adjust.
 Identities = 142/273 (52%), Positives = 183/273 (67%), Gaps = 5/273 (2%)
 Frame = -1

Query  946  AKYQQHNIMAGRWSLHGMTALVTGGTRGLGHAIVEELACLGATVYTCSRTEKELEECIQN  767
            AK  + +    RWSL G TALVTGGTRG+GHA+VEELA  GATVYTCSR E EL +C+  
Sbjct  2    AKATESSSRGSRWSLKGATALVTGGTRGIGHAVVEELAEFGATVYTCSRNEVELNKCLNQ  61

Query  766  WKAKGYKVFGSVCDILQPSQRENLIQLVSKQFDGKLTILVNNVAILIPKETLKSDGQDFS  587
            W+ KG+ V+GSVCD+   SQRE LI+ V+  F+GKL ILVNN    + K T+    +++S
Sbjct  62   WQEKGFSVYGSVCDLSSSSQREELIRKVASAFNGKLNILVNNAGTNVRKPTIDYTAEEYS  121

Query  586  NTIGTNLEASLNLCQLAHPLLKATGNGsivfisscssfVYAPFHTIYASTKGAINSLVKN  407
              + TNL++  +L QLA+ LLK +GNGSIVF SS +S       +IYA +K AIN L K+
Sbjct  122  KVMNTNLDSVYHLSQLAYSLLKESGNGSIVFNSSVASLTSVGSGSIYALSKAAINQLTKS  181

Query  406  LACEWANDNIRVNAVAPWLMRTSLTES--SRGEFGAVIEALIRRTLQHRLVEPKEASAAV  233
            LACEWA DNIR N VAPW  +TSL E   +  EF   +  ++ RT   R+ E  E S+ V
Sbjct  182  LACEWAKDNIRSNCVAPWYTKTSLVEHLIANEEF---VNEILSRTPIKRIAEAHEVSSLV  238

Query  232  AFLCFPAASFVTGQIISVDGGGSIYGL*TSVWI  134
             FLC PAAS++TGQI+SVDGG ++ G   S+ I
Sbjct  239  TFLCLPAASYITGQIVSVDGGFTVNGFQPSMRI  271



>ref|XP_009375952.1| PREDICTED: tropinone reductase homolog At1g07440-like [Pyrus 
x bretschneideri]
Length=264

 Score =   263 bits (672),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 141/260 (54%), Positives = 181/260 (70%), Gaps = 3/260 (1%)
 Frame = -1

Query  928  NIMAGRWSLHGMTALVTGGTRGLGHAIVEELACLGATVYTCSRTEKELEECIQNWKAKGY  749
            N   GRW+L GMTALVTGGT+G+G+AIVEEL  LGA V+TCSR E +L +C+  W+ KG+
Sbjct  2    NSREGRWALPGMTALVTGGTKGIGYAIVEELVGLGALVHTCSRNEVDLNDCLSQWEKKGF  61

Query  748  KVFGSVCDILQPSQRENLIQLVSKQFDGKLTILVNNVAILIPKETLKSDGQDFSNTIGTN  569
            +V GSVCD++  ++RE LI  VS  FDGKL IL+NNV  ++PK TL+   +D+S  + TN
Sbjct  62   QVTGSVCDVVSKTEREELINKVSSLFDGKLNILINNVGTVLPKATLEYTAEDYSFIMSTN  121

Query  568  LEASLNLCQLAHPLLKATGNGsivfisscssfVYAPFHTIYASTKGAINSLVKNLACEWA  389
            LE++ N  QL+HPLLKA    SIVF+SS +  V     +IY++ KGA+N L KNLACEWA
Sbjct  122  LESAYNFLQLSHPLLKAAEAASIVFLSSTAGVVSINGASIYSAAKGAMNQLTKNLACEWA  181

Query  388  NDNIRVNAVAPWLMRTSLTESS-RGEFGAVIEALIRRTLQHRLVEPKEASAAVAFLCFPA  212
             DNIR+N VAPW + T L E   R E    +E +  R    R  EPKE S+ VAFLC PA
Sbjct  182  KDNIRINNVAPWFITTPLVEPILRNE--KKLEMINSRCPLGRPGEPKEVSSLVAFLCLPA  239

Query  211  ASFVTGQIISVDGGGSIYGL  152
            AS++TGQ I VDGG ++ GL
Sbjct  240  ASYITGQTIIVDGGLTVNGL  259



>ref|XP_011048912.1| PREDICTED: tropinone reductase homolog At1g07440-like isoform 
X4 [Populus euphratica]
 ref|XP_011048914.1| PREDICTED: tropinone reductase homolog At1g07440-like isoform 
X4 [Populus euphratica]
Length=268

 Score =   263 bits (673),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 140/263 (53%), Positives = 179/263 (68%), Gaps = 2/263 (1%)
 Frame = -1

Query  937  QQHNIMAGRWSLHGMTALVTGGTRGLGHAIVEELACLGATVYTCSRTEKELEECIQNWKA  758
            Q+++    RWSL GMTALVTGGT+GLG+AIV ELA LGA V+TC R++ +L E ++ WKA
Sbjct  4    QENSSRDKRWSLQGMTALVTGGTKGLGYAIVGELAALGAIVHTCGRSQDQLNENLREWKA  63

Query  757  KGYKVFGSVCDILQPSQRENLIQLVSKQFDGKLTILVNNVAILIPKETLKSDGQDFSNTI  578
            KG+KV GSVCD+   ++RE L++ VS  FDGKL IL+NN    I K TL    +DF + +
Sbjct  64   KGFKVTGSVCDLSSNAEREKLMKEVSSLFDGKLDILINNAGGNIHKGTLDYTTEDFVSIM  123

Query  577  GTNLEASLNLCQLAHPLLKATGNGsiv-fisscssfVYAPFHTIYASTKGAINSLVKNLA  401
              NL ++ +L QLAHPLLKA+G G IV   S  S     P + IY++ KGA+N L +NLA
Sbjct  124  NINLGSAFHLSQLAHPLLKASGAGRIVFMSSVTSVVSINPQYPIYSAAKGAMNQLTRNLA  183

Query  400  CEWANDNIRVNAVAPWLMRTSLTESSRGEFGAVIEALIRRTLQHRLVEPKEASAAVAFLC  221
            CEWA DNIRVNAVAPW +RT LTE    +     + +  RT   RL EP + S+ VAFLC
Sbjct  184  CEWAKDNIRVNAVAPWSIRTPLTEHFLDD-DKFRKEVFNRTPMKRLGEPGDVSSVVAFLC  242

Query  220  FPAASFVTGQIISVDGGGSIYGL  152
            FPA  F+TGQ+I VDGG S+ G 
Sbjct  243  FPAPGFLTGQVICVDGGMSVNGF  265



>ref|XP_006424909.1| hypothetical protein CICLE_v10029051mg [Citrus clementina]
 gb|ESR38149.1| hypothetical protein CICLE_v10029051mg [Citrus clementina]
Length=270

 Score =   263 bits (673),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 137/255 (54%), Positives = 178/255 (70%), Gaps = 2/255 (1%)
 Frame = -1

Query  913  RWSLHGMTALVTGGTRGLGHAIVEELACLGATVYTCSRTEKELEECIQNWKAKGYKVFGS  734
            RW+L G TALVTGGT+GLGHA+VEELA LGA V+TC+R E +L+EC++ WK KG+KV GS
Sbjct  12   RWTLEGKTALVTGGTKGLGHAVVEELAELGAIVHTCARNEADLDECLREWKMKGFKVTGS  71

Query  733  VCDILQPSQRENLIQLVSKQFDGKLTILVNNVAILIPKETLKSDGQDFSNTIGTNLEASL  554
            +CD     +RE L+  VS  F+GKL IL+NNV   I K T++   +DFS  + TN E++ 
Sbjct  72   ICDASSRGEREMLMDKVSTLFNGKLNILINNVGTSIRKPTVEYTAEDFSVLMATNFESAY  131

Query  553  NLCQLAHPLLKATGNGsivfisscs-sfVYAPFHTIYASTKGAINSLVKNLACEWANDNI  377
            +L QLAHPLLKA+G G+I+ +SS +        ++IYA+TKGA+N L KNLACEWA DNI
Sbjct  132  HLSQLAHPLLKASGAGNIILMSSIAGVVSLNTGNSIYAATKGAMNQLAKNLACEWARDNI  191

Query  376  RVNAVAPWLMRTSLTESSRGEFGAVIEALIRRTLQHRLVEPKEASAAVAFLCFPAASFVT  197
            R N+VAPW +RT L E    +    +E +  RT   R  EP E S+ VAFLC PAAS++T
Sbjct  192  RTNSVAPWFIRTPLVEPYLSD-EKFLEEIKCRTPMERTGEPDEVSSLVAFLCMPAASYIT  250

Query  196  GQIISVDGGGSIYGL  152
            GQ I VDGG ++ G 
Sbjct  251  GQTICVDGGLTVNGF  265



>ref|XP_006399065.1| hypothetical protein EUTSA_v10014421mg [Eutrema salsugineum]
 gb|ESQ40518.1| hypothetical protein EUTSA_v10014421mg [Eutrema salsugineum]
Length=262

 Score =   263 bits (672),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 140/256 (55%), Positives = 183/256 (71%), Gaps = 5/256 (2%)
 Frame = -1

Query  913  RWSLHGMTALVTGGTRGLGHAIVEELACLGATVYTCSRTEKELEECIQNWKAKGYKVFGS  734
            RWSL G TALVTGGTRG+G AIVEELA  GATV+TCSR ++EL+ C+  WK+ G  V GS
Sbjct  6    RWSLVGKTALVTGGTRGIGRAIVEELARFGATVHTCSRNQEELKACLDVWKSNGLVVSGS  65

Query  733  VCDILQPSQRENLIQLVSKQFDGKLTILVNNVAILIPKETLKSDGQDFSNTIGTNLEASL  554
            VCD     QRE LIQ VS  F GKL IL+NNV   I K T++   ++++  + TNLE++ 
Sbjct  66   VCDASVRDQREKLIQEVSSAFSGKLNILINNVGTNIRKPTVEYSSEEYAKIMSTNLESAF  125

Query  553  NLCQLAHPLLKATGNGsivfisscssfVYAPFHTIYASTKGAINSLVKNLACEWANDNIR  374
            +  Q+AHPLLK++G GSIVFISS +  V+    +IY +TKGA+N L +NLACEWA DNIR
Sbjct  126  HFSQIAHPLLKSSGVGSIVFISSVAGLVHLRSGSIYGATKGALNQLTRNLACEWAGDNIR  185

Query  373  VNAVAPWLMRTSLTES--SRGEFGAVIEALIRRTLQHRLVEPKEASAAVAFLCFPAASFV  200
             N VAPW ++TSL E    + +F   +EA++ RT   R+ EP+E ++ VAFLC PAAS++
Sbjct  186  TNCVAPWYIKTSLVEPLLEKKDF---VEAVVSRTPLGRVGEPEEVASLVAFLCLPAASYI  242

Query  199  TGQIISVDGGGSIYGL  152
            TGQ+ISVDGG ++ G 
Sbjct  243  TGQVISVDGGLTVNGF  258



>ref|XP_010037803.1| PREDICTED: tropinone reductase 1-like [Eucalyptus grandis]
Length=316

 Score =   265 bits (676),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 140/251 (56%), Positives = 181/251 (72%), Gaps = 1/251 (0%)
 Frame = -1

Query  913  RWSLHGMTALVTGGTRGLGHAIVEELACLGATVYTCSRTEKELEECIQNWKAKGYKVFGS  734
            RWSL G TALVTGGTRG+G+AIV ELA LGA+V+TCSR EKEL E ++ W+ KG +V GS
Sbjct  65   RWSLKGKTALVTGGTRGIGYAIVAELAGLGASVHTCSRNEKELNERVEEWRGKGLQVSGS  124

Query  733  VCDILQPSQRENLIQLVSKQFDGKLTILVNNVAILIPKETLKSDGQDFSNTIGTNLEASL  554
            VCD+   +Q+E L++ VS  FDGKL ILVNN A ++ K  L    +D S  +  NLE+  
Sbjct  125  VCDLTCNTQKEALVKTVSSVFDGKLNILVNNAATVVLKGVLDHTLEDCSYVLKANLESPY  184

Query  553  NLCQLAHPLLKATGNGsivfisscssfVYAPFHTIYASTKGAINSLVKNLACEWANDNIR  374
            +LCQLAHPLLKA+G+G+IVF+SS +  V  P  +IY+++KGAIN L KNLACEWA DNIR
Sbjct  185  HLCQLAHPLLKASGDGNIVFLSSIAGEVALPALSIYSASKGAINQLTKNLACEWAKDNIR  244

Query  373  VNAVAPWLMRTSLTESSRGEFGAVIEALIRRTLQHRLVEPKEASAAVAFLCFPAASFVTG  194
            +N VAP  ++T++ +    E       ++ R   HRL EP E S+ VAFLC PAAS+VTG
Sbjct  245  INTVAPGPVKTTIAK-PEPEIKEKFLKMLARMPLHRLGEPNEISSVVAFLCLPAASYVTG  303

Query  193  QIISVDGGGSI  161
            Q+ISVDGG ++
Sbjct  304  QVISVDGGYTV  314



>ref|XP_011094903.1| PREDICTED: tropinone reductase homolog [Sesamum indicum]
Length=268

 Score =   263 bits (672),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 142/262 (54%), Positives = 183/262 (70%), Gaps = 4/262 (2%)
 Frame = -1

Query  946  AKYQQHNIMAGRWSLHGMTALVTGGTRGLGHAIVEELACLGATVYTCSRTEKELEECIQN  767
            AK +Q      RW+L GMTALVTGGT+G+G+AIVEELA  GATVYTCSR + EL E ++ 
Sbjct  2    AKEEQSRSREQRWTLQGMTALVTGGTKGIGYAIVEELAGFGATVYTCSRNQAELSERLKE  61

Query  766  WKAKGYKVFGSVCDILQPSQRENLIQLVSKQFDGKLTILVNNVAILIPKETLKSDGQDFS  587
            W+ KG+KV GS CD+    QRE LIQ VS  FDGKL ILVNN A+ + K       +D+ 
Sbjct  62   WEGKGFKVKGSACDLSSSPQREELIQSVSAAFDGKLNILVNNAAMSLLKRASDHTAEDYR  121

Query  586  NTIGTNLEASLNLCQLAHPLLKATGNGsivfisscssfVYAPFHTIYASTKGAINSLVKN  407
              + TNLE+  ++CQLA+PLLKA+G G+IVFISS +  V  P  + YA++KGAIN L KN
Sbjct  122  RIMETNLESPYHICQLAYPLLKASGLGNIVFISSVAGGVALPAISAYAASKGAINQLTKN  181

Query  406  LACEWANDNIRVNAVAPWLMRTSLTESSRGEFGAVIE---ALIRRTLQHRLVEPKEASAA  236
            LACEWA DNIR N VAP+ +RTS+ +    +  +++E    L+ RT   R+ EP+E S+ 
Sbjct  182  LACEWAKDNIRTNTVAPFGVRTSILKPEDID-PSILEMFIPLMGRTPIGRIAEPEEVSSL  240

Query  235  VAFLCFPAASFVTGQIISVDGG  170
            V FLC PAAS++TGQ+I VDGG
Sbjct  241  VTFLCLPAASYITGQVIYVDGG  262



>ref|XP_011023548.1| PREDICTED: tropinone reductase homolog At1g07440-like isoform 
X1 [Populus euphratica]
Length=267

 Score =   263 bits (672),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 134/255 (53%), Positives = 176/255 (69%), Gaps = 2/255 (1%)
 Frame = -1

Query  913  RWSLHGMTALVTGGTRGLGHAIVEELACLGATVYTCSRTEKELEECIQNWKAKGYKVFGS  734
            RW L GM+ALVTGGT+GLG AIVEELA LGA V+TC+R + +L E ++ WK KG+KV GS
Sbjct  11   RWGLQGMSALVTGGTKGLGCAIVEELAALGAIVHTCARNQDQLNERVREWKEKGFKVTGS  70

Query  733  VCDILQPSQRENLIQLVSKQFDGKLTILVNNVAILIPKETLKSDGQDFSNTIGTNLEASL  554
            VCD+   ++RE L++ VS  FDGKL ILVNN    I K TL    +DF++ + TNL+++ 
Sbjct  71   VCDVSSNAEREKLMKEVSSLFDGKLNILVNNAGTNIYKATLDYTAEDFTSLMNTNLQSAF  130

Query  553  NLCQLAHPLLKATGNGsiv-fisscssfVYAPFHTIYASTKGAINSLVKNLACEWANDNI  377
            +L QLAHPLLKA+  G IV   S  S       + +Y+++KGA+N L +NLACEWA DNI
Sbjct  131  HLSQLAHPLLKASRAGKIVFMSSIASVVSINTLYALYSASKGAMNQLTRNLACEWAKDNI  190

Query  376  RVNAVAPWLMRTSLTESSRGEFGAVIEALIRRTLQHRLVEPKEASAAVAFLCFPAASFVT  197
            RVNAVAPW +RT LT  S  +   +++ +  RT   R+ EP E S+ VAFLC PA  F+T
Sbjct  191  RVNAVAPWFIRTPLTTPSLDDEN-ILKEVFNRTPMRRVGEPGEVSSVVAFLCLPAPGFLT  249

Query  196  GQIISVDGGGSIYGL  152
            GQ+I +DGG S+ G 
Sbjct  250  GQVICIDGGMSVNGF  264



>ref|XP_007206210.1| hypothetical protein PRUPE_ppa015172mg [Prunus persica]
 gb|EMJ07409.1| hypothetical protein PRUPE_ppa015172mg [Prunus persica]
Length=249

 Score =   262 bits (670),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 134/254 (53%), Positives = 173/254 (68%), Gaps = 16/254 (6%)
 Frame = -1

Query  913  RWSLHGMTALVTGGTRGLGHAIVEELACLGATVYTCSRTEKELEECIQNWKAKGYKVFGS  734
            RWSL G+TALVTGGT+G+G+AIVEELA LGAT++TC+R E +L +C+  W  KG+KV GS
Sbjct  7    RWSLEGLTALVTGGTKGIGYAIVEELAGLGATIHTCARNEVDLNDCLSQWGKKGFKVTGS  66

Query  733  VCDILQPSQRENLIQLVSKQFDGKLTILVNNVAILIPKETLKSDGQDFSNTIGTNLEASL  554
            VCD++  +QRE LI  VS  FDGKL IL+NNV   IPK T +   +D++  + TNLE++ 
Sbjct  67   VCDVVSKTQREELINKVSSLFDGKLNILINNVGTNIPKPTTEYTAEDYTFLMSTNLESAY  126

Query  553  NLCQLAHPLLKATGNGsivfisscssfVYAPFHTIYASTKGAINSLVKNLACEWANDNIR  374
            +LCQLAHPLLKA+G G+I                  +S  GA+N L KNLACEWA DNIR
Sbjct  127  HLCQLAHPLLKASGAGNI---------------VFLSSVAGAMNQLAKNLACEWAKDNIR  171

Query  373  VNAVAPWLMRTSLTESSRGEFGAVIEALIRRTLQHRLVEPKEASAAVAFLCFPAASFVTG  194
             N+VAPW ++T L +   G     ++ +  RT   R  EP+E SA VAFLC PAAS++TG
Sbjct  172  TNSVAPWFIKTLLGDHFLGH-EKTLKIINSRTPLGRPGEPEEVSALVAFLCLPAASYITG  230

Query  193  QIISVDGGGSIYGL  152
            Q I VDGG ++ GL
Sbjct  231  QTICVDGGVTVNGL  244



>ref|XP_006344593.1| PREDICTED: tropinone reductase homolog [Solanum tuberosum]
Length=316

 Score =   264 bits (675),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 141/266 (53%), Positives = 183/266 (69%), Gaps = 4/266 (2%)
 Frame = -1

Query  940  YQQHNIM---AGRWSLHGMTALVTGGTRGLGHAIVEELACLGATVYTCSRTEKELEECIQ  770
            Y  H  M   + RWSL GMTALVTGGTRG+GHA+VEELA LGATVYTCSR E+ L +C+Q
Sbjct  47   YILHKSMFRSSSRWSLSGMTALVTGGTRGIGHAVVEELAELGATVYTCSRNEEALNKCLQ  106

Query  769  NWKAKGYKVFGSVCDILQPSQRENLIQLVSKQFDGKLTILVNNVAILIPKETLKSDGQDF  590
             W  KG KV G VCD+    QR  LI+ VS  F GKL+IL+NN    I K T+    +++
Sbjct  107  EWSVKGLKVNGCVCDVSSTPQRVKLIENVSSAFHGKLSILINNAGTNIRKPTIDYTAEEY  166

Query  589  SNTIGTNLEASLNLCQLAHPLLKATGNGsivfisscssfVYAPFHTIYASTKGAINSLVK  410
            ++  GTN E+  ++CQLAHPLLKA+  GSIVFISS +  V+    +IYA+TKGA+N L +
Sbjct  167  AHLFGTNFESGYHICQLAHPLLKASEVGSIVFISSVAGLVHLSTSSIYAATKGAMNQLTR  226

Query  409  NLACEWANDNIRVNAVAPWLMRTSLTESSRGEFGAVIEALIRRTLQHRLVEPKEASAAVA  230
            +LACEWA DNIRVN VAPW ++TS  E        +++ +I RT   R  E +E S+ VA
Sbjct  227  DLACEWAKDNIRVNGVAPWYIKTSSVEYVIKN-KTLLDGIISRTPLMRPGEAQEVSSLVA  285

Query  229  FLCFPAASFVTGQIISVDGGGSIYGL  152
            +LC P AS++TGQ+I+VDGG ++ G 
Sbjct  286  YLCLPGASYITGQVIAVDGGFTVNGF  311



>gb|KEH34736.1| NAD(P)-binding rossmann-fold protein [Medicago truncatula]
Length=275

 Score =   263 bits (672),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 139/260 (53%), Positives = 180/260 (69%), Gaps = 5/260 (2%)
 Frame = -1

Query  904  LHGMTALVTGGTRGLGHAIVEELACLGATVYTCSRTEKELEECIQNWKAKGYKVFGSVCD  725
            L G TALVTGGTRG+GHAIVEELA  GA VYTCSR E+EL +C+  WK KG+ V+GSVCD
Sbjct  17   LKGFTALVTGGTRGIGHAIVEELAEFGAIVYTCSRNEEELNKCLNEWKEKGFSVYGSVCD  76

Query  724  ILQPSQRENLIQLVSKQFDGKLTILVNNVAILIPKETLKSDGQDFSNTIGTNLEASLNLC  545
            +   SQRE L++ V+  F+GKL ILVNNV   + K T++   +D+S  +  NL+++ +LC
Sbjct  77   VTSSSQREELVRKVASAFNGKLNILVNNVGTNVRKPTIEYTTEDYSKLMTINLDSAYHLC  136

Query  544  QLAHPLLKATGNGsivfisscssfVYAPFHTIYASTKGAINSLVKNLACEWANDNIRVNA  365
            QL +PLLK +GNGSIVF SS +S  +    TIYA+ K AIN L K LACEWA DNIR+N 
Sbjct  137  QLTYPLLKESGNGSIVFNSSVASLTHVGSGTIYAACKAAINQLNKGLACEWAKDNIRINC  196

Query  364  VAPWLMRTSLTE--SSRGEFGAVIEALIRRTLQHRLVEPKEASAAVAFLCFPAASFVTGQ  191
            VAPW  +T L +   +  EF   +  ++ RT   R+ E  E S+ VAFLC PAAS++TGQ
Sbjct  197  VAPWYTKTPLNDYLYANKEF---VNEVLSRTPIKRIAETHEVSSLVAFLCLPAASYITGQ  253

Query  190  IISVDGGGSIYGL*TSVWIK  131
            +ISVDGG +  G   S+ I+
Sbjct  254  VISVDGGFTANGFQPSMIIR  273



>gb|KHN04080.1| Tropinone reductase like [Glycine soja]
Length=264

 Score =   263 bits (671),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 137/250 (55%), Positives = 175/250 (70%), Gaps = 2/250 (1%)
 Frame = -1

Query  913  RWSLHGMTALVTGGTRGLGHAIVEELACLGATVYTCSRTEKELEECIQNWKAKGYKVFGS  734
            RWSLHGMTALVTGGTRG+GHAIVEELA  GATV+ C+R + ++++C++ WK KG  V GS
Sbjct  12   RWSLHGMTALVTGGTRGIGHAIVEELAEFGATVHICARNQDDIDKCLEEWKNKGLNVTGS  71

Query  733  VCDILQPSQRENLIQLVSKQFDGKLTILVNNVAILIPKETLKSDGQDFSNTIGTNLEASL  554
            VCD+L   QR+ L+++V   F GKL ILVNN A  I K+      +D S  +GTN E+  
Sbjct  72   VCDLLCSDQRKRLMEIVGSIFHGKLNILVNNAATNITKKITDYTAEDISAIMGTNFESVY  131

Query  553  NLCQLAHPLLKATGNGsivfisscssfVYAPFHTIYASTKGAINSLVKNLACEWANDNIR  374
            +LCQ+AHPLLK +GNGSIVFISS +     P  ++YA++KGA+N   KNLA EWA DNIR
Sbjct  132  HLCQVAHPLLKDSGNGSIVFISSVAGLKALPVFSVYAASKGAMNQFTKNLALEWAKDNIR  191

Query  373  VNAVAPWLMRTSLTES--SRGEFGAVIEALIRRTLQHRLVEPKEASAAVAFLCFPAASFV  200
             NAVAP  ++T L E   +  E    I  ++ +T   R+ E KE SA VAFLC PAAS++
Sbjct  192  ANAVAPGPVKTKLLECIVNSSEGNESINGVVSQTFVGRMGETKEISALVAFLCLPAASYI  251

Query  199  TGQIISVDGG  170
            TGQ+I VDGG
Sbjct  252  TGQVICVDGG  261



>ref|XP_010033100.1| PREDICTED: tropinone reductase homolog At1g07440-like [Eucalyptus 
grandis]
Length=282

 Score =   263 bits (672),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 147/259 (57%), Positives = 180/259 (69%), Gaps = 8/259 (3%)
 Frame = -1

Query  913  RWSLHGMTALVTGGTRGLGHAIVEELACLGATVYTCSRTEKELEECIQNWKAKGYKVFGS  734
            RWSL GMTALVTGG++G+G AIVEELA LGATVYTCSRTE EL EC++ WK KG++V GS
Sbjct  22   RWSLQGMTALVTGGSKGIGRAIVEELAGLGATVYTCSRTEAELNECLKEWKRKGFQVAGS  81

Query  733  VCDILQPSQRENLIQLVSKQFDGKLTILVNNVAIL-----IPKETLKSDGQDFSNTIGTN  569
             CD+   S+RE L+  VS  FDGKL IL+NNV  L     +P  T+    +DFS  + TN
Sbjct  82   ACDVSSRSEREKLMLAVSSLFDGKLNILINNVGTLGTTGGMP--TVDYTAEDFSFIMTTN  139

Query  568  LEASLNLCQLAHPLLKATGNGsivfisscssfVYAPFHTIYASTKGAINSLVKNLACEWA  389
             E++ +L QLAHPLLKA+G GSIVF+SS    V     +IY++TKGA+N L KNLACEWA
Sbjct  140  FESAYHLSQLAHPLLKASGTGSIVFLSSVCGIVSLGLGSIYSATKGAMNQLTKNLACEWA  199

Query  388  NDNIRVNAVAPWLMRTSLTESSRGEFGAVIEALIRRTLQHRLVEPKEASAAVAFLCFPAA  209
             DNIR N+VAP+ + T LTE          EA+ R  L  R  EPKE S+ VAFLC PAA
Sbjct  200  KDNIRSNSVAPYFILTPLTEPLLCSEEYHKEAIARAPL-GRTGEPKEVSSLVAFLCLPAA  258

Query  208  SFVTGQIISVDGGGSIYGL  152
            S++TGQ I VDGG ++ G 
Sbjct  259  SYITGQTICVDGGFTVNGF  277



>ref|XP_010040245.1| PREDICTED: tropinone reductase homolog At1g07440-like [Eucalyptus 
grandis]
 gb|KCW45355.1| hypothetical protein EUGRSUZ_L00968 [Eucalyptus grandis]
Length=282

 Score =   263 bits (672),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 147/259 (57%), Positives = 180/259 (69%), Gaps = 8/259 (3%)
 Frame = -1

Query  913  RWSLHGMTALVTGGTRGLGHAIVEELACLGATVYTCSRTEKELEECIQNWKAKGYKVFGS  734
            RWSL GMTALVTGG++G+G AIVEELA LGATVYTCSRTE EL EC++ WK KG++V GS
Sbjct  22   RWSLQGMTALVTGGSKGIGRAIVEELAGLGATVYTCSRTEAELNECLKEWKRKGFQVAGS  81

Query  733  VCDILQPSQRENLIQLVSKQFDGKLTILVNNVAIL-----IPKETLKSDGQDFSNTIGTN  569
             CD+   S+RE L+  VS  FDGKL IL+NNV  L     +P  T+    +DFS  + TN
Sbjct  82   ACDVSSRSEREKLMLAVSSLFDGKLNILINNVGTLGTTGGMP--TVDYTAEDFSFIMTTN  139

Query  568  LEASLNLCQLAHPLLKATGNGsivfisscssfVYAPFHTIYASTKGAINSLVKNLACEWA  389
             E++ +L QLAHPLLKA+G GSIVF+SS    V     +IY++TKGA+N L KNLACEWA
Sbjct  140  FESAYHLSQLAHPLLKASGTGSIVFLSSVCGIVSLGLGSIYSATKGAMNQLTKNLACEWA  199

Query  388  NDNIRVNAVAPWLMRTSLTESSRGEFGAVIEALIRRTLQHRLVEPKEASAAVAFLCFPAA  209
             DNIR N+VAP+ + T LTE          EA+ R  L  R  EPKE S+ VAFLC PAA
Sbjct  200  KDNIRSNSVAPYFILTPLTEPLLCSEEYHKEAIARAPL-GRTGEPKEVSSLVAFLCLPAA  258

Query  208  SFVTGQIISVDGGGSIYGL  152
            S++TGQ I VDGG ++ G 
Sbjct  259  SYITGQTICVDGGFTVNGF  277



>emb|CAN69508.1| hypothetical protein VITISV_016038 [Vitis vinifera]
Length=298

 Score =   263 bits (673),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 146/282 (52%), Positives = 185/282 (66%), Gaps = 29/282 (10%)
 Frame = -1

Query  913  RWSLHGMTALVTGGTRGLG----------------------------HAIVEELACLGAT  818
            RWSL GMTALVTGGT+G+G                            HAIVEELA LGAT
Sbjct  13   RWSLKGMTALVTGGTKGIGFVMLPVFYVFGLDYTFLPIYKCMYQLCRHAIVEELAGLGAT  72

Query  817  VYTCSRTEKELEECIQNWKAKGYKVFGSVCDILQPSQRENLIQLVSKQFDGKLTILVNNV  638
            ++TCSR E EL EC+++WKAKG+ V GSVCD+   +QRE L+Q +S  F+GKL IL+NN 
Sbjct  73   IHTCSRKETELNECLKDWKAKGFGVSGSVCDVSSRAQREKLMQTISSVFNGKLNILINNA  132

Query  637  AILIPKETLKSDGQDFSNTIGTNLEASLNLCQLAHPLLKATGNGsivfisscssfVYAPF  458
            AI I K T++   ++FS  + TN E+  +L Q+AHPLLKA+G GSIVFISS S  V    
Sbjct  133  AISIQKPTIEVTAEEFSTIMATNFESVYHLSQIAHPLLKASGAGSIVFISSVSGIVAHKN  192

Query  457  HTIYASTKGAINSLVKNLACEWANDNIRVNAVAPWLMRTSLTESSRGEFGAVIEALIRRT  278
             + Y+ TKGA+N L KNLACEWA DNIR NAVAPW ++T + E       A +E +I R 
Sbjct  193  ISAYSVTKGAMNQLTKNLACEWAKDNIRSNAVAPWYIKTPMVEQMLTN-QAFLEEVINRA  251

Query  277  LQHRLVEPKEASAAVAFLCFPAASFVTGQIISVDGGGSIYGL  152
               R+ +PKE S+ VAFLC PA+S++TGQII VDGG ++ G 
Sbjct  252  PLRRVGDPKEVSSLVAFLCLPASSYITGQIICVDGGMTVNGF  293



>gb|KEH22981.1| NAD(P)-binding rossmann-fold protein [Medicago truncatula]
Length=266

 Score =   262 bits (670),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 136/254 (54%), Positives = 177/254 (70%), Gaps = 3/254 (1%)
 Frame = -1

Query  913  RWSLHGMTALVTGGTRGLGHAIVEELACLGATVYTCSRTEKELEECIQNWKAKGYKVFGS  734
            RWSL GMTALVTGGTRG+G+AIVEELA  GA+V+ C+R ++++ +C++ WK KG+ V GS
Sbjct  13   RWSLQGMTALVTGGTRGIGYAIVEELAEFGASVHICARNQEDINKCLEEWKGKGFCVTGS  72

Query  733  VCDILQPSQRENLIQLVSKQFDGKLTILVNNVAILIPKETLKSDGQDFSNTIGTNLEASL  554
             CD+L   QR+ L++ V+  FDGKL ILVNN  I  PK  +    +D + TIGTN  +  
Sbjct  73   TCDLLFHDQRQKLMETVALVFDGKLNILVNNAGIFTPKPIMDYTDEDITTTIGTNFVSGY  132

Query  553  NLCQLAHPLLKATGNGsivfisscssfVYAPFHTIYASTKGAINSLVKNLACEWANDNIR  374
            +LCQLAHPLLK +GNGSIVFISS +     PF ++YA++KGA+N   KNLA EWA DNIR
Sbjct  133  HLCQLAHPLLKQSGNGSIVFISSIAGLKAWPFASVYAASKGAMNQCAKNLALEWAKDNIR  192

Query  373  VNAVAPWLMRTSLTESS---RGEFGAVIEALIRRTLQHRLVEPKEASAAVAFLCFPAASF  203
             N VAP  + T L E++    G    V+E ++  T   R+ EPK+ S  VAFLC PAAS 
Sbjct  193  ANVVAPGAVMTILFENAAKLAGRVDNVVEDMVSLTPSGRIGEPKDISGLVAFLCLPAASH  252

Query  202  VTGQIISVDGGGSI  161
            +TGQII+ DGG +I
Sbjct  253  ITGQIIAADGGFTI  266



>ref|XP_004294666.1| PREDICTED: tropinone reductase homolog At1g07440-like [Fragaria 
vesca subsp. vesca]
Length=270

 Score =   262 bits (670),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 138/251 (55%), Positives = 173/251 (69%), Gaps = 3/251 (1%)
 Frame = -1

Query  913  RWSLHGMTALVTGGTRGLGHAIVEELACLGATVYTCSRTEKELEECIQNWKAKGY-KVFG  737
            RWSL G+TALVTGGT+G+G+AIVEELA LGA+VYTCSR E +L EC+  WK KGY +V G
Sbjct  9    RWSLEGVTALVTGGTKGIGYAIVEELAGLGASVYTCSRNEAQLHECLNQWKKKGYHQVTG  68

Query  736  SVCDILQPSQRENLIQLVSKQFDGKLTILVNNVAILIPKETL-KSDGQDFSNTIGTNLEA  560
            SVCD+    QRE LI  VS  F GKL ILVNNV          +   +++S+ + TNLE+
Sbjct  69   SVCDVASKIQREELIHKVSSLFHGKLNILVNNVGTTHGPTPTTECTAEEYSSIMNTNLES  128

Query  559  SLNLCQLAHPLLKATGNGsiv-fisscssfVYAPFHTIYASTKGAINSLVKNLACEWAND  383
            + NLCQLAHPLLK +G G+IV   S           ++Y +TKGA+N L KNLACEWA D
Sbjct  129  TYNLCQLAHPLLKTSGAGNIVFMSSVAGVVSIWGGGSVYGATKGAMNQLAKNLACEWAKD  188

Query  382  NIRVNAVAPWLMRTSLTESSRGEFGAVIEALIRRTLQHRLVEPKEASAAVAFLCFPAASF  203
            NIR+N+VAPW++RT L E    +   ++EA+I RT   R+ EP+E SA VAFLC P AS+
Sbjct  189  NIRINSVAPWVIRTPLVEPILNDDVKIMEAVISRTPLGRIGEPEEVSALVAFLCLPVASY  248

Query  202  VTGQIISVDGG  170
            +TGQ   VDGG
Sbjct  249  ITGQTFCVDGG  259



>ref|XP_004137775.1| PREDICTED: tropinone reductase homolog [Cucumis sativus]
 ref|XP_004169351.1| PREDICTED: tropinone reductase homolog [Cucumis sativus]
 gb|KGN58843.1| hypothetical protein Csa_3G733970 [Cucumis sativus]
Length=259

 Score =   262 bits (669),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 137/251 (55%), Positives = 178/251 (71%), Gaps = 7/251 (3%)
 Frame = -1

Query  913  RWSLHGMTALVTGGTRGLGHAIVEELACLGATVYTCSRTEKELEECIQNWKAKGYKVFGS  734
            RWSL+G TALVTGGTRG+G+AIVEELA LGA+V+TCSR + E+++ +Q W+ KG+KV  S
Sbjct  7    RWSLNGFTALVTGGTRGIGYAIVEELASLGASVHTCSRNQTEIDQRLQEWQQKGFKVTAS  66

Query  733  VCDILQPSQRENLIQLVSKQFDGKLTILVNNVAILIPKETLKSDGQDFSNTIGTNLEASL  554
            VCD+   SQR+ LI  VS  F+G L ILVNN   +  K   +   +D++  + TN EA  
Sbjct  67   VCDLTSSSQRQQLIDTVSSIFNGTLNILVNNAGTVTMKTATEYTTEDYNYMMSTNFEAPY  126

Query  553  NLCQLAHPLLKATGNGsivfisscssfVYAPFHTIYASTKGAINSLVKNLACEWANDNIR  374
            +L Q++HP+LKA+G GSIVF+SS +     P  +IYA+TKGAIN + KNLACEWA DNIR
Sbjct  127  HLSQISHPILKASGYGSIVFVSSIAGVTALPRISIYAATKGAINQITKNLACEWAKDNIR  186

Query  373  VNAVAPWLMRTSLTESSRG---EFGAVIEALIRRTLQHRLVEPKEASAAVAFLCFPAASF  203
            +N VAPW +RT+++        E+G     LI RT   RL EP+E S+ VAFLC PAAS+
Sbjct  187  INTVAPWGVRTTISTPDAAAVEEYG----RLIGRTPAGRLGEPEEISSVVAFLCLPAASY  242

Query  202  VTGQIISVDGG  170
            V+GQII VDGG
Sbjct  243  VSGQIICVDGG  253



>ref|XP_010067435.1| PREDICTED: tropinone reductase homolog At1g07440-like isoform 
X1 [Eucalyptus grandis]
Length=271

 Score =   262 bits (670),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 137/263 (52%), Positives = 181/263 (69%), Gaps = 5/263 (2%)
 Frame = -1

Query  934  QHNIMAGRWSLHGMTALVTGGTRGLGHAIVEELACLGATVYTCSRTEKELEECIQNWKAK  755
            Q N    RW+L G TALVTGGTRG+GHAIVEEL   GATV+TCS   +EL +C++ W+ K
Sbjct  5    QKNDRESRWTLRGTTALVTGGTRGIGHAIVEELGGFGATVHTCSWNGEELSKCLKEWEGK  64

Query  754  GYKVFGSVCDILQPSQRENLIQLVSKQFDGKLTILVNNVAILIPKETLKSDGQDFSNTIG  575
            G  V GSVCD+    QRENL++ VS +F G L IL+NN      K T+    ++FS  + 
Sbjct  65   GLAVTGSVCDVSSRDQRENLMKEVSSKFGGGLNILINNAGTNFRKPTVDYTVEEFSKIMA  124

Query  574  TNLEASLNLCQLAHPLLKATGNGsivfisscssfVYAPFHTIYASTKGAINSLVKNLACE  395
            TN +++ +LCQ+AHPLLKA+G GSI+FISS +  V     ++YA+ KGAIN + KNLACE
Sbjct  125  TNFDSAYHLCQIAHPLLKASGAGSIIFISSVAGVVSLGNGSVYAAAKGAINQITKNLACE  184

Query  394  WANDNIRVNAVAPWLMRTSLTES--SRGEFGAVIEALIRRTLQHRLVEPKEASAAVAFLC  221
            WA DNIR N++APW +RTSL E+     EF    + +I RT   R+ EP+E ++  AFLC
Sbjct  185  WAKDNIRSNSIAPWYIRTSLVENLLKNKEF---YDGIIARTPLQRVGEPREVASLAAFLC  241

Query  220  FPAASFVTGQIISVDGGGSIYGL  152
             PAAS++TGQ+ISVDGG ++ G 
Sbjct  242  LPAASYITGQVISVDGGMTVNGF  264



>ref|XP_009346407.1| PREDICTED: tropinone reductase homolog isoform X1 [Pyrus x bretschneideri]
Length=260

 Score =   262 bits (669),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 141/261 (54%), Positives = 182/261 (70%), Gaps = 5/261 (2%)
 Frame = -1

Query  922  MAG----RWSLHGMTALVTGGTRGLGHAIVEELACLGATVYTCSRTEKELEECIQNWKAK  755
            MAG    RWSL GMTALVTGGT+G+G+AIVEELA LGATV+TC+R + ++ E +Q W++K
Sbjct  1    MAGFDSQRWSLKGMTALVTGGTKGIGYAIVEELAGLGATVHTCARNQSQILERLQEWESK  60

Query  754  GYKVFGSVCDILQPSQRENLIQLVSKQFDGKLTILVNNVAILIPKETLKSDGQDFSNTIG  575
            G+KV GSVCD+   +QRENLI+ VS  F+GKL ILVNN A    + T     +DFS+ + 
Sbjct  61   GFKVTGSVCDLTSKAQRENLIKTVSSIFEGKLNILVNNAATCTLRGTTDYTLEDFSSMMK  120

Query  574  TNLEASLNLCQLAHPLLKATGNGsivfisscssfVYAPFHTIYASTKGAINSLVKNLACE  395
            TN+E+  +L QLAHPLLKA+GN SIVF++S +  V  P  + YA+TK A+  + KNLACE
Sbjct  121  TNVESPYHLSQLAHPLLKASGNASIVFVASIAGVVALPKLSAYAATKSAVIQISKNLACE  180

Query  394  WANDNIRVNAVAPWLMRTSLTESSRGEFGAVIEALIRRTLQHRLVEPKEASAAVAFLCFP  215
            WA DNIR NAVAPW + T +   S G        LI RT   RL +P E S+ + FLC P
Sbjct  181  WAKDNIRTNAVAPWAVNTGVKVDSDGHSDD-FRRLIGRTPIRRLAQPNEISSLITFLCLP  239

Query  214  AASFVTGQIISVDGGGSIYGL  152
            AAS++ GQ+ISVDGG ++ G 
Sbjct  240  AASYINGQVISVDGGFTVSGF  260



>gb|AGY46257.1| tropinone reductase I [Withania somnifera]
Length=273

 Score =   262 bits (670),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 134/251 (53%), Positives = 185/251 (74%), Gaps = 3/251 (1%)
 Frame = -1

Query  913  RWSLHGMTALVTGGTRGLGHAIVEELACLGATVYTCSRTEKELEECIQNWKAKGYKVFGS  734
            RWSL G TALVTGG++G+G+AIVEELA LGATVYTCSR E EL++C++ W+ KG KV GS
Sbjct  16   RWSLKGTTALVTGGSKGIGYAIVEELAGLGATVYTCSRNENELQQCLEIWREKGLKVEGS  75

Query  733  VCDILQPSQRENLIQLVSKQFDGKLTILVNNVAILIPKETLKSDGQDFSNTIGTNLEASL  554
            +CD+L  ++RE L+Q V+  FDGKL ILVNN  ++I KE      +D++  +GTN EA+ 
Sbjct  76   ICDLLVRTEREKLMQTVADVFDGKLNILVNNAGVVIHKEAKDFTEKDYNIIMGTNFEAAY  135

Query  553  NLCQLAHPLLKATGNGsivfisscssfVYAPFHTIYASTKGAINSLVKNLACEWANDNIR  374
            +L Q+A+PLLKA+ NG+++F+SS + F   P  ++Y+++KGAIN + KNLACEWA DNIR
Sbjct  136  HLSQIAYPLLKASQNGNVIFLSSIAGFSALPSVSLYSASKGAINQMTKNLACEWAKDNIR  195

Query  373  VNAVAPWLMRTSLTESS---RGEFGAVIEALIRRTLQHRLVEPKEASAAVAFLCFPAASF  203
            VN+VAP ++ T L E++     +    I+  + +T   R  +P+E +A +AFLCFPAAS+
Sbjct  196  VNSVAPGVIVTPLVEAAIKKNPQQKDEIDNFVVKTPMGRAGKPEEVAAVIAFLCFPAASY  255

Query  202  VTGQIISVDGG  170
            VTGQII  DGG
Sbjct  256  VTGQIIWADGG  266



>ref|XP_002308173.1| hypothetical protein POPTR_0006s09070g [Populus trichocarpa]
 gb|EEE91696.1| hypothetical protein POPTR_0006s09070g [Populus trichocarpa]
Length=267

 Score =   262 bits (669),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 138/250 (55%), Positives = 174/250 (70%), Gaps = 2/250 (1%)
 Frame = -1

Query  913  RWSLHGMTALVTGGTRGLGHAIVEELACLGATVYTCSRTEKELEECIQNWKAKGYKVFGS  734
            RWSL GMTALVTGGTRG+G AIVEELA  GA VYTCSR EKEL E I+ W+ KG+ V GS
Sbjct  12   RWSLKGMTALVTGGTRGIGFAIVEELAGFGARVYTCSRNEKELNERIKEWEIKGFNVRGS  71

Query  733  VCDILQPSQRENLIQLVSKQFDGKLTILVNNVAILIPKETLKSDGQDFSNTIGTNLEASL  554
            VCD+     R+ LI  V+  FDGKL ILVNN A  I +++L    +D+S  + TNL++  
Sbjct  72   VCDLSSQDDRQKLIGSVTSAFDGKLNILVNNAATAILRKSLDYTLEDYSFIMNTNLQSPY  131

Query  553  NLCQLAHPLLKATGNGsivfisscssfVYAPFHTIYASTKGAINSLVKNLACEWANDNIR  374
            +LCQLAHPLLKA+GNG+IVFISS +  V  P  ++Y++TKGAIN L +NLACEWA DNIR
Sbjct  132  HLCQLAHPLLKASGNGNIVFISSVAGIVALPMLSVYSATKGAINQLTRNLACEWAKDNIR  191

Query  373  VNAVAPWLMRTSL--TESSRGEFGAVIEALIRRTLQHRLVEPKEASAAVAFLCFPAASFV  200
             N VAP  +RT++   +S+  + G     +  R    R+ EP E S+ V FLC P AS++
Sbjct  192  TNTVAPGGIRTTVGQDQSADPDVGEAYSDMFSRIPISRIGEPNEVSSLVVFLCLPTASYI  251

Query  199  TGQIISVDGG  170
             GQ+I VDGG
Sbjct  252  NGQVICVDGG  261



>ref|XP_006649828.1| PREDICTED: tropinone reductase homolog At1g07440-like [Oryza 
brachyantha]
Length=271

 Score =   262 bits (670),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 143/258 (55%), Positives = 183/258 (71%), Gaps = 3/258 (1%)
 Frame = -1

Query  919  AGRWSLHGMTALVTGGTRGLG--HAIVEELACLGATVYTCSRTEKELEECIQNWKAKGYK  746
            AG W+L G TALVTGGTRG+G   A+V+ELA LGA V+TCSR E EL E ++ W+ KG++
Sbjct  10   AGGWALSGKTALVTGGTRGIGDRRAVVDELAALGAAVHTCSRKEGELGERLREWEGKGFR  69

Query  745  VFGSVCDILQPSQRENLIQLVSKQFDGKLTILVNNVAILIPKETLKSDGQDFSNTIGTNL  566
            V GSV D+    QRE +++ V+  + GKL ILVNNV   I K+T +    D+S  + TNL
Sbjct  70   VTGSVYDVSVREQRERMLREVAGLYGGKLDILVNNVGTNISKQTTEYSADDYSFIMATNL  129

Query  565  EASLNLCQLAHPLLKATGNGsivfisscssfVYAPFHTIYASTKGAINSLVKNLACEWAN  386
            E++ +LCQLAHPLLKA+G GSIVFISS S  V     T+YA TKGA+N L KNLACEWA 
Sbjct  130  ESAYHLCQLAHPLLKASGAGSIVFISSVSGVVAVCSGTVYAMTKGAMNQLAKNLACEWAK  189

Query  385  DNIRVNAVAPWLMRTSLTESSRGEFGAVIEALIRRTLQHRLVEPKEASAAVAFLCFPAAS  206
            DNIR N+VAPW ++TSL E      G   ++++RRT   R+ EP+E S+ VA+LC P AS
Sbjct  190  DNIRTNSVAPWYIKTSLVEDELAREG-FADSVMRRTALKRVGEPEEVSSLVAYLCMPGAS  248

Query  205  FVTGQIISVDGGGSIYGL  152
            ++TGQ ISVDGG +I GL
Sbjct  249  YITGQTISVDGGMTINGL  266



>ref|XP_010521885.1| PREDICTED: tropinone reductase homolog At1g07440-like [Tarenaya 
hassleriana]
Length=265

 Score =   262 bits (669),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 136/254 (54%), Positives = 177/254 (70%), Gaps = 1/254 (0%)
 Frame = -1

Query  922  MAGRWSLHGMTALVTGGTRGLGHAIVEELACLGATVYTCSRTEKELEECIQNWKAKGYKV  743
            M  RW+L GMTALVTGG RGLGHA+VEELA  GA VYTC  +E  L + ++ WK KG +V
Sbjct  1    MENRWTLRGMTALVTGGARGLGHAMVEELAGFGAIVYTCDISESHLNQNLREWKEKGLRV  60

Query  742  FGSVCDILQPSQRENLIQLVSKQFDGKLTILVNNVAILIPKETLKSDGQDFSNTIGTNLE  563
            +GSVCD+   S+R  L+++VS  F GKL IL+NNV + + K T +   QDFS  I TN E
Sbjct  61   YGSVCDVSSRSERGKLMEIVSSLFGGKLNILINNVGVCVSKPTTEYTAQDFSFLIATNFE  120

Query  562  ASLNLCQLAHPLLKATGNGsivfisscssfVYAPFHTIYASTKGAINSLVKNLACEWAND  383
            ++ +LCQLAHPLLKA+G+GSIVF SS    V     +IY +TKGA+N L +NLACEWA+D
Sbjct  121  SAYHLCQLAHPLLKASGSGSIVFNSSIGGVVSCVLGSIYGATKGAMNQLARNLACEWASD  180

Query  382  NIRVNAVAPWLMRTSLTESSRGEFGAVIEALIRRTLQHRLVEPKEASAAVAFLCFPAASF  203
            NIR N+VAP ++ T + E+   ++    + ++ R    RL E KE S+ VAFLC PAAS+
Sbjct  181  NIRANSVAPGVIPTPMAETHMRDY-EFTKTVLSRIPMERLGETKEVSSFVAFLCMPAASY  239

Query  202  VTGQIISVDGGGSI  161
            +TGQ I VDGG +I
Sbjct  240  ITGQTIVVDGGLTI  253



>ref|XP_007026941.1| NAD(P)-binding Rossmann-fold superfamily protein isoform 2 [Theobroma 
cacao]
 gb|EOY07443.1| NAD(P)-binding Rossmann-fold superfamily protein isoform 2 [Theobroma 
cacao]
Length=278

 Score =   262 bits (670),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 137/248 (55%), Positives = 176/248 (71%), Gaps = 0/248 (0%)
 Frame = -1

Query  913  RWSLHGMTALVTGGTRGLGHAIVEELACLGATVYTCSRTEKELEECIQNWKAKGYKVFGS  734
            RWSL GMTALVTGGTRG+G+AIVEELA LGA V+TCSR + E+ E +Q W++KG+KV GS
Sbjct  12   RWSLQGMTALVTGGTRGIGYAIVEELAALGAVVHTCSRNQTEINERLQEWQSKGFKVSGS  71

Query  733  VCDILQPSQRENLIQLVSKQFDGKLTILVNNVAILIPKETLKSDGQDFSNTIGTNLEASL  554
            VCD+    QRE L++ VS  F GKL ILVNN  I + K  ++   +D+S  + TN+EA  
Sbjct  72   VCDLSSREQREKLMETVSSVFYGKLNILVNNAGITMLKPCVEHTLEDYSTVMSTNVEAPY  131

Query  553  NLCQLAHPLLKATGNGsivfisscssfVYAPFHTIYASTKGAINSLVKNLACEWANDNIR  374
            +L QLAHP LKA+GNGSIVFISS +  +  P  + Y+++KGAIN + KNLACEWA DNIR
Sbjct  132  HLSQLAHPFLKASGNGSIVFISSVAGSLALPRLSAYSASKGAINQITKNLACEWAKDNIR  191

Query  373  VNAVAPWLMRTSLTESSRGEFGAVIEALIRRTLQHRLVEPKEASAAVAFLCFPAASFVTG  194
             N V+PW ++T++       +      LI  T   R  EP+E S+ VAFLC PAAS++TG
Sbjct  192  TNTVSPWGVKTTIMIPPDSPYVEEFIRLIAGTAMPRTGEPEEISSLVAFLCLPAASYITG  251

Query  193  QIISVDGG  170
            Q+ISVDGG
Sbjct  252  QVISVDGG  259



>gb|KEH22972.1| NAD(P)-binding rossmann-fold protein [Medicago truncatula]
Length=266

 Score =   262 bits (669),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 138/251 (55%), Positives = 176/251 (70%), Gaps = 3/251 (1%)
 Frame = -1

Query  913  RWSLHGMTALVTGGTRGLGHAIVEELACLGATVYTCSRTEKELEECIQNWKAKGYKVFGS  734
            RWSLHGMTALVTGGTRG+G+AIVEELA  GA+V+ C+R E+++ +C++ WK KG+ V GS
Sbjct  13   RWSLHGMTALVTGGTRGIGYAIVEELAEFGASVHICARNEEDINKCLEEWKNKGFNVTGS  72

Query  733  VCDILQPSQRENLIQLVSKQFDGKLTILVNNVAILIPKETLKSDGQDFSNTIGTNLEASL  554
            VCDIL   QR+ L++ VS  F GKL ILVNN A    K+ + +  +D + T+GTN  +  
Sbjct  73   VCDILFHEQRKKLMETVSSIFQGKLNILVNNAAKPTSKKIIDNTDEDINTTLGTNFVSGY  132

Query  553  NLCQLAHPLLKATGNGsivfisscssfVYAPFHTIYASTKGAINSLVKNLACEWANDNIR  374
            +LCQLAHPLLK +G GSIVF SS +     P  ++YA+TKGA+N   KNLA EWA DNIR
Sbjct  133  HLCQLAHPLLKQSGYGSIVFTSSVAGLKAIPVLSVYAATKGAVNQFTKNLALEWAKDNIR  192

Query  373  VNAVAPWLMRTSLTES---SRGEFGAVIEALIRRTLQHRLVEPKEASAAVAFLCFPAASF  203
             NAVAP  ++TSL ES      E    I  ++ +T   R+ E KE SA VAFLC PAAS 
Sbjct  193  ANAVAPGPVKTSLLESVMDYDSEGYKAIAGIVSQTPTGRMGETKEISALVAFLCLPAASH  252

Query  202  VTGQIISVDGG  170
            +TGQII++DGG
Sbjct  253  ITGQIIAIDGG  263



>ref|XP_004302763.1| PREDICTED: tropinone reductase homolog [Fragaria vesca subsp. 
vesca]
Length=260

 Score =   261 bits (668),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 136/261 (52%), Positives = 184/261 (70%), Gaps = 5/261 (2%)
 Frame = -1

Query  922  MAG----RWSLHGMTALVTGGTRGLGHAIVEELACLGATVYTCSRTEKELEECIQNWKAK  755
            MAG    RWSL GMTALVTGGT+G+G+AIVEELA LGATV+TC+R +++++E ++ WK+K
Sbjct  1    MAGFNSQRWSLKGMTALVTGGTKGIGYAIVEELAGLGATVHTCARNQEQIDEWVREWKSK  60

Query  754  GYKVFGSVCDILQPSQRENLIQLVSKQFDGKLTILVNNVAILIPKETLKSDGQDFSNTIG  575
            G++V GSVCD+   SQRE L++ VS +FDGKL ILVNN A +  + T +   +D S+ + 
Sbjct  61   GFQVSGSVCDLTSKSQREELMRTVSSKFDGKLNILVNNAATVTLRSTTEYALEDLSSMMS  120

Query  574  TNLEASLNLCQLAHPLLKATGNGsivfisscssfVYAPFHTIYASTKGAINSLVKNLACE  395
            TN+E+  +LCQLA+PLLKA+GNGSIVFI+S +     P  + YA+TK A+  + KNLACE
Sbjct  121  TNVESPYHLCQLAYPLLKASGNGSIVFIASIAGLKALPRLSAYAATKSAVIQISKNLACE  180

Query  394  WANDNIRVNAVAPWLMRTSLTESSRGEFGAVIEALIRRTLQHRLVEPKEASAAVAFLCFP  215
            WA D IR N VAPW + T + +    +       LI RT   R+ EP E S+ V FLC P
Sbjct  181  WAKDGIRTNTVAPWAVNTGV-KVENDDHSDDFRRLIGRTPIRRVAEPNEISSLVTFLCLP  239

Query  214  AASFVTGQIISVDGGGSIYGL  152
            AAS++ GQ++SVDGG ++ G 
Sbjct  240  AASYINGQVVSVDGGFTVSGF  260



>ref|XP_006295594.1| hypothetical protein CARUB_v10024703mg [Capsella rubella]
 gb|EOA28492.1| hypothetical protein CARUB_v10024703mg [Capsella rubella]
Length=271

 Score =   262 bits (669),  Expect = 4e-82, Method: Compositional matrix adjust.
 Identities = 143/271 (53%), Positives = 186/271 (69%), Gaps = 8/271 (3%)
 Frame = -1

Query  958  LAKNAKYQQHNIMAGRWSLHGMTALVTGGTRGLGHAIVEELACLGATVYTCSRTEKELEE  779
            +AK  +  + N    RWSL GMTALVTGG++G+G AIVEELA LGA V+TC+R E EL+E
Sbjct  1    MAKTGESLREN---PRWSLRGMTALVTGGSKGIGEAIVEELAMLGARVHTCARDETELQE  57

Query  778  CIQNWKAKGYKVFGSVCDILQPSQRENLIQLVSKQFDGKLTILVNNVAILIPKETLKSDG  599
             ++ W+ KG++V  SVCD+    QRE L++ VS  F GKL ILVNNV  +I K T+    
Sbjct  58   SLRKWQEKGFQVTTSVCDVSSRDQREKLMETVSSVFQGKLNILVNNVGAIIVKPTVMHTS  117

Query  598  QDFSNTIGTNLEASLNLCQLAHPLLKATGNGsivfisscssfVYAPFHTIYASTKGAINS  419
            +DFS TI TNLE++ +L QLAHPLLKA+G+G+IV ISS S  V+    ++Y ++KGA+N 
Sbjct  118  EDFSFTIATNLESAFHLSQLAHPLLKASGSGNIVLISSVSGVVHVTGASMYGASKGALNQ  177

Query  418  LVKNLACEWANDNIRVNAVAPWLMRTSLTES--SRGEFGAVIEALIRRTLQHRLVEPKEA  245
            L +NLACEWA+DNIRVN+V PW + T       S  EF   +E+   R    R+ EP E 
Sbjct  178  LGRNLACEWASDNIRVNSVCPWFIATPFVNEVLSDKEFRNEVES---RPPMGRVGEPNEV  234

Query  244  SAAVAFLCFPAASFVTGQIISVDGGGSIYGL  152
            S+ VAFLC PAAS++TGQ I VDGG +I G 
Sbjct  235  SSLVAFLCLPAASYITGQTICVDGGFTINGF  265



>ref|XP_008442514.1| PREDICTED: tropinone reductase homolog [Cucumis melo]
Length=259

 Score =   261 bits (668),  Expect = 4e-82, Method: Compositional matrix adjust.
 Identities = 138/251 (55%), Positives = 179/251 (71%), Gaps = 7/251 (3%)
 Frame = -1

Query  913  RWSLHGMTALVTGGTRGLGHAIVEELACLGATVYTCSRTEKELEECIQNWKAKGYKVFGS  734
            RWSL G TALVTGGTRG+G+AIVEELA LGA+V+TCSR + E+++ +Q W+ KG+KV  S
Sbjct  7    RWSLDGFTALVTGGTRGIGYAIVEELASLGASVHTCSRNQTEIDQRLQEWQQKGFKVTAS  66

Query  733  VCDILQPSQRENLIQLVSKQFDGKLTILVNNVAILIPKETLKSDGQDFSNTIGTNLEASL  554
            VCD+   SQR+ LI  VS  F+G L ILVNN   +  K   +   +D++  + TN EA  
Sbjct  67   VCDLTSSSQRQQLIDTVSSIFNGTLNILVNNAGTVTLKGATEYTTEDYNYMMSTNFEAPY  126

Query  553  NLCQLAHPLLKATGNGsivfisscssfVYAPFHTIYASTKGAINSLVKNLACEWANDNIR  374
            +L Q++HP+LKA+G GSIVF+SS +     P  +IYA+TKGAIN + KNLACEWA DNIR
Sbjct  127  HLSQISHPILKASGYGSIVFVSSIAGVTALPKISIYAATKGAINQITKNLACEWAKDNIR  186

Query  373  VNAVAPWLMRTSLTESSRGEFGAVIEA---LIRRTLQHRLVEPKEASAAVAFLCFPAASF  203
            VN VAPW +RT++++       AV+E    LI RT   R+ EP+E S+ VAFLC PAAS+
Sbjct  187  VNTVAPWGVRTTISKPD----AAVVEEYGRLIGRTPAGRIGEPEEISSVVAFLCLPAASY  242

Query  202  VTGQIISVDGG  170
            V+GQII VDGG
Sbjct  243  VSGQIICVDGG  253



>gb|AFK36946.1| unknown [Medicago truncatula]
Length=266

 Score =   261 bits (668),  Expect = 4e-82, Method: Compositional matrix adjust.
 Identities = 137/251 (55%), Positives = 175/251 (70%), Gaps = 3/251 (1%)
 Frame = -1

Query  913  RWSLHGMTALVTGGTRGLGHAIVEELACLGATVYTCSRTEKELEECIQNWKAKGYKVFGS  734
            RWSLHGMTALVTGGTRG+G+AIVEELA  GA+V+ C+R E+++ +C++ WK KG+ V GS
Sbjct  13   RWSLHGMTALVTGGTRGIGYAIVEELAEFGASVHICARNEEDINKCLEEWKNKGFNVTGS  72

Query  733  VCDILQPSQRENLIQLVSKQFDGKLTILVNNVAILIPKETLKSDGQDFSNTIGTNLEASL  554
            VCDIL   QR+ L++ VS  F GKL ILVNN A    K+ + +  +D + T+GTN  +  
Sbjct  73   VCDILFHEQRKKLMETVSSIFQGKLNILVNNAAKPTSKKIIDNTDEDINTTLGTNFVSGY  132

Query  553  NLCQLAHPLLKATGNGsivfisscssfVYAPFHTIYASTKGAINSLVKNLACEWANDNIR  374
            +LCQLAHPLLK +G GSIVF SS +     P  ++Y +TKGA+N   KNLA EWA DNIR
Sbjct  133  HLCQLAHPLLKQSGYGSIVFTSSVAGLKAIPVLSVYTATKGAVNQFTKNLALEWAKDNIR  192

Query  373  VNAVAPWLMRTSLTES---SRGEFGAVIEALIRRTLQHRLVEPKEASAAVAFLCFPAASF  203
             NAVAP  ++TSL ES      E    I  ++ +T   R+ E KE SA VAF CFPAAS 
Sbjct  193  ANAVAPGPVKTSLLESVMDYDSEGYKAIAGIVSQTPTGRMGETKEISALVAFFCFPAASH  252

Query  202  VTGQIISVDGG  170
            +TGQII++DGG
Sbjct  253  ITGQIIAIDGG  263



>ref|XP_008461702.1| PREDICTED: tropinone reductase homolog [Cucumis melo]
Length=273

 Score =   262 bits (669),  Expect = 5e-82, Method: Compositional matrix adjust.
 Identities = 141/254 (56%), Positives = 177/254 (70%), Gaps = 1/254 (0%)
 Frame = -1

Query  913  RWSLHGMTALVTGGTRGLGHAIVEELACLGATVYTCSRTEKELEECIQNWKAKGYKVFGS  734
            RWSL G TALVTGGTRG+GHA+VEELA LGA+V+TCSR + +L +C++ W+AKG+ V GS
Sbjct  12   RWSLKGFTALVTGGTRGIGHAVVEELAGLGASVHTCSRNQSDLNQCLKEWEAKGFVVTGS  71

Query  733  VCDILQPSQRENLIQLVSKQFDGKLTILVNNVAILIPKETLKSDGQDFSNTIGTNLEASL  554
            VCD    +QRE LIQ V+  F+G L ILVNN    I K T +   +D S  + TN E++ 
Sbjct  72   VCDASSRTQREELIQEVASSFNGTLNILVNNAGTNIRKPTAEYSLEDVSTLMTTNFESAY  131

Query  553  NLCQLAHPLLKATGNGsivfisscssfVYAPFHTIYASTKGAINSLVKNLACEWANDNIR  374
            +L QL+HPLLKA+GNGSIVFISS    V     +IYA+TK AIN L K LACEWA DNIR
Sbjct  132  HLSQLSHPLLKASGNGSIVFISSVGGLVSVGSGSIYAATKSAINQLTKYLACEWAKDNIR  191

Query  373  VNAVAPWLMRTSLTESSRGEFGAVIEALIRRTLQHRLVEPKEASAAVAFLCFPAASFVTG  194
            VN VAPW + T L E        +++ ++ RT   R+ E KE S+ VAFLC PAAS++TG
Sbjct  192  VNGVAPWYINTPLVEKLLNN-KTLVDNIVSRTPLRRIGESKEVSSLVAFLCLPAASYITG  250

Query  193  QIISVDGGGSIYGL  152
            QI+SVDGG +  G 
Sbjct  251  QIMSVDGGFTANGF  264



>ref|XP_009140979.1| PREDICTED: tropinone reductase homolog At1g07440 [Brassica rapa]
Length=300

 Score =   263 bits (671),  Expect = 5e-82, Method: Compositional matrix adjust.
 Identities = 138/256 (54%), Positives = 183/256 (71%), Gaps = 5/256 (2%)
 Frame = -1

Query  913  RWSLHGMTALVTGGTRGLGHAIVEELACLGATVYTCSRTEKELEECIQNWKAKGYKVFGS  734
            RWSLHGM+ALVTGGTRG+G AIVEEL  LGA V+TC+R E EL++C+++W   G++V GS
Sbjct  43   RWSLHGMSALVTGGTRGIGRAIVEELVGLGAKVHTCARNETELKDCLRDWNRSGFQVDGS  102

Query  733  VCDILQPSQRENLIQLVSKQFDGKLTILVNNVAILIPKETLKSDGQDFSNTIGTNLEASL  554
            VCD+   +QRE+L++ VS  F GKL ILVNNV   I K  +    ++FS  + TN E+  
Sbjct  103  VCDVSDRAQRESLMETVSSLFHGKLHILVNNVGTNIRKPMVDFTPEEFSTLLSTNFESVF  162

Query  553  NLCQLAHPLLKATGNGsivfisscssfVYAPFHTIYASTKGAINSLVKNLACEWANDNIR  374
            +LCQLA+P+L+AT  G +V ISS S FV     ++ ++TKGAIN L +NLACEWA DNIR
Sbjct  163  HLCQLAYPILRATEAGCVVSISSVSGFVSLKNMSVQSATKGAINQLTRNLACEWAKDNIR  222

Query  373  VNAVAPWLMRTSLTES--SRGEFGAVIEALIRRTLQHRLVEPKEASAAVAFLCFPAASFV  200
            VNAVAPW ++TS+ E   S  ++   ++ +   T   RL EP+E S+AVAFLC PA+S++
Sbjct  223  VNAVAPWYIKTSMVEQVLSNKDY---LDEVYSVTPLGRLGEPREVSSAVAFLCLPASSYI  279

Query  199  TGQIISVDGGGSIYGL  152
            TGQI+ VDGG SI G 
Sbjct  280  TGQIVRVDGGMSINGF  295



>ref|XP_004291519.1| PREDICTED: tropinone reductase homolog At1g07440-like [Fragaria 
vesca subsp. vesca]
Length=264

 Score =   261 bits (668),  Expect = 5e-82, Method: Compositional matrix adjust.
 Identities = 143/259 (55%), Positives = 179/259 (69%), Gaps = 8/259 (3%)
 Frame = -1

Query  913  RWSLHGMTALVTGGTRGLGHAIVEELACLGATVYTCSRTEKELEECIQNWKAKG-YKVFG  737
            RWSL GMTALVTGGT+G+G+AIVEELA LGA V+TCSR E +L EC+  WK KG ++V G
Sbjct  9    RWSLEGMTALVTGGTKGIGYAIVEELAGLGARVHTCSRNEAQLHECLSQWKKKGLHQVTG  68

Query  736  SVCDILQPSQRENLIQLVSKQFDGKLTILVNNVAIL-IPKETLKSDGQDFSNTIGTNLEA  560
            SVCD++    RE LI  VS  F GKL IL+NNV      K T +   +++S  I TNLE+
Sbjct  69   SVCDVVSKIHREELIHRVSSLFHGKLNILINNVGTTHKTKPTTEYTSEEYSFIISTNLES  128

Query  559  SLNLCQLAHPLLKATGNGsivfisscs-sfVYAPFHTIYASTKGAINSLVKNLACEWAND  383
            + N+CQLA PLLKA+  G+I+ +SS +         +IY +TKGA+N L KNLACEWA D
Sbjct  129  TYNMCQLAQPLLKASSAGNIILLSSVAGVVSIGKVGSIYGATKGAMNQLAKNLACEWAKD  188

Query  382  NIRVNAVAPWLMRTSLTES--SRGEFGAVIEALIRRTLQHRLVEPKEASAAVAFLCFPAA  209
            NIR+N+VAPW +RT L E   S  +F    EA+I RT   R+ EP+E SA VAFLC PAA
Sbjct  189  NIRINSVAPWFIRTPLVEPLLSDEKFS---EAVISRTPLERIGEPEEVSALVAFLCLPAA  245

Query  208  SFVTGQIISVDGGGSIYGL  152
            S++TGQ I VDGG +I G 
Sbjct  246  SYITGQTICVDGGMTINGF  264



>ref|XP_003552795.1| PREDICTED: tropinone reductase homolog [Glycine max]
 gb|KHN07592.1| Tropinone reductase like [Glycine soja]
Length=272

 Score =   261 bits (668),  Expect = 6e-82, Method: Compositional matrix adjust.
 Identities = 137/260 (53%), Positives = 181/260 (70%), Gaps = 1/260 (0%)
 Frame = -1

Query  913  RWSLHGMTALVTGGTRGLGHAIVEELACLGATVYTCSRTEKELEECIQNWKAKGYKVFGS  734
            RWSL+G TALVTGGTRG+GHAIV +LA  GA V+TCSRT+ EL +C+Q W++ G++V GS
Sbjct  13   RWSLNGTTALVTGGTRGIGHAIVSDLAAFGAAVHTCSRTQTELNKCLQEWQSLGFQVTGS  72

Query  733  VCDILQPSQRENLIQLVSKQFDGKLTILVNNVAILIPKETLKSDGQDFSNTIGTNLEASL  554
            VCD+  PSQRE LI+ V+   +GKL I VNNV     K T++   +++S  +  NL++S 
Sbjct  73   VCDVSSPSQREKLIEEVTSILNGKLNIYVNNVGTNFRKPTIEYTAEEYSQLMTVNLDSSF  132

Query  553  NLCQLAHPLLKATGNGsivfisscssfVYAPFHTIYASTKGAINSLVKNLACEWANDNIR  374
            +LCQLA+PLLKA+ NGSIVFISS +  V      +YA++K AIN L KNLACEWA DNIR
Sbjct  133  HLCQLAYPLLKASENGSIVFISSVAGVVSLGTGAVYAASKAAINQLTKNLACEWAKDNIR  192

Query  373  VNAVAPWLMRTSLTESSRGEFGAVIEALIRRTLQHRLVEPKEASAAVAFLCFPAASFVTG  194
             N V PW  RT L E    +    ++ ++ RT   R+ EP+E S+ V FLC PAAS++TG
Sbjct  193  SNCVVPWATRTPLVEHLLRD-QKFVDDIMSRTPIKRIAEPEEVSSLVTFLCLPAASYITG  251

Query  193  QIISVDGGGSIYGL*TSVWI  134
            Q+I VDGG ++ G   S+ I
Sbjct  252  QVICVDGGLTVNGFQPSMRI  271



>ref|XP_004150641.1| PREDICTED: tropinone reductase homolog At1g07440-like [Cucumis 
sativus]
 ref|XP_004172534.1| PREDICTED: tropinone reductase homolog At1g07440-like [Cucumis 
sativus]
 gb|KGN50576.1| hypothetical protein Csa_5G184270 [Cucumis sativus]
Length=273

 Score =   261 bits (668),  Expect = 6e-82, Method: Compositional matrix adjust.
 Identities = 140/254 (55%), Positives = 179/254 (70%), Gaps = 1/254 (0%)
 Frame = -1

Query  913  RWSLHGMTALVTGGTRGLGHAIVEELACLGATVYTCSRTEKELEECIQNWKAKGYKVFGS  734
            RWSL G TALVTGGTRG+GHA+VEELA LGA+V+TC+R E +L +C++ W+AKGY V GS
Sbjct  12   RWSLEGFTALVTGGTRGIGHAVVEELAGLGASVHTCARNESDLNQCLKEWEAKGYVVTGS  71

Query  733  VCDILQPSQRENLIQLVSKQFDGKLTILVNNVAILIPKETLKSDGQDFSNTIGTNLEASL  554
            VCD    +QRE LIQ V+  F+G L ILVNNV   I K + +   ++ S  + TN E++ 
Sbjct  72   VCDASSRTQREELIQEVASSFNGTLNILVNNVGTNIRKPSAEYSLEEVSTLMTTNFESAF  131

Query  553  NLCQLAHPLLKATGNGsivfisscssfVYAPFHTIYASTKGAINSLVKNLACEWANDNIR  374
            +L QL+HPLLKA+GNGSIVFISS    V     +IYA+TK AIN L +NL CEWA DNIR
Sbjct  132  HLSQLSHPLLKASGNGSIVFISSVGGLVSIGSGSIYAATKSAINQLTRNLTCEWAKDNIR  191

Query  373  VNAVAPWLMRTSLTESSRGEFGAVIEALIRRTLQHRLVEPKEASAAVAFLCFPAASFVTG  194
            VN VAPW + T L E    +   +++ ++ RT   R+ E KE S+ VAFLC PAAS++TG
Sbjct  192  VNCVAPWYINTPLVEKLM-KNKTLVDNIVSRTPLGRIGESKEVSSLVAFLCLPAASYITG  250

Query  193  QIISVDGGGSIYGL  152
            QI+SVDGG +  G 
Sbjct  251  QIMSVDGGFTANGF  264



>ref|XP_009623489.1| PREDICTED: tropinone reductase 1-like isoform X2 [Nicotiana tomentosiformis]
Length=275

 Score =   261 bits (668),  Expect = 6e-82, Method: Compositional matrix adjust.
 Identities = 139/256 (54%), Positives = 184/256 (72%), Gaps = 11/256 (4%)
 Frame = -1

Query  916  GRWSLHGMTALVTGGTRGLGHAIVEELACLGATVYTCSRTEKELEECIQNWKAKGYKVFG  737
            GRWSL G TALVTGG++G+G+AIVEELA LGA VYTCSR EKEL+EC++ W+ KG+KV G
Sbjct  17   GRWSLKGKTALVTGGSKGIGYAIVEELAGLGARVYTCSRNEKELQECLEIWRNKGFKVEG  76

Query  736  SVCDILQPSQRENLIQLVSKQFDGKLTILVNNVAILIPKETLKSDGQDFSNTIGTNLEAS  557
            SVCD+L  ++RENL+Q V   F+GKL ILVNN  ++I KET     +D++  +GTN EA 
Sbjct  77   SVCDLLLCTERENLMQAVGDVFNGKLNILVNNAGVVIHKETKDFTAEDYNIVMGTNFEAG  136

Query  556  LNLCQLAHPLLKATGNGsivfisscssfVYAPFHTIYASTKGAINSLVKNLACEWANDNI  377
             +L QLA+PLLKA+ NG+++F+SS + F   P  ++Y+++KG IN   K+LACEWA DNI
Sbjct  137  FHLSQLAYPLLKASENGNVIFLSSIAGFSALPSLSLYSASKGQINQTTKSLACEWAKDNI  196

Query  376  RVNAVAPWLMRTSLTESS-------RGEFGAVIEALIRRTLQHRLVEPKEASAAVAFLCF  218
            RVN+VAP ++ T L E++       R E    I+  I RT   R  +P+E SA + FLCF
Sbjct  197  RVNSVAPGIIMTPLVETAIKRNPRQREE----IDHFIVRTPMGRAGKPEEISALITFLCF  252

Query  217  PAASFVTGQIISVDGG  170
            PAAS++TGQII  D G
Sbjct  253  PAASYITGQIIWADCG  268



>emb|CAN69103.1| hypothetical protein VITISV_027298 [Vitis vinifera]
Length=274

 Score =   261 bits (668),  Expect = 6e-82, Method: Compositional matrix adjust.
 Identities = 141/254 (56%), Positives = 175/254 (69%), Gaps = 1/254 (0%)
 Frame = -1

Query  913  RWSLHGMTALVTGGTRGLGHAIVEELACLGATVYTCSRTEKELEECIQNWKAKGYKVFGS  734
            RWSL GMTALVTGGTRG+GHAIVEEL  LGATV+TCSR E EL+ C++ W   G++V G 
Sbjct  17   RWSLRGMTALVTGGTRGIGHAIVEELLGLGATVHTCSRNEAELDGCLKGWTGMGFRVTGC  76

Query  733  VCDILQPSQRENLIQLVSKQFDGKLTILVNNVAILIPKETLKSDGQDFSNTIGTNLEASL  554
            VCD+    +RE L+  V   FDGKL IL+NNV   I K  +    +DFS  + TN E+  
Sbjct  77   VCDVSSRVERERLMDNVCDVFDGKLNILINNVGTNIRKPVVDFTEEDFSTLMATNFESVF  136

Query  553  NLCQLAHPLLKATGNGsivfisscssfVYAPFHTIYASTKGAINSLVKNLACEWANDNIR  374
            +  QLA+PLLK +G+GSIVF+SS S FV     ++  +TKGAIN L KNLACEWA DNIR
Sbjct  137  HTSQLAYPLLKTSGSGSIVFVSSVSGFVSLKSMSVQGATKGAINQLTKNLACEWAKDNIR  196

Query  373  VNAVAPWLMRTSLTESSRGEFGAVIEALIRRTLQHRLVEPKEASAAVAFLCFPAASFVTG  194
             NAVAPW +RTS+ E   G     +E +  RT   RL +P+E S+ VAFLC PA+S++TG
Sbjct  197  SNAVAPWYIRTSMVEKVLGN-KEYLEEVFARTPLRRLGDPEEVSSLVAFLCLPASSYITG  255

Query  193  QIISVDGGGSIYGL  152
            QII VDGG S+ G 
Sbjct  256  QIICVDGGMSVNGF  269



>gb|AFK34899.1| unknown [Medicago truncatula]
 gb|AFK41906.1| unknown [Medicago truncatula]
 gb|KEH30190.1| NAD(P)-binding rossmann-fold protein [Medicago truncatula]
Length=267

 Score =   261 bits (667),  Expect = 6e-82, Method: Compositional matrix adjust.
 Identities = 140/251 (56%), Positives = 177/251 (71%), Gaps = 3/251 (1%)
 Frame = -1

Query  919  AGRWSLHGMTALVTGGTRGLGHAIVEELACLGATVYTCSRTEKELEECIQNWKAKGYKVF  740
            + +WSL G TALVTGG++G+G+ IVE+LA LGATV+TC+R E EL EC+  W  KGYK+ 
Sbjct  10   SSKWSLKGTTALVTGGSKGIGYDIVEQLAELGATVHTCARNEAELNECLNQWVTKGYKIT  69

Query  739  GSVCDILQPSQRENLIQLVSKQFDGKLTILVNNVAILIPKETLKSDGQDFSNTIGTNLEA  560
            GSVCD+   +QRE+LI  VS +F+GKL ILVNNV   + K+TL    QDFS  + TNLE+
Sbjct  70   GSVCDVASRAQREDLIARVSSEFNGKLNILVNNVGTNMQKQTLDFTEQDFSFLVNTNLES  129

Query  559  SLNLCQLAHPLLKATGNGsivfisscssfVYAPFHTIYASTKGAINSLVKNLACEWANDN  380
            + ++ QLAHPLLKA+ N SIVF+SS          TIY++ KGAI  L KNLACEWA DN
Sbjct  130  AFHISQLAHPLLKASNNASIVFMSSIGGVASLNIGTIYSAAKGAIIQLTKNLACEWAKDN  189

Query  379  IRVNAVAPWLMRTSL-TESSRGEFGAVIEALIRRTLQHRLVEPKEASAAVAFLCFPAASF  203
            IR N VAP  +RT L  E  + E   +++A I RT   R+ EP+E S+ VAFLC PAASF
Sbjct  190  IRTNCVAPGPIRTPLAAEHLKDE--KLLDAFIERTPLGRIGEPEEVSSLVAFLCLPAASF  247

Query  202  VTGQIISVDGG  170
            +TGQ I +DGG
Sbjct  248  ITGQTICIDGG  258



>sp|P50162.1|TRN1_DATST RecName: Full=Tropinone reductase 1; AltName: Full=Tropine dehydrogenase; 
AltName: Full=Tropinone reductase I; Short=TR-I 
[Datura stramonium]
 pdb|1AE1|A Chain A, Tropinone Reductase-I Complex With Nadp
 pdb|1AE1|B Chain B, Tropinone Reductase-I Complex With Nadp
 gb|AAA33281.1| tropinone reductase-I [Datura stramonium]
Length=273

 Score =   261 bits (668),  Expect = 7e-82, Method: Compositional matrix adjust.
 Identities = 135/252 (54%), Positives = 184/252 (73%), Gaps = 3/252 (1%)
 Frame = -1

Query  916  GRWSLHGMTALVTGGTRGLGHAIVEELACLGATVYTCSRTEKELEECIQNWKAKGYKVFG  737
            GRWSL G TALVTGG++G+G+AIVEELA LGA VYTCSR EKEL+EC++ W+ KG  V G
Sbjct  15   GRWSLKGTTALVTGGSKGIGYAIVEELAGLGARVYTCSRNEKELDECLEIWREKGLNVEG  74

Query  736  SVCDILQPSQRENLIQLVSKQFDGKLTILVNNVAILIPKETLKSDGQDFSNTIGTNLEAS  557
            SVCD+L  ++R+ L+Q V+  FDGKL ILVNN  ++I KE      +D++  +GTN EA+
Sbjct  75   SVCDLLSRTERDKLMQTVAHVFDGKLNILVNNAGVVIHKEAKDFTEKDYNIIMGTNFEAA  134

Query  556  LNLCQLAHPLLKATGNGsivfisscssfVYAPFHTIYASTKGAINSLVKNLACEWANDNI  377
             +L Q+A+PLLKA+ NG+++F+SS + F   P  ++Y+++KGAIN + K+LACEWA DNI
Sbjct  135  YHLSQIAYPLLKASQNGNVIFLSSIAGFSALPSVSLYSASKGAINQMTKSLACEWAKDNI  194

Query  376  RVNAVAPWLMRTSLTESS---RGEFGAVIEALIRRTLQHRLVEPKEASAAVAFLCFPAAS  206
            RVN+VAP ++ T L E++          I+  I +T   R  +P+E SA +AFLCFPAAS
Sbjct  195  RVNSVAPGVILTPLVETAIKKNPHQKEEIDNFIVKTPMGRAGKPQEVSALIAFLCFPAAS  254

Query  205  FVTGQIISVDGG  170
            ++TGQII  DGG
Sbjct  255  YITGQIIWADGG  266



>ref|XP_003529117.1| PREDICTED: tropinone reductase homolog isoform 1 [Glycine max]
Length=266

 Score =   261 bits (667),  Expect = 8e-82, Method: Compositional matrix adjust.
 Identities = 137/265 (52%), Positives = 180/265 (68%), Gaps = 3/265 (1%)
 Frame = -1

Query  946  AKYQQHNIMAGRWSLHGMTALVTGGTRGLGHAIVEELACLGATVYTCSRTEKELEECIQN  767
            AK +   I   RWSLHGMTALVTG TRG+GHAI EELA  GA V+ C+R +++++ C++ 
Sbjct  2    AKTKLSCIKDERWSLHGMTALVTGATRGIGHAIAEELAEFGAVVHICARKQQDIDRCLEE  61

Query  766  WKAKGYKVFGSVCDILQPSQRENLIQLVSKQFDGKLTILVNNVAILIPKETLKSDGQDFS  587
            W  K +++ GS CD+L   QRENL++ V+  F GKL IL+NN     PK  +    +D +
Sbjct  62   WSKKEFRITGSACDVLYRDQRENLMKNVASIFHGKLNILINNTGTNTPKNLIDYTAEDVT  121

Query  586  NTIGTNLEASLNLCQLAHPLLKATGNGsivfisscssfVYAPFHTIYASTKGAINSLVKN  407
              +GTN E+S +LCQLAHPLLKA+G GSIVFISS +     P  +IY  +KGA+N L KN
Sbjct  122  TIMGTNFESSYHLCQLAHPLLKASGYGSIVFISSIAGLKALPLCSIYGPSKGAMNQLTKN  181

Query  406  LACEWANDNIRVNAVAPWLMRTSLTES---SRGEFGAVIEALIRRTLQHRLVEPKEASAA  236
            +A EWA DNIR N VAP  ++T L +S   S  E    IEA++ +    RL +P++ SA 
Sbjct  182  IALEWAKDNIRANTVAPGPVKTLLLDSFVKSGNEADKAIEAIVSQAPAGRLGDPEDISAM  241

Query  235  VAFLCFPAASFVTGQIISVDGGGSI  161
            VAFLC PAASF+TGQII+VDGG +I
Sbjct  242  VAFLCLPAASFITGQIINVDGGCTI  266



>emb|CDY09823.1| BnaC09g43380D [Brassica napus]
Length=271

 Score =   261 bits (667),  Expect = 8e-82, Method: Compositional matrix adjust.
 Identities = 138/256 (54%), Positives = 179/256 (70%), Gaps = 5/256 (2%)
 Frame = -1

Query  913  RWSLHGMTALVTGGTRGLGHAIVEELACLGATVYTCSRTEKELEECIQNWKAKGYKVFGS  734
            RWSL GMTALVTGG++GLG A+VEELA LGA V+TC+R E +L+EC+  W+AKG++V  S
Sbjct  13   RWSLRGMTALVTGGSKGLGSAVVEELAMLGARVHTCARDETQLQECLLEWQAKGFQVTTS  72

Query  733  VCDILQPSQRENLIQLVSKQFDGKLTILVNNVAILIPKETLKSDGQDFSNTIGTNLEASL  554
            VCD+    QRE L++ VS  F GKL ILVNN    I K T +   +DFS  + TNLE++ 
Sbjct  73   VCDVSSRVQREKLMETVSTLFQGKLNILVNNAGTCITKPTTEFSAEDFSFLMATNLESAF  132

Query  553  NLCQLAHPLLKATGNGsivfisscssfVYAPFHTIYASTKGAINSLVKNLACEWANDNIR  374
            +L QLAHP LKA+G+GSIVF+SS +  V+    +IY +TKGA+N L +NLACEWA+D+IR
Sbjct  133  HLSQLAHPFLKASGSGSIVFMSSAAGVVHVNVGSIYGATKGAMNQLARNLACEWASDSIR  192

Query  373  VNAVAPWLMRTSLTES--SRGEFGAVIEALIRRTLQHRLVEPKEASAAVAFLCFPAASFV  200
            VN+V PW + T L        E    +E    +T   R+ E  E S+ VAFLCFPAAS++
Sbjct  193  VNSVCPWFIATPLANKFMDHEELKKEVET---KTPMGRVGEANEVSSLVAFLCFPAASYI  249

Query  199  TGQIISVDGGGSIYGL  152
            TGQ+I VDGG +I GL
Sbjct  250  TGQVICVDGGATINGL  265



>emb|CBI16068.3| unnamed protein product [Vitis vinifera]
Length=252

 Score =   260 bits (665),  Expect = 8e-82, Method: Compositional matrix adjust.
 Identities = 134/247 (54%), Positives = 178/247 (72%), Gaps = 5/247 (2%)
 Frame = -1

Query  895  MTALVTGGTRGLGHAIVEELACLGATVYTCSRTEKELEECIQNWKAKGYKVFGSVCDILQ  716
            MTALVTGGTRG+GHA+VEEL  LGA ++TCSRTE EL E +++W+ KG++V GSVCD+  
Sbjct  1    MTALVTGGTRGIGHAVVEELTGLGARIHTCSRTETELNEYLRDWEGKGFEVTGSVCDVSS  60

Query  715  PSQRENLIQLVSKQFDGKLTILVNNVAILIPKETLKSDGQDFSNTIGTNLEASLNLCQLA  536
             +QRE L++ VS +F+GKL IL+NN     P  T++   ++FS+ +  N E   +LCQLA
Sbjct  61   RAQREKLMETVSSKFNGKLNILINNAGTGKPGRTVEFTAEEFSSIMAVNFEFVYHLCQLA  120

Query  535  HPLLKATGNGsivfisscssfVYAPFHTIYASTKGAINSLVKNLACEWANDNIRVNAVAP  356
            HPLLKA+G GSIV +SS +  V   + + Y +TKGA+N L K+LACEWA DNIR N++AP
Sbjct  121  HPLLKASGAGSIVLMSSVAGVVSLKYLSAYGATKGALNQLAKSLACEWAQDNIRANSIAP  180

Query  355  WLMRTSLTES--SRGEFGAVIEALIRRTLQHRLVEPKEASAAVAFLCFPAASFVTGQIIS  182
            W ++TSL E   S+  F    E +IRRT   R+ +PKE S+ VAFLC PA+S++TGQ I 
Sbjct  181  WFIKTSLVEPFLSKKSF---TEEVIRRTPLGRVGDPKEVSSLVAFLCLPASSYITGQTIC  237

Query  181  VDGGGSI  161
            VDGG SI
Sbjct  238  VDGGMSI  244



>ref|XP_010033102.1| PREDICTED: tropinone reductase homolog At1g07440-like isoform 
X1 [Eucalyptus grandis]
 gb|KCW52640.1| hypothetical protein EUGRSUZ_J02016 [Eucalyptus grandis]
Length=282

 Score =   261 bits (668),  Expect = 8e-82, Method: Compositional matrix adjust.
 Identities = 148/261 (57%), Positives = 181/261 (69%), Gaps = 12/261 (5%)
 Frame = -1

Query  913  RWSLHGMTALVTGGTRGLGHAIVEELACLGATVYTCSRTEKELEECIQNWKAKGYKVFGS  734
            RWSL GMTALVTGG++G+G AIVEELA LGATVYTCSRTE EL EC++ WK KG++V GS
Sbjct  22   RWSLQGMTALVTGGSKGIGRAIVEELAGLGATVYTCSRTEAELNECLKEWKRKGFQVAGS  81

Query  733  VCDILQPSQRENLIQLVSKQFDGKLTILVNNVAIL-----IPKETLKSDGQDFSNTIGTN  569
             CD+   S+RE L+   S  FDGKL IL+NNV  L     +P  T+    +DFS  + TN
Sbjct  82   ACDVSSRSEREKLMLAASSLFDGKLNILINNVGTLGTTGGMP--TVDCTAEDFSFIMTTN  139

Query  568  LEASLNLCQLAHPLLKATGNGsivfisscssfVYAPFHTIYASTKGAINSLVKNLACEWA  389
             E++ +L QLAHPLLKA+G GSIVF+SS    V     +IY++TKGA+N L KNLACEWA
Sbjct  140  FESAYHLSQLAHPLLKASGTGSIVFLSSVCGIVSLSVGSIYSATKGAMNQLTKNLACEWA  199

Query  388  NDNIRVNAVAPWLMRTSLTES--SRGEFGAVIEALIRRTLQHRLVEPKEASAAVAFLCFP  215
             DNIR N+VAP+ + T LTE      EF    EA+ R  L  R  EPKE S+ VAFLC P
Sbjct  200  KDNIRSNSVAPYFILTPLTEPLLCSEEFHK--EAIARAPL-GRTGEPKEVSSLVAFLCLP  256

Query  214  AASFVTGQIISVDGGGSIYGL  152
            AAS++TGQ I VDGG ++ G 
Sbjct  257  AASYITGQTICVDGGFTVNGF  277



>ref|XP_011023544.1| PREDICTED: tropinone reductase homolog At1g07440-like isoform 
X1 [Populus euphratica]
Length=267

 Score =   261 bits (666),  Expect = 8e-82, Method: Compositional matrix adjust.
 Identities = 138/255 (54%), Positives = 182/255 (71%), Gaps = 2/255 (1%)
 Frame = -1

Query  913  RWSLHGMTALVTGGTRGLGHAIVEELACLGATVYTCSRTEKELEECIQNWKAKGYKVFGS  734
            RW L G++ALVTGGT+GLG AIVEELA LGA V+TC+R + +L E ++ WK KG+KV GS
Sbjct  11   RWGLQGISALVTGGTKGLGCAIVEELAALGAIVHTCARNQDQLNERVREWKEKGFKVTGS  70

Query  733  VCDILQPSQRENLIQLVSKQFDGKLTILVNNVAILIPKETLKSDGQDFSNTIGTNLEASL  554
            VCD+   ++RE L++ VS  FDGKL ILVNN    I K TL    +DF++ + TNL+++ 
Sbjct  71   VCDVSSNAEREKLMKEVSSLFDGKLNILVNNAGTNIYKATLDYTAEDFTSLMNTNLQSAF  130

Query  553  NLCQLAHPLLKATGNGsivfisscssfVYAPF-HTIYASTKGAINSLVKNLACEWANDNI  377
            +L QLAHPLLKA+G G IVF+SS SS V     + +Y+++KGA+N L +NLACEWA DNI
Sbjct  131  HLSQLAHPLLKASGAGKIVFMSSISSVVSINTQYPLYSASKGAMNQLTRNLACEWAQDNI  190

Query  376  RVNAVAPWLMRTSLTESSRGEFGAVIEALIRRTLQHRLVEPKEASAAVAFLCFPAASFVT  197
            RVNAVAPW +RT LT  S  +   +++ +  RT   R+ EP E S+ VAFLC PA  F+T
Sbjct  191  RVNAVAPWFIRTPLTTPSLDDEN-ILKEVFNRTPMRRVGEPGEVSSVVAFLCLPAPGFLT  249

Query  196  GQIISVDGGGSIYGL  152
            GQ+I +DGG S+ G 
Sbjct  250  GQVICIDGGMSVNGF  264



>gb|ABW81146.1| TRL26 [Capsella rubella]
Length=271

 Score =   261 bits (667),  Expect = 9e-82, Method: Compositional matrix adjust.
 Identities = 139/256 (54%), Positives = 180/256 (70%), Gaps = 5/256 (2%)
 Frame = -1

Query  913  RWSLHGMTALVTGGTRGLGHAIVEELACLGATVYTCSRTEKELEECIQNWKAKGYKVFGS  734
            RWSL GMTALVTGG++G+G AIVEELA LGA V+TC+R E EL+E ++ W+ KG++V  S
Sbjct  13   RWSLRGMTALVTGGSKGIGEAIVEELAMLGARVHTCARDETELQESLRKWQEKGFQVTTS  72

Query  733  VCDILQPSQRENLIQLVSKQFDGKLTILVNNVAILIPKETLKSDGQDFSNTIGTNLEASL  554
            VCD+    QRE L++ VS  F GKL ILVNNV  +I K T+    +DFS T+ TNLE++ 
Sbjct  73   VCDVSSRDQREKLMETVSSVFQGKLNILVNNVGAIIVKPTVMHTSEDFSFTMATNLESAF  132

Query  553  NLCQLAHPLLKATGNGsivfisscssfVYAPFHTIYASTKGAINSLVKNLACEWANDNIR  374
            +L QLAHPLLKA+G+G+IV ISS S  V+    ++Y ++KGA+N L +NLACEWA+DNIR
Sbjct  133  HLSQLAHPLLKASGSGNIVLISSVSGVVHVTGASMYGASKGALNQLGRNLACEWASDNIR  192

Query  373  VNAVAPWLMRTSLTES--SRGEFGAVIEALIRRTLQHRLVEPKEASAAVAFLCFPAASFV  200
            VN+V PW + T       S  EF   +E+   R    R+ EP E S+ VAFLC PAAS++
Sbjct  193  VNSVCPWFIATPFVNEVLSDKEFRNEVES---RPPMGRVGEPNEVSSLVAFLCLPAASYI  249

Query  199  TGQIISVDGGGSIYGL  152
            TGQ I VDGG +I G 
Sbjct  250  TGQTICVDGGFTINGF  265



>ref|XP_006294815.1| hypothetical protein CARUB_v10023866mg [Capsella rubella]
 gb|ABW81154.1| TRL17 [Capsella rubella]
 gb|EOA27713.1| hypothetical protein CARUB_v10023866mg [Capsella rubella]
Length=263

 Score =   261 bits (666),  Expect = 9e-82, Method: Compositional matrix adjust.
 Identities = 134/257 (52%), Positives = 181/257 (70%), Gaps = 1/257 (0%)
 Frame = -1

Query  922  MAGRWSLHGMTALVTGGTRGLGHAIVEELACLGATVYTCSRTEKELEECIQNWKAKGYKV  743
            M  RWSL GMTALVTGGT+G+G A+VEEL+ LGA V+TC+R E +L+E ++ W+AKG++V
Sbjct  1    MDKRWSLQGMTALVTGGTKGIGEAVVEELSMLGARVHTCARDETQLQERLREWQAKGFQV  60

Query  742  FGSVCDILQPSQRENLIQLVSKQFDGKLTILVNNVAILIPKETLKSDGQDFSNTIGTNLE  563
              S CD+    QRE L++ VS  F GKL ILVNNV   I K T +  G+++S  + TNLE
Sbjct  61   STSTCDVTSREQREKLMETVSSLFQGKLNILVNNVGTFIVKPTTEYTGEEYSLIMATNLE  120

Query  562  ASLNLCQLAHPLLKATGNGsivfisscssfVYAPFHTIYASTKGAINSLVKNLACEWAND  383
            ++ +L QL+HPLLKA+G+GSIV +SS +  V+A   +IY  TKGA+N L +NLACEWA D
Sbjct  121  SAFHLSQLSHPLLKASGSGSIVLMSSIAGLVHANVGSIYGITKGAMNQLARNLACEWARD  180

Query  382  NIRVNAVAPWLMRTSLTESSRGEFGAVIEALIRRTLQHRLVEPKEASAAVAFLCFPAASF  203
            +IR NAV PW + T L      E G +I+ ++ RT   R+ EP E ++ VAFLC PAAS+
Sbjct  181  SIRTNAVCPWYIATPLVNDLLKE-GEIIKEVVSRTPLGRVGEPNEVASLVAFLCLPAASY  239

Query  202  VTGQIISVDGGGSIYGL  152
            +TGQ I +DGG ++ G 
Sbjct  240  ITGQSICIDGGLTVNGF  256



>ref|XP_006429149.1| hypothetical protein CICLE_v10012479mg [Citrus clementina]
 ref|XP_006480854.1| PREDICTED: tropinone reductase homolog isoform X1 [Citrus sinensis]
 gb|ESR42389.1| hypothetical protein CICLE_v10012479mg [Citrus clementina]
Length=266

 Score =   261 bits (666),  Expect = 9e-82, Method: Compositional matrix adjust.
 Identities = 138/250 (55%), Positives = 180/250 (72%), Gaps = 3/250 (1%)
 Frame = -1

Query  913  RWSLHGMTALVTGGTRGLGHAIVEELACLGATVYTCSRTEKELEECIQNWKAKGYKVFGS  734
            +WSL GMTALVTGGTRG+G+AIVEELA  GA V+TC R +  + + IQ W++KG+KV GS
Sbjct  13   KWSLRGMTALVTGGTRGIGYAIVEELARFGALVHTCGRDQNMINKRIQEWESKGFKVTGS  72

Query  733  VCDILQPSQRENLIQLVSKQFDGKLTILVNNVAILIPKETLKSDGQDFSNTIGTNLEASL  554
            VCD+    QRE LI+ VS  FDGKL ILVNN A+++ K   +   +++S+ + TN+E+S 
Sbjct  73   VCDLSFGDQREKLIETVSSVFDGKLNILVNNAALVVMKGATEYTLEEYSSVMSTNVESSY  132

Query  553  NLCQLAHPLLKATGNGsivfisscssfVYAPFHTIYASTKGAINSLVKNLACEWANDNIR  374
            +LCQLAHPLLKA+GN SIVF+SS +  +  P  + YA++KGAIN L KNLACEWA D+IR
Sbjct  133  HLCQLAHPLLKASGNASIVFMSSVAGAISIPRLSAYAASKGAINQLTKNLACEWATDSIR  192

Query  373  VNAVAPWLMRTSLTESSRGEFGAVIE--ALIRRTLQHRLVEPKEASAAVAFLCFPAASFV  200
            VNAV+PW + T ++     +   V E   LI +T   R  EP E S  VAFLC PAAS++
Sbjct  193  VNAVSPWAVNTQISPPDLNDL-LVQEYVKLIAKTPIARSAEPNEISPLVAFLCLPAASYI  251

Query  199  TGQIISVDGG  170
            TGQ+IS+DGG
Sbjct  252  TGQVISIDGG  261



>gb|ABW81158.1| TRL13 [Capsella rubella]
Length=313

 Score =   262 bits (670),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 146/283 (52%), Positives = 189/283 (67%), Gaps = 9/283 (3%)
 Frame = -1

Query  994  LRFADHQSSKSKLAKNAKYQQHNIMAGRWSLHGMTALVTGGTRGLGHAIVEELACLGATV  815
            ++    QSS S +      Q     + RWSL G +ALVTGGTRG+G AIVEELA LGA V
Sbjct  33   IKLQTQQSSASSVHVRCATQS----SERWSLQGKSALVTGGTRGIGRAIVEELAGLGAKV  88

Query  814  YTCSRTEKELEECIQNWKAKGYKVFGSVCDILQPSQRENLIQLVSKQFDGKLTILVNNVA  635
            +TC+R E ELE C+++W + G ++ GSVCD+    QRE L++ VS  FDGKL ILVNNV 
Sbjct  89   HTCARNESELENCLRDWNSSGLRIAGSVCDVSDRGQREALMETVSSVFDGKLHILVNNVG  148

Query  634  ILIPKETLKSDGQDFSNTIGTNLEASLNLCQLAHPLLKATGNGsivfisscssfVYAPFH  455
              I K  ++    +FS  + TN E+  NLCQLA+PLL+A+  GS V ISS S FV     
Sbjct  149  TNIRKPMVEFTAGEFSTLMSTNFESVFNLCQLAYPLLRASEAGSAVSISSVSGFVSLKNM  208

Query  454  TIYASTKGAINSLVKNLACEWANDNIRVNAVAPWLMRTSLTES--SRGEFGAVIEALIRR  281
            ++ ++TKGAIN L ++LACEWA DNIRVNAVAPW ++TS+ E   S  ++   +E +   
Sbjct  209  SVQSATKGAINQLTRSLACEWAKDNIRVNAVAPWYIKTSMVEQVLSNKDY---LEEVYSI  265

Query  280  TLQHRLVEPKEASAAVAFLCFPAASFVTGQIISVDGGGSIYGL  152
            T   RL EP+E S+AVAFLC PA+S++TGQII VDGG SI G 
Sbjct  266  TPLGRLGEPREVSSAVAFLCLPASSYITGQIICVDGGMSINGF  308



>sp|P50164.1|TRN2_HYONI RecName: Full=Tropinone reductase 2; AltName: Full=Tropinone 
reductase II; Short=TR-II [Hyoscyamus niger]
 gb|AAB09776.1| tropinone reductase-II [Hyoscyamus niger]
 dbj|BAA85845.1| tropinone reductase-II [Hyoscyamus niger]
Length=260

 Score =   260 bits (665),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 136/253 (54%), Positives = 176/253 (70%), Gaps = 2/253 (1%)
 Frame = -1

Query  922  MAGRWSLHGMTALVTGGTRGLGHAIVEELACLGATVYTCSRTEKELEECIQNWKAKGYKV  743
            MAGRW+L G TALVTGG+RG+G+ IVEELA LGA+VYTCSR +KEL+EC+  W++KG+ V
Sbjct  1    MAGRWNLEGCTALVTGGSRGIGYGIVEELANLGASVYTCSRNQKELDECLTQWRSKGFNV  60

Query  742  FGSVCDILQPSQRENLIQLVSKQFDGKLTILVNNVAILIPKETLKSDGQDFSNTIGTNLE  563
              SVCD+   S+RE  ++ VS  F GKL ILVNN  I+I KE      +D+S+ +  N E
Sbjct  61   EASVCDLSSRSEREEFMKTVSNHFHGKLNILVNNAGIVIYKEAKDYTMEDYSHIMSINFE  120

Query  562  ASLNLCQLAHPLLKATGNGsivfisscssfVYAPFHTIYASTKGAINSLVKNLACEWAND  383
            A+ +L  LAHP LKA+  G++VFISS S     P+  +Y +TKGA++ L + LA EWA D
Sbjct  121  AAYHLSVLAHPFLKASERGNVVFISSISGASALPYEAVYGATKGAMDQLTRCLAFEWAKD  180

Query  382  NIRVNAVAPWLMRTSLTESS--RGEFGAVIEALIRRTLQHRLVEPKEASAAVAFLCFPAA  209
            NIRVN V P ++ TS+ E +    E    ++ LI R    R+ EPKE +A VAFLCFPAA
Sbjct  181  NIRVNGVGPGVIATSMVEMTIQDPEQKENLDKLIDRCALRRMGEPKELAAVVAFLCFPAA  240

Query  208  SFVTGQIISVDGG  170
            S+VTGQII VDGG
Sbjct  241  SYVTGQIIYVDGG  253



>gb|KHG18781.1| Tropinone reductase [Gossypium arboreum]
Length=322

 Score =   262 bits (670),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 141/261 (54%), Positives = 183/261 (70%), Gaps = 5/261 (2%)
 Frame = -1

Query  928  NIMAGRWSLHGMTALVTGGTRGLGHAIVEELACLGATVYTCSRTEKELEECIQNWKAKGY  749
            NI + RWSL GMTALVTGGTRG+G AIVEEL  LGA V+TCSR E EL++ + +WK+ G+
Sbjct  60   NIKSNRWSLQGMTALVTGGTRGIGRAIVEELGGLGARVHTCSRNENELDKALVDWKSLGF  119

Query  748  KVFGSVCDILQPSQRENLIQLVSKQFDGKLTILVNNVAILIPKETLKSDGQDFSNTIGTN  569
            +V GS+CD+   +QR++L++ VS  FD KL IL+NNV   I K  +    ++ S  + TN
Sbjct  120  EVSGSICDVSIAAQRQSLMETVSSLFDCKLNILINNVGTNIRKPMVDFTVEEVSTLLATN  179

Query  568  LEASLNLCQLAHPLLKATGNGsivfisscssfVYAPFHTIYASTKGAINSLVKNLACEWA  389
             E+  NLCQLA+PLLK +G+GS+VF SS S FV     ++  +TKGAIN L +NLACEWA
Sbjct  180  FESVFNLCQLAYPLLKTSGSGSVVFTSSVSGFVSLKSMSLQGATKGAINQLTRNLACEWA  239

Query  388  NDNIRVNAVAPWLMRTSLTES--SRGEFGAVIEALIRRTLQHRLVEPKEASAAVAFLCFP  215
             DNIR NAVAPW +RTS+ E   S  E+   +E +  RT   RL +P E S+ VAFLC P
Sbjct  240  KDNIRSNAVAPWYIRTSMVEQVLSNKEY---LEEVYSRTPLGRLGDPTEVSSLVAFLCLP  296

Query  214  AASFVTGQIISVDGGGSIYGL  152
            A+S++TGQII VDGG S+ G 
Sbjct  297  ASSYITGQIICVDGGMSVNGF  317



>ref|XP_010452516.1| PREDICTED: tropinone reductase homolog At1g07440-like isoform 
X1 [Camelina sativa]
Length=261

 Score =   260 bits (665),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 138/254 (54%), Positives = 183/254 (72%), Gaps = 2/254 (1%)
 Frame = -1

Query  913  RWSLHGMTALVTGGTRGLGHAIVEELACLGATVYTCSRTEKELEECIQNWKAKGYKVFGS  734
            RWSL G TAL+TGGTRG+G A+VEELA  GA V+TCSR + EL  C+ +WK+ G+ V GS
Sbjct  6    RWSLAGKTALLTGGTRGIGRAVVEELAKFGAKVHTCSRNQDELNACLDDWKSHGFVVSGS  65

Query  733  VCDILQPSQRENLIQLVSKQFDGKLTILVNNVAILIPKETLKSDGQDFSNTIGTNLEASL  554
            VCD     QR+ LIQ VS  F GKL IL+NNV   I K T++   +++++ + TNLE++ 
Sbjct  66   VCDASVKDQRDKLIQDVSSAFSGKLNILINNVGFNIRKPTVEYSSEEYASIMSTNLESAF  125

Query  553  NLCQLAHPLLKATGNGsivfisscssfVYAPFHTIYASTKGAINSLVKNLACEWANDNIR  374
            +  Q+AHPLLKA+G G+IVFISS S  V     ++YA+TKGA+N L +NLACEWA+DNIR
Sbjct  126  HFSQIAHPLLKASGVGNIVFISSVSGLVSCG-GSVYAATKGALNQLTRNLACEWASDNIR  184

Query  373  VNAVAPWLMRTSLTESSRGEFGAVIEALIRRTLQHRLVEPKEASAAVAFLCFPAASFVTG  194
             N VAPW ++TSL ES   E    +EA++ RT   R+ EP+E ++ VAFLC PAAS++TG
Sbjct  185  TNCVAPWYIKTSLVESLL-EKQDYLEAVVSRTPLGRVGEPEEVASLVAFLCLPAASYITG  243

Query  193  QIISVDGGGSIYGL  152
            Q+ISVDGG ++ G 
Sbjct  244  QVISVDGGFTVNGF  257



>gb|KHN40273.1| Tropinone reductase like [Glycine soja]
Length=266

 Score =   260 bits (665),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 137/265 (52%), Positives = 180/265 (68%), Gaps = 3/265 (1%)
 Frame = -1

Query  946  AKYQQHNIMAGRWSLHGMTALVTGGTRGLGHAIVEELACLGATVYTCSRTEKELEECIQN  767
            AK +   I   RWSLHGMTALVTG TRG+GHAI EELA  GA V+ C+R +++++ C++ 
Sbjct  2    AKTKLSCIKDERWSLHGMTALVTGATRGIGHAIAEELAEFGAVVHICARKQQDIDRCLEE  61

Query  766  WKAKGYKVFGSVCDILQPSQRENLIQLVSKQFDGKLTILVNNVAILIPKETLKSDGQDFS  587
            W  K +++ GS CD+L   QRENL++ V+  F GKL IL+NN     PK  +    +D +
Sbjct  62   WSKKEFRITGSACDVLYRDQRENLMKNVASIFHGKLNILINNTGTNTPKNLIDYTAEDVT  121

Query  586  NTIGTNLEASLNLCQLAHPLLKATGNGsivfisscssfVYAPFHTIYASTKGAINSLVKN  407
              +GTN E+S +LCQLAHPLLKA+G GSIVFISS +     P  +IY  +KGA+N L KN
Sbjct  122  TIMGTNFESSYHLCQLAHPLLKASGYGSIVFISSIAGLKALPLCSIYGPSKGAMNQLTKN  181

Query  406  LACEWANDNIRVNAVAPWLMRTSLTES---SRGEFGAVIEALIRRTLQHRLVEPKEASAA  236
            +A EWA DNIR N VAP  ++T L +S   S  E    IEA++ +    RL +P++ SA 
Sbjct  182  IALEWAKDNIRANTVAPGPVKTLLLDSFVKSGNEADKAIEAIVSQAPVGRLGDPEDISAM  241

Query  235  VAFLCFPAASFVTGQIISVDGGGSI  161
            VAFLC PAASF+TGQII+VDGG +I
Sbjct  242  VAFLCLPAASFITGQIINVDGGCTI  266



>ref|XP_011010114.1| PREDICTED: tropinone reductase homolog At1g07440-like [Populus 
euphratica]
Length=265

 Score =   260 bits (665),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 136/262 (52%), Positives = 181/262 (69%), Gaps = 4/262 (2%)
 Frame = -1

Query  931  HNIMAGRWSLHGMTALVTGGTRGLGHAIVEELACLGATVYTCSRTEKELEECIQNWKAKG  752
            H  +  RWSL G TALVTGGT+G+G+A+VEELA LGA V+TC+R++ +++ C++ WK +G
Sbjct  3    HPEITNRWSLQGTTALVTGGTKGIGYAVVEELAALGACVHTCARSQGQIDACLRQWKERG  62

Query  751  YKVFGSVCDILQPSQRENLIQLVSKQFDGKLTILVNNVAILIPKETLKSDGQDFSNTIGT  572
             KV GSVCD+   + RENLI+ VS  F GKL IL+NN    + K TL+   +DFS  + T
Sbjct  63   LKVSGSVCDVSSQADRENLIKEVSSLFGGKLNILINNAGTNVYKPTLEYTAEDFSFMMNT  122

Query  571  NLEASLNLCQLAHPLLKATGNGsivfisscssfVYAPF-HTIYASTKGAINSLVKNLACE  395
            NL+++ +L QLAHPLLKA+G G IVF+SS          + IY+++KGAIN L +NLACE
Sbjct  123  NLQSAFHLSQLAHPLLKASGAGRIVFVSSICGVTSVNIGYPIYSASKGAINQLTRNLACE  182

Query  394  WANDNIRVNAVAPWLMRTSLTESS-RGEFGAVIEALIRRTLQHRLVEPKEASAAVAFLCF  218
            WA DNIRVN+VAPW + T + E S + E  +V++ L  RT   R  EP E S+ VAFLC 
Sbjct  183  WAKDNIRVNSVAPWFINTPMNEDSLKNE--SVVKELGYRTPMGRAGEPGEVSSVVAFLCL  240

Query  217  PAASFVTGQIISVDGGGSIYGL  152
            P  SF TGQ+I +DGG S+ G 
Sbjct  241  PGPSFTTGQVICIDGGMSVNGF  262



>ref|XP_006846356.1| hypothetical protein AMTR_s00012p00261070 [Amborella trichopoda]
 gb|ERN08031.1| hypothetical protein AMTR_s00012p00261070 [Amborella trichopoda]
Length=273

 Score =   260 bits (665),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 129/253 (51%), Positives = 174/253 (69%), Gaps = 2/253 (1%)
 Frame = -1

Query  913  RWSLHGMTALVTGGTRGLGHAIVEELACLGATVYTCSRTEKELEECIQNWKAKGYKVFGS  734
            RWSL+GMTALVTGGT+G+GHAI+EELA LGA+VYTC+R E +L +C+  WK  G  V GS
Sbjct  20   RWSLNGMTALVTGGTKGIGHAIIEELAGLGASVYTCARNEDDLNKCLNQWKGMGLDVHGS  79

Query  733  VCDILQPSQRENLIQLVSKQFDGKLTILVNNVAILIPKETLKSDGQDFSNTIGTNLEASL  554
            VCD+   S R  LI+ VS  F GKL ILVNNV   I K T++   +DFS  + TN E++ 
Sbjct  80   VCDLSSRSDRHKLIEAVSSHFKGKLNILVNNVGTAIGKSTVEFTAEDFSFMMMTNFESAY  139

Query  553  NLCQLAHPLLKATGNGsivfisscssfVYAPFHTIYASTKGAINSLVKNLACEWANDNIR  374
            ++CQL+HPLLKA+G G  +  +S  + V     ++Y +TK A+N + KNLACEWAND IR
Sbjct  140  HMCQLSHPLLKASGAG-SIVFNSSVTGVVGTHCSLYGATKAAMNQITKNLACEWANDKIR  198

Query  373  VNAVAPWLMRTSLTESSRGEFGAVIEALIRRTLQHRLVEPKEASAAVAFLCFPAASFVTG  194
             N+VAPW ++T   +    E    +  ++ RT   R+ +P+E S+ VAFLC PAAS++TG
Sbjct  199  TNSVAPWFIKTPFVKDVL-ENKEWLAGIVARTPMRRVGDPEEVSSLVAFLCMPAASYITG  257

Query  193  QIISVDGGGSIYG  155
            Q+I VDGG ++ G
Sbjct  258  QVICVDGGMTVNG  270



>emb|CDY09824.1| BnaC09g43370D [Brassica napus]
 emb|CDX97893.1| BnaC04g40460D [Brassica napus]
Length=271

 Score =   260 bits (665),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 138/256 (54%), Positives = 179/256 (70%), Gaps = 5/256 (2%)
 Frame = -1

Query  913  RWSLHGMTALVTGGTRGLGHAIVEELACLGATVYTCSRTEKELEECIQNWKAKGYKVFGS  734
            RWSL GMTALVTGG++GLG A+VEELA LGA V+TC+R E +L+EC+  W+AKG++V  S
Sbjct  13   RWSLGGMTALVTGGSKGLGEAVVEELAMLGARVHTCARDETQLQECLLEWQAKGFQVTTS  72

Query  733  VCDILQPSQRENLIQLVSKQFDGKLTILVNNVAILIPKETLKSDGQDFSNTIGTNLEASL  554
            VCD+    QRE L++ VS  F GKL ILVNN    I K T +   +DFS  + TNLE++ 
Sbjct  73   VCDVSSRVQREKLMETVSTLFQGKLNILVNNAGTCITKPTTEFSAEDFSFLMATNLESAF  132

Query  553  NLCQLAHPLLKATGNGsivfisscssfVYAPFHTIYASTKGAINSLVKNLACEWANDNIR  374
            +L QLAHP LKA+G+GSIVF+SS +  V+    +IY +TKGA+N L +NLACEWA+D+IR
Sbjct  133  HLSQLAHPFLKASGSGSIVFMSSAAGVVHVNVGSIYGATKGAMNQLARNLACEWASDSIR  192

Query  373  VNAVAPWLMRTSLTES--SRGEFGAVIEALIRRTLQHRLVEPKEASAAVAFLCFPAASFV  200
            VN+V PW + T L        E    +E    +T   R+ E  E S+ VAFLCFPAAS++
Sbjct  193  VNSVCPWFIATPLANKFMDHEELKKEVET---KTPMGRVGEANEVSSLVAFLCFPAASYI  249

Query  199  TGQIISVDGGGSIYGL  152
            TGQ+I VDGG +I GL
Sbjct  250  TGQVICVDGGATINGL  265



>ref|XP_010557240.1| PREDICTED: tropinone reductase homolog At1g07440 [Tarenaya hassleriana]
Length=319

 Score =   262 bits (669),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 139/254 (55%), Positives = 179/254 (70%), Gaps = 1/254 (0%)
 Frame = -1

Query  913  RWSLHGMTALVTGGTRGLGHAIVEELACLGATVYTCSRTEKELEECIQNWKAKGYKVFGS  734
            RWSLHGM+ALVTGGTRG+G A+VEELA  GA V+TC+R E ELE C+++    G++V GS
Sbjct  63   RWSLHGMSALVTGGTRGIGRAVVEELAGFGAEVHTCARNESELENCLRDLNGSGFRVTGS  122

Query  733  VCDILQPSQRENLIQLVSKQFDGKLTILVNNVAILIPKETLKSDGQDFSNTIGTNLEASL  554
            VCD+    QR  L++ VS  FDGKL ILVNNV   I K  ++    +FS  + TN E+  
Sbjct  123  VCDVSDRDQRVMLMEAVSSVFDGKLNILVNNVGTNIRKPMVEFTAGEFSTLLSTNFESVF  182

Query  553  NLCQLAHPLLKATGNGsivfisscssfVYAPFHTIYASTKGAINSLVKNLACEWANDNIR  374
            +LCQL++PLL+A+G GS+VFISS S FV     ++ ++TKGAIN L +NLACEWA DNIR
Sbjct  183  HLCQLSYPLLRASGAGSVVFISSISGFVSLKNMSVQSATKGAINQLTRNLACEWAKDNIR  242

Query  373  VNAVAPWLMRTSLTESSRGEFGAVIEALIRRTLQHRLVEPKEASAAVAFLCFPAASFVTG  194
             NAVAPW +RTS+ E         +E +  RT   RL EP+E ++AVAFLC PA+SF+TG
Sbjct  243  SNAVAPWYIRTSMVEQILIN-EDYLEEVYSRTPLRRLGEPREVASAVAFLCLPASSFITG  301

Query  193  QIISVDGGGSIYGL  152
            Q+I +DGG SI G 
Sbjct  302  QVIGIDGGMSINGF  315



>emb|CDP11659.1| unnamed protein product [Coffea canephora]
Length=264

 Score =   260 bits (664),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 140/255 (55%), Positives = 171/255 (67%), Gaps = 2/255 (1%)
 Frame = -1

Query  922  MAGRWSLHGMTALVTGGTRGLGHAIVEELACLGATVYTCSRTEKELEECIQNWKAKGYKV  743
            ++GRWSL+GMTALVTGGTRG+GH+IVEELA  GA VYTCSR +KEL E +Q W AKGYKV
Sbjct  6    LSGRWSLNGMTALVTGGTRGIGHSIVEELAGFGAIVYTCSRNQKELNERLQEWGAKGYKV  65

Query  742  FGSVCDILQPSQRENLIQLVSKQFDGKLTILVNNVAILIPKETLKSDGQDFSNTIGTNLE  563
            +GS CD+    +R  L++ VS  FDGKL ILVNN A +I +       +DFS  +GTNLE
Sbjct  66   YGSTCDLASRPERVELMKNVSSTFDGKLNILVNNAAAIILRRATDLSAEDFSRVLGTNLE  125

Query  562  ASLNLCQLAHPLLKATGNGsivfisscssfVYAPFHTIYASTKGAINSLVKNLACEWAND  383
               +LCQLA+PLLK +   SIVFISS +     P  +IY S+KGAIN L K+LACEWA D
Sbjct  126  GPYHLCQLAYPLLKVSEARSIVFISSVAGGTALPGTSIYGSSKGAINQLTKSLACEWAKD  185

Query  382  NIRVNAVAPWLMRTSLT--ESSRGEFGAVIEALIRRTLQHRLVEPKEASAAVAFLCFPAA  209
             IRVN VAP  ++T+    E         +  ++ RT    L EP E S  VAFL  P A
Sbjct  186  KIRVNTVAPHGVKTTRPKLEDYDESIALQMRPIMSRTPLRPLAEPNEVSPLVAFLSLPVA  245

Query  208  SFVTGQIISVDGGGS  164
            SF+TGQ+I VDGG S
Sbjct  246  SFITGQVIQVDGGYS  260



>ref|XP_007016316.1| NAD(P)-binding Rossmann-fold superfamily protein isoform 3 [Theobroma 
cacao]
 gb|EOY33935.1| NAD(P)-binding Rossmann-fold superfamily protein isoform 3 [Theobroma 
cacao]
Length=273

 Score =   260 bits (665),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 141/256 (55%), Positives = 178/256 (70%), Gaps = 3/256 (1%)
 Frame = -1

Query  913  RWSLHGMTALVTGGTRGLG--HAIVEELACLGATVYTCSRTEKELEECIQNWKAKGYKVF  740
            RWSLHGMTALVTGGT+G+G  HAIVEELA LGA ++TCSRTE EL +C+  W+AKG++V 
Sbjct  12   RWSLHGMTALVTGGTKGIGIRHAIVEELAGLGARIHTCSRTETELNKCLLEWQAKGFQVT  71

Query  739  GSVCDILQPSQRENLIQLVSKQFDGKLTILVNNVAILIPKETLKSDGQDFSNTIGTNLEA  560
            GS CD+   +QRE LI   S  F+GKL IL+NNV  +  K   +   ++ S  +GTN E+
Sbjct  72   GSACDVSSKAQREKLINTASSVFNGKLDILINNVGTVFAKPISEETAEEVSFLMGTNFES  131

Query  559  SLNLCQLAHPLLKATGNGsivfisscssfVYAPFHTIYASTKGAINSLVKNLACEWANDN  380
            + NL  LAHPLLKA+G GS+V +SS +  +       Y +TKGA+N L K LACEWA DN
Sbjct  132  AHNLSLLAHPLLKASGAGSVVLLSSIAGLIPLRTAPTYGATKGAMNQLAKYLACEWAGDN  191

Query  379  IRVNAVAPWLMRTSLTESSRGEFGAVIEALIRRTLQHRLVEPKEASAAVAFLCFPAASFV  200
            IRVNAVAP ++RT L E    +  A +EA I +    R  EPKE S+ VAFLC PAAS++
Sbjct  192  IRVNAVAPSVIRTPLVEPFFHDEKA-LEAFITKIPMGRTGEPKEVSSLVAFLCLPAASYI  250

Query  199  TGQIISVDGGGSIYGL  152
            TGQII VDGG ++ GL
Sbjct  251  TGQIIYVDGGITLNGL  266



>ref|XP_002282638.2| PREDICTED: tropinone reductase homolog At1g07440 [Vitis vinifera]
Length=335

 Score =   262 bits (670),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 141/254 (56%), Positives = 175/254 (69%), Gaps = 1/254 (0%)
 Frame = -1

Query  913  RWSLHGMTALVTGGTRGLGHAIVEELACLGATVYTCSRTEKELEECIQNWKAKGYKVFGS  734
            RWSL GMTALVTGGTRG+GHAIVEEL  LGATV+TCSR E EL+ C++ W   G++V G 
Sbjct  78   RWSLRGMTALVTGGTRGIGHAIVEELLGLGATVHTCSRNEAELDGCLKGWTGMGFRVTGC  137

Query  733  VCDILQPSQRENLIQLVSKQFDGKLTILVNNVAILIPKETLKSDGQDFSNTIGTNLEASL  554
            VCD+    +RE L+  V   FDGKL IL+NNV   I K  +    +DFS  + TN E+  
Sbjct  138  VCDVSSRVERERLMDNVCDVFDGKLNILINNVGTNIRKPVVDFTEEDFSTLMATNFESVF  197

Query  553  NLCQLAHPLLKATGNGsivfisscssfVYAPFHTIYASTKGAINSLVKNLACEWANDNIR  374
            +  QLA+PLLK +G+GSIVF+SS S FV     ++  +TKGAIN L KNLACEWA DNIR
Sbjct  198  HTSQLAYPLLKTSGSGSIVFVSSVSGFVSLKSMSVQGATKGAINQLTKNLACEWAKDNIR  257

Query  373  VNAVAPWLMRTSLTESSRGEFGAVIEALIRRTLQHRLVEPKEASAAVAFLCFPAASFVTG  194
             NAVAPW +RTS+ E   G     +E +  RT   RL +P+E S+ VAFLC PA+S++TG
Sbjct  258  SNAVAPWYIRTSMVEKVLGN-KEYLEEVFARTPLRRLGDPEEVSSLVAFLCLPASSYITG  316

Query  193  QIISVDGGGSIYGL  152
            QII VDGG S+ G 
Sbjct  317  QIICVDGGMSVNGF  330



>ref|XP_010040250.1| PREDICTED: tropinone reductase homolog At1g07440-like [Eucalyptus 
grandis]
 gb|KCW45357.1| hypothetical protein EUGRSUZ_L00973 [Eucalyptus grandis]
Length=289

 Score =   261 bits (666),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 146/259 (56%), Positives = 179/259 (69%), Gaps = 8/259 (3%)
 Frame = -1

Query  913  RWSLHGMTALVTGGTRGLGHAIVEELACLGATVYTCSRTEKELEECIQNWKAKGYKVFGS  734
            RWSL GMTALVTGG++G+G AIVEELA LGATVYTCSRTE EL EC++ WK KG++V GS
Sbjct  22   RWSLQGMTALVTGGSKGIGRAIVEELAGLGATVYTCSRTEAELNECLKEWKRKGFQVAGS  81

Query  733  VCDILQPSQRENLIQLVSKQFDGKLTILVNNVAIL-----IPKETLKSDGQDFSNTIGTN  569
             CD+   S+RE L+   S  FDGKL IL+NNV  L     +P  T+    +DFS  + TN
Sbjct  82   ACDVSSRSEREKLMLAASSLFDGKLNILINNVGTLGTTGGMP--TVDYTAEDFSFIMTTN  139

Query  568  LEASLNLCQLAHPLLKATGNGsivfisscssfVYAPFHTIYASTKGAINSLVKNLACEWA  389
             E++ +L QLAHPLLKA+G GSIVF+SS    V     +IY++TKGA+N L KNLACEWA
Sbjct  140  FESAYHLSQLAHPLLKASGTGSIVFLSSVCGIVSLGLGSIYSATKGAMNQLTKNLACEWA  199

Query  388  NDNIRVNAVAPWLMRTSLTESSRGEFGAVIEALIRRTLQHRLVEPKEASAAVAFLCFPAA  209
             DNIR N+VAP+ + T LTE          EA+ R  L  R  EPKE S+ VAFLC PAA
Sbjct  200  KDNIRSNSVAPYFILTPLTEPLLCSEEYHKEAIARAPLG-RTGEPKEVSSLVAFLCLPAA  258

Query  208  SFVTGQIISVDGGGSIYGL  152
            S++TGQ I VDGG ++ G 
Sbjct  259  SYITGQTICVDGGFTVNGF  277



>ref|XP_006429152.1| hypothetical protein CICLE_v10012433mg [Citrus clementina]
 ref|XP_006493557.1| PREDICTED: tropinone reductase homolog [Citrus sinensis]
 ref|XP_006493558.1| PREDICTED: tropinone reductase homolog [Citrus sinensis]
 gb|ESR42392.1| hypothetical protein CICLE_v10012433mg [Citrus clementina]
Length=276

 Score =   260 bits (665),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 139/253 (55%), Positives = 174/253 (69%), Gaps = 2/253 (1%)
 Frame = -1

Query  913  RWSLHGMTALVTGGTRGLGHAIVEELACLGATVYTCSRTEKELEECIQNWKAKGYKVFGS  734
            RWSL+GMTALVTGGTRG+GHA VEELA  GA V+TCSR + EL+  +  WK KG+KV GS
Sbjct  12   RWSLNGMTALVTGGTRGIGHATVEELARFGAIVHTCSRNQIELDARLHEWKNKGFKVTGS  71

Query  733  VCDILQPSQRENLIQLVSKQFDGKLTILVNNVAILIPKETLKSDGQDFSNTIGTNLEASL  554
            VCD+    QRE LI+ V+  F GKL IL+NN AI   K T+    +D S    TN E+  
Sbjct  72   VCDLSSREQREKLIETVTSIFQGKLNILINNAAIAFVKPTVDITAEDMSTVSSTNFESVF  131

Query  553  NLCQLAHPLLKATGNGsivfisscssfVYAPFHTIYASTKGAINSLVKNLACEWANDNIR  374
            +L QLAHPL KA+GNGSIVFISS       P  ++Y + KGA+N L KNLACEWA DNIR
Sbjct  132  HLSQLAHPLFKASGNGSIVFISSVGGVRGIPSVSLYGAYKGAMNQLTKNLACEWAKDNIR  191

Query  373  VNAVAPWLMRTSLTES-SRGEFGA-VIEALIRRTLQHRLVEPKEASAAVAFLCFPAASFV  200
             N VAPW+++TS+ +    G  G+  ++ + R+T   R  EP E S+ VAFLC PAAS++
Sbjct  192  TNTVAPWVIKTSMIKPFEEGPEGSEFLDGIARQTPIGRAGEPDEVSSLVAFLCLPAASYI  251

Query  199  TGQIISVDGGGSI  161
            TGQII VDGG ++
Sbjct  252  TGQIICVDGGVTV  264



>ref|XP_008349700.1| PREDICTED: uncharacterized protein LOC103412975 [Malus domestica]
Length=701

 Score =   273 bits (697),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 146/280 (52%), Positives = 195/280 (70%), Gaps = 3/280 (1%)
 Frame = -1

Query  988  FADHQSSKSKLAKNAKYQQHNIMAGRWSLHGMTALVTGGTRGLGHAIVEELACLGATVYT  809
             A+H+  +    +N +  + N  A RWSL GMTALVTGGT+G+G+AIVEELA LGA V+T
Sbjct  419  MANHKYLQRADRENREQIEMNSRARRWSLRGMTALVTGGTKGIGYAIVEELAGLGAIVHT  478

Query  808  CSRTEKELEECIQNWKAKGYKVFGSVCDILQPSQRENLIQLVSKQFDGKLTILVNNVAIL  629
            CSR E +L +C+  W+ KG++V GSVCD++  +QRE LI  VS  F+GKL IL+NNV   
Sbjct  479  CSRNEADLNDCLSQWEKKGFQVTGSVCDVVSKTQREELINKVSSLFEGKLNILINNVGTS  538

Query  628  IPKETLKSDGQDFSNTIGTNLEASLNLCQLAHPLLKATGNGsivfisscssfVYAPFHTI  449
            I K TL+   +D+S  + TNLE+  +LCQL+HPLLKA+G  +I+F+SS +  V     +I
Sbjct  539  ILKATLEYTAEDYSFVMSTNLESVYHLCQLSHPLLKASGAANIIFLSSTAGVVSIDVGSI  598

Query  448  YASTKGAINSLVKNLACEWANDNIRVNAVAPWLMRTSLTESS-RGEFGAVIEALIRRTLQ  272
            Y++TKGA+N L KNLACEWA DNIR N+VAPW ++T LT+   R E    +E +  R   
Sbjct  599  YSATKGALNQLAKNLACEWARDNIRTNSVAPWFIKTPLTDPILRNE--KKLEMINSRCPL  656

Query  271  HRLVEPKEASAAVAFLCFPAASFVTGQIISVDGGGSIYGL  152
             R  EP+E S+ VAFLC PAAS++TGQ I VDGG ++ GL
Sbjct  657  GRPGEPEEVSSLVAFLCLPAASYITGQTIIVDGGVTVNGL  696



>ref|XP_010510523.1| PREDICTED: tropinone reductase homolog At1g07440-like isoform 
X1 [Camelina sativa]
Length=272

 Score =   260 bits (664),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 139/254 (55%), Positives = 179/254 (70%), Gaps = 1/254 (0%)
 Frame = -1

Query  913  RWSLHGMTALVTGGTRGLGHAIVEELACLGATVYTCSRTEKELEECIQNWKAKGYKVFGS  734
            RWSL GMTALVTGG++GLG A+VEELA LGA V+TC+R E +L+E ++ W AKG++V  S
Sbjct  14   RWSLGGMTALVTGGSKGLGEAVVEELAMLGARVHTCARDETQLQERLREWHAKGFQVSIS  73

Query  733  VCDILQPSQRENLIQLVSKQFDGKLTILVNNVAILIPKETLKSDGQDFSNTIGTNLEASL  554
            VCD+    QRE L++ VS  F GKL ILVNN    I K T +   QD+S  + TNLE++ 
Sbjct  74   VCDVSYREQREKLMETVSSLFQGKLNILVNNAGTCIAKPTTEYTSQDYSFLMATNLESAF  133

Query  553  NLCQLAHPLLKATGNGsivfisscssfVYAPFHTIYASTKGAINSLVKNLACEWANDNIR  374
            +L QLAHPLLKA+G+GSIV +SS S  VY    +IYA+TKGA+N L +NLACEWANDNIR
Sbjct  134  HLSQLAHPLLKASGSGSIVLMSSASGVVYVNISSIYAATKGAMNQLGRNLACEWANDNIR  193

Query  373  VNAVAPWLMRTSLTESSRGEFGAVIEALIRRTLQHRLVEPKEASAAVAFLCFPAASFVTG  194
            VN+V PW + T L +    +     E + ++T   R  +P E S+ VAFLCFPAAS++TG
Sbjct  194  VNSVCPWFIETPLAKDYL-DVEEYKEEVEKKTPMGRAGKPNEVSSLVAFLCFPAASYITG  252

Query  193  QIISVDGGGSIYGL  152
            Q I VDGG ++ G 
Sbjct  253  QTICVDGGATVNGF  266



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 2205876588188