BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c25565_g9_i1 len=1258 path=[47229:0-580 47810:581-601 47831:602-718
47948:719-763 46937:764-804 50451:805-882 50529:883-896
50543:897-920 50567:921-934 50581:935-975 50621:976-1153
22442:1154-1257]

Length=1258
                                                                      Score     E

emb|CAD62568.1|  putative tropinone reductase                           381   1e-127   Calystegia sepium
ref|XP_006355361.1|  PREDICTED: tropinone reductase homolog             302   1e-96    
ref|XP_009621668.1|  PREDICTED: tropinone reductase homolog             301   3e-96    
ref|XP_004237405.1|  PREDICTED: tropinone reductase homolog             300   6e-96    
ref|XP_009794560.1|  PREDICTED: tropinone reductase homolog             300   1e-95    
ref|XP_010920509.1|  PREDICTED: tropinone reductase homolog             291   4e-92    
ref|XP_008801625.1|  PREDICTED: tropinone reductase homolog At1g0...    290   6e-91    
ref|XP_009772417.1|  PREDICTED: tropinone reductase homolog             286   2e-90    
sp|P50165.1|TRNH_DATST  RecName: Full=Tropinone reductase homolog...    285   6e-90    Datura stramonium [common thornapple]
ref|XP_006341201.1|  PREDICTED: tropinone reductase homolog             285   7e-90    
ref|XP_009630417.1|  PREDICTED: tropinone reductase 1-like              283   3e-89    
ref|XP_002299847.1|  tropinone reductase family protein                 281   3e-88    Populus trichocarpa [western balsam poplar]
ref|XP_009375951.1|  PREDICTED: tropinone reductase homolog At1g0...    280   3e-88    
ref|XP_010654243.1|  PREDICTED: tropinone reductase homolog             280   7e-88    
ref|XP_011006388.1|  PREDICTED: tropinone reductase homolog             280   8e-88    
ref|XP_006493561.1|  PREDICTED: tropinone reductase homolog             279   1e-87    
ref|XP_010650985.1|  PREDICTED: tropinone reductase homolog At1g0...    279   1e-87    
ref|XP_006429154.1|  hypothetical protein CICLE_v10012494mg             279   1e-87    
emb|CBI30508.3|  unnamed protein product                                279   1e-87    
ref|XP_006493560.1|  PREDICTED: tropinone reductase homolog             278   2e-87    
ref|XP_011035255.1|  PREDICTED: tropinone reductase homolog At1g0...    278   2e-87    
emb|CBI30506.3|  unnamed protein product                                277   6e-87    
ref|XP_006429155.1|  hypothetical protein CICLE_v10012221mg             279   9e-87    
ref|XP_002271837.2|  PREDICTED: tropinone reductase homolog             277   1e-86    Vitis vinifera
ref|XP_006493569.1|  PREDICTED: tropinone reductase homolog isofo...    276   2e-86    
ref|XP_008223763.1|  PREDICTED: tropinone reductase homolog At1g0...    276   2e-86    
ref|XP_007016318.1|  Senescence-associated gene 13 isoform 1            276   3e-86    
gb|KEH34737.1|  NAD(P)-binding rossmann-fold protein                    275   4e-86    
ref|XP_004246864.1|  PREDICTED: tropinone reductase homolog             275   4e-86    
ref|XP_010256814.1|  PREDICTED: tropinone reductase homolog At1g0...    275   4e-86    
ref|XP_006846355.1|  hypothetical protein AMTR_s00012p00260970          275   5e-86    
ref|XP_010650989.1|  PREDICTED: tropinone reductase homolog At1g0...    275   6e-86    
ref|XP_003632186.1|  PREDICTED: tropinone reductase homolog At1g0...    275   8e-86    
ref|XP_006424908.1|  hypothetical protein CICLE_v10029047mg             274   1e-85    
ref|XP_003558258.1|  PREDICTED: tropinone reductase homolog At1g0...    274   1e-85    
emb|CAN63543.1|  hypothetical protein VITISV_035429                     273   2e-85    Vitis vinifera
ref|XP_010650983.1|  PREDICTED: tropinone reductase homolog At1g0...    273   2e-85    
emb|CBI16073.3|  unnamed protein product                                273   3e-85    
emb|CAN69507.1|  hypothetical protein VITISV_016037                     273   3e-85    Vitis vinifera
ref|XP_010650991.1|  PREDICTED: tropinone reductase homolog At1g0...    273   3e-85    
ref|XP_010650984.1|  PREDICTED: tropinone reductase homolog At1g0...    273   4e-85    
ref|XP_010650992.1|  PREDICTED: tropinone reductase homolog At1g0...    273   4e-85    
ref|XP_004246428.1|  PREDICTED: tropinone reductase homolog isofo...    273   4e-85    
ref|XP_006493568.1|  PREDICTED: tropinone reductase homolog isofo...    272   5e-85    
ref|XP_010654244.1|  PREDICTED: tropinone reductase homolog             272   6e-85    
ref|XP_006429157.1|  hypothetical protein CICLE_v10012496mg             272   6e-85    
ref|XP_010033096.1|  PREDICTED: tropinone reductase homolog At1g0...    272   6e-85    
ref|XP_006493570.1|  PREDICTED: tropinone reductase homolog             272   7e-85    
ref|XP_006493567.1|  PREDICTED: tropinone reductase homolog             271   9e-85    
ref|XP_008221978.1|  PREDICTED: tropinone reductase homolog At1g0...    271   1e-84    
gb|AFD23289.1|  tropinone reductase II                                  271   1e-84    
ref|XP_007205726.1|  hypothetical protein PRUPE_ppa010064mg             271   1e-84    
ref|XP_006838385.1|  hypothetical protein AMTR_s00002p00066940          271   1e-84    
ref|XP_004503172.1|  PREDICTED: tropinone reductase homolog At1g0...    271   1e-84    
ref|XP_010033094.1|  PREDICTED: tropinone reductase homolog At1g0...    271   1e-84    
ref|XP_007205718.1|  hypothetical protein PRUPE_ppa009959mg             271   1e-84    
ref|XP_006341200.1|  PREDICTED: tropinone reductase homolog             271   1e-84    
ref|XP_009364346.1|  PREDICTED: tropinone reductase homolog At1g0...    271   2e-84    
ref|XP_009603003.1|  PREDICTED: tropinone reductase homolog isofo...    271   2e-84    
ref|XP_008356736.1|  PREDICTED: tropinone reductase homolog At1g0...    271   2e-84    
ref|XP_008356743.1|  PREDICTED: tropinone reductase homolog At1g0...    270   3e-84    
ref|XP_002308174.2|  hypothetical protein POPTR_0006s09080g             270   3e-84    Populus trichocarpa [western balsam poplar]
gb|KFK24998.1|  hypothetical protein AALP_AA8G053200                    270   4e-84    
gb|KDO69163.1|  hypothetical protein CISIN_1g024125mg                   270   4e-84    
gb|EYU19938.1|  hypothetical protein MIMGU_mgv1a012090mg                270   4e-84    
ref|XP_007140482.1|  hypothetical protein PHAVU_008G116300g             270   4e-84    
gb|AFK38962.1|  unknown                                                 270   5e-84    
ref|XP_006290197.1|  hypothetical protein CARUB_v10003882mg             269   6e-84    
ref|XP_004235263.1|  PREDICTED: tropinone reductase homolog             270   7e-84    
ref|XP_006429160.1|  hypothetical protein CICLE_v10012493mg             269   7e-84    
emb|CDX86486.1|  BnaC08g02170D                                          269   7e-84    
ref|XP_008222026.1|  PREDICTED: tropinone reductase homolog At1g0...    269   7e-84    
ref|XP_007163456.1|  hypothetical protein PHAVU_001G235700g             269   9e-84    
ref|XP_006424907.1|  hypothetical protein CICLE_v10029040mg             269   9e-84    
ref|XP_010452515.1|  PREDICTED: tropinone reductase homolog At1g0...    269   9e-84    
gb|KDO52384.1|  hypothetical protein CISIN_1g024752mg                   269   1e-83    
ref|XP_006435623.1|  hypothetical protein CICLE_v10032389mg             269   1e-83    
gb|ABK94587.1|  unknown                                                 269   1e-83    Populus trichocarpa [western balsam poplar]
ref|XP_002532998.1|  tropinone reductase, putative                      269   1e-83    Ricinus communis
ref|XP_010033099.1|  PREDICTED: tropinone reductase homolog At1g0...    269   1e-83    
ref|XP_006341006.1|  PREDICTED: tropinone reductase 1-like              269   1e-83    
ref|XP_010685684.1|  PREDICTED: tropinone reductase homolog At1g0...    268   1e-83    
ref|XP_010542632.1|  PREDICTED: tropinone reductase homolog At1g0...    268   1e-83    
ref|XP_007016329.1|  NAD(P)-binding Rossmann-fold superfamily pro...    270   2e-83    
ref|XP_009421329.1|  PREDICTED: tropinone reductase homolog             268   2e-83    
ref|XP_002520507.1|  tropinone reductase, putative                      268   2e-83    Ricinus communis
ref|XP_006488386.1|  PREDICTED: tropinone reductase homolog At1g0...    268   2e-83    
ref|XP_006488387.1|  PREDICTED: tropinone reductase homolog At1g0...    268   3e-83    
ref|XP_002319562.1|  hypothetical protein POPTR_0013s02690g             268   3e-83    Populus trichocarpa [western balsam poplar]
ref|XP_010650990.1|  PREDICTED: tropinone reductase homolog isofo...    275   5e-83    
ref|XP_011076794.1|  PREDICTED: tropinone reductase homolog             267   5e-83    
ref|XP_007009277.1|  NAD(P)-binding Rossmann-fold superfamily pro...    267   6e-83    
ref|XP_007205714.1|  hypothetical protein PRUPE_ppa009944mg             267   6e-83    
ref|XP_004293354.1|  PREDICTED: tropinone reductase homolog At1g0...    267   6e-83    
emb|CDY14094.1|  BnaC02g02110D                                          267   7e-83    
ref|XP_010256821.1|  PREDICTED: tropinone reductase homolog             267   7e-83    
ref|XP_007218806.1|  hypothetical protein PRUPE_ppa009941mg             267   7e-83    
emb|CDY04977.1|  BnaAnng01590D                                          266   8e-83    
ref|XP_010067433.1|  PREDICTED: tropinone reductase homolog At1g0...    267   8e-83    
emb|CDX98899.1|  BnaC09g49360D                                          266   9e-83    
ref|XP_008221969.1|  PREDICTED: tropinone reductase homolog At1g0...    266   1e-82    
ref|NP_001049677.1|  Os03g0269100                                       266   1e-82    Oryza sativa Japonica Group [Japonica rice]
gb|KDP35685.1|  hypothetical protein JCGZ_09123                         266   1e-82    
gb|KEH34749.1|  NAD(P)-binding rossmann-fold protein                    266   1e-82    
emb|CDX86485.1|  BnaC08g02180D                                          266   1e-82    
gb|KCW65561.1|  hypothetical protein EUGRSUZ_G02957                     266   1e-82    
ref|XP_010491151.1|  PREDICTED: tropinone reductase homolog At1g0...    266   1e-82    
ref|XP_011023546.1|  PREDICTED: tropinone reductase homolog At1g0...    265   2e-82    
ref|XP_009125632.1|  PREDICTED: tropinone reductase homolog At1g0...    266   2e-82    
ref|XP_009343858.1|  PREDICTED: tropinone reductase homolog At1g0...    266   2e-82    
ref|NP_196225.1|  putative tropine dehydrogenase                        266   2e-82    Arabidopsis thaliana [mouse-ear cress]
gb|KCW65560.1|  hypothetical protein EUGRSUZ_G02957                     265   3e-82    
ref|XP_011023547.1|  PREDICTED: tropinone reductase homolog At1g0...    265   3e-82    
gb|ABW81118.1|  putative tropinone reductase                            267   3e-82    Boechera divaricarpa
ref|XP_004307471.1|  PREDICTED: tropinone reductase homolog             265   4e-82    
gb|KCW52641.1|  hypothetical protein EUGRSUZ_J02019                     265   4e-82    
emb|CDP14238.1|  unnamed protein product                                265   4e-82    
gb|KDP44893.1|  hypothetical protein JCGZ_01393                         265   5e-82    
ref|XP_008222016.1|  PREDICTED: tropinone reductase homolog At1g0...    265   5e-82    
ref|XP_004294665.1|  PREDICTED: tropinone reductase homolog At1g0...    265   5e-82    
gb|AFK36242.1|  unknown                                                 265   5e-82    
ref|XP_004984926.1|  PREDICTED: tropinone reductase homolog At1g0...    264   8e-82    
ref|XP_002277835.1|  PREDICTED: tropinone reductase homolog At1g0...    264   8e-82    Vitis vinifera
gb|AFP55030.1|  tropinone reductase I                                   264   9e-82    
ref|XP_002319563.2|  tropinone reductase family protein                 264   9e-82    Populus trichocarpa [western balsam poplar]
ref|XP_008349592.1|  PREDICTED: tropinone reductase homolog At1g0...    264   9e-82    
ref|XP_010096620.1|  Tropinone reductase-like protein                   264   9e-82    
ref|XP_010067438.1|  PREDICTED: tropinone reductase homolog At1g0...    264   1e-81    
ref|XP_008375982.1|  PREDICTED: tropinone reductase homolog At1g0...    264   1e-81    
ref|NP_001275240.1|  tropinone reductase 2-like                         263   1e-81    
ref|XP_007163457.1|  hypothetical protein PHAVU_001G235800g             264   1e-81    
emb|CDY68057.1|  BnaAnng26060D                                          263   1e-81    
gb|AIX10937.1|  putative tropinone reductase                            264   1e-81    
ref|XP_011048910.1|  PREDICTED: tropinone reductase homolog At1g0...    263   2e-81    
ref|XP_004235264.1|  PREDICTED: tropinone reductase homolog isofo...    263   2e-81    
ref|XP_008387076.1|  PREDICTED: tropinone reductase homolog At1g0...    263   2e-81    
ref|XP_010423393.1|  PREDICTED: tropinone reductase homolog At1g0...    263   2e-81    
ref|XP_008233480.1|  PREDICTED: tropinone reductase homolog At1g0...    263   2e-81    
ref|XP_003537468.1|  PREDICTED: tropinone reductase homolog At1g0...    263   2e-81    
ref|XP_002311182.2|  tropinone reductase family protein                 263   2e-81    Populus trichocarpa [western balsam poplar]
ref|XP_009140979.1|  PREDICTED: tropinone reductase homolog At1g0...    264   2e-81    
emb|CAQ19732.1|  tropinone reductase II                                 263   2e-81    Solanum dulcamara [climbing nightshade]
emb|CAC19810.1|  tropinone reductase II                                 263   2e-81    Solanum tuberosum [potatoes]
gb|AGH24753.1|  tropinone reductase-II                                  263   2e-81    
ref|XP_011033874.1|  PREDICTED: tropinone reductase homolog At1g0...    263   2e-81    
ref|XP_004302758.1|  PREDICTED: tropinone reductase homolog             263   3e-81    
ref|XP_006288477.1|  hypothetical protein CARUB_v10001737mg             263   3e-81    
ref|XP_009110944.1|  PREDICTED: tropinone reductase homolog At1g0...    262   3e-81    
emb|CDP00133.1|  unnamed protein product                                263   3e-81    
gb|AIN39992.1|  tropinone reductase I                                   263   4e-81    
ref|XP_011094903.1|  PREDICTED: tropinone reductase homolog             262   5e-81    
gb|AAM61117.1|  short chain alcohol dehydrogenase-like                  262   5e-81    Arabidopsis thaliana [mouse-ear cress]
ref|XP_008358998.1|  PREDICTED: tropinone reductase homolog At1g0...    262   5e-81    
emb|CBI16074.3|  unnamed protein product                                261   6e-81    
ref|XP_007206475.1|  hypothetical protein PRUPE_ppa018984mg             262   6e-81    
ref|XP_007016327.1|  Senescence-associated gene 13, putative isof...    263   6e-81    
ref|XP_002873234.1|  hypothetical protein ARALYDRAFT_487407             261   7e-81    
ref|XP_006424909.1|  hypothetical protein CICLE_v10029051mg             261   8e-81    
ref|XP_004303414.1|  PREDICTED: tropinone reductase homolog             261   8e-81    
ref|XP_009623489.1|  PREDICTED: tropinone reductase 1-like isofor...    262   8e-81    
ref|XP_002465494.1|  hypothetical protein SORBIDRAFT_01g039880          261   8e-81    Sorghum bicolor [broomcorn]
ref|XP_006352698.1|  PREDICTED: tropinone reductase homolog             261   9e-81    
ref|XP_006344593.1|  PREDICTED: tropinone reductase homolog             263   1e-80    
emb|CAD20555.1|  tropinone reductase I                                  261   1e-80    Calystegia sepium
ref|XP_006399065.1|  hypothetical protein EUTSA_v10014421mg             261   1e-80    
gb|KHN17906.1|  Tropinone reductase like                                261   1e-80    
gb|ABF95188.1|  Tropinone reductase, putative, expressed                261   1e-80    Oryza sativa Japonica Group [Japonica rice]
ref|XP_010542622.1|  PREDICTED: tropinone reductase homolog At1g0...    261   1e-80    
ref|XP_004137775.1|  PREDICTED: tropinone reductase homolog             261   1e-80    
ref|XP_010521885.1|  PREDICTED: tropinone reductase homolog At1g0...    261   1e-80    
ref|XP_002282755.1|  PREDICTED: tropinone reductase homolog At1g0...    261   2e-80    Vitis vinifera
emb|CDY09823.1|  BnaC09g43380D                                          261   2e-80    
ref|XP_011048912.1|  PREDICTED: tropinone reductase homolog At1g0...    261   2e-80    
gb|KEH22973.1|  NAD(P)-binding rossmann-fold protein                    261   2e-80    
ref|XP_009375950.1|  PREDICTED: tropinone reductase homolog At1g0...    261   2e-80    
ref|XP_011048908.1|  PREDICTED: tropinone reductase homolog At1g0...    263   2e-80    
gb|EMT31236.1|  Tropinone reductase-like protein                        262   2e-80    
ref|XP_004302763.1|  PREDICTED: tropinone reductase homolog             260   2e-80    
gb|ABW81054.1|  tropinone-reductase-like39                              262   2e-80    Arabidopsis lyrata subsp. lyrata
ref|XP_006352700.1|  PREDICTED: tropinone reductase homolog             260   3e-80    
emb|CBI30509.3|  unnamed protein product                                259   3e-80    
ref|XP_011023548.1|  PREDICTED: tropinone reductase homolog At1g0...    260   3e-80    
emb|CDY09824.1|  BnaC09g43370D                                          260   3e-80    
ref|XP_010040245.1|  PREDICTED: tropinone reductase homolog At1g0...    261   3e-80    
ref|XP_010033100.1|  PREDICTED: tropinone reductase homolog At1g0...    260   3e-80    
ref|XP_007016320.1|  NAD(P)-binding Rossmann-fold superfamily pro...    261   4e-80    
ref|XP_009611893.1|  PREDICTED: tropinone reductase homolog At1g0...    259   4e-80    
ref|XP_004302760.1|  PREDICTED: tropinone reductase homolog             259   4e-80    
ref|XP_004503163.1|  PREDICTED: tropinone reductase homolog             260   4e-80    
gb|KHG18781.1|  Tropinone reductase                                     261   4e-80    
ref|XP_010033102.1|  PREDICTED: tropinone reductase homolog At1g0...    260   4e-80    
gb|KEH22972.1|  NAD(P)-binding rossmann-fold protein                    259   4e-80    
ref|XP_010510523.1|  PREDICTED: tropinone reductase homolog At1g0...    259   5e-80    
sp|P50162.1|TRN1_DATST  RecName: Full=Tropinone reductase 1; AltN...    259   5e-80    Datura stramonium [common thornapple]
gb|ACU16743.1|  unknown                                                 259   5e-80    Glycine max [soybeans]
ref|NP_001242650.1|  uncharacterized protein LOC100819646               259   5e-80    
gb|KHG18782.1|  hypothetical protein F383_24463                         259   5e-80    
ref|XP_010685685.1|  PREDICTED: tropinone reductase homolog At1g0...    259   5e-80    
gb|AFK36946.1|  unknown                                                 259   5e-80    
ref|XP_010542627.1|  PREDICTED: tropinone reductase homolog At1g0...    259   5e-80    
ref|XP_002308173.1|  hypothetical protein POPTR_0006s09070g             259   6e-80    Populus trichocarpa [western balsam poplar]
gb|KDO38494.1|  hypothetical protein CISIN_1g024551mg                   259   6e-80    
ref|XP_003538423.1|  PREDICTED: tropinone reductase homolog At1g0...    259   6e-80    
ref|XP_006295594.1|  hypothetical protein CARUB_v10024703mg             259   6e-80    
ref|XP_007016314.1|  NAD(P)-binding Rossmann-fold superfamily pro...    260   6e-80    
emb|CDX70101.1|  BnaA10g24500D                                          259   7e-80    
ref|XP_009375952.1|  PREDICTED: tropinone reductase homolog At1g0...    259   7e-80    
ref|NP_001149071.1|  LOC100282692                                       259   8e-80    Zea mays [maize]
ref|XP_010106548.1|  hypothetical protein L484_025308                   259   8e-80    
ref|XP_010452516.1|  PREDICTED: tropinone reductase homolog At1g0...    259   8e-80    
ref|XP_011089796.1|  PREDICTED: tropinone reductase homolog isofo...    260   8e-80    
gb|ABW81126.1|  short chain dehydrogenase-21                            259   8e-80    Boechera divaricarpa
ref|XP_004150641.1|  PREDICTED: tropinone reductase homolog At1g0...    259   8e-80    
ref|XP_008442514.1|  PREDICTED: tropinone reductase homolog             258   8e-80    
ref|XP_010228815.1|  PREDICTED: tropinone reductase homolog At1g0...    259   8e-80    
ref|XP_006294815.1|  hypothetical protein CARUB_v10023866mg             259   9e-80    
ref|XP_004291519.1|  PREDICTED: tropinone reductase homolog At1g0...    259   9e-80    
gb|KCW49544.1|  hypothetical protein EUGRSUZ_K03064                     259   9e-80    
ref|XP_011089795.1|  PREDICTED: tropinone reductase homolog isofo...    260   9e-80    
ref|XP_010414423.1|  PREDICTED: tropinone reductase homolog At1g0...    259   9e-80    
gb|EAY89400.1|  hypothetical protein OsI_10905                          259   9e-80    Oryza sativa Indica Group [Indian rice]
ref|XP_003552193.1|  PREDICTED: tropinone reductase homolog isofo...    258   1e-79    
gb|ABW81158.1|  TRL13                                                   260   1e-79    Capsella rubella
ref|XP_010557240.1|  PREDICTED: tropinone reductase homolog At1g0...    260   1e-79    
gb|KEH22981.1|  NAD(P)-binding rossmann-fold protein                    258   1e-79    
ref|XP_006649826.1|  PREDICTED: tropinone reductase homolog At1g0...    258   2e-79    
gb|ABW81146.1|  TRL26                                                   258   2e-79    Capsella rubella
ref|XP_011023544.1|  PREDICTED: tropinone reductase homolog At1g0...    258   2e-79    
ref|XP_007206734.1|  hypothetical protein PRUPE_ppa024823mg             258   2e-79    
ref|XP_010067435.1|  PREDICTED: tropinone reductase homolog At1g0...    258   2e-79    
ref|NP_001275290.1|  tropinone reductase 1-like                         258   2e-79    
ref|XP_006488391.1|  PREDICTED: tropinone reductase homolog At1g0...    258   2e-79    
ref|XP_009346407.1|  PREDICTED: tropinone reductase homolog isofo...    258   2e-79    
sp|P50164.1|TRN2_HYONI  RecName: Full=Tropinone reductase 2; AltN...    258   2e-79    Hyoscyamus niger [black henbane]
ref|XP_009122209.1|  PREDICTED: tropinone reductase homolog At1g0...    257   3e-79    
ref|XP_006590970.1|  PREDICTED: tropinone reductase homolog At1g0...    259   3e-79    
gb|KEH30187.1|  enoyl-(acyl carrier) reductase                          258   3e-79    
emb|CAN69508.1|  hypothetical protein VITISV_016038                     259   3e-79    Vitis vinifera
gb|ACJ84726.1|  unknown                                                 258   3e-79    Medicago truncatula
ref|XP_003552795.1|  PREDICTED: tropinone reductase homolog             258   3e-79    
ref|XP_010475505.1|  PREDICTED: tropinone reductase homolog At1g0...    258   3e-79    
ref|XP_010037803.1|  PREDICTED: tropinone reductase 1-like              259   3e-79    
ref|XP_006846356.1|  hypothetical protein AMTR_s00012p00261070          258   3e-79    
ref|XP_010040250.1|  PREDICTED: tropinone reductase homolog At1g0...    258   3e-79    
gb|AGY46257.1|  tropinone reductase I                                   258   3e-79    
ref|XP_009796888.1|  PREDICTED: tropinone reductase homolog             258   3e-79    
ref|XP_004294666.1|  PREDICTED: tropinone reductase homolog At1g0...    258   3e-79    
gb|KHN04080.1|  Tropinone reductase like                                257   3e-79    
ref|XP_011048909.1|  PREDICTED: tropinone reductase homolog At1g0...    259   3e-79    
ref|XP_010423394.1|  PREDICTED: tropinone reductase homolog At1g0...    257   4e-79    
gb|AGL76990.1|  tropinone reductase II                                  257   4e-79    
gb|KEH34736.1|  NAD(P)-binding rossmann-fold protein                    257   4e-79    
gb|AGL76989.1|  tropinone reductase I                                   257   4e-79    
gb|ABW81156.1|  TRL15                                                   257   4e-79    Capsella rubella
ref|XP_010106549.1|  hypothetical protein L484_025309                   257   5e-79    
ref|XP_010106552.1|  Tropinone reductase-like protein                   257   5e-79    
ref|XP_007026941.1|  NAD(P)-binding Rossmann-fold superfamily pro...    257   6e-79    
ref|XP_006409971.1|  hypothetical protein EUTSA_v10017105mg             256   6e-79    
ref|XP_010487469.1|  PREDICTED: tropinone reductase homolog At1g0...    256   7e-79    
ref|NP_180497.1|  tropinone reductase-like protein                      256   7e-79    Arabidopsis thaliana [mouse-ear cress]
emb|CDY31776.1|  BnaA04g17120D                                          256   7e-79    
gb|ACB71203.1|  tropinone reductase II                                  256   7e-79    Anisodus acutangulus
ref|XP_010033103.1|  PREDICTED: tropinone reductase homolog At1g0...    257   7e-79    
gb|ABI78943.1|  tropinone reductase                                     256   8e-79    Anisodus acutangulus
ref|XP_004236988.1|  PREDICTED: tropinone reductase 2                   256   8e-79    
gb|KEH22982.1|  enoyl-(acyl carrier) reductase                          256   9e-79    
ref|XP_008359743.1|  PREDICTED: tropinone reductase homolog isofo...    256   9e-79    
ref|XP_006846352.1|  hypothetical protein AMTR_s00012p00260130          256   1e-78    
gb|ADE77494.1|  unknown                                                 256   1e-78    
ref|XP_010510510.1|  PREDICTED: tropinone reductase homolog At1g0...    258   1e-78    
ref|XP_004137777.1|  PREDICTED: tropinone reductase homolog             256   1e-78    
ref|XP_008461702.1|  PREDICTED: tropinone reductase homolog             256   1e-78    
ref|XP_010475501.1|  PREDICTED: tropinone reductase homolog At1g0...    257   1e-78    
ref|XP_006344583.1|  PREDICTED: tropinone reductase homolog             256   1e-78    
ref|XP_008349700.1|  PREDICTED: uncharacterized protein LOC103412975    268   1e-78    
ref|XP_007016316.1|  NAD(P)-binding Rossmann-fold superfamily pro...    256   1e-78    
emb|CAN69103.1|  hypothetical protein VITISV_027298                     256   1e-78    Vitis vinifera
ref|XP_011010114.1|  PREDICTED: tropinone reductase homolog At1g0...    256   1e-78    
gb|ACB71202.1|  tropinone reductase I                                   256   1e-78    Anisodus acutangulus
ref|XP_004240378.1|  PREDICTED: tropinone reductase homolog             257   1e-78    
gb|AFK34899.1|  unknown                                                 256   1e-78    
ref|XP_008363884.1|  PREDICTED: tropinone reductase homolog             255   2e-78    
ref|XP_002314932.1|  tropinone reductase family protein                 255   2e-78    
emb|CDP11659.1|  unnamed protein product                                255   2e-78    
ref|XP_011070195.1|  PREDICTED: tropinone reductase 1-like              255   2e-78    
ref|XP_010557238.1|  PREDICTED: tropinone reductase homolog At1g0...    255   2e-78    
ref|XP_002879211.1|  hypothetical protein ARALYDRAFT_481852             255   2e-78    
ref|XP_006429149.1|  hypothetical protein CICLE_v10012479mg             255   2e-78    
ref|XP_010469989.1|  PREDICTED: tropinone reductase homolog At1g0...    255   2e-78    
ref|XP_006429152.1|  hypothetical protein CICLE_v10012433mg             256   2e-78    
ref|XP_009603002.1|  PREDICTED: tropinone reductase homolog isofo...    257   2e-78    
ref|NP_180489.1|  NAD(P)-binding Rossmann-fold superfamily protein      257   2e-78    
ref|XP_010487481.1|  PREDICTED: tropinone reductase homolog At1g0...    255   2e-78    
gb|ABW74557.1|  tropinone-reductase-like protein                        256   2e-78    
gb|AIN39993.1|  tropinone reductase I                                   255   3e-78    
ref|XP_010256816.1|  PREDICTED: tropinone reductase homolog At1g0...    258   3e-78    
gb|ABW81127.1|  putative tropinone reductase-22                         255   3e-78    
ref|XP_010650987.1|  PREDICTED: tropinone reductase homolog At1g0...    254   3e-78    
ref|XP_010469976.1|  PREDICTED: tropinone reductase homolog At1g0...    256   3e-78    
ref|XP_007132036.1|  hypothetical protein PHAVU_011G061400g             256   3e-78    
ref|XP_007140480.1|  hypothetical protein PHAVU_008G116200g             255   3e-78    
ref|XP_011023549.1|  PREDICTED: tropinone reductase homolog At1g0...    254   3e-78    
ref|XP_002892399.1|  hypothetical protein ARALYDRAFT_470766             254   4e-78    
ref|XP_010414393.1|  PREDICTED: tropinone reductase homolog At1g0...    255   4e-78    
ref|XP_006488388.1|  PREDICTED: tropinone reductase homolog isofo...    257   4e-78    
gb|EYU41758.1|  hypothetical protein MIMGU_mgv1a011856mg                254   4e-78    
ref|XP_011006389.1|  PREDICTED: tropinone reductase homolog isofo...    254   4e-78    
emb|CDP12723.1|  unnamed protein product                                254   4e-78    
ref|XP_006409970.1|  hypothetical protein EUTSA_v10016944mg             256   4e-78    
ref|XP_010521894.1|  PREDICTED: tropinone reductase homolog At1g0...    254   4e-78    
dbj|BAJ87177.1|  predicted protein                                      254   4e-78    
gb|KEH34739.1|  NAD(P)-binding rossmann-fold protein                    254   4e-78    
sp|P50163.1|TRN2_DATST  RecName: Full=Tropinone reductase 2; AltN...    254   4e-78    
ref|XP_010931228.1|  PREDICTED: tropinone reductase homolog At1g0...    254   4e-78    
ref|XP_010650986.1|  PREDICTED: tropinone reductase homolog At1g0...    254   4e-78    
ref|XP_002282638.2|  PREDICTED: tropinone reductase homolog At1g0...    256   5e-78    
dbj|BAA13547.1|  tropinone reductase-I                                  254   5e-78    
ref|XP_008363883.1|  PREDICTED: tropinone reductase 1-like              254   5e-78    
ref|XP_008221957.1|  PREDICTED: tropinone reductase homolog At1g0...    254   6e-78    
ref|XP_007140477.1|  hypothetical protein PHAVU_008G115900g             254   6e-78    
ref|XP_007206210.1|  hypothetical protein PRUPE_ppa015172mg             253   7e-78    
gb|ADE76974.1|  unknown                                                 254   7e-78    
ref|XP_003529117.1|  PREDICTED: tropinone reductase homolog isofo...    254   8e-78    
gb|ABW81066.1|  tropinone-reductase-like53                              254   8e-78    
ref|XP_009358752.1|  PREDICTED: tropinone reductase homolog isofo...    253   8e-78    
gb|AGB56644.1|  tropinone reductase I                                   254   8e-78    
ref|XP_010691207.1|  PREDICTED: tropinone reductase homolog At1g0...    253   8e-78    
ref|XP_006846351.1|  hypothetical protein AMTR_s00012p00260070          255   9e-78    
ref|XP_010510518.1|  PREDICTED: tropinone reductase homolog At1g0...    255   1e-77    
ref|XP_009346408.1|  PREDICTED: tropinone reductase homolog isofo...    253   1e-77    
gb|ABW81120.1|  putative tropinone reductase-14                         253   1e-77    
gb|EPS58365.1|  hypothetical protein M569_16448                         253   1e-77    
emb|CBI16068.3|  unnamed protein product                                253   1e-77    
ref|XP_009358760.1|  PREDICTED: tropinone reductase homolog             253   1e-77    
ref|XP_010665941.1|  PREDICTED: tropinone reductase homolog At1g0...    253   1e-77    
ref|XP_010521893.1|  PREDICTED: tropinone reductase homolog At1g0...    253   1e-77    
ref|XP_006358703.1|  PREDICTED: tropinone reductase homolog At1g0...    254   1e-77    
gb|AAO42159.1|  putative tropinone reductase                            255   1e-77    
gb|ABW81080.1|  TRL3                                                    254   1e-77    
ref|NP_172224.1|  NAD(P)-binding Rossmann-fold superfamily protein      253   1e-77    
gb|KHN40273.1|  Tropinone reductase like                                253   1e-77    
ref|XP_010521558.1|  PREDICTED: tropinone reductase homolog At1g0...    253   1e-77    
gb|AAM63669.1|  putative tropinone reductase                            253   1e-77    
ref|XP_009346409.1|  PREDICTED: tropinone reductase homolog             253   2e-77    
ref|XP_009118438.1|  PREDICTED: tropinone reductase homolog At1g0...    253   2e-77    
ref|XP_009113419.1|  PREDICTED: tropinone reductase homolog At1g0...    253   2e-77    
ref|XP_009773607.1|  PREDICTED: tropinone reductase homolog             253   2e-77    
ref|XP_010088522.1|  Tropinone reductase-like protein                   253   2e-77    
ref|XP_002520511.1|  tropinone reductase, putative                      262   2e-77    
emb|CDY06260.1|  BnaA09g49430D                                          252   2e-77    
ref|XP_008349591.1|  PREDICTED: tropinone reductase homolog At1g0...    253   2e-77    
ref|XP_002524214.1|  tropinone reductase, putative                      253   2e-77    
ref|XP_004249378.1|  PREDICTED: tropinone reductase 1 isoform X2        252   3e-77    
emb|CAQ19734.1|  putative tropinone reductase I                         252   3e-77    
ref|XP_009358754.1|  PREDICTED: tropinone reductase homolog isofo...    252   3e-77    
ref|XP_008387806.1|  PREDICTED: tropinone reductase homolog             252   3e-77    
gb|KHG29311.1|  Tropinone reductase                                     253   3e-77    
emb|CDY09917.1|  BnaC08g45340D                                          252   3e-77    
ref|XP_010418801.1|  PREDICTED: tropinone reductase homolog At1g0...    252   3e-77    
ref|XP_004249635.1|  PREDICTED: tropinone reductase homolog isofo...    252   3e-77    
pdb|1IPE|A  Chain A, Tropinone Reductase-Ii Complexed With Nadph        252   4e-77    
gb|ABW81178.1|  tropinone reductase-like protein 16                     252   4e-77    
gb|KFK43068.1|  hypothetical protein AALP_AA1G074500                    252   4e-77    
gb|KDP30781.1|  hypothetical protein JCGZ_13724                         252   4e-77    
ref|XP_004492175.1|  PREDICTED: tropinone reductase homolog             252   4e-77    
gb|KHN17894.1|  Tropinone reductase like                                251   5e-77    
gb|KDP35687.1|  hypothetical protein JCGZ_09125                         251   6e-77    
ref|XP_010521883.1|  PREDICTED: tropinone reductase homolog At1g0...    251   6e-77    
gb|ABK96466.1|  unknown                                                 251   6e-77    
ref|XP_007026940.1|  NAD(P)-binding Rossmann-fold superfamily pro...    254   6e-77    
ref|XP_003539545.1|  PREDICTED: tropinone reductase homolog At1g0...    251   7e-77    
ref|XP_006349492.1|  PREDICTED: tropinone reductase homolog             252   7e-77    
emb|CDY51372.1|  BnaA04g28660D                                          252   7e-77    
ref|XP_006649828.1|  PREDICTED: tropinone reductase homolog At1g0...    251   7e-77    
ref|XP_010558920.1|  PREDICTED: tropinone reductase homolog At1g0...    256   7e-77    
ref|XP_010475502.1|  PREDICTED: tropinone reductase homolog At1g0...    252   7e-77    
gb|KHN25230.1|  Tropinone reductase like                                251   8e-77    
ref|XP_006417804.1|  hypothetical protein EUTSA_v10008362mg             252   8e-77    
ref|XP_010557237.1|  PREDICTED: tropinone reductase homolog At1g0...    251   9e-77    
gb|AFK45411.1|  unknown                                                 251   9e-77    
ref|NP_172225.1|  NAD(P)-binding Rossmann-fold superfamily protein      251   1e-76    
ref|XP_008442511.1|  PREDICTED: tropinone reductase homolog             251   1e-76    
ref|XP_010469814.1|  PREDICTED: tropinone reductase homolog At1g0...    251   1e-76    
gb|KDP42205.1|  hypothetical protein JCGZ_02935                         253   1e-76    
ref|XP_003539556.1|  PREDICTED: tropinone reductase homolog At1g0...    251   1e-76    
ref|XP_010521549.1|  PREDICTED: tropinone reductase homolog At1g0...    251   1e-76    
emb|CAB88214.1|  putative tropinone reductase                           251   1e-76    
gb|AFK35677.1|  unknown                                                 251   1e-76    
ref|XP_010414428.1|  PREDICTED: tropinone reductase homolog At1g0...    251   1e-76    
ref|XP_004507158.1|  PREDICTED: tropinone reductase homolog             252   1e-76    
ref|XP_009600097.1|  PREDICTED: tropinone reductase homolog isofo...    252   1e-76    
ref|XP_008359746.1|  PREDICTED: tropinone reductase homolog             250   1e-76    
ref|XP_007205761.1|  hypothetical protein PRUPE_ppa010313mg             250   1e-76    
ref|XP_010658532.1|  PREDICTED: tropinone reductase homolog At1g0...    251   1e-76    
ref|XP_010469962.1|  PREDICTED: tropinone reductase homolog At1g0...    251   1e-76    
emb|CDY14610.1|  BnaC02g25030D                                          250   2e-76    
gb|AAC95218.1|  putative tropinone reductase                            250   2e-76    
ref|XP_010685687.1|  PREDICTED: tropinone reductase homolog At1g0...    252   2e-76    
gb|KFK41763.1|  hypothetical protein AALP_AA2G169000                    249   2e-76    
ref|XP_010521889.1|  PREDICTED: tropinone reductase homolog At1g0...    249   2e-76    
ref|XP_009118960.1|  PREDICTED: tropinone reductase homolog At1g0...    250   2e-76    
gb|AFK33539.1|  unknown                                                 250   2e-76    
ref|XP_006294711.1|  hypothetical protein CARUB_v10023749mg             251   3e-76    
ref|XP_007132035.1|  hypothetical protein PHAVU_011G061300g             250   3e-76    
ref|NP_001118408.1|  tropinone reductase-like protein                   249   3e-76    
ref|XP_010034592.1|  PREDICTED: tropinone reductase homolog At1g0...    250   3e-76    
ref|XP_009127473.1|  PREDICTED: tropinone reductase homolog At1g0...    249   3e-76    
gb|ABW81165.1|  TRL5                                                    250   3e-76    
ref|XP_010685686.1|  PREDICTED: tropinone reductase homolog At1g0...    253   3e-76    
ref|NP_001049675.1|  Os03g0268900                                       249   3e-76    
ref|XP_009622919.1|  PREDICTED: tropinone reductase homolog             250   3e-76    
ref|XP_008777412.1|  PREDICTED: tropinone reductase homolog At1g0...    249   4e-76    
ref|XP_009760666.1|  PREDICTED: LOW QUALITY PROTEIN: tropinone re...    251   4e-76    
ref|XP_006294819.1|  hypothetical protein CARUB_v10023870mg             249   4e-76    
ref|XP_009358758.1|  PREDICTED: tropinone reductase homolog             249   4e-76    
ref|XP_009140995.1|  PREDICTED: tropinone reductase homolog At1g0...    249   4e-76    
emb|CAN74482.1|  hypothetical protein VITISV_028249                     251   4e-76    
gb|AFK34404.1|  unknown                                                 249   4e-76    
emb|CDY52942.1|  BnaCnng23860D                                          249   4e-76    
ref|NP_180479.1|  tropinone reductase-like protein                      249   6e-76    
gb|KHF98968.1|  hypothetical protein F383_10254                         249   6e-76    
gb|KFK38265.1|  hypothetical protein AALP_AA3G091300                    249   7e-76    
gb|KDO66642.1|  hypothetical protein CISIN_1g019370mg                   251   7e-76    
ref|NP_001237661.1|  uncharacterized protein LOC100306108               248   8e-76    
gb|AFK36108.1|  unknown                                                 248   9e-76    
ref|XP_010510310.1|  PREDICTED: tropinone reductase homolog At1g0...    248   1e-75    
ref|XP_002282875.1|  PREDICTED: tropinone reductase homolog At1g0...    248   1e-75    
emb|CDY31768.1|  BnaA04g17040D                                          248   1e-75    
ref|XP_010457924.1|  PREDICTED: tropinone reductase homolog At1g0...    248   1e-75    
ref|XP_002879208.1|  hypothetical protein ARALYDRAFT_481843             248   1e-75    
gb|ABW81067.1|  Tropinon-reductase-like54                               248   2e-75    
ref|XP_009416162.1|  PREDICTED: tropinone reductase homolog At1g0...    248   2e-75    
ref|XP_002976988.1|  hypothetical protein SELMODRAFT_416905             257   2e-75    
ref|XP_002881032.1|  hypothetical protein ARALYDRAFT_481835             248   2e-75    
ref|XP_009358759.1|  PREDICTED: tropinone reductase homolog             247   2e-75    
emb|CDO98530.1|  unnamed protein product                                248   2e-75    
emb|CDP12722.1|  unnamed protein product                                248   2e-75    
ref|XP_002879210.1|  hypothetical protein ARALYDRAFT_481850             248   2e-75    
ref|XP_010106547.1|  Tropinone reductase-like protein                   247   2e-75    
ref|XP_003540716.1|  PREDICTED: tropinone reductase homolog             249   2e-75    
ref|NP_180496.1|  senescence-associated protein 13                      247   3e-75    
dbj|BAC65128.2|  short chain alcohol dehydrogenase-like protein         248   3e-75    
gb|ABW81147.1|  TRL24                                                   247   3e-75    
ref|XP_006369543.1|  hypothetical protein POPTR_0001s25180g             246   3e-75    
ref|XP_010414392.1|  PREDICTED: tropinone reductase homolog At1g0...    247   4e-75    
emb|CAO02390.1|  tropinone reductase                                    247   4e-75    
ref|XP_010469963.1|  PREDICTED: tropinone reductase homolog At1g0...    247   4e-75    
ref|XP_009416161.1|  PREDICTED: tropinone reductase homolog At1g0...    247   4e-75    
ref|XP_008777402.1|  PREDICTED: tropinone reductase homolog At1g0...    247   4e-75    
ref|XP_006352697.1|  PREDICTED: tropinone reductase homolog At1g0...    247   4e-75    
ref|XP_004242401.1|  PREDICTED: tropinone reductase homolog At1g0...    246   5e-75    
gb|ABW81087.1|  TRL11                                                   247   5e-75    
ref|XP_009804542.1|  PREDICTED: tropinone reductase homolog isofo...    249   5e-75    
ref|XP_002980725.1|  hypothetical protein SELMODRAFT_444601             254   5e-75    
ref|XP_008369937.1|  PREDICTED: tropinone reductase homolog             246   6e-75    
gb|KHG25916.1|  hypothetical protein F383_01801                         246   6e-75    
ref|XP_007140479.1|  hypothetical protein PHAVU_008G116100g             246   6e-75    
ref|XP_010910872.1|  PREDICTED: tropinone reductase homolog At1g0...    246   7e-75    
ref|XP_009140980.1|  PREDICTED: tropinone reductase homolog At1g0...    246   7e-75    
gb|ABW81150.1|  TRL21                                                   246   7e-75    
ref|XP_010543921.1|  PREDICTED: tropinone reductase homolog At1g0...    245   8e-75    
ref|NP_180625.1|  NAD(P)-binding Rossmann-fold superfamily protein      246   9e-75    
emb|CDY31773.1|  BnaA04g17090D                                          246   9e-75    
gb|AAP06907.1|  hypothetical protein                                    247   1e-74    
gb|EAY89401.1|  hypothetical protein OsI_10906                          247   1e-74    
ref|XP_006293509.1|  hypothetical protein CARUB_v10023815mg             246   1e-74    
ref|XP_009375972.1|  PREDICTED: tropinone reductase homolog At1g0...    246   1e-74    
ref|XP_010510309.1|  PREDICTED: tropinone reductase homolog At1g0...    245   1e-74    
ref|XP_006429148.1|  hypothetical protein CICLE_v10012479mg             244   1e-74    
ref|XP_010521892.1|  PREDICTED: tropinone reductase homolog At1g0...    246   1e-74    
gb|KHG00112.1|  Tropinone reductase                                     246   1e-74    
ref|XP_010675701.1|  PREDICTED: tropinone reductase homolog At1g0...    246   2e-74    
ref|XP_002863054.1|  hypothetical protein ARALYDRAFT_497196             245   2e-74    
ref|XP_008457446.1|  PREDICTED: tropinone reductase homolog At1g0...    247   2e-74    
ref|XP_007140484.1|  hypothetical protein PHAVU_008G116500g             245   2e-74    
ref|XP_002892400.1|  hypothetical protein ARALYDRAFT_470767             245   2e-74    
ref|XP_010510314.1|  PREDICTED: tropinone reductase homolog At1g0...    245   2e-74    
emb|CBI16078.3|  unnamed protein product                                244   2e-74    
gb|AAF79553.1|AC022464_11  F22G5.20                                     253   2e-74    
ref|XP_010510516.1|  PREDICTED: tropinone reductase homolog At1g0...    245   2e-74    
ref|XP_009140976.1|  PREDICTED: tropinone reductase homolog At1g0...    245   2e-74    
ref|XP_009407503.1|  PREDICTED: tropinone reductase homolog             244   2e-74    
ref|XP_006391358.1|  hypothetical protein EUTSA_v10019005mg             244   3e-74    
ref|XP_010414408.1|  PREDICTED: tropinone reductase homolog At1g0...    244   3e-74    
ref|XP_007140493.1|  hypothetical protein PHAVU_008G117200g             244   3e-74    
gb|KDP35675.1|  hypothetical protein JCGZ_09113                         244   3e-74    
ref|XP_003538424.1|  PREDICTED: tropinone reductase homolog At1g0...    244   3e-74    
ref|XP_008777422.1|  PREDICTED: tropinone reductase homolog At1g0...    244   4e-74    
ref|XP_010034595.1|  PREDICTED: tropinone reductase homolog At1g0...    244   4e-74    
gb|AAP06917.1|  unknown protein                                         246   4e-74    
ref|XP_006649825.1|  PREDICTED: tropinone reductase homolog At1g0...    244   5e-74    
gb|AAP06906.1|  putative pfam00106, adh_short, short chain dehydr...    245   5e-74    
ref|XP_006352699.1|  PREDICTED: tropinone reductase homolog At1g0...    244   5e-74    
emb|CDY40165.1|  BnaC04g13930D                                          243   6e-74    
ref|XP_006583599.1|  PREDICTED: tropinone reductase homolog             244   6e-74    
ref|XP_010542633.1|  PREDICTED: tropinone reductase homolog At1g0...    244   6e-74    
gb|KFK41764.1|  hypothetical protein AALP_AA2G169200                    243   6e-74    
ref|XP_010469961.1|  PREDICTED: tropinone reductase homolog At1g0...    244   6e-74    
gb|KHN40275.1|  Tropinone reductase like                                243   7e-74    
gb|KDO52375.1|  hypothetical protein CISIN_1g024994mg                   243   7e-74    



>emb|CAD62568.1| putative tropinone reductase [Calystegia sepium]
Length=258

 Score =   381 bits (979),  Expect = 1e-127, Method: Compositional matrix adjust.
 Identities = 196/258 (76%), Positives = 220/258 (85%), Gaps = 1/258 (0%)
 Frame = -1

Query  1186  MAGRWSLHGMTALVTGGTRGLGHAIVEELACLGATVYTCSRTEKELEECIQNWKAKGYKV  1007
             MAGRWSL GMTALVTGGTRGLGHAIVEEL+ LGA  YTCSR +KEL+EC++NWK KGY V
Sbjct  1     MAGRWSLQGMTALVTGGTRGLGHAIVEELSSLGAIAYTCSRNQKELDECLKNWKEKGYPV  60

Query  1006  FGSVCDILQPSQRENLIQLVSKQFDGKLTILVNNVAILIPKETLKSDGQDFSNTIGTNLE  827
             FGS CDI Q S+RENLIQLV KQFDGKL ILVN+ A +IPKETL  + +D S  IGTNL 
Sbjct  61    FGSTCDISQQSERENLIQLVCKQFDGKLHILVNSAATIIPKETLNLNAEDNSIVIGTNLM  120

Query  826   ASLNLCQLAHPLLKATGNGsivfisscssfVYAPFHTIYAATKGGINSLVRNLACEWTND  647
              SLN  QLAHPLLKA+GNGSIVFISSC+SFV+ P HT+YAATKG INSL +NLACEW ND
Sbjct  121   TSLNFSQLAHPLLKASGNGSIVFISSCASFVFVPVHTVYAATKGAINSLAKNLACEWAND  180

Query  646   NIRVNAVAPWLMRTSLTESSREEFGA-VIEALIGRTLQHRLVEPKEASAAVAFLCFPAAS  470
             NIRVNAVAPW MRTSLTE++REE G  ++EALI RT QHRLVEPKEASAAVAFLCFPA+S
Sbjct  181   NIRVNAVAPWAMRTSLTEAAREEAGGEILEALIQRTPQHRLVEPKEASAAVAFLCFPASS  240

Query  469   SITGQIIRVDGGASVYGV  416
              +TGQ+I VDGGA+ YG+
Sbjct  241   FVTGQVICVDGGATSYGL  258



>ref|XP_006355361.1| PREDICTED: tropinone reductase homolog [Solanum tuberosum]
Length=263

 Score =   302 bits (773),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 154/255 (60%), Positives = 191/255 (75%), Gaps = 1/255 (0%)
 Frame = -1

Query  1180  GRWSLHGMTALVTGGTRGLGHAIVEELACLGATVYTCSRTEKELEECIQNWKAKGYKVFG  1001
             GRWSLHGMTALVTGGTRG+G+AIVEELA  GA++YTCSR +K+L+EC++ W+ KGYKV G
Sbjct  7     GRWSLHGMTALVTGGTRGIGYAIVEELASFGASIYTCSRNKKDLDECLEKWQTKGYKVNG  66

Query  1000  SVCDILQPSQRENLIQLVSKQFDGKLTILVNNVAILIPKETLKSDGQDFSNTIGTNLEAS  821
             S CD+    QR  LI   ++ F+GKL ILVNN AI +PKET +    D S  +GTN EAS
Sbjct  67    STCDLFLEDQRIELIDKATQHFNGKLDILVNNAAICVPKETAQITSADCSLMMGTNFEAS  126

Query  820   LNLCQLAHPLLKATGNGsivfisscssfVYAPFHTIYAATKGGINSLVRNLACEWTNDNI  641
              NLCQLA+P LK +G  SIVFISS S  +  PF ++YAATKG IN L +NLACEW  DNI
Sbjct  127   YNLCQLAYPYLKGSGKASIVFISSISGIMAIPFVSLYAATKGAINQLTKNLACEWGKDNI  186

Query  640   RVNAVAPWLMRTSLTESSREEF-GAVIEALIGRTLQHRLVEPKEASAAVAFLCFPAASSI  464
             RVNAVAPW++ T+LT++  E+F  + +E LI RT   R+ +P E S+ VA+LCFPAA+ I
Sbjct  187   RVNAVAPWIIDTALTDTVAEDFESSDVEKLIKRTPISRMGKPNEVSSLVAYLCFPAAAYI  246

Query  463   TGQIIRVDGGASVYG  419
             TGQII VDGG +V G
Sbjct  247   TGQIICVDGGKTVSG  261



>ref|XP_009621668.1| PREDICTED: tropinone reductase homolog [Nicotiana tomentosiformis]
Length=267

 Score =   301 bits (771),  Expect = 3e-96, Method: Compositional matrix adjust.
 Identities = 153/255 (60%), Positives = 191/255 (75%), Gaps = 1/255 (0%)
 Frame = -1

Query  1180  GRWSLHGMTALVTGGTRGLGHAIVEELACLGATVYTCSRTEKELEECIQNWKAKGYKVFG  1001
             GRWSLHGMTALVTGGTRG+GHAIVEELA  GAT++TCSR +K+L+EC++ W+ KGYKV G
Sbjct  11    GRWSLHGMTALVTGGTRGIGHAIVEELASFGATIFTCSRNKKDLDECLEKWQKKGYKVNG  70

Query  1000  SVCDILQPSQRENLIQLVSKQFDGKLTILVNNVAILIPKETLKSDGQDFSNTIGTNLEAS  821
             S CD+    QR  LI+  ++ F+G+L ILVNN  + +PKET K    D S  +GTN EAS
Sbjct  71    STCDLFSEDQRNQLIEKATEYFNGRLDILVNNAGVCVPKETTKITSGDCSLMMGTNFEAS  130

Query  820   LNLCQLAHPLLKATGNGsivfisscssfVYAPFHTIYAATKGGINSLVRNLACEWTNDNI  641
              +LCQLA+P LK +G  SIVFISS S  +  PF ++YAATKG IN L +NLACEW  DNI
Sbjct  131   YHLCQLAYPFLKVSGKASIVFISSISGIMAIPFVSLYAATKGAINQLTKNLACEWGKDNI  190

Query  640   RVNAVAPWLMRTSLTESSREEFGAV-IEALIGRTLQHRLVEPKEASAAVAFLCFPAASSI  464
             RVNAVAPW++ T+LT+S  E+F +  +E LI RT   R+ +P E S+ VA+LCFPAA+ I
Sbjct  191   RVNAVAPWIIDTALTDSVAEDFESKDVENLIKRTPISRMGKPNEVSSLVAYLCFPAAAYI  250

Query  463   TGQIIRVDGGASVYG  419
             TGQII VDGG +V G
Sbjct  251   TGQIICVDGGKTVCG  265



>ref|XP_004237405.1| PREDICTED: tropinone reductase homolog [Solanum lycopersicum]
Length=263

 Score =   300 bits (768),  Expect = 6e-96, Method: Compositional matrix adjust.
 Identities = 152/255 (60%), Positives = 191/255 (75%), Gaps = 1/255 (0%)
 Frame = -1

Query  1180  GRWSLHGMTALVTGGTRGLGHAIVEELACLGATVYTCSRTEKELEECIQNWKAKGYKVFG  1001
             GRWSLHGMTALVTGGTRG+G+AIVEELA  GA++YTCSR +K+L+EC++ W+ KGYKV G
Sbjct  7     GRWSLHGMTALVTGGTRGIGYAIVEELASFGASIYTCSRNKKDLDECLEKWQTKGYKVNG  66

Query  1000  SVCDILQPSQRENLIQLVSKQFDGKLTILVNNVAILIPKETLKSDGQDFSNTIGTNLEAS  821
             S CD+    QR  LI   ++ F+G+L ILVNN AI +PKET +    D S  +GTN EAS
Sbjct  67    STCDLFLEDQRIELIGKATQHFNGELDILVNNAAICVPKETTQITSADCSLMMGTNFEAS  126

Query  820   LNLCQLAHPLLKATGNGsivfisscssfVYAPFHTIYAATKGGINSLVRNLACEWTNDNI  641
              NLCQLA+P LK +G  S+VFISS S  +  PF ++YAATKG IN L +NLACEW  DNI
Sbjct  127   YNLCQLAYPFLKGSGKASVVFISSISGIMAIPFVSLYAATKGAINQLTKNLACEWGKDNI  186

Query  640   RVNAVAPWLMRTSLTESSREEF-GAVIEALIGRTLQHRLVEPKEASAAVAFLCFPAASSI  464
             RVNAVAPW++ T+LT++  E+F  + +E LI RT   R+ +P E S+ VA+LCFPAA+ I
Sbjct  187   RVNAVAPWIIDTALTDTVAEDFESSDVEKLIKRTPISRMGKPNEVSSLVAYLCFPAAAYI  246

Query  463   TGQIIRVDGGASVYG  419
             TGQII VDGG +V G
Sbjct  247   TGQIICVDGGKTVSG  261



>ref|XP_009794560.1| PREDICTED: tropinone reductase homolog [Nicotiana sylvestris]
Length=268

 Score =   300 bits (768),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 152/263 (58%), Positives = 191/263 (73%), Gaps = 2/263 (1%)
 Frame = -1

Query  1201  QQHNIMAGRWSLHGMTALVTGGTRGLGHAIVEELACLGATVYTCSRTEKELEECIQNWKA  1022
              ++N   GRWSLHGMTALVTGGTRG+GHAIVEELA  GAT++TCSR +K+L EC++ W+ 
Sbjct  4     NENNNGDGRWSLHGMTALVTGGTRGIGHAIVEELASFGATIFTCSRNKKDLIECLEKWQK  63

Query  1021  KGYKVFGSVCDILQPSQRENLIQLVSKQFDGKLTILVNNVAILIPKETLKSDGQDFSNTI  842
             KGYKV GS CD+    +R  LI+  ++ F+GKL ILVNN  I +PKET K+   D S  I
Sbjct  64    KGYKVNGSTCDLFSEDERNQLIEKATEYFNGKLDILVNNAGICVPKETTKTTSGDCSLMI  123

Query  841   GTNLEASLNLCQLAHPLLKATGNGsivfisscssfVYA-PFHTIYAATKGGINSLVRNLA  665
             GTN EAS +LCQLA+P LK +G  S +   S  S + A PF ++YAATKG IN L +NLA
Sbjct  124   GTNFEASYHLCQLAYPFLKVSGKASSIVFISSISGIMAIPFVSLYAATKGAINQLTKNLA  183

Query  664   CEWTNDNIRVNAVAPWLMRTSLTESSREEFGAV-IEALIGRTLQHRLVEPKEASAAVAFL  488
             CEW  DNIRVNAVAPW++ T+LT++  E+F +  +E LI RT   R+ +P E S+ VA+L
Sbjct  184   CEWGKDNIRVNAVAPWIIDTALTDTVAEDFESKDVENLIKRTPISRMGKPNEVSSLVAYL  243

Query  487   CFPAASSITGQIIRVDGGASVYG  419
             CFPAAS ITGQII VDGG +V G
Sbjct  244   CFPAASYITGQIICVDGGKTVCG  266



>ref|XP_010920509.1| PREDICTED: tropinone reductase homolog [Elaeis guineensis]
Length=272

 Score =   291 bits (744),  Expect = 4e-92, Method: Compositional matrix adjust.
 Identities = 152/256 (59%), Positives = 189/256 (74%), Gaps = 5/256 (2%)
 Frame = -1

Query  1180  GRWSLHGMTALVTGGTRGLGHAIVEELACLGATVYTCSRTEKELEECIQNWKAKGYKVFG  1001
             GRWSL GMTALVTGGTRG+GHA+VEELA  GATV+TCSR E EL EC++ W+A+G +V G
Sbjct  14    GRWSLQGMTALVTGGTRGIGHAVVEELAGFGATVHTCSRKEGELSECLKKWEAQGLRVTG  73

Query  1000  SVCDILQPSQRENLIQLVSKQFDGKLTILVNNVAILIPKETLKSDGQDFSNTIGTNLEAS  821
             SVCD+  P +RE+L++ VS  FDGKL IL+NN    I K+ ++   +++S+ + TNLE++
Sbjct  74    SVCDVSIPDRREDLMREVSSLFDGKLNILINNAGTNIRKKAVEYTAEEYSSIMATNLESA  133

Query  820   LNLCQLAHPLLKATGNGsivfisscssfVYAPFHTIYAATKGGINSLVRNLACEWTNDNI  641
              +LCQLAHP LKA G GSIVFISS +  V  P  TIYAATKG IN L +N ACEW  DNI
Sbjct  134   FHLCQLAHPFLKAAGRGSIVFISSVAGVVAVPSGTIYAATKGAINQLTKNFACEWAKDNI  193

Query  640   RVNAVAPWLMRTSLTES--SREEFGAVIEALIGRTLQHRLVEPKEASAAVAFLCFPAASS  467
             R N VAPW +RTSL E+   +EEF   +E L+ RT   R+ EP+E S+ VAFLC PAAS 
Sbjct  194   RTNCVAPWYIRTSLVENVIKQEEF---MERLVDRTPLGRVGEPEEVSSLVAFLCLPAASY  250

Query  466   ITGQIIRVDGGASVYG  419
             I+GQ+I VDGG SV G
Sbjct  251   ISGQVICVDGGMSVNG  266



>ref|XP_008801625.1| PREDICTED: tropinone reductase homolog At1g07440-like [Phoenix 
dactylifera]
Length=332

 Score =   290 bits (742),  Expect = 6e-91, Method: Compositional matrix adjust.
 Identities = 153/256 (60%), Positives = 188/256 (73%), Gaps = 5/256 (2%)
 Frame = -1

Query  1180  GRWSLHGMTALVTGGTRGLGHAIVEELACLGATVYTCSRTEKELEECIQNWKAKGYKVFG  1001
             GRWSL GMTALVTGGTRG+GHA+VEELA LGATV+TCSR E EL EC+  W+A+G +V G
Sbjct  77    GRWSLQGMTALVTGGTRGIGHAVVEELAGLGATVHTCSRKEGELSECLNKWEAQGLRVTG  136

Query  1000  SVCDILQPSQRENLIQLVSKQFDGKLTILVNNVAILIPKETLKSDGQDFSNTIGTNLEAS  821
             SVCD+  P QR++L++ VS  FDGKL IL+NNV   I K+ ++   +++S  + TNLE++
Sbjct  137   SVCDLSVPDQRDDLMRKVSSLFDGKLNILINNVGTNIRKKAIEYTAEEYSFIMATNLESA  196

Query  820   LNLCQLAHPLLKATGNGsivfisscssfVYAPFHTIYAATKGGINSLVRNLACEWTNDNI  641
              +LCQLAHPLLKA+G GSIVFISS +  V  P  TIYAATKG IN L +N ACEW  DNI
Sbjct  197   FHLCQLAHPLLKASGRGSIVFISSVAGVVAVPSGTIYAATKGAINQLTKNFACEWAKDNI  256

Query  640   RVNAVAPWLMRTSLTES--SREEFGAVIEALIGRTLQHRLVEPKEASAAVAFLCFPAASS  467
             R N+VAPW +RTSL E+    EEF   +E  + RT   R+ EP+E S+ VAFLC PAAS 
Sbjct  257   RTNSVAPWYIRTSLVENVIKDEEF---MERFVHRTPLGRVGEPEEVSSLVAFLCLPAASY  313

Query  466   ITGQIIRVDGGASVYG  419
             I GQ+I  DGG SV G
Sbjct  314   INGQVIIADGGMSVNG  329



>ref|XP_009772417.1| PREDICTED: tropinone reductase homolog [Nicotiana sylvestris]
Length=263

 Score =   286 bits (733),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 150/255 (59%), Positives = 185/255 (73%), Gaps = 3/255 (1%)
 Frame = -1

Query  1180  GRWSLHGMTALVTGGTRGLGHAIVEELACLGATVYTCSRTEKELEECIQNWKAKGYKVFG  1001
             GRWSL G TA+VTGGTRG+GHAIVEELA  GA VYTCSR + EL+EC++ WK KG KV G
Sbjct  5     GRWSLQGTTAIVTGGTRGIGHAIVEELASFGANVYTCSRNQMELDECLRQWKTKGSKVEG  64

Query  1000  SVCDILQPSQRENLIQLVSKQFDGKLTILVNNVAILIPKETLKSDGQDFSNTIGTNLEAS  821
             SVCD+L  SQRE  +  VS  FDGK+ IL+NN A+ I K T +   +D++  +G N EAS
Sbjct  65    SVCDLLSRSQREKFMDTVSSYFDGKINILINNAAVAIAKLTTEFTHEDYNTMMGINFEAS  124

Query  820   LNLCQLAHPLLKATGNGsivfisscssfVYAPFHTIYAATKGGINSLVRNLACEWTNDNI  641
              +L QLAHP LKA+GNGSIVFISS +  V  P  +IY+A+KG +N L R+LACEW  DNI
Sbjct  125   YHLSQLAHPFLKASGNGSIVFISSVAGLVSLPLCSIYSASKGAMNQLARSLACEWAKDNI  184

Query  640   RVNAVAPWLMRTSLTESSREE--FGAVIEALIGRT-LQHRLVEPKEASAAVAFLCFPAAS  470
             RVNAVAPW++RTSL +++ +       I  L  RT +  R+ EPKE SA VAFLCFP AS
Sbjct  185   RVNAVAPWIIRTSLIDAASQNPVHKENINKLTSRTPIGGRVGEPKEVSAMVAFLCFPCAS  244

Query  469   SITGQIIRVDGGASV  425
              ITGQI+ VDGG ++
Sbjct  245   YITGQIMCVDGGITI  259



>sp|P50165.1|TRNH_DATST RecName: Full=Tropinone reductase homolog; AltName: Full=P29X 
[Datura stramonium]
 gb|AAA33280.1| 29kDa protein; high homology to aa sequence of tropinone reductases 
[Datura stramonium]
Length=268

 Score =   285 bits (729),  Expect = 6e-90, Method: Compositional matrix adjust.
 Identities = 144/255 (56%), Positives = 183/255 (72%), Gaps = 2/255 (1%)
 Frame = -1

Query  1177  RWSLHGMTALVTGGTRGLGHAIVEELACLGATVYTCSRTEKELEECIQNWKAKGYKVFGS  998
             RWSL GMTALVTGGTRG+G+AIVEELA  GA VYTCSR++ +L+EC++ W+ KG+KV G 
Sbjct  12    RWSLRGMTALVTGGTRGIGYAIVEELANFGAEVYTCSRSQNDLDECLEKWRRKGFKVSGP  71

Query  997   VCDILQPSQRENLIQLVSKQFDGKLTILVNNVAILIPKETLKSDGQDFSNTIGTNLEASL  818
             VCD+   SQR+ L++ V+  F+GKL IL+NN    IPKE      +D+S  +GTN EAS 
Sbjct  72    VCDVSSISQRQTLMESVTSSFNGKLNILINNAGTTIPKEATNFTAEDYSIIMGTNFEASY  131

Query  817   NLCQLAHPLLKATGNGsivfisscssfVYAPFHTIYAATKGGINSLVRNLACEWTNDNIR  638
             NLCQLAHPLLKA+GN SIVF SS +  +  P  +IYAA+KG IN + ++LACEW  D+IR
Sbjct  132   NLCQLAHPLLKASGNASIVFNSSAAGVIAVPLSSIYAASKGAINQVTKSLACEWAKDSIR  191

Query  637   VNAVAPWLMRTSLTESSRE--EFGAVIEALIGRTLQHRLVEPKEASAAVAFLCFPAASSI  464
             VNAVAPW++ T + E++ +       IE+LIGR    R  EP E S+ V +LC P AS I
Sbjct  192   VNAVAPWIINTPIIEAACQVPSQKKNIESLIGRAPMKRAGEPSEVSSLVTYLCLPTASYI  251

Query  463   TGQIIRVDGGASVYG  419
             TGQII VDGG +V G
Sbjct  252   TGQIICVDGGYTVNG  266



>ref|XP_006341201.1| PREDICTED: tropinone reductase homolog [Solanum tuberosum]
Length=263

 Score =   285 bits (728),  Expect = 7e-90, Method: Compositional matrix adjust.
 Identities = 147/257 (57%), Positives = 189/257 (74%), Gaps = 3/257 (1%)
 Frame = -1

Query  1180  GRWSLHGMTALVTGGTRGLGHAIVEELACLGATVYTCSRTEKELEECIQNWKAKGYKVFG  1001
             GRW+L G TA+VTGGTRG+G+AIVEELA  GA VYTCSR + EL+EC++ WKAKG+KV G
Sbjct  5     GRWTLQGNTAIVTGGTRGIGYAIVEELASFGANVYTCSRNQMELDECLRKWKAKGFKVGG  64

Query  1000  SVCDILQPSQRENLIQLVSKQFDGKLTILVNNVAILIPKETLKSDGQDFSNTIGTNLEAS  821
             S+CD+L  +QR+  +  VS  FDGK+ IL+NN A+++     +S  +D++  +GTN EAS
Sbjct  65    SMCDLLSRTQRQKFMDNVSSYFDGKINILINNAAVIVSNLATESTHEDYNTMMGTNFEAS  124

Query  820   LNLCQLAHPLLKATGNGsivfisscssfVYAPFHTIYAATKGGINSLVRNLACEWTNDNI  641
              +L QLAHP LKA+ NG IVFISS + FV  PF +IY+A KG +N L R+LACEW  DNI
Sbjct  125   YHLSQLAHPFLKASKNGRIVFISSVAGFVSLPFCSIYSAAKGAMNQLTRSLACEWAMDNI  184

Query  640   RVNAVAPWLMRTSLTESSRE--EFGAVIEALIGRT-LQHRLVEPKEASAAVAFLCFPAAS  470
             RVNAVAPW+++TSL E++ +  E    I  L+ RT +  R  EPKE SA VAFLCFP AS
Sbjct  185   RVNAVAPWVIKTSLIEAASQDSEVKKRINKLVSRTPIGGRPGEPKEVSAMVAFLCFPCAS  244

Query  469   SITGQIIRVDGGASVYG  419
              ITGQI+ VDGG ++ G
Sbjct  245   YITGQIMCVDGGITING  261



>ref|XP_009630417.1| PREDICTED: tropinone reductase 1-like [Nicotiana tomentosiformis]
Length=263

 Score =   283 bits (724),  Expect = 3e-89, Method: Compositional matrix adjust.
 Identities = 149/255 (58%), Positives = 183/255 (72%), Gaps = 3/255 (1%)
 Frame = -1

Query  1180  GRWSLHGMTALVTGGTRGLGHAIVEELACLGATVYTCSRTEKELEECIQNWKAKGYKVFG  1001
             GRWSL G TA+VTGGTRG+GHAIVEELA  GA VYTCSR + EL+EC++ WK KG+KV G
Sbjct  5     GRWSLQGTTAIVTGGTRGIGHAIVEELASFGANVYTCSRNQMELDECLRQWKTKGFKVEG  64

Query  1000  SVCDILQPSQRENLIQLVSKQFDGKLTILVNNVAILIPKETLKSDGQDFSNTIGTNLEAS  821
             SVCD+L  SQRE  +  VS  FDGK+ IL+NN  + I K T +   +D++  +G N EAS
Sbjct  65    SVCDLLSRSQREKFMDTVSNYFDGKINILINNAGVAIAKLTTEFTHEDYNTMMGINFEAS  124

Query  820   LNLCQLAHPLLKATGNGsivfisscssfVYAPFHTIYAATKGGINSLVRNLACEWTNDNI  641
              +L QLAHP L+A+GNGSIVFISS +  V  P  +IY+A+KG +N L R+LACEW  DNI
Sbjct  125   YHLSQLAHPFLQASGNGSIVFISSVAGLVSLPLCSIYSASKGAMNQLTRSLACEWAKDNI  184

Query  640   RVNAVAPWLMRTSLTE--SSREEFGAVIEALIGRT-LQHRLVEPKEASAAVAFLCFPAAS  470
             RVNAVAPW++RTSL +  S        I  L  RT +  R+ EPKE SA VAFLCFP AS
Sbjct  185   RVNAVAPWIIRTSLIDVASQNPVHKENINKLTIRTPIGGRVGEPKEVSAMVAFLCFPCAS  244

Query  469   SITGQIIRVDGGASV  425
              ITGQI+ VDGG ++
Sbjct  245   YITGQIMCVDGGITI  259



>ref|XP_002299847.1| tropinone reductase family protein [Populus trichocarpa]
 gb|ABK94936.1| unknown [Populus trichocarpa]
 gb|EEE84652.1| tropinone reductase family protein [Populus trichocarpa]
Length=266

 Score =   281 bits (718),  Expect = 3e-88, Method: Compositional matrix adjust.
 Identities = 151/254 (59%), Positives = 184/254 (72%), Gaps = 2/254 (1%)
 Frame = -1

Query  1177  RWSLHGMTALVTGGTRGLGHAIVEELACLGATVYTCSRTEKELEECIQNWKAKGYKVFGS  998
             RW LHGMTALVTGG++GLGHAIVEELA LGAT++TC+RTE  L EC+Q WK KG+KV GS
Sbjct  13    RWLLHGMTALVTGGSKGLGHAIVEELAGLGATIHTCARTESVLNECLQEWKMKGFKVTGS  72

Query  997   VCDILQPSQRENLIQLVSKQFDGKLTILVNNVAILIPKETLKSDGQDFSNTIGTNLEASL  818
             VCD+   ++RE L+  VS QFDGKL ILVNNV IL  + T+    +D S  + TN E++ 
Sbjct  73    VCDVSSRTEREKLMSTVSSQFDGKLNILVNNVGILYFQRTIDVTPEDISLYLSTNFESAY  132

Query  817   NLCQLAHPLLKATGNGsivfisscssfVYAPFHTIYAATKGGINSLVRNLACEWTNDNIR  638
             +LCQLAHPLLK +G G+IVF+SS S  V     ++Y ATKG IN L +NLACEW  DNIR
Sbjct  133   HLCQLAHPLLKNSGAGNIVFMSSVSGVVSV-SVSLYGATKGAINQLTKNLACEWAKDNIR  191

Query  637   VNAVAPWLMRTSLTESSREEFGAVIEALIGRTLQHRLVEPKEASAAVAFLCFPAASSITG  458
              N+VAPWL+RT L E   E     ++A+  RT   RL EPKE S+ VAFLC PAAS ITG
Sbjct  192   ANSVAPWLIRTPLVERDLEN-ELFLKAVEARTPMGRLGEPKEVSSLVAFLCMPAASYITG  250

Query  457   QIIRVDGGASVYGV  416
             Q+I VDGG +V G+
Sbjct  251   QVICVDGGFTVNGL  264



>ref|XP_009375951.1| PREDICTED: tropinone reductase homolog At1g07440-like [Pyrus 
x bretschneideri]
Length=264

 Score =   280 bits (717),  Expect = 3e-88, Method: Compositional matrix adjust.
 Identities = 148/260 (57%), Positives = 184/260 (71%), Gaps = 3/260 (1%)
 Frame = -1

Query  1192  NIMAGRWSLHGMTALVTGGTRGLGHAIVEELACLGATVYTCSRTEKELEECIQNWKAKGY  1013
             N   GRWSL GMTALVTGGT+G+G+AIVEELA LGA V+TCSR E +L +C   WK KG+
Sbjct  2     NSREGRWSLRGMTALVTGGTKGIGYAIVEELAGLGAIVHTCSRNEVDLNDCQSQWKKKGF  61

Query  1012  KVFGSVCDILQPSQRENLIQLVSKQFDGKLTILVNNVAILIPKETLKSDGQDFSNTIGTN  833
             +V GSVCD++  +QRE LI  VS  FDGKL I +NNV  ++PK TL+   +D+S  + TN
Sbjct  62    QVTGSVCDVVSKTQREELINKVSSLFDGKLNIFINNVGTVVPKATLEYTAEDYSFMMSTN  121

Query  832   LEASLNLCQLAHPLLKATGNGsivfisscssfVYAPFHTIYAATKGGINSLVRNLACEWT  653
             LE++ NLCQL HPLLKA+G  +IVF+SS +  V A   +IY+ATKG +N L +NLACEW 
Sbjct  122   LESAYNLCQLTHPLLKASGVANIVFVSSVAGVVSASVGSIYSATKGAMNQLAKNLACEWA  181

Query  652   NDNIRVNAVAPWLMRTSLTESS-REEFGAVIEALIGRTLQHRLVEPKEASAAVAFLCFPA  476
              DNIR N+VAPW +RT L E   R+E    +E +  R    R  EPKE S+ VAFLC PA
Sbjct  182   KDNIRTNSVAPWFIRTPLVEPFLRDE--KKLEMINSRCPLGRPGEPKEVSSLVAFLCLPA  239

Query  475   ASSITGQIIRVDGGASVYGV  416
             AS ITGQ I VDGG +V G+
Sbjct  240   ASYITGQTIIVDGGVTVNGL  259



>ref|XP_010654243.1| PREDICTED: tropinone reductase homolog [Vitis vinifera]
Length=269

 Score =   280 bits (715),  Expect = 7e-88, Method: Compositional matrix adjust.
 Identities = 147/255 (58%), Positives = 184/255 (72%), Gaps = 2/255 (1%)
 Frame = -1

Query  1177  RWSLHGMTALVTGGTRGLGHAIVEELACLGATVYTCSRTEKELEECIQNWKAKGYKVFGS  998
             RWSL G TALVTGGTRG+GHAIVEELA  GATV+TCSR +KEL+E +Q WK+KG+KV GS
Sbjct  14    RWSLQGTTALVTGGTRGIGHAIVEELAAFGATVHTCSRNQKELDEMLQVWKSKGFKVSGS  73

Query  997   VCDILQPSQRENLIQLVSKQFDGKLTILVNNVAILIPKETLKSDGQDFSNTIGTNLEASL  818
             VCD+    QR  L+  VS  FDGKL ILVNN   +I K T +   +D S  +GTN E++ 
Sbjct  74    VCDVSSRPQRTQLMDTVSSLFDGKLNILVNNAGTVISKRTEEYTVEDVSIIMGTNFESAY  133

Query  817   NLCQLAHPLLKATGNGsivfisscssfVYAPFHTIYAATKGGINSLVRNLACEWTNDNIR  638
             +L QL +PLLKA+G GSIVFISS +  +  P  +IYAA+KG +N + RNLACEW  DNIR
Sbjct  134   HLSQLGYPLLKASGRGSIVFISSVAGVMALPVISIYAASKGAMNQVTRNLACEWAEDNIR  193

Query  637   VNAVAPWLMRTSLTESSREEFGA--VIEALIGRTLQHRLVEPKEASAAVAFLCFPAASSI  464
             VN +APW++ TSL   ++++  +   I+ +I RT   R+ EP E S+ VAFLCFPAAS I
Sbjct  194   VNTIAPWVINTSLIHKAKDDPSSEEKIKRIISRTPICRMGEPDEVSSLVAFLCFPAASYI  253

Query  463   TGQIIRVDGGASVYG  419
             TGQ+I VDGG SV G
Sbjct  254   TGQVICVDGGYSVTG  268



>ref|XP_011006388.1| PREDICTED: tropinone reductase homolog [Populus euphratica]
Length=275

 Score =   280 bits (715),  Expect = 8e-88, Method: Compositional matrix adjust.
 Identities = 146/257 (57%), Positives = 187/257 (73%), Gaps = 4/257 (2%)
 Frame = -1

Query  1177  RWSLHGMTALVTGGTRGLGHAIVEELACLGATVYTCSRTEKELEECIQNWKAKGYKVFGS  998
             RWSL GMTALVTGGTRG+G AIVEELA  GA V+TCSR E +L+ECI+ W++KG++V GS
Sbjct  12    RWSLKGMTALVTGGTRGIGFAIVEELAGFGAAVHTCSRNETKLDECIREWESKGFRVTGS  71

Query  997   VCDILQPSQRENLIQLVSKQFDGKLTILVNNVAILIPKETLKSDGQDFSNTIGTNLEASL  818
             VCD+   +QRE LI+ VS  F GKL ILVNN A ++ K + K   +D +NT+GTN+EAS 
Sbjct  72    VCDVSCRTQREKLIEKVSSTFQGKLNILVNNAAAVVSKNSTKVTAEDMANTLGTNVEASY  131

Query  817   NLCQLAHPLLKATGNGsivfisscssfVYAPFHTIYAATKGGINSLVRNLACEWTNDNIR  638
             +LCQLAHPLLKA+GNGSIVFISS ++ V  P  + Y A+KG +N L ++LACEW  D IR
Sbjct  132   HLCQLAHPLLKASGNGSIVFISSVAAVVALPTLSFYGASKGALNQLTKSLACEWAQDKIR  191

Query  637   VNAVAPWLMRTSLTES----SREEFGAVIEALIGRTLQHRLVEPKEASAAVAFLCFPAAS  470
              NAV+PW+++T L ++    S  E  A +  ++ +T  +RL EP E S+ VAFLC P AS
Sbjct  192   ANAVSPWIIKTPLLDASLAKSASEQRAGMSRIVSQTPINRLGEPTEISSLVAFLCLPTAS  251

Query  469   SITGQIIRVDGGASVYG  419
              ITGQII VDGG +  G
Sbjct  252   YITGQIISVDGGYTANG  268



>ref|XP_006493561.1| PREDICTED: tropinone reductase homolog [Citrus sinensis]
Length=263

 Score =   279 bits (713),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 146/255 (57%), Positives = 182/255 (71%), Gaps = 2/255 (1%)
 Frame = -1

Query  1177  RWSLHGMTALVTGGTRGLGHAIVEELACLGATVYTCSRTEKELEECIQNWKAKGYKVFGS  998
             RWSL GMTALVTGGTRG+GHAIVEEL   GA V+TCSR E EL E IQ WK+KG KV GS
Sbjct  8     RWSLKGMTALVTGGTRGIGHAIVEELTAFGAIVHTCSRNETELNERIQEWKSKGLKVSGS  67

Query  997   VCDILQPSQRENLIQLVSKQFDGKLTILVNNVAILIPKETLKSDGQDFSNTIGTNLEASL  818
              CD+   ++R+ L++ V  +FDGKL ILVNN    IPKE  +   +DFS  + TN E++ 
Sbjct  68    ACDLKIRAERQKLMEAVCSEFDGKLNILVNNAGTTIPKEATEFTMEDFSTIMTTNFESAY  127

Query  817   NLCQLAHPLLKATGNGsivfisscssfVYAPFHTIYAATKGGINSLVRNLACEWTNDNIR  638
             +L QLA+PLLKA+GNG+I+FISS +  +  P  +IYA+TKG +N L +NLACEW  DNIR
Sbjct  128   HLSQLAYPLLKASGNGNIIFISSVTGVIAVPLSSIYASTKGAMNQLTKNLACEWGKDNIR  187

Query  637   VNAVAPWLMRTSLTESSREEFGAVIEA--LIGRTLQHRLVEPKEASAAVAFLCFPAASSI  464
             VNAVAPW++RTSL +S  ++   +  A  LI RT   R  EP E S+ VAFLC PAAS +
Sbjct  188   VNAVAPWIIRTSLIDSIEKDPRVMEHASRLIPRTPIPRPGEPNEVSSVVAFLCLPAASYV  247

Query  463   TGQIIRVDGGASVYG  419
             TGQ+  +DGG SV G
Sbjct  248   TGQVFCIDGGYSVNG  262



>ref|XP_010650985.1| PREDICTED: tropinone reductase homolog At1g07440-like isoform 
X3 [Vitis vinifera]
 ref|XP_010650988.1| PREDICTED: tropinone reductase homolog At1g07440-like isoform 
X6 [Vitis vinifera]
Length=270

 Score =   279 bits (714),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 146/255 (57%), Positives = 185/255 (73%), Gaps = 5/255 (2%)
 Frame = -1

Query  1177  RWSLHGMTALVTGGTRGLGHAIVEELACLGATVYTCSRTEKELEECIQNWKAKGYKVFGS  998
             RWSL GMTALVTGGT+G+GHAIVEELA LGAT++TCSR E EL EC+++WKAKG+ V GS
Sbjct  13    RWSLKGMTALVTGGTKGIGHAIVEELAGLGATIHTCSRKETELNECLKDWKAKGFGVSGS  72

Query  997   VCDILQPSQRENLIQLVSKQFDGKLTILVNNVAILIPKETLKSDGQDFSNTIGTNLEASL  818
             VCD+  P+QRE L++ VS  F GKL ILVNN AI+I K T++   ++FS  +  N E+  
Sbjct  73    VCDVSSPAQREKLMETVSSVFKGKLNILVNNAAIVIQKPTVEVTAEEFSTIMAINFESVY  132

Query  817   NLCQLAHPLLKATGNGsivfisscssfVYAPFHTIYAATKGGINSLVRNLACEWTNDNIR  638
             +L QLAHPLLKA+G GSIVFISS +  V   + + Y+ATKG +N L +NLACEW  DNIR
Sbjct  133   HLSQLAHPLLKASGAGSIVFISSVAGVVSLKYLSAYSATKGAMNQLTKNLACEWAEDNIR  192

Query  637   VNAVAPWLMRTSLTES--SREEFGAVIEALIGRTLQHRLVEPKEASAAVAFLCFPAASSI  464
              NAVAPW ++T + +   S + F   +E +I R    R+ +PKE S+ VAFLC PA+S I
Sbjct  193   SNAVAPWYIKTPMVDQMLSNKTF---LEGVINRAPLRRVGDPKEVSSLVAFLCLPASSYI  249

Query  463   TGQIIRVDGGASVYG  419
             TGQ I VDGG +V G
Sbjct  250   TGQTICVDGGVTVNG  264



>ref|XP_006429154.1| hypothetical protein CICLE_v10012494mg [Citrus clementina]
 gb|ESR42394.1| hypothetical protein CICLE_v10012494mg [Citrus clementina]
Length=263

 Score =   279 bits (713),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 147/255 (58%), Positives = 183/255 (72%), Gaps = 2/255 (1%)
 Frame = -1

Query  1177  RWSLHGMTALVTGGTRGLGHAIVEELACLGATVYTCSRTEKELEECIQNWKAKGYKVFGS  998
             RWSL GMTALVTGGTRG+G+AIVEEL   GA V+TCSR E EL E IQ WK+KG KV GS
Sbjct  8     RWSLKGMTALVTGGTRGIGYAIVEELTAFGAIVHTCSRNETELNERIQEWKSKGLKVSGS  67

Query  997   VCDILQPSQRENLIQLVSKQFDGKLTILVNNVAILIPKETLKSDGQDFSNTIGTNLEASL  818
              CD+   ++R+ L++ V  +FDGKL ILVNN    IPKE  +   +DFS  + TN E++ 
Sbjct  68    ACDLKIRAERQKLMETVCSEFDGKLNILVNNAGTTIPKEATEFTMEDFSTIMTTNFESAY  127

Query  817   NLCQLAHPLLKATGNGsivfisscssfVYAPFHTIYAATKGGINSLVRNLACEWTNDNIR  638
             +L QLA+PLLKA+GNG+I+FISS +  +  P  +IYA+TKG +N L +NLACEW  DNIR
Sbjct  128   HLSQLAYPLLKASGNGNIIFISSVTGVIAVPLCSIYASTKGAMNQLTKNLACEWGKDNIR  187

Query  637   VNAVAPWLMRTSLTESSREEFGAVIEA--LIGRTLQHRLVEPKEASAAVAFLCFPAASSI  464
             VNAVAPW++RTSL +S  ++   +  A  LI RT   R  EP E S+ VAFLC PAAS I
Sbjct  188   VNAVAPWIIRTSLIDSIEKDPRVLEHASRLIARTPIPRPGEPNEVSSVVAFLCLPAASYI  247

Query  463   TGQIIRVDGGASVYG  419
             TGQ+I +DGG SV G
Sbjct  248   TGQVICIDGGYSVTG  262



>emb|CBI30508.3| unnamed protein product [Vitis vinifera]
Length=277

 Score =   279 bits (714),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 147/255 (58%), Positives = 184/255 (72%), Gaps = 2/255 (1%)
 Frame = -1

Query  1177  RWSLHGMTALVTGGTRGLGHAIVEELACLGATVYTCSRTEKELEECIQNWKAKGYKVFGS  998
             RWSL G TALVTGGTRG+GHAIVEELA  GATV+TCSR +KEL+E +Q WK+KG+KV GS
Sbjct  7     RWSLQGTTALVTGGTRGIGHAIVEELAAFGATVHTCSRNQKELDEMLQVWKSKGFKVSGS  66

Query  997   VCDILQPSQRENLIQLVSKQFDGKLTILVNNVAILIPKETLKSDGQDFSNTIGTNLEASL  818
             VCD+    QR  L+  VS  FDGKL ILVNN   +I K T +   +D S  +GTN E++ 
Sbjct  67    VCDVSSRPQRTQLMDTVSSLFDGKLNILVNNAGTVISKRTEEYTVEDVSIIMGTNFESAY  126

Query  817   NLCQLAHPLLKATGNGsivfisscssfVYAPFHTIYAATKGGINSLVRNLACEWTNDNIR  638
             +L QL +PLLKA+G GSIVFISS +  +  P  +IYAA+KG +N + RNLACEW  DNIR
Sbjct  127   HLSQLGYPLLKASGRGSIVFISSVAGVMALPVISIYAASKGAMNQVTRNLACEWAEDNIR  186

Query  637   VNAVAPWLMRTSLTESSREEFGA--VIEALIGRTLQHRLVEPKEASAAVAFLCFPAASSI  464
             VN +APW++ TSL   ++++  +   I+ +I RT   R+ EP E S+ VAFLCFPAAS I
Sbjct  187   VNTIAPWVINTSLIHKAKDDPSSEEKIKRIISRTPICRMGEPDEVSSLVAFLCFPAASYI  246

Query  463   TGQIIRVDGGASVYG  419
             TGQ+I VDGG SV G
Sbjct  247   TGQVICVDGGYSVTG  261



>ref|XP_006493560.1| PREDICTED: tropinone reductase homolog [Citrus sinensis]
Length=263

 Score =   278 bits (712),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 147/255 (58%), Positives = 183/255 (72%), Gaps = 2/255 (1%)
 Frame = -1

Query  1177  RWSLHGMTALVTGGTRGLGHAIVEELACLGATVYTCSRTEKELEECIQNWKAKGYKVFGS  998
             RWSL GMTALVTGGTRG+G+AIVEEL   GA V+TCSR E EL E IQ WK+KG KV GS
Sbjct  8     RWSLKGMTALVTGGTRGIGYAIVEELTAFGAIVHTCSRNETELNERIQEWKSKGLKVSGS  67

Query  997   VCDILQPSQRENLIQLVSKQFDGKLTILVNNVAILIPKETLKSDGQDFSNTIGTNLEASL  818
              CD+   ++R+ L++ V  +FDGKL ILVNN    IPKE  +   +DFS  + TN E++ 
Sbjct  68    ACDLKIRAERQKLMEAVCSEFDGKLNILVNNAGTTIPKEATEFTMEDFSTIMTTNFESAY  127

Query  817   NLCQLAHPLLKATGNGsivfisscssfVYAPFHTIYAATKGGINSLVRNLACEWTNDNIR  638
             +L QLA+PLLKA+GNG+I+FISS +  +  P  +IYA+TKG +N L +NLACEW  DNIR
Sbjct  128   HLSQLAYPLLKASGNGNIIFISSVTGVIAVPLCSIYASTKGAMNQLTKNLACEWGKDNIR  187

Query  637   VNAVAPWLMRTSLTESSREEFGAVIEA--LIGRTLQHRLVEPKEASAAVAFLCFPAASSI  464
             VNAVAPW++RTSL +S  ++   +  A  LI RT   R  EP E S+ VAFLC PAAS I
Sbjct  188   VNAVAPWIIRTSLIDSIEKDPRVLEHASRLIARTPIPRPGEPNEVSSVVAFLCLPAASYI  247

Query  463   TGQIIRVDGGASVYG  419
             TGQ+I +DGG SV G
Sbjct  248   TGQVICIDGGYSVTG  262



>ref|XP_011035255.1| PREDICTED: tropinone reductase homolog At1g07440-like [Populus 
euphratica]
Length=266

 Score =   278 bits (712),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 150/254 (59%), Positives = 183/254 (72%), Gaps = 2/254 (1%)
 Frame = -1

Query  1177  RWSLHGMTALVTGGTRGLGHAIVEELACLGATVYTCSRTEKELEECIQNWKAKGYKVFGS  998
             RW L GMTALVTGG++GLGHAIVEELA LGAT++TC+RTE  L EC+Q WK KG+KV GS
Sbjct  13    RWLLLGMTALVTGGSKGLGHAIVEELAGLGATIHTCARTESVLNECLQEWKMKGFKVTGS  72

Query  997   VCDILQPSQRENLIQLVSKQFDGKLTILVNNVAILIPKETLKSDGQDFSNTIGTNLEASL  818
             VCD+   ++RE L+  VS QFDGKL ILVNNV IL  + T+    +D S  + TN E++ 
Sbjct  73    VCDVTSRTEREKLMSTVSSQFDGKLNILVNNVGILYFQRTIDVTPEDISRYLSTNFESAY  132

Query  817   NLCQLAHPLLKATGNGsivfisscssfVYAPFHTIYAATKGGINSLVRNLACEWTNDNIR  638
             +LCQLAHPLLK +G G+IVF+SS S  V     ++Y ATKG IN L +NLACEW  DNIR
Sbjct  133   HLCQLAHPLLKNSGAGNIVFMSSVSGVVSV-SVSLYGATKGAINQLTKNLACEWAKDNIR  191

Query  637   VNAVAPWLMRTSLTESSREEFGAVIEALIGRTLQHRLVEPKEASAAVAFLCFPAASSITG  458
              N+VAPWL+RT L E   E     ++A+  RT   RL EPKE S+ VAFLC PAAS ITG
Sbjct  192   ANSVAPWLIRTPLVERDLEN-ELFLKAVEARTPMGRLGEPKEVSSLVAFLCMPAASYITG  250

Query  457   QIIRVDGGASVYGV  416
             Q+I VDGG +V G+
Sbjct  251   QVICVDGGFTVNGL  264



>emb|CBI30506.3| unnamed protein product [Vitis vinifera]
Length=267

 Score =   277 bits (709),  Expect = 6e-87, Method: Compositional matrix adjust.
 Identities = 145/255 (57%), Positives = 179/255 (70%), Gaps = 2/255 (1%)
 Frame = -1

Query  1177  RWSLHGMTALVTGGTRGLGHAIVEELACLGATVYTCSRTEKELEECIQNWKAKGYKVFGS  998
             RWSL GMTALVTGG+RG+GHAIVEELA  GATV+TCSR ++EL++ +Q WK KG+KV  S
Sbjct  12    RWSLEGMTALVTGGSRGIGHAIVEELAAFGATVHTCSRNQEELDQRLQEWKNKGFKVSAS  71

Query  997   VCDILQPSQRENLIQLVSKQFDGKLTILVNNVAILIPKETLKSDGQDFSNTIGTNLEASL  818
             +CD+   SQR  L++ VS  FDGKL+ILVNN   +I KE  +   +DFS  +GTN E++ 
Sbjct  72    LCDVSSRSQRTQLMETVSSIFDGKLSILVNNAGTIILKEATECTAEDFSTIMGTNFESAY  131

Query  817   NLCQLAHPLLKATGNGsivfisscssfVYAPFHTIYAATKGGINSLVRNLACEWTNDNIR  638
             +LCQL HPLLKA+GNGSIVFISS S  +  P  +IYAA+KG +N + +NLACEW  D IR
Sbjct  132   HLCQLGHPLLKASGNGSIVFISSISGLLAFPASSIYAASKGAMNQVTKNLACEWAKDGIR  191

Query  637   VNAVAPWLMRTSLTE--SSREEFGAVIEALIGRTLQHRLVEPKEASAAVAFLCFPAASSI  464
             VN +APW+++TSL             +  LI RT   R  EP E S  VAFLCFP AS I
Sbjct  192   VNTIAPWIIKTSLLHVIDDHPNIKENMSRLISRTPISRPGEPDEVSPLVAFLCFPVASYI  251

Query  463   TGQIIRVDGGASVYG  419
             TGQ+I VDGG  V G
Sbjct  252   TGQVICVDGGYKVTG  266



>ref|XP_006429155.1| hypothetical protein CICLE_v10012221mg [Citrus clementina]
 gb|ESR42395.1| hypothetical protein CICLE_v10012221mg [Citrus clementina]
Length=320

 Score =   279 bits (713),  Expect = 9e-87, Method: Compositional matrix adjust.
 Identities = 146/255 (57%), Positives = 182/255 (71%), Gaps = 2/255 (1%)
 Frame = -1

Query  1177  RWSLHGMTALVTGGTRGLGHAIVEELACLGATVYTCSRTEKELEECIQNWKAKGYKVFGS  998
             RWSL GMTALVTGGTRG+GHAIVEEL   GA V+TCSR E EL E IQ WK+KG KV GS
Sbjct  65    RWSLKGMTALVTGGTRGIGHAIVEELTAFGAIVHTCSRNETELNERIQEWKSKGLKVSGS  124

Query  997   VCDILQPSQRENLIQLVSKQFDGKLTILVNNVAILIPKETLKSDGQDFSNTIGTNLEASL  818
              CD+   ++R+ L++ V  +FDGKL ILVNN    IPKE  +   +DFS  + TN E++ 
Sbjct  125   ACDLKIRAERQKLMEAVCSEFDGKLNILVNNAGTTIPKEATEFTMEDFSTIMTTNFESAY  184

Query  817   NLCQLAHPLLKATGNGsivfisscssfVYAPFHTIYAATKGGINSLVRNLACEWTNDNIR  638
             +L QLA+PLLKA+GNG+I+FISS +  +  P  +IYA+TKG +N L +NLACEW  DNIR
Sbjct  185   HLSQLAYPLLKASGNGNIIFISSVTGVIAVPLSSIYASTKGAMNQLTKNLACEWGKDNIR  244

Query  637   VNAVAPWLMRTSLTESSREEFGAVIEA--LIGRTLQHRLVEPKEASAAVAFLCFPAASSI  464
             VNAVAPW++RTSL +S  ++   +  A  LI RT   R  EP E S+ VAFLC PAAS +
Sbjct  245   VNAVAPWIIRTSLIDSIEKDPRVMEHASRLIPRTPIPRPGEPNEVSSVVAFLCLPAASYV  304

Query  463   TGQIIRVDGGASVYG  419
             TGQ+  +DGG SV G
Sbjct  305   TGQVFCIDGGYSVNG  319



>ref|XP_002271837.2| PREDICTED: tropinone reductase homolog [Vitis vinifera]
Length=291

 Score =   277 bits (709),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 145/255 (57%), Positives = 179/255 (70%), Gaps = 2/255 (1%)
 Frame = -1

Query  1177  RWSLHGMTALVTGGTRGLGHAIVEELACLGATVYTCSRTEKELEECIQNWKAKGYKVFGS  998
             RWSL GMTALVTGG+RG+GHAIVEELA  GATV+TCSR ++EL++ +Q WK KG+KV  S
Sbjct  36    RWSLEGMTALVTGGSRGIGHAIVEELAAFGATVHTCSRNQEELDQRLQEWKNKGFKVSAS  95

Query  997   VCDILQPSQRENLIQLVSKQFDGKLTILVNNVAILIPKETLKSDGQDFSNTIGTNLEASL  818
             +CD+   SQR  L++ VS  FDGKL+ILVNN   +I KE  +   +DFS  +GTN E++ 
Sbjct  96    LCDVSSRSQRTQLMETVSSIFDGKLSILVNNAGTIILKEATECTAEDFSTIMGTNFESAY  155

Query  817   NLCQLAHPLLKATGNGsivfisscssfVYAPFHTIYAATKGGINSLVRNLACEWTNDNIR  638
             +LCQL HPLLKA+GNGSIVFISS S  +  P  +IYAA+KG +N + +NLACEW  D IR
Sbjct  156   HLCQLGHPLLKASGNGSIVFISSISGLLAFPASSIYAASKGAMNQVTKNLACEWAKDGIR  215

Query  637   VNAVAPWLMRTSLTE--SSREEFGAVIEALIGRTLQHRLVEPKEASAAVAFLCFPAASSI  464
             VN +APW+++TSL             +  LI RT   R  EP E S  VAFLCFP AS I
Sbjct  216   VNTIAPWIIKTSLLHVIDDHPNIKENMSRLISRTPISRPGEPDEVSPLVAFLCFPVASYI  275

Query  463   TGQIIRVDGGASVYG  419
             TGQ+I VDGG  V G
Sbjct  276   TGQVICVDGGYKVTG  290



>ref|XP_006493569.1| PREDICTED: tropinone reductase homolog isoform X2 [Citrus sinensis]
Length=261

 Score =   276 bits (706),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 139/253 (55%), Positives = 180/253 (71%), Gaps = 0/253 (0%)
 Frame = -1

Query  1177  RWSLHGMTALVTGGTRGLGHAIVEELACLGATVYTCSRTEKELEECIQNWKAKGYKVFGS  998
             RWSL GMTALVTGGT+G+G+A+VEELA  GA V+TCSR E EL + IQ WK+KG +V G+
Sbjct  8     RWSLKGMTALVTGGTKGIGYAVVEELAAFGAIVHTCSRNETELNQRIQEWKSKGLQVSGN  67

Query  997   VCDILQPSQRENLIQLVSKQFDGKLTILVNNVAILIPKETLKSDGQDFSNTIGTNLEASL  818
              CD+   +QRE L++ VS QFDGKL IL+NN    IPKET +   +DFS  + TN E++ 
Sbjct  68    ACDVKIRAQREKLMETVSSQFDGKLNILINNAGTFIPKETTEFTEEDFSTVMTTNFESAY  127

Query  817   NLCQLAHPLLKATGNGsivfisscssfVYAPFHTIYAATKGGINSLVRNLACEWTNDNIR  638
             ++ QLAHPLLK++GNG+I+FISS +  +  P  +I A++KG +N L +NLACEW  D IR
Sbjct  128   HVSQLAHPLLKSSGNGNIIFISSVAGVIAIPMCSIAASSKGAMNQLTKNLACEWAKDKIR  187

Query  637   VNAVAPWLMRTSLTESSREEFGAVIEALIGRTLQHRLVEPKEASAAVAFLCFPAASSITG  458
             VN+VAPW++RT L +     F      +I RT   R  EP E S+ VAFLCFPAAS +TG
Sbjct  188   VNSVAPWIIRTPLIDKKDSTFLEQANRMILRTPIPRPGEPTEVSSVVAFLCFPAASYVTG  247

Query  457   QIIRVDGGASVYG  419
             Q+I VDGG S+ G
Sbjct  248   QVICVDGGYSITG  260



>ref|XP_008223763.1| PREDICTED: tropinone reductase homolog At1g07440-like [Prunus 
mume]
Length=270

 Score =   276 bits (707),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 149/257 (58%), Positives = 186/257 (72%), Gaps = 6/257 (2%)
 Frame = -1

Query  1177  RWSLHGMTALVTGGTRGLGHAIVEELACLGATVYTCSRTEKELEECIQNWKAKGY-KVFG  1001
             RWSLHGMTALVTGGT+G+G+AIVEELA LGATV+TCSR E +L +C+  WK KG+ +V G
Sbjct  12    RWSLHGMTALVTGGTKGIGYAIVEELAGLGATVHTCSRNEVQLNDCLSQWKIKGFDQVTG  71

Query  1000  SVCDILQPSQRENLIQLVSKQFDGKLTILVNNVAILIPKETLKSDGQDFSNTIGTNLEAS  821
             SVCD++  +QRE LI  VS  F GKL IL+NNV     K  ++S  +D+S  + TNLE++
Sbjct  72    SVCDVVSKAQREELINKVSSLFHGKLNILINNVGTFKIKPAIESTTEDYSFIMSTNLESA  131

Query  820   LNLCQLAHPLLKATGNGsivfisscssfVYAPFHTIYAATKGGINSLVRNLACEWTNDNI  641
              +  QLAHPLLKA+G G+I+F+SS +  V     TIYAATKG +N L +NLACEW  DNI
Sbjct  132   YHFSQLAHPLLKASGAGNIIFMSSVAGVVSVGTATIYAATKGAMNQLAKNLACEWAKDNI  191

Query  640   RVNAVAPWLMRTSLTES--SREEFGAVIEALIGRTLQHRLVEPKEASAAVAFLCFPAASS  467
             R N+VAPW +RT LTE   S ++F   +EA+  R    R+ EPKE SA VAFLCFPAAS 
Sbjct  192   RTNSVAPWFIRTPLTEPLLSDQKF---MEAINSRCPLGRIGEPKEVSALVAFLCFPAASY  248

Query  466   ITGQIIRVDGGASVYGV  416
             ITGQ I VDGG +V G+
Sbjct  249   ITGQTICVDGGFTVNGL  265



>ref|XP_007016318.1| Senescence-associated gene 13 isoform 1 [Theobroma cacao]
 gb|EOY33937.1| Senescence-associated gene 13 isoform 1 [Theobroma cacao]
Length=283

 Score =   276 bits (706),  Expect = 3e-86, Method: Compositional matrix adjust.
 Identities = 144/267 (54%), Positives = 187/267 (70%), Gaps = 7/267 (3%)
 Frame = -1

Query  1225  KLAKNAKYQQHNIMAGRWSLHGMTALVTGGTRGLGHAIVEELACLGATVYTCSRTEKELE  1046
             ++A++   ++ N    RWSL GMTALVTGGT+G+GHAI+EELA L A ++TCSRTE +L 
Sbjct  4     RMAQSDNSRKDN----RWSLQGMTALVTGGTKGIGHAIIEELAGLRARIHTCSRTETDLN  59

Query  1045  ECIQNWKAKGYKVFGSVCDILQPSQRENLIQLVSKQFDGKLTILVNNVAILIPKETLKSD  866
             +C+ +W AKG++V GSVCD+   +QRE LI  VS +F GKL IL+NNV   I K T    
Sbjct  60    KCLLDWAAKGFQVTGSVCDVSSQAQREKLINTVSSEFGGKLNILINNVGTAILKPTPDIT  119

Query  865   GQDFSNTIGTNLEASLNLCQLAHPLLKATGNGsivfisscssfVYAPFHTIYAATKGGIN  686
              +DFS  +GTN E++ NLCQLA+PLLKA+G GSIVF+SS +  V   F ++Y  TKG +N
Sbjct  120   TEDFSFMMGTNFESAYNLCQLAYPLLKASGAGSIVFLSSIAGVVSVSFGSLYGVTKGAMN  179

Query  685   SLVRNLACEWTNDNIRVNAVAPWLMRTSLTESSREEFGAVIEALIGRTLQHRLVEPKEAS  506
              L + LACEW  DNIRVN+VAPW +RT LTE   ++F    E +I RT   R+ EP+E S
Sbjct  180   HLAKYLACEWAKDNIRVNSVAPWFIRTPLTEDYIQKFS---ENIISRTPMGRIGEPEEVS  236

Query  505   AAVAFLCFPAASSITGQIIRVDGGASV  425
             + V FLC PA+S ITGQ   +DGG SV
Sbjct  237   SLVGFLCLPASSYITGQTFCIDGGMSV  263



>gb|KEH34737.1| NAD(P)-binding rossmann-fold protein [Medicago truncatula]
Length=269

 Score =   275 bits (703),  Expect = 4e-86, Method: Compositional matrix adjust.
 Identities = 143/263 (54%), Positives = 184/263 (70%), Gaps = 5/263 (2%)
 Frame = -1

Query  1201  QQHNIMAGRWSLHGMTALVTGGTRGLGHAIVEELACLGATVYTCSRTEKELEECIQNWKA  1022
             Q+ ++   RWSL G TALVTGGTRG+GHA+VEELA  GATV+TCSR E+EL +C+  WK 
Sbjct  4     QESSMRGSRWSLKGTTALVTGGTRGIGHAVVEELAEFGATVFTCSRNEEELNKCLNEWKE  63

Query  1021  KGYKVFGSVCDILQPSQRENLIQLVSKQFDGKLTILVNNVAILIPKETLKSDGQDFSNTI  842
             KG+ V+GSVCD   PSQRE LI+ V+  F+GKL ILVNN    + K T++   +D+S  +
Sbjct  64    KGFSVYGSVCDASSPSQREELIRQVASAFNGKLNILVNNAGTNVRKPTIEYTAEDYSKVM  123

Query  841   GTNLEASLNLCQLAHPLLKATGNGsivfisscssfVYAPFHTIYAATKGGINSLVRNLAC  662
              TNL+++ +LCQLA+PLLK +GNGSIVFISS +S +     +IYA +K  IN L +NLAC
Sbjct  124   TTNLDSAYHLCQLAYPLLKESGNGSIVFISSVASLISVGTGSIYAVSKAAINQLTKNLAC  183

Query  661   EWTNDNIRVNAVAPWLMRTSLTES--SREEFGAVIEALIGRTLQHRLVEPKEASAAVAFL  488
             EW  DNIR N VAPW  +TSL E   + +EF   ++ ++ RT   R+ E  E SA V FL
Sbjct  184   EWAKDNIRSNCVAPWYTKTSLVEQFIANKEF---VDEVLSRTPIKRIAETHEVSALVTFL  240

Query  487   CFPAASSITGQIIRVDGGASVYG  419
             C PAAS ITGQ + VDGG +V G
Sbjct  241   CLPAASYITGQTVSVDGGFTVNG  263



>ref|XP_004246864.1| PREDICTED: tropinone reductase homolog [Solanum lycopersicum]
Length=263

 Score =   275 bits (703),  Expect = 4e-86, Method: Compositional matrix adjust.
 Identities = 145/257 (56%), Positives = 183/257 (71%), Gaps = 3/257 (1%)
 Frame = -1

Query  1180  GRWSLHGMTALVTGGTRGLGHAIVEELACLGATVYTCSRTEKELEECIQNWKAKGYKVFG  1001
             GRW+L G TA+VTGGTRG+GHAIVEELA  GA VYTCSR + EL+EC++ WKAKGY V G
Sbjct  5     GRWTLQGNTAIVTGGTRGIGHAIVEELASFGANVYTCSRNQMELDECLRQWKAKGYTVGG  64

Query  1000  SVCDILQPSQRENLIQLVSKQFDGKLTILVNNVAILIPKETLKSDGQDFSNTIGTNLEAS  821
             S+CD+   SQR   +  VS  F+GK+ IL+NN A+++     +   +D++  +GTN EAS
Sbjct  65    SMCDLQSRSQRLKFMDNVSSYFEGKINILINNAAVVVSNIATEYTHEDYNTMMGTNFEAS  124

Query  820   LNLCQLAHPLLKATGNGsivfisscssfVYAPFHTIYAATKGGINSLVRNLACEWTNDNI  641
              +L QLAHP LKA+ NG IVFISS + FV  P  +IY+A KG IN L R+LACEW  DNI
Sbjct  125   YHLSQLAHPFLKASKNGRIVFISSVAGFVSLPLCSIYSAAKGAINQLTRSLACEWAMDNI  184

Query  640   RVNAVAPWLMRTSLTESSRE--EFGAVIEALIGRT-LQHRLVEPKEASAAVAFLCFPAAS  470
             RVNAVAPW+++TSL E++ +  E    I  L+ RT +  R  EPKE SA VAFLC P AS
Sbjct  185   RVNAVAPWVIKTSLIEAASKDLEMNKRINKLVSRTPIGGRAGEPKEVSAMVAFLCLPCAS  244

Query  469   SITGQIIRVDGGASVYG  419
              ITGQI+ VDGG ++ G
Sbjct  245   YITGQIMCVDGGITING  261



>ref|XP_010256814.1| PREDICTED: tropinone reductase homolog At1g07440-like isoform 
X1 [Nelumbo nucifera]
Length=269

 Score =   275 bits (703),  Expect = 4e-86, Method: Compositional matrix adjust.
 Identities = 148/255 (58%), Positives = 181/255 (71%), Gaps = 5/255 (2%)
 Frame = -1

Query  1177  RWSLHGMTALVTGGTRGLGHAIVEELACLGATVYTCSRTEKELEECIQNWKAKGYKVFGS  998
             RW L GMTALVTGGTRG+GHAIVEELA LGATV+TCSR E EL  C+++W +KG++V GS
Sbjct  12    RWYLKGMTALVTGGTRGIGHAIVEELAGLGATVHTCSRKEDELNGCLRDWASKGFRVSGS  71

Query  997   VCDILQPSQRENLIQLVSKQFDGKLTILVNNVAILIPKETLKSDGQDFSNTIGTNLEASL  818
             VCD+    QRE LI+ VS  F GKL IL+NN    I K T++   ++FS  I TNLE++ 
Sbjct  72    VCDVSSRPQREKLIETVSSVFSGKLNILINNAGTNIRKPTIEYTAEEFSTLIATNLESAY  131

Query  817   NLCQLAHPLLKATGNGsivfisscssfVYAPFHTIYAATKGGINSLVRNLACEWTNDNIR  638
             +LCQLA+PLLK +G GSIVFISS +  V     T+Y A+KG IN L +NLACEW  DNIR
Sbjct  132   HLCQLAYPLLKLSGVGSIVFISSVAGVVALGSGTVYGASKGAINQLTKNLACEWAKDNIR  191

Query  637   VNAVAPWLMRTSLTES--SREEFGAVIEALIGRTLQHRLVEPKEASAAVAFLCFPAASSI  464
              N VAPW +RTSL E     +EF   ++ +I RT   R  EPKE S+ VAFLC PA+S I
Sbjct  192   TNCVAPWYIRTSLVEHLLDNKEF---LDTVIARTPLRRPGEPKEVSSLVAFLCLPASSYI  248

Query  463   TGQIIRVDGGASVYG  419
             TGQ+I VDGG +V G
Sbjct  249   TGQVISVDGGMTVNG  263



>ref|XP_006846355.1| hypothetical protein AMTR_s00012p00260970 [Amborella trichopoda]
 gb|ERN08030.1| hypothetical protein AMTR_s00012p00260970 [Amborella trichopoda]
Length=268

 Score =   275 bits (703),  Expect = 5e-86, Method: Compositional matrix adjust.
 Identities = 142/253 (56%), Positives = 182/253 (72%), Gaps = 7/253 (3%)
 Frame = -1

Query  1168  LHGMTALVTGGTRGLGHAIVEELACLGATVYTCSRTEKELEECIQNWKAKGYKVFGSVCD  989
             LHGM+ALVTGGT+G+G+AIVEELA LGA++YTC+RTE +L +C+  WK +G+ V GSVCD
Sbjct  17    LHGMSALVTGGTKGIGYAIVEELAGLGASIYTCARTEVDLNKCLNEWKGQGFSVHGSVCD  76

Query  988   ILQPSQRENLIQLVSKQFDGKLTILVNNVAILIPKETLKSDGQDFSNTIGTNLEASLNLC  809
             +     RENLI+ VS  F+GKL ILVNNV   IPK+T+    +DFS  + TNLE++ ++C
Sbjct  77    LSSRPHRENLIEAVSAHFNGKLNILVNNVGTNIPKQTVDYTAEDFSFLVSTNLESAFHMC  136

Query  808   QLAHPLLKATGNGsivfisscssfVYAPFHTIYAATKGGINSLVRNLACEWTNDNIRVNA  629
             QL+HPLLKA+G GSIVFISS +  V     +IY ATKG IN L +NLACEW  DNIR N+
Sbjct  137   QLSHPLLKASGAGSIVFISSVAGVVALQVGSIYGATKGAINQLTKNLACEWAKDNIRTNS  196

Query  628   VAPWLMRTSLTE---SSREEFGAVIEALIGRTLQHRLVEPKEASAAVAFLCFPAASSITG  458
             V PW +RT L E    + E +    + ++ RT   R+ EP+E S+ VA+LC PAAS ITG
Sbjct  197   VTPWFIRTPLAELILGNEEHY----KQIVARTPLKRVGEPEEVSSLVAYLCLPAASYITG  252

Query  457   QIIRVDGGASVYG  419
             Q+I VDGG SV G
Sbjct  253   QVISVDGGVSVNG  265



>ref|XP_010650989.1| PREDICTED: tropinone reductase homolog At1g07440 isoform X1 [Vitis 
vinifera]
 emb|CBI16066.3| unnamed protein product [Vitis vinifera]
Length=270

 Score =   275 bits (702),  Expect = 6e-86, Method: Compositional matrix adjust.
 Identities = 145/255 (57%), Positives = 183/255 (72%), Gaps = 5/255 (2%)
 Frame = -1

Query  1177  RWSLHGMTALVTGGTRGLGHAIVEELACLGATVYTCSRTEKELEECIQNWKAKGYKVFGS  998
             RWSL GMTALVTGGT+G+GHAIVEELA LGAT++TCSR E EL EC+++WKAKG+ V GS
Sbjct  13    RWSLKGMTALVTGGTKGIGHAIVEELAGLGATIHTCSRKETELNECLKDWKAKGFGVSGS  72

Query  997   VCDILQPSQRENLIQLVSKQFDGKLTILVNNVAILIPKETLKSDGQDFSNTIGTNLEASL  818
             VCD+   +QRE L++ VS  F GKL ILVNN AI+I K T++   ++FS  +  N E+  
Sbjct  73    VCDVSSRAQREKLMETVSSVFKGKLNILVNNAAIVIQKPTVEVTAEEFSTIMAINFESVY  132

Query  817   NLCQLAHPLLKATGNGsivfisscssfVYAPFHTIYAATKGGINSLVRNLACEWTNDNIR  638
             +L QLAHPLLKA+G GSIVFISS +  V   + + YA TKG +N L +NLACEW  DNIR
Sbjct  133   HLSQLAHPLLKASGAGSIVFISSVAGVVSVKYLSAYAVTKGAMNQLTKNLACEWAEDNIR  192

Query  637   VNAVAPWLMRTSLTES--SREEFGAVIEALIGRTLQHRLVEPKEASAAVAFLCFPAASSI  464
              NAVAPW ++T + +   S + F   +E +I R    R+ +PKE S+ VAFLC PA+S I
Sbjct  193   SNAVAPWCIKTPMVDQMLSNKTF---LEGVINRAPLRRVGDPKEVSSLVAFLCLPASSYI  249

Query  463   TGQIIRVDGGASVYG  419
             TGQ I VDGG +V G
Sbjct  250   TGQTICVDGGVTVNG  264



>ref|XP_003632186.1| PREDICTED: tropinone reductase homolog At1g07440 [Vitis vinifera]
 emb|CBI16071.3| unnamed protein product [Vitis vinifera]
Length=270

 Score =   275 bits (702),  Expect = 8e-86, Method: Compositional matrix adjust.
 Identities = 145/253 (57%), Positives = 182/253 (72%), Gaps = 1/253 (0%)
 Frame = -1

Query  1177  RWSLHGMTALVTGGTRGLGHAIVEELACLGATVYTCSRTEKELEECIQNWKAKGYKVFGS  998
             RWSL GMTALVTGGT+G+GHAIVEELA LGAT++TCSR E EL EC+++WKAKG+ V GS
Sbjct  13    RWSLKGMTALVTGGTKGIGHAIVEELAGLGATIHTCSRKETELNECLKDWKAKGFGVSGS  72

Query  997   VCDILQPSQRENLIQLVSKQFDGKLTILVNNVAILIPKETLKSDGQDFSNTIGTNLEASL  818
             VCD+   +QRE L+Q +S  F+GKL IL+NN AI I K T++   ++FS  + TN E+  
Sbjct  73    VCDVSSRAQREKLMQTISSVFNGKLNILINNAAISIQKPTIEVTAEEFSTIMATNFESVY  132

Query  817   NLCQLAHPLLKATGNGsivfisscssfVYAPFHTIYAATKGGINSLVRNLACEWTNDNIR  638
             +L Q+AHPLLKA+G GSIVFISS S  V     + Y+ TKG +N L +NLACEW  DNIR
Sbjct  133   HLSQIAHPLLKASGAGSIVFISSVSGIVAHKNISAYSVTKGAMNQLTKNLACEWAKDNIR  192

Query  637   VNAVAPWLMRTSLTESSREEFGAVIEALIGRTLQHRLVEPKEASAAVAFLCFPAASSITG  458
              NAVAPW ++T + E       A +E +I R    R+ +PKE S+ VAFLC PA+S ITG
Sbjct  193   SNAVAPWYIKTPMVEQMLTN-QAFLEEVINRAPLRRVGDPKEVSSLVAFLCLPASSYITG  251

Query  457   QIIRVDGGASVYG  419
             QII VDGG +V G
Sbjct  252   QIICVDGGMTVNG  264



>ref|XP_006424908.1| hypothetical protein CICLE_v10029047mg [Citrus clementina]
 ref|XP_006488390.1| PREDICTED: tropinone reductase homolog At1g07440-like [Citrus 
sinensis]
 gb|ESR38148.1| hypothetical protein CICLE_v10029047mg [Citrus clementina]
 gb|KDO66644.1| hypothetical protein CISIN_1g024230mg [Citrus sinensis]
Length=270

 Score =   274 bits (701),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 144/253 (57%), Positives = 177/253 (70%), Gaps = 1/253 (0%)
 Frame = -1

Query  1177  RWSLHGMTALVTGGTRGLGHAIVEELACLGATVYTCSRTEKELEECIQNWKAKGYKVFGS  998
             RWSL GMTALVTGGT+GLG A+VEEL+ LGATV+TCSRTE EL ECI + + KG KV GS
Sbjct  15    RWSLQGMTALVTGGTKGLGLAVVEELSMLGATVHTCSRTETELNECIHHLQMKGLKVTGS  74

Query  997   VCDILQPSQRENLIQLVSKQFDGKLTILVNNVAILIPKETLKSDGQDFSNTIGTNLEASL  818
             VCD+    QR+ LI  VS  F+GKL I VNNV   + K TL+ + +DFS  + TN E++ 
Sbjct  75    VCDVSSRPQRQTLINTVSSLFNGKLNIFVNNVGTSVLKPTLEYNAEDFSLVMSTNFESAF  134

Query  817   NLCQLAHPLLKATGNGsivfisscssfVYAPFHTIYAATKGGINSLVRNLACEWTNDNIR  638
             +LCQLAHPLL+A+G  SIV +SS    V A   T+Y+ATKG +N L +NLACEW  DNIR
Sbjct  135   HLCQLAHPLLRASGAASIVLMSSALGIVSANVGTVYSATKGAMNQLAKNLACEWAKDNIR  194

Query  637   VNAVAPWLMRTSLTESSREEFGAVIEALIGRTLQHRLVEPKEASAAVAFLCFPAASSITG  458
              N+VAPW +RT  TE      G  ++ +  RT   RL EPKE S+ VAFLC PAAS ITG
Sbjct  195   TNSVAPWYIRTPFTEPLLGN-GKFVDEVKSRTPMGRLGEPKEVSSLVAFLCMPAASYITG  253

Query  457   QIIRVDGGASVYG  419
             Q + +DGG +V G
Sbjct  254   QTVCIDGGFTVNG  266



>ref|XP_003558258.1| PREDICTED: tropinone reductase homolog At1g07440-like [Brachypodium 
distachyon]
Length=270

 Score =   274 bits (700),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 145/258 (56%), Positives = 187/258 (72%), Gaps = 5/258 (2%)
 Frame = -1

Query  1183  AGRWSLHGMTALVTGGTRGLGHAIVEELACLGATVYTCSRTEKELEECIQNWKAKGYKVF  1004
             A RWSLHG TALVTGGTRG+G A+VEELA LGA V+TCSR E EL E ++ W+AKG++V 
Sbjct  11    AARWSLHGKTALVTGGTRGIGRAVVEELAALGAAVHTCSRKESELRERLKEWEAKGFRVT  70

Query  1003  GSVCDILQPSQRENLIQLVSKQFDGKLTILVNNVAILIPKETLKSDGQDFSNTIGTNLEA  824
             GSVCD+    QRE L++ V+ +F GKL ILVNNV     K T +    D+S  + TNLE+
Sbjct  71    GSVCDVSVRDQRELLLRDVAGRFAGKLDILVNNVGTNFTKPTTEYSADDYSFIMTTNLES  130

Query  823   SLNLCQLAHPLLKATGNGsivfisscssfVYAPFHTIYAATKGGINSLVRNLACEWTNDN  644
             + +LCQLAHPLLKA+G+ SIVFISS S  V     +IYA TKG +N L +NLAC+W  DN
Sbjct  131   AYHLCQLAHPLLKASGSASIVFISSVSGVVAISSGSIYAMTKGAMNQLAKNLACDWAKDN  190

Query  643   IRVNAVAPWLMRTSLTES--SREEFGAVIEALIGRTLQHRLVEPKEASAAVAFLCFPAAS  470
             IR N+VAPW ++TSLTE   +RE+F   +++++ RT   R+ EP+E S+ VAFLC PA+S
Sbjct  191   IRTNSVAPWYIKTSLTEENLAREDF---VDSIVRRTPMRRVGEPEEVSSLVAFLCMPASS  247

Query  469   SITGQIIRVDGGASVYGV  416
              ITGQ I VDGG ++ G+
Sbjct  248   YITGQTISVDGGMTINGL  265



>emb|CAN63543.1| hypothetical protein VITISV_035429 [Vitis vinifera]
Length=270

 Score =   273 bits (699),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 144/255 (56%), Positives = 184/255 (72%), Gaps = 5/255 (2%)
 Frame = -1

Query  1177  RWSLHGMTALVTGGTRGLGHAIVEELACLGATVYTCSRTEKELEECIQNWKAKGYKVFGS  998
             RWSL GMTALVTGGT+G+GHAIVEELA LGA ++TCSR E EL EC+++WKAKG+ V GS
Sbjct  13    RWSLKGMTALVTGGTKGIGHAIVEELAGLGAAIHTCSRKETELNECLKDWKAKGFGVSGS  72

Query  997   VCDILQPSQRENLIQLVSKQFDGKLTILVNNVAILIPKETLKSDGQDFSNTIGTNLEASL  818
             VCD+   +QRE L++ VS  F+GKL ILVNN AI+I K T++   ++FS  +  N E+  
Sbjct  73    VCDVSSRAQREKLMETVSSVFNGKLNILVNNAAIVIQKPTVEVTAEEFSTIMAINFESVY  132

Query  817   NLCQLAHPLLKATGNGsivfisscssfVYAPFHTIYAATKGGINSLVRNLACEWTNDNIR  638
             +L QLAHPLLKA+G GSIVFISS +  V   + + Y+ATKG +N L +NLACEW  DNIR
Sbjct  133   HLSQLAHPLLKASGAGSIVFISSVAGVVSLKYLSAYSATKGAMNQLTKNLACEWAEDNIR  192

Query  637   VNAVAPWLMRTSLTES--SREEFGAVIEALIGRTLQHRLVEPKEASAAVAFLCFPAASSI  464
              NAVAPW ++T + +   S + F   +E +I R    R+ +PKE S+ VAFLC PA+S I
Sbjct  193   SNAVAPWYIKTPMVDQMLSNKTF---LEXVINRAPLRRVGDPKEVSSLVAFLCLPASSYI  249

Query  463   TGQIIRVDGGASVYG  419
             TGQ I VDGG +V G
Sbjct  250   TGQTICVDGGVTVNG  264



>ref|XP_010650983.1| PREDICTED: tropinone reductase homolog At1g07440-like isoform 
X1 [Vitis vinifera]
Length=270

 Score =   273 bits (698),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 144/255 (56%), Positives = 185/255 (73%), Gaps = 5/255 (2%)
 Frame = -1

Query  1177  RWSLHGMTALVTGGTRGLGHAIVEELACLGATVYTCSRTEKELEECIQNWKAKGYKVFGS  998
             RWSL GMTALVTGGT+G+GHAIVEELA L AT++TCSR E EL+EC+++WKAKG+ V GS
Sbjct  13    RWSLKGMTALVTGGTKGIGHAIVEELAGLVATIHTCSRKETELDECLKDWKAKGFGVSGS  72

Query  997   VCDILQPSQRENLIQLVSKQFDGKLTILVNNVAILIPKETLKSDGQDFSNTIGTNLEASL  818
             VCD+   +QRE L++ VS  F+GKL ILVNN AI+I K T++   ++FS  +  N E+  
Sbjct  73    VCDVSSRAQREKLMETVSSVFNGKLNILVNNAAIVIQKPTVEVTAEEFSTIMAINFESVY  132

Query  817   NLCQLAHPLLKATGNGsivfisscssfVYAPFHTIYAATKGGINSLVRNLACEWTNDNIR  638
             +L QLAHPLLKA+G GSIVFISS +  V   + + Y+ATKG +N L +NLACEW  DNIR
Sbjct  133   HLSQLAHPLLKASGAGSIVFISSVAGVVSLKYLSAYSATKGAMNQLTKNLACEWAEDNIR  192

Query  637   VNAVAPWLMRTSLTES--SREEFGAVIEALIGRTLQHRLVEPKEASAAVAFLCFPAASSI  464
              NAVAPW ++T + +   S + F   +E +I R    R+ +PKE S+ VAFLC PA+S I
Sbjct  193   SNAVAPWYIKTPMVDQMLSNKTF---LEGVINRAPLRRVGDPKEVSSLVAFLCLPASSYI  249

Query  463   TGQIIRVDGGASVYG  419
             TGQ I VDGG +V G
Sbjct  250   TGQTICVDGGVTVNG  264



>emb|CBI16073.3| unnamed protein product [Vitis vinifera]
Length=270

 Score =   273 bits (698),  Expect = 3e-85, Method: Compositional matrix adjust.
 Identities = 144/255 (56%), Positives = 183/255 (72%), Gaps = 5/255 (2%)
 Frame = -1

Query  1177  RWSLHGMTALVTGGTRGLGHAIVEELACLGATVYTCSRTEKELEECIQNWKAKGYKVFGS  998
             RWSL GMTALVTGGT+G+GHAIVEELA LGAT++TCSR E EL EC+++WKAKG+ V GS
Sbjct  13    RWSLKGMTALVTGGTKGIGHAIVEELAGLGATIHTCSRKETELNECLKDWKAKGFGVSGS  72

Query  997   VCDILQPSQRENLIQLVSKQFDGKLTILVNNVAILIPKETLKSDGQDFSNTIGTNLEASL  818
             VCD+   +QRE L++ VS  F GKL ILVNN AI+I K T++   ++FS  +  N E+  
Sbjct  73    VCDVSSRAQREKLMETVSSVFKGKLNILVNNAAIVIQKPTVEVTAEEFSTIMAINFESVY  132

Query  817   NLCQLAHPLLKATGNGsivfisscssfVYAPFHTIYAATKGGINSLVRNLACEWTNDNIR  638
             +L QLAHPLLKA+G GSIVFISS +  V   + + Y+ TKG +N L +NLACEW  DNIR
Sbjct  133   HLSQLAHPLLKASGAGSIVFISSVAGVVSIKYLSAYSVTKGAMNQLTKNLACEWAEDNIR  192

Query  637   VNAVAPWLMRTSLTES--SREEFGAVIEALIGRTLQHRLVEPKEASAAVAFLCFPAASSI  464
              NAVAPW ++T + +   S + F   +E +I R    R+ +PKE S+ VAFLC PA+S I
Sbjct  193   SNAVAPWYIKTPMVDQMFSNKTF---LEEVINRAPLRRVGDPKEVSSLVAFLCLPASSYI  249

Query  463   TGQIIRVDGGASVYG  419
             TGQ I VDGG +V G
Sbjct  250   TGQTICVDGGVTVNG  264



>emb|CAN69507.1| hypothetical protein VITISV_016037 [Vitis vinifera]
Length=270

 Score =   273 bits (698),  Expect = 3e-85, Method: Compositional matrix adjust.
 Identities = 143/255 (56%), Positives = 182/255 (71%), Gaps = 5/255 (2%)
 Frame = -1

Query  1177  RWSLHGMTALVTGGTRGLGHAIVEELACLGATVYTCSRTEKELEECIQNWKAKGYKVFGS  998
             RWSL GMTALVTGGT+G+GHAIVEELA LGAT++TCSR E EL EC+++WKAKG+ V GS
Sbjct  13    RWSLKGMTALVTGGTKGIGHAIVEELAGLGATIHTCSRKETELNECLKDWKAKGFGVSGS  72

Query  997   VCDILQPSQRENLIQLVSKQFDGKLTILVNNVAILIPKETLKSDGQDFSNTIGTNLEASL  818
             VCD+   +QRE L++ VS  F GKL ILVNN AI+I K T++   ++FS  +  N E+  
Sbjct  73    VCDVSSRAQREKLMETVSSVFKGKLNILVNNAAIVIQKPTVEVTAEEFSTIMAINFESVY  132

Query  817   NLCQLAHPLLKATGNGsivfisscssfVYAPFHTIYAATKGGINSLVRNLACEWTNDNIR  638
             +L QLAHPLLKA+G GSIVFISS +      + + Y+ TKG +N L +NLACEW  DNIR
Sbjct  133   HLSQLAHPLLKASGAGSIVFISSVAGVASIKYLSAYSVTKGAMNQLTKNLACEWAEDNIR  192

Query  637   VNAVAPWLMRTSLTES--SREEFGAVIEALIGRTLQHRLVEPKEASAAVAFLCFPAASSI  464
              NAVAPW ++T + +   S + F   +E +I R    R+ +PKE S+ VAFLC PA+S I
Sbjct  193   SNAVAPWYIKTPMVDQMLSNKTF---LEEVINRAPLRRVGDPKEVSSLVAFLCLPASSYI  249

Query  463   TGQIIRVDGGASVYG  419
             TGQ I VDGG +V G
Sbjct  250   TGQTICVDGGVTVNG  264



>ref|XP_010650991.1| PREDICTED: tropinone reductase homolog At1g07440-like isoform 
X1 [Vitis vinifera]
 emb|CBI16061.3| unnamed protein product [Vitis vinifera]
Length=270

 Score =   273 bits (698),  Expect = 3e-85, Method: Compositional matrix adjust.
 Identities = 144/256 (56%), Positives = 183/256 (71%), Gaps = 5/256 (2%)
 Frame = -1

Query  1180  GRWSLHGMTALVTGGTRGLGHAIVEELACLGATVYTCSRTEKELEECIQNWKAKGYKVFG  1001
             GRWSL GMTALVTGGT+G+GHAIVEELA LGAT++TCSR E EL EC+++WKAKG+ V G
Sbjct  12    GRWSLKGMTALVTGGTKGIGHAIVEELAGLGATIHTCSRKETELNECLKDWKAKGFGVSG  71

Query  1000  SVCDILQPSQRENLIQLVSKQFDGKLTILVNNVAILIPKETLKSDGQDFSNTIGTNLEAS  821
             SVCD+   +QRE L+Q +S  F+GKL IL+NN AI I K T++   ++FS  +  N E+ 
Sbjct  72    SVCDVSSRAQREKLMQTISSVFNGKLNILINNAAITIQKPTVEVTAEEFSTIMAINFESV  131

Query  820   LNLCQLAHPLLKATGNGsivfisscssfVYAPFHTIYAATKGGINSLVRNLACEWTNDNI  641
              +L Q+AHPLLKA+G GSIVFISS    V     + Y+ TKG +N L +NLACEW  DNI
Sbjct  132   YHLSQIAHPLLKASGAGSIVFISSVCGIVAHKNISAYSVTKGAMNQLTKNLACEWAEDNI  191

Query  640   RVNAVAPWLMRTSLTES--SREEFGAVIEALIGRTLQHRLVEPKEASAAVAFLCFPAASS  467
             R NAVAPW ++T + +   S + F   +E +I RT   R+ +PKE S+ VAFLC PA+S 
Sbjct  192   RSNAVAPWYIKTPMVDQMLSNKTF---LEGVINRTPLRRVGDPKEVSSVVAFLCLPASSY  248

Query  466   ITGQIIRVDGGASVYG  419
             ITGQ I VDGG +V G
Sbjct  249   ITGQTICVDGGMTVNG  264



>ref|XP_010650984.1| PREDICTED: tropinone reductase homolog At1g07440-like isoform 
X2 [Vitis vinifera]
Length=270

 Score =   273 bits (697),  Expect = 4e-85, Method: Compositional matrix adjust.
 Identities = 144/255 (56%), Positives = 185/255 (73%), Gaps = 5/255 (2%)
 Frame = -1

Query  1177  RWSLHGMTALVTGGTRGLGHAIVEELACLGATVYTCSRTEKELEECIQNWKAKGYKVFGS  998
             RWSL GMTALVTGGT+G+GHAIVEELA L AT++TCSR E EL+EC+++WKAKG+ V GS
Sbjct  13    RWSLKGMTALVTGGTKGIGHAIVEELAGLVATIHTCSRKETELDECLKDWKAKGFGVSGS  72

Query  997   VCDILQPSQRENLIQLVSKQFDGKLTILVNNVAILIPKETLKSDGQDFSNTIGTNLEASL  818
             VCD+   +QRE L++ VS  F+GKL ILVNN AI+I K T++   ++FS  +  N E+  
Sbjct  73    VCDVSSRAQREKLMETVSSVFNGKLNILVNNAAIVIQKPTVEVTAEEFSTIMAINFESVY  132

Query  817   NLCQLAHPLLKATGNGsivfisscssfVYAPFHTIYAATKGGINSLVRNLACEWTNDNIR  638
             +L QLAHPLLKA+G GSIVFISS +  V   + + Y+ATKG +N L +NLACEW  DNIR
Sbjct  133   HLSQLAHPLLKASGAGSIVFISSVAGVVSLKYLSAYSATKGAMNQLTKNLACEWAEDNIR  192

Query  637   VNAVAPWLMRTSLTES--SREEFGAVIEALIGRTLQHRLVEPKEASAAVAFLCFPAASSI  464
              NAVAPW ++T + +   S + F   +E +I R    R+ +PKE S+ VAFLC PA+S I
Sbjct  193   SNAVAPWYIKTPMVDQMFSNKTF---LEEVINRAPLRRVGDPKEVSSLVAFLCLPASSYI  249

Query  463   TGQIIRVDGGASVYG  419
             TGQ I VDGG +V G
Sbjct  250   TGQTICVDGGVTVNG  264



>ref|XP_010650992.1| PREDICTED: tropinone reductase homolog At1g07440-like isoform 
X2 [Vitis vinifera]
Length=270

 Score =   273 bits (697),  Expect = 4e-85, Method: Compositional matrix adjust.
 Identities = 144/256 (56%), Positives = 183/256 (71%), Gaps = 5/256 (2%)
 Frame = -1

Query  1180  GRWSLHGMTALVTGGTRGLGHAIVEELACLGATVYTCSRTEKELEECIQNWKAKGYKVFG  1001
             GRWSL GMTALVTGGT+G+GHAIVEELA LGAT++TCSR E EL EC+++WKAKG+ V G
Sbjct  12    GRWSLKGMTALVTGGTKGIGHAIVEELAGLGATIHTCSRKETELNECLKDWKAKGFGVSG  71

Query  1000  SVCDILQPSQRENLIQLVSKQFDGKLTILVNNVAILIPKETLKSDGQDFSNTIGTNLEAS  821
             SVCD+   +QRE L+Q +S  F+GKL IL+NN AI I K T++   ++FS  +  N E+ 
Sbjct  72    SVCDVSSRAQREKLMQTISSVFNGKLNILINNAAITIQKPTVEVTAEEFSTIMAINFESV  131

Query  820   LNLCQLAHPLLKATGNGsivfisscssfVYAPFHTIYAATKGGINSLVRNLACEWTNDNI  641
              +L Q+AHPLLKA+G GSIVFISS    V     + Y+ TKG +N L +NLACEW  DNI
Sbjct  132   YHLSQIAHPLLKASGAGSIVFISSVCGIVAHKNISAYSVTKGAMNQLTKNLACEWAEDNI  191

Query  640   RVNAVAPWLMRTSLTES--SREEFGAVIEALIGRTLQHRLVEPKEASAAVAFLCFPAASS  467
             R NAVAPW ++T + +   S + F   +E +I RT   R+ +PKE S+ VAFLC PA+S 
Sbjct  192   RSNAVAPWYIKTPMVDQMLSNKTF---LEGVINRTPLRRVGDPKEVSSVVAFLCLPASSY  248

Query  466   ITGQIIRVDGGASVYG  419
             ITGQ I VDGG +V G
Sbjct  249   ITGQTICVDGGMTVNG  264



>ref|XP_004246428.1| PREDICTED: tropinone reductase homolog isoform X1 [Solanum lycopersicum]
Length=270

 Score =   273 bits (697),  Expect = 4e-85, Method: Compositional matrix adjust.
 Identities = 147/265 (55%), Positives = 189/265 (71%), Gaps = 2/265 (1%)
 Frame = -1

Query  1207  KYQQHNIMAGRWSLHGMTALVTGGTRGLGHAIVEELACLGATVYTCSRTEKELEECIQNW  1028
             K + +N   GRW+L G TALVTGGT+G+GHAIVEELA  GATVYTC R +++L+EC++ W
Sbjct  4     KNESNNSEDGRWTLQGKTALVTGGTKGIGHAIVEELAGFGATVYTCCRNQEQLDECLEKW  63

Query  1027  KAKGYKVFGSVCDILQPSQRENLIQLVSKQFDGKLTILVNNVAILIPKETLKSDGQDFSN  848
             + KGYKV G VCD+   SQRE L++ V   F GKL IL+NN  ILI K   +    D+S 
Sbjct  64    RGKGYKVEGCVCDLTLRSQREMLMEKVINFFQGKLNILINNAGILIVKPATEFTEDDYSI  123

Query  847   TIGTNLEASLNLCQLAHPLLKATGNGsivfisscssfVYAPFHTIYAATKGGINSLVRNL  668
              + TN EAS ++ Q+AHP+LKA+ +G+IVFISS +  V  P ++IYAATKG +N L R+L
Sbjct  124   LMKTNFEASHHISQIAHPILKASESGNIVFISSIAGLVALPTNSIYAATKGAMNQLTRSL  183

Query  667   ACEWTNDNIRVNAVAPWLMRTSLTESSREE--FGAVIEALIGRTLQHRLVEPKEASAAVA  494
             A EW  DNIRVNAVAPW++ T L E+++++     +IE  I RT   R  EPKE SA VA
Sbjct  184   AYEWAKDNIRVNAVAPWIINTPLIEAAKKDSLTKELIERSISRTPICRAGEPKEVSAMVA  243

Query  493   FLCFPAASSITGQIIRVDGGASVYG  419
             FLCFPAAS ITGQ+I VDGG ++ G
Sbjct  244   FLCFPAASYITGQVICVDGGHTING  268



>ref|XP_006493568.1| PREDICTED: tropinone reductase homolog isoform X1 [Citrus sinensis]
Length=263

 Score =   272 bits (696),  Expect = 5e-85, Method: Compositional matrix adjust.
 Identities = 139/255 (55%), Positives = 184/255 (72%), Gaps = 2/255 (1%)
 Frame = -1

Query  1177  RWSLHGMTALVTGGTRGLGHAIVEELACLGATVYTCSRTEKELEECIQNWKAKGYKVFGS  998
             RWSL GMTALVTGGT+G+G+A+VEELA  GA V+TCSR E EL + IQ WK+KG +V G+
Sbjct  8     RWSLKGMTALVTGGTKGIGYAVVEELAAFGAIVHTCSRNETELNQRIQEWKSKGLQVSGN  67

Query  997   VCDILQPSQRENLIQLVSKQFDGKLTILVNNVAILIPKETLKSDGQDFSNTIGTNLEASL  818
              CD+   +QRE L++ VS QFDGKL IL+NN    IPKET +   +DFS  + TN E++ 
Sbjct  68    ACDVKIRAQREKLMETVSSQFDGKLNILINNAGTFIPKETTEFTEEDFSTVMTTNFESAY  127

Query  817   NLCQLAHPLLKATGNGsivfisscssfVYAPFHTIYAATKGGINSLVRNLACEWTNDNIR  638
             ++ QLAHPLLK++GNG+I+FISS +  +  P  +I A++KG +N L +NLACEW  D IR
Sbjct  128   HVSQLAHPLLKSSGNGNIIFISSVAGVIAIPMCSIAASSKGAMNQLTKNLACEWAKDKIR  187

Query  637   VNAVAPWLMRTSLTESSREEFGAVIEA--LIGRTLQHRLVEPKEASAAVAFLCFPAASSI  464
             VN+VAPW++RT L +   ++   + +A  +I RT   R  EP E S+ VAFLCFPAAS +
Sbjct  188   VNSVAPWIIRTPLIDKVLKDSTFLEQANRMILRTPIPRPGEPTEVSSVVAFLCFPAASYV  247

Query  463   TGQIIRVDGGASVYG  419
             TGQ+I VDGG S+ G
Sbjct  248   TGQVICVDGGYSITG  262



>ref|XP_010654244.1| PREDICTED: tropinone reductase homolog [Vitis vinifera]
Length=267

 Score =   272 bits (695),  Expect = 6e-85, Method: Compositional matrix adjust.
 Identities = 144/257 (56%), Positives = 176/257 (68%), Gaps = 2/257 (1%)
 Frame = -1

Query  1183  AGRWSLHGMTALVTGGTRGLGHAIVEELACLGATVYTCSRTEKELEECIQNWKAKGYKVF  1004
             A RWSL GMTAL+TGGTRG+G+AIVEELA LGA V+TCSR + EL E +Q W+ KG++V 
Sbjct  10    AKRWSLKGMTALITGGTRGIGYAIVEELAELGAIVHTCSRNQTELNERLQEWEGKGFRVS  69

Query  1003  GSVCDILQPSQRENLIQLVSKQFDGKLTILVNNVAILIPKETLKSDGQDFSNTIGTNLEA  824
             GSVCD+   +QRE L + VS  F+GKL ILVNN A +  K       +D S+ + TN E+
Sbjct  70    GSVCDLTSRAQREKLTETVSSLFEGKLNILVNNAATVALKAPTNYTAEDCSSILQTNFES  129

Query  823   SLNLCQLAHPLLKATGNGsivfisscssfVYAPFHTIYAATKGGINSLVRNLACEWTNDN  644
               +LCQLAHPLLKA+G GSI+FISS +  +  P  ++YAATKG IN + +NLACEW  DN
Sbjct  130   PYHLCQLAHPLLKASGRGSIIFISSVAGLISLPHMSVYAATKGAINQVTKNLACEWAKDN  189

Query  643   IRVNAVAPWLMRTSLTE--SSREEFGAVIEALIGRTLQHRLVEPKEASAAVAFLCFPAAS  470
             IR NAVAPW +RTS+                L+ RT  HR+ EP E S  VAFLC PAAS
Sbjct  190   IRTNAVAPWTVRTSVRPILEPDNPMATAYPQLLARTPLHRIAEPDEVSPLVAFLCLPAAS  249

Query  469   SITGQIIRVDGGASVYG  419
              ITGQ+I VDGG SV G
Sbjct  250   YITGQVICVDGGFSVNG  266



>ref|XP_006429157.1| hypothetical protein CICLE_v10012496mg [Citrus clementina]
 gb|ESR42397.1| hypothetical protein CICLE_v10012496mg [Citrus clementina]
Length=263

 Score =   272 bits (695),  Expect = 6e-85, Method: Compositional matrix adjust.
 Identities = 141/255 (55%), Positives = 181/255 (71%), Gaps = 2/255 (1%)
 Frame = -1

Query  1177  RWSLHGMTALVTGGTRGLGHAIVEELACLGATVYTCSRTEKELEECIQNWKAKGYKVFGS  998
             RWSL GMTALVTGGT+G+G+A+VEELA  GA V+TCSR E EL + IQ WK+KG +V GS
Sbjct  8     RWSLKGMTALVTGGTKGIGYAVVEELAAFGAIVHTCSRNETELNQRIQEWKSKGLQVSGS  67

Query  997   VCDILQPSQRENLIQLVSKQFDGKLTILVNNVAILIPKETLKSDGQDFSNTIGTNLEASL  818
             VCD+   +QRE L+  VS QFDGKL IL+NN    IPKET +   +DFS  + TN E++ 
Sbjct  68    VCDLKIRAQREKLMLTVSSQFDGKLNILINNAGTFIPKETTEFTEEDFSTVMTTNFESAY  127

Query  817   NLCQLAHPLLKATGNGsivfisscssfVYAPFHTIYAATKGGINSLVRNLACEWTNDNIR  638
             +L QLAHPLLK+ GNG+I+FISS +  +  P  +IYA++KG +N L +NLACEW  D IR
Sbjct  128   HLSQLAHPLLKSAGNGNIIFISSVAGVIAIPMCSIYASSKGAMNQLTKNLACEWAKDKIR  187

Query  637   VNAVAPWLMRTSLTESSREEFGAVIEA--LIGRTLQHRLVEPKEASAAVAFLCFPAASSI  464
             VN VAPW++RT L ++  ++   +  A  ++ RT   R  EP E S+ VAFLC  AAS +
Sbjct  188   VNTVAPWVIRTPLLDTVEKDSNFLEHANRMVLRTPMLRPGEPNEVSSVVAFLCLSAASYV  247

Query  463   TGQIIRVDGGASVYG  419
             TGQ+I VDGG SV G
Sbjct  248   TGQVICVDGGYSVTG  262



>ref|XP_010033096.1| PREDICTED: tropinone reductase homolog At1g07440-like [Eucalyptus 
grandis]
 gb|KCW52638.1| hypothetical protein EUGRSUZ_J02011 [Eucalyptus grandis]
Length=279

 Score =   272 bits (696),  Expect = 6e-85, Method: Compositional matrix adjust.
 Identities = 148/264 (56%), Positives = 183/264 (69%), Gaps = 5/264 (2%)
 Frame = -1

Query  1204  YQQHNIMAGRWSLHGMTALVTGGTRGLGHAIVEELACLGATVYTCSRTEKELEECIQNWK  1025
             +   N    RWSLHGMTALVTGGT+G+GHAIVEELA LGATV+TCSR E E+ EC+++WK
Sbjct  13    HSSSNDNKNRWSLHGMTALVTGGTKGIGHAIVEELARLGATVHTCSRNEAEINECLKDWK  72

Query  1024  AKGYKVFGSVCDILQPSQRENLIQLVSKQFDGKLTILVNNVAILIPKETLKSDGQDFSNT  845
             +KG++V GS CD+   S+RE L+  VS  FDGKL IL+NNV     K T+    +DFS  
Sbjct  73    SKGFRVSGSTCDVSSRSEREKLMLTVSSVFDGKLNILINNVGTNTLKSTMDYTAEDFSFI  132

Query  844   IGTNLEASLNLCQLAHPLLKATGNGsivfisscssfVYAPFHTIYAATKGGINSLVRNLA  665
             + TN E++ +L QLAHPLLKA+G GSIVF+SS    V     +IY+ATKG +N L +NLA
Sbjct  133   MTTNFESAYHLSQLAHPLLKASGAGSIVFLSSVCGVVSINVGSIYSATKGAMNQLTKNLA  192

Query  664   CEWTNDNIRVNAVAPWLMRTSLTES--SREEFGAVIEALIGRTLQHRLVEPKEASAAVAF  491
             CEW  DNIR N+VAPW + T L E   S ++F    E +I RT   R  EP+E S+ VAF
Sbjct  193   CEWAKDNIRSNSVAPWFILTPLAEPLLSDKKFH---EEVIARTPLGRTGEPEEVSSLVAF  249

Query  490   LCFPAASSITGQIIRVDGGASVYG  419
             LC PAAS ITGQ I VDGG +V G
Sbjct  250   LCLPAASYITGQTICVDGGFTVNG  273



>ref|XP_006493570.1| PREDICTED: tropinone reductase homolog [Citrus sinensis]
Length=263

 Score =   272 bits (695),  Expect = 7e-85, Method: Compositional matrix adjust.
 Identities = 140/255 (55%), Positives = 181/255 (71%), Gaps = 2/255 (1%)
 Frame = -1

Query  1177  RWSLHGMTALVTGGTRGLGHAIVEELACLGATVYTCSRTEKELEECIQNWKAKGYKVFGS  998
             RWSL GMTALVTGGT+G+G+A+VEELA  GA V+TCSR E EL + IQ WK+KG +V GS
Sbjct  8     RWSLKGMTALVTGGTKGIGYAVVEELAAFGAIVHTCSRNETELNQRIQEWKSKGLQVSGS  67

Query  997   VCDILQPSQRENLIQLVSKQFDGKLTILVNNVAILIPKETLKSDGQDFSNTIGTNLEASL  818
             VCD+   +QRE L++ VS QFDGKL IL+NN    IPKET +   +DFS  + TN E++ 
Sbjct  68    VCDLKIRAQREKLMETVSSQFDGKLNILINNAGTFIPKETTEFTEEDFSTVMTTNFESAY  127

Query  817   NLCQLAHPLLKATGNGsivfisscssfVYAPFHTIYAATKGGINSLVRNLACEWTNDNIR  638
             +L QLAHPLLK+ GNG+I+FISS +  +  P  +IYA++KG +N L +NLACEW  D IR
Sbjct  128   HLSQLAHPLLKSAGNGNIIFISSVAGVIAIPMCSIYASSKGAMNQLTKNLACEWAKDKIR  187

Query  637   VNAVAPWLMRTSLTESSREEFGAVIEA--LIGRTLQHRLVEPKEASAAVAFLCFPAASSI  464
             VN VAPW++RT L ++  ++   +  A  ++ RT   R  EP E S+ VAFLC  A S +
Sbjct  188   VNTVAPWVIRTPLLDTVEKDSNFLEHANRMVLRTPMLRPGEPNEVSSVVAFLCLSATSYV  247

Query  463   TGQIIRVDGGASVYG  419
             TGQ+I VDGG SV G
Sbjct  248   TGQVICVDGGYSVTG  262



>ref|XP_006493567.1| PREDICTED: tropinone reductase homolog [Citrus sinensis]
Length=263

 Score =   271 bits (694),  Expect = 9e-85, Method: Compositional matrix adjust.
 Identities = 142/255 (56%), Positives = 184/255 (72%), Gaps = 2/255 (1%)
 Frame = -1

Query  1177  RWSLHGMTALVTGGTRGLGHAIVEELACLGATVYTCSRTEKELEECIQNWKAKGYKVFGS  998
             RWSL  MTALVTGGT+G+G+AIV+ELA  GA V+TCSR E EL + +Q WK+ G KV GS
Sbjct  8     RWSLKDMTALVTGGTKGIGYAIVKELAAFGAIVHTCSRNEAELNQRVQEWKSMGLKVSGS  67

Query  997   VCDILQPSQRENLIQLVSKQFDGKLTILVNNVAILIPKETLKSDGQDFSNTIGTNLEASL  818
             VCD+   +Q+E L++ VS  FDGKL ILVNN  I IPKE  +   +DFS  I TN E++ 
Sbjct  68    VCDLKVRAQQEKLMETVSSLFDGKLNILVNNAGISIPKEATEFTMEDFSTIITTNFESAY  127

Query  817   NLCQLAHPLLKATGNGsivfisscssfVYAPFHTIYAATKGGINSLVRNLACEWTNDNIR  638
             +L Q+AHPLLKA+GNG+I+FISS +  +  P  +IYA++KG +N L +NLACEW  D IR
Sbjct  128   HLSQIAHPLLKASGNGNIIFISSVAGVIALPMCSIYASSKGAMNELTKNLACEWAKDKIR  187

Query  637   VNAVAPWLMRTSLTESSREEFGAVIEA--LIGRTLQHRLVEPKEASAAVAFLCFPAASSI  464
             VN+VAPW++RT L ++  ++   + +A  LI RT   R  EP E S+ VAFLCFPAAS +
Sbjct  188   VNSVAPWMIRTPLLDNFEKDSTFLEQANRLILRTPIPRPREPNEVSSVVAFLCFPAASYV  247

Query  463   TGQIIRVDGGASVYG  419
             TGQ+I VDGG S+ G
Sbjct  248   TGQVICVDGGYSITG  262



>ref|XP_008221978.1| PREDICTED: tropinone reductase homolog At1g07440-like [Prunus 
mume]
Length=270

 Score =   271 bits (694),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 147/257 (57%), Positives = 185/257 (72%), Gaps = 6/257 (2%)
 Frame = -1

Query  1177  RWSLHGMTALVTGGTRGLGHAIVEELACLGATVYTCSRTEKELEECIQNWKAKGY-KVFG  1001
             RWSL GMTALVTGGT+G+G+AIVEELA LGAT++TCSR E +L +C+  WK KG+ +V G
Sbjct  12    RWSLRGMTALVTGGTKGIGYAIVEELAGLGATIHTCSRNEVQLNDCLSQWKMKGFDQVTG  71

Query  1000  SVCDILQPSQRENLIQLVSKQFDGKLTILVNNVAILIPKETLKSDGQDFSNTIGTNLEAS  821
             SVCD++  +QRE LI  VS  F+GKL IL+NNV     K  ++S  +D+S  + TNLE++
Sbjct  72    SVCDVVSKAQREELINKVSSLFNGKLNILINNVGTAEIKPAIESTTEDYSFIMSTNLESA  131

Query  820   LNLCQLAHPLLKATGNGsivfisscssfVYAPFHTIYAATKGGINSLVRNLACEWTNDNI  641
              +  QLAHPLLKA+G G+I+F+SS +  V     +IYAATKG +N L +NLACEW  DNI
Sbjct  132   YHFSQLAHPLLKASGAGNIIFMSSVAGVVSLGTASIYAATKGAMNQLAKNLACEWAKDNI  191

Query  640   RVNAVAPWLMRTSLTES--SREEFGAVIEALIGRTLQHRLVEPKEASAAVAFLCFPAASS  467
             R N+VAPW +RT LTE   S + F   +EA+  R    R  EPKE SA VAFLCFPAAS 
Sbjct  192   RTNSVAPWFIRTPLTEPLLSNQNF---LEAVNSRCPLGRTGEPKEVSALVAFLCFPAASY  248

Query  466   ITGQIIRVDGGASVYGV  416
             ITGQII VDGG +V G+
Sbjct  249   ITGQIICVDGGFTVNGL  265



>gb|AFD23289.1| tropinone reductase II, partial [Dendrobium nobile]
Length=272

 Score =   271 bits (694),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 143/258 (55%), Positives = 184/258 (71%), Gaps = 5/258 (2%)
 Frame = -1

Query  1186  MAGRWSLHGMTALVTGGTRGLGHAIVEELACLGATVYTCSRTEKELEECIQNWKAKGYKV  1007
             +AGRWSL GMTALVTGGTRG+G+A+VEELA LGA VYTCSR E EL +C++ W+  G +V
Sbjct  11    IAGRWSLEGMTALVTGGTRGIGNAVVEELAELGAVVYTCSRKESELNDCLKKWEGLGLRV  70

Query  1006  FGSVCDILQPSQRENLIQLVSKQFDGKLTILVNNVAILIPKETLKSDGQDFSNTIGTNLE  827
              GS+CD+    QR +LIQ VS  FDGKL IL+NNV   I K T+    +D+S  + TN +
Sbjct  71    SGSICDLSVREQRVDLIQKVSSAFDGKLNILINNVGTNIRKPTVDYSEEDYSFIMKTNFD  130

Query  826   ASLNLCQLAHPLLKATGNGsivfisscssfVYAPFHTIYAATKGGINSLVRNLACEWTND  647
             A+ ++CQLAHPLLKA+GNGSIVFISS +  V      IYAATK  +N + +NLACEW  D
Sbjct  131   AAFHICQLAHPLLKASGNGSIVFISSVAGVVAISSGVIYAATKAAMNQITKNLACEWAKD  190

Query  646   NIRVNAVAPWLMRTSLTES--SREEFGAVIEALIGRTLQHRLVEPKEASAAVAFLCFPAA  473
             NIR+N+V+PW ++TSL      +E F   + +++ RT  +R+ E +E S+ VAFLC P A
Sbjct  191   NIRINSVSPWYIKTSLVNHLLEKENF---LNSVVSRTPLNRVGEAEEVSSLVAFLCMPCA  247

Query  472   SSITGQIIRVDGGASVYG  419
             S ITGQII VDGG +V G
Sbjct  248   SYITGQIISVDGGMTVNG  265



>ref|XP_007205726.1| hypothetical protein PRUPE_ppa010064mg [Prunus persica]
 gb|EMJ06925.1| hypothetical protein PRUPE_ppa010064mg [Prunus persica]
Length=266

 Score =   271 bits (694),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 143/256 (56%), Positives = 184/256 (72%), Gaps = 5/256 (2%)
 Frame = -1

Query  1177  RWSLHGMTALVTGGTRGLGHAIVEELACLGATVYTCSRTEKELEECIQNWKAKGYKVFGS  998
             RWSL G+TALVTGGT+G+GHAIVEELA LGAT++TC+R E +L +C+  W+ KG++V GS
Sbjct  9     RWSLEGLTALVTGGTKGIGHAIVEELAGLGATIHTCARNEVDLNDCLSQWEKKGFQVTGS  68

Query  997   VCDILQPSQRENLIQLVSKQFDGKLTILVNNVAILIPKETLKSDGQDFSNTIGTNLEASL  818
             VCD++  +QRE LI  VS  FDGKL IL+NNV   I K T++   +D++  + TNLE++ 
Sbjct  69    VCDVVSRAQREELINKVSSLFDGKLNILINNVGTSILKPTMEFTAEDYTFLMSTNLESAY  128

Query  817   NLCQLAHPLLKATGNGsivfisscssfVYAPFHTIYAATKGGINSLVRNLACEWTNDNIR  638
             + CQLAHPLLKA+G G+IVF+SS +  V     + Y+ATKG IN L +NLACEW  DNIR
Sbjct  129   HFCQLAHPLLKASGAGNIVFLSSVAGVVSVEVGSAYSATKGAINQLAKNLACEWAKDNIR  188

Query  637   VNAVAPWLMRTSLTES--SREEFGAVIEALIGRTLQHRLVEPKEASAAVAFLCFPAASSI  464
             +N+VAPW ++T L E   S E F  +I +   RT   R  EP+E SA VAFLC PAAS I
Sbjct  189   INSVAPWFIKTPLAEHFLSDEFFLKIINS---RTPLGRPGEPEEVSALVAFLCLPAASYI  245

Query  463   TGQIIRVDGGASVYGV  416
             TGQ I VDGG +V G+
Sbjct  246   TGQTICVDGGMTVNGL  261



>ref|XP_006838385.1| hypothetical protein AMTR_s00002p00066940 [Amborella trichopoda]
 gb|ERN00954.1| hypothetical protein AMTR_s00002p00066940 [Amborella trichopoda]
Length=270

 Score =   271 bits (694),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 144/253 (57%), Positives = 176/253 (70%), Gaps = 1/253 (0%)
 Frame = -1

Query  1177  RWSLHGMTALVTGGTRGLGHAIVEELACLGATVYTCSRTEKELEECIQNWKAKGYKVFGS  998
             RWSL+GMTALVTGGT+G+GHA VEE+A LGA+VYTCSR E +L +C+  WK  G    GS
Sbjct  16    RWSLNGMTALVTGGTKGIGHATVEEIASLGASVYTCSRNEDDLNKCLNEWKGMGLDAHGS  75

Query  997   VCDILQPSQRENLIQLVSKQFDGKLTILVNNVAILIPKETLKSDGQDFSNTIGTNLEASL  818
             VCD+     RE LI  VS  F GKL ILVNNV   I K T++    +FS  + TNLE++ 
Sbjct  76    VCDLSSRPDREKLIDAVSSHFKGKLNILVNNVGTNIRKPTMQYTAAEFSFLMATNLESAY  135

Query  817   NLCQLAHPLLKATGNGsivfisscssfVYAPFHTIYAATKGGINSLVRNLACEWTNDNIR  638
             ++CQL HPLLKA+G GSIVFISS +  V     TIYAATKG +N + +NLACEW  DNIR
Sbjct  136   HMCQLTHPLLKASGVGSIVFISSVAGVVALHTGTIYAATKGALNQITKNLACEWAKDNIR  195

Query  637   VNAVAPWLMRTSLTESSREEFGAVIEALIGRTLQHRLVEPKEASAAVAFLCFPAASSITG  458
              N+VAPW ++T L E   +  G + E +I RT   R+ EP+E S+ VAFLC PAAS ITG
Sbjct  196   TNSVAPWFIKTPLVEDFLQVKG-ITEGIIARTPMRRMGEPEEVSSLVAFLCLPAASYITG  254

Query  457   QIIRVDGGASVYG  419
             QII VDGG +V G
Sbjct  255   QIICVDGGMTVNG  267



>ref|XP_004503172.1| PREDICTED: tropinone reductase homolog At1g07440-like [Cicer 
arietinum]
Length=269

 Score =   271 bits (694),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 140/255 (55%), Positives = 182/255 (71%), Gaps = 5/255 (2%)
 Frame = -1

Query  1177  RWSLHGMTALVTGGTRGLGHAIVEELACLGATVYTCSRTEKELEECIQNWKAKGYKVFGS  998
             RWSL GMTALVTGGTRG+GHAIV +LA  GATV+TCSRTE EL +C+Q W+++G+ V GS
Sbjct  10    RWSLTGMTALVTGGTRGIGHAIVNDLAAFGATVHTCSRTESELNKCLQEWQSQGFLVTGS  69

Query  997   VCDILQPSQRENLIQLVSKQFDGKLTILVNNVAILIPKETLKSDGQDFSNTIGTNLEASL  818
             VCD+    QRENL+Q V+  F+GKL I VNNV   I K T++  G+++S  +  NL+++ 
Sbjct  70    VCDVASRPQRENLVQQVTSTFNGKLNIFVNNVGTNIRKPTVEYTGEEYSELMAINLDSAF  129

Query  817   NLCQLAHPLLKATGNGsivfisscssfVYAPFHTIYAATKGGINSLVRNLACEWTNDNIR  638
             +LCQLA+PLLKA+G GSIVFISS +  V     ++YAA+K  IN L +NLACEW  DNIR
Sbjct  130   HLCQLAYPLLKASGIGSIVFISSVAGVVSLGTGSVYAASKAAINQLTKNLACEWAKDNIR  189

Query  637   VNAVAPWLMRTSLTES--SREEFGAVIEALIGRTLQHRLVEPKEASAAVAFLCFPAASSI  464
              N V PW  RT L E     ++F   ++ ++ RT   R+ EP+E S+ V FLC PAAS I
Sbjct  190   SNCVVPWATRTPLVEHLFQNQKF---VDDIMSRTPLKRIAEPEEVSSLVTFLCLPAASYI  246

Query  463   TGQIIRVDGGASVYG  419
             TGQ+I VDGG +V+G
Sbjct  247   TGQVISVDGGLTVFG  261



>ref|XP_010033094.1| PREDICTED: tropinone reductase homolog At1g07440-like [Eucalyptus 
grandis]
 gb|KCW52634.1| hypothetical protein EUGRSUZ_J02006 [Eucalyptus grandis]
Length=279

 Score =   271 bits (694),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 147/264 (56%), Positives = 181/264 (69%), Gaps = 5/264 (2%)
 Frame = -1

Query  1204  YQQHNIMAGRWSLHGMTALVTGGTRGLGHAIVEELACLGATVYTCSRTEKELEECIQNWK  1025
             Y   N    RWSLHGMTALVTGGT+G+GHAIVEEL  LG+TV+TCSR E E+ EC+++WK
Sbjct  13    YSSSNDNKNRWSLHGMTALVTGGTKGIGHAIVEELGGLGSTVHTCSRNEAEINECLKDWK  72

Query  1024  AKGYKVFGSVCDILQPSQRENLIQLVSKQFDGKLTILVNNVAILIPKETLKSDGQDFSNT  845
             +KG++V GS CD+   S+RE L+  VS  FDGKL IL+NNV     K T+    +DFS  
Sbjct  73    SKGFRVSGSTCDVSSRSEREKLMLTVSSVFDGKLNILINNVGTNTLKSTMDYTAEDFSFI  132

Query  844   IGTNLEASLNLCQLAHPLLKATGNGsivfisscssfVYAPFHTIYAATKGGINSLVRNLA  665
             +  N E++ +L QLAHPLLKA+G GSIVF+SS    V     +IY+ATKG +N L +NLA
Sbjct  133   MTINFESAYHLSQLAHPLLKASGAGSIVFLSSVCGVVSINVGSIYSATKGAMNQLTKNLA  192

Query  664   CEWTNDNIRVNAVAPWLMRTSLTES--SREEFGAVIEALIGRTLQHRLVEPKEASAAVAF  491
             CEW  DNIR N+VAPW + T L E   S E+F    E +I RT   R  EP+E S+ VAF
Sbjct  193   CEWAKDNIRSNSVAPWFILTPLAEPVLSDEKFH---EEVIARTPLGRTGEPEEVSSLVAF  249

Query  490   LCFPAASSITGQIIRVDGGASVYG  419
             LC PAAS ITGQ I VDGG +V G
Sbjct  250   LCLPAASYITGQTICVDGGFTVNG  273



>ref|XP_007205718.1| hypothetical protein PRUPE_ppa009959mg [Prunus persica]
 gb|EMJ06917.1| hypothetical protein PRUPE_ppa009959mg [Prunus persica]
Length=270

 Score =   271 bits (693),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 147/257 (57%), Positives = 185/257 (72%), Gaps = 6/257 (2%)
 Frame = -1

Query  1177  RWSLHGMTALVTGGTRGLGHAIVEELACLGATVYTCSRTEKELEECIQNWKAKGY-KVFG  1001
             RWSLHGMTALVTGGT+G+G+AIVEELA LGAT++TCSR E +L +C+  WK KG+ +V G
Sbjct  12    RWSLHGMTALVTGGTKGIGYAIVEELAGLGATIHTCSRNEVQLNDCLSQWKMKGFDQVTG  71

Query  1000  SVCDILQPSQRENLIQLVSKQFDGKLTILVNNVAILIPKETLKSDGQDFSNTIGTNLEAS  821
             SVCD++  +QRE LI  VS  F GKL ILVNNV     K  +++  +D+S  + TNLE++
Sbjct  72    SVCDVVSKAQREELINKVSSLFHGKLNILVNNVGTAEIKPAIENTTEDYSFIMSTNLESA  131

Query  820   LNLCQLAHPLLKATGNGsivfisscssfVYAPFHTIYAATKGGINSLVRNLACEWTNDNI  641
              +  QLAHPLLKA+G G+I+F+SS +  V     +IYAATKG +N L +NLACEW  DNI
Sbjct  132   YHFSQLAHPLLKASGAGNIIFMSSVAGVVSLGTASIYAATKGAMNQLAKNLACEWAKDNI  191

Query  640   RVNAVAPWLMRTSLTES--SREEFGAVIEALIGRTLQHRLVEPKEASAAVAFLCFPAASS  467
             R N+VAPW +RT LTE   S ++F   +EA+  R    R  EPKE SA VAFLCFPAAS 
Sbjct  192   RTNSVAPWFIRTPLTEPLLSNQKF---LEAVNSRCPLGRTGEPKEVSALVAFLCFPAASY  248

Query  466   ITGQIIRVDGGASVYGV  416
             ITGQ I VDGG +V G+
Sbjct  249   ITGQTICVDGGFTVNGL  265



>ref|XP_006341200.1| PREDICTED: tropinone reductase homolog [Solanum tuberosum]
Length=270

 Score =   271 bits (693),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 147/265 (55%), Positives = 188/265 (71%), Gaps = 2/265 (1%)
 Frame = -1

Query  1207  KYQQHNIMAGRWSLHGMTALVTGGTRGLGHAIVEELACLGATVYTCSRTEKELEECIQNW  1028
             K + +N   GRW+L G TALVTGGT+G+GHAIVEELA  GA VYTC R +++L++C+  W
Sbjct  4     KKESNNSEDGRWTLQGKTALVTGGTKGIGHAIVEELAEFGAIVYTCCRNQEQLDQCLMKW  63

Query  1027  KAKGYKVFGSVCDILQPSQRENLIQLVSKQFDGKLTILVNNVAILIPKETLKSDGQDFSN  848
             + K YKV G VCD+    QRE L++ V+  F GKL IL+NNV I I K   +   + +S 
Sbjct  64    RGKDYKVEGCVCDLTLRLQREMLMEKVTNFFQGKLNILINNVGIQIGKPATEYTEEVYSI  123

Query  847   TIGTNLEASLNLCQLAHPLLKATGNGsivfisscssfVYAPFHTIYAATKGGINSLVRNL  668
              + TN EAS ++ Q+AHP+LKA+G+GSIVFISS   FV  P ++IY+ATKG IN L RNL
Sbjct  124   IMKTNFEASYHISQIAHPILKASGSGSIVFISSVVGFVALPANSIYSATKGAINQLTRNL  183

Query  667   ACEWTNDNIRVNAVAPWLMRTSLTESSREE--FGAVIEALIGRTLQHRLVEPKEASAAVA  494
             A EW  DNIRVNAVAPW+++TSLTE+ ++      ++E  I RT   R  EPKE SA VA
Sbjct  184   AYEWAKDNIRVNAVAPWIIKTSLTEALKQNPLVKELMEKNISRTPISRAGEPKEVSAMVA  243

Query  493   FLCFPAASSITGQIIRVDGGASVYG  419
             FLCFPAAS ITGQ+I VDGG ++ G
Sbjct  244   FLCFPAASYITGQVICVDGGLTING  268



>ref|XP_009364346.1| PREDICTED: tropinone reductase homolog At1g07440-like [Pyrus 
x bretschneideri]
Length=264

 Score =   271 bits (692),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 143/254 (56%), Positives = 181/254 (71%), Gaps = 1/254 (0%)
 Frame = -1

Query  1177  RWSLHGMTALVTGGTRGLGHAIVEELACLGATVYTCSRTEKELEECIQNWKAKGYKVFGS  998
             RWSL GMTALVTGGT+G+G+AIVEELA LGA V+TC+RTE +L +C+  W+ KG++V GS
Sbjct  7     RWSLEGMTALVTGGTKGIGYAIVEELAGLGAIVHTCARTEVDLNDCLSQWEKKGFQVTGS  66

Query  997   VCDILQPSQRENLIQLVSKQFDGKLTILVNNVAILIPKETLKSDGQDFSNTIGTNLEASL  818
             VCD++  +QRE LI  VS  FDGKL IL+NNV    PK TL+   +D+S  + TNLE++ 
Sbjct  67    VCDVVSKTQREELINKVSSLFDGKLNILINNVGANRPKATLEYTAEDYSFLMSTNLESAY  126

Query  817   NLCQLAHPLLKATGNGsivfisscssfVYAPFHTIYAATKGGINSLVRNLACEWTNDNIR  638
             +LCQL+HPLLKA+G+ +IV +SS +  V     TIY+ATKG IN L RNLACEW  DNIR
Sbjct  127   HLCQLSHPLLKASGSANIVLLSSIAGVVSLNIGTIYSATKGAINQLARNLACEWAKDNIR  186

Query  637   VNAVAPWLMRTSLTESSREEFGAVIEALIGRTLQHRLVEPKEASAAVAFLCFPAASSITG  458
              N+VAPW + T L +    +  A +E +  R    R  EP+E S+ VAFLC PAAS ITG
Sbjct  187   TNSVAPWFIATPLGDMFLGKEKA-LEMINSRCPLGRPGEPEEVSSLVAFLCLPAASYITG  245

Query  457   QIIRVDGGASVYGV  416
             Q I VDGG SV G+
Sbjct  246   QTILVDGGVSVNGI  259



>ref|XP_009603003.1| PREDICTED: tropinone reductase homolog isoform X2 [Nicotiana 
tomentosiformis]
Length=269

 Score =   271 bits (692),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 146/255 (57%), Positives = 178/255 (70%), Gaps = 1/255 (0%)
 Frame = -1

Query  1183  AGRWSLHGMTALVTGGTRGLGHAIVEELACLGATVYTCSRTEKELEECIQNWKAKGYKVF  1004
             + RWSL G TALVTGGTRG+GHA+VEELA LGATVYTCSR + EL E +Q W  KG +V 
Sbjct  10    SSRWSLSGFTALVTGGTRGIGHAVVEELAELGATVYTCSRNQAELNERLQEWAVKGLQVK  69

Query  1003  GSVCDILQPSQRENLIQLVSKQFDGKLTILVNNVAILIPKETLKSDGQDFSNTIGTNLEA  824
             GSVCD     QR  L++ VS  FDGKL ILVNNV   I K T     ++++  + TNLE+
Sbjct  70    GSVCDASSREQRVQLMENVSSAFDGKLNILVNNVGTNIRKPTTDYSAEEYARLLSTNLES  129

Query  823   SLNLCQLAHPLLKATGNGsivfisscssfVYAPFHTIYAATKGGINSLVRNLACEWTNDN  644
             + +LCQLAHPLLKA+GNGS+VFISS +  V+    +IY ATKG +N L RNLACEW ND+
Sbjct  130   AYHLCQLAHPLLKASGNGSVVFISSVAGLVHLSSGSIYGATKGAMNQLTRNLACEWANDS  189

Query  643   IRVNAVAPWLMRTSLTESSREEFGAVIEALIGRTLQHRLVEPKEASAAVAFLCFPAASSI  464
             IRVN VAPW +RTSL E   E     ++ +I RT   R  E +E S+ VA+LC P AS I
Sbjct  190   IRVNGVAPWYIRTSLVEHLLEN-KTFLDGVISRTPLRRPGESQEVSSLVAYLCLPGASYI  248

Query  463   TGQIIRVDGGASVYG  419
             TGQ+I VDGG +V G
Sbjct  249   TGQVIAVDGGFTVNG  263



>ref|XP_008356736.1| PREDICTED: tropinone reductase homolog At1g07440-like isoform 
X1 [Malus domestica]
Length=264

 Score =   271 bits (692),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 143/254 (56%), Positives = 180/254 (71%), Gaps = 1/254 (0%)
 Frame = -1

Query  1177  RWSLHGMTALVTGGTRGLGHAIVEELACLGATVYTCSRTEKELEECIQNWKAKGYKVFGS  998
             RWSL GMTALVTGGT+G+G+AIVEELA LGA V+TC+RTE +L +C+  W+ KG++V GS
Sbjct  7     RWSLEGMTALVTGGTKGIGYAIVEELAGLGAIVHTCARTEXDLNDCLSQWEKKGFQVTGS  66

Query  997   VCDILQPSQRENLIQLVSKQFDGKLTILVNNVAILIPKETLKSDGQDFSNTIGTNLEASL  818
             VCD++  +QRE LI  VS  FDGKL IL+NNV    PK TL+   +D+S  + TNLE++ 
Sbjct  67    VCDVVSKTQREELINKVSSLFDGKLNILINNVGANRPKATLEYTAEDYSFLMSTNLESAY  126

Query  817   NLCQLAHPLLKATGNGsivfisscssfVYAPFHTIYAATKGGINSLVRNLACEWTNDNIR  638
             +LCQL+HPLLKA+G+ +IV +SS +  V     TIY+ATKG IN L RNLACEW  DNIR
Sbjct  127   HLCQLSHPLLKASGSANIVLLSSIAGVVSLNIGTIYSATKGAINQLARNLACEWAKDNIR  186

Query  637   VNAVAPWLMRTSLTESSREEFGAVIEALIGRTLQHRLVEPKEASAAVAFLCFPAASSITG  458
              N+VAPW + T L +       A +E +  R    R  EP+E S+ VAFLC PAAS ITG
Sbjct  187   TNSVAPWFIATPLGDMFLGNEKA-LEMINSRCPLGRPGEPEEVSSLVAFLCLPAASYITG  245

Query  457   QIIRVDGGASVYGV  416
             Q + VDGG SV GV
Sbjct  246   QTLLVDGGVSVNGV  259



>ref|XP_008356743.1| PREDICTED: tropinone reductase homolog At1g07440-like isoform 
X2 [Malus domestica]
Length=264

 Score =   270 bits (691),  Expect = 3e-84, Method: Compositional matrix adjust.
 Identities = 143/254 (56%), Positives = 180/254 (71%), Gaps = 1/254 (0%)
 Frame = -1

Query  1177  RWSLHGMTALVTGGTRGLGHAIVEELACLGATVYTCSRTEKELEECIQNWKAKGYKVFGS  998
             RWSL GMTALVTGGT+G+G+AIVEELA LGA V+TC+RTE +L +C+  W+ KG++V GS
Sbjct  7     RWSLEGMTALVTGGTKGIGYAIVEELAGLGAIVHTCARTEXDLNDCLSQWEKKGFQVTGS  66

Query  997   VCDILQPSQRENLIQLVSKQFDGKLTILVNNVAILIPKETLKSDGQDFSNTIGTNLEASL  818
             VCD++  +QRE LI  VS  FDGKL IL+NNV    PK TL+   +D+S  + TNLE++ 
Sbjct  67    VCDVVSKTQREELINKVSSLFDGKLNILINNVGANRPKATLEYTAEDYSFLMSTNLESAY  126

Query  817   NLCQLAHPLLKATGNGsivfisscssfVYAPFHTIYAATKGGINSLVRNLACEWTNDNIR  638
             +LCQL+HPLLKA+G+ +IV +SS +  V     TIY+ATKG IN L RNLACEW  DNIR
Sbjct  127   HLCQLSHPLLKASGSANIVLLSSIAGVVSLNIGTIYSATKGAINQLARNLACEWAKDNIR  186

Query  637   VNAVAPWLMRTSLTESSREEFGAVIEALIGRTLQHRLVEPKEASAAVAFLCFPAASSITG  458
              N+VAPW + T L +       A +E +  R    R  EP+E S+ VAFLC PAAS ITG
Sbjct  187   TNSVAPWFIATPLGDMFLGNEKA-LEMINSRCPLGRPGEPEEVSSLVAFLCLPAASYITG  245

Query  457   QIIRVDGGASVYGV  416
             Q + VDGG SV GV
Sbjct  246   QTLLVDGGVSVNGV  259



>ref|XP_002308174.2| hypothetical protein POPTR_0006s09080g [Populus trichocarpa]
 gb|EEE91697.2| hypothetical protein POPTR_0006s09080g [Populus trichocarpa]
Length=275

 Score =   270 bits (691),  Expect = 3e-84, Method: Compositional matrix adjust.
 Identities = 142/257 (55%), Positives = 185/257 (72%), Gaps = 4/257 (2%)
 Frame = -1

Query  1177  RWSLHGMTALVTGGTRGLGHAIVEELACLGATVYTCSRTEKELEECIQNWKAKGYKVFGS  998
             RWSL GMTALVTGGTRG+G AIVEELA  GA V+TCSR E +L+ECI+ W++KG++V GS
Sbjct  12    RWSLKGMTALVTGGTRGIGFAIVEELAGFGAAVHTCSRNETKLDECIREWESKGFRVTGS  71

Query  997   VCDILQPSQRENLIQLVSKQFDGKLTILVNNVAILIPKETLKSDGQDFSNTIGTNLEASL  818
             VCD+   +QR+ LI+ VS  F GKL ILVNN A ++ K + K   +D + T+GTN+EAS 
Sbjct  72    VCDVSCRTQRDKLIEKVSSTFQGKLNILVNNAAAVVSKNSTKVTAEDMAYTLGTNVEASY  131

Query  817   NLCQLAHPLLKATGNGsivfisscssfVYAPFHTIYAATKGGINSLVRNLACEWTNDNIR  638
             +LCQLAHPLLKA+GNGSIVFISS ++ V  P  + Y A+KG +N L ++LACEW +D IR
Sbjct  132   HLCQLAHPLLKASGNGSIVFISSVAAVVALPTLSFYGASKGALNQLTKSLACEWAHDKIR  191

Query  637   VNAVAPWLMRTSLTES----SREEFGAVIEALIGRTLQHRLVEPKEASAAVAFLCFPAAS  470
              NAV+PW+++T L ++    S  E  A +  ++ +T   RL E  E S+ VAFLC P A+
Sbjct  192   ANAVSPWIIKTPLLDASLAKSPSEQRAGMSRIVAQTPISRLGEASEISSLVAFLCLPTAA  251

Query  469   SITGQIIRVDGGASVYG  419
              ITGQII VDGG +  G
Sbjct  252   YITGQIISVDGGYTANG  268



>gb|KFK24998.1| hypothetical protein AALP_AA8G053200 [Arabis alpina]
Length=262

 Score =   270 bits (690),  Expect = 4e-84, Method: Compositional matrix adjust.
 Identities = 143/255 (56%), Positives = 181/255 (71%), Gaps = 5/255 (2%)
 Frame = -1

Query  1177  RWSLHGMTALVTGGTRGLGHAIVEELACLGATVYTCSRTEKELEECIQNWKAKGYKVFGS  998
             RWSL G TALVTGGTRG+G A+VEELA  GA VYTCSR E+EL+ C+ +WK+ G  V+GS
Sbjct  6     RWSLAGKTALVTGGTRGIGRAVVEELARFGAKVYTCSRNEEELKACLADWKSNGLVVYGS  65

Query  997   VCDILQPSQRENLIQLVSKQFDGKLTILVNNVAILIPKETLKSDGQDFSNTIGTNLEASL  818
             VCD     QRE L+Q VS  F GKL ILVNNV   I K T+    ++++  + TNLE++ 
Sbjct  66    VCDASVKDQREQLMQEVSAMFSGKLNILVNNVGTNIRKPTVDYSSEEYAKIMSTNLESAF  125

Query  817   NLCQLAHPLLKATGNGsivfisscssfVYAPFHTIYAATKGGINSLVRNLACEWTNDNIR  638
             +L QLAHPLLKA+G GS+VFISS +  V+    +IY ATKG +N L RNLACEW  DNIR
Sbjct  126   HLSQLAHPLLKASGVGSVVFISSVAGLVHVRTGSIYGATKGALNQLTRNLACEWAGDNIR  185

Query  637   VNAVAPWLMRTSLTES--SREEFGAVIEALIGRTLQHRLVEPKEASAAVAFLCFPAASSI  464
              N VAPW ++TSL E    +++F   +EA++ RT   R+ EP+E S+ VAFLC PA+S I
Sbjct  186   TNCVAPWYIKTSLVEPLLEKKDF---VEAVVSRTPLGRVGEPEEVSSLVAFLCLPASSYI  242

Query  463   TGQIIRVDGGASVYG  419
             TGQ+I VDGG +V G
Sbjct  243   TGQVISVDGGFTVNG  257



>gb|KDO69163.1| hypothetical protein CISIN_1g024125mg [Citrus sinensis]
Length=272

 Score =   270 bits (691),  Expect = 4e-84, Method: Compositional matrix adjust.
 Identities = 143/262 (55%), Positives = 181/262 (69%), Gaps = 5/262 (2%)
 Frame = -1

Query  1198  QHNIMAGRWSLHGMTALVTGGTRGLGHAIVEELACLGATVYTCSRTEKELEECIQNWKAK  1019
             + +  + RWSL GMTALVTGGTRG+G A VEELA LGA V+TCSR E EL +C++ W++K
Sbjct  5     ESSFKSSRWSLKGMTALVTGGTRGIGQATVEELAGLGAVVHTCSRNEVELNKCLKEWQSK  64

Query  1018  GYKVFGSVCDILQPSQRENLIQLVSKQFDGKLTILVNNVAILIPKETLKSDGQDFSNTIG  839
             G+ V GSVCD   P QRE LIQ V  +F+GKL ILVNNV   I K T++   +++S  + 
Sbjct  65    GFVVSGSVCDAASPDQREKLIQEVGSKFNGKLNILVNNVGTNIRKPTIEYSAEEYSKIMT  124

Query  838   TNLEASLNLCQLAHPLLKATGNGsivfisscssfVYAPFHTIYAATKGGINSLVRNLACE  659
             TN E++ +LCQL +PLLKA+G GSIVFISS     +    +IY ATK  +N L RNLACE
Sbjct  125   TNFESTYHLCQLVYPLLKASGVGSIVFISSVGGLSHVGSGSIYGATKAAMNQLTRNLACE  184

Query  658   WTNDNIRVNAVAPWLMRTSLTESSRE--EFGAVIEALIGRTLQHRLVEPKEASAAVAFLC  485
             W  DNIR N+VAPW  +TSL E   E  EF   ++ +I RT   R+ EP+E ++ VA+LC
Sbjct  185   WAKDNIRTNSVAPWYTKTSLVERLLENKEF---VDKVIARTPLQRVGEPEEVASLVAYLC  241

Query  484   FPAASSITGQIIRVDGGASVYG  419
              PAAS ITGQII VDGG +  G
Sbjct  242   LPAASYITGQIISVDGGFTANG  263



>gb|EYU19938.1| hypothetical protein MIMGU_mgv1a012090mg [Erythranthe guttata]
Length=262

 Score =   270 bits (689),  Expect = 4e-84, Method: Compositional matrix adjust.
 Identities = 146/257 (57%), Positives = 184/257 (72%), Gaps = 5/257 (2%)
 Frame = -1

Query  1189  IMAGRWSLHGMTALVTGGTRGLGHAIVEELACLGATVYTCSRTEKELEECIQNWKAKGYK  1010
             I + RWSL G TALVTGGTRG+G+A VEELA +GATVYTCSR ++EL + +Q W +KG+K
Sbjct  4     IGSSRWSLSGTTALVTGGTRGIGYATVEELAEMGATVYTCSRNQEELTQRLQEWSSKGFK  63

Query  1009  VFGSVCDILQPSQRENLIQLVSKQFDGKLTILVNNVAILIPKETLKSDGQDFSNTIGTNL  830
             V GSVCD     QR  L++ VS  F+GKL IL+NNV   I K T++   +++S+ + TNL
Sbjct  64    VSGSVCDASSREQRVQLMEKVSSSFNGKLNILINNVGTNIRKPTVEYTAEEYSSIMTTNL  123

Query  829   EASLNLCQLAHPLLKATGNGsivfisscssfVYAPFHTIYAATKGGINSLVRNLACEWTN  650
             E+S +LCQLAHPLLKA+ N SIVFISS +  V+    +IY ATKG IN L +NLACEW  
Sbjct  124   ESSYHLCQLAHPLLKASANSSIVFISSVAGLVHLYTGSIYGATKGAINQLTKNLACEWAK  183

Query  649   DNIRVNAVAPWLMRTSLTES--SREEFGAVIEALIGRTLQHRLVEPKEASAAVAFLCFPA  476
             DNIRVN VAPW ++TSL +     EEF   +E ++ RT   R  EP+E S+ VAFLC PA
Sbjct  184   DNIRVNCVAPWYIKTSLVKHLLENEEF---LEHVVSRTPLKRPGEPQEVSSLVAFLCLPA  240

Query  475   ASSITGQIIRVDGGASV  425
             AS ITGQ+I VDGG +V
Sbjct  241   ASYITGQVISVDGGFTV  257



>ref|XP_007140482.1| hypothetical protein PHAVU_008G116300g [Phaseolus vulgaris]
 gb|ESW12476.1| hypothetical protein PHAVU_008G116300g [Phaseolus vulgaris]
Length=266

 Score =   270 bits (690),  Expect = 4e-84, Method: Compositional matrix adjust.
 Identities = 130/254 (51%), Positives = 180/254 (71%), Gaps = 3/254 (1%)
 Frame = -1

Query  1177  RWSLHGMTALVTGGTRGLGHAIVEELACLGATVYTCSRTEKELEECIQNWKAKGYKVFGS  998
             +WSLHGMTALVTGGTRG+G+A+ EELA  GA+V+ C+R ++++++C++ W  KG+ + GS
Sbjct  13    KWSLHGMTALVTGGTRGIGYAVAEELAEFGASVHICARKQQDIDKCLEEWNRKGFSITGS  72

Query  997   VCDILQPSQRENLIQLVSKQFDGKLTILVNNVAILIPKETLKSDGQDFSNTIGTNLEASL  818
              CD+L   QRENL++ V+  FDGKL IL+NN    +PK  +    +D S  +GTN E+S 
Sbjct  73    SCDVLSRDQRENLMRDVASIFDGKLNILINNAGTTVPKNLIDYTAEDISTIMGTNFESSY  132

Query  817   NLCQLAHPLLKATGNGsivfisscssfVYAPFHTIYAATKGGINSLVRNLACEWTNDNIR  638
             +LCQLAHPLLKA+G G+IVFISS +     PF ++YA++KG +N   +N+A EW  DNIR
Sbjct  133   HLCQLAHPLLKASGYGNIVFISSIAGLKSFPFSSVYASSKGAMNQFTKNVALEWAKDNIR  192

Query  637   VNAVAPWLMRTSLTE---SSREEFGAVIEALIGRTLQHRLVEPKEASAAVAFLCFPAASS  467
              NAVAP  ++T L +    S +E   +IEA   +T+  R+ EPK+ S  VAFLC PAAS 
Sbjct  193   ANAVAPGFVKTELLDFILESLDEGSKIIEATKAKTMAGRIGEPKDISGMVAFLCLPAASY  252

Query  466   ITGQIIRVDGGASV  425
             ITGQII +DGG ++
Sbjct  253   ITGQIITIDGGYTI  266



>gb|AFK38962.1| unknown [Medicago truncatula]
Length=269

 Score =   270 bits (690),  Expect = 5e-84, Method: Compositional matrix adjust.
 Identities = 141/263 (54%), Positives = 183/263 (70%), Gaps = 5/263 (2%)
 Frame = -1

Query  1201  QQHNIMAGRWSLHGMTALVTGGTRGLGHAIVEELACLGATVYTCSRTEKELEECIQNWKA  1022
             Q+ ++   RWSL G TALVTGGTRG+GHA+VEELA  GATV+TCSR E+EL +C+  WK 
Sbjct  4     QESSMRGSRWSLKGTTALVTGGTRGIGHAVVEELAEFGATVFTCSRNEEELNKCLNEWKE  63

Query  1021  KGYKVFGSVCDILQPSQRENLIQLVSKQFDGKLTILVNNVAILIPKETLKSDGQDFSNTI  842
             KG+ V+GSVCD   PSQRE LI+ V+  F+GKL ILV+N    + K T++   +D+S  +
Sbjct  64    KGFSVYGSVCDASSPSQREELIRQVASAFNGKLNILVSNAGTNVRKPTIEYTAEDYSKVM  123

Query  841   GTNLEASLNLCQLAHPLLKATGNGsivfisscssfVYAPFHTIYAATKGGINSLVRNLAC  662
              TNL+++ +LCQLA+PLLK +GNGSIVFISS +S +     +IYA +K  IN L +NLAC
Sbjct  124   TTNLDSAYHLCQLAYPLLKESGNGSIVFISSVASLISVGTGSIYAVSKAAINQLTKNLAC  183

Query  661   EWTNDNIRVNAVAPWLMRTSLTES--SREEFGAVIEALIGRTLQHRLVEPKEASAAVAFL  488
             EW  DNI  N VAPW  +TSL E   + +EF   ++ ++ RT   R+ E  E SA V FL
Sbjct  184   EWAKDNIGSNCVAPWYTKTSLVEQFIANKEF---VDEVLSRTPIKRIAETHEVSALVTFL  240

Query  487   CFPAASSITGQIIRVDGGASVYG  419
             C PAAS ITGQ + VDGG +V G
Sbjct  241   CLPAASYITGQTVSVDGGFTVNG  263



>ref|XP_006290197.1| hypothetical protein CARUB_v10003882mg [Capsella rubella]
 gb|EOA23095.1| hypothetical protein CARUB_v10003882mg [Capsella rubella]
Length=261

 Score =   269 bits (688),  Expect = 6e-84, Method: Compositional matrix adjust.
 Identities = 144/253 (57%), Positives = 185/253 (73%), Gaps = 2/253 (1%)
 Frame = -1

Query  1177  RWSLHGMTALVTGGTRGLGHAIVEELACLGATVYTCSRTEKELEECIQNWKAKGYKVFGS  998
             RWSL G TALVTGGTRG+G A+VEELA  GA VYTCSR+++EL+ C+ +WK+ G  V GS
Sbjct  6     RWSLAGKTALVTGGTRGIGRAVVEELAKFGAKVYTCSRSQEELDACLDDWKSSGLVVSGS  65

Query  997   VCDILQPSQRENLIQLVSKQFDGKLTILVNNVAILIPKETLKSDGQDFSNTIGTNLEASL  818
             VCD    +QR+ LIQ VS  F GKL IL+NNV I I K T+   G++++N + TNLE++ 
Sbjct  66    VCDASVRNQRDKLIQEVSSTFSGKLNILINNVGINIRKPTVDYSGEEYANIMTTNLESAF  125

Query  817   NLCQLAHPLLKATGNGsivfisscssfVYAPFHTIYAATKGGINSLVRNLACEWTNDNIR  638
             +L Q+AHPLLKA+G G+IVFISS +  V     +IYAATKG +N L RNLACEW +DNIR
Sbjct  126   HLSQIAHPLLKASGVGNIVFISSVAGLVRCS-GSIYAATKGALNQLARNLACEWASDNIR  184

Query  637   VNAVAPWLMRTSLTESSREEFGAVIEALIGRTLQHRLVEPKEASAAVAFLCFPAASSITG  458
              N VAPW ++TSL ES  E+    +EA++ RT   R+ EP+E ++ VAFLC PAAS ITG
Sbjct  185   TNCVAPWYIKTSLVESLLEK-QDYLEAVVSRTPLGRVGEPEEVASLVAFLCLPAASYITG  243

Query  457   QIIRVDGGASVYG  419
             Q+I VDGG ++ G
Sbjct  244   QVISVDGGFTING  256



>ref|XP_004235263.1| PREDICTED: tropinone reductase homolog [Solanum lycopersicum]
Length=268

 Score =   270 bits (689),  Expect = 7e-84, Method: Compositional matrix adjust.
 Identities = 146/253 (58%), Positives = 176/253 (70%), Gaps = 1/253 (0%)
 Frame = -1

Query  1177  RWSLHGMTALVTGGTRGLGHAIVEELACLGATVYTCSRTEKELEECIQNWKAKGYKVFGS  998
             RWSL G TALVTGGTRG+GHA+VEELA LGATVYTCSR E EL E +Q W  KG +V GS
Sbjct  11    RWSLSGFTALVTGGTRGIGHAVVEELAELGATVYTCSRNEAELNERLQEWAVKGLQVKGS  70

Query  997   VCDILQPSQRENLIQLVSKQFDGKLTILVNNVAILIPKETLKSDGQDFSNTIGTNLEASL  818
             VCD     QR  L++ VS  FDGKL IL+NNV   I K T     +++++   TNLE++ 
Sbjct  71    VCDASSREQRIQLMENVSAAFDGKLNILINNVGTNIRKPTTDYTAEEYAHLFSTNLESAY  130

Query  817   NLCQLAHPLLKATGNGsivfisscssfVYAPFHTIYAATKGGINSLVRNLACEWTNDNIR  638
             +LCQLAHPLLKA+GNGS+VFISS +  V+    +IY ATKG IN L RNLACEW  DNIR
Sbjct  131   HLCQLAHPLLKASGNGSVVFISSVAGLVHLSSGSIYGATKGAINQLTRNLACEWAKDNIR  190

Query  637   VNAVAPWLMRTSLTESSREEFGAVIEALIGRTLQHRLVEPKEASAAVAFLCFPAASSITG  458
             VN VAPW ++TSL E   E     ++ +I RT   R  E +E S+ VA+LC P AS ITG
Sbjct  191   VNGVAPWYIKTSLVEHLLEN-KTFLDGVISRTPLRRPGESQEVSSLVAYLCLPGASYITG  249

Query  457   QIIRVDGGASVYG  419
             Q+I VDGG +V G
Sbjct  250   QVIAVDGGFTVNG  262



>ref|XP_006429160.1| hypothetical protein CICLE_v10012493mg [Citrus clementina]
 gb|ESR42400.1| hypothetical protein CICLE_v10012493mg [Citrus clementina]
Length=263

 Score =   269 bits (688),  Expect = 7e-84, Method: Compositional matrix adjust.
 Identities = 138/255 (54%), Positives = 183/255 (72%), Gaps = 2/255 (1%)
 Frame = -1

Query  1177  RWSLHGMTALVTGGTRGLGHAIVEELACLGATVYTCSRTEKELEECIQNWKAKGYKVFGS  998
             RWSL GMTALVTGGT+G+G+A+VEELA  GA V+TCSR E EL + IQ WK+KG +V G+
Sbjct  8     RWSLKGMTALVTGGTKGIGYAVVEELAAFGAIVHTCSRNETELNQRIQEWKSKGLQVSGN  67

Query  997   VCDILQPSQRENLIQLVSKQFDGKLTILVNNVAILIPKETLKSDGQDFSNTIGTNLEASL  818
              CD+   +QRE L++ VS QFDG L IL+NN    IPKET +   +DFS  + TN E++ 
Sbjct  68    ACDLKIRAQREKLMETVSSQFDGMLNILINNAGTFIPKETTEFTEEDFSTVMTTNFESAY  127

Query  817   NLCQLAHPLLKATGNGsivfisscssfVYAPFHTIYAATKGGINSLVRNLACEWTNDNIR  638
             ++ QLAHPLLK++GNG+I+FISS +  +  P  +I A++KG +N L +NLACEW  D IR
Sbjct  128   HVSQLAHPLLKSSGNGNIIFISSVAGVIAIPMCSIAASSKGAMNQLTKNLACEWAKDKIR  187

Query  637   VNAVAPWLMRTSLTESSREEFGAVIEA--LIGRTLQHRLVEPKEASAAVAFLCFPAASSI  464
             VN+VAPW++RT L +   ++   + +A  +I RT   R  EP E S+ VAFLCFPAAS +
Sbjct  188   VNSVAPWIIRTPLIDKVLKDSTFLEQANRMILRTPIPRPGEPTEVSSVVAFLCFPAASYV  247

Query  463   TGQIIRVDGGASVYG  419
             TGQ+I VDGG S+ G
Sbjct  248   TGQVICVDGGYSITG  262



>emb|CDX86486.1| BnaC08g02170D [Brassica napus]
Length=262

 Score =   269 bits (688),  Expect = 7e-84, Method: Compositional matrix adjust.
 Identities = 141/258 (55%), Positives = 178/258 (69%), Gaps = 5/258 (2%)
 Frame = -1

Query  1186  MAGRWSLHGMTALVTGGTRGLGHAIVEELACLGATVYTCSRTEKELEECIQNWKAKGYKV  1007
             M  RWSL GMTALVTGG RG+G+AIVEELA  GA ++TC R +  L+EC+  WKAKG++V
Sbjct  1     MDSRWSLQGMTALVTGGARGIGYAIVEELAGFGAKIHTCDRDQTLLDECLSEWKAKGFQV  60

Query  1006  FGSVCDILQPSQRENLIQLVSKQFDGKLTILVNNVAILIPKETLKSDGQDFSNTIGTNLE  827
              GSVCD+    QR+ L++ VS  F GKL IL+NNV  L+ K T +   QDFS  I TNLE
Sbjct  61    TGSVCDVSSRPQRDGLMKTVSSLFSGKLNILINNVGTLVSKPTTEFTAQDFSGQIATNLE  120

Query  826   ASLNLCQLAHPLLKATGNGsivfisscssfVYAPFHTIYAATKGGINSLVRNLACEWTND  647
             ++ +  QLAHPLLKA+G GSIVF+SS    V + F +IY+ TKGG+N L RNLACEW +D
Sbjct  121   SAYHFSQLAHPLLKASGFGSIVFLSSVCGVVSSGFVSIYSLTKGGMNQLARNLACEWASD  180

Query  646   NIRVNAVAPWLMRTSLTES--SREEFGAVIEALIGRTLQHRLVEPKEASAAVAFLCFPAA  473
              IR N+VAPW+ +T L +     E+F    EA+  RT   R  EP+E ++ V FLC PAA
Sbjct  181   GIRANSVAPWMTKTPLVQKRLDDEKFA---EAIFSRTPLGRACEPREVASLVTFLCLPAA  237

Query  472   SSITGQIIRVDGGASVYG  419
             S ITGQ I +DGG +V G
Sbjct  238   SYITGQTICIDGGFTVNG  255



>ref|XP_008222026.1| PREDICTED: tropinone reductase homolog At1g07440-like [Prunus 
mume]
Length=264

 Score =   269 bits (688),  Expect = 7e-84, Method: Compositional matrix adjust.
 Identities = 143/255 (56%), Positives = 182/255 (71%), Gaps = 5/255 (2%)
 Frame = -1

Query  1177  RWSLHGMTALVTGGTRGLGHAIVEELACLGATVYTCSRTEKELEECIQNWKAKGYKVFGS  998
             RWSL G+TALVTGGT+G+G+AIVEELA LGAT++TC+R E +L +C+  W  KG+KV GS
Sbjct  7     RWSLEGLTALVTGGTKGIGYAIVEELAGLGATIHTCARNEVDLNDCLSQWGKKGFKVTGS  66

Query  997   VCDILQPSQRENLIQLVSKQFDGKLTILVNNVAILIPKETLKSDGQDFSNTIGTNLEASL  818
             VCD++  +QRE LI  VS  FDGKL IL+NNV   IPK T +   +D++  + TNLE++ 
Sbjct  67    VCDVVSKTQREELINKVSSLFDGKLNILINNVGTNIPKPTTEYTAEDYTFLMSTNLESAY  126

Query  817   NLCQLAHPLLKATGNGsivfisscssfVYAPFHTIYAATKGGINSLVRNLACEWTNDNIR  638
             +LCQLAHPLLKA+G G+IVF+SS +  V     TIY+ATKG +N L +NLACEW  DNIR
Sbjct  127   HLCQLAHPLLKASGAGNIVFLSSVAGVVSLEIGTIYSATKGAMNQLAKNLACEWAKDNIR  186

Query  637   VNAVAPWLMRTSLTES--SREEFGAVIEALIGRTLQHRLVEPKEASAAVAFLCFPAASSI  464
              N+VAPW ++T L +     E+   +I +   RT   R  EP+E SA VAFLC PAAS I
Sbjct  187   TNSVAPWFIKTLLGDHFLGHEKTLKIINS---RTPLGRPGEPEEVSALVAFLCLPAASYI  243

Query  463   TGQIIRVDGGASVYG  419
             TGQ I VDGG +V G
Sbjct  244   TGQTICVDGGVTVNG  258



>ref|XP_007163456.1| hypothetical protein PHAVU_001G235700g [Phaseolus vulgaris]
 gb|ESW35450.1| hypothetical protein PHAVU_001G235700g [Phaseolus vulgaris]
Length=273

 Score =   269 bits (688),  Expect = 9e-84, Method: Compositional matrix adjust.
 Identities = 141/254 (56%), Positives = 177/254 (70%), Gaps = 1/254 (0%)
 Frame = -1

Query  1180  GRWSLHGMTALVTGGTRGLGHAIVEELACLGATVYTCSRTEKELEECIQNWKAKGYKVFG  1001
             GRWSL GMTALVTGGTRG+GHAIV +LA  GA V+TCSRT+ EL +C++ W+  G+KV G
Sbjct  13    GRWSLSGMTALVTGGTRGIGHAIVSDLAAFGAAVHTCSRTQTELNKCLEEWQNLGFKVTG  72

Query  1000  SVCDILQPSQRENLIQLVSKQFDGKLTILVNNVAILIPKETLKSDGQDFSNTIGTNLEAS  821
             SVCD+  P QRENLIQ V+  F+G+L I VNNV I   K T++    ++S  +  NL++S
Sbjct  73    SVCDVSSPPQRENLIQEVASTFNGRLNIYVNNVGINFRKPTIEYSTDEYSQLMAVNLDSS  132

Query  820   LNLCQLAHPLLKATGNGsivfisscssfVYAPFHTIYAATKGGINSLVRNLACEWTNDNI  641
              +LCQLA+PLLKA+G GSIVFISS +  V      +YAA+K  IN L +NLACEW  DNI
Sbjct  133   FHLCQLAYPLLKASGKGSIVFISSVAGVVSLGTGAVYAASKAAINQLTKNLACEWAKDNI  192

Query  640   RVNAVAPWLMRTSLTESSREEFGAVIEALIGRTLQHRLVEPKEASAAVAFLCFPAASSIT  461
             R N V PW  RTSL E   ++   V E ++ RT   R+ EP+E S+ V FLC P AS IT
Sbjct  193   RSNCVVPWATRTSLVEHLLKDLKFVDE-ILSRTPIKRIAEPEEVSSLVTFLCLPGASYIT  251

Query  460   GQIIRVDGGASVYG  419
             GQ+I VDGG +V G
Sbjct  252   GQVICVDGGLTVNG  265



>ref|XP_006424907.1| hypothetical protein CICLE_v10029040mg [Citrus clementina]
 gb|ESR38147.1| hypothetical protein CICLE_v10029040mg [Citrus clementina]
Length=272

 Score =   269 bits (688),  Expect = 9e-84, Method: Compositional matrix adjust.
 Identities = 141/254 (56%), Positives = 174/254 (69%), Gaps = 2/254 (1%)
 Frame = -1

Query  1177  RWSLHGMTALVTGGTRGLGHAIVEELACLGATVYTCSRTEKELEECIQNWKAKGYKVFGS  998
             RW++HGMTALVTGGT+GLGHA+VEELA LGA V+TCSR E +L ECI++WK KG+K+ GS
Sbjct  14    RWTVHGMTALVTGGTKGLGHAVVEELAELGAAVHTCSRNEADLSECIRDWKTKGFKLTGS  73

Query  997   VCDILQPSQRENLIQLVSKQFDGKLTILVNNVAILIPKETLKSDGQDFSNTIGTNLEASL  818
             VCD+    +RE LI  VS  FDGKL IL+NNV   I K T++   +DFS  + TN E++ 
Sbjct  74    VCDVSSRIEREKLINQVSSLFDGKLNILINNVGTTIRKATVEYTAEDFSFLMATNFESAY  133

Query  817   NLCQLAHPLLKATGNGs-ivfisscssfVYAPFHTIYAATKGGINSLVRNLACEWTNDNI  641
             NLCQLAHPLLKA+G  S ++  S C         +IY ATKG +N L R LACEW  DNI
Sbjct  134   NLCQLAHPLLKASGAASIVLMSSVCGVVSVVDAGSIYGATKGAMNHLARILACEWAQDNI  193

Query  640   RVNAVAPWLMRTSLTESSREEFGAVIEALIGRTLQHRLVEPKEASAAVAFLCFPAASSIT  461
             R N+V PW + T LTES   +  A ++ + GRT   R  +P E S+ VAFLC PAAS IT
Sbjct  194   RTNSVTPWFVATPLTESFLND-EAFLKEVEGRTPMRRTGKPNEISSLVAFLCMPAASYIT  252

Query  460   GQIIRVDGGASVYG  419
             GQ I  DGG +V G
Sbjct  253   GQTISADGGFTVNG  266



>ref|XP_010452515.1| PREDICTED: tropinone reductase homolog At1g07440-like [Camelina 
sativa]
Length=262

 Score =   269 bits (687),  Expect = 9e-84, Method: Compositional matrix adjust.
 Identities = 141/255 (55%), Positives = 182/255 (71%), Gaps = 5/255 (2%)
 Frame = -1

Query  1177  RWSLHGMTALVTGGTRGLGHAIVEELACLGATVYTCSRTEKELEECIQNWKAKGYKVFGS  998
             RW+L G TALVTGGTRG+G A+VEELA  GA V+TCSR + EL  C+ NWK+ G+ V GS
Sbjct  6     RWTLAGKTALVTGGTRGIGRAVVEELARFGAKVHTCSRNQDELNSCLNNWKSNGFVVSGS  65

Query  997   VCDILQPSQRENLIQLVSKQFDGKLTILVNNVAILIPKETLKSDGQDFSNTIGTNLEASL  818
             VCD     QR+ LIQ VS  F GKL IL+NNV   I K T++   +D++  + TNLE++ 
Sbjct  66    VCDASLKDQRDKLIQDVSSAFSGKLNILINNVGTNIRKPTVEYSSEDYAKIMSTNLESAF  125

Query  817   NLCQLAHPLLKATGNGsivfisscssfVYAPFHTIYAATKGGINSLVRNLACEWTNDNIR  638
             +L Q+AHPLLKA+G G+IVFISS +  V+    +IY ATKG +N L RNLACEW +DNIR
Sbjct  126   HLSQIAHPLLKASGVGNIVFISSVAGLVHLSSGSIYGATKGALNQLTRNLACEWASDNIR  185

Query  637   VNAVAPWLMRTSLTES--SREEFGAVIEALIGRTLQHRLVEPKEASAAVAFLCFPAASSI  464
              N VAPW ++TSL ES   ++EF   ++A++ RT   R+ EP+E ++ VAFLC PAAS I
Sbjct  186   TNCVAPWYIKTSLVESLLEKKEF---VDAVVSRTPLGRVGEPEEVASLVAFLCLPAASYI  242

Query  463   TGQIIRVDGGASVYG  419
             TGQ+I VDGG +V G
Sbjct  243   TGQVISVDGGFTVNG  257



>gb|KDO52384.1| hypothetical protein CISIN_1g024752mg [Citrus sinensis]
Length=263

 Score =   269 bits (687),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 139/255 (55%), Positives = 180/255 (71%), Gaps = 2/255 (1%)
 Frame = -1

Query  1177  RWSLHGMTALVTGGTRGLGHAIVEELACLGATVYTCSRTEKELEECIQNWKAKGYKVFGS  998
             RWSL GMTALVTGGT+G+G+A+VEELA  GA V+TCSR E EL + IQ WK+KG +V GS
Sbjct  8     RWSLKGMTALVTGGTKGIGYAVVEELAAFGAIVHTCSRNETELNQRIQEWKSKGLQVSGS  67

Query  997   VCDILQPSQRENLIQLVSKQFDGKLTILVNNVAILIPKETLKSDGQDFSNTIGTNLEASL  818
             VCD+   +QRE L++ VS QFDGKL IL+NN    IPKET +   +DFS  + TN E++ 
Sbjct  68    VCDLKIRAQREKLMETVSSQFDGKLNILINNAGTFIPKETTEFTEEDFSTVMTTNFESAY  127

Query  817   NLCQLAHPLLKATGNGsivfisscssfVYAPFHTIYAATKGGINSLVRNLACEWTNDNIR  638
             +L QLAHPLLK+ GNG+I+FISS +  +  P  +IYA++K  +N L +NLACEW  D IR
Sbjct  128   HLSQLAHPLLKSAGNGNIIFISSVAGVIAIPMCSIYASSKVAMNQLTKNLACEWAKDKIR  187

Query  637   VNAVAPWLMRTSLTESSREEFGAVIEA--LIGRTLQHRLVEPKEASAAVAFLCFPAASSI  464
             VN VAPW++RT L ++  ++   +  A  ++ RT   R  EP E S+ VAFLC  A S +
Sbjct  188   VNTVAPWVIRTPLLDTVEKDSNFLEHANRMVLRTPMLRPGEPNEVSSVVAFLCLSATSYV  247

Query  463   TGQIIRVDGGASVYG  419
             TGQ+I VDGG SV G
Sbjct  248   TGQVICVDGGYSVTG  262



>ref|XP_006435623.1| hypothetical protein CICLE_v10032389mg [Citrus clementina]
 ref|XP_006486406.1| PREDICTED: tropinone reductase homolog At1g07440-like [Citrus 
sinensis]
 gb|ESR48863.1| hypothetical protein CICLE_v10032389mg [Citrus clementina]
Length=272

 Score =   269 bits (688),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 143/262 (55%), Positives = 181/262 (69%), Gaps = 5/262 (2%)
 Frame = -1

Query  1198  QHNIMAGRWSLHGMTALVTGGTRGLGHAIVEELACLGATVYTCSRTEKELEECIQNWKAK  1019
             + +  + RWSL GMTALVTGGTRG+G A VEELA LGA V+TCSR E EL +C++ W++K
Sbjct  5     ESSFKSSRWSLKGMTALVTGGTRGIGQATVEELAGLGAVVHTCSRNEVELNKCLKEWQSK  64

Query  1018  GYKVFGSVCDILQPSQRENLIQLVSKQFDGKLTILVNNVAILIPKETLKSDGQDFSNTIG  839
             G+ V GSVCD   P QRE LIQ V  +F+GKL ILVNNV   I K T++   +++S  + 
Sbjct  65    GFVVSGSVCDAASPDQREKLIQEVGSKFNGKLNILVNNVGTNIRKPTIEYSAEEYSKIMT  124

Query  838   TNLEASLNLCQLAHPLLKATGNGsivfisscssfVYAPFHTIYAATKGGINSLVRNLACE  659
             TN E++ +LCQL +PLLKA+G GSIVFISS     +    +IY ATK  +N L RNLACE
Sbjct  125   TNFESTYHLCQLVYPLLKASGVGSIVFISSVGGLSHIGSGSIYGATKAAMNQLTRNLACE  184

Query  658   WTNDNIRVNAVAPWLMRTSLTESSRE--EFGAVIEALIGRTLQHRLVEPKEASAAVAFLC  485
             W  DNIR N+VAPW  +TSL E   E  EF   ++ +I RT   R+ EP+E ++ VA+LC
Sbjct  185   WAKDNIRTNSVAPWYTKTSLVEHLLENKEF---VDKVIARTPLQRVGEPEEVASLVAYLC  241

Query  484   FPAASSITGQIIRVDGGASVYG  419
              PAAS ITGQII VDGG +  G
Sbjct  242   LPAASYITGQIISVDGGFTANG  263



>gb|ABK94587.1| unknown [Populus trichocarpa]
Length=267

 Score =   269 bits (687),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 136/254 (54%), Positives = 178/254 (70%), Gaps = 2/254 (1%)
 Frame = -1

Query  1177  RWSLHGMTALVTGGTRGLGHAIVEELACLGATVYTCSRTEKELEECIQNWKAKGYKVFGS  998
             RW L GMTALVTGGT+GLG+AIVEELA LGA V+TC+R + ++ E ++ WK KG+KV GS
Sbjct  11    RWGLQGMTALVTGGTKGLGYAIVEELAALGAIVHTCARNQDQINERVREWKEKGFKVTGS  70

Query  997   VCDILQPSQRENLIQLVSKQFDGKLTILVNNVAILIPKETLKSDGQDFSNTIGTNLEASL  818
             VCD+   ++RE L++ VS  FDGKL ILVNN    I K TL    +DF++ + TNL+++ 
Sbjct  71    VCDVSSNAEREKLMKEVSSLFDGKLNILVNNAGTNIYKATLDYTAEDFTSLMNTNLQSAF  130

Query  817   NLCQLAHPLLKATGNGsiv-fisscssfVYAPFHTIYAATKGGINSLVRNLACEWTNDNI  641
             +L QLAHPLLKA+G G IV   S  S     P + +Y+A+KG +N L RNLACEW  DNI
Sbjct  131   HLSQLAHPLLKASGAGKIVFMSSIISVVSMNPQYPLYSASKGAMNQLTRNLACEWAKDNI  190

Query  640   RVNAVAPWLMRTSLTESSREEFGAVIEALIGRTLQHRLVEPKEASAAVAFLCFPAASSIT  461
             RVNAVAPW +RT LT  S ++  ++++ +  RT   R+ EP E S+ VAFLC PA   +T
Sbjct  191   RVNAVAPWFIRTPLTAHSLDD-ESIVKEVFNRTPMRRVGEPGEVSSVVAFLCLPAPGFLT  249

Query  460   GQIIRVDGGASVYG  419
             GQ+I +DGG SV G
Sbjct  250   GQVICIDGGMSVNG  263



>ref|XP_002532998.1| tropinone reductase, putative [Ricinus communis]
 gb|EEF29390.1| tropinone reductase, putative [Ricinus communis]
Length=266

 Score =   269 bits (687),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 148/256 (58%), Positives = 182/256 (71%), Gaps = 6/256 (2%)
 Frame = -1

Query  1177  RWSLHGMTALVTGGTRGLGHAIVEELACLGATVYTCSRTEKELEECIQNWKAKGYKVFGS  998
             RWSL GMTALVTGGTRG+G+A+VEELA  GA VYTCSR EKEL E I+ W+ KG+ V GS
Sbjct  13    RWSLQGMTALVTGGTRGIGYAVVEELAGFGAKVYTCSRNEKELNERIKEWEIKGFNVCGS  72

Query  997   VCDILQPSQRENLIQLVSKQFDGKLTILVNNVAILIPKETLKSDGQDFSNTIGTNLEASL  818
             VCD++   QR+NLI  VS  F+GKL ILVNN   +  K T+    +D+S+ + TNLE+  
Sbjct  73    VCDLICRDQRQNLIDTVSSSFEGKLNILVNNAGTIKHKNTVDYTLEDYSSIMSTNLESPY  132

Query  817   NLCQLAHPLLKATGNGsivfisscssfVYAPFHTIYAATKGGINSLVRNLACEWTNDNIR  638
             +LCQLA+PLLKA+GNGSIVF+SS + F+  P  ++YAATKG IN L +NLACEW  DNIR
Sbjct  133   HLCQLAYPLLKASGNGSIVFLSSVAGFIALPLISVYAATKGAINQLTKNLACEWAKDNIR  192

Query  637   VNAVAPWLMRTSLTESSREEFGAVIEA---LIGRTLQHRLVEPKEASAAVAFLCFPAASS  467
              NAVAP   RT++ +   E   AVIEA   +I R     + EP E S+ VAFLC PAAS 
Sbjct  193   TNAVAPSGTRTTILQ---EPDPAVIEAYAGIIPRNPIRPIAEPNEVSSLVAFLCLPAASY  249

Query  466   ITGQIIRVDGGASVYG  419
             I GQ+I VDGG +V G
Sbjct  250   INGQVICVDGGFTVNG  265



>ref|XP_010033099.1| PREDICTED: tropinone reductase homolog At1g07440-like [Eucalyptus 
grandis]
Length=279

 Score =   269 bits (688),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 147/264 (56%), Positives = 181/264 (69%), Gaps = 5/264 (2%)
 Frame = -1

Query  1204  YQQHNIMAGRWSLHGMTALVTGGTRGLGHAIVEELACLGATVYTCSRTEKELEECIQNWK  1025
             Y   N    RW LHGMT LVTGGT+G+GHAIVEELA LGATV+TCSR E E+ EC+++WK
Sbjct  13    YSSSNNNKNRWLLHGMTTLVTGGTKGIGHAIVEELARLGATVHTCSRNEAEINECLKDWK  72

Query  1024  AKGYKVFGSVCDILQPSQRENLIQLVSKQFDGKLTILVNNVAILIPKETLKSDGQDFSNT  845
             +KG++V GS CD+   S+RE L+  VS  FDGKL IL+NNV     K T+    +DFS  
Sbjct  73    SKGFRVSGSTCDVSSRSEREKLMLTVSSVFDGKLNILINNVGTNTLKSTMDYTAEDFSFI  132

Query  844   IGTNLEASLNLCQLAHPLLKATGNGsivfisscssfVYAPFHTIYAATKGGINSLVRNLA  665
             + TN E++ +L QLAHPLLKA+G GSIVF+SS    V     +IY+ATKG +N L +NLA
Sbjct  133   MTTNFESAYHLSQLAHPLLKASGAGSIVFLSSVCGVVSINVGSIYSATKGAMNQLTKNLA  192

Query  664   CEWTNDNIRVNAVAPWLMRTSLTES--SREEFGAVIEALIGRTLQHRLVEPKEASAAVAF  491
             CEW  DNIR N+VAPW + T  TE   S ++F    E +I RT   R  EP+E S+ VAF
Sbjct  193   CEWAKDNIRSNSVAPWFILTPQTEPVLSDKKFH---EEVIARTPLGRTGEPEEVSSLVAF  249

Query  490   LCFPAASSITGQIIRVDGGASVYG  419
             LC PAAS ITGQ I VDGG +V G
Sbjct  250   LCLPAASYITGQTICVDGGFTVNG  273



>ref|XP_006341006.1| PREDICTED: tropinone reductase 1-like [Solanum tuberosum]
Length=270

 Score =   269 bits (687),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 145/265 (55%), Positives = 184/265 (69%), Gaps = 2/265 (1%)
 Frame = -1

Query  1207  KYQQHNIMAGRWSLHGMTALVTGGTRGLGHAIVEELACLGATVYTCSRTEKELEECIQNW  1028
             K + +N   GRW+L G TALVTGGT+G+GHAIVEELA  GA VYTC R +++L++C++ W
Sbjct  4     KNESNNSEDGRWTLQGKTALVTGGTKGIGHAIVEELAGFGAIVYTCCRNQEQLDQCLERW  63

Query  1027  KAKGYKVFGSVCDILQPSQRENLIQLVSKQFDGKLTILVNNVAILIPKETLKSDGQDFSN  848
             + KGYKV G VCD+    QRE L++ V   F GKL IL+NN  ILI K   +    D+S 
Sbjct  64    RGKGYKVEGCVCDLTLRPQREMLMEKVINFFQGKLNILINNAGILIVKAATEFTEDDYSL  123

Query  847   TIGTNLEASLNLCQLAHPLLKATGNGsivfisscssfVYAPFHTIYAATKGGINSLVRNL  668
              + TN EAS ++ Q+AHP+LKA+ NG+IVFISS +  V  P  +IYAATKG +N L RNL
Sbjct  124   IMKTNFEASHHISQIAHPILKASENGNIVFISSVAGLVALPISSIYAATKGAMNQLTRNL  183

Query  667   ACEWTNDNIRVNAVAPWLMRTSLTESSREE--FGAVIEALIGRTLQHRLVEPKEASAAVA  494
             A EW  DNIRVNAVAPW++ T L E++++       +E  I RT   R  EPKE SA VA
Sbjct  184   AYEWAKDNIRVNAVAPWIINTPLIEAAKKNPLTKERMEKSISRTPICRAGEPKEVSAMVA  243

Query  493   FLCFPAASSITGQIIRVDGGASVYG  419
             FLCFPAAS ITGQ+I VDGG ++ G
Sbjct  244   FLCFPAASYITGQVICVDGGLTING  268



>ref|XP_010685684.1| PREDICTED: tropinone reductase homolog At1g07440-like [Beta vulgaris 
subsp. vulgaris]
Length=267

 Score =   268 bits (686),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 142/261 (54%), Positives = 183/261 (70%), Gaps = 7/261 (3%)
 Frame = -1

Query  1189  IMAGRWSLHGMTALVTGGTRGLGHAIVEELACLGATVYTCSRTEKELEECIQNWKAKGYK  1010
             +M  RWSL GMTALVTGGT+GLGHAIVEELA LGA V+TC+R E ELE C +NW+ KG+ 
Sbjct  10    MMNKRWSLVGMTALVTGGTKGLGHAIVEELAGLGARVHTCARNETELEACKRNWETKGFH  69

Query  1009  VFGSVCDILQPSQRENLIQLVSKQFDGKLTILVNNVAILIPKETLKSDGQDFSNTIGTNL  830
             V  SVCD+   +QRENL+++VS +F+GKL ILVNNV   + K T +   ++++  + TNL
Sbjct  70    VTASVCDVTSRAQRENLMEIVSSEFNGKLNILVNNVGTYVKKPTTELTAEEYATVMTTNL  129

Query  829   EASLNLCQLAHPLLKATGNGsivfisscssfVYAPFHTIYAATKGGINSLVRNLACEWTN  650
             E++ + CQLAHPLLKA+G  SI+F+SS +  V     ++Y  TKG +N L +NLACEW  
Sbjct  130   ESAYHFCQLAHPLLKASGFASIIFMSSVAGVVALDVGSVYGTTKGAMNQLAKNLACEWAK  189

Query  649   DNIRVNAVAPWLMRTSLTE---SSREEFGAVIEALIGRTLQHRLVEPKEASAAVAFLCFP  479
             DNIR N+VAPW +RT LTE   S +E    V E    RT   R  E +E S+ VAFLC P
Sbjct  190   DNIRTNSVAPWYIRTPLTEVVLSDKEYLAKVKE----RTPLGRTGEVEEVSSLVAFLCMP  245

Query  478   AASSITGQIIRVDGGASVYGV  416
             AAS ITGQ I VDGG +++G+
Sbjct  246   AASYITGQTICVDGGFTIHGL  266



>ref|XP_010542632.1| PREDICTED: tropinone reductase homolog At1g07440 [Tarenaya hassleriana]
Length=262

 Score =   268 bits (686),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 142/256 (55%), Positives = 183/256 (71%), Gaps = 1/256 (0%)
 Frame = -1

Query  1186  MAGRWSLHGMTALVTGGTRGLGHAIVEELACLGATVYTCSRTEKELEECIQNWKAKGYKV  1007
             M  RWSL GMTALVTGGT+G+G A+VEELA  GA ++TC+R E  L  C++ W++KG++V
Sbjct  1     MDNRWSLRGMTALVTGGTKGIGQAVVEELAGFGAKIHTCARDEALLNRCLREWQSKGFQV  60

Query  1006  FGSVCDILQPSQRENLIQLVSKQFDGKLTILVNNVAILIPKETLKSDGQDFSNTIGTNLE  827
              GSVCD+    +R+ L+Q VS QF GKL IL+NNV   I K  ++   +DFS ++ TNLE
Sbjct  61    TGSVCDLSSRPERQRLMQDVSSQFHGKLNILINNVGTFILKPAVECTEEDFSISMATNLE  120

Query  826   ASLNLCQLAHPLLKATGNGsivfisscssfVYAPFHTIYAATKGGINSLVRNLACEWTND  647
             ++ +LCQL HPLLKA+G GSIVFISS S  V A   +IY  TKG +N L RNLACEW +D
Sbjct  121   SAYHLCQLGHPLLKASGYGSIVFISSASGVVSALNTSIYGPTKGAMNQLARNLACEWASD  180

Query  646   NIRVNAVAPWLMRTSLTESSREEFGAVIEALIGRTLQHRLVEPKEASAAVAFLCFPAASS  467
             NIR N+VAPWL  T L E+  E+   ++EA+I RT   R+ EP++ S+ VAF+C PAAS 
Sbjct  181   NIRANSVAPWLTVTPLVENLLED-EKLMEAIISRTPLGRVAEPRDVSSLVAFMCLPAASY  239

Query  466   ITGQIIRVDGGASVYG  419
             ITGQ I VDGG +V G
Sbjct  240   ITGQTICVDGGYTVNG  255



>ref|XP_007016329.1| NAD(P)-binding Rossmann-fold superfamily protein [Theobroma cacao]
 gb|EOY33948.1| NAD(P)-binding Rossmann-fold superfamily protein [Theobroma cacao]
Length=320

 Score =   270 bits (691),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 147/267 (55%), Positives = 182/267 (68%), Gaps = 5/267 (2%)
 Frame = -1

Query  1213  NAKYQQHNIMAGRWSLHGMTALVTGGTRGLGHAIVEELACLGATVYTCSRTEKELEECIQ  1034
             N      N  + RWSL GMTALVTGGTRG+G AIVEELA LGA VYTCSR E EL++C+ 
Sbjct  51    NQSMAPRNTKSNRWSLQGMTALVTGGTRGVGRAIVEELAGLGARVYTCSRNENELDKCLV  110

Query  1033  NWKAKGYKVFGSVCDILQPSQRENLIQLVSKQFDGKLTILVNNVAILIPKETLKSDGQDF  854
             +WK+ G++V GS+CD+    +RE L++ VS  FD KL IL+NNV   I K  ++   ++ 
Sbjct  111   DWKSLGFEVSGSICDVSMGVERERLMENVSSLFDSKLNILINNVGTNIRKPMVEFTAEEV  170

Query  853   SNTIGTNLEASLNLCQLAHPLLKATGNGsivfisscssfVYAPFHTIYAATKGGINSLVR  674
             S  + TN E+  NLCQLA+PLLKA+G GS+VF SS S FV     ++  ATKG IN L R
Sbjct  171   STLLATNFESVFNLCQLAYPLLKASGVGSVVFTSSVSGFVSLKSMSLQGATKGAINQLTR  230

Query  673   NLACEWTNDNIRVNAVAPWLMRTSLTES--SREEFGAVIEALIGRTLQHRLVEPKEASAA  500
             NLACEW  DNIR NAVAPW +RTS+ E   S +E+   +E +  RT   RL +P E S+ 
Sbjct  231   NLACEWAKDNIRSNAVAPWYIRTSMVEQVLSNQEY---LEEVYSRTPLQRLGDPTEVSSL  287

Query  499   VAFLCFPAASSITGQIIRVDGGASVYG  419
             VAFLC PA+S ITGQII VDGG SV G
Sbjct  288   VAFLCLPASSYITGQIICVDGGMSVNG  314



>ref|XP_009421329.1| PREDICTED: tropinone reductase homolog [Musa acuminata subsp. 
malaccensis]
Length=271

 Score =   268 bits (686),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 141/253 (56%), Positives = 183/253 (72%), Gaps = 1/253 (0%)
 Frame = -1

Query  1177  RWSLHGMTALVTGGTRGLGHAIVEELACLGATVYTCSRTEKELEECIQNWKAKGYKVFGS  998
             RWSL GMTALVTGGTRG+GHA+VEELA LGA+V+TCSR E +L EC++ W AKG++V GS
Sbjct  15    RWSLGGMTALVTGGTRGIGHAVVEELAGLGASVHTCSRKEADLTECLRKWAAKGFRVTGS  74

Query  997   VCDILQPSQRENLIQLVSKQFDGKLTILVNNVAILIPKETLKSDGQDFSNTIGTNLEASL  818
             VCD+    QR+ LI+ VS  F+GKL ILVNNV   I K T++   +++S  + TNLE++ 
Sbjct  75    VCDLSSREQRDQLIREVSATFNGKLNILVNNVGTNIRKPTVEYSAEEYSFLMATNLESAY  134

Query  817   NLCQLAHPLLKATGNGsivfisscssfVYAPFHTIYAATKGGINSLVRNLACEWTNDNIR  638
             +LCQLAHPLLKA+G GSIVFISS +  V     +IYAA K  +N + +NLACEW  DNIR
Sbjct  135   HLCQLAHPLLKASGMGSIVFISSVAGVVALSSGSIYAAAKAAMNQMTKNLACEWAKDNIR  194

Query  637   VNAVAPWLMRTSLTESSREEFGAVIEALIGRTLQHRLVEPKEASAAVAFLCFPAASSITG  458
              N+V+PW ++T L E    +  + ++ +I RT   R+ EP+E S+ V +LC PAAS ITG
Sbjct  195   TNSVSPWYIKTKLVEHLLNDKDS-LQRIIDRTPLGRVGEPEEVSSLVGYLCLPAASYITG  253

Query  457   QIIRVDGGASVYG  419
             QII VDGG +V G
Sbjct  254   QIISVDGGMTVNG  266



>ref|XP_002520507.1| tropinone reductase, putative [Ricinus communis]
 gb|EEF41920.1| tropinone reductase, putative [Ricinus communis]
Length=268

 Score =   268 bits (685),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 147/255 (58%), Positives = 175/255 (69%), Gaps = 5/255 (2%)
 Frame = -1

Query  1177  RWSLHGMTALVTGGTRGLGHAIVEELACLGATVYTCSRTEKELEECIQNWKAKGYKVFGS  998
             RWSL GMTALVTGGT+G+GHAIVEELA LGA VYTCSR E +L ECI  WKAKG+KV GS
Sbjct  9     RWSLEGMTALVTGGTKGIGHAIVEELAGLGAEVYTCSRNEVQLNECIHKWKAKGFKVTGS  68

Query  997   VCDILQPSQRENLIQLVSKQFDGKLTILVNNVAILIPKETLKSDGQDFSNTIGTNLEASL  818
             VCD+   + RE+L+  +S  F+ KL IL+NNV   I K T+K   +DFS  + TN E++ 
Sbjct  69    VCDVSSRANREDLMNRISSLFNRKLNILINNVGTNIGKPTVKYTAEDFSYLVNTNFESAY  128

Query  817   NLCQLAHPLLKATGNGsivfisscssfVYAPFHTIYAATKGGINSLVRNLACEWTNDNIR  638
             +L QLA PLLK +G GSIVF+SS S  +     TIY ATK  +N L +NLACEW  DNIR
Sbjct  129   HLSQLAQPLLKGSGAGSIVFMSSVSGVLSVNVGTIYGATKAAMNQLTKNLACEWAKDNIR  188

Query  637   VNAVAPWLMRTSLTES--SREEFGAVIEALIGRTLQHRLVEPKEASAAVAFLCFPAASSI  464
              N VAPW +RT LTE   + E F   I A   RT   R+ E +E S+ VAFLC PAAS I
Sbjct  189   TNCVAPWFIRTPLTEQDLNHERFSNSIAA---RTPMGRVGEAEEVSSLVAFLCLPAASYI  245

Query  463   TGQIIRVDGGASVYG  419
             TGQ I VDGG +V G
Sbjct  246   TGQTICVDGGMTVNG  260



>ref|XP_006488386.1| PREDICTED: tropinone reductase homolog At1g07440-like isoform 
X1 [Citrus sinensis]
 ref|XP_006488389.1| PREDICTED: tropinone reductase homolog At1g07440-like [Citrus 
sinensis]
Length=272

 Score =   268 bits (685),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 143/254 (56%), Positives = 173/254 (68%), Gaps = 2/254 (1%)
 Frame = -1

Query  1177  RWSLHGMTALVTGGTRGLGHAIVEELACLGATVYTCSRTEKELEECIQNWKAKGYKVFGS  998
             RW++ GMTALVTGGT+GLGHA+VEELA LGA V+TCSR E +L ECI++WK KG+KV GS
Sbjct  14    RWTVQGMTALVTGGTKGLGHAVVEELAELGAAVHTCSRNEADLSECIRDWKTKGFKVTGS  73

Query  997   VCDILQPSQRENLIQLVSKQFDGKLTILVNNVAILIPKETLKSDGQDFSNTIGTNLEASL  818
             VCD+    +RE LI  VS  FDGKL IL+NNV   I K T++   +DFS  + TN E++ 
Sbjct  74    VCDVSSRIEREKLINQVSSLFDGKLNILINNVGTTIRKATVEYTAEDFSFLMATNFESAY  133

Query  817   NLCQLAHPLLKATGNGsiv-fisscssfVYAPFHTIYAATKGGINSLVRNLACEWTNDNI  641
             NLCQLAHPLLKA+G  SIV   S C         +IY ATKG +N L R LACEW  DNI
Sbjct  134   NLCQLAHPLLKASGAASIVLMSSVCGVVSVVDAGSIYGATKGAMNHLARILACEWAQDNI  193

Query  640   RVNAVAPWLMRTSLTESSREEFGAVIEALIGRTLQHRLVEPKEASAAVAFLCFPAASSIT  461
             R N+V PW + T LTES   +  A ++ + GRT   R  +P E S+ VAFLC PAAS IT
Sbjct  194   RTNSVTPWFVATPLTESFLND-EAFLKEVEGRTPMRRTGKPNEISSLVAFLCMPAASYIT  252

Query  460   GQIIRVDGGASVYG  419
             GQ I  DGG +V G
Sbjct  253   GQTISADGGFTVNG  266



>ref|XP_006488387.1| PREDICTED: tropinone reductase homolog At1g07440-like isoform 
X2 [Citrus sinensis]
Length=272

 Score =   268 bits (685),  Expect = 3e-83, Method: Compositional matrix adjust.
 Identities = 143/254 (56%), Positives = 173/254 (68%), Gaps = 2/254 (1%)
 Frame = -1

Query  1177  RWSLHGMTALVTGGTRGLGHAIVEELACLGATVYTCSRTEKELEECIQNWKAKGYKVFGS  998
             RW++ GMTALVTGGT+GLGHA+VEELA LGA V+TCSR E +L ECI++WK KG+KV GS
Sbjct  14    RWTVQGMTALVTGGTKGLGHAVVEELAELGAAVHTCSRNEADLSECIRDWKTKGFKVTGS  73

Query  997   VCDILQPSQRENLIQLVSKQFDGKLTILVNNVAILIPKETLKSDGQDFSNTIGTNLEASL  818
             VCD+    +RE LI  VS  FDGKL IL+NNV   I K T++   +DFS  + TN E++ 
Sbjct  74    VCDVSSRIEREKLINQVSSLFDGKLNILINNVGTTIRKATVEYTAEDFSFLMATNFESAY  133

Query  817   NLCQLAHPLLKATGNGsiv-fisscssfVYAPFHTIYAATKGGINSLVRNLACEWTNDNI  641
             NLCQLAHPLLKA+G  SIV   S C         +IY ATKG +N L R LACEW  DNI
Sbjct  134   NLCQLAHPLLKASGAASIVLMSSVCGVVSVVDAGSIYGATKGAMNHLARILACEWAQDNI  193

Query  640   RVNAVAPWLMRTSLTESSREEFGAVIEALIGRTLQHRLVEPKEASAAVAFLCFPAASSIT  461
             R N+V PW + T LTES   +  A ++ + GRT   R  +P E S+ VAFLC PAAS IT
Sbjct  194   RTNSVTPWFVATPLTESFLND-EAFLKEVEGRTPMRRTGKPNEISSLVAFLCMPAASYIT  252

Query  460   GQIIRVDGGASVYG  419
             GQ I  DGG +V G
Sbjct  253   GQTISADGGFTVNG  266



>ref|XP_002319562.1| hypothetical protein POPTR_0013s02690g [Populus trichocarpa]
 gb|EEE95485.1| hypothetical protein POPTR_0013s02690g [Populus trichocarpa]
Length=260

 Score =   268 bits (684),  Expect = 3e-83, Method: Compositional matrix adjust.
 Identities = 139/257 (54%), Positives = 181/257 (70%), Gaps = 2/257 (1%)
 Frame = -1

Query  1186  MAGRWSLHGMTALVTGGTRGLGHAIVEELACLGATVYTCSRTEKELEECIQNWKAKGYKV  1007
             M  RWSL GMTALVTGGT+G+G+A+V+ELA LGA V+TC+R + +L E I+ W  KG+KV
Sbjct  1     MEKRWSLQGMTALVTGGTKGIGYAVVDELAALGAIVHTCARNQDQLNERIREWNEKGFKV  60

Query  1006  FGSVCDILQPSQRENLIQLVSKQFDGKLTILVNNVAILIPKETLKSDGQDFSNTIGTNLE  827
              GSVCD+   ++RE L++ VS +FDGKL ILVNN    I K TL    +DF++ + TNL+
Sbjct  61    TGSVCDVSSDAEREKLMEEVSSRFDGKLNILVNNAGTNIYKATLDYTAEDFTSLMNTNLQ  120

Query  826   ASLNLCQLAHPLLKATGNGsivfissc-ssfVYAPFHTIYAATKGGINSLVRNLACEWTN  650
             ++ +L QLAHPLLKA+G G IVF+SS  S     P + +Y+A+KG +N L RNLACEW  
Sbjct  121   SAFHLSQLAHPLLKASGAGKIVFMSSIGSVVSVNPQYPLYSASKGAMNQLTRNLACEWAK  180

Query  649   DNIRVNAVAPWLMRTSLTESSREEFGAVIEALIGRTLQHRLVEPKEASAAVAFLCFPAAS  470
             DNIRVN VAPW +RT LT  S ++  ++ + +  RT   R+ EP E S+ VAFLC PA  
Sbjct  181   DNIRVNGVAPWFVRTPLTAHSLDD-ESIAKEVFSRTPMRRVGEPGEVSSVVAFLCLPAPG  239

Query  469   SITGQIIRVDGGASVYG  419
              +TGQII VDGG SV G
Sbjct  240   FLTGQIICVDGGMSVNG  256



>ref|XP_010650990.1| PREDICTED: tropinone reductase homolog isoform X2 [Vitis vinifera]
Length=519

 Score =   275 bits (704),  Expect = 5e-83, Method: Compositional matrix adjust.
 Identities = 146/258 (57%), Positives = 184/258 (71%), Gaps = 5/258 (2%)
 Frame = -1

Query  1186  MAGRWSLHGMTALVTGGTRGLGHAIVEELACLGATVYTCSRTEKELEECIQNWKAKGYKV  1007
             M  RWSL GMTALVTGGT+G+GHAIVEELA LGAT++TCSR E EL EC+++WKAKG+ V
Sbjct  259   MNSRWSLKGMTALVTGGTKGIGHAIVEELAGLGATIHTCSRKETELNECLKDWKAKGFGV  318

Query  1006  FGSVCDILQPSQRENLIQLVSKQFDGKLTILVNNVAILIPKETLKSDGQDFSNTIGTNLE  827
              GSVCD+   +QRE L++ VS  F GKL ILVNN AI+I K T++   ++FS  +  N E
Sbjct  319   SGSVCDVSSRAQREKLMETVSSVFKGKLNILVNNAAIVIQKPTVEVTAEEFSTIMAINFE  378

Query  826   ASLNLCQLAHPLLKATGNGsivfisscssfVYAPFHTIYAATKGGINSLVRNLACEWTND  647
             +  +L QLAHPLLKA+G GSIVFISS +  V   + + YA TKG +N L +NLACEW  D
Sbjct  379   SVYHLSQLAHPLLKASGAGSIVFISSVAGVVSVKYLSAYAVTKGAMNQLTKNLACEWAED  438

Query  646   NIRVNAVAPWLMRTSLTES--SREEFGAVIEALIGRTLQHRLVEPKEASAAVAFLCFPAA  473
             NIR NAVAPW ++T + +   S + F   +E +I R    R+ +PKE S+ VAFLC PA+
Sbjct  439   NIRSNAVAPWCIKTPMVDQMLSNKTF---LEGVINRAPLRRVGDPKEVSSLVAFLCLPAS  495

Query  472   SSITGQIIRVDGGASVYG  419
             S ITGQ I VDGG +V G
Sbjct  496   SYITGQTICVDGGVTVNG  513


 Score =   263 bits (672),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 135/250 (54%), Positives = 178/250 (71%), Gaps = 5/250 (2%)
 Frame = -1

Query  1177  RWSLHGMTALVTGGTRGLGHAIVEELACLGATVYTCSRTEKELEECIQNWKAKGYKVFGS  998
             RWSL GMTALVTGGTRG+GHA+VEEL  LGA ++TCSRTE EL E +++W+ KG++V GS
Sbjct  12    RWSLKGMTALVTGGTRGIGHAVVEELTGLGARIHTCSRTETELNEYLRDWEGKGFEVTGS  71

Query  997   VCDILQPSQRENLIQLVSKQFDGKLTILVNNVAILIPKETLKSDGQDFSNTIGTNLEASL  818
             VCD+   +QRE L++ VS +F+GKL IL+NN     P  T++   ++FS+ +  N E   
Sbjct  72    VCDVSSRAQREKLMETVSSKFNGKLNILINNAGTGKPGRTVEFTAEEFSSIMAVNFEFVY  131

Query  817   NLCQLAHPLLKATGNGsivfisscssfVYAPFHTIYAATKGGINSLVRNLACEWTNDNIR  638
             +LCQLAHPLLKA+G GSIV +SS +  V   + + Y ATKG +N L ++LACEW  DNIR
Sbjct  132   HLCQLAHPLLKASGAGSIVLMSSVAGVVSLKYLSAYGATKGALNQLAKSLACEWAQDNIR  191

Query  637   VNAVAPWLMRTSLTES--SREEFGAVIEALIGRTLQHRLVEPKEASAAVAFLCFPAASSI  464
              N++APW ++TSL E   S++ F    E +I RT   R+ +PKE S+ VAFLC PA+S I
Sbjct  192   ANSIAPWFIKTSLVEPFLSKKSF---TEEVIRRTPLGRVGDPKEVSSLVAFLCLPASSYI  248

Query  463   TGQIIRVDGG  434
             TGQ I VDGG
Sbjct  249   TGQTICVDGG  258



>ref|XP_011076794.1| PREDICTED: tropinone reductase homolog [Sesamum indicum]
Length=266

 Score =   267 bits (683),  Expect = 5e-83, Method: Compositional matrix adjust.
 Identities = 148/258 (57%), Positives = 182/258 (71%), Gaps = 5/258 (2%)
 Frame = -1

Query  1186  MAG----RWSLHGMTALVTGGTRGLGHAIVEELACLGATVYTCSRTEKELEECIQNWKAK  1019
             MAG    RWSL GMTALVTGGTRG+G A VEELA +GATVYTCSR E+EL + +Q W +K
Sbjct  1     MAGSSNSRWSLSGMTALVTGGTRGIGQATVEELAEMGATVYTCSRNEEELNQRLQEWNSK  60

Query  1018  GYKVFGSVCDILQPSQRENLIQLVSKQFDGKLTILVNNVAILIPKETLKSDGQDFSNTIG  839
             G+KV GSVCD     +R  L++ VS  F+ KL IL+NNV   I K T+    +++S  + 
Sbjct  61    GFKVSGSVCDASSREERVQLMEKVSSVFNAKLDILINNVGTNIRKPTVDFTAEEYSTIMA  120

Query  838   TNLEASLNLCQLAHPLLKATGNGsivfisscssfVYAPFHTIYAATKGGINSLVRNLACE  659
             TNLE+S +L QLAHPLLKA+G  SIVFISS +  V+    +IY ATKG IN L +NLACE
Sbjct  121   TNLESSYHLSQLAHPLLKASGTSSIVFISSVAGLVHLFSGSIYGATKGAINQLTKNLACE  180

Query  658   WTNDNIRVNAVAPWLMRTSLTESSREEFGAVIEALIGRTLQHRLVEPKEASAAVAFLCFP  479
             W  DNIRVN+VAPW ++TSLT+S  E     ++ +I RT   R  EP+E S+ VAFLC P
Sbjct  181   WAKDNIRVNSVAPWYIKTSLTKSLLEN-TKFLDNVISRTPLKRPGEPQEVSSLVAFLCLP  239

Query  478   AASSITGQIIRVDGGASV  425
             AAS ITGQII VDGG +V
Sbjct  240   AASYITGQIIAVDGGMTV  257



>ref|XP_007009277.1| NAD(P)-binding Rossmann-fold superfamily protein [Theobroma cacao]
 gb|EOY18087.1| NAD(P)-binding Rossmann-fold superfamily protein [Theobroma cacao]
Length=273

 Score =   267 bits (683),  Expect = 6e-83, Method: Compositional matrix adjust.
 Identities = 144/255 (56%), Positives = 181/255 (71%), Gaps = 1/255 (0%)
 Frame = -1

Query  1189  IMAGRWSLHGMTALVTGGTRGLGHAIVEELACLGATVYTCSRTEKELEECIQNWKAKGYK  1010
             I   RWSL+GMTALVTGGTRG+GHAIVEELA LGA VYTCSR E EL +C++ W+ KG+ 
Sbjct  10    IKTSRWSLNGMTALVTGGTRGIGHAIVEELAGLGAAVYTCSRNEAELNKCLKEWEGKGFL  69

Query  1009  VFGSVCDILQPSQRENLIQLVSKQFDGKLTILVNNVAILIPKETLKSDGQDFSNTIGTNL  830
             V GSVCD     QR+ L++ V+  F+G+L ILVNNV   I K T++   +++S  I TN 
Sbjct  70    VSGSVCDASSKDQRQKLVENVASLFNGRLNILVNNVGTNIRKPTIEYSAEEYSKLITTNF  129

Query  829   EASLNLCQLAHPLLKATGNGsivfisscssfVYAPFHTIYAATKGGINSLVRNLACEWTN  650
             E+S +LCQLAHPLLKA+  GSIVFISS +  ++    +IY  TK  IN L +NLACEW  
Sbjct  130   ESSYHLCQLAHPLLKASQVGSIVFISSVAGVMHIGSGSIYGPTKAAINQLTKNLACEWAK  189

Query  649   DNIRVNAVAPWLMRTSLTESSREEFGAVIEALIGRTLQHRLVEPKEASAAVAFLCFPAAS  470
             DNIR N VAPW +RTSL E   E+   ++E +I RT   R+ EP+E S+ VAFLC PA+S
Sbjct  190   DNIRTNCVAPWYIRTSLVEHLLEKK-ELLEKIITRTPLQRVGEPEEVSSIVAFLCLPASS  248

Query  469   SITGQIIRVDGGASV  425
              ITGQ+I VDGG +V
Sbjct  249   YITGQVISVDGGLTV  263



>ref|XP_007205714.1| hypothetical protein PRUPE_ppa009944mg [Prunus persica]
 gb|EMJ06913.1| hypothetical protein PRUPE_ppa009944mg [Prunus persica]
Length=271

 Score =   267 bits (683),  Expect = 6e-83, Method: Compositional matrix adjust.
 Identities = 146/258 (57%), Positives = 182/258 (71%), Gaps = 7/258 (3%)
 Frame = -1

Query  1177  RWSLHGMTALVTGGTRGLGHAIVEELACLGATVYTCSRTEKELEECIQNWKAKGY-KVFG  1001
             RWSLHGMTALVTGGT+G+G+AIVEELA LGAT++TCSR E +L +C+  WK KG+ +V G
Sbjct  12    RWSLHGMTALVTGGTKGIGYAIVEELAGLGATIHTCSRNEVQLNDCLSQWKMKGFDQVTG  71

Query  1000  SVCDILQPSQRENLIQLVSKQFDGKLTILVNNVAILIPKETLKSDGQDFSNTIGTNLEAS  821
             SVCD++  +QRE LI  VS  F GKL IL+NNV     K  ++S  +D+S  + TNLE++
Sbjct  72    SVCDVVSKAQREELINKVSSLFHGKLNILINNVGTTDLKPAIESTTEDYSFIMSTNLESA  131

Query  820   LNLCQLAHPLLKATGNGsivfisscs-sfVYAPFHTIYAATKGGINSLVRNLACEWTNDN  644
              +  QLAHPLLKA+G G+I+F+SS +         +IYAATKG IN L +NLACEW  DN
Sbjct  132   YHFSQLAHPLLKASGAGNIIFLSSVAGVVSVGEGGSIYAATKGAINQLAKNLACEWAKDN  191

Query  643   IRVNAVAPWLMRTSLTES--SREEFGAVIEALIGRTLQHRLVEPKEASAAVAFLCFPAAS  470
             IR N+VAPW +RT L E   S + F   +EA+  R    R  EPKE SA VAFLCFPAAS
Sbjct  192   IRTNSVAPWFIRTPLVEPLLSNQNF---LEAVNSRCPLGRTGEPKEVSALVAFLCFPAAS  248

Query  469   SITGQIIRVDGGASVYGV  416
              ITGQ I VDGG +V G+
Sbjct  249   YITGQTICVDGGFTVNGL  266



>ref|XP_004293354.1| PREDICTED: tropinone reductase homolog At1g07440-like [Fragaria 
vesca subsp. vesca]
Length=268

 Score =   267 bits (682),  Expect = 6e-83, Method: Compositional matrix adjust.
 Identities = 145/257 (56%), Positives = 181/257 (70%), Gaps = 4/257 (2%)
 Frame = -1

Query  1177  RWSLHGMTALVTGGTRGLGHAIVEELACLGATVYTCSRTEKELEECIQNWKAKGY-KVFG  1001
             RWSL GMTALVTGGT+G+G+AIVEELA LGA+VYTCSR E +L EC+  WK KGY +V G
Sbjct  9     RWSLEGMTALVTGGTKGIGYAIVEELAGLGASVYTCSRNEAQLHECLNQWKKKGYHQVTG  68

Query  1000  SVCDILQPSQRENLIQLVSKQFDGKLTILVNNVAILI-PKETLKSDGQDFSNTIGTNLEA  824
             SVCD+    QRE LI  VS  F GKL ILVNNV     P  T +   +++S+ + TNLE+
Sbjct  69    SVCDVASKIQREELIHKVSSLFHGKLNILVNNVGTAHGPTPTTECTAEEYSSIMSTNLES  128

Query  823   SLNLCQLAHPLLKATGNGsivfisscssfVYA-PFHTIYAATKGGINSLVRNLACEWTND  647
             + NLCQLAHPLLK +G G+IVF+SS +  +      ++Y ATKG +N L +NLACEW  D
Sbjct  129   TYNLCQLAHPLLKTSGAGNIVFMSSVAGVLSTWGGGSVYGATKGAMNQLAKNLACEWAKD  188

Query  646   NIRVNAVAPWLMRTSLTESSREEFG-AVIEALIGRTLQHRLVEPKEASAAVAFLCFPAAS  470
             NIR+N+VAPW +RT   E    + G ++IEA+I RT   R+ EP+E SA VAFLC PAAS
Sbjct  189   NIRINSVAPWFIRTPFVEPMFNDDGKSLIEAVISRTPLGRIGEPEEVSALVAFLCLPAAS  248

Query  469   SITGQIIRVDGGASVYG  419
              ITGQ   VDGG ++ G
Sbjct  249   YITGQTFCVDGGMTING  265



>emb|CDY14094.1| BnaC02g02110D [Brassica napus]
Length=263

 Score =   267 bits (682),  Expect = 7e-83, Method: Compositional matrix adjust.
 Identities = 142/253 (56%), Positives = 179/253 (71%), Gaps = 1/253 (0%)
 Frame = -1

Query  1177  RWSLHGMTALVTGGTRGLGHAIVEELACLGATVYTCSRTEKELEECIQNWKAKGYKVFGS  998
             RWSL G TALVTGGTRG+G A+VEELA  GATV+TCSR ++ELE C+ +WK+ G  V GS
Sbjct  7     RWSLAGKTALVTGGTRGIGRAVVEELARFGATVHTCSRNQEELESCLDDWKSNGLVVTGS  66

Query  997   VCDILQPSQRENLIQLVSKQFDGKLTILVNNVAILIPKETLKSDGQDFSNTIGTNLEASL  818
             VCD     QRE LIQ VS  F GKL IL+NNV   + K T++   +D++  + TNLE++ 
Sbjct  67    VCDASVRDQREKLIQEVSSAFSGKLNILINNVGTNLRKPTVEYSSEDYAKIMSTNLESAF  126

Query  817   NLCQLAHPLLKATGNGsivfisscssfVYAPFHTIYAATKGGINSLVRNLACEWTNDNIR  638
             +  Q+AHPLLKA+G GSIVFISS +  V+    ++Y ATKG +N L RNLACEW  DNIR
Sbjct  127   HFSQIAHPLLKASGVGSIVFISSVAGLVHVSSGSVYGATKGALNQLTRNLACEWAGDNIR  186

Query  637   VNAVAPWLMRTSLTESSREEFGAVIEALIGRTLQHRLVEPKEASAAVAFLCFPAASSITG  458
              N VAPW ++TSL +   E+ G   EA++ RT   R+ EP+E S+ VAFLC PAAS ITG
Sbjct  187   TNCVAPWYIKTSLVKPLLEKEG-FEEAIVSRTPLGRVGEPEEVSSLVAFLCLPAASYITG  245

Query  457   QIIRVDGGASVYG  419
             Q+I VDGG +V G
Sbjct  246   QVISVDGGFTVNG  258



>ref|XP_010256821.1| PREDICTED: tropinone reductase homolog [Nelumbo nucifera]
Length=273

 Score =   267 bits (682),  Expect = 7e-83, Method: Compositional matrix adjust.
 Identities = 141/254 (56%), Positives = 182/254 (72%), Gaps = 1/254 (0%)
 Frame = -1

Query  1180  GRWSLHGMTALVTGGTRGLGHAIVEELACLGATVYTCSRTEKELEECIQNWKAKGYKVFG  1001
             GRWSL GMTALVTGGTRG+GHA+VEEL  LGA +YTC R E EL E +Q W  KG++V G
Sbjct  15    GRWSLKGMTALVTGGTRGIGHAVVEELGGLGAIIYTCCRNETELSERLQEWTRKGFQVTG  74

Query  1000  SVCDILQPSQRENLIQLVSKQFDGKLTILVNNVAILIPKETLKSDGQDFSNTIGTNLEAS  821
             SVCDI     RE L++ VS  F+GKL I VNN A ++ K+ L+S  +D ++T+  N E++
Sbjct  75    SVCDISSRQGREKLMESVSSAFNGKLHIFVNNPATVVMKQILESTAEDLTSTMAVNFESA  134

Query  820   LNLCQLAHPLLKATGNGsivfisscssfVYAPFHTIYAATKGGINSLVRNLACEWTNDNI  641
              +LCQLA+PLLKA+G GSIVFISS SS V  P+ ++Y A+KG IN + ++LACEW  DNI
Sbjct  135   YHLCQLAYPLLKASGMGSIVFISSLSSVVALPYMSVYGASKGAINQVTKSLACEWAKDNI  194

Query  640   RVNAVAPWLMRTSLTESSREEFGAVIEALIGRTLQHRLVEPKEASAAVAFLCFPAASSIT  461
             R N+VAP ++RTS  E   E    ++E +I R    R+ EP+E S+ VAFLC P+AS IT
Sbjct  195   RTNSVAPSIIRTSSVEPYLEN-KELVERVISRAPITRIGEPQEVSSLVAFLCLPSASYIT  253

Query  460   GQIIRVDGGASVYG  419
             GQ+I VDGG +V G
Sbjct  254   GQVICVDGGYAVNG  267



>ref|XP_007218806.1| hypothetical protein PRUPE_ppa009941mg [Prunus persica]
 gb|EMJ20005.1| hypothetical protein PRUPE_ppa009941mg [Prunus persica]
Length=271

 Score =   267 bits (682),  Expect = 7e-83, Method: Compositional matrix adjust.
 Identities = 145/262 (55%), Positives = 181/262 (69%), Gaps = 5/262 (2%)
 Frame = -1

Query  1177  RWSLHGMTALVTGGTRGLGHAIVEELACLGATVYTCSRTEKELEECIQNWKAKGYKVFGS  998
             RWSL GMTALVTGGTRG+G+A+VEELA  GA V+TCSR E EL +C++ W+AKG+ V GS
Sbjct  12    RWSLKGMTALVTGGTRGIGYAVVEELAGFGAAVHTCSRKEAELHKCLKEWEAKGFLVTGS  71

Query  997   VCDILQPSQRENLIQLVSKQFDGKLTILVNNVAILIPKETLKSDGQDFSNTIGTNLEASL  818
             VCD    ++RE L+Q V+  F+GKL ILVNNV   I K T +   +++S  + TNLE++ 
Sbjct  72    VCDASSKTEREKLVQQVASSFNGKLNILVNNVGTNIRKPTTEYTSEEYSIVMATNLESTY  131

Query  817   NLCQLAHPLLKATGNGsivfisscssfVYAPFHTIYAATKGGINSLVRNLACEWTNDNIR  638
             +L QLAHPLL+A+G GSIVFISS +  V     TIYAA+K  IN L +NLACEW  DNIR
Sbjct  132   HLSQLAHPLLRASGAGSIVFISSVAGLVSIGSGTIYAASKAAINQLTKNLACEWAKDNIR  191

Query  637   VNAVAPWLMRTSLTES--SREEFGAVIEALIGRTLQHRLVEPKEASAAVAFLCFPAASSI  464
             +N+V PW  RTSL E     +EF   +E +  RT   R+ EP+E S+ VAFLC PAAS I
Sbjct  192   INSVCPWYTRTSLVEHLLDNKEF---LEEITSRTPIDRVAEPEEVSSLVAFLCLPAASYI  248

Query  463   TGQIIRVDGGASVYGV*TIIEP  398
             TGQII VDGG +      I  P
Sbjct  249   TGQIISVDGGMTANSFNPIRRP  270



>emb|CDY04977.1| BnaAnng01590D [Brassica napus]
Length=263

 Score =   266 bits (681),  Expect = 8e-83, Method: Compositional matrix adjust.
 Identities = 142/253 (56%), Positives = 180/253 (71%), Gaps = 1/253 (0%)
 Frame = -1

Query  1177  RWSLHGMTALVTGGTRGLGHAIVEELACLGATVYTCSRTEKELEECIQNWKAKGYKVFGS  998
             RWSL G TALVTGGTRG+G A+VEELA  GATV+TCSR+++EL+ C+ +WK+ G  V GS
Sbjct  7     RWSLAGKTALVTGGTRGIGRAVVEELARFGATVHTCSRSQEELKSCLDDWKSNGLVVTGS  66

Query  997   VCDILQPSQRENLIQLVSKQFDGKLTILVNNVAILIPKETLKSDGQDFSNTIGTNLEASL  818
             VCD     QRE LIQ VS  F GK+ ILVNNV   + K T++   +D++  + TNLE++ 
Sbjct  67    VCDASDRDQREKLIQEVSSAFSGKINILVNNVGTNLRKPTVEYSSEDYAKIMSTNLESAF  126

Query  817   NLCQLAHPLLKATGNGsivfisscssfVYAPFHTIYAATKGGINSLVRNLACEWTNDNIR  638
             +  QLAHPLLKA+G GSIVFISS +  V+    ++Y ATKG +N L RNLACEW  DNIR
Sbjct  127   HFSQLAHPLLKASGVGSIVFISSVAGLVHLSSGSVYGATKGALNQLTRNLACEWAGDNIR  186

Query  637   VNAVAPWLMRTSLTESSREEFGAVIEALIGRTLQHRLVEPKEASAAVAFLCFPAASSITG  458
              N VAPW ++TSL +   E+ G   EA++ RT   R+ EP+E S+ VAFLC PAAS ITG
Sbjct  187   TNCVAPWYIKTSLVKPLLEKKG-FEEAIVSRTPLGRVGEPEEVSSLVAFLCLPAASYITG  245

Query  457   QIIRVDGGASVYG  419
             Q+I VDGG +V G
Sbjct  246   QVISVDGGFTVNG  258



>ref|XP_010067433.1| PREDICTED: tropinone reductase homolog At1g07440 [Eucalyptus 
grandis]
Length=272

 Score =   267 bits (682),  Expect = 8e-83, Method: Compositional matrix adjust.
 Identities = 140/266 (53%), Positives = 184/266 (69%), Gaps = 5/266 (2%)
 Frame = -1

Query  1210  AKYQQHNIMAGRWSLHGMTALVTGGTRGLGHAIVEELACLGATVYTCSRTEKELEECIQN  1031
             A   Q N    RW+L G TALVTGGTRG+GHAIVEEL+  GATV+TCSR  +EL +C++ 
Sbjct  2     AAAAQKNDRESRWTLRGTTALVTGGTRGIGHAIVEELSGFGATVHTCSRNGEELSKCLKE  61

Query  1030  WKAKGYKVFGSVCDILQPSQRENLIQLVSKQFDGKLTILVNNVAILIPKETLKSDGQDFS  851
             W+ KG  V GSVCD+    QRE+LI+ VS +F G+L IL+NN  +   K T+    ++FS
Sbjct  62    WEGKGLAVTGSVCDLSSRDQRESLIKEVSSKFGGRLNILINNAGMNFRKPTVDYTVEEFS  121

Query  850   NTIGTNLEASLNLCQLAHPLLKATGNGsivfisscssfVYAPFHTIYAATKGGINSLVRN  671
               + TN +++ +LCQ+AHPLLKA+G GSI+FISS +  V     ++YAATKG IN + +N
Sbjct  122   KIMATNFDSAYHLCQIAHPLLKASGAGSIIFISSVAGVVSLGTGSVYAATKGAINQITKN  181

Query  670   LACEWTNDNIRVNAVAPWLMRTSLTES--SREEFGAVIEALIGRTLQHRLVEPKEASAAV  497
             LACEW  DNIR N++APW +RTSL E+    +EF    + +I RT   R+ EPKE ++  
Sbjct  182   LACEWAKDNIRSNSIAPWYIRTSLVENLLKNKEF---YDGIIARTPLQRVGEPKEVASLA  238

Query  496   AFLCFPAASSITGQIIRVDGGASVYG  419
             AFLC PAAS ITGQ+I VDGG +V G
Sbjct  239   AFLCLPAASYITGQVISVDGGMTVNG  264



>emb|CDX98899.1| BnaC09g49360D [Brassica napus]
Length=262

 Score =   266 bits (680),  Expect = 9e-83, Method: Compositional matrix adjust.
 Identities = 142/253 (56%), Positives = 180/253 (71%), Gaps = 1/253 (0%)
 Frame = -1

Query  1177  RWSLHGMTALVTGGTRGLGHAIVEELACLGATVYTCSRTEKELEECIQNWKAKGYKVFGS  998
             RWSL G  ALVTGGTRG+G AIVEELA LGA V+TCSR ++EL+ C+ +WK+ G  V GS
Sbjct  6     RWSLAGKAALVTGGTRGIGRAIVEELARLGAKVHTCSRNQEELKACLDDWKSNGLVVSGS  65

Query  997   VCDILQPSQRENLIQLVSKQFDGKLTILVNNVAILIPKETLKSDGQDFSNTIGTNLEASL  818
             VCD     QRE LIQ VS  F GKL ILVNNV   + K T++   +D++  + TNLE++ 
Sbjct  66    VCDASDRDQREKLIQEVSSAFSGKLNILVNNVGTSVRKPTVEYTSEDYAKIMSTNLESAF  125

Query  817   NLCQLAHPLLKATGNGsivfisscssfVYAPFHTIYAATKGGINSLVRNLACEWTNDNIR  638
             ++ Q+AHPLLKA+G GSIVFISS +  V     +IY ATKG +N L RNLACEW  DNIR
Sbjct  126   HISQIAHPLLKASGVGSIVFISSVAGLVRLSTASIYGATKGALNQLTRNLACEWAGDNIR  185

Query  637   VNAVAPWLMRTSLTESSREEFGAVIEALIGRTLQHRLVEPKEASAAVAFLCFPAASSITG  458
              N+VAPW ++TSL E   E+ G  ++A++ RT   R+ EP+E ++ VAFLC PAAS ITG
Sbjct  186   TNSVAPWYIKTSLVEPLLEKKG-FVDAVVDRTPLGRVGEPEEVASLVAFLCLPAASYITG  244

Query  457   QIIRVDGGASVYG  419
             Q+I VDGG +V G
Sbjct  245   QVIAVDGGFTVNG  257



>ref|XP_008221969.1| PREDICTED: tropinone reductase homolog At1g07440-like [Prunus 
mume]
Length=271

 Score =   266 bits (681),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 145/258 (56%), Positives = 182/258 (71%), Gaps = 7/258 (3%)
 Frame = -1

Query  1177  RWSLHGMTALVTGGTRGLGHAIVEELACLGATVYTCSRTEKELEECIQNWKAKGY-KVFG  1001
             RWSLHGMTALVTGGT+G+G+AIVEELA LGAT++TCSR E +L +C+  WK KG+ +V G
Sbjct  12    RWSLHGMTALVTGGTKGIGYAIVEELAGLGATIHTCSRNEVQLNDCLSQWKTKGFDQVTG  71

Query  1000  SVCDILQPSQRENLIQLVSKQFDGKLTILVNNVAILIPKETLKSDGQDFSNTIGTNLEAS  821
             SVCD++  +QRE LI  VS  F GKL IL+NNV     K  ++S  +D+S  + TNLE++
Sbjct  72    SVCDVVSNAQREELINKVSSLFQGKLNILINNVGTAELKPAIESTTEDYSCIMSTNLESA  131

Query  820   LNLCQLAHPLLKATGNGsivfisscs-sfVYAPFHTIYAATKGGINSLVRNLACEWTNDN  644
              +  QLAHPLLKA+G G+I+F+SS +         +IY ATKG +N L +NLACEW  DN
Sbjct  132   YHFSQLAHPLLKASGAGNIIFLSSVAGVVSVGTAGSIYGATKGAMNQLAKNLACEWAKDN  191

Query  643   IRVNAVAPWLMRTSLTES--SREEFGAVIEALIGRTLQHRLVEPKEASAAVAFLCFPAAS  470
             IR N+VAPW +RT LTE   S + F   +EA+  R    R  EPKE SA VAFLCFPAAS
Sbjct  192   IRTNSVAPWFIRTPLTEPLLSNQNF---LEAVNSRCPLGRTGEPKEVSALVAFLCFPAAS  248

Query  469   SITGQIIRVDGGASVYGV  416
              ITGQ I VDGG +V G+
Sbjct  249   YITGQTICVDGGFTVNGL  266



>ref|NP_001049677.1| Os03g0269100 [Oryza sativa Japonica Group]
 gb|ABF95192.1| Tropinone reductase, putative, expressed [Oryza sativa Japonica 
Group]
 dbj|BAF11591.1| Os03g0269100 [Oryza sativa Japonica Group]
 dbj|BAG86765.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEE58768.1| hypothetical protein OsJ_10279 [Oryza sativa Japonica Group]
Length=269

 Score =   266 bits (681),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 139/258 (54%), Positives = 185/258 (72%), Gaps = 5/258 (2%)
 Frame = -1

Query  1183  AGRWSLHGMTALVTGGTRGLGHAIVEELACLGATVYTCSRTEKELEECIQNWKAKGYKVF  1004
             AGRW+L G TALVTGGTRG+GHA+V+ELA LGA V+TCSR E EL E ++ W+ KG++V 
Sbjct  10    AGRWTLRGKTALVTGGTRGIGHAVVDELAALGAAVHTCSRKEAELGERLREWEGKGFRVT  69

Query  1003  GSVCDILQPSQRENLIQLVSKQFDGKLTILVNNVAILIPKETLKSDGQDFSNTIGTNLEA  824
             GSVCD+    QRE +++ V+  + GKL ILVNNV     K+T +    D+S  + TNLE+
Sbjct  70    GSVCDVSVREQRERMLREVAGLYGGKLDILVNNVGTNFSKQTTEYSADDYSFIMATNLES  129

Query  823   SLNLCQLAHPLLKATGNGsivfisscssfVYAPFHTIYAATKGGINSLVRNLACEWTNDN  644
             + +LCQLAHPLLK++G+GS+VFISS S  V     ++YA TKG +N L +NLACEW  DN
Sbjct  130   AYHLCQLAHPLLKSSGSGSVVFISSVSGVVAVSSGSVYAMTKGAMNQLAKNLACEWAKDN  189

Query  643   IRVNAVAPWLMRTSLTES--SREEFGAVIEALIGRTLQHRLVEPKEASAAVAFLCFPAAS  470
             IR N+VAPW M+TSL E   +R++F    ++++ RT   R+ EP+E S+ VAFLC P AS
Sbjct  190   IRTNSVAPWYMKTSLVEDELARKDFA---DSVVRRTALKRVGEPEEVSSLVAFLCMPGAS  246

Query  469   SITGQIIRVDGGASVYGV  416
              ITGQ I VDGG ++ G+
Sbjct  247   YITGQTISVDGGMTINGL  264



>gb|KDP35685.1| hypothetical protein JCGZ_09123 [Jatropha curcas]
Length=268

 Score =   266 bits (681),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 150/258 (58%), Positives = 181/258 (70%), Gaps = 8/258 (3%)
 Frame = -1

Query  1177  RWSLHGMTALVTGGTRGLGHAIVEELACLGATVYTCSRTEKELEECIQNWKAKGYKVFGS  998
             RWSL GMTALVTGGT+G+G AIVEELA  GA V+TCSR EK+  E ++ WKAKGY+V  S
Sbjct  12    RWSLKGMTALVTGGTKGIGRAIVEELAGFGARVHTCSRNEKDFNERVKEWKAKGYQVSFS  71

Query  997   VCDILQPSQRENLIQLVSKQFDGKLTILVNNVAILIPKETLKSDGQDFSNTIGTNLEASL  818
             VCD+   +QRE LI  VS  FDGKL ILVNN  I+  K+ L    +++SN + TNLEA  
Sbjct  72    VCDLTCRTQREKLIDTVSSVFDGKLNILVNNAGIVALKDCLNYTSEEYSNIMSTNLEAPY  131

Query  817   NLCQLAHPLLKATGNGsivfisscssfVYAPFHTIYAATKGGINSLVRNLACEWTNDNIR  638
             ++ QLAHPLLK +GNGSIVFISS +  V  P  ++YAATKG IN L +NLACEW  DNIR
Sbjct  132   HISQLAHPLLKTSGNGSIVFISSIAGIVSLPIISVYAATKGAINQLTKNLACEWAKDNIR  191

Query  637   VNAVAPWLMRTS-LTESSREEFGAVIEA---LIGRTLQHRLVEPKEASAAVAFLCFPAAS  470
              N VAP  ++T  LTE       AVI+A   ++ RT   R+ EP E S+ VAFLC PAAS
Sbjct  192   TNTVAPSGVKTEILTEPDL----AVIKAYGGVLDRTPMGRMAEPNEVSSVVAFLCLPAAS  247

Query  469   SITGQIIRVDGGASVYGV  416
              ITGQII VDGG +V G+
Sbjct  248   YITGQIICVDGGITVNGL  265



>gb|KEH34749.1| NAD(P)-binding rossmann-fold protein [Medicago truncatula]
Length=275

 Score =   266 bits (681),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 138/255 (54%), Positives = 179/255 (70%), Gaps = 5/255 (2%)
 Frame = -1

Query  1177  RWSLHGMTALVTGGTRGLGHAIVEELACLGATVYTCSRTEKELEECIQNWKAKGYKVFGS  998
             RWSL GMTALVTGGTRG+GHAIV +L   GA V+TCSRTE EL +C+Q W++KG+ V GS
Sbjct  16    RWSLTGMTALVTGGTRGIGHAIVNDLVAFGAAVHTCSRTESELSKCLQEWQSKGFSVTGS  75

Query  997   VCDILQPSQRENLIQLVSKQFDGKLTILVNNVAILIPKETLKSDGQDFSNTIGTNLEASL  818
             VCD+   SQRE+L+Q V+  F+GKL I VNNV     K T++   +++S  +  NL++S 
Sbjct  76    VCDVSSRSQRESLVQEVASTFNGKLNIFVNNVGSNFRKPTIEYTAEEYSELMTINLDSSF  135

Query  817   NLCQLAHPLLKATGNGsivfisscssfVYAPFHTIYAATKGGINSLVRNLACEWTNDNIR  638
             +LCQL+HPLLK +GNGSIVFISS +  V     ++YAA+K  IN L +NLACEW  DNIR
Sbjct  136   HLCQLSHPLLKESGNGSIVFISSVAGVVSLGTGSVYAASKAAINQLTKNLACEWAIDNIR  195

Query  637   VNAVAPWLMRTSLTES--SREEFGAVIEALIGRTLQHRLVEPKEASAAVAFLCFPAASSI  464
              N V PW  RT L E     ++F   ++ ++ RT   R+ EP+E S+ V FLC PAAS I
Sbjct  196   SNCVVPWATRTPLVEHLFQNQKF---VDDILSRTPLKRIAEPEEVSSLVTFLCLPAASYI  252

Query  463   TGQIIRVDGGASVYG  419
             TGQ+I VDGG +V+G
Sbjct  253   TGQVICVDGGLTVFG  267



>emb|CDX86485.1| BnaC08g02180D [Brassica napus]
Length=262

 Score =   266 bits (680),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 142/256 (55%), Positives = 176/256 (69%), Gaps = 1/256 (0%)
 Frame = -1

Query  1186  MAGRWSLHGMTALVTGGTRGLGHAIVEELACLGATVYTCSRTEKELEECIQNWKAKGYKV  1007
             M  RWSL GMT LVTGGT+G+G+AIVEELA  GA V+TC+R +  L+EC+  WKAKGY+V
Sbjct  1     MDSRWSLRGMTGLVTGGTKGIGYAIVEELAGFGARVHTCARDQTLLDECLNEWKAKGYQV  60

Query  1006  FGSVCDILQPSQRENLIQLVSKQFDGKLTILVNNVAILIPKETLKSDGQDFSNTIGTNLE  827
              GSVCD+    QR+ L++ VS  F GKL IL+NNV  L  K   +   QDFS+ I TNLE
Sbjct  61    TGSVCDVSSRPQRDELMKTVSSLFSGKLNILINNVGTLTSKPATEFTAQDFSSQIATNLE  120

Query  826   ASLNLCQLAHPLLKATGNGsivfisscssfVYAPFHTIYAATKGGINSLVRNLACEWTND  647
             ++ +L QLAHPLLKA+G GSIVF+SS    V A   +IY+ TKGG+N L RNLACEW +D
Sbjct  121   SAYHLSQLAHPLLKASGFGSIVFMSSVCGVVSAGTVSIYSLTKGGMNQLARNLACEWASD  180

Query  646   NIRVNAVAPWLMRTSLTESSREEFGAVIEALIGRTLQHRLVEPKEASAAVAFLCFPAASS  467
              IR N+VAPW+ RT L +  R +     EA+  RT   R  EP E ++ V FLC PAAS 
Sbjct  181   GIRANSVAPWVTRTPLAQ-DRLDDKKYAEAICSRTPLGRTCEPSEVASLVTFLCLPAASY  239

Query  466   ITGQIIRVDGGASVYG  419
             ITGQ I +DGG +V G
Sbjct  240   ITGQTIFIDGGLTVNG  255



>gb|KCW65561.1| hypothetical protein EUGRSUZ_G02957 [Eucalyptus grandis]
Length=271

 Score =   266 bits (680),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 139/262 (53%), Positives = 183/262 (70%), Gaps = 5/262 (2%)
 Frame = -1

Query  1198  QHNIMAGRWSLHGMTALVTGGTRGLGHAIVEELACLGATVYTCSRTEKELEECIQNWKAK  1019
             Q N    RW+L G TALVTGGTRG+GHAIVEEL+  GATV+TCSR  +EL +C++ W+ K
Sbjct  5     QKNDRESRWTLRGTTALVTGGTRGIGHAIVEELSGFGATVHTCSRNGEELSKCLKEWEGK  64

Query  1018  GYKVFGSVCDILQPSQRENLIQLVSKQFDGKLTILVNNVAILIPKETLKSDGQDFSNTIG  839
             G  V GSVCD+    QRE+LI+ VS +F G+L IL+NN  +   K T+    ++FS  + 
Sbjct  65    GLAVTGSVCDLSSRDQRESLIKEVSSKFGGRLNILINNAGMNFRKPTVDYTVEEFSKIMA  124

Query  838   TNLEASLNLCQLAHPLLKATGNGsivfisscssfVYAPFHTIYAATKGGINSLVRNLACE  659
             TN +++ +LCQ+AHPLLKA+G GSI+FISS +  V     ++YAATKG IN + +NLACE
Sbjct  125   TNFDSAYHLCQIAHPLLKASGAGSIIFISSVAGVVSLGTGSVYAATKGAINQITKNLACE  184

Query  658   WTNDNIRVNAVAPWLMRTSLTES--SREEFGAVIEALIGRTLQHRLVEPKEASAAVAFLC  485
             W  DNIR N++APW +RTSL E+    +EF    + +I RT   R+ EPKE ++  AFLC
Sbjct  185   WAKDNIRSNSIAPWYIRTSLVENLLKNKEF---YDGIIARTPLQRVGEPKEVASLAAFLC  241

Query  484   FPAASSITGQIIRVDGGASVYG  419
              PAAS ITGQ+I VDGG +V G
Sbjct  242   LPAASYITGQVISVDGGMTVNG  263



>ref|XP_010491151.1| PREDICTED: tropinone reductase homolog At1g07440-like [Camelina 
sativa]
Length=262

 Score =   266 bits (679),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 138/255 (54%), Positives = 182/255 (71%), Gaps = 5/255 (2%)
 Frame = -1

Query  1177  RWSLHGMTALVTGGTRGLGHAIVEELACLGATVYTCSRTEKELEECIQNWKAKGYKVFGS  998
             RW+L G TALVTGGTRG+G A+VEELA  GA V+TCSR + EL  C+ +WK+ G+ V GS
Sbjct  6     RWTLAGKTALVTGGTRGIGRAVVEELARFGAKVHTCSRNQDELNACLNDWKSNGFVVSGS  65

Query  997   VCDILQPSQRENLIQLVSKQFDGKLTILVNNVAILIPKETLKSDGQDFSNTIGTNLEASL  818
             VCD     QR+ LIQ VS  F GKL IL+NNV   I K T++   +D++  + TNLE++ 
Sbjct  66    VCDASVKDQRDKLIQDVSSAFSGKLNILINNVGTNIRKPTVEYSSEDYAKIMSTNLESAF  125

Query  817   NLCQLAHPLLKATGNGsivfisscssfVYAPFHTIYAATKGGINSLVRNLACEWTNDNIR  638
             +L Q+AHPLLKA+G G++VFISS +  V+    +IY ATKG +N L RNLACEW +DNIR
Sbjct  126   HLSQIAHPLLKASGVGNVVFISSVAGLVHLSSGSIYGATKGALNQLTRNLACEWASDNIR  185

Query  637   VNAVAPWLMRTSLTES--SREEFGAVIEALIGRTLQHRLVEPKEASAAVAFLCFPAASSI  464
              N VAPW ++TSL E+   ++EF   ++A++ RT   R+ EP+E ++ VAFLC PAAS I
Sbjct  186   TNCVAPWYIKTSLVETLLEKKEF---VDAVVSRTPLGRVGEPEEVASLVAFLCLPAASYI  242

Query  463   TGQIIRVDGGASVYG  419
             TGQ+I VDGG +V G
Sbjct  243   TGQVISVDGGFTVNG  257



>ref|XP_011023546.1| PREDICTED: tropinone reductase homolog At1g07440-like [Populus 
euphratica]
Length=260

 Score =   265 bits (678),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 135/257 (53%), Positives = 179/257 (70%), Gaps = 2/257 (1%)
 Frame = -1

Query  1186  MAGRWSLHGMTALVTGGTRGLGHAIVEELACLGATVYTCSRTEKELEECIQNWKAKGYKV  1007
             M  RWSL GMTALVTGGT+G+G+A+V+ELA LGA V+TC+R +++L E I+ W  KG+KV
Sbjct  1     MEKRWSLQGMTALVTGGTKGIGYAVVDELAALGAIVHTCARNQEQLNERIREWNEKGFKV  60

Query  1006  FGSVCDILQPSQRENLIQLVSKQFDGKLTILVNNVAILIPKETLKSDGQDFSNTIGTNLE  827
              GSVCD+   ++RE L++ VS +FDGKL ILVNN    I K TL    +DF++ + TNL+
Sbjct  61    TGSVCDVSSDAEREKLMEEVSSRFDGKLNILVNNAGTNIYKATLDYTAEDFTSLMNTNLQ  120

Query  826   ASLNLCQLAHPLLKATGNGsiv-fisscssfVYAPFHTIYAATKGGINSLVRNLACEWTN  650
             ++ +L QLAHPLLKA+G G IV   S  S       + +Y+A+KG +N L RNLACEW  
Sbjct  121   SAFHLSQLAHPLLKASGAGKIVFMSSITSVVSINTQYPLYSASKGAMNQLTRNLACEWAK  180

Query  649   DNIRVNAVAPWLMRTSLTESSREEFGAVIEALIGRTLQHRLVEPKEASAAVAFLCFPAAS  470
             DNIRVNAVAPW +RT LT  S ++   +++ +  RT   R+ EP E S+ VAFLC PA  
Sbjct  181   DNIRVNAVAPWFIRTPLTTPSLDDEN-ILKEVFNRTPMKRVGEPGEVSSVVAFLCLPAPG  239

Query  469   SITGQIIRVDGGASVYG  419
              +TGQ+I +DGG SV G
Sbjct  240   FLTGQVICIDGGMSVNG  256



>ref|XP_009125632.1| PREDICTED: tropinone reductase homolog At1g07440-like [Brassica 
rapa]
Length=263

 Score =   266 bits (679),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 141/253 (56%), Positives = 181/253 (72%), Gaps = 1/253 (0%)
 Frame = -1

Query  1177  RWSLHGMTALVTGGTRGLGHAIVEELACLGATVYTCSRTEKELEECIQNWKAKGYKVFGS  998
             RWSL G TALVTGGTRG+G A+VEELA  GATV+TCSR+++EL+ C+ +WK+ G  + GS
Sbjct  7     RWSLAGKTALVTGGTRGIGRAVVEELARFGATVHTCSRSQEELKSCLDDWKSNGLVITGS  66

Query  997   VCDILQPSQRENLIQLVSKQFDGKLTILVNNVAILIPKETLKSDGQDFSNTIGTNLEASL  818
             VCD     QRENLIQ VS  F GK+ ILVNNV   + K T++   +D++  + TNLE++ 
Sbjct  67    VCDASVRDQRENLIQEVSSVFSGKINILVNNVGTNLRKPTVEYTSEDYAKIMSTNLESAF  126

Query  817   NLCQLAHPLLKATGNGsivfisscssfVYAPFHTIYAATKGGINSLVRNLACEWTNDNIR  638
             +  Q+AHPLLKA+G GSIVFISS +  V+    ++Y ATKG +N L RNLACEW  DNIR
Sbjct  127   HFSQIAHPLLKASGVGSIVFISSVAGLVHLSSGSVYGATKGALNQLTRNLACEWAGDNIR  186

Query  637   VNAVAPWLMRTSLTESSREEFGAVIEALIGRTLQHRLVEPKEASAAVAFLCFPAASSITG  458
              N VAPW ++TSL +   E+ G   EA++ RT   R+ EP+E S+ VAFLC PAAS ITG
Sbjct  187   TNCVAPWYIKTSLVKPLLEKKG-FEEAIVSRTPLGRVGEPEEVSSLVAFLCLPAASYITG  245

Query  457   QIIRVDGGASVYG  419
             Q+I VDGG +V G
Sbjct  246   QVISVDGGFTVNG  258



>ref|XP_009343858.1| PREDICTED: tropinone reductase homolog At1g07440-like [Pyrus 
x bretschneideri]
Length=271

 Score =   266 bits (679),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 142/260 (55%), Positives = 177/260 (68%), Gaps = 5/260 (2%)
 Frame = -1

Query  1198  QHNIMAGRWSLHGMTALVTGGTRGLGHAIVEELACLGATVYTCSRTEKELEECIQNWKAK  1019
             + N    RWSLHG  ALVTGGTRG+G+A+VEELA  GA V+TCSR E EL +C++ WKAK
Sbjct  5     ESNYPNARWSLHGGAALVTGGTRGIGYAVVEELAGFGAAVHTCSRNEAELSKCLEQWKAK  64

Query  1018  GYKVFGSVCDILQPSQRENLIQLVSKQFDGKLTILVNNVAILIPKETLKSDGQDFSNTIG  839
             G+ V GSVCD    ++RE L+  V+  F+GKL ILVNNV   I K T +   +++S  + 
Sbjct  65    GFSVTGSVCDTSSTTEREKLMDQVASTFNGKLNILVNNVGTNIRKPTTEYASEEYSLLMA  124

Query  838   TNLEASLNLCQLAHPLLKATGNGsivfisscssfVYAPFHTIYAATKGGINSLVRNLACE  659
             TNLE++ +L QLAHPLLKA+G GSIVFISS +        +IY A+K  IN L +NLACE
Sbjct  125   TNLESTYHLSQLAHPLLKASGRGSIVFISSVAGVASIASGSIYGASKAAINQLTKNLACE  184

Query  658   WTNDNIRVNAVAPWLMRTSLTES--SREEFGAVIEALIGRTLQHRLVEPKEASAAVAFLC  485
             W  DNIR NAV PW  RTSL E     +EF   +E +  RT   R+ EP+E S+ VAFLC
Sbjct  185   WAKDNIRSNAVCPWYTRTSLVEHLLDNKEF---LEEITSRTPLERVAEPEEVSSLVAFLC  241

Query  484   FPAASSITGQIIRVDGGASV  425
              PAAS ITGQ+I VDGG +V
Sbjct  242   LPAASYITGQVISVDGGMTV  261



>ref|NP_196225.1| putative tropine dehydrogenase [Arabidopsis thaliana]
 dbj|BAA98195.1| short chain alcohol dehydrogenase-like [Arabidopsis thaliana]
 gb|AAO22710.1| putative short chain alcohol dehydrogenase [Arabidopsis thaliana]
 gb|AAO42448.1| putative short chain alcohol dehydrogenase [Arabidopsis thaliana]
 gb|AED90960.1| putative tropine dehydrogenase [Arabidopsis thaliana]
Length=264

 Score =   266 bits (679),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 142/262 (54%), Positives = 184/262 (70%), Gaps = 5/262 (2%)
 Frame = -1

Query  1177  RWSLHGMTALVTGGTRGLGHAIVEELACLGATVYTCSRTEKELEECIQNWKAKGYKVFGS  998
             RWSL G TALVTGGTRG+G A+VEELA  GA V+TCSR ++EL  C+ +WKA G  V GS
Sbjct  6     RWSLAGKTALVTGGTRGIGRAVVEELAKFGAKVHTCSRNQEELNACLNDWKANGLVVSGS  65

Query  997   VCDILQPSQRENLIQLVSKQFDGKLTILVNNVAILIPKETLKSDGQDFSNTIGTNLEASL  818
             VCD     QRE LIQ  S  F GKL IL+NNV   + K T++   ++++  + TNLE++ 
Sbjct  66    VCDASVRDQREKLIQEASSAFSGKLNILINNVGTNVRKPTVEYSSEEYAKIMSTNLESAF  125

Query  817   NLCQLAHPLLKATGNGsivfisscssfVYAPFHTIYAATKGGINSLVRNLACEWTNDNIR  638
             +L Q+AHPLLKA+G GSIVFISS +  V+    +IY ATKG +N L RNLACEW +DNIR
Sbjct  126   HLSQIAHPLLKASGVGSIVFISSVAGLVHLSSGSIYGATKGALNQLTRNLACEWASDNIR  185

Query  637   VNAVAPWLMRTSLTES--SREEFGAVIEALIGRTLQHRLVEPKEASAAVAFLCFPAASSI  464
              N VAPW ++TSL E+   ++EF   +EA++ RT   R+ EP+E S+ VAFLC PA+S I
Sbjct  186   TNCVAPWYIKTSLVETLLEKKEF---VEAVVSRTPLGRVGEPEEVSSLVAFLCLPASSYI  242

Query  463   TGQIIRVDGGASVYGV*TIIEP  398
             TGQ+I VDGG +V G    ++P
Sbjct  243   TGQVISVDGGFTVNGFSYAMKP  264



>gb|KCW65560.1| hypothetical protein EUGRSUZ_G02957 [Eucalyptus grandis]
Length=271

 Score =   265 bits (678),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 138/262 (53%), Positives = 183/262 (70%), Gaps = 5/262 (2%)
 Frame = -1

Query  1198  QHNIMAGRWSLHGMTALVTGGTRGLGHAIVEELACLGATVYTCSRTEKELEECIQNWKAK  1019
             Q N    RW+L G TALVTGGTRG+GHAIVEEL+  GATV+TCSR  +EL +C++ W+ K
Sbjct  5     QKNDRESRWTLRGTTALVTGGTRGIGHAIVEELSGFGATVHTCSRNGEELSKCLKEWEGK  64

Query  1018  GYKVFGSVCDILQPSQRENLIQLVSKQFDGKLTILVNNVAILIPKETLKSDGQDFSNTIG  839
             G  V GSVCD+    QRE+LI+ VS +F G+L IL+NN  +   K T+    ++FS  + 
Sbjct  65    GLAVTGSVCDLSSRDQRESLIKEVSSKFGGRLNILINNAGMNFRKPTVDYTVEEFSKIMA  124

Query  838   TNLEASLNLCQLAHPLLKATGNGsivfisscssfVYAPFHTIYAATKGGINSLVRNLACE  659
             TN +++ +LCQ+AHPLLKA+G GSI+FISS +  V     ++YAATKG IN + +NLACE
Sbjct  125   TNFDSAYHLCQIAHPLLKASGAGSIIFISSVAGVVSLGTGSVYAATKGAINQITKNLACE  184

Query  658   WTNDNIRVNAVAPWLMRTSLTES--SREEFGAVIEALIGRTLQHRLVEPKEASAAVAFLC  485
             W  DNIR N++APW +RTSL E+    +EF    + +I RT   R+ EP+E ++  AFLC
Sbjct  185   WAKDNIRSNSIAPWYIRTSLVENLLKNKEF---YDGIIARTPLQRVGEPREVASLAAFLC  241

Query  484   FPAASSITGQIIRVDGGASVYG  419
              PAAS ITGQ+I VDGG +V G
Sbjct  242   LPAASYITGQVISVDGGMTVNG  263



>ref|XP_011023547.1| PREDICTED: tropinone reductase homolog At1g07440-like [Populus 
euphratica]
Length=260

 Score =   265 bits (677),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 138/257 (54%), Positives = 182/257 (71%), Gaps = 2/257 (1%)
 Frame = -1

Query  1186  MAGRWSLHGMTALVTGGTRGLGHAIVEELACLGATVYTCSRTEKELEECIQNWKAKGYKV  1007
             M  RWSL GMTALVTGGT+G+G+A+V+ELA LGA V+TC+R + +L E I+ W  KG+KV
Sbjct  1     MEKRWSLQGMTALVTGGTKGIGYAVVDELAALGAIVHTCARNKDQLNERIREWNEKGFKV  60

Query  1006  FGSVCDILQPSQRENLIQLVSKQFDGKLTILVNNVAILIPKETLKSDGQDFSNTIGTNLE  827
              GSVCD+   ++RE L++ VS +FDGKL ILVNN    I K TL    +DF++ + TNL+
Sbjct  61    TGSVCDVSSDAEREKLMEEVSSRFDGKLNILVNNAGTNIYKATLDYTAEDFTSLMNTNLQ  120

Query  826   ASLNLCQLAHPLLKATGNGsivfisscssfVYAPF-HTIYAATKGGINSLVRNLACEWTN  650
             ++ +L QLAHPLLKA+G G IVF+SS  S V     + +Y+A+KG +N L RNLACEW  
Sbjct  121   SAFHLSQLAHPLLKASGAGKIVFMSSIGSVVSVNTQYPVYSASKGAMNQLTRNLACEWAK  180

Query  649   DNIRVNAVAPWLMRTSLTESSREEFGAVIEALIGRTLQHRLVEPKEASAAVAFLCFPAAS  470
             DNIRVNAVAPW +RT LT  S ++   +++ +  RT   R+ EP E S+ VAFLC PA  
Sbjct  181   DNIRVNAVAPWFIRTPLTTPSLDDEN-ILKEVFNRTPMKRVGEPGEVSSVVAFLCLPAPG  239

Query  469   SITGQIIRVDGGASVYG  419
              +TGQ+I +DGG SV G
Sbjct  240   FLTGQVICIDGGMSVNG  256



>gb|ABW81118.1| putative tropinone reductase [Boechera divaricarpa]
Length=318

 Score =   267 bits (682),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 144/282 (51%), Positives = 193/282 (68%), Gaps = 5/282 (2%)
 Frame = -1

Query  1258  LRFADHQSSKSKLAKNAKYQQHNIMAGRWSLHGMTALVTGGTRGLGHAIVEELACLGATV  1079
             ++     +S S L + A     ++ + +WSL GM+ALVTGGTRG+G AIVEELA LGA V
Sbjct  34    IKLQPQTTSSSVLIRCASQSSISVTSKKWSLQGMSALVTGGTRGIGRAIVEELAGLGAEV  93

Query  1078  YTCSRTEKELEECIQNWKAKGYKVFGSVCDILQPSQRENLIQLVSKQFDGKLTILVNNVA  899
             +TC+R E ELE C+++W + G+++ GSVCD+   +QRE L+++VS  FDGKL ILVNNV 
Sbjct  94    HTCARNESELENCLRDWNSSGFRIAGSVCDVSDQAQREALMEIVSSVFDGKLHILVNNVG  153

Query  898   ILIPKETLKSDGQDFSNTIGTNLEASLNLCQLAHPLLKATGNGsivfisscssfVYAPFH  719
               I K  ++    +FS  + TN E   NLCQLA+PLL+A+  GS+V ISS S FV     
Sbjct  154   TNIRKPMVEFTAGEFSTLMSTNFEPVFNLCQLAYPLLRASEAGSVVSISSVSGFVSLKNM  213

Query  718   TIYAATKGGINSLVRNLACEWTNDNIRVNAVAPWLMRTSLTES--SREEFGAVIEALIGR  545
             ++ +ATKG IN L R+LACEW  DNIR+NAVAPW ++TS+ E   S +++   +E +   
Sbjct  214   SVQSATKGAINQLTRSLACEWAKDNIRINAVAPWYIKTSMVEQVLSNKDY---LEEVYSV  270

Query  544   TLQHRLVEPKEASAAVAFLCFPAASSITGQIIRVDGGASVYG  419
             T   RL EP+E S+AVAFLC PA+S ITGQII VDGG S+ G
Sbjct  271   TPLGRLGEPREVSSAVAFLCLPASSYITGQIICVDGGMSING  312



>ref|XP_004307471.1| PREDICTED: tropinone reductase homolog [Fragaria vesca subsp. 
vesca]
Length=271

 Score =   265 bits (677),  Expect = 4e-82, Method: Compositional matrix adjust.
 Identities = 140/254 (55%), Positives = 177/254 (70%), Gaps = 1/254 (0%)
 Frame = -1

Query  1195  HNIMAGRWSLHGMTALVTGGTRGLGHAIVEELACLGATVYTCSRTEKELEECIQNWKAKG  1016
              N+   RWSL G TALVTGGTRG+G+A+VEELA LGA V+TCSR  +ELE C++ W AKG
Sbjct  6     RNLATPRWSLTGTTALVTGGTRGIGYAVVEELASLGAYVFTCSRNAEELERCLKEWSAKG  65

Query  1015  YKVFGSVCDILQPSQRENLIQLVSKQFDGKLTILVNNVAILIPKETLKSDGQDFSNTIGT  836
             +++ G VCD+   S+RE L++ V   F G+L I VNNV   I K T +   +++S  + T
Sbjct  66    FRITGIVCDVSVKSEREKLMEQVGVSFAGRLNIFVNNVGTNIRKPTTEYTFEEYSKVMST  125

Query  835   NLEASLNLCQLAHPLLKATGNGsivfisscssfVYAPFHTIYAATKGGINSLVRNLACEW  656
             NLE++ +LCQ+AHPLLK +G GS+VFISS +  V     TIYAA+K  IN L +NLACEW
Sbjct  126   NLESTYHLCQIAHPLLKGSGAGSVVFISSVAGLVSLGSGTIYAASKAAINQLTKNLACEW  185

Query  655   TNDNIRVNAVAPWLMRTSLTESSREEFGAVIEALIGRTLQHRLVEPKEASAAVAFLCFPA  476
               DNIR NAVAPW  RTSL E   E+    +E +  RT  +R+ EP+E S+ VAFLC PA
Sbjct  186   AKDNIRSNAVAPWYTRTSLVEHMLED-KKFLEEVTSRTPLNRVAEPEEVSSLVAFLCLPA  244

Query  475   ASSITGQIIRVDGG  434
             AS ITGQII VDGG
Sbjct  245   ASYITGQIICVDGG  258



>gb|KCW52641.1| hypothetical protein EUGRSUZ_J02019 [Eucalyptus grandis]
Length=279

 Score =   265 bits (678),  Expect = 4e-82, Method: Compositional matrix adjust.
 Identities = 144/255 (56%), Positives = 179/255 (70%), Gaps = 5/255 (2%)
 Frame = -1

Query  1177  RWSLHGMTALVTGGTRGLGHAIVEELACLGATVYTCSRTEKELEECIQNWKAKGYKVFGS  998
             +W LHGMTALVTG T+G+GHAIV+ELA LGATV+TCSR E E+ EC+++WK+KG++V GS
Sbjct  22    KWLLHGMTALVTGRTKGIGHAIVKELARLGATVHTCSRNEAEINECLKDWKSKGFRVSGS  81

Query  997   VCDILQPSQRENLIQLVSKQFDGKLTILVNNVAILIPKETLKSDGQDFSNTIGTNLEASL  818
              CD+   S+RE L+  VS  FDGKL IL+NNV     K T+    +DFS  + TN E++ 
Sbjct  82    TCDVSSRSEREKLMLTVSSVFDGKLNILINNVGTNTLKSTMDYTAEDFSFIMTTNFESTY  141

Query  817   NLCQLAHPLLKATGNGsivfisscssfVYAPFHTIYAATKGGINSLVRNLACEWTNDNIR  638
             +L QLAHPLLKA+G GSIVF+SS    V     +IY+ATKG +N L +NLACEW  DNIR
Sbjct  142   HLSQLAHPLLKASGAGSIVFLSSVCGVVSINVGSIYSATKGAMNQLTKNLACEWAKDNIR  201

Query  637   VNAVAPWLMRTSLTES--SREEFGAVIEALIGRTLQHRLVEPKEASAAVAFLCFPAASSI  464
              N+VAPW + T L E   S E+F    E +I RT   R  EP+E S+ VAFLC PAAS I
Sbjct  202   SNSVAPWFILTPLAEPVLSDEKFH---EEVIARTPLGRTGEPEEVSSLVAFLCLPAASYI  258

Query  463   TGQIIRVDGGASVYG  419
             TGQ I VDGG +V G
Sbjct  259   TGQTICVDGGFTVNG  273



>emb|CDP14238.1| unnamed protein product [Coffea canephora]
Length=271

 Score =   265 bits (677),  Expect = 4e-82, Method: Compositional matrix adjust.
 Identities = 141/250 (56%), Positives = 175/250 (70%), Gaps = 2/250 (1%)
 Frame = -1

Query  1177  RWSLHGMTALVTGGTRGLGHAIVEELACLGATVYTCSRTEKELEECIQNWKAKGYKVFGS  998
             RWSL G TALVTGGTRG+GHAIVEELA  GA V+TCSR + EL + ++ WKAKG++V GS
Sbjct  12    RWSLKGQTALVTGGTRGIGHAIVEELAGFGARVHTCSRNQTELNDRLKEWKAKGFQVSGS  71

Query  997   VCDILQPSQRENLIQLVSKQFDGKLTILVNNVAILIPKETLKSDGQDFSNTIGTNLEASL  818
             VCD+L  +QRE L++ VS +FD KL ILVNN A    K    S  +D+S  + TNLE+S 
Sbjct  72    VCDLLSRTQREELMKTVSSEFDAKLNILVNNAATTKMKRAENSTSEDYSFLMSTNLESSF  131

Query  817   NLCQLAHPLLKATGNGsivfisscssfVYAPFHTIYAATKGGINSLVRNLACEWTNDNIR  638
             +L QLA+PLLKA+ NG+IVFISS +     P  +IY+ATKG IN L +NLACEW  D+IR
Sbjct  132   HLSQLAYPLLKASANGNIVFISSVAGATALPGLSIYSATKGAINQLTKNLACEWAKDSIR  191

Query  637   VNAVAPWLMRTSL--TESSREEFGAVIEALIGRTLQHRLVEPKEASAAVAFLCFPAASSI  464
             VN VAPW +RT++   E + E    +   L+ RT   R+ E  E S  VAFLC PAAS I
Sbjct  192   VNTVAPWAVRTTVLKPEEADESLLRMFFPLVNRTPLRRIAEANEISPLVAFLCLPAASYI  251

Query  463   TGQIIRVDGG  434
             TGQ+I VDGG
Sbjct  252   TGQVICVDGG  261



>gb|KDP44893.1| hypothetical protein JCGZ_01393 [Jatropha curcas]
Length=274

 Score =   265 bits (677),  Expect = 5e-82, Method: Compositional matrix adjust.
 Identities = 142/250 (57%), Positives = 176/250 (70%), Gaps = 5/250 (2%)
 Frame = -1

Query  1177  RWSLHGMTALVTGGTRGLGHAIVEELACLGATVYTCSRTEKELEECIQNWKAKGYKVFGS  998
             RWSL G+TALVTGGTRG+G+A VEELA LGA V+TCSR E EL +C++ W+AKG+ V GS
Sbjct  12    RWSLQGLTALVTGGTRGIGYATVEELAGLGARVHTCSRNEAELSKCLKEWEAKGFLVTGS  71

Query  997   VCDILQPSQRENLIQLVSKQFDGKLTILVNNVAILIPKETLKSDGQDFSNTIGTNLEASL  818
             VCD     QRENLI+ V   F G L ILVNNV   I K T++   ++F+  + TNLE + 
Sbjct  72    VCDASSREQRENLIREVGSAFSGSLNILVNNVGTNIRKPTIEYSAEEFAKLMTTNLETTY  131

Query  817   NLCQLAHPLLKATGNGsivfisscssfVYAPFHTIYAATKGGINSLVRNLACEWTNDNIR  638
             +LCQLAHPLLKA+G GSIVFISS     +    +IY A+KG IN L +NLACEW  DNIR
Sbjct  132   HLCQLAHPLLKASGVGSIVFISSVGGLAHIGSGSIYGASKGAINQLTKNLACEWAKDNIR  191

Query  637   VNAVAPWLMRTSLTES--SREEFGAVIEALIGRTLQHRLVEPKEASAAVAFLCFPAASSI  464
              N VAPW ++TSL E+    +EF   ++ ++ RT   R+ E KE S+ VAFLC PAAS I
Sbjct  192   SNCVAPWYIKTSLVENLLDNKEF---LDKVVSRTPLQRVGEAKEVSSLVAFLCLPAASYI  248

Query  463   TGQIIRVDGG  434
             TGQ+I VDGG
Sbjct  249   TGQVIAVDGG  258



>ref|XP_008222016.1| PREDICTED: tropinone reductase homolog At1g07440-like [Prunus 
mume]
Length=264

 Score =   265 bits (676),  Expect = 5e-82, Method: Compositional matrix adjust.
 Identities = 138/256 (54%), Positives = 180/256 (70%), Gaps = 5/256 (2%)
 Frame = -1

Query  1177  RWSLHGMTALVTGGTRGLGHAIVEELACLGATVYTCSRTEKELEECIQNWKAKGYKVFGS  998
             RWSL G+TALVTGGT+G+G+AIVEELA  GAT++TC+R E +L +C+  W+ KG+KV GS
Sbjct  7     RWSLEGLTALVTGGTKGIGYAIVEELAGFGATIHTCARNEVDLNDCLSQWENKGFKVTGS  66

Query  997   VCDILQPSQRENLIQLVSKQFDGKLTILVNNVAILIPKETLKSDGQDFSNTIGTNLEASL  818
             VCD++  SQRE LI  +S  FDGKL IL++NV   I K T +   +D++  + TNLE++ 
Sbjct  67    VCDVVSKSQREELINKLSSLFDGKLNILISNVGTNITKPTTEFTAEDYTFLMSTNLESAY  126

Query  817   NLCQLAHPLLKATGNGsivfisscssfVYAPFHTIYAATKGGINSLVRNLACEWTNDNIR  638
             NLCQLAHPLLKA+G G+IVF+SS +        +IY+A KG IN L +NLACEW  DNIR
Sbjct  127   NLCQLAHPLLKASGAGNIVFVSSVAGVTSLEVGSIYSAAKGAINQLAKNLACEWAKDNIR  186

Query  637   VNAVAPWLMRTSLTES--SREEFGAVIEALIGRTLQHRLVEPKEASAAVAFLCFPAASSI  464
              N+VAPW + T L +     E+   +I++   RT   R  EP+E S+ VAFLC PAAS I
Sbjct  187   TNSVAPWFITTPLADHFLGNEKSLKIIKS---RTPLRRPGEPEEVSSLVAFLCLPAASYI  243

Query  463   TGQIIRVDGGASVYGV  416
             TGQ I VDGG +V G+
Sbjct  244   TGQTISVDGGVTVNGL  259



>ref|XP_004294665.1| PREDICTED: tropinone reductase homolog At1g07440-like [Fragaria 
vesca subsp. vesca]
Length=272

 Score =   265 bits (676),  Expect = 5e-82, Method: Compositional matrix adjust.
 Identities = 145/257 (56%), Positives = 182/257 (71%), Gaps = 4/257 (2%)
 Frame = -1

Query  1177  RWSLHGMTALVTGGTRGLGHAIVEELACLGATVYTCSRTEKELEECIQNWKAKGY-KVFG  1001
             RWSL GMTALVTGGT+G+G+AIVEELA LGA+VYTCSR E +L EC+  WK KGY +V G
Sbjct  9     RWSLEGMTALVTGGTKGIGYAIVEELAGLGASVYTCSRNEAQLHECLNQWKKKGYHQVTG  68

Query  1000  SVCDILQPSQRENLIQLVSKQFDGKLTILVNNVAILI-PKETLKSDGQDFSNTIGTNLEA  824
             SVCD+    QRE LI  VS  F GKL ILVNNV     P  T +   +++S+ + TNLE+
Sbjct  69    SVCDVASKIQREELIHKVSSLFHGKLNILVNNVGTSHGPTPTTECTAEEYSSIMNTNLES  128

Query  823   SLNLCQLAHPLLKATGNGsivfisscssfVYA-PFHTIYAATKGGINSLVRNLACEWTND  647
             + NLCQLAHPLLK +G G+IVF+SS +  V      ++Y  TKG +N L +NLACEW  D
Sbjct  129   TYNLCQLAHPLLKTSGAGNIVFMSSVAGVVSTWGGGSVYGVTKGAMNQLAKNLACEWAKD  188

Query  646   NIRVNAVAPWLMRTSLTESSREEFG-AVIEALIGRTLQHRLVEPKEASAAVAFLCFPAAS  470
             NIR+N+VAPW++RT L E    + G +++EA+I RT   R+ EP+E SA VAFLC PAAS
Sbjct  189   NIRINSVAPWVVRTPLAEPMFTDDGKSLLEAVISRTPLGRIGEPEEVSALVAFLCLPAAS  248

Query  469   SITGQIIRVDGGASVYG  419
              ITGQ   VDGG ++ G
Sbjct  249   YITGQTFCVDGGMTING  265



>gb|AFK36242.1| unknown [Medicago truncatula]
Length=275

 Score =   265 bits (677),  Expect = 5e-82, Method: Compositional matrix adjust.
 Identities = 137/255 (54%), Positives = 178/255 (70%), Gaps = 5/255 (2%)
 Frame = -1

Query  1177  RWSLHGMTALVTGGTRGLGHAIVEELACLGATVYTCSRTEKELEECIQNWKAKGYKVFGS  998
             RWSL GMTALVTGGTRG+GHAIV +L   GA V+TCSRTE EL +C+Q W++KG+ V GS
Sbjct  16    RWSLTGMTALVTGGTRGIGHAIVNDLVAFGAAVHTCSRTESELSKCLQEWQSKGFSVTGS  75

Query  997   VCDILQPSQRENLIQLVSKQFDGKLTILVNNVAILIPKETLKSDGQDFSNTIGTNLEASL  818
             VCD+   SQRE+L+Q V+  F+GKL I VNNV     K T++   +++S  +  NL++S 
Sbjct  76    VCDVSSRSQRESLVQEVASTFNGKLNIFVNNVGSNFRKPTIEYTAEEYSELMTINLDSSF  135

Query  817   NLCQLAHPLLKATGNGsivfisscssfVYAPFHTIYAATKGGINSLVRNLACEWTNDNIR  638
             +LCQL+HPLLK +GNGSIVFISS +  V     ++Y A+K  IN L +NLACEW  DNIR
Sbjct  136   HLCQLSHPLLKESGNGSIVFISSVAGVVSLGTGSVYTASKAAINQLTKNLACEWAIDNIR  195

Query  637   VNAVAPWLMRTSLTES--SREEFGAVIEALIGRTLQHRLVEPKEASAAVAFLCFPAASSI  464
              N V PW  RT L E     ++F   ++ ++ RT   R+ EP+E S+ V FLC PAAS I
Sbjct  196   SNCVVPWATRTPLVEHLFQNQKF---VDDILSRTPLKRIAEPEEVSSLVTFLCLPAASYI  252

Query  463   TGQIIRVDGGASVYG  419
             TGQ+I VDGG +V+G
Sbjct  253   TGQVICVDGGLTVFG  267



>ref|XP_004984926.1| PREDICTED: tropinone reductase homolog At1g07440-like [Setaria 
italica]
Length=274

 Score =   264 bits (675),  Expect = 8e-82, Method: Compositional matrix adjust.
 Identities = 143/255 (56%), Positives = 181/255 (71%), Gaps = 1/255 (0%)
 Frame = -1

Query  1183  AGRWSLHGMTALVTGGTRGLGHAIVEELACLGATVYTCSRTEKELEECIQNWKAKGYKVF  1004
             +GRW+LHG TALVTGGTRG+G A+VEELA LGA V+TCSR E+EL E I+ W+A+G++V 
Sbjct  14    SGRWALHGKTALVTGGTRGIGRAVVEELAALGAAVHTCSRKEEELGERIKEWEARGFRVT  73

Query  1003  GSVCDILQPSQRENLIQLVSKQFDGKLTILVNNVAILIPKETLKSDGQDFSNTIGTNLEA  824
             GSVCD+    QRE L++ V+ +F GKL ILVNNV   I K T +   +++S  + TNLE+
Sbjct  74    GSVCDLSARDQRERLLREVADRFGGKLDILVNNVGTNIRKPTTEFSAEEYSFLMATNLES  133

Query  823   SLNLCQLAHPLLKATGNGsivfisscssfVYAPFHTIYAATKGGINSLVRNLACEWTNDN  644
             + +LCQ+AHPLLK +G+GSIVFISS +  V     TIYA TKG IN L + LACEW  DN
Sbjct  134   AYHLCQIAHPLLKLSGSGSIVFISSVAGVVSVFSGTIYAMTKGAINQLTKTLACEWARDN  193

Query  643   IRVNAVAPWLMRTSLTESSREEFGAVIEALIGRTLQHRLVEPKEASAAVAFLCFPAASSI  464
             IR N+VAPW + TSLTE   E   +  E ++ RT   R+ EP E SA VAFLC P ++ I
Sbjct  194   IRANSVAPWYITTSLTEKLLES-NSFKEQVVSRTPLGRVGEPGEISALVAFLCMPGSTYI  252

Query  463   TGQIIRVDGGASVYG  419
             TGQ I VDGG +V G
Sbjct  253   TGQTISVDGGTTVNG  267



>ref|XP_002277835.1| PREDICTED: tropinone reductase homolog At1g07440 [Vitis vinifera]
 emb|CBI31630.3| unnamed protein product [Vitis vinifera]
Length=268

 Score =   264 bits (675),  Expect = 8e-82, Method: Compositional matrix adjust.
 Identities = 142/254 (56%), Positives = 182/254 (72%), Gaps = 5/254 (2%)
 Frame = -1

Query  1174  WSLHGMTALVTGGTRGLGHAIVEELACLGATVYTCSRTEKELEECIQNWKAKGYKVFGSV  995
             WSL G TALVTGGTRG+G+A+VEELA LG+TV+TCSR E EL++C++ W AKG+ V GSV
Sbjct  13    WSLRGTTALVTGGTRGIGYAVVEELAGLGSTVHTCSRNEAELDKCLREWHAKGFAVTGSV  72

Query  994   CDILQPSQRENLIQLVSKQFDGKLTILVNNVAILIPKETLKSDGQDFSNTIGTNLEASLN  815
             CD    +QRE L++ VS  F+GKL IL+NNV   I K T+     ++S  + TNLE++ +
Sbjct  73    CDGSDRAQREQLMEKVSSIFNGKLNILINNVGTNIRKPTVDFTAAEYSTIMTTNLESAYH  132

Query  814   LCQLAHPLLKATGNGsivfisscssfVYAPFHTIYAATKGGINSLVRNLACEWTNDNIRV  635
             LCQLAHPLLKA+G GSIVFISS +  +     +IYAATK  +N L +NL+CEW  DNIR 
Sbjct  133   LCQLAHPLLKASGAGSIVFISSVAGVLSLGTGSIYAATKAAMNQLTKNLSCEWAKDNIRS  192

Query  634   NAVAPWLMRTSLTES--SREEFGAVIEALIGRTLQHRLVEPKEASAAVAFLCFPAASSIT  461
             N+VAPW ++TSL E    +++F    E++I RT   R  EPKE S+ VAFLC P AS IT
Sbjct  193   NSVAPWYIKTSLVEHLLQKQDF---FESVISRTPLRRPGEPKEVSSLVAFLCLPVASYIT  249

Query  460   GQIIRVDGGASVYG  419
             GQ+I VDGG +V G
Sbjct  250   GQVICVDGGMTVNG  263



>gb|AFP55030.1| tropinone reductase I [Atropa belladonna]
Length=272

 Score =   264 bits (675),  Expect = 9e-82, Method: Compositional matrix adjust.
 Identities = 139/261 (53%), Positives = 183/261 (70%), Gaps = 11/261 (4%)
 Frame = -1

Query  1180  GRWSLHGMTALVTGGTRGLGHAIVEELACLGATVYTCSRTEKELEECIQNWKAKGYKVFG  1001
             GRWSL G TALVTGG++G+G+AIVEELA  GATVYTCSR E EL+ECI NW+  G KV G
Sbjct  14    GRWSLKGTTALVTGGSKGIGYAIVEELAGFGATVYTCSRNENELQECIDNWRKNGLKVEG  73

Query  1000  SVCDILQPSQRENLIQLVSKQFDGKLTILVNNVAILIPKETLKSDGQDFSNTIGTNLEAS  821
             SVCD+L  ++RE L+Q V   F+GKL+ILVNN  ++I KE      +D++  +GTN EA+
Sbjct  74    SVCDLLLRTEREKLMQTVGDAFNGKLSILVNNAGVVIHKEAKDFTAEDYNIVMGTNFEAA  133

Query  820   LNLCQLAHPLLKATGNGsivfisscssfVYAPFHTIYAATKGGINSLVRNLACEWTNDNI  641
              +L Q+A+PLLKA+ NG+++F+SS + F   P  ++Y+A+K  IN + +NLACEW  DNI
Sbjct  134   YHLSQIAYPLLKASENGNVIFLSSIAGFSALPSVSLYSASKAAINQMTKNLACEWAKDNI  193

Query  640   RVNAVAPWLMRTSLTESS-------REEFGAVIEALIGRTLQHRLVEPKEASAAVAFLCF  482
             RVN+VAP ++ T L E++       +EE    I+  I +T   R   PKE SA +AFLCF
Sbjct  194   RVNSVAPGVILTPLVETAIKKNPHQKEE----IDNFIVKTPMGRAGNPKEVSALIAFLCF  249

Query  481   PAASSITGQIIRVDGGASVYG  419
             PAAS ITGQII  DGG +  G
Sbjct  250   PAASYITGQIIWADGGFTANG  270



>ref|XP_002319563.2| tropinone reductase family protein [Populus trichocarpa]
 gb|EEE95486.2| tropinone reductase family protein [Populus trichocarpa]
Length=267

 Score =   264 bits (674),  Expect = 9e-82, Method: Compositional matrix adjust.
 Identities = 137/254 (54%), Positives = 175/254 (69%), Gaps = 2/254 (1%)
 Frame = -1

Query  1177  RWSLHGMTALVTGGTRGLGHAIVEELACLGATVYTCSRTEKELEECIQNWKAKGYKVFGS  998
             RW L GMTALVTGGT+GLG AIVEELA LGA V+TC+R + ++ E ++ WK KG+KV GS
Sbjct  11    RWGLQGMTALVTGGTKGLGCAIVEELAALGAIVHTCARNQDQINERVREWKEKGFKVTGS  70

Query  997   VCDILQPSQRENLIQLVSKQFDGKLTILVNNVAILIPKETLKSDGQDFSNTIGTNLEASL  818
             VCD+   ++RE L++ VS  FDGKL ILVNN    I K TL    +DF++ + TNL+++ 
Sbjct  71    VCDVSSNAEREKLMKEVSSLFDGKLNILVNNAGTNIYKATLDYTAEDFTSLMNTNLQSAF  130

Query  817   NLCQLAHPLLKATGNGsiv-fisscssfVYAPFHTIYAATKGGINSLVRNLACEWTNDNI  641
             +L QLAHPLLKA+G G IV   S  S     P + +Y+A+KG +N L RNLACEW  DNI
Sbjct  131   HLSQLAHPLLKASGAGKIVFMSSIISVVSMNPQYPLYSASKGAMNQLTRNLACEWAKDNI  190

Query  640   RVNAVAPWLMRTSLTESSREEFGAVIEALIGRTLQHRLVEPKEASAAVAFLCFPAASSIT  461
             RVN VAPW +RT LT  S ++  ++ + +  RT   R+ EP E S+ VAFLC PA   +T
Sbjct  191   RVNGVAPWFVRTPLTAHSLDD-ESIAKEVFSRTPMRRVGEPGEVSSVVAFLCLPAPGFLT  249

Query  460   GQIIRVDGGASVYG  419
             GQII VDGG SV G
Sbjct  250   GQIICVDGGMSVNG  263



>ref|XP_008349592.1| PREDICTED: tropinone reductase homolog At1g07440-like isoform 
X1 [Malus domestica]
 ref|XP_008358999.1| PREDICTED: tropinone reductase homolog At1g07440-like isoform 
X1 [Malus domestica]
Length=264

 Score =   264 bits (674),  Expect = 9e-82, Method: Compositional matrix adjust.
 Identities = 142/255 (56%), Positives = 177/255 (69%), Gaps = 3/255 (1%)
 Frame = -1

Query  1177  RWSLHGMTALVTGGTRGLGHAIVEELACLGATVYTCSRTEKELEECIQNWKAKGYKVFGS  998
             RWSL GMTALVTGGT+G+G+AIVEELA LGA V+TCSR E +L +C   W+ KG++V GS
Sbjct  7     RWSLRGMTALVTGGTKGIGYAIVEELAGLGAIVHTCSRNEVDLNDCQSQWEKKGFQVTGS  66

Query  997   VCDILQPSQRENLIQLVSKQFDGKLTILVNNVAILIPKETLKSDGQDFSNTIGTNLEASL  818
             VCD++  +QRE LI  VS  FDGKL IL+NNV   + K TL+   +D+S  + TNLE++ 
Sbjct  67    VCDVVSKTQREELINKVSSLFDGKLNILINNVGTSLTKATLEYTAEDYSFIMSTNLESAY  126

Query  817   NLCQLAHPLLKATGNGsivfisscssfVYAPFHTIYAATKGGINSLVRNLACEWTNDNIR  638
             N CQL+HPLLKA G  SIVF+SS +  V     +IY+ATKG +N L +NLACEW  DNIR
Sbjct  127   NFCQLSHPLLKAAGAASIVFLSSTAGVVSIDGESIYSATKGAMNQLAKNLACEWAKDNIR  186

Query  637   VNAVAPWLMRTSLTESS-REEFGAVIEALIGRTLQHRLVEPKEASAAVAFLCFPAASSIT  461
              N+VAPW + T L E   R E    +E +  R    R  EP+E S+ VAFLC PAAS IT
Sbjct  187   TNSVAPWFITTPLAEPFLRNE--KKLEMINSRCPLGRPGEPEEVSSLVAFLCLPAASYIT  244

Query  460   GQIIRVDGGASVYGV  416
             GQ I VDGG +V G+
Sbjct  245   GQTIIVDGGVTVNGL  259



>ref|XP_010096620.1| Tropinone reductase-like protein [Morus notabilis]
 gb|EXB65288.1| Tropinone reductase-like protein [Morus notabilis]
Length=275

 Score =   264 bits (675),  Expect = 9e-82, Method: Compositional matrix adjust.
 Identities = 141/257 (55%), Positives = 179/257 (70%), Gaps = 5/257 (2%)
 Frame = -1

Query  1183  AGRWSLHGMTALVTGGTRGLGHAIVEELACLGATVYTCSRTEKELEECIQNWKAKGYKVF  1004
             + RWSL G TA+VTGGTRG+G A+VEELA  GA V+TCSR E+EL+ C++ W+ KG  V 
Sbjct  14    SSRWSLKGTTAVVTGGTRGIGRAVVEELAEFGAAVHTCSRNEEELKRCLKEWEGKGLLVS  73

Query  1003  GSVCDILQPSQRENLIQLVSKQFDGKLTILVNNVAILIPKETLKSDGQDFSNTIGTNLEA  824
             GSVCD    +QRE LIQ V+  F+GKL I+VNNV   I K TL+   ++++  + TN E+
Sbjct  74    GSVCDASSKTQREKLIQEVASAFNGKLNIIVNNVGTNIRKPTLEYTAEEYTLLLSTNFES  133

Query  823   SLNLCQLAHPLLKATGNGsivfisscssfVYAPFHTIYAATKGGINSLVRNLACEWTNDN  644
             + +LCQLAHPLLKA+G GSIVFISS +  +     +IYAA+K  IN L +NLACEW  DN
Sbjct  134   TYHLCQLAHPLLKASGGGSIVFISSVAGLLNISSGSIYAASKAAINQLTKNLACEWAKDN  193

Query  643   IRVNAVAPWLMRTSLTES--SREEFGAVIEALIGRTLQHRLVEPKEASAAVAFLCFPAAS  470
             IR N VAPW  RTSL E     +EF   +E +I +T  HR+ EP+E S+ V +LC PAAS
Sbjct  194   IRSNCVAPWYTRTSLVEHLLDNKEF---LEEIIDKTPLHRVAEPEEVSSLVTYLCLPAAS  250

Query  469   SITGQIIRVDGGASVYG  419
              ITGQ+I VDGG  V G
Sbjct  251   YITGQVISVDGGMIVNG  267



>ref|XP_010067438.1| PREDICTED: tropinone reductase homolog At1g07440-like [Eucalyptus 
grandis]
 gb|KCW65563.1| hypothetical protein EUGRSUZ_G02959 [Eucalyptus grandis]
Length=271

 Score =   264 bits (674),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 137/260 (53%), Positives = 179/260 (69%), Gaps = 1/260 (0%)
 Frame = -1

Query  1198  QHNIMAGRWSLHGMTALVTGGTRGLGHAIVEELACLGATVYTCSRTEKELEECIQNWKAK  1019
             Q N    RW+L G TALVTGGTRG+GHAIVEEL+  GATV+TCSR  +EL +C++ W+ K
Sbjct  5     QKNDRESRWTLRGTTALVTGGTRGIGHAIVEELSGFGATVHTCSRNGEELSKCLKEWEGK  64

Query  1018  GYKVFGSVCDILQPSQRENLIQLVSKQFDGKLTILVNNVAILIPKETLKSDGQDFSNTIG  839
             G  V GSVCD+    QRENLI+ VS +F G+L IL+NN      K T+    ++FS  + 
Sbjct  65    GLAVTGSVCDLSSRDQRENLIKEVSSKFGGRLNILINNAGTNFRKPTVDYTVEEFSKIMA  124

Query  838   TNLEASLNLCQLAHPLLKATGNGsivfisscssfVYAPFHTIYAATKGGINSLVRNLACE  659
             TN +++ +LCQ+AHPLLKA+G GSI+FISS +  V     ++YAATKG IN + +NLACE
Sbjct  125   TNFDSAYHLCQIAHPLLKASGAGSIIFISSVAGVVSLGTGSVYAATKGAINQITKNLACE  184

Query  658   WTNDNIRVNAVAPWLMRTSLTESSREEFGAVIEALIGRTLQHRLVEPKEASAAVAFLCFP  479
             W  DNIR N++APW  RTS  E+  +    + + +I RT   R+ EPKE ++  AFLC P
Sbjct  185   WAKDNIRSNSIAPWYTRTSFVENLLKN-KELYDGIIARTPLQRVGEPKEVASLAAFLCLP  243

Query  478   AASSITGQIIRVDGGASVYG  419
             AAS ITGQ+I VDGG +V G
Sbjct  244   AASYITGQVISVDGGMTVNG  263



>ref|XP_008375982.1| PREDICTED: tropinone reductase homolog At1g07440-like isoform 
X1 [Malus domestica]
Length=264

 Score =   264 bits (674),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 141/256 (55%), Positives = 181/256 (71%), Gaps = 5/256 (2%)
 Frame = -1

Query  1177  RWSLHGMTALVTGGTRGLGHAIVEELACLGATVYTCSRTEKELEECIQNWKAKGYKVFGS  998
             RWSL+GMTALVTGGT+G+G+AIVEELA LGA V+TCSR E +L +C+  W+ KG++V GS
Sbjct  7     RWSLNGMTALVTGGTKGIGYAIVEELAGLGAIVHTCSRNEVDLNDCLSQWEKKGFQVTGS  66

Query  997   VCDILQPSQRENLIQLVSKQFDGKLTILVNNVAILIPKETLKSDGQDFSNTIGTNLEASL  818
             VCD++  +QRE LI  VS  FDGKL IL+NNV    PK TL+   +D+S  +  NLE++ 
Sbjct  67    VCDVVSKTQREELINKVSSLFDGKLNILINNVGANRPKATLEYTAEDYSFMMSINLESAY  126

Query  817   NLCQLAHPLLKATGNGsivfisscssfVYAPFHTIYAATKGGINSLVRNLACEWTNDNIR  638
             +LCQL+HPLLKA+G+ +IVF+SS +  V     +IY+ATKG IN L +NLACEW  D IR
Sbjct  127   HLCQLSHPLLKASGSANIVFLSSVAGVVSLEVGSIYSATKGAINQLAKNLACEWAKDKIR  186

Query  637   VNAVAPWLMRTSLTES--SREEFGAVIEALIGRTLQHRLVEPKEASAAVAFLCFPAASSI  464
              N+VAPW + T L E     ++  AVI +   R    R  EP+E S+ VAFLC PAAS I
Sbjct  187   TNSVAPWFITTPLGEMFLGNKKKSAVINS---RCPLGRPGEPEEVSSLVAFLCLPAASYI  243

Query  463   TGQIIRVDGGASVYGV  416
             TGQ I VDGG +V G+
Sbjct  244   TGQTITVDGGVTVNGL  259



>ref|NP_001275240.1| tropinone reductase 2-like [Solanum tuberosum]
 emb|CAB52307.1| tropinone reductase II [Solanum tuberosum]
Length=261

 Score =   263 bits (673),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 137/254 (54%), Positives = 176/254 (69%), Gaps = 2/254 (1%)
 Frame = -1

Query  1189  IMAGRWSLHGMTALVTGGTRGLGHAIVEELACLGATVYTCSRTEKELEECIQNWKAKGYK  1010
             + AGRW+L G TALVTGG+RG+G+ IVEELA LGA+VYTCSR +KEL EC+  W++KG+K
Sbjct  1     MAAGRWNLEGCTALVTGGSRGIGYGIVEELASLGASVYTCSRNQKELNECLTQWRSKGFK  60

Query  1009  VFGSVCDILQPSQRENLIQLVSKQFDGKLTILVNNVAILIPKETLKSDGQDFSNTIGTNL  830
             V  SVCD+   S+RE  I+ V+  FDGKL ILVNN  I+I KE      +D+S  +  N 
Sbjct  61    VEASVCDLSSRSEREEFIKTVANHFDGKLNILVNNAGIVIYKEAKDYTMEDYSLIMSINF  120

Query  829   EASLNLCQLAHPLLKATGNGsivfisscssfVYAPFHTIYAATKGGINSLVRNLACEWTN  650
             EA+ +L  LAHP LKA+  G++VFISS S     P+  +Y ATKG ++ L R LA EW  
Sbjct  121   EAAYHLSVLAHPFLKASQRGNVVFISSISGASALPYEAVYGATKGAMDQLTRCLAFEWAK  180

Query  649   DNIRVNAVAPWLMRTSLTESS--REEFGAVIEALIGRTLQHRLVEPKEASAAVAFLCFPA  476
             DNIRVN VAP ++ +S+ E +   +E    ++ LI R   HR+ EPKE +A VAFLCFPA
Sbjct  181   DNIRVNGVAPGVIASSMVEMTIQDQEQKENLDKLIDRCALHRMGEPKELAAVVAFLCFPA  240

Query  475   ASSITGQIIRVDGG  434
             AS +TGQII VDGG
Sbjct  241   ASYVTGQIIYVDGG  254



>ref|XP_007163457.1| hypothetical protein PHAVU_001G235800g [Phaseolus vulgaris]
 gb|ESW35451.1| hypothetical protein PHAVU_001G235800g [Phaseolus vulgaris]
Length=273

 Score =   264 bits (674),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 131/254 (52%), Positives = 176/254 (69%), Gaps = 1/254 (0%)
 Frame = -1

Query  1180  GRWSLHGMTALVTGGTRGLGHAIVEELACLGATVYTCSRTEKELEECIQNWKAKGYKVFG  1001
             GRW L GMTALV+GGTRG+GHAIV +LA  GA V+TCSRT+ EL++C++ WK++G++V G
Sbjct  13    GRWCLKGMTALVSGGTRGIGHAIVSDLAAFGAAVHTCSRTQTELKKCLEKWKSEGFQVTG  72

Query  1000  SVCDILQPSQRENLIQLVSKQFDGKLTILVNNVAILIPKETLKSDGQDFSNTIGTNLEAS  821
             SVCD+  P  RE L++ V+  F+GKL I VNNV     K T++  G+++S  +  NL++S
Sbjct  73    SVCDVTSPQDREKLLEEVASTFNGKLNIYVNNVGTNFRKPTIEYSGEEYSQLMTVNLDSS  132

Query  820   LNLCQLAHPLLKATGNGsivfisscssfVYAPFHTIYAATKGGINSLVRNLACEWTNDNI  641
              +LCQLA+PLLKA+G G IVF+SS +        ++YAA+K  IN L +NLACEW  DNI
Sbjct  133   FHLCQLAYPLLKASGKGCIVFLSSVAGVTSMGTGSVYAASKAAINQLTKNLACEWAKDNI  192

Query  640   RVNAVAPWLMRTSLTESSREEFGAVIEALIGRTLQHRLVEPKEASAAVAFLCFPAASSIT  461
             R N V PW  RT L E   +     ++ ++ RT   R+ EP+E S+ V FLC PAAS IT
Sbjct  193   RSNCVVPWTTRTPLVEHLLQN-QTFVDDVMSRTPLKRIAEPEEVSSLVTFLCLPAASYIT  251

Query  460   GQIIRVDGGASVYG  419
             GQ+I VDGG +V G
Sbjct  252   GQVICVDGGVTVNG  265



>emb|CDY68057.1| BnaAnng26060D [Brassica napus]
Length=262

 Score =   263 bits (673),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 139/258 (54%), Positives = 178/258 (69%), Gaps = 5/258 (2%)
 Frame = -1

Query  1186  MAGRWSLHGMTALVTGGTRGLGHAIVEELACLGATVYTCSRTEKELEECIQNWKAKGYKV  1007
             M  RWSL GMTALVTGGT+G+G+AIVEELA  GA V+TC+R +  L+EC+  WK KG++V
Sbjct  1     MDSRWSLRGMTALVTGGTKGIGYAIVEELAGFGARVHTCARDQTLLDECLSEWKEKGFQV  60

Query  1006  FGSVCDILQPSQRENLIQLVSKQFDGKLTILVNNVAILIPKETLKSDGQDFSNTIGTNLE  827
              GSVCD+    QR+ L++ VS  F GKL IL+NNV  L+ K T +   QDFS  I TNL+
Sbjct  61    TGSVCDVSSRPQRDELMKTVSSLFSGKLNILINNVGTLVSKPTTEFTAQDFSGQIATNLD  120

Query  826   ASLNLCQLAHPLLKATGNGsivfisscssfVYAPFHTIYAATKGGINSLVRNLACEWTND  647
             ++ +  QLAHPLLKA+G GSIVF+SS    V + F +IY+ TKG +N L RNLACEW +D
Sbjct  121   SAYHFSQLAHPLLKASGFGSIVFLSSVCGVVSSGFVSIYSLTKGCMNQLARNLACEWASD  180

Query  646   NIRVNAVAPWLMRTSLTES--SREEFGAVIEALIGRTLQHRLVEPKEASAAVAFLCFPAA  473
              IR N+VAPW+ +T L +     E+F    EA+  RT   R  EP+E ++ V FLC PAA
Sbjct  181   GIRANSVAPWMTKTPLVQKRLDDEKFA---EAIFSRTPLGRACEPREVASLVTFLCLPAA  237

Query  472   SSITGQIIRVDGGASVYG  419
             S ITGQ I +DGG +V G
Sbjct  238   SYITGQTICIDGGFTVNG  255



>gb|AIX10937.1| putative tropinone reductase [Gardenia jasminoides]
Length=274

 Score =   264 bits (674),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 143/256 (56%), Positives = 180/256 (70%), Gaps = 5/256 (2%)
 Frame = -1

Query  1177  RWSLHGMTALVTGGTRGLGHAIVEELACLGATVYTCSRTEKELEECIQNWKAKGYKVFGS  998
             RWSL G TALVTGGTRG+G A+VEELA LGAT++TCSR E EL E +Q W +KG+KV GS
Sbjct  12    RWSLAGKTALVTGGTRGIGLAVVEELAELGATIHTCSRNEVELNERLQEWASKGFKVTGS  71

Query  997   VCDILQPSQRENLIQLVSKQFDGKLTILVNNVAILIPKETLKSDGQDFSNTIGTNLEASL  818
             VCD     QRE L+  VS  FDGKL +L+NNV   I K T     +++   + TNLE++ 
Sbjct  72    VCDASSREQREQLMGKVSSVFDGKLNLLINNVGTNIRKPTTDYTAEEYCRIMATNLESAY  131

Query  817   NLCQLAHPLLKATGNGsivfisscssfVYAPFHTIYAATKGGINSLVRNLACEWTNDNIR  638
             +L QLA+PLLKA+G GS VFISS +  V+    +IY ATKG +N L RNLACEW  DNIR
Sbjct  132   HLSQLAYPLLKASGVGSTVFISSVAGLVHLSSGSIYGATKGAMNQLTRNLACEWAKDNIR  191

Query  637   VNAVAPWLMRTSLTES--SREEFGAVIEALIGRTLQHRLVEPKEASAAVAFLCFPAASSI  464
             VN VAPW +RTSL E+  + +EF   ++ +I RT   R  EPKE S+ VA+ C PAAS I
Sbjct  192   VNCVAPWYIRTSLVENLLNNKEF---LDMVISRTPLGRPGEPKEVSSLVAYFCLPAASYI  248

Query  463   TGQIIRVDGGASVYGV  416
             TGQ++ VDGG +V+G+
Sbjct  249   TGQVVAVDGGMTVFGL  264



>ref|XP_011048910.1| PREDICTED: tropinone reductase homolog At1g07440-like isoform 
X3 [Populus euphratica]
Length=268

 Score =   263 bits (673),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 143/262 (55%), Positives = 185/262 (71%), Gaps = 2/262 (1%)
 Frame = -1

Query  1201  QQHNIMAGRWSLHGMTALVTGGTRGLGHAIVEELACLGATVYTCSRTEKELEECIQNWKA  1022
             Q+++    +WSL GMTALVTGGT+GLG+AIV ELA LGA V+TC R++ +L E ++ WKA
Sbjct  4     QENSSRDKKWSLQGMTALVTGGTKGLGYAIVGELAALGAIVHTCGRSQDQLNENLREWKA  63

Query  1021  KGYKVFGSVCDILQPSQRENLIQLVSKQFDGKLTILVNNVAILIPKETLKSDGQDFSNTI  842
             KG+KV GSVCD+   ++RE L++ VS  FDGKL IL+NN    I K +L    +DF + +
Sbjct  64    KGFKVTGSVCDLSSNAEREKLMEEVSSFFDGKLDILINNAGGNIHKGSLDYTSEDFVSIL  123

Query  841   GTNLEASLNLCQLAHPLLKATGNGsivfisscssfVYA-PFHTIYAATKGGINSLVRNLA  665
              TNL ++ +L QLAHPLLKA+G G IVF+SS +S V   P + IY+ATKG +N L RNLA
Sbjct  124   NTNLGSAFHLSQLAHPLLKASGAGRIVFMSSIASVVSVNPQYPIYSATKGAMNQLTRNLA  183

Query  664   CEWTNDNIRVNAVAPWLMRTSLTESSREEFGAVIEALIGRTLQHRLVEPKEASAAVAFLC  485
             CEW  DNIRVNAVAPW +RT LTE    +   + + ++ RT   RL EP + S+ VAFLC
Sbjct  184   CEWAKDNIRVNAVAPWAVRTPLTEQFL-DVEKIRKDVVDRTPMKRLGEPGDVSSVVAFLC  242

Query  484   FPAASSITGQIIRVDGGASVYG  419
             FPA   +TGQ+I VDGG SV G
Sbjct  243   FPAPGFLTGQVICVDGGMSVNG  264



>ref|XP_004235264.1| PREDICTED: tropinone reductase homolog isoform X1 [Solanum lycopersicum]
Length=264

 Score =   263 bits (672),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 140/255 (55%), Positives = 177/255 (69%), Gaps = 1/255 (0%)
 Frame = -1

Query  1183  AGRWSLHGMTALVTGGTRGLGHAIVEELACLGATVYTCSRTEKELEECIQNWKAKGYKVF  1004
             + RW+L GMTALVTGGTRG+GHA+VEELA LGATVYTCSR E  L +C+Q W  KG+KV 
Sbjct  5     SSRWTLSGMTALVTGGTRGIGHAVVEELAELGATVYTCSRNENALNKCLQEWSVKGFKVN  64

Query  1003  GSVCDILQPSQRENLIQLVSKQFDGKLTILVNNVAILIPKETLKSDGQDFSNTIGTNLEA  824
             G VCD+    QR  LIQ VS  F GKL IL+NN    I K T+   G+++++  GTNLE+
Sbjct  65    GCVCDVSSRPQRVKLIQNVSSAFHGKLNILINNAGTNIRKPTIDYTGEEYAHLFGTNLES  124

Query  823   SLNLCQLAHPLLKATGNGsivfisscssfVYAPFHTIYAATKGGINSLVRNLACEWTNDN  644
               ++CQLAHPLLKA+  GS+VFISS +  V+    +IYAATKG +N L R+LACEW  DN
Sbjct  125   GYHICQLAHPLLKASEVGSVVFISSVAGLVHLSTSSIYAATKGAMNQLTRDLACEWAKDN  184

Query  643   IRVNAVAPWLMRTSLTESSREEFGAVIEALIGRTLQHRLVEPKEASAAVAFLCFPAASSI  464
             IRVN VAPW ++TS  E   +    +++ +  RT   R  E +E S+ VA+LC P AS I
Sbjct  185   IRVNGVAPWYIKTSSVEYVIKN-KTLLDGIKSRTPLMRPGEAQEVSSLVAYLCLPGASYI  243

Query  463   TGQIIRVDGGASVYG  419
             TGQ+I VDGG +V G
Sbjct  244   TGQVIAVDGGFTVNG  258



>ref|XP_008387076.1| PREDICTED: tropinone reductase homolog At1g07440-like isoform 
X1 [Malus domestica]
Length=264

 Score =   263 bits (672),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 141/256 (55%), Positives = 180/256 (70%), Gaps = 5/256 (2%)
 Frame = -1

Query  1177  RWSLHGMTALVTGGTRGLGHAIVEELACLGATVYTCSRTEKELEECIQNWKAKGYKVFGS  998
             RWSL GMTALVTGGT+G+G+AIVEELA LGA V+TCSR E +L +C+  W+ KG++V GS
Sbjct  7     RWSLKGMTALVTGGTKGIGYAIVEELAGLGAIVHTCSRNEVDLNDCLSQWEKKGFQVTGS  66

Query  997   VCDILQPSQRENLIQLVSKQFDGKLTILVNNVAILIPKETLKSDGQDFSNTIGTNLEASL  818
             VCD++  +QRE LI  VS  FDGKL IL+NNV    PK TL+   +D+S  +  NLE++ 
Sbjct  67    VCDVVSKTQREELINKVSSLFDGKLNILINNVGANRPKATLEYTAEDYSFMMSINLESAY  126

Query  817   NLCQLAHPLLKATGNGsivfisscssfVYAPFHTIYAATKGGINSLVRNLACEWTNDNIR  638
             +LCQL+HPLLKA+G+ +IVF+SS +  V     +IY+ATKG IN L +NLACEW  D IR
Sbjct  127   HLCQLSHPLLKASGSANIVFLSSVAGVVSLEVGSIYSATKGAINQLAKNLACEWAKDKIR  186

Query  637   VNAVAPWLMRTSLTES--SREEFGAVIEALIGRTLQHRLVEPKEASAAVAFLCFPAASSI  464
              N+VAPW + T L E     ++  AVI +   R    R  EP+E S+ VAFLC PAAS I
Sbjct  187   TNSVAPWFITTPLGEMFLGNKKKSAVINS---RCPLGRPGEPEEVSSLVAFLCLPAASYI  243

Query  463   TGQIIRVDGGASVYGV  416
             TGQ I VDGG +V G+
Sbjct  244   TGQTITVDGGVTVNGL  259



>ref|XP_010423393.1| PREDICTED: tropinone reductase homolog At1g07440-like [Camelina 
sativa]
Length=262

 Score =   263 bits (672),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 138/255 (54%), Positives = 181/255 (71%), Gaps = 5/255 (2%)
 Frame = -1

Query  1177  RWSLHGMTALVTGGTRGLGHAIVEELACLGATVYTCSRTEKELEECIQNWKAKGYKVFGS  998
             RW+L G TALVTGGTRG+G A+VEELA  GA V+TCSR + EL  C+ +WK+ G+ V GS
Sbjct  6     RWTLAGKTALVTGGTRGIGRAVVEELARFGAKVHTCSRNQDELNACLDDWKSNGFVVSGS  65

Query  997   VCDILQPSQRENLIQLVSKQFDGKLTILVNNVAILIPKETLKSDGQDFSNTIGTNLEASL  818
             VCD     QR+ LIQ VS  F GKL IL+NNV   I K  ++   ++++  + TNLE++ 
Sbjct  66    VCDASVKDQRDQLIQDVSSAFSGKLNILINNVGTNIRKPAVEYSSEEYAKIMSTNLESAF  125

Query  817   NLCQLAHPLLKATGNGsivfisscssfVYAPFHTIYAATKGGINSLVRNLACEWTNDNIR  638
             +L Q+AHPLLKA+G G+IVFISS +  V+    +IY ATKG +N L RNLACEW +DNIR
Sbjct  126   HLSQIAHPLLKASGVGNIVFISSVAGLVHLSSGSIYGATKGALNQLTRNLACEWASDNIR  185

Query  637   VNAVAPWLMRTSLTES--SREEFGAVIEALIGRTLQHRLVEPKEASAAVAFLCFPAASSI  464
              N VAPW ++TSL ES   ++EF   ++A++ RT   R+ EP+E ++ VAFLC PAAS I
Sbjct  186   TNCVAPWYIKTSLVESLLEKKEF---VDAVVSRTPLGRVGEPEEVASLVAFLCLPAASYI  242

Query  463   TGQIIRVDGGASVYG  419
             TGQ+I VDGG +V G
Sbjct  243   TGQVISVDGGFTVNG  257



>ref|XP_008233480.1| PREDICTED: tropinone reductase homolog At1g07440-like [Prunus 
mume]
Length=271

 Score =   263 bits (673),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 145/262 (55%), Positives = 180/262 (69%), Gaps = 5/262 (2%)
 Frame = -1

Query  1177  RWSLHGMTALVTGGTRGLGHAIVEELACLGATVYTCSRTEKELEECIQNWKAKGYKVFGS  998
             RWSL GMTALVTGGTRG+G+A+VEELA  GA V+TCSR E EL +C++ W+AKG+ V GS
Sbjct  12    RWSLKGMTALVTGGTRGIGYAVVEELAGFGAAVHTCSRNEAELHKCLKEWEAKGFLVTGS  71

Query  997   VCDILQPSQRENLIQLVSKQFDGKLTILVNNVAILIPKETLKSDGQDFSNTIGTNLEASL  818
             VCD    ++RE L+Q V+  F+GKL ILVNNV   I K T +   +++S  + TNLE++ 
Sbjct  72    VCDASSKTEREKLVQQVASSFNGKLNILVNNVGTNIRKPTTEYTSEEYSIVMATNLESTY  131

Query  817   NLCQLAHPLLKATGNGsivfisscssfVYAPFHTIYAATKGGINSLVRNLACEWTNDNIR  638
             +L QLAHPLL+A+G GSIVFISS +  V     TIYAA+K  IN L +NLACEW  DNIR
Sbjct  132   HLSQLAHPLLRASGAGSIVFISSVAGLVGIGSGTIYAASKAAINQLTKNLACEWAKDNIR  191

Query  637   VNAVAPWLMRTSLTES--SREEFGAVIEALIGRTLQHRLVEPKEASAAVAFLCFPAASSI  464
              N+V PW  RTSL       +EF   +E +  RT   R+ EP+E S+ VAFLC PAAS I
Sbjct  192   SNSVCPWYTRTSLVGHLLGNKEF---LEEITSRTPIDRVAEPEEVSSLVAFLCLPAASYI  248

Query  463   TGQIIRVDGGASVYGV*TIIEP  398
             TGQII VDGG +V     I  P
Sbjct  249   TGQIISVDGGMTVNSFNPIRRP  270



>ref|XP_003537468.1| PREDICTED: tropinone reductase homolog At1g07440-like [Glycine 
max]
Length=277

 Score =   263 bits (673),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 133/253 (53%), Positives = 175/253 (69%), Gaps = 1/253 (0%)
 Frame = -1

Query  1177  RWSLHGMTALVTGGTRGLGHAIVEELACLGATVYTCSRTEKELEECIQNWKAKGYKVFGS  998
             RWSL+GMTALVTGGTRG+GHAIV +LA  GA V+TCSR + EL +C+Q W+++G++V GS
Sbjct  18    RWSLNGMTALVTGGTRGIGHAIVNDLAAFGAAVHTCSRNQTELNKCLQEWQSQGFEVTGS  77

Query  997   VCDILQPSQRENLIQLVSKQFDGKLTILVNNVAILIPKETLKSDGQDFSNTIGTNLEASL  818
             VCD+  P QRE LIQ  +  F+GKL I VNNV +   K T++   +++S  +  NL ++ 
Sbjct  78    VCDVSSPPQREKLIQEAASTFNGKLNIYVNNVGVNYRKPTIEYSAEEYSEMMTVNLNSAF  137

Query  817   NLCQLAHPLLKATGNGsivfisscssfVYAPFHTIYAATKGGINSLVRNLACEWTNDNIR  638
             +LCQLA+PLLKA+G GSIVF+SS +        ++YAA+K  IN L +NLACEW  DNIR
Sbjct  138   HLCQLAYPLLKASGKGSIVFLSSVAGVTSMGTGSVYAASKAAINQLTKNLACEWAKDNIR  197

Query  637   VNAVAPWLMRTSLTESSREEFGAVIEALIGRTLQHRLVEPKEASAAVAFLCFPAASSITG  458
              N V PW  RT L E   +     +E ++ RT   R+ EP+E S+ VAFLC PAAS ITG
Sbjct  198   SNCVVPWTTRTPLIEHLLQN-QTFVEDVMSRTPLKRIAEPEEVSSLVAFLCLPAASYITG  256

Query  457   QIIRVDGGASVYG  419
             Q+I  DGG +V G
Sbjct  257   QVICADGGVTVNG  269



>ref|XP_002311182.2| tropinone reductase family protein [Populus trichocarpa]
 gb|EEE88549.2| tropinone reductase family protein [Populus trichocarpa]
Length=266

 Score =   263 bits (672),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 139/253 (55%), Positives = 176/253 (70%), Gaps = 1/253 (0%)
 Frame = -1

Query  1177  RWSLHGMTALVTGGTRGLGHAIVEELACLGATVYTCSRTEKELEECIQNWKAKGYKVFGS  998
             RWSLHGMTALVTGGTRG+G+A VEELA  GA V+TCSR E+EL +C++ W+AKG+ V GS
Sbjct  11    RWSLHGMTALVTGGTRGIGNATVEELAGFGARVHTCSRNEEELNKCLKEWEAKGFVVTGS  70

Query  997   VCDILQPSQRENLIQLVSKQFDGKLTILVNNVAILIPKETLKSDGQDFSNTIGTNLEASL  818
             VCD     QRE LI+ V   F GKL  LVNNV   I K T     ++FSN + TN E++ 
Sbjct  71    VCDASSRVQREKLIEEVGSVFHGKLNSLVNNVGTNIRKPTTGYSAEEFSNLLATNFESAY  130

Query  817   NLCQLAHPLLKATGNGsivfisscssfVYAPFHTIYAATKGGINSLVRNLACEWTNDNIR  638
             +L Q+AHPLLK +G GS+VFISS +  ++    +IY A+KG IN L +NLACEW  DNIR
Sbjct  131   HLSQIAHPLLKESGAGSVVFISSVAGLLHIGSGSIYGASKGAINQLTKNLACEWAKDNIR  190

Query  637   VNAVAPWLMRTSLTESSREEFGAVIEALIGRTLQHRLVEPKEASAAVAFLCFPAASSITG  458
              N VAPW +RTSL E   ++    ++ +I RT   R+ +PKE S+ V FLC PAA+ ITG
Sbjct  191   TNCVAPWYIRTSLVEHLLDD-KVFLDKIISRTPLQRVGDPKEVSSLVGFLCLPAAAYITG  249

Query  457   QIIRVDGGASVYG  419
             Q+I VDGG +V G
Sbjct  250   QVISVDGGFTVNG  262



>ref|XP_009140979.1| PREDICTED: tropinone reductase homolog At1g07440 [Brassica rapa]
Length=300

 Score =   264 bits (675),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 139/255 (55%), Positives = 182/255 (71%), Gaps = 5/255 (2%)
 Frame = -1

Query  1177  RWSLHGMTALVTGGTRGLGHAIVEELACLGATVYTCSRTEKELEECIQNWKAKGYKVFGS  998
             RWSLHGM+ALVTGGTRG+G AIVEEL  LGA V+TC+R E EL++C+++W   G++V GS
Sbjct  43    RWSLHGMSALVTGGTRGIGRAIVEELVGLGAKVHTCARNETELKDCLRDWNRSGFQVDGS  102

Query  997   VCDILQPSQRENLIQLVSKQFDGKLTILVNNVAILIPKETLKSDGQDFSNTIGTNLEASL  818
             VCD+   +QRE+L++ VS  F GKL ILVNNV   I K  +    ++FS  + TN E+  
Sbjct  103   VCDVSDRAQRESLMETVSSLFHGKLHILVNNVGTNIRKPMVDFTPEEFSTLLSTNFESVF  162

Query  817   NLCQLAHPLLKATGNGsivfisscssfVYAPFHTIYAATKGGINSLVRNLACEWTNDNIR  638
             +LCQLA+P+L+AT  G +V ISS S FV     ++ +ATKG IN L RNLACEW  DNIR
Sbjct  163   HLCQLAYPILRATEAGCVVSISSVSGFVSLKNMSVQSATKGAINQLTRNLACEWAKDNIR  222

Query  637   VNAVAPWLMRTSLTES--SREEFGAVIEALIGRTLQHRLVEPKEASAAVAFLCFPAASSI  464
             VNAVAPW ++TS+ E   S +++   ++ +   T   RL EP+E S+AVAFLC PA+S I
Sbjct  223   VNAVAPWYIKTSMVEQVLSNKDY---LDEVYSVTPLGRLGEPREVSSAVAFLCLPASSYI  279

Query  463   TGQIIRVDGGASVYG  419
             TGQI+RVDGG S+ G
Sbjct  280   TGQIVRVDGGMSING  294



>emb|CAQ19732.1| tropinone reductase II [Solanum dulcamara]
Length=261

 Score =   263 bits (671),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 137/254 (54%), Positives = 176/254 (69%), Gaps = 2/254 (1%)
 Frame = -1

Query  1189  IMAGRWSLHGMTALVTGGTRGLGHAIVEELACLGATVYTCSRTEKELEECIQNWKAKGYK  1010
             + AGRW+L G TALVTGG+RG+G+ IVEELA LGA+VYTCSR +KEL EC+  W++KG+K
Sbjct  1     MAAGRWNLEGCTALVTGGSRGIGYGIVEELASLGASVYTCSRNQKELNECLSQWRSKGFK  60

Query  1009  VFGSVCDILQPSQRENLIQLVSKQFDGKLTILVNNVAILIPKETLKSDGQDFSNTIGTNL  830
             V  SVCD+   S+RE  I+ V+  FDGKL ILVNN  I+I KE      +D+S  +  N 
Sbjct  61    VEASVCDLSSRSEREEFIKTVANHFDGKLNILVNNAGIVIYKEAKDYTMEDYSLIMSINF  120

Query  829   EASLNLCQLAHPLLKATGNGsivfisscssfVYAPFHTIYAATKGGINSLVRNLACEWTN  650
             EA+ +L  LAHP LKA+  G++VFISS S     P+  +Y ATKG ++ L R LA EW  
Sbjct  121   EAAYHLSVLAHPFLKASERGNVVFISSISGAAALPYEAVYGATKGAMDQLARCLAFEWAK  180

Query  649   DNIRVNAVAPWLMRTSLTESSRE--EFGAVIEALIGRTLQHRLVEPKEASAAVAFLCFPA  476
             DNIRVN VAP ++ +S+ E + +  E    ++ LI R   HR+ EPKE +A VAFLCFPA
Sbjct  181   DNIRVNGVAPGVIASSMVEMTIQDPEQKENLDKLIDRCALHRMGEPKELAAVVAFLCFPA  240

Query  475   ASSITGQIIRVDGG  434
             AS +TGQII VDGG
Sbjct  241   ASYVTGQIIYVDGG  254



>emb|CAC19810.1| tropinone reductase II [Solanum tuberosum]
Length=261

 Score =   263 bits (671),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 138/254 (54%), Positives = 177/254 (70%), Gaps = 2/254 (1%)
 Frame = -1

Query  1189  IMAGRWSLHGMTALVTGGTRGLGHAIVEELACLGATVYTCSRTEKELEECIQNWKAKGYK  1010
             + AGRW+L G TALVTGG+RG+G+ IVEELA LGA+VYTCSR +KEL EC+  W++KG+K
Sbjct  1     MAAGRWNLEGCTALVTGGSRGIGYGIVEELASLGASVYTCSRNQKELNECLTQWRSKGFK  60

Query  1009  VFGSVCDILQPSQRENLIQLVSKQFDGKLTILVNNVAILIPKETLKSDGQDFSNTIGTNL  830
             V  SVCD+   S+RE  I+ V+  FDGKL ILVNN  I+I KE      +D+S  +  N 
Sbjct  61    VEASVCDLSSRSEREEFIKNVANHFDGKLNILVNNAGIVIYKEAKDYTMEDYSLIMSINF  120

Query  829   EASLNLCQLAHPLLKATGNGsivfisscssfVYAPFHTIYAATKGGINSLVRNLACEWTN  650
             EA+ +L  LAHPLLKA+  G++VFISS S     P+  +Y ATKG ++ L R LA EW  
Sbjct  121   EAAYHLSVLAHPLLKASQRGNVVFISSISGASALPYEAVYGATKGAMDQLTRCLAFEWAK  180

Query  649   DNIRVNAVAPWLMRTSLTESSRE--EFGAVIEALIGRTLQHRLVEPKEASAAVAFLCFPA  476
             DNIRVN VAP ++ +S+ E + +  E    ++ LI R   HR+ EPKE +A VAFLCFPA
Sbjct  181   DNIRVNGVAPGVIASSMVEMTIQDPEQKENLDKLIDRCALHRMGEPKELAAVVAFLCFPA  240

Query  475   ASSITGQIIRVDGG  434
             AS +TGQII VDGG
Sbjct  241   ASYVTGQIIYVDGG  254



>gb|AGH24753.1| tropinone reductase-II [Atropa belladonna]
Length=260

 Score =   263 bits (671),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 138/253 (55%), Positives = 174/253 (69%), Gaps = 2/253 (1%)
 Frame = -1

Query  1186  MAGRWSLHGMTALVTGGTRGLGHAIVEELACLGATVYTCSRTEKELEECIQNWKAKGYKV  1007
             MAGRW+L G TALVTGG+RG+G+ IVEELA LGA+VYTCSR +KEL EC+  W++KG+ V
Sbjct  1     MAGRWNLEGCTALVTGGSRGIGYGIVEELASLGASVYTCSRNQKELNECLTQWRSKGFNV  60

Query  1006  FGSVCDILQPSQRENLIQLVSKQFDGKLTILVNNVAILIPKETLKSDGQDFSNTIGTNLE  827
               SVCD+   S+RE  ++ VS  FDGKL ILVNN  I+I KE      +D+S  +  N E
Sbjct  61    EASVCDLSSRSEREEFMKTVSNHFDGKLNILVNNAGIVIYKEAKDYTMEDYSLIMSINFE  120

Query  826   ASLNLCQLAHPLLKATGNGsivfisscssfVYAPFHTIYAATKGGINSLVRNLACEWTND  647
             A+ +L  LAHP LKA+  G++VFISS S     P+  +Y ATKG ++ L R LA EW  D
Sbjct  121   AAYHLSVLAHPFLKASERGNVVFISSISGASALPYEAVYGATKGALDQLTRCLAFEWAKD  180

Query  646   NIRVNAVAPWLMRTSLTESSRE--EFGAVIEALIGRTLQHRLVEPKEASAAVAFLCFPAA  473
             NIRVN V P ++ TSL E + +  E    ++ LI R   HR+ EPKE +A VAFLCFPAA
Sbjct  181   NIRVNGVGPGVIATSLVEMTIQDPEQKENLDKLIDRCALHRMGEPKELAAVVAFLCFPAA  240

Query  472   SSITGQIIRVDGG  434
             S +TGQII VDGG
Sbjct  241   SYVTGQIIYVDGG  253



>ref|XP_011033874.1| PREDICTED: tropinone reductase homolog At1g07440-like [Populus 
euphratica]
Length=266

 Score =   263 bits (671),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 139/253 (55%), Positives = 178/253 (70%), Gaps = 1/253 (0%)
 Frame = -1

Query  1177  RWSLHGMTALVTGGTRGLGHAIVEELACLGATVYTCSRTEKELEECIQNWKAKGYKVFGS  998
             RWSLHGMTALVTGGTRG+G+A V ELA  GA V+TCSR E+EL +C++ W+AKG+ V GS
Sbjct  11    RWSLHGMTALVTGGTRGIGNATVVELAGFGARVHTCSRNEEELNKCLKEWEAKGFVVTGS  70

Query  997   VCDILQPSQRENLIQLVSKQFDGKLTILVNNVAILIPKETLKSDGQDFSNTIGTNLEASL  818
             VCD     QRE LI+ V   F GKL ILVNNV   I K T     ++FSN + TN E++ 
Sbjct  71    VCDASSHVQREKLIEEVDSVFHGKLNILVNNVGTNIRKPTTGYSAEEFSNLLATNFESAY  130

Query  817   NLCQLAHPLLKATGNGsivfisscssfVYAPFHTIYAATKGGINSLVRNLACEWTNDNIR  638
             +L Q+AHPLLKA+G GSIVFISS +  ++    +IY A+KG IN L +NLACEW  DNIR
Sbjct  131   HLSQIAHPLLKASGAGSIVFISSVAGLLHIGSGSIYGASKGAINQLTKNLACEWAKDNIR  190

Query  637   VNAVAPWLMRTSLTESSREEFGAVIEALIGRTLQHRLVEPKEASAAVAFLCFPAASSITG  458
              N VAPW ++TSL ++  ++    ++ +I RT   R+ +PKE S+ V FLC PAA+ ITG
Sbjct  191   TNCVAPWYIKTSLVKNLLDD-KVFLDKIISRTPLQRIGDPKEVSSLVGFLCLPAAAYITG  249

Query  457   QIIRVDGGASVYG  419
             Q+I VDGG +V G
Sbjct  250   QVISVDGGFTVNG  262



>ref|XP_004302758.1| PREDICTED: tropinone reductase homolog [Fragaria vesca subsp. 
vesca]
Length=262

 Score =   263 bits (671),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 139/253 (55%), Positives = 175/253 (69%), Gaps = 1/253 (0%)
 Frame = -1

Query  1177  RWSLHGMTALVTGGTRGLGHAIVEELACLGATVYTCSRTEKELEECIQNWKAKGYKVFGS  998
             RWSL G TALVTGGT+G+G+AIVEELA LGATV+TC+R E  L + IQ W++KG+KV GS
Sbjct  10    RWSLKGKTALVTGGTKGIGYAIVEELAGLGATVHTCARNEALLNQRIQEWESKGFKVSGS  69

Query  997   VCDILQPSQRENLIQLVSKQFDGKLTILVNNVAILIPKETLKSDGQDFSNTIGTNLEASL  818
             VCD+   SQRE L++ VS  FDGKL ILVNN A    + T     +DFS+ + TN+E+  
Sbjct  70    VCDLTSKSQREELLETVSSVFDGKLNILVNNAATCTLRTTTDYSLEDFSSMMSTNVESPY  129

Query  817   NLCQLAHPLLKATGNGsivfisscssfVYAPFHTIYAATKGGINSLVRNLACEWTNDNIR  638
             +LCQLAHPLLKA+GNGSIVFI+S +     P  + YAATK  I  + +NLACEW  D+IR
Sbjct  130   HLCQLAHPLLKASGNGSIVFIASIAGIKALPRLSAYAATKSAIIQISKNLACEWAQDSIR  189

Query  637   VNAVAPWLMRTSLTESSREEFGAVIEALIGRTLQHRLVEPKEASAAVAFLCFPAASSITG  458
              N VAPW + T   +   ++  A    LIGRT   R+ EP E S+ V FLC PAAS ITG
Sbjct  190   TNTVAPWAVNTG-AKPDNDDHSADYRRLIGRTPIRRVAEPNEISSLVTFLCLPAASYITG  248

Query  457   QIIRVDGGASVYG  419
             Q++ +DGG +V G
Sbjct  249   QVVSIDGGFTVSG  261



>ref|XP_006288477.1| hypothetical protein CARUB_v10001737mg [Capsella rubella]
 gb|EOA21375.1| hypothetical protein CARUB_v10001737mg [Capsella rubella]
Length=263

 Score =   263 bits (671),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 138/255 (54%), Positives = 180/255 (71%), Gaps = 5/255 (2%)
 Frame = -1

Query  1177  RWSLHGMTALVTGGTRGLGHAIVEELACLGATVYTCSRTEKELEECIQNWKAKGYKVFGS  998
             RW+L G TALVTGGTRG+G A+VEELA  GA V+TCSR ++EL  C+ +WK+ G+ V GS
Sbjct  7     RWTLAGKTALVTGGTRGIGRAVVEELARFGAKVHTCSRNQEELNACLNDWKSNGFVVTGS  66

Query  997   VCDILQPSQRENLIQLVSKQFDGKLTILVNNVAILIPKETLKSDGQDFSNTIGTNLEASL  818
             VCD     QR+ LIQ VS  F GKL IL+NNV   I K  +    ++++  + TNLE++ 
Sbjct  67    VCDASVRDQRDKLIQDVSSAFSGKLNILINNVGTNIRKPAIDYSSEEYAKIMSTNLESAF  126

Query  817   NLCQLAHPLLKATGNGsivfisscssfVYAPFHTIYAATKGGINSLVRNLACEWTNDNIR  638
             ++ Q+AHPLLKA+G G+IVFISS +  V+     IY ATKG +N L RNLACEW +DNIR
Sbjct  127   HISQIAHPLLKASGVGNIVFISSVAGLVHLSSGAIYGATKGALNQLTRNLACEWASDNIR  186

Query  637   VNAVAPWLMRTSLTES--SREEFGAVIEALIGRTLQHRLVEPKEASAAVAFLCFPAASSI  464
              N VAPW ++TSL ES   ++EF   +EA++ RT   R+ EP+E ++ VAFLC PAAS I
Sbjct  187   TNCVAPWYIKTSLVESLLEKKEF---VEAIVSRTPLGRVGEPEEVASLVAFLCLPAASYI  243

Query  463   TGQIIRVDGGASVYG  419
             TGQ+I VDGG +V G
Sbjct  244   TGQVISVDGGFTVNG  258



>ref|XP_009110944.1| PREDICTED: tropinone reductase homolog At1g07440-like [Brassica 
rapa]
Length=262

 Score =   262 bits (670),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 139/258 (54%), Positives = 178/258 (69%), Gaps = 5/258 (2%)
 Frame = -1

Query  1186  MAGRWSLHGMTALVTGGTRGLGHAIVEELACLGATVYTCSRTEKELEECIQNWKAKGYKV  1007
             M  RWSL GMTALVTGGT+G+G+AIVEELA  GA V+TC+R +  L+EC+  WK KG++V
Sbjct  1     MDSRWSLRGMTALVTGGTKGIGYAIVEELAGFGARVHTCARDQTLLDECLSEWKEKGFQV  60

Query  1006  FGSVCDILQPSQRENLIQLVSKQFDGKLTILVNNVAILIPKETLKSDGQDFSNTIGTNLE  827
              GSVCD+   +QR+ L++ VS  F GKL IL+NNV  L+ K T +   QDFS  I TNL+
Sbjct  61    TGSVCDVSSRAQRDELMKTVSSLFSGKLNILINNVGTLVSKPTTEFTAQDFSGQIATNLD  120

Query  826   ASLNLCQLAHPLLKATGNGsivfisscssfVYAPFHTIYAATKGGINSLVRNLACEWTND  647
             ++ +  QLAHPLLKA+G GSIVF+SS    V + F +IY+ TKG +N L RNLACEW +D
Sbjct  121   SAYHFSQLAHPLLKASGFGSIVFLSSVCGVVSSGFVSIYSLTKGCMNQLARNLACEWASD  180

Query  646   NIRVNAVAPWLMRTSLTES--SREEFGAVIEALIGRTLQHRLVEPKEASAAVAFLCFPAA  473
              IR N+VAPW+ +T L +     E+F    EA+  RT   R  EP E ++ V FLC PAA
Sbjct  181   GIRANSVAPWMTKTPLVQKRLDDEKFA---EAIFSRTPLGRACEPGEVASLVTFLCLPAA  237

Query  472   SSITGQIIRVDGGASVYG  419
             S ITGQ I +DGG +V G
Sbjct  238   SYITGQTICIDGGFTVNG  255



>emb|CDP00133.1| unnamed protein product [Coffea canephora]
Length=274

 Score =   263 bits (671),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 142/255 (56%), Positives = 178/255 (70%), Gaps = 5/255 (2%)
 Frame = -1

Query  1177  RWSLHGMTALVTGGTRGLGHAIVEELACLGATVYTCSRTEKELEECIQNWKAKGYKVFGS  998
             RWSL G TALVTGGTRG+G A+VEELA LGAT++TCSR   +L E +Q W +KG KV GS
Sbjct  12    RWSLAGKTALVTGGTRGIGFAVVEELAELGATIHTCSRNAAQLNERLQEWASKGLKVTGS  71

Query  997   VCDILQPSQRENLIQLVSKQFDGKLTILVNNVAILIPKETLKSDGQDFSNTIGTNLEASL  818
             VCD+     RE L+Q VS  FDGKL IL+NNV   I K T     +++S  + TNLE++ 
Sbjct  72    VCDVSSRELREQLMQKVSSVFDGKLNILINNVGTNIRKPTTDYIPEEYSRIMATNLESAY  131

Query  817   NLCQLAHPLLKATGNGsivfisscssfVYAPFHTIYAATKGGINSLVRNLACEWTNDNIR  638
             +L QLA+PLLKA+G GS VF+SS S  V++   +IY A KG +N L RNLACEW  DNIR
Sbjct  132   HLSQLAYPLLKASGVGSTVFVSSISGLVHSSSGSIYGAAKGAMNQLTRNLACEWAKDNIR  191

Query  637   VNAVAPWLMRTSLTES--SREEFGAVIEALIGRTLQHRLVEPKEASAAVAFLCFPAASSI  464
             VN VAPW +RT L E+  S +EF   ++ +I RT   R  EPKE S+ VA+ C PAAS I
Sbjct  192   VNCVAPWYIRTPLVENLLSNKEF---LDMVISRTPLQRPGEPKEVSSLVAYFCLPAASYI  248

Query  463   TGQIIRVDGGASVYG  419
             TGQ++ VDGG +V+G
Sbjct  249   TGQVVAVDGGMTVFG  263



>gb|AIN39992.1| tropinone reductase I [Datura inoxia]
Length=273

 Score =   263 bits (671),  Expect = 4e-81, Method: Compositional matrix adjust.
 Identities = 138/261 (53%), Positives = 186/261 (71%), Gaps = 11/261 (4%)
 Frame = -1

Query  1180  GRWSLHGMTALVTGGTRGLGHAIVEELACLGATVYTCSRTEKELEECIQNWKAKGYKVFG  1001
             GRWSL G TALVTGG++G+G+AIVEELA LGA VYTCSR EKEL+EC++ W+ KG  V G
Sbjct  15    GRWSLKGTTALVTGGSKGIGYAIVEELAGLGARVYTCSRNEKELDECLEIWRKKGLNVEG  74

Query  1000  SVCDILQPSQRENLIQLVSKQFDGKLTILVNNVAILIPKETLKSDGQDFSNTIGTNLEAS  821
             SVCD+L  ++R+ L+Q V+  FDGKL ILVNN  ++I KE      +D++  +GTN EA+
Sbjct  75    SVCDLLSRTERDKLMQTVAHVFDGKLNILVNNAGVVIHKEAKDFTEEDYNIIMGTNFEAA  134

Query  820   LNLCQLAHPLLKATGNGsivfisscssfVYAPFHTIYAATKGGINSLVRNLACEWTNDNI  641
              +L Q+A+PLLKA+ NG+++F+SS + F   P  ++Y+A+KG IN + +NLACEW  DNI
Sbjct  135   YHLSQIAYPLLKASQNGNVIFLSSIAGFSALPSVSLYSASKGAINQMTKNLACEWAKDNI  194

Query  640   RVNAVAPWLMRTSLTESS-------REEFGAVIEALIGRTLQHRLVEPKEASAAVAFLCF  482
             RVN+VAP ++ T L E++       +EE    I+  I +T   R  +P+E SA +AFLCF
Sbjct  195   RVNSVAPGVILTPLVETAIKKNPHQKEE----IDNFIVKTPMGRAGKPQEVSALIAFLCF  250

Query  481   PAASSITGQIIRVDGGASVYG  419
             PAAS ITGQII  DGG +  G
Sbjct  251   PAASYITGQIIWADGGFTANG  271



>ref|XP_011094903.1| PREDICTED: tropinone reductase homolog [Sesamum indicum]
Length=268

 Score =   262 bits (670),  Expect = 5e-81, Method: Compositional matrix adjust.
 Identities = 142/261 (54%), Positives = 177/261 (68%), Gaps = 2/261 (1%)
 Frame = -1

Query  1210  AKYQQHNIMAGRWSLHGMTALVTGGTRGLGHAIVEELACLGATVYTCSRTEKELEECIQN  1031
             AK +Q      RW+L GMTALVTGGT+G+G+AIVEELA  GATVYTCSR + EL E ++ 
Sbjct  2     AKEEQSRSREQRWTLQGMTALVTGGTKGIGYAIVEELAGFGATVYTCSRNQAELSERLKE  61

Query  1030  WKAKGYKVFGSVCDILQPSQRENLIQLVSKQFDGKLTILVNNVAILIPKETLKSDGQDFS  851
             W+ KG+KV GS CD+    QRE LIQ VS  FDGKL ILVNN A+ + K       +D+ 
Sbjct  62    WEGKGFKVKGSACDLSSSPQREELIQSVSAAFDGKLNILVNNAAMSLLKRASDHTAEDYR  121

Query  850   NTIGTNLEASLNLCQLAHPLLKATGNGsivfisscssfVYAPFHTIYAATKGGINSLVRN  671
               + TNLE+  ++CQLA+PLLKA+G G+IVFISS +  V  P  + YAA+KG IN L +N
Sbjct  122   RIMETNLESPYHICQLAYPLLKASGLGNIVFISSVAGGVALPAISAYAASKGAINQLTKN  181

Query  670   LACEWTNDNIRVNAVAPWLMRTSL--TESSREEFGAVIEALIGRTLQHRLVEPKEASAAV  497
             LACEW  DNIR N VAP+ +RTS+   E        +   L+GRT   R+ EP+E S+ V
Sbjct  182   LACEWAKDNIRTNTVAPFGVRTSILKPEDIDPSILEMFIPLMGRTPIGRIAEPEEVSSLV  241

Query  496   AFLCFPAASSITGQIIRVDGG  434
              FLC PAAS ITGQ+I VDGG
Sbjct  242   TFLCLPAASYITGQVIYVDGG  262



>gb|AAM61117.1| short chain alcohol dehydrogenase-like [Arabidopsis thaliana]
Length=264

 Score =   262 bits (669),  Expect = 5e-81, Method: Compositional matrix adjust.
 Identities = 141/262 (54%), Positives = 183/262 (70%), Gaps = 5/262 (2%)
 Frame = -1

Query  1177  RWSLHGMTALVTGGTRGLGHAIVEELACLGATVYTCSRTEKELEECIQNWKAKGYKVFGS  998
             RWSL G TALVTGGTRG+G A+VEELA   A V+TCSR ++EL  C+ +WKA G  V GS
Sbjct  6     RWSLAGKTALVTGGTRGIGRAVVEELAKFCAKVHTCSRNQEELNACLNDWKANGLVVSGS  65

Query  997   VCDILQPSQRENLIQLVSKQFDGKLTILVNNVAILIPKETLKSDGQDFSNTIGTNLEASL  818
             VCD     QRE LIQ  S  F GKL IL+NNV   + K T++   ++++  + TNLE++ 
Sbjct  66    VCDASVRDQREKLIQEASSAFSGKLNILINNVGTNVRKPTVEYSSEEYAKIMSTNLESAF  125

Query  817   NLCQLAHPLLKATGNGsivfisscssfVYAPFHTIYAATKGGINSLVRNLACEWTNDNIR  638
             +L Q+AHPLLKA+G GSIVFISS +  V+    +IY ATKG +N L RNLACEW +DNIR
Sbjct  126   HLSQIAHPLLKASGVGSIVFISSVAGLVHLSSGSIYGATKGALNQLTRNLACEWASDNIR  185

Query  637   VNAVAPWLMRTSLTES--SREEFGAVIEALIGRTLQHRLVEPKEASAAVAFLCFPAASSI  464
              N VAPW ++TSL E+   ++EF   +EA++ RT   R+ EP+E S+ VAFLC PA+S I
Sbjct  186   TNCVAPWYIKTSLVETLLEKKEF---VEAVVSRTPLGRVGEPEEVSSLVAFLCLPASSYI  242

Query  463   TGQIIRVDGGASVYGV*TIIEP  398
             TGQ+I VDGG +V G    ++P
Sbjct  243   TGQVISVDGGFTVNGFSYAMKP  264



>ref|XP_008358998.1| PREDICTED: tropinone reductase homolog At1g07440-like [Malus 
domestica]
Length=264

 Score =   262 bits (669),  Expect = 5e-81, Method: Compositional matrix adjust.
 Identities = 139/254 (55%), Positives = 178/254 (70%), Gaps = 3/254 (1%)
 Frame = -1

Query  1174  WSLHGMTALVTGGTRGLGHAIVEELACLGATVYTCSRTEKELEECIQNWKAKGYKVFGSV  995
             WSL GMTALVTGGT+G+G+AIVEELA LGA V+TCSR E +L +C+  W+ KG++V GSV
Sbjct  8     WSLRGMTALVTGGTKGIGYAIVEELAGLGAIVHTCSRNEVDLNDCLSQWEKKGFQVTGSV  67

Query  994   CDILQPSQRENLIQLVSKQFDGKLTILVNNVAILIPKETLKSDGQDFSNTIGTNLEASLN  815
             CD++  +QRE LI  VS  FDGKL IL+NNV I+  K T++   +D+S  + TNLE++ N
Sbjct  68    CDVVSKTQREELINKVSSLFDGKLNILINNVGIVEAKATVEYTAEDYSFIMSTNLESAYN  127

Query  814   LCQLAHPLLKATGNGsivfisscssfVYAPFHTIYAATKGGINSLVRNLACEWTNDNIRV  635
              CQL+HPLLKA G  +IVF+SS +  V     +IY+A KG +N L +NLACEW  DNIR 
Sbjct  128   FCQLSHPLLKAAGAANIVFLSSTAGVVSINGASIYSAAKGAMNQLAKNLACEWAKDNIRT  187

Query  634   NAVAPWLMRTSLTESS-REEFGAVIEALIGRTLQHRLVEPKEASAAVAFLCFPAASSITG  458
             N+VAPW + T L+E   R E    +E +  R    R  EP+E S+ VAFLC PAAS ITG
Sbjct  188   NSVAPWFITTPLSEPVLRNE--KKLEMINSRCPLRRPGEPEEVSSLVAFLCLPAASYITG  245

Query  457   QIIRVDGGASVYGV  416
             Q I VDGG +V G+
Sbjct  246   QTIIVDGGVTVNGL  259



>emb|CBI16074.3| unnamed protein product [Vitis vinifera]
Length=252

 Score =   261 bits (668),  Expect = 6e-81, Method: Compositional matrix adjust.
 Identities = 139/249 (56%), Positives = 180/249 (72%), Gaps = 5/249 (2%)
 Frame = -1

Query  1159  MTALVTGGTRGLGHAIVEELACLGATVYTCSRTEKELEECIQNWKAKGYKVFGSVCDILQ  980
             MTALVTGGT+G+GHAIVEELA L AT++TCSR E EL+EC+++WKAKG+ V GSVCD+  
Sbjct  1     MTALVTGGTKGIGHAIVEELAGLVATIHTCSRKETELDECLKDWKAKGFGVSGSVCDVSS  60

Query  979   PSQRENLIQLVSKQFDGKLTILVNNVAILIPKETLKSDGQDFSNTIGTNLEASLNLCQLA  800
              +QRE L++ VS  F+GKL ILVNN AI+I K T++   ++FS  +  N E+  +L QLA
Sbjct  61    RAQREKLMETVSSVFNGKLNILVNNAAIVIQKPTVEVTAEEFSTIMAINFESVYHLSQLA  120

Query  799   HPLLKATGNGsivfisscssfVYAPFHTIYAATKGGINSLVRNLACEWTNDNIRVNAVAP  620
             HPLLKA+G GSIVFISS +  V   + + Y+ATKG +N L +NLACEW  DNIR NAVAP
Sbjct  121   HPLLKASGAGSIVFISSVAGVVSLKYLSAYSATKGAMNQLTKNLACEWAEDNIRSNAVAP  180

Query  619   WLMRTSLTES--SREEFGAVIEALIGRTLQHRLVEPKEASAAVAFLCFPAASSITGQIIR  446
             W ++T + +   S + F   +E +I R    R+ +PKE S+ VAFLC PA+S ITGQ I 
Sbjct  181   WYIKTPMVDQMLSNKTF---LEGVINRAPLRRVGDPKEVSSLVAFLCLPASSYITGQTIC  237

Query  445   VDGGASVYG  419
             VDGG +V G
Sbjct  238   VDGGVTVNG  246



>ref|XP_007206475.1| hypothetical protein PRUPE_ppa018984mg [Prunus persica]
 gb|EMJ07674.1| hypothetical protein PRUPE_ppa018984mg [Prunus persica]
Length=271

 Score =   262 bits (669),  Expect = 6e-81, Method: Compositional matrix adjust.
 Identities = 142/258 (55%), Positives = 181/258 (70%), Gaps = 7/258 (3%)
 Frame = -1

Query  1177  RWSLHGMTALVTGGTRGLGHAIVEELACLGATVYTCSRTEKELEECIQNWKAKGY-KVFG  1001
             RWSLHGMTALVTGGT+G+G+AIVEELA LGAT++TCSR E +L +C+  WK KG+ +V G
Sbjct  12    RWSLHGMTALVTGGTKGIGYAIVEELAGLGATIHTCSRNEVQLNDCLSQWKMKGFDQVTG  71

Query  1000  SVCDILQPSQRENLIQLVSKQFDGKLTILVNNVAILIPKETLKSDGQDFSNTIGTNLEAS  821
             SVCD++  +QRE LI  VS  F GKL I +NNV     K  ++S  +D+S  + TNLE++
Sbjct  72    SVCDVVSKAQREELINKVSSLFHGKLNIFINNVGTAELKPAIESTTEDYSCIMSTNLESA  131

Query  820   LNLCQLAHPLLKATGNGsivfisscs-sfVYAPFHTIYAATKGGINSLVRNLACEWTNDN  644
              +  QLA+PLLK +G G+I+F+SS +         +IY ATKG +N L +NLACEW  DN
Sbjct  132   YHFSQLAYPLLKVSGAGNIIFMSSVAGVVSVGTAGSIYGATKGAMNQLAKNLACEWAKDN  191

Query  643   IRVNAVAPWLMRTSLTES--SREEFGAVIEALIGRTLQHRLVEPKEASAAVAFLCFPAAS  470
             IR N+VAPW +RT LTE   S ++F   +EA+  R    R  EPKE SA VAFLCFPAAS
Sbjct  192   IRTNSVAPWFIRTPLTEPLLSNQKF---LEAVNSRCPLGRTGEPKEVSALVAFLCFPAAS  248

Query  469   SITGQIIRVDGGASVYGV  416
              ITGQ I VDGG +V G+
Sbjct  249   YITGQTICVDGGFTVNGL  266



>ref|XP_007016327.1| Senescence-associated gene 13, putative isoform 1 [Theobroma 
cacao]
 gb|EOY33946.1| Senescence-associated gene 13, putative isoform 1 [Theobroma 
cacao]
Length=298

 Score =   263 bits (672),  Expect = 6e-81, Method: Compositional matrix adjust.
 Identities = 142/265 (54%), Positives = 179/265 (68%), Gaps = 12/265 (5%)
 Frame = -1

Query  1177  RWSLHGMTALVTGGTRGLGHAIVEELACLGATVYTCSRTEKELEECIQNWKAKGYKVFGS  998
             RWSLH MTALVTGGT+G+G+AIVEELA LGA ++TCSR E +L +C+ +W AKG++V GS
Sbjct  16    RWSLHAMTALVTGGTKGIGYAIVEELAALGARIHTCSRNETDLNKCLLDWDAKGFQVTGS  75

Query  997   VCDILQPSQRENLIQLVSKQFDGKLTILVNNVAILIPKETLKSDGQDFSNTIGTNLEASL  818
             VCD+   +QRE LI  VS +F GKL IL+NNV   + K T     +DFS  +GTN E++ 
Sbjct  76    VCDVSSQAQREKLINTVSSEFGGKLNILINNVGTSVLKPTPDFTAEDFSFIMGTNFESAY  135

Query  817   NLCQLAHPLLKATGNGsivfisscssfVYAPFHTIYAATKGGINSLVRNLACEWTNDNIR  638
             NLCQLA+PLLKA+G GSIVF+SS S  V   F ++Y ATKG +N L + LACEW  DNIR
Sbjct  136   NLCQLAYPLLKASGAGSIVFLSSVSGVVSVSFGSLYGATKGAMNHLAKYLACEWAKDNIR  195

Query  637   VNAVAPWLMRTSLTES------------SREEFGAVIEALIGRTLQHRLVEPKEASAAVA  494
             VN+VAPW ++T LTE               +      E +I RT   R+ EP+E S+ V 
Sbjct  196   VNSVAPWFIQTPLTEDCCSSIYNCCPSPCLQYIQKFSEIIISRTPLGRIGEPEEVSSLVG  255

Query  493   FLCFPAASSITGQIIRVDGGASVYG  419
             FLC PA+S ITGQ   +DGG SV G
Sbjct  256   FLCLPASSYITGQTFCIDGGMSVNG  280



>ref|XP_002873234.1| hypothetical protein ARALYDRAFT_487407 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH49493.1| hypothetical protein ARALYDRAFT_487407 [Arabidopsis lyrata subsp. 
lyrata]
Length=262

 Score =   261 bits (668),  Expect = 7e-81, Method: Compositional matrix adjust.
 Identities = 140/255 (55%), Positives = 180/255 (71%), Gaps = 5/255 (2%)
 Frame = -1

Query  1177  RWSLHGMTALVTGGTRGLGHAIVEELACLGATVYTCSRTEKELEECIQNWKAKGYKVFGS  998
             RWSL G TALVTGGTRG+G A+VEELA  GA V+TCSR ++EL  C+ +WK+ G  V GS
Sbjct  6     RWSLAGKTALVTGGTRGIGRAVVEELAKFGAKVHTCSRNQEELNACLNDWKSNGLVVSGS  65

Query  997   VCDILQPSQRENLIQLVSKQFDGKLTILVNNVAILIPKETLKSDGQDFSNTIGTNLEASL  818
             VCD     QRE LIQ  S  F GKL ILVNNV   + K T++   ++++  + TNLE++ 
Sbjct  66    VCDASVRDQREKLIQEASSAFSGKLNILVNNVGTNVRKPTVEYSSEEYAKIMTTNLESAF  125

Query  817   NLCQLAHPLLKATGNGsivfisscssfVYAPFHTIYAATKGGINSLVRNLACEWTNDNIR  638
             +L Q+AHPLLKA+G GSIVFISS +  V+    +IY ATKG +N L RNLACEW  DNIR
Sbjct  126   HLSQIAHPLLKASGVGSIVFISSVAGLVHLQSGSIYGATKGALNQLTRNLACEWARDNIR  185

Query  637   VNAVAPWLMRTSLTES--SREEFGAVIEALIGRTLQHRLVEPKEASAAVAFLCFPAASSI  464
              N VAPW ++TSL E+   +++F   +EA++ RT   R+ EP+E ++ VAFLC PAAS I
Sbjct  186   TNCVAPWYIKTSLVETLLEKKDF---VEAVVSRTPLGRVGEPEEVASLVAFLCLPAASYI  242

Query  463   TGQIIRVDGGASVYG  419
             TGQ+I VDGG +V G
Sbjct  243   TGQVISVDGGFTVNG  257



>ref|XP_006424909.1| hypothetical protein CICLE_v10029051mg [Citrus clementina]
 gb|ESR38149.1| hypothetical protein CICLE_v10029051mg [Citrus clementina]
Length=270

 Score =   261 bits (668),  Expect = 8e-81, Method: Compositional matrix adjust.
 Identities = 140/256 (55%), Positives = 178/256 (70%), Gaps = 6/256 (2%)
 Frame = -1

Query  1177  RWSLHGMTALVTGGTRGLGHAIVEELACLGATVYTCSRTEKELEECIQNWKAKGYKVFGS  998
             RW+L G TALVTGGT+GLGHA+VEELA LGA V+TC+R E +L+EC++ WK KG+KV GS
Sbjct  12    RWTLEGKTALVTGGTKGLGHAVVEELAELGAIVHTCARNEADLDECLREWKMKGFKVTGS  71

Query  997   VCDILQPSQRENLIQLVSKQFDGKLTILVNNVAILIPKETLKSDGQDFSNTIGTNLEASL  818
             +CD     +RE L+  VS  F+GKL IL+NNV   I K T++   +DFS  + TN E++ 
Sbjct  72    ICDASSRGEREMLMDKVSTLFNGKLNILINNVGTSIRKPTVEYTAEDFSVLMATNFESAY  131

Query  817   NLCQLAHPLLKATGNGsivfisscs-sfVYAPFHTIYAATKGGINSLVRNLACEWTNDNI  641
             +L QLAHPLLKA+G G+I+ +SS +        ++IYAATKG +N L +NLACEW  DNI
Sbjct  132   HLSQLAHPLLKASGAGNIILMSSIAGVVSLNTGNSIYAATKGAMNQLAKNLACEWARDNI  191

Query  640   RVNAVAPWLMRTSLTES--SREEFGAVIEALIGRTLQHRLVEPKEASAAVAFLCFPAASS  467
             R N+VAPW +RT L E   S E+F   +E +  RT   R  EP E S+ VAFLC PAAS 
Sbjct  192   RTNSVAPWFIRTPLVEPYLSDEKF---LEEIKCRTPMERTGEPDEVSSLVAFLCMPAASY  248

Query  466   ITGQIIRVDGGASVYG  419
             ITGQ I VDGG +V G
Sbjct  249   ITGQTICVDGGLTVNG  264



>ref|XP_004303414.1| PREDICTED: tropinone reductase homolog [Fragaria vesca subsp. 
vesca]
Length=249

 Score =   261 bits (666),  Expect = 8e-81, Method: Compositional matrix adjust.
 Identities = 137/253 (54%), Positives = 175/253 (69%), Gaps = 12/253 (5%)
 Frame = -1

Query  1177  RWSLHGMTALVTGGTRGLGHAIVEELACLGATVYTCSRTEKELEECIQNWKAKGYKVFGS  998
             RWSL GMTALVT GTRG+G+AIVEELA LGATV+TC+R +  ++E +Q WK KG+ V GS
Sbjct  8     RWSLKGMTALVTSGTRGIGYAIVEELAGLGATVHTCARNKALIDERVQEWKIKGFTVSGS  67

Query  997   VCDILQPSQRENLIQLVSKQFDGKLTILVNNVAILIPKETLKSDGQDFSNTIGTNLEASL  818
             VCD+   SQRE LI+ VS  FDGKL+ILVNN AI+  + T     +DFS+ + +N+E+  
Sbjct  68    VCDLTSKSQREELIKTVSSAFDGKLSILVNNAAIVTLRGTTDYSLEDFSSMMSSNVESPY  127

Query  817   NLCQLAHPLLKATGNGsivfisscssfVYAPFHTIYAATKGGINSLVRNLACEWTNDNIR  638
             +LCQLAHPLLKA+GNGSI+F+SS +  +  P  + YAATKG I  + +NLACEW  D IR
Sbjct  128   HLCQLAHPLLKASGNGSIIFVSSIAGVIALPKLSAYAATKGAIIQISKNLACEWAKDKIR  187

Query  637   VNAVAPWLMRTSLTESSREEFGAVIEALIGRTLQHRLVEPKEASAAVAFLCFPAASSITG  458
              N VAPW        + R++F      LI RT   RL +P E S+ V FLC PAAS I G
Sbjct  188   TNTVAPW--------AQRDDF----RRLIARTPIRRLADPNEISSLVTFLCLPAASYING  235

Query  457   QIIRVDGGASVYG  419
             Q++ +DGG +V G
Sbjct  236   QVVSIDGGFTVSG  248



>ref|XP_009623489.1| PREDICTED: tropinone reductase 1-like isoform X2 [Nicotiana tomentosiformis]
Length=275

 Score =   262 bits (669),  Expect = 8e-81, Method: Compositional matrix adjust.
 Identities = 141/261 (54%), Positives = 185/261 (71%), Gaps = 11/261 (4%)
 Frame = -1

Query  1180  GRWSLHGMTALVTGGTRGLGHAIVEELACLGATVYTCSRTEKELEECIQNWKAKGYKVFG  1001
             GRWSL G TALVTGG++G+G+AIVEELA LGA VYTCSR EKEL+EC++ W+ KG+KV G
Sbjct  17    GRWSLKGKTALVTGGSKGIGYAIVEELAGLGARVYTCSRNEKELQECLEIWRNKGFKVEG  76

Query  1000  SVCDILQPSQRENLIQLVSKQFDGKLTILVNNVAILIPKETLKSDGQDFSNTIGTNLEAS  821
             SVCD+L  ++RENL+Q V   F+GKL ILVNN  ++I KET     +D++  +GTN EA 
Sbjct  77    SVCDLLLCTERENLMQAVGDVFNGKLNILVNNAGVVIHKETKDFTAEDYNIVMGTNFEAG  136

Query  820   LNLCQLAHPLLKATGNGsivfisscssfVYAPFHTIYAATKGGINSLVRNLACEWTNDNI  641
              +L QLA+PLLKA+ NG+++F+SS + F   P  ++Y+A+KG IN   ++LACEW  DNI
Sbjct  137   FHLSQLAYPLLKASENGNVIFLSSIAGFSALPSLSLYSASKGQINQTTKSLACEWAKDNI  196

Query  640   RVNAVAPWLMRTSLTESS-------REEFGAVIEALIGRTLQHRLVEPKEASAAVAFLCF  482
             RVN+VAP ++ T L E++       REE    I+  I RT   R  +P+E SA + FLCF
Sbjct  197   RVNSVAPGIIMTPLVETAIKRNPRQREE----IDHFIVRTPMGRAGKPEEISALITFLCF  252

Query  481   PAASSITGQIIRVDGGASVYG  419
             PAAS ITGQII  D G +  G
Sbjct  253   PAASYITGQIIWADCGFTANG  273



>ref|XP_002465494.1| hypothetical protein SORBIDRAFT_01g039880 [Sorghum bicolor]
 gb|EER92492.1| hypothetical protein SORBIDRAFT_01g039880 [Sorghum bicolor]
Length=273

 Score =   261 bits (668),  Expect = 8e-81, Method: Compositional matrix adjust.
 Identities = 141/257 (55%), Positives = 183/257 (71%), Gaps = 5/257 (2%)
 Frame = -1

Query  1183  AGRWSLHGMTALVTGGTRGLGHAIVEELACLGATVYTCSRTEKELEECIQNWKAKGYKVF  1004
             +GRW+LHG TALVTGGTRG+G A+VEELA LGA V+TCSR  +EL E I+ W+A+G++V 
Sbjct  14    SGRWALHGKTALVTGGTRGIGRAVVEELAALGAAVHTCSRKAEELGERIKEWEARGFRVT  73

Query  1003  GSVCDILQPSQRENLIQLVSKQFDGKLTILVNNVAILIPKETLKSDGQDFSNTIGTNLEA  824
             GSVCD+ +  QRE L++ V  +F GKL ILVNNV   I K T +   +++S  + TNLE+
Sbjct  74    GSVCDLSERDQRERLLREVGNRFGGKLNILVNNVGTNIRKPTTEFTAEEYSFVMATNLES  133

Query  823   SLNLCQLAHPLLKATGNGsivfisscssfVYAPFHTIYAATKGGINSLVRNLACEWTNDN  644
             + +LCQ+AHPLLK +G+GSI+FISS    V     TIYA TKG IN L +N+ACEW  DN
Sbjct  134   AYHLCQIAHPLLKLSGSGSIIFISSVCGMVGVFSGTIYAMTKGAINQLTKNIACEWAKDN  193

Query  643   IRVNAVAPWLMRTSLTES--SREEFGAVIEALIGRTLQHRLVEPKEASAAVAFLCFPAAS  470
             IR N+VAPW + TSLTE   + ++F    E ++ RT   R+ EP+E SA VAFLC P ++
Sbjct  194   IRANSVAPWYITTSLTERLLANKDFE---EQVVSRTPLGRVGEPEEISALVAFLCMPGST  250

Query  469   SITGQIIRVDGGASVYG  419
              ITGQ I VDGG +V G
Sbjct  251   YITGQTIAVDGGMTVNG  267



>ref|XP_006352698.1| PREDICTED: tropinone reductase homolog [Solanum tuberosum]
Length=265

 Score =   261 bits (668),  Expect = 9e-81, Method: Compositional matrix adjust.
 Identities = 139/255 (55%), Positives = 178/255 (70%), Gaps = 5/255 (2%)
 Frame = -1

Query  1177  RWSLHGMTALVTGGTRGLGHAIVEELACLGATVYTCSRTEKELEECIQNWKAKGYKVFGS  998
             RWSL+G+ ALVTGGT G+GHAIVEEL   GA VYTCSR E  L EC++ W  KG +V G 
Sbjct  8     RWSLNGLVALVTGGTYGIGHAIVEELCEFGAKVYTCSRNESVLNECLKKWTDKGLQVKGC  67

Query  997   VCDILQPSQRENLIQLVSKQFDGKLTILVNNVAILIPKETLKSDGQDFSNTIGTNLEASL  818
             VCD+    QR  L++ VS +FDGKL IL+NNV   I K T +  G+++++ + TNLE+S 
Sbjct  68    VCDVSSKEQRVQLMEKVSLEFDGKLNILINNVGTNIWKPTTEYTGEEYAHIMATNLESSF  127

Query  817   NLCQLAHPLLKATGNGsivfisscssfVYAPFHTIYAATKGGINSLVRNLACEWTNDNIR  638
             +LCQLAHPLLK++G+GSIVF+SS +  V+    +IY ATKG +N L RNLACEW  D IR
Sbjct  128   HLCQLAHPLLKSSGSGSIVFLSSVAGLVHLSGTSIYGATKGAMNQLTRNLACEWAKDGIR  187

Query  637   VNAVAPWLMRTSLTES--SREEFGAVIEALIGRTLQHRLVEPKEASAAVAFLCFPAASSI  464
             VN VAPW + T L E     +EF   +E ++ RT   R  E +E S+ VA+LC PAAS +
Sbjct  188   VNGVAPWYINTPLVEHVLGDKEF---MEGVVSRTPLKRPGEVEEVSSMVAYLCLPAASYV  244

Query  463   TGQIIRVDGGASVYG  419
             TGQ+I VDGG +VYG
Sbjct  245   TGQVIAVDGGFTVYG  259



>ref|XP_006344593.1| PREDICTED: tropinone reductase homolog [Solanum tuberosum]
Length=316

 Score =   263 bits (672),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 143/265 (54%), Positives = 180/265 (68%), Gaps = 4/265 (2%)
 Frame = -1

Query  1204  YQQHNIM---AGRWSLHGMTALVTGGTRGLGHAIVEELACLGATVYTCSRTEKELEECIQ  1034
             Y  H  M   + RWSL GMTALVTGGTRG+GHA+VEELA LGATVYTCSR E+ L +C+Q
Sbjct  47    YILHKSMFRSSSRWSLSGMTALVTGGTRGIGHAVVEELAELGATVYTCSRNEEALNKCLQ  106

Query  1033  NWKAKGYKVFGSVCDILQPSQRENLIQLVSKQFDGKLTILVNNVAILIPKETLKSDGQDF  854
              W  KG KV G VCD+    QR  LI+ VS  F GKL+IL+NN    I K T+    +++
Sbjct  107   EWSVKGLKVNGCVCDVSSTPQRVKLIENVSSAFHGKLSILINNAGTNIRKPTIDYTAEEY  166

Query  853   SNTIGTNLEASLNLCQLAHPLLKATGNGsivfisscssfVYAPFHTIYAATKGGINSLVR  674
             ++  GTN E+  ++CQLAHPLLKA+  GSIVFISS +  V+    +IYAATKG +N L R
Sbjct  167   AHLFGTNFESGYHICQLAHPLLKASEVGSIVFISSVAGLVHLSTSSIYAATKGAMNQLTR  226

Query  673   NLACEWTNDNIRVNAVAPWLMRTSLTESSREEFGAVIEALIGRTLQHRLVEPKEASAAVA  494
             +LACEW  DNIRVN VAPW ++TS  E   +    +++ +I RT   R  E +E S+ VA
Sbjct  227   DLACEWAKDNIRVNGVAPWYIKTSSVEYVIKN-KTLLDGIISRTPLMRPGEAQEVSSLVA  285

Query  493   FLCFPAASSITGQIIRVDGGASVYG  419
             +LC P AS ITGQ+I VDGG +V G
Sbjct  286   YLCLPGASYITGQVIAVDGGFTVNG  310



>emb|CAD20555.1| tropinone reductase I [Calystegia sepium]
Length=263

 Score =   261 bits (667),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 140/256 (55%), Positives = 177/256 (69%), Gaps = 2/256 (1%)
 Frame = -1

Query  1180  GRWSLHGMTALVTGGTRGLGHAIVEELACLGATVYTCSRTEKELEECIQNWKAKGYKVFG  1001
             G+WSL GMTALVTGGTRG+G+ IVEELA  GA VY CSR + E++EC+  W+ KG+KV G
Sbjct  6     GKWSLQGMTALVTGGTRGIGYGIVEELAGFGAEVYICSRKQNEVDECVGKWREKGFKVAG  65

Query  1000  SVCDILQPSQRENLIQLVSKQFDGKLTILVNNVAILIPKETLKSDGQDFSNTIGTNLEAS  821
             S CDI   +QRE LI+ V+  F+GKL ILVNN   ++PK+  +   +D++  +GTN EAS
Sbjct  66    SACDISSRTQREELIKNVAHHFNGKLNILVNNAGTILPKDATEFKAEDYTLIMGTNFEAS  125

Query  820   LNLCQLAHPLLKATGNGsivfisscssfVYAPFHTIYAATKGGINSLVRNLACEWTNDNI  641
              +LCQLAHP LKA+  G+IVF SS +  +     T+YAA+KG IN + +NLACEW  DNI
Sbjct  126   FHLCQLAHPFLKASSMGTIVFNSSVAGIIPVFKTTLYAASKGAINQVTKNLACEWAKDNI  185

Query  640   RVNAVAPWLMRTSLTE--SSREEFGAVIEALIGRTLQHRLVEPKEASAAVAFLCFPAASS  467
             RVN+VAPW++RT L     S  E    IE +I RT   R  E  E S+ VAFLC PAAS 
Sbjct  186   RVNSVAPWVIRTKLVNDFDSESEGSEEIERMIRRTPISRPGEVGEVSSLVAFLCLPAASY  245

Query  466   ITGQIIRVDGGASVYG  419
             ITGQ I VDGG ++ G
Sbjct  246   ITGQTICVDGGYTITG  261



>ref|XP_006399065.1| hypothetical protein EUTSA_v10014421mg [Eutrema salsugineum]
 gb|ESQ40518.1| hypothetical protein EUTSA_v10014421mg [Eutrema salsugineum]
Length=262

 Score =   261 bits (666),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 141/255 (55%), Positives = 180/255 (71%), Gaps = 5/255 (2%)
 Frame = -1

Query  1177  RWSLHGMTALVTGGTRGLGHAIVEELACLGATVYTCSRTEKELEECIQNWKAKGYKVFGS  998
             RWSL G TALVTGGTRG+G AIVEELA  GATV+TCSR ++EL+ C+  WK+ G  V GS
Sbjct  6     RWSLVGKTALVTGGTRGIGRAIVEELARFGATVHTCSRNQEELKACLDVWKSNGLVVSGS  65

Query  997   VCDILQPSQRENLIQLVSKQFDGKLTILVNNVAILIPKETLKSDGQDFSNTIGTNLEASL  818
             VCD     QRE LIQ VS  F GKL IL+NNV   I K T++   ++++  + TNLE++ 
Sbjct  66    VCDASVRDQREKLIQEVSSAFSGKLNILINNVGTNIRKPTVEYSSEEYAKIMSTNLESAF  125

Query  817   NLCQLAHPLLKATGNGsivfisscssfVYAPFHTIYAATKGGINSLVRNLACEWTNDNIR  638
             +  Q+AHPLLK++G GSIVFISS +  V+    +IY ATKG +N L RNLACEW  DNIR
Sbjct  126   HFSQIAHPLLKSSGVGSIVFISSVAGLVHLRSGSIYGATKGALNQLTRNLACEWAGDNIR  185

Query  637   VNAVAPWLMRTSLTES--SREEFGAVIEALIGRTLQHRLVEPKEASAAVAFLCFPAASSI  464
              N VAPW ++TSL E    +++F   +EA++ RT   R+ EP+E ++ VAFLC PAAS I
Sbjct  186   TNCVAPWYIKTSLVEPLLEKKDF---VEAVVSRTPLGRVGEPEEVASLVAFLCLPAASYI  242

Query  463   TGQIIRVDGGASVYG  419
             TGQ+I VDGG +V G
Sbjct  243   TGQVISVDGGLTVNG  257



>gb|KHN17906.1| Tropinone reductase like [Glycine soja]
Length=271

 Score =   261 bits (667),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 141/253 (56%), Positives = 170/253 (67%), Gaps = 1/253 (0%)
 Frame = -1

Query  1177  RWSLHGMTALVTGGTRGLGHAIVEELACLGATVYTCSRTEKELEECIQNWKAKGYKVFGS  998
             RWSL G TALVTGGTRG+GHA+VEELA  GATVYTCSR E+EL  C++ WK KG+ V G 
Sbjct  12    RWSLKGTTALVTGGTRGIGHAVVEELAEFGATVYTCSRNEEELNACLKEWKEKGFSVSGL  71

Query  997   VCDILQPSQRENLIQLVSKQFDGKLTILVNNVAILIPKETLKSDGQDFSNTIGTNLEASL  818
             VCD   P  RENLIQ V+  F+GKL ILVNNV   + K T++   +++S  + TNL+++ 
Sbjct  72    VCDASSPPHRENLIQQVASAFNGKLNILVNNVGTNVRKPTIEYTAEEYSKLMATNLDSAY  131

Query  817   NLCQLAHPLLKATGNGsivfisscssfVYAPFHTIYAATKGGINSLVRNLACEWTNDNIR  638
             +LCQLA+PLLKA+GNGSIV ISS +S        IYAATK  I+ L +  ACEW  DNIR
Sbjct  132   HLCQLAYPLLKASGNGSIVSISSVASQTSVGSGAIYAATKAAIDQLTKYFACEWAKDNIR  191

Query  637   VNAVAPWLMRTSLTESSREEFGAVIEALIGRTLQHRLVEPKEASAAVAFLCFPAASSITG  458
              N VAPW   TSL E        V E +I RT   R+ E  E S+ V FLC PAAS ITG
Sbjct  192   SNGVAPWYTITSLVEPLLANKQLVSE-IISRTPIKRMAETHEVSSLVTFLCLPAASYITG  250

Query  457   QIIRVDGGASVYG  419
             QI+ VDGG +  G
Sbjct  251   QIVSVDGGFTANG  263



>gb|ABF95188.1| Tropinone reductase, putative, expressed [Oryza sativa Japonica 
Group]
Length=271

 Score =   261 bits (667),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 140/256 (55%), Positives = 183/256 (71%), Gaps = 5/256 (2%)
 Frame = -1

Query  1177  RWSLHGMTALVTGGTRGLGHAIVEELACLGATVYTCSRTEKELEECIQNWKAKGYKVFGS  998
             RWSL G TALVTGGTRG+G A+VEELA LGATV+TCSR E+EL E ++ W+A+G++V  S
Sbjct  16    RWSLQGKTALVTGGTRGIGRAVVEELAALGATVHTCSRKEEELSERLKEWEARGFRVTTS  75

Query  997   VCDILQPSQRENLIQLVSKQFDGKLTILVNNVAILIPKETLKSDGQDFSNTIGTNLEASL  818
             VCD+    QRE L++ V+  F GKL ILVNNV   I K T +   +++S  + TNLE++ 
Sbjct  76    VCDLSVRDQRERLLRQVADLFGGKLDILVNNVGTNIRKPTTEFSAEEYSFMMATNLESAY  135

Query  817   NLCQLAHPLLKATGNGsivfisscssfVYAPFHTIYAATKGGINSLVRNLACEWTNDNIR  638
             +LCQL+HPLLKA+G+GSIVFISS    V     ++YA TKG IN L +NLACEW  DNIR
Sbjct  136   HLCQLSHPLLKASGSGSIVFISSVCGLVAVFSGSLYAMTKGAINQLTKNLACEWARDNIR  195

Query  637   VNAVAPWLMRTSLTES--SREEFGAVIEALIGRTLQHRLVEPKEASAAVAFLCFPAASSI  464
              N++APW +RTSLTE   + ++F     A++ RT   R+ EP+E S+ VAFLC P +S I
Sbjct  196   SNSIAPWYIRTSLTEGLLANKDFEG---AVVSRTPLRRVGEPEEVSSLVAFLCMPGSSYI  252

Query  463   TGQIIRVDGGASVYGV  416
             TGQ I VDGG ++ G+
Sbjct  253   TGQTISVDGGMTINGL  268



>ref|XP_010542622.1| PREDICTED: tropinone reductase homolog At1g07440-like [Tarenaya 
hassleriana]
Length=271

 Score =   261 bits (667),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 139/253 (55%), Positives = 180/253 (71%), Gaps = 0/253 (0%)
 Frame = -1

Query  1177  RWSLHGMTALVTGGTRGLGHAIVEELACLGATVYTCSRTEKELEECIQNWKAKGYKVFGS  998
             RWSL GMTALVTGGT+G+G+AIVEELA  GA V+TC+R +  L++C++ W+ KG++V GS
Sbjct  12    RWSLRGMTALVTGGTQGIGYAIVEELAGFGARVHTCARNQSLLDQCLREWQTKGFQVTGS  71

Query  997   VCDILQPSQRENLIQLVSKQFDGKLTILVNNVAILIPKETLKSDGQDFSNTIGTNLEASL  818
             VCD+    +RE L+Q VS  FDGKL IL+NNV   I K T +   +DFS  I TNLE++ 
Sbjct  72    VCDVSSRPEREKLMQTVSSAFDGKLNILINNVGTSIVKPTTEYTAEDFSFHITTNLESAY  131

Query  817   NLCQLAHPLLKATGNGsivfisscssfVYAPFHTIYAATKGGINSLVRNLACEWTNDNIR  638
             +L QLAHPL+KATG G+IVFISS +  V     +IY ATKG IN L RNLACEW +D+IR
Sbjct  132   HLSQLAHPLVKATGFGNIVFISSIAGIVSTSVGSIYNATKGAINQLARNLACEWASDDIR  191

Query  637   VNAVAPWLMRTSLTESSREEFGAVIEALIGRTLQHRLVEPKEASAAVAFLCFPAASSITG  458
             VN+VAP  + T + E++       ++A+I R    R+ EP+E S+ VAFLC PAAS ITG
Sbjct  192   VNSVAPGFIATPMAETAVLGDDNFLKAVISRKPLARVGEPREVSSLVAFLCLPAASYITG  251

Query  457   QIIRVDGGASVYG  419
             Q I VDGG ++ G
Sbjct  252   QTICVDGGLTING  264



>ref|XP_004137775.1| PREDICTED: tropinone reductase homolog [Cucumis sativus]
 ref|XP_004169351.1| PREDICTED: tropinone reductase homolog [Cucumis sativus]
 gb|KGN58843.1| hypothetical protein Csa_3G733970 [Cucumis sativus]
Length=259

 Score =   261 bits (666),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 137/256 (54%), Positives = 181/256 (71%), Gaps = 7/256 (3%)
 Frame = -1

Query  1177  RWSLHGMTALVTGGTRGLGHAIVEELACLGATVYTCSRTEKELEECIQNWKAKGYKVFGS  998
             RWSL+G TALVTGGTRG+G+AIVEELA LGA+V+TCSR + E+++ +Q W+ KG+KV  S
Sbjct  7     RWSLNGFTALVTGGTRGIGYAIVEELASLGASVHTCSRNQTEIDQRLQEWQQKGFKVTAS  66

Query  997   VCDILQPSQRENLIQLVSKQFDGKLTILVNNVAILIPKETLKSDGQDFSNTIGTNLEASL  818
             VCD+   SQR+ LI  VS  F+G L ILVNN   +  K   +   +D++  + TN EA  
Sbjct  67    VCDLTSSSQRQQLIDTVSSIFNGTLNILVNNAGTVTMKTATEYTTEDYNYMMSTNFEAPY  126

Query  817   NLCQLAHPLLKATGNGsivfisscssfVYAPFHTIYAATKGGINSLVRNLACEWTNDNIR  638
             +L Q++HP+LKA+G GSIVF+SS +     P  +IYAATKG IN + +NLACEW  DNIR
Sbjct  127   HLSQISHPILKASGYGSIVFVSSIAGVTALPRISIYAATKGAINQITKNLACEWAKDNIR  186

Query  637   VNAVAPWLMRTSLTE---SSREEFGAVIEALIGRTLQHRLVEPKEASAAVAFLCFPAASS  467
             +N VAPW +RT+++    ++ EE+G     LIGRT   RL EP+E S+ VAFLC PAAS 
Sbjct  187   INTVAPWGVRTTISTPDAAAVEEYG----RLIGRTPAGRLGEPEEISSVVAFLCLPAASY  242

Query  466   ITGQIIRVDGGASVYG  419
             ++GQII VDGG +  G
Sbjct  243   VSGQIICVDGGYTAGG  258



>ref|XP_010521885.1| PREDICTED: tropinone reductase homolog At1g07440-like [Tarenaya 
hassleriana]
Length=265

 Score =   261 bits (666),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 136/254 (54%), Positives = 174/254 (69%), Gaps = 1/254 (0%)
 Frame = -1

Query  1186  MAGRWSLHGMTALVTGGTRGLGHAIVEELACLGATVYTCSRTEKELEECIQNWKAKGYKV  1007
             M  RW+L GMTALVTGG RGLGHA+VEELA  GA VYTC  +E  L + ++ WK KG +V
Sbjct  1     MENRWTLRGMTALVTGGARGLGHAMVEELAGFGAIVYTCDISESHLNQNLREWKEKGLRV  60

Query  1006  FGSVCDILQPSQRENLIQLVSKQFDGKLTILVNNVAILIPKETLKSDGQDFSNTIGTNLE  827
             +GSVCD+   S+R  L+++VS  F GKL IL+NNV + + K T +   QDFS  I TN E
Sbjct  61    YGSVCDVSSRSERGKLMEIVSSLFGGKLNILINNVGVCVSKPTTEYTAQDFSFLIATNFE  120

Query  826   ASLNLCQLAHPLLKATGNGsivfisscssfVYAPFHTIYAATKGGINSLVRNLACEWTND  647
             ++ +LCQLAHPLLKA+G+GSIVF SS    V     +IY ATKG +N L RNLACEW +D
Sbjct  121   SAYHLCQLAHPLLKASGSGSIVFNSSIGGVVSCVLGSIYGATKGAMNQLARNLACEWASD  180

Query  646   NIRVNAVAPWLMRTSLTESSREEFGAVIEALIGRTLQHRLVEPKEASAAVAFLCFPAASS  467
             NIR N+VAP ++ T + E+   ++    + ++ R    RL E KE S+ VAFLC PAAS 
Sbjct  181   NIRANSVAPGVIPTPMAETHMRDY-EFTKTVLSRIPMERLGETKEVSSFVAFLCMPAASY  239

Query  466   ITGQIIRVDGGASV  425
             ITGQ I VDGG ++
Sbjct  240   ITGQTIVVDGGLTI  253



>ref|XP_002282755.1| PREDICTED: tropinone reductase homolog At1g07440 [Vitis vinifera]
 emb|CBI31629.3| unnamed protein product [Vitis vinifera]
Length=268

 Score =   261 bits (666),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 140/254 (55%), Positives = 178/254 (70%), Gaps = 5/254 (2%)
 Frame = -1

Query  1174  WSLHGMTALVTGGTRGLGHAIVEELACLGATVYTCSRTEKELEECIQNWKAKGYKVFGSV  995
             WSL G TALVTGGTRG+G+A+VEELA LGATV+TCSR E EL++C++ W AKG+ V  S+
Sbjct  13    WSLRGTTALVTGGTRGIGYAVVEELAGLGATVHTCSRNEAELDKCLREWHAKGFSVTASI  72

Query  994   CDILQPSQRENLIQLVSKQFDGKLTILVNNVAILIPKETLKSDGQDFSNTIGTNLEASLN  815
             CD    +QRE L++ VS  F+GKL ILVNNV     K T+     ++S  + TNLE++ +
Sbjct  73    CDGSDRAQREKLMEKVSSIFNGKLNILVNNVGTSFRKPTVDYTAAEYSTIMTTNLESAYH  132

Query  814   LCQLAHPLLKATGNGsivfisscssfVYAPFHTIYAATKGGINSLVRNLACEWTNDNIRV  635
             LCQLAHPLLKA+G GSIVF+SS +  V     +IYAATK  IN L +N ACEW  DNIR 
Sbjct  133   LCQLAHPLLKASGAGSIVFVSSVAGVVSLGTGSIYAATKAAINQLTKNFACEWAKDNIRS  192

Query  634   NAVAPWLMRTSLTES--SREEFGAVIEALIGRTLQHRLVEPKEASAAVAFLCFPAASSIT  461
             N+VAPW ++TSL E    +++F    E ++ RT   R  EPKE ++ VAFLC P AS IT
Sbjct  193   NSVAPWYIKTSLVEHLLQKKDF---FEGIVSRTPLGRPGEPKEVASLVAFLCLPVASYIT  249

Query  460   GQIIRVDGGASVYG  419
             GQ+I VDGG +V G
Sbjct  250   GQVICVDGGMTVNG  263



>emb|CDY09823.1| BnaC09g43380D [Brassica napus]
Length=271

 Score =   261 bits (666),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 139/256 (54%), Positives = 178/256 (70%), Gaps = 5/256 (2%)
 Frame = -1

Query  1177  RWSLHGMTALVTGGTRGLGHAIVEELACLGATVYTCSRTEKELEECIQNWKAKGYKVFGS  998
             RWSL GMTALVTGG++GLG A+VEELA LGA V+TC+R E +L+EC+  W+AKG++V  S
Sbjct  13    RWSLRGMTALVTGGSKGLGSAVVEELAMLGARVHTCARDETQLQECLLEWQAKGFQVTTS  72

Query  997   VCDILQPSQRENLIQLVSKQFDGKLTILVNNVAILIPKETLKSDGQDFSNTIGTNLEASL  818
             VCD+    QRE L++ VS  F GKL ILVNN    I K T +   +DFS  + TNLE++ 
Sbjct  73    VCDVSSRVQREKLMETVSTLFQGKLNILVNNAGTCITKPTTEFSAEDFSFLMATNLESAF  132

Query  817   NLCQLAHPLLKATGNGsivfisscssfVYAPFHTIYAATKGGINSLVRNLACEWTNDNIR  638
             +L QLAHP LKA+G+GSIVF+SS +  V+    +IY ATKG +N L RNLACEW +D+IR
Sbjct  133   HLSQLAHPFLKASGSGSIVFMSSAAGVVHVNVGSIYGATKGAMNQLARNLACEWASDSIR  192

Query  637   VNAVAPWLMRTSLTES--SREEFGAVIEALIGRTLQHRLVEPKEASAAVAFLCFPAASSI  464
             VN+V PW + T L       EE    +E    +T   R+ E  E S+ VAFLCFPAAS I
Sbjct  193   VNSVCPWFIATPLANKFMDHEELKKEVET---KTPMGRVGEANEVSSLVAFLCFPAASYI  249

Query  463   TGQIIRVDGGASVYGV  416
             TGQ+I VDGGA++ G+
Sbjct  250   TGQVICVDGGATINGL  265



>ref|XP_011048912.1| PREDICTED: tropinone reductase homolog At1g07440-like isoform 
X4 [Populus euphratica]
 ref|XP_011048914.1| PREDICTED: tropinone reductase homolog At1g07440-like isoform 
X4 [Populus euphratica]
Length=268

 Score =   261 bits (666),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 140/262 (53%), Positives = 177/262 (68%), Gaps = 2/262 (1%)
 Frame = -1

Query  1201  QQHNIMAGRWSLHGMTALVTGGTRGLGHAIVEELACLGATVYTCSRTEKELEECIQNWKA  1022
             Q+++    RWSL GMTALVTGGT+GLG+AIV ELA LGA V+TC R++ +L E ++ WKA
Sbjct  4     QENSSRDKRWSLQGMTALVTGGTKGLGYAIVGELAALGAIVHTCGRSQDQLNENLREWKA  63

Query  1021  KGYKVFGSVCDILQPSQRENLIQLVSKQFDGKLTILVNNVAILIPKETLKSDGQDFSNTI  842
             KG+KV GSVCD+   ++RE L++ VS  FDGKL IL+NN    I K TL    +DF + +
Sbjct  64    KGFKVTGSVCDLSSNAEREKLMKEVSSLFDGKLDILINNAGGNIHKGTLDYTTEDFVSIM  123

Query  841   GTNLEASLNLCQLAHPLLKATGNGsiv-fisscssfVYAPFHTIYAATKGGINSLVRNLA  665
               NL ++ +L QLAHPLLKA+G G IV   S  S     P + IY+A KG +N L RNLA
Sbjct  124   NINLGSAFHLSQLAHPLLKASGAGRIVFMSSVTSVVSINPQYPIYSAAKGAMNQLTRNLA  183

Query  664   CEWTNDNIRVNAVAPWLMRTSLTESSREEFGAVIEALIGRTLQHRLVEPKEASAAVAFLC  485
             CEW  DNIRVNAVAPW +RT LTE   ++     + +  RT   RL EP + S+ VAFLC
Sbjct  184   CEWAKDNIRVNAVAPWSIRTPLTEHFLDD-DKFRKEVFNRTPMKRLGEPGDVSSVVAFLC  242

Query  484   FPAASSITGQIIRVDGGASVYG  419
             FPA   +TGQ+I VDGG SV G
Sbjct  243   FPAPGFLTGQVICVDGGMSVNG  264



>gb|KEH22973.1| NAD(P)-binding rossmann-fold protein [Medicago truncatula]
Length=265

 Score =   261 bits (666),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 134/250 (54%), Positives = 175/250 (70%), Gaps = 2/250 (1%)
 Frame = -1

Query  1177  RWSLHGMTALVTGGTRGLGHAIVEELACLGATVYTCSRTEKELEECIQNWKAKGYKVFGS  998
             RWSLHGMTALVTGGTRG+G+AIVEELA  GA V+ C+R E+++ +C++ WK KG+ V GS
Sbjct  13    RWSLHGMTALVTGGTRGIGYAIVEELAEFGAAVHVCARNEEDINKCLEEWKNKGFNVTGS  72

Query  997   VCDILQPSQRENLIQLVSKQFDGKLTILVNNVAILIPKETLKSDGQDFSNTIGTNLEASL  818
             VCDIL   QR+ L++ VS  F GKL ILVNN A    K+ + +  +D + T+GTN  +  
Sbjct  73    VCDILFHEQRKRLMETVSSIFHGKLNILVNNAAKPTSKKIIDNTDEDINTTLGTNFVSGY  132

Query  817   NLCQLAHPLLKATGNGsivfisscssfVYAPFHTIYAATKGGINSLVRNLACEWTNDNIR  638
             +LCQLAHPLLK +G GSIVF SS +     P  ++YAATKG +N   +NLA EW  DNIR
Sbjct  133   HLCQLAHPLLKQSGYGSIVFTSSVAGLKAIPVLSVYAATKGAVNQFTKNLALEWAKDNIR  192

Query  637   VNAVAPWLMRTSLTES--SREEFGAVIEALIGRTLQHRLVEPKEASAAVAFLCFPAASSI  464
              NAVAP  ++TSL +S  +  E    ++ ++ +T   R+ EPKE S+ VAFLC PAAS I
Sbjct  193   ANAVAPGPVKTSLLQSITNDNEGDEAVDGVVSQTPMGRMGEPKEISSLVAFLCLPAASYI  252

Query  463   TGQIIRVDGG  434
             TGQ+I +DGG
Sbjct  253   TGQVIAIDGG  262



>ref|XP_009375950.1| PREDICTED: tropinone reductase homolog At1g07440-like [Pyrus 
x bretschneideri]
Length=263

 Score =   261 bits (666),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 141/255 (55%), Positives = 180/255 (71%), Gaps = 4/255 (2%)
 Frame = -1

Query  1177  RWSLHGMTALVTGGTRGLGHAIVEELACLGATVYTCSRTEKELEECIQNWKAKGYKVFGS  998
             RWSL GMTALVTGGT+G+G+AIVEELA LGA V+TCSR E +L +C+  W+ KG++V GS
Sbjct  7     RWSLRGMTALVTGGTKGIGYAIVEELAGLGAIVHTCSRNEVDLNDCLSQWE-KGFQVTGS  65

Query  997   VCDILQPSQRENLIQLVSKQFDGKLTILVNNVAILIPKETLKSDGQDFSNTIGTNLEASL  818
             VCD++  +QR+ LI  VS  F+GKL IL+NNV   I K TL+   +D+S  + TNLE+  
Sbjct  66    VCDVMYKTQRDKLINKVSSLFEGKLNILINNVGTSILKATLEYTAEDYSFVMSTNLESVY  125

Query  817   NLCQLAHPLLKATGNGsivfisscssfVYAPFHTIYAATKGGINSLVRNLACEWTNDNIR  638
             +LCQL+HPLLKA+G  +IVF+SS +  V     +IY+ATKG IN L +NLACEW  DNIR
Sbjct  126   HLCQLSHPLLKASGAANIVFLSSTAGVVSIDVGSIYSATKGAINQLAKNLACEWAKDNIR  185

Query  637   VNAVAPWLMRTSLTESS-REEFGAVIEALIGRTLQHRLVEPKEASAAVAFLCFPAASSIT  461
              N+VAPW + T LT+   R E    +E +  R    R  EPKE S+ VAFLC PAAS IT
Sbjct  186   TNSVAPWFITTPLTDPVLRNE--KKLEMINSRCPLGRPGEPKEVSSLVAFLCLPAASYIT  243

Query  460   GQIIRVDGGASVYGV  416
             GQ I +DGG +V G+
Sbjct  244   GQTIIIDGGVTVNGL  258



>ref|XP_011048908.1| PREDICTED: tropinone reductase homolog At1g07440-like isoform 
X1 [Populus euphratica]
Length=331

 Score =   263 bits (672),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 143/262 (55%), Positives = 184/262 (70%), Gaps = 2/262 (1%)
 Frame = -1

Query  1201  QQHNIMAGRWSLHGMTALVTGGTRGLGHAIVEELACLGATVYTCSRTEKELEECIQNWKA  1022
             Q+++    +WSL GMTALVTGGT+GLG+AIV ELA LGA V+TC R++ +L E ++ WKA
Sbjct  67    QENSSRDKKWSLQGMTALVTGGTKGLGYAIVGELAALGAIVHTCGRSQDQLNENLREWKA  126

Query  1021  KGYKVFGSVCDILQPSQRENLIQLVSKQFDGKLTILVNNVAILIPKETLKSDGQDFSNTI  842
             KG+KV GSVCD+   ++RE L++ VS  FDGKL IL+NN    I K +L    +DF + +
Sbjct  127   KGFKVTGSVCDLSSNAEREKLMEEVSSFFDGKLDILINNAGGNIHKGSLDYTSEDFVSIL  186

Query  841   GTNLEASLNLCQLAHPLLKATGNGsivfisscssfVYA-PFHTIYAATKGGINSLVRNLA  665
              TNL ++ +L QLAHPLLKA+G G IVF+SS +S V   P + IY+ATKG +N L RNLA
Sbjct  187   NTNLGSAFHLSQLAHPLLKASGAGRIVFMSSIASVVSVNPQYPIYSATKGAMNQLTRNLA  246

Query  664   CEWTNDNIRVNAVAPWLMRTSLTESSREEFGAVIEALIGRTLQHRLVEPKEASAAVAFLC  485
             CEW  DNIRVNAVAPW +RT LTE    +   + + +  RT   RL EP + S+ VAFLC
Sbjct  247   CEWAKDNIRVNAVAPWAVRTPLTEQFL-DVEKIRKDVFNRTPMKRLGEPGDVSSVVAFLC  305

Query  484   FPAASSITGQIIRVDGGASVYG  419
             FPA   +TGQ+I VDGG SV G
Sbjct  306   FPAPGFLTGQVICVDGGMSVNG  327



>gb|EMT31236.1| Tropinone reductase-like protein [Aegilops tauschii]
Length=317

 Score =   262 bits (670),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 141/258 (55%), Positives = 183/258 (71%), Gaps = 5/258 (2%)
 Frame = -1

Query  1183  AGRWSLHGMTALVTGGTRGLGHAIVEELACLGATVYTCSRTEKELEECIQNWKAKGYKVF  1004
             AGRWSLHG  ALVTGGTRG+G A+VEELA LGA V+TCSR E EL E ++ W+AKG++V 
Sbjct  58    AGRWSLHGRRALVTGGTRGIGRAVVEELAALGAAVHTCSRKEAELGERLKEWEAKGFRVT  117

Query  1003  GSVCDILQPSQRENLIQLVSKQFDGKLTILVNNVAILIPKETLKSDGQDFSNTIGTNLEA  824
             GSVCD+    QRE L+Q V+ +F GKL IL+NNV     K T +    ++S  + TNLE+
Sbjct  118   GSVCDVSVRDQRELLLQDVAGRFAGKLDILINNVGTNHRKPTTEYSADEYSFIMATNLES  177

Query  823   SLNLCQLAHPLLKATGNGsivfisscssfVYAPFHTIYAATKGGINSLVRNLACEWTNDN  644
             + +LCQLAHPLLKA+G  SIVFISS S  V     +IY  TKG +N L +NLACEW  DN
Sbjct  178   AYHLCQLAHPLLKASGVASIVFISSVSGVVAISSGSIYGMTKGAMNQLAKNLACEWAKDN  237

Query  643   IRVNAVAPWLMRTSLTES--SREEFGAVIEALIGRTLQHRLVEPKEASAAVAFLCFPAAS  470
             IR+N+VAPW ++TSL E   ++E+F   ++++  RT   R+ EP+E S+ VAFLC P +S
Sbjct  238   IRINSVAPWYIKTSLVEEDLAKEDF---VDSIARRTPMRRVGEPEEVSSLVAFLCMPGSS  294

Query  469   SITGQIIRVDGGASVYGV  416
              ITGQ I VDGG ++ G+
Sbjct  295   YITGQTISVDGGMTINGM  312



>ref|XP_004302763.1| PREDICTED: tropinone reductase homolog [Fragaria vesca subsp. 
vesca]
Length=260

 Score =   260 bits (664),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 136/260 (52%), Positives = 182/260 (70%), Gaps = 5/260 (2%)
 Frame = -1

Query  1186  MAG----RWSLHGMTALVTGGTRGLGHAIVEELACLGATVYTCSRTEKELEECIQNWKAK  1019
             MAG    RWSL GMTALVTGGT+G+G+AIVEELA LGATV+TC+R +++++E ++ WK+K
Sbjct  1     MAGFNSQRWSLKGMTALVTGGTKGIGYAIVEELAGLGATVHTCARNQEQIDEWVREWKSK  60

Query  1018  GYKVFGSVCDILQPSQRENLIQLVSKQFDGKLTILVNNVAILIPKETLKSDGQDFSNTIG  839
             G++V GSVCD+   SQRE L++ VS +FDGKL ILVNN A +  + T +   +D S+ + 
Sbjct  61    GFQVSGSVCDLTSKSQREELMRTVSSKFDGKLNILVNNAATVTLRSTTEYALEDLSSMMS  120

Query  838   TNLEASLNLCQLAHPLLKATGNGsivfisscssfVYAPFHTIYAATKGGINSLVRNLACE  659
             TN+E+  +LCQLA+PLLKA+GNGSIVFI+S +     P  + YAATK  +  + +NLACE
Sbjct  121   TNVESPYHLCQLAYPLLKASGNGSIVFIASIAGLKALPRLSAYAATKSAVIQISKNLACE  180

Query  658   WTNDNIRVNAVAPWLMRTSLTESSREEFGAVIEALIGRTLQHRLVEPKEASAAVAFLCFP  479
             W  D IR N VAPW + T + +   ++       LIGRT   R+ EP E S+ V FLC P
Sbjct  181   WAKDGIRTNTVAPWAVNTGV-KVENDDHSDDFRRLIGRTPIRRVAEPNEISSLVTFLCLP  239

Query  478   AASSITGQIIRVDGGASVYG  419
             AAS I GQ++ VDGG +V G
Sbjct  240   AASYINGQVVSVDGGFTVSG  259



>gb|ABW81054.1| tropinone-reductase-like39 [Arabidopsis lyrata subsp. lyrata]
Length=325

 Score =   262 bits (670),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 143/255 (56%), Positives = 181/255 (71%), Gaps = 5/255 (2%)
 Frame = -1

Query  1177  RWSLHGMTALVTGGTRGLGHAIVEELACLGATVYTCSRTEKELEECIQNWKAKGYKVFGS  998
             RWSL+G++ALVTGGTRG+G AIVEELA LGA V+TC+R E ELE C+ +W   G +V GS
Sbjct  68    RWSLNGLSALVTGGTRGIGRAIVEELAGLGAKVHTCARNENELENCLSDWNRYGLRVAGS  127

Query  997   VCDILQPSQRENLIQLVSKQFDGKLTILVNNVAILIPKETLKSDGQDFSNTIGTNLEASL  818
             VCD+   SQRE+L++ VS  FDGKL ILVNNV   I K  ++    +FS  + TN E+  
Sbjct  128   VCDVSDQSQREDLMETVSSVFDGKLHILVNNVGTNIRKPMVEFTAGEFSTLMSTNFESVF  187

Query  817   NLCQLAHPLLKATGNGsivfisscssfVYAPFHTIYAATKGGINSLVRNLACEWTNDNIR  638
             +LCQLA+PLL+A+  GS+V ISS S FV     ++ +ATKG IN L R+LACEW  DNIR
Sbjct  188   HLCQLAYPLLRASEAGSVVSISSVSGFVSLKNMSVQSATKGAINQLTRSLACEWAKDNIR  247

Query  637   VNAVAPWLMRTSLTES--SREEFGAVIEALIGRTLQHRLVEPKEASAAVAFLCFPAASSI  464
             VNAVAPW ++TS+ E   S E++   +E +   T   RL EP+E S+AVAFLC PA+S I
Sbjct  248   VNAVAPWYIKTSMVEQVLSNEDY---LEEVYSVTPLGRLGEPREVSSAVAFLCLPASSYI  304

Query  463   TGQIIRVDGGASVYG  419
             TGQII VDGG S+ G
Sbjct  305   TGQIIYVDGGMSING  319



>ref|XP_006352700.1| PREDICTED: tropinone reductase homolog [Solanum tuberosum]
Length=265

 Score =   260 bits (664),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 138/255 (54%), Positives = 177/255 (69%), Gaps = 5/255 (2%)
 Frame = -1

Query  1177  RWSLHGMTALVTGGTRGLGHAIVEELACLGATVYTCSRTEKELEECIQNWKAKGYKVFGS  998
             RWSL+G+ ALVTGGT G+GHAIVEEL   GA VYTCSR E  L EC++ W  KG +V G 
Sbjct  8     RWSLNGLVALVTGGTCGIGHAIVEELCEFGAKVYTCSRNESVLNECLKKWTDKGLQVKGC  67

Query  997   VCDILQPSQRENLIQLVSKQFDGKLTILVNNVAILIPKETLKSDGQDFSNTIGTNLEASL  818
             VCD+    QR  L++ VS +FDGKL IL+NNV   I K T +   +D+++ + TNLE+S 
Sbjct  68    VCDVSSKEQRVQLMEKVSLEFDGKLNILINNVGTNIWKPTTEYTSEDYAHMMATNLESSF  127

Query  817   NLCQLAHPLLKATGNGsivfisscssfVYAPFHTIYAATKGGINSLVRNLACEWTNDNIR  638
             +LCQLAHPLLK++G+G+IVF+SS +  V+    +IY ATKG +N L RNLACEW  D IR
Sbjct  128   HLCQLAHPLLKSSGSGTIVFLSSVAGLVHLSGTSIYGATKGAMNQLTRNLACEWAKDGIR  187

Query  637   VNAVAPWLMRTSLTES--SREEFGAVIEALIGRTLQHRLVEPKEASAAVAFLCFPAASSI  464
             VN VAPW + T L E     +EF   +E ++ RT   R  E +E S+ VA+LC PAAS +
Sbjct  188   VNGVAPWYINTPLVEHVLGDKEF---MEGVVSRTPLKRPGEVEEVSSMVAYLCLPAASYV  244

Query  463   TGQIIRVDGGASVYG  419
             TGQ+I VDGG +VYG
Sbjct  245   TGQVIAVDGGFTVYG  259



>emb|CBI30509.3| unnamed protein product [Vitis vinifera]
Length=250

 Score =   259 bits (663),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 138/249 (55%), Positives = 170/249 (68%), Gaps = 2/249 (1%)
 Frame = -1

Query  1159  MTALVTGGTRGLGHAIVEELACLGATVYTCSRTEKELEECIQNWKAKGYKVFGSVCDILQ  980
             MTAL+TGGTRG+G+AIVEELA LGA V+TCSR + EL E +Q W+ KG++V GSVCD+  
Sbjct  1     MTALITGGTRGIGYAIVEELAELGAIVHTCSRNQTELNERLQEWEGKGFRVSGSVCDLTS  60

Query  979   PSQRENLIQLVSKQFDGKLTILVNNVAILIPKETLKSDGQDFSNTIGTNLEASLNLCQLA  800
              +QRE L + VS  F+GKL ILVNN A +  K       +D S+ + TN E+  +LCQLA
Sbjct  61    RAQREKLTETVSSLFEGKLNILVNNAATVALKAPTNYTAEDCSSILQTNFESPYHLCQLA  120

Query  799   HPLLKATGNGsivfisscssfVYAPFHTIYAATKGGINSLVRNLACEWTNDNIRVNAVAP  620
             HPLLKA+G GSI+FISS +  +  P  ++YAATKG IN + +NLACEW  DNIR NAVAP
Sbjct  121   HPLLKASGRGSIIFISSVAGLISLPHMSVYAATKGAINQVTKNLACEWAKDNIRTNAVAP  180

Query  619   WLMRTSLTE--SSREEFGAVIEALIGRTLQHRLVEPKEASAAVAFLCFPAASSITGQIIR  446
             W +RTS+                L+ RT  HR+ EP E S  VAFLC PAAS ITGQ+I 
Sbjct  181   WTVRTSVRPILEPDNPMATAYPQLLARTPLHRIAEPDEVSPLVAFLCLPAASYITGQVIC  240

Query  445   VDGGASVYG  419
             VDGG SV G
Sbjct  241   VDGGFSVNG  249



>ref|XP_011023548.1| PREDICTED: tropinone reductase homolog At1g07440-like isoform 
X1 [Populus euphratica]
Length=267

 Score =   260 bits (664),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 134/254 (53%), Positives = 174/254 (69%), Gaps = 2/254 (1%)
 Frame = -1

Query  1177  RWSLHGMTALVTGGTRGLGHAIVEELACLGATVYTCSRTEKELEECIQNWKAKGYKVFGS  998
             RW L GM+ALVTGGT+GLG AIVEELA LGA V+TC+R + +L E ++ WK KG+KV GS
Sbjct  11    RWGLQGMSALVTGGTKGLGCAIVEELAALGAIVHTCARNQDQLNERVREWKEKGFKVTGS  70

Query  997   VCDILQPSQRENLIQLVSKQFDGKLTILVNNVAILIPKETLKSDGQDFSNTIGTNLEASL  818
             VCD+   ++RE L++ VS  FDGKL ILVNN    I K TL    +DF++ + TNL+++ 
Sbjct  71    VCDVSSNAEREKLMKEVSSLFDGKLNILVNNAGTNIYKATLDYTAEDFTSLMNTNLQSAF  130

Query  817   NLCQLAHPLLKATGNGsiv-fisscssfVYAPFHTIYAATKGGINSLVRNLACEWTNDNI  641
             +L QLAHPLLKA+  G IV   S  S       + +Y+A+KG +N L RNLACEW  DNI
Sbjct  131   HLSQLAHPLLKASRAGKIVFMSSIASVVSINTLYALYSASKGAMNQLTRNLACEWAKDNI  190

Query  640   RVNAVAPWLMRTSLTESSREEFGAVIEALIGRTLQHRLVEPKEASAAVAFLCFPAASSIT  461
             RVNAVAPW +RT LT  S ++   +++ +  RT   R+ EP E S+ VAFLC PA   +T
Sbjct  191   RVNAVAPWFIRTPLTTPSLDDEN-ILKEVFNRTPMRRVGEPGEVSSVVAFLCLPAPGFLT  249

Query  460   GQIIRVDGGASVYG  419
             GQ+I +DGG SV G
Sbjct  250   GQVICIDGGMSVNG  263



>emb|CDY09824.1| BnaC09g43370D [Brassica napus]
 emb|CDX97893.1| BnaC04g40460D [Brassica napus]
Length=271

 Score =   260 bits (665),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 139/256 (54%), Positives = 178/256 (70%), Gaps = 5/256 (2%)
 Frame = -1

Query  1177  RWSLHGMTALVTGGTRGLGHAIVEELACLGATVYTCSRTEKELEECIQNWKAKGYKVFGS  998
             RWSL GMTALVTGG++GLG A+VEELA LGA V+TC+R E +L+EC+  W+AKG++V  S
Sbjct  13    RWSLGGMTALVTGGSKGLGEAVVEELAMLGARVHTCARDETQLQECLLEWQAKGFQVTTS  72

Query  997   VCDILQPSQRENLIQLVSKQFDGKLTILVNNVAILIPKETLKSDGQDFSNTIGTNLEASL  818
             VCD+    QRE L++ VS  F GKL ILVNN    I K T +   +DFS  + TNLE++ 
Sbjct  73    VCDVSSRVQREKLMETVSTLFQGKLNILVNNAGTCITKPTTEFSAEDFSFLMATNLESAF  132

Query  817   NLCQLAHPLLKATGNGsivfisscssfVYAPFHTIYAATKGGINSLVRNLACEWTNDNIR  638
             +L QLAHP LKA+G+GSIVF+SS +  V+    +IY ATKG +N L RNLACEW +D+IR
Sbjct  133   HLSQLAHPFLKASGSGSIVFMSSAAGVVHVNVGSIYGATKGAMNQLARNLACEWASDSIR  192

Query  637   VNAVAPWLMRTSLTES--SREEFGAVIEALIGRTLQHRLVEPKEASAAVAFLCFPAASSI  464
             VN+V PW + T L       EE    +E    +T   R+ E  E S+ VAFLCFPAAS I
Sbjct  193   VNSVCPWFIATPLANKFMDHEELKKEVET---KTPMGRVGEANEVSSLVAFLCFPAASYI  249

Query  463   TGQIIRVDGGASVYGV  416
             TGQ+I VDGGA++ G+
Sbjct  250   TGQVICVDGGATINGL  265



>ref|XP_010040245.1| PREDICTED: tropinone reductase homolog At1g07440-like [Eucalyptus 
grandis]
 gb|KCW45355.1| hypothetical protein EUGRSUZ_L00968 [Eucalyptus grandis]
Length=282

 Score =   261 bits (666),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 149/262 (57%), Positives = 181/262 (69%), Gaps = 16/262 (6%)
 Frame = -1

Query  1177  RWSLHGMTALVTGGTRGLGHAIVEELACLGATVYTCSRTEKELEECIQNWKAKGYKVFGS  998
             RWSL GMTALVTGG++G+G AIVEELA LGATVYTCSRTE EL EC++ WK KG++V GS
Sbjct  22    RWSLQGMTALVTGGSKGIGRAIVEELAGLGATVYTCSRTEAELNECLKEWKRKGFQVAGS  81

Query  997   VCDILQPSQRENLIQLVSKQFDGKLTILVNNVAIL-----IPKETLKSDGQDFSNTIGTN  833
              CD+   S+RE L+  VS  FDGKL IL+NNV  L     +P  T+    +DFS  + TN
Sbjct  82    ACDVSSRSEREKLMLAVSSLFDGKLNILINNVGTLGTTGGMP--TVDYTAEDFSFIMTTN  139

Query  832   LEASLNLCQLAHPLLKATGNGsivfisscssfVYAPFHTIYAATKGGINSLVRNLACEWT  653
              E++ +L QLAHPLLKA+G GSIVF+SS    V     +IY+ATKG +N L +NLACEW 
Sbjct  140   FESAYHLSQLAHPLLKASGTGSIVFLSSVCGIVSLGLGSIYSATKGAMNQLTKNLACEWA  199

Query  652   NDNIRVNAVAPWLMRTSLTES--SREEF--GAVIEALIGRTLQHRLVEPKEASAAVAFLC  485
              DNIR N+VAP+ + T LTE     EE+   A+  A +GRT      EPKE S+ VAFLC
Sbjct  200   KDNIRSNSVAPYFILTPLTEPLLCSEEYHKEAIARAPLGRT-----GEPKEVSSLVAFLC  254

Query  484   FPAASSITGQIIRVDGGASVYG  419
              PAAS ITGQ I VDGG +V G
Sbjct  255   LPAASYITGQTICVDGGFTVNG  276



>ref|XP_010033100.1| PREDICTED: tropinone reductase homolog At1g07440-like [Eucalyptus 
grandis]
Length=282

 Score =   260 bits (665),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 149/262 (57%), Positives = 181/262 (69%), Gaps = 16/262 (6%)
 Frame = -1

Query  1177  RWSLHGMTALVTGGTRGLGHAIVEELACLGATVYTCSRTEKELEECIQNWKAKGYKVFGS  998
             RWSL GMTALVTGG++G+G AIVEELA LGATVYTCSRTE EL EC++ WK KG++V GS
Sbjct  22    RWSLQGMTALVTGGSKGIGRAIVEELAGLGATVYTCSRTEAELNECLKEWKRKGFQVAGS  81

Query  997   VCDILQPSQRENLIQLVSKQFDGKLTILVNNVAIL-----IPKETLKSDGQDFSNTIGTN  833
              CD+   S+RE L+  VS  FDGKL IL+NNV  L     +P  T+    +DFS  + TN
Sbjct  82    ACDVSSRSEREKLMLAVSSLFDGKLNILINNVGTLGTTGGMP--TVDYTAEDFSFIMTTN  139

Query  832   LEASLNLCQLAHPLLKATGNGsivfisscssfVYAPFHTIYAATKGGINSLVRNLACEWT  653
              E++ +L QLAHPLLKA+G GSIVF+SS    V     +IY+ATKG +N L +NLACEW 
Sbjct  140   FESAYHLSQLAHPLLKASGTGSIVFLSSVCGIVSLGLGSIYSATKGAMNQLTKNLACEWA  199

Query  652   NDNIRVNAVAPWLMRTSLTES--SREEF--GAVIEALIGRTLQHRLVEPKEASAAVAFLC  485
              DNIR N+VAP+ + T LTE     EE+   A+  A +GRT      EPKE S+ VAFLC
Sbjct  200   KDNIRSNSVAPYFILTPLTEPLLCSEEYHKEAIARAPLGRT-----GEPKEVSSLVAFLC  254

Query  484   FPAASSITGQIIRVDGGASVYG  419
              PAAS ITGQ I VDGG +V G
Sbjct  255   LPAASYITGQTICVDGGFTVNG  276



>ref|XP_007016320.1| NAD(P)-binding Rossmann-fold superfamily protein isoform 1 [Theobroma 
cacao]
 ref|XP_007016321.1| NAD(P)-binding Rossmann-fold superfamily protein isoform 1 [Theobroma 
cacao]
 gb|EOY33939.1| NAD(P)-binding Rossmann-fold superfamily protein isoform 1 [Theobroma 
cacao]
 gb|EOY33940.1| NAD(P)-binding Rossmann-fold superfamily protein isoform 1 [Theobroma 
cacao]
Length=298

 Score =   261 bits (666),  Expect = 4e-80, Method: Compositional matrix adjust.
 Identities = 138/256 (54%), Positives = 173/256 (68%), Gaps = 5/256 (2%)
 Frame = -1

Query  1177  RWSLHGMTALVTGGTRGLGHAIVEELACLGATVYTCSRTEKELEECIQNWKAKGYKVFGS  998
             RWSLHGMTALVTGGT+G+GHAIVEELA LGA ++TCSRTE EL +C+  W+AKG++V GS
Sbjct  39    RWSLHGMTALVTGGTKGIGHAIVEELAGLGARIHTCSRTETELNKCLLEWQAKGFQVTGS  98

Query  997   VCDILQPSQRENLIQLVSKQFDGKLTILVNNVAILIPKETLKSDGQDFSNTIGTNLEASL  818
              CD+   +Q E LI   S  F+GKL IL+NNV  ++ K   +   ++ S  +GTN E++ 
Sbjct  99    ACDVSSKAQGEKLINTASSVFNGKLDILINNVGTIVAKPISEETAEEVSFLMGTNFESAH  158

Query  817   NLCQLAHPLLKATGNGsivfisscssfVYAPFHTI--YAATKGGINSLVRNLACEWTNDN  644
             NL  LAHPLLKA+G G    +   S     P  T+  Y ATKG +N L ++LACEW  DN
Sbjct  159   NLSLLAHPLLKASGAG--SIVLLSSIAGLTPVRTLPTYGATKGAMNQLAKHLACEWAGDN  216

Query  643   IRVNAVAPWLMRTSLTESSREEFGAVIEALIGRTLQHRLVEPKEASAAVAFLCFPAASSI  464
             IRVNAVAP L+RT L E    +  A +EA I +    R  EPKE S+ VAFLC PAAS I
Sbjct  217   IRVNAVAPSLIRTPLAEPVFHDEKA-LEAFITKIPMGRAGEPKEVSSLVAFLCLPAASYI  275

Query  463   TGQIIRVDGGASVYGV  416
             TGQII VDGG ++ G+
Sbjct  276   TGQIIYVDGGITLNGL  291



>ref|XP_009611893.1| PREDICTED: tropinone reductase homolog At1g07440-like isoform 
X1 [Nicotiana tomentosiformis]
 ref|XP_009611894.1| PREDICTED: tropinone reductase homolog At1g07440-like isoform 
X1 [Nicotiana tomentosiformis]
Length=265

 Score =   259 bits (663),  Expect = 4e-80, Method: Compositional matrix adjust.
 Identities = 141/268 (53%), Positives = 183/268 (68%), Gaps = 5/268 (2%)
 Frame = -1

Query  1222  LAKNAKYQQHNIMAGRWSLHGMTALVTGGTRGLGHAIVEELACLGATVYTCSRTEKELEE  1043
             +AK A + + +    RWSL+G+ ALVTGGT G+GHA+VEELA LGA VYTCS+TE EL E
Sbjct  1     MAKVAAFAKSS----RWSLNGLAALVTGGTSGIGHAVVEELAGLGAKVYTCSKTESELNE  56

Query  1042  CIQNWKAKGYKVFGSVCDILQPSQRENLIQLVSKQFDGKLTILVNNVAILIPKETLKSDG  863
              +Q+W  +G +V GS CD+    QR  L+  VS  FDGKL IL+NNV   I K ++K   
Sbjct  57    PMQDWADRGIQVKGSACDVTCREQRVELMNKVSSAFDGKLNILINNVGTNIWKPSIKYTA  116

Query  862   QDFSNTIGTNLEASLNLCQLAHPLLKATGNGsivfisscssfVYAPFHTIYAATKGGINS  683
             +D+S+ + TNLE+S +L QLAHPLLK++G GSIVF SS +  V+    +IY ATK G+  
Sbjct  117   EDYSHMMATNLESSFHLSQLAHPLLKSSGAGSIVFTSSVAGLVHVSGTSIYGATKAGMIQ  176

Query  682   LVRNLACEWTNDNIRVNAVAPWLMRTSLTESSREEFGAVIEALIGRTLQHRLVEPKEASA  503
             L RNLACEW  D IRVNAVAPW  +T L +   ++  A ++ LI RT   R  E +E S+
Sbjct  177   LTRNLACEWGKDGIRVNAVAPWYTKTPLVKDVLKD-KAFLDELIARTPLRRPGEVEEVSS  235

Query  502   AVAFLCFPAASSITGQIIRVDGGASVYG  419
              VA+LC P AS +TGQ+I VDGG +VYG
Sbjct  236   VVAYLCLPGASYVTGQVIAVDGGFTVYG  263



>ref|XP_004302760.1| PREDICTED: tropinone reductase homolog [Fragaria vesca subsp. 
vesca]
Length=260

 Score =   259 bits (663),  Expect = 4e-80, Method: Compositional matrix adjust.
 Identities = 139/263 (53%), Positives = 183/263 (70%), Gaps = 11/263 (4%)
 Frame = -1

Query  1186  MAG----RWSLHGMTALVTGGTRGLGHAIVEELACLGATVYTCSRTEKELEECIQNWKAK  1019
             MAG    RWSL GMTALVTGGT+G+G+AIVEELA LGATV+TC+R +++++E +Q WK+K
Sbjct  1     MAGFDSQRWSLKGMTALVTGGTKGIGYAIVEELAGLGATVHTCARNQEQIDERVQEWKSK  60

Query  1018  GYKVFGSVCDILQPSQRENLIQLVSKQFDGKLTILVNNVAILIPKETLKSDGQDFSNTIG  839
             G+KV GSVCD+   SQRE LI+ VS  FDGKL ILVNN A +  + T     +D S+ +G
Sbjct  61    GFKVSGSVCDLTSKSQREELIKTVSSVFDGKLNILVNNAASVTLRRTEDYTLEDLSSMMG  120

Query  838   TNLEASLNLCQLAHPLLKATGNGsivfisscssfVYAPFHTIYAATKGGINSLVRNLACE  659
             +N+E+S +LCQL++PLLKA+ N SIVFI+S +  +  P  + YAATK  +  + +NLACE
Sbjct  121   SNVESSYHLCQLSYPLLKASENASIVFIASIAGAIALPRLSAYAATKSAVIQISKNLACE  180

Query  658   WTNDNIRVNAVAPWLMRTSL---TESSREEFGAVIEALIGRTLQHRLVEPKEASAAVAFL  488
             W  D IR N VAPW + T +    +   E+F      LIGRT   R+ EP E S+ V+FL
Sbjct  181   WARDKIRTNTVAPWAVNTGVKVGNDDHSEDF----RRLIGRTPIRRVAEPNEISSLVSFL  236

Query  487   CFPAASSITGQIIRVDGGASVYG  419
             C PAAS I GQ++ VDGG +V G
Sbjct  237   CLPAASYINGQVVNVDGGFTVSG  259



>ref|XP_004503163.1| PREDICTED: tropinone reductase homolog [Cicer arietinum]
Length=272

 Score =   260 bits (664),  Expect = 4e-80, Method: Compositional matrix adjust.
 Identities = 139/266 (52%), Positives = 177/266 (67%), Gaps = 5/266 (2%)
 Frame = -1

Query  1210  AKYQQHNIMAGRWSLHGMTALVTGGTRGLGHAIVEELACLGATVYTCSRTEKELEECIQN  1031
             AK  + +    RWSL G TALVTGGTRG+GHA+VEELA  GATVYTCSR E EL +C+  
Sbjct  2     AKATESSSRGSRWSLKGATALVTGGTRGIGHAVVEELAEFGATVYTCSRNEVELNKCLNQ  61

Query  1030  WKAKGYKVFGSVCDILQPSQRENLIQLVSKQFDGKLTILVNNVAILIPKETLKSDGQDFS  851
             W+ KG+ V+GSVCD+   SQRE LI+ V+  F+GKL ILVNN    + K T+    +++S
Sbjct  62    WQEKGFSVYGSVCDLSSSSQREELIRKVASAFNGKLNILVNNAGTNVRKPTIDYTAEEYS  121

Query  850   NTIGTNLEASLNLCQLAHPLLKATGNGsivfisscssfVYAPFHTIYAATKGGINSLVRN  671
               + TNL++  +L QLA+ LLK +GNGSIVF SS +S       +IYA +K  IN L ++
Sbjct  122   KVMNTNLDSVYHLSQLAYSLLKESGNGSIVFNSSVASLTSVGSGSIYALSKAAINQLTKS  181

Query  670   LACEWTNDNIRVNAVAPWLMRTSLTES--SREEFGAVIEALIGRTLQHRLVEPKEASAAV  497
             LACEW  DNIR N VAPW  +TSL E   + EEF   +  ++ RT   R+ E  E S+ V
Sbjct  182   LACEWAKDNIRSNCVAPWYTKTSLVEHLIANEEF---VNEILSRTPIKRIAEAHEVSSLV  238

Query  496   AFLCFPAASSITGQIIRVDGGASVYG  419
              FLC PAAS ITGQI+ VDGG +V G
Sbjct  239   TFLCLPAASYITGQIVSVDGGFTVNG  264



>gb|KHG18781.1| Tropinone reductase [Gossypium arboreum]
Length=322

 Score =   261 bits (668),  Expect = 4e-80, Method: Compositional matrix adjust.
 Identities = 143/260 (55%), Positives = 181/260 (70%), Gaps = 5/260 (2%)
 Frame = -1

Query  1192  NIMAGRWSLHGMTALVTGGTRGLGHAIVEELACLGATVYTCSRTEKELEECIQNWKAKGY  1013
             NI + RWSL GMTALVTGGTRG+G AIVEEL  LGA V+TCSR E EL++ + +WK+ G+
Sbjct  60    NIKSNRWSLQGMTALVTGGTRGIGRAIVEELGGLGARVHTCSRNENELDKALVDWKSLGF  119

Query  1012  KVFGSVCDILQPSQRENLIQLVSKQFDGKLTILVNNVAILIPKETLKSDGQDFSNTIGTN  833
             +V GS+CD+   +QR++L++ VS  FD KL IL+NNV   I K  +    ++ S  + TN
Sbjct  120   EVSGSICDVSIAAQRQSLMETVSSLFDCKLNILINNVGTNIRKPMVDFTVEEVSTLLATN  179

Query  832   LEASLNLCQLAHPLLKATGNGsivfisscssfVYAPFHTIYAATKGGINSLVRNLACEWT  653
              E+  NLCQLA+PLLK +G+GS+VF SS S FV     ++  ATKG IN L RNLACEW 
Sbjct  180   FESVFNLCQLAYPLLKTSGSGSVVFTSSVSGFVSLKSMSLQGATKGAINQLTRNLACEWA  239

Query  652   NDNIRVNAVAPWLMRTSLTES--SREEFGAVIEALIGRTLQHRLVEPKEASAAVAFLCFP  479
              DNIR NAVAPW +RTS+ E   S +E+   +E +  RT   RL +P E S+ VAFLC P
Sbjct  240   KDNIRSNAVAPWYIRTSMVEQVLSNKEY---LEEVYSRTPLGRLGDPTEVSSLVAFLCLP  296

Query  478   AASSITGQIIRVDGGASVYG  419
             A+S ITGQII VDGG SV G
Sbjct  297   ASSYITGQIICVDGGMSVNG  316



>ref|XP_010033102.1| PREDICTED: tropinone reductase homolog At1g07440-like isoform 
X1 [Eucalyptus grandis]
 gb|KCW52640.1| hypothetical protein EUGRSUZ_J02016 [Eucalyptus grandis]
Length=282

 Score =   260 bits (664),  Expect = 4e-80, Method: Compositional matrix adjust.
 Identities = 149/262 (57%), Positives = 180/262 (69%), Gaps = 16/262 (6%)
 Frame = -1

Query  1177  RWSLHGMTALVTGGTRGLGHAIVEELACLGATVYTCSRTEKELEECIQNWKAKGYKVFGS  998
             RWSL GMTALVTGG++G+G AIVEELA LGATVYTCSRTE EL EC++ WK KG++V GS
Sbjct  22    RWSLQGMTALVTGGSKGIGRAIVEELAGLGATVYTCSRTEAELNECLKEWKRKGFQVAGS  81

Query  997   VCDILQPSQRENLIQLVSKQFDGKLTILVNNVAIL-----IPKETLKSDGQDFSNTIGTN  833
              CD+   S+RE L+   S  FDGKL IL+NNV  L     +P  T+    +DFS  + TN
Sbjct  82    ACDVSSRSEREKLMLAASSLFDGKLNILINNVGTLGTTGGMP--TVDCTAEDFSFIMTTN  139

Query  832   LEASLNLCQLAHPLLKATGNGsivfisscssfVYAPFHTIYAATKGGINSLVRNLACEWT  653
              E++ +L QLAHPLLKA+G GSIVF+SS    V     +IY+ATKG +N L +NLACEW 
Sbjct  140   FESAYHLSQLAHPLLKASGTGSIVFLSSVCGIVSLSVGSIYSATKGAMNQLTKNLACEWA  199

Query  652   NDNIRVNAVAPWLMRTSLTES--SREEF--GAVIEALIGRTLQHRLVEPKEASAAVAFLC  485
              DNIR N+VAP+ + T LTE     EEF   A+  A +GRT      EPKE S+ VAFLC
Sbjct  200   KDNIRSNSVAPYFILTPLTEPLLCSEEFHKEAIARAPLGRT-----GEPKEVSSLVAFLC  254

Query  484   FPAASSITGQIIRVDGGASVYG  419
              PAAS ITGQ I VDGG +V G
Sbjct  255   LPAASYITGQTICVDGGFTVNG  276



>gb|KEH22972.1| NAD(P)-binding rossmann-fold protein [Medicago truncatula]
Length=266

 Score =   259 bits (663),  Expect = 4e-80, Method: Compositional matrix adjust.
 Identities = 137/251 (55%), Positives = 174/251 (69%), Gaps = 3/251 (1%)
 Frame = -1

Query  1177  RWSLHGMTALVTGGTRGLGHAIVEELACLGATVYTCSRTEKELEECIQNWKAKGYKVFGS  998
             RWSLHGMTALVTGGTRG+G+AIVEELA  GA+V+ C+R E+++ +C++ WK KG+ V GS
Sbjct  13    RWSLHGMTALVTGGTRGIGYAIVEELAEFGASVHICARNEEDINKCLEEWKNKGFNVTGS  72

Query  997   VCDILQPSQRENLIQLVSKQFDGKLTILVNNVAILIPKETLKSDGQDFSNTIGTNLEASL  818
             VCDIL   QR+ L++ VS  F GKL ILVNN A    K+ + +  +D + T+GTN  +  
Sbjct  73    VCDILFHEQRKKLMETVSSIFQGKLNILVNNAAKPTSKKIIDNTDEDINTTLGTNFVSGY  132

Query  817   NLCQLAHPLLKATGNGsivfisscssfVYAPFHTIYAATKGGINSLVRNLACEWTNDNIR  638
             +LCQLAHPLLK +G GSIVF SS +     P  ++YAATKG +N   +NLA EW  DNIR
Sbjct  133   HLCQLAHPLLKQSGYGSIVFTSSVAGLKAIPVLSVYAATKGAVNQFTKNLALEWAKDNIR  192

Query  637   VNAVAPWLMRTSLTESSRE---EFGAVIEALIGRTLQHRLVEPKEASAAVAFLCFPAASS  467
              NAVAP  ++TSL ES  +   E    I  ++ +T   R+ E KE SA VAFLC PAAS 
Sbjct  193   ANAVAPGPVKTSLLESVMDYDSEGYKAIAGIVSQTPTGRMGETKEISALVAFLCLPAASH  252

Query  466   ITGQIIRVDGG  434
             ITGQII +DGG
Sbjct  253   ITGQIIAIDGG  263



>ref|XP_010510523.1| PREDICTED: tropinone reductase homolog At1g07440-like isoform 
X1 [Camelina sativa]
Length=272

 Score =   259 bits (663),  Expect = 5e-80, Method: Compositional matrix adjust.
 Identities = 144/261 (55%), Positives = 179/261 (69%), Gaps = 3/261 (1%)
 Frame = -1

Query  1177  RWSLHGMTALVTGGTRGLGHAIVEELACLGATVYTCSRTEKELEECIQNWKAKGYKVFGS  998
             RWSL GMTALVTGG++GLG A+VEELA LGA V+TC+R E +L+E ++ W AKG++V  S
Sbjct  14    RWSLGGMTALVTGGSKGLGEAVVEELAMLGARVHTCARDETQLQERLREWHAKGFQVSIS  73

Query  997   VCDILQPSQRENLIQLVSKQFDGKLTILVNNVAILIPKETLKSDGQDFSNTIGTNLEASL  818
             VCD+    QRE L++ VS  F GKL ILVNN    I K T +   QD+S  + TNLE++ 
Sbjct  74    VCDVSYREQREKLMETVSSLFQGKLNILVNNAGTCIAKPTTEYTSQDYSFLMATNLESAF  133

Query  817   NLCQLAHPLLKATGNGsivfisscssfVYAPFHTIYAATKGGINSLVRNLACEWTNDNIR  638
             +L QLAHPLLKA+G+GSIV +SS S  VY    +IYAATKG +N L RNLACEW NDNIR
Sbjct  134   HLSQLAHPLLKASGSGSIVLMSSASGVVYVNISSIYAATKGAMNQLGRNLACEWANDNIR  193

Query  637   VNAVAPWLMRTSLTESSREEFGAVIEALIGRTLQHRLVEPKEASAAVAFLCFPAASSITG  458
             VN+V PW + T L +   +      E +  +T   R  +P E S+ VAFLCFPAAS ITG
Sbjct  194   VNSVCPWFIETPLAKDYLDVE-EYKEEVEKKTPMGRAGKPNEVSSLVAFLCFPAASYITG  252

Query  457   QIIRVDGGASVYGV*TIIEPP  395
             Q I VDGGA+V G     +PP
Sbjct  253   QTICVDGGATVNGF--SFKPP  271



>sp|P50162.1|TRN1_DATST RecName: Full=Tropinone reductase 1; AltName: Full=Tropine dehydrogenase; 
AltName: Full=Tropinone reductase I; Short=TR-I 
[Datura stramonium]
 pdb|1AE1|A Chain A, Tropinone Reductase-I Complex With Nadp
 pdb|1AE1|B Chain B, Tropinone Reductase-I Complex With Nadp
 gb|AAA33281.1| tropinone reductase-I [Datura stramonium]
Length=273

 Score =   259 bits (663),  Expect = 5e-80, Method: Compositional matrix adjust.
 Identities = 137/261 (52%), Positives = 186/261 (71%), Gaps = 11/261 (4%)
 Frame = -1

Query  1180  GRWSLHGMTALVTGGTRGLGHAIVEELACLGATVYTCSRTEKELEECIQNWKAKGYKVFG  1001
             GRWSL G TALVTGG++G+G+AIVEELA LGA VYTCSR EKEL+EC++ W+ KG  V G
Sbjct  15    GRWSLKGTTALVTGGSKGIGYAIVEELAGLGARVYTCSRNEKELDECLEIWREKGLNVEG  74

Query  1000  SVCDILQPSQRENLIQLVSKQFDGKLTILVNNVAILIPKETLKSDGQDFSNTIGTNLEAS  821
             SVCD+L  ++R+ L+Q V+  FDGKL ILVNN  ++I KE      +D++  +GTN EA+
Sbjct  75    SVCDLLSRTERDKLMQTVAHVFDGKLNILVNNAGVVIHKEAKDFTEKDYNIIMGTNFEAA  134

Query  820   LNLCQLAHPLLKATGNGsivfisscssfVYAPFHTIYAATKGGINSLVRNLACEWTNDNI  641
              +L Q+A+PLLKA+ NG+++F+SS + F   P  ++Y+A+KG IN + ++LACEW  DNI
Sbjct  135   YHLSQIAYPLLKASQNGNVIFLSSIAGFSALPSVSLYSASKGAINQMTKSLACEWAKDNI  194

Query  640   RVNAVAPWLMRTSLTESS-------REEFGAVIEALIGRTLQHRLVEPKEASAAVAFLCF  482
             RVN+VAP ++ T L E++       +EE    I+  I +T   R  +P+E SA +AFLCF
Sbjct  195   RVNSVAPGVILTPLVETAIKKNPHQKEE----IDNFIVKTPMGRAGKPQEVSALIAFLCF  250

Query  481   PAASSITGQIIRVDGGASVYG  419
             PAAS ITGQII  DGG +  G
Sbjct  251   PAASYITGQIIWADGGFTANG  271



>gb|ACU16743.1| unknown [Glycine max]
Length=269

 Score =   259 bits (663),  Expect = 5e-80, Method: Compositional matrix adjust.
 Identities = 133/253 (53%), Positives = 179/253 (71%), Gaps = 1/253 (0%)
 Frame = -1

Query  1177  RWSLHGMTALVTGGTRGLGHAIVEELACLGATVYTCSRTEKELEECIQNWKAKGYKVFGS  998
             RWSL+GMTALVTGGTRG+GH+IV +LA  GA V+TCSRT+ EL +C+Q W+++G++V GS
Sbjct  11    RWSLNGMTALVTGGTRGIGHSIVSDLAAFGAAVHTCSRTQTELNKCLQEWQSQGFQVTGS  70

Query  997   VCDILQPSQRENLIQLVSKQFDGKLTILVNNVAILIPKETLKSDGQDFSNTIGTNLEASL  818
             +CD+  P QRE LIQ V+  F+GKL I VNNV I I K T++   +++S  +  NL++S 
Sbjct  71    LCDVSSPPQREKLIQEVASTFNGKLNIYVNNVGINIRKPTIEYTAEEYSQIMTVNLDSSF  130

Query  817   NLCQLAHPLLKATGNGsivfisscssfVYAPFHTIYAATKGGINSLVRNLACEWTNDNIR  638
             +LCQLA+PLLKA+  GSIVFISS +  V      ++AA+K  IN L +NLAC+W  DNIR
Sbjct  131   HLCQLAYPLLKASEKGSIVFISSVAGVVSLGTGAVFAASKAAINQLTKNLACDWAKDNIR  190

Query  637   VNAVAPWLMRTSLTESSREEFGAVIEALIGRTLQHRLVEPKEASAAVAFLCFPAASSITG  458
              N V PW  RT + E   ++    ++ ++ RT   R+ EP+E S+ V FLC PAAS ITG
Sbjct  191   SNCVVPWATRTPVVEHLFKD-QKFVDDIMSRTPIKRIAEPEEVSSLVNFLCLPAASFITG  249

Query  457   QIIRVDGGASVYG  419
             Q+I VDGG +V G
Sbjct  250   QVICVDGGLTVNG  262



>ref|NP_001242650.1| uncharacterized protein LOC100819646 [Glycine max]
 gb|ACU21266.1| unknown [Glycine max]
Length=271

 Score =   259 bits (663),  Expect = 5e-80, Method: Compositional matrix adjust.
 Identities = 140/253 (55%), Positives = 169/253 (67%), Gaps = 1/253 (0%)
 Frame = -1

Query  1177  RWSLHGMTALVTGGTRGLGHAIVEELACLGATVYTCSRTEKELEECIQNWKAKGYKVFGS  998
             RWSL G TALVTGGTRG+GHA+VEELA  GATVYTCSR E+EL  C++ WK KG+ V G 
Sbjct  12    RWSLKGTTALVTGGTRGIGHAVVEELAEFGATVYTCSRNEEELNACLKEWKEKGFSVSGL  71

Query  997   VCDILQPSQRENLIQLVSKQFDGKLTILVNNVAILIPKETLKSDGQDFSNTIGTNLEASL  818
             VCD   P  RENLIQ V+  F+GKL ILVNNV   + K T++   +++S  + TNL+++ 
Sbjct  72    VCDASSPPHRENLIQQVASAFNGKLNILVNNVGTNVRKPTIEYTAEEYSKLMATNLDSTY  131

Query  817   NLCQLAHPLLKATGNGsivfisscssfVYAPFHTIYAATKGGINSLVRNLACEWTNDNIR  638
             +LCQLA+PLLKA+GNGSIV ISS +S        IYAATK  I+ L +  ACEW  DNIR
Sbjct  132   HLCQLAYPLLKASGNGSIVSISSVASQTSVGSGAIYAATKAAIDQLTKYFACEWAKDNIR  191

Query  637   VNAVAPWLMRTSLTESSREEFGAVIEALIGRTLQHRLVEPKEASAAVAFLCFPAASSITG  458
              N VAPW   TSL E        V E +I RT   R+ E  E S+ V FLC PAA  ITG
Sbjct  192   SNGVAPWYTITSLVEPLLANKQLVSE-IISRTPIKRMAETHEVSSLVTFLCLPAAPYITG  250

Query  457   QIIRVDGGASVYG  419
             QI+ VDGG +  G
Sbjct  251   QIVSVDGGFTANG  263



>gb|KHG18782.1| hypothetical protein F383_24463 [Gossypium arboreum]
Length=270

 Score =   259 bits (663),  Expect = 5e-80, Method: Compositional matrix adjust.
 Identities = 138/256 (54%), Positives = 175/256 (68%), Gaps = 5/256 (2%)
 Frame = -1

Query  1180  GRWSLHGMTALVTGGTRGLGHAIVEELACLGATVYTCSRTEKELEECIQNWKAKGYKVFG  1001
             GRWSL G TALVTGGT+G+G A+VEELA LGATVYTCSR + +L EC++ WK KG++VFG
Sbjct  10    GRWSLKGTTALVTGGTKGIGLAVVEELAALGATVYTCSRNQDQLNECLKEWKMKGFQVFG  69

Query  1000  SVCDILQPSQRENLIQLVSKQFDGKLTILVNNVAILIPKETLKSDGQDFSNTIGTNLEAS  821
             SVCD   P+QRE LI  VS  F+ +L IL+NNV     K T +    + S  + TN E++
Sbjct  70    SVCDATSPAQREALINNVSSMFNAQLNILINNVGTNDWKPTAEYTNTELSTLLSTNFESA  129

Query  820   LNLCQLAHPLLKATGNGsivfisscssfVYAPFHTIYAATKGGINSLVRNLACEWTNDNI  641
              +  QLA+PLLKA+G GSIVF+SS +        +IY +TKG +N L + LACEW  DNI
Sbjct  130   YHFSQLAYPLLKASGRGSIVFVSSVAGVFSINVGSIYGSTKGAMNQLTKELACEWAKDNI  189

Query  640   RVNAVAPWLMRTSLTES--SREEFGAVIEALIGRTLQHRLVEPKEASAAVAFLCFPAASS  467
             R N VAPW +RT LTE   S  +F   +EA++ RT   R+ EP+E +  VAFLC PA+S 
Sbjct  190   RTNCVAPWFIRTPLTEQVLSSSKF---MEAVVSRTPLGRVGEPEEVAHLVAFLCLPASSF  246

Query  466   ITGQIIRVDGGASVYG  419
             ITGQII VDGG +  G
Sbjct  247   ITGQIICVDGGLTANG  262



>ref|XP_010685685.1| PREDICTED: tropinone reductase homolog At1g07440-like [Beta vulgaris 
subsp. vulgaris]
Length=258

 Score =   259 bits (662),  Expect = 5e-80, Method: Compositional matrix adjust.
 Identities = 137/261 (52%), Positives = 180/261 (69%), Gaps = 7/261 (3%)
 Frame = -1

Query  1189  IMAGRWSLHGMTALVTGGTRGLGHAIVEELACLGATVYTCSRTEKELEECIQNWKAKGYK  1010
             +M  RWSL GMTALVTGGT+G+GHAIVEELA LGA V+TC+R E ELE C +NW+ KG+ 
Sbjct  1     MMNKRWSLVGMTALVTGGTKGIGHAIVEELAGLGARVHTCARNETELEACKRNWETKGFH  60

Query  1009  VFGSVCDILQPSQRENLIQLVSKQFDGKLTILVNNVAILIPKETLKSDGQDFSNTIGTNL  830
             V  S+CD+    QRENL+++VS +F GKL ILVNNV   + K T +   ++++  + TNL
Sbjct  61    VTASICDVTSRVQRENLMEIVSSEFKGKLNILVNNVGAYMKKPTTEFTAEEYATVMTTNL  120

Query  829   EASLNLCQLAHPLLKATGNGsivfisscssfVYAPFHTIYAATKGGINSLVRNLACEWTN  650
             E++ + CQLAHPLLKA+G  SI+F+SS +  V     ++Y   KG +N L +NLACEW  
Sbjct  121   ESAYHFCQLAHPLLKASGFASIIFMSSVAGVVAVDVGSLYGTAKGAMNQLAKNLACEWAK  180

Query  649   DNIRVNAVAPWLMRTSLTE---SSREEFGAVIEALIGRTLQHRLVEPKEASAAVAFLCFP  479
             DNIR N++AP+ +RT LTE   S +E    V E    RT   R  E +E S+ VAFLC P
Sbjct  181   DNIRTNSIAPFYIRTPLTEVVLSDKEYLAKVKE----RTPLGRTGEVEEVSSLVAFLCMP  236

Query  478   AASSITGQIIRVDGGASVYGV  416
             AAS ITGQ I VDGG +++G+
Sbjct  237   AASYITGQTICVDGGFTIHGL  257



>gb|AFK36946.1| unknown [Medicago truncatula]
Length=266

 Score =   259 bits (662),  Expect = 5e-80, Method: Compositional matrix adjust.
 Identities = 136/251 (54%), Positives = 173/251 (69%), Gaps = 3/251 (1%)
 Frame = -1

Query  1177  RWSLHGMTALVTGGTRGLGHAIVEELACLGATVYTCSRTEKELEECIQNWKAKGYKVFGS  998
             RWSLHGMTALVTGGTRG+G+AIVEELA  GA+V+ C+R E+++ +C++ WK KG+ V GS
Sbjct  13    RWSLHGMTALVTGGTRGIGYAIVEELAEFGASVHICARNEEDINKCLEEWKNKGFNVTGS  72

Query  997   VCDILQPSQRENLIQLVSKQFDGKLTILVNNVAILIPKETLKSDGQDFSNTIGTNLEASL  818
             VCDIL   QR+ L++ VS  F GKL ILVNN A    K+ + +  +D + T+GTN  +  
Sbjct  73    VCDILFHEQRKKLMETVSSIFQGKLNILVNNAAKPTSKKIIDNTDEDINTTLGTNFVSGY  132

Query  817   NLCQLAHPLLKATGNGsivfisscssfVYAPFHTIYAATKGGINSLVRNLACEWTNDNIR  638
             +LCQLAHPLLK +G GSIVF SS +     P  ++Y ATKG +N   +NLA EW  DNIR
Sbjct  133   HLCQLAHPLLKQSGYGSIVFTSSVAGLKAIPVLSVYTATKGAVNQFTKNLALEWAKDNIR  192

Query  637   VNAVAPWLMRTSLTESSRE---EFGAVIEALIGRTLQHRLVEPKEASAAVAFLCFPAASS  467
              NAVAP  ++TSL ES  +   E    I  ++ +T   R+ E KE SA VAF CFPAAS 
Sbjct  193   ANAVAPGPVKTSLLESVMDYDSEGYKAIAGIVSQTPTGRMGETKEISALVAFFCFPAASH  252

Query  466   ITGQIIRVDGG  434
             ITGQII +DGG
Sbjct  253   ITGQIIAIDGG  263



>ref|XP_010542627.1| PREDICTED: tropinone reductase homolog At1g07440-like isoform 
X1 [Tarenaya hassleriana]
Length=273

 Score =   259 bits (663),  Expect = 5e-80, Method: Compositional matrix adjust.
 Identities = 140/255 (55%), Positives = 181/255 (71%), Gaps = 5/255 (2%)
 Frame = -1

Query  1177  RWSLHGMTALVTGGTRGLGHAIVEELACLGATVYTCSRTEKELEECIQNWKAKGYKVFGS  998
             RWSL GMTALVTGGT+G+G+AIVEELA  GA V+TC+R +  L EC++ W+ KG++V GS
Sbjct  12    RWSLEGMTALVTGGTKGIGYAIVEELAGFGARVHTCARNQSLLNECLRKWQTKGFQVTGS  71

Query  997   VCDILQPSQRENLIQLVSKQFDGKLTILVNNVAILIPKETLKSDGQDFSNTIGTNLEASL  818
             VCD+   S+RE L+Q VS  FDGKL+IL+NNV   I K T +   +DFS  I TNLE++ 
Sbjct  72    VCDVSSRSEREKLMQTVSSTFDGKLSILINNVGTSIVKPTTEYTAEDFSFHITTNLESAY  131

Query  817   NLCQLAHPLLKATGNGsivfisscssfVYAPFHTIYAATKGGINSLVRNLACEWTNDNIR  638
             +L QLAHPLLKA+G+G+IVFISS +  V     +I  ATKG +N L RNLACEW +DNIR
Sbjct  132   HLSQLAHPLLKASGSGNIVFISSIAGIVSTSVGSICNATKGAVNQLARNLACEWASDNIR  191

Query  637   VNAVAPWLMRTSLTES--SREEFGAVIEALIGRTLQHRLVEPKEASAAVAFLCFPAASSI  464
             VN+VAP  + T + E+    + F   ++A+I R    R+ EP+E S+ V FLC PAAS I
Sbjct  192   VNSVAPGFIATPMAETVLGDDNF---LKAVISRKPLGRVGEPREVSSMVVFLCLPAASYI  248

Query  463   TGQIIRVDGGASVYG  419
             TGQ I VDGG ++ G
Sbjct  249   TGQTICVDGGLTING  263



>ref|XP_002308173.1| hypothetical protein POPTR_0006s09070g [Populus trichocarpa]
 gb|EEE91696.1| hypothetical protein POPTR_0006s09070g [Populus trichocarpa]
Length=267

 Score =   259 bits (662),  Expect = 6e-80, Method: Compositional matrix adjust.
 Identities = 139/250 (56%), Positives = 171/250 (68%), Gaps = 2/250 (1%)
 Frame = -1

Query  1177  RWSLHGMTALVTGGTRGLGHAIVEELACLGATVYTCSRTEKELEECIQNWKAKGYKVFGS  998
             RWSL GMTALVTGGTRG+G AIVEELA  GA VYTCSR EKEL E I+ W+ KG+ V GS
Sbjct  12    RWSLKGMTALVTGGTRGIGFAIVEELAGFGARVYTCSRNEKELNERIKEWEIKGFNVRGS  71

Query  997   VCDILQPSQRENLIQLVSKQFDGKLTILVNNVAILIPKETLKSDGQDFSNTIGTNLEASL  818
             VCD+     R+ LI  V+  FDGKL ILVNN A  I +++L    +D+S  + TNL++  
Sbjct  72    VCDLSSQDDRQKLIGSVTSAFDGKLNILVNNAATAILRKSLDYTLEDYSFIMNTNLQSPY  131

Query  817   NLCQLAHPLLKATGNGsivfisscssfVYAPFHTIYAATKGGINSLVRNLACEWTNDNIR  638
             +LCQLAHPLLKA+GNG+IVFISS +  V  P  ++Y+ATKG IN L RNLACEW  DNIR
Sbjct  132   HLCQLAHPLLKASGNGNIVFISSVAGIVALPMLSVYSATKGAINQLTRNLACEWAKDNIR  191

Query  637   VNAVAPWLMRTSL--TESSREEFGAVIEALIGRTLQHRLVEPKEASAAVAFLCFPAASSI  464
              N VAP  +RT++   +S+  + G     +  R    R+ EP E S+ V FLC P AS I
Sbjct  192   TNTVAPGGIRTTVGQDQSADPDVGEAYSDMFSRIPISRIGEPNEVSSLVVFLCLPTASYI  251

Query  463   TGQIIRVDGG  434
              GQ+I VDGG
Sbjct  252   NGQVICVDGG  261



>gb|KDO38494.1| hypothetical protein CISIN_1g024551mg [Citrus sinensis]
Length=266

 Score =   259 bits (662),  Expect = 6e-80, Method: Compositional matrix adjust.
 Identities = 137/250 (55%), Positives = 177/250 (71%), Gaps = 3/250 (1%)
 Frame = -1

Query  1177  RWSLHGMTALVTGGTRGLGHAIVEELACLGATVYTCSRTEKELEECIQNWKAKGYKVFGS  998
             +WSL GMTALVTGGTRG+G+AIVEELA  GA+V+TC R +  + E IQ W++KG+KV GS
Sbjct  13    KWSLRGMTALVTGGTRGIGYAIVEELARFGASVHTCGRDQNMINERIQEWESKGFKVTGS  72

Query  997   VCDILQPSQRENLIQLVSKQFDGKLTILVNNVAILIPKETLKSDGQDFSNTIGTNLEASL  818
             VCD+    QRE LI+ VS  FDGKL ILVNN A+++ K   +   +++S+ + TN+E+S 
Sbjct  73    VCDLSFGDQREKLIETVSSVFDGKLNILVNNAALVVMKRATEYTLEEYSSVMSTNVESSY  132

Query  817   NLCQLAHPLLKATGNGsivfisscssfVYAPFHTIYAATKGGINSLVRNLACEWTNDNIR  638
             +LCQLAHPLLKA+GN SIVF+SS +  +  P  + YAA+KG IN L +NLACEW  D+IR
Sbjct  133   HLCQLAHPLLKASGNASIVFMSSVAGAISIPRLSAYAASKGAINQLTKNLACEWATDSIR  192

Query  637   VNAVAPWLMRTSLTESSREEFGAVIE--ALIGRTLQHRLVEPKEASAAVAFLCFPAASSI  464
             VNAV+PW + T ++     +   V E   LI +T   R  EP E S  VAFLC PAAS I
Sbjct  193   VNAVSPWAVNTQISPPDLNDL-LVQEYVKLIAKTPLARSAEPNEISPLVAFLCLPAASYI  251

Query  463   TGQIIRVDGG  434
             TGQ+I +DGG
Sbjct  252   TGQVISIDGG  261



>ref|XP_003538423.1| PREDICTED: tropinone reductase homolog At1g07440 [Glycine max]
Length=270

 Score =   259 bits (662),  Expect = 6e-80, Method: Compositional matrix adjust.
 Identities = 133/253 (53%), Positives = 179/253 (71%), Gaps = 1/253 (0%)
 Frame = -1

Query  1177  RWSLHGMTALVTGGTRGLGHAIVEELACLGATVYTCSRTEKELEECIQNWKAKGYKVFGS  998
             RWSL+GMTALVTGGTRG+GH+IV +LA  GA V+TCSRT+ EL +C+Q W+++G++V GS
Sbjct  11    RWSLNGMTALVTGGTRGIGHSIVSDLAAFGAAVHTCSRTQTELNKCLQEWQSQGFQVTGS  70

Query  997   VCDILQPSQRENLIQLVSKQFDGKLTILVNNVAILIPKETLKSDGQDFSNTIGTNLEASL  818
             +CD+  P QRE LIQ V+  F+GKL I VNNV I I K T++   +++S  +  NL++S 
Sbjct  71    LCDVSSPPQREKLIQEVASTFNGKLNIYVNNVGINIRKPTIEYTAEEYSQIMTVNLDSSF  130

Query  817   NLCQLAHPLLKATGNGsivfisscssfVYAPFHTIYAATKGGINSLVRNLACEWTNDNIR  638
             +LCQLA+PLLKA+  GSIVFISS +  V      ++AA+K  IN L +NLAC+W  DNIR
Sbjct  131   HLCQLAYPLLKASEKGSIVFISSVAGVVSLGTGAVFAASKAAINQLTKNLACDWAKDNIR  190

Query  637   VNAVAPWLMRTSLTESSREEFGAVIEALIGRTLQHRLVEPKEASAAVAFLCFPAASSITG  458
              N V PW  RT + E   ++    ++ ++ RT   R+ EP+E S+ V FLC PAAS ITG
Sbjct  191   SNCVVPWATRTPVVEHLFKD-QKFVDDIMSRTPIKRIAEPEEVSSLVNFLCLPAASFITG  249

Query  457   QIIRVDGGASVYG  419
             Q+I VDGG +V G
Sbjct  250   QVICVDGGLTVNG  262



>ref|XP_006295594.1| hypothetical protein CARUB_v10024703mg [Capsella rubella]
 gb|EOA28492.1| hypothetical protein CARUB_v10024703mg [Capsella rubella]
Length=271

 Score =   259 bits (662),  Expect = 6e-80, Method: Compositional matrix adjust.
 Identities = 140/255 (55%), Positives = 178/255 (70%), Gaps = 5/255 (2%)
 Frame = -1

Query  1177  RWSLHGMTALVTGGTRGLGHAIVEELACLGATVYTCSRTEKELEECIQNWKAKGYKVFGS  998
             RWSL GMTALVTGG++G+G AIVEELA LGA V+TC+R E EL+E ++ W+ KG++V  S
Sbjct  13    RWSLRGMTALVTGGSKGIGEAIVEELAMLGARVHTCARDETELQESLRKWQEKGFQVTTS  72

Query  997   VCDILQPSQRENLIQLVSKQFDGKLTILVNNVAILIPKETLKSDGQDFSNTIGTNLEASL  818
             VCD+    QRE L++ VS  F GKL ILVNNV  +I K T+    +DFS TI TNLE++ 
Sbjct  73    VCDVSSRDQREKLMETVSSVFQGKLNILVNNVGAIIVKPTVMHTSEDFSFTIATNLESAF  132

Query  817   NLCQLAHPLLKATGNGsivfisscssfVYAPFHTIYAATKGGINSLVRNLACEWTNDNIR  638
             +L QLAHPLLKA+G+G+IV ISS S  V+    ++Y A+KG +N L RNLACEW +DNIR
Sbjct  133   HLSQLAHPLLKASGSGNIVLISSVSGVVHVTGASMYGASKGALNQLGRNLACEWASDNIR  192

Query  637   VNAVAPWLMRTSLTES--SREEFGAVIEALIGRTLQHRLVEPKEASAAVAFLCFPAASSI  464
             VN+V PW + T       S +EF   +E+   R    R+ EP E S+ VAFLC PAAS I
Sbjct  193   VNSVCPWFIATPFVNEVLSDKEFRNEVES---RPPMGRVGEPNEVSSLVAFLCLPAASYI  249

Query  463   TGQIIRVDGGASVYG  419
             TGQ I VDGG ++ G
Sbjct  250   TGQTICVDGGFTING  264



>ref|XP_007016314.1| NAD(P)-binding Rossmann-fold superfamily protein isoform 1 [Theobroma 
cacao]
 gb|EOY33933.1| NAD(P)-binding Rossmann-fold superfamily protein isoform 1 [Theobroma 
cacao]
Length=298

 Score =   260 bits (665),  Expect = 6e-80, Method: Compositional matrix adjust.
 Identities = 139/254 (55%), Positives = 175/254 (69%), Gaps = 1/254 (0%)
 Frame = -1

Query  1177  RWSLHGMTALVTGGTRGLGHAIVEELACLGATVYTCSRTEKELEECIQNWKAKGYKVFGS  998
             RWSLHGMTALVTGGT+G+GHAIVEELA LGA ++TCSRTE EL +C+  W+AKG++V GS
Sbjct  39    RWSLHGMTALVTGGTKGIGHAIVEELAGLGARIHTCSRTETELNKCLLEWQAKGFQVTGS  98

Query  997   VCDILQPSQRENLIQLVSKQFDGKLTILVNNVAILIPKETLKSDGQDFSNTIGTNLEASL  818
              CD+   +QRE LI   S  F+GKL IL+NNV  +  K   +   ++ S  +GTN E++ 
Sbjct  99    ACDVSSKAQREKLINTASSVFNGKLDILINNVGTVFAKPISEETAEEVSFLMGTNFESAH  158

Query  817   NLCQLAHPLLKATGNGsivfisscssfVYAPFHTIYAATKGGINSLVRNLACEWTNDNIR  638
             NL  LAHPLLKA+G GS+V +SS +  +       Y ATKG +N L + LACEW  DNIR
Sbjct  159   NLSLLAHPLLKASGAGSVVLLSSIAGLIPLRTAPTYGATKGAMNQLAKYLACEWAGDNIR  218

Query  637   VNAVAPWLMRTSLTESSREEFGAVIEALIGRTLQHRLVEPKEASAAVAFLCFPAASSITG  458
             VNAVAP ++RT L E    +  A +EA I +    R  EPKE S+ VAFLC PAAS ITG
Sbjct  219   VNAVAPSVIRTPLVEPFFHDEKA-LEAFITKIPMGRTGEPKEVSSLVAFLCLPAASYITG  277

Query  457   QIIRVDGGASVYGV  416
             QII VDGG ++ G+
Sbjct  278   QIIYVDGGITLNGL  291



>emb|CDX70101.1| BnaA10g24500D [Brassica napus]
Length=262

 Score =   259 bits (661),  Expect = 7e-80, Method: Compositional matrix adjust.
 Identities = 138/255 (54%), Positives = 177/255 (69%), Gaps = 5/255 (2%)
 Frame = -1

Query  1177  RWSLHGMTALVTGGTRGLGHAIVEELACLGATVYTCSRTEKELEECIQNWKAKGYKVFGS  998
             RWSL G TALVTGGTRG+G AIVEELA  GATV+TCSR ++EL+ C+ +W++ G    GS
Sbjct  6     RWSLAGKTALVTGGTRGIGRAIVEELARFGATVHTCSRNQEELKACLDDWRSNGLTESGS  65

Query  997   VCDILQPSQRENLIQLVSKQFDGKLTILVNNVAILIPKETLKSDGQDFSNTIGTNLEASL  818
             VCD     +RE L+Q VS  F GKL ILVNNV   + K T++   +D++  + TN E++ 
Sbjct  66    VCDASDRDEREKLMQQVSSAFSGKLNILVNNVGTNVWKPTVEYTSEDYAKVMSTNFESAF  125

Query  817   NLCQLAHPLLKATGNGsivfisscssfVYAPFHTIYAATKGGINSLVRNLACEWTNDNIR  638
             +  Q+AHPLLKA+G GSIVF+SS +  VYA    IY ATKG +N L RNLACEW  DNIR
Sbjct  126   HFSQIAHPLLKASGVGSIVFVSSVAGLVYASAGPIYGATKGALNQLTRNLACEWACDNIR  185

Query  637   VNAVAPWLMRTSLTESSRE--EFGAVIEALIGRTLQHRLVEPKEASAAVAFLCFPAASSI  464
              N+VAPW ++TS  E   E  EF   ++A++ RT   R+ EP+E ++ VAFLC PAAS I
Sbjct  186   TNSVAPWYIKTSFVEPVLENKEF---MDAVVNRTPLGRVGEPEEVASLVAFLCLPAASYI  242

Query  463   TGQIIRVDGGASVYG  419
             TGQ+I  DGG +V G
Sbjct  243   TGQVIVADGGFTVNG  257



>ref|XP_009375952.1| PREDICTED: tropinone reductase homolog At1g07440-like [Pyrus 
x bretschneideri]
Length=264

 Score =   259 bits (661),  Expect = 7e-80, Method: Compositional matrix adjust.
 Identities = 140/260 (54%), Positives = 178/260 (68%), Gaps = 3/260 (1%)
 Frame = -1

Query  1192  NIMAGRWSLHGMTALVTGGTRGLGHAIVEELACLGATVYTCSRTEKELEECIQNWKAKGY  1013
             N   GRW+L GMTALVTGGT+G+G+AIVEEL  LGA V+TCSR E +L +C+  W+ KG+
Sbjct  2     NSREGRWALPGMTALVTGGTKGIGYAIVEELVGLGALVHTCSRNEVDLNDCLSQWEKKGF  61

Query  1012  KVFGSVCDILQPSQRENLIQLVSKQFDGKLTILVNNVAILIPKETLKSDGQDFSNTIGTN  833
             +V GSVCD++  ++RE LI  VS  FDGKL IL+NNV  ++PK TL+   +D+S  + TN
Sbjct  62    QVTGSVCDVVSKTEREELINKVSSLFDGKLNILINNVGTVLPKATLEYTAEDYSFIMSTN  121

Query  832   LEASLNLCQLAHPLLKATGNGsivfisscssfVYAPFHTIYAATKGGINSLVRNLACEWT  653
             LE++ N  QL+HPLLKA    SIVF+SS +  V     +IY+A KG +N L +NLACEW 
Sbjct  122   LESAYNFLQLSHPLLKAAEAASIVFLSSTAGVVSINGASIYSAAKGAMNQLTKNLACEWA  181

Query  652   NDNIRVNAVAPWLMRTSLTESS-REEFGAVIEALIGRTLQHRLVEPKEASAAVAFLCFPA  476
              DNIR+N VAPW + T L E   R E    +E +  R    R  EPKE S+ VAFLC PA
Sbjct  182   KDNIRINNVAPWFITTPLVEPILRNE--KKLEMINSRCPLGRPGEPKEVSSLVAFLCLPA  239

Query  475   ASSITGQIIRVDGGASVYGV  416
             AS ITGQ I VDGG +V G+
Sbjct  240   ASYITGQTIIVDGGLTVNGL  259



>ref|NP_001149071.1| LOC100282692 [Zea mays]
 gb|ACG34080.1| tropinone reductase [Zea mays]
 tpg|DAA44601.1| TPA: tropinone reductase [Zea mays]
Length=273

 Score =   259 bits (662),  Expect = 8e-80, Method: Compositional matrix adjust.
 Identities = 142/265 (54%), Positives = 184/265 (69%), Gaps = 9/265 (3%)
 Frame = -1

Query  1183  AGRWSLHGMTALVTGGTRGLGHAIVEELACLGATVYTCSRTEKELEECIQNWKAKGYKVF  1004
             +GRW+LHG TALVTGGTRG+G A+VEELA LGA V+TCSR  +EL E I+ W+A+G+ V 
Sbjct  14    SGRWALHGKTALVTGGTRGIGRAVVEELAALGAAVHTCSRKAEELGERIKEWEARGFSVT  73

Query  1003  GSVCDILQPSQRENLIQLVSKQFDGKLTILVNNVAILIPKETLKSDGQDFSNTIGTNLEA  824
             GSVCD+ +  QRE L++ V+ +F GKL ILVNNV   I K T +   +++S  + TNLE+
Sbjct  74    GSVCDLSERDQRERLLREVADRFGGKLNILVNNVGTNIRKPTTEFTAEEYSFLMATNLES  133

Query  823   SLNLCQLAHPLLKATGNGsivfisscssfVYAPFHTIYAATKGGINSLVRNLACEWTNDN  644
             + +LCQ+AHPLLK +G+GSI+FISS +  +     TIYA TKG IN L +NLACEW  DN
Sbjct  134   AYHLCQIAHPLLKLSGSGSIIFISSVAGAIGIFSGTIYAMTKGAINQLTKNLACEWAKDN  193

Query  643   IRVNAVAPWLMRTSLTES--SREEFGAVIEALIGRTLQHRLVEPKEASAAVAFLCFPAAS  470
             IR N+VAPW + TSLTE   + + F    E ++ RT   R+ EP E SA VAFLC P ++
Sbjct  194   IRANSVAPWYITTSLTEGILANKNFE---EQVVSRTPLGRVGEPGEVSALVAFLCMPGST  250

Query  469   SITGQIIRVDGGASVYGV*TIIEPP  395
              I+GQ I VDGG +V G      PP
Sbjct  251   YISGQTIAVDGGMTVNG----FYPP  271



>ref|XP_010106548.1| hypothetical protein L484_025308 [Morus notabilis]
 gb|EXC10724.1| hypothetical protein L484_025308 [Morus notabilis]
Length=267

 Score =   259 bits (661),  Expect = 8e-80, Method: Compositional matrix adjust.
 Identities = 144/257 (56%), Positives = 169/257 (66%), Gaps = 6/257 (2%)
 Frame = -1

Query  1177  RWSLHGMTALVTGGTRGLGHAIVEELACLGATVYTCSRTEKELEECIQNWKAKGYKVFGS  998
             RWSL GMTALVTGG +G+G AIVEELA  GATVYTCSR E E+ E +  WK KG++V+GS
Sbjct  14    RWSLEGMTALVTGGIKGIGQAIVEELAGFGATVYTCSRNEVEINERLAEWKRKGFRVYGS  73

Query  997   VCDILQPSQRENLIQLVSKQFDGKLTILVNNV-AILIPKETLKSDGQDFSNTIGTNLEAS  821
             VCD+     R+ LI  VS  F+GKL ILVNNV A  +PK+TL+   +DFS  I TNLE++
Sbjct  74    VCDVASEEDRKELINKVSLVFNGKLNILVNNVGATCLPKKTLEHTAEDFSFLIKTNLESA  133

Query  820   LNLCQLAHPLLKATGNGsivfisscssfVYAPFHTIYAATKGGINSLVRNLACEWTNDNI  641
              N CQL HPLLKA+G  SIV ISS +S     F  I+   K G+N L RNLACEW  DNI
Sbjct  134   YNFCQLCHPLLKASGAASIVCISSAASVRTLSFEPIHGVAKAGMNQLARNLACEWAKDNI  193

Query  640   RVNAVAPWLMRTSLTES--SREEFGAVIEALIGRTLQHRLVEPKEASAAVAFLCFPAASS  467
             R NAV PW   T   E+  S E F   I   I RT   R+ +  E SA VAFLC PAAS 
Sbjct  194   RSNAVVPWQTFTPFAETLFSDESF---IRPCINRTPLGRVAQTNEVSALVAFLCLPAASY  250

Query  466   ITGQIIRVDGGASVYGV  416
             ITGQ I VDGG +  G+
Sbjct  251   ITGQAICVDGGFTALGI  267



>ref|XP_010452516.1| PREDICTED: tropinone reductase homolog At1g07440-like isoform 
X1 [Camelina sativa]
Length=261

 Score =   259 bits (661),  Expect = 8e-80, Method: Compositional matrix adjust.
 Identities = 139/253 (55%), Positives = 180/253 (71%), Gaps = 2/253 (1%)
 Frame = -1

Query  1177  RWSLHGMTALVTGGTRGLGHAIVEELACLGATVYTCSRTEKELEECIQNWKAKGYKVFGS  998
             RWSL G TAL+TGGTRG+G A+VEELA  GA V+TCSR + EL  C+ +WK+ G+ V GS
Sbjct  6     RWSLAGKTALLTGGTRGIGRAVVEELAKFGAKVHTCSRNQDELNACLDDWKSHGFVVSGS  65

Query  997   VCDILQPSQRENLIQLVSKQFDGKLTILVNNVAILIPKETLKSDGQDFSNTIGTNLEASL  818
             VCD     QR+ LIQ VS  F GKL IL+NNV   I K T++   +++++ + TNLE++ 
Sbjct  66    VCDASVKDQRDKLIQDVSSAFSGKLNILINNVGFNIRKPTVEYSSEEYASIMSTNLESAF  125

Query  817   NLCQLAHPLLKATGNGsivfisscssfVYAPFHTIYAATKGGINSLVRNLACEWTNDNIR  638
             +  Q+AHPLLKA+G G+IVFISS S  V     ++YAATKG +N L RNLACEW +DNIR
Sbjct  126   HFSQIAHPLLKASGVGNIVFISSVSGLVSCG-GSVYAATKGALNQLTRNLACEWASDNIR  184

Query  637   VNAVAPWLMRTSLTESSREEFGAVIEALIGRTLQHRLVEPKEASAAVAFLCFPAASSITG  458
              N VAPW ++TSL ES  E+    +EA++ RT   R+ EP+E ++ VAFLC PAAS ITG
Sbjct  185   TNCVAPWYIKTSLVESLLEK-QDYLEAVVSRTPLGRVGEPEEVASLVAFLCLPAASYITG  243

Query  457   QIIRVDGGASVYG  419
             Q+I VDGG +V G
Sbjct  244   QVISVDGGFTVNG  256



>ref|XP_011089796.1| PREDICTED: tropinone reductase homolog isoform X2 [Sesamum indicum]
Length=297

 Score =   260 bits (664),  Expect = 8e-80, Method: Compositional matrix adjust.
 Identities = 135/255 (53%), Positives = 182/255 (71%), Gaps = 5/255 (2%)
 Frame = -1

Query  1177  RWSLHGMTALVTGGTRGLGHAIVEELACLGATVYTCSRTEKELEECIQNWKAKGYKVFGS  998
             RWSLHG TALVTGGTRG+GHAIVEELA LGA V+TC+R++ EL++C++ W+ +G+ + GS
Sbjct  40    RWSLHGSTALVTGGTRGIGHAIVEELAGLGAAVHTCARSKDELDKCLRGWEDEGFGITGS  99

Query  997   VCDILQPSQRENLIQLVSKQFDGKLTILVNNVAILIPKETLKSDGQDFSNTIGTNLEASL  818
             VCD+   + RE L+  VS  F+ KL IL+NNV   I K  +    ++ S  +GTN E++ 
Sbjct  100   VCDVSSQADREKLLDSVSSIFNQKLNILINNVGTNIRKPMVDFTSEEVSMLMGTNFESAF  159

Query  817   NLCQLAHPLLKATGNGsivfisscssfVYAPFHTIYAATKGGINSLVRNLACEWTNDNIR  638
             ++CQLA+PLLKA+G GS+VF SS S FV   + +++ A+KG IN L +NLACEW  D IR
Sbjct  160   HMCQLAYPLLKASGAGSVVFTSSVSGFVSLKYMSVHGASKGAINQLTKNLACEWARDGIR  219

Query  637   VNAVAPWLMRTSLTES--SREEFGAVIEALIGRTLQHRLVEPKEASAAVAFLCFPAASSI  464
             VNAVAPW ++TS+ E   S +++   +E +  RT   RL +P E S+ VAFLC PA+S I
Sbjct  220   VNAVAPWYIKTSMVEQVLSNKKY---LEEVYDRTPMRRLGDPTEVSSMVAFLCLPASSFI  276

Query  463   TGQIIRVDGGASVYG  419
             TGQI+ VDGG SV G
Sbjct  277   TGQIVCVDGGMSVNG  291



>gb|ABW81126.1| short chain dehydrogenase-21 [Boechera divaricarpa]
Length=261

 Score =   259 bits (661),  Expect = 8e-80, Method: Compositional matrix adjust.
 Identities = 142/265 (54%), Positives = 183/265 (69%), Gaps = 9/265 (3%)
 Frame = -1

Query  1210  AKYQQHNIMAGRWSLHGMTALVTGGTRGLGHAIVEELACLGATVYTCSRTEKELEECIQN  1031
             AK +Q +    RWSL GMTALVTGGT+G+GHAI EELA LGAT++TC+R E +L +C++ 
Sbjct  2     AKAEQRS----RWSLQGMTALVTGGTKGIGHAISEELAGLGATIHTCARDESQLNQCLKE  57

Query  1030  WKAKGYKVFGSVCDILQPSQRENLIQLVSKQFDGKLTILVNNVAILIPKETLKSDGQDFS  851
             W+ KG+ V GSVCDI   + RE L+Q VS  F+GKL IL+NNV   + K T +S  +DFS
Sbjct  58    WQTKGFNVTGSVCDISSHTDREKLMQTVSSLFEGKLNILINNVGTCVTKPTTESTAEDFS  117

Query  850   NTIGTNLEASLNLCQLAHPLLKATGNGsivfisscssfVYAPFHTIYAATKGGINSLVRN  671
             + I TNLE++ +LCQLAHPLLK++G+GSIVFISS +  V     +IY+ATKG I  L R+
Sbjct  118   HQISTNLESAYHLCQLAHPLLKSSGSGSIVFISSAAGVVSCSVGSIYSATKGAICQLARS  177

Query  670   LACEWTNDNIRVNAVAPWLMRTSLTES--SREEFGAVIEALIGRTLQHRLVEPKEASAAV  497
             LACEW +DNIR N+VAP ++ T   ++    EEF   I   I      R  EP+E +A  
Sbjct  178   LACEWASDNIRANSVAPGVIATPTAKTFIQGEEFAKNIAPNIP---MRRAGEPEEVAAMT  234

Query  496   AFLCFPAASSITGQIIRVDGGASVY  422
             AFLC PAAS +TGQ I VDG  SV+
Sbjct  235   AFLCLPAASYVTGQTICVDGALSVH  259



>ref|XP_004150641.1| PREDICTED: tropinone reductase homolog At1g07440-like [Cucumis 
sativus]
 ref|XP_004172534.1| PREDICTED: tropinone reductase homolog At1g07440-like [Cucumis 
sativus]
 gb|KGN50576.1| hypothetical protein Csa_5G184270 [Cucumis sativus]
Length=273

 Score =   259 bits (662),  Expect = 8e-80, Method: Compositional matrix adjust.
 Identities = 140/253 (55%), Positives = 175/253 (69%), Gaps = 1/253 (0%)
 Frame = -1

Query  1177  RWSLHGMTALVTGGTRGLGHAIVEELACLGATVYTCSRTEKELEECIQNWKAKGYKVFGS  998
             RWSL G TALVTGGTRG+GHA+VEELA LGA+V+TC+R E +L +C++ W+AKGY V GS
Sbjct  12    RWSLEGFTALVTGGTRGIGHAVVEELAGLGASVHTCARNESDLNQCLKEWEAKGYVVTGS  71

Query  997   VCDILQPSQRENLIQLVSKQFDGKLTILVNNVAILIPKETLKSDGQDFSNTIGTNLEASL  818
             VCD    +QRE LIQ V+  F+G L ILVNNV   I K + +   ++ S  + TN E++ 
Sbjct  72    VCDASSRTQREELIQEVASSFNGTLNILVNNVGTNIRKPSAEYSLEEVSTLMTTNFESAF  131

Query  817   NLCQLAHPLLKATGNGsivfisscssfVYAPFHTIYAATKGGINSLVRNLACEWTNDNIR  638
             +L QL+HPLLKA+GNGSIVFISS    V     +IYAATK  IN L RNL CEW  DNIR
Sbjct  132   HLSQLSHPLLKASGNGSIVFISSVGGLVSIGSGSIYAATKSAINQLTRNLTCEWAKDNIR  191

Query  637   VNAVAPWLMRTSLTESSREEFGAVIEALIGRTLQHRLVEPKEASAAVAFLCFPAASSITG  458
             VN VAPW + T L E   +    +++ ++ RT   R+ E KE S+ VAFLC PAAS ITG
Sbjct  192   VNCVAPWYINTPLVEKLMKN-KTLVDNIVSRTPLGRIGESKEVSSLVAFLCLPAASYITG  250

Query  457   QIIRVDGGASVYG  419
             QI+ VDGG +  G
Sbjct  251   QIMSVDGGFTANG  263



>ref|XP_008442514.1| PREDICTED: tropinone reductase homolog [Cucumis melo]
Length=259

 Score =   258 bits (660),  Expect = 8e-80, Method: Compositional matrix adjust.
 Identities = 137/256 (54%), Positives = 179/256 (70%), Gaps = 7/256 (3%)
 Frame = -1

Query  1177  RWSLHGMTALVTGGTRGLGHAIVEELACLGATVYTCSRTEKELEECIQNWKAKGYKVFGS  998
             RWSL G TALVTGGTRG+G+AIVEELA LGA+V+TCSR + E+++ +Q W+ KG+KV  S
Sbjct  7     RWSLDGFTALVTGGTRGIGYAIVEELASLGASVHTCSRNQTEIDQRLQEWQQKGFKVTAS  66

Query  997   VCDILQPSQRENLIQLVSKQFDGKLTILVNNVAILIPKETLKSDGQDFSNTIGTNLEASL  818
             VCD+   SQR+ LI  VS  F+G L ILVNN   +  K   +   +D++  + TN EA  
Sbjct  67    VCDLTSSSQRQQLIDTVSSIFNGTLNILVNNAGTVTLKGATEYTTEDYNYMMSTNFEAPY  126

Query  817   NLCQLAHPLLKATGNGsivfisscssfVYAPFHTIYAATKGGINSLVRNLACEWTNDNIR  638
             +L Q++HP+LKA+G GSIVF+SS +     P  +IYAATKG IN + +NLACEW  DNIR
Sbjct  127   HLSQISHPILKASGYGSIVFVSSIAGVTALPKISIYAATKGAINQITKNLACEWAKDNIR  186

Query  637   VNAVAPWLMRTSLTESSR---EEFGAVIEALIGRTLQHRLVEPKEASAAVAFLCFPAASS  467
             VN VAPW +RT++++      EE+G     LIGRT   R+ EP+E S+ VAFLC PAAS 
Sbjct  187   VNTVAPWGVRTTISKPDAAVVEEYG----RLIGRTPAGRIGEPEEISSVVAFLCLPAASY  242

Query  466   ITGQIIRVDGGASVYG  419
             ++GQII VDGG +  G
Sbjct  243   VSGQIICVDGGFTAGG  258



>ref|XP_010228815.1| PREDICTED: tropinone reductase homolog At1g07440-like [Brachypodium 
distachyon]
Length=270

 Score =   259 bits (661),  Expect = 8e-80, Method: Compositional matrix adjust.
 Identities = 143/257 (56%), Positives = 179/257 (70%), Gaps = 5/257 (2%)
 Frame = -1

Query  1180  GRWSLHGMTALVTGGTRGLGHAIVEELACLGATVYTCSRTEKELEECIQNWKAKGYKVFG  1001
             GRWSLHG TALVTGGTRG+G A+VEELA LGA V+TCSR E EL E ++ W+AKG++V  
Sbjct  14    GRWSLHGKTALVTGGTRGIGRAVVEELAALGAAVHTCSRKESELGERLKEWEAKGFRVTT  73

Query  1000  SVCDILQPSQRENLIQLVSKQFDGKLTILVNNVAILIPKETLKSDGQDFSNTIGTNLEAS  821
             SVCD+    QR+ L   V+++F GKL ILVNNV   I K T +   +D+S  + TNLE+ 
Sbjct  74    SVCDLSVRDQRDRLAGEVAERFGGKLDILVNNVGTNIRKPTTEYSSEDYSFVMATNLESG  133

Query  820   LNLCQLAHPLLKATGNGsivfisscssfVYAPFHTIYAATKGGINSLVRNLACEWTNDNI  641
              +LCQLAHPLLKA+G+GSIVF+SS    V     TIYA TKG IN L +NLACEW  D I
Sbjct  134   YHLCQLAHPLLKASGSGSIVFVSSVCGVVAVFSGTIYAMTKGAINQLTKNLACEWAKDGI  193

Query  640   RVNAVAPWLMRTSLTES--SREEFGAVIEALIGRTLQHRLVEPKEASAAVAFLCFPAASS  467
             R N+VAPW + TSLTE   + +EF A   +++  T   R+ EP E S+ VAFLC P ++ 
Sbjct  194   RANSVAPWYITTSLTEGLLANKEFEA---SVVNCTPLRRVGEPGEVSSLVAFLCMPGSTY  250

Query  466   ITGQIIRVDGGASVYGV  416
             ITGQ I VDGG +V G+
Sbjct  251   ITGQTISVDGGMTVKGL  267



>ref|XP_006294815.1| hypothetical protein CARUB_v10023866mg [Capsella rubella]
 gb|ABW81154.1| TRL17 [Capsella rubella]
 gb|EOA27713.1| hypothetical protein CARUB_v10023866mg [Capsella rubella]
Length=263

 Score =   259 bits (661),  Expect = 9e-80, Method: Compositional matrix adjust.
 Identities = 135/256 (53%), Positives = 179/256 (70%), Gaps = 1/256 (0%)
 Frame = -1

Query  1186  MAGRWSLHGMTALVTGGTRGLGHAIVEELACLGATVYTCSRTEKELEECIQNWKAKGYKV  1007
             M  RWSL GMTALVTGGT+G+G A+VEEL+ LGA V+TC+R E +L+E ++ W+AKG++V
Sbjct  1     MDKRWSLQGMTALVTGGTKGIGEAVVEELSMLGARVHTCARDETQLQERLREWQAKGFQV  60

Query  1006  FGSVCDILQPSQRENLIQLVSKQFDGKLTILVNNVAILIPKETLKSDGQDFSNTIGTNLE  827
               S CD+    QRE L++ VS  F GKL ILVNNV   I K T +  G+++S  + TNLE
Sbjct  61    STSTCDVTSREQREKLMETVSSLFQGKLNILVNNVGTFIVKPTTEYTGEEYSLIMATNLE  120

Query  826   ASLNLCQLAHPLLKATGNGsivfisscssfVYAPFHTIYAATKGGINSLVRNLACEWTND  647
             ++ +L QL+HPLLKA+G+GSIV +SS +  V+A   +IY  TKG +N L RNLACEW  D
Sbjct  121   SAFHLSQLSHPLLKASGSGSIVLMSSIAGLVHANVGSIYGITKGAMNQLARNLACEWARD  180

Query  646   NIRVNAVAPWLMRTSLTESSREEFGAVIEALIGRTLQHRLVEPKEASAAVAFLCFPAASS  467
             +IR NAV PW + T L     +E G +I+ ++ RT   R+ EP E ++ VAFLC PAAS 
Sbjct  181   SIRTNAVCPWYIATPLVNDLLKE-GEIIKEVVSRTPLGRVGEPNEVASLVAFLCLPAASY  239

Query  466   ITGQIIRVDGGASVYG  419
             ITGQ I +DGG +V G
Sbjct  240   ITGQSICIDGGLTVNG  255



>ref|XP_004291519.1| PREDICTED: tropinone reductase homolog At1g07440-like [Fragaria 
vesca subsp. vesca]
Length=264

 Score =   259 bits (661),  Expect = 9e-80, Method: Compositional matrix adjust.
 Identities = 142/258 (55%), Positives = 177/258 (69%), Gaps = 8/258 (3%)
 Frame = -1

Query  1177  RWSLHGMTALVTGGTRGLGHAIVEELACLGATVYTCSRTEKELEECIQNWKAKG-YKVFG  1001
             RWSL GMTALVTGGT+G+G+AIVEELA LGA V+TCSR E +L EC+  WK KG ++V G
Sbjct  9     RWSLEGMTALVTGGTKGIGYAIVEELAGLGARVHTCSRNEAQLHECLSQWKKKGLHQVTG  68

Query  1000  SVCDILQPSQRENLIQLVSKQFDGKLTILVNNVAIL-IPKETLKSDGQDFSNTIGTNLEA  824
             SVCD++    RE LI  VS  F GKL IL+NNV      K T +   +++S  I TNLE+
Sbjct  69    SVCDVVSKIHREELIHRVSSLFHGKLNILINNVGTTHKTKPTTEYTSEEYSFIISTNLES  128

Query  823   SLNLCQLAHPLLKATGNGsivfisscs-sfVYAPFHTIYAATKGGINSLVRNLACEWTND  647
             + N+CQLA PLLKA+  G+I+ +SS +         +IY ATKG +N L +NLACEW  D
Sbjct  129   TYNMCQLAQPLLKASSAGNIILLSSVAGVVSIGKVGSIYGATKGAMNQLAKNLACEWAKD  188

Query  646   NIRVNAVAPWLMRTSLTES--SREEFGAVIEALIGRTLQHRLVEPKEASAAVAFLCFPAA  473
             NIR+N+VAPW +RT L E   S E+F    EA+I RT   R+ EP+E SA VAFLC PAA
Sbjct  189   NIRINSVAPWFIRTPLVEPLLSDEKFS---EAVISRTPLERIGEPEEVSALVAFLCLPAA  245

Query  472   SSITGQIIRVDGGASVYG  419
             S ITGQ I VDGG ++ G
Sbjct  246   SYITGQTICVDGGMTING  263



>gb|KCW49544.1| hypothetical protein EUGRSUZ_K03064 [Eucalyptus grandis]
Length=263

 Score =   259 bits (661),  Expect = 9e-80, Method: Compositional matrix adjust.
 Identities = 137/251 (55%), Positives = 177/251 (71%), Gaps = 1/251 (0%)
 Frame = -1

Query  1177  RWSLHGMTALVTGGTRGLGHAIVEELACLGATVYTCSRTEKELEECIQNWKAKGYKVFGS  998
             RWSL G TALVTGGTRG+G+AIV ELA LGA+V+TCSR EKEL E ++ W+ KG +V GS
Sbjct  12    RWSLKGKTALVTGGTRGIGYAIVAELAGLGASVHTCSRNEKELNERVEEWRGKGLQVSGS  71

Query  997   VCDILQPSQRENLIQLVSKQFDGKLTILVNNVAILIPKETLKSDGQDFSNTIGTNLEASL  818
             VCD+   +Q+E L++ VS  FDGKL ILVNN A ++ K  L    +D S  +  NLE+  
Sbjct  72    VCDLTCNTQKEALVKTVSSVFDGKLNILVNNAATVVLKGVLDHTLEDCSYVLKANLESPY  131

Query  817   NLCQLAHPLLKATGNGsivfisscssfVYAPFHTIYAATKGGINSLVRNLACEWTNDNIR  638
             +LCQLAHPLLKA+G+G+IVF+SS +  V  P  +IY+A+KG IN L +NLACEW  DNIR
Sbjct  132   HLCQLAHPLLKASGDGNIVFLSSIAGEVALPALSIYSASKGAINQLTKNLACEWAKDNIR  191

Query  637   VNAVAPWLMRTSLTESSREEFGAVIEALIGRTLQHRLVEPKEASAAVAFLCFPAASSITG  458
             +N VAP  ++T++ +    E       ++ R   HRL EP E S+ VAFLC PAAS +TG
Sbjct  192   INTVAPGPVKTTIAK-PEPEIKEKFLKMLARMPLHRLGEPNEISSVVAFLCLPAASYVTG  250

Query  457   QIIRVDGGASV  425
             Q+I VDGG +V
Sbjct  251   QVISVDGGYTV  261



>ref|XP_011089795.1| PREDICTED: tropinone reductase homolog isoform X1 [Sesamum indicum]
Length=316

 Score =   260 bits (665),  Expect = 9e-80, Method: Compositional matrix adjust.
 Identities = 135/255 (53%), Positives = 182/255 (71%), Gaps = 5/255 (2%)
 Frame = -1

Query  1177  RWSLHGMTALVTGGTRGLGHAIVEELACLGATVYTCSRTEKELEECIQNWKAKGYKVFGS  998
             RWSLHG TALVTGGTRG+GHAIVEELA LGA V+TC+R++ EL++C++ W+ +G+ + GS
Sbjct  59    RWSLHGSTALVTGGTRGIGHAIVEELAGLGAAVHTCARSKDELDKCLRGWEDEGFGITGS  118

Query  997   VCDILQPSQRENLIQLVSKQFDGKLTILVNNVAILIPKETLKSDGQDFSNTIGTNLEASL  818
             VCD+   + RE L+  VS  F+ KL IL+NNV   I K  +    ++ S  +GTN E++ 
Sbjct  119   VCDVSSQADREKLLDSVSSIFNQKLNILINNVGTNIRKPMVDFTSEEVSMLMGTNFESAF  178

Query  817   NLCQLAHPLLKATGNGsivfisscssfVYAPFHTIYAATKGGINSLVRNLACEWTNDNIR  638
             ++CQLA+PLLKA+G GS+VF SS S FV   + +++ A+KG IN L +NLACEW  D IR
Sbjct  179   HMCQLAYPLLKASGAGSVVFTSSVSGFVSLKYMSVHGASKGAINQLTKNLACEWARDGIR  238

Query  637   VNAVAPWLMRTSLTES--SREEFGAVIEALIGRTLQHRLVEPKEASAAVAFLCFPAASSI  464
             VNAVAPW ++TS+ E   S +++   +E +  RT   RL +P E S+ VAFLC PA+S I
Sbjct  239   VNAVAPWYIKTSMVEQVLSNKKY---LEEVYDRTPMRRLGDPTEVSSMVAFLCLPASSFI  295

Query  463   TGQIIRVDGGASVYG  419
             TGQI+ VDGG SV G
Sbjct  296   TGQIVCVDGGMSVNG  310



>ref|XP_010414423.1| PREDICTED: tropinone reductase homolog At1g07440-like [Camelina 
sativa]
Length=272

 Score =   259 bits (661),  Expect = 9e-80, Method: Compositional matrix adjust.
 Identities = 142/263 (54%), Positives = 179/263 (68%), Gaps = 7/263 (3%)
 Frame = -1

Query  1177  RWSLHGMTALVTGGTRGLGHAIVEELACLGATVYTCSRTEKELEECIQNWKAKGYKVFGS  998
             RWSL GMTALVTGG++GLG A+VEELA LGA V+TC+R E +L+E ++ W  KG++V  S
Sbjct  14    RWSLGGMTALVTGGSKGLGEAVVEELAMLGARVHTCARDETQLQERLREWHEKGFQVSIS  73

Query  997   VCDILQPSQRENLIQLVSKQFDGKLTILVNNVAILIPKETLKSDGQDFSNTIGTNLEASL  818
             VCD+    QRE L++ VS  F GKL ILVNN    I K T +   QD+S  + TNLE++ 
Sbjct  74    VCDVSSRDQREKLMETVSTLFQGKLNILVNNAGTCIAKPTTEYTSQDYSFLMATNLESAF  133

Query  817   NLCQLAHPLLKATGNGsivfisscssfVYAPFHTIYAATKGGINSLVRNLACEWTNDNIR  638
             +L QLAHPLLKA+G+GSIV +SS +  V+    +IYAATKG +N L RNLACEW ND IR
Sbjct  134   HLSQLAHPLLKASGSGSIVLMSSAAGVVHVNISSIYAATKGAMNQLGRNLACEWANDKIR  193

Query  637   VNAVAPWLMRTSLTES--SREEFGAVIEALIGRTLQHRLVEPKEASAAVAFLCFPAASSI  464
             VN+V PW + T L +     EE+   +E    +T   R  +P E S+ VAFLCFPAAS I
Sbjct  194   VNSVCPWFIDTPLAKDYLDDEEYKDEVEK---KTPMGRAGKPNEVSSLVAFLCFPAASYI  250

Query  463   TGQIIRVDGGASVYGV*TIIEPP  395
             TGQ I VDGGA+V G     +PP
Sbjct  251   TGQTICVDGGATVNGF--SFKPP  271



>gb|EAY89400.1| hypothetical protein OsI_10905 [Oryza sativa Indica Group]
Length=277

 Score =   259 bits (662),  Expect = 9e-80, Method: Compositional matrix adjust.
 Identities = 139/250 (56%), Positives = 179/250 (72%), Gaps = 5/250 (2%)
 Frame = -1

Query  1177  RWSLHGMTALVTGGTRGLGHAIVEELACLGATVYTCSRTEKELEECIQNWKAKGYKVFGS  998
             RWSL G TALVTGGTRG+G A+VEELA LGATV+TCSR E+EL E ++ W+A+G++V  S
Sbjct  16    RWSLQGKTALVTGGTRGIGRAVVEELAALGATVHTCSRKEEELSERLKEWEARGFRVTTS  75

Query  997   VCDILQPSQRENLIQLVSKQFDGKLTILVNNVAILIPKETLKSDGQDFSNTIGTNLEASL  818
             VCD+    QRE L++ V+  F GKL ILVNNV   I K T +   +++S  + TNLE++ 
Sbjct  76    VCDLSVRDQRERLLRQVADLFGGKLDILVNNVGTNIRKPTTEFSAEEYSFMMATNLESAY  135

Query  817   NLCQLAHPLLKATGNGsivfisscssfVYAPFHTIYAATKGGINSLVRNLACEWTNDNIR  638
             +LCQL+HPLLKA+G+GSIVFISS    V     ++YA TKG IN L +NLACEW  DNIR
Sbjct  136   HLCQLSHPLLKASGSGSIVFISSVCGLVAVFSGSLYAMTKGAINQLTKNLACEWARDNIR  195

Query  637   VNAVAPWLMRTSLTES--SREEFGAVIEALIGRTLQHRLVEPKEASAAVAFLCFPAASSI  464
              N++APW +RTSLTE   + ++F     A++ RT   R+ EP+E S+ VAFLC P +S I
Sbjct  196   SNSIAPWYIRTSLTEGLLANKDFEG---AVVSRTPLRRVGEPEEVSSLVAFLCMPGSSYI  252

Query  463   TGQIIRVDGG  434
             TGQ I VDGG
Sbjct  253   TGQTISVDGG  262



>ref|XP_003552193.1| PREDICTED: tropinone reductase homolog isoform 1 [Glycine max]
Length=264

 Score =   258 bits (660),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 136/250 (54%), Positives = 173/250 (69%), Gaps = 2/250 (1%)
 Frame = -1

Query  1177  RWSLHGMTALVTGGTRGLGHAIVEELACLGATVYTCSRTEKELEECIQNWKAKGYKVFGS  998
             RWSLHGMTALVTGGTRG+GHAIVEELA  GATV+ C+R + ++++C++ WK+KG  V GS
Sbjct  12    RWSLHGMTALVTGGTRGIGHAIVEELAEFGATVHICARNQDDIDKCLEEWKSKGLNVTGS  71

Query  997   VCDILQPSQRENLIQLVSKQFDGKLTILVNNVAILIPKETLKSDGQDFSNTIGTNLEASL  818
             VCD+L   QR+ L+++V   F GKL ILVNN A  I K+      +D S  +GTN E+  
Sbjct  72    VCDLLCSDQRKRLMEIVGSIFHGKLNILVNNAATNITKKITDYTAEDISAIMGTNFESVY  131

Query  817   NLCQLAHPLLKATGNGsivfisscssfVYAPFHTIYAATKGGINSLVRNLACEWTNDNIR  638
             +LCQ+AHPLLK +GNGSIVFISS +     P  ++YAA+KG +N   +NLA EW  DNIR
Sbjct  132   HLCQVAHPLLKDSGNGSIVFISSVAGLKALPVFSVYAASKGAMNQFTKNLALEWAKDNIR  191

Query  637   VNAVAPWLMRTSLTES--SREEFGAVIEALIGRTLQHRLVEPKEASAAVAFLCFPAASSI  464
              NAVAP  ++T L E   +  E    I  ++ +T   R+ E KE SA VAFLC PAAS I
Sbjct  192   ANAVAPGPVKTKLLECIVNSSEGNESINGVVSQTFVGRMGETKEISALVAFLCLPAASYI  251

Query  463   TGQIIRVDGG  434
             TGQ+I VDGG
Sbjct  252   TGQVICVDGG  261



>gb|ABW81158.1| TRL13 [Capsella rubella]
Length=313

 Score =   260 bits (664),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 146/282 (52%), Positives = 187/282 (66%), Gaps = 9/282 (3%)
 Frame = -1

Query  1258  LRFADHQSSKSKLAKNAKYQQHNIMAGRWSLHGMTALVTGGTRGLGHAIVEELACLGATV  1079
             ++    QSS S +      Q     + RWSL G +ALVTGGTRG+G AIVEELA LGA V
Sbjct  33    IKLQTQQSSASSVHVRCATQS----SERWSLQGKSALVTGGTRGIGRAIVEELAGLGAKV  88

Query  1078  YTCSRTEKELEECIQNWKAKGYKVFGSVCDILQPSQRENLIQLVSKQFDGKLTILVNNVA  899
             +TC+R E ELE C+++W + G ++ GSVCD+    QRE L++ VS  FDGKL ILVNNV 
Sbjct  89    HTCARNESELENCLRDWNSSGLRIAGSVCDVSDRGQREALMETVSSVFDGKLHILVNNVG  148

Query  898   ILIPKETLKSDGQDFSNTIGTNLEASLNLCQLAHPLLKATGNGsivfisscssfVYAPFH  719
               I K  ++    +FS  + TN E+  NLCQLA+PLL+A+  GS V ISS S FV     
Sbjct  149   TNIRKPMVEFTAGEFSTLMSTNFESVFNLCQLAYPLLRASEAGSAVSISSVSGFVSLKNM  208

Query  718   TIYAATKGGINSLVRNLACEWTNDNIRVNAVAPWLMRTSLTES--SREEFGAVIEALIGR  545
             ++ +ATKG IN L R+LACEW  DNIRVNAVAPW ++TS+ E   S +++   +E +   
Sbjct  209   SVQSATKGAINQLTRSLACEWAKDNIRVNAVAPWYIKTSMVEQVLSNKDY---LEEVYSI  265

Query  544   TLQHRLVEPKEASAAVAFLCFPAASSITGQIIRVDGGASVYG  419
             T   RL EP+E S+AVAFLC PA+S ITGQII VDGG S+ G
Sbjct  266   TPLGRLGEPREVSSAVAFLCLPASSYITGQIICVDGGMSING  307



>ref|XP_010557240.1| PREDICTED: tropinone reductase homolog At1g07440 [Tarenaya hassleriana]
Length=319

 Score =   260 bits (665),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 139/255 (55%), Positives = 179/255 (70%), Gaps = 5/255 (2%)
 Frame = -1

Query  1177  RWSLHGMTALVTGGTRGLGHAIVEELACLGATVYTCSRTEKELEECIQNWKAKGYKVFGS  998
             RWSLHGM+ALVTGGTRG+G A+VEELA  GA V+TC+R E ELE C+++    G++V GS
Sbjct  63    RWSLHGMSALVTGGTRGIGRAVVEELAGFGAEVHTCARNESELENCLRDLNGSGFRVTGS  122

Query  997   VCDILQPSQRENLIQLVSKQFDGKLTILVNNVAILIPKETLKSDGQDFSNTIGTNLEASL  818
             VCD+    QR  L++ VS  FDGKL ILVNNV   I K  ++    +FS  + TN E+  
Sbjct  123   VCDVSDRDQRVMLMEAVSSVFDGKLNILVNNVGTNIRKPMVEFTAGEFSTLLSTNFESVF  182

Query  817   NLCQLAHPLLKATGNGsivfisscssfVYAPFHTIYAATKGGINSLVRNLACEWTNDNIR  638
             +LCQL++PLL+A+G GS+VFISS S FV     ++ +ATKG IN L RNLACEW  DNIR
Sbjct  183   HLCQLSYPLLRASGAGSVVFISSISGFVSLKNMSVQSATKGAINQLTRNLACEWAKDNIR  242

Query  637   VNAVAPWLMRTSLTES--SREEFGAVIEALIGRTLQHRLVEPKEASAAVAFLCFPAASSI  464
              NAVAPW +RTS+ E     E++   +E +  RT   RL EP+E ++AVAFLC PA+S I
Sbjct  243   SNAVAPWYIRTSMVEQILINEDY---LEEVYSRTPLRRLGEPREVASAVAFLCLPASSFI  299

Query  463   TGQIIRVDGGASVYG  419
             TGQ+I +DGG S+ G
Sbjct  300   TGQVIGIDGGMSING  314



>gb|KEH22981.1| NAD(P)-binding rossmann-fold protein [Medicago truncatula]
Length=266

 Score =   258 bits (659),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 134/254 (53%), Positives = 175/254 (69%), Gaps = 3/254 (1%)
 Frame = -1

Query  1177  RWSLHGMTALVTGGTRGLGHAIVEELACLGATVYTCSRTEKELEECIQNWKAKGYKVFGS  998
             RWSL GMTALVTGGTRG+G+AIVEELA  GA+V+ C+R ++++ +C++ WK KG+ V GS
Sbjct  13    RWSLQGMTALVTGGTRGIGYAIVEELAEFGASVHICARNQEDINKCLEEWKGKGFCVTGS  72

Query  997   VCDILQPSQRENLIQLVSKQFDGKLTILVNNVAILIPKETLKSDGQDFSNTIGTNLEASL  818
              CD+L   QR+ L++ V+  FDGKL ILVNN  I  PK  +    +D + TIGTN  +  
Sbjct  73    TCDLLFHDQRQKLMETVALVFDGKLNILVNNAGIFTPKPIMDYTDEDITTTIGTNFVSGY  132

Query  817   NLCQLAHPLLKATGNGsivfisscssfVYAPFHTIYAATKGGINSLVRNLACEWTNDNIR  638
             +LCQLAHPLLK +GNGSIVFISS +     PF ++YAA+KG +N   +NLA EW  DNIR
Sbjct  133   HLCQLAHPLLKQSGNGSIVFISSIAGLKAWPFASVYAASKGAMNQCAKNLALEWAKDNIR  192

Query  637   VNAVAPWLMRTSLTESSREEFGA---VIEALIGRTLQHRLVEPKEASAAVAFLCFPAASS  467
              N VAP  + T L E++ +  G    V+E ++  T   R+ EPK+ S  VAFLC PAAS 
Sbjct  193   ANVVAPGAVMTILFENAAKLAGRVDNVVEDMVSLTPSGRIGEPKDISGLVAFLCLPAASH  252

Query  466   ITGQIIRVDGGASV  425
             ITGQII  DGG ++
Sbjct  253   ITGQIIAADGGFTI  266



>ref|XP_006649826.1| PREDICTED: tropinone reductase homolog At1g07440-like isoform 
X1 [Oryza brachyantha]
Length=271

 Score =   258 bits (660),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 139/257 (54%), Positives = 182/257 (71%), Gaps = 5/257 (2%)
 Frame = -1

Query  1180  GRWSLHGMTALVTGGTRGLGHAIVEELACLGATVYTCSRTEKELEECIQNWKAKGYKVFG  1001
             GRWSL G TAL+TGGTRG+G A+VEELA LGA V+TCSR E EL E ++ W+A+G++V  
Sbjct  15    GRWSLQGKTALITGGTRGIGRAVVEELAALGAIVHTCSRKEAELGERLREWEARGFRVTT  74

Query  1000  SVCDILQPSQRENLIQLVSKQFDGKLTILVNNVAILIPKETLKSDGQDFSNTIGTNLEAS  821
             SVCD+    QRE L++ V+  F GKL ILVNNV   I K T +   +++S  + TNLE++
Sbjct  75    SVCDLSVRDQRERLLRQVADLFGGKLDILVNNVGTNIRKPTTEFSAEEYSFMMATNLESA  134

Query  820   LNLCQLAHPLLKATGNGsivfisscssfVYAPFHTIYAATKGGINSLVRNLACEWTNDNI  641
              +LCQL+HPLLKA+G+G+IVFISS    V     ++YA TKG IN L +NLACEW  DNI
Sbjct  135   YHLCQLSHPLLKASGSGNIVFISSVCGLVAVFSGSLYAMTKGAINQLTKNLACEWARDNI  194

Query  640   RVNAVAPWLMRTSLTES--SREEFGAVIEALIGRTLQHRLVEPKEASAAVAFLCFPAASS  467
             R N+VAPW +RTSLT+   + +EF    + ++ RT   R+ EP+E S+ VAFLC P +S 
Sbjct  195   RTNSVAPWYIRTSLTQGLLANKEFE---DTVVNRTPLKRVGEPEEVSSLVAFLCMPGSSY  251

Query  466   ITGQIIRVDGGASVYGV  416
             ITGQ I VDGG +V G+
Sbjct  252   ITGQTISVDGGMTVNGL  268



>gb|ABW81146.1| TRL26 [Capsella rubella]
Length=271

 Score =   258 bits (660),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 139/255 (55%), Positives = 178/255 (70%), Gaps = 5/255 (2%)
 Frame = -1

Query  1177  RWSLHGMTALVTGGTRGLGHAIVEELACLGATVYTCSRTEKELEECIQNWKAKGYKVFGS  998
             RWSL GMTALVTGG++G+G AIVEELA LGA V+TC+R E EL+E ++ W+ KG++V  S
Sbjct  13    RWSLRGMTALVTGGSKGIGEAIVEELAMLGARVHTCARDETELQESLRKWQEKGFQVTTS  72

Query  997   VCDILQPSQRENLIQLVSKQFDGKLTILVNNVAILIPKETLKSDGQDFSNTIGTNLEASL  818
             VCD+    QRE L++ VS  F GKL ILVNNV  +I K T+    +DFS T+ TNLE++ 
Sbjct  73    VCDVSSRDQREKLMETVSSVFQGKLNILVNNVGAIIVKPTVMHTSEDFSFTMATNLESAF  132

Query  817   NLCQLAHPLLKATGNGsivfisscssfVYAPFHTIYAATKGGINSLVRNLACEWTNDNIR  638
             +L QLAHPLLKA+G+G+IV ISS S  V+    ++Y A+KG +N L RNLACEW +DNIR
Sbjct  133   HLSQLAHPLLKASGSGNIVLISSVSGVVHVTGASMYGASKGALNQLGRNLACEWASDNIR  192

Query  637   VNAVAPWLMRTSLTES--SREEFGAVIEALIGRTLQHRLVEPKEASAAVAFLCFPAASSI  464
             VN+V PW + T       S +EF   +E+   R    R+ EP E S+ VAFLC PAAS I
Sbjct  193   VNSVCPWFIATPFVNEVLSDKEFRNEVES---RPPMGRVGEPNEVSSLVAFLCLPAASYI  249

Query  463   TGQIIRVDGGASVYG  419
             TGQ I VDGG ++ G
Sbjct  250   TGQTICVDGGFTING  264



>ref|XP_011023544.1| PREDICTED: tropinone reductase homolog At1g07440-like isoform 
X1 [Populus euphratica]
Length=267

 Score =   258 bits (659),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 138/254 (54%), Positives = 180/254 (71%), Gaps = 2/254 (1%)
 Frame = -1

Query  1177  RWSLHGMTALVTGGTRGLGHAIVEELACLGATVYTCSRTEKELEECIQNWKAKGYKVFGS  998
             RW L G++ALVTGGT+GLG AIVEELA LGA V+TC+R + +L E ++ WK KG+KV GS
Sbjct  11    RWGLQGISALVTGGTKGLGCAIVEELAALGAIVHTCARNQDQLNERVREWKEKGFKVTGS  70

Query  997   VCDILQPSQRENLIQLVSKQFDGKLTILVNNVAILIPKETLKSDGQDFSNTIGTNLEASL  818
             VCD+   ++RE L++ VS  FDGKL ILVNN    I K TL    +DF++ + TNL+++ 
Sbjct  71    VCDVSSNAEREKLMKEVSSLFDGKLNILVNNAGTNIYKATLDYTAEDFTSLMNTNLQSAF  130

Query  817   NLCQLAHPLLKATGNGsivfisscssfVYAPF-HTIYAATKGGINSLVRNLACEWTNDNI  641
             +L QLAHPLLKA+G G IVF+SS SS V     + +Y+A+KG +N L RNLACEW  DNI
Sbjct  131   HLSQLAHPLLKASGAGKIVFMSSISSVVSINTQYPLYSASKGAMNQLTRNLACEWAQDNI  190

Query  640   RVNAVAPWLMRTSLTESSREEFGAVIEALIGRTLQHRLVEPKEASAAVAFLCFPAASSIT  461
             RVNAVAPW +RT LT  S ++   +++ +  RT   R+ EP E S+ VAFLC PA   +T
Sbjct  191   RVNAVAPWFIRTPLTTPSLDDEN-ILKEVFNRTPMRRVGEPGEVSSVVAFLCLPAPGFLT  249

Query  460   GQIIRVDGGASVYG  419
             GQ+I +DGG SV G
Sbjct  250   GQVICIDGGMSVNG  263



>ref|XP_007206734.1| hypothetical protein PRUPE_ppa024823mg [Prunus persica]
 gb|EMJ07933.1| hypothetical protein PRUPE_ppa024823mg [Prunus persica]
Length=267

 Score =   258 bits (659),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 142/257 (55%), Positives = 179/257 (70%), Gaps = 7/257 (3%)
 Frame = -1

Query  1177  RWSLHGMTALVTGGTRGLGHAIVEELACLGATVYTCSRTEKELEECIQNWKAKGY-KVFG  1001
             RWSL GMTALVTGGT+G+GHAIVEEL+ LGA+V+TC+R + +L +C+  WK KG+ +V G
Sbjct  9     RWSLQGMTALVTGGTKGMGHAIVEELSGLGASVHTCARNQNQLNDCLNQWKTKGFHQVTG  68

Query  1000  SVCDILQPSQRENLIQLVSKQFDGKLTILVNNVAILIPKETLKSDGQDFSNTIGTNLEAS  821
             SVCD+   +QR  LI  VS QF+GKL IL+NNV     K TL    +DF+    TNLE+S
Sbjct  69    SVCDLSSRAQRHELINEVSSQFNGKLNILINNVGTTEAKATLDCTAEDFAFVTSTNLESS  128

Query  820   LNLCQLAHPLLKATGNGsivfisscs-sfVYAPFHTIYAATKGGINSLVRNLACEWTNDN  644
              +L QLAHPLLKA G G+IVFISS + S   A   +IYAATKG +N L R+ ACEW  DN
Sbjct  129   YHLSQLAHPLLKAAGAGNIVFISSVAGSVSVAGIGSIYAATKGAVNQLARSFACEWGKDN  188

Query  643   IRVNAVAPWLMRTSLTES--SREEFGAVIEALIGRTLQHRLVEPKEASAAVAFLCFPAAS  470
             IRVN+VAPW ++TSL+    + E+F   + +   RT   R  EP+E +A V+FLC PAAS
Sbjct  189   IRVNSVAPWFIKTSLSVDFLNNEQFSNAVNS---RTPLGRPGEPEEVAALVSFLCLPAAS  245

Query  469   SITGQIIRVDGGASVYG  419
              ITGQ I  DGG +V G
Sbjct  246   YITGQTICADGGMTVNG  262



>ref|XP_010067435.1| PREDICTED: tropinone reductase homolog At1g07440-like isoform 
X1 [Eucalyptus grandis]
Length=271

 Score =   258 bits (659),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 136/262 (52%), Positives = 178/262 (68%), Gaps = 5/262 (2%)
 Frame = -1

Query  1198  QHNIMAGRWSLHGMTALVTGGTRGLGHAIVEELACLGATVYTCSRTEKELEECIQNWKAK  1019
             Q N    RW+L G TALVTGGTRG+GHAIVEEL   GATV+TCS   +EL +C++ W+ K
Sbjct  5     QKNDRESRWTLRGTTALVTGGTRGIGHAIVEELGGFGATVHTCSWNGEELSKCLKEWEGK  64

Query  1018  GYKVFGSVCDILQPSQRENLIQLVSKQFDGKLTILVNNVAILIPKETLKSDGQDFSNTIG  839
             G  V GSVCD+    QRENL++ VS +F G L IL+NN      K T+    ++FS  + 
Sbjct  65    GLAVTGSVCDVSSRDQRENLMKEVSSKFGGGLNILINNAGTNFRKPTVDYTVEEFSKIMA  124

Query  838   TNLEASLNLCQLAHPLLKATGNGsivfisscssfVYAPFHTIYAATKGGINSLVRNLACE  659
             TN +++ +LCQ+AHPLLKA+G GSI+FISS +  V     ++YAA KG IN + +NLACE
Sbjct  125   TNFDSAYHLCQIAHPLLKASGAGSIIFISSVAGVVSLGNGSVYAAAKGAINQITKNLACE  184

Query  658   WTNDNIRVNAVAPWLMRTSLTES--SREEFGAVIEALIGRTLQHRLVEPKEASAAVAFLC  485
             W  DNIR N++APW +RTSL E+    +EF    + +I RT   R+ EP+E ++  AFLC
Sbjct  185   WAKDNIRSNSIAPWYIRTSLVENLLKNKEF---YDGIIARTPLQRVGEPREVASLAAFLC  241

Query  484   FPAASSITGQIIRVDGGASVYG  419
              PAAS ITGQ+I VDGG +V G
Sbjct  242   LPAASYITGQVISVDGGMTVNG  263



>ref|NP_001275290.1| tropinone reductase 1-like [Solanum tuberosum]
 emb|CAC34420.1| tropinone reductase I [Solanum tuberosum]
Length=264

 Score =   258 bits (658),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 135/260 (52%), Positives = 183/260 (70%), Gaps = 11/260 (4%)
 Frame = -1

Query  1177  RWSLHGMTALVTGGTRGLGHAIVEELACLGATVYTCSRTEKELEECIQNWKAKGYKVFGS  998
             +WSL G TALVTGG++G+G+AIVEELA  GA VYTCSR E EL+EC+  W+ KG KV GS
Sbjct  7     KWSLKGTTALVTGGSKGIGYAIVEELANFGARVYTCSRNENELQECLDIWRKKGLKVEGS  66

Query  997   VCDILQPSQRENLIQLVSKQFDGKLTILVNNVAILIPKETLKSDGQDFSNTIGTNLEASL  818
             VCD+L  ++RE L++ V   FDGKL ILVNN  + I KE      +D++  +GTN EA+ 
Sbjct  67    VCDLLSRTEREKLMKTVEDVFDGKLNILVNNAGVAIHKEAKDFTKEDYNIIMGTNFEAAY  126

Query  817   NLCQLAHPLLKATGNGsivfisscssfVYAPFHTIYAATKGGINSLVRNLACEWTNDNIR  638
             +L Q+A+PLLKA+ NG+++F+SS + F   P  ++Y+A+KG IN + +NLACEW  DNIR
Sbjct  127   HLSQIAYPLLKASQNGNVIFVSSIAGFSALPSLSLYSASKGAINQMTKNLACEWAKDNIR  186

Query  637   VNAVAPWLMRTSLTESS-------REEFGAVIEALIGRTLQHRLVEPKEASAAVAFLCFP  479
             VN+VAP ++ T L E++       +EE    I++ + +T   R  +P+EASA +AFLCFP
Sbjct  187   VNSVAPAVILTPLVETAIKKNPQQKEE----IDSFVVKTPLGRAGKPEEASAVIAFLCFP  242

Query  478   AASSITGQIIRVDGGASVYG  419
             AAS ITGQII  DGG +  G
Sbjct  243   AASYITGQIIWADGGFTANG  262



>ref|XP_006488391.1| PREDICTED: tropinone reductase homolog At1g07440-like [Citrus 
sinensis]
Length=270

 Score =   258 bits (659),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 139/256 (54%), Positives = 177/256 (69%), Gaps = 6/256 (2%)
 Frame = -1

Query  1177  RWSLHGMTALVTGGTRGLGHAIVEELACLGATVYTCSRTEKELEECIQNWKAKGYKVFGS  998
             RW+L G TALVTGGT+GLGHA+VEELA LGA V+TC+R E +L+EC++ WK KG+KV GS
Sbjct  12    RWTLEGKTALVTGGTKGLGHAVVEELAELGAIVHTCARNEADLDECLREWKMKGFKVTGS  71

Query  997   VCDILQPSQRENLIQLVSKQFDGKLTILVNNVAILIPKETLKSDGQDFSNTIGTNLEASL  818
             +CD     +RE L+  VS  F+GKL IL+NNV   I K T++   +DFS  + TN E++ 
Sbjct  72    ICDASSRGEREMLMDKVSALFNGKLNILINNVGTSIRKPTVEYTAEDFSVLMATNFESAY  131

Query  817   NLCQLAHPLLKATGNGsivfisscs-sfVYAPFHTIYAATKGGINSLVRNLACEWTNDNI  641
             +L QLAHPLLKA+G G+I+ +SS +        ++IYAATKG +N L +NLACEW  DNI
Sbjct  132   HLSQLAHPLLKASGAGNIILMSSIAGVVSLNTGNSIYAATKGAMNQLAKNLACEWARDNI  191

Query  640   RVNAVAPWLMRTSLTES--SREEFGAVIEALIGRTLQHRLVEPKEASAAVAFLCFPAASS  467
             R N+VAPW +RT L E   S E+F   +E +  RT      EP E S+ VAFLC PAAS 
Sbjct  192   RTNSVAPWFIRTPLVEPYLSDEKF---LEEIKCRTPMECTGEPDEVSSLVAFLCMPAASY  248

Query  466   ITGQIIRVDGGASVYG  419
             ITGQ I VDGG +V G
Sbjct  249   ITGQTICVDGGLTVNG  264



>ref|XP_009346407.1| PREDICTED: tropinone reductase homolog isoform X1 [Pyrus x bretschneideri]
Length=260

 Score =   258 bits (658),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 140/263 (53%), Positives = 182/263 (69%), Gaps = 11/263 (4%)
 Frame = -1

Query  1186  MAG----RWSLHGMTALVTGGTRGLGHAIVEELACLGATVYTCSRTEKELEECIQNWKAK  1019
             MAG    RWSL GMTALVTGGT+G+G+AIVEELA LGATV+TC+R + ++ E +Q W++K
Sbjct  1     MAGFDSQRWSLKGMTALVTGGTKGIGYAIVEELAGLGATVHTCARNQSQILERLQEWESK  60

Query  1018  GYKVFGSVCDILQPSQRENLIQLVSKQFDGKLTILVNNVAILIPKETLKSDGQDFSNTIG  839
             G+KV GSVCD+   +QRENLI+ VS  F+GKL ILVNN A    + T     +DFS+ + 
Sbjct  61    GFKVTGSVCDLTSKAQRENLIKTVSSIFEGKLNILVNNAATCTLRGTTDYTLEDFSSMMK  120

Query  838   TNLEASLNLCQLAHPLLKATGNGsivfisscssfVYAPFHTIYAATKGGINSLVRNLACE  659
             TN+E+  +L QLAHPLLKA+GN SIVF++S +  V  P  + YAATK  +  + +NLACE
Sbjct  121   TNVESPYHLSQLAHPLLKASGNASIVFVASIAGVVALPKLSAYAATKSAVIQISKNLACE  180

Query  658   WTNDNIRVNAVAPWLMRTSL---TESSREEFGAVIEALIGRTLQHRLVEPKEASAAVAFL  488
             W  DNIR NAVAPW + T +   ++   ++F      LIGRT   RL +P E S+ + FL
Sbjct  181   WAKDNIRTNAVAPWAVNTGVKVDSDGHSDDF----RRLIGRTPIRRLAQPNEISSLITFL  236

Query  487   CFPAASSITGQIIRVDGGASVYG  419
             C PAAS I GQ+I VDGG +V G
Sbjct  237   CLPAASYINGQVISVDGGFTVSG  259



>sp|P50164.1|TRN2_HYONI RecName: Full=Tropinone reductase 2; AltName: Full=Tropinone 
reductase II; Short=TR-II [Hyoscyamus niger]
 gb|AAB09776.1| tropinone reductase-II [Hyoscyamus niger]
 dbj|BAA85845.1| tropinone reductase-II [Hyoscyamus niger]
Length=260

 Score =   258 bits (658),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 135/253 (53%), Positives = 174/253 (69%), Gaps = 2/253 (1%)
 Frame = -1

Query  1186  MAGRWSLHGMTALVTGGTRGLGHAIVEELACLGATVYTCSRTEKELEECIQNWKAKGYKV  1007
             MAGRW+L G TALVTGG+RG+G+ IVEELA LGA+VYTCSR +KEL+EC+  W++KG+ V
Sbjct  1     MAGRWNLEGCTALVTGGSRGIGYGIVEELANLGASVYTCSRNQKELDECLTQWRSKGFNV  60

Query  1006  FGSVCDILQPSQRENLIQLVSKQFDGKLTILVNNVAILIPKETLKSDGQDFSNTIGTNLE  827
               SVCD+   S+RE  ++ VS  F GKL ILVNN  I+I KE      +D+S+ +  N E
Sbjct  61    EASVCDLSSRSEREEFMKTVSNHFHGKLNILVNNAGIVIYKEAKDYTMEDYSHIMSINFE  120

Query  826   ASLNLCQLAHPLLKATGNGsivfisscssfVYAPFHTIYAATKGGINSLVRNLACEWTND  647
             A+ +L  LAHP LKA+  G++VFISS S     P+  +Y ATKG ++ L R LA EW  D
Sbjct  121   AAYHLSVLAHPFLKASERGNVVFISSISGASALPYEAVYGATKGAMDQLTRCLAFEWAKD  180

Query  646   NIRVNAVAPWLMRTSLTESSRE--EFGAVIEALIGRTLQHRLVEPKEASAAVAFLCFPAA  473
             NIRVN V P ++ TS+ E + +  E    ++ LI R    R+ EPKE +A VAFLCFPAA
Sbjct  181   NIRVNGVGPGVIATSMVEMTIQDPEQKENLDKLIDRCALRRMGEPKELAAVVAFLCFPAA  240

Query  472   SSITGQIIRVDGG  434
             S +TGQII VDGG
Sbjct  241   SYVTGQIIYVDGG  253



>ref|XP_009122209.1| PREDICTED: tropinone reductase homolog At1g07440 [Brassica rapa]
Length=262

 Score =   257 bits (657),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 138/255 (54%), Positives = 177/255 (69%), Gaps = 5/255 (2%)
 Frame = -1

Query  1177  RWSLHGMTALVTGGTRGLGHAIVEELACLGATVYTCSRTEKELEECIQNWKAKGYKVFGS  998
             RWSL G TALVTGGTRG+G AIVEELA  GATV+TCSR ++EL+ C+ +W++ G  V GS
Sbjct  6     RWSLAGKTALVTGGTRGIGRAIVEELARFGATVHTCSRNQEELKACLDDWRSNGLTVSGS  65

Query  997   VCDILQPSQRENLIQLVSKQFDGKLTILVNNVAILIPKETLKSDGQDFSNTIGTNLEASL  818
             VCD     +RE L+Q VS  F GKL ILVNNV   + K T++   +D++  + TN E++ 
Sbjct  66    VCDASDRDEREKLMQQVSSAFSGKLNILVNNVGTNVWKPTVEYTSEDYAKVMSTNFESAF  125

Query  817   NLCQLAHPLLKATGNGsivfisscssfVYAPFHTIYAATKGGINSLVRNLACEWTNDNIR  638
             +  Q+AHPLLKA+G GSIVF+SS +  VYA    IY ATKG +N L RNLACEW   NIR
Sbjct  126   HFSQIAHPLLKASGVGSIVFVSSVAGLVYASAGPIYGATKGALNQLTRNLACEWACGNIR  185

Query  637   VNAVAPWLMRTSLTESSRE--EFGAVIEALIGRTLQHRLVEPKEASAAVAFLCFPAASSI  464
              N+VAPW ++TS  E   E  EF   ++A++ RT   R+ EP+E ++ VAFLC PAAS I
Sbjct  186   TNSVAPWYIQTSFVEPVLENKEF---MDAVVNRTPLGRVGEPEEVASLVAFLCLPAASYI  242

Query  463   TGQIIRVDGGASVYG  419
             TGQ+I  DGG +V G
Sbjct  243   TGQVIVADGGFTVNG  257



>ref|XP_006590970.1| PREDICTED: tropinone reductase homolog At1g07440-like [Glycine 
max]
 gb|KHN21920.1| Tropinone reductase like [Glycine soja]
Length=307

 Score =   259 bits (662),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 146/278 (53%), Positives = 184/278 (66%), Gaps = 7/278 (3%)
 Frame = -1

Query  1246  DHQSSKSKLAKNAKYQQHNIMAGRWSLHGMTALVTGGTRGLGHAIVEELACLGATVYTCS  1067
             +H+  KS+   N      + +  RW+L GMTALVTGGTRG+GHAIVEEL   GA V+TC+
Sbjct  28    NHRRKKSQ--SNCIRSHQSTIQQRWTLQGMTALVTGGTRGIGHAIVEELTGFGARVHTCA  85

Query  1066  RTEKELEECIQNWKAKGYKVFGSVCDILQPSQRENLIQLVSKQFDGKLTILVNNVAILIP  887
             R E +L +C++NW   G+ V GSVCD+  P QRE L++ VS  F GKL IL+NNV   I 
Sbjct  86    RNEHDLTKCLKNWNDSGFDVTGSVCDVSVPHQREALMESVSSLFHGKLNILINNVGTNIR  145

Query  886   KETLKSDGQDFSNTIGTNLEASLNLCQLAHPLLKATGNGsivfisscssfVYAPFHTIYA  707
             K        +FS  I TNL +  +LCQLA+PLLKA+G GS+VF+SS S FV     ++  
Sbjct  146   KPVTDFTSAEFSTLIDTNLGSVFHLCQLAYPLLKASGMGSVVFVSSVSGFVSLKSMSVQG  205

Query  706   ATKGGINSLVRNLACEWTNDNIRVNAVAPWLMRTSLTES--SREEFGAVIEALIGRTLQH  533
             ATKG IN L RNLACEW  DNIR NAVAPW ++TSL E   S +++   +E +  RT   
Sbjct  206   ATKGAINQLTRNLACEWAKDNIRSNAVAPWYIKTSLVEQVLSNKDY---LEEVYSRTPLR  262

Query  532   RLVEPKEASAAVAFLCFPAASSITGQIIRVDGGASVYG  419
             RL +P E S+ VAFLC PA+S ITGQII +DGG SV G
Sbjct  263   RLGDPAEVSSLVAFLCLPASSYITGQIICIDGGMSVNG  300



>gb|KEH30187.1| enoyl-(acyl carrier) reductase [Medicago truncatula]
Length=268

 Score =   258 bits (658),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 140/263 (53%), Positives = 181/263 (69%), Gaps = 5/263 (2%)
 Frame = -1

Query  1201  QQHNIMAGRWSLHGMTALVTGGTRGLGHAIVEELACLGATVYTCSRTEKELEECIQNWKA  1022
               H     +WSL+GMTALVTGGTRG+G+AIVEEL   GA V+TC+R E +L +C+++W  
Sbjct  3     HSHTPTNHKWSLNGMTALVTGGTRGIGYAIVEELMGFGAKVHTCARNEDDLNKCLKDWNH  62

Query  1021  KGYKVFGSVCDILQPSQRENLIQLVSKQFDGKLTILVNNVAILIPKETLKSDGQDFSNTI  842
              G++V GS+CD+  P QRE L++ VS  F+GKL IL+NNV   I K  +     +FS  I
Sbjct  63    LGFEVTGSICDVSVPQQREVLMEDVSSVFNGKLNILINNVGTNIRKPMIDFTAAEFSRLI  122

Query  841   GTNLEASLNLCQLAHPLLKATGNGsivfisscssfVYAPFHTIYAATKGGINSLVRNLAC  662
              TNL ++ ++CQLA+PLLKA+G GS+VFISS S FV     ++  ATKG IN L RNLAC
Sbjct  123   DTNLGSTFHMCQLAYPLLKASGVGSVVFISSVSGFVSLKSMSVQGATKGAINQLTRNLAC  182

Query  661   EWTNDNIRVNAVAPWLMRTSLTES--SREEFGAVIEALIGRTLQHRLVEPKEASAAVAFL  488
             EW  DNIR NAVAPW +RTS+ E   S +++   +E +  RT   RL +P E S+ VAFL
Sbjct  183   EWAKDNIRSNAVAPWYIRTSMVEQVLSNKDY---LEEVYSRTPLRRLGDPAEVSSLVAFL  239

Query  487   CFPAASSITGQIIRVDGGASVYG  419
             C PA+S ITGQII VDGG S+ G
Sbjct  240   CLPASSYITGQIICVDGGMSING  262



>emb|CAN69508.1| hypothetical protein VITISV_016038 [Vitis vinifera]
Length=298

 Score =   259 bits (661),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 145/281 (52%), Positives = 182/281 (65%), Gaps = 29/281 (10%)
 Frame = -1

Query  1177  RWSLHGMTALVTGGTRGLG----------------------------HAIVEELACLGAT  1082
             RWSL GMTALVTGGT+G+G                            HAIVEELA LGAT
Sbjct  13    RWSLKGMTALVTGGTKGIGFVMLPVFYVFGLDYTFLPIYKCMYQLCRHAIVEELAGLGAT  72

Query  1081  VYTCSRTEKELEECIQNWKAKGYKVFGSVCDILQPSQRENLIQLVSKQFDGKLTILVNNV  902
             ++TCSR E EL EC+++WKAKG+ V GSVCD+   +QRE L+Q +S  F+GKL IL+NN 
Sbjct  73    IHTCSRKETELNECLKDWKAKGFGVSGSVCDVSSRAQREKLMQTISSVFNGKLNILINNA  132

Query  901   AILIPKETLKSDGQDFSNTIGTNLEASLNLCQLAHPLLKATGNGsivfisscssfVYAPF  722
             AI I K T++   ++FS  + TN E+  +L Q+AHPLLKA+G GSIVFISS S  V    
Sbjct  133   AISIQKPTIEVTAEEFSTIMATNFESVYHLSQIAHPLLKASGAGSIVFISSVSGIVAHKN  192

Query  721   HTIYAATKGGINSLVRNLACEWTNDNIRVNAVAPWLMRTSLTESSREEFGAVIEALIGRT  542
              + Y+ TKG +N L +NLACEW  DNIR NAVAPW ++T + E       A +E +I R 
Sbjct  193   ISAYSVTKGAMNQLTKNLACEWAKDNIRSNAVAPWYIKTPMVEQMLTN-QAFLEEVINRA  251

Query  541   LQHRLVEPKEASAAVAFLCFPAASSITGQIIRVDGGASVYG  419
                R+ +PKE S+ VAFLC PA+S ITGQII VDGG +V G
Sbjct  252   PLRRVGDPKEVSSLVAFLCLPASSYITGQIICVDGGMTVNG  292



>gb|ACJ84726.1| unknown [Medicago truncatula]
 gb|AFK40433.1| unknown [Medicago truncatula]
 gb|KEH22978.1| enoyl-(acyl carrier) reductase [Medicago truncatula]
Length=264

 Score =   258 bits (658),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 134/255 (53%), Positives = 175/255 (69%), Gaps = 2/255 (1%)
 Frame = -1

Query  1192  NIMAGRWSLHGMTALVTGGTRGLGHAIVEELACLGATVYTCSRTEKELEECIQNWKAKGY  1013
             N    +WSLHGMTALVTGGTRG+G+AIVEELA  GA+V+ C+R + ++ +C++ WK KG+
Sbjct  7     NFKDQKWSLHGMTALVTGGTRGIGYAIVEELAEFGASVHICARNQDDINKCLEEWKGKGF  66

Query  1012  KVFGSVCDILQPSQRENLIQLVSKQFDGKLTILVNNVAILIPKETLKSDGQDFSNTIGTN  833
              V GS CD+L   QR+ L++ V+  FDGKL ILVNN   + PK  L+   +D +NT+G N
Sbjct  67    CVTGSTCDLLFHDQRQKLMETVASIFDGKLNILVNNAGTITPKTMLEHTAEDVTNTMGIN  126

Query  832   LEASLNLCQLAHPLLKATGNGsivfisscssfVYAPFHTIYAATKGGINSLVRNLACEWT  653
              E+S +LCQLAHPLLK +G GSIV ISS       P  +IYAA+KG IN   +N+A E+ 
Sbjct  127   FESSYHLCQLAHPLLKESGYGSIVSISSILGLRPLPLCSIYAASKGAINQCTKNIALEYG  186

Query  652   NDNIRVNAVAPWLMRTSLTESSREEFGA--VIEALIGRTLQHRLVEPKEASAAVAFLCFP  479
              DNIR N VAP  + T+L ES  E   A  V+E  + +T  +R+ +P++ SA VAFLC P
Sbjct  187   KDNIRANVVAPGAVMTTLLESILEHPDAPKVMEVALSQTPINRVAQPRDISALVAFLCLP  246

Query  478   AASSITGQIIRVDGG  434
             AAS ITGQII  DGG
Sbjct  247   AASYITGQIIAADGG  261



>ref|XP_003552795.1| PREDICTED: tropinone reductase homolog [Glycine max]
 gb|KHN07592.1| Tropinone reductase like [Glycine soja]
Length=272

 Score =   258 bits (658),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 135/253 (53%), Positives = 175/253 (69%), Gaps = 1/253 (0%)
 Frame = -1

Query  1177  RWSLHGMTALVTGGTRGLGHAIVEELACLGATVYTCSRTEKELEECIQNWKAKGYKVFGS  998
             RWSL+G TALVTGGTRG+GHAIV +LA  GA V+TCSRT+ EL +C+Q W++ G++V GS
Sbjct  13    RWSLNGTTALVTGGTRGIGHAIVSDLAAFGAAVHTCSRTQTELNKCLQEWQSLGFQVTGS  72

Query  997   VCDILQPSQRENLIQLVSKQFDGKLTILVNNVAILIPKETLKSDGQDFSNTIGTNLEASL  818
             VCD+  PSQRE LI+ V+   +GKL I VNNV     K T++   +++S  +  NL++S 
Sbjct  73    VCDVSSPSQREKLIEEVTSILNGKLNIYVNNVGTNFRKPTIEYTAEEYSQLMTVNLDSSF  132

Query  817   NLCQLAHPLLKATGNGsivfisscssfVYAPFHTIYAATKGGINSLVRNLACEWTNDNIR  638
             +LCQLA+PLLKA+ NGSIVFISS +  V      +YAA+K  IN L +NLACEW  DNIR
Sbjct  133   HLCQLAYPLLKASENGSIVFISSVAGVVSLGTGAVYAASKAAINQLTKNLACEWAKDNIR  192

Query  637   VNAVAPWLMRTSLTESSREEFGAVIEALIGRTLQHRLVEPKEASAAVAFLCFPAASSITG  458
              N V PW  RT L E    +    ++ ++ RT   R+ EP+E S+ V FLC PAAS ITG
Sbjct  193   SNCVVPWATRTPLVEHLLRD-QKFVDDIMSRTPIKRIAEPEEVSSLVTFLCLPAASYITG  251

Query  457   QIIRVDGGASVYG  419
             Q+I VDGG +V G
Sbjct  252   QVICVDGGLTVNG  264



>ref|XP_010475505.1| PREDICTED: tropinone reductase homolog At1g07440-like [Camelina 
sativa]
Length=266

 Score =   258 bits (658),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 135/253 (53%), Positives = 176/253 (70%), Gaps = 2/253 (1%)
 Frame = -1

Query  1177  RWSLHGMTALVTGGTRGLGHAIVEELACLGATVYTCSRTEKELEECIQNWKAKGYKVFGS  998
             RWSL G TALVTGGT+G+GH +VEELA  GA ++TC+R E +L EC+  WK KG++V GS
Sbjct  9     RWSLKGKTALVTGGTKGIGHGVVEELAGFGAVIHTCARDESQLNECLSKWKKKGFQVSGS  68

Query  997   VCDILQPSQRENLIQLVSKQFDGKLTILVNNVAILIPKETLKSDGQDFSNTIGTNLEASL  818
             VCD+   ++RENL+Q VS  F GKL IL+NNV  +  K T+    +DFS  I TNLE++ 
Sbjct  69    VCDVTLRTERENLMQTVSSMFGGKLDILINNVGSIRAKPTVDFTAEDFSFHISTNLESAY  128

Query  817   NLCQLAHPLLKATGNGsivfisscssfVYAPFHTIYAATKGGINSLVRNLACEWTNDNIR  638
             +L QLAHPLLK +G+G+IVF+SS +  V     ++Y+ATKG +N L RNLACEW +D IR
Sbjct  129   HLSQLAHPLLKTSGSGNIVFMSSVAGVVSFTVSSLYSATKGAMNQLARNLACEWASDGIR  188

Query  637   VNAVAPWLMRTSLTESSREEFGAVIEALIGRTLQHRLVEPKEASAAVAFLCFPAASSITG  458
              NAVAP ++ T L  +  ++  A  + +I R    R  EP+E ++ VAFLC PAAS ITG
Sbjct  189   TNAVAPGVIATPLAGAVYDD--AFKKVMISRKPLGRFGEPEEVASVVAFLCMPAASYITG  246

Query  457   QIIRVDGGASVYG  419
             Q I VDGG SV G
Sbjct  247   QTICVDGGLSVNG  259



>ref|XP_010037803.1| PREDICTED: tropinone reductase 1-like [Eucalyptus grandis]
Length=316

 Score =   259 bits (662),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 137/251 (55%), Positives = 177/251 (71%), Gaps = 1/251 (0%)
 Frame = -1

Query  1177  RWSLHGMTALVTGGTRGLGHAIVEELACLGATVYTCSRTEKELEECIQNWKAKGYKVFGS  998
             RWSL G TALVTGGTRG+G+AIV ELA LGA+V+TCSR EKEL E ++ W+ KG +V GS
Sbjct  65    RWSLKGKTALVTGGTRGIGYAIVAELAGLGASVHTCSRNEKELNERVEEWRGKGLQVSGS  124

Query  997   VCDILQPSQRENLIQLVSKQFDGKLTILVNNVAILIPKETLKSDGQDFSNTIGTNLEASL  818
             VCD+   +Q+E L++ VS  FDGKL ILVNN A ++ K  L    +D S  +  NLE+  
Sbjct  125   VCDLTCNTQKEALVKTVSSVFDGKLNILVNNAATVVLKGVLDHTLEDCSYVLKANLESPY  184

Query  817   NLCQLAHPLLKATGNGsivfisscssfVYAPFHTIYAATKGGINSLVRNLACEWTNDNIR  638
             +LCQLAHPLLKA+G+G+IVF+SS +  V  P  +IY+A+KG IN L +NLACEW  DNIR
Sbjct  185   HLCQLAHPLLKASGDGNIVFLSSIAGEVALPALSIYSASKGAINQLTKNLACEWAKDNIR  244

Query  637   VNAVAPWLMRTSLTESSREEFGAVIEALIGRTLQHRLVEPKEASAAVAFLCFPAASSITG  458
             +N VAP  ++T++ +    E       ++ R   HRL EP E S+ VAFLC PAAS +TG
Sbjct  245   INTVAPGPVKTTIAK-PEPEIKEKFLKMLARMPLHRLGEPNEISSVVAFLCLPAASYVTG  303

Query  457   QIIRVDGGASV  425
             Q+I VDGG +V
Sbjct  304   QVISVDGGYTV  314



>ref|XP_006846356.1| hypothetical protein AMTR_s00012p00261070 [Amborella trichopoda]
 gb|ERN08031.1| hypothetical protein AMTR_s00012p00261070 [Amborella trichopoda]
Length=273

 Score =   258 bits (658),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 129/253 (51%), Positives = 171/253 (68%), Gaps = 2/253 (1%)
 Frame = -1

Query  1177  RWSLHGMTALVTGGTRGLGHAIVEELACLGATVYTCSRTEKELEECIQNWKAKGYKVFGS  998
             RWSL+GMTALVTGGT+G+GHAI+EELA LGA+VYTC+R E +L +C+  WK  G  V GS
Sbjct  20    RWSLNGMTALVTGGTKGIGHAIIEELAGLGASVYTCARNEDDLNKCLNQWKGMGLDVHGS  79

Query  997   VCDILQPSQRENLIQLVSKQFDGKLTILVNNVAILIPKETLKSDGQDFSNTIGTNLEASL  818
             VCD+   S R  LI+ VS  F GKL ILVNNV   I K T++   +DFS  + TN E++ 
Sbjct  80    VCDLSSRSDRHKLIEAVSSHFKGKLNILVNNVGTAIGKSTVEFTAEDFSFMMMTNFESAY  139

Query  817   NLCQLAHPLLKATGNGsivfisscssfVYAPFHTIYAATKGGINSLVRNLACEWTNDNIR  638
             ++CQL+HPLLKA+G G  +  +S  + V     ++Y ATK  +N + +NLACEW ND IR
Sbjct  140   HMCQLSHPLLKASGAG-SIVFNSSVTGVVGTHCSLYGATKAAMNQITKNLACEWANDKIR  198

Query  637   VNAVAPWLMRTSLTESSREEFGAVIEALIGRTLQHRLVEPKEASAAVAFLCFPAASSITG  458
              N+VAPW ++T   +   E     +  ++ RT   R+ +P+E S+ VAFLC PAAS ITG
Sbjct  199   TNSVAPWFIKTPFVKDVLEN-KEWLAGIVARTPMRRVGDPEEVSSLVAFLCMPAASYITG  257

Query  457   QIIRVDGGASVYG  419
             Q+I VDGG +V G
Sbjct  258   QVICVDGGMTVNG  270



>ref|XP_010040250.1| PREDICTED: tropinone reductase homolog At1g07440-like [Eucalyptus 
grandis]
 gb|KCW45357.1| hypothetical protein EUGRSUZ_L00973 [Eucalyptus grandis]
Length=289

 Score =   258 bits (660),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 148/262 (56%), Positives = 180/262 (69%), Gaps = 16/262 (6%)
 Frame = -1

Query  1177  RWSLHGMTALVTGGTRGLGHAIVEELACLGATVYTCSRTEKELEECIQNWKAKGYKVFGS  998
             RWSL GMTALVTGG++G+G AIVEELA LGATVYTCSRTE EL EC++ WK KG++V GS
Sbjct  22    RWSLQGMTALVTGGSKGIGRAIVEELAGLGATVYTCSRTEAELNECLKEWKRKGFQVAGS  81

Query  997   VCDILQPSQRENLIQLVSKQFDGKLTILVNNVAIL-----IPKETLKSDGQDFSNTIGTN  833
              CD+   S+RE L+   S  FDGKL IL+NNV  L     +P  T+    +DFS  + TN
Sbjct  82    ACDVSSRSEREKLMLAASSLFDGKLNILINNVGTLGTTGGMP--TVDYTAEDFSFIMTTN  139

Query  832   LEASLNLCQLAHPLLKATGNGsivfisscssfVYAPFHTIYAATKGGINSLVRNLACEWT  653
              E++ +L QLAHPLLKA+G GSIVF+SS    V     +IY+ATKG +N L +NLACEW 
Sbjct  140   FESAYHLSQLAHPLLKASGTGSIVFLSSVCGIVSLGLGSIYSATKGAMNQLTKNLACEWA  199

Query  652   NDNIRVNAVAPWLMRTSLTES--SREEFG--AVIEALIGRTLQHRLVEPKEASAAVAFLC  485
              DNIR N+VAP+ + T LTE     EE+   A+  A +GRT      EPKE S+ VAFLC
Sbjct  200   KDNIRSNSVAPYFILTPLTEPLLCSEEYHKEAIARAPLGRT-----GEPKEVSSLVAFLC  254

Query  484   FPAASSITGQIIRVDGGASVYG  419
              PAAS ITGQ I VDGG +V G
Sbjct  255   LPAASYITGQTICVDGGFTVNG  276



>gb|AGY46257.1| tropinone reductase I [Withania somnifera]
Length=273

 Score =   258 bits (658),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 133/260 (51%), Positives = 186/260 (72%), Gaps = 11/260 (4%)
 Frame = -1

Query  1177  RWSLHGMTALVTGGTRGLGHAIVEELACLGATVYTCSRTEKELEECIQNWKAKGYKVFGS  998
             RWSL G TALVTGG++G+G+AIVEELA LGATVYTCSR E EL++C++ W+ KG KV GS
Sbjct  16    RWSLKGTTALVTGGSKGIGYAIVEELAGLGATVYTCSRNENELQQCLEIWREKGLKVEGS  75

Query  997   VCDILQPSQRENLIQLVSKQFDGKLTILVNNVAILIPKETLKSDGQDFSNTIGTNLEASL  818
             +CD+L  ++RE L+Q V+  FDGKL ILVNN  ++I KE      +D++  +GTN EA+ 
Sbjct  76    ICDLLVRTEREKLMQTVADVFDGKLNILVNNAGVVIHKEAKDFTEKDYNIIMGTNFEAAY  135

Query  817   NLCQLAHPLLKATGNGsivfisscssfVYAPFHTIYAATKGGINSLVRNLACEWTNDNIR  638
             +L Q+A+PLLKA+ NG+++F+SS + F   P  ++Y+A+KG IN + +NLACEW  DNIR
Sbjct  136   HLSQIAYPLLKASQNGNVIFLSSIAGFSALPSVSLYSASKGAINQMTKNLACEWAKDNIR  195

Query  637   VNAVAPWLMRTSLTESS-------REEFGAVIEALIGRTLQHRLVEPKEASAAVAFLCFP  479
             VN+VAP ++ T L E++       ++E    I+  + +T   R  +P+E +A +AFLCFP
Sbjct  196   VNSVAPGVIVTPLVEAAIKKNPQQKDE----IDNFVVKTPMGRAGKPEEVAAVIAFLCFP  251

Query  478   AASSITGQIIRVDGGASVYG  419
             AAS +TGQII  DGG +  G
Sbjct  252   AASYVTGQIIWADGGFTANG  271



>ref|XP_009796888.1| PREDICTED: tropinone reductase homolog [Nicotiana sylvestris]
Length=269

 Score =   258 bits (658),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 140/248 (56%), Positives = 172/248 (69%), Gaps = 1/248 (0%)
 Frame = -1

Query  1162  GMTALVTGGTRGLGHAIVEELACLGATVYTCSRTEKELEECIQNWKAKGYKVFGSVCDIL  983
             G TALVTGGTRG+GHA+VEELA LGATVYTCSR + EL E +Q W  KG +V GSVCD  
Sbjct  17    GFTALVTGGTRGIGHAVVEELAELGATVYTCSRNQAELNERLQEWAEKGLQVKGSVCDAS  76

Query  982   QPSQRENLIQLVSKQFDGKLTILVNNVAILIPKETLKSDGQDFSNTIGTNLEASLNLCQL  803
                QR  L++ VS  FDGKL ILVNNV   I K T     ++++  + TNLE++ +LCQL
Sbjct  77    SREQRVQLMENVSSAFDGKLNILVNNVGTNIRKPTTHYTAEEYARLLSTNLESAYHLCQL  136

Query  802   AHPLLKATGNGsivfisscssfVYAPFHTIYAATKGGINSLVRNLACEWTNDNIRVNAVA  623
             AHPLLKA+GNGS+VFISS +  V+    ++Y ATKG +N L RNLACEW  D+IRVN VA
Sbjct  137   AHPLLKASGNGSVVFISSVAGLVHLSSGSVYGATKGALNQLTRNLACEWAKDSIRVNGVA  196

Query  622   PWLMRTSLTESSREEFGAVIEALIGRTLQHRLVEPKEASAAVAFLCFPAASSITGQIIRV  443
             PW +RTSL E   E     ++ +I RT   R  E +E S+ VA+LC P AS ITGQ+I V
Sbjct  197   PWYIRTSLVEHLLEN-KTFLDGVISRTPLRRPGESQEVSSLVAYLCLPGASYITGQVIAV  255

Query  442   DGGASVYG  419
             DGG +V G
Sbjct  256   DGGFTVNG  263



>ref|XP_004294666.1| PREDICTED: tropinone reductase homolog At1g07440-like [Fragaria 
vesca subsp. vesca]
Length=270

 Score =   258 bits (658),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 140/256 (55%), Positives = 176/256 (69%), Gaps = 3/256 (1%)
 Frame = -1

Query  1177  RWSLHGMTALVTGGTRGLGHAIVEELACLGATVYTCSRTEKELEECIQNWKAKGY-KVFG  1001
             RWSL G+TALVTGGT+G+G+AIVEELA LGA+VYTCSR E +L EC+  WK KGY +V G
Sbjct  9     RWSLEGVTALVTGGTKGIGYAIVEELAGLGASVYTCSRNEAQLHECLNQWKKKGYHQVTG  68

Query  1000  SVCDILQPSQRENLIQLVSKQFDGKLTILVNNVAILIPKETL-KSDGQDFSNTIGTNLEA  824
             SVCD+    QRE LI  VS  F GKL ILVNNV          +   +++S+ + TNLE+
Sbjct  69    SVCDVASKIQREELIHKVSSLFHGKLNILVNNVGTTHGPTPTTECTAEEYSSIMNTNLES  128

Query  823   SLNLCQLAHPLLKATGNGsivfisscs-sfVYAPFHTIYAATKGGINSLVRNLACEWTND  647
             + NLCQLAHPLLK +G G+IVF+SS +         ++Y ATKG +N L +NLACEW  D
Sbjct  129   TYNLCQLAHPLLKTSGAGNIVFMSSVAGVVSIWGGGSVYGATKGAMNQLAKNLACEWAKD  188

Query  646   NIRVNAVAPWLMRTSLTESSREEFGAVIEALIGRTLQHRLVEPKEASAAVAFLCFPAASS  467
             NIR+N+VAPW++RT L E    +   ++EA+I RT   R+ EP+E SA VAFLC P AS 
Sbjct  189   NIRINSVAPWVIRTPLVEPILNDDVKIMEAVISRTPLGRIGEPEEVSALVAFLCLPVASY  248

Query  466   ITGQIIRVDGGASVYG  419
             ITGQ   VDGG +  G
Sbjct  249   ITGQTFCVDGGITANG  264



>gb|KHN04080.1| Tropinone reductase like [Glycine soja]
Length=264

 Score =   257 bits (657),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 136/250 (54%), Positives = 172/250 (69%), Gaps = 2/250 (1%)
 Frame = -1

Query  1177  RWSLHGMTALVTGGTRGLGHAIVEELACLGATVYTCSRTEKELEECIQNWKAKGYKVFGS  998
             RWSLHGMTALVTGGTRG+GHAIVEELA  GATV+ C+R + ++++C++ WK KG  V GS
Sbjct  12    RWSLHGMTALVTGGTRGIGHAIVEELAEFGATVHICARNQDDIDKCLEEWKNKGLNVTGS  71

Query  997   VCDILQPSQRENLIQLVSKQFDGKLTILVNNVAILIPKETLKSDGQDFSNTIGTNLEASL  818
             VCD+L   QR+ L+++V   F GKL ILVNN A  I K+      +D S  +GTN E+  
Sbjct  72    VCDLLCSDQRKRLMEIVGSIFHGKLNILVNNAATNITKKITDYTAEDISAIMGTNFESVY  131

Query  817   NLCQLAHPLLKATGNGsivfisscssfVYAPFHTIYAATKGGINSLVRNLACEWTNDNIR  638
             +LCQ+AHPLLK +GNGSIVFISS +     P  ++YAA+KG +N   +NLA EW  DNIR
Sbjct  132   HLCQVAHPLLKDSGNGSIVFISSVAGLKALPVFSVYAASKGAMNQFTKNLALEWAKDNIR  191

Query  637   VNAVAPWLMRTSLTES--SREEFGAVIEALIGRTLQHRLVEPKEASAAVAFLCFPAASSI  464
              NAVAP  ++T L E   +  E    I  ++ +T   R+ E KE SA VAFLC PAAS I
Sbjct  192   ANAVAPGPVKTKLLECIVNSSEGNESINGVVSQTFVGRMGETKEISALVAFLCLPAASYI  251

Query  463   TGQIIRVDGG  434
             TGQ+I VDGG
Sbjct  252   TGQVICVDGG  261



>ref|XP_011048909.1| PREDICTED: tropinone reductase homolog At1g07440-like isoform 
X2 [Populus euphratica]
Length=331

 Score =   259 bits (663),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 139/262 (53%), Positives = 177/262 (68%), Gaps = 2/262 (1%)
 Frame = -1

Query  1201  QQHNIMAGRWSLHGMTALVTGGTRGLGHAIVEELACLGATVYTCSRTEKELEECIQNWKA  1022
             Q+++    +WSL GMTALVTGGT+GLG+AIV ELA LGA V+TC R++ +L E ++ WKA
Sbjct  67    QENSSRDKKWSLQGMTALVTGGTKGLGYAIVGELAALGAIVHTCGRSQDQLNENLREWKA  126

Query  1021  KGYKVFGSVCDILQPSQRENLIQLVSKQFDGKLTILVNNVAILIPKETLKSDGQDFSNTI  842
             KG+KV GSVCD+   ++RE L++ VS  FDGKL IL+NN    I K TL    +DF + +
Sbjct  127   KGFKVTGSVCDLSSNAEREKLMEEVSSFFDGKLDILINNAGGNIHKGTLDYTTEDFVSIM  186

Query  841   GTNLEASLNLCQLAHPLLKATGNGsiv-fisscssfVYAPFHTIYAATKGGINSLVRNLA  665
               NL ++ +L QLAHPLLKA+G G IV   S  S     P + IY+A KG +N L RNLA
Sbjct  187   NINLGSAFHLSQLAHPLLKASGAGRIVFMSSVTSVVSINPQYPIYSAAKGAMNQLTRNLA  246

Query  664   CEWTNDNIRVNAVAPWLMRTSLTESSREEFGAVIEALIGRTLQHRLVEPKEASAAVAFLC  485
             CEW  DNIRVNAVAPW +RT LTE   ++     + +  RT   RL EP + S+ VAFLC
Sbjct  247   CEWAKDNIRVNAVAPWSIRTPLTEHFLDD-DKFRKEVFNRTPMKRLGEPGDVSSVVAFLC  305

Query  484   FPAASSITGQIIRVDGGASVYG  419
             FPA   +TGQ+I VDGG SV G
Sbjct  306   FPAPGFLTGQVICVDGGMSVNG  327



>ref|XP_010423394.1| PREDICTED: tropinone reductase homolog At1g07440-like [Camelina 
sativa]
Length=261

 Score =   257 bits (656),  Expect = 4e-79, Method: Compositional matrix adjust.
 Identities = 138/255 (54%), Positives = 182/255 (71%), Gaps = 6/255 (2%)
 Frame = -1

Query  1177  RWSLHGMTALVTGGTRGLGHAIVEELACLGATVYTCSRTEKELEECIQNWKAKGYKVFGS  998
             RWSL G TALVTGGTRG+G A+VEELA  GA V+TCSR ++EL  C+ +WK+ G+ V GS
Sbjct  6     RWSLAGKTALVTGGTRGIGRAVVEELAKFGAKVHTCSRNQEELNTCLNDWKSNGFVVSGS  65

Query  997   VCDILQPSQRENLIQLVSKQFDGKLTILVNNVAILIPKETLKSDGQDFSNTIGTNLEASL  818
             VCD     QR+ LIQ VS  F GKL IL+NNV   I K T++   +++++ + TNLE++ 
Sbjct  66    VCDASVKDQRDKLIQDVSSAFSGKLNILINNVGFNIRKPTVEYSSEEYASIMSTNLESAF  125

Query  817   NLCQLAHPLLKATGNGsivfisscssfVYAPFHTIYAATKGGINSLVRNLACEWTNDNIR  638
             +  Q+AHPLLKA+G G+IVFISS S  V     ++YAATKG +N L RNLACEW +D+IR
Sbjct  126   HFSQIAHPLLKASGVGNIVFISSVSGLVSCG-GSVYAATKGALNQLTRNLACEWASDHIR  184

Query  637   VNAVAPWLMRTSLTES--SREEFGAVIEALIGRTLQHRLVEPKEASAAVAFLCFPAASSI  464
              N VAPW ++TSL E    +++F   +EA++ RT   R+ EP+E ++ VAFLC PAAS I
Sbjct  185   TNCVAPWYIKTSLVEPLLEKQDF---LEAVVSRTPLGRVGEPEEVASLVAFLCLPAASYI  241

Query  463   TGQIIRVDGGASVYG  419
             TGQ+I VDGG +V G
Sbjct  242   TGQVISVDGGFTVNG  256



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 3264754197270