BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c25565_g11_i1 len=1733 path=[38268:0-776 @39045@!:777-1574
54126:1575-1647 39843:1648-1732]

Length=1733
                                                                      Score     E

ref|XP_009610978.1|  PREDICTED: uncharacterized protein LOC104104559    764   0.0      
ref|XP_009795615.1|  PREDICTED: uncharacterized protein LOC104242282    758   0.0      
emb|CDP06214.1|  unnamed protein product                                751   0.0      
ref|XP_004249124.1|  PREDICTED: uncharacterized protein LOC101264685    748   0.0      
ref|XP_006364789.1|  PREDICTED: uncharacterized protein LOC102582...    747   0.0      
ref|XP_002283075.1|  PREDICTED: uncharacterized protein LOC100267048    704   0.0      Vitis vinifera
ref|XP_011070092.1|  PREDICTED: uncharacterized protein LOC105155823    702   0.0      
ref|XP_011079082.1|  PREDICTED: uncharacterized protein LOC105162...    693   0.0      
ref|XP_011079083.1|  PREDICTED: uncharacterized protein LOC105162...    692   0.0      
gb|EYU18600.1|  hypothetical protein MIMGU_mgv1a005347mg                687   0.0      
ref|XP_002517279.1|  conserved hypothetical protein                     672   0.0      Ricinus communis
ref|XP_008359578.1|  PREDICTED: uncharacterized protein LOC103423286    671   0.0      
ref|XP_009339983.1|  PREDICTED: uncharacterized protein LOC103932159    669   0.0      
ref|XP_008227319.1|  PREDICTED: uncharacterized protein LOC103326844    669   0.0      
ref|XP_007201975.1|  hypothetical protein PRUPE_ppa004791mg             665   0.0      
ref|XP_006482052.1|  PREDICTED: restin homolog isoform X1               659   0.0      
ref|XP_006430520.1|  hypothetical protein CICLE_v10011580mg             658   0.0      
ref|XP_008455735.1|  PREDICTED: uncharacterized protein LOC103495...    658   0.0      
ref|XP_010036381.1|  PREDICTED: uncharacterized protein LOC104425391    657   0.0      
ref|XP_008455737.1|  PREDICTED: myosin-11-like isoform X2               656   0.0      
ref|XP_004170254.1|  PREDICTED: uncharacterized protein LOC101224204    656   0.0      
ref|XP_004144324.1|  PREDICTED: uncharacterized protein LOC101217442    655   0.0      
gb|ADN33873.1|  hypothetical protein                                    650   0.0      
gb|KDP26333.1|  hypothetical protein JCGZ_22108                         649   0.0      
gb|KHG23663.1|  Laminin subunit gamma-1                                 649   0.0      
ref|XP_003521113.1|  PREDICTED: uncharacterized protein LOC100816...    647   0.0      
ref|NP_001242328.1|  uncharacterized protein LOC100798320               644   0.0      
ref|XP_006603721.1|  PREDICTED: uncharacterized protein LOC100798...    643   0.0      
ref|XP_007162055.1|  hypothetical protein PHAVU_001G119900g             643   0.0      
ref|XP_004296634.1|  PREDICTED: uncharacterized protein LOC101291134    637   0.0      
ref|XP_004493368.1|  PREDICTED: uncharacterized protein LOC101494...    636   0.0      
ref|XP_007028248.1|  Uncharacterized protein isoform 5                  634   0.0      
ref|XP_007028244.1|  Uncharacterized protein isoform 1                  635   0.0      
ref|XP_007028245.1|  Uncharacterized protein isoform 2                  633   0.0      
ref|XP_002308873.2|  proline-rich family protein                        629   0.0      Populus trichocarpa [western balsam poplar]
ref|XP_007028249.1|  Uncharacterized protein isoform 6                  629   0.0      
ref|XP_002323226.2|  proline-rich family protein                        627   0.0      Populus trichocarpa [western balsam poplar]
ref|XP_003624923.1|  hypothetical protein MTR_7g089090                  627   0.0      
ref|XP_011041396.1|  PREDICTED: uncharacterized protein LOC105137366    626   0.0      
ref|XP_011040736.1|  PREDICTED: uncharacterized protein LOC105136922    625   0.0      
gb|AFK36222.1|  unknown                                                 623   0.0      
ref|XP_010525425.1|  PREDICTED: uncharacterized protein LOC104803222    620   0.0      
ref|XP_003624924.1|  hypothetical protein MTR_7g089090                  617   0.0      
ref|XP_010673068.1|  PREDICTED: uncharacterized protein LOC104889525    616   0.0      
ref|XP_010554728.1|  PREDICTED: uncharacterized protein LOC104824371    609   0.0      
ref|XP_007211839.1|  hypothetical protein PRUPE_ppa004638mg             593   0.0      
gb|KFK36952.1|  hypothetical protein AALP_AA4G193500                    593   0.0      
ref|XP_008227380.1|  PREDICTED: cingulin                                589   0.0      
ref|XP_010271915.1|  PREDICTED: uncharacterized protein LOC104607...    588   0.0      
ref|XP_007015354.1|  Plectin-related isoform 1                          587   0.0      
gb|KHG04844.1|  Pyridoxine 5'-phosphate synthase                        586   0.0      
ref|XP_004291720.1|  PREDICTED: uncharacterized protein LOC101300025    585   0.0      
emb|CBI24323.3|  unnamed protein product                                584   0.0      
ref|XP_002269709.1|  PREDICTED: uncharacterized protein LOC100242766    582   0.0      Vitis vinifera
ref|XP_011025009.1|  PREDICTED: uncharacterized protein LOC105126...    581   0.0      
ref|XP_011025013.1|  PREDICTED: uncharacterized protein LOC105126...    581   0.0      
ref|XP_009116348.1|  PREDICTED: uncharacterized protein LOC103841552    580   0.0      
ref|XP_006470512.1|  PREDICTED: uncharacterized protein LOC102622518    579   0.0      
gb|KDO66436.1|  hypothetical protein CISIN_1g011054mg                   579   0.0      
ref|XP_006402982.1|  hypothetical protein EUTSA_v10005916mg             578   0.0      
gb|KHN11019.1|  hypothetical protein glysoja_047269                     578   0.0      
emb|CDY23880.1|  BnaC04g01570D                                          579   0.0      
ref|XP_006595779.1|  PREDICTED: rootletin-like isoform X1               578   0.0      
ref|NP_181614.7|  uncharacterized protein                               578   0.0      Arabidopsis thaliana [mouse-ear cress]
ref|XP_006446352.1|  hypothetical protein CICLE_v10015010mg             577   0.0      
ref|XP_009142710.1|  PREDICTED: uncharacterized protein LOC103866...    577   0.0      
ref|XP_002523243.1|  transcription factor, putative                     576   0.0      Ricinus communis
ref|XP_003519505.1|  PREDICTED: cingulin-like isoform X1                576   0.0      
ref|XP_009142709.1|  PREDICTED: uncharacterized protein LOC103866...    577   0.0      
emb|CDY27211.1|  BnaA09g35910D                                          575   0.0      
ref|XP_002313274.2|  plectin-related family protein                     575   0.0      Populus trichocarpa [western balsam poplar]
ref|XP_010093534.1|  hypothetical protein L484_002074                   578   0.0      
emb|CDX79969.1|  BnaA05g01870D                                          575   0.0      
gb|KDP36619.1|  hypothetical protein JCGZ_08435                         574   0.0      
ref|XP_004491215.1|  PREDICTED: paramyosin-like                         573   0.0      
ref|XP_007146154.1|  hypothetical protein PHAVU_006G016800g             573   0.0      
emb|CDX72133.1|  BnaC08g27410D                                          573   0.0      
ref|XP_011036381.1|  PREDICTED: uncharacterized protein LOC105133920    573   0.0      
ref|XP_006411350.1|  hypothetical protein EUTSA_v10016526mg             573   0.0      
ref|XP_006293991.1|  hypothetical protein CARUB_v10022982mg             573   0.0      
ref|XP_009357896.1|  PREDICTED: uncharacterized protein LOC103948575    572   0.0      
ref|XP_006293992.1|  hypothetical protein CARUB_v10022982mg             572   0.0      
gb|KHN44993.1|  hypothetical protein glysoja_023565                     570   0.0      
gb|ACU19354.1|  unknown                                                 570   0.0      Glycine max [soybeans]
ref|XP_003542411.1|  PREDICTED: uncharacterized protein LOC100780477    569   0.0      
emb|CDY04465.1|  BnaA07g12910D                                          569   0.0      
emb|CDX67649.1|  BnaA07g16890D                                          568   0.0      
ref|XP_010505839.1|  PREDICTED: uncharacterized protein LOC104782...    568   0.0      
ref|XP_009103557.1|  PREDICTED: plectin                                 568   0.0      
ref|XP_006290430.1|  hypothetical protein CARUB_v10019330mg             567   0.0      
ref|XP_010508801.1|  PREDICTED: uncharacterized protein LOC104785...    567   0.0      
emb|CDY14746.1|  BnaC04g47430D                                          568   0.0      
ref|XP_010521573.1|  PREDICTED: uncharacterized protein LOC104800467    567   0.0      
ref|XP_007141525.1|  hypothetical protein PHAVU_008G203500g             567   0.0      
ref|XP_008451066.1|  PREDICTED: uncharacterized protein LOC103492455    566   0.0      
ref|NP_180245.1|  stomatal closure-related actin binding protein1       566   0.0      Arabidopsis thaliana [mouse-ear cress]
ref|XP_010505838.1|  PREDICTED: uncharacterized protein LOC104782...    568   0.0      
ref|XP_010508799.1|  PREDICTED: uncharacterized protein LOC104785...    568   0.0      
ref|XP_002880833.1|  hypothetical protein ARALYDRAFT_481549             566   0.0      
ref|XP_003555196.1|  PREDICTED: inner centromere protein-like iso...    565   0.0      
ref|XP_010427474.1|  PREDICTED: uncharacterized protein LOC104712309    565   0.0      
gb|KEH28369.1|  Cyclin 4                                                564   0.0      
ref|XP_003617192.1|  hypothetical protein MTR_5g088860                  563   0.0      
gb|AET00151.2|  Cyclin 4                                                564   0.0      
ref|XP_010516253.1|  PREDICTED: uncharacterized protein LOC104791943    563   0.0      
ref|XP_009141945.1|  PREDICTED: uncharacterized protein LOC103865845    563   0.0      
ref|XP_010517525.1|  PREDICTED: uncharacterized protein LOC104792...    562   0.0      
ref|XP_010504553.1|  PREDICTED: uncharacterized protein LOC104781546    562   0.0      
emb|CDX71487.1|  BnaC04g17220D                                          565   0.0      
ref|XP_006836249.1|  hypothetical protein AMTR_s00101p00130320          561   0.0      
ref|XP_009104004.1|  PREDICTED: uncharacterized protein LOC103830056    561   0.0      
ref|XP_010557466.1|  PREDICTED: uncharacterized protein LOC104826463    561   0.0      
ref|XP_011080459.1|  PREDICTED: uncharacterized protein LOC105163715    560   0.0      
ref|XP_010517524.1|  PREDICTED: uncharacterized protein LOC104792...    562   0.0      
emb|CDY06958.1|  BnaA04g23570D                                          561   0.0      
emb|CDY32017.1|  BnaC06g15950D                                          560   0.0      
ref|XP_011090182.1|  PREDICTED: uncharacterized protein LOC105170...    558   0.0      
ref|XP_011090183.1|  PREDICTED: uncharacterized protein LOC105170...    558   0.0      
ref|XP_006397374.1|  hypothetical protein EUTSA_v10022499mg             558   0.0      
ref|XP_009769256.1|  PREDICTED: uncharacterized protein LOC104220139    557   0.0      
ref|XP_010473060.1|  PREDICTED: uncharacterized protein LOC104752580    556   0.0      
ref|XP_002878087.1|  hypothetical protein ARALYDRAFT_324161             556   0.0      
emb|CAB88051.1|  putative protein                                       556   0.0      Arabidopsis thaliana [mouse-ear cress]
ref|XP_006293926.1|  hypothetical protein CARUB_v10022916mg             558   0.0      
ref|XP_010510866.1|  PREDICTED: uncharacterized protein LOC104787061    555   0.0      
ref|NP_191207.2|  myosin heavy chain-like protein                       554   0.0      Arabidopsis thaliana [mouse-ear cress]
ref|XP_004513217.1|  PREDICTED: paramyosin-like isoform X1              551   0.0      
ref|XP_002881742.1|  proline-rich family protein                        564   0.0      
gb|EYU46172.1|  hypothetical protein MIMGU_mgv1a005272mg                550   0.0      
ref|XP_010922033.1|  PREDICTED: uncharacterized protein LOC105045454    550   0.0      
gb|KEH33524.1|  Cyclin 4                                                548   0.0      
ref|XP_004250883.1|  PREDICTED: uncharacterized protein LOC101257435    548   0.0      
ref|XP_010096133.1|  Molybdopterin synthase catalytic subunit           556   0.0      
ref|XP_006356373.1|  PREDICTED: myosin-7B-like isoform X1               546   0.0      
ref|XP_008786860.1|  PREDICTED: uncharacterized protein LOC103705047    545   0.0      
emb|CDP09656.1|  unnamed protein product                                544   0.0      
ref|XP_008788541.1|  PREDICTED: uncharacterized protein LOC103706263    543   0.0      
ref|XP_010031696.1|  PREDICTED: uncharacterized protein LOC104421446    543   0.0      
ref|XP_009610562.1|  PREDICTED: uncharacterized protein LOC104104241    538   0.0      
gb|KGN66395.1|  hypothetical protein Csa_1G600850                       532   0.0      
ref|XP_010673798.1|  PREDICTED: uncharacterized protein LOC104890123    531   1e-180   
gb|EYU35958.1|  hypothetical protein MIMGU_mgv1a005292mg                529   7e-180   
ref|XP_010417822.1|  PREDICTED: uncharacterized protein LOC104703495    527   1e-179   
ref|XP_007015356.1|  Plectin-related isoform 3                          526   2e-179   
ref|XP_010931532.1|  PREDICTED: uncharacterized protein LOC105052...    526   1e-178   
ref|XP_010045094.1|  PREDICTED: uncharacterized protein LOC104433899    526   1e-178   
ref|XP_010931531.1|  PREDICTED: uncharacterized protein LOC105052...    520   7e-176   
gb|AAB86442.1|  hypothetical protein                                    535   7e-176   Arabidopsis thaliana [mouse-ear cress]
ref|XP_004144148.1|  PREDICTED: uncharacterized protein LOC101215534    516   4e-175   
emb|CAN82324.1|  hypothetical protein VITISV_039755                     512   5e-175   Vitis vinifera
ref|XP_007015357.1|  Plectin-related isoform 4                          513   3e-174   
ref|XP_010271917.1|  PREDICTED: uncharacterized protein LOC104607...    502   8e-170   
ref|XP_007028250.1|  Uncharacterized protein isoform 7                  496   1e-168   
ref|XP_007028251.1|  Uncharacterized protein isoform 8                  490   8e-166   
ref|XP_006595782.1|  PREDICTED: rootletin-like isoform X4               492   9e-166   
dbj|BAD68172.1|  plectin-related protein-like                           492   2e-165   Oryza sativa Japonica Group [Japonica rice]
ref|NP_001044563.1|  Os01g0805700                                       492   2e-165   Oryza sativa Japonica Group [Japonica rice]
ref|NP_001136837.1|  uncharacterized protein LOC100216987               491   6e-165   Zea mays [maize]
ref|XP_002458653.1|  hypothetical protein SORBIDRAFT_03g037470          484   3e-162   Sorghum bicolor [broomcorn]
ref|XP_010938831.1|  PREDICTED: putative protein tag-278 isoform X1     483   1e-161   
ref|XP_008810356.1|  PREDICTED: uncharacterized protein LOC103721...    478   9e-160   
gb|EEE55547.1|  hypothetical protein OsJ_03800                          492   6e-159   Oryza sativa Japonica Group [Japonica rice]
ref|XP_003564423.1|  PREDICTED: uncharacterized protein LOC100842834    475   1e-158   
ref|XP_006644870.1|  PREDICTED: uncharacterized protein LOC102717018    490   3e-158   
gb|AFW84819.1|  cyclin4                                                 490   3e-158   
ref|XP_008810354.1|  PREDICTED: uncharacterized protein LOC103721...    474   4e-158   
gb|AFW84820.1|  cyclin4                                                 490   6e-158   
gb|EEC71664.1|  hypothetical protein OsI_04127                          487   8e-157   Oryza sativa Indica Group [Indian rice]
gb|EMT27137.1|  hypothetical protein F775_30934                         471   1e-156   
emb|CDJ26534.1|  unnamed protein product                                469   4e-156   
ref|XP_002299966.2|  hypothetical protein POPTR_0001s27920g             464   2e-155   Populus trichocarpa [western balsam poplar]
tpg|DAA57205.1|  TPA: hypothetical protein ZEAMMB73_282504              466   2e-155   
ref|XP_010931533.1|  PREDICTED: meiosis-specific nuclear structur...    451   4e-150   
gb|KDO66437.1|  hypothetical protein CISIN_1g011054mg                   449   1e-149   
ref|XP_006293140.1|  hypothetical protein CARUB_v10019446mg             449   4e-149   
ref|XP_006446351.1|  hypothetical protein CICLE_v10015010mg             447   9e-149   
ref|XP_010938833.1|  PREDICTED: uncharacterized protein LOC105057...    436   6e-144   
ref|XP_008362650.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...    436   3e-141   
ref|XP_008810357.1|  PREDICTED: uncharacterized protein LOC103721...    425   2e-139   
ref|XP_010938834.1|  PREDICTED: putative protein tag-278 isoform X3     407   9e-133   
ref|NP_001060438.1|  Os07g0642800                                       399   5e-129   Oryza sativa Japonica Group [Japonica rice]
ref|XP_008810358.1|  PREDICTED: uncharacterized protein LOC103721...    396   1e-128   
ref|NP_001136832.1|  hypothetical protein                               397   2e-128   Zea mays [maize]
gb|EAZ04885.1|  hypothetical protein OsI_27067                          397   3e-128   Oryza sativa Indica Group [Indian rice]
gb|ABF96114.1|  proline-rich family protein, putative, expressed        396   1e-127   Oryza sativa Japonica Group [Japonica rice]
ref|XP_002465226.1|  hypothetical protein SORBIDRAFT_01g034550          392   3e-126   Sorghum bicolor [broomcorn]
ref|XP_006650110.1|  PREDICTED: uncharacterized protein LOC102719937    391   8e-126   
ref|XP_004984289.1|  PREDICTED: uncharacterized protein LOC101759597    389   4e-125   
ref|XP_002461113.1|  hypothetical protein SORBIDRAFT_02g040980          388   1e-124   Sorghum bicolor [broomcorn]
ref|XP_008658208.1|  PREDICTED: uncharacterized protein LOC100217...    385   3e-123   
ref|XP_003557842.1|  PREDICTED: uncharacterized protein LOC100840551    384   3e-123   
ref|XP_004958494.1|  PREDICTED: uncharacterized protein LOC101770...    384   6e-123   
gb|AFW88301.1|  hypothetical protein ZEAMMB73_412695                    382   2e-122   
ref|XP_006658035.1|  PREDICTED: sarcolemmal membrane-associated p...    381   4e-122   
gb|AFW88303.1|  hypothetical protein ZEAMMB73_412695                    382   9e-122   
ref|XP_008658210.1|  PREDICTED: uncharacterized protein LOC100217...    380   1e-121   
ref|XP_003562576.1|  PREDICTED: uncharacterized protein LOC100843028    378   6e-121   
ref|XP_008810442.1|  PREDICTED: uncharacterized protein LOC103721857    375   5e-120   
dbj|BAK07098.1|  predicted protein                                      365   9e-116   
ref|XP_002979271.1|  hypothetical protein SELMODRAFT_110449             362   5e-115   
ref|XP_002988577.1|  hypothetical protein SELMODRAFT_128387             361   2e-114   
gb|EPS58021.1|  hypothetical protein M569_16796                         344   4e-111   
gb|EMT27221.1|  hypothetical protein F775_16353                         349   2e-109   
ref|XP_008656013.1|  PREDICTED: fas-binding factor 1 homolog            346   5e-109   
gb|KDO53648.1|  hypothetical protein CISIN_1g0127251mg                  335   4e-107   
gb|EPS62653.1|  hypothetical protein M569_12137                         302   4e-95    
gb|EMT17545.1|  hypothetical protein F775_29736                         308   1e-93    
ref|XP_008674925.1|  PREDICTED: interactor of constitutive active...    300   6e-92    
ref|XP_001754501.1|  predicted protein                                  295   2e-89    
ref|XP_001778664.1|  predicted protein                                  291   2e-87    
ref|XP_004159362.1|  PREDICTED: uncharacterized LOC101215534            281   1e-86    
ref|XP_001761779.1|  predicted protein                                  290   1e-86    
pdb|4DIX|A  Chain A, Crystal Structure Of The Ig-ph Domain Of Act...    279   3e-86    
ref|XP_001767383.1|  predicted protein                                  276   2e-82    
ref|XP_001777717.1|  predicted protein                                  276   3e-82    
tpg|DAA45492.1|  TPA: hypothetical protein ZEAMMB73_782278              273   6e-82    
ref|XP_004172976.1|  PREDICTED: uncharacterized LOC101215534            266   6e-81    
gb|EPS58051.1|  hypothetical protein M569_16765                         263   4e-80    
emb|CAN69648.1|  hypothetical protein VITISV_043238                     254   2e-76    Vitis vinifera
ref|NP_001137123.1|  uncharacterized protein LOC100217304               241   9e-71    Zea mays [maize]
gb|KDO53647.1|  hypothetical protein CISIN_1g0127252mg                  231   1e-68    
ref|NP_001050172.1|  Os03g0364500                                       221   6e-64    Oryza sativa Japonica Group [Japonica rice]
gb|ACJ83336.1|  unknown                                                 214   7e-62    Medicago truncatula
tpg|DAA63878.1|  TPA: hypothetical protein ZEAMMB73_650755              196   7e-54    
gb|KHN05999.1|  hypothetical protein glysoja_048539                     187   1e-51    
gb|EMS52536.1|  hypothetical protein TRIUR3_27268                       183   2e-47    
gb|KHG04375.1|  ribosomal rna large subunit methyltransferase i         173   3e-47    
ref|XP_003620242.1|  hypothetical protein MTR_6g079040                  171   3e-46    
gb|ACJ07060.1|  expressed protein                                       169   7e-46    Triticum urartu
gb|ACJ07059.1|  expressed protein                                       168   1e-45    Aegilops speltoides
gb|ACJ07057.1|  expressed protein                                       167   4e-45    Secale cereale
gb|ACJ07058.1|  expressed protein                                       167   5e-45    Triticum monococcum [einkorn wheat]
gb|AFK36560.1|  unknown                                                 158   9e-42    
gb|EPS57928.1|  hypothetical protein M569_16888                         153   2e-40    
ref|XP_008362638.1|  PREDICTED: uncharacterized protein LOC103426324    140   1e-35    
emb|CDY46462.1|  BnaA08g06460D                                          140   3e-35    
gb|KDP36625.1|  hypothetical protein JCGZ_08441                         121   3e-29    
gb|KDP36964.1|  hypothetical protein JCGZ_08556                         114   1e-26    
ref|XP_002980338.1|  hypothetical protein SELMODRAFT_420081             115   1e-24    
gb|AFW81568.1|  hypothetical protein ZEAMMB73_269241                    103   1e-21    
emb|CDY35368.1|  BnaA04g14790D                                        95.5    9e-20    
gb|AFW81567.1|  hypothetical protein ZEAMMB73_269241                  92.8    2e-17    
ref|XP_010908517.1|  PREDICTED: uncharacterized protein LOC105034896  88.6    3e-17    
dbj|BAK04085.1|  predicted protein                                    87.4    2e-16    
pdb|4DJG|A  Chain A, Crystal Structure Of The Coiled-coil 1 Domai...  84.7    2e-16    
dbj|BAK08073.1|  predicted protein                                    87.0    4e-16    
gb|AFK33883.1|  unknown                                               82.8    1e-15    
ref|XP_003623842.1|  hypothetical protein MTR_7g076240                72.0    1e-11    
gb|AFW75782.1|  putative O-Glycosyl hydrolase superfamily protein     74.7    3e-11    
gb|ABN08253.1|  hypothetical protein MtrDRAFT_AC155886g31v2           68.9    1e-10    Medicago truncatula
gb|EPS66863.1|  hypothetical protein M569_07915                       63.5    1e-08    
gb|KHN33797.1|  hypothetical protein glysoja_013803                   63.5    2e-08    
gb|AEW08891.1|  hypothetical protein CL2142Contig1_03                 59.3    2e-07    
gb|AFW88305.1|  hypothetical protein ZEAMMB73_412695                  53.5    3e-05    



>ref|XP_009610978.1| PREDICTED: uncharacterized protein LOC104104559 [Nicotiana tomentosiformis]
 ref|XP_009610979.1| PREDICTED: uncharacterized protein LOC104104559 [Nicotiana tomentosiformis]
 ref|XP_009610980.1| PREDICTED: uncharacterized protein LOC104104559 [Nicotiana tomentosiformis]
 ref|XP_009610981.1| PREDICTED: uncharacterized protein LOC104104559 [Nicotiana tomentosiformis]
Length=493

 Score =   764 bits (1972),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 384/483 (80%), Positives = 436/483 (90%), Gaps = 1/483 (0%)
 Frame = +1

Query  130   MTKVSPEFVGGEVQMYTFKSVSADVSFASNQFPKYKLGPDFQILEEALLENKGPSLKevv  309
             MTKVSPEFV  E QM T +SVS DVS A+NQFPKYKLGP+F++L+E   ++KGP LKEVV
Sbjct  1     MTKVSPEFVD-EPQMQTVQSVSTDVSLANNQFPKYKLGPNFEVLQETKEDDKGPPLKEVV  59

Query  310   eeettRLTEQHKRLSVRDLASKFDKNLSSAAKLANEAKLRDAPSLEGHVLLKKLRDALET  489
             EEETTRLTEQH RLSVRDLASKFDKNL++AAKL+NEAK+R+ PSLEGHVLLKKLRD+LE 
Sbjct  60    EEETTRLTEQHNRLSVRDLASKFDKNLAAAAKLSNEAKIREVPSLEGHVLLKKLRDSLEF  119

Query  490   LKGRLAGRNKEDVEIAIAMVEALAVRLTQKEGDLIQEKFEVNKLVSILKQASEDAKKLVN  669
             LKGRL G NKED+EIAI++VEALAV+LTQ EG+LIQEKFEV KLV+ LKQASEDAK+LVN
Sbjct  120   LKGRLTGLNKEDIEIAISLVEALAVKLTQNEGELIQEKFEVKKLVNFLKQASEDAKRLVN  179

Query  670   QERSFACAEIESARAVVQRIGEALEEQEINSQVSGKQeveelmeeiqeARRIRVLHQPSK  849
             QERSFACAEIESAR+VVQRIGEAL+E+E NS  S KQEVE L+EE+QEARRI++LHQPSK
Sbjct  180   QERSFACAEIESARSVVQRIGEALDEEERNSPTSAKQEVEGLLEEVQEARRIKLLHQPSK  239

Query  850   VMDMEHELRALRIQLNEKSVVSFKLQNELAMSKRTEQNKSQLYRIIGSESVGSILRIQPC  1029
             VMDMEHELRALRIQ+ EKS VS KLQ ELAMS+R  QNKS+ Y + GSE++GSILRIQ C
Sbjct  240   VMDMEHELRALRIQIREKSTVSIKLQKELAMSRRAGQNKSEFYELTGSETLGSILRIQSC  299

Query  1030  SDEAVDLSKCSIQWYRLSSECSRREPILGADKSVYAPEPIDVGRVLEADIVSNGLKASVT  1209
             SDEA+D+SKCSIQWYRLSSECSRREPI+GADK VYAPEPIDVGR+LEADIVSNG K S+T
Sbjct  300   SDEAIDISKCSIQWYRLSSECSRREPIVGADKFVYAPEPIDVGRLLEADIVSNGQKVSLT  359

Query  1210  TIGQIDQAAGLGNYVETLLRKSNTEFSVVIAQMNGRNYSSRSIHSFHVGKMRMKLNKGWI  1389
             T   +D A+GLG+YVETLLRKSN EFSV+IAQMNGRNYSSRS H FHVGK ++KL KGWI
Sbjct  360   TTAPVDSASGLGSYVETLLRKSNVEFSVIIAQMNGRNYSSRSAHCFHVGKTKLKLGKGWI  419

Query  1390  TKARDSYSGSMQLCGFRGGGNSAAKSLFWQPRKGQSFVLVFDSERERNGALVVARKHALE  1569
             TKARDSYSG+MQLCGFRGGGNSAAKSLFWQPRKG SFVLVF+SE+ERNGAL+VARK+A++
Sbjct  420   TKARDSYSGTMQLCGFRGGGNSAAKSLFWQPRKGHSFVLVFESEKERNGALMVARKYAID  479

Query  1570  CNV  1578
             CNV
Sbjct  480   CNV  482



>ref|XP_009795615.1| PREDICTED: uncharacterized protein LOC104242282 [Nicotiana sylvestris]
 ref|XP_009795616.1| PREDICTED: uncharacterized protein LOC104242282 [Nicotiana sylvestris]
 ref|XP_009795617.1| PREDICTED: uncharacterized protein LOC104242282 [Nicotiana sylvestris]
Length=493

 Score =   758 bits (1958),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 383/483 (79%), Positives = 434/483 (90%), Gaps = 1/483 (0%)
 Frame = +1

Query  130   MTKVSPEFVGGEVQMYTFKSVSADVSFASNQFPKYKLGPDFQILEEALLENKGPSLKevv  309
             MTKVSPEFV  E QM T +S+S DVS A+NQFPKYKLGP+F++L+E    ++GP LKEVV
Sbjct  1     MTKVSPEFVD-EPQMQTVQSISTDVSLANNQFPKYKLGPNFEVLQETKEYDQGPPLKEVV  59

Query  310   eeettRLTEQHKRLSVRDLASKFDKNLSSAAKLANEAKLRDAPSLEGHVLLKKLRDALET  489
             EEETTRLTEQH RLSVRDLASKFDKNL++AAKL+NEAK+R+ PSLEGHVLLKKLRD+LE 
Sbjct  60    EEETTRLTEQHNRLSVRDLASKFDKNLAAAAKLSNEAKIREVPSLEGHVLLKKLRDSLEF  119

Query  490   LKGRLAGRNKEDVEIAIAMVEALAVRLTQKEGDLIQEKFEVNKLVSILKQASEDAKKLVN  669
             LKGRL G NKED+EIAI++VEALAV+LTQ EG+LIQEKFEV KLV+ LKQASEDAK+LVN
Sbjct  120   LKGRLTGLNKEDIEIAISLVEALAVKLTQNEGELIQEKFEVKKLVNFLKQASEDAKRLVN  179

Query  670   QERSFACAEIESARAVVQRIGEALEEQEINSQVSGKQeveelmeeiqeARRIRVLHQPSK  849
             QERSFACAEIESAR+VVQRIGEAL+E+E NS  S KQEVE L+EE+QEARRI++LHQPSK
Sbjct  180   QERSFACAEIESARSVVQRIGEALDEEERNSPTSAKQEVEGLLEEVQEARRIKLLHQPSK  239

Query  850   VMDMEHELRALRIQLNEKSVVSFKLQNELAMSKRTEQNKSQLYRIIGSESVGSILRIQPC  1029
             VMDMEHELRALRIQ+ EKS VS KLQ ELAMS+R  QNKS+ Y + G E++GSILRIQ C
Sbjct  240   VMDMEHELRALRIQIREKSTVSIKLQKELAMSRRAGQNKSEFYELTGFETLGSILRIQSC  299

Query  1030  SDEAVDLSKCSIQWYRLSSECSRREPILGADKSVYAPEPIDVGRVLEADIVSNGLKASVT  1209
             SDEA+D+SKCSIQWYRLSSECSRREPI+GADK VYAPEPIDVGR+LEADIVSNG K S+T
Sbjct  300   SDEAIDISKCSIQWYRLSSECSRREPIVGADKFVYAPEPIDVGRLLEADIVSNGQKVSLT  359

Query  1210  TIGQIDQAAGLGNYVETLLRKSNTEFSVVIAQMNGRNYSSRSIHSFHVGKMRMKLNKGWI  1389
             T   ID A+GLG+YVETLLRKSN EFSVVIAQMNGRNYSSRS H FHVGK ++KL KGWI
Sbjct  360   TTAPIDPASGLGSYVETLLRKSNVEFSVVIAQMNGRNYSSRSAHCFHVGKTKLKLGKGWI  419

Query  1390  TKARDSYSGSMQLCGFRGGGNSAAKSLFWQPRKGQSFVLVFDSERERNGALVVARKHALE  1569
             TKARDSYSGSMQLCGFRGGGNSAAKSLFWQPRKG SFVLVF+SE+ERNGAL++ARK+A++
Sbjct  420   TKARDSYSGSMQLCGFRGGGNSAAKSLFWQPRKGHSFVLVFESEKERNGALMIARKYAID  479

Query  1570  CNV  1578
             CNV
Sbjct  480   CNV  482



>emb|CDP06214.1| unnamed protein product [Coffea canephora]
Length=493

 Score =   751 bits (1939),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 380/485 (78%), Positives = 433/485 (89%), Gaps = 1/485 (0%)
 Frame = +1

Query  130   MTKVSPEFVGGEVQMYTFKSVSADVSFASNQFPKYKLGPDFQILEEALLENKGPSLKevv  309
             MT++SPEF GGEV+M T +S+SADVSFA +QFPKYKLGPD Q+LEE     KGP LKEV+
Sbjct  1     MTRISPEF-GGEVEMQTIRSLSADVSFACDQFPKYKLGPDNQVLEEIEENAKGPPLKEVI  59

Query  310   eeettRLTEQHKRLSVRDLASKFDKNLSSAAKLANEAKLRDAPSLEGHVLLKKLRDALET  489
              +ETT LTEQHKRLSVRDLASKFDKNLS+AAKL+NEAKLR+  SLEGHVLLKKLRDALE 
Sbjct  60    LQETTELTEQHKRLSVRDLASKFDKNLSAAAKLSNEAKLREVASLEGHVLLKKLRDALEF  119

Query  490   LKGRLAGRNKEDVEIAIAMVEALAVRLTQKEGDLIQEKFEVNKLVSILKQASEDAKKLVN  669
             LKGR+ GRNKEDVE AI++VEALAV+LTQKEG+LIQEKFEV KL++ LKQASEDAKKLVN
Sbjct  120   LKGRMVGRNKEDVEKAISIVEALAVKLTQKEGELIQEKFEVKKLLNFLKQASEDAKKLVN  179

Query  670   QERSFACAEIESARAVVQRIGEALEEQEINSQVSGKQeveelmeeiqeARRIRVLHQPSK  849
             QERSFACAEIESARAVVQRIGEALEEQE   Q SGKQE+EELMEE+QEARRI++ HQPSK
Sbjct  180   QERSFACAEIESARAVVQRIGEALEEQERTCQTSGKQEMEELMEEVQEARRIKLKHQPSK  239

Query  850   VMDMEHELRALRIQLNEKSVVSFKLQNELAMSKRTEQNKSQLYRIIGSESVGSILRIQPC  1029
             VMDME+E+RALRI++ EKS +SF LQ EL M+KR E+NK   Y I GSE++GSILR+QPC
Sbjct  240   VMDMEYEVRALRIEIREKSSISFNLQKELLMNKRAEENKFLPYEISGSETLGSILRVQPC  299

Query  1030  SDEAVDLSKCSIQWYRLSSECSRREPILGADKSVYAPEPIDVGRVLEADIVSNGLKASVT  1209
             S+EA +L+KCSIQWYRLSSECSRREPILGA+KSVYAPEPID+GRVL+ DI SNG   SVT
Sbjct  300   SNEATELTKCSIQWYRLSSECSRREPILGANKSVYAPEPIDIGRVLQVDITSNGQTVSVT  359

Query  1210  TIGQIDQAAGLGNYVETLLRKSNTEFSVVIAQMNGRNYSSRSIHSFHVGKMRMKLNKGWI  1389
             T G ID AAGL NYVETLLRKSN+EF VV++QMNGRNYSS S H+FH+GKMRMKL +GWI
Sbjct  360   TAGPIDPAAGLENYVETLLRKSNSEFHVVVSQMNGRNYSSHSTHAFHIGKMRMKLCRGWI  419

Query  1390  TKARDSYSGSMQLCGFRGGGNSAAKSLFWQPRKGQSFVLVFDSERERNGALVVARKHALE  1569
             TKARDSYSGSMQLCGFRGGGNSAAKSL+WQPRKGQ+FVLVF+SERERNGAL++ARK+AL+
Sbjct  420   TKARDSYSGSMQLCGFRGGGNSAAKSLYWQPRKGQTFVLVFESERERNGALMLARKYALD  479

Query  1570  CNVSI  1584
              NV +
Sbjct  480   SNVML  484



>ref|XP_004249124.1| PREDICTED: uncharacterized protein LOC101264685 [Solanum lycopersicum]
 ref|XP_004249125.1| PREDICTED: uncharacterized protein LOC101264685 [Solanum lycopersicum]
Length=493

 Score =   748 bits (1931),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 378/483 (78%), Positives = 429/483 (89%), Gaps = 1/483 (0%)
 Frame = +1

Query  130   MTKVSPEFVGGEVQMYTFKSVSADVSFASNQFPKYKLGPDFQILEEALLENKGPSLKevv  309
             MTKVSPEFV  E QM   +SVS DVS ++NQFP YKLGP+F++L++   +NKGP LKEVV
Sbjct  1     MTKVSPEFVA-EPQMQIARSVSRDVSLSNNQFPTYKLGPNFEVLQDTKEDNKGPPLKEVV  59

Query  310   eeettRLTEQHKRLSVRDLASKFDKNLSSAAKLANEAKLRDAPSLEGHVLLKKLRDALET  489
             EEET RLTEQH RLSVRDLASKFDKNLS+AAKL+NEAK+R+APSLEGHVLLKKLRD+LE 
Sbjct  60    EEETNRLTEQHNRLSVRDLASKFDKNLSAAAKLSNEAKIREAPSLEGHVLLKKLRDSLEF  119

Query  490   LKGRLAGRNKEDVEIAIAMVEALAVRLTQKEGDLIQEKFEVNKLVSILKQASEDAKKLVN  669
             LKGRL G NKED+E  I++VEALAV+LTQ EG+LIQEKFEV KLV+ LKQASEDAK+LVN
Sbjct  120   LKGRLTGLNKEDIEKTISLVEALAVKLTQNEGELIQEKFEVKKLVNFLKQASEDAKRLVN  179

Query  670   QERSFACAEIESARAVVQRIGEALEEQEINSQVSGKQeveelmeeiqeARRIRVLHQPSK  849
             QERSFACAEIESAR+VVQRIGEAL+E+E NS  S KQEVE L+EE+QEARRI++LHQPSK
Sbjct  180   QERSFACAEIESARSVVQRIGEALDEEERNSPTSAKQEVEGLLEEVQEARRIKLLHQPSK  239

Query  850   VMDMEHELRALRIQLNEKSVVSFKLQNELAMSKRTEQNKSQLYRIIGSESVGSILRIQPC  1029
             VMDMEHELRALRIQ+ EKS VSFKLQ EL MS+R  QNKS+ Y +IGSE++GSI+RIQ C
Sbjct  240   VMDMEHELRALRIQIREKSTVSFKLQKELTMSRRAGQNKSEFYELIGSETLGSIIRIQSC  299

Query  1030  SDEAVDLSKCSIQWYRLSSECSRREPILGADKSVYAPEPIDVGRVLEADIVSNGLKASVT  1209
             S+EA+D+SKCSIQWYRLSSECSRREPI+GADK VYAPEPIDVGR+LEADIVSNG K S+T
Sbjct  300   SNEAIDVSKCSIQWYRLSSECSRREPIVGADKFVYAPEPIDVGRLLEADIVSNGQKVSLT  359

Query  1210  TIGQIDQAAGLGNYVETLLRKSNTEFSVVIAQMNGRNYSSRSIHSFHVGKMRMKLNKGWI  1389
             T   ID A+GLG+YVETL RKSN EFSVVIAQMNGRNYSSRS H FHVGK ++KL KGWI
Sbjct  360   TTAPIDPASGLGSYVETLFRKSNIEFSVVIAQMNGRNYSSRSAHCFHVGKTKLKLGKGWI  419

Query  1390  TKARDSYSGSMQLCGFRGGGNSAAKSLFWQPRKGQSFVLVFDSERERNGALVVARKHALE  1569
             TKARDSYS SMQLCGFRGGGNSAAKSLFW PRKG SFVLVF+SE+ERNGAL+ ARK+A++
Sbjct  420   TKARDSYSKSMQLCGFRGGGNSAAKSLFWLPRKGHSFVLVFESEKERNGALMAARKYAMD  479

Query  1570  CNV  1578
             CNV
Sbjct  480   CNV  482



>ref|XP_006364789.1| PREDICTED: uncharacterized protein LOC102582276 isoform X1 [Solanum 
tuberosum]
 ref|XP_006364790.1| PREDICTED: uncharacterized protein LOC102582276 isoform X2 [Solanum 
tuberosum]
 ref|XP_006364791.1| PREDICTED: uncharacterized protein LOC102582276 isoform X3 [Solanum 
tuberosum]
Length=493

 Score =   747 bits (1929),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 379/483 (78%), Positives = 428/483 (89%), Gaps = 1/483 (0%)
 Frame = +1

Query  130   MTKVSPEFVGGEVQMYTFKSVSADVSFASNQFPKYKLGPDFQILEEALLENKGPSLKevv  309
             MTKVSPEFV  E QM   +SVS DVS ++NQFP YKLGP+F++L++   +NKGP LKEVV
Sbjct  1     MTKVSPEFVE-EPQMQIVRSVSRDVSLSNNQFPTYKLGPNFEVLQDTKEDNKGPPLKEVV  59

Query  310   eeettRLTEQHKRLSVRDLASKFDKNLSSAAKLANEAKLRDAPSLEGHVLLKKLRDALET  489
             EEET RLTEQH RLSVRDLASKFDKNLS+AAKL+NEAK+R+APSLEGHVLLKKLRD+LE 
Sbjct  60    EEETDRLTEQHNRLSVRDLASKFDKNLSAAAKLSNEAKIREAPSLEGHVLLKKLRDSLEF  119

Query  490   LKGRLAGRNKEDVEIAIAMVEALAVRLTQKEGDLIQEKFEVNKLVSILKQASEDAKKLVN  669
             LKGRL G NKED+E AI++VEALAV+LTQ EG+LIQEKFEV KLV+ LKQASEDAK+LVN
Sbjct  120   LKGRLTGLNKEDIEKAISLVEALAVKLTQNEGELIQEKFEVKKLVNFLKQASEDAKRLVN  179

Query  670   QERSFACAEIESARAVVQRIGEALEEQEINSQVSGKQeveelmeeiqeARRIRVLHQPSK  849
             QERSFACAEIESAR+VVQRIGEAL+E+E NS  S KQEVE L+EE+QEARRI++LHQPSK
Sbjct  180   QERSFACAEIESARSVVQRIGEALDEEERNSPTSAKQEVEGLLEEVQEARRIKLLHQPSK  239

Query  850   VMDMEHELRALRIQLNEKSVVSFKLQNELAMSKRTEQNKSQLYRIIGSESVGSILRIQPC  1029
             VMDMEHELRALRIQ+ EKS VSFKLQ EL MS+R  QNKS+ Y + GSE +GSI+RIQ C
Sbjct  240   VMDMEHELRALRIQIREKSTVSFKLQKELTMSRRAGQNKSEFYELTGSEMLGSIIRIQSC  299

Query  1030  SDEAVDLSKCSIQWYRLSSECSRREPILGADKSVYAPEPIDVGRVLEADIVSNGLKASVT  1209
             SDEA+D+SKCSIQWYRLSSECSRREPI+GADK VYAPEPIDVGR+LEADIVSNG K S+T
Sbjct  300   SDEAIDVSKCSIQWYRLSSECSRREPIVGADKFVYAPEPIDVGRLLEADIVSNGQKVSLT  359

Query  1210  TIGQIDQAAGLGNYVETLLRKSNTEFSVVIAQMNGRNYSSRSIHSFHVGKMRMKLNKGWI  1389
             T   ID A+GLG+YVETL RKSN EFSVVIAQMNGRNYSSRS H FHVGK ++KL KGWI
Sbjct  360   TTAPIDPASGLGSYVETLFRKSNIEFSVVIAQMNGRNYSSRSAHCFHVGKTKLKLGKGWI  419

Query  1390  TKARDSYSGSMQLCGFRGGGNSAAKSLFWQPRKGQSFVLVFDSERERNGALVVARKHALE  1569
             TKARDSYS SMQLCGFRGGGNSAAKSLFW PRKG SFVLVF+SE+ERNGAL+ ARK+A++
Sbjct  420   TKARDSYSKSMQLCGFRGGGNSAAKSLFWLPRKGHSFVLVFESEKERNGALMAARKYAMD  479

Query  1570  CNV  1578
             CNV
Sbjct  480   CNV  482



>ref|XP_002283075.1| PREDICTED: uncharacterized protein LOC100267048 [Vitis vinifera]
 ref|XP_010653637.1| PREDICTED: uncharacterized protein LOC100267048 [Vitis vinifera]
 ref|XP_010653638.1| PREDICTED: uncharacterized protein LOC100267048 [Vitis vinifera]
 emb|CBI32809.3| unnamed protein product [Vitis vinifera]
Length=491

 Score =   704 bits (1816),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 357/483 (74%), Positives = 421/483 (87%), Gaps = 1/483 (0%)
 Frame = +1

Query  130   MTKVSPEFVGGEVQMYTFKSVSADVSFASNQFPKYKLGPDFQILEEALLENKGPSLKevv  309
             MTKVSPE VG ++Q     SVSADVSFASN FPKYK+GP+ QILEE  ++ K PSLKEVV
Sbjct  1     MTKVSPE-VGDKMQEEIVLSVSADVSFASNHFPKYKIGPNNQILEEPKVDPKAPSLKEVV  59

Query  310   eeettRLTEQHKRLSVRDLASKFDKNLSSAAKLANEAKLRDAPSLEGHVLLKKLRDALET  489
              +ET+ L EQ KRLSVRDLASKFDKNLS+AAKL +EA+LR+  SLEGHVLLKKLRDALE+
Sbjct  60    AQETSLLVEQQKRLSVRDLASKFDKNLSAAAKLNDEARLREVASLEGHVLLKKLRDALES  119

Query  490   LKGRLAGRNKEDVEIAIAMVEALAVRLTQKEGDLIQEKFEVNKLVSILKQASEDAKKLVN  669
             ++GRLAGRNKEDVE AI+MVEALAV+LTQ+EG+LIQEKFEV KL + LKQASEDAKKLV+
Sbjct  120   IRGRLAGRNKEDVEKAISMVEALAVKLTQREGELIQEKFEVKKLANFLKQASEDAKKLVS  179

Query  670   QERSFACAEIESARAVVQRIGEALEEQEINSQVSGKQeveelmeeiqeARRIRVLHQPSK  849
             QERSFACAEIESARAVVQR GEALEEQE NSQ S KQ+VE LM+E+QEAR+IR+ HQPSK
Sbjct  180   QERSFACAEIESARAVVQRFGEALEEQEKNSQASEKQDVEGLMDEVQEARKIRIRHQPSK  239

Query  850   VMDMEHELRALRIQLNEKSVVSFKLQNELAMSKRTEQNKSQLYRIIGSESVGSILRIQPC  1029
             VMDMEHELRALRIQ+ EKS+ S KLQ ELA+SKR E+N S+LY + GSE++GS LRIQPC
Sbjct  240   VMDMEHELRALRIQIREKSIFSVKLQKELAISKRAEENPSRLYELNGSETLGSYLRIQPC  299

Query  1030  SDEAVDLSKCSIQWYRLSSECSRREPILGADKSVYAPEPIDVGRVLEADIVSNGLKASVT  1209
             SD+A +L KCSIQWYR+SSE S+ EPI GA+KS+YAPEP DVGR+L+ADIVSNG KA+V 
Sbjct  300   SDKAPELLKCSIQWYRVSSESSKNEPISGANKSIYAPEPFDVGRILQADIVSNGQKATVM  359

Query  1210  TIGQIDQAAGLGNYVETLLRKSNTEFSVVIAQMNGRNYSSRSIHSFHVGKMRMKLNKGWI  1389
             T G I+ AAGLGNYV+TL+RK NTEF+VVI+Q NG+++ S S+H FHVGKMRMKL KGWI
Sbjct  360   TTGPIEHAAGLGNYVDTLMRKPNTEFNVVISQTNGQDHPSHSVHVFHVGKMRMKLCKGWI  419

Query  1390  TKARDSYSGSMQLCGFRGGGNSAAKSLFWQPRKGQSFVLVFDSERERNGALVVARKHALE  1569
             TKAR+SY+ SMQLCG RGGGN+AAK+LFWQ RKG SFVL F+SER+RN A+++AR++AL+
Sbjct  420   TKARESYTASMQLCGVRGGGNAAAKALFWQARKGHSFVLAFESERDRNAAIMLARRYALD  479

Query  1570  CNV  1578
             CNV
Sbjct  480   CNV  482



>ref|XP_011070092.1| PREDICTED: uncharacterized protein LOC105155823 [Sesamum indicum]
 ref|XP_011070093.1| PREDICTED: uncharacterized protein LOC105155823 [Sesamum indicum]
Length=491

 Score =   702 bits (1812),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 362/482 (75%), Positives = 420/482 (87%), Gaps = 3/482 (1%)
 Frame = +1

Query  130   MTKVSPEFVGGEVQMYTFKSVSADVSFASNQFPKYKLGPDFQILEEALLENKGPSLKevv  309
             MT+VSPEF G EVQ     ++SADVSF SNQFPKYKLGPD +ILEE   +NKGP LKEVV
Sbjct  1     MTRVSPEF-GDEVQ--AVWTLSADVSFQSNQFPKYKLGPDNEILEEIKEDNKGPPLKEVV  57

Query  310   eeettRLTEQHKRLSVRDLASKFDKNLSSAAKLANEAKLRDAPSLEGHVLLKKLRDALET  489
               ET +LTEQHKRLSVRDLASKFDKNL++AAKL+ EAKL++  SL+GHVLLKKLRDALE 
Sbjct  58    IRETNQLTEQHKRLSVRDLASKFDKNLAAAAKLSEEAKLKEVASLDGHVLLKKLRDALEC  117

Query  490   LKGRLAGRNKEDVEIAIAMVEALAVRLTQKEGDLIQEKFEVNKLVSILKQASEDAKKLVN  669
             LKGRLAGRNKEDVE AI+MVEALAV+LTQKEG+LIQEKFEV KLV+ LKQASEDAKKLVN
Sbjct  118   LKGRLAGRNKEDVEKAISMVEALAVKLTQKEGELIQEKFEVKKLVNFLKQASEDAKKLVN  177

Query  670   QERSFACAEIESARAVVQRIGEALEEQEINSQVSGKQeveelmeeiqeARRIRVLHQPSK  849
             QE+SFACAEIESAR+VVQRIGEALEEQE N     +QE+EEL+EE+QEARRIR++HQP K
Sbjct  178   QEKSFACAEIESARSVVQRIGEALEEQERNQNPGMQQELEELIEEVQEARRIRLMHQPRK  237

Query  850   VMDMEHELRALRIQLNEKSVVSFKLQNELAMSKRTEQNKSQLYRIIGSESVGSILRIQPC  1029
             V+DME ELR LR+Q+ EK  +S  LQNELA S + E+N  +LY + GSE++GSILRIQPC
Sbjct  238   VVDMESELRELRLQIREKCTISLNLQNELARSMKAEENMYRLYELSGSETLGSILRIQPC  297

Query  1030  SDEAVDLSKCSIQWYRLSSECSRREPILGADKSVYAPEPIDVGRVLEADIVSNGLKASVT  1209
             SD+AV+L+KCSIQWYRLSS+CSRRE ILGA+K VYAPEPID+GRVL+ADI SNGLK ++T
Sbjct  298   SDKAVELAKCSIQWYRLSSQCSRREAILGANKCVYAPEPIDIGRVLQADITSNGLKVTLT  357

Query  1210  TIGQIDQAAGLGNYVETLLRKSNTEFSVVIAQMNGRNYSSRSIHSFHVGKMRMKLNKGWI  1389
             T G I QA+ LG+Y+E LLRK N +FSVVI+QMNGRNYSS S+H FH+GK R+KL++GWI
Sbjct  358   TDGPIKQASDLGSYLEALLRKPNNDFSVVISQMNGRNYSSHSVHLFHIGKTRIKLSRGWI  417

Query  1390  TKARDSYSGSMQLCGFRGGGNSAAKSLFWQPRKGQSFVLVFDSERERNGALVVARKHALE  1569
             TKAR+SYS SMQLCGFRGGGNSAAKSLFWQ RKGQSFVLVF+SERERNGAL +ARK+A +
Sbjct  418   TKARESYSRSMQLCGFRGGGNSAAKSLFWQARKGQSFVLVFESERERNGALTLARKYASD  477

Query  1570  CN  1575
             CN
Sbjct  478   CN  479



>ref|XP_011079082.1| PREDICTED: uncharacterized protein LOC105162690 isoform X1 [Sesamum 
indicum]
Length=502

 Score =   693 bits (1789),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 361/486 (74%), Positives = 418/486 (86%), Gaps = 3/486 (1%)
 Frame = +1

Query  121   TGKMTKVSPEFVGGEVQMYTFKSVSADVSFASNQFPKYKLGPDFQILEEALLENKGPSLK  300
              G MT++SPEF G E +     SVS+DVSF S QFPKY+LGPD QILEE   +NKGP LK
Sbjct  9     VGPMTRISPEF-GDEGE--GVWSVSSDVSFQSIQFPKYRLGPDNQILEEVKEDNKGPPLK  65

Query  301   evveeettRLTEQHKRLSVRDLASKFDKNLSSAAKLANEAKLRDAPSLEGHVLLKKLRDA  480
             EVV EE  +L+EQHKRLSVRDLASKFDKNL++AAKL+ EAKLR+  SLEGHVLLKKLRDA
Sbjct  66    EVVAEEINQLSEQHKRLSVRDLASKFDKNLAAAAKLSEEAKLREVASLEGHVLLKKLRDA  125

Query  481   LETLKGRLAGRNKEDVEIAIAMVEALAVRLTQKEGDLIQEKFEVNKLVSILKQASEDAKK  660
             LE LKGRLAG+NK+DVE AI+MVEALAV+LTQKEG+LIQEKFEV KLV+ LKQASEDAKK
Sbjct  126   LECLKGRLAGQNKDDVEKAISMVEALAVKLTQKEGELIQEKFEVKKLVNFLKQASEDAKK  185

Query  661   LVNQERSFACAEIESARAVVQRIGEALEEQEINSQVSGKQeveelmeeiqeARRIRVLHQ  840
             LVNQE+SFACAEIESARAVVQRIGEALEEQE N     +QE+EEL+EE+QEARRI++ HQ
Sbjct  186   LVNQEKSFACAEIESARAVVQRIGEALEEQERNQSSGKQQELEELIEEVQEARRIKLKHQ  245

Query  841   PSKVMDMEHELRALRIQLNEKSVVSFKLQNELAMSKRTEQNKSQLYRIIGSESVGSILRI  1020
             P KVMDMEHELR LR+Q+ EK  +S  LQNELAM K+ ++N  +LY + GSE++GSILRI
Sbjct  246   PMKVMDMEHELRELRLQIREKCTISVNLQNELAMMKKVDENIPRLYELNGSETLGSILRI  305

Query  1021  QPCSDEAVDLSKCSIQWYRLSSECSRREPILGADKSVYAPEPIDVGRVLEADIVSNGLKA  1200
             QPCS++A +L+KCSIQWYRLSS+CSRREPILGA K VYAPEPIDVGRVL+ADIV+NG K 
Sbjct  306   QPCSEKATELAKCSIQWYRLSSQCSRREPILGAHKCVYAPEPIDVGRVLQADIVANGQKI  365

Query  1201  SVTTIGQIDQAAGLGNYVETLLRKSNTEFSVVIAQMNGRNYSSRSIHSFHVGKMRMKLNK  1380
              +TT G I QA  LG+YVETLLRK N +FSVVI+QMNGRNYSS+S H FH+GK R+KL++
Sbjct  366   WITTHGPIAQAIDLGSYVETLLRKPNHDFSVVISQMNGRNYSSQSAHLFHIGKTRIKLSR  425

Query  1381  GWITKARDSYSGSMQLCGFRGGGNSAAKSLFWQPRKGQSFVLVFDSERERNGALVVARKH  1560
             GWITKAR+SYS SMQLCGFRGGGN A KSLFWQ RKGQSFVLVF SE+ERNGAL++ARK+
Sbjct  426   GWITKARESYSKSMQLCGFRGGGNLAGKSLFWQARKGQSFVLVFGSEQERNGALILARKY  485

Query  1561  ALECNV  1578
             AL+CNV
Sbjct  486   ALDCNV  491



>ref|XP_011079083.1| PREDICTED: uncharacterized protein LOC105162690 isoform X2 [Sesamum 
indicum]
Length=491

 Score =   692 bits (1785),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 358/484 (74%), Positives = 414/484 (86%), Gaps = 5/484 (1%)
 Frame = +1

Query  130   MTKVSPEFVGGEVQMYTFKSVSADVSFASNQFPKYKLGPDFQILEEALLENKGPSLKevv  309
             MT++SPEF G E +     SVS+DVSF S QFPKY+LGPD QILEE   +NKGP LKEVV
Sbjct  1     MTRISPEF-GDEGE--GVWSVSSDVSFQSIQFPKYRLGPDNQILEEVKEDNKGPPLKEVV  57

Query  310   eeettRLTEQHKRLSVRDLASKFDKNLSSAAKLANEAKLRDAPSLEGHVLLKKLRDALET  489
              EE  +L+EQHKRLSVRDLASKFDKNL++AAKL+ EAKLR+  SLEGHVLLKKLRDALE 
Sbjct  58    AEEINQLSEQHKRLSVRDLASKFDKNLAAAAKLSEEAKLREVASLEGHVLLKKLRDALEC  117

Query  490   LKGRLAGRNKEDVEIAIAMVEALAVRLTQKEGDLIQEKFEVNKLVSILKQASEDAKKLVN  669
             LKGRLAG+NK+DVE AI+MVEALAV+LTQKEG+LIQEKFEV KLV+ LKQASEDAKKLVN
Sbjct  118   LKGRLAGQNKDDVEKAISMVEALAVKLTQKEGELIQEKFEVKKLVNFLKQASEDAKKLVN  177

Query  670   QERSFACAEIESARAVVQRIGEALEEQEINSQVSGKQeveelmeeiqe-ARRIRVLHQPS  846
             QE+SFACAEIESARAVVQRIGEALEEQE N Q SGKQ+  E + E  + ARRI++ HQP 
Sbjct  178   QEKSFACAEIESARAVVQRIGEALEEQERN-QSSGKQQELEELIEEVQEARRIKLKHQPM  236

Query  847   KVMDMEHELRALRIQLNEKSVVSFKLQNELAMSKRTEQNKSQLYRIIGSESVGSILRIQP  1026
             KVMDMEHELR LR+Q+ EK  +S  LQNELAM K+ ++N  +LY + GSE++GSILRIQP
Sbjct  237   KVMDMEHELRELRLQIREKCTISVNLQNELAMMKKVDENIPRLYELNGSETLGSILRIQP  296

Query  1027  CSDEAVDLSKCSIQWYRLSSECSRREPILGADKSVYAPEPIDVGRVLEADIVSNGLKASV  1206
             CS++A +L+KCSIQWYRLSS+CSRREPILGA K VYAPEPIDVGRVL+ADIV+NG K  +
Sbjct  297   CSEKATELAKCSIQWYRLSSQCSRREPILGAHKCVYAPEPIDVGRVLQADIVANGQKIWI  356

Query  1207  TTIGQIDQAAGLGNYVETLLRKSNTEFSVVIAQMNGRNYSSRSIHSFHVGKMRMKLNKGW  1386
             TT G I QA  LG+YVETLLRK N +FSVVI+QMNGRNYSS+S H FH+GK R+KL++GW
Sbjct  357   TTHGPIAQAIDLGSYVETLLRKPNHDFSVVISQMNGRNYSSQSAHLFHIGKTRIKLSRGW  416

Query  1387  ITKARDSYSGSMQLCGFRGGGNSAAKSLFWQPRKGQSFVLVFDSERERNGALVVARKHAL  1566
             ITKAR+SYS SMQLCGFRGGGN A KSLFWQ RKGQSFVLVF SE+ERNGAL++ARK+AL
Sbjct  417   ITKARESYSKSMQLCGFRGGGNLAGKSLFWQARKGQSFVLVFGSEQERNGALILARKYAL  476

Query  1567  ECNV  1578
             +CNV
Sbjct  477   DCNV  480



>gb|EYU18600.1| hypothetical protein MIMGU_mgv1a005347mg [Erythranthe guttata]
Length=488

 Score =   687 bits (1774),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 358/484 (74%), Positives = 417/484 (86%), Gaps = 8/484 (2%)
 Frame = +1

Query  130   MTKVSPEFVGGEVQMYTFKSVSADVSFASNQFPKYKLGPDFQILEEALLENKGPSLKevv  309
             MT+VSPE +G EV      +VS+DVSF SNQFPKYKLGP+ +ILEE   E KGP LKEVV
Sbjct  1     MTRVSPE-IGDEVW-----TVSSDVSFRSNQFPKYKLGPNNEILEEIKEEIKGPPLKEVV  54

Query  310   eeettRLTEQHKRLSVRDLASKFDKNLSSAAKLANEAKLRDAPSLEGHVLLKKLRDALET  489
               ET +LTEQHKRLSVRDLASKFDKNL++AAKL+ EAK+++  SL+GHVLLKKLRDALE 
Sbjct  55    LNETNQLTEQHKRLSVRDLASKFDKNLAAAAKLSEEAKIKEVASLDGHVLLKKLRDALEY  114

Query  490   LKGRLAGRNKEDVEIAIAMVEALAVRLTQKEGDLIQEKFEVNKLVSILKQASEDAKKLVN  669
             LKGRLAGRNKEDVE AI++VEALAV+LTQKEG+LIQEKFEV KLV+ LKQASEDAKKLVN
Sbjct  115   LKGRLAGRNKEDVERAISLVEALAVKLTQKEGELIQEKFEVKKLVNFLKQASEDAKKLVN  174

Query  670   QERSFACAEIESARAVVQRIGEALEEQEINSQVSGKQeveelmeeiqe-ARRIRVLHQPS  846
             QE+SFACAEIESARAVVQRIGEAL+EQE N Q SGKQ+  E + E  + ARRIR++HQP 
Sbjct  175   QEKSFACAEIESARAVVQRIGEALDEQERN-QSSGKQQELEELVEEVQEARRIRLMHQPR  233

Query  847   KVMDMEHELRALRIQLNEKSVVSFKLQNELAMSKRTEQNKSQLYRIIGSESVGSILRIQP  1026
             KV+DMEHELR LR+Q+ EK  +S  LQN+LAMS + ++N S++Y I GSES+ SILRIQP
Sbjct  234   KVVDMEHELRELRLQIREKCTISVNLQNQLAMSMKADENTSRVYEISGSESLSSILRIQP  293

Query  1027  CSDEAVDLSKCSIQWYRLSSECSRREPILGADKSVYAPEPIDVGRVLEADIVSNGLKASV  1206
             CS++A+DL+KCSIQWYRLS +CSRREPILGA K VYAPEPIDVGRVL+ADI SNGLK ++
Sbjct  294   CSNDAIDLAKCSIQWYRLSPQCSRREPILGAHKCVYAPEPIDVGRVLQADITSNGLKVTI  353

Query  1207  TTIGQIDQAAGLGNYVETLLRKSNTEFSVVIAQMNGRNYSSRSIHSFHVGKMRMKLNKGW  1386
             TT G I QA+ L +Y+ETLLRK N +FSVVI+QMNGRNYSS S H FH+GK ++KL++GW
Sbjct  354   TTNGPIQQASELASYLETLLRKPNNDFSVVISQMNGRNYSSHSAHLFHIGKTKIKLSRGW  413

Query  1387  ITKARDSYSGSMQLCGFRGGGNSAAKSLFWQPRKGQSFVLVFDSERERNGALVVARKHAL  1566
             ITKARDSYS SMQLCGFRGGGNSAAKSLFWQ RKGQSFVLVF+SERERNGALV+ARK+A 
Sbjct  414   ITKARDSYSRSMQLCGFRGGGNSAAKSLFWQSRKGQSFVLVFESERERNGALVLARKYAS  473

Query  1567  ECNV  1578
             +CNV
Sbjct  474   DCNV  477



>ref|XP_002517279.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF45072.1| conserved hypothetical protein [Ricinus communis]
Length=509

 Score =   672 bits (1734),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 343/487 (70%), Positives = 411/487 (84%), Gaps = 3/487 (1%)
 Frame = +1

Query  130   MTKVSPEFVGGEVQMYTFKSVSADVSFASNQFPKYKLGPDFQILEEALLENKGPSLKevv  309
             MTK+SPE     ++      VSADVSFASN+FPKYKLGPD QILEE   ENKGPSLKEVV
Sbjct  1     MTKISPEMQEA-MRTEIILPVSADVSFASNEFPKYKLGPDNQILEEPKEENKGPSLKEVV  59

Query  310   eeettRLTEQHKRLSVRDLASKFDKNLSSAAKLANEAKLRDAPSLEGHVLLKKLRDALET  489
             E+ET +L +QHKRLSVRDLASKFDKNL++AAK+  EAKLR+  SLEGHVLLKKLRDALE+
Sbjct  60    EQETMQLADQHKRLSVRDLASKFDKNLAAAAKMTEEAKLREVASLEGHVLLKKLRDALES  119

Query  490   LKGRLAGRNKEDVEIAIAMVEALAVRLTQKEGDLIQEKFEVNKLVSILKQASEDAKKLVN  669
             L+GR+AGRNKEDVE AI+MVEALAV+LTQKEG+LIQEKFEV KL + LKQASEDAKKLVN
Sbjct  120   LRGRMAGRNKEDVEQAISMVEALAVKLTQKEGELIQEKFEVKKLANFLKQASEDAKKLVN  179

Query  670   QERSFACAEIESARAVVQRIGEALEEQEINSQVSGKQeveel--meeiqeARRIRVLHQP  843
             QE+SFACAEIESARAVVQR GEAL+E+E N+Q S  Q  +    +EE+QEARRI++LHQP
Sbjct  180   QEKSFACAEIESARAVVQRFGEALDEEEKNAQNSKNQTPDVDGLVEEVQEARRIKLLHQP  239

Query  844   SKVMDMEHELRALRIQLNEKSVVSFKLQNELAMSKRTEQNKSQLYRIIGSESVGSILRIQ  1023
             SKVMDMEHELRALR Q+ EKS+ S KLQNELAMSKR EQNKS  Y + GS ++GS +++Q
Sbjct  240   SKVMDMEHELRALRAQIREKSIFSVKLQNELAMSKRAEQNKSSPYILDGSATLGSCMQVQ  299

Query  1024  PCSDEAVDLSKCSIQWYRLSSECSRREPILGADKSVYAPEPIDVGRVLEADIVSNGLKAS  1203
             P SD +  LSKCSIQWYR+S + S++E ILGA+ S YAPEP DVGRVL+ADI+SNG +AS
Sbjct  300   PRSDSSPPLSKCSIQWYRVSCDGSQKEAILGANTSTYAPEPFDVGRVLQADIISNGQRAS  359

Query  1204  VTTIGQIDQAAGLGNYVETLLRKSNTEFSVVIAQMNGRNYSSRSIHSFHVGKMRMKLNKG  1383
             VTT   I+ AAGLG+YVETLLRKS++EF+VVI+QMNG+++ S S+H+ +VGKMR+KL +G
Sbjct  360   VTTTAPIETAAGLGSYVETLLRKSSSEFNVVISQMNGQDHPSHSVHALNVGKMRIKLCRG  419

Query  1384  WITKARDSYSGSMQLCGFRGGGNSAAKSLFWQPRKGQSFVLVFDSERERNGALVVARKHA  1563
             WITKAR+ YS  MQLCG R  GN+AAK+LFWQPRKG S+VL F+SERERN A+++ARK+A
Sbjct  420   WITKAREIYSTPMQLCGVRTNGNAAAKALFWQPRKGLSYVLTFESERERNAAIMLARKYA  479

Query  1564  LECNVSI  1584
              +CNVSI
Sbjct  480   YDCNVSI  486



>ref|XP_008359578.1| PREDICTED: uncharacterized protein LOC103423286 [Malus domestica]
 ref|XP_008359579.1| PREDICTED: uncharacterized protein LOC103423286 [Malus domestica]
 ref|XP_008359580.1| PREDICTED: uncharacterized protein LOC103423286 [Malus domestica]
Length=491

 Score =   671 bits (1730),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 344/483 (71%), Positives = 412/483 (85%), Gaps = 1/483 (0%)
 Frame = +1

Query  130   MTKVSPEFVGGEVQMYTFKSVSADVSFASNQFPKYKLGPDFQILEEALLENKGPSLKevv  309
             MTK+SP F   E+      SVSADVSF S+ FPKYKLGPD QILEE    + GP++KEVV
Sbjct  1     MTKISPAF-EEEIPTEGVLSVSADVSFISDGFPKYKLGPDNQILEEPKENSDGPTVKEVV  59

Query  310   eeettRLTEQHKRLSVRDLASKFDKNLSSAAKLANEAKLRDAPSLEGHVLLKKLRDALET  489
             E+ETT L+EQHKRLSVRDLASKFDKNL +AAKL+ EAKLR+  SLEGHVLLKKLRDALE 
Sbjct  60    EQETTHLSEQHKRLSVRDLASKFDKNLVAAAKLSEEAKLREVASLEGHVLLKKLRDALEH  119

Query  490   LKGRLAGRNKEDVEIAIAMVEALAVRLTQKEGDLIQEKFEVNKLVSILKQASEDAKKLVN  669
             L+GRLAGRNKEDVE AI+MVEALAV+LTQKEG+LIQEKFEV KL S LKQASEDAKKLVN
Sbjct  120   LRGRLAGRNKEDVEKAISMVEALAVKLTQKEGELIQEKFEVKKLASFLKQASEDAKKLVN  179

Query  670   QERSFACAEIESARAVVQRIGEALEEQEINSQVSGKQeveelmeeiqeARRIRVLHQPSK  849
             QE+SFACAEIESARAVVQRIGEALEEQ+I  + S KQ+VEEL+E +QEARRI+++HQPSK
Sbjct  180   QEKSFACAEIESARAVVQRIGEALEEQDITFEASKKQDVEELVEVVQEARRIKLMHQPSK  239

Query  850   VMDMEHELRALRIQLNEKSVVSFKLQNELAMSKRTEQNKSQLYRIIGSESVGSILRIQPC  1029
             VMDMEHELRALR Q+ EK +VS KLQ ELAM+KR E+NKS LY I GSE++G+ LRIQP 
Sbjct  240   VMDMEHELRALRTQIREKCIVSVKLQKELAMNKRAEENKSSLYLIDGSETLGAYLRIQPV  299

Query  1030  SDEAVDLSKCSIQWYRLSSECSRREPILGADKSVYAPEPIDVGRVLEADIVSNGLKASVT  1209
             S+ A  LS C+IQWYR+SS+ SR E I GA+KS+YAPEP DVGR+L+ADI+SN  +  V 
Sbjct  300   SENAPQLSNCAIQWYRVSSDGSRNEAISGANKSIYAPEPFDVGRILQADIISNDQRVIVM  359

Query  1210  TIGQIDQAAGLGNYVETLLRKSNTEFSVVIAQMNGRNYSSRSIHSFHVGKMRMKLNKGWI  1389
             T G ID AAG+G+YV+TLLRKSNTEF+VVI++MNG++++S S+H+FHVGKMRMKL++GWI
Sbjct  360   TAGPIDPAAGIGSYVDTLLRKSNTEFNVVISKMNGQDHTSHSVHAFHVGKMRMKLSRGWI  419

Query  1390  TKARDSYSGSMQLCGFRGGGNSAAKSLFWQPRKGQSFVLVFDSERERNGALVVARKHALE  1569
             TK+R++YS SMQLCG RG   +AAK+LFWQ RKG SFVL F++ERERN A+++ARK+AL+
Sbjct  420   TKSRENYSSSMQLCGVRGDIANAAKALFWQARKGLSFVLTFETERERNAAIILARKYALD  479

Query  1570  CNV  1578
             CN+
Sbjct  480   CNI  482



>ref|XP_009339983.1| PREDICTED: uncharacterized protein LOC103932159 [Pyrus x bretschneideri]
 ref|XP_009339984.1| PREDICTED: uncharacterized protein LOC103932159 [Pyrus x bretschneideri]
Length=491

 Score =   669 bits (1726),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 342/483 (71%), Positives = 411/483 (85%), Gaps = 1/483 (0%)
 Frame = +1

Query  130   MTKVSPEFVGGEVQMYTFKSVSADVSFASNQFPKYKLGPDFQILEEALLENKGPSLKevv  309
             MTK+SP F   E+      SVSADVSF S+ FPKYKLGPD QILEE    + GP++KEVV
Sbjct  1     MTKISPAF-EEEIPTEGVLSVSADVSFISDGFPKYKLGPDNQILEEPKENSDGPTVKEVV  59

Query  310   eeettRLTEQHKRLSVRDLASKFDKNLSSAAKLANEAKLRDAPSLEGHVLLKKLRDALET  489
             E+ETT L+EQHKRLSVRDLASKFDKNL +AAKL+ EAKLR+  SLEGHVLLKKLRDALE 
Sbjct  60    EQETTHLSEQHKRLSVRDLASKFDKNLVAAAKLSEEAKLREVASLEGHVLLKKLRDALEH  119

Query  490   LKGRLAGRNKEDVEIAIAMVEALAVRLTQKEGDLIQEKFEVNKLVSILKQASEDAKKLVN  669
             L+GRLAGRNKEDVE AI+MVEALAV+LTQKEG+LIQEKFEV KL S LKQASEDAKKLVN
Sbjct  120   LRGRLAGRNKEDVEKAISMVEALAVKLTQKEGELIQEKFEVKKLASFLKQASEDAKKLVN  179

Query  670   QERSFACAEIESARAVVQRIGEALEEQEINSQVSGKQeveelmeeiqeARRIRVLHQPSK  849
             QE+SFACAEIESARAVVQRIGEALEEQ+I  + S KQ+VEEL+E +QEARRI+++HQPSK
Sbjct  180   QEKSFACAEIESARAVVQRIGEALEEQDITFEASKKQDVEELVEVVQEARRIKLMHQPSK  239

Query  850   VMDMEHELRALRIQLNEKSVVSFKLQNELAMSKRTEQNKSQLYRIIGSESVGSILRIQPC  1029
             VMDMEHELRALR Q+ EK +VS KLQ ELAM+KR E+NKS LY I GSE++G+ LRIQP 
Sbjct  240   VMDMEHELRALRTQIREKCIVSVKLQKELAMNKRAEENKSSLYLIDGSETLGAYLRIQPV  299

Query  1030  SDEAVDLSKCSIQWYRLSSECSRREPILGADKSVYAPEPIDVGRVLEADIVSNGLKASVT  1209
             S+ A  LS C+IQWYR+SS+ SR E I GA+KS+YAPEP DVGR+L+ADI+SN  +  + 
Sbjct  300   SENAPQLSNCAIQWYRVSSDGSRNEAISGANKSIYAPEPFDVGRILQADIISNDQRVILM  359

Query  1210  TIGQIDQAAGLGNYVETLLRKSNTEFSVVIAQMNGRNYSSRSIHSFHVGKMRMKLNKGWI  1389
             T G ID AAG+G+YV+TLLRKSNTEF+VVI++MNG++++S S+H+FHVGKMRMKL++GWI
Sbjct  360   TAGPIDPAAGIGSYVDTLLRKSNTEFNVVISKMNGQDHTSHSVHAFHVGKMRMKLSRGWI  419

Query  1390  TKARDSYSGSMQLCGFRGGGNSAAKSLFWQPRKGQSFVLVFDSERERNGALVVARKHALE  1569
             TK+R++YS SMQLCG RG   +AAK+LFWQ RKG SFVL F++ERERN A+++ARK+A +
Sbjct  420   TKSRENYSSSMQLCGVRGDITNAAKALFWQARKGLSFVLTFETERERNAAIILARKYAFD  479

Query  1570  CNV  1578
             CN+
Sbjct  480   CNI  482



>ref|XP_008227319.1| PREDICTED: uncharacterized protein LOC103326844 [Prunus mume]
Length=491

 Score =   669 bits (1725),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 347/485 (72%), Positives = 412/485 (85%), Gaps = 5/485 (1%)
 Frame = +1

Query  130   MTKVSPEFVGGEVQMYT--FKSVSADVSFASNQFPKYKLGPDFQILEEALLENKGPSLKe  303
             MTK+SPEF   E Q+ T    SVSADVSF SN FPKYKLGP+ QILEE    N GP+LKE
Sbjct  1     MTKISPEF---EDQILTEGVLSVSADVSFISNGFPKYKLGPNNQILEEPKENNDGPTLKE  57

Query  304   vveeettRLTEQHKRLSVRDLASKFDKNLSSAAKLANEAKLRDAPSLEGHVLLKKLRDAL  483
             VVE ETT L+EQHKRLSVRDLASKFDKNL++AAKL  EAKLR+  SLEGHVLLKKLRDAL
Sbjct  58    VVERETTHLSEQHKRLSVRDLASKFDKNLAAAAKLTEEAKLREVASLEGHVLLKKLRDAL  117

Query  484   ETLKGRLAGRNKEDVEIAIAMVEALAVRLTQKEGDLIQEKFEVNKLVSILKQASEDAKKL  663
             E L+GRLAGRNKEDVE AI+MVEALAV+LTQKEG+LIQEKFEV KL S LKQASEDAKKL
Sbjct  118   EHLRGRLAGRNKEDVEKAISMVEALAVKLTQKEGELIQEKFEVKKLASFLKQASEDAKKL  177

Query  664   VNQERSFACAEIESARAVVQRIGEALEEQEINSQVSGKQeveelmeeiqeARRIRVLHQP  843
             VNQE+SFACAEIESARAVVQRIGEAL+EQ+  S+ S KQ+VEEL+E +QEARRI+++HQP
Sbjct  178   VNQEKSFACAEIESARAVVQRIGEALDEQDTTSEASKKQDVEELVEVVQEARRIKLMHQP  237

Query  844   SKVMDMEHELRALRIQLNEKSVVSFKLQNELAMSKRTEQNKSQLYRIIGSESVGSILRIQ  1023
             SKVMDMEHELRALR Q+ EK + S KLQ ELAMSK  E+NKS LY I GSE++G+ LRIQ
Sbjct  238   SKVMDMEHELRALRTQIREKCIFSVKLQKELAMSKWAEENKSCLYLIDGSETLGAYLRIQ  297

Query  1024  PCSDEAVDLSKCSIQWYRLSSECSRREPILGADKSVYAPEPIDVGRVLEADIVSNGLKAS  1203
             P S+ A  LSKC+IQWYR+SS+ SR E I GA+KS+YAPEP DVGR+L+ADI+SN  + +
Sbjct  298   PRSENAPQLSKCAIQWYRVSSDGSRNEAISGANKSIYAPEPFDVGRILQADIISNDQRVT  357

Query  1204  VTTIGQIDQAAGLGNYVETLLRKSNTEFSVVIAQMNGRNYSSRSIHSFHVGKMRMKLNKG  1383
             VTT   ID AAGLG+YV+TLLRKSNTEF+VVI+++NG+++ S S+H+FHVGKMRMKL++G
Sbjct  358   VTTACPIDPAAGLGSYVDTLLRKSNTEFNVVISKVNGQDHPSHSVHAFHVGKMRMKLSRG  417

Query  1384  WITKARDSYSGSMQLCGFRGGGNSAAKSLFWQPRKGQSFVLVFDSERERNGALVVARKHA  1563
             WITK+R+ YS SMQLCG RG   +AAK+++WQ RKG SFVL F++ERERN A+++ARK+A
Sbjct  418   WITKSREIYSSSMQLCGVRGDITNAAKAMYWQARKGLSFVLTFETERERNAAIILARKYA  477

Query  1564  LECNV  1578
             L+CNV
Sbjct  478   LDCNV  482



>ref|XP_007201975.1| hypothetical protein PRUPE_ppa004791mg [Prunus persica]
 gb|EMJ03174.1| hypothetical protein PRUPE_ppa004791mg [Prunus persica]
Length=491

 Score =   665 bits (1717),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 346/485 (71%), Positives = 412/485 (85%), Gaps = 5/485 (1%)
 Frame = +1

Query  130   MTKVSPEFVGGEVQMYT--FKSVSADVSFASNQFPKYKLGPDFQILEEALLENKGPSLKe  303
             MTK++PEF   E Q+ T    SVSADVSF S+ FPKYKLGP+ QILEE    N GP+LKE
Sbjct  1     MTKINPEF---EDQIPTEGVLSVSADVSFISDGFPKYKLGPNNQILEEPKENNDGPTLKE  57

Query  304   vveeettRLTEQHKRLSVRDLASKFDKNLSSAAKLANEAKLRDAPSLEGHVLLKKLRDAL  483
             VVE ETT L+EQHKRLSVRDLASKFDKNL++AAKL  EAKLR+  SLEGHVLLKKLRDAL
Sbjct  58    VVERETTHLSEQHKRLSVRDLASKFDKNLAAAAKLTEEAKLREVASLEGHVLLKKLRDAL  117

Query  484   ETLKGRLAGRNKEDVEIAIAMVEALAVRLTQKEGDLIQEKFEVNKLVSILKQASEDAKKL  663
             E L+GRLAGRNKEDVE AI+MVEALAV+LTQKEG+LIQEKFEV KL S LKQASEDAKKL
Sbjct  118   EHLRGRLAGRNKEDVEKAISMVEALAVKLTQKEGELIQEKFEVKKLASFLKQASEDAKKL  177

Query  664   VNQERSFACAEIESARAVVQRIGEALEEQEINSQVSGKQeveelmeeiqeARRIRVLHQP  843
             VNQE+SFACAEIESARAVVQRIGEAL+EQ+  S+ S KQ+VEEL+E +QEARRI+++HQP
Sbjct  178   VNQEKSFACAEIESARAVVQRIGEALDEQDTTSEASKKQDVEELVEVVQEARRIKLMHQP  237

Query  844   SKVMDMEHELRALRIQLNEKSVVSFKLQNELAMSKRTEQNKSQLYRIIGSESVGSILRIQ  1023
             SKVMDMEHELRALR Q+ EK + S KLQ ELAMSK  E+NKS LY I GSE++G+ LRIQ
Sbjct  238   SKVMDMEHELRALRTQIREKCIFSVKLQKELAMSKWAEENKSCLYLIDGSETLGAYLRIQ  297

Query  1024  PCSDEAVDLSKCSIQWYRLSSECSRREPILGADKSVYAPEPIDVGRVLEADIVSNGLKAS  1203
             P S+ A  LSKC+IQWYR+SS+ SR E I GA+KS+YAPEP DVGR+L+ADI+SN  + +
Sbjct  298   PRSENAPQLSKCAIQWYRVSSDGSRNEAISGANKSIYAPEPFDVGRILQADIISNDQRVT  357

Query  1204  VTTIGQIDQAAGLGNYVETLLRKSNTEFSVVIAQMNGRNYSSRSIHSFHVGKMRMKLNKG  1383
             VTT   ID AAGLG+YV+TLLRKSNTEF+VVI+++NG+++ S S+H+FHVGKMRMKL++G
Sbjct  358   VTTACPIDPAAGLGSYVDTLLRKSNTEFNVVISKVNGQDHPSHSVHAFHVGKMRMKLSRG  417

Query  1384  WITKARDSYSGSMQLCGFRGGGNSAAKSLFWQPRKGQSFVLVFDSERERNGALVVARKHA  1563
             WITK+R+ YS SMQLCG RG   +AAK++FWQ RKG SFVL F++ERERN A+++ARK+A
Sbjct  418   WITKSREIYSSSMQLCGVRGDITNAAKAMFWQARKGLSFVLTFETERERNAAIILARKYA  477

Query  1564  LECNV  1578
             L+CNV
Sbjct  478   LDCNV  482



>ref|XP_006482052.1| PREDICTED: restin homolog isoform X1 [Citrus sinensis]
 ref|XP_006482053.1| PREDICTED: restin homolog isoform X2 [Citrus sinensis]
 ref|XP_006482054.1| PREDICTED: restin homolog isoform X3 [Citrus sinensis]
Length=491

 Score =   659 bits (1699),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 343/483 (71%), Positives = 412/483 (85%), Gaps = 1/483 (0%)
 Frame = +1

Query  130   MTKVSPEFVGGEVQMYTFKSVSADVSFASNQFPKYKLGPDFQILEEALLENKGPSLKevv  309
             MTK+SPE +  +VQ  +  SVSADVSF+SN FPKYKLGPD QI+EE+  ++KG SLKEVV
Sbjct  1     MTKISPE-IEEDVQAESLLSVSADVSFSSNCFPKYKLGPDNQIVEESKEDSKGLSLKEVV  59

Query  310   eeettRLTEQHKRLSVRDLASKFDKNLSSAAKLANEAKLRDAPSLEGHVLLKKLRDALET  489
             E+ET +L+EQHKRLSVRDLASKFDKNL++AAKLA+EAKLRD  SLEGHVLLKKLRDALE 
Sbjct  60    EKETVQLSEQHKRLSVRDLASKFDKNLTAAAKLADEAKLRDVASLEGHVLLKKLRDALEA  119

Query  490   LKGRLAGRNKEDVEIAIAMVEALAVRLTQKEGDLIQEKFEVNKLVSILKQASEDAKKLVN  669
             L+GR+AGR KEDVE AI++VEALAV+LTQ EG+LIQEKFEV KL + LKQASEDAKKLVN
Sbjct  120   LRGRMAGRTKEDVEKAISLVEALAVKLTQNEGELIQEKFEVKKLANFLKQASEDAKKLVN  179

Query  670   QERSFACAEIESARAVVQRIGEALEEQEINSQVSGKQeveelmeeiqeARRIRVLHQPSK  849
             QE+SFACAEIESARAVVQR GEALEE+E NS  S  Q+VE L++EIQEARRI+ LHQPSK
Sbjct  180   QEKSFACAEIESARAVVQRFGEALEEEEKNSPKSKTQDVERLVDEIQEARRIKRLHQPSK  239

Query  850   VMDMEHELRALRIQLNEKSVVSFKLQNELAMSKRTEQNKSQLYRIIGSESVGSILRIQPC  1029
             VMDMEHEL ALR Q+ EKSV+S K+Q ELAM+KR E+NKS LY   GSE++GS LRI+P 
Sbjct  240   VMDMEHELHALRTQIREKSVLSLKIQKELAMNKRAEENKSCLYVFDGSEALGSHLRIRPR  299

Query  1030  SDEAVDLSKCSIQWYRLSSECSRREPILGADKSVYAPEPIDVGRVLEADIVSNGLKASVT  1209
             SD A  LSKCSIQWYR+S + S++E I GA K  YAPEP+DVGRVL+ADI+SNG K +VT
Sbjct  300   SDTAPSLSKCSIQWYRVSLDGSQKEIISGASKLAYAPEPLDVGRVLQADILSNGQKITVT  359

Query  1210  TIGQIDQAAGLGNYVETLLRKSNTEFSVVIAQMNGRNYSSRSIHSFHVGKMRMKLNKGWI  1389
             ++G I+ AAGLG+YVETLLRKS++EF+VVI+QMNG++Y S S H F+VGK+R+KL +GWI
Sbjct  360   SVGPIESAAGLGSYVETLLRKSSSEFNVVISQMNGQDYLSHSNHCFNVGKLRIKLCRGWI  419

Query  1390  TKARDSYSGSMQLCGFRGGGNSAAKSLFWQPRKGQSFVLVFDSERERNGALVVARKHALE  1569
             TK+R+ Y  SMQLCG RG  N+AAKSLFWQ RKG S+VL F+SE+ERN A+++ARKHAL+
Sbjct  420   TKSREIYHTSMQLCGVRGDSNAAAKSLFWQARKGLSYVLTFESEKERNAAIMIARKHALD  479

Query  1570  CNV  1578
             CN+
Sbjct  480   CNI  482



>ref|XP_006430520.1| hypothetical protein CICLE_v10011580mg [Citrus clementina]
 gb|ESR43760.1| hypothetical protein CICLE_v10011580mg [Citrus clementina]
Length=491

 Score =   658 bits (1698),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 344/483 (71%), Positives = 413/483 (86%), Gaps = 1/483 (0%)
 Frame = +1

Query  130   MTKVSPEFVGGEVQMYTFKSVSADVSFASNQFPKYKLGPDFQILEEALLENKGPSLKevv  309
             MTK+SPE +  +VQ  +  SVSADVSF+SN FPKYKLGP+ QI+EE+  ++KG SLKEVV
Sbjct  1     MTKISPE-IEEDVQAESLLSVSADVSFSSNCFPKYKLGPENQIVEESKEDSKGLSLKEVV  59

Query  310   eeettRLTEQHKRLSVRDLASKFDKNLSSAAKLANEAKLRDAPSLEGHVLLKKLRDALET  489
             E+ET +L+EQHKRLSVRDLASKFDKNL++AAKLA+EAKLRD  SLEGHVLLKKLRDALE 
Sbjct  60    EKETVQLSEQHKRLSVRDLASKFDKNLTAAAKLADEAKLRDVASLEGHVLLKKLRDALEA  119

Query  490   LKGRLAGRNKEDVEIAIAMVEALAVRLTQKEGDLIQEKFEVNKLVSILKQASEDAKKLVN  669
             L+GR+AGR KEDVE AI++VEALAV+LTQ EG+LIQEKFEV KL + LKQASEDAKKLVN
Sbjct  120   LRGRMAGRTKEDVEKAISLVEALAVKLTQNEGELIQEKFEVKKLANFLKQASEDAKKLVN  179

Query  670   QERSFACAEIESARAVVQRIGEALEEQEINSQVSGKQeveelmeeiqeARRIRVLHQPSK  849
             QE+SFACAEIESARAVVQR GEALEE+E NS  S  Q+VE L++EIQEARRI+ LHQPSK
Sbjct  180   QEKSFACAEIESARAVVQRFGEALEEEEKNSPKSKTQDVERLVDEIQEARRIKRLHQPSK  239

Query  850   VMDMEHELRALRIQLNEKSVVSFKLQNELAMSKRTEQNKSQLYRIIGSESVGSILRIQPC  1029
             VMDMEHEL ALR Q+ EKSV+S K+Q ELAM+KR E+NKS LY   GSE++GS LRI+P 
Sbjct  240   VMDMEHELLALRTQIREKSVLSLKIQKELAMNKRAEENKSCLYVFDGSEALGSHLRIRPR  299

Query  1030  SDEAVDLSKCSIQWYRLSSECSRREPILGADKSVYAPEPIDVGRVLEADIVSNGLKASVT  1209
             SD A  LSKCSIQWYR+S + S++E I GA K  YAPEP+DVGRVL+ADI+SNG K +VT
Sbjct  300   SDTAPSLSKCSIQWYRVSLDGSQKEIISGASKLAYAPEPLDVGRVLQADILSNGQKITVT  359

Query  1210  TIGQIDQAAGLGNYVETLLRKSNTEFSVVIAQMNGRNYSSRSIHSFHVGKMRMKLNKGWI  1389
             + G I+ AAGLG+YVETLLRKS++EF+VVI+QMNG++YSS S H F+VGK+R+KL +GWI
Sbjct  360   SAGPIESAAGLGSYVETLLRKSSSEFNVVISQMNGQDYSSHSNHCFNVGKLRIKLCRGWI  419

Query  1390  TKARDSYSGSMQLCGFRGGGNSAAKSLFWQPRKGQSFVLVFDSERERNGALVVARKHALE  1569
             TK+R+ Y  SMQLCG RG GN+AAKSLFWQ RKG S+VL F+SE+ERN A+++ARKHAL+
Sbjct  420   TKSREIYHTSMQLCGVRGDGNAAAKSLFWQARKGLSYVLTFESEKERNAAIMIARKHALD  479

Query  1570  CNV  1578
             CN+
Sbjct  480   CNI  482



>ref|XP_008455735.1| PREDICTED: uncharacterized protein LOC103495837 isoform X1 [Cucumis 
melo]
 ref|XP_008455736.1| PREDICTED: uncharacterized protein LOC103495837 isoform X1 [Cucumis 
melo]
Length=491

 Score =   658 bits (1698),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 340/485 (70%), Positives = 408/485 (84%), Gaps = 1/485 (0%)
 Frame = +1

Query  130   MTKVSPEFVGGEVQMYTFKSVSADVSFASNQFPKYKLGPDFQILEEALLENKGPSLKevv  309
             MTK+SPEF    + M     VS DVSFASNQFPKYKLGPD QILEE   +++GPSLKEV+
Sbjct  1     MTKISPEF-EETMHMEGILPVSVDVSFASNQFPKYKLGPDNQILEEPQDDDQGPSLKEVI  59

Query  310   eeettRLTEQHKRLSVRDLASKFDKNLSSAAKLANEAKLRDAPSLEGHVLLKKLRDALET  489
             E+ET +L+EQHKRLSVRDLA KFDKNLSSAAKL++EAKLR+ PSLEGHVLLKKLRDALE 
Sbjct  60    EQETAQLSEQHKRLSVRDLACKFDKNLSSAAKLSDEAKLREVPSLEGHVLLKKLRDALEY  119

Query  490   LKGRLAGRNKEDVEIAIAMVEALAVRLTQKEGDLIQEKFEVNKLVSILKQASEDAKKLVN  669
             LKGRLAGRNKEDVE AI+MVEALAV+LTQKEG+LIQEKFEV KL + LKQASEDAK+LVN
Sbjct  120   LKGRLAGRNKEDVEKAISMVEALAVKLTQKEGELIQEKFEVKKLATFLKQASEDAKRLVN  179

Query  670   QERSFACAEIESARAVVQRIGEALEEQEINSQVSGKQeveelmeeiqeARRIRVLHQPSK  849
             QE+SFACAEIESARAVVQRIGEALEEQE NS  S KQ+VE L+EE+QEARRI+ LHQPSK
Sbjct  180   QEKSFACAEIESARAVVQRIGEALEEQEKNSDDSNKQDVEGLVEEVQEARRIKQLHQPSK  239

Query  850   VMDMEHELRALRIQLNEKSVVSFKLQNELAMSKRTEQNKSQLYRIIGSESVGSILRIQPC  1029
             V+ MEHELRALR  + EKS++S KLQ EL M KR  +NKS  Y + GSE++GS LRI+  
Sbjct  240   VLGMEHELRALRATIREKSIISAKLQRELTMCKRAAENKSCFYGLDGSETLGSFLRIKCA  299

Query  1030  SDEAVDLSKCSIQWYRLSSECSRREPILGADKSVYAPEPIDVGRVLEADIVSNGLKASVT  1209
             SD A  LSKCSIQWYR+SS+CS ++ I GA KS+YA EP+DVGR L+ ++VSNG K ++ 
Sbjct  300   SDVAPPLSKCSIQWYRMSSDCSWKQVITGATKSIYALEPLDVGRTLQVEVVSNGQKVNLM  359

Query  1210  TIGQIDQAAGLGNYVETLLRKSNTEFSVVIAQMNGRNYSSRSIHSFHVGKMRMKLNKGWI  1389
             T G I+ AAGLG +VETLLRKSN+EF+V I+QMNG++Y+S S+H FHVGKMRMKL++GWI
Sbjct  360   TTGPIESAAGLGTHVETLLRKSNSEFNVTISQMNGQDYASNSVHVFHVGKMRMKLSRGWI  419

Query  1390  TKARDSYSGSMQLCGFRGGGNSAAKSLFWQPRKGQSFVLVFDSERERNGALVVARKHALE  1569
             TKAR++YS SMQLCG R   ++A K+LFWQ RKG SF+L+F+SER+RN A+++ARK+A +
Sbjct  420   TKARENYSSSMQLCGVRDDRSTATKALFWQGRKGLSFMLMFESERDRNAAIMLARKYAND  479

Query  1570  CNVSI  1584
             CNV +
Sbjct  480   CNVML  484



>ref|XP_010036381.1| PREDICTED: uncharacterized protein LOC104425391 [Eucalyptus grandis]
 gb|KCW47928.1| hypothetical protein EUGRSUZ_K01667 [Eucalyptus grandis]
 gb|KCW47929.1| hypothetical protein EUGRSUZ_K01667 [Eucalyptus grandis]
Length=491

 Score =   657 bits (1696),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 343/486 (71%), Positives = 413/486 (85%), Gaps = 3/486 (1%)
 Frame = +1

Query  130   MTKVSPEFVGGEVQMYTFKSVSADVSFASNQFPKYKLGPDFQILEEALLENKGPSLKevv  309
             MTKVSPE  G   Q     +VSADVSFAS+ FPKYKLGPD QILEE   +NKGPSLKEVV
Sbjct  1     MTKVSPELGGMGSQEVL--AVSADVSFASDCFPKYKLGPDNQILEEPKDDNKGPSLKEVV  58

Query  310   eeettRLTEQHKRLSVRDLASKFDKNLSSAAKLANEAKLRD-APSLEGHVLLKKLRDALE  486
             E+ET +L+EQHKRLSVRDLASKFDKNL++AAKL+NEAKLR+   SLEGHVLLKKLRDALE
Sbjct  59    EKETAQLSEQHKRLSVRDLASKFDKNLAAAAKLSNEAKLREEVASLEGHVLLKKLRDALE  118

Query  487   TLKGRLAGRNKEDVEIAIAMVEALAVRLTQKEGDLIQEKFEVNKLVSILKQASEDAKKLV  666
             +L+GRL+G+NKEDVE AI+MVEALAV+LTQKEG+LIQEKFEV KLV+ LKQASEDAKKLV
Sbjct  119   SLRGRLSGQNKEDVEKAISMVEALAVKLTQKEGELIQEKFEVKKLVNFLKQASEDAKKLV  178

Query  667   NQERSFACAEIESARAVVQRIGEALEEQEINSQVSGKQeveelmeeiqeARRIRVLHQPS  846
             +QE SFACAEIESARAVVQR GEALEE+E NSQ S KQ+VEEL++E+QEARRI++LHQPS
Sbjct  179   SQENSFACAEIESARAVVQRFGEALEEEERNSQTSKKQDVEELLQEVQEARRIKLLHQPS  238

Query  847   KVMDMEHELRALRIQLNEKSVVSFKLQNELAMSKRTEQNKSQLYRIIGSESVGSILRIQP  1026
             KVMDMEHELRALR+Q+ EKS+ SFKLQ EL MS+R E+N+S+LY + G E++GS LR++P
Sbjct  239   KVMDMEHELRALRLQIREKSIFSFKLQKELTMSRRAEENRSRLYILDGCEALGSNLRVRP  298

Query  1027  CSDEAVDLSKCSIQWYRLSSECSRREPILGADKSVYAPEPIDVGRVLEADIVSNGLKASV  1206
             C++ A  L KCSIQW+R+SS+ S+R+ I GA+   YAPEP+DVGR+L A+I+ NG K SV
Sbjct  299   CAENAPALCKCSIQWFRISSDGSQRDAISGANSPSYAPEPLDVGRILVAEIILNGNKDSV  358

Query  1207  TTIGQIDQAAGLGNYVETLLRKSNTEFSVVIAQMNGRNYSSRSIHSFHVGKMRMKLNKGW  1386
              TIG ID  AGL ++VETL+RKSN EF+V I+QMNG+++ S S H FHVGK R+KL +GW
Sbjct  359   ATIGPIDPVAGLESHVETLMRKSNAEFTVTISQMNGQDHQSHSSHMFHVGKTRVKLCRGW  418

Query  1387  ITKARDSYSGSMQLCGFRGGGNSAAKSLFWQPRKGQSFVLVFDSERERNGALVVARKHAL  1566
             ITKARD YS SMQLCG R  G++AAK LFWQPRKG SFVL F+SER+RN A+++ARK+AL
Sbjct  419   ITKARDIYSTSMQLCGDRSDGSAAAKGLFWQPRKGSSFVLTFESERDRNAAIMLARKYAL  478

Query  1567  ECNVSI  1584
             +CNV +
Sbjct  479   DCNVML  484



>ref|XP_008455737.1| PREDICTED: myosin-11-like isoform X2 [Cucumis melo]
Length=482

 Score =   656 bits (1692),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 339/482 (70%), Positives = 406/482 (84%), Gaps = 1/482 (0%)
 Frame = +1

Query  130   MTKVSPEFVGGEVQMYTFKSVSADVSFASNQFPKYKLGPDFQILEEALLENKGPSLKevv  309
             MTK+SPEF    + M     VS DVSFASNQFPKYKLGPD QILEE   +++GPSLKEV+
Sbjct  1     MTKISPEF-EETMHMEGILPVSVDVSFASNQFPKYKLGPDNQILEEPQDDDQGPSLKEVI  59

Query  310   eeettRLTEQHKRLSVRDLASKFDKNLSSAAKLANEAKLRDAPSLEGHVLLKKLRDALET  489
             E+ET +L+EQHKRLSVRDLA KFDKNLSSAAKL++EAKLR+ PSLEGHVLLKKLRDALE 
Sbjct  60    EQETAQLSEQHKRLSVRDLACKFDKNLSSAAKLSDEAKLREVPSLEGHVLLKKLRDALEY  119

Query  490   LKGRLAGRNKEDVEIAIAMVEALAVRLTQKEGDLIQEKFEVNKLVSILKQASEDAKKLVN  669
             LKGRLAGRNKEDVE AI+MVEALAV+LTQKEG+LIQEKFEV KL + LKQASEDAK+LVN
Sbjct  120   LKGRLAGRNKEDVEKAISMVEALAVKLTQKEGELIQEKFEVKKLATFLKQASEDAKRLVN  179

Query  670   QERSFACAEIESARAVVQRIGEALEEQEINSQVSGKQeveelmeeiqeARRIRVLHQPSK  849
             QE+SFACAEIESARAVVQRIGEALEEQE NS  S KQ+VE L+EE+QEARRI+ LHQPSK
Sbjct  180   QEKSFACAEIESARAVVQRIGEALEEQEKNSDDSNKQDVEGLVEEVQEARRIKQLHQPSK  239

Query  850   VMDMEHELRALRIQLNEKSVVSFKLQNELAMSKRTEQNKSQLYRIIGSESVGSILRIQPC  1029
             V+ MEHELRALR  + EKS++S KLQ EL M KR  +NKS  Y + GSE++GS LRI+  
Sbjct  240   VLGMEHELRALRATIREKSIISAKLQRELTMCKRAAENKSCFYGLDGSETLGSFLRIKCA  299

Query  1030  SDEAVDLSKCSIQWYRLSSECSRREPILGADKSVYAPEPIDVGRVLEADIVSNGLKASVT  1209
             SD A  LSKCSIQWYR+SS+CS ++ I GA KS+YA EP+DVGR L+ ++VSNG K ++ 
Sbjct  300   SDVAPPLSKCSIQWYRMSSDCSWKQVITGATKSIYALEPLDVGRTLQVEVVSNGQKVNLM  359

Query  1210  TIGQIDQAAGLGNYVETLLRKSNTEFSVVIAQMNGRNYSSRSIHSFHVGKMRMKLNKGWI  1389
             T G I+ AAGLG +VETLLRKSN+EF+V I+QMNG++Y+S S+H FHVGKMRMKL++GWI
Sbjct  360   TTGPIESAAGLGTHVETLLRKSNSEFNVTISQMNGQDYASNSVHVFHVGKMRMKLSRGWI  419

Query  1390  TKARDSYSGSMQLCGFRGGGNSAAKSLFWQPRKGQSFVLVFDSERERNGALVVARKHALE  1569
             TKAR++YS SMQLCG R   ++A K+LFWQ RKG SF+L+F+SER+RN A+++ARK+A +
Sbjct  420   TKARENYSSSMQLCGVRDDRSTATKALFWQGRKGLSFMLMFESERDRNAAIMLARKYAND  479

Query  1570  CN  1575
             CN
Sbjct  480   CN  481



>ref|XP_004170254.1| PREDICTED: uncharacterized protein LOC101224204 [Cucumis sativus]
Length=491

 Score =   656 bits (1692),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 339/485 (70%), Positives = 407/485 (84%), Gaps = 1/485 (0%)
 Frame = +1

Query  130   MTKVSPEFVGGEVQMYTFKSVSADVSFASNQFPKYKLGPDFQILEEALLENKGPSLKevv  309
             MTK+SPEF    + M     VS DVSFASNQFPKYKLGPD QILEE   +++GPSLKEVV
Sbjct  1     MTKISPEF-EETMHMEGILPVSVDVSFASNQFPKYKLGPDNQILEEPQDDDQGPSLKEVV  59

Query  310   eeettRLTEQHKRLSVRDLASKFDKNLSSAAKLANEAKLRDAPSLEGHVLLKKLRDALET  489
             E+ET +L++QHKRLSVRDLA KFDKNLSSAAKL++EAKLR+ PSLEGHVLLKKLRDALE 
Sbjct  60    EQETAQLSDQHKRLSVRDLACKFDKNLSSAAKLSDEAKLREVPSLEGHVLLKKLRDALEY  119

Query  490   LKGRLAGRNKEDVEIAIAMVEALAVRLTQKEGDLIQEKFEVNKLVSILKQASEDAKKLVN  669
             LKGRLAGRNKEDVE AI+MVEALAV+LTQKEG+LIQEKFEV KL + LKQASEDAK+LVN
Sbjct  120   LKGRLAGRNKEDVEKAISMVEALAVKLTQKEGELIQEKFEVKKLATFLKQASEDAKRLVN  179

Query  670   QERSFACAEIESARAVVQRIGEALEEQEINSQVSGKQeveelmeeiqeARRIRVLHQPSK  849
             QE+SFACAEIESARAVVQRIGEALEEQE NS  S KQ+V+ L+EE+QEARRI+ LHQPSK
Sbjct  180   QEKSFACAEIESARAVVQRIGEALEEQEKNSDDSNKQDVDGLVEEVQEARRIKQLHQPSK  239

Query  850   VMDMEHELRALRIQLNEKSVVSFKLQNELAMSKRTEQNKSQLYRIIGSESVGSILRIQPC  1029
             VM MEHELRALR  + EKS++S KLQ EL M KR  +NKS  Y + GSE++GS LRI+  
Sbjct  240   VMGMEHELRALRATIREKSIISAKLQRELTMCKRAAENKSCFYVLDGSETLGSFLRIKCA  299

Query  1030  SDEAVDLSKCSIQWYRLSSECSRREPILGADKSVYAPEPIDVGRVLEADIVSNGLKASVT  1209
             SD A  LSKCSIQWYR+SS+CS ++ I GA KS+YA EP+DVGR L+ ++VSNG K ++ 
Sbjct  300   SDVAPPLSKCSIQWYRMSSDCSWKQVITGATKSIYALEPLDVGRTLQVEVVSNGQKVNLM  359

Query  1210  TIGQIDQAAGLGNYVETLLRKSNTEFSVVIAQMNGRNYSSRSIHSFHVGKMRMKLNKGWI  1389
             T G I+ AAGLG +VE LLRKSN+EF+V I+QMNG++Y+S S+H FHVGKMRMKL++GWI
Sbjct  360   TTGPIESAAGLGTHVEMLLRKSNSEFNVTISQMNGQDYASNSVHVFHVGKMRMKLSRGWI  419

Query  1390  TKARDSYSGSMQLCGFRGGGNSAAKSLFWQPRKGQSFVLVFDSERERNGALVVARKHALE  1569
             TKAR++YS SMQLCG R   ++A K+LFWQ RKG SF+L+F+SER+RN A+++ARK+A +
Sbjct  420   TKARENYSSSMQLCGVRDDRSTATKALFWQGRKGLSFMLMFESERDRNAAIMLARKYAND  479

Query  1570  CNVSI  1584
             CNV +
Sbjct  480   CNVML  484



>ref|XP_004144324.1| PREDICTED: uncharacterized protein LOC101217442 [Cucumis sativus]
 gb|KGN54686.1| hypothetical protein Csa_4G425750 [Cucumis sativus]
Length=491

 Score =   655 bits (1691),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 338/485 (70%), Positives = 407/485 (84%), Gaps = 1/485 (0%)
 Frame = +1

Query  130   MTKVSPEFVGGEVQMYTFKSVSADVSFASNQFPKYKLGPDFQILEEALLENKGPSLKevv  309
             MTK+SPEF    + M     VS DVSFASNQFPKYKLGPD QILEE   +++GPSLKEV+
Sbjct  1     MTKISPEF-EETMHMEGILPVSVDVSFASNQFPKYKLGPDNQILEEPQDDDQGPSLKEVI  59

Query  310   eeettRLTEQHKRLSVRDLASKFDKNLSSAAKLANEAKLRDAPSLEGHVLLKKLRDALET  489
             E+ET +L++QHKRLSVRDLA KFDKNLSSAAKL++EAKLR+ PSLEGHVLLKKLRDALE 
Sbjct  60    EQETAQLSDQHKRLSVRDLACKFDKNLSSAAKLSDEAKLREVPSLEGHVLLKKLRDALEY  119

Query  490   LKGRLAGRNKEDVEIAIAMVEALAVRLTQKEGDLIQEKFEVNKLVSILKQASEDAKKLVN  669
             LKGRLAGRNKEDVE AI+MVEALAV+LTQKEG+LIQEKFEV KL + LKQASEDAK+LVN
Sbjct  120   LKGRLAGRNKEDVEKAISMVEALAVKLTQKEGELIQEKFEVKKLATFLKQASEDAKRLVN  179

Query  670   QERSFACAEIESARAVVQRIGEALEEQEINSQVSGKQeveelmeeiqeARRIRVLHQPSK  849
             QE+SFACAEIESARAVVQRIGEALEEQE NS  S KQ+V+ L+EE+QEARRI+ LHQPSK
Sbjct  180   QEKSFACAEIESARAVVQRIGEALEEQEKNSDDSNKQDVDGLVEEVQEARRIKQLHQPSK  239

Query  850   VMDMEHELRALRIQLNEKSVVSFKLQNELAMSKRTEQNKSQLYRIIGSESVGSILRIQPC  1029
             VM MEHELRALR  + EKS++S KLQ EL M KR  +NKS  Y + GSE++GS LRI+  
Sbjct  240   VMGMEHELRALRATIREKSIISAKLQRELTMCKRAAENKSCFYVLDGSETLGSFLRIKCA  299

Query  1030  SDEAVDLSKCSIQWYRLSSECSRREPILGADKSVYAPEPIDVGRVLEADIVSNGLKASVT  1209
             SD A  LSKCSIQWYR+SS+CS ++ I GA KS+YA EP+DVGR L+ ++VSNG K ++ 
Sbjct  300   SDVAPPLSKCSIQWYRMSSDCSWKQVITGATKSIYALEPLDVGRTLQVEVVSNGQKVNLM  359

Query  1210  TIGQIDQAAGLGNYVETLLRKSNTEFSVVIAQMNGRNYSSRSIHSFHVGKMRMKLNKGWI  1389
             T G I+ AAGLG +VE LLRKSN+EF+V I+QMNG++Y+S S+H FHVGKMRMKL++GWI
Sbjct  360   TTGPIESAAGLGTHVEMLLRKSNSEFNVTISQMNGQDYASNSVHVFHVGKMRMKLSRGWI  419

Query  1390  TKARDSYSGSMQLCGFRGGGNSAAKSLFWQPRKGQSFVLVFDSERERNGALVVARKHALE  1569
             TKAR++YS SMQLCG R   ++A K+LFWQ RKG SF+L+F+SER+RN A+++ARK+A +
Sbjct  420   TKARENYSSSMQLCGVRDDRSTATKALFWQGRKGLSFMLMFESERDRNAAIMLARKYAND  479

Query  1570  CNVSI  1584
             CNV +
Sbjct  480   CNVML  484



>gb|ADN33873.1| hypothetical protein [Cucumis melo subsp. melo]
Length=489

 Score =   650 bits (1678),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 338/485 (70%), Positives = 407/485 (84%), Gaps = 3/485 (1%)
 Frame = +1

Query  130   MTKVSPEFVGGEVQMYTFKSVSADVSFASNQFPKYKLGPDFQILEEALLENKGPSLKevv  309
             MTK+SPEF    + M     VS DVSFASNQFPKYKLGPD QILEE   +++GPSLKEV+
Sbjct  1     MTKISPEF-EETMHMEGILPVSVDVSFASNQFPKYKLGPDNQILEEPQDDDQGPSLKEVI  59

Query  310   eeettRLTEQHKRLSVRDLASKFDKNLSSAAKLANEAKLRDAPSLEGHVLLKKLRDALET  489
             E+ET +L+EQHKRLSVRDLA KFDKNLSSAAKL++EAKLR+ PSLEGHVLLKKLRDALE 
Sbjct  60    EQETAQLSEQHKRLSVRDLACKFDKNLSSAAKLSDEAKLREVPSLEGHVLLKKLRDALEY  119

Query  490   LKGRLAGRNKEDVEIAIAMVEALAVRLTQKEGDLIQEKFEVNKLVSILKQASEDAKKLVN  669
             LKGRLAGRNKEDVE AI+MVEALAV+LTQKEG+LIQEKFEV KL + LKQASEDAK+LVN
Sbjct  120   LKGRLAGRNKEDVEKAISMVEALAVKLTQKEGELIQEKFEVKKLATFLKQASEDAKRLVN  179

Query  670   QERSFACAEIESARAVVQRIGEALEEQEINSQVSGKQeveelmeeiqeARRIRVLHQPSK  849
             QE+SFACAEIESARAVVQRIGEALEEQE NS  S KQ+VE L+EE+QEARRI+ LHQPSK
Sbjct  180   QEKSFACAEIESARAVVQRIGEALEEQEKNSDDSNKQDVEGLVEEVQEARRIKQLHQPSK  239

Query  850   VMDMEHELRALRIQLNEKSVVSFKLQNELAMSKRTEQNKSQLYRIIGSESVGSILRIQPC  1029
             V+ MEHELRALR  + EKS++S KLQ EL M KR  +NKS  Y + GSE++GS LRI+  
Sbjct  240   VLGMEHELRALRATIREKSIISAKLQRELTMCKRAAENKSCFYGLDGSETLGSFLRIKCA  299

Query  1030  SDEAVDLSKCSIQWYRLSSECSRREPILGADKSVYAPEPIDVGRVLEADIVSNGLKASVT  1209
             SD A  LSKCSIQWYR+SS+CS ++ I GA KS+YA EP+DVGR L+ ++VSNG K ++ 
Sbjct  300   SDVAPPLSKCSIQWYRMSSDCSWKQVITGATKSIYALEPLDVGRTLQVEVVSNGQKVNLM  359

Query  1210  TIGQIDQAAGLGNYVETLLRKSNTEFSVVIAQMNGRNYSSRSIHSFHVGKMRMKLNKGWI  1389
             T G I+  +GLG +VETLLRKSN+EF+V I+QMNG++Y+S S+H FHVGKMRMKL++GWI
Sbjct  360   TTGPIE--SGLGTHVETLLRKSNSEFNVTISQMNGQDYASNSVHVFHVGKMRMKLSRGWI  417

Query  1390  TKARDSYSGSMQLCGFRGGGNSAAKSLFWQPRKGQSFVLVFDSERERNGALVVARKHALE  1569
             TKAR++YS SMQLCG R   ++A K+LFWQ RKG SF+L+F+SER+RN A+++ARK+A +
Sbjct  418   TKARENYSSSMQLCGVRDDRSTATKALFWQGRKGLSFMLMFESERDRNAAIMLARKYAND  477

Query  1570  CNVSI  1584
             CNV +
Sbjct  478   CNVML  482



>gb|KDP26333.1| hypothetical protein JCGZ_22108 [Jatropha curcas]
Length=483

 Score =   649 bits (1675),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 337/474 (71%), Positives = 403/474 (85%), Gaps = 3/474 (1%)
 Frame = +1

Query  166   VQMYTFKSVSADVSFASNQFPKYKLGPDFQILEEALLENKGPSLKevveeettRLTEQHK  345
             ++M     VSADVSFASNQFP+YKLGPD QILEE   + KGPSLKEVVE+ET +L++QHK
Sbjct  1     MRMEVILPVSADVSFASNQFPRYKLGPDNQILEEPKEDTKGPSLKEVVEQETMQLSDQHK  60

Query  346   RLSVRDLASKFDKNLSSAAKLANEAKLRDAPSLEGHVLLKKLRDALETLKGRLAGRNKED  525
             RLSVRDLASKFDKNL+SAAKLA EAKLR+  SLEGHVLLKKLRDALE+L+GR+AGRNKED
Sbjct  61    RLSVRDLASKFDKNLASAAKLAEEAKLREVASLEGHVLLKKLRDALESLRGRMAGRNKED  120

Query  526   VEIAIAMVEALAVRLTQKEGDLIQEKFEVNKLVSILKQASEDAKKLVNQERSFACAEIES  705
             VE AI+MVEALAV+LTQKEG+LIQEKFEV KL + LKQASEDAKKLVNQE+SFACAEIES
Sbjct  121   VEKAISMVEALAVKLTQKEGELIQEKFEVKKLANFLKQASEDAKKLVNQEKSFACAEIES  180

Query  706   ARAVVQRIGEALEEQEINSQVSGKQeveelm--eeiqeARRIRVLHQPSKVMDMEHELRA  879
             ARAVVQR GEALEE+E N+Q S     +     EE+QEARRI++LHQPSKVMDMEHEL A
Sbjct  181   ARAVVQRFGEALEEEEKNAQNSKNHAPDVEELIEEVQEARRIKLLHQPSKVMDMEHELLA  240

Query  880   LRIQLNEKSVVSFKLQNELAMSKRTEQNKSQLYRIIGSESVGSILRIQPCSD-EAVDLSK  1056
             LR Q+ EKS+VS KLQ ELA SKR E+N+S  Y + GSE++GS L+++P SD  A  LSK
Sbjct  241   LRKQIREKSIVSVKLQKELAKSKRAEENRSSPYALDGSETLGSCLQLRPKSDVSAPPLSK  300

Query  1057  CSIQWYRLSSECSRREPILGADKSVYAPEPIDVGRVLEADIVSNGLKASVTTIGQIDQAA  1236
             CSIQWYR+SS+ S++E I GA+K +YAPEP+DVGR+L+A+I+S+G KASVTT G I+ AA
Sbjct  301   CSIQWYRVSSDGSQKEVISGANKCIYAPEPLDVGRILQAEIISDGHKASVTTDGPIETAA  360

Query  1237  GLGNYVETLLRKSNTEFSVVIAQMNGRNYSSRSIHSFHVGKMRMKLNKGWITKARDSYSG  1416
             GLG+YVETLLRKS++EF+VVI+QMNG++  S S+H F+VGKMR+KL +GWITKARD YS 
Sbjct  361   GLGSYVETLLRKSSSEFNVVISQMNGQDNPSHSVHIFNVGKMRIKLCRGWITKARDIYSA  420

Query  1417  SMQLCGFRGGGNSAAKSLFWQPRKGQSFVLVFDSERERNGALVVARKHALECNV  1578
             SMQLCG R   N+AAK+LFWQPRKG SFVL F+SERERN A+++ARK+A +CNV
Sbjct  421   SMQLCGVRADCNTAAKALFWQPRKGLSFVLTFESERERNAAIMLARKYAHDCNV  474



>gb|KHG23663.1| Laminin subunit gamma-1 [Gossypium arboreum]
Length=492

 Score =   649 bits (1673),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 339/484 (70%), Positives = 416/484 (86%), Gaps = 2/484 (0%)
 Frame = +1

Query  130   MTKVSPEFVGGEVQMYTFKSVSADVSFASNQFPKYKLGPDFQILEEALLENKGPSLKevv  309
             MTK+SP+ +   +   +  +VSADVSFAS+ FPKYKLGPD QILEE   +N GPSLKEV+
Sbjct  1     MTKISPD-IDETMLKESIVAVSADVSFASDHFPKYKLGPDNQILEEPRGDNNGPSLKEVL  59

Query  310   eeettRLTEQHKRLSVRDLASKFDKNLSSAAKLANEAKLRDAPSLEGHVLLKKLRDALET  489
             E ETT+L+EQHKRLSVRDLASKFDKNL++AAK A+EAKLR+  SLEGHVLLKKLRDALE+
Sbjct  60    ERETTQLSEQHKRLSVRDLASKFDKNLTAAAKFADEAKLREVASLEGHVLLKKLRDALES  119

Query  490   LKGRLAGRNKEDVEIAIAMVEALAVRLTQKEGDLIQEKFEVNKLVSILKQASEDAKKLVN  669
             L+GR+AGRNKEDVE AI+MVEALAV+LTQKEG+LIQEKFEV KL + LKQASEDAKKLVN
Sbjct  120   LRGRMAGRNKEDVEKAISMVEALAVKLTQKEGELIQEKFEVKKLANFLKQASEDAKKLVN  179

Query  670   QERSFACAEIESARAVVQRIGEALEEQEINSQVSGK-QeveelmeeiqeARRIRVLHQPS  846
             QE+SFACAEIESARAVVQR GEAL+EQE N + S K QEVEEL+EE+QEARRI+ +HQPS
Sbjct  180   QEKSFACAEIESARAVVQRFGEALDEQEKNPENSQKTQEVEELVEEVQEARRIKFMHQPS  239

Query  847   KVMDMEHELRALRIQLNEKSVVSFKLQNELAMSKRTEQNKSQLYRIIGSESVGSILRIQP  1026
             KVMDMEHELRALR Q+ EK++ S KLQ ELA++KR E+NKS +  + GSE++GS L+++P
Sbjct  240   KVMDMEHELRALRAQIREKAIFSVKLQKELAINKRAEENKSCMLVLHGSETLGSCLQLKP  299

Query  1027  CSDEAVDLSKCSIQWYRLSSECSRREPILGADKSVYAPEPIDVGRVLEADIVSNGLKASV  1206
              SD A  LS+ SIQWYRLSS+ +R+E I GA+K++YAPEP+DVGR+L+ADI+SNG K SV
Sbjct  300   RSDNAPSLSQSSIQWYRLSSDENRKEVISGANKTMYAPEPLDVGRILQADILSNGQKISV  359

Query  1207  TTIGQIDQAAGLGNYVETLLRKSNTEFSVVIAQMNGRNYSSRSIHSFHVGKMRMKLNKGW  1386
             TT   ID AAGL +YVETLLRKS++EF+VVI+++NG+++S RS HSF+VGKMR+KL +GW
Sbjct  360   TTANPIDSAAGLASYVETLLRKSSSEFNVVISRINGQDHSLRSTHSFNVGKMRIKLCRGW  419

Query  1387  ITKARDSYSGSMQLCGFRGGGNSAAKSLFWQPRKGQSFVLVFDSERERNGALVVARKHAL  1566
             ITK+R++YS SM LCG RG  N+ AKSLFWQPRKG S+VL F+SER+RN A++VARKHAL
Sbjct  420   ITKSRENYSTSMLLCGARGDANAPAKSLFWQPRKGHSYVLTFESERDRNAAIMVARKHAL  479

Query  1567  ECNV  1578
             +C+V
Sbjct  480   DCSV  483



>ref|XP_003521113.1| PREDICTED: uncharacterized protein LOC100816432 isoform X1 [Glycine 
max]
 ref|XP_006576771.1| PREDICTED: uncharacterized protein LOC100816432 isoform X2 [Glycine 
max]
 gb|KHN12168.1| hypothetical protein glysoja_036491 [Glycine soja]
Length=490

 Score =   647 bits (1670),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 337/483 (70%), Positives = 404/483 (84%), Gaps = 2/483 (0%)
 Frame = +1

Query  130   MTKVSPEFVGGEVQMYTFKSVSADVSFASNQFPKYKLGPDFQILEEALLENKGPSLKevv  309
             MTK+SPE V   + M  F  VSADVSF SN FPKYKL  D Q+LEE + +N+GPSLK+V+
Sbjct  1     MTKISPE-VEIRMPMEAFPPVSADVSFISNSFPKYKLDADNQVLEEPVEDNQGPSLKDVI  59

Query  310   eeettRLTEQHKRLSVRDLASKFDKNLSSAAKLANEAKLRDAPSLEGHVLLKKLRDALET  489
             E+E + L++QHKR+SVRDLASKFDKNL++AAKL+NEAKLRD  SLEGHVLLKKLRDALE+
Sbjct  60    EQEASNLSDQHKRISVRDLASKFDKNLAAAAKLSNEAKLRDVASLEGHVLLKKLRDALES  119

Query  490   LKGRLAGRNKEDVEIAIAMVEALAVRLTQKEGDLIQEKFEVNKLVSILKQASEDAKKLVN  669
             L+GR AGRNKEDVE AI+MVEALAV+LTQ EG+LIQEKFEV KLV+ LKQASEDAK LVN
Sbjct  120   LRGRFAGRNKEDVEKAISMVEALAVKLTQNEGELIQEKFEVKKLVNFLKQASEDAKNLVN  179

Query  670   QERSFACAEIESARAVVQRIGEALEEQEINSQVSGKQeveelmeeiqeARRIRVLHQPSK  849
             QE+SFACAEIESARAVV RIGEALEEQE  SQ S  Q+V+ L+EE+QE+RRI++LH PSK
Sbjct  180   QEKSFACAEIESARAVVLRIGEALEEQEKASQASKPQDVDGLVEEVQESRRIKLLHHPSK  239

Query  850   VMDMEHELRALRIQLNEKSVVSFKLQNELAMSKRTEQNKSQLYRIIGSESVGSILRIQPC  1029
             VM ME+ELRALR Q+ EKS+ S KLQ EL MSKR E+NKS LY + GSE++GS LR+QPC
Sbjct  240   VMAMEYELRALRDQIREKSIFSIKLQKELIMSKRNEENKSCLYMLDGSEALGSYLRVQPC  299

Query  1030  SDEAVDLSKCSIQWYRLSSECSRREPILGADKSVYAPEPIDVGRVLEADIVSNGLKASVT  1209
             SDE   +SKCS QWYRLSSE S RE I GA+KS+YAP+P DVGR+L+ DIVSNG K ++T
Sbjct  300   SDEVPQVSKCSFQWYRLSSEGSWREVISGANKSIYAPDPSDVGRILQVDIVSNGKKLTLT  359

Query  1210  TIGQIDQAAGLGNYVETLLRKSNTEFSVVIAQMNGRNYSSRSIHSFHVGKMRMKLNKGWI  1389
             T   I   +GLG++VETLLRKSNT+F+VVI+QMNG+++SS S HSF+VG+MR+KL +GWI
Sbjct  360   T-NPIQTVSGLGSHVETLLRKSNTDFNVVISQMNGKDHSSHSTHSFNVGRMRIKLCRGWI  418

Query  1390  TKARDSYSGSMQLCGFRGGGNSAAKSLFWQPRKGQSFVLVFDSERERNGALVVARKHALE  1569
             TKAR+ YS SMQLCG R    +AAK LFWQ RKG SFVL F+SER+RN A++VARK+AL+
Sbjct  419   TKAREIYSPSMQLCGVRSDVANAAKVLFWQARKGLSFVLTFESERDRNSAIMVARKYALD  478

Query  1570  CNV  1578
             CNV
Sbjct  479   CNV  481



>ref|NP_001242328.1| uncharacterized protein LOC100798320 [Glycine max]
 gb|ACU20347.1| unknown [Glycine max]
Length=490

 Score =   644 bits (1662),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 336/483 (70%), Positives = 404/483 (84%), Gaps = 2/483 (0%)
 Frame = +1

Query  130   MTKVSPEFVGGEVQMYTFKSVSADVSFASNQFPKYKLGPDFQILEEALLENKGPSLKevv  309
             MTK+SPE V   + M  F  VSADVSF SN FPKYKL  D Q+LEE + +N GPSLK+V+
Sbjct  1     MTKISPE-VEIRMPMEAFPPVSADVSFISNSFPKYKLDVDNQVLEEPVEDNLGPSLKDVI  59

Query  310   eeettRLTEQHKRLSVRDLASKFDKNLSSAAKLANEAKLRDAPSLEGHVLLKKLRDALET  489
             E+E   L++QHKR+SVRDLASKFDKNL++AAKL+NEAKL++  SLEGHVLLKKLRDALE+
Sbjct  60    EQEAFNLSDQHKRISVRDLASKFDKNLAAAAKLSNEAKLKEVASLEGHVLLKKLRDALES  119

Query  490   LKGRLAGRNKEDVEIAIAMVEALAVRLTQKEGDLIQEKFEVNKLVSILKQASEDAKKLVN  669
             L+GR AG NKEDVE AI+MVEALAV+LTQ EG+LIQEKFEV KLV+ LKQASEDAKKLVN
Sbjct  120   LRGRFAGINKEDVEKAISMVEALAVKLTQNEGELIQEKFEVKKLVNFLKQASEDAKKLVN  179

Query  670   QERSFACAEIESARAVVQRIGEALEEQEINSQVSGKQeveelmeeiqeARRIRVLHQPSK  849
             QE+SFACAEIESARAVV RIGEALEEQE  SQ S  Q+V+ L+EE+QEARRI++LHQPSK
Sbjct  180   QEKSFACAEIESARAVVLRIGEALEEQEKASQASKPQDVDGLIEEVQEARRIKLLHQPSK  239

Query  850   VMDMEHELRALRIQLNEKSVVSFKLQNELAMSKRTEQNKSQLYRIIGSESVGSILRIQPC  1029
             VM ME+ELRALR Q+ EKS+ S KLQ EL MSKR E+NKS+LY + GSE++GS LR+QPC
Sbjct  240   VMAMEYELRALRDQIREKSIFSIKLQKELTMSKRDEENKSRLYMLDGSEALGSYLRVQPC  299

Query  1030  SDEAVDLSKCSIQWYRLSSECSRREPILGADKSVYAPEPIDVGRVLEADIVSNGLKASVT  1209
             S E   +SKCS QWYRLSSE S RE I GA+K++YAP+P DVGR+L+ DIVSNG K ++T
Sbjct  300   SAEVPQVSKCSFQWYRLSSEGSWREVISGANKTIYAPDPSDVGRILQVDIVSNGKKLTLT  359

Query  1210  TIGQIDQAAGLGNYVETLLRKSNTEFSVVIAQMNGRNYSSRSIHSFHVGKMRMKLNKGWI  1389
             T   I   +GLGN+VETLLRKSNT+F+VVI+QMNG+++SS S HSF+VG+MR+KL +GWI
Sbjct  360   T-DPIQTVSGLGNHVETLLRKSNTDFNVVISQMNGKDHSSHSTHSFNVGRMRIKLCRGWI  418

Query  1390  TKARDSYSGSMQLCGFRGGGNSAAKSLFWQPRKGQSFVLVFDSERERNGALVVARKHALE  1569
             TKAR+ YS SMQLCG R    +AAK+LFWQ RKG SFVL F+SER+RN A++VARK+AL+
Sbjct  419   TKAREIYSPSMQLCGVRSDIANAAKALFWQARKGLSFVLTFESERDRNAAIMVARKYALD  478

Query  1570  CNV  1578
             CNV
Sbjct  479   CNV  481



>ref|XP_006603721.1| PREDICTED: uncharacterized protein LOC100798320 isoform X1 [Glycine 
max]
 ref|XP_006603722.1| PREDICTED: uncharacterized protein LOC100798320 isoform X2 [Glycine 
max]
 ref|XP_006603723.1| PREDICTED: uncharacterized protein LOC100798320 isoform X3 [Glycine 
max]
 gb|KHN08904.1| hypothetical protein glysoja_029481 [Glycine soja]
Length=490

 Score =   643 bits (1659),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 336/483 (70%), Positives = 404/483 (84%), Gaps = 2/483 (0%)
 Frame = +1

Query  130   MTKVSPEFVGGEVQMYTFKSVSADVSFASNQFPKYKLGPDFQILEEALLENKGPSLKevv  309
             MTK+SPE V   + M  F  VSADVSF SN FPKYKL  D Q+LEE + +N GPSLK+V+
Sbjct  1     MTKISPE-VEIRMPMEAFPPVSADVSFISNSFPKYKLDVDNQVLEEPVEDNLGPSLKDVI  59

Query  310   eeettRLTEQHKRLSVRDLASKFDKNLSSAAKLANEAKLRDAPSLEGHVLLKKLRDALET  489
             E+E   L++QHKR+SVRDLASKFDKNL++AAKL+NEAKLR+  SLEGHVLLKKLRDALE+
Sbjct  60    EQEAFNLSDQHKRISVRDLASKFDKNLAAAAKLSNEAKLREVASLEGHVLLKKLRDALES  119

Query  490   LKGRLAGRNKEDVEIAIAMVEALAVRLTQKEGDLIQEKFEVNKLVSILKQASEDAKKLVN  669
             L+GR AG NKEDVE AI+MVEALAV+LTQ EG+LIQEKFEV KLV+ LKQASEDAKKLVN
Sbjct  120   LRGRFAGINKEDVEKAISMVEALAVKLTQNEGELIQEKFEVKKLVNFLKQASEDAKKLVN  179

Query  670   QERSFACAEIESARAVVQRIGEALEEQEINSQVSGKQeveelmeeiqeARRIRVLHQPSK  849
             QE+SFACAEIESARAVV RIGEALEEQE  SQ S  Q+V+ L+EE+QEARRI++LHQPSK
Sbjct  180   QEKSFACAEIESARAVVLRIGEALEEQEKASQASKPQDVDGLIEEVQEARRIKLLHQPSK  239

Query  850   VMDMEHELRALRIQLNEKSVVSFKLQNELAMSKRTEQNKSQLYRIIGSESVGSILRIQPC  1029
             VM ME+ELRALR Q+ EKS+ S KLQ EL MSKR E+NKS+LY + GSE++GS LR+QPC
Sbjct  240   VMAMEYELRALRDQIREKSIFSIKLQKELTMSKRDEENKSRLYMLDGSEALGSYLRVQPC  299

Query  1030  SDEAVDLSKCSIQWYRLSSECSRREPILGADKSVYAPEPIDVGRVLEADIVSNGLKASVT  1209
             S E   +SKCS QWYRLSSE S RE I GA+K++YAP+P DVGR+L+ DIVSNG K ++T
Sbjct  300   SAEVPQVSKCSFQWYRLSSEGSWREVISGANKTIYAPDPSDVGRILQVDIVSNGKKLTLT  359

Query  1210  TIGQIDQAAGLGNYVETLLRKSNTEFSVVIAQMNGRNYSSRSIHSFHVGKMRMKLNKGWI  1389
             T   I   +GLG++VETLLRKSNT+F+VVI+QMNG+++SS S HSF+VG+MR+KL +GWI
Sbjct  360   T-DPIQTVSGLGSHVETLLRKSNTDFNVVISQMNGKDHSSHSTHSFNVGRMRIKLCRGWI  418

Query  1390  TKARDSYSGSMQLCGFRGGGNSAAKSLFWQPRKGQSFVLVFDSERERNGALVVARKHALE  1569
             TKAR+ YS SMQLCG R    +AAK+LFWQ RKG SFVL F+SER+RN A++VARK+AL+
Sbjct  419   TKAREIYSPSMQLCGVRSDIANAAKALFWQARKGLSFVLTFESERDRNAAIMVARKYALD  478

Query  1570  CNV  1578
             CNV
Sbjct  479   CNV  481



>ref|XP_007162055.1| hypothetical protein PHAVU_001G119900g [Phaseolus vulgaris]
 gb|ESW34049.1| hypothetical protein PHAVU_001G119900g [Phaseolus vulgaris]
Length=490

 Score =   643 bits (1659),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 333/483 (69%), Positives = 407/483 (84%), Gaps = 2/483 (0%)
 Frame = +1

Query  130   MTKVSPEFVGGEVQMYTFKSVSADVSFASNQFPKYKLGPDFQILEEALLENKGPSLKevv  309
             MTK+SPE V  ++ M  F  VSADVSF  + FPKYKLG D QIL++ + EN+GPSLK+V+
Sbjct  1     MTKISPE-VEIKMPMEAFPPVSADVSFIYDSFPKYKLGADNQILDDPVEENQGPSLKDVI  59

Query  310   eeettRLTEQHKRLSVRDLASKFDKNLSSAAKLANEAKLRDAPSLEGHVLLKKLRDALET  489
             E+E + L++QHKR+SVRDLASKFDKNL++AAKL+NEAKLRD  SLEGHVLLKKLRDALE+
Sbjct  60    EQEASNLSDQHKRISVRDLASKFDKNLAAAAKLSNEAKLRDVASLEGHVLLKKLRDALES  119

Query  490   LKGRLAGRNKEDVEIAIAMVEALAVRLTQKEGDLIQEKFEVNKLVSILKQASEDAKKLVN  669
             L+G  AGRNKEDVE AI+MVEALAV+LTQ EG+LIQEKFEV KLV+ LKQASEDAKKLVN
Sbjct  120   LRGHFAGRNKEDVEKAISMVEALAVKLTQNEGELIQEKFEVKKLVNFLKQASEDAKKLVN  179

Query  670   QERSFACAEIESARAVVQRIGEALEEQEINSQVSGKQeveelmeeiqeARRIRVLHQPSK  849
             QE+SFACAEI SAR+VV RIGEALEEQE  SQ S  Q+V+ L+EE+QEARRI++LHQPSK
Sbjct  180   QEKSFACAEIASARSVVLRIGEALEEQEKASQASKPQDVDGLIEEVQEARRIKLLHQPSK  239

Query  850   VMDMEHELRALRIQLNEKSVVSFKLQNELAMSKRTEQNKSQLYRIIGSESVGSILRIQPC  1029
             VM ME+ELRALR Q+ EKS+ S KLQ EL MSKR E+NKS+LY + GSE++GS LR+QPC
Sbjct  240   VMAMEYELRALRDQIREKSIFSIKLQKELTMSKRDEENKSRLYMLDGSEALGSYLRVQPC  299

Query  1030  SDEAVDLSKCSIQWYRLSSECSRREPILGADKSVYAPEPIDVGRVLEADIVSNGLKASVT  1209
             SDE   +SKCS+QWYRLSSE S RE I GA KS+YAP+P DVGR+L+ DIVSNG K ++T
Sbjct  300   SDEVPHVSKCSLQWYRLSSEGSWREVISGAIKSIYAPDPSDVGRILQVDIVSNGKKLTLT  359

Query  1210  TIGQIDQAAGLGNYVETLLRKSNTEFSVVIAQMNGRNYSSRSIHSFHVGKMRMKLNKGWI  1389
             T   +   +GLG++VE+LLRKSN +F+VVI+QMNG+++SS S HSF+VG+MR+KL +GWI
Sbjct  360   T-NPVQAVSGLGSHVESLLRKSNADFNVVISQMNGKDHSSHSTHSFNVGRMRIKLCRGWI  418

Query  1390  TKARDSYSGSMQLCGFRGGGNSAAKSLFWQPRKGQSFVLVFDSERERNGALVVARKHALE  1569
             TKAR+ YS SMQLCG R   ++AAK+LFWQ RKG SFVL F+SERERN A+++ARK+AL+
Sbjct  419   TKAREIYSPSMQLCGVRSDVSNAAKALFWQARKGLSFVLTFESERERNVAIMIARKYALD  478

Query  1570  CNV  1578
             CNV
Sbjct  479   CNV  481



>ref|XP_004296634.1| PREDICTED: uncharacterized protein LOC101291134 [Fragaria vesca 
subsp. vesca]
Length=491

 Score =   637 bits (1643),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 333/485 (69%), Positives = 400/485 (82%), Gaps = 1/485 (0%)
 Frame = +1

Query  130   MTKVSPEFVGGEVQMYTFKSVSADVSFASNQFPKYKLGPDFQILEEALLENKGPSLKevv  309
             MTK+SPEF    +      SVSADVSF SN FPKYKLGPD QIL+E    + GP+LKEVV
Sbjct  1     MTKISPEFEDN-IATDGVLSVSADVSFISNGFPKYKLGPDNQILDEPKGGSDGPNLKEVV  59

Query  310   eeettRLTEQHKRLSVRDLASKFDKNLSSAAKLANEAKLRDAPSLEGHVLLKKLRDALET  489
             EEETT+L+EQHKRLSVRDLASKFDKNL++AAKL+ EAK+R+  SLEGHVLLKKLRDALE 
Sbjct  60    EEETTQLSEQHKRLSVRDLASKFDKNLAAAAKLSEEAKIREVASLEGHVLLKKLRDALEY  119

Query  490   LKGRLAGRNKEDVEIAIAMVEALAVRLTQKEGDLIQEKFEVNKLVSILKQASEDAKKLVN  669
             L+G LAGRNKEDVE AI+MVEALAV+LTQKEG+LIQ+KFEV KL S LKQ SEDAKKLVN
Sbjct  120   LRGLLAGRNKEDVEEAISMVEALAVKLTQKEGELIQDKFEVKKLASYLKQTSEDAKKLVN  179

Query  670   QERSFACAEIESARAVVQRIGEALEEQEINSQVSGKQeveelmeeiqeARRIRVLHQPSK  849
             QE+SFACAEIESAR +V+RIGEALEE+   ++   +Q+VEEL+E +QEARRI+++HQPSK
Sbjct  180   QEKSFACAEIESARGIVKRIGEALEERNRTTEDPKRQDVEELVEVVQEARRIKLMHQPSK  239

Query  850   VMDMEHELRALRIQLNEKSVVSFKLQNELAMSKRTEQNKSQLYRIIGSESVGSILRIQPC  1029
             VMDMEHELRALR Q+ EK +VS KLQ ELAMSKR  +NKS+ Y ++GSE++GS L IQ C
Sbjct  240   VMDMEHELRALRTQIREKCLVSVKLQKELAMSKREAENKSRGYAMLGSETLGSYLHIQTC  299

Query  1030  SDEAVDLSKCSIQWYRLSSECSRREPILGADKSVYAPEPIDVGRVLEADIVSNGLKASVT  1209
             S+    L  CSIQWYR+S + S  E I GA+KS+YAPEP DVGR L ADI+SNG K +VT
Sbjct  300   SENVPQLPSCSIQWYRVSPDGSWNEAISGANKSIYAPEPFDVGRTLGADIISNGQKKTVT  359

Query  1210  TIGQIDQAAGLGNYVETLLRKSNTEFSVVIAQMNGRNYSSRSIHSFHVGKMRMKLNKGWI  1389
             T G ID AAGL ++++TLLRKSNTEF VVI+QMNGR++ SRS+H FHVGK+RMKL +GWI
Sbjct  360   TAGPIDPAAGLQSHIDTLLRKSNTEFHVVISQMNGRDHPSRSVHIFHVGKIRMKLCRGWI  419

Query  1390  TKARDSYSGSMQLCGFRGGGNSAAKSLFWQPRKGQSFVLVFDSERERNGALVVARKHALE  1569
             TK+R+ YS SMQLCG RG   + AK +FWQPRKG SFVL F++ER+RN AL++ARK+AL+
Sbjct  420   TKSREIYSSSMQLCGARGDLANVAKGVFWQPRKGLSFVLTFETERDRNAALLLARKYALD  479

Query  1570  CNVSI  1584
             CNV +
Sbjct  480   CNVML  484



>ref|XP_004493368.1| PREDICTED: uncharacterized protein LOC101494762 isoform X1 [Cicer 
arietinum]
 ref|XP_004493369.1| PREDICTED: uncharacterized protein LOC101494762 isoform X2 [Cicer 
arietinum]
Length=491

 Score =   636 bits (1640),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 322/483 (67%), Positives = 402/483 (83%), Gaps = 1/483 (0%)
 Frame = +1

Query  130   MTKVSPEFVGGEVQMYTFKSVSADVSFASNQFPKYKLGPDFQILEEALLENKGPSLKevv  309
             MTK+SPE    ++ M     VSADVSF SN FPKYKLG D Q+ +E   +N GPSLK V+
Sbjct  1     MTKISPEIETNKMAMEAVPPVSADVSFISNSFPKYKLGADHQVYDEPAEDNHGPSLKNVI  60

Query  310   eeettRLTEQHKRLSVRDLASKFDKNLSSAAKLANEAKLRDAPSLEGHVLLKKLRDALET  489
             E+E + L++QHKR+SVRDLA+KFDKNL++AAKL+NEAKLR+ PSLEGHVLLKKLRDALE+
Sbjct  61    EQEASNLSDQHKRISVRDLATKFDKNLAAAAKLSNEAKLREVPSLEGHVLLKKLRDALES  120

Query  490   LKGRLAGRNKEDVEIAIAMVEALAVRLTQKEGDLIQEKFEVNKLVSILKQASEDAKKLVN  669
             LKGR  GRNKEDVE AI+MVEALA++LTQ EG+LIQEKFEV +LV+ LKQASEDAKKLVN
Sbjct  121   LKGRFTGRNKEDVEKAISMVEALAIKLTQNEGELIQEKFEVKRLVNFLKQASEDAKKLVN  180

Query  670   QERSFACAEIESARAVVQRIGEALEEQEINSQVSGKQeveelmeeiqeARRIRVLHQPSK  849
             QE+SFACAEIESAR+VV RIGEALEEQE   Q S  Q+V+ L+EE+QEARRIR+LHQPSK
Sbjct  181   QEKSFACAEIESARSVVLRIGEALEEQEKAIQASKPQDVDGLVEEVQEARRIRLLHQPSK  240

Query  850   VMDMEHELRALRIQLNEKSVVSFKLQNELAMSKRTEQNKSQLYRIIGSESVGSILRIQPC  1029
             VM ME+ELRALR Q+ EKS+ S +LQ EL MSK  ++NKS LY + GSE++GS L+++PC
Sbjct  241   VMAMEYELRALRDQIQEKSIFSIQLQKELTMSKWDKENKSHLYMLDGSEALGSYLQVKPC  300

Query  1030  SDEAVDLSKCSIQWYRLSSECSRREPILGADKSVYAPEPIDVGRVLEADIVSNGLKASVT  1209
             S+E   +S+CS QWYRLSSE S RE I GA+KS+YAP+P+DVGR+L+ DIVSNG K ++T
Sbjct  301   SNEVPQVSQCSFQWYRLSSEGSWREVISGANKSIYAPDPLDVGRMLQVDIVSNGKKLTLT  360

Query  1210  TIGQIDQAAGLGNYVETLLRKSNTEFSVVIAQMNGRNYSSRSIHSFHVGKMRMKLNKGWI  1389
             TI  I   +GLG++VE LLRKSNT+F+VVI+QMNG+++SS S HSF+VG+MR+KL +GWI
Sbjct  361   TI-PIQTVSGLGSHVEALLRKSNTDFNVVISQMNGKDHSSHSTHSFNVGRMRIKLCRGWI  419

Query  1390  TKARDSYSGSMQLCGFRGGGNSAAKSLFWQPRKGQSFVLVFDSERERNGALVVARKHALE  1569
             TK+R+ YS +MQLCG R    +AAK+LFWQ RKG SFVL F+SE++RN A+++ARK+AL+
Sbjct  420   TKSREIYSPTMQLCGVRSDVGNAAKALFWQARKGLSFVLTFESEKDRNVAIMIARKYALD  479

Query  1570  CNV  1578
             CNV
Sbjct  480   CNV  482



>ref|XP_007028248.1| Uncharacterized protein isoform 5 [Theobroma cacao]
 gb|EOY08750.1| Uncharacterized protein isoform 5 [Theobroma cacao]
Length=492

 Score =   634 bits (1636),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 345/486 (71%), Positives = 416/486 (86%), Gaps = 6/486 (1%)
 Frame = +1

Query  130   MTKVSPEFVGGEVQMY--TFKSVSADVSFASNQFPKYKLGPDFQILEEALLENKGPSLKe  303
             MTK+SPE    E  M   +  +VSADVSFAS+ FPKYKLGP+ QILEE   +N GPSLKE
Sbjct  1     MTKISPEI---EESMLKESILAVSADVSFASDHFPKYKLGPENQILEEPKGDNNGPSLKE  57

Query  304   vveeettRLTEQHKRLSVRDLASKFDKNLSSAAKLANEAKLRDAPSLEGHVLLKKLRDAL  483
             VVE ETT+L+EQHKRLSVRDLASKFDKNL++AAKLA+EAKLR+  SLEGHVLLKKLRDAL
Sbjct  58    VVERETTQLSEQHKRLSVRDLASKFDKNLAAAAKLADEAKLREVASLEGHVLLKKLRDAL  117

Query  484   ETLKGRLAGRNKEDVEIAIAMVEALAVRLTQKEGDLIQEKFEVNKLVSILKQASEDAKKL  663
             E+L+GR+AGRNKEDVE AI+MVEALAV+LTQKEG+LIQEKFEV KL + LKQASEDAKKL
Sbjct  118   ESLRGRMAGRNKEDVEKAISMVEALAVKLTQKEGELIQEKFEVKKLANFLKQASEDAKKL  177

Query  664   VNQERSFACAEIESARAVVQRIGEALEEQEINSQVSGK-QeveelmeeiqeARRIRVLHQ  840
             VNQE+SFACAEIESARAVVQR GEALEEQE NS++S K QEVEEL+EE+Q ARRI+++HQ
Sbjct  178   VNQEKSFACAEIESARAVVQRFGEALEEQEKNSEISQKTQEVEELIEEVQVARRIKLMHQ  237

Query  841   PSKVMDMEHELRALRIQLNEKSVVSFKLQNELAMSKRTEQNKSQLYRIIGSESVGSILRI  1020
             PSKVM MEHELRALR Q+ EKS+ S KLQ ELA++K+ E+NKS++Y + GSE++GS LR+
Sbjct  238   PSKVMGMEHELRALRTQIREKSIFSVKLQKELALNKKAEENKSRVYILHGSETLGSCLRL  297

Query  1021  QPCSDEAVDLSKCSIQWYRLSSECSRREPILGADKSVYAPEPIDVGRVLEADIVSNGLKA  1200
             QPCSD A  LSK SIQWYR+SS+ +++E I GA+K +YAPEP+DVGR+L  DI+SNG K 
Sbjct  298   QPCSDNAPVLSKSSIQWYRMSSDGNQQEIISGANKIMYAPEPLDVGRILLVDILSNGQKV  357

Query  1201  SVTTIGQIDQAAGLGNYVETLLRKSNTEFSVVIAQMNGRNYSSRSIHSFHVGKMRMKLNK  1380
             +VTT   I  AAGLG YVETLLRKS++EF+VVI+Q+NG+++ S S H+F+VGKMR+KL +
Sbjct  358   TVTTSVPIGSAAGLGGYVETLLRKSSSEFNVVISQINGQDHPSHSTHAFNVGKMRIKLCR  417

Query  1381  GWITKARDSYSGSMQLCGFRGGGNSAAKSLFWQPRKGQSFVLVFDSERERNGALVVARKH  1560
             GWITK+R+ YS SM LCG RG GN+AAKSLFWQPRKG S+VL  +SERERN A++VARKH
Sbjct  418   GWITKSREIYSTSMLLCGVRGDGNAAAKSLFWQPRKGLSYVLTCESERERNAAIMVARKH  477

Query  1561  ALECNV  1578
             AL+C+V
Sbjct  478   ALDCSV  483



>ref|XP_007028244.1| Uncharacterized protein isoform 1 [Theobroma cacao]
 gb|EOY08746.1| Uncharacterized protein isoform 1 [Theobroma cacao]
Length=511

 Score =   635 bits (1637),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 345/486 (71%), Positives = 416/486 (86%), Gaps = 6/486 (1%)
 Frame = +1

Query  130   MTKVSPEFVGGEVQMY--TFKSVSADVSFASNQFPKYKLGPDFQILEEALLENKGPSLKe  303
             MTK+SPE    E  M   +  +VSADVSFAS+ FPKYKLGP+ QILEE   +N GPSLKE
Sbjct  1     MTKISPEI---EESMLKESILAVSADVSFASDHFPKYKLGPENQILEEPKGDNNGPSLKE  57

Query  304   vveeettRLTEQHKRLSVRDLASKFDKNLSSAAKLANEAKLRDAPSLEGHVLLKKLRDAL  483
             VVE ETT+L+EQHKRLSVRDLASKFDKNL++AAKLA+EAKLR+  SLEGHVLLKKLRDAL
Sbjct  58    VVERETTQLSEQHKRLSVRDLASKFDKNLAAAAKLADEAKLREVASLEGHVLLKKLRDAL  117

Query  484   ETLKGRLAGRNKEDVEIAIAMVEALAVRLTQKEGDLIQEKFEVNKLVSILKQASEDAKKL  663
             E+L+GR+AGRNKEDVE AI+MVEALAV+LTQKEG+LIQEKFEV KL + LKQASEDAKKL
Sbjct  118   ESLRGRMAGRNKEDVEKAISMVEALAVKLTQKEGELIQEKFEVKKLANFLKQASEDAKKL  177

Query  664   VNQERSFACAEIESARAVVQRIGEALEEQEINSQVSGK-QeveelmeeiqeARRIRVLHQ  840
             VNQE+SFACAEIESARAVVQR GEALEEQE NS++S K QEVEEL+EE+Q ARRI+++HQ
Sbjct  178   VNQEKSFACAEIESARAVVQRFGEALEEQEKNSEISQKTQEVEELIEEVQVARRIKLMHQ  237

Query  841   PSKVMDMEHELRALRIQLNEKSVVSFKLQNELAMSKRTEQNKSQLYRIIGSESVGSILRI  1020
             PSKVM MEHELRALR Q+ EKS+ S KLQ ELA++K+ E+NKS++Y + GSE++GS LR+
Sbjct  238   PSKVMGMEHELRALRTQIREKSIFSVKLQKELALNKKAEENKSRVYILHGSETLGSCLRL  297

Query  1021  QPCSDEAVDLSKCSIQWYRLSSECSRREPILGADKSVYAPEPIDVGRVLEADIVSNGLKA  1200
             QPCSD A  LSK SIQWYR+SS+ +++E I GA+K +YAPEP+DVGR+L  DI+SNG K 
Sbjct  298   QPCSDNAPVLSKSSIQWYRMSSDGNQQEIISGANKIMYAPEPLDVGRILLVDILSNGQKV  357

Query  1201  SVTTIGQIDQAAGLGNYVETLLRKSNTEFSVVIAQMNGRNYSSRSIHSFHVGKMRMKLNK  1380
             +VTT   I  AAGLG YVETLLRKS++EF+VVI+Q+NG+++ S S H+F+VGKMR+KL +
Sbjct  358   TVTTSVPIGSAAGLGGYVETLLRKSSSEFNVVISQINGQDHPSHSTHAFNVGKMRIKLCR  417

Query  1381  GWITKARDSYSGSMQLCGFRGGGNSAAKSLFWQPRKGQSFVLVFDSERERNGALVVARKH  1560
             GWITK+R+ YS SM LCG RG GN+AAKSLFWQPRKG S+VL  +SERERN A++VARKH
Sbjct  418   GWITKSREIYSTSMLLCGVRGDGNAAAKSLFWQPRKGLSYVLTCESERERNAAIMVARKH  477

Query  1561  ALECNV  1578
             AL+C+V
Sbjct  478   ALDCSV  483



>ref|XP_007028245.1| Uncharacterized protein isoform 2 [Theobroma cacao]
 ref|XP_007028246.1| Uncharacterized protein isoform 2 [Theobroma cacao]
 ref|XP_007028247.1| Uncharacterized protein isoform 2 [Theobroma cacao]
 gb|EOY08747.1| Uncharacterized protein isoform 2 [Theobroma cacao]
 gb|EOY08748.1| Uncharacterized protein isoform 2 [Theobroma cacao]
 gb|EOY08749.1| Uncharacterized protein isoform 2 [Theobroma cacao]
Length=498

 Score =   633 bits (1633),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 345/486 (71%), Positives = 416/486 (86%), Gaps = 6/486 (1%)
 Frame = +1

Query  130   MTKVSPEFVGGEVQMY--TFKSVSADVSFASNQFPKYKLGPDFQILEEALLENKGPSLKe  303
             MTK+SPE    E  M   +  +VSADVSFAS+ FPKYKLGP+ QILEE   +N GPSLKE
Sbjct  1     MTKISPEI---EESMLKESILAVSADVSFASDHFPKYKLGPENQILEEPKGDNNGPSLKE  57

Query  304   vveeettRLTEQHKRLSVRDLASKFDKNLSSAAKLANEAKLRDAPSLEGHVLLKKLRDAL  483
             VVE ETT+L+EQHKRLSVRDLASKFDKNL++AAKLA+EAKLR+  SLEGHVLLKKLRDAL
Sbjct  58    VVERETTQLSEQHKRLSVRDLASKFDKNLAAAAKLADEAKLREVASLEGHVLLKKLRDAL  117

Query  484   ETLKGRLAGRNKEDVEIAIAMVEALAVRLTQKEGDLIQEKFEVNKLVSILKQASEDAKKL  663
             E+L+GR+AGRNKEDVE AI+MVEALAV+LTQKEG+LIQEKFEV KL + LKQASEDAKKL
Sbjct  118   ESLRGRMAGRNKEDVEKAISMVEALAVKLTQKEGELIQEKFEVKKLANFLKQASEDAKKL  177

Query  664   VNQERSFACAEIESARAVVQRIGEALEEQEINSQVSGK-QeveelmeeiqeARRIRVLHQ  840
             VNQE+SFACAEIESARAVVQR GEALEEQE NS++S K QEVEEL+EE+Q ARRI+++HQ
Sbjct  178   VNQEKSFACAEIESARAVVQRFGEALEEQEKNSEISQKTQEVEELIEEVQVARRIKLMHQ  237

Query  841   PSKVMDMEHELRALRIQLNEKSVVSFKLQNELAMSKRTEQNKSQLYRIIGSESVGSILRI  1020
             PSKVM MEHELRALR Q+ EKS+ S KLQ ELA++K+ E+NKS++Y + GSE++GS LR+
Sbjct  238   PSKVMGMEHELRALRTQIREKSIFSVKLQKELALNKKAEENKSRVYILHGSETLGSCLRL  297

Query  1021  QPCSDEAVDLSKCSIQWYRLSSECSRREPILGADKSVYAPEPIDVGRVLEADIVSNGLKA  1200
             QPCSD A  LSK SIQWYR+SS+ +++E I GA+K +YAPEP+DVGR+L  DI+SNG K 
Sbjct  298   QPCSDNAPVLSKSSIQWYRMSSDGNQQEIISGANKIMYAPEPLDVGRILLVDILSNGQKV  357

Query  1201  SVTTIGQIDQAAGLGNYVETLLRKSNTEFSVVIAQMNGRNYSSRSIHSFHVGKMRMKLNK  1380
             +VTT   I  AAGLG YVETLLRKS++EF+VVI+Q+NG+++ S S H+F+VGKMR+KL +
Sbjct  358   TVTTSVPIGSAAGLGGYVETLLRKSSSEFNVVISQINGQDHPSHSTHAFNVGKMRIKLCR  417

Query  1381  GWITKARDSYSGSMQLCGFRGGGNSAAKSLFWQPRKGQSFVLVFDSERERNGALVVARKH  1560
             GWITK+R+ YS SM LCG RG GN+AAKSLFWQPRKG S+VL  +SERERN A++VARKH
Sbjct  418   GWITKSREIYSTSMLLCGVRGDGNAAAKSLFWQPRKGLSYVLTCESERERNAAIMVARKH  477

Query  1561  ALECNV  1578
             AL+C+V
Sbjct  478   ALDCSV  483



>ref|XP_002308873.2| proline-rich family protein [Populus trichocarpa]
 gb|EEE92396.2| proline-rich family protein [Populus trichocarpa]
Length=494

 Score =   629 bits (1622),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 343/484 (71%), Positives = 407/484 (84%), Gaps = 3/484 (1%)
 Frame = +1

Query  130   MTKVSPEFVGGEVQMYTFKSVSADVSFASNQFPKYKLGPDFQILEEALLENKGPSLKevv  309
             MTK+SPE +   +Q      VSADVSFAS+ FPKYKLGPD QILEE   +NKGPSLKEVV
Sbjct  1     MTKISPE-IEENMQGEVIFPVSADVSFASDGFPKYKLGPDNQILEEPKEDNKGPSLKEVV  59

Query  310   eeettRLTEQHKRLSVRDLASKFDKNLSSAAKLANEAKLRDAPSLEGHVLLKKLRDALET  489
             E+ET +L++QHKRLSVRDLA KFDKNL++AAKLA EAKLR+  SLEGHVLLKKLRDALE+
Sbjct  60    EQETMQLSDQHKRLSVRDLACKFDKNLTAAAKLAEEAKLREVASLEGHVLLKKLRDALES  119

Query  490   LKGRLAGRNKEDVEIAIAMVEALAVRLTQKEGDLIQEKFEVNKLVSILKQASEDAKKLVN  669
             L+GR+AGRNKEDVE AI+MVEALAV+LTQ EG+LIQEKFEV KL + LKQASEDAKKLVN
Sbjct  120   LRGRMAGRNKEDVEKAISMVEALAVKLTQNEGELIQEKFEVKKLANFLKQASEDAKKLVN  179

Query  670   QERSFACAEIESARAVVQRIGEALEEQEINSQVSGKQev--eelmeeiqeARRIRVLHQP  843
             QE+SFACAEIESARAVVQRIGEAL+E+E ++Q S  Q    EEL+EE+QEARRI++LHQP
Sbjct  180   QEKSFACAEIESARAVVQRIGEALDEEERDAQNSKNQAADVEELVEEVQEARRIKLLHQP  239

Query  844   SKVMDMEHELRALRIQLNEKSVVSFKLQNELAMSKRTEQNKSQLYRIIGSESVGSILRIQ  1023
             SKVMDMEHELRALR Q+ EKS+VS KLQ ELA SKR EQNKS  Y + GSE++GS L+++
Sbjct  240   SKVMDMEHELRALRNQIREKSIVSVKLQKELAKSKRAEQNKSAPYVLDGSETLGSSLQLK  299

Query  1024  PCSDEAVDLSKCSIQWYRLSSECSRREPILGADKSVYAPEPIDVGRVLEADIVSNGLKAS  1203
             P SD +  LSKCS+QWYR+SSE S+ E I GADK+ YAPEP DVGRVL+ DIVSNG K S
Sbjct  300   PRSDGSPPLSKCSVQWYRVSSEGSQHEVISGADKTFYAPEPFDVGRVLQVDIVSNGQKVS  359

Query  1204  VTTIGQIDQAAGLGNYVETLLRKSNTEFSVVIAQMNGRNYSSRSIHSFHVGKMRMKLNKG  1383
             VTT G I+ AAGL ++VE LLRKS+ EFSVVI+QMNG++++S S+H F+VGKMR+KL +G
Sbjct  360   VTTSGPIEPAAGLASHVENLLRKSSFEFSVVISQMNGQDHASHSVHVFNVGKMRIKLCRG  419

Query  1384  WITKARDSYSGSMQLCGFRGGGNSAAKSLFWQPRKGQSFVLVFDSERERNGALVVARKHA  1563
             WITKAR+ YS SM LCG R   N+AAKSLFWQPRKG SFVL F+SER+RN A+++ARK+A
Sbjct  420   WITKAREIYSMSMLLCGVRTNSNTAAKSLFWQPRKGLSFVLTFNSERDRNAAIMLARKYA  479

Query  1564  LECN  1575
              +CN
Sbjct  480   YDCN  483



>ref|XP_007028249.1| Uncharacterized protein isoform 6 [Theobroma cacao]
 gb|EOY08751.1| Uncharacterized protein isoform 6 [Theobroma cacao]
Length=499

 Score =   629 bits (1622),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 345/487 (71%), Positives = 416/487 (85%), Gaps = 7/487 (1%)
 Frame = +1

Query  130   MTKVSPEFVGGEVQMY--TFKSVSADVSFASNQFPKYKLGPDFQILEEALLENKGPSLKe  303
             MTK+SPE    E  M   +  +VSADVSFAS+ FPKYKLGP+ QILEE   +N GPSLKE
Sbjct  1     MTKISPEI---EESMLKESILAVSADVSFASDHFPKYKLGPENQILEEPKGDNNGPSLKE  57

Query  304   vveeettRLTEQHKRLSVRDLASKFDKNLSSAAKLANEAKLRDAPSLEGHVLLKKLRDAL  483
             VVE ETT+L+EQHKRLSVRDLASKFDKNL++AAKLA+EAKLR+  SLEGHVLLKKLRDAL
Sbjct  58    VVERETTQLSEQHKRLSVRDLASKFDKNLAAAAKLADEAKLREVASLEGHVLLKKLRDAL  117

Query  484   ETLKGRLAGRNKEDVEIAIAMVEALAVRLTQKEGDLIQEKFEVNKLVSILKQASEDAKKL  663
             E+L+GR+AGRNKEDVE AI+MVEALAV+LTQKEG+LIQEKFEV KL + LKQASEDAKKL
Sbjct  118   ESLRGRMAGRNKEDVEKAISMVEALAVKLTQKEGELIQEKFEVKKLANFLKQASEDAKKL  177

Query  664   VNQERSFACAEIESARAVVQRIGEALEEQEINSQVSGK-QeveelmeeiqeARRIRVLHQ  840
             VNQE+SFACAEIESARAVVQR GEALEEQE NS++S K QEVEEL+EE+Q ARRI+++HQ
Sbjct  178   VNQEKSFACAEIESARAVVQRFGEALEEQEKNSEISQKTQEVEELIEEVQVARRIKLMHQ  237

Query  841   PSKVMDMEHELRALRIQLNEKSVVSFKLQNELAMSKRTEQNKSQLYRIIGSESVGSILRI  1020
             PSKVM MEHELRALR Q+ EKS+ S KLQ ELA++K+ E+NKS++Y + GSE++GS LR+
Sbjct  238   PSKVMGMEHELRALRTQIREKSIFSVKLQKELALNKKAEENKSRVYILHGSETLGSCLRL  297

Query  1021  QPCSDEAVDLSKCSIQWYRLSSECSRREPILGADKSVYAPEPIDVGRVLEADIVSNGLKA  1200
             QPCSD A  LSK SIQWYR+SS+ +++E I GA+K +YAPEP+DVGR+L  DI+SNG K 
Sbjct  298   QPCSDNAPVLSKSSIQWYRMSSDGNQQEIISGANKIMYAPEPLDVGRILLVDILSNGQKV  357

Query  1201  SVTTIGQIDQAAGLGNYVETLLRKSNTEFS-VVIAQMNGRNYSSRSIHSFHVGKMRMKLN  1377
             +VTT   I  AAGLG YVETLLRKS++EF+ VVI+Q+NG+++ S S H+F+VGKMR+KL 
Sbjct  358   TVTTSVPIGSAAGLGGYVETLLRKSSSEFNVVVISQINGQDHPSHSTHAFNVGKMRIKLC  417

Query  1378  KGWITKARDSYSGSMQLCGFRGGGNSAAKSLFWQPRKGQSFVLVFDSERERNGALVVARK  1557
             +GWITK+R+ YS SM LCG RG GN+AAKSLFWQPRKG S+VL  +SERERN A++VARK
Sbjct  418   RGWITKSREIYSTSMLLCGVRGDGNAAAKSLFWQPRKGLSYVLTCESERERNAAIMVARK  477

Query  1558  HALECNV  1578
             HAL+C+V
Sbjct  478   HALDCSV  484



>ref|XP_002323226.2| proline-rich family protein [Populus trichocarpa]
 gb|EEF04987.2| proline-rich family protein [Populus trichocarpa]
Length=494

 Score =   627 bits (1616),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 344/487 (71%), Positives = 408/487 (84%), Gaps = 9/487 (2%)
 Frame = +1

Query  130   MTKVSPEF---VGGEVQMYTFKSVSADVSFASNQFPKYKLGPDFQILEEALLENKGPSLK  300
             MTK+SPE    + GEV       VSADVSFAS+ FPKYKLGPD QILEE   +NKGPSLK
Sbjct  1     MTKISPEIEENMKGEVVF----PVSADVSFASDGFPKYKLGPDNQILEEPKEDNKGPSLK  56

Query  301   evveeettRLTEQHKRLSVRDLASKFDKNLSSAAKLANEAKLRDAPSLEGHVLLKKLRDA  480
             EVVE+ETT+L++QHKRLSVRDLA KFDKNL++AAKLA EAKLR+  SLEGHVLLKKLRDA
Sbjct  57    EVVEQETTQLSDQHKRLSVRDLACKFDKNLTAAAKLAEEAKLREVASLEGHVLLKKLRDA  116

Query  481   LETLKGRLAGRNKEDVEIAIAMVEALAVRLTQKEGDLIQEKFEVNKLVSILKQASEDAKK  660
             LE+L+GR+AGRNKEDVE AI+MVEALAV+LTQKEG+LIQEKFEV KL + LKQASEDAKK
Sbjct  117   LESLRGRMAGRNKEDVEKAISMVEALAVKLTQKEGELIQEKFEVKKLANFLKQASEDAKK  176

Query  661   LVNQERSFACAEIESARAVVQRIGEALEEQEINSQVSGKQev--eelmeeiqeARRIRVL  834
             LVNQE+SFACAEIESARAVVQRIGEAL+E+E ++Q S  Q    EEL+EE+QEARRI++L
Sbjct  177   LVNQEKSFACAEIESARAVVQRIGEALDEEERDAQNSKNQAADVEELVEEVQEARRIKLL  236

Query  835   HQPSKVMDMEHELRALRIQLNEKSVVSFKLQNELAMSKRTEQNKSQLYRIIGSESVGSIL  1014
             HQPSKV+DMEHELRALR Q+ EKS+VS KLQ ELA SKR EQNKS  Y + GSE++GS L
Sbjct  237   HQPSKVIDMEHELRALRNQIREKSLVSVKLQKELAKSKRAEQNKSAPYVLDGSETLGSSL  296

Query  1015  RIQPCSDEAVDLSKCSIQWYRLSSECSRREPILGADKSVYAPEPIDVGRVLEADIVSNGL  1194
             +++P SD +  LSKCS+QWYR+SSE S+ E I GA+K+ YAPEP DVGRVL+ DIVSNG 
Sbjct  297   QLKPRSDSSPPLSKCSVQWYRVSSEDSQNEVISGANKTFYAPEPFDVGRVLQVDIVSNGQ  356

Query  1195  KASVTTIGQIDQAAGLGNYVETLLRKSNTEFSVVIAQMNGRNYSSRSIHSFHVGKMRMKL  1374
             K  VTT G I+ AAGL   VE LLRKS+ EFSVVI+QMNG+++ S S+H F+VGKMR+KL
Sbjct  357   KVIVTTSGPIEPAAGLATRVENLLRKSSCEFSVVISQMNGQDHPSHSVHVFNVGKMRLKL  416

Query  1375  NKGWITKARDSYSGSMQLCGFRGGGNSAAKSLFWQPRKGQSFVLVFDSERERNGALVVAR  1554
              +GWITKAR+ YS SMQLCG R   N+AA+SLFWQPRKG SFVL+F+SER+RN A+++AR
Sbjct  417   CRGWITKAREIYSASMQLCGVRTNANTAARSLFWQPRKGLSFVLIFESERDRNAAIMLAR  476

Query  1555  KHALECN  1575
             K+A +CN
Sbjct  477   KYAYDCN  483



>ref|XP_003624923.1| hypothetical protein MTR_7g089090 [Medicago truncatula]
 gb|AES81141.1| myosin heavy chain-like protein [Medicago truncatula]
Length=490

 Score =   627 bits (1616),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 323/483 (67%), Positives = 400/483 (83%), Gaps = 2/483 (0%)
 Frame = +1

Query  130   MTKVSPEFVGGEVQMYTFKSVSADVSFASNQFPKYKLGPDFQILEEALLENKGPSLKevv  309
             MTK+SPE +  ++ M     VSADVSF SN FPKYKLG D Q+ +E   +N+GPSLKEV+
Sbjct  1     MTKISPE-IETKMPMEAVPPVSADVSFISNSFPKYKLGADHQVFQETAEDNQGPSLKEVI  59

Query  310   eeettRLTEQHKRLSVRDLASKFDKNLSSAAKLANEAKLRDAPSLEGHVLLKKLRDALET  489
             E+E + L+EQ+ R+SVRDLASKFDKNLS+AAKL+NEAKLR+ PSLEGHVLLKKLRDALE 
Sbjct  60    EQEASNLSEQNNRISVRDLASKFDKNLSAAAKLSNEAKLREVPSLEGHVLLKKLRDALEY  119

Query  490   LKGRLAGRNKEDVEIAIAMVEALAVRLTQKEGDLIQEKFEVNKLVSILKQASEDAKKLVN  669
             LKGR  GRNKEDV  AI+MVEALAV+LTQ EG+LIQEKFEV KL++ LKQASEDAKKLVN
Sbjct  120   LKGRFTGRNKEDVANAISMVEALAVKLTQNEGELIQEKFEVKKLLNFLKQASEDAKKLVN  179

Query  670   QERSFACAEIESARAVVQRIGEALEEQEINSQVSGKQeveelmeeiqeARRIRVLHQPSK  849
             QE+SFACAEIESARAVV RIGEALEEQE  ++ S  Q+V+ L+EE+QEARRIR+LHQPSK
Sbjct  180   QEKSFACAEIESARAVVLRIGEALEEQEKVTEASKPQDVDGLVEEVQEARRIRLLHQPSK  239

Query  850   VMDMEHELRALRIQLNEKSVVSFKLQNELAMSKRTEQNKSQLYRIIGSESVGSILRIQPC  1029
             VM ME+ELRALR Q+ EKSV S +LQ EL MSK  ++NKS  Y++ GSE++GS ++++PC
Sbjct  240   VMAMEYELRALRDQIQEKSVFSIQLQKELTMSKWDKENKSHSYKLDGSEALGSYMQVKPC  299

Query  1030  SDEAVDLSKCSIQWYRLSSECSRREPILGADKSVYAPEPIDVGRVLEADIVSNGLKASVT  1209
             + E   +SKCS QWYRLSSE S RE I GA+KS+YAP+P+DVGR+L+ DIVS+G K ++T
Sbjct  300   TSEVPQVSKCSFQWYRLSSEGSWREVISGANKSIYAPDPLDVGRMLQVDIVSDGKKLTLT  359

Query  1210  TIGQIDQAAGLGNYVETLLRKSNTEFSVVIAQMNGRNYSSRSIHSFHVGKMRMKLNKGWI  1389
             T   I    GLG+ VE LLRKSNT+F+VVI+QMNG+++SS S HSF+VG+MR+KL +GWI
Sbjct  360   T-NPIQTVPGLGSQVEALLRKSNTDFNVVISQMNGKDHSSHSTHSFNVGRMRIKLCRGWI  418

Query  1390  TKARDSYSGSMQLCGFRGGGNSAAKSLFWQPRKGQSFVLVFDSERERNGALVVARKHALE  1569
             TKAR+ YS +MQLCG R   ++AAK+LFWQ RKG SFVL F+SE++RN A+++ARKHAL+
Sbjct  419   TKAREIYSPTMQLCGVRSDVSNAAKTLFWQARKGLSFVLTFESEKDRNVAIMIARKHALD  478

Query  1570  CNV  1578
             CNV
Sbjct  479   CNV  481



>ref|XP_011041396.1| PREDICTED: uncharacterized protein LOC105137366 [Populus euphratica]
Length=494

 Score =   626 bits (1614),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 343/487 (70%), Positives = 407/487 (84%), Gaps = 9/487 (2%)
 Frame = +1

Query  130   MTKVSPEF---VGGEVQMYTFKSVSADVSFASNQFPKYKLGPDFQILEEALLENKGPSLK  300
             MTK+SPE    + GEV       VSADVSFAS+ FPKYKLGPD QILEE   +NKGPSLK
Sbjct  1     MTKISPEIEENMKGEVIF----PVSADVSFASDGFPKYKLGPDNQILEEPKEDNKGPSLK  56

Query  301   evveeettRLTEQHKRLSVRDLASKFDKNLSSAAKLANEAKLRDAPSLEGHVLLKKLRDA  480
             EVVE+ETT+L+ QHKRLSVRDLA KFDKNL++AAKLA EAKLR+  SLEGHVLLKKLRDA
Sbjct  57    EVVEQETTQLSNQHKRLSVRDLACKFDKNLTAAAKLAEEAKLREVASLEGHVLLKKLRDA  116

Query  481   LETLKGRLAGRNKEDVEIAIAMVEALAVRLTQKEGDLIQEKFEVNKLVSILKQASEDAKK  660
             LE+L+GR+AGRNKEDVE AI+MVEALAV+LTQKEG+LIQEKFEV KL + LKQASEDAKK
Sbjct  117   LESLRGRMAGRNKEDVEKAISMVEALAVKLTQKEGELIQEKFEVKKLANFLKQASEDAKK  176

Query  661   LVNQERSFACAEIESARAVVQRIGEALEEQEINSQVSGKQev--eelmeeiqeARRIRVL  834
             LVNQE+SFACAEIESARAVVQRIGEAL+E+E ++Q S  Q    EEL+EE+QEARRI++L
Sbjct  177   LVNQEKSFACAEIESARAVVQRIGEALDEEERDAQHSKNQAADVEELVEEVQEARRIKLL  236

Query  835   HQPSKVMDMEHELRALRIQLNEKSVVSFKLQNELAMSKRTEQNKSQLYRIIGSESVGSIL  1014
             HQPSKV+DMEHELRALR Q+ EKS+VS KLQ ELA SKR EQNKS  Y + GSE++GS L
Sbjct  237   HQPSKVIDMEHELRALRNQIQEKSLVSVKLQKELAKSKRAEQNKSAPYVLDGSETLGSSL  296

Query  1015  RIQPCSDEAVDLSKCSIQWYRLSSECSRREPILGADKSVYAPEPIDVGRVLEADIVSNGL  1194
             +++P SD +  LSKCS+QWYR+SSE S+ E I GA+++ YAPEP DVGRVL+ DIVSNG 
Sbjct  297   QLKPRSDSSPPLSKCSVQWYRVSSEDSQNEVISGANRTFYAPEPFDVGRVLQVDIVSNGQ  356

Query  1195  KASVTTIGQIDQAAGLGNYVETLLRKSNTEFSVVIAQMNGRNYSSRSIHSFHVGKMRMKL  1374
             K  VTT G I+ AAGL  +VE LLRKS+ EFSVVI+QMNG+++ S S+H F+VGKMR+KL
Sbjct  357   KVIVTTSGPIEPAAGLATHVENLLRKSSCEFSVVISQMNGQDHPSHSVHVFNVGKMRVKL  416

Query  1375  NKGWITKARDSYSGSMQLCGFRGGGNSAAKSLFWQPRKGQSFVLVFDSERERNGALVVAR  1554
              +GWITKAR+ YS SMQLCG R   N+AA+SLFWQPRKG SFVL F+SER+RN A+++AR
Sbjct  417   CRGWITKAREIYSASMQLCGVRTNANTAARSLFWQPRKGLSFVLTFESERDRNAAIMLAR  476

Query  1555  KHALECN  1575
             K+A +CN
Sbjct  477   KYAYDCN  483



>ref|XP_011040736.1| PREDICTED: uncharacterized protein LOC105136922 [Populus euphratica]
Length=494

 Score =   625 bits (1612),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 341/484 (70%), Positives = 406/484 (84%), Gaps = 3/484 (1%)
 Frame = +1

Query  130   MTKVSPEFVGGEVQMYTFKSVSADVSFASNQFPKYKLGPDFQILEEALLENKGPSLKevv  309
             MTK+SPE +   +Q      VSADVSFAS+ FP+YKLGPD QILEE   +NKGPSLKEVV
Sbjct  1     MTKISPE-IEENMQGEVIFPVSADVSFASDGFPRYKLGPDNQILEEPKEDNKGPSLKEVV  59

Query  310   eeettRLTEQHKRLSVRDLASKFDKNLSSAAKLANEAKLRDAPSLEGHVLLKKLRDALET  489
             E+ET +L++QHKRLSVRDLA KFDKNL++AAKLA EAKLR+  SLEGHVLLKKLRDALE+
Sbjct  60    EQETVQLSDQHKRLSVRDLACKFDKNLTAAAKLAEEAKLREVASLEGHVLLKKLRDALES  119

Query  490   LKGRLAGRNKEDVEIAIAMVEALAVRLTQKEGDLIQEKFEVNKLVSILKQASEDAKKLVN  669
             L+G +AGRNKEDVE AI+MVEALAV+LTQ EG+LIQEKFEV KL + LKQASEDAKKLVN
Sbjct  120   LRGCMAGRNKEDVEKAISMVEALAVKLTQNEGELIQEKFEVKKLANFLKQASEDAKKLVN  179

Query  670   QERSFACAEIESARAVVQRIGEALEEQEINSQVSGKQev--eelmeeiqeARRIRVLHQP  843
             QE+SFACAEIESARAVVQRIGEAL+E+E ++Q S  Q    EEL+EE+QEARRI++LHQP
Sbjct  180   QEKSFACAEIESARAVVQRIGEALDEEERDAQNSKNQAADVEELVEEVQEARRIKLLHQP  239

Query  844   SKVMDMEHELRALRIQLNEKSVVSFKLQNELAMSKRTEQNKSQLYRIIGSESVGSILRIQ  1023
             SKVMDMEHELRALR Q+ EKS+VS KLQ ELA SKR EQNKS  Y + GSE++GS L+++
Sbjct  240   SKVMDMEHELRALRNQIREKSIVSVKLQKELAKSKRAEQNKSAPYVLDGSETLGSSLQLK  299

Query  1024  PCSDEAVDLSKCSIQWYRLSSECSRREPILGADKSVYAPEPIDVGRVLEADIVSNGLKAS  1203
             P SD +  LSKCS+QWYR+SSE S+ E I GADK+ YAPEP DVGRVL+ DIVSNG K S
Sbjct  300   PRSDSSPPLSKCSVQWYRVSSEGSQHEVISGADKTFYAPEPFDVGRVLQVDIVSNGQKVS  359

Query  1204  VTTIGQIDQAAGLGNYVETLLRKSNTEFSVVIAQMNGRNYSSRSIHSFHVGKMRMKLNKG  1383
             VTT G I+ AAGL ++VE LLRKS+ EFSVVI+QMNG++++S S+H F+VGKMR+KL +G
Sbjct  360   VTTSGPIEPAAGLASHVENLLRKSSFEFSVVISQMNGQDHASHSVHVFNVGKMRIKLCRG  419

Query  1384  WITKARDSYSGSMQLCGFRGGGNSAAKSLFWQPRKGQSFVLVFDSERERNGALVVARKHA  1563
             WITKAR+ YS SM LCG R   N+AAKSLFWQPRKG SFVL F+SER+RN A+++ARK+A
Sbjct  420   WITKAREIYSMSMLLCGVRTNSNTAAKSLFWQPRKGLSFVLTFNSERDRNAAIMLARKYA  479

Query  1564  LECN  1575
              +CN
Sbjct  480   YDCN  483



>gb|AFK36222.1| unknown [Medicago truncatula]
Length=490

 Score =   623 bits (1607),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 322/483 (67%), Positives = 399/483 (83%), Gaps = 2/483 (0%)
 Frame = +1

Query  130   MTKVSPEFVGGEVQMYTFKSVSADVSFASNQFPKYKLGPDFQILEEALLENKGPSLKevv  309
             MTK+SPE +  ++ M     VSADVSF SN FPKYKLG D Q+L+E   +N+GPSLKEV+
Sbjct  1     MTKISPE-IETKMPMEAVPPVSADVSFISNSFPKYKLGADHQVLQETAEDNQGPSLKEVI  59

Query  310   eeettRLTEQHKRLSVRDLASKFDKNLSSAAKLANEAKLRDAPSLEGHVLLKKLRDALET  489
             E+E + L+EQ+ R+SVRDLASKFDKNLS+AAKL+NEAKLR+ PSLEGHVLLKKLRDALE 
Sbjct  60    EQEASNLSEQNNRISVRDLASKFDKNLSAAAKLSNEAKLREVPSLEGHVLLKKLRDALEY  119

Query  490   LKGRLAGRNKEDVEIAIAMVEALAVRLTQKEGDLIQEKFEVNKLVSILKQASEDAKKLVN  669
             LKGR  GRNKEDV  AI+MVEALAV+LTQ EG+LIQEKFEV KL++ LKQASEDAKKLVN
Sbjct  120   LKGRFTGRNKEDVANAISMVEALAVKLTQNEGELIQEKFEVKKLLNFLKQASEDAKKLVN  179

Query  670   QERSFACAEIESARAVVQRIGEALEEQEINSQVSGKQeveelmeeiqeARRIRVLHQPSK  849
             QE+SFACAEIESARAVV RIGEALEEQE  ++ S  Q+V+ L+EE+QEARRIR+LHQPSK
Sbjct  180   QEKSFACAEIESARAVVLRIGEALEEQEKVTEASKPQDVDGLVEEVQEARRIRLLHQPSK  239

Query  850   VMDMEHELRALRIQLNEKSVVSFKLQNELAMSKRTEQNKSQLYRIIGSESVGSILRIQPC  1029
             VM ME+ELRALR Q+ EKSV S +LQ EL MSK  ++NKS  Y++ GSE++GS ++++PC
Sbjct  240   VMAMEYELRALRDQIQEKSVFSIQLQKELTMSKWDKENKSHSYKLDGSEALGSYMQVKPC  299

Query  1030  SDEAVDLSKCSIQWYRLSSECSRREPILGADKSVYAPEPIDVGRVLEADIVSNGLKASVT  1209
             + E   +SKCS QWYRLSSE S  E I GA+KS+YAP+P+DVGR+L+ DIVS+G K ++T
Sbjct  300   TSEVPQVSKCSFQWYRLSSEGSWGEVISGANKSIYAPDPLDVGRMLQVDIVSDGKKLTLT  359

Query  1210  TIGQIDQAAGLGNYVETLLRKSNTEFSVVIAQMNGRNYSSRSIHSFHVGKMRMKLNKGWI  1389
             T   I    GLG+ VE LLRKSNT+F+VVI+QMNG+++SS S HSF+VG+MR+KL +GWI
Sbjct  360   T-NPIQTVPGLGSQVEALLRKSNTDFNVVISQMNGKDHSSHSTHSFNVGRMRIKLCRGWI  418

Query  1390  TKARDSYSGSMQLCGFRGGGNSAAKSLFWQPRKGQSFVLVFDSERERNGALVVARKHALE  1569
             TKAR+ YS +MQLCG R   ++AAK+LFWQ RKG SFVL F+SE++RN A+++ARKH L+
Sbjct  419   TKAREIYSPTMQLCGVRSDVSNAAKTLFWQARKGLSFVLTFESEKDRNVAIMIARKHVLD  478

Query  1570  CNV  1578
             CNV
Sbjct  479   CNV  481



>ref|XP_010525425.1| PREDICTED: uncharacterized protein LOC104803222 [Tarenaya hassleriana]
 ref|XP_010525426.1| PREDICTED: uncharacterized protein LOC104803222 [Tarenaya hassleriana]
 ref|XP_010525427.1| PREDICTED: uncharacterized protein LOC104803222 [Tarenaya hassleriana]
Length=488

 Score =   620 bits (1600),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 316/487 (65%), Positives = 403/487 (83%), Gaps = 6/487 (1%)
 Frame = +1

Query  130   MTKVSPEFVGGEVQMYTFKSVSADVSFASNQFPKYKLGPDFQILEEALLENKGPSLKevv  309
             MTKV PE    E  +     VSADVSFASN FPKYK GPD QI+EE   + KGPS+KE+V
Sbjct  1     MTKVCPEMTLSEAVL----PVSADVSFASNHFPKYKFGPDNQIVEEPKEDEKGPSVKEIV  56

Query  310   eeettRLTEQHKRLSVRDLASKFDKNLSSAAKLANEAKLRDAPSLEGHVLLKKLRDALET  489
             E+ET +L+EQHKRLSVRDLASKFDKNL++AA L +EAKLR+  SLEGHV+LKKLRDALE+
Sbjct  57    EKETEQLSEQHKRLSVRDLASKFDKNLTAAANLTDEAKLREVASLEGHVMLKKLRDALES  116

Query  490   LKGRLAGRNKEDVEIAIAMVEALAVRLTQKEGDLIQEKFEVNKLVSILKQASEDAKKLVN  669
             L+G +AG+NKEDVE AI+MVEALAV+LTQ EG+L+QEKF+V KL + LKQASEDAKKLVN
Sbjct  117   LRGCMAGQNKEDVEKAISMVEALAVKLTQNEGELLQEKFQVKKLANFLKQASEDAKKLVN  176

Query  670   QERSFACAEIESARAVVQRIGEALEEQEINSQVSGKQ--eveelmeeiqeARRIRVLHQP  843
             QE+SFACAEIESARAVV R+G+A  EQE +S+ S  Q  +VE+L+EE+QEARRI+ +HQP
Sbjct  177   QEKSFACAEIESARAVVHRLGDAFTEQERSSEASKTQGPDVEKLVEEVQEARRIKRMHQP  236

Query  844   SKVMDMEHELRALRIQLNEKSVVSFKLQNELAMSKRTEQNKSQLYRIIGSESVGSILRIQ  1023
             +KVMDM+HELRALR Q+ EKSV S KLQ E+A+ KRT+++KS LY + G +S+GS LRI+
Sbjct  237   TKVMDMQHELRALRNQIREKSVNSVKLQKEIAIVKRTDESKSHLYALDGKQSLGSFLRIR  296

Query  1024  PCSDEAVDLSKCSIQWYRLSSECSRREPILGADKSVYAPEPIDVGRVLEADIVSNGLKAS  1203
              CSD A ++S+CS+QWYR +SE SRRE I GA+++VYAPEP DVGRVL+AD+  NG K +
Sbjct  297   SCSDNAPNISECSVQWYRAASETSRREAISGANRTVYAPEPFDVGRVLQADVCFNGQKVT  356

Query  1204  VTTIGQIDQAAGLGNYVETLLRKSNTEFSVVIAQMNGRNYSSRSIHSFHVGKMRMKLNKG  1383
             +TT   ID AAGL ++VE+L+RKS++EF+VVI+QMNG++++SRS H   +GKMR+KL +G
Sbjct  357   LTTDSPIDPAAGLQSHVESLMRKSHSEFNVVISQMNGQDHASRSNHVLSIGKMRIKLCRG  416

Query  1384  WITKARDSYSGSMQLCGFRGGGNSAAKSLFWQPRKGQSFVLVFDSERERNGALVVARKHA  1563
             WITK+R+ YS  MQLCG RG  N+ AK+LFWQPRKG +FVL F+SE++RN A+V+ARK+A
Sbjct  417   WITKSREIYSTFMQLCGVRGKANAPAKALFWQPRKGLTFVLTFESEKDRNAAIVLARKYA  476

Query  1564  LECNVSI  1584
              +CNV++
Sbjct  477   FDCNVTL  483



>ref|XP_003624924.1| hypothetical protein MTR_7g089090 [Medicago truncatula]
Length=479

 Score =   617 bits (1591),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 317/469 (68%), Positives = 390/469 (83%), Gaps = 1/469 (0%)
 Frame = +1

Query  172   MYTFKSVSADVSFASNQFPKYKLGPDFQILEEALLENKGPSLKevveeettRLTEQHKRL  351
             M     VSADVSF SN FPKYKLG D Q+ +E   +N+GPSLKEV+E+E + L+EQ+ R+
Sbjct  3     MEAVPPVSADVSFISNSFPKYKLGADHQVFQETAEDNQGPSLKEVIEQEASNLSEQNNRI  62

Query  352   SVRDLASKFDKNLSSAAKLANEAKLRDAPSLEGHVLLKKLRDALETLKGRLAGRNKEDVE  531
             SVRDLASKFDKNLS+AAKL+NEAKLR+ PSLEGHVLLKKLRDALE LKGR  GRNKEDV 
Sbjct  63    SVRDLASKFDKNLSAAAKLSNEAKLREVPSLEGHVLLKKLRDALEYLKGRFTGRNKEDVA  122

Query  532   IAIAMVEALAVRLTQKEGDLIQEKFEVNKLVSILKQASEDAKKLVNQERSFACAEIESAR  711
              AI+MVEALAV+LTQ EG+LIQEKFEV KL++ LKQASEDAKKLVNQE+SFACAEIESAR
Sbjct  123   NAISMVEALAVKLTQNEGELIQEKFEVKKLLNFLKQASEDAKKLVNQEKSFACAEIESAR  182

Query  712   AVVQRIGEALEEQEINSQVSGKQeveelmeeiqeARRIRVLHQPSKVMDMEHELRALRIQ  891
             AVV RIGEALEEQE  ++ S  Q+V+ L+EE+QEARRIR+LHQPSKVM ME+ELRALR Q
Sbjct  183   AVVLRIGEALEEQEKVTEASKPQDVDGLVEEVQEARRIRLLHQPSKVMAMEYELRALRDQ  242

Query  892   LNEKSVVSFKLQNELAMSKRTEQNKSQLYRIIGSESVGSILRIQPCSDEAVDLSKCSIQW  1071
             + EKSV S +LQ EL MSK  ++NKS  Y++ GSE++GS ++++PC+ E   +SKCS QW
Sbjct  243   IQEKSVFSIQLQKELTMSKWDKENKSHSYKLDGSEALGSYMQVKPCTSEVPQVSKCSFQW  302

Query  1072  YRLSSECSRREPILGADKSVYAPEPIDVGRVLEADIVSNGLKASVTTIGQIDQAAGLGNY  1251
             YRLSSE S RE I GA+KS+YAP+P+DVGR+L+ DIVS+G K ++TT   I    GLG+ 
Sbjct  303   YRLSSEGSWREVISGANKSIYAPDPLDVGRMLQVDIVSDGKKLTLTT-NPIQTVPGLGSQ  361

Query  1252  VETLLRKSNTEFSVVIAQMNGRNYSSRSIHSFHVGKMRMKLNKGWITKARDSYSGSMQLC  1431
             VE LLRKSNT+F+VVI+QMNG+++SS S HSF+VG+MR+KL +GWITKAR+ YS +MQLC
Sbjct  362   VEALLRKSNTDFNVVISQMNGKDHSSHSTHSFNVGRMRIKLCRGWITKAREIYSPTMQLC  421

Query  1432  GFRGGGNSAAKSLFWQPRKGQSFVLVFDSERERNGALVVARKHALECNV  1578
             G R   ++AAK+LFWQ RKG SFVL F+SE++RN A+++ARKHAL+CNV
Sbjct  422   GVRSDVSNAAKTLFWQARKGLSFVLTFESEKDRNVAIMIARKHALDCNV  470



>ref|XP_010673068.1| PREDICTED: uncharacterized protein LOC104889525 [Beta vulgaris 
subsp. vulgaris]
Length=489

 Score =   616 bits (1588),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 321/485 (66%), Positives = 400/485 (82%), Gaps = 1/485 (0%)
 Frame = +1

Query  130   MTKVSPEFVGGEVQMYTFKSVSADVSFASNQFPKYKLGPDFQILEEALLENKGPSLKevv  309
             MT+VSPE    EV      SVSADVSF SN FPKYK+GP+ +I+EE       P LKEVV
Sbjct  1     MTRVSPEL-DYEVHSDAVLSVSADVSFPSNGFPKYKIGPNNEIVEEPKPHPDSPPLKEVV  59

Query  310   eeettRLTEQHKRLSVRDLASKFDKNLSSAAKLANEAKLRDAPSLEGHVLLKKLRDALET  489
              +ET +L EQ+KRLSVRDLA+KFDKNLS+AAKL+++AK+R+  SLEGHVLLKKLRDALE 
Sbjct  60    TQETKQLAEQNKRLSVRDLATKFDKNLSAAAKLSDQAKIRETASLEGHVLLKKLRDALEL  119

Query  490   LKGRLAGRNKEDVEIAIAMVEALAVRLTQKEGDLIQEKFEVNKLVSILKQASEDAKKLVN  669
              KG +AGRNKEDVE AI+MVEALAV+LTQ+EG+LIQEKFEV KL + LKQASEDAK+LVN
Sbjct  120   FKGCMAGRNKEDVEKAISMVEALAVKLTQEEGELIQEKFEVKKLANFLKQASEDAKRLVN  179

Query  670   QERSFACAEIESARAVVQRIGEALEEQEINSQVSGKQeveelmeeiqeARRIRVLHQPSK  849
             QERSFACAEIESARAVVQR GEALEE+E  +Q SGKQ+VE L+EE+QEARRI+++HQP K
Sbjct  180   QERSFACAEIESARAVVQRFGEALEEEEKLAQTSGKQDVETLVEEVQEARRIKMMHQPCK  239

Query  850   VMDMEHELRALRIQLNEKSVVSFKLQNELAMSKRTEQNKSQLYRIIGSESVGSILRIQPC  1029
             VMDMEHELRALR+QL EKS+ S KLQ ELAMSKR E+++  +Y++ G +++GS LRI+P 
Sbjct  240   VMDMEHELRALRLQLREKSIFSAKLQKELAMSKRAEESRLCVYQLEGVQTLGSCLRIRPR  299

Query  1030  SDEAVDLSKCSIQWYRLSSECSRREPILGADKSVYAPEPIDVGRVLEADIVSNGLKASVT  1209
             ++ A DLSKCSIQWYR+SSE   +E I GA+K +YAPEP+DVG++L AD+VS+    SVT
Sbjct  300   ANNAPDLSKCSIQWYRVSSEGDLKEIISGANKPIYAPEPLDVGKILRADVVSDTQTISVT  359

Query  1210  TIGQIDQAAGLGNYVETLLRKSNTEFSVVIAQMNGRNYSSRSIHSFHVGKMRMKLNKGWI  1389
             T+  ID A GL +YV++L R+SN EF VVI+QMNG +Y S S+H FHVG+ R+KL++GWI
Sbjct  360   TVAAIDPAPGLTSYVQSLQRRSNAEFHVVISQMNGHDYPSHSVHVFHVGRSRLKLSRGWI  419

Query  1390  TKARDSYSGSMQLCGFRGGGNSAAKSLFWQPRKGQSFVLVFDSERERNGALVVARKHALE  1569
              K R+SYS SMQLCG RGGGN+A+KSLFWQ RKG S+VL F+SER+RN A+++ARK+AL+
Sbjct  420   NKTRESYSTSMQLCGVRGGGNAASKSLFWQVRKGLSYVLTFESERDRNAAIMIARKYALD  479

Query  1570  CNVSI  1584
             C++ +
Sbjct  480   CHIEL  484



>ref|XP_010554728.1| PREDICTED: uncharacterized protein LOC104824371 [Tarenaya hassleriana]
 ref|XP_010554729.1| PREDICTED: uncharacterized protein LOC104824371 [Tarenaya hassleriana]
 ref|XP_010554730.1| PREDICTED: uncharacterized protein LOC104824371 [Tarenaya hassleriana]
 ref|XP_010554731.1| PREDICTED: uncharacterized protein LOC104824371 [Tarenaya hassleriana]
 ref|XP_010554732.1| PREDICTED: uncharacterized protein LOC104824371 [Tarenaya hassleriana]
 ref|XP_010554733.1| PREDICTED: uncharacterized protein LOC104824371 [Tarenaya hassleriana]
Length=491

 Score =   609 bits (1570),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 319/487 (66%), Positives = 396/487 (81%), Gaps = 3/487 (1%)
 Frame = +1

Query  130   MTKVSPEFVGGEVQMYTFKSVSADVSFASNQFPKYKLGPDFQILEEALLENKGPSLKevv  309
             MTKV PE +           VSADVSF SN FPKYKLG D QI+EE   + KGPS+KEVV
Sbjct  1     MTKVCPE-IEERTMSEAILPVSADVSFVSNHFPKYKLGSDNQIVEEPKEDEKGPSVKEVV  59

Query  310   eeettRLTEQHKRLSVRDLASKFDKNLSSAAKLANEAKLRDAPSLEGHVLLKKLRDALET  489
             EEET +L+EQHKRLSVRDLASKFDKNL+SA  L +EAKLR+  SLEGHV+LKKLRDALE+
Sbjct  60    EEETEQLSEQHKRLSVRDLASKFDKNLASAVNLTDEAKLREVASLEGHVMLKKLRDALES  119

Query  490   LKGRLAGRNKEDVEIAIAMVEALAVRLTQKEGDLIQEKFEVNKLVSILKQASEDAKKLVN  669
             L+GR+AGRNKEDVE AI+MVEALAV+LTQ EG+LIQEKFEV KL + LKQASEDAKKLVN
Sbjct  120   LRGRMAGRNKEDVEKAISMVEALAVKLTQNEGELIQEKFEVKKLANFLKQASEDAKKLVN  179

Query  670   QERSFACAEIESARAVVQRIGEALEEQEINSQVSGKQ--eveelmeeiqeARRIRVLHQP  843
             QE+SFACAEIESARAVVQR+GEA EEQE NS+ S  Q  +VE+L+EE+QEARRI+ +HQP
Sbjct  180   QEKSFACAEIESARAVVQRLGEAFEEQERNSEASRTQGPDVEKLVEEVQEARRIKRMHQP  239

Query  844   SKVMDMEHELRALRIQLNEKSVVSFKLQNELAMSKRTEQNKSQLYRIIGSESVGSILRIQ  1023
             +KVMDM+HEL ALR Q+ EKSV S KLQ E+++ KR E++KS  Y + G++++GS LRI+
Sbjct  240   TKVMDMQHELHALRNQIREKSVTSVKLQKEISIVKRAEESKSHPYALDGAQTLGSCLRIR  299

Query  1024  PCSDEAVDLSKCSIQWYRLSSECSRREPILGADKSVYAPEPIDVGRVLEADIVSNGLKAS  1203
              CSD + +LS CS+QWYR +SE SRRE I GA++ VYAPEP DV RVL+AD+  NG K +
Sbjct  300   ACSDSSPNLSNCSVQWYRAASETSRREAISGANQLVYAPEPFDVSRVLQADVCFNGQKVT  359

Query  1204  VTTIGQIDQAAGLGNYVETLLRKSNTEFSVVIAQMNGRNYSSRSIHSFHVGKMRMKLNKG  1383
             +TT G ID AAGL ++VE L+RKS++EF+VVI+QMNG++ +SRS H   +GKMR+KL +G
Sbjct  360   LTTDGPIDSAAGLQSHVEALMRKSHSEFNVVISQMNGQDNASRSNHVLSIGKMRIKLCRG  419

Query  1384  WITKARDSYSGSMQLCGFRGGGNSAAKSLFWQPRKGQSFVLVFDSERERNGALVVARKHA  1563
             WITK+R+ YS SMQLCG R   N+ AK+L WQPRKG +FVL F+SE++RN A+V+ARK+A
Sbjct  420   WITKSREIYSTSMQLCGARSKVNAPAKALLWQPRKGLTFVLTFESEQDRNAAIVLARKYA  479

Query  1564  LECNVSI  1584
              +CNV++
Sbjct  480   FDCNVTL  486



>ref|XP_007211839.1| hypothetical protein PRUPE_ppa004638mg [Prunus persica]
 gb|EMJ13038.1| hypothetical protein PRUPE_ppa004638mg [Prunus persica]
Length=498

 Score =   593 bits (1528),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 317/486 (65%), Positives = 394/486 (81%), Gaps = 2/486 (0%)
 Frame = +1

Query  130   MTKVSPEFVGGEVQMYTFKSVSADVSFASNQFPKYKLGPDFQILEEALLENKGPSLKevv  309
             MT+V  +F G  +Q     +VSADV F+S++FP YK+G + QI+E A  E K  S+KEVV
Sbjct  1     MTRVGRDF-GDTMQKDAVPAVSADVIFSSSRFPIYKIGANNQIVE-AKDEQKVLSMKEVV  58

Query  310   eeettRLTEQHKRLSVRDLASKFDKNLSSAAKLANEAKLRDAPSLEGHVLLKKLRDALET  489
               ET +L EQ KRLSVRDLASKF+K L++AAKL+ EA+LR+A SLE HVLLKKLRDALE+
Sbjct  59    ARETAQLLEQQKRLSVRDLASKFEKGLAAAAKLSEEARLREAASLEKHVLLKKLRDALES  118

Query  490   LKGRLAGRNKEDVEIAIAMVEALAVRLTQKEGDLIQEKFEVNKLVSILKQASEDAKKLVN  669
             LKGR+AGRNK+DVE AI+MVEALAV+LTQ+EG+LIQEK EV KL + LKQASEDAKKLV+
Sbjct  119   LKGRVAGRNKDDVEDAISMVEALAVQLTQREGELIQEKAEVKKLANFLKQASEDAKKLVD  178

Query  670   QERSFACAEIESARAVVQRIGEALEEQEINSQVSGKQeveelmeeiqeARRIRVLHQPSK  849
             +ER+FA AEIE+ARA VQR+ EAL+EQE  S+ SGKQ++EELM+E+QEARRI++LHQPSK
Sbjct  179   EERAFARAEIENARAAVQRVEEALQEQEQMSRASGKQDLEELMKEVQEARRIKMLHQPSK  238

Query  850   VMDMEHELRALRIQLNEKSVVSFKLQNELAMSKRTEQNKSQLYRIIGSESVGSILRIQPC  1029
             VMDMEHELRALR QL EKS  S +LQ ELAMSKR  +  SQLY + G E++GS LRIQPC
Sbjct  239   VMDMEHELRALRAQLTEKSKNSVRLQKELAMSKRGLEQNSQLYELDGPEALGSYLRIQPC  298

Query  1030  SDEAVDLSKCSIQWYRLSSECSRREPILGADKSVYAPEPIDVGRVLEADIVSNGLKASVT  1209
             SD+A +LSKCSIQWYR+SS+  ++E I GA KSVYAPEP DVGR+L+ADI+  G   ++T
Sbjct  299   SDDAPELSKCSIQWYRVSSQGGKKELISGAIKSVYAPEPFDVGRILQADIILEGQWLTLT  358

Query  1210  TIGQIDQAAGLGNYVETLLRKSNTEFSVVIAQMNGRNYSSRSIHSFHVGKMRMKLNKGWI  1389
             T G ID AAGLG+YVE L+RK + EF+VVI QMNG N+ S SIH FHVGKMR+KL KG  
Sbjct  359   TAGPIDPAAGLGSYVEALVRKHDIEFNVVITQMNGVNHPSESIHVFHVGKMRIKLCKGKT  418

Query  1390  TKARDSYSGSMQLCGFRGGGNSAAKSLFWQPRKGQSFVLVFDSERERNGALVVARKHALE  1569
             T A++ +S SMQLCG RGGGN+AA++LFWQ ++G SFVL F+SERERN A+++AR+ A +
Sbjct  419   TIAKEYFSTSMQLCGVRGGGNAAAQALFWQAKQGLSFVLAFESERERNAAIMLARRFAFD  478

Query  1570  CNVSIT  1587
             CN+ + 
Sbjct  479   CNIMLA  484



>gb|KFK36952.1| hypothetical protein AALP_AA4G193500 [Arabis alpina]
Length=519

 Score =   593 bits (1528),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 311/490 (63%), Positives = 396/490 (81%), Gaps = 5/490 (1%)
 Frame = +1

Query  130   MTKVSPEFVGGEVQM--YTFKSVSADVSFASNQFPKYKLGPDFQILEEALLENKGPSLKe  303
             MTKV P+    E +M     +S+SADVSFASNQFP YKLGPD QI++E   ++KGPS+K+
Sbjct  27    MTKVCPKVEVEEKRMCEAVVESISADVSFASNQFPSYKLGPDDQIIDEPEEDDKGPSVKD  86

Query  304   vveeettRLTEQHKRLSVRDLASKFDKNLSSAAKLANEAKLRDAPSLEGHVLLKKLRDAL  483
             VV++ET  L++QHKRLSVRDLA KFDKNL+SAAKL +EAKL +  SLEGHV+LKKLRDAL
Sbjct  87    VVDKETGDLSDQHKRLSVRDLACKFDKNLASAAKLVDEAKLNEVTSLEGHVMLKKLRDAL  146

Query  484   ETLKGRLAGRNKEDVEIAIAMVEALAVRLTQKEGDLIQEKFEVNKLVSILKQASEDAKKL  663
             E ++GR+ GRNKE++E AI+MVEALAV+LTQ EG L+QEKFEV KL + LKQASEDAKKL
Sbjct  147   EFMRGRMDGRNKEEIEKAISMVEALAVKLTQNEGGLVQEKFEVKKLANFLKQASEDAKKL  206

Query  664   VNQERSFACAEIESARAVVQRIGEALEEQEINSQVSGK--QeveelmeeiqeARRIRVLH  837
             VNQE SFACAEIESARA+V R+G   EEQE+ S+ S      VE+L++E+QEARRI+ +H
Sbjct  207   VNQENSFACAEIESARALVLRLGGTFEEQELCSKASRALGPNVEKLVDEVQEARRIKRMH  266

Query  838   QPSKVMDMEHELRALRIQLNEKSVVSFKLQNELAMSKRTEQNKSQLYRIIGSESVGSILR  1017
             +P+KV+ M+HELR ++ Q+ EKS  S KLQ E+A+ KR E +KS  Y + G++S+GS L+
Sbjct  267   KPTKVIGMQHELRDIKSQIQEKSAYSVKLQREIAIIKRAEGSKSCPYVLDGAQSLGSCLK  326

Query  1018  IQPCSDEAVDLSKCSIQWYRLSSECSRREPILGADKSVYAPEPIDVGRVLEADIVSNGLK  1197
             I+  S+ A+D+SKCSIQWYR +SE SRRE I GA++ VYAPEP DVGRV++ADIVSNG K
Sbjct  327   IRASSESALDISKCSIQWYRAASESSRREAISGANRPVYAPEPFDVGRVIQADIVSNGQK  386

Query  1198  ASVTTIGQIDQAAGLGNYVETLLRKSNTEFSVVIAQMNGRNYSSRSIHSFHVGKMRMKLN  1377
              +VTT G I+ AA L + VE+LLRKSN+EF+VVI+QMNG+++SSRS H F VGK R+KL+
Sbjct  387   FAVTTDGPINTAASLQSRVESLLRKSNSEFTVVISQMNGQDHSSRS-HVFTVGKARIKLS  445

Query  1378  KGWITKARDSYSGSMQLCGFRGGGNSAAKSLFWQPRKGQSFVLVFDSERERNGALVVARK  1557
             +GWITKARD YS SMQLCG RG  N  AKSLFWQPRKG +F+L F+SE+ERN A+V++RK
Sbjct  446   RGWITKARDIYSNSMQLCGVRGNANVPAKSLFWQPRKGLTFLLTFESEQERNAAIVLSRK  505

Query  1558  HALECNVSIT  1587
             +A +CNV++ 
Sbjct  506   YAYDCNVTLV  515



>ref|XP_008227380.1| PREDICTED: cingulin [Prunus mume]
 ref|XP_008227381.1| PREDICTED: cingulin [Prunus mume]
Length=498

 Score =   589 bits (1519),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 314/486 (65%), Positives = 392/486 (81%), Gaps = 2/486 (0%)
 Frame = +1

Query  130   MTKVSPEFVGGEVQMYTFKSVSADVSFASNQFPKYKLGPDFQILEEALLENKGPSLKevv  309
             MT+V  +F G  +Q     +VSADV F+S++FP YK+G + QI+E A  E K  S+KEVV
Sbjct  1     MTRVGRDF-GDTMQKDAVPAVSADVIFSSSRFPNYKIGANNQIVE-AKDEQKVLSMKEVV  58

Query  310   eeettRLTEQHKRLSVRDLASKFDKNLSSAAKLANEAKLRDAPSLEGHVLLKKLRDALET  489
               ET +L EQ KRLSVRDLASKF+K L++AAKL+ EA+LR+A SLE HVLLKKLRDALE+
Sbjct  59    ARETAQLLEQQKRLSVRDLASKFEKGLAAAAKLSEEARLREAASLEKHVLLKKLRDALES  118

Query  490   LKGRLAGRNKEDVEIAIAMVEALAVRLTQKEGDLIQEKFEVNKLVSILKQASEDAKKLVN  669
             LKGR+AGRNK+DVE AI+MVEALAV+LTQ+EG+L+QEK EV KL + LKQASEDAKKLV+
Sbjct  119   LKGRVAGRNKDDVEDAISMVEALAVQLTQREGELMQEKAEVKKLANFLKQASEDAKKLVD  178

Query  670   QERSFACAEIESARAVVQRIGEALEEQEINSQVSGKQeveelmeeiqeARRIRVLHQPSK  849
             +ER+FA AEIE+ARA VQR+ EAL+EQE  S+ SGKQ++EELM+E+QEARRI++LHQPSK
Sbjct  179   EERAFARAEIENARAAVQRVEEALQEQEQMSRASGKQDLEELMKEVQEARRIKMLHQPSK  238

Query  850   VMDMEHELRALRIQLNEKSVVSFKLQNELAMSKRTEQNKSQLYRIIGSESVGSILRIQPC  1029
             VMDMEHELRALR QL EKS  S +LQ ELAMSKR  +   QLY + G E++GS LRIQPC
Sbjct  239   VMDMEHELRALRAQLTEKSKNSVRLQKELAMSKRGLEQNCQLYELDGPEALGSYLRIQPC  298

Query  1030  SDEAVDLSKCSIQWYRLSSECSRREPILGADKSVYAPEPIDVGRVLEADIVSNGLKASVT  1209
             SD+A +LSKCSIQWYR+SS+  ++E I GA KSVYAPEP DVGR+L+ADI+  G   ++T
Sbjct  299   SDDAPELSKCSIQWYRVSSQGGKKELISGAIKSVYAPEPFDVGRILQADIILEGQWLTLT  358

Query  1210  TIGQIDQAAGLGNYVETLLRKSNTEFSVVIAQMNGRNYSSRSIHSFHVGKMRMKLNKGWI  1389
             T G ID AAGLG+YVE L+RK + EF+VVI QMNG N+ S SIH FHVGKMR+KL KG  
Sbjct  359   TAGPIDPAAGLGSYVEALVRKHDIEFNVVITQMNGVNHPSESIHVFHVGKMRIKLCKGKT  418

Query  1390  TKARDSYSGSMQLCGFRGGGNSAAKSLFWQPRKGQSFVLVFDSERERNGALVVARKHALE  1569
             T A++ +S SMQLCG RGGGN+A ++LFWQ ++G SFVL F+SERERN A+++AR+ A +
Sbjct  419   TIAKEYFSTSMQLCGVRGGGNAATQALFWQAKQGLSFVLAFESERERNAAIMLARRFAFD  478

Query  1570  CNVSIT  1587
             CN+ + 
Sbjct  479   CNIMLA  484



>ref|XP_010271915.1| PREDICTED: uncharacterized protein LOC104607860 isoform X1 [Nelumbo 
nucifera]
 ref|XP_010271916.1| PREDICTED: uncharacterized protein LOC104607860 isoform X1 [Nelumbo 
nucifera]
Length=494

 Score =   588 bits (1516),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 308/488 (63%), Positives = 389/488 (80%), Gaps = 8/488 (2%)
 Frame = +1

Query  130   MTKVSPEFVGGEVQMYTFKSVSADVSFASNQFPKYKLGPDFQILEEALLENKGP---SLK  300
             MT+VS +F G  +Q     SVSADVSF SN+FP Y++G + +I+E      +GP   S+K
Sbjct  1     MTRVSRDF-GNTMQRDAVPSVSADVSFVSNRFPHYRIGANNKIMEP----KEGPEVPSMK  55

Query  301   evveeettRLTEQHKRLSVRDLASKFDKNLSSAAKLANEAKLRDAPSLEGHVLLKKLRDA  480
             ++V  ET +L EQ KRLSVRDLASKF+K L++AAKL+ EA+ +DA SLE HVLLKKLRDA
Sbjct  56    DIVARETAKLIEQKKRLSVRDLASKFEKGLAAAAKLSEEARFKDAASLERHVLLKKLRDA  115

Query  481   LETLKGRLAGRNKEDVEIAIAMVEALAVRLTQKEGDLIQEKFEVNKLVSILKQASEDAKK  660
             LE+L+GR+AGRNK+DVE AIAMVEALAV+LT+ EGDLI EK EV KL +ILKQASEDA+K
Sbjct  116   LESLRGRVAGRNKDDVEEAIAMVEALAVQLTKSEGDLIHEKSEVKKLANILKQASEDARK  175

Query  661   LVNQERSFACAEIESARAVVQRIGEALEEQEINSQVSGKQeveelmeeiqeARRIRVLHQ  840
             LV++ERSFA AEIE+ARA VQR+ EAL+EQE  +Q SGKQE+E+L +E+QEARRI++LHQ
Sbjct  176   LVDEERSFARAEIENARAAVQRVEEALKEQERIAQTSGKQEMEDLRKEVQEARRIKMLHQ  235

Query  841   PSKVMDMEHELRALRIQLNEKSVVSFKLQNELAMSKRTEQNKSQLYRIIGSESVGSILRI  1020
             PSKVMDMEHELRALR QL EKS+ S +LQ ELAM K+ ++NKS+LY I GSE++GS LRI
Sbjct  236   PSKVMDMEHELRALRTQLAEKSMHSLQLQKELAMIKKLQENKSRLYVIDGSETLGSYLRI  295

Query  1021  QPCSDEAVDLSKCSIQWYRLSSECSRREPILGADKSVYAPEPIDVGRVLEADIVSNGLKA  1200
               C D+A D+ KCSIQWYR+  +  ++E I GA K  YAPEP DVGR+L+ADIVS+    
Sbjct  296   TSCVDKAPDILKCSIQWYRVLPDGGKKELISGATKPFYAPEPFDVGRILQADIVSDDQTV  355

Query  1201  SVTTIGQIDQAAGLGNYVETLLRKSNTEFSVVIAQMNGRNYSSRSIHSFHVGKMRMKLNK  1380
             SVTT G ID AAGLG+YVE L+RK  TEF+VVI QMNG+++ S  +H+FHVGKMR+KL K
Sbjct  356   SVTTAGPIDPAAGLGSYVEALVRKPETEFNVVITQMNGQDHPSNVVHTFHVGKMRIKLCK  415

Query  1381  GWITKARDSYSGSMQLCGFRGGGNSAAKSLFWQPRKGQSFVLVFDSERERNGALVVARKH  1560
             G  TKA+++YS SMQLCG RG GN+A ++LFW  +KGQS VL F+SERERN A+++AR+ 
Sbjct  416   GRFTKAKENYSNSMQLCGVRGAGNAAPQALFWHVKKGQSLVLAFESERERNAAIMLARRF  475

Query  1561  ALECNVSI  1584
             A +CN+ +
Sbjct  476   AFDCNIML  483



>ref|XP_007015354.1| Plectin-related isoform 1 [Theobroma cacao]
 ref|XP_007015355.1| Plectin-related isoform 1 [Theobroma cacao]
 gb|EOY32973.1| Plectin-related isoform 1 [Theobroma cacao]
 gb|EOY32974.1| Plectin-related isoform 1 [Theobroma cacao]
Length=494

 Score =   587 bits (1513),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 314/486 (65%), Positives = 387/486 (80%), Gaps = 2/486 (0%)
 Frame = +1

Query  130   MTKVSPEFVGGEVQMYTFKSVSADVSFASNQFPKYKLGPDFQILEEALLENKGPSLKevv  309
             MT+VS EF G  +Q     +VSADV FAS++FP YK+G + QIL+ A  + K  S+KEVV
Sbjct  1     MTRVSREF-GDTMQKEAVPAVSADVIFASSRFPNYKIGANNQILD-AKEDPKVLSMKEVV  58

Query  310   eeettRLTEQHKRLSVRDLASKFDKNLSSAAKLANEAKLRDAPSLEGHVLLKKLRDALET  489
               ET  L EQ KRLSVRDLASKF+K L++AAKL+ EA+LR+A SLE HVLLKKLRDALE+
Sbjct  59    ARETALLLEQQKRLSVRDLASKFEKGLAAAAKLSEEARLREAASLEKHVLLKKLRDALES  118

Query  490   LKGRLAGRNKEDVEIAIAMVEALAVRLTQKEGDLIQEKFEVNKLVSILKQASEDAKKLVN  669
             LKGR+AGRNK+DV  AIAMVEALAV+LTQ+EG+LIQEK EV KL + LKQASEDAKKLV+
Sbjct  119   LKGRVAGRNKDDVAEAIAMVEALAVQLTQREGELIQEKAEVKKLANFLKQASEDAKKLVD  178

Query  670   QERSFACAEIESARAVVQRIGEALEEQEINSQVSGKQeveelmeeiqeARRIRVLHQPSK  849
             +ER+FA  EIESARA VQR+ EAL+E E  S+ SGKQ++EELM+E+QEARRI++LHQPSK
Sbjct  179   EERAFARVEIESARAAVQRVEEALQEHEQMSRASGKQDLEELMKEVQEARRIKMLHQPSK  238

Query  850   VMDMEHELRALRIQLNEKSVVSFKLQNELAMSKRTEQNKSQLYRIIGSESVGSILRIQPC  1029
             VMDMEHELRALRIQL EKS  S  LQ ELA SKR E+N S LY + G+E++GS  RI+PC
Sbjct  239   VMDMEHELRALRIQLAEKSKHSILLQKELARSKRVEENLSHLYELDGAETLGSYFRIKPC  298

Query  1030  SDEAVDLSKCSIQWYRLSSECSRREPILGADKSVYAPEPIDVGRVLEADIVSNGLKASVT  1209
             SD A +LS+CSIQWYR+SSE  ++E I GA KSVYAPEP DVGR+L+A+I+ +G K  + 
Sbjct  299   SDFAPELSRCSIQWYRISSEGGKKELISGASKSVYAPEPFDVGRILQAEIIYDGQKIILK  358

Query  1210  TIGQIDQAAGLGNYVETLLRKSNTEFSVVIAQMNGRNYSSRSIHSFHVGKMRMKLNKGWI  1389
             T G ID AAGLGNYVE L+RK + EF+VV+ QMNG ++ S SIH  HVGKMRMKL KG +
Sbjct  359   TTGAIDPAAGLGNYVEALVRKHDVEFNVVVTQMNGADHPSESIHVLHVGKMRMKLCKGKM  418

Query  1390  TKARDSYSGSMQLCGFRGGGNSAAKSLFWQPRKGQSFVLVFDSERERNGALVVARKHALE  1569
               A++ YS  MQLCG RGGGN+AA++LFWQ +KG S VL F+SERERN A+++AR+ A +
Sbjct  419   AIAKEYYSTVMQLCGVRGGGNAAAQALFWQAKKGLSVVLAFESERERNAAIMLARRFAFD  478

Query  1570  CNVSIT  1587
             CN+ + 
Sbjct  479   CNIMLA  484



>gb|KHG04844.1| Pyridoxine 5'-phosphate synthase [Gossypium arboreum]
Length=495

 Score =   586 bits (1511),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 312/486 (64%), Positives = 390/486 (80%), Gaps = 2/486 (0%)
 Frame = +1

Query  130   MTKVSPEFVGGEVQMYTFKSVSADVSFASNQFPKYKLGPDFQILEEALLENKGPSLKevv  309
             MT+VS EF G  +Q     +VSADV FAS++FP YK+G + QI++ A  + K  ++KEVV
Sbjct  1     MTRVSREF-GNTMQKEAVSAVSADVIFASSRFPNYKIGANNQIVD-AKEDPKVLTMKEVV  58

Query  310   eeettRLTEQHKRLSVRDLASKFDKNLSSAAKLANEAKLRDAPSLEGHVLLKKLRDALET  489
               ET  L EQ KRLSVRDLASKF+K L++AAKL+ EA+LR+A SLE HVLLKKLRDALE+
Sbjct  59    ARETALLLEQQKRLSVRDLASKFEKGLAAAAKLSEEARLREAASLEKHVLLKKLRDALES  118

Query  490   LKGRLAGRNKEDVEIAIAMVEALAVRLTQKEGDLIQEKFEVNKLVSILKQASEDAKKLVN  669
             LKGR+AGRNK+DVE AIAMVEALAV+LTQ+EG+L+QEK EV KL + LKQASEDAKKLV+
Sbjct  119   LKGRVAGRNKDDVEEAIAMVEALAVQLTQREGELLQEKTEVKKLANFLKQASEDAKKLVD  178

Query  670   QERSFACAEIESARAVVQRIGEALEEQEINSQVSGKQeveelmeeiqeARRIRVLHQPSK  849
             +ER+ A AEIESARA VQR+ EA++EQE  S+ SGKQ++EELM+E+QEARRI++LHQPSK
Sbjct  179   EERAHARAEIESARAAVQRVEEAVQEQEQISRASGKQDLEELMKEVQEARRIKMLHQPSK  238

Query  850   VMDMEHELRALRIQLNEKSVVSFKLQNELAMSKRTEQNKSQLYRIIGSESVGSILRIQPC  1029
             VMDMEHEL ALRIQL EKS  S  LQ ELA SKR E+  S +Y + G+E++GS LRI+PC
Sbjct  239   VMDMEHELHALRIQLAEKSKHSLLLQKELARSKRMEKTISHIYELGGTETLGSYLRIKPC  298

Query  1030  SDEAVDLSKCSIQWYRLSSECSRREPILGADKSVYAPEPIDVGRVLEADIVSNGLKASVT  1209
             SD A +LS+CSIQWYR+SSE S++E ILGA KSVYAPEP DVGR+L+ +I+ +G    +T
Sbjct  299   SDIAPELSECSIQWYRISSETSKKELILGASKSVYAPEPFDVGRILQVEIIYDGQLIVLT  358

Query  1210  TIGQIDQAAGLGNYVETLLRKSNTEFSVVIAQMNGRNYSSRSIHSFHVGKMRMKLNKGWI  1389
             T G ID AAGLGNYVE L+RK + EF+VV++QMNG ++ S SIH  HVGKMRMKL KG  
Sbjct  359   TAGAIDPAAGLGNYVEALVRKHDIEFNVVVSQMNGADHPSESIHVLHVGKMRMKLCKGKT  418

Query  1390  TKARDSYSGSMQLCGFRGGGNSAAKSLFWQPRKGQSFVLVFDSERERNGALVVARKHALE  1569
             T  ++ YS SMQLCG RGGGN+AA++LFWQ +KG S VL F+SERERN A+++AR+ A +
Sbjct  419   TIVKEYYSSSMQLCGVRGGGNAAAQALFWQAKKGFSVVLAFESERERNAAIMLARRFAFD  478

Query  1570  CNVSIT  1587
             CN+ + 
Sbjct  479   CNIMLA  484



>ref|XP_004291720.1| PREDICTED: uncharacterized protein LOC101300025 [Fragaria vesca 
subsp. vesca]
Length=494

 Score =   585 bits (1507),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 310/486 (64%), Positives = 391/486 (80%), Gaps = 2/486 (0%)
 Frame = +1

Query  130   MTKVSPEFVGGEVQMYTFKSVSADVSFASNQFPKYKLGPDFQILEEALLENKGPSLKevv  309
             MT+V  +F G  +    F  VSADV+FAS+QFP YK+GP+ QI+E   L+ K  S+KEVV
Sbjct  1     MTRVGRDF-GDTMHKDAFPPVSADVTFASSQFPDYKIGPNNQIVE-GKLDQKVLSMKEVV  58

Query  310   eeettRLTEQHKRLSVRDLASKFDKNLSSAAKLANEAKLRDAPSLEGHVLLKKLRDALET  489
               ET +L EQ KRLSVRDLASKF+K L++ AKL+ EA+LR+A SLE HVLLKKLRDALE+
Sbjct  59    ARETAQLLEQQKRLSVRDLASKFEKGLAATAKLSEEARLREAASLEKHVLLKKLRDALES  118

Query  490   LKGRLAGRNKEDVEIAIAMVEALAVRLTQKEGDLIQEKFEVNKLVSILKQASEDAKKLVN  669
             LKGR+AGRNK+DVE AI+MVEALAV+LTQ+EG+L+QEK EV KL + LKQASEDAKKLV+
Sbjct  119   LKGRVAGRNKDDVEEAISMVEALAVQLTQREGELMQEKAEVKKLANFLKQASEDAKKLVD  178

Query  670   QERSFACAEIESARAVVQRIGEALEEQEINSQVSGKQeveelmeeiqeARRIRVLHQPSK  849
             +ER+FA AEIE+A+A VQR+ EAL+EQE  SQ SGKQ+++ELM+E+QEARRI++LHQPSK
Sbjct  179   EERAFARAEIENAKAAVQRVEEALQEQEQTSQASGKQDLDELMKEVQEARRIKMLHQPSK  238

Query  850   VMDMEHELRALRIQLNEKSVVSFKLQNELAMSKRTEQNKSQLYRIIGSESVGSILRIQPC  1029
             VMDMEHELRALR QL +KS  S +LQ ELA SKR  +  SQ Y++ GSE++GS LRI+  
Sbjct  239   VMDMEHELRALRAQLTQKSENSLRLQKELANSKRGLEKSSQPYQLDGSEALGSYLRIKSL  298

Query  1030  SDEAVDLSKCSIQWYRLSSECSRREPILGADKSVYAPEPIDVGRVLEADIVSNGLKASVT  1209
             SD+A++LS CSIQWYRLS + + +E I GA KSVYAPEP DVG  L+ADIV NG + ++T
Sbjct  299   SDDAIELSTCSIQWYRLSCDGANKELISGAIKSVYAPEPFDVGWFLQADIVFNGQRLTLT  358

Query  1210  TIGQIDQAAGLGNYVETLLRKSNTEFSVVIAQMNGRNYSSRSIHSFHVGKMRMKLNKGWI  1389
             T G ID AAGLG+YVE L+RK + EF+VVI QMNG N+ S SIH FHVG+MR+KL KG  
Sbjct  359   TAGPIDPAAGLGSYVEALVRKHDIEFNVVITQMNGVNHLSESIHVFHVGRMRIKLCKGKT  418

Query  1390  TKARDSYSGSMQLCGFRGGGNSAAKSLFWQPRKGQSFVLVFDSERERNGALVVARKHALE  1569
             T A++ +S SMQLCG RGGGN+AA++LFWQ ++G SFVL F+SERERN A+++AR+ A +
Sbjct  419   TVAKEYFSASMQLCGVRGGGNAAAQALFWQVKQGLSFVLAFESERERNAAIMLARRFAFD  478

Query  1570  CNVSIT  1587
             CN+ + 
Sbjct  479   CNIMLA  484



>emb|CBI24323.3| unnamed protein product [Vitis vinifera]
Length=529

 Score =   584 bits (1506),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 313/491 (64%), Positives = 393/491 (80%), Gaps = 4/491 (1%)
 Frame = +1

Query  121   TGKMTKVSPEFVGGEVQMYTFKSVSADVSFASNQFPKYKLGPDFQILEEALLENKGPSLK  300
              G MT+VS +F    +Q     +VSADV+F S++FP YKLGP  QI+E A  + K  S+K
Sbjct  31    VGTMTRVSRDF-SNTMQKEAVPAVSADVTFTSSRFPNYKLGPYNQIME-AKEDPKVLSMK  88

Query  301   evveeettRLTEQHKRLSVRDLASKFDKNLSSAAKLANEAKLRDAPSLEGHVLLKKLRDA  480
             EVV  ET +L EQ KRLSVRDLA+KF+K L++AAKL++EA+LR+A SLE HVLLKKLRDA
Sbjct  89    EVVARETAQLLEQQKRLSVRDLANKFEKGLAAAAKLSDEARLREAASLEKHVLLKKLRDA  148

Query  481   LETLKGRLAGRNKEDVEIAIAMVEALAVRLTQKEGDLIQEKFEVNKLVSILKQASEDAKK  660
             LE+LKGR+AGRNK+DVE AIAMVEALAV+LTQ+EG+LIQEK EV KL + LKQASEDAKK
Sbjct  149   LESLKGRVAGRNKDDVEDAIAMVEALAVQLTQREGELIQEKAEVKKLANFLKQASEDAKK  208

Query  661   LVNQERSFACAEIESARAVVQRIGEALEEQEINSQVSGKQeveelmeeiqeARRIRVLHQ  840
             LV++ERSFA AEIE+AR  V+R+ EALEEQE  ++ SGKQ+++ELM+E+QEARRI++LHQ
Sbjct  209   LVDEERSFARAEIENAREAVRRVEEALEEQERIARASGKQDMDELMKEVQEARRIKMLHQ  268

Query  841   PSKVMDMEHELRALRIQLNEKSVVSFKLQNELAMSK--RTEQNKSQLYRIIGSESVGSIL  1014
             PSKVMDMEHEL ALR+QL EKS  S +LQ EL +SK  R E+N S +Y + G E++GS L
Sbjct  269   PSKVMDMEHELLALRLQLAEKSKHSLQLQKELLISKSRRGEENMSDMYELDGPEALGSFL  328

Query  1015  RIQPCSDEAVDLSKCSIQWYRLSSECSRREPILGADKSVYAPEPIDVGRVLEADIVSNGL  1194
             +IQ CSD+A DLS CSIQWYR+SSE  +RE I GA KSVYAPEP DVGRVL+ADIV +G 
Sbjct  329   QIQACSDKAPDLSHCSIQWYRVSSEGGKRELISGAIKSVYAPEPFDVGRVLQADIVLDGY  388

Query  1195  KASVTTIGQIDQAAGLGNYVETLLRKSNTEFSVVIAQMNGRNYSSRSIHSFHVGKMRMKL  1374
             + ++ T G ID AAGLG+YVE L+RK +TEF+VVI QMNG ++ S SIH  HVGKMR+KL
Sbjct  389   QITLATAGPIDPAAGLGSYVEALVRKHDTEFNVVITQMNGADHPSESIHVLHVGKMRIKL  448

Query  1375  NKGWITKARDSYSGSMQLCGFRGGGNSAAKSLFWQPRKGQSFVLVFDSERERNGALVVAR  1554
              KG  T A++ YS SMQLCG RGGGN+A ++L+WQ +KG SFVL F+SER+RN A+++AR
Sbjct  449   CKGKATIAKEYYSTSMQLCGVRGGGNAATQALYWQAKKGLSFVLAFESERDRNAAIMLAR  508

Query  1555  KHALECNVSIT  1587
             + A +CN+ + 
Sbjct  509   RFAFDCNIMLA  519



>ref|XP_002269709.1| PREDICTED: uncharacterized protein LOC100242766 [Vitis vinifera]
 ref|XP_010651583.1| PREDICTED: uncharacterized protein LOC100242766 [Vitis vinifera]
 ref|XP_010651584.1| PREDICTED: uncharacterized protein LOC100242766 [Vitis vinifera]
Length=496

 Score =   582 bits (1501),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 312/488 (64%), Positives = 392/488 (80%), Gaps = 4/488 (1%)
 Frame = +1

Query  130   MTKVSPEFVGGEVQMYTFKSVSADVSFASNQFPKYKLGPDFQILEEALLENKGPSLKevv  309
             MT+VS +F    +Q     +VSADV+F S++FP YKLGP  QI+E A  + K  S+KEVV
Sbjct  1     MTRVSRDF-SNTMQKEAVPAVSADVTFTSSRFPNYKLGPYNQIME-AKEDPKVLSMKEVV  58

Query  310   eeettRLTEQHKRLSVRDLASKFDKNLSSAAKLANEAKLRDAPSLEGHVLLKKLRDALET  489
               ET +L EQ KRLSVRDLA+KF+K L++AAKL++EA+LR+A SLE HVLLKKLRDALE+
Sbjct  59    ARETAQLLEQQKRLSVRDLANKFEKGLAAAAKLSDEARLREAASLEKHVLLKKLRDALES  118

Query  490   LKGRLAGRNKEDVEIAIAMVEALAVRLTQKEGDLIQEKFEVNKLVSILKQASEDAKKLVN  669
             LKGR+AGRNK+DVE AIAMVEALAV+LTQ+EG+LIQEK EV KL + LKQASEDAKKLV+
Sbjct  119   LKGRVAGRNKDDVEDAIAMVEALAVQLTQREGELIQEKAEVKKLANFLKQASEDAKKLVD  178

Query  670   QERSFACAEIESARAVVQRIGEALEEQEINSQVSGKQeveelmeeiqeARRIRVLHQPSK  849
             +ERSFA AEIE+AR  V+R+ EALEEQE  ++ SGKQ+++ELM+E+QEARRI++LHQPSK
Sbjct  179   EERSFARAEIENAREAVRRVEEALEEQERIARASGKQDMDELMKEVQEARRIKMLHQPSK  238

Query  850   VMDMEHELRALRIQLNEKSVVSFKLQNELAMSK--RTEQNKSQLYRIIGSESVGSILRIQ  1023
             VMDMEHEL ALR+QL EKS  S +LQ EL +SK  R E+N S +Y + G E++GS L+IQ
Sbjct  239   VMDMEHELLALRLQLAEKSKHSLQLQKELLISKSRRGEENMSDMYELDGPEALGSFLQIQ  298

Query  1024  PCSDEAVDLSKCSIQWYRLSSECSRREPILGADKSVYAPEPIDVGRVLEADIVSNGLKAS  1203
              CSD+A DLS CSIQWYR+SSE  +RE I GA KSVYAPEP DVGRVL+ADIV +G + +
Sbjct  299   ACSDKAPDLSHCSIQWYRVSSEGGKRELISGAIKSVYAPEPFDVGRVLQADIVLDGYQIT  358

Query  1204  VTTIGQIDQAAGLGNYVETLLRKSNTEFSVVIAQMNGRNYSSRSIHSFHVGKMRMKLNKG  1383
             + T G ID AAGLG+YVE L+RK +TEF+VVI QMNG ++ S SIH  HVGKMR+KL KG
Sbjct  359   LATAGPIDPAAGLGSYVEALVRKHDTEFNVVITQMNGADHPSESIHVLHVGKMRIKLCKG  418

Query  1384  WITKARDSYSGSMQLCGFRGGGNSAAKSLFWQPRKGQSFVLVFDSERERNGALVVARKHA  1563
               T A++ YS SMQLCG RGGGN+A ++L+WQ +KG SFVL F+SER+RN A+++AR+ A
Sbjct  419   KATIAKEYYSTSMQLCGVRGGGNAATQALYWQAKKGLSFVLAFESERDRNAAIMLARRFA  478

Query  1564  LECNVSIT  1587
              +CN+ + 
Sbjct  479   FDCNIMLA  486



>ref|XP_011025009.1| PREDICTED: uncharacterized protein LOC105126009 isoform X1 [Populus 
euphratica]
 ref|XP_011025010.1| PREDICTED: uncharacterized protein LOC105126009 isoform X1 [Populus 
euphratica]
 ref|XP_011025011.1| PREDICTED: uncharacterized protein LOC105126009 isoform X1 [Populus 
euphratica]
 ref|XP_011025012.1| PREDICTED: uncharacterized protein LOC105126009 isoform X1 [Populus 
euphratica]
Length=494

 Score =   581 bits (1498),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 310/486 (64%), Positives = 388/486 (80%), Gaps = 2/486 (0%)
 Frame = +1

Query  130   MTKVSPEFVGGEVQMYTFKSVSADVSFASNQFPKYKLGPDFQILEEALLENKGPSLKevv  309
             MT+V+ +F G  +Q     +VSADV+FAS++FP YK+G   QIL+    + K  S+KE V
Sbjct  1     MTRVTRDF-GDTMQKDAVLAVSADVAFASSRFPNYKIGATNQILDTKD-DPKVLSMKEAV  58

Query  310   eeettRLTEQHKRLSVRDLASKFDKNLSSAAKLANEAKLRDAPSLEGHVLLKKLRDALET  489
               ET  L EQ KRLSVRDLASKF+K L++AAKL+ EA+LR+A SLE HVLLKKLRDALE+
Sbjct  59    ARETALLLEQQKRLSVRDLASKFEKGLAAAAKLSEEARLREAASLEKHVLLKKLRDALES  118

Query  490   LKGRLAGRNKEDVEIAIAMVEALAVRLTQKEGDLIQEKFEVNKLVSILKQASEDAKKLVN  669
             LKGR+AGRNK+DVE AIAMVEALAV+LTQ+EG+LIQEK EV KL + LKQASEDAKKLV+
Sbjct  119   LKGRVAGRNKDDVEEAIAMVEALAVQLTQREGELIQEKAEVKKLANFLKQASEDAKKLVD  178

Query  670   QERSFACAEIESARAVVQRIGEALEEQEINSQVSGKQeveelmeeiqeARRIRVLHQPSK  849
             +ER++A AEIESARA VQR+ EAL+E E  S+  GKQ++EELM+E+QEARRI++LHQPSK
Sbjct  179   EERAYARAEIESARATVQRVEEALQEHERMSRALGKQDLEELMKEVQEARRIKMLHQPSK  238

Query  850   VMDMEHELRALRIQLNEKSVVSFKLQNELAMSKRTEQNKSQLYRIIGSESVGSILRIQPC  1029
             VMDMEHELRALRIQL EKS  S +LQ ELA S+R EQ+   L+ + GSE++GS LRI PC
Sbjct  239   VMDMEHELRALRIQLAEKSKCSLQLQKELARSRRGEQSIFHLFELDGSEALGSCLRINPC  298

Query  1030  SDEAVDLSKCSIQWYRLSSECSRREPILGADKSVYAPEPIDVGRVLEADIVSNGLKASVT  1209
             SD A +LS+CSIQWYRLSSE  ++  I GA K VYAPEP DVGRVL+A+I+S+G + ++T
Sbjct  299   SDNAPELSECSIQWYRLSSEDVKKALISGATKPVYAPEPFDVGRVLQAEIISDGQQFTLT  358

Query  1210  TIGQIDQAAGLGNYVETLLRKSNTEFSVVIAQMNGRNYSSRSIHSFHVGKMRMKLNKGWI  1389
             T   ID AAGLG+YVE L+RK + EF+VV+ QMNG +++S SIH  HVGKMRMKL KG  
Sbjct  359   TTCAIDPAAGLGSYVEALVRKHDVEFNVVVTQMNGLDHTSESIHVLHVGKMRMKLRKGKS  418

Query  1390  TKARDSYSGSMQLCGFRGGGNSAAKSLFWQPRKGQSFVLVFDSERERNGALVVARKHALE  1569
             T A++ YS SMQLCG RGGGN+AA++LFWQ +KG SFVL F+S RERN A+++AR+ A +
Sbjct  419   TIAKEYYSTSMQLCGVRGGGNAAAQALFWQAKKGVSFVLAFESARERNAAIMLARRFAFD  478

Query  1570  CNVSIT  1587
             CN+ + 
Sbjct  479   CNIMLA  484



>ref|XP_011025013.1| PREDICTED: uncharacterized protein LOC105126009 isoform X2 [Populus 
euphratica]
Length=494

 Score =   581 bits (1497),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 309/486 (64%), Positives = 388/486 (80%), Gaps = 2/486 (0%)
 Frame = +1

Query  130   MTKVSPEFVGGEVQMYTFKSVSADVSFASNQFPKYKLGPDFQILEEALLENKGPSLKevv  309
             MT+V+ +F G  +Q     +VSADV+FAS++FP YK+G   QIL+    + K  S+KE V
Sbjct  1     MTRVTRDF-GDTMQKDAVLAVSADVAFASSRFPNYKIGATNQILDTKD-DPKVLSMKEAV  58

Query  310   eeettRLTEQHKRLSVRDLASKFDKNLSSAAKLANEAKLRDAPSLEGHVLLKKLRDALET  489
               ET  L EQ KRLSVRDLASKF+K L++AAKL+ EA+LR+A SLE HVLLKKLRDALE+
Sbjct  59    ARETALLLEQQKRLSVRDLASKFEKGLAAAAKLSEEARLREAASLEKHVLLKKLRDALES  118

Query  490   LKGRLAGRNKEDVEIAIAMVEALAVRLTQKEGDLIQEKFEVNKLVSILKQASEDAKKLVN  669
             LKGR+AGRNK+DVE AIAMVEALAV+LTQ+EG+LIQEK EV KL + LKQASEDAKKLV+
Sbjct  119   LKGRVAGRNKDDVEEAIAMVEALAVQLTQREGELIQEKAEVKKLANFLKQASEDAKKLVD  178

Query  670   QERSFACAEIESARAVVQRIGEALEEQEINSQVSGKQeveelmeeiqeARRIRVLHQPSK  849
             +ER++A AEIESARA VQR+ EAL+E E  S+  GKQ++EELM+E+QEARRI++LHQPSK
Sbjct  179   EERAYARAEIESARATVQRVEEALQEHERMSRALGKQDLEELMKEVQEARRIKMLHQPSK  238

Query  850   VMDMEHELRALRIQLNEKSVVSFKLQNELAMSKRTEQNKSQLYRIIGSESVGSILRIQPC  1029
             VMDMEHELRALRIQL EKS  S +LQ ELA S+R EQ+   L+ + GSE++GS LRI PC
Sbjct  239   VMDMEHELRALRIQLAEKSKCSLQLQKELARSRRGEQSIFHLFELDGSEALGSCLRINPC  298

Query  1030  SDEAVDLSKCSIQWYRLSSECSRREPILGADKSVYAPEPIDVGRVLEADIVSNGLKASVT  1209
             SD A +LS+CSIQWYRLSSE  ++  I GA K VYAPEP DVGRVL+A+I+S+G + ++T
Sbjct  299   SDNAPELSECSIQWYRLSSEDVKKALISGATKPVYAPEPFDVGRVLQAEIISDGQQFTLT  358

Query  1210  TIGQIDQAAGLGNYVETLLRKSNTEFSVVIAQMNGRNYSSRSIHSFHVGKMRMKLNKGWI  1389
             T   ID AAGLG+YVE L+RK + EF+V++ QMNG +++S SIH  HVGKMRMKL KG  
Sbjct  359   TTCAIDPAAGLGSYVEALVRKHDVEFNVIVTQMNGLDHTSESIHVLHVGKMRMKLRKGKS  418

Query  1390  TKARDSYSGSMQLCGFRGGGNSAAKSLFWQPRKGQSFVLVFDSERERNGALVVARKHALE  1569
             T A++ YS SMQLCG RGGGN+AA++LFWQ +KG SFVL F+S RERN A+++AR+ A +
Sbjct  419   TIAKEYYSTSMQLCGVRGGGNAAAQALFWQAKKGVSFVLAFESARERNAAIMLARRFAFD  478

Query  1570  CNVSIT  1587
             CN+ + 
Sbjct  479   CNIMLA  484



>ref|XP_009116348.1| PREDICTED: uncharacterized protein LOC103841552 [Brassica rapa]
Length=487

 Score =   580 bits (1495),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 304/487 (62%), Positives = 390/487 (80%), Gaps = 7/487 (1%)
 Frame = +1

Query  130   MTKVSPEFVGGEVQMYTFKSVSADVSFASNQFPKYKLGPDFQILEEALLENKGPSLKevv  309
             MTKV PE +          +VSADVSFASN FP YKLGPD QI+EE   ++KGPS+++ V
Sbjct  1     MTKVCPE-IEDMTLPEPVTTVSADVSFASNHFPSYKLGPDNQIVEEPKEDDKGPSVQDTV  59

Query  310   eeettRLTEQHKRLSVRDLASKFDKNLSSAAKLANEAKLRDAPSLEGHVLLKKLRDALET  489
             E+E+  L++QHKRLSVRDLASKFDKNL++A  LA+EAKL++A SLEGHV+LKKLRDALE 
Sbjct  60    EKESELLSDQHKRLSVRDLASKFDKNLAAAVTLADEAKLKEAASLEGHVMLKKLRDALEY  119

Query  490   LKGRLAGRNKEDVEIAIAMVEALAVRLTQKEGDLIQEKFEVNKLVSILKQASEDAKKLVN  669
             ++GR+ G+NKEDVE AI+MVEALAV+LTQ EG+LIQEKFEV KL + LKQASEDAKKLVN
Sbjct  120   MRGRMDGQNKEDVEKAISMVEALAVKLTQNEGELIQEKFEVKKLGNFLKQASEDAKKLVN  179

Query  670   QERSFACAEIESARAVVQRIGEALEEQEINSQVSGKQ--eveelmeeiqeARRIRVLHQP  843
              E+SFACAEIESARAVV ++GEA EEQE +S+ S  Q  +VE+L+EE+QEAR+I+ +H P
Sbjct  180   HEKSFACAEIESARAVVLKLGEAFEEQERSSEASRAQGPDVEKLVEEVQEARQIKRMHHP  239

Query  844   SKVMDMEHELRALRIQLNEKSVVSFKLQNELAMSKRTEQNKSQLYRIIGSESVGSILRIQ  1023
             +KVM M+HEL  LR +L EK + S KL  E+   KR E++KS  + + G++S+GS LRI 
Sbjct  240   TKVMGMQHELHGLRSRLQEKYLNSIKLHQEI---KRVEESKSCPFVLEGTQSLGSCLRIH  296

Query  1024  PCSDEAVDLSKCSIQWYRLSSECSRREPILGADKSVYAPEPIDVGRVLEADIVSNGLKAS  1203
               SD+A+DLS CSIQWYR + E SRRE I GA++SVYAPEP DVGR+L+ADI+SNG K +
Sbjct  297   VSSDDAIDLSNCSIQWYRAACETSRREAISGANQSVYAPEPFDVGRILQADIISNGQKVT  356

Query  1204  VTTIGQIDQAAGLGNYVETLLRKSNTEFSVVIAQMNGRNYSSRSIHSFHVGKMRMKLNKG  1383
             VTT G ID  + L   VE+L+RKSN+EF+VVI+QMNG++Y+SR+ H F VGK R+KL++G
Sbjct  357   VTTDGPIDPDSCLQTRVESLMRKSNSEFNVVISQMNGQDYASRT-HVFTVGKTRIKLSRG  415

Query  1384  WITKARDSYSGSMQLCGFRGGGNSAAKSLFWQPRKGQSFVLVFDSERERNGALVVARKHA  1563
             WITKAR+ YS SMQLCG RG   + A++LFWQPRK  +F+L F+SE+ERN A+V+ARK+A
Sbjct  416   WITKAREIYSTSMQLCGVRGNIKAPARALFWQPRKSLTFILTFESEQERNTAIVLARKYA  475

Query  1564  LECNVSI  1584
              +CNV++
Sbjct  476   FDCNVTL  482



>ref|XP_006470512.1| PREDICTED: uncharacterized protein LOC102622518 [Citrus sinensis]
Length=494

 Score =   579 bits (1493),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 307/486 (63%), Positives = 386/486 (79%), Gaps = 2/486 (0%)
 Frame = +1

Query  130   MTKVSPEFVGGEVQMYTFKSVSADVSFASNQFPKYKLGPDFQILEEALLENKGPSLKevv  309
             MT+VS +F G  +Q     +VSADV FAS++FP YK+G + Q+++    + K  S+KEVV
Sbjct  1     MTRVSRDF-GNTMQKDAVPAVSADVVFASSRFPNYKIGANNQVVD-GKDDPKVLSMKEVV  58

Query  310   eeettRLTEQHKRLSVRDLASKFDKNLSSAAKLANEAKLRDAPSLEGHVLLKKLRDALET  489
               ET +L EQ KRLSVRDLA+KF+K L++AAKL+ EAKLR+A SLE HVLLKKLRDALE+
Sbjct  59    ARETAQLLEQQKRLSVRDLANKFEKGLAAAAKLSEEAKLREAASLEKHVLLKKLRDALES  118

Query  490   LKGRLAGRNKEDVEIAIAMVEALAVRLTQKEGDLIQEKFEVNKLVSILKQASEDAKKLVN  669
             L+GR+AGRNK+DVE AIAMVEALAV+LTQ+EG+LIQEK EV KL   LK+ASEDAKKLV+
Sbjct  119   LRGRVAGRNKDDVEEAIAMVEALAVQLTQREGELIQEKAEVKKLADFLKKASEDAKKLVD  178

Query  670   QERSFACAEIESARAVVQRIGEALEEQEINSQVSGKQeveelmeeiqeARRIRVLHQPSK  849
             +ER+FA AEIESARA VQR+ E+L+E E  S+ SGKQ+ EELM+E+QEARRI++LHQPSK
Sbjct  179   EERAFARAEIESARAAVQRVEESLQEHERMSRASGKQDFEELMKEVQEARRIKMLHQPSK  238

Query  850   VMDMEHELRALRIQLNEKSVVSFKLQNELAMSKRTEQNKSQLYRIIGSESVGSILRIQPC  1029
             VMDMEHELRALRIQL EKS  S  L+ ELAMSKR E+  S  Y + GSE++GS LRI+PC
Sbjct  239   VMDMEHELRALRIQLAEKSKCSLLLRKELAMSKRIEEKLSDSYELDGSEALGSYLRIKPC  298

Query  1030  SDEAVDLSKCSIQWYRLSSECSRREPILGADKSVYAPEPIDVGRVLEADIVSNGLKASVT  1209
             S+   +LSKCSIQWYR+ SE  +RE I GA KSVYAPEP DVGR+L+A+I  NG + ++T
Sbjct  299   SNNGPELSKCSIQWYRVPSEGGKRELISGATKSVYAPEPFDVGRILQAEITYNGQQITLT  358

Query  1210  TIGQIDQAAGLGNYVETLLRKSNTEFSVVIAQMNGRNYSSRSIHSFHVGKMRMKLNKGWI  1389
             T G +D A GLG+YVE L+RK + EF VV+ QMNG ++ S SIH  HVGKMR+KL KG +
Sbjct  359   TTGAVDPAPGLGSYVEALVRKHDVEFHVVVTQMNGVDHPSESIHVLHVGKMRIKLCKGKM  418

Query  1390  TKARDSYSGSMQLCGFRGGGNSAAKSLFWQPRKGQSFVLVFDSERERNGALVVARKHALE  1569
             T A++ YS SMQLCG RGGGN+AA++LFWQ +KG SFVL F+SERERN  +++AR+ A +
Sbjct  419   TIAKEYYSTSMQLCGVRGGGNAAAQALFWQAKKGVSFVLAFESERERNATIMLARRFAFD  478

Query  1570  CNVSIT  1587
             CN+ + 
Sbjct  479   CNIMLA  484



>gb|KDO66436.1| hypothetical protein CISIN_1g011054mg [Citrus sinensis]
Length=494

 Score =   579 bits (1492),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 307/486 (63%), Positives = 386/486 (79%), Gaps = 2/486 (0%)
 Frame = +1

Query  130   MTKVSPEFVGGEVQMYTFKSVSADVSFASNQFPKYKLGPDFQILEEALLENKGPSLKevv  309
             MT+VS +F G  +Q     +VSADV FAS++FP YK+G + Q+++    + K  S+KEVV
Sbjct  1     MTRVSRDF-GNTMQKDAVPAVSADVVFASSRFPNYKIGANNQVVD-GKDDPKVLSMKEVV  58

Query  310   eeettRLTEQHKRLSVRDLASKFDKNLSSAAKLANEAKLRDAPSLEGHVLLKKLRDALET  489
               ET +L EQ KRLSVRDLA+KF+K L++AAKL+ EAKLR+A SLE HVLLKKLRDALE+
Sbjct  59    ARETAQLLEQQKRLSVRDLANKFEKGLAAAAKLSEEAKLREAASLEKHVLLKKLRDALES  118

Query  490   LKGRLAGRNKEDVEIAIAMVEALAVRLTQKEGDLIQEKFEVNKLVSILKQASEDAKKLVN  669
             L+GR+AGRNK+DVE AIAMVEALAV+LTQ+EG+LIQEK EV KL   LK+ASEDAKKLV+
Sbjct  119   LRGRVAGRNKDDVEEAIAMVEALAVQLTQREGELIQEKAEVKKLADFLKKASEDAKKLVD  178

Query  670   QERSFACAEIESARAVVQRIGEALEEQEINSQVSGKQeveelmeeiqeARRIRVLHQPSK  849
             +ER+FA AEIESARA VQR+ E+L+E E  S+ SGKQ+ EELM+E+QEARRI++LHQPSK
Sbjct  179   EERAFARAEIESARAAVQRVEESLQEHEQMSRASGKQDFEELMKEVQEARRIKMLHQPSK  238

Query  850   VMDMEHELRALRIQLNEKSVVSFKLQNELAMSKRTEQNKSQLYRIIGSESVGSILRIQPC  1029
             VMDMEHELRALRIQL EKS  S  L+ ELAMSKR E+  S  Y + GSE++GS LRI+PC
Sbjct  239   VMDMEHELRALRIQLAEKSKCSLLLRKELAMSKRIEEKLSDSYELDGSEALGSYLRIKPC  298

Query  1030  SDEAVDLSKCSIQWYRLSSECSRREPILGADKSVYAPEPIDVGRVLEADIVSNGLKASVT  1209
             S+   +LSKCSIQWYR+ SE  +RE I GA KSVYAPEP DVGR+L+A+I  NG + ++T
Sbjct  299   SNNGPELSKCSIQWYRVPSEGGKRELISGATKSVYAPEPFDVGRILQAEITYNGQQITLT  358

Query  1210  TIGQIDQAAGLGNYVETLLRKSNTEFSVVIAQMNGRNYSSRSIHSFHVGKMRMKLNKGWI  1389
             T G +D A GLG+YVE L+RK + EF VV+ QMNG ++ S SIH  HVGKMR+KL KG +
Sbjct  359   TTGAVDPAPGLGSYVEALVRKHDVEFHVVVTQMNGVDHPSESIHVLHVGKMRIKLCKGKM  418

Query  1390  TKARDSYSGSMQLCGFRGGGNSAAKSLFWQPRKGQSFVLVFDSERERNGALVVARKHALE  1569
             T A++ YS SMQLCG RGGGN+AA++LFWQ +KG SFVL F+SERERN  +++AR+ A +
Sbjct  419   TIAKEYYSTSMQLCGVRGGGNAAAQALFWQAKKGVSFVLAFESERERNATIMLARRLAFD  478

Query  1570  CNVSIT  1587
             CN+ + 
Sbjct  479   CNIMLA  484



>ref|XP_006402982.1| hypothetical protein EUTSA_v10005916mg [Eutrema salsugineum]
 gb|ESQ44435.1| hypothetical protein EUTSA_v10005916mg [Eutrema salsugineum]
Length=494

 Score =   578 bits (1491),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 307/491 (63%), Positives = 388/491 (79%), Gaps = 8/491 (2%)
 Frame = +1

Query  130   MTKVSPEFVGGEVQMYTFKSVSADVSFASNQFPKYKLGPDFQILEEALLENKGPSLKevv  309
             MTKV PE     +   +  +VS DVSFASN FP YKLGPD QI+EE   + KGPS+KE V
Sbjct  1     MTKVCPEIEERTLPESSL-TVSVDVSFASNHFPTYKLGPDNQIIEEPKEDEKGPSVKETV  59

Query  310   eeettRLTEQHKRLSVRDLASKFDKNLSSAAKLANEAKLRDAPSLEGHVLLKKLRDALET  489
             E+E+  L++QHKRLSVRDLASKFDKNL++A  LA+EAKLR+  SLEGHV+LKKLRDALE 
Sbjct  60    EKESELLSDQHKRLSVRDLASKFDKNLAAAVSLADEAKLREVASLEGHVMLKKLRDALEY  119

Query  490   LKGRLAGRNKEDVEIAIAMVEALAVRLTQKEGDLIQEKFEVNKLVSILKQASEDAKKLVN  669
             ++GR  G+NKEDVE AI+MVEALAV+LTQ EG+LIQEKFEV KL + LKQASEDAKKLVN
Sbjct  120   MRGRTDGQNKEDVEKAISMVEALAVKLTQNEGELIQEKFEVKKLGNFLKQASEDAKKLVN  179

Query  670   QERSFACAEIESARAVVQRIGEALEEQEINSQVSGKQ--eveelmeeiqeARRIRVLHQP  843
             QE+SFACAEIE+ARAVV R+GEA EEQE  S+ S  Q  +VE+L+EE+QEAR+I+ +H P
Sbjct  180   QEKSFACAEIETARAVVLRLGEAFEEQEQISEASRAQGPDVEKLVEEVQEARKIKRMHHP  239

Query  844   SKVMDMEHELRALRIQLNEKSVVSFKLQNELAMSKRTEQNKSQLYRIIGSESVGSILRIQ  1023
             +KVM M+HEL  LR +L EK + S K+  E+A+ KR E++KS  + + G +S+GS LRI+
Sbjct  240   TKVMGMQHELHGLRNRLQEKYMNSIKIHQEIAIIKRAEESKSCPFVLEGKQSLGSCLRIR  299

Query  1024  PCS----DEAVDLSKCSIQWYRLSSECSRREPILGADKSVYAPEPIDVGRVLEADIVSNG  1191
               S    + A+DLS CSIQWYR + E SRRE I GA++SVYAPEP DVGR+L+ADI+SNG
Sbjct  300   VFSENAPENAIDLSNCSIQWYRAACETSRREAISGANQSVYAPEPFDVGRILQADILSNG  359

Query  1192  LKASVTTIGQIDQAAGLGNYVETLLRKSNTEFSVVIAQMNGRNYSSRSIHSFHVGKMRMK  1371
              K +V+T G ID  +GL + VE+L+RKSN EFSV+I+QMNG++Y+SRS H F VGK R+K
Sbjct  360   QKVTVSTDGPIDPDSGLQSRVESLMRKSNCEFSVIISQMNGQDYASRS-HVFTVGKTRIK  418

Query  1372  LNKGWITKARDSYSGSMQLCGFRGGGNSAAKSLFWQPRKGQSFVLVFDSERERNGALVVA  1551
             L++GWITKAR+ YS SMQLCG RG   + AK+LFWQPRK  +F+L F+SE+ERN A+ +A
Sbjct  419   LSRGWITKAREIYSTSMQLCGVRGNIKAPAKALFWQPRKSLTFILTFESEQERNAAIALA  478

Query  1552  RKHALECNVSI  1584
             RKHA +CNV++
Sbjct  479   RKHAFDCNVTL  489



>gb|KHN11019.1| hypothetical protein glysoja_047269 [Glycine soja]
Length=494

 Score =   578 bits (1491),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 300/485 (62%), Positives = 386/485 (80%), Gaps = 2/485 (0%)
 Frame = +1

Query  130   MTKVSPEFVGGEVQMYTFKSVSADVSFASNQFPKYKLGPDFQILEEALLENKGPSLKevv  309
             MT+++ +F G  +Q     +VS+DV FAS++FP Y++G + QI+E    + K  S+KEVV
Sbjct  1     MTRLTRDF-GDTMQRDAVPAVSSDVVFASSRFPNYRIGANNQIIETKD-DPKVLSMKEVV  58

Query  310   eeettRLTEQHKRLSVRDLASKFDKNLSSAAKLANEAKLRDAPSLEGHVLLKKLRDALET  489
               ET +L EQH RLSVRDLASKF+K L++AAKL+ EA+LR+A SLE HVLLKKLRDALE+
Sbjct  59    ARETAQLLEQHNRLSVRDLASKFEKGLAAAAKLSEEARLREAASLEKHVLLKKLRDALES  118

Query  490   LKGRLAGRNKEDVEIAIAMVEALAVRLTQKEGDLIQEKFEVNKLVSILKQASEDAKKLVN  669
             LKGR+AGRNK+DVE AIA+VEALAV+LTQ+EG+LIQEK EV KL + LKQASEDAKKLV+
Sbjct  119   LKGRVAGRNKDDVEEAIAIVEALAVQLTQREGELIQEKAEVKKLANFLKQASEDAKKLVD  178

Query  670   QERSFACAEIESARAVVQRIGEALEEQEINSQVSGKQeveelmeeiqeARRIRVLHQPSK  849
             +ER+FA AEIE ARA VQR+ EAL+E E  SQ SGKQ+ E+LM E+QEARRI++LHQPSK
Sbjct  179   EERAFARAEIEDARAAVQRVEEALQEHERMSQASGKQDQEQLMREVQEARRIKMLHQPSK  238

Query  850   VMDMEHELRALRIQLNEKSVVSFKLQNELAMSKRTEQNKSQLYRIIGSESVGSILRIQPC  1029
             VMDMEHELRALR QL EK+    +LQ EL  +K+  +N   LY + G+E++GS L+IQPC
Sbjct  239   VMDMEHELRALRSQLAEKTRQYLRLQKELTRTKKGGENVPHLYELEGNETLGSYLQIQPC  298

Query  1030  SDEAVDLSKCSIQWYRLSSECSRREPILGADKSVYAPEPIDVGRVLEADIVSNGLKASVT  1209
             SD A ++SKCSIQWYR+SS+ +++E I GA KSVYAPEP DVGR+L+ DI+S     +++
Sbjct  299   SDNAPEVSKCSIQWYRVSSDGAKKELISGATKSVYAPEPFDVGRILQVDIISESEHVTLS  358

Query  1210  TIGQIDQAAGLGNYVETLLRKSNTEFSVVIAQMNGRNYSSRSIHSFHVGKMRMKLNKGWI  1389
             T G ID AAGLG YVE L+RK +TEF+VV+ QMNG ++ + SIH  HVGKMR+KL KG  
Sbjct  359   TAGPIDPAAGLGTYVEALVRKHDTEFNVVVTQMNGSHHPTESIHVLHVGKMRIKLCKGKT  418

Query  1390  TKARDSYSGSMQLCGFRGGGNSAAKSLFWQPRKGQSFVLVFDSERERNGALVVARKHALE  1569
             T A++ YS SMQLCG RGGGN+AA++LFWQP++G SFVL F+SERERN A+++AR+ A +
Sbjct  419   TIAKEYYSSSMQLCGVRGGGNAAAQALFWQPKQGHSFVLAFESERERNAAIMLARRFAFD  478

Query  1570  CNVSI  1584
             CN+ +
Sbjct  479   CNIML  483



>emb|CDY23880.1| BnaC04g01570D [Brassica napus]
Length=521

 Score =   579 bits (1493),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 308/490 (63%), Positives = 391/490 (80%), Gaps = 6/490 (1%)
 Frame = +1

Query  130   MTKVSPEF--VGGEVQMYTFKSVSADVSFASNQFPKYKLGPDFQILEEALLENKGPSLKe  303
             MTKV PE         +   +++SADVSFASNQFP YKLGPD QI++E     K PS+K+
Sbjct  28    MTKVCPEMHEKKVCEAVVVVEAISADVSFASNQFPSYKLGPDDQIVDEPKENEKHPSVKD  87

Query  304   vveeettRLTEQHKRLSVRDLASKFDKNLSSAAKLANEAKLRDAPSLEGHVLLKKLRDAL  483
             VV++ET  L++QHKRLSVRDLA KFDKNL++AAKL +EAKL +  SLEGHV+LKKLRDAL
Sbjct  88    VVDKETGDLSDQHKRLSVRDLACKFDKNLAAAAKLVDEAKLSEVTSLEGHVMLKKLRDAL  147

Query  484   ETLKGRLAGRNKEDVEIAIAMVEALAVRLTQKEGDLIQEKFEVNKLVSILKQASEDAKKL  663
             E+++GR+ GRNKE VE AI+MVEALAV+LTQ EG  IQEK EV KL S LKQASEDAKKL
Sbjct  148   ESMRGRMDGRNKEAVEKAISMVEALAVKLTQHEGGFIQEKAEVKKLASFLKQASEDAKKL  207

Query  664   VNQERSFACAEIESARAVVQRIGEALEEQEINSQVSGKQ--eveelmeeiqeARRIRVLH  837
             VNQERSFACAEIESA+ +V R+G A EEQEI+S+ S  Q   VE+L+EE+QEARRI+ +H
Sbjct  208   VNQERSFACAEIESAKTLVMRLGGAFEEQEISSKASRAQGPNVEKLVEEVQEARRIKRMH  267

Query  838   QPSKVMDMEHELRALRIQLNEKSVVSFKLQNELAMSKRTEQNKSQLYRIIGSESVGSILR  1017
             +P+KVM M+HELR L+ Q+ EKS  S KLQ E+A+ KR E +K+  Y + G++S+GS L+
Sbjct  268   RPTKVMGMQHELRDLKSQIQEKSAYSIKLQREIAIIKRAEGSKTCPYVLDGAQSLGSCLK  327

Query  1018  IQPCSD-EAVDLSKCSIQWYRLSSECSRREPILGADKSVYAPEPIDVGRVLEADIVSNGL  1194
             I+  SD  A D+SKCS QWYR +SE SRRE I GA++SVYAPEP DVGRV++ADI+ NG 
Sbjct  328   IRASSDSNASDISKCSFQWYRAASESSRREAISGANQSVYAPEPYDVGRVIQADILCNGQ  387

Query  1195  KASVTTIGQIDQAAGLGNYVETLLRKSNTEFSVVIAQMNGRNYSSRSIHSFHVGKMRMKL  1374
             K +VTT G I+ A+GL + VE+L+RKSN+EF+VVI+QMNG+++ SRS H F VGK R+KL
Sbjct  388   KFTVTTEGPINTASGLQSRVESLMRKSNSEFTVVISQMNGQDHVSRS-HVFTVGKARVKL  446

Query  1375  NKGWITKARDSYSGSMQLCGFRGGGNSAAKSLFWQPRKGQSFVLVFDSERERNGALVVAR  1554
             ++GWITKAR+ YS SMQLCG RG  N+ AK+LFWQPRKG SF+L F+SE+ERN A+V++R
Sbjct  447   SRGWITKAREIYSNSMQLCGVRGNANAPAKALFWQPRKGLSFLLTFESEQERNAAIVLSR  506

Query  1555  KHALECNVSI  1584
             K+A +CNV++
Sbjct  507   KYAYDCNVTL  516



>ref|XP_006595779.1| PREDICTED: rootletin-like isoform X1 [Glycine max]
 ref|XP_006595780.1| PREDICTED: rootletin-like isoform X2 [Glycine max]
 ref|XP_006595781.1| PREDICTED: rootletin-like isoform X3 [Glycine max]
Length=494

 Score =   578 bits (1490),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 300/485 (62%), Positives = 387/485 (80%), Gaps = 2/485 (0%)
 Frame = +1

Query  130   MTKVSPEFVGGEVQMYTFKSVSADVSFASNQFPKYKLGPDFQILEEALLENKGPSLKevv  309
             MT+++ +F G  +Q     +VS+DV FAS++FP Y++G + QI+E    + K  S+KEVV
Sbjct  1     MTRLTRDF-GDTMQRDAVPAVSSDVVFASSRFPNYRIGANNQIIETKD-DPKVLSMKEVV  58

Query  310   eeettRLTEQHKRLSVRDLASKFDKNLSSAAKLANEAKLRDAPSLEGHVLLKKLRDALET  489
               ET +L EQH RLSVRDLASKF+K L++AAKL+ EA+LR+A SLE HVLLKKLRDALE+
Sbjct  59    ARETAQLLEQHNRLSVRDLASKFEKGLAAAAKLSEEARLREAASLEKHVLLKKLRDALES  118

Query  490   LKGRLAGRNKEDVEIAIAMVEALAVRLTQKEGDLIQEKFEVNKLVSILKQASEDAKKLVN  669
             LKGR+AGRNK+DVE AIA+VEALAV+LTQ+EG+LIQEK EV KL + LKQASEDAKKLV+
Sbjct  119   LKGRVAGRNKDDVEEAIAIVEALAVQLTQREGELIQEKAEVKKLANFLKQASEDAKKLVD  178

Query  670   QERSFACAEIESARAVVQRIGEALEEQEINSQVSGKQeveelmeeiqeARRIRVLHQPSK  849
             +ER+FA AEIE ARA VQR+ EAL+E E  SQ SGKQ++E+LM E+QEARRI++LHQPSK
Sbjct  179   EERAFARAEIEDARAAVQRVEEALQEHERMSQASGKQDLEQLMREVQEARRIKMLHQPSK  238

Query  850   VMDMEHELRALRIQLNEKSVVSFKLQNELAMSKRTEQNKSQLYRIIGSESVGSILRIQPC  1029
             VMDMEHELRALR QL EK+    +LQ EL  +K+  +N   LY + G+E++GS L+IQPC
Sbjct  239   VMDMEHELRALRSQLAEKTRQYLRLQKELTRTKKGGENVPHLYELEGNETLGSYLQIQPC  298

Query  1030  SDEAVDLSKCSIQWYRLSSECSRREPILGADKSVYAPEPIDVGRVLEADIVSNGLKASVT  1209
             SD A ++SKCSIQWYR+SS+ +++E I GA KSVYAPEP DVGR+L+ DI+S     +++
Sbjct  299   SDNAPEVSKCSIQWYRVSSDGAKKELISGATKSVYAPEPFDVGRILQVDIISESEHVTLS  358

Query  1210  TIGQIDQAAGLGNYVETLLRKSNTEFSVVIAQMNGRNYSSRSIHSFHVGKMRMKLNKGWI  1389
             T G ID AAGLG YVE L+RK +TEF+VV+ QMNG ++ + SIH  HVGKMR+KL KG  
Sbjct  359   TAGPIDPAAGLGTYVEALVRKHDTEFNVVVTQMNGSHHPTESIHVLHVGKMRIKLCKGKT  418

Query  1390  TKARDSYSGSMQLCGFRGGGNSAAKSLFWQPRKGQSFVLVFDSERERNGALVVARKHALE  1569
             T A++ YS SMQLCG RGGGN+AA++LFWQP++G SFVL F+SERERN A+++AR+ A +
Sbjct  419   TIAKEYYSSSMQLCGVRGGGNAAAQALFWQPKQGHSFVLAFESERERNAAIMLARRFAFD  478

Query  1570  CNVSI  1584
             CN+ +
Sbjct  479   CNIML  483



>ref|NP_181614.7| uncharacterized protein [Arabidopsis thaliana]
 gb|AEC09885.1| uncharacterized protein AT2G40820 [Arabidopsis thaliana]
Length=492

 Score =   578 bits (1490),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 305/488 (63%), Positives = 390/488 (80%), Gaps = 4/488 (1%)
 Frame = +1

Query  130   MTKVSPEFVGGEV-QMYTFKSVSADVSFASNQFPKYKLGPDFQILEEALLENKGPSLKev  306
             MTKV P+     V      + +SADVSFASN FP YKLGPD QI++E   ++K PS+K+V
Sbjct  1     MTKVCPKTEEKRVVSEAVVEPISADVSFASNHFPTYKLGPDDQIVDEPDEDDKVPSVKDV  60

Query  307   veeettRLTEQHKRLSVRDLASKFDKNLSSAAKLANEAKLRDAPSLEGHVLLKKLRDALE  486
             V +ET  L++QHK+LSVRDLA KFDKNL++A+KL +EAKL D  SLEGHV+LKKLRDALE
Sbjct  61    VGKETGDLSDQHKKLSVRDLACKFDKNLAAASKLVDEAKLNDVTSLEGHVMLKKLRDALE  120

Query  487   TLKGRLAGRNKEDVEIAIAMVEALAVRLTQKEGDLIQEKFEVNKLVSILKQASEDAKKLV  666
             T++GR+ GRN+E VE AI+MVEALAV+LTQ EG+LI +KFEV KL S LK+AS+DAKKLV
Sbjct  121   TMRGRMDGRNREAVEKAISMVEALAVKLTQNEGELIHDKFEVKKLASFLKKASDDAKKLV  180

Query  667   NQERSFACAEIESARAVVQRIGEALEEQEINSQVSGKQ--eveelmeeiqeARRIRVLHQ  840
             NQE+SFACAEIESARA+V ++G A EEQE+ S+ S  Q   VE+L+EE+QEARRIR LH+
Sbjct  181   NQEKSFACAEIESARALVMKLGGAFEEQELCSKASRDQGPNVEKLVEEVQEARRIRRLHK  240

Query  841   PSKVMDMEHELRALRIQLNEKSVVSFKLQNELAMSKRTEQNKSQLYRIIGSESVGSILRI  1020
             P+ V+ M+HELR L+ Q+ EKS  S KLQ E+A+ K+ E +KS  Y + G++S+GS LRI
Sbjct  241   PTMVIGMQHELRDLKSQIQEKSAYSVKLQREIAIIKKAEGSKSCPYVLDGAQSLGSCLRI  300

Query  1021  QPCSDEAVDLSKCSIQWYRLSSECSRREPILGADKSVYAPEPIDVGRVLEADIVSNGLKA  1200
             +  SD  +D+SKCSI WYR +SE SRRE I GA++SVYAPEP DVGRV++ADIVSNG K 
Sbjct  301   RASSDSGIDISKCSIHWYRAASESSRREAISGANRSVYAPEPFDVGRVIQADIVSNGQKF  360

Query  1201  SVTTIGQIDQAAGLGNYVETLLRKSNTEFSVVIAQMNGRNYSSRSIHSFHVGKMRMKLNK  1380
             +VTT G I+ AAGL + VE+LLRKSN+EF+VVI+QMNG++++SRS H F VGK R+KL++
Sbjct  361   TVTTDGPINTAAGLQSRVESLLRKSNSEFTVVISQMNGQDHASRS-HVFTVGKARIKLSR  419

Query  1381  GWITKARDSYSGSMQLCGFRGGGNSAAKSLFWQPRKGQSFVLVFDSERERNGALVVARKH  1560
             GWITKAR+ YS SMQLCG RG  N  AK+LFWQ RKG +F+L F+SE+ERN A+V+AR +
Sbjct  420   GWITKAREIYSTSMQLCGVRGNANVPAKALFWQLRKGLTFLLTFESEQERNAAIVLARTY  479

Query  1561  ALECNVSI  1584
             A +CNV++
Sbjct  480   AYDCNVTL  487



>ref|XP_006446352.1| hypothetical protein CICLE_v10015010mg [Citrus clementina]
 gb|ESR59592.1| hypothetical protein CICLE_v10015010mg [Citrus clementina]
Length=494

 Score =   577 bits (1487),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 306/486 (63%), Positives = 386/486 (79%), Gaps = 2/486 (0%)
 Frame = +1

Query  130   MTKVSPEFVGGEVQMYTFKSVSADVSFASNQFPKYKLGPDFQILEEALLENKGPSLKevv  309
             MT++S +F G  +Q     +VSADV FAS++FP YK+G + Q+++    + K  S+KEVV
Sbjct  1     MTRLSRDF-GNTMQKDAVPAVSADVVFASSRFPNYKIGANNQVVD-GKDDPKVLSMKEVV  58

Query  310   eeettRLTEQHKRLSVRDLASKFDKNLSSAAKLANEAKLRDAPSLEGHVLLKKLRDALET  489
               ET +L EQ KRLSVRDLA+KF+K L++AAKL+ EAKLR+A SLE HVLLKKLRDALE+
Sbjct  59    ARETAQLLEQQKRLSVRDLANKFEKGLAAAAKLSEEAKLREAASLEKHVLLKKLRDALES  118

Query  490   LKGRLAGRNKEDVEIAIAMVEALAVRLTQKEGDLIQEKFEVNKLVSILKQASEDAKKLVN  669
             L+GR+AGRNK+DVE AIAMVEALAV+LTQ+EG+LIQEK EV KL   LK+ASEDAKKLV+
Sbjct  119   LRGRVAGRNKDDVEEAIAMVEALAVQLTQREGELIQEKAEVKKLADFLKKASEDAKKLVD  178

Query  670   QERSFACAEIESARAVVQRIGEALEEQEINSQVSGKQeveelmeeiqeARRIRVLHQPSK  849
             +ER+FA AEIESARA VQR+ E+L+E E  S+ SGKQ+ EELM+E+QEARRI++LHQPSK
Sbjct  179   EERAFARAEIESARAAVQRVEESLQEHERMSRASGKQDFEELMKEVQEARRIKMLHQPSK  238

Query  850   VMDMEHELRALRIQLNEKSVVSFKLQNELAMSKRTEQNKSQLYRIIGSESVGSILRIQPC  1029
             VMDMEHELRALRIQL EKS  S  L+ ELAMSKR E+  S  Y + GSE++GS LRI+PC
Sbjct  239   VMDMEHELRALRIQLAEKSKCSLLLRKELAMSKRIEEKLSDSYELDGSEALGSYLRIKPC  298

Query  1030  SDEAVDLSKCSIQWYRLSSECSRREPILGADKSVYAPEPIDVGRVLEADIVSNGLKASVT  1209
             S+   +LSKCSIQWYR+ SE  +RE I GA KSVYAPEP DVGR+L+A+I  NG + ++T
Sbjct  299   SNNGPELSKCSIQWYRVPSEGGKRELISGATKSVYAPEPFDVGRILQAEITYNGQQITLT  358

Query  1210  TIGQIDQAAGLGNYVETLLRKSNTEFSVVIAQMNGRNYSSRSIHSFHVGKMRMKLNKGWI  1389
             T G +D A GLG+YVE L+RK + EF VV+ QMNG ++ S SIH  HVGKMR+KL KG +
Sbjct  359   TTGAVDPAPGLGSYVEALVRKHDVEFHVVVTQMNGVDHPSESIHVLHVGKMRIKLCKGKM  418

Query  1390  TKARDSYSGSMQLCGFRGGGNSAAKSLFWQPRKGQSFVLVFDSERERNGALVVARKHALE  1569
             T A++ YS SMQLCG RGGGN+AA++LFWQ +KG SFVL F+SERERN  +++AR+ A +
Sbjct  419   TIAKEYYSTSMQLCGVRGGGNAAAQALFWQAKKGVSFVLAFESERERNATIMLARRLAFD  478

Query  1570  CNVSIT  1587
             CN+ + 
Sbjct  479   CNIMLA  484



>ref|XP_009142710.1| PREDICTED: uncharacterized protein LOC103866519 isoform X2 [Brassica 
rapa]
Length=494

 Score =   577 bits (1486),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 305/490 (62%), Positives = 384/490 (78%), Gaps = 6/490 (1%)
 Frame = +1

Query  130   MTKVSPEF--VGGEVQMYTFKSVSADVSFASNQFPKYKLGPDFQILEEALLENKGPSLKe  303
             MTKV PE         +   +++SADVSFASNQFP YKLGPD QI++E     K PS+K+
Sbjct  1     MTKVCPEMQEKKVCEAVVVVEAISADVSFASNQFPSYKLGPDDQIVDEPKENEKHPSVKD  60

Query  304   vveeettRLTEQHKRLSVRDLASKFDKNLSSAAKLANEAKLRDAPSLEGHVLLKKLRDAL  483
             VV++ET  L++QHKRLSVRDLA KFDKNL++AAKL +EAKL +  SLEGHV+LKKLRDAL
Sbjct  61    VVDKETGDLSDQHKRLSVRDLACKFDKNLAAAAKLVDEAKLSEVTSLEGHVMLKKLRDAL  120

Query  484   ETLKGRLAGRNKEDVEIAIAMVEALAVRLTQKEGDLIQEKFEVNKLVSILKQASEDAKKL  663
             E+++GR+ GRNKE VE AI+MVEALAV+LTQ EG  IQEK EV KL S LKQASEDAKKL
Sbjct  121   ESMRGRMDGRNKEAVEKAISMVEALAVKLTQHEGVFIQEKTEVKKLASFLKQASEDAKKL  180

Query  664   VNQERSFACAEIESARAVVQRIGEALEEQEINSQVSGKQeveelm--eeiqeARRIRVLH  837
             VNQERSFACAEI+SAR +V R+G A EEQE+ S+ S  QE       EE+QEARRI+ +H
Sbjct  181   VNQERSFACAEIDSARTLVMRLGGAFEEQELCSKASRAQEPNVEKLVEEVQEARRIKRMH  240

Query  838   QPSKVMDMEHELRALRIQLNEKSVVSFKLQNELAMSKRTEQNKSQLYRIIGSESVGSILR  1017
             QP+KVM M+HEL  L+ Q+ EKS  S KLQ E+A+ KR E +KS  Y + G++++GS L+
Sbjct  241   QPTKVMGMQHELHDLKSQIQEKSAYSIKLQREIAIIKRAEGSKSCPYVLDGAQTLGSCLK  300

Query  1018  IQPCSD-EAVDLSKCSIQWYRLSSECSRREPILGADKSVYAPEPIDVGRVLEADIVSNGL  1194
             I   SD  A D+SKCS QWYR +SE SRRE I GA++SVYAPEP DVGRV++ADI+ NG 
Sbjct  301   IHASSDSNASDISKCSFQWYRAASESSRREAISGANQSVYAPEPYDVGRVIQADILCNGQ  360

Query  1195  KASVTTIGQIDQAAGLGNYVETLLRKSNTEFSVVIAQMNGRNYSSRSIHSFHVGKMRMKL  1374
             K +VTT G I+ A+GL + VE+L+RKSN+EF+VVI+QMNG+++ SRS H F VGK R+KL
Sbjct  361   KFTVTTEGPINTASGLQSRVESLMRKSNSEFTVVISQMNGQDHVSRS-HVFTVGKARVKL  419

Query  1375  NKGWITKARDSYSGSMQLCGFRGGGNSAAKSLFWQPRKGQSFVLVFDSERERNGALVVAR  1554
             ++GWITKAR+ YS SMQLCG RG  N+ AK+LFWQPRKG SF+L F+SE+ERN A+V++R
Sbjct  420   SRGWITKAREIYSNSMQLCGVRGNANAPAKALFWQPRKGLSFLLTFESEQERNAAIVLSR  479

Query  1555  KHALECNVSI  1584
             K+A +CNV++
Sbjct  480   KYAYDCNVTL  489



>ref|XP_002523243.1| transcription factor, putative [Ricinus communis]
 gb|EEF39164.1| transcription factor, putative [Ricinus communis]
Length=494

 Score =   576 bits (1485),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 308/486 (63%), Positives = 386/486 (79%), Gaps = 2/486 (0%)
 Frame = +1

Query  130   MTKVSPEFVGGEVQMYTFKSVSADVSFASNQFPKYKLGPDFQILEEALLENKGPSLKevv  309
             MT+ + +F G  ++     +VSADV FAS++FP Y+LG + QIL+ A  + K  S+KEVV
Sbjct  1     MTRATRDF-GDTMRKDAVPAVSADVIFASSRFPNYRLGANNQILD-AKDDPKVMSMKEVV  58

Query  310   eeettRLTEQHKRLSVRDLASKFDKNLSSAAKLANEAKLRDAPSLEGHVLLKKLRDALET  489
               ET  L EQ KRLSVRDLASKF+K L++AAKL+ EA+LR+A SLE HVLLKKLRDALE+
Sbjct  59    ARETAMLLEQQKRLSVRDLASKFEKGLAAAAKLSEEARLREAASLEKHVLLKKLRDALES  118

Query  490   LKGRLAGRNKEDVEIAIAMVEALAVRLTQKEGDLIQEKFEVNKLVSILKQASEDAKKLVN  669
             LKGR+ G+NK+DVE AIAMVEALAV+LTQ+EG+LIQEK EV +L + LKQASEDAKKLV+
Sbjct  119   LKGRVVGKNKDDVEEAIAMVEALAVQLTQREGELIQEKAEVKRLANFLKQASEDAKKLVD  178

Query  670   QERSFACAEIESARAVVQRIGEALEEQEINSQVSGKQeveelmeeiqeARRIRVLHQPSK  849
             +ER+FA AEIESARA VQR+ EAL+E E  S+ SGKQ++EELM+E+QEARRI++LHQPSK
Sbjct  179   EERAFARAEIESARAAVQRVEEALQEHERVSRASGKQDLEELMKEVQEARRIKMLHQPSK  238

Query  850   VMDMEHELRALRIQLNEKSVVSFKLQNELAMSKRTEQNKSQLYRIIGSESVGSILRIQPC  1029
             VMDMEHELRALRIQL EKS  S  LQ ELA S+R EQN SQ Y + GSE++GS L+I PC
Sbjct  239   VMDMEHELRALRIQLAEKSKRSLLLQKELARSRRGEQNISQSYELNGSETLGSYLQINPC  298

Query  1030  SDEAVDLSKCSIQWYRLSSECSRREPILGADKSVYAPEPIDVGRVLEADIVSNGLKASVT  1209
              D    LSKCSIQWYR+SSE  +RE I GA KSVYAPEP DVGRV++ +I+++G + ++T
Sbjct  299   CDNVPVLSKCSIQWYRVSSEGGKRELISGATKSVYAPEPFDVGRVVQVEIIADGQQITLT  358

Query  1210  TIGQIDQAAGLGNYVETLLRKSNTEFSVVIAQMNGRNYSSRSIHSFHVGKMRMKLNKGWI  1389
             T G ID AAGLG+YVE L+RK + EF+VV+ QMNG ++ S SIH  HVGKMRMKL KG  
Sbjct  359   TSGAIDPAAGLGSYVEALVRKHDVEFNVVVTQMNGVDHKSESIHVLHVGKMRMKLRKGKT  418

Query  1390  TKARDSYSGSMQLCGFRGGGNSAAKSLFWQPRKGQSFVLVFDSERERNGALVVARKHALE  1569
             T A++ YS  MQLCG RGGGN+AA++++WQ  KG SFVL F+SERERN A+++ R+ A +
Sbjct  419   TVAKEYYSTLMQLCGVRGGGNAAAQAIYWQVNKGLSFVLAFESERERNAAIMLVRRFAFD  478

Query  1570  CNVSIT  1587
             CN+ +T
Sbjct  479   CNIMLT  484



>ref|XP_003519505.1| PREDICTED: cingulin-like isoform X1 [Glycine max]
 ref|XP_006575616.1| PREDICTED: cingulin-like isoform X2 [Glycine max]
 gb|KHN38406.1| hypothetical protein glysoja_004071 [Glycine soja]
Length=494

 Score =   576 bits (1485),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 300/485 (62%), Positives = 385/485 (79%), Gaps = 2/485 (0%)
 Frame = +1

Query  130   MTKVSPEFVGGEVQMYTFKSVSADVSFASNQFPKYKLGPDFQILEEALLENKGPSLKevv  309
             MT+V+ +F G  +Q     +VS+DV FAS +FP YK+G + QI+E    + K  S+KEVV
Sbjct  1     MTRVTRDF-GDTMQREAVPAVSSDVVFASARFPNYKIGANNQIMETKD-DPKVLSMKEVV  58

Query  310   eeettRLTEQHKRLSVRDLASKFDKNLSSAAKLANEAKLRDAPSLEGHVLLKKLRDALET  489
               ET +L EQH RLSVRDLASKF+K L++AAKL+ EA+LR+A SLE HVLLKKLRDALE+
Sbjct  59    ARETAQLLEQHNRLSVRDLASKFEKGLAAAAKLSEEARLREAASLEKHVLLKKLRDALES  118

Query  490   LKGRLAGRNKEDVEIAIAMVEALAVRLTQKEGDLIQEKFEVNKLVSILKQASEDAKKLVN  669
             LKGR+AGRNK+DVE AIAMVEALAV+LTQ+EG+LIQEK EV KL + LKQASEDAKKLV+
Sbjct  119   LKGRVAGRNKDDVEEAIAMVEALAVQLTQREGELIQEKAEVKKLANFLKQASEDAKKLVD  178

Query  670   QERSFACAEIESARAVVQRIGEALEEQEINSQVSGKQeveelmeeiqeARRIRVLHQPSK  849
             +ER+FA AEIE ARA VQR+ EAL+E E  SQ SGKQ++E+LM+E+QEARRI++LHQPSK
Sbjct  179   EERAFARAEIEDARAAVQRVEEALQEHERMSQASGKQDMEQLMKEVQEARRIKMLHQPSK  238

Query  850   VMDMEHELRALRIQLNEKSVVSFKLQNELAMSKRTEQNKSQLYRIIGSESVGSILRIQPC  1029
             VMDMEHELRALR QL EK+    +LQ EL  +K+  +N   LY + G+E++GS L+IQPC
Sbjct  239   VMDMEHELRALRAQLAEKTRQYLRLQKELTRTKKGGENVPHLYELEGNETLGSYLQIQPC  298

Query  1030  SDEAVDLSKCSIQWYRLSSECSRREPILGADKSVYAPEPIDVGRVLEADIVSNGLKASVT  1209
             SD A ++S+C+IQWY +SS+ +++E I GA KSVYAPEP DVGR+L+ DI+S     +++
Sbjct  299   SDNAPEVSRCAIQWYCVSSDGAKKELISGATKSVYAPEPFDVGRILQVDIISENEHITLS  358

Query  1210  TIGQIDQAAGLGNYVETLLRKSNTEFSVVIAQMNGRNYSSRSIHSFHVGKMRMKLNKGWI  1389
             T G ID AAGLG YVE L+RK +TEF+VV+ QMNG ++ + SIH  HVGKMR+KL KG  
Sbjct  359   TAGPIDPAAGLGTYVEALMRKHDTEFNVVVTQMNGSHHPTESIHVLHVGKMRIKLCKGKT  418

Query  1390  TKARDSYSGSMQLCGFRGGGNSAAKSLFWQPRKGQSFVLVFDSERERNGALVVARKHALE  1569
             T A++ YS SMQLCG RGGGN+AA++LFWQP +G SFVL F+SERERN A+++AR+ A +
Sbjct  419   TIAKEYYSSSMQLCGVRGGGNAAAQALFWQPMQGHSFVLAFESERERNAAIMLARRFAFD  478

Query  1570  CNVSI  1584
             CN+ +
Sbjct  479   CNIML  483



>ref|XP_009142709.1| PREDICTED: uncharacterized protein LOC103866519 isoform X1 [Brassica 
rapa]
Length=520

 Score =   577 bits (1487),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 305/490 (62%), Positives = 384/490 (78%), Gaps = 6/490 (1%)
 Frame = +1

Query  130   MTKVSPEF--VGGEVQMYTFKSVSADVSFASNQFPKYKLGPDFQILEEALLENKGPSLKe  303
             MTKV PE         +   +++SADVSFASNQFP YKLGPD QI++E     K PS+K+
Sbjct  27    MTKVCPEMQEKKVCEAVVVVEAISADVSFASNQFPSYKLGPDDQIVDEPKENEKHPSVKD  86

Query  304   vveeettRLTEQHKRLSVRDLASKFDKNLSSAAKLANEAKLRDAPSLEGHVLLKKLRDAL  483
             VV++ET  L++QHKRLSVRDLA KFDKNL++AAKL +EAKL +  SLEGHV+LKKLRDAL
Sbjct  87    VVDKETGDLSDQHKRLSVRDLACKFDKNLAAAAKLVDEAKLSEVTSLEGHVMLKKLRDAL  146

Query  484   ETLKGRLAGRNKEDVEIAIAMVEALAVRLTQKEGDLIQEKFEVNKLVSILKQASEDAKKL  663
             E+++GR+ GRNKE VE AI+MVEALAV+LTQ EG  IQEK EV KL S LKQASEDAKKL
Sbjct  147   ESMRGRMDGRNKEAVEKAISMVEALAVKLTQHEGVFIQEKTEVKKLASFLKQASEDAKKL  206

Query  664   VNQERSFACAEIESARAVVQRIGEALEEQEINSQVSGKQeveelm--eeiqeARRIRVLH  837
             VNQERSFACAEI+SAR +V R+G A EEQE+ S+ S  QE       EE+QEARRI+ +H
Sbjct  207   VNQERSFACAEIDSARTLVMRLGGAFEEQELCSKASRAQEPNVEKLVEEVQEARRIKRMH  266

Query  838   QPSKVMDMEHELRALRIQLNEKSVVSFKLQNELAMSKRTEQNKSQLYRIIGSESVGSILR  1017
             QP+KVM M+HEL  L+ Q+ EKS  S KLQ E+A+ KR E +KS  Y + G++++GS L+
Sbjct  267   QPTKVMGMQHELHDLKSQIQEKSAYSIKLQREIAIIKRAEGSKSCPYVLDGAQTLGSCLK  326

Query  1018  IQPCSD-EAVDLSKCSIQWYRLSSECSRREPILGADKSVYAPEPIDVGRVLEADIVSNGL  1194
             I   SD  A D+SKCS QWYR +SE SRRE I GA++SVYAPEP DVGRV++ADI+ NG 
Sbjct  327   IHASSDSNASDISKCSFQWYRAASESSRREAISGANQSVYAPEPYDVGRVIQADILCNGQ  386

Query  1195  KASVTTIGQIDQAAGLGNYVETLLRKSNTEFSVVIAQMNGRNYSSRSIHSFHVGKMRMKL  1374
             K +VTT G I+ A+GL + VE+L+RKSN+EF+VVI+QMNG+++ SRS H F VGK R+KL
Sbjct  387   KFTVTTEGPINTASGLQSRVESLMRKSNSEFTVVISQMNGQDHVSRS-HVFTVGKARVKL  445

Query  1375  NKGWITKARDSYSGSMQLCGFRGGGNSAAKSLFWQPRKGQSFVLVFDSERERNGALVVAR  1554
             ++GWITKAR+ YS SMQLCG RG  N+ AK+LFWQPRKG SF+L F+SE+ERN A+V++R
Sbjct  446   SRGWITKAREIYSNSMQLCGVRGNANAPAKALFWQPRKGLSFLLTFESEQERNAAIVLSR  505

Query  1555  KHALECNVSI  1584
             K+A +CNV++
Sbjct  506   KYAYDCNVTL  515



>emb|CDY27211.1| BnaA09g35910D [Brassica napus]
Length=487

 Score =   575 bits (1483),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 304/487 (62%), Positives = 389/487 (80%), Gaps = 7/487 (1%)
 Frame = +1

Query  130   MTKVSPEFVGGEVQMYTFKSVSADVSFASNQFPKYKLGPDFQILEEALLENKGPSLKevv  309
             MTKV PE +          +VSADVSFASN FP YKLGPD QI+EE   ++KGPS+++ V
Sbjct  1     MTKVCPE-IEDMTLPEPVTTVSADVSFASNHFPSYKLGPDNQIVEEPKEDDKGPSVQDTV  59

Query  310   eeettRLTEQHKRLSVRDLASKFDKNLSSAAKLANEAKLRDAPSLEGHVLLKKLRDALET  489
             E+E+  L++QHKRLSVRDLASKFDKNL++A  LA+EAKL++A SLEGHV+LKKLRDALE 
Sbjct  60    EKESELLSDQHKRLSVRDLASKFDKNLAAAVTLADEAKLKEAASLEGHVMLKKLRDALEY  119

Query  490   LKGRLAGRNKEDVEIAIAMVEALAVRLTQKEGDLIQEKFEVNKLVSILKQASEDAKKLVN  669
             ++GR+ G+NKEDVE AI+MVEALAV+LTQ EG+LIQEKFEV KL + LKQASEDAKKLVN
Sbjct  120   MRGRMDGQNKEDVEKAISMVEALAVKLTQNEGELIQEKFEVKKLGNFLKQASEDAKKLVN  179

Query  670   QERSFACAEIESARAVVQRIGEALEEQEINSQVSGKQ--eveelmeeiqeARRIRVLHQP  843
              E+SFACAEIESARAVV ++GEA EEQE +S+ S  Q  +VE+L+EE+QEAR+I+ +H P
Sbjct  180   HEKSFACAEIESARAVVLKLGEAFEEQERSSEASRAQGPDVEKLVEEVQEARQIKRMHHP  239

Query  844   SKVMDMEHELRALRIQLNEKSVVSFKLQNELAMSKRTEQNKSQLYRIIGSESVGSILRIQ  1023
             +KVM M+HEL  LR +L EK + S KL  E+   KR E++KS  + + G++S+GS LRI 
Sbjct  240   TKVMGMQHELHGLRSRLQEKYMNSIKLHQEI---KRVEESKSCPFVLEGTQSLGSCLRIN  296

Query  1024  PCSDEAVDLSKCSIQWYRLSSECSRREPILGADKSVYAPEPIDVGRVLEADIVSNGLKAS  1203
               S+ A+DLS CSIQWYR + E SRRE I GA++S+YAPEP DVGR+L+ADI+SNG K +
Sbjct  297   VSSENAIDLSNCSIQWYRAACETSRREAISGANQSLYAPEPFDVGRILQADILSNGQKVT  356

Query  1204  VTTIGQIDQAAGLGNYVETLLRKSNTEFSVVIAQMNGRNYSSRSIHSFHVGKMRMKLNKG  1383
             VTT G ID  + L + VE+L+RKSN+EFSVVI+QMNG++Y+SR+ H F VGK R+KL++G
Sbjct  357   VTTDGPIDPDSCLQSRVESLMRKSNSEFSVVISQMNGQDYASRT-HVFTVGKTRIKLSRG  415

Query  1384  WITKARDSYSGSMQLCGFRGGGNSAAKSLFWQPRKGQSFVLVFDSERERNGALVVARKHA  1563
             WITKAR+ YS SMQLCG RG   + AK LFWQPRK  +F+L F+SE+ERN A+V+ARK+A
Sbjct  416   WITKAREIYSTSMQLCGVRGNIKAPAKVLFWQPRKSLTFILTFESEQERNTAIVLARKYA  475

Query  1564  LECNVSI  1584
              +CNV++
Sbjct  476   FDCNVTL  482



>ref|XP_002313274.2| plectin-related family protein [Populus trichocarpa]
 gb|EEE87229.2| plectin-related family protein [Populus trichocarpa]
Length=494

 Score =   575 bits (1483),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 307/486 (63%), Positives = 389/486 (80%), Gaps = 2/486 (0%)
 Frame = +1

Query  130   MTKVSPEFVGGEVQMYTFKSVSADVSFASNQFPKYKLGPDFQILEEALLENKGPSLKevv  309
             MT+V+ +F G  +Q     +VSADV+FAS++FP YK+G + QI++ A    K  S+KEVV
Sbjct  1     MTRVNRDF-GDTMQKDAVPAVSADVAFASSRFPNYKIGANNQIVD-AKDSPKVLSMKEVV  58

Query  310   eeettRLTEQHKRLSVRDLASKFDKNLSSAAKLANEAKLRDAPSLEGHVLLKKLRDALET  489
               ET  L EQ KRLSVRDLA+KF+K L++AAKL+ EA+LR+A SLE HVLLKKLRDALE+
Sbjct  59    ARETALLLEQQKRLSVRDLANKFEKGLAAAAKLSEEARLREAASLEKHVLLKKLRDALES  118

Query  490   LKGRLAGRNKEDVEIAIAMVEALAVRLTQKEGDLIQEKFEVNKLVSILKQASEDAKKLVN  669
             LKGR+AGRNK+DVE AIAMVEALAV+LT +EG+LIQEK EV KL + LKQASEDAKKLV+
Sbjct  119   LKGRVAGRNKDDVEEAIAMVEALAVQLTHREGELIQEKAEVKKLANFLKQASEDAKKLVD  178

Query  670   QERSFACAEIESARAVVQRIGEALEEQEINSQVSGKQeveelmeeiqeARRIRVLHQPSK  849
              ER++A AEIESARA VQR+ EA++E E  S+ SGKQ++EELM+E+QEARRI++LHQPSK
Sbjct  179   GERAYARAEIESARAAVQRVEEAIQEHERMSRASGKQDLEELMKEVQEARRIKMLHQPSK  238

Query  850   VMDMEHELRALRIQLNEKSVVSFKLQNELAMSKRTEQNKSQLYRIIGSESVGSILRIQPC  1029
             VMDMEHE+RALRIQL EKS  S  LQ ELA S+R EQ+  QL+ + G+E++GS LRI PC
Sbjct  239   VMDMEHEIRALRIQLAEKSKRSLLLQKELARSRRAEQSIFQLFELDGTEALGSCLRINPC  298

Query  1030  SDEAVDLSKCSIQWYRLSSECSRREPILGADKSVYAPEPIDVGRVLEADIVSNGLKASVT  1209
             SD A +LSKCSIQWYRLSS+  ++E I GA K VYAPEP DVGRVL+A+I+S+G + S++
Sbjct  299   SDNAPELSKCSIQWYRLSSDGGKKELISGATKPVYAPEPFDVGRVLQAEIISDGQQFSLS  358

Query  1210  TIGQIDQAAGLGNYVETLLRKSNTEFSVVIAQMNGRNYSSRSIHSFHVGKMRMKLNKGWI  1389
             T   ID AAGLG+YVE L+RK + EF+V++ QMNG ++ S SIH  HVGKMR+KL KG  
Sbjct  359   TTCPIDPAAGLGSYVEALVRKHDVEFNVIVTQMNGVDHPSESIHVLHVGKMRIKLRKGKS  418

Query  1390  TKARDSYSGSMQLCGFRGGGNSAAKSLFWQPRKGQSFVLVFDSERERNGALVVARKHALE  1569
             T A++ YS SMQLCG RGGGN+AA++LFWQ +KG SFVL F+S RERN A+++AR+ A +
Sbjct  419   TNAKEYYSTSMQLCGVRGGGNAAAQALFWQAKKGLSFVLAFESARERNAAIMLARRFAFD  478

Query  1570  CNVSIT  1587
             CN+ + 
Sbjct  479   CNIMLA  484



>ref|XP_010093534.1| hypothetical protein L484_002074 [Morus notabilis]
 gb|EXB54224.1| hypothetical protein L484_002074 [Morus notabilis]
Length=582

 Score =   578 bits (1490),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 315/505 (62%), Positives = 378/505 (75%), Gaps = 27/505 (5%)
 Frame = +1

Query  130   MTKVSPEFVGGEVQMYTFKSVSADVSFASNQFPKYKLGPDFQILEEALLENKGPSLKevv  309
             MTKVSPE     + M     VSADVSF SN FPKYKLG D QILEE   +N GPSLKEVV
Sbjct  1     MTKVSPEV--DAMDMDAVLPVSADVSFKSNHFPKYKLGADNQILEEPKEDNNGPSLKEVV  58

Query  310   eeettRLTEQHKRLSVRDLASKFDKNLSSAAKLANEAKLRDAPSLEGHVLLKKLRDALET  489
             E+ETT+L+EQHKRLSVRDLA KFDKNL++AAKL+ EAKLR+  SLEGHVLLKKLRDALE 
Sbjct  59    EQETTQLSEQHKRLSVRDLACKFDKNLTAAAKLSEEAKLREVASLEGHVLLKKLRDALEH  118

Query  490   LKGRLAGRNKEDVEIAIAMVEALAVRLTQKEGDLIQEKFEVNKLVSILKQASEDAKKLVN  669
             L+GR+AGRNKEDVE AI+MVEALAV+LTQ EG+LIQEKFEV KL + LKQASEDAKKLVN
Sbjct  119   LRGRMAGRNKEDVEKAISMVEALAVKLTQNEGELIQEKFEVKKLANFLKQASEDAKKLVN  178

Query  670   QERSFACAEIESARAVVQRIGEALEEQEINSQVSGKQeveelmeeiqeARRIRVLHQPS-  846
             QE+SFACAEIESARAVVQRIGEAL+EQ+  SQ S +Q        ++    I  +     
Sbjct  179   QEKSFACAEIESARAVVQRIGEALDEQDRISQASKEQSPMSNPLYVKVQNNIPSIEHAEG  238

Query  847   ---------------------KVMDMEHELRALRIQLNEKSVVSFKLQ-NELAMSKRTEQ  960
                                  K   +  ++  L  ++ E   +    Q ++LA+SKR E+
Sbjct  239   GPWHRGGSACVCTRGPRFESRKRPLLRGDVEGLLEEVQEARRIKLLHQPSKLAISKRAEE  298

Query  961   NKSQLYRIIGSESVGSILRIQPCSDEAVDLSKCSIQWYRLSSECSRREPILGADKSVYAP  1140
             NKS+LY + GS  +GS LRIQ  SDEA  LSKCSIQWYR+S EC+R E I GA+K VYAP
Sbjct  299   NKSRLYMLDGSAMLGSYLRIQVSSDEAPQLSKCSIQWYRVSLECNRDEVISGANKPVYAP  358

Query  1141  EPIDVGRVLEADIVSNGLKASVTTIGQIDQAAGLGNYVETLLRKSNTEFSVVIAQMNGRN  1320
             EP+DVGR+L+ADI  NG KASV T G ID   GLG++VETL+RKSN+EF+VVI++MNG++
Sbjct  359   EPLDVGRILQADICFNGQKASVMTPGPID--PGLGSHVETLMRKSNSEFNVVISKMNGQD  416

Query  1321  YSSRSIHSFHVGKMRMKLNKGWITKARDSYSGSMQLCGFRGGGNSAAKSLFWQPRKGQSF  1500
             YSS S+H+FHVGKMRMKL +GWITKAR+ YS SMQLCG+RG  N+AAK+LFWQ RKG SF
Sbjct  417   YSSHSVHAFHVGKMRMKLCRGWITKAREIYSSSMQLCGYRGESNTAAKALFWQARKGLSF  476

Query  1501  VLVFDSERERNGALVVARKHALECN  1575
             VL F+SER+RN A+ +ARK+A +CN
Sbjct  477   VLTFESERDRNAAITLARKYAHDCN  501



>emb|CDX79969.1| BnaA05g01870D [Brassica napus]
Length=521

 Score =   575 bits (1482),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 304/490 (62%), Positives = 383/490 (78%), Gaps = 6/490 (1%)
 Frame = +1

Query  130   MTKVSPEF--VGGEVQMYTFKSVSADVSFASNQFPKYKLGPDFQILEEALLENKGPSLKe  303
             MTKV PE         +   +++SADVSFASNQFP YKLGPD QI++E     K PS+K+
Sbjct  28    MTKVCPEMQEKKVCEAVVVVEAISADVSFASNQFPSYKLGPDDQIVDEPKENEKHPSVKD  87

Query  304   vveeettRLTEQHKRLSVRDLASKFDKNLSSAAKLANEAKLRDAPSLEGHVLLKKLRDAL  483
             VV++ET  L++QHKRLSVRDLA KFDKNL++AAKL +EAKL +  SLEGHV+LKKLRDAL
Sbjct  88    VVDKETGDLSDQHKRLSVRDLACKFDKNLAAAAKLVDEAKLSEVTSLEGHVMLKKLRDAL  147

Query  484   ETLKGRLAGRNKEDVEIAIAMVEALAVRLTQKEGDLIQEKFEVNKLVSILKQASEDAKKL  663
             E+++GR+ GRNKE VE AI+MVEALAV+LTQ EG  IQEK EV KL S LKQASEDAKKL
Sbjct  148   ESMRGRMDGRNKEAVEKAISMVEALAVKLTQHEGVFIQEKTEVKKLASFLKQASEDAKKL  207

Query  664   VNQERSFACAEIESARAVVQRIGEALEEQEINSQVSGKQeveelm--eeiqeARRIRVLH  837
             VNQERSFACAEI+SAR +V R+G A EEQE+ S+ S  QE       EE+QEARRI+ +H
Sbjct  208   VNQERSFACAEIDSARTLVMRLGGAFEEQELCSKASRAQEPNVEKLVEEVQEARRIKRMH  267

Query  838   QPSKVMDMEHELRALRIQLNEKSVVSFKLQNELAMSKRTEQNKSQLYRIIGSESVGSILR  1017
             QP+KVM M+HEL  L+ Q+ EKS  S KLQ E+A+ KR E +KS  Y + G++++GS L+
Sbjct  268   QPTKVMGMQHELHDLKSQIQEKSAYSIKLQREIAIIKRAEGSKSCPYVLDGAQTLGSCLK  327

Query  1018  IQPCSD-EAVDLSKCSIQWYRLSSECSRREPILGADKSVYAPEPIDVGRVLEADIVSNGL  1194
             I   SD  A D+SKCS QWYR +SE SRRE I GA++SVYAPEP DVGRV++ADI+ NG 
Sbjct  328   IHASSDSNASDISKCSFQWYRAASESSRREAISGANQSVYAPEPYDVGRVIQADILCNGQ  387

Query  1195  KASVTTIGQIDQAAGLGNYVETLLRKSNTEFSVVIAQMNGRNYSSRSIHSFHVGKMRMKL  1374
             K +VTT G I+ A+GL + VE+L+RKSN+EF+VVI+QMNG+++ SRS H F VGK R+KL
Sbjct  388   KFTVTTEGPINTASGLQSRVESLMRKSNSEFTVVISQMNGQDHVSRS-HVFTVGKARVKL  446

Query  1375  NKGWITKARDSYSGSMQLCGFRGGGNSAAKSLFWQPRKGQSFVLVFDSERERNGALVVAR  1554
             ++GWITK R+ YS SMQLCG RG  N+ AK+LFWQPRKG SF+L F+SE+ERN A+V++R
Sbjct  447   SRGWITKGREIYSNSMQLCGVRGNANAPAKALFWQPRKGLSFLLTFESEQERNAAIVLSR  506

Query  1555  KHALECNVSI  1584
             K+A +CNV++
Sbjct  507   KYAYDCNVTL  516



>gb|KDP36619.1| hypothetical protein JCGZ_08435 [Jatropha curcas]
Length=491

 Score =   574 bits (1479),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 311/490 (63%), Positives = 386/490 (79%), Gaps = 10/490 (2%)
 Frame = +1

Query  130   MTKVSPEFVGGEVQMYTFKSVSADVSFASNQFPKYKLGPDFQILEEALLENKGPSLKevv  309
             MT+V+ +F GG +Q     +VSADV FAS++FP YKLG + QI++ A  + K  S+KEVV
Sbjct  1     MTRVNRDF-GGTMQKDAVPAVSADVIFASSRFPNYKLGANNQIVD-AKDDPKVLSMKEVV  58

Query  310   eeettRLTEQHKRLSVRDLASKFDKNLSSAAKLANE--------AKLRDAPSLEGHVLLK  465
               ET  L EQ KRLSVRDLASKF+K L++AAKL+ E        A+LR+A SLE HVLLK
Sbjct  59    ARETAMLLEQQKRLSVRDLASKFEKGLAAAAKLSEEYLLLVVEGARLREAASLEKHVLLK  118

Query  466   KLRDALETLKGRLAGRNKEDVEIAIAMVEALAVRLTQKEGDLIQEKFEVNKLVSILKQAS  645
              LRDALE+L+GR+ GRNK+DVE AIAMVEALAV+LTQ+EG+L+QEK EV KL + LKQAS
Sbjct  119   NLRDALESLRGRVVGRNKDDVEEAIAMVEALAVQLTQREGELVQEKAEVKKLANFLKQAS  178

Query  646   EDAKKLVNQERSFACAEIESARAVVQRIGEALEEQEINSQVSGKQeveelmeeiqeARRI  825
             EDAK+LV++ER+FA AEIESARA VQR+ EAL+E E  S+ SGKQ++EELM+E+QEARRI
Sbjct  179   EDAKRLVDEERAFARAEIESARAAVQRVEEALQEHERMSRASGKQDLEELMKEVQEARRI  238

Query  826   RVLHQPSKVMDMEHELRALRIQLNEKSVVSFKLQNELAMSKRTEQNKSQLYRIIGSESVG  1005
             ++LHQPSKVMDMEHELRALRIQL EKS  S  LQ ELA SKR E N SQ Y + GSE +G
Sbjct  239   KMLHQPSKVMDMEHELRALRIQLAEKSKRSLLLQRELARSKRGELNISQSYELEGSEVLG  298

Query  1006  SILRIQPCSDEAVDLSKCSIQWYRLSSECSRREPILGADKSVYAPEPIDVGRVLEADIVS  1185
             S L+I PCSD+A +LSKCSIQWYR+SSE  ++E I GA KS+YAPEPIDVGRVL+ +I++
Sbjct  299   SYLQITPCSDDAPELSKCSIQWYRVSSEGGKKELISGATKSIYAPEPIDVGRVLQVEIIA  358

Query  1186  NGLKASVTTIGQIDQAAGLGNYVETLLRKSNTEFSVVIAQMNGRNYSSRSIHSFHVGKMR  1365
             +G +  +TT G ID AAGLG+YVE L+RK + EF+VV+ QMNG +Y S SIH  HVGKMR
Sbjct  359   DGRQVILTTTGAIDPAAGLGSYVEALVRKHDVEFNVVVTQMNGVDYKSDSIHVLHVGKMR  418

Query  1366  MKLNKGWITKARDSYSGSMQLCGFRGGGNSAAKSLFWQPRKGQSFVLVFDSERERNGALV  1545
             MKL KG  T  ++ YS  MQLCG RGGGN+AA++L+WQ  KG SFVL F+SER+RN A++
Sbjct  419   MKLRKGKSTITKEYYSTLMQLCGVRGGGNAAAQALYWQASKGLSFVLAFESERDRNAAIM  478

Query  1546  VARKHALECN  1575
             +AR+ A +CN
Sbjct  479   LARRFAFDCN  488



>ref|XP_004491215.1| PREDICTED: paramyosin-like [Cicer arietinum]
Length=494

 Score =   573 bits (1478),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 298/485 (61%), Positives = 385/485 (79%), Gaps = 2/485 (0%)
 Frame = +1

Query  130   MTKVSPEFVGGEVQMYTFKSVSADVSFASNQFPKYKLGPDFQILEEALLENKGPSLKevv  309
             MT+V+ +F G  +Q     +VS+DV FAS++FP Y++G + QI+E    + K  S+KEV+
Sbjct  1     MTRVTRDF-GDTMQKEAVPAVSSDVIFASSRFPSYRIGANNQIMETKD-DPKVLSMKEVI  58

Query  310   eeettRLTEQHKRLSVRDLASKFDKNLSSAAKLANEAKLRDAPSLEGHVLLKKLRDALET  489
               ET +L +QH RLSVRDLASKF+K L++AAKL+ EAKLR+A SLE HVLLKKLRD+LE+
Sbjct  59    ARETAQLLDQHNRLSVRDLASKFEKGLAAAAKLSEEAKLREAVSLEKHVLLKKLRDSLES  118

Query  490   LKGRLAGRNKEDVEIAIAMVEALAVRLTQKEGDLIQEKFEVNKLVSILKQASEDAKKLVN  669
             LKGR+AG NK+DVE AIAMVEALAV+LTQ+EG+LIQEK EV KL + LKQASEDAKKLV+
Sbjct  119   LKGRVAGSNKDDVEDAIAMVEALAVQLTQREGELIQEKTEVKKLANFLKQASEDAKKLVD  178

Query  670   QERSFACAEIESARAVVQRIGEALEEQEINSQVSGKQeveelmeeiqeARRIRVLHQPSK  849
             +ER+FA AEI++AR  VQR+ EAL+E E  SQ SGKQ+VE+LM+E+QEARRI++LHQPSK
Sbjct  179   EERAFARAEIDNARTAVQRVEEALQEHEKMSQASGKQDVEQLMKEVQEARRIKMLHQPSK  238

Query  850   VMDMEHELRALRIQLNEKSVVSFKLQNELAMSKRTEQNKSQLYRIIGSESVGSILRIQPC  1029
             VMDMEHELRALR QL EK+    +LQ EL  +K+ E+N   LY + G+E++GS L+IQPC
Sbjct  239   VMDMEHELRALRAQLAEKTRHYLRLQKELTRTKKGEENVPHLYELEGNETLGSYLQIQPC  298

Query  1030  SDEAVDLSKCSIQWYRLSSECSRREPILGADKSVYAPEPIDVGRVLEADIVSNGLKASVT  1209
             SD A D+SKCSIQWYR+SS+ S++E I GA KSVYAPEP DVG +L+ DI+S      ++
Sbjct  299   SDIAPDVSKCSIQWYRVSSDGSKKELISGATKSVYAPEPFDVGHILQVDIISEHQHIVLS  358

Query  1210  TIGQIDQAAGLGNYVETLLRKSNTEFSVVIAQMNGRNYSSRSIHSFHVGKMRMKLNKGWI  1389
             T G ID AAGLG YVE L+RK +TEF+VV+ QM G ++ + SIH  HVGKMR+KL KG  
Sbjct  359   TTGPIDPAAGLGTYVEALVRKHDTEFNVVVTQMRGAHHPTESIHVLHVGKMRIKLCKGKT  418

Query  1390  TKARDSYSGSMQLCGFRGGGNSAAKSLFWQPRKGQSFVLVFDSERERNGALVVARKHALE  1569
             T A++ YS +MQLCG RGGGN+AA++LFWQP++G SFVL F+SERERN A+++AR+ A +
Sbjct  419   TIAKEYYSSTMQLCGVRGGGNAAAQALFWQPKQGHSFVLAFESERERNAAIMLARRFAFD  478

Query  1570  CNVSI  1584
             CN+ +
Sbjct  479   CNIML  483



>ref|XP_007146154.1| hypothetical protein PHAVU_006G016800g [Phaseolus vulgaris]
 gb|ESW18148.1| hypothetical protein PHAVU_006G016800g [Phaseolus vulgaris]
Length=493

 Score =   573 bits (1477),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 300/487 (62%), Positives = 387/487 (79%), Gaps = 11/487 (2%)
 Frame = +1

Query  130   MTKVSPEFVGGEVQMYTFKSVSADVSFASNQFPKYKLGPDFQILEEALLENKGP----SL  297
             MT+++ +F G  +Q     +VSADV FAS +FP YK+G + QI+E      KG     S+
Sbjct  1     MTRMTRDF-GDTMQKDAVPAVSADVIFASLRFPNYKIGVNNQIME-----TKGDPKVLSM  54

Query  298   KevveeettRLTEQHKRLSVRDLASKFDKNLSSAAKLANEAKLRDAPSLEGHVLLKKLRD  477
             KEVV  ET +L EQ KR+SVRDLASKF+K L++AAKL+ EA+LR+A SLE HVLLKKLRD
Sbjct  55    KEVVARETAQLLEQQKRMSVRDLASKFEKGLAAAAKLSEEARLREAASLEKHVLLKKLRD  114

Query  478   ALETLKGRLAGRNKEDVEIAIAMVEALAVRLTQKEGDLIQEKFEVNKLVSILKQASEDAK  657
             AL++LKGR+AGRNKEDV  AIAMVEALAV+LTQ+EG+LIQEK EV KL + LKQASEDAK
Sbjct  115   ALQSLKGRVAGRNKEDVAEAIAMVEALAVQLTQREGELIQEKAEVKKLTNFLKQASEDAK  174

Query  658   KLVNQERSFACAEIESARAVVQRIGEALEEQEINSQVSGKQeveelmeeiqeARRIRVLH  837
             KLVN+ER+FA  EIE+ARA VQR+ EAL+E E  S+ SGKQ++++LM+E+QEARRI++LH
Sbjct  175   KLVNEERAFARFEIENARAAVQRVEEALQEHERMSEASGKQDLDQLMKEVQEARRIKMLH  234

Query  838   QPSKVMDMEHELRALRIQLNEKSVVSFKLQNELAMSKRTEQNKSQLYRIIGSESVGSILR  1017
             QPSKVMDMEHELRALR QL EKS +  +LQ EL+ +K+ E+N   LY + G+E++GS L+
Sbjct  235   QPSKVMDMEHELRALRAQLGEKSRLYLRLQKELSRTKKGEENVPHLYELEGAETLGSYLQ  294

Query  1018  IQPCSDEAVDLSKCSIQWYRLSSECSRREPILGADKSVYAPEPIDVGRVLEADIVSNGLK  1197
             IQPCSD A +LSKCSIQWYR+++E +++E I GA KSVYAPEP DVGR+L+ DI+S G +
Sbjct  295   IQPCSDNAPELSKCSIQWYRVATEGAKKELISGATKSVYAPEPFDVGRILQVDIISKGQE  354

Query  1198  ASVTTIGQIDQAAGLGNYVETLLRKSNTEFSVVIAQMNGRNYSSRSIHSFHVGKMRMKLN  1377
              +++T G ID AAGLG YVE L+RK +TEF+VV+ Q  G ++ + SIH  HVGKMRMKL 
Sbjct  355   ITLSTTGPIDPAAGLGTYVEALVRKHDTEFNVVVTQ-TGSDHPTESIHLLHVGKMRMKLC  413

Query  1378  KGWITKARDSYSGSMQLCGFRGGGNSAAKSLFWQPRKGQSFVLVFDSERERNGALVVARK  1557
             KG  T  ++ YS SMQLCG RGGGN+AA+++FWQP++G SFVL F+SERERN A+++AR+
Sbjct  414   KGKTTITKEYYSSSMQLCGVRGGGNAAAQAVFWQPKQGLSFVLAFESERERNAAIMLARR  473

Query  1558  HALECNV  1578
              A +CN+
Sbjct  474   FAFDCNI  480



>emb|CDX72133.1| BnaC08g27410D [Brassica napus]
Length=487

 Score =   573 bits (1476),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 304/488 (62%), Positives = 389/488 (80%), Gaps = 9/488 (2%)
 Frame = +1

Query  130   MTKVSPEFVGGEV-QMYTFKSVSADVSFASNQFPKYKLGPDFQILEEALLENKGPSLKev  306
             MTKV PE     + ++ T  +VSADVSFASN FP YKLGPD QI+EE   + KGPS+K+ 
Sbjct  1     MTKVCPEIEDMTLPELVT--TVSADVSFASNHFPTYKLGPDNQIVEEPKEDEKGPSVKDT  58

Query  307   veeettRLTEQHKRLSVRDLASKFDKNLSSAAKLANEAKLRDAPSLEGHVLLKKLRDALE  486
             VE+E+  L++QHKRLSVRDLASKFDKNL++A  LA+EAKL++  SLEGHV+LKKLRDALE
Sbjct  59    VEKESELLSDQHKRLSVRDLASKFDKNLAAAVTLADEAKLKEVASLEGHVMLKKLRDALE  118

Query  487   TLKGRLAGRNKEDVEIAIAMVEALAVRLTQKEGDLIQEKFEVNKLVSILKQASEDAKKLV  666
              ++GR+ G+NKEDVE AI+MVEALAV+LTQ EG+LIQEKFEV KL + LKQASEDAKKLV
Sbjct  119   YMRGRMDGQNKEDVEKAISMVEALAVKLTQNEGELIQEKFEVKKLGNFLKQASEDAKKLV  178

Query  667   NQERSFACAEIESARAVVQRIGEALEEQEINSQVSGKQ--eveelmeeiqeARRIRVLHQ  840
             NQE+SFACAEIESARAVV ++GEA EEQE +S+ S  Q  +VE+L+EE+QEAR+I+ +H 
Sbjct  179   NQEKSFACAEIESARAVVLKLGEAFEEQERSSEASRAQGPDVEKLVEEVQEARQIKRMHH  238

Query  841   PSKVMDMEHELRALRIQLNEKSVVSFKLQNELAMSKRTEQNKSQLYRIIGSESVGSILRI  1020
             P+KVM M+HEL  LR +L EK + S KL  E+   KR E++KS  + + G++S+GS LRI
Sbjct  239   PTKVMGMQHELHGLRNRLQEKYMNSIKLHQEI---KRAEESKSCPFVLEGTQSLGSCLRI  295

Query  1021  QPCSDEAVDLSKCSIQWYRLSSECSRREPILGADKSVYAPEPIDVGRVLEADIVSNGLKA  1200
                SD A DLS CSIQWYR + E SRRE I  A++SVYAPEP DVGR+L+ADI+SNG K 
Sbjct  296   CVSSDNATDLSSCSIQWYRAACETSRREAISDANQSVYAPEPFDVGRILQADILSNGQKV  355

Query  1201  SVTTIGQIDQAAGLGNYVETLLRKSNTEFSVVIAQMNGRNYSSRSIHSFHVGKMRMKLNK  1380
             +VTT G ID  + L + VE+L+RKSN+EF+VVI+QMNG++Y+SR+ H F VGK R+KL++
Sbjct  356   TVTTDGPIDPDSCLQSRVESLMRKSNSEFNVVISQMNGQDYASRT-HVFTVGKTRIKLSR  414

Query  1381  GWITKARDSYSGSMQLCGFRGGGNSAAKSLFWQPRKGQSFVLVFDSERERNGALVVARKH  1560
             GWITKAR+ YS SMQLCG RG   + A++LFWQPRK  +F+L F+SE+ERN A+ +ARK+
Sbjct  415   GWITKAREIYSTSMQLCGVRGNIKAPARALFWQPRKSLTFILTFESEQERNTAITLARKY  474

Query  1561  ALECNVSI  1584
             A +CNV++
Sbjct  475   AFDCNVTL  482



>ref|XP_011036381.1| PREDICTED: uncharacterized protein LOC105133920 [Populus euphratica]
 ref|XP_011036382.1| PREDICTED: uncharacterized protein LOC105133920 [Populus euphratica]
Length=494

 Score =   573 bits (1476),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 308/486 (63%), Positives = 388/486 (80%), Gaps = 2/486 (0%)
 Frame = +1

Query  130   MTKVSPEFVGGEVQMYTFKSVSADVSFASNQFPKYKLGPDFQILEEALLENKGPSLKevv  309
             MT+V+ +F G  +Q     +VSADV+FAS++FP YK+G + QI++ A    K  S+KEVV
Sbjct  1     MTRVTRDF-GDTMQKDAVPAVSADVAFASSRFPNYKIGANNQIVD-AKDSPKVLSMKEVV  58

Query  310   eeettRLTEQHKRLSVRDLASKFDKNLSSAAKLANEAKLRDAPSLEGHVLLKKLRDALET  489
               ETT L EQ KRLSVRDLA+KF+K L++AAKL+ EA+LR+A SLE HVLLKKLRDALE+
Sbjct  59    ARETTLLLEQQKRLSVRDLANKFEKGLAAAAKLSEEARLREAASLEKHVLLKKLRDALES  118

Query  490   LKGRLAGRNKEDVEIAIAMVEALAVRLTQKEGDLIQEKFEVNKLVSILKQASEDAKKLVN  669
             LKGR+AGRNK+DVE AIAMVEALAV+LTQ+EG+LIQEK EV KL + LKQASEDAKKLV+
Sbjct  119   LKGRVAGRNKDDVEEAIAMVEALAVQLTQREGELIQEKAEVKKLANFLKQASEDAKKLVD  178

Query  670   QERSFACAEIESARAVVQRIGEALEEQEINSQVSGKQeveelmeeiqeARRIRVLHQPSK  849
              ER++A AEIESARA VQR+ EA+ E E  S+ SGKQ++EELM+E+QEARRI++LHQPSK
Sbjct  179   GERAYARAEIESARAAVQRVEEAILEHERMSRASGKQDLEELMKEVQEARRIKMLHQPSK  238

Query  850   VMDMEHELRALRIQLNEKSVVSFKLQNELAMSKRTEQNKSQLYRIIGSESVGSILRIQPC  1029
             VMDMEHE+RALRIQL EKS  S  LQ ELA S+R EQ+  QL+ + G+E++GS LRI PC
Sbjct  239   VMDMEHEIRALRIQLAEKSKRSLLLQKELARSRRAEQSIFQLFELDGTEALGSCLRINPC  298

Query  1030  SDEAVDLSKCSIQWYRLSSECSRREPILGADKSVYAPEPIDVGRVLEADIVSNGLKASVT  1209
             SD A +LSKCSIQWYRLSS+  ++E I GA K VYAPEP DVGRVL+A+I+S+G + S++
Sbjct  299   SDNAPELSKCSIQWYRLSSDGGKKELISGATKPVYAPEPFDVGRVLQAEIISDGQQFSLS  358

Query  1210  TIGQIDQAAGLGNYVETLLRKSNTEFSVVIAQMNGRNYSSRSIHSFHVGKMRMKLNKGWI  1389
             T   ID AAGLG+YVE L+RK + EF+V++ Q NG ++ S SIH  HVGKMRMKL KG  
Sbjct  359   TTCPIDPAAGLGSYVEALVRKHDVEFNVIVTQSNGADHPSESIHVLHVGKMRMKLRKGKS  418

Query  1390  TKARDSYSGSMQLCGFRGGGNSAAKSLFWQPRKGQSFVLVFDSERERNGALVVARKHALE  1569
             T A++ YS SMQLCG RGGGN+AA++LFWQ + G SFVL F+S RERN A+++AR+ A +
Sbjct  419   TIAKEYYSTSMQLCGVRGGGNAAAQALFWQAKTGLSFVLAFESARERNAAIMLARRFAFD  478

Query  1570  CNVSIT  1587
             CN+ + 
Sbjct  479   CNIMLA  484



>ref|XP_006411350.1| hypothetical protein EUTSA_v10016526mg [Eutrema salsugineum]
 gb|ESQ52803.1| hypothetical protein EUTSA_v10016526mg [Eutrema salsugineum]
Length=516

 Score =   573 bits (1477),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 305/487 (63%), Positives = 388/487 (80%), Gaps = 3/487 (1%)
 Frame = +1

Query  130   MTKVSPEFVGGEVQMYTFKSVSADVSFASNQFPKYKLGPDFQILEEALLENKGPSLKevv  309
             M+KV PE     V +   + +SADVSFASN FP YKLGPD QI++E   + K PS+K+VV
Sbjct  26    MSKVCPEMEEQRVCVAVVEPISADVSFASNHFPSYKLGPDDQIVDEPEEDEKAPSVKDVV  85

Query  310   eeettRLTEQHKRLSVRDLASKFDKNLSSAAKLANEAKLRDAPSLEGHVLLKKLRDALET  489
             ++ET  L++QHKRLSVRDLA KFDKNL++A KL +EAKL +  SL+GHV+LKKLRDALE+
Sbjct  86    DKETGDLSDQHKRLSVRDLACKFDKNLAAAVKLVDEAKLNEVTSLDGHVMLKKLRDALES  145

Query  490   LKGRLAGRNKEDVEIAIAMVEALAVRLTQKEGDLIQEKFEVNKLVSILKQASEDAKKLVN  669
             ++ R+ GRN+E VE  I+MVEALAV+LTQ EG+LIQEKFEV KL S LKQASEDAKKLVN
Sbjct  146   MRSRMDGRNREAVEKVISMVEALAVKLTQNEGELIQEKFEVKKLASFLKQASEDAKKLVN  205

Query  670   QERSFACAEIESARAVVQRIGEALEEQEINSQVSGKQ--eveelmeeiqeARRIRVLHQP  843
             QE+SFACAEIESARA+V ++G A EEQE+ S+ S  Q   VE L+EE+QEARRIR +HQP
Sbjct  206   QEKSFACAEIESARALVMKLGGAFEEQELCSKASRSQGPNVEMLVEEVQEARRIRRMHQP  265

Query  844   SKVMDMEHELRALRIQLNEKSVVSFKLQNELAMSKRTEQNKSQLYRIIGSESVGSILRIQ  1023
             +KVM M+HEL  ++ Q+ EKS  S KLQ E+A+ KR E +KS  Y + G++S+GS LRI+
Sbjct  266   TKVMGMQHELHDIKSQIQEKSAYSVKLQREIAIIKRAEGSKSCPYVLDGAQSLGSCLRIR  325

Query  1024  PCSDEAVDLSKCSIQWYRLSSECSRREPILGADKSVYAPEPIDVGRVLEADIVSNGLKAS  1203
               SD A D+S CSIQWYR +SE SRRE I GA+ SVYAPEP DV RV++ADI+SNG K +
Sbjct  326   ASSDSASDISTCSIQWYRAASESSRREAISGANGSVYAPEPFDVSRVIQADILSNGQKFT  385

Query  1204  VTTIGQIDQAAGLGNYVETLLRKSNTEFSVVIAQMNGRNYSSRSIHSFHVGKMRMKLNKG  1383
             VTT G I+ A+GL + VE+LLRKSN+EF+V+I+QMNG++++SRS H F VGK R+KL++G
Sbjct  386   VTTDGPINTASGLQSRVESLLRKSNSEFTVIISQMNGQDHASRS-HVFTVGKTRIKLSRG  444

Query  1384  WITKARDSYSGSMQLCGFRGGGNSAAKSLFWQPRKGQSFVLVFDSERERNGALVVARKHA  1563
             WITKARD YS SMQLCG RG  N  AK+LFWQPRKG +F+L F+SE+ERN A+V++RK+A
Sbjct  445   WITKARDIYSTSMQLCGVRGNANVPAKALFWQPRKGLTFLLTFESEQERNAAIVLSRKYA  504

Query  1564  LECNVSI  1584
              +CNV++
Sbjct  505   YDCNVTL  511



>ref|XP_006293991.1| hypothetical protein CARUB_v10022982mg, partial [Capsella rubella]
 gb|EOA26889.1| hypothetical protein CARUB_v10022982mg, partial [Capsella rubella]
Length=510

 Score =   573 bits (1476),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 302/493 (61%), Positives = 395/493 (80%), Gaps = 10/493 (2%)
 Frame = +1

Query  130   MTKVSPE------FVGGEVQMYTFKSVSADVSFASNQFPKYKLGPDFQILEEALLENKGP  291
             MTK+ P+       V  E + +  + +SADVSFASN FP YKLGPD QI++E   + K P
Sbjct  15    MTKLYPKKTEEKRVVNSEEEAFV-EPISADVSFASNHFPSYKLGPDDQIVDEPEEDQKAP  73

Query  292   SLKevveeettRLTEQHKRLSVRDLASKFDKNLSSAAKLANEAKLRDAPSLEGHVLLKKL  471
             S+K+VV++ET  L++QHK+LSVRDLA KFDKNL++A+KL +EAKL +  SLEGHV+LKKL
Sbjct  74    SVKDVVDKETGDLSDQHKQLSVRDLACKFDKNLAAASKLVDEAKLNEVTSLEGHVMLKKL  133

Query  472   RDALETLKGRLAGRNKEDVEIAIAMVEALAVRLTQKEGDLIQEKFEVNKLVSILKQASED  651
             RDALET++GR+ GRN+E+VE AI+MVEALAV+LTQ EG+LIQ+KFEV KL S LK+ASED
Sbjct  134   RDALETVRGRMDGRNREEVEKAISMVEALAVKLTQNEGELIQDKFEVKKLASFLKKASED  193

Query  652   AKKLVNQERSFACAEIESARAVVQRIGEALEEQEINSQVSGKQ--eveelmeeiqeARRI  825
             AKKLVNQE+SFACAEI+SARA+V R+G   +EQE+ S+ S  Q   VE+L+EE+QEARRI
Sbjct  194   AKKLVNQEKSFACAEIDSARALVMRLGGTFQEQELCSKASRDQGPNVEKLVEEVQEARRI  253

Query  826   RVLHQPSKVMDMEHELRALRIQLNEKSVVSFKLQNELAMSKRTEQNKSQLYRIIGSESVG  1005
             + +H+P+KV+ M+HEL  L+ Q+ EKS  S K+Q E+A+ KR E +KS  Y + G++S+G
Sbjct  254   KQMHKPTKVLGMQHELYDLKSQIREKSAYSVKIQREIAIIKRAEGSKSCPYVLDGAQSLG  313

Query  1006  SILRIQPCSDEAVDLSKCSIQWYRLSSECSRREPILGADKSVYAPEPIDVGRVLEADIVS  1185
             S LRI+   D  VD+SKCSIQWYR +SE SRRE I GA+ SVYAPEP DVGRV++ADI+S
Sbjct  314   SCLRIRASPDNGVDISKCSIQWYRAASESSRREAISGANWSVYAPEPFDVGRVIQADILS  373

Query  1186  NGLKASVTTIGQIDQAAGLGNYVETLLRKSNTEFSVVIAQMNGRNYSSRSIHSFHVGKMR  1365
             NG K +VTT G I+ A+GL + VE+LLRKSN+EF+VVI+QMNG++++SRS H F VGK R
Sbjct  374   NGQKFTVTTDGPINTASGLQSRVESLLRKSNSEFTVVISQMNGQDHASRS-HVFTVGKAR  432

Query  1366  MKLNKGWITKARDSYSGSMQLCGFRGGGNSAAKSLFWQPRKGQSFVLVFDSERERNGALV  1545
             +KL++GWITKAR+ YS SMQLCG RG  N+ AK+LFWQ RKG +F+L F+SE+ERN A+V
Sbjct  433   IKLSRGWITKAREIYSTSMQLCGVRGNANAPAKALFWQLRKGSTFLLTFESEQERNVAIV  492

Query  1546  VARKHALECNVSI  1584
             +ARK+A +CNV++
Sbjct  493   LARKYADDCNVTL  505



>ref|XP_009357896.1| PREDICTED: uncharacterized protein LOC103948575 [Pyrus x bretschneideri]
 ref|XP_009357897.1| PREDICTED: uncharacterized protein LOC103948575 [Pyrus x bretschneideri]
Length=494

 Score =   572 bits (1474),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 306/486 (63%), Positives = 387/486 (80%), Gaps = 2/486 (0%)
 Frame = +1

Query  130   MTKVSPEFVGGEVQMYTFKSVSADVSFASNQFPKYKLGPDFQILEEALLENKGPSLKevv  309
             MT+V  +F G  +Q     +VSADV FAS++FP Y++G + QI+E    + K  S+KEVV
Sbjct  1     MTRVGRDF-GDTMQKDAVPAVSADVVFASSRFPNYRIGANNQIVE-GKDDRKVLSMKEVV  58

Query  310   eeettRLTEQHKRLSVRDLASKFDKNLSSAAKLANEAKLRDAPSLEGHVLLKKLRDALET  489
               ET +L EQ  RLSVRDLASKF+K L++AAKL+ EA+LR+A SLE HVLLKKLRDALE+
Sbjct  59    ARETAQLLEQQNRLSVRDLASKFEKGLAAAAKLSEEARLREAASLEKHVLLKKLRDALES  118

Query  490   LKGRLAGRNKEDVEIAIAMVEALAVRLTQKEGDLIQEKFEVNKLVSILKQASEDAKKLVN  669
             LKGR+AGRNK+DV  AI+MVEALAV+LTQ+EG+LIQEK EV KL + LK+ASEDAKKLV+
Sbjct  119   LKGRVAGRNKDDVVDAISMVEALAVQLTQREGELIQEKAEVKKLANFLKKASEDAKKLVD  178

Query  670   QERSFACAEIESARAVVQRIGEALEEQEINSQVSGKQeveelmeeiqeARRIRVLHQPSK  849
             +ER+FA AEIE+ARA VQR+ +AL+EQE  S+ SGKQ++EELM+E+QEARRI++LHQPSK
Sbjct  179   EERAFARAEIENARAAVQRVEKALQEQEQMSRASGKQDLEELMKEVQEARRIKMLHQPSK  238

Query  850   VMDMEHELRALRIQLNEKSVVSFKLQNELAMSKRTEQNKSQLYRIIGSESVGSILRIQPC  1029
             VMDMEHELRALR QL EKS  S +LQ ELAMSKR     S+L+ + G E +GS LRIQPC
Sbjct  239   VMDMEHELRALRAQLTEKSKNSVRLQKELAMSKRGLDKISELFELDGPEVLGSYLRIQPC  298

Query  1030  SDEAVDLSKCSIQWYRLSSECSRREPILGADKSVYAPEPIDVGRVLEADIVSNGLKASVT  1209
             S +A +LSKC IQWYR+SS+  ++E I GA KSVYAPEP DVGRVL+ DI+  G + ++T
Sbjct  299   SGDAPELSKCLIQWYRVSSQGGKKESISGAIKSVYAPEPFDVGRVLQVDIIYEGQRLTLT  358

Query  1210  TIGQIDQAAGLGNYVETLLRKSNTEFSVVIAQMNGRNYSSRSIHSFHVGKMRMKLNKGWI  1389
             T G ID AAGLG+YVE L+RK + EF+VVI QMNG N+ S SIH FHVGKMR+KL KG  
Sbjct  359   TAGPIDPAAGLGSYVEALVRKHDIEFNVVITQMNGVNHPSESIHVFHVGKMRIKLCKGKT  418

Query  1390  TKARDSYSGSMQLCGFRGGGNSAAKSLFWQPRKGQSFVLVFDSERERNGALVVARKHALE  1569
             T A++ +S SMQLCG RGGGN+AA++LFWQ ++G S+VL F+SERERN A+++AR+ A +
Sbjct  419   TIAKEYFSPSMQLCGVRGGGNAAAQALFWQAKQGLSYVLAFESERERNAAIMLARRFAFD  478

Query  1570  CNVSIT  1587
             CN+ + 
Sbjct  479   CNIMLA  484



>ref|XP_006293992.1| hypothetical protein CARUB_v10022982mg, partial [Capsella rubella]
 gb|EOA26890.1| hypothetical protein CARUB_v10022982mg, partial [Capsella rubella]
Length=529

 Score =   572 bits (1475),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 302/493 (61%), Positives = 395/493 (80%), Gaps = 10/493 (2%)
 Frame = +1

Query  130   MTKVSPE------FVGGEVQMYTFKSVSADVSFASNQFPKYKLGPDFQILEEALLENKGP  291
             MTK+ P+       V  E + +  + +SADVSFASN FP YKLGPD QI++E   + K P
Sbjct  34    MTKLYPKKTEEKRVVNSEEEAFV-EPISADVSFASNHFPSYKLGPDDQIVDEPEEDQKAP  92

Query  292   SLKevveeettRLTEQHKRLSVRDLASKFDKNLSSAAKLANEAKLRDAPSLEGHVLLKKL  471
             S+K+VV++ET  L++QHK+LSVRDLA KFDKNL++A+KL +EAKL +  SLEGHV+LKKL
Sbjct  93    SVKDVVDKETGDLSDQHKQLSVRDLACKFDKNLAAASKLVDEAKLNEVTSLEGHVMLKKL  152

Query  472   RDALETLKGRLAGRNKEDVEIAIAMVEALAVRLTQKEGDLIQEKFEVNKLVSILKQASED  651
             RDALET++GR+ GRN+E+VE AI+MVEALAV+LTQ EG+LIQ+KFEV KL S LK+ASED
Sbjct  153   RDALETVRGRMDGRNREEVEKAISMVEALAVKLTQNEGELIQDKFEVKKLASFLKKASED  212

Query  652   AKKLVNQERSFACAEIESARAVVQRIGEALEEQEINSQVSGKQ--eveelmeeiqeARRI  825
             AKKLVNQE+SFACAEI+SARA+V R+G   +EQE+ S+ S  Q   VE+L+EE+QEARRI
Sbjct  213   AKKLVNQEKSFACAEIDSARALVMRLGGTFQEQELCSKASRDQGPNVEKLVEEVQEARRI  272

Query  826   RVLHQPSKVMDMEHELRALRIQLNEKSVVSFKLQNELAMSKRTEQNKSQLYRIIGSESVG  1005
             + +H+P+KV+ M+HEL  L+ Q+ EKS  S K+Q E+A+ KR E +KS  Y + G++S+G
Sbjct  273   KQMHKPTKVLGMQHELYDLKSQIREKSAYSVKIQREIAIIKRAEGSKSCPYVLDGAQSLG  332

Query  1006  SILRIQPCSDEAVDLSKCSIQWYRLSSECSRREPILGADKSVYAPEPIDVGRVLEADIVS  1185
             S LRI+   D  VD+SKCSIQWYR +SE SRRE I GA+ SVYAPEP DVGRV++ADI+S
Sbjct  333   SCLRIRASPDNGVDISKCSIQWYRAASESSRREAISGANWSVYAPEPFDVGRVIQADILS  392

Query  1186  NGLKASVTTIGQIDQAAGLGNYVETLLRKSNTEFSVVIAQMNGRNYSSRSIHSFHVGKMR  1365
             NG K +VTT G I+ A+GL + VE+LLRKSN+EF+VVI+QMNG++++SRS H F VGK R
Sbjct  393   NGQKFTVTTDGPINTASGLQSRVESLLRKSNSEFTVVISQMNGQDHASRS-HVFTVGKAR  451

Query  1366  MKLNKGWITKARDSYSGSMQLCGFRGGGNSAAKSLFWQPRKGQSFVLVFDSERERNGALV  1545
             +KL++GWITKAR+ YS SMQLCG RG  N+ AK+LFWQ RKG +F+L F+SE+ERN A+V
Sbjct  452   IKLSRGWITKAREIYSTSMQLCGVRGNANAPAKALFWQLRKGSTFLLTFESEQERNVAIV  511

Query  1546  VARKHALECNVSI  1584
             +ARK+A +CNV++
Sbjct  512   LARKYADDCNVTL  524



>gb|KHN44993.1| hypothetical protein glysoja_023565 [Glycine soja]
Length=493

 Score =   570 bits (1470),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 302/483 (63%), Positives = 385/483 (80%), Gaps = 3/483 (1%)
 Frame = +1

Query  130   MTKVSPEFVGGEVQMYTFKSVSADVSFASNQFPKYKLGPDFQILEEALLENKGPSLKevv  309
             MT+++ +F G  +Q      VSADV FAS +FP YK+G + QI+E    + K  S+KEVV
Sbjct  1     MTRMTHDF-GDTMQKDAVPVVSADVIFASLRFPNYKIGVNNQIMETKD-DPKVLSMKEVV  58

Query  310   eeettRLTEQHKRLSVRDLASKFDKNLSSAAKLANEAKLRDAPSLEGHVLLKKLRDALET  489
               ET +L +Q KR+SVRDLASKF+K L++AAKL+ EA+LR+A SLE HVLLKKLRDAL++
Sbjct  59    ARETAQLLDQQKRMSVRDLASKFEKGLAAAAKLSEEARLREAASLEKHVLLKKLRDALQS  118

Query  490   LKGRLAGRNKEDVEIAIAMVEALAVRLTQKEGDLIQEKFEVNKLVSILKQASEDAKKLVN  669
             LKGR+AGRNK+DV  AIAMVEALAV+LTQ+EG+LIQEK EV KL + LKQASEDAKKLVN
Sbjct  119   LKGRVAGRNKDDVAEAIAMVEALAVQLTQREGELIQEKSEVKKLTNFLKQASEDAKKLVN  178

Query  670   QERSFACAEIESARAVVQRIGEALEEQEINSQVSGKQeveelmeeiqeARRIRVLHQPSK  849
             +ER+FA  EIE+ARA VQR+ EAL+E E  SQ SGKQ++E+LM+E+QEARRI++LHQPSK
Sbjct  179   EERAFARFEIENARAAVQRVEEALQEHERMSQASGKQDLEQLMKEVQEARRIKMLHQPSK  238

Query  850   VMDMEHELRALRIQLNEKSVVSFKLQNELAMSKRTEQNKSQLYRIIGSESVGSILRIQPC  1029
             VMDMEHELRALR QL EKS +  +LQ ELA +K+ E+N   LY + G+E++GS L+IQPC
Sbjct  239   VMDMEHELRALRAQLAEKSRLYLRLQKELARTKKGEENAPHLYELEGTETLGSYLQIQPC  298

Query  1030  SDEAVDLSKCSIQWYRLSSECSRREPILGADKSVYAPEPIDVGRVLEADIVSNGLKASVT  1209
             SD   +LSKCSIQWYR+SSE +++E I GA KSVYAPEP DVGRVL+ DI+S G + +++
Sbjct  299   SDNGPELSKCSIQWYRVSSEGAKKELISGATKSVYAPEPFDVGRVLQVDIISEGQQITLS  358

Query  1210  TIGQIDQAAGLGNYVETLLRKSNTEFSVVIAQMNGRNYSSRSIHSFHVGKMRMKLNKGWI  1389
             T G ID AAGLG YVE L+RK +TEF+VV+ Q    ++ + SIH  HVGKMRMKL KG  
Sbjct  359   TTGPIDPAAGLGTYVEALVRKHDTEFNVVVTQTVS-DHPNESIHVLHVGKMRMKLCKGNT  417

Query  1390  TKARDSYSGSMQLCGFRGGGNSAAKSLFWQPRKGQSFVLVFDSERERNGALVVARKHALE  1569
             T A++ YS SMQLCG RGGGN+AA+++FWQP++G SFVL F+SERERN A+++AR+ A +
Sbjct  418   TIAKEYYSSSMQLCGVRGGGNAAAQAVFWQPKQGLSFVLAFESERERNAAIMLARRFAFD  477

Query  1570  CNV  1578
             CN+
Sbjct  478   CNI  480



>gb|ACU19354.1| unknown [Glycine max]
Length=494

 Score =   570 bits (1470),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 298/485 (61%), Positives = 384/485 (79%), Gaps = 2/485 (0%)
 Frame = +1

Query  130   MTKVSPEFVGGEVQMYTFKSVSADVSFASNQFPKYKLGPDFQILEEALLENKGPSLKevv  309
             MT+++ +F G  +Q     +VS+DV FAS++FP Y++G + QI+E    + K  S+KEVV
Sbjct  1     MTRLTRDF-GDTMQRDAVPAVSSDVVFASSRFPNYRIGANNQIIETKD-DPKVLSMKEVV  58

Query  310   eeettRLTEQHKRLSVRDLASKFDKNLSSAAKLANEAKLRDAPSLEGHVLLKKLRDALET  489
               ET +L EQ  RLSVRDLASKF+K L++AAKL+ EA+LR+A SLE HVLLKKLRDALE+
Sbjct  59    ARETAQLLEQLNRLSVRDLASKFEKGLAAAAKLSEEARLREAASLEKHVLLKKLRDALES  118

Query  490   LKGRLAGRNKEDVEIAIAMVEALAVRLTQKEGDLIQEKFEVNKLVSILKQASEDAKKLVN  669
             LKGR+AGRNK+DVE AIA+VEALAV+LTQ+EG+LIQEK EV KL + LKQASEDAKKLV+
Sbjct  119   LKGRVAGRNKDDVEEAIAIVEALAVQLTQREGELIQEKAEVKKLANFLKQASEDAKKLVD  178

Query  670   QERSFACAEIESARAVVQRIGEALEEQEINSQVSGKQeveelmeeiqeARRIRVLHQPSK  849
             +ER+FA AEIE ARA VQR+ EAL+E E  SQ SGKQ+ E+LM E+QEARRI++LHQPSK
Sbjct  179   EERAFARAEIEDARAAVQRVEEALQEHERISQASGKQDQEQLMREVQEARRIKMLHQPSK  238

Query  850   VMDMEHELRALRIQLNEKSVVSFKLQNELAMSKRTEQNKSQLYRIIGSESVGSILRIQPC  1029
             VMDMEHELRALR QL EK+    +LQ EL  +K+  +N   LY + G+E++GS L+IQPC
Sbjct  239   VMDMEHELRALRSQLAEKTRQYLRLQKELTRTKKGGENVPHLYELEGNETLGSYLQIQPC  298

Query  1030  SDEAVDLSKCSIQWYRLSSECSRREPILGADKSVYAPEPIDVGRVLEADIVSNGLKASVT  1209
             SD A ++SKCSIQWYR+SS+ +++E I GA KSVYAPEP DVGR+L+ DI+S     +++
Sbjct  299   SDNAPEVSKCSIQWYRVSSDGAKKELISGATKSVYAPEPFDVGRILQVDIISESEHVTLS  358

Query  1210  TIGQIDQAAGLGNYVETLLRKSNTEFSVVIAQMNGRNYSSRSIHSFHVGKMRMKLNKGWI  1389
             T G ID AAGLG YVE L+RK +TEF+VV+ QMNG ++ + SIH  HVGKMR+KL KG  
Sbjct  359   TAGPIDPAAGLGTYVEALVRKHDTEFNVVVTQMNGSHHPTESIHVLHVGKMRIKLCKGKT  418

Query  1390  TKARDSYSGSMQLCGFRGGGNSAAKSLFWQPRKGQSFVLVFDSERERNGALVVARKHALE  1569
             T A++ YS SMQLCG RGGGN+AA++LFWQP++G  FVL F+SERERN A+++AR+ A +
Sbjct  419   TIAKEYYSSSMQLCGVRGGGNAAAQALFWQPKQGHFFVLAFESERERNAAIMLARRFAFD  478

Query  1570  CNVSI  1584
             CN+ +
Sbjct  479   CNIML  483



>ref|XP_003542411.1| PREDICTED: uncharacterized protein LOC100780477 [Glycine max]
Length=493

 Score =   569 bits (1467),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 301/483 (62%), Positives = 385/483 (80%), Gaps = 3/483 (1%)
 Frame = +1

Query  130   MTKVSPEFVGGEVQMYTFKSVSADVSFASNQFPKYKLGPDFQILEEALLENKGPSLKevv  309
             MT+++ +F G  +Q      VSADV FAS +FP YK+G + QI+E    + K  S+KEVV
Sbjct  1     MTRMTHDF-GDTMQKDAVPVVSADVIFASLRFPNYKIGVNNQIMETKD-DPKVLSMKEVV  58

Query  310   eeettRLTEQHKRLSVRDLASKFDKNLSSAAKLANEAKLRDAPSLEGHVLLKKLRDALET  489
               ET +L +Q KR+SVRDLASKF+K L++AAKL+ EA+LR+A SLE HVLLKKLRDAL++
Sbjct  59    ARETAQLLDQQKRMSVRDLASKFEKGLAAAAKLSEEARLREAASLEKHVLLKKLRDALQS  118

Query  490   LKGRLAGRNKEDVEIAIAMVEALAVRLTQKEGDLIQEKFEVNKLVSILKQASEDAKKLVN  669
             LKGR+AGRNK+DV  AIAMVEALAV+LTQ+EG+LIQEK EV KL + LKQASEDAKKLVN
Sbjct  119   LKGRVAGRNKDDVAEAIAMVEALAVQLTQREGELIQEKSEVKKLTNFLKQASEDAKKLVN  178

Query  670   QERSFACAEIESARAVVQRIGEALEEQEINSQVSGKQeveelmeeiqeARRIRVLHQPSK  849
             +ER+FA  EIE+ARA VQR+ EAL+E E  SQ SGKQ++E+LM+E+QEARRI++LHQPSK
Sbjct  179   EERAFARFEIENARAAVQRVEEALQEHERMSQASGKQDLEQLMKEVQEARRIKMLHQPSK  238

Query  850   VMDMEHELRALRIQLNEKSVVSFKLQNELAMSKRTEQNKSQLYRIIGSESVGSILRIQPC  1029
             VMDMEHELRALR QL EKS +  +LQ ELA +K+ E+N   LY + G+E++GS L+IQPC
Sbjct  239   VMDMEHELRALRAQLAEKSRLYLRLQKELARTKKGEENAPHLYELEGTETLGSYLQIQPC  298

Query  1030  SDEAVDLSKCSIQWYRLSSECSRREPILGADKSVYAPEPIDVGRVLEADIVSNGLKASVT  1209
             SD   +LS+CSIQWYR+SSE +++E I GA KSVYAPEP DVGRVL+ DI+S G + +++
Sbjct  299   SDNGPELSECSIQWYRVSSEGAKKELISGATKSVYAPEPFDVGRVLQVDIISEGQQITLS  358

Query  1210  TIGQIDQAAGLGNYVETLLRKSNTEFSVVIAQMNGRNYSSRSIHSFHVGKMRMKLNKGWI  1389
             T G ID AAGLG YVE L+RK +TEF+VV+ Q    ++ + SIH  HVGKMRMKL KG  
Sbjct  359   TTGPIDPAAGLGTYVEALVRKHDTEFNVVVTQTVS-DHPNESIHVLHVGKMRMKLCKGNT  417

Query  1390  TKARDSYSGSMQLCGFRGGGNSAAKSLFWQPRKGQSFVLVFDSERERNGALVVARKHALE  1569
             T A++ YS SMQLCG RGGGN+AA+++FWQP++G SFVL F+SERERN A+++AR+ A +
Sbjct  418   TIAKEYYSSSMQLCGVRGGGNAAAQAVFWQPKQGLSFVLAFESERERNAAIMLARRFAFD  477

Query  1570  CNV  1578
             CN+
Sbjct  478   CNI  480



>emb|CDY04465.1| BnaA07g12910D [Brassica napus]
Length=511

 Score =   569 bits (1467),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 298/488 (61%), Positives = 393/488 (81%), Gaps = 2/488 (0%)
 Frame = +1

Query  121   TGKMTKVSPEFVGGEVQMYTFKSVSADVSFASNQFPKYKLGPDFQILEEALLENKGPSLK  300
             +G MT+V+ +F    +      +VSADV FAS++FP Y++G + QI + A  + K  S+K
Sbjct  14    SGTMTRVTRDFRDS-LHKEVVPAVSADVRFASSRFPNYRIGANDQIFD-AKDDPKVLSMK  71

Query  301   evveeettRLTEQHKRLSVRDLASKFDKNLSSAAKLANEAKLRDAPSLEGHVLLKKLRDA  480
             EVV  ET +L +Q KR+SVRDLA+KF+K L++AAKL+ EAKL++A SLE HVLLKKLRDA
Sbjct  72    EVVARETAQLMDQQKRMSVRDLANKFEKGLAAAAKLSEEAKLKEATSLEKHVLLKKLRDA  131

Query  481   LETLKGRLAGRNKEDVEIAIAMVEALAVRLTQKEGDLIQEKFEVNKLVSILKQASEDAKK  660
             LE+L+GR+AGRNK+DVE AIAMVEALAV+LTQ+EG+L  EK EV KL S LKQASEDAKK
Sbjct  132   LESLRGRVAGRNKDDVEEAIAMVEALAVQLTQREGELFIEKAEVKKLASFLKQASEDAKK  191

Query  661   LVNQERSFACAEIESARAVVQRIGEALEEQEINSQVSGKQeveelmeeiqeARRIRVLHQ  840
             +V++ER+FA AEIESARA VQR+ EAL E E  S+ SGKQ++E+LM+E+QEARRI++LHQ
Sbjct  192   IVDEERAFARAEIESARAAVQRVEEALREHEQMSRASGKQDMEDLMKEVQEARRIKMLHQ  251

Query  841   PSKVMDMEHELRALRIQLNEKSVVSFKLQNELAMSKRTEQNKSQLYRIIGSESVGSILRI  1020
             PSKVMDME+ELRALR QL EKS    +L+ +LAM +++E+N S LY I G+E++GS LR+
Sbjct  252   PSKVMDMEYELRALRNQLAEKSKHFLQLKKKLAMCRKSEENISLLYEIDGNEALGSSLRV  311

Query  1021  QPCSDEAVDLSKCSIQWYRLSSECSRREPILGADKSVYAPEPIDVGRVLEADIVSNGLKA  1200
             +PCSDEA DLSKC+IQWYR SS+ S++E I GA KSVYAPEP DVGR L ADI+ NG   
Sbjct  312   RPCSDEAPDLSKCTIQWYRSSSDDSKKELISGATKSVYAPEPFDVGRALHADIIYNGHTL  371

Query  1201  SVTTIGQIDQAAGLGNYVETLLRKSNTEFSVVIAQMNGRNYSSRSIHSFHVGKMRMKLNK  1380
             S++T+G+ID AAGLG+YVE L+RK + +F+VV+ QM+G +++S SIH FHVGKMR+KL K
Sbjct  372   SLSTVGKIDPAAGLGSYVEALVRKHDVDFNVVVTQMSGEDHTSESIHLFHVGKMRIKLCK  431

Query  1381  GWITKARDSYSGSMQLCGFRGGGNSAAKSLFWQPRKGQSFVLVFDSERERNGALVVARKH  1560
             G    A++ YS +MQLCG RGGGN+AA++++WQ +KG SFV+ F+SERERN A+++AR+ 
Sbjct  432   GKTVIAKEYYSSAMQLCGVRGGGNAAAQAVYWQAKKGVSFVVAFESERERNAAIMLARRF  491

Query  1561  ALECNVSI  1584
             A +CNV++
Sbjct  492   ACDCNVTL  499



>emb|CDX67649.1| BnaA07g16890D [Brassica napus]
Length=491

 Score =   568 bits (1464),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 299/488 (61%), Positives = 384/488 (79%), Gaps = 5/488 (1%)
 Frame = +1

Query  130   MTKVSPEFVGGEVQMYTFKSVSADVSFASNQFPKYKLGPDFQILEEALLENKGPSLKevv  309
             MTKV PE  G         +VS DVSFASN FP YKLGPD +I++E   + KGPS+KE V
Sbjct  1     MTKVCPE-TGERTLQEPVLTVSTDVSFASNHFPTYKLGPDNEIVDEPKEDQKGPSMKETV  59

Query  310   eeettRLTEQHKRLSVRDLASKFDKNLSSAAKLANEAKLRDAPSLEGHVLLKKLRDALET  489
             EEE+  L++QHKRLSVRDLASKFDK L++A  LA+EAKL++  SLEGHV+LKKLRDALE 
Sbjct  60    EEESQLLSDQHKRLSVRDLASKFDKKLAAAVSLADEAKLKEVASLEGHVMLKKLRDALEY  119

Query  490   LKGRLAGRNKEDVEIAIAMVEALAVRLTQKEGDLIQEKFEVNKLVSILKQASEDAKKLVN  669
             ++GR  G+NKEDVE AI+MVEALAV+LTQ EG+LIQEKFEV KL + LKQ SEDAKKLVN
Sbjct  120   MRGRTDGQNKEDVEKAISMVEALAVKLTQNEGELIQEKFEVKKLGNFLKQTSEDAKKLVN  179

Query  670   QERSFACAEIESARAVVQRIGEALEEQEINSQVSGKQ--eveelmeeiqeARRIRVLHQP  843
              E+SFACAEIESARAVV R+GEA EEQE +S+ S  Q  +VE+++EE+QEAR+I+ +H P
Sbjct  180   HEKSFACAEIESARAVVLRLGEAFEEQERSSEASRAQGPDVEKMVEEVQEARQIKRMHHP  239

Query  844   SKVMDMEHELRALRIQLNEKSVVSFKLQNELAMSKRTEQNKSQLYRIIGSESVGSILRIQ  1023
             +KVM M+HEL  LR ++ EK + S +L  E+A  KR E++KS  + + G++S+GS L+I+
Sbjct  240   TKVMGMQHELHGLRSRIQEKYMNSVRLHQEIATIKRAEESKSCPFVLEGTQSLGSCLQIR  299

Query  1024  -PCSDEAVDLSKCSIQWYRLSSECSRREPILGADKSVYAPEPIDVGRVLEADIVSNGLKA  1200
                 D A++LS CSIQWYR + E SRRE I GA++SVYAPEP DVGR+L+ADI+SNG K 
Sbjct  300   VNAPDNAIELSNCSIQWYRAACETSRREAISGANQSVYAPEPFDVGRILQADILSNGHKV  359

Query  1201  SVTTIGQIDQAAGLGNYVETLLRKSNTEFSVVIAQMNGRNYSSRSIHSFHVGKMRMKLNK  1380
             +VTT G ID  AGL + +++L++KSN+EFSVVI+QMNG++Y+SRS H F VGK R+KL++
Sbjct  360   TVTTDGPIDPDAGLQSRIDSLMKKSNSEFSVVISQMNGQDYASRS-HVFTVGKTRIKLSR  418

Query  1381  GWITKARDSYSGSMQLCGFRGGGNSAAKSLFWQPRKGQSFVLVFDSERERNGALVVARKH  1560
             GWITKAR+ YS SMQLCG RG   + AK+LFWQPRK  +F L F+SE+ERN A+ +ARK+
Sbjct  419   GWITKAREIYSTSMQLCGVRGNIKAPAKALFWQPRKSLTFTLTFESEQERNTAIALARKY  478

Query  1561  ALECNVSI  1584
             A +CNV++
Sbjct  479   AFDCNVTL  486



>ref|XP_010505839.1| PREDICTED: uncharacterized protein LOC104782569 isoform X2 [Camelina 
sativa]
Length=494

 Score =   568 bits (1464),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 298/467 (64%), Positives = 385/467 (82%), Gaps = 4/467 (1%)
 Frame = +1

Query  190   VSADVSFASNQFPKYKLGPDFQILEEALLENKGPSLKevveeettRLTEQHKRLSVRDLA  369
             +SADVSFA N FP YKLGPD QI++E   ++KG S+K+VV++E + L++QHK+LSVRDLA
Sbjct  25    ISADVSFAFNHFPSYKLGPDDQIVDEPEDDSKGLSVKDVVDKEISDLSDQHKQLSVRDLA  84

Query  370   SKFDKNLSSAAKLANEAKLRDAPSLEGHVLLKKLRDALETLKGRLAGRNKEDVEIAIAMV  549
              KFDKNL++A+KL +EAKL +  SLEGHV+LKKLRDALET++GR+ GRN+E+VE AI+MV
Sbjct  85    CKFDKNLAAASKLVDEAKLNEVTSLEGHVMLKKLRDALETVRGRMDGRNREEVEKAISMV  144

Query  550   EALAVRLTQKEGDLIQEKFEVNKLVSILKQASEDAKKLVNQERSFACAEIESARAVVQRI  729
             EALAV+LTQ EG+LIQ+KFEV KL S LK+ASEDAKKLVNQE+SFACAEI+SARA+V R+
Sbjct  145   EALAVKLTQNEGELIQDKFEVKKLASFLKKASEDAKKLVNQEKSFACAEIDSARALVMRL  204

Query  730   GEALEEQEINSQVSGKQ--eveelmeeiqeARRIRVLHQPSKVMDMEHELRALRIQLNEK  903
             G   EEQE+ S+ S +Q   VE+L+EE+QEARRI+ +H+P+KV+ M+HEL  L+ Q+ EK
Sbjct  205   GGTFEEQELCSKASREQGPNVEKLVEEVQEARRIKRMHKPTKVIGMQHELYDLKSQIREK  264

Query  904   SVVSFKLQNELAMSKRTEQNKSQLYRIIGSESVGSILRIQPCSDEAVDLSKCSIQWYRLS  1083
             S  S KLQ E+A+ KR E +KS  Y + G++S+GS LRI+  SD  VD+SKCSIQWYR +
Sbjct  265   SAYSVKLQREIAIIKRAEGSKSCPYVLDGAQSLGSCLRIR-ASDSGVDISKCSIQWYRAA  323

Query  1084  SECSRREPILGADKSVYAPEPIDVGRVLEADIVSNGLKASVTTIGQIDQAAGLGNYVETL  1263
             SE SRRE I GA+ SVYAPEP DVGRV++ADI+SNG K +VTT G I+ AAGL + VE+L
Sbjct  324   SESSRREAISGANWSVYAPEPFDVGRVIQADIISNGQKFTVTTDGPINTAAGLQSRVESL  383

Query  1264  LRKSNTEFSVVIAQMNGRNYSSRSIHSFHVGKMRMKLNKGWITKARDSYSGSMQLCGFRG  1443
             LRKSN+EF+VVI+QMNG++++SRS H F +GK R+KL++GWITKAR+ YS SMQLCG RG
Sbjct  384   LRKSNSEFTVVISQMNGQDHTSRS-HIFTIGKARIKLSRGWITKAREIYSTSMQLCGVRG  442

Query  1444  GGNSAAKSLFWQPRKGQSFVLVFDSERERNGALVVARKHALECNVSI  1584
               N  AK+LFWQ RKG +F+L F+SE+ERN A+V+ARK+A ECNV++
Sbjct  443   NANLPAKALFWQLRKGLTFLLTFESEQERNAAIVLARKYADECNVTL  489



>ref|XP_009103557.1| PREDICTED: plectin [Brassica rapa]
Length=495

 Score =   568 bits (1463),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 297/486 (61%), Positives = 391/486 (80%), Gaps = 2/486 (0%)
 Frame = +1

Query  130   MTKVSPEFVGGEVQMYTFKSVSADVSFASNQFPKYKLGPDFQILEEALLENKGPSLKevv  309
             MT+V+ +F    +      +VSADV FAS++FP Y++G + QI + A  + K  S+KEVV
Sbjct  1     MTRVTRDFRDS-LHKEVVPAVSADVRFASSRFPNYRIGANDQIFD-AKDDPKVLSMKEVV  58

Query  310   eeettRLTEQHKRLSVRDLASKFDKNLSSAAKLANEAKLRDAPSLEGHVLLKKLRDALET  489
               ET +L +Q KR+SVRDLA+KF+K L++AAKL+ EAKL++A SLE HVLLKKLRDALE+
Sbjct  59    ARETAQLMDQQKRMSVRDLANKFEKGLAAAAKLSEEAKLKEATSLEKHVLLKKLRDALES  118

Query  490   LKGRLAGRNKEDVEIAIAMVEALAVRLTQKEGDLIQEKFEVNKLVSILKQASEDAKKLVN  669
             L+GR+AGRNK+DVE AIAMVEALAV+LTQ+EG+L  EK EV KL S LKQASEDAKK+V+
Sbjct  119   LRGRVAGRNKDDVEEAIAMVEALAVQLTQREGELFIEKAEVKKLASFLKQASEDAKKIVD  178

Query  670   QERSFACAEIESARAVVQRIGEALEEQEINSQVSGKQeveelmeeiqeARRIRVLHQPSK  849
             +ER+FA AEIESARA VQR+ EAL E E  S+ SGKQ++E+LM+E+QEARRI++LHQPSK
Sbjct  179   EERAFARAEIESARAAVQRVEEALREHEQMSRASGKQDMEDLMKEVQEARRIKMLHQPSK  238

Query  850   VMDMEHELRALRIQLNEKSVVSFKLQNELAMSKRTEQNKSQLYRIIGSESVGSILRIQPC  1029
             VMDME+ELRALR QL EKS    +L+ +LAM +++E+N S LY I G+E++GS LR++PC
Sbjct  239   VMDMEYELRALRNQLAEKSKHFLQLKKKLAMCRKSEENVSLLYEIDGNEALGSSLRVRPC  298

Query  1030  SDEAVDLSKCSIQWYRLSSECSRREPILGADKSVYAPEPIDVGRVLEADIVSNGLKASVT  1209
             SDEA DLSKC+IQWYR SS+ S++E I GA KSVYAPEP DVGR L ADI+ NG   S++
Sbjct  299   SDEAPDLSKCTIQWYRSSSDDSKKELISGATKSVYAPEPFDVGRALHADIIYNGHTLSLS  358

Query  1210  TIGQIDQAAGLGNYVETLLRKSNTEFSVVIAQMNGRNYSSRSIHSFHVGKMRMKLNKGWI  1389
             T+G+ID AAGLG+YVE L+RK + +F+VV+ QM+G +++S SIH FHVGKMR+KL KG  
Sbjct  359   TVGKIDPAAGLGSYVEALVRKHDVDFNVVVTQMSGEDHTSESIHLFHVGKMRIKLCKGKT  418

Query  1390  TKARDSYSGSMQLCGFRGGGNSAAKSLFWQPRKGQSFVLVFDSERERNGALVVARKHALE  1569
               A++ YS +MQLCG RGGGN+AA++++WQ +KG SFV+ F+SERERN A+++AR+ A +
Sbjct  419   VIAKEYYSSAMQLCGVRGGGNAAAQAVYWQAKKGVSFVVAFESERERNAAIMLARRFACD  478

Query  1570  CNVSIT  1587
             CNV++ 
Sbjct  479   CNVTLA  484



>ref|XP_006290430.1| hypothetical protein CARUB_v10019330mg [Capsella rubella]
 gb|EOA23328.1| hypothetical protein CARUB_v10019330mg [Capsella rubella]
Length=487

 Score =   567 bits (1461),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 302/489 (62%), Positives = 385/489 (79%), Gaps = 9/489 (2%)
 Frame = +1

Query  130   MTKVSPEFVGGEVQMYTFKSVSADVSFASNQFPKYKLGPDFQILEEALLENKGPSLKevv  309
             MTKV PE +  E    +   VSADVSFAS+ FP YKLGPD QI+EE   ++KGPS+KE V
Sbjct  1     MTKVCPE-IEEETLPKSAVPVSADVSFASDHFPTYKLGPDNQIIEEPKEDDKGPSVKETV  59

Query  310   eeettRLTEQHKRLSVRDLASKFDKNLSSAAKLANEAKLRDAPSLEGHVLLKKLRDALET  489
             ++E+  L++QHKRLSVRDLASKFDKNL++A  LA+EAKLR+  SLEGHV+LKKLRDALE 
Sbjct  60    QKESELLSDQHKRLSVRDLASKFDKNLAAAVSLADEAKLREVASLEGHVMLKKLRDALEY  119

Query  490   LKGRLAGRNKEDVEIAIAMVEALAVRLTQKEGDLIQEKFEVNKLVSILKQASEDAKKLVN  669
             ++GR  G+NKEDVE AI+MVEALAV+LTQ EG+LIQEKFEV KL + LKQ SEDAKKLVN
Sbjct  120   MRGRTDGQNKEDVETAISMVEALAVKLTQNEGELIQEKFEVKKLGNFLKQTSEDAKKLVN  179

Query  670   QERSFACAEIESARAVVQRIGEALEEQEINSQVSGKQ--eveelmeeiqeARRIRVLHQP  843
             QE+SFACAEIE+ARAVV ++GEA EEQE  S+ S  Q  +VE+L++E+QEAR+I+ +H P
Sbjct  180   QEKSFACAEIETARAVVLKLGEAFEEQERISEASRAQGPDVEKLVKEVQEARQIKRMHHP  239

Query  844   SKVMDMEHELRALRIQLNEKSVVSFKLQNELAMSKRTEQNKSQLYRIIGSESVGSILRIQ  1023
             +KVM M+HEL  LR ++ EK + S KL  E+A+ KR E++KS  + + G++S+GS LRI 
Sbjct  240   TKVMGMQHELHGLRNRIQEKYMNSVKLHKEIAIIKRVEESKSCPFVLEGTQSLGSCLRI-  298

Query  1024  PCS---DEAVDLSKCSIQWYRLSSECSRREPILGADKSVYAPEPIDVGRVLEADIVSNGL  1194
              C    + A DLS CSIQWYR + E SRRE I GA +S+YAPEP DVGR+L+ADI+SNG 
Sbjct  299   -CINGLENAPDLSNCSIQWYRAACETSRREAISGAIQSIYAPEPFDVGRILQADILSNGQ  357

Query  1195  KASVTTIGQIDQAAGLGNYVETLLRKSNTEFSVVIAQMNGRNYSSRSIHSFHVGKMRMKL  1374
             K +VTT   +D  +GL + VETL+RKSN+EFSVVI+QMNG++Y+SRS H F +GK R+KL
Sbjct  358   KFTVTTDDPVDPDSGLQSRVETLMRKSNSEFSVVISQMNGQDYASRS-HIFTIGKTRIKL  416

Query  1375  NKGWITKARDSYSGSMQLCGFRGGGNSAAKSLFWQPRKGQSFVLVFDSERERNGALVVAR  1554
             ++GWI+KAR+ YS SMQLCG R    +  K+LFWQPRK  SF+L F+SE+ERN A+V+AR
Sbjct  417   SRGWISKAREIYSTSMQLCGVRSNIKTPTKALFWQPRKSLSFILTFESEQERNAAIVLAR  476

Query  1555  KHALECNVS  1581
             K+A +CNVS
Sbjct  477   KYAFDCNVS  485



>ref|XP_010508801.1| PREDICTED: uncharacterized protein LOC104785313 isoform X2 [Camelina 
sativa]
Length=496

 Score =   567 bits (1462),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 298/467 (64%), Positives = 383/467 (82%), Gaps = 3/467 (1%)
 Frame = +1

Query  190   VSADVSFASNQFPKYKLGPDFQILEEALLENKGPSLKevveeettRLTEQHKRLSVRDLA  369
             +SADVSFA N FP YKLGPD QI++E   ++KG S+K+VV++E   L++QH +LSVRDLA
Sbjct  26    ISADVSFAFNHFPSYKLGPDDQIVDEPEDDSKGLSVKDVVDKEIGDLSDQHMQLSVRDLA  85

Query  370   SKFDKNLSSAAKLANEAKLRDAPSLEGHVLLKKLRDALETLKGRLAGRNKEDVEIAIAMV  549
              KFDKNL++A+KL +EAKL +  SLEGHV+LKKLRDALET++GR+ GRN+E+VE AI+MV
Sbjct  86    CKFDKNLAAASKLVDEAKLNEVTSLEGHVMLKKLRDALETVRGRMDGRNREEVEKAISMV  145

Query  550   EALAVRLTQKEGDLIQEKFEVNKLVSILKQASEDAKKLVNQERSFACAEIESARAVVQRI  729
             EALAV+LTQ EG+LIQ+KFEV KL S LK+ASEDAKKLVNQE+SFACAEI+SARA+V R+
Sbjct  146   EALAVKLTQNEGELIQDKFEVKKLASFLKKASEDAKKLVNQEKSFACAEIDSARALVMRL  205

Query  730   GEALEEQEINSQVSGKQ--eveelmeeiqeARRIRVLHQPSKVMDMEHELRALRIQLNEK  903
             G   EEQE++S+ S +Q   VE+L+EE+QEARRI+ +H+P+KV+ M+HEL  L+ Q+ EK
Sbjct  206   GGTFEEQELSSKASREQGPNVEKLVEEVQEARRIKRMHKPTKVIGMQHELYDLKSQIREK  265

Query  904   SVVSFKLQNELAMSKRTEQNKSQLYRIIGSESVGSILRIQPCSDEAVDLSKCSIQWYRLS  1083
             S  S KLQ E+A+ KR E +KS  Y + GS+S+GS LRI+  SD  VD+SKCSIQWYR +
Sbjct  266   SAYSVKLQREIAIIKRAEGSKSCPYVLDGSQSLGSCLRIRASSDIGVDISKCSIQWYRAA  325

Query  1084  SECSRREPILGADKSVYAPEPIDVGRVLEADIVSNGLKASVTTIGQIDQAAGLGNYVETL  1263
             SE SRRE I GA+ SVYAPEP DVGRV++ADI+ NG K +VTT G I+ AAGL + VE+L
Sbjct  326   SESSRREAISGANWSVYAPEPFDVGRVIQADILLNGQKFTVTTDGPINTAAGLESRVESL  385

Query  1264  LRKSNTEFSVVIAQMNGRNYSSRSIHSFHVGKMRMKLNKGWITKARDSYSGSMQLCGFRG  1443
             LRKSN+EF+VVI+QMNG+++SSRS H F VGK R+KL++GWITKAR+ YS SMQLCG RG
Sbjct  386   LRKSNSEFTVVISQMNGQDHSSRS-HVFTVGKARIKLSRGWITKAREIYSTSMQLCGVRG  444

Query  1444  GGNSAAKSLFWQPRKGQSFVLVFDSERERNGALVVARKHALECNVSI  1584
               N  AK+LFWQ RKG +F+L F+SE+ERN A+V+ARK+A +CNV++
Sbjct  445   NANLPAKALFWQLRKGITFLLTFESEQERNAAIVLARKYADDCNVTL  491



>emb|CDY14746.1| BnaC04g47430D [Brassica napus]
Length=521

 Score =   568 bits (1464),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 301/490 (61%), Positives = 385/490 (79%), Gaps = 6/490 (1%)
 Frame = +1

Query  130   MTKV---SPEFVGGEVQMYTFKSVSADVSFASNQFPKYKLGPDFQILEEALLENKGPSLK  300
             MTKV   SPE     V     + +SADVSFASN+FP Y+LGPD QI++E   + KGPS+K
Sbjct  28    MTKVCPDSPEMKAKSVCEAVAEPISADVSFASNRFPSYRLGPDDQIIDEPEEDEKGPSVK  87

Query  301   evveeettRLTEQHKRLSVRDLASKFDKNLSSAAKLANEAKLRDAPSLEGHVLLKKLRDA  480
             +VV++ET  L +QHKRLSVRDLA KFDKNL++A+KL  EAK  +  SLEGHV+LKKLRDA
Sbjct  88    DVVDKETGDLLDQHKRLSVRDLACKFDKNLAAASKLVAEAKSNEVTSLEGHVMLKKLRDA  147

Query  481   LETLKGRLAGRNKEDVEIAIAMVEALAVRLTQKEGDLIQEKFEVNKLVSILKQASEDAKK  660
             LE ++GR+ GRNK+ VE AI+MVE+LAV LTQ EG +IQE+FEV KL S LKQASEDAKK
Sbjct  148   LEAMRGRMDGRNKDSVEKAISMVESLAVTLTQHEGGIIQERFEVKKLASFLKQASEDAKK  207

Query  661   LVNQERSFACAEIESARAVVQRIGEALEEQEINSQVSGKQ--eveelmeeiqeARRIRVL  834
             LVNQERSFACAEIESAR +V R+G A +EQE+ S+ S  Q   V++L+EE+QEARRIR++
Sbjct  208   LVNQERSFACAEIESARDLVMRLGGAFKEQELCSKASQDQGPNVKKLVEEVQEARRIRLM  267

Query  835   HQPSKVMDMEHELRALRIQLNEKSVVSFKLQNELAMSKRTEQNKSQLYRIIGSESVGSIL  1014
             HQP+KVM M+HELR L+ Q+ EKS  S KLQ E+   KR E +KS  Y + G++S+GS L
Sbjct  268   HQPTKVMGMKHELRDLKSQIEEKSAYSVKLQREIGRIKRVEGSKSCPYVLDGAQSLGSCL  327

Query  1015  RIQPCSDEAVDLSKCSIQWYRLSSECSRREPILGADKSVYAPEPIDVGRVLEADIVSNGL  1194
             RI+  S+ A D+SKCS+QWYR +SE S    I GA++SVYAPEP DVGRV++ADI+SN  
Sbjct  328   RIRASSESASDVSKCSVQWYRAASESSFMLSISGANRSVYAPEPYDVGRVIQADILSNDQ  387

Query  1195  KASVTTIGQIDQAAGLGNYVETLLRKSNTEFSVVIAQMNGRNYSSRSIHSFHVGKMRMKL  1374
             + +VTT+G I+ AAGL + VETLLRKSN+EF+VVI+QMNG+ ++SRS H F VGK R+KL
Sbjct  388   RFTVTTVGPINTAAGLQSRVETLLRKSNSEFTVVISQMNGQEHASRS-HVFTVGKTRIKL  446

Query  1375  NKGWITKARDSYSGSMQLCGFRGGGNSAAKSLFWQPRKGQSFVLVFDSERERNGALVVAR  1554
             ++GWITKAR+ YS SMQ+CG R   N  AK+LFWQPRKG SF+L F+SE+ERN A+V++R
Sbjct  447   SRGWITKAREIYSNSMQMCGVRDNANVPAKTLFWQPRKGLSFLLTFESEQERNAAIVLSR  506

Query  1555  KHALECNVSI  1584
             K+A +C+V++
Sbjct  507   KYAYDCSVTL  516



>ref|XP_010521573.1| PREDICTED: uncharacterized protein LOC104800467 [Tarenaya hassleriana]
 ref|XP_010521574.1| PREDICTED: uncharacterized protein LOC104800467 [Tarenaya hassleriana]
Length=493

 Score =   567 bits (1461),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 301/486 (62%), Positives = 389/486 (80%), Gaps = 3/486 (1%)
 Frame = +1

Query  130   MTKVSPEFVGGEVQMYTFKSVSADVSFASNQFPKYKLGPDFQILEEALLENKGPSLKevv  309
             MT+V+ +F G  +Q      VSADV FAS++FP Y++G + QI +    + K  S+KEVV
Sbjct  1     MTRVTRDF-GDSMQKNAVPPVSADVKFASSRFPNYRIGANDQIFD-VKDDPKVLSMKEVV  58

Query  310   eeettRLTEQHKRLSVRDLASKFDKNLSSAAKLANEAKLRDAPSLEGHVLLKKLRDALET  489
               ET +L EQ KRLSVRDLA+KF+K L++AAKL+ EAKL++A SLE HVLLKKLRDALE+
Sbjct  59    ARETAQLLEQQKRLSVRDLANKFEKGLAAAAKLSEEAKLKEAASLEKHVLLKKLRDALES  118

Query  490   LKGRLAGRNKEDVEIAIAMVEALAVRLTQKEGDLIQEKFEVNKLVSILKQASEDAKKLVN  669
             LKGR+ GRN++DVE AIAMVEALAV+LTQ+EG+L QEK EV KL + LKQASEDAKKLV+
Sbjct  119   LKGRVTGRNRDDVEEAIAMVEALAVQLTQREGELFQEKAEVKKLATFLKQASEDAKKLVD  178

Query  670   QERSFACAEIESARAVVQRIGEALEEQEINSQVSGKQeveelmeeiqeARRIRVLHQPSK  849
             +ER+FA +EIESA+A VQR+ EAL E E  S+VSGKQ++EELM+E+QEARRI++LHQPSK
Sbjct  179   EERAFARSEIESAKAAVQRVEEALHEHERISRVSGKQDMEELMKEVQEARRIKMLHQPSK  238

Query  850   VMDMEHELRALRIQLNEKSVVSFKLQNELAMSKRTEQNKSQLYRIIGSESVGSILRIQPC  1029
             VMDMEHELRALR QL EKS  S +LQ  LA+ K++E+  S LY I GSE++GS LRI+PC
Sbjct  239   VMDMEHELRALRNQLAEKSRYSLELQKMLAVCKQSEEKISLLYEIDGSEALGSCLRIKPC  298

Query  1030  SDEAVDLSKCSIQWYRLSSECSRREPILGADKSVYAPEPIDVGRVLEADIVSNGLKASVT  1209
             SD+A D+SKCSIQWYR SS+ S +EPI GA K  YAPEPIDVGRVL A+I  +G   +++
Sbjct  299   SDDAPDISKCSIQWYRSSSDGS-KEPISGATKPAYAPEPIDVGRVLLAEIFYDGHSLTLS  357

Query  1210  TIGQIDQAAGLGNYVETLLRKSNTEFSVVIAQMNGRNYSSRSIHSFHVGKMRMKLNKGWI  1389
             T+G+ID AAGLG+YVE L+RK + +F+VV+ QM+G ++ S S+H FHVGKMR+KL KG  
Sbjct  358   TVGKIDPAAGLGSYVEALVRKHDVDFNVVVTQMSGEDHPSESLHVFHVGKMRIKLCKGNT  417

Query  1390  TKARDSYSGSMQLCGFRGGGNSAAKSLFWQPRKGQSFVLVFDSERERNGALVVARKHALE  1569
               A++ YS +MQLCG RGGGN+AA++L+WQ +KG SFV+ F+SERERN A+++AR+ A +
Sbjct  418   VIAKEYYSSAMQLCGVRGGGNAAAQALYWQAKKGVSFVIAFESERERNAAVMLARRFAFD  477

Query  1570  CNVSIT  1587
             CNV++ 
Sbjct  478   CNVTLA  483



>ref|XP_007141525.1| hypothetical protein PHAVU_008G203500g [Phaseolus vulgaris]
 gb|ESW13519.1| hypothetical protein PHAVU_008G203500g [Phaseolus vulgaris]
Length=493

 Score =   567 bits (1461),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 297/485 (61%), Positives = 385/485 (79%), Gaps = 3/485 (1%)
 Frame = +1

Query  130   MTKVSPEFVGGEVQMYTFKSVSADVSFASNQFPKYKLGPDFQILEEALLENKGPSLKevv  309
             MT+V+ +F G  +Q     +VS+DV FAS++FP Y++G + QI+E    + K  S+KEVV
Sbjct  1     MTRVARDF-GDTMQKEAVPAVSSDVVFASSRFPNYRIGANNQIMETKD-DPKVLSMKEVV  58

Query  310   eeettRLTEQHKRLSVRDLASKFDKNLSSAAKLANEAKLRDAPSLEGHVLLKKLRDALET  489
               ET +L EQH RLSVRDLASKF+K L++AAKL+ EA+LR+A SLE HVLLKKLRDALE+
Sbjct  59    ARETAQLLEQHNRLSVRDLASKFEKGLAAAAKLSEEARLREAASLEKHVLLKKLRDALES  118

Query  490   LKGRLAGRNKEDVEIAIAMVEALAVRLTQKEGDLIQEKFEVNKLVSILKQASEDAKKLVN  669
             LKGR+AGRNK+DVE AI+MVEALAV+LTQ+EG+LIQEK EV KL + LKQASEDAKKLV+
Sbjct  119   LKGRVAGRNKDDVEEAISMVEALAVQLTQREGELIQEKAEVKKLANFLKQASEDAKKLVD  178

Query  670   QERSFACAEIESARAVVQRIGEALEEQEINSQVSGKQeveelmeeiqeARRIRVLHQPSK  849
             +ER+FA AEIE ARA VQR+ EAL+E E  SQ S KQ++E+LM+E+QEARRI++LHQPSK
Sbjct  179   EERAFARAEIEDARAAVQRVEEALQEHERMSQASEKQDMEQLMKEVQEARRIKMLHQPSK  238

Query  850   VMDMEHELRALRIQLNEKSVVSFKLQNELAMSKRTEQNKSQLYRIIGSESVGSILRIQPC  1029
             VMDMEHELRALR QL EK+    +LQ EL  +K+  +N S  Y + G+E++GS L+IQPC
Sbjct  239   VMDMEHELRALRAQLAEKTRQYLRLQKELTRTKKGGENISHFYELEGNETLGSYLQIQPC  298

Query  1030  SDEAVDLSKCSIQWYRLSSECSRREPILGADKSVYAPEPIDVGRVLEADIVSNGLKASVT  1209
             SD A ++S+CSIQWYR+SS+ +++E I GA KS+YAPEP DVGRVL+ D++S     +++
Sbjct  299   SDNAPEVSECSIQWYRVSSDGAKKELISGASKSIYAPEPFDVGRVLQVDVISESEHVTLS  358

Query  1210  TIGQIDQAAGLGNYVETLLRKSNTEFSVVIAQMNGRNYSSRSIHSFHVGKMRMKLNKGWI  1389
             T G ID AAGLG YVE L+RK +TEF+VV+ Q+NG +  + SIH  HVGKMR+KL KG  
Sbjct  359   TAGPIDPAAGLGTYVEALVRKHDTEFNVVVTQVNG-SPPTESIHVLHVGKMRIKLCKGKT  417

Query  1390  TKARDSYSGSMQLCGFRGGGNSAAKSLFWQPRKGQSFVLVFDSERERNGALVVARKHALE  1569
             T A++ YS SMQLCG RGGGN+AA+ LFWQP++G SFVL F+SERERN A+++AR+ A +
Sbjct  418   TIAKEYYSSSMQLCGVRGGGNAAAQGLFWQPKQGHSFVLAFESERERNAAIMLARRFAFD  477

Query  1570  CNVSI  1584
             CN+ +
Sbjct  478   CNIML  482



>ref|XP_008451066.1| PREDICTED: uncharacterized protein LOC103492455 [Cucumis melo]
 ref|XP_008451067.1| PREDICTED: uncharacterized protein LOC103492455 [Cucumis melo]
 ref|XP_008451068.1| PREDICTED: uncharacterized protein LOC103492455 [Cucumis melo]
Length=494

 Score =   566 bits (1460),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 301/483 (62%), Positives = 384/483 (80%), Gaps = 2/483 (0%)
 Frame = +1

Query  130   MTKVSPEFVGGEVQMYTFKSVSADVSFASNQFPKYKLGPDFQILEEALLENKGPSLKevv  309
             MT++S  +    +Q     +VSADV FAS++FP YK+GP+ QI+E A  + K  S+KEVV
Sbjct  1     MTRISRTY-SDTMQREGVSAVSADVIFASSRFPNYKIGPNNQIVE-AKDDPKVLSMKEVV  58

Query  310   eeettRLTEQHKRLSVRDLASKFDKNLSSAAKLANEAKLRDAPSLEGHVLLKKLRDALET  489
               ET +L EQ KRLSVRDLASKF+K L++AAKL+ EA+LR+A SLE HVLLKKLRDALE 
Sbjct  59    ARETAQLLEQQKRLSVRDLASKFEKGLAAAAKLSEEARLREAASLEKHVLLKKLRDALEA  118

Query  490   LKGRLAGRNKEDVEIAIAMVEALAVRLTQKEGDLIQEKFEVNKLVSILKQASEDAKKLVN  669
             L+GR+AGRNK+DVE AIAMVEALAV+LTQ+EG+LIQEK EV KL + LKQASEDAKKLV+
Sbjct  119   LRGRVAGRNKDDVEEAIAMVEALAVQLTQREGELIQEKAEVKKLANFLKQASEDAKKLVD  178

Query  670   QERSFACAEIESARAVVQRIGEALEEQEINSQVSGKQeveelmeeiqeARRIRVLHQPSK  849
             +ER+FA AEIE+AR  VQR+ EAL+E E  S+ +GKQ++EELM+E+QEARRI++LHQPSK
Sbjct  179   EERAFARAEIENAREAVQRVEEALQEHERMSRAAGKQDLEELMKEVQEARRIKMLHQPSK  238

Query  850   VMDMEHELRALRIQLNEKSVVSFKLQNELAMSKRTEQNKSQLYRIIGSESVGSILRIQPC  1029
             VMDMEHEL ALR+QL EKS  S  LQ ELA+SK+   + S LY I G+ES+GS L IQP 
Sbjct  239   VMDMEHELHALRLQLAEKSKYSILLQKELAISKKAMGDNSNLYEIDGTESLGSYLHIQPS  298

Query  1030  SDEAVDLSKCSIQWYRLSSECSRREPILGADKSVYAPEPIDVGRVLEADIVSNGLKASVT  1209
              D + DLSKCSIQWYR++SE  ++E I GA KSVYAPEP DVG++L+AD++ +  + ++T
Sbjct  299   CDTSPDLSKCSIQWYRVASESGKKELISGATKSVYAPEPFDVGKILQADVILDDHRITLT  358

Query  1210  TIGQIDQAAGLGNYVETLLRKSNTEFSVVIAQMNGRNYSSRSIHSFHVGKMRMKLNKGWI  1389
             T G ID AAGLG+YVE L+RK + EF+VV+ Q+NG N  S SIHS HVGKMR+KL KG  
Sbjct  359   TTGPIDPAAGLGSYVEALVRKHDVEFNVVLTQVNGVNNPSESIHSLHVGKMRIKLCKGKN  418

Query  1390  TKARDSYSGSMQLCGFRGGGNSAAKSLFWQPRKGQSFVLVFDSERERNGALVVARKHALE  1569
             T A++ YS SMQLCG RGGGN+AA++LFWQ +K  S++L F+SER+RN A+++AR+ A +
Sbjct  419   TIAKEYYSSSMQLCGVRGGGNAAAQALFWQAKKDLSYILAFESERDRNAAIMLARRFAFD  478

Query  1570  CNV  1578
             CN+
Sbjct  479   CNI  481



>ref|NP_180245.1| stomatal closure-related actin binding protein1 [Arabidopsis 
thaliana]
 ref|NP_850085.1| stomatal closure-related actin binding protein1 [Arabidopsis 
thaliana]
 gb|AAB95312.1| hypothetical protein [Arabidopsis thaliana]
 gb|AAM97015.1| unknown protein [Arabidopsis thaliana]
 gb|AAN15512.1| unknown protein [Arabidopsis thaliana]
 dbj|BAC43431.1| unknown protein [Arabidopsis thaliana]
 gb|AEC07884.1| stomatal closure-related actin binding protein1 [Arabidopsis 
thaliana]
 gb|AEC07885.1| stomatal closure-related actin binding protein1 [Arabidopsis 
thaliana]
Length=496

 Score =   566 bits (1460),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 297/486 (61%), Positives = 391/486 (80%), Gaps = 2/486 (0%)
 Frame = +1

Query  130   MTKVSPEFVGGEVQMYTFKSVSADVSFASNQFPKYKLGPDFQILEEALLENKGPSLKevv  309
             MT+V+ +F    +Q     +VSADV FAS++FP Y++G + QI +    + K  S+KEVV
Sbjct  1     MTRVTRDFRDS-LQRDGVPAVSADVKFASSRFPNYRIGANDQIFD-VKDDPKVMSMKEVV  58

Query  310   eeettRLTEQHKRLSVRDLASKFDKNLSSAAKLANEAKLRDAPSLEGHVLLKKLRDALET  489
               ET +L +Q KRLSVRDLA KF+K L++AAKL+ EAKL++A SLE HVLLKKLRDALE+
Sbjct  59    ARETAQLMDQQKRLSVRDLAHKFEKGLAAAAKLSEEAKLKEATSLEKHVLLKKLRDALES  118

Query  490   LKGRLAGRNKEDVEIAIAMVEALAVRLTQKEGDLIQEKFEVNKLVSILKQASEDAKKLVN  669
             L+GR+AGRNK+DVE AIAMVEALAV+LTQ+EG+L  EK EV KL S LKQASEDAKKLV+
Sbjct  119   LRGRVAGRNKDDVEEAIAMVEALAVQLTQREGELFIEKAEVKKLASFLKQASEDAKKLVD  178

Query  670   QERSFACAEIESARAVVQRIGEALEEQEINSQVSGKQeveelmeeiqeARRIRVLHQPSK  849
             +ER+FA AEIESARA VQR+ EAL E E  S+ SGKQ++E+LM+E+QEARRI++LHQPS+
Sbjct  179   EERAFARAEIESARAAVQRVEEALREHEQMSRASGKQDMEDLMKEVQEARRIKMLHQPSR  238

Query  850   VMDMEHELRALRIQLNEKSVVSFKLQNELAMSKRTEQNKSQLYRIIGSESVGSILRIQPC  1029
             VMDME+ELRALR QL EKS    +LQ +LAM +++E+N S +Y I G+E++GS LR++PC
Sbjct  239   VMDMEYELRALRNQLAEKSKHFLQLQKKLAMCRKSEENISLVYEIDGTEALGSCLRVRPC  298

Query  1030  SDEAVDLSKCSIQWYRLSSECSRREPILGADKSVYAPEPIDVGRVLEADIVSNGLKASVT  1209
             S++A DLSKC+IQWYR SS+ S++E I GA KSVYAPEP DVGRVL ADI+ +G   S++
Sbjct  299   SNDAPDLSKCTIQWYRSSSDGSKKELISGATKSVYAPEPFDVGRVLHADIIYDGHSLSLS  358

Query  1210  TIGQIDQAAGLGNYVETLLRKSNTEFSVVIAQMNGRNYSSRSIHSFHVGKMRMKLNKGWI  1389
             T+G+ID AAGLG+YVE L+RK + +F+VV+ QM+G +++S SIH FHVGKMR+KL KG  
Sbjct  359   TVGKIDPAAGLGSYVEALVRKHDVDFNVVVTQMSGEDHTSESIHLFHVGKMRIKLCKGKT  418

Query  1390  TKARDSYSGSMQLCGFRGGGNSAAKSLFWQPRKGQSFVLVFDSERERNGALVVARKHALE  1569
               A++ YS +MQLCG RGGGN+AA++L+WQ +KG SFV+ F+SERERN A+++AR+ A +
Sbjct  419   VIAKEYYSSAMQLCGVRGGGNAAAQALYWQAKKGVSFVIAFESERERNAAIMLARRFACD  478

Query  1570  CNVSIT  1587
             CNV++ 
Sbjct  479   CNVTLA  484



>ref|XP_010505838.1| PREDICTED: uncharacterized protein LOC104782569 isoform X1 [Camelina 
sativa]
Length=541

 Score =   568 bits (1464),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 298/467 (64%), Positives = 385/467 (82%), Gaps = 4/467 (1%)
 Frame = +1

Query  190   VSADVSFASNQFPKYKLGPDFQILEEALLENKGPSLKevveeettRLTEQHKRLSVRDLA  369
             +SADVSFA N FP YKLGPD QI++E   ++KG S+K+VV++E + L++QHK+LSVRDLA
Sbjct  72    ISADVSFAFNHFPSYKLGPDDQIVDEPEDDSKGLSVKDVVDKEISDLSDQHKQLSVRDLA  131

Query  370   SKFDKNLSSAAKLANEAKLRDAPSLEGHVLLKKLRDALETLKGRLAGRNKEDVEIAIAMV  549
              KFDKNL++A+KL +EAKL +  SLEGHV+LKKLRDALET++GR+ GRN+E+VE AI+MV
Sbjct  132   CKFDKNLAAASKLVDEAKLNEVTSLEGHVMLKKLRDALETVRGRMDGRNREEVEKAISMV  191

Query  550   EALAVRLTQKEGDLIQEKFEVNKLVSILKQASEDAKKLVNQERSFACAEIESARAVVQRI  729
             EALAV+LTQ EG+LIQ+KFEV KL S LK+ASEDAKKLVNQE+SFACAEI+SARA+V R+
Sbjct  192   EALAVKLTQNEGELIQDKFEVKKLASFLKKASEDAKKLVNQEKSFACAEIDSARALVMRL  251

Query  730   GEALEEQEINSQVSGKQ--eveelmeeiqeARRIRVLHQPSKVMDMEHELRALRIQLNEK  903
             G   EEQE+ S+ S +Q   VE+L+EE+QEARRI+ +H+P+KV+ M+HEL  L+ Q+ EK
Sbjct  252   GGTFEEQELCSKASREQGPNVEKLVEEVQEARRIKRMHKPTKVIGMQHELYDLKSQIREK  311

Query  904   SVVSFKLQNELAMSKRTEQNKSQLYRIIGSESVGSILRIQPCSDEAVDLSKCSIQWYRLS  1083
             S  S KLQ E+A+ KR E +KS  Y + G++S+GS LRI+  SD  VD+SKCSIQWYR +
Sbjct  312   SAYSVKLQREIAIIKRAEGSKSCPYVLDGAQSLGSCLRIR-ASDSGVDISKCSIQWYRAA  370

Query  1084  SECSRREPILGADKSVYAPEPIDVGRVLEADIVSNGLKASVTTIGQIDQAAGLGNYVETL  1263
             SE SRRE I GA+ SVYAPEP DVGRV++ADI+SNG K +VTT G I+ AAGL + VE+L
Sbjct  371   SESSRREAISGANWSVYAPEPFDVGRVIQADIISNGQKFTVTTDGPINTAAGLQSRVESL  430

Query  1264  LRKSNTEFSVVIAQMNGRNYSSRSIHSFHVGKMRMKLNKGWITKARDSYSGSMQLCGFRG  1443
             LRKSN+EF+VVI+QMNG++++SRS H F +GK R+KL++GWITKAR+ YS SMQLCG RG
Sbjct  431   LRKSNSEFTVVISQMNGQDHTSRS-HIFTIGKARIKLSRGWITKAREIYSTSMQLCGVRG  489

Query  1444  GGNSAAKSLFWQPRKGQSFVLVFDSERERNGALVVARKHALECNVSI  1584
               N  AK+LFWQ RKG +F+L F+SE+ERN A+V+ARK+A ECNV++
Sbjct  490   NANLPAKALFWQLRKGLTFLLTFESEQERNAAIVLARKYADECNVTL  536



>ref|XP_010508799.1| PREDICTED: uncharacterized protein LOC104785313 isoform X1 [Camelina 
sativa]
 ref|XP_010508800.1| PREDICTED: uncharacterized protein LOC104785313 isoform X1 [Camelina 
sativa]
Length=538

 Score =   568 bits (1463),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 298/467 (64%), Positives = 383/467 (82%), Gaps = 3/467 (1%)
 Frame = +1

Query  190   VSADVSFASNQFPKYKLGPDFQILEEALLENKGPSLKevveeettRLTEQHKRLSVRDLA  369
             +SADVSFA N FP YKLGPD QI++E   ++KG S+K+VV++E   L++QH +LSVRDLA
Sbjct  68    ISADVSFAFNHFPSYKLGPDDQIVDEPEDDSKGLSVKDVVDKEIGDLSDQHMQLSVRDLA  127

Query  370   SKFDKNLSSAAKLANEAKLRDAPSLEGHVLLKKLRDALETLKGRLAGRNKEDVEIAIAMV  549
              KFDKNL++A+KL +EAKL +  SLEGHV+LKKLRDALET++GR+ GRN+E+VE AI+MV
Sbjct  128   CKFDKNLAAASKLVDEAKLNEVTSLEGHVMLKKLRDALETVRGRMDGRNREEVEKAISMV  187

Query  550   EALAVRLTQKEGDLIQEKFEVNKLVSILKQASEDAKKLVNQERSFACAEIESARAVVQRI  729
             EALAV+LTQ EG+LIQ+KFEV KL S LK+ASEDAKKLVNQE+SFACAEI+SARA+V R+
Sbjct  188   EALAVKLTQNEGELIQDKFEVKKLASFLKKASEDAKKLVNQEKSFACAEIDSARALVMRL  247

Query  730   GEALEEQEINSQVSGKQ--eveelmeeiqeARRIRVLHQPSKVMDMEHELRALRIQLNEK  903
             G   EEQE++S+ S +Q   VE+L+EE+QEARRI+ +H+P+KV+ M+HEL  L+ Q+ EK
Sbjct  248   GGTFEEQELSSKASREQGPNVEKLVEEVQEARRIKRMHKPTKVIGMQHELYDLKSQIREK  307

Query  904   SVVSFKLQNELAMSKRTEQNKSQLYRIIGSESVGSILRIQPCSDEAVDLSKCSIQWYRLS  1083
             S  S KLQ E+A+ KR E +KS  Y + GS+S+GS LRI+  SD  VD+SKCSIQWYR +
Sbjct  308   SAYSVKLQREIAIIKRAEGSKSCPYVLDGSQSLGSCLRIRASSDIGVDISKCSIQWYRAA  367

Query  1084  SECSRREPILGADKSVYAPEPIDVGRVLEADIVSNGLKASVTTIGQIDQAAGLGNYVETL  1263
             SE SRRE I GA+ SVYAPEP DVGRV++ADI+ NG K +VTT G I+ AAGL + VE+L
Sbjct  368   SESSRREAISGANWSVYAPEPFDVGRVIQADILLNGQKFTVTTDGPINTAAGLESRVESL  427

Query  1264  LRKSNTEFSVVIAQMNGRNYSSRSIHSFHVGKMRMKLNKGWITKARDSYSGSMQLCGFRG  1443
             LRKSN+EF+VVI+QMNG+++SSRS H F VGK R+KL++GWITKAR+ YS SMQLCG RG
Sbjct  428   LRKSNSEFTVVISQMNGQDHSSRS-HVFTVGKARIKLSRGWITKAREIYSTSMQLCGVRG  486

Query  1444  GGNSAAKSLFWQPRKGQSFVLVFDSERERNGALVVARKHALECNVSI  1584
               N  AK+LFWQ RKG +F+L F+SE+ERN A+V+ARK+A +CNV++
Sbjct  487   NANLPAKALFWQLRKGITFLLTFESEQERNAAIVLARKYADDCNVTL  533



>ref|XP_002880833.1| hypothetical protein ARALYDRAFT_481549 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH57092.1| hypothetical protein ARALYDRAFT_481549 [Arabidopsis lyrata subsp. 
lyrata]
Length=496

 Score =   566 bits (1459),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 298/486 (61%), Positives = 391/486 (80%), Gaps = 2/486 (0%)
 Frame = +1

Query  130   MTKVSPEFVGGEVQMYTFKSVSADVSFASNQFPKYKLGPDFQILEEALLENKGPSLKevv  309
             MT+V+ +F    +Q     +VSADV FAS++FP Y++G + QI +    + K  S+KEVV
Sbjct  1     MTRVTRDFRDS-LQRDGVPAVSADVKFASSRFPNYRIGANDQIFD-VKDDPKVMSMKEVV  58

Query  310   eeettRLTEQHKRLSVRDLASKFDKNLSSAAKLANEAKLRDAPSLEGHVLLKKLRDALET  489
               ET +L +Q KRLSVRDLA+KF+K L++AAKL+ EAKL++A SLE HVLLKKLRDALE+
Sbjct  59    ARETAQLMDQQKRLSVRDLANKFEKGLAAAAKLSEEAKLKEATSLEKHVLLKKLRDALES  118

Query  490   LKGRLAGRNKEDVEIAIAMVEALAVRLTQKEGDLIQEKFEVNKLVSILKQASEDAKKLVN  669
             L+GR+AGRNK+DVE AIAMVEALAV+LTQ+EG+L  EK EV KL S LKQASEDAKKLV+
Sbjct  119   LRGRVAGRNKDDVEEAIAMVEALAVQLTQREGELFIEKAEVKKLASFLKQASEDAKKLVD  178

Query  670   QERSFACAEIESARAVVQRIGEALEEQEINSQVSGKQeveelmeeiqeARRIRVLHQPSK  849
             +ER+FA AEIESARA VQR+ EAL E E  S+ SGKQ++E+LM+E+QEARRI++LHQPS+
Sbjct  179   EERAFARAEIESARAAVQRVEEALREHEQMSRASGKQDMEDLMKEVQEARRIKMLHQPSR  238

Query  850   VMDMEHELRALRIQLNEKSVVSFKLQNELAMSKRTEQNKSQLYRIIGSESVGSILRIQPC  1029
             VMDME+ELRALR QL EKS    +LQ +LAM +++E+N S +Y I G+E++GS LR++PC
Sbjct  239   VMDMEYELRALRNQLAEKSKHFLQLQKKLAMCRKSEENISLIYEIDGTEALGSCLRVRPC  298

Query  1030  SDEAVDLSKCSIQWYRLSSECSRREPILGADKSVYAPEPIDVGRVLEADIVSNGLKASVT  1209
             S++A DLSKC+IQWYR SS+ S+RE I GA KSVYAPEP DVGRVL ADI  +G   S++
Sbjct  299   SNDAPDLSKCTIQWYRSSSDGSKRELISGATKSVYAPEPFDVGRVLHADITYDGRLLSLS  358

Query  1210  TIGQIDQAAGLGNYVETLLRKSNTEFSVVIAQMNGRNYSSRSIHSFHVGKMRMKLNKGWI  1389
             T+G+ID AAGLG+YVE L+RK + +F+VV+ QM+G +++S SIH FHVGKMR+KL KG  
Sbjct  359   TVGKIDPAAGLGSYVEALVRKHDVDFNVVVTQMSGEDHTSESIHLFHVGKMRIKLCKGKT  418

Query  1390  TKARDSYSGSMQLCGFRGGGNSAAKSLFWQPRKGQSFVLVFDSERERNGALVVARKHALE  1569
               A++ YS +MQLCG RGGGN+AA++L+WQ +KG SFV+ F+SERERN A+++AR+ A +
Sbjct  419   VIAKEYYSSAMQLCGVRGGGNAAAQALYWQAKKGVSFVIAFESERERNAAIMLARRFACD  478

Query  1570  CNVSIT  1587
             CNV++ 
Sbjct  479   CNVTLA  484



>ref|XP_003555196.1| PREDICTED: inner centromere protein-like isoform X1 [Glycine 
max]
 ref|XP_006605607.1| PREDICTED: inner centromere protein-like isoform X2 [Glycine 
max]
 gb|KHN27346.1| hypothetical protein glysoja_030610 [Glycine soja]
Length=493

 Score =   565 bits (1456),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 299/486 (62%), Positives = 383/486 (79%), Gaps = 9/486 (2%)
 Frame = +1

Query  130   MTKVSPEFVGGEVQMYTFKSVSADVSFASNQFPKYKLGPDFQILEEALLENKGP---SLK  300
             MT+++ +F G  +Q     +VSAD+ FAS +FP YK+G + QI+E        P   S+K
Sbjct  1     MTRMTRDF-GDTMQKDAVPAVSADIIFASLRFPNYKIGVNNQIMET----KDSPKVLSMK  55

Query  301   evveeettRLTEQHKRLSVRDLASKFDKNLSSAAKLANEAKLRDAPSLEGHVLLKKLRDA  480
             EVV  ET +L +Q KRLSVRDLASKF+K L++AAKL+ EA+LR+A SLE HVLLKKLRDA
Sbjct  56    EVVARETAQLLDQQKRLSVRDLASKFEKGLAAAAKLSEEARLREAASLEKHVLLKKLRDA  115

Query  481   LETLKGRLAGRNKEDVEIAIAMVEALAVRLTQKEGDLIQEKFEVNKLVSILKQASEDAKK  660
             L++LKGR+AGRNK+DV  AIAMVEALAV+LTQ+EG+LIQEK EV KL + LKQASEDAKK
Sbjct  116   LQSLKGRVAGRNKDDVAEAIAMVEALAVQLTQREGELIQEKSEVKKLTNFLKQASEDAKK  175

Query  661   LVNQERSFACAEIESARAVVQRIGEALEEQEINSQVSGKQeveelmeeiqeARRIRVLHQ  840
             LVN+ER+FA  EIE+ARA VQR+ EAL+E E  SQ SGKQ++E+LM+E+QEARRI++LHQ
Sbjct  176   LVNEERAFARFEIENARAAVQRVEEALQEHERMSQASGKQDLEQLMKEVQEARRIKMLHQ  235

Query  841   PSKVMDMEHELRALRIQLNEKSVVSFKLQNELAMSKRTEQNKSQLYRIIGSESVGSILRI  1020
             PSKVMDMEHELRALR QL EKS +  +LQ ELA +K+ E+N   LY + G+E +GS L+I
Sbjct  236   PSKVMDMEHELRALRAQLAEKSRLYLRLQKELARAKKGEENAPHLYELEGTEMLGSYLQI  295

Query  1021  QPCSDEAVDLSKCSIQWYRLSSECSRREPILGADKSVYAPEPIDVGRVLEADIVSNGLKA  1200
             QPCSD   +LS+CSIQWYR+S+E + +E I GA+KSVYAPEP DVGRVL+ DI+  G + 
Sbjct  296   QPCSDNVPELSECSIQWYRVSTEGANKELISGANKSVYAPEPFDVGRVLQVDIILEGHQI  355

Query  1201  SVTTIGQIDQAAGLGNYVETLLRKSNTEFSVVIAQMNGRNYSSRSIHSFHVGKMRMKLNK  1380
             +++T G ID AAGLG YVE L+RK +TEF+VV+ Q  G ++ + SIH  HVGKMRMKL K
Sbjct  356   TLSTTGPIDPAAGLGTYVEALVRKHDTEFNVVVTQ-TGSDHPNESIHVLHVGKMRMKLCK  414

Query  1381  GWITKARDSYSGSMQLCGFRGGGNSAAKSLFWQPRKGQSFVLVFDSERERNGALVVARKH  1560
             G  T A++ YS  MQLCG RGGGN+AA+++FWQP++G SFVL F+SERERN A+++AR+ 
Sbjct  415   GKTTIAKEYYSSFMQLCGVRGGGNAAAQAVFWQPKQGLSFVLAFESERERNAAIMLARRF  474

Query  1561  ALECNV  1578
             A +CN+
Sbjct  475   AFDCNI  480



>ref|XP_010427474.1| PREDICTED: uncharacterized protein LOC104712309 [Camelina sativa]
 ref|XP_010427475.1| PREDICTED: uncharacterized protein LOC104712309 [Camelina sativa]
 ref|XP_010427476.1| PREDICTED: uncharacterized protein LOC104712309 [Camelina sativa]
Length=491

 Score =   565 bits (1455),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 301/490 (61%), Positives = 384/490 (78%), Gaps = 9/490 (2%)
 Frame = +1

Query  130   MTKVSPEFVGGEVQMYTFKSVSADVSFASNQFPKYKLGPDFQILEEALLENKGPSLKevv  309
             MTKV PE   G +       VS DVSF+S+ FP YKLGPD QI+EE   ++KGPS+KE V
Sbjct  1     MTKVCPEIEEGTLSKLAV-PVSVDVSFSSDHFPTYKLGPDNQIVEEPKEDDKGPSVKETV  59

Query  310   eeettRLTEQHKRLSVRDLASKFDKNLSSAAKLANEAKLRDAPSLEGHVLLKKLRDALET  489
             E+E+  L++QHKRLSVRDLASKFDKNL++A  LA+EAKLR+  SLEGHV+LKKLRDALE 
Sbjct  60    EKESELLSDQHKRLSVRDLASKFDKNLAAAVSLADEAKLREVASLEGHVMLKKLRDALEY  119

Query  490   LKGRLAGRNKEDVEIAIAMVEALAVRLTQKEGDLIQEKFEVNKLVSILKQASEDAKKLVN  669
             ++GR  G+NKEDVE AI+MVEALAV+LTQ EG+LIQEKFEV KL + LKQ SEDAKKLVN
Sbjct  120   MRGRTDGQNKEDVETAISMVEALAVKLTQNEGELIQEKFEVKKLGNFLKQTSEDAKKLVN  179

Query  670   QERSFACAEIESARAVVQRIGEALEEQEINSQVSGKQ--eveelmeeiqeARRIRVLHQP  843
             QE+SFACAEIE+ARAVV ++GEA EEQE  S+ S  Q  +VE+L+EE+QEAR+I+ +H P
Sbjct  180   QEKSFACAEIETARAVVLKLGEAFEEQERISEASRAQGPDVEKLVEEVQEARQIKRMHHP  239

Query  844   SKVMDMEHELRALRIQLNEKSVVSFKLQNELAMSKRTEQNKSQLYRIIGSESVGSILRIQ  1023
             +KVM M+HEL  LR ++ EK + S KL  E+A+ KR E++KS  + + G +S+GS LRI 
Sbjct  240   TKVMGMQHELYGLRNRIQEKYMNSVKLHKEIAIIKRAEESKSCPFVLEGKQSLGSCLRI-  298

Query  1024  PC---SDEAVDLSKCSIQWYRLSSECSRREPILGADKSVYAPEPIDVGRVLEADIVSNGL  1194
              C   S+ A D+S CSIQWYR + E SRRE I GA +S+YAPEP DVGR+L+ADI+SNG 
Sbjct  299   -CVNASENAPDISSCSIQWYRAACETSRREAISGAIQSMYAPEPFDVGRILQADILSNGQ  357

Query  1195  KASVTTIGQIDQAAGLGNYVETLLRKSNTEFSVVIAQMNGRNYSSRSIHSFHVGKMRMKL  1374
             K +VTT   +D  + L + VE+L+RKSN+EFSVVI+QMNG++Y+SRS H F +GK R+KL
Sbjct  358   KFTVTTDDPVDPDSALQSRVESLMRKSNSEFSVVISQMNGQDYASRS-HIFTIGKTRIKL  416

Query  1375  NKGWITKARDSYSGSMQLCGFRGGGNSAAKSLFWQPRKGQSFVLVFDSERERNGALVVAR  1554
             ++GWI+KAR+ YS SMQLCG RG   +  KSLFWQPRK  +F+L F+SE+ERN A+V+AR
Sbjct  417   SRGWISKAREIYSTSMQLCGVRGNVKTPTKSLFWQPRKSLTFILTFESEQERNAAIVLAR  476

Query  1555  KHALECNVSI  1584
             K+A +CNVS+
Sbjct  477   KYAFDCNVSL  486



>gb|KEH28369.1| Cyclin 4 [Medicago truncatula]
Length=494

 Score =   564 bits (1453),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 293/485 (60%), Positives = 386/485 (80%), Gaps = 2/485 (0%)
 Frame = +1

Query  130   MTKVSPEFVGGEVQMYTFKSVSADVSFASNQFPKYKLGPDFQILEEALLENKGPSLKevv  309
             MT+V+ +F G  +Q     +VS+DV FA+++FP Y++G + QI+E A  + K  S+KEV+
Sbjct  1     MTRVTRDF-GDTMQKEAVPAVSSDVVFATSRFPNYRIGANNQIME-AKDDPKVLSMKEVI  58

Query  310   eeettRLTEQHKRLSVRDLASKFDKNLSSAAKLANEAKLRDAPSLEGHVLLKKLRDALET  489
               ET  L +QH RLSVRDLASKF+K L++AAKL+ EA+LR+A SLE HVLLKKLRD+LE+
Sbjct  59    ARETAMLLDQHNRLSVRDLASKFEKGLAAAAKLSEEARLREAASLEKHVLLKKLRDSLES  118

Query  490   LKGRLAGRNKEDVEIAIAMVEALAVRLTQKEGDLIQEKFEVNKLVSILKQASEDAKKLVN  669
             LKGR+AGRNK+DVE AIAMVEALAV+LTQ+EG+L+QEK EV KL + LKQASEDAKKLV+
Sbjct  119   LKGRVAGRNKDDVEDAIAMVEALAVQLTQREGELLQEKAEVKKLANFLKQASEDAKKLVD  178

Query  670   QERSFACAEIESARAVVQRIGEALEEQEINSQVSGKQeveelmeeiqeARRIRVLHQPSK  849
             +ER+FA AEI++AR+ VQR+ E+L+E E  SQ SGKQ+VE+LM+E+QEARRI++LHQPSK
Sbjct  179   EERAFARAEIDNARSAVQRVEESLQEHERMSQASGKQDVEQLMKEVQEARRIKMLHQPSK  238

Query  850   VMDMEHELRALRIQLNEKSVVSFKLQNELAMSKRTEQNKSQLYRIIGSESVGSILRIQPC  1029
             VMDMEHEL+ALR QL EK+    +LQ E+  +K+ E+N   LY + G+E++GS L+IQPC
Sbjct  239   VMDMEHELQALRAQLAEKTRHYLRLQKEITRTKKGEENVPHLYELEGNETLGSYLQIQPC  298

Query  1030  SDEAVDLSKCSIQWYRLSSECSRREPILGADKSVYAPEPIDVGRVLEADIVSNGLKASVT  1209
             SD A DLS CSIQW R+SS+ +++E I GA KSVYAPEP DVGR+L  D++S      ++
Sbjct  299   SDNAPDLSNCSIQWCRVSSDGAKKELISGAIKSVYAPEPFDVGRILHVDVISENQHIILS  358

Query  1210  TIGQIDQAAGLGNYVETLLRKSNTEFSVVIAQMNGRNYSSRSIHSFHVGKMRMKLNKGWI  1389
             T G ID AAGLG YVE L+RK +TEF+VV+ QM+G ++ + SIH  HVGKMR+KL KG  
Sbjct  359   TTGPIDPAAGLGTYVEALVRKHDTEFNVVVTQMSGLHHPTESIHVLHVGKMRIKLCKGKT  418

Query  1390  TKARDSYSGSMQLCGFRGGGNSAAKSLFWQPRKGQSFVLVFDSERERNGALVVARKHALE  1569
             T A++ YS SMQLCG RGGGN+AA++LFWQP++G SFVL F+SERERN A+++AR+ A +
Sbjct  419   TIAKEYYSSSMQLCGVRGGGNAAAQALFWQPKQGLSFVLAFESERERNAAIMLARRFAFD  478

Query  1570  CNVSI  1584
             CN+ +
Sbjct  479   CNIML  483



>ref|XP_003617192.1| hypothetical protein MTR_5g088860 [Medicago truncatula]
Length=503

 Score =   563 bits (1452),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 293/486 (60%), Positives = 387/486 (80%), Gaps = 2/486 (0%)
 Frame = +1

Query  127   KMTKVSPEFVGGEVQMYTFKSVSADVSFASNQFPKYKLGPDFQILEEALLENKGPSLKev  306
             +MT+V+ +F G  +Q     +VS+DV FA+++FP Y++G + QI+E A  + K  S+KEV
Sbjct  9     EMTRVTRDF-GDTMQKEAVPAVSSDVVFATSRFPNYRIGANNQIME-AKDDPKVLSMKEV  66

Query  307   veeettRLTEQHKRLSVRDLASKFDKNLSSAAKLANEAKLRDAPSLEGHVLLKKLRDALE  486
             +  ET  L +QH RLSVRDLASKF+K L++AAKL+ EA+LR+A SLE HVLLKKLRD+LE
Sbjct  67    IARETAMLLDQHNRLSVRDLASKFEKGLAAAAKLSEEARLREAASLEKHVLLKKLRDSLE  126

Query  487   TLKGRLAGRNKEDVEIAIAMVEALAVRLTQKEGDLIQEKFEVNKLVSILKQASEDAKKLV  666
             +LKGR+AGRNK+DVE AIAMVEALAV+LTQ+EG+L+QEK EV KL + LKQASEDAKKLV
Sbjct  127   SLKGRVAGRNKDDVEDAIAMVEALAVQLTQREGELLQEKAEVKKLANFLKQASEDAKKLV  186

Query  667   NQERSFACAEIESARAVVQRIGEALEEQEINSQVSGKQeveelmeeiqeARRIRVLHQPS  846
             ++ER+FA AEI++AR+ VQR+ E+L+E E  SQ SGKQ+VE+LM+E+QEARRI++LHQPS
Sbjct  187   DEERAFARAEIDNARSAVQRVEESLQEHERMSQASGKQDVEQLMKEVQEARRIKMLHQPS  246

Query  847   KVMDMEHELRALRIQLNEKSVVSFKLQNELAMSKRTEQNKSQLYRIIGSESVGSILRIQP  1026
             KVMDMEHEL+ALR QL EK+    +LQ E+  +K+ E+N   LY + G+E++GS L+IQP
Sbjct  247   KVMDMEHELQALRAQLAEKTRHYLRLQKEITRTKKGEENVPHLYELEGNETLGSYLQIQP  306

Query  1027  CSDEAVDLSKCSIQWYRLSSECSRREPILGADKSVYAPEPIDVGRVLEADIVSNGLKASV  1206
             CSD A DLS CSIQW R+SS+ +++E I GA KSVYAPEP DVGR+L  D++S      +
Sbjct  307   CSDNAPDLSNCSIQWCRVSSDGAKKELISGAIKSVYAPEPFDVGRILHVDVISENQHIIL  366

Query  1207  TTIGQIDQAAGLGNYVETLLRKSNTEFSVVIAQMNGRNYSSRSIHSFHVGKMRMKLNKGW  1386
             +T G ID AAGLG YVE L+RK +TEF+VV+ QM+G ++ + SIH  HVGKMR+KL KG 
Sbjct  367   STTGPIDPAAGLGTYVEALVRKHDTEFNVVVTQMSGLHHPTESIHVLHVGKMRIKLCKGK  426

Query  1387  ITKARDSYSGSMQLCGFRGGGNSAAKSLFWQPRKGQSFVLVFDSERERNGALVVARKHAL  1566
              T A++ YS SMQLCG RGGGN+AA++LFWQP++G SFVL F+SERERN A+++AR+ A 
Sbjct  427   TTIAKEYYSSSMQLCGVRGGGNAAAQALFWQPKQGLSFVLAFESERERNAAIMLARRFAF  486

Query  1567  ECNVSI  1584
             +CN+ +
Sbjct  487   DCNIML  492



>gb|AET00151.2| Cyclin 4 [Medicago truncatula]
Length=516

 Score =   564 bits (1453),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 293/486 (60%), Positives = 387/486 (80%), Gaps = 2/486 (0%)
 Frame = +1

Query  127   KMTKVSPEFVGGEVQMYTFKSVSADVSFASNQFPKYKLGPDFQILEEALLENKGPSLKev  306
             +MT+V+ +F G  +Q     +VS+DV FA+++FP Y++G + QI+E A  + K  S+KEV
Sbjct  22    EMTRVTRDF-GDTMQKEAVPAVSSDVVFATSRFPNYRIGANNQIME-AKDDPKVLSMKEV  79

Query  307   veeettRLTEQHKRLSVRDLASKFDKNLSSAAKLANEAKLRDAPSLEGHVLLKKLRDALE  486
             +  ET  L +QH RLSVRDLASKF+K L++AAKL+ EA+LR+A SLE HVLLKKLRD+LE
Sbjct  80    IARETAMLLDQHNRLSVRDLASKFEKGLAAAAKLSEEARLREAASLEKHVLLKKLRDSLE  139

Query  487   TLKGRLAGRNKEDVEIAIAMVEALAVRLTQKEGDLIQEKFEVNKLVSILKQASEDAKKLV  666
             +LKGR+AGRNK+DVE AIAMVEALAV+LTQ+EG+L+QEK EV KL + LKQASEDAKKLV
Sbjct  140   SLKGRVAGRNKDDVEDAIAMVEALAVQLTQREGELLQEKAEVKKLANFLKQASEDAKKLV  199

Query  667   NQERSFACAEIESARAVVQRIGEALEEQEINSQVSGKQeveelmeeiqeARRIRVLHQPS  846
             ++ER+FA AEI++AR+ VQR+ E+L+E E  SQ SGKQ+VE+LM+E+QEARRI++LHQPS
Sbjct  200   DEERAFARAEIDNARSAVQRVEESLQEHERMSQASGKQDVEQLMKEVQEARRIKMLHQPS  259

Query  847   KVMDMEHELRALRIQLNEKSVVSFKLQNELAMSKRTEQNKSQLYRIIGSESVGSILRIQP  1026
             KVMDMEHEL+ALR QL EK+    +LQ E+  +K+ E+N   LY + G+E++GS L+IQP
Sbjct  260   KVMDMEHELQALRAQLAEKTRHYLRLQKEITRTKKGEENVPHLYELEGNETLGSYLQIQP  319

Query  1027  CSDEAVDLSKCSIQWYRLSSECSRREPILGADKSVYAPEPIDVGRVLEADIVSNGLKASV  1206
             CSD A DLS CSIQW R+SS+ +++E I GA KSVYAPEP DVGR+L  D++S      +
Sbjct  320   CSDNAPDLSNCSIQWCRVSSDGAKKELISGAIKSVYAPEPFDVGRILHVDVISENQHIIL  379

Query  1207  TTIGQIDQAAGLGNYVETLLRKSNTEFSVVIAQMNGRNYSSRSIHSFHVGKMRMKLNKGW  1386
             +T G ID AAGLG YVE L+RK +TEF+VV+ QM+G ++ + SIH  HVGKMR+KL KG 
Sbjct  380   STTGPIDPAAGLGTYVEALVRKHDTEFNVVVTQMSGLHHPTESIHVLHVGKMRIKLCKGK  439

Query  1387  ITKARDSYSGSMQLCGFRGGGNSAAKSLFWQPRKGQSFVLVFDSERERNGALVVARKHAL  1566
              T A++ YS SMQLCG RGGGN+AA++LFWQP++G SFVL F+SERERN A+++AR+ A 
Sbjct  440   TTIAKEYYSSSMQLCGVRGGGNAAAQALFWQPKQGLSFVLAFESERERNAAIMLARRFAF  499

Query  1567  ECNVSI  1584
             +CN+ +
Sbjct  500   DCNIML  505



>ref|XP_010516253.1| PREDICTED: uncharacterized protein LOC104791943 [Camelina sativa]
 ref|XP_010516254.1| PREDICTED: uncharacterized protein LOC104791943 [Camelina sativa]
 ref|XP_010516255.1| PREDICTED: uncharacterized protein LOC104791943 [Camelina sativa]
Length=491

 Score =   563 bits (1450),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 300/488 (61%), Positives = 384/488 (79%), Gaps = 5/488 (1%)
 Frame = +1

Query  130   MTKVSPEFVGGEVQMYTFKSVSADVSFASNQFPKYKLGPDFQILEEALLENKGPSLKevv  309
             MTKV PE +  E    +   VS DVSFAS+ FP YKLGPD QI+EE   ++KGPS+KE V
Sbjct  1     MTKVCPE-IEEETLSKSAVPVSVDVSFASDHFPTYKLGPDNQIVEEPKEDDKGPSVKETV  59

Query  310   eeettRLTEQHKRLSVRDLASKFDKNLSSAAKLANEAKLRDAPSLEGHVLLKKLRDALET  489
             E+E+  L++QHKRLSVRDLASKFDKNL++A  LA+EAKLR+  SLEGHV+LKKLRDALE 
Sbjct  60    EKESELLSDQHKRLSVRDLASKFDKNLAAAVTLADEAKLREVASLEGHVMLKKLRDALEY  119

Query  490   LKGRLAGRNKEDVEIAIAMVEALAVRLTQKEGDLIQEKFEVNKLVSILKQASEDAKKLVN  669
             ++GR  G+NKEDVE AI+MVEALAV+LTQ EG+LIQEKFEV KL + LKQ SEDAKKLVN
Sbjct  120   MRGRTDGQNKEDVEAAISMVEALAVKLTQNEGELIQEKFEVKKLGNFLKQTSEDAKKLVN  179

Query  670   QERSFACAEIESARAVVQRIGEALEEQEINSQVSGKQ--eveelmeeiqeARRIRVLHQP  843
             QE+SFACAEIE+ARAVV ++GEA EEQE  S+ S  Q  +VE+L+EE+QEAR+I+ +H P
Sbjct  180   QEKSFACAEIETARAVVLKLGEAFEEQERISEASRAQGPDVEKLVEEVQEARQIKRMHHP  239

Query  844   SKVMDMEHELRALRIQLNEKSVVSFKLQNELAMSKRTEQNKSQLYRIIGSESVGSILRIQ  1023
             +KVM M+HEL  LR ++ +K + S KL  E+A+ KR E++KS  + + G +S+GS LRI+
Sbjct  240   TKVMGMQHELYGLRNRIQQKYMNSVKLHKEIAIIKRAEESKSCPFVLEGKQSLGSCLRIR  299

Query  1024  -PCSDEAVDLSKCSIQWYRLSSECSRREPILGADKSVYAPEPIDVGRVLEADIVSNGLKA  1200
                S+ A DLS CSIQWYR + E SRRE I GA +S+YAPEP DVGR+L+ADI+SNG K 
Sbjct  300   VNASENAPDLSNCSIQWYRAACETSRREAISGAIQSMYAPEPFDVGRILQADILSNGQKF  359

Query  1201  SVTTIGQIDQAAGLGNYVETLLRKSNTEFSVVIAQMNGRNYSSRSIHSFHVGKMRMKLNK  1380
             +VTT   +D  + L + VE+L+RKSN+EFSVVI QMNG++Y+SRS H F +GK R+KL++
Sbjct  360   TVTTDDPVDPDSALQSRVESLMRKSNSEFSVVITQMNGQDYASRS-HIFTIGKTRIKLSR  418

Query  1381  GWITKARDSYSGSMQLCGFRGGGNSAAKSLFWQPRKGQSFVLVFDSERERNGALVVARKH  1560
             GWI+KAR+ YS SMQLCG RG   +  K+LFWQPRK  +F+L F+SE+ERN A+V+ARK+
Sbjct  419   GWISKAREIYSTSMQLCGVRGNIKNPTKALFWQPRKSPTFILTFESEQERNAAIVLARKY  478

Query  1561  ALECNVSI  1584
             A +CNVS+
Sbjct  479   AFDCNVSL  486



>ref|XP_009141945.1| PREDICTED: uncharacterized protein LOC103865845 [Brassica rapa]
Length=518

 Score =   563 bits (1452),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 297/488 (61%), Positives = 382/488 (78%), Gaps = 4/488 (1%)
 Frame = +1

Query  130   MTKVSPEFVGGEVQM-YTFKSVSADVSFASNQFPKYKLGPDFQILEEALLENKGPSLKev  306
             MTKV PE      +    F+ +SADVSFASN+FP YKLGPD QI++E   + KGPS+K+V
Sbjct  27    MTKVCPEMKARVCEKSVVFEPISADVSFASNRFPSYKLGPDDQIIDEPEEDEKGPSVKDV  86

Query  307   veeettRLTEQHKRLSVRDLASKFDKNLSSAAKLANEAKLRDAPSLEGHVLLKKLRDALE  486
             V++ET  L++QHKRLSVRDLA KFDKNL++A+KL  EAK ++  SLEGHV+LKKLRDALE
Sbjct  87    VDKETRALSDQHKRLSVRDLACKFDKNLAAASKLVAEAKSKEVNSLEGHVMLKKLRDALE  146

Query  487   TLKGRLAGRNKEDVEIAIAMVEALAVRLTQKEGDLIQEKFEVNKLVSILKQASEDAKKLV  666
              ++GR+ GRNK+ VE AI+MVE+LAV LTQ EG LIQE+FEV KL S LKQASEDAKKLV
Sbjct  147   AMRGRMDGRNKDSVEKAISMVESLAVTLTQHEGGLIQERFEVKKLASFLKQASEDAKKLV  206

Query  667   NQERSFACAEIESARAVVQRIGEALEEQEINSQVSGKQ--eveelmeeiqeARRIRVLHQ  840
             NQERSFACAEIESAR +V R+G    E E  S+ S  Q   VE+L+EE QEARRIR++HQ
Sbjct  207   NQERSFACAEIESARDLVMRLGGEFNESERCSKASQDQGPNVEKLVEEFQEARRIRLMHQ  266

Query  841   PSKVMDMEHELRALRIQLNEKSVVSFKLQNELAMSKRTEQNKSQLYRIIGSESVGSILRI  1020
             P+KVM M+HE+  L+ Q+ EKS  S KLQ E+   KR E +KS  Y + G++S+GS LRI
Sbjct  267   PTKVMGMKHEIHDLKSQIQEKSAYSVKLQREIGRIKRVEGSKSCPYVLDGAQSLGSCLRI  326

Query  1021  QPCSDEAVDLSKCSIQWYRLSSECSRREPILGADKSVYAPEPIDVGRVLEADIVSNGLKA  1200
             +  S+ A D+SKCS+QWYR +SE SRRE I GA++SVYAPEP DVGRV++A ++SN  K 
Sbjct  327   RASSESASDVSKCSVQWYRAASESSRREAISGANRSVYAPEPYDVGRVIQAVVLSNAQKF  386

Query  1201  SVTTIGQIDQAAGLGNYVETLLRKSNTEFSVVIAQMNGRNYSSRSIHSFHVGKMRMKLNK  1380
             +VTT G I+ A+GL + VE+L+RKSN+EF+VVI+QMNG+ ++SRS H F VGK R+KL++
Sbjct  387   TVTTDGPINTASGLQSRVESLMRKSNSEFTVVISQMNGQEHASRS-HVFTVGKTRIKLSR  445

Query  1381  GWITKARDSYSGSMQLCGFRGGGNSAAKSLFWQPRKGQSFVLVFDSERERNGALVVARKH  1560
             GWITKAR+ YS SMQ+CG R   N  AK+LFWQPRKG +F+L F+SE+ERN A+V++RK+
Sbjct  446   GWITKAREIYSNSMQMCGVRDNANVPAKTLFWQPRKGLTFLLTFESEQERNAAIVLSRKY  505

Query  1561  ALECNVSI  1584
             A +C+V++
Sbjct  506   AYDCSVTL  513



>ref|XP_010517525.1| PREDICTED: uncharacterized protein LOC104792948 isoform X2 [Camelina 
sativa]
Length=495

 Score =   562 bits (1449),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 295/467 (63%), Positives = 381/467 (82%), Gaps = 3/467 (1%)
 Frame = +1

Query  190   VSADVSFASNQFPKYKLGPDFQILEEALLENKGPSLKevveeettRLTEQHKRLSVRDLA  369
             +SADVSFA N FP YKLGPD QI++E   ++KG S+K+VV++E   L++Q K+LSVRDLA
Sbjct  25    ISADVSFAFNHFPSYKLGPDDQIVDEPEDDSKGLSVKDVVDKEIGDLSDQQKQLSVRDLA  84

Query  370   SKFDKNLSSAAKLANEAKLRDAPSLEGHVLLKKLRDALETLKGRLAGRNKEDVEIAIAMV  549
              KFDKNL++A+KL +EA L +  SLEGHV+LKKLRDALET++GR+ GRN+E+VE AI+MV
Sbjct  85    CKFDKNLAAASKLVDEANLNEVTSLEGHVMLKKLRDALETVRGRMDGRNREEVEKAISMV  144

Query  550   EALAVRLTQKEGDLIQEKFEVNKLVSILKQASEDAKKLVNQERSFACAEIESARAVVQRI  729
             EALAV+LTQ EG+LIQ+KFEV KL S LK+ASEDAKKLVNQE+SFACAEI+SARA+V R+
Sbjct  145   EALAVKLTQNEGELIQDKFEVKKLASFLKKASEDAKKLVNQEKSFACAEIDSARALVMRL  204

Query  730   GEALEEQEINSQVSGKQ--eveelmeeiqeARRIRVLHQPSKVMDMEHELRALRIQLNEK  903
             G   EEQE+ S+ S +Q   VE+L+EE+QEARRI+ +H+P+KV+ M+HEL  L+ Q+ EK
Sbjct  205   GGTFEEQELCSKASREQGPNVEKLVEEVQEARRIKRMHKPTKVIGMQHELYDLKSQIREK  264

Query  904   SVVSFKLQNELAMSKRTEQNKSQLYRIIGSESVGSILRIQPCSDEAVDLSKCSIQWYRLS  1083
             S  S KLQ E+A+ KR E +KS  Y + G++S+GS LRI+  SD  VD+SKCSIQWYR +
Sbjct  265   SAYSVKLQREIAIIKRAEGSKSCPYVLDGAQSLGSCLRIRTSSDSGVDISKCSIQWYRAA  324

Query  1084  SECSRREPILGADKSVYAPEPIDVGRVLEADIVSNGLKASVTTIGQIDQAAGLGNYVETL  1263
             SE SRRE I GA+ SVYAPEP DVGRV++ADI+ NG K +VTT G I+ AAGL + VE+L
Sbjct  325   SESSRREAISGANCSVYAPEPFDVGRVIQADILLNGQKFTVTTDGPINTAAGLQSRVESL  384

Query  1264  LRKSNTEFSVVIAQMNGRNYSSRSIHSFHVGKMRMKLNKGWITKARDSYSGSMQLCGFRG  1443
             LRKSN+EF+VVI+QMNG++++SRS H F VGK R+KL++GWITKAR+ YS SMQLCG RG
Sbjct  385   LRKSNSEFTVVISQMNGQDHASRS-HVFTVGKARIKLSRGWITKAREIYSTSMQLCGVRG  443

Query  1444  GGNSAAKSLFWQPRKGQSFVLVFDSERERNGALVVARKHALECNVSI  1584
               N  AK+LFWQ RKG +F+L F+SE+ERN A+V+ARK+A +CNV++
Sbjct  444   NANLPAKALFWQLRKGITFLLTFESEQERNAAIVLARKYADDCNVTL  490



>ref|XP_010504553.1| PREDICTED: uncharacterized protein LOC104781546 [Camelina sativa]
 ref|XP_010504554.1| PREDICTED: uncharacterized protein LOC104781546 [Camelina sativa]
Length=491

 Score =   562 bits (1448),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 300/488 (61%), Positives = 385/488 (79%), Gaps = 5/488 (1%)
 Frame = +1

Query  130   MTKVSPEFVGGEVQMYTFKSVSADVSFASNQFPKYKLGPDFQILEEALLENKGPSLKevv  309
             MTKV PE   G +   +   VS DVSFAS+ FP YKLGPD QI++E   ++KGPS+KE V
Sbjct  1     MTKVCPEIEEG-ILSKSAVPVSVDVSFASDHFPTYKLGPDNQIVDEPKEDDKGPSVKETV  59

Query  310   eeettRLTEQHKRLSVRDLASKFDKNLSSAAKLANEAKLRDAPSLEGHVLLKKLRDALET  489
             E+E+  L++QHKRLSVRDLASKFDKNL++A  LA+EAKLR+  SLEGHV+LKKLRDALE 
Sbjct  60    EKESELLSDQHKRLSVRDLASKFDKNLAAAVSLADEAKLREVASLEGHVMLKKLRDALEY  119

Query  490   LKGRLAGRNKEDVEIAIAMVEALAVRLTQKEGDLIQEKFEVNKLVSILKQASEDAKKLVN  669
             ++GR  G+NKEDVE AI+MVEALAV+LTQ EG+LIQEKFEV KL + LKQ SEDAKKLVN
Sbjct  120   MRGRTDGQNKEDVETAISMVEALAVKLTQNEGELIQEKFEVKKLGNFLKQTSEDAKKLVN  179

Query  670   QERSFACAEIESARAVVQRIGEALEEQEINSQVSGKQ--eveelmeeiqeARRIRVLHQP  843
             QE+SFACAEIE+ARAVV ++GEA EEQE  S+ S  Q  +VE+L+EE+QEAR+I+ +H P
Sbjct  180   QEKSFACAEIETARAVVLKLGEAFEEQERISEASRAQGPDVEKLVEEVQEARQIKRMHHP  239

Query  844   SKVMDMEHELRALRIQLNEKSVVSFKLQNELAMSKRTEQNKSQLYRIIGSESVGSILRIQ  1023
             +KVM M+HEL  LR ++ EK + S KL  E+A+ KR E++KS  + + G +S+GS LRI+
Sbjct  240   TKVMGMQHELYGLRNRIQEKYMNSVKLHKEIAIIKRAEESKSCPFVLEGKQSLGSCLRIR  299

Query  1024  -PCSDEAVDLSKCSIQWYRLSSECSRREPILGADKSVYAPEPIDVGRVLEADIVSNGLKA  1200
                S+ A DLS CSIQWYR + E SRRE I GA +S+YAPEP DVGR+L+ADI+SNG K 
Sbjct  300   VNASENAPDLSNCSIQWYRAACETSRREAISGAIQSMYAPEPFDVGRILQADILSNGQKF  359

Query  1201  SVTTIGQIDQAAGLGNYVETLLRKSNTEFSVVIAQMNGRNYSSRSIHSFHVGKMRMKLNK  1380
             +VTT   +D  + L + VE+L+RKSN+EFSVVI+QMNG++Y+SRS H F +GK R+KL++
Sbjct  360   TVTTDDPVDPDSALQSRVESLMRKSNSEFSVVISQMNGQDYASRS-HIFTIGKTRIKLSR  418

Query  1381  GWITKARDSYSGSMQLCGFRGGGNSAAKSLFWQPRKGQSFVLVFDSERERNGALVVARKH  1560
             GWI+KAR+ YS SMQLCG RG   +  K+LFWQPRK  +F+L F+SE+ERN A+V+ARK+
Sbjct  419   GWISKAREIYSTSMQLCGVRGNIKNPTKALFWQPRKSLTFMLTFESEQERNAAIVLARKY  478

Query  1561  ALECNVSI  1584
             A +CNVS+
Sbjct  479   AFDCNVSL  486



>emb|CDX71487.1| BnaC04g17220D [Brassica napus]
Length=604

 Score =   565 bits (1457),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 295/488 (60%), Positives = 392/488 (80%), Gaps = 2/488 (0%)
 Frame = +1

Query  124   GKMTKVSPEFVGG-EVQMYTFKSVSADVSFASNQFPKYKLGPDFQILEEALLENKGPSLK  300
             G MT+V+ +F      ++    +VSADV FAS++FP Y++G + QI +    + K  S+K
Sbjct  106   GTMTRVTRDFRDSLHKEVVPAAAVSADVRFASSRFPNYRIGANDQIFD-VKDDPKVLSMK  164

Query  301   evveeettRLTEQHKRLSVRDLASKFDKNLSSAAKLANEAKLRDAPSLEGHVLLKKLRDA  480
             EVV  ET +L +Q KR+SVRDLA+KF+K L++AAKL+ EAKL++A SLE HVLLKKLRDA
Sbjct  165   EVVARETAQLMDQQKRMSVRDLANKFEKGLAAAAKLSEEAKLKEATSLEKHVLLKKLRDA  224

Query  481   LETLKGRLAGRNKEDVEIAIAMVEALAVRLTQKEGDLIQEKFEVNKLVSILKQASEDAKK  660
             LE+L+GR+AGRNK+DVE AIAMVEALAV+LTQ+EG+L  EK EV KL S LKQASEDAKK
Sbjct  225   LESLRGRVAGRNKDDVEEAIAMVEALAVQLTQREGELFIEKAEVKKLASFLKQASEDAKK  284

Query  661   LVNQERSFACAEIESARAVVQRIGEALEEQEINSQVSGKQeveelmeeiqeARRIRVLHQ  840
             +V++ER+FA AEIESARA VQR+ EAL E E  S+ SGKQ++E+LM+E+QEARRI++LHQ
Sbjct  285   IVDEERAFARAEIESARAAVQRVEEALREHEQMSRASGKQDMEDLMKEVQEARRIKMLHQ  344

Query  841   PSKVMDMEHELRALRIQLNEKSVVSFKLQNELAMSKRTEQNKSQLYRIIGSESVGSILRI  1020
             PSKVMDME+ELRALR QL EKS    +L+ +LA+ +++E+N S LY I G+E++GS LR+
Sbjct  345   PSKVMDMEYELRALRNQLAEKSKHFLQLKKKLALCRKSEENVSLLYEIDGNEALGSCLRV  404

Query  1021  QPCSDEAVDLSKCSIQWYRLSSECSRREPILGADKSVYAPEPIDVGRVLEADIVSNGLKA  1200
             +PCSDEA DLSKC+IQWYR SS+ +++E I GA KSVYAPEP DVGR L ADI+ NG   
Sbjct  405   RPCSDEAPDLSKCTIQWYRSSSDDTKKELISGATKSVYAPEPFDVGRALHADIIYNGHTL  464

Query  1201  SVTTIGQIDQAAGLGNYVETLLRKSNTEFSVVIAQMNGRNYSSRSIHSFHVGKMRMKLNK  1380
             S++T+G+ID AAGLG+YVE L+RK + +F+VV+ QM+G +++S SIH FHVGKMR+KL K
Sbjct  465   SLSTVGKIDPAAGLGSYVEALVRKHDVDFNVVVTQMSGEDHTSESIHLFHVGKMRIKLCK  524

Query  1381  GWITKARDSYSGSMQLCGFRGGGNSAAKSLFWQPRKGQSFVLVFDSERERNGALVVARKH  1560
             G    A++ YS +MQLCG RGGGN+AA++++WQ +KG SFV+ F+SERERN A+++AR+ 
Sbjct  525   GKTVIAKEYYSSAMQLCGVRGGGNAAAQAVYWQAKKGVSFVVAFESERERNAAIMLARRF  584

Query  1561  ALECNVSI  1584
             A +CNV++
Sbjct  585   ACDCNVTL  592



>ref|XP_006836249.1| hypothetical protein AMTR_s00101p00130320 [Amborella trichopoda]
 gb|ERM99102.1| hypothetical protein AMTR_s00101p00130320 [Amborella trichopoda]
Length=493

 Score =   561 bits (1446),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 296/474 (62%), Positives = 379/474 (80%), Gaps = 2/474 (0%)
 Frame = +1

Query  166   VQMYTFKSVSADVSFASNQFPKYKLGPDFQILEEALLENKGPSLKevveeettRLTEQHK  345
             +Q  T KSVSADV+F SN+FP YK+G +  I+E +   + GPSLKE+V  ET +L EQ K
Sbjct  12    MQNDTVKSVSADVNFLSNRFPNYKIGANDSIVE-SKEGSDGPSLKEIVAHETAQLLEQQK  70

Query  346   RLSVRDLASKFDKNLSSAAKLANEAKLRDAPSLEGHVLLKKLRDALETLKGRLAGRNKED  525
             RLSVRDLASKF+K L++AAKL++EAK R+  SL+  VLLKKLRD LE+L+GR+AGRNK+D
Sbjct  71    RLSVRDLASKFEKGLAAAAKLSDEAKFRETASLDKQVLLKKLRDVLESLRGRVAGRNKDD  130

Query  526   VEIAIAMVEALAVRLTQKEGDLIQEKFEVNKLVSILKQASEDAKKLVNQERSFACAEIES  705
             VE AI+MVEALAV+LTQ+EG+L+ EK EV KL S LKQASEDAK++V + R+FA AEIE 
Sbjct  131   VEEAISMVEALAVQLTQREGELLHEKSEVKKLASFLKQASEDAKRMVEEARAFAQAEIEK  190

Query  706   ARAVVQRIGEALEEQEINSQVSGKQeveelmeeiqeARRIRVLHQPSKVMDMEHELRALR  885
             ARA VQ + +A EEQE  S+ S KQ+++ELM+E+QEARRI++LHQPSKVMDMEHEL+ALR
Sbjct  191   ARASVQIVEQAFEEQENISRSSDKQDLDELMKEVQEARRIKMLHQPSKVMDMEHELQALR  250

Query  886   IQLNEKSVVSFKLQNELAMSKRTEQNKSQLYRIIGSESVGSILRIQPCSDEAVDLSKCSI  1065
             IQL EKS  S +L+ EL MSKR E+  S+L  + G ES+GS LRI P  +  +D+S+C+I
Sbjct  251   IQLAEKSKYSLQLRKELVMSKRLEEGDSKLCELDGDESLGSYLRIVPNVNTTLDISRCTI  310

Query  1066  QWYRLSSECSRREPILGADKSVYAPEPIDVGRVLEADIVSNGLKASVTTIGQIDQAAGLG  1245
             QW+R+S+E S+RE I GA KSVYAPEP DVGR L+A+IV++G K  VTT G I+ A GLG
Sbjct  311   QWFRISAERSKRERISGATKSVYAPEPFDVGRYLQAEIVADGEKLLVTTTGPIEPAPGLG  370

Query  1246  NYVETLLRKSNTEFSVVIAQMNGRNYSSRSIHSFHVGKMRMKLNKGWITKARDSYSGSMQ  1425
             NYVE L+RK +TEF+VV+ QMNG ++ S S+H FHVGKMR+KL KG ITKA++ YS SMQ
Sbjct  371   NYVEALVRKPDTEFNVVL-QMNGVDHPSHSLHVFHVGKMRIKLRKGRITKAKEPYSSSMQ  429

Query  1426  LCGFRGGGNSAAKSLFWQPRKGQSFVLVFDSERERNGALVVARKHALECNVSIT  1587
             LCG RGGGN+AA++LFWQP+KG SF L F+SERERN A+++AR+ A +CN+ + 
Sbjct  430   LCGLRGGGNAAAQALFWQPKKGVSFTLAFESERERNAAIMLARRFAFDCNIMLA  483



>ref|XP_009104004.1| PREDICTED: uncharacterized protein LOC103830056 [Brassica rapa]
 ref|XP_009104005.1| PREDICTED: uncharacterized protein LOC103830056 [Brassica rapa]
 ref|XP_009104007.1| PREDICTED: uncharacterized protein LOC103830056 [Brassica rapa]
Length=491

 Score =   561 bits (1445),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 296/488 (61%), Positives = 381/488 (78%), Gaps = 5/488 (1%)
 Frame = +1

Query  130   MTKVSPEFVGGEVQMYTFKSVSADVSFASNQFPKYKLGPDFQILEEALLENKGPSLKevv  309
             MTKV PE  G         +VS DVSFASN FP Y LGPD +I++E   + KGPS+KE V
Sbjct  1     MTKVCPE-TGERTLQEPVLTVSTDVSFASNHFPTYTLGPDNEIVDEPKEDEKGPSVKETV  59

Query  310   eeettRLTEQHKRLSVRDLASKFDKNLSSAAKLANEAKLRDAPSLEGHVLLKKLRDALET  489
             EEE+  L++QHKRLSVRDLASKFDK L++A  LA+EAKL++  SLEGHV+LKKLRDALE 
Sbjct  60    EEESQLLSDQHKRLSVRDLASKFDKKLAAAVSLADEAKLKEVASLEGHVMLKKLRDALEY  119

Query  490   LKGRLAGRNKEDVEIAIAMVEALAVRLTQKEGDLIQEKFEVNKLVSILKQASEDAKKLVN  669
             ++GR  G+NKEDVE AI+MVEALAV+LTQ EG+LIQEKFEV KL + LKQ SEDAKKLVN
Sbjct  120   MRGRTDGQNKEDVEKAISMVEALAVKLTQNEGELIQEKFEVKKLGNFLKQTSEDAKKLVN  179

Query  670   QERSFACAEIESARAVVQRIGEALEEQEINSQVSGKQ--eveelmeeiqeARRIRVLHQP  843
              E+SFACAEIESARAVV R+GEA EEQE +S+ S  Q  +VE+++EE+QEAR+I+ +H P
Sbjct  180   HEKSFACAEIESARAVVLRLGEAFEEQERSSKASRAQGPDVEKMVEEVQEARQIKRMHHP  239

Query  844   SKVMDMEHELRALRIQLNEKSVVSFKLQNELAMSKRTEQNKSQLYRIIGSESVGSILRIQ  1023
             +KVM M+HEL  LR ++ EK + S +L  E+A  KR E++KS  + +  ++S+GS L+I+
Sbjct  240   TKVMGMQHELHGLRSRIQEKYMNSVRLHQEIATIKRAEESKSCPFVLESTQSLGSCLKIR  299

Query  1024  -PCSDEAVDLSKCSIQWYRLSSECSRREPILGADKSVYAPEPIDVGRVLEADIVSNGLKA  1200
                 D A+DLS CSIQWYR + E SRRE I GA++ VYAPEP DVGR+L+ADI+SNG K 
Sbjct  300   VNAPDNAIDLSNCSIQWYRAACETSRREAISGANQVVYAPEPFDVGRILQADILSNGHKV  359

Query  1201  SVTTIGQIDQAAGLGNYVETLLRKSNTEFSVVIAQMNGRNYSSRSIHSFHVGKMRMKLNK  1380
             +VTT G I+  AGL + +++L++KSN+EFSVVI+QMNG++Y+SRS H F VGK R+KL++
Sbjct  360   TVTTNGPINPEAGLQSRIDSLMKKSNSEFSVVISQMNGQDYASRS-HVFTVGKTRIKLSR  418

Query  1381  GWITKARDSYSGSMQLCGFRGGGNSAAKSLFWQPRKGQSFVLVFDSERERNGALVVARKH  1560
             GWITKAR+ YS SMQLCG RG   + AK+LFWQPRK  +F L F+SE+ERN A+ +ARK+
Sbjct  419   GWITKAREIYSTSMQLCGVRGNIKAPAKALFWQPRKSLTFTLTFESEQERNTAIALARKY  478

Query  1561  ALECNVSI  1584
             A +CNV++
Sbjct  479   AFDCNVTL  486



>ref|XP_010557466.1| PREDICTED: uncharacterized protein LOC104826463 [Tarenaya hassleriana]
 ref|XP_010557467.1| PREDICTED: uncharacterized protein LOC104826463 [Tarenaya hassleriana]
 ref|XP_010557468.1| PREDICTED: uncharacterized protein LOC104826463 [Tarenaya hassleriana]
 ref|XP_010557469.1| PREDICTED: uncharacterized protein LOC104826463 [Tarenaya hassleriana]
Length=494

 Score =   561 bits (1445),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 294/486 (60%), Positives = 388/486 (80%), Gaps = 2/486 (0%)
 Frame = +1

Query  130   MTKVSPEFVGGEVQMYTFKSVSADVSFASNQFPKYKLGPDFQILEEALLENKGPSLKevv  309
             MT+V+ + +G  VQ     +VSADV FAS++FP Y++G + QI +    + K  S++EVV
Sbjct  1     MTRVTLD-LGDSVQKDAVSAVSADVKFASSRFPNYRIGTNDQIFD-VKDDPKVLSMREVV  58

Query  310   eeettRLTEQHKRLSVRDLASKFDKNLSSAAKLANEAKLRDAPSLEGHVLLKKLRDALET  489
               ET +L EQ  RLSVRDLA+KF+K L++AAKL+ EAKL++A SLE HVLLKKLRDALE+
Sbjct  59    ARETAQLLEQQTRLSVRDLANKFEKGLAAAAKLSEEAKLKEAASLEKHVLLKKLRDALES  118

Query  490   LKGRLAGRNKEDVEIAIAMVEALAVRLTQKEGDLIQEKFEVNKLVSILKQASEDAKKLVN  669
             LKGR+AGRNK+DVE AI+MVEA AV+L  +EG+L QEK EV KL ++LKQASEDAKKLV+
Sbjct  119   LKGRVAGRNKDDVEEAISMVEAFAVQLILREGELFQEKAEVKKLAAVLKQASEDAKKLVD  178

Query  670   QERSFACAEIESARAVVQRIGEALEEQEINSQVSGKQeveelmeeiqeARRIRVLHQPSK  849
             +ER+FA AEIESARA VQR+ EA+ E E  S+VSGKQ++EELM+E+QEARRI++LHQPSK
Sbjct  179   EERAFARAEIESARAAVQRVEEAIHEHERMSRVSGKQDMEELMKEVQEARRIKMLHQPSK  238

Query  850   VMDMEHELRALRIQLNEKSVVSFKLQNELAMSKRTEQNKSQLYRIIGSESVGSILRIQPC  1029
             VMDME+ELRALR QL EK   S +LQ +LAM +++++  S LY I GSE++GS LRI+PC
Sbjct  239   VMDMEYELRALRNQLAEKCRHSLQLQKKLAMCRKSKEGVSLLYEIDGSEALGSCLRIKPC  298

Query  1030  SDEAVDLSKCSIQWYRLSSECSRREPILGADKSVYAPEPIDVGRVLEADIVSNGLKASVT  1209
             SD+A D+SKCSIQWYRLSS+ S++EPI GA K  YAPEP DVGR L A+I+ +G   +++
Sbjct  299   SDDAPDISKCSIQWYRLSSDGSKKEPISGATKPAYAPEPFDVGRALNAEILYDGHSFTLS  358

Query  1210  TIGQIDQAAGLGNYVETLLRKSNTEFSVVIAQMNGRNYSSRSIHSFHVGKMRMKLNKGWI  1389
             T+G+ID AAGLG+YVE L+RK + +F+VV+ QM+G ++   SIH FHVGKMR+KL KG  
Sbjct  359   TVGKIDPAAGLGSYVEALVRKHDVDFNVVVTQMSGEDHPPESIHVFHVGKMRIKLCKGKT  418

Query  1390  TKARDSYSGSMQLCGFRGGGNSAAKSLFWQPRKGQSFVLVFDSERERNGALVVARKHALE  1569
               A++ YS +MQLCG RGGGN+AA++L+WQ +KG SFV+ F+SERERN A+++AR+ A +
Sbjct  419   VIAKEYYSIAMQLCGVRGGGNAAAQALYWQAKKGISFVIAFESERERNAAIMLARRFAFD  478

Query  1570  CNVSIT  1587
             CNV++ 
Sbjct  479   CNVTLA  484



>ref|XP_011080459.1| PREDICTED: uncharacterized protein LOC105163715 [Sesamum indicum]
Length=494

 Score =   560 bits (1444),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 295/485 (61%), Positives = 384/485 (79%), Gaps = 2/485 (0%)
 Frame = +1

Query  130   MTKVSPEFVGGEVQMYTFKSVSADVSFASNQFPKYKLGPDFQILEEALLENKGPSLKevv  309
             MT +S +F    +Q      VSADV FAS++FP YK+G + QI+E    +++  S+K++V
Sbjct  1     MTMLSRDF-SYTMQKDMVSPVSADVFFASSRFPNYKIGANNQIVE-VKEDSRTSSMKDMV  58

Query  310   eeettRLTEQHKRLSVRDLASKFDKNLSSAAKLANEAKLRDAPSLEGHVLLKKLRDALET  489
               ET  L EQ KRLSVRDLASKF+K L++AAKL++EA+L++A SLE HVLLKKLRDALE 
Sbjct  59    ARETALLLEQQKRLSVRDLASKFEKGLAAAAKLSDEARLKEAASLEKHVLLKKLRDALEA  118

Query  490   LKGRLAGRNKEDVEIAIAMVEALAVRLTQKEGDLIQEKFEVNKLVSILKQASEDAKKLVN  669
             LKGR+AG+NK+DVE AIAMVEALAV+LTQ+EG+LIQEK EV KL + LKQASEDAKKLV+
Sbjct  119   LKGRVAGKNKDDVEEAIAMVEALAVQLTQREGELIQEKAEVKKLATFLKQASEDAKKLVD  178

Query  670   QERSFACAEIESARAVVQRIGEALEEQEINSQVSGKQeveelmeeiqeARRIRVLHQPSK  849
             +ER+FA AEIE+ARA VQR+ EAL+E E  S+ SGKQ+V+ELM+E+QEARRI++LHQPS+
Sbjct  179   EERAFARAEIENARAAVQRVEEALQEHEQMSRASGKQDVDELMKEVQEARRIKMLHQPSR  238

Query  850   VMDMEHELRALRIQLNEKSVVSFKLQNELAMSKRTEQNKSQLYRIIGSESVGSILRIQPC  1029
             VMDMEHEL+ALRIQL EKS  S +LQ ELA+SK+ +++   LY I G+ ++GS L I PC
Sbjct  239   VMDMEHELQALRIQLAEKSKHSLQLQKELALSKKGDKDAPHLYDIDGTLALGSYLLIYPC  298

Query  1030  SDEAVDLSKCSIQWYRLSSECSRREPILGADKSVYAPEPIDVGRVLEADIVSNGLKASVT  1209
             SD A +LS+C+ QWYR +SE  ++EPI GA KSVYAPEP DVG++L+ADI+      ++T
Sbjct  299   SDSAPELSECAFQWYRSTSEGGKKEPISGATKSVYAPEPFDVGQILQADILIADHTITLT  358

Query  1210  TIGQIDQAAGLGNYVETLLRKSNTEFSVVIAQMNGRNYSSRSIHSFHVGKMRMKLNKGWI  1389
             T   ID A GLGNYVE L+R+  TEF+VVI QMNG ++ S+SIH  HVGKMR+KL KG  
Sbjct  359   TSAPIDPAPGLGNYVEALVRRHETEFNVVIIQMNGVDHPSQSIHVLHVGKMRIKLCKGKT  418

Query  1390  TKARDSYSGSMQLCGFRGGGNSAAKSLFWQPRKGQSFVLVFDSERERNGALVVARKHALE  1569
             T A++ YS SMQLCG RGGGN+AA++++WQ + G SFVL F+SERERN A+++AR+ A +
Sbjct  419   TMAKEYYSNSMQLCGVRGGGNAAAQAVYWQAKVGLSFVLAFESERERNAAIMLARRFAFD  478

Query  1570  CNVSI  1584
             CN+++
Sbjct  479   CNITL  483



>ref|XP_010517524.1| PREDICTED: uncharacterized protein LOC104792948 isoform X1 [Camelina 
sativa]
Length=541

 Score =   562 bits (1449),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 295/467 (63%), Positives = 381/467 (82%), Gaps = 3/467 (1%)
 Frame = +1

Query  190   VSADVSFASNQFPKYKLGPDFQILEEALLENKGPSLKevveeettRLTEQHKRLSVRDLA  369
             +SADVSFA N FP YKLGPD QI++E   ++KG S+K+VV++E   L++Q K+LSVRDLA
Sbjct  71    ISADVSFAFNHFPSYKLGPDDQIVDEPEDDSKGLSVKDVVDKEIGDLSDQQKQLSVRDLA  130

Query  370   SKFDKNLSSAAKLANEAKLRDAPSLEGHVLLKKLRDALETLKGRLAGRNKEDVEIAIAMV  549
              KFDKNL++A+KL +EA L +  SLEGHV+LKKLRDALET++GR+ GRN+E+VE AI+MV
Sbjct  131   CKFDKNLAAASKLVDEANLNEVTSLEGHVMLKKLRDALETVRGRMDGRNREEVEKAISMV  190

Query  550   EALAVRLTQKEGDLIQEKFEVNKLVSILKQASEDAKKLVNQERSFACAEIESARAVVQRI  729
             EALAV+LTQ EG+LIQ+KFEV KL S LK+ASEDAKKLVNQE+SFACAEI+SARA+V R+
Sbjct  191   EALAVKLTQNEGELIQDKFEVKKLASFLKKASEDAKKLVNQEKSFACAEIDSARALVMRL  250

Query  730   GEALEEQEINSQVSGKQ--eveelmeeiqeARRIRVLHQPSKVMDMEHELRALRIQLNEK  903
             G   EEQE+ S+ S +Q   VE+L+EE+QEARRI+ +H+P+KV+ M+HEL  L+ Q+ EK
Sbjct  251   GGTFEEQELCSKASREQGPNVEKLVEEVQEARRIKRMHKPTKVIGMQHELYDLKSQIREK  310

Query  904   SVVSFKLQNELAMSKRTEQNKSQLYRIIGSESVGSILRIQPCSDEAVDLSKCSIQWYRLS  1083
             S  S KLQ E+A+ KR E +KS  Y + G++S+GS LRI+  SD  VD+SKCSIQWYR +
Sbjct  311   SAYSVKLQREIAIIKRAEGSKSCPYVLDGAQSLGSCLRIRTSSDSGVDISKCSIQWYRAA  370

Query  1084  SECSRREPILGADKSVYAPEPIDVGRVLEADIVSNGLKASVTTIGQIDQAAGLGNYVETL  1263
             SE SRRE I GA+ SVYAPEP DVGRV++ADI+ NG K +VTT G I+ AAGL + VE+L
Sbjct  371   SESSRREAISGANCSVYAPEPFDVGRVIQADILLNGQKFTVTTDGPINTAAGLQSRVESL  430

Query  1264  LRKSNTEFSVVIAQMNGRNYSSRSIHSFHVGKMRMKLNKGWITKARDSYSGSMQLCGFRG  1443
             LRKSN+EF+VVI+QMNG++++SRS H F VGK R+KL++GWITKAR+ YS SMQLCG RG
Sbjct  431   LRKSNSEFTVVISQMNGQDHASRS-HVFTVGKARIKLSRGWITKAREIYSTSMQLCGVRG  489

Query  1444  GGNSAAKSLFWQPRKGQSFVLVFDSERERNGALVVARKHALECNVSI  1584
               N  AK+LFWQ RKG +F+L F+SE+ERN A+V+ARK+A +CNV++
Sbjct  490   NANLPAKALFWQLRKGITFLLTFESEQERNAAIVLARKYADDCNVTL  536



>emb|CDY06958.1| BnaA04g23570D [Brassica napus]
Length=519

 Score =   561 bits (1446),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 298/489 (61%), Positives = 381/489 (78%), Gaps = 5/489 (1%)
 Frame = +1

Query  130   MTKVSPEFVGGEV--QMYTFKSVSADVSFASNQFPKYKLGPDFQILEEALLENKGPSLKe  303
             MTKV PE     V  +   F+ +SADVSFASN+FP YKLGPD QI++E   + KGPS+K+
Sbjct  27    MTKVCPEMKARRVCEKSVVFEPISADVSFASNRFPSYKLGPDDQIIDEPEEDEKGPSVKD  86

Query  304   vveeettRLTEQHKRLSVRDLASKFDKNLSSAAKLANEAKLRDAPSLEGHVLLKKLRDAL  483
             VV++ET  L++QHKRLSVRDLA KFDKNL++A+KL  EAK  +  SLEGHV+LKKLRDAL
Sbjct  87    VVDKETRDLSDQHKRLSVRDLACKFDKNLAAASKLVAEAKSNEVTSLEGHVMLKKLRDAL  146

Query  484   ETLKGRLAGRNKEDVEIAIAMVEALAVRLTQKEGDLIQEKFEVNKLVSILKQASEDAKKL  663
             E ++GR+ GRNK+ VE AI+MVE+LAV LTQ EG LIQE+FEV KL S LKQASEDAKKL
Sbjct  147   EAMRGRMDGRNKDSVEKAISMVESLAVTLTQHEGGLIQERFEVKKLASFLKQASEDAKKL  206

Query  664   VNQERSFACAEIESARAVVQRIGEALEEQEINSQVSGKQ--eveelmeeiqeARRIRVLH  837
             VNQERSFACAEIESAR +V R+G    E E  S+ S  Q   VE+L+EE+QEARRIR++H
Sbjct  207   VNQERSFACAEIESARDLVMRLGGEFNESERCSKASQDQGPNVEKLVEEVQEARRIRLMH  266

Query  838   QPSKVMDMEHELRALRIQLNEKSVVSFKLQNELAMSKRTEQNKSQLYRIIGSESVGSILR  1017
             QP+KVM M+HE+  L+ Q+ EKS  S KLQ E+   KR E +KS  Y + G++S+GS LR
Sbjct  267   QPTKVMGMKHEIHDLKSQIQEKSAYSVKLQREIGRIKRVEGSKSCPYVLEGAQSLGSCLR  326

Query  1018  IQPCSDEAVDLSKCSIQWYRLSSECSRREPILGADKSVYAPEPIDVGRVLEADIVSNGLK  1197
             I+  S+ A D+SKCS+QWYR +SE S    I GA++SVYAPEP DVGRV++ADI+SNG K
Sbjct  327   IRASSESASDVSKCSVQWYRAASESSFMLSISGANRSVYAPEPYDVGRVIQADILSNGQK  386

Query  1198  ASVTTIGQIDQAAGLGNYVETLLRKSNTEFSVVIAQMNGRNYSSRSIHSFHVGKMRMKLN  1377
              +VTT G I+ A+GL + VE+L+RKSN+EF+VVI+QMNG+ ++SRS H   VGK R+KL+
Sbjct  387   LTVTTDGPINTASGLQSRVESLMRKSNSEFTVVISQMNGQEHASRS-HVLTVGKTRIKLS  445

Query  1378  KGWITKARDSYSGSMQLCGFRGGGNSAAKSLFWQPRKGQSFVLVFDSERERNGALVVARK  1557
             +GWITKAR+ YS SMQ+CG R   N  AK+LFWQPRKG SF+L F+SE+ERN A+V++RK
Sbjct  446   RGWITKAREIYSTSMQMCGVRDNANVPAKTLFWQPRKGLSFLLTFESEQERNAAIVLSRK  505

Query  1558  HALECNVSI  1584
             +A +C+V++
Sbjct  506   YAYDCSVTL  514



>emb|CDY32017.1| BnaC06g15950D [Brassica napus]
Length=491

 Score =   560 bits (1442),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 297/488 (61%), Positives = 382/488 (78%), Gaps = 5/488 (1%)
 Frame = +1

Query  130   MTKVSPEFVGGEVQMYTFKSVSADVSFASNQFPKYKLGPDFQILEEALLENKGPSLKevv  309
             MTKV PE     +Q  T  +VS DVSFASN FP YKLGPD +I++E   + KGPS+KE V
Sbjct  1     MTKVCPETEERTLQ-ETVLTVSTDVSFASNHFPTYKLGPDNEIVDEPKEDEKGPSVKETV  59

Query  310   eeettRLTEQHKRLSVRDLASKFDKNLSSAAKLANEAKLRDAPSLEGHVLLKKLRDALET  489
             EEE+  L++QHKRLSVRDLASKFDK L++A  LA+EAKL++  SLEGHV+LKKLRDALE 
Sbjct  60    EEESQLLSDQHKRLSVRDLASKFDKKLAAAVSLADEAKLKEVASLEGHVMLKKLRDALEY  119

Query  490   LKGRLAGRNKEDVEIAIAMVEALAVRLTQKEGDLIQEKFEVNKLVSILKQASEDAKKLVN  669
             ++GR  G+NKEDVE AI+MVEALAV+LTQ EG+LIQEKFEV KL + LKQASEDAKKLVN
Sbjct  120   MRGRTDGQNKEDVEKAISMVEALAVKLTQNEGELIQEKFEVKKLGNFLKQASEDAKKLVN  179

Query  670   QERSFACAEIESARAVVQRIGEALEEQEINSQVSGKQ--eveelmeeiqeARRIRVLHQP  843
              E+SFACAEIESARAVV R+GEA EEQ+ +S+ S  Q  +VE+L EE+QEAR+I+ +H  
Sbjct  180   HEKSFACAEIESARAVVLRLGEAFEEQKRSSEASRAQGPDVEKLAEEVQEARQIKRMHHS  239

Query  844   SKVMDMEHELRALRIQLNEKSVVSFKLQNELAMSKRTEQNKSQLYRIIGSESVGSILRIQ  1023
             +KVM M+HEL  LR ++ EK + S +L  E+A  KR E++ S  + + G++S+GS L+I 
Sbjct  240   TKVMGMQHELHGLRSRIQEKYMNSVRLHQEIATIKRAEESMSCPFVLEGTQSLGSCLKIH  299

Query  1024  -PCSDEAVDLSKCSIQWYRLSSECSRREPILGADKSVYAPEPIDVGRVLEADIVSNGLKA  1200
                 D A+DLS CSIQWYR + E SRRE I GA+++VYAPEP DVGR+L+ADI+SNG K 
Sbjct  300   VSAPDNAIDLSNCSIQWYRAACETSRREAISGANQAVYAPEPFDVGRILQADILSNGQKV  359

Query  1201  SVTTIGQIDQAAGLGNYVETLLRKSNTEFSVVIAQMNGRNYSSRSIHSFHVGKMRMKLNK  1380
             +VTT G ID  AGL + +E+L++KSN++FSVVI+QMNG++Y+SRS H   +GK R+KL++
Sbjct  360   TVTTDGPIDPDAGLQSRIESLMKKSNSDFSVVISQMNGQDYASRS-HVLTIGKTRIKLSR  418

Query  1381  GWITKARDSYSGSMQLCGFRGGGNSAAKSLFWQPRKGQSFVLVFDSERERNGALVVARKH  1560
             GWITKAR+ YS SMQLCG RG   + AK+LFWQPRK  +F L F+SE+ERN A+ +ARK+
Sbjct  419   GWITKAREIYSTSMQLCGVRGNIKAPAKALFWQPRKSLTFTLTFESEQERNTAISLARKY  478

Query  1561  ALECNVSI  1584
             A +CNV++
Sbjct  479   AFDCNVTL  486



>ref|XP_011090182.1| PREDICTED: uncharacterized protein LOC105170938 isoform X1 [Sesamum 
indicum]
Length=499

 Score =   558 bits (1439),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 289/465 (62%), Positives = 372/465 (80%), Gaps = 1/465 (0%)
 Frame = +1

Query  190   VSADVSFASNQFPKYKLGPDFQILEEALLENKGPSLKevveeettRLTEQHKRLSVRDLA  369
             VSADV FAS +FPKYK+G + QI+E    + K  S KE+V  ET  L EQ +RLSVRDLA
Sbjct  25    VSADVVFASTRFPKYKIGANNQIVE-VKEDQKMLSHKEMVARETALLLEQQQRLSVRDLA  83

Query  370   SKFDKNLSSAAKLANEAKLRDAPSLEGHVLLKKLRDALETLKGRLAGRNKEDVEIAIAMV  549
             SKF+K  ++AAKL++EA+L++A SLE HVLLKKLRDALE L+GR+ G+NK+DVE AIAM+
Sbjct  84    SKFEKGSAAAAKLSDEARLKEAASLEKHVLLKKLRDALEALRGRVGGKNKDDVEEAIAMI  143

Query  550   EALAVRLTQKEGDLIQEKFEVNKLVSILKQASEDAKKLVNQERSFACAEIESARAVVQRI  729
             EALAV+LTQ+EG+LIQEK EV KL + LKQASEDAKKLV++ER+FA AEIE+ARA VQR+
Sbjct  144   EALAVQLTQREGELIQEKAEVKKLATFLKQASEDAKKLVDEERAFARAEIENARAAVQRV  203

Query  730   GEALEEQEINSQVSGKQeveelmeeiqeARRIRVLHQPSKVMDMEHELRALRIQLNEKSV  909
              EAL+E E  S+ SGKQ+++ELM+E+QEARRI++LHQPS+VMDME+EL+ALRIQL EKS 
Sbjct  204   EEALQEHERISRASGKQDLDELMKEVQEARRIKMLHQPSRVMDMENELQALRIQLAEKSK  263

Query  910   VSFKLQNELAMSKRTEQNKSQLYRIIGSESVGSILRIQPCSDEAVDLSKCSIQWYRLSSE  1089
              S +LQ EL MSK+ ++NK  LY I G E++GS LRI PCSD A DLS+C+IQWYR ++E
Sbjct  264   CSLQLQKELEMSKKGDKNKPHLYEIDGMEALGSYLRIYPCSDSAPDLSECTIQWYRSTAE  323

Query  1090  CSRREPILGADKSVYAPEPIDVGRVLEADIVSNGLKASVTTIGQIDQAAGLGNYVETLLR  1269
               +RE I GA KS YAPEP DVGR+L+ADI ++    ++ T   ID AAGLGNYVE L+R
Sbjct  324   GGKRELISGATKSEYAPEPFDVGRILQADISTSDHTTTIMTSAPIDPAAGLGNYVEALVR  383

Query  1270  KSNTEFSVVIAQMNGRNYSSRSIHSFHVGKMRMKLNKGWITKARDSYSGSMQLCGFRGGG  1449
             + +TEF+VV+ QMNG +  S+SIH  H+GKMR+KL KG  T A++ YS SMQLCG RGGG
Sbjct  384   RHDTEFTVVVIQMNGVDQPSQSIHVLHIGKMRIKLRKGQTTMAKEYYSNSMQLCGIRGGG  443

Query  1450  NSAAKSLFWQPRKGQSFVLVFDSERERNGALVVARKHALECNVSI  1584
             N+AA+S++WQ + G SF+L F+SERERN A+++AR+ A +CN+ +
Sbjct  444   NAAAQSVYWQAKMGLSFILAFESERERNAAIMLARRFAFDCNIML  488



>ref|XP_011090183.1| PREDICTED: uncharacterized protein LOC105170938 isoform X2 [Sesamum 
indicum]
 ref|XP_011090184.1| PREDICTED: uncharacterized protein LOC105170938 isoform X2 [Sesamum 
indicum]
Length=494

 Score =   558 bits (1438),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 289/465 (62%), Positives = 372/465 (80%), Gaps = 1/465 (0%)
 Frame = +1

Query  190   VSADVSFASNQFPKYKLGPDFQILEEALLENKGPSLKevveeettRLTEQHKRLSVRDLA  369
             VSADV FAS +FPKYK+G + QI+E    + K  S KE+V  ET  L EQ +RLSVRDLA
Sbjct  20    VSADVVFASTRFPKYKIGANNQIVE-VKEDQKMLSHKEMVARETALLLEQQQRLSVRDLA  78

Query  370   SKFDKNLSSAAKLANEAKLRDAPSLEGHVLLKKLRDALETLKGRLAGRNKEDVEIAIAMV  549
             SKF+K  ++AAKL++EA+L++A SLE HVLLKKLRDALE L+GR+ G+NK+DVE AIAM+
Sbjct  79    SKFEKGSAAAAKLSDEARLKEAASLEKHVLLKKLRDALEALRGRVGGKNKDDVEEAIAMI  138

Query  550   EALAVRLTQKEGDLIQEKFEVNKLVSILKQASEDAKKLVNQERSFACAEIESARAVVQRI  729
             EALAV+LTQ+EG+LIQEK EV KL + LKQASEDAKKLV++ER+FA AEIE+ARA VQR+
Sbjct  139   EALAVQLTQREGELIQEKAEVKKLATFLKQASEDAKKLVDEERAFARAEIENARAAVQRV  198

Query  730   GEALEEQEINSQVSGKQeveelmeeiqeARRIRVLHQPSKVMDMEHELRALRIQLNEKSV  909
              EAL+E E  S+ SGKQ+++ELM+E+QEARRI++LHQPS+VMDME+EL+ALRIQL EKS 
Sbjct  199   EEALQEHERISRASGKQDLDELMKEVQEARRIKMLHQPSRVMDMENELQALRIQLAEKSK  258

Query  910   VSFKLQNELAMSKRTEQNKSQLYRIIGSESVGSILRIQPCSDEAVDLSKCSIQWYRLSSE  1089
              S +LQ EL MSK+ ++NK  LY I G E++GS LRI PCSD A DLS+C+IQWYR ++E
Sbjct  259   CSLQLQKELEMSKKGDKNKPHLYEIDGMEALGSYLRIYPCSDSAPDLSECTIQWYRSTAE  318

Query  1090  CSRREPILGADKSVYAPEPIDVGRVLEADIVSNGLKASVTTIGQIDQAAGLGNYVETLLR  1269
               +RE I GA KS YAPEP DVGR+L+ADI ++    ++ T   ID AAGLGNYVE L+R
Sbjct  319   GGKRELISGATKSEYAPEPFDVGRILQADISTSDHTTTIMTSAPIDPAAGLGNYVEALVR  378

Query  1270  KSNTEFSVVIAQMNGRNYSSRSIHSFHVGKMRMKLNKGWITKARDSYSGSMQLCGFRGGG  1449
             + +TEF+VV+ QMNG +  S+SIH  H+GKMR+KL KG  T A++ YS SMQLCG RGGG
Sbjct  379   RHDTEFTVVVIQMNGVDQPSQSIHVLHIGKMRIKLRKGQTTMAKEYYSNSMQLCGIRGGG  438

Query  1450  NSAAKSLFWQPRKGQSFVLVFDSERERNGALVVARKHALECNVSI  1584
             N+AA+S++WQ + G SF+L F+SERERN A+++AR+ A +CN+ +
Sbjct  439   NAAAQSVYWQAKMGLSFILAFESERERNAAIMLARRFAFDCNIML  483



>ref|XP_006397374.1| hypothetical protein EUTSA_v10022499mg [Eutrema salsugineum]
 gb|ESQ38827.1| hypothetical protein EUTSA_v10022499mg [Eutrema salsugineum]
Length=495

 Score =   558 bits (1437),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 293/486 (60%), Positives = 389/486 (80%), Gaps = 2/486 (0%)
 Frame = +1

Query  130   MTKVSPEFVGGEVQMYTFKSVSADVSFASNQFPKYKLGPDFQILEEALLENKGPSLKevv  309
             MT+V+ +F    +      +VSADV FAS++FP Y++G + QI +    + K  S+KEVV
Sbjct  1     MTRVTRDFRDS-LHKDVVPAVSADVKFASSRFPNYRIGANDQIFD-VKDDPKVLSMKEVV  58

Query  310   eeettRLTEQHKRLSVRDLASKFDKNLSSAAKLANEAKLRDAPSLEGHVLLKKLRDALET  489
               ET +L +Q KR+SVRDLA+KF+K L++AAKL+ EAKL++A SLE HVLLKKLRDALE+
Sbjct  59    ARETAQLLDQQKRMSVRDLANKFEKGLAAAAKLSEEAKLKEATSLEKHVLLKKLRDALES  118

Query  490   LKGRLAGRNKEDVEIAIAMVEALAVRLTQKEGDLIQEKFEVNKLVSILKQASEDAKKLVN  669
             L+GR+AGRNK+DVE AIAMVEALAV+LTQ+EG+L  EK EV KL S LKQASEDAKKLV 
Sbjct  119   LRGRVAGRNKDDVEEAIAMVEALAVQLTQREGELFIEKAEVKKLASFLKQASEDAKKLVE  178

Query  670   QERSFACAEIESARAVVQRIGEALEEQEINSQVSGKQeveelmeeiqeARRIRVLHQPSK  849
             +ER+FA AEIESARA VQR+ EAL E E  S+ SGKQ++E+LM+E+QEARRI++LHQPSK
Sbjct  179   EERAFARAEIESARAAVQRVEEALREHEQMSRASGKQDMEDLMKEVQEARRIKMLHQPSK  238

Query  850   VMDMEHELRALRIQLNEKSVVSFKLQNELAMSKRTEQNKSQLYRIIGSESVGSILRIQPC  1029
             VMDME+ELRALR QL EKS    +LQ +LAM +++E++ S LY I G+E++GS LR++P 
Sbjct  239   VMDMEYELRALRNQLAEKSKHFLQLQKKLAMCRKSEESISLLYEIDGTEALGSCLRVRPY  298

Query  1030  SDEAVDLSKCSIQWYRLSSECSRREPILGADKSVYAPEPIDVGRVLEADIVSNGLKASVT  1209
             S++A DLSKC++QWYR SS+ S++E I GA KSVYAPEP DVGR L ADI+ +G   S++
Sbjct  299   SNDAPDLSKCTMQWYRSSSDDSKKELISGATKSVYAPEPFDVGRALHADIIYDGHTLSLS  358

Query  1210  TIGQIDQAAGLGNYVETLLRKSNTEFSVVIAQMNGRNYSSRSIHSFHVGKMRMKLNKGWI  1389
             T+G+ID AAGLG+YVE L+RK + +F+VV+ QM+G +++S SIH FHVGKMR+KL KG  
Sbjct  359   TVGKIDPAAGLGSYVEALVRKHDVDFNVVVTQMSGEDHTSESIHLFHVGKMRIKLCKGKT  418

Query  1390  TKARDSYSGSMQLCGFRGGGNSAAKSLFWQPRKGQSFVLVFDSERERNGALVVARKHALE  1569
               A++ YS +MQLCG RGGGN+AA++++WQ +KG SFV+ F+SERERN A+++AR+ A +
Sbjct  419   VIAKEYYSSAMQLCGVRGGGNAAAQAVYWQAKKGVSFVVAFESERERNAAIMLARRFACD  478

Query  1570  CNVSIT  1587
             CNV++T
Sbjct  479   CNVTLT  484



>ref|XP_009769256.1| PREDICTED: uncharacterized protein LOC104220139 [Nicotiana sylvestris]
 ref|XP_009769257.1| PREDICTED: uncharacterized protein LOC104220139 [Nicotiana sylvestris]
 ref|XP_009769258.1| PREDICTED: uncharacterized protein LOC104220139 [Nicotiana sylvestris]
Length=493

 Score =   557 bits (1436),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 295/485 (61%), Positives = 380/485 (78%), Gaps = 3/485 (1%)
 Frame = +1

Query  130   MTKVSPEFVGGEVQMYTFKSVSADVSFASNQFPKYKLGPDFQILEEALLENKGPSLKevv  309
             MT+V+ +F G  +Q      VSADV F S++FP YK+G + QI+E    ++   ++KEVV
Sbjct  1     MTRVTRDF-GNTMQRDAVPPVSADVIFPSSRFPNYKIGANNQIVE-VKEDSTALTMKEVV  58

Query  310   eeettRLTEQHKRLSVRDLASKFDKNLSSAAKLANEAKLRDAPSLEGHVLLKKLRDALET  489
               ET +L EQ KRLSVRDLASKF+K L++AAKL++EA+L+DA SLE HVLLKKLRDALE 
Sbjct  59    ARETAQLLEQQKRLSVRDLASKFEKGLAAAAKLSDEARLKDAASLEKHVLLKKLRDALED  118

Query  490   LKGRLAGRNKEDVEIAIAMVEALAVRLTQKEGDLIQEKFEVNKLVSILKQASEDAKKLVN  669
             L+GR+AG+NK+DVE AIAMVEALAV+L+Q+EG+LIQEK EV KL + LKQASEDAKKLV 
Sbjct  119   LRGRVAGKNKDDVEEAIAMVEALAVQLSQREGELIQEKTEVKKLATFLKQASEDAKKLVE  178

Query  670   QERSFACAEIESARAVVQRIGEALEEQEINSQVSGKQeveelmeeiqeARRIRVLHQPSK  849
             +ER++A AEIE+ARA VQR+ EAL+E E  S  SGKQ++EELM+E+QEARRI++LHQPSK
Sbjct  179   EERAYARAEIENARAAVQRVEEALQEYERMSGASGKQDMEELMKEVQEARRIKMLHQPSK  238

Query  850   VMDMEHELRALRIQLNEKSVVSFKLQNELAMSKRTEQNKSQLYRIIGSESVGSILRIQPC  1029
             VMDMEHEL+ALR+QL EKS  S +LQ ELA  K  E+  SQLY + G+E++GS L+IQPC
Sbjct  239   VMDMEHELQALRMQLAEKSKYSVQLQKELA-RKMGEETVSQLYELDGTEALGSFLQIQPC  297

Query  1030  SDEAVDLSKCSIQWYRLSSECSRREPILGADKSVYAPEPIDVGRVLEADIVSNGLKASVT  1209
             S  A +LS+CSIQWYRL+ E  ++EPI GA K VYAPEP DVGRVL+A+I        +T
Sbjct  298   SLAAPELSECSIQWYRLACEGGKKEPISGATKPVYAPEPFDVGRVLQAEITFGDQTTLMT  357

Query  1210  TIGQIDQAAGLGNYVETLLRKSNTEFSVVIAQMNGRNYSSRSIHSFHVGKMRMKLNKGWI  1389
             T   ID AAGLGNYVE L+R+ + EF+VV+ QMNG +++S SIH  H+G+MRMKL KG  
Sbjct  358   TASAIDPAAGLGNYVEALVRRHDIEFNVVVVQMNGTDHTSESIHVLHIGRMRMKLRKGKT  417

Query  1390  TKARDSYSGSMQLCGFRGGGNSAAKSLFWQPRKGQSFVLVFDSERERNGALVVARKHALE  1569
             + A++ YS SMQLCG RGGGN+AA++ FWQ + G SFVL F++ERERN A+++AR+ A +
Sbjct  418   SVAKEYYSASMQLCGVRGGGNAAAQATFWQVKTGLSFVLAFETERERNAAIMLARRFAYD  477

Query  1570  CNVSI  1584
             CN+ +
Sbjct  478   CNIML  482



>ref|XP_010473060.1| PREDICTED: uncharacterized protein LOC104752580 [Camelina sativa]
Length=496

 Score =   556 bits (1434),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 295/486 (61%), Positives = 387/486 (80%), Gaps = 2/486 (0%)
 Frame = +1

Query  130   MTKVSPEFVGGEVQMYTFKSVSADVSFASNQFPKYKLGPDFQILEEALLENKGPSLKevv  309
             MT+V+ +F    +Q     +VSADV FAS++FP Y++G + QI +    + K  S+KEVV
Sbjct  1     MTRVTRDFRDS-LQRDGVPAVSADVKFASSRFPNYRIGANDQIFD-VKDDPKVLSMKEVV  58

Query  310   eeettRLTEQHKRLSVRDLASKFDKNLSSAAKLANEAKLRDAPSLEGHVLLKKLRDALET  489
               ET +L +Q KRLSVRDLA+KF+K L++AAKL+ EAKL++A SLE HVLLKKLRDALE+
Sbjct  59    ARETAQLMDQQKRLSVRDLANKFEKGLAAAAKLSEEAKLKEATSLEKHVLLKKLRDALES  118

Query  490   LKGRLAGRNKEDVEIAIAMVEALAVRLTQKEGDLIQEKFEVNKLVSILKQASEDAKKLVN  669
             L+GR+AGRNK+DVE AIAMVEALAV+LTQ+EG+L  EK EV KL S LKQASEDAKKLV+
Sbjct  119   LRGRVAGRNKDDVEEAIAMVEALAVQLTQREGELFIEKAEVKKLASFLKQASEDAKKLVD  178

Query  670   QERSFACAEIESARAVVQRIGEALEEQEINSQVSGKQeveelmeeiqeARRIRVLHQPSK  849
             +ER+FA AEIESARA VQR+ EAL E E  S+ SGKQ++E+LM+E+QEARRI++LHQPS+
Sbjct  179   EERAFARAEIESARAAVQRVEEALREHEQMSRASGKQDMEDLMKEVQEARRIKMLHQPSR  238

Query  850   VMDMEHELRALRIQLNEKSVVSFKLQNELAMSKRTEQNKSQLYRIIGSESVGSILRIQPC  1029
             VMDME+ELRALR QL EKS    +LQ +LAM +++E+N S +Y I G+E++GS LR++ C
Sbjct  239   VMDMEYELRALRNQLAEKSKHFLQLQKKLAMCRKSEENISLIYEIDGTEALGSCLRVRTC  298

Query  1030  SDEAVDLSKCSIQWYRLSSECSRREPILGADKSVYAPEPIDVGRVLEADIVSNGLKASVT  1209
             S++A DLSKC IQWYR SS  S++E I GA KSVYAPEP DVGRVL ADI  +G   S++
Sbjct  299   SNDAPDLSKCMIQWYRSSSGGSKKELISGATKSVYAPEPFDVGRVLHADITYDGRLLSLS  358

Query  1210  TIGQIDQAAGLGNYVETLLRKSNTEFSVVIAQMNGRNYSSRSIHSFHVGKMRMKLNKGWI  1389
             T+G+ID AAGLG+YVE L+RK + +F+VV+ QM+G +++S SIH FHVGKMR+KL KG  
Sbjct  359   TVGKIDPAAGLGSYVEALVRKHDVDFNVVVTQMSGEDHTSESIHLFHVGKMRIKLCKGKT  418

Query  1390  TKARDSYSGSMQLCGFRGGGNSAAKSLFWQPRKGQSFVLVFDSERERNGALVVARKHALE  1569
               A++ YS +MQLCG RGGGN+A ++L+WQ +KG SFV+ F+SERERN A+++AR+ A +
Sbjct  419   VIAKEYYSSAMQLCGVRGGGNAAPQALYWQAKKGVSFVIAFESERERNAAIMLARRFACD  478

Query  1570  CNVSIT  1587
             CNV++ 
Sbjct  479   CNVTLA  484



>ref|XP_002878087.1| hypothetical protein ARALYDRAFT_324161 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH54346.1| hypothetical protein ARALYDRAFT_324161 [Arabidopsis lyrata subsp. 
lyrata]
Length=491

 Score =   556 bits (1432),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 301/488 (62%), Positives = 381/488 (78%), Gaps = 5/488 (1%)
 Frame = +1

Query  130   MTKVSPEFVGGEVQMYTFKSVSADVSFASNQFPKYKLGPDFQILEEALLENKGPSLKevv  309
             MTKV PE   G     +   VS DVSFASN FP YKLGPD QI+EE   + KGPS+KE V
Sbjct  1     MTKVCPEIEEG-TLSLSVVPVSVDVSFASNHFPTYKLGPDNQIVEEPKEDEKGPSVKETV  59

Query  310   eeettRLTEQHKRLSVRDLASKFDKNLSSAAKLANEAKLRDAPSLEGHVLLKKLRDALET  489
             ++E+  L++QHKRLSVRDLASKFDKNL++A  LA+EAKLR+  SLEGHV+LKKLRDALE 
Sbjct  60    DKESELLSDQHKRLSVRDLASKFDKNLAAAVNLADEAKLREVASLEGHVMLKKLRDALEY  119

Query  490   LKGRLAGRNKEDVEIAIAMVEALAVRLTQKEGDLIQEKFEVNKLVSILKQASEDAKKLVN  669
             ++GR  G+NKEDVE AI+MVEALAV+LTQ EG+LIQEKFEV KL + LKQ SEDAKKLVN
Sbjct  120   MRGRTDGQNKEDVETAISMVEALAVKLTQNEGELIQEKFEVKKLGNFLKQTSEDAKKLVN  179

Query  670   QERSFACAEIESARAVVQRIGEALEEQEINSQVSGKQ--eveelmeeiqeARRIRVLHQP  843
             QE+SFACAEIE+ARAVV R+GEA EEQE  S+ S  Q   VE+L+EE+QEAR+I+ +H P
Sbjct  180   QEKSFACAEIETARAVVLRLGEAFEEQERISEASRAQGPNVEKLVEEVQEARQIKRMHHP  239

Query  844   SKVMDMEHELRALRIQLNEKSVVSFKLQNELAMSKRTEQNKSQLYRIIGSESVGSILRIQ  1023
             +KVM M+HEL  LR ++ EK + S KL  E+A+ KR E++KS  + + G +S+GS LRI+
Sbjct  240   TKVMGMQHELHGLRNRIQEKYMNSVKLHKEIAIIKRVEESKSCPFVLEGKQSLGSCLRIR  299

Query  1024  -PCSDEAVDLSKCSIQWYRLSSECSRREPILGADKSVYAPEPIDVGRVLEADIVSNGLKA  1200
                +D A DLS CSIQWYR + E SRRE I GA +S+YAPEP DVGR+L+ADI+SNG K 
Sbjct  300   VNAADNAPDLSNCSIQWYRAACETSRREAISGAIQSMYAPEPFDVGRILQADILSNGQKF  359

Query  1201  SVTTIGQIDQAAGLGNYVETLLRKSNTEFSVVIAQMNGRNYSSRSIHSFHVGKMRMKLNK  1380
             +VTT   +D  + L + VE+L+RKSN+EFSVVI+QMNG++Y+SRS H F VGK R+KL++
Sbjct  360   TVTTDDPVDPDSSLQSRVESLMRKSNSEFSVVISQMNGQDYASRS-HVFTVGKTRIKLSR  418

Query  1381  GWITKARDSYSGSMQLCGFRGGGNSAAKSLFWQPRKGQSFVLVFDSERERNGALVVARKH  1560
             GWITKAR+ YS SMQLCG RG   +  K++FWQPRK  +F+L F+SE+ERN A+ +ARK+
Sbjct  419   GWITKARELYSTSMQLCGVRGNIKAPTKAVFWQPRKSLTFILTFESEQERNAAIALARKY  478

Query  1561  ALECNVSI  1584
             A +CNV++
Sbjct  479   AFDCNVTL  486



>emb|CAB88051.1| putative protein [Arabidopsis thaliana]
Length=499

 Score =   556 bits (1433),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 303/492 (62%), Positives = 382/492 (78%), Gaps = 6/492 (1%)
 Frame = +1

Query  130   MTKVSPEFVGGEVQMYTFKSVSADVSFASNQFPKYKLGPDFQILEEALLENKGPSLKevv  309
             MTKV PE  G      +   VS DVSFAS+ FP YKLGPD QI+EE   + KGPS+KE V
Sbjct  1     MTKVCPEIEG--TLSLSVVPVSVDVSFASDHFPTYKLGPDNQIVEEPKEDEKGPSVKETV  58

Query  310   eeettRLTEQHKRLSVRDLASKFDKNLSSAAKLANEAKLRDAPSLEGHVLLKKLRDALET  489
             E+E+  L++QHKRLSVRDLASKFDKNL++A  LANEAKLR+  SLEGHV+LKKLRDALE 
Sbjct  59    EKESELLSDQHKRLSVRDLASKFDKNLAAAVSLANEAKLREVASLEGHVMLKKLRDALEY  118

Query  490   LKGRLAGRNKEDVEIAIAMVEALAVRLTQKEGDLIQEKFEVNKLVSILKQASEDAKKLVN  669
             ++GR  G+NK+DVE AI+MVEALAV+LTQ EG+LIQEKFEV KL + LKQ SEDAKKLVN
Sbjct  119   MRGRTDGQNKQDVETAISMVEALAVKLTQNEGELIQEKFEVKKLGNFLKQTSEDAKKLVN  178

Query  670   QERSFACAEIESARAVVQRIGEALEEQEINSQVSGKQ--eveelmeeiqeARRIRVLHQP  843
             QE+SF+CAEIE+ARAVV R+GEA EEQE  S+ S  Q  +VE+L+EE+QEAR+I+ +H P
Sbjct  179   QEKSFSCAEIETARAVVLRLGEAFEEQERISEASRAQGPDVEKLVEEVQEARQIKRMHHP  238

Query  844   SKVMDMEHELRALRIQLNEKSVVSFKLQNELAMSKRTEQNKSQLYRIIGSESVGSILRIQ  1023
             +KVM M+HEL  LR ++ EK + S KL  E+A+ KR E++KS  + + G +S+GS LRI+
Sbjct  239   TKVMGMQHELHGLRNRIQEKYMNSVKLHKEIAIIKRVEESKSCPFVLEGKQSLGSCLRIR  298

Query  1024  -PCSDEAVDLSKCSIQWYRLSSECSRREPILGADKSVYAPEPIDVGRVLEADIVSNGLKA  1200
                 D A DLS CSIQWYR + E SRRE I GA +S+YAPEP DVGR+L+ADI+SNG K 
Sbjct  299   VNAQDNAPDLSNCSIQWYRAACETSRREAISGAIQSMYAPEPFDVGRILQADILSNGQKF  358

Query  1201  SVTTIGQIDQAAGLGNYVETLLRKSNTEFSVVIAQMNGRNYSSRSIHSFHVGKMRMKLNK  1380
             +VTT   +D  +GL + VE+L+RKSN+EFSVVI+QMNG++Y+SRS H F VGK R+KL++
Sbjct  359   TVTTDDPVDPDSGLPSRVESLMRKSNSEFSVVISQMNGQDYASRS-HVFTVGKTRIKLSR  417

Query  1381  GWITKARDSYSGSMQLCGFRGGGNSAAKSLFWQPRKGQSFVLVFDSERERNGALVVARKH  1560
             GWITKAR+ YS SMQLCG RG   +  K++FWQPRK  +F+L F+SE ERN A+ +ARK+
Sbjct  418   GWITKARELYSTSMQLCGVRGNIKAPTKAVFWQPRKSLTFILTFESEHERNAAIALARKY  477

Query  1561  ALECNVSITSNL  1596
             A +C+V IT  L
Sbjct  478   AFDCSVYITGLL  489



>ref|XP_006293926.1| hypothetical protein CARUB_v10022916mg, partial [Capsella rubella]
 gb|EOA26824.1| hypothetical protein CARUB_v10022916mg, partial [Capsella rubella]
Length=563

 Score =   558 bits (1438),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 294/485 (61%), Positives = 389/485 (80%), Gaps = 2/485 (0%)
 Frame = +1

Query  130   MTKVSPEFVGGEVQMYTFKSVSADVSFASNQFPKYKLGPDFQILEEALLENKGPSLKevv  309
             MT+V+ +F    +Q     +VSADV FAS++FP Y++G + QI +    + K  S+KEVV
Sbjct  68    MTRVTRDFRDS-LQRDVVPAVSADVKFASSRFPNYRIGANDQIFD-VKDDPKVLSMKEVV  125

Query  310   eeettRLTEQHKRLSVRDLASKFDKNLSSAAKLANEAKLRDAPSLEGHVLLKKLRDALET  489
               ET +L +Q KR+SVRDLA+KF+K L++AAKL+ EAKL++A SLE HVLLKKLRDALE+
Sbjct  126   ARETAQLMDQQKRMSVRDLANKFEKGLAAAAKLSEEAKLKEATSLEKHVLLKKLRDALES  185

Query  490   LKGRLAGRNKEDVEIAIAMVEALAVRLTQKEGDLIQEKFEVNKLVSILKQASEDAKKLVN  669
             L+GR+AGRNK+DVE AIAMVEALAV+LTQ+EG+L  EK EV KL S LKQASEDAKKLV+
Sbjct  186   LRGRVAGRNKDDVEEAIAMVEALAVQLTQREGELFIEKAEVKKLASFLKQASEDAKKLVD  245

Query  670   QERSFACAEIESARAVVQRIGEALEEQEINSQVSGKQeveelmeeiqeARRIRVLHQPSK  849
             +ER+FA AEIESARA VQR+ EAL E E  S+ SGKQ++E+LM+E+QEARRI++LHQPS+
Sbjct  246   EERAFARAEIESARAAVQRVEEALREHEQMSRASGKQDMEDLMKEVQEARRIKMLHQPSR  305

Query  850   VMDMEHELRALRIQLNEKSVVSFKLQNELAMSKRTEQNKSQLYRIIGSESVGSILRIQPC  1029
             VMDME+ELRALR QL EKS    +LQ +LA+ +++E+N S +Y I G+E++GS LR++ C
Sbjct  306   VMDMEYELRALRNQLAEKSKHFLQLQKKLALCRKSEENISLIYEIDGTEALGSCLRVRSC  365

Query  1030  SDEAVDLSKCSIQWYRLSSECSRREPILGADKSVYAPEPIDVGRVLEADIVSNGLKASVT  1209
             S++A DLSKC IQWYR SS+ S++E I GA KSVYAPEP DVGRVL ADI  +G   S++
Sbjct  366   SNDAPDLSKCMIQWYRSSSDGSKKELISGATKSVYAPEPFDVGRVLHADITYDGRLLSLS  425

Query  1210  TIGQIDQAAGLGNYVETLLRKSNTEFSVVIAQMNGRNYSSRSIHSFHVGKMRMKLNKGWI  1389
             T+G+ID AAGLG+YVE L+RK + +F+VV+ QM+G +++S SIH FHVGKMR+KL KG  
Sbjct  426   TVGKIDPAAGLGSYVEALVRKHDVDFNVVVTQMSGEDHTSESIHLFHVGKMRIKLCKGKT  485

Query  1390  TKARDSYSGSMQLCGFRGGGNSAAKSLFWQPRKGQSFVLVFDSERERNGALVVARKHALE  1569
               A++ YS +MQLCG RGGGN+AA++L+WQ +KG SFV+ F+SERERN A+++AR+ A +
Sbjct  486   VIAKEYYSSAMQLCGVRGGGNAAAQALYWQAKKGVSFVIAFESERERNAAIMLARRFACD  545

Query  1570  CNVSI  1584
             CNV++
Sbjct  546   CNVTL  550



>ref|XP_010510866.1| PREDICTED: uncharacterized protein LOC104787061 [Camelina sativa]
 ref|XP_010510867.1| PREDICTED: uncharacterized protein LOC104787061 [Camelina sativa]
Length=496

 Score =   555 bits (1431),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 295/486 (61%), Positives = 386/486 (79%), Gaps = 2/486 (0%)
 Frame = +1

Query  130   MTKVSPEFVGGEVQMYTFKSVSADVSFASNQFPKYKLGPDFQILEEALLENKGPSLKevv  309
             MT+V+ +F    +Q      VSADV FAS++FP Y++G + QI +    + K  S+KEVV
Sbjct  1     MTRVTRDFRDS-LQRDGVPVVSADVKFASSRFPNYRIGANDQIFD-VKDDPKVLSMKEVV  58

Query  310   eeettRLTEQHKRLSVRDLASKFDKNLSSAAKLANEAKLRDAPSLEGHVLLKKLRDALET  489
               ET +L +Q KRLSVRDLA+KF+K L++AAKL+ EAKL++A SLE HVLLKKLRDALE+
Sbjct  59    ARETAQLMDQQKRLSVRDLANKFEKGLAAAAKLSEEAKLKEATSLEKHVLLKKLRDALES  118

Query  490   LKGRLAGRNKEDVEIAIAMVEALAVRLTQKEGDLIQEKFEVNKLVSILKQASEDAKKLVN  669
             L GR+AGRNK+DVE AIAMVEALAV+LTQ+EG+L  EK EV KL S LKQASEDAKKLV+
Sbjct  119   LSGRVAGRNKDDVEEAIAMVEALAVQLTQREGELFIEKAEVKKLASFLKQASEDAKKLVD  178

Query  670   QERSFACAEIESARAVVQRIGEALEEQEINSQVSGKQeveelmeeiqeARRIRVLHQPSK  849
             +ER+FA AEIESARA VQR+ EAL E E  S+ SGKQ++E+LM+E+QEARRI++LHQPS+
Sbjct  179   EERAFARAEIESARAAVQRVEEALREHEQMSRASGKQDMEDLMKEVQEARRIKMLHQPSR  238

Query  850   VMDMEHELRALRIQLNEKSVVSFKLQNELAMSKRTEQNKSQLYRIIGSESVGSILRIQPC  1029
             VMDME+ELRALR QL EKS    +LQ +LAM +++E+N S +Y I G+E++GS LR++ C
Sbjct  239   VMDMEYELRALRNQLAEKSKHFLQLQKKLAMCRKSEENISLIYEIDGTEALGSCLRVRSC  298

Query  1030  SDEAVDLSKCSIQWYRLSSECSRREPILGADKSVYAPEPIDVGRVLEADIVSNGLKASVT  1209
             S++A DLSKC IQWYR SS+ S++E I GA KSVYAPEP DVGRVL ADI  +G   S++
Sbjct  299   SNDAPDLSKCMIQWYRSSSDGSKKELISGATKSVYAPEPFDVGRVLHADITYDGRLLSLS  358

Query  1210  TIGQIDQAAGLGNYVETLLRKSNTEFSVVIAQMNGRNYSSRSIHSFHVGKMRMKLNKGWI  1389
             T+G+ID AAGLG+YVE L+RK + +F+VV+ QM+G +++S SIH FHVGKMR+KL KG  
Sbjct  359   TVGKIDPAAGLGSYVEALVRKHDVDFNVVVTQMSGEDHTSESIHLFHVGKMRIKLCKGKT  418

Query  1390  TKARDSYSGSMQLCGFRGGGNSAAKSLFWQPRKGQSFVLVFDSERERNGALVVARKHALE  1569
               A++ YS +MQLCG RGGGN+A ++L+WQ +KG SFV+ F+SERERN A+++AR+ A +
Sbjct  419   VIAKEYYSSAMQLCGVRGGGNAAPQALYWQAKKGVSFVIAFESERERNAAIMLARRFACD  478

Query  1570  CNVSIT  1587
             CNV++ 
Sbjct  479   CNVTLA  484



>ref|NP_191207.2| myosin heavy chain-like protein [Arabidopsis thaliana]
 dbj|BAC43120.1| unknown protein [Arabidopsis thaliana]
 gb|AAO64828.1| At3g56480 [Arabidopsis thaliana]
 gb|AEE79526.1| myosin heavy chain-like protein [Arabidopsis thaliana]
Length=490

 Score =   554 bits (1427),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 300/488 (61%), Positives = 381/488 (78%), Gaps = 6/488 (1%)
 Frame = +1

Query  130   MTKVSPEFVGGEVQMYTFKSVSADVSFASNQFPKYKLGPDFQILEEALLENKGPSLKevv  309
             MTKV PE  G      +   VS DVSFAS+ FP YKLGPD QI+EE   + KGPS+KE V
Sbjct  1     MTKVCPEIEG--TLSLSVVPVSVDVSFASDHFPTYKLGPDNQIVEEPKEDEKGPSVKETV  58

Query  310   eeettRLTEQHKRLSVRDLASKFDKNLSSAAKLANEAKLRDAPSLEGHVLLKKLRDALET  489
             E+E+  L++QHKRLSVRDLASKFDKNL++A  LANEAKLR+  SLEGHV+LKKLRDALE 
Sbjct  59    EKESELLSDQHKRLSVRDLASKFDKNLAAAVSLANEAKLREVASLEGHVMLKKLRDALEY  118

Query  490   LKGRLAGRNKEDVEIAIAMVEALAVRLTQKEGDLIQEKFEVNKLVSILKQASEDAKKLVN  669
             ++GR  G+NK+DVE AI+MVEALAV+LTQ EG+LIQEKFEV KL + LKQ SEDAKKLVN
Sbjct  119   MRGRTDGQNKQDVETAISMVEALAVKLTQNEGELIQEKFEVKKLGNFLKQTSEDAKKLVN  178

Query  670   QERSFACAEIESARAVVQRIGEALEEQEINSQVSGKQ--eveelmeeiqeARRIRVLHQP  843
             QE+SF+CAEIE+ARAVV R+GEA EEQE  S+ S  Q  +VE+L+EE+QEAR+I+ +H P
Sbjct  179   QEKSFSCAEIETARAVVLRLGEAFEEQERISEASRAQGPDVEKLVEEVQEARQIKRMHHP  238

Query  844   SKVMDMEHELRALRIQLNEKSVVSFKLQNELAMSKRTEQNKSQLYRIIGSESVGSILRIQ  1023
             +KVM M+HEL  LR ++ EK + S KL  E+A+ KR E++KS  + + G +S+GS LRI+
Sbjct  239   TKVMGMQHELHGLRNRIQEKYMNSVKLHKEIAIIKRVEESKSCPFVLEGKQSLGSCLRIR  298

Query  1024  -PCSDEAVDLSKCSIQWYRLSSECSRREPILGADKSVYAPEPIDVGRVLEADIVSNGLKA  1200
                 D A DLS CSIQWYR + E SRRE I GA +S+YAPEP DVGR+L+ADI+SNG K 
Sbjct  299   VNAQDNAPDLSNCSIQWYRAACETSRREAISGAIQSMYAPEPFDVGRILQADILSNGQKF  358

Query  1201  SVTTIGQIDQAAGLGNYVETLLRKSNTEFSVVIAQMNGRNYSSRSIHSFHVGKMRMKLNK  1380
             +VTT   +D  +GL + VE+L+RKSN+EFSVVI+QMNG++Y+SRS H F VGK R+KL++
Sbjct  359   TVTTDDPVDPDSGLPSRVESLMRKSNSEFSVVISQMNGQDYASRS-HVFTVGKTRIKLSR  417

Query  1381  GWITKARDSYSGSMQLCGFRGGGNSAAKSLFWQPRKGQSFVLVFDSERERNGALVVARKH  1560
             GWITKAR+ YS SMQLCG RG   +  K++FWQPRK  +F+L F+SE ERN A+ +ARK+
Sbjct  418   GWITKARELYSTSMQLCGVRGNIKAPTKAVFWQPRKSLTFILTFESEHERNAAIALARKY  477

Query  1561  ALECNVSI  1584
             A +C+V++
Sbjct  478   AFDCSVTL  485



>ref|XP_004513217.1| PREDICTED: paramyosin-like isoform X1 [Cicer arietinum]
 ref|XP_004513218.1| PREDICTED: paramyosin-like isoform X2 [Cicer arietinum]
Length=494

 Score =   551 bits (1421),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 293/485 (60%), Positives = 379/485 (78%), Gaps = 2/485 (0%)
 Frame = +1

Query  130   MTKVSPEFVGGEVQMYTFKSVSADVSFASNQFPKYKLGPDFQILEEALLENKGPSLKevv  309
             MT+V+  F G  +       VSADV FAS +FP YK+G + QI+E    + K   +KE+V
Sbjct  1     MTRVTRNF-GDTMYREAVPVVSADVIFASLRFPTYKIGSNNQIMETKD-DLKVLPMKEIV  58

Query  310   eeettRLTEQHKRLSVRDLASKFDKNLSSAAKLANEAKLRDAPSLEGHVLLKKLRDALET  489
               ET +L EQ  RLSVRDLASKF+K L++AAKL+ EA+LR+A SLE HVLLKKLRDALE+
Sbjct  59    ARETAQLLEQQNRLSVRDLASKFEKGLAAAAKLSEEARLREAASLEKHVLLKKLRDALES  118

Query  490   LKGRLAGRNKEDVEIAIAMVEALAVRLTQKEGDLIQEKFEVNKLVSILKQASEDAKKLVN  669
             LKGR+AGRNK+DV  AI+MVEALAV+LT +EG+LIQEK EV KL + LKQASEDAKKLV 
Sbjct  119   LKGRVAGRNKDDVHQAISMVEALAVQLTHREGELIQEKSEVKKLTNFLKQASEDAKKLVE  178

Query  670   QERSFACAEIESARAVVQRIGEALEEQEINSQVSGKQeveelmeeiqeARRIRVLHQPSK  849
              ER+FA  EI++ARA VQR+ EAL+E E  SQ SGKQ++E+LM+E+QEARRI++LHQPSK
Sbjct  179   VERAFARFEIDNARAAVQRVEEALQEHEKMSQASGKQDLEQLMKEVQEARRIKMLHQPSK  238

Query  850   VMDMEHELRALRIQLNEKSVVSFKLQNELAMSKRTEQNKSQLYRIIGSESVGSILRIQPC  1029
             VMDMEHELRALR QL EKS    +LQ ELA +K+ +++   LY + G+E++GS L+IQ C
Sbjct  239   VMDMEHELRALRAQLAEKSRHYLRLQKELARAKKGDESVPHLYELEGTETLGSYLQIQSC  298

Query  1030  SDEAVDLSKCSIQWYRLSSECSRREPILGADKSVYAPEPIDVGRVLEADIVSNGLKASVT  1209
             S+ A +LS+CSIQWYR+S+E +++E I GA KSVYAPEP+DVGR+L   I+S  L+ +++
Sbjct  299   SNNAPELSECSIQWYRVSTEGAKKELISGATKSVYAPEPLDVGRLLHVGIISEVLQITLS  358

Query  1210  TIGQIDQAAGLGNYVETLLRKSNTEFSVVIAQMNGRNYSSRSIHSFHVGKMRMKLNKGWI  1389
             T G I+ AAGLGNYVE L+RK +TEF+VV+ Q N  ++ + SIH  HVGKMRMKL KG  
Sbjct  359   TTGPIEPAAGLGNYVEALVRKHDTEFNVVVTQTNDSHHPTESIHILHVGKMRMKLCKGKT  418

Query  1390  TKARDSYSGSMQLCGFRGGGNSAAKSLFWQPRKGQSFVLVFDSERERNGALVVARKHALE  1569
             T A++ YS SMQLCG RGGGN+AA++LFWQP++G SFVL F+SERERN A+++AR+ A +
Sbjct  419   TIAKEYYSSSMQLCGVRGGGNAAAQALFWQPKQGLSFVLAFESERERNAAIMLARRFAFD  478

Query  1570  CNVSI  1584
             CN+ +
Sbjct  479   CNIVL  483



>ref|XP_002881742.1| proline-rich family protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH58001.1| proline-rich family protein [Arabidopsis lyrata subsp. lyrata]
Length=838

 Score =   564 bits (1453),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 302/491 (62%), Positives = 387/491 (79%), Gaps = 8/491 (2%)
 Frame = +1

Query  130   MTKVSPEFVGGEVQMYTF-KSVSADVSFASNQFPKYKLGPDFQILEEALLENKGPSLKev  306
             MTKV P+     V      + +SADVSFASN FP YKLGPD QI++E   ++KGPS+K+V
Sbjct  1     MTKVCPKTEEKRVMCEALVEPISADVSFASNHFPLYKLGPDDQIVDEPEQDDKGPSVKDV  60

Query  307   veeettRLTEQHKRLSVRDLASKFDKNLSSAAKLANEAKLRDAPSLEGHVLLKKLRDALE  486
             V  ET  L++QHK+LSVRDLA KFDKNL++A+KL +EAKL +  SLEGHV+LKKLRDALE
Sbjct  61    VHRETGDLSDQHKKLSVRDLACKFDKNLAAASKLVDEAKLNEVTSLEGHVMLKKLRDALE  120

Query  487   TLKGRLAGRNKEDVEIAIAMVEALAVRLTQKEGDLIQEKFEVNKLVSILKQASEDAKKLV  666
             T++GR+ GRN+E VE AI+MVEALAV+LTQ EG+LIQ+KFEV KL S LK+AS+DAKKLV
Sbjct  121   TMRGRMDGRNREAVENAISMVEALAVKLTQNEGELIQDKFEVKKLASFLKKASDDAKKLV  180

Query  667   NQERSFACAEIESARAVVQRIGEALEEQEINSQVSGKQ--eveelmeeiqeARRIRVLHQ  840
             NQE+SFACAEIESARA+V ++G   +EQE+  + S  Q   VE+L+EE+QEARRIR +H+
Sbjct  181   NQEKSFACAEIESARALVMKLGGEFQEQELCFKASRDQGPNVEKLVEEVQEARRIRRMHK  240

Query  841   PSKVMDMEHELRALRIQLNEKSVVSFKLQNELAMSKRTEQNKSQLYRIIGSESVGSILRI  1020
             P+KV+ M+HELR L+ Q+ EKS  S KLQ E+ + K+ E +KS  Y + G++S+GS LRI
Sbjct  241   PTKVIGMQHELRDLKSQIQEKSAYSVKLQREITIIKKAEGSKSCPYVLDGAQSLGSCLRI  300

Query  1021  QPCSDEAVDLSKCSIQWYRLSSECSRREPILGADKSVYAPEPIDVGRVLEADIVSNGLKA  1200
             +  SD  +D+SKCSIQWYR +SE SRRE I GA++SVYAPEP DVGRV++ADIVSNG K 
Sbjct  301   RASSDSGLDISKCSIQWYRAASESSRREAISGANRSVYAPEPFDVGRVIQADIVSNGQKF  360

Query  1201  SVTTIGQIDQAAGLGNYVETLLRKSNTEFSVVIAQMNGRNYSSRSIHSFHVGKMRMKLNK  1380
             +VTT G I+ AAGL + VE LLRKSN+EF+VVI+QMNG++++SRS H F VGK R+KL++
Sbjct  361   TVTTDGPINTAAGLQSRVEALLRKSNSEFTVVISQMNGQDHASRS-HVFTVGKARIKLSR  419

Query  1381  GWITKARDSYSGSMQL----CGFRGGGNSAAKSLFWQPRKGQSFVLVFDSERERNGALVV  1548
             GWITKAR+ YS SMQL      F+G  N  AK+LFWQ RKG +F+L F+SE+ERN A+V+
Sbjct  420   GWITKAREIYSTSMQLYLKFLSFKGNANVPAKALFWQLRKGLTFLLTFESEQERNSAIVL  479

Query  1549  ARKHALECNVS  1581
             AR +A +CNVS
Sbjct  480   ARTYAYDCNVS  490



>gb|EYU46172.1| hypothetical protein MIMGU_mgv1a005272mg [Erythranthe guttata]
Length=490

 Score =   550 bits (1416),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 288/472 (61%), Positives = 377/472 (80%), Gaps = 3/472 (1%)
 Frame = +1

Query  175   YTF--KSVSADVSFASNQFPKYKLGPDFQILEEALLENKGPSLKevveeettRLTEQHKR  348
             YT    +VSADV FAS++FP YK+G + QI+E    ++K  ++K++V +ET  L EQ KR
Sbjct  9     YTMPKDAVSADVFFASSRFPNYKIGANNQIVE-VKEDSKMSTMKDMVAKETALLLEQQKR  67

Query  349   LSVRDLASKFDKNLSSAAKLANEAKLRDAPSLEGHVLLKKLRDALETLKGRLAGRNKEDV  528
             LSVRDLASKF+K L++A KL++EA+L++A SLE HVLLK LRDAL+ L+GR+AG+NKEDV
Sbjct  68    LSVRDLASKFEKGLAAAVKLSDEARLKEAASLEKHVLLKNLRDALDALRGRVAGKNKEDV  127

Query  529   EIAIAMVEALAVRLTQKEGDLIQEKFEVNKLVSILKQASEDAKKLVNQERSFACAEIESA  708
             E AI MVEALAV+LTQ+EG+LIQEK EV KL S LKQASEDAK+LV++ER+FA  EIE+A
Sbjct  128   EEAITMVEALAVQLTQREGELIQEKAEVKKLASFLKQASEDAKRLVDEERAFARDEIENA  187

Query  709   RAVVQRIGEALEEQEINSQVSGKQeveelmeeiqeARRIRVLHQPSKVMDMEHELRALRI  888
             RA VQR+ EAL+E E  S  S  Q+VEELM+E+QEARRI++LHQPS+VMDMEHEL+ALR 
Sbjct  188   RAAVQRVEEALQEHERMSLSSVNQDVEELMKEVQEARRIKMLHQPSRVMDMEHELQALRT  247

Query  889   QLNEKSVVSFKLQNELAMSKRTEQNKSQLYRIIGSESVGSILRIQPCSDEAVDLSKCSIQ  1068
             QL EKS  S +LQ ELA++K+ ++N  QLY I G ES+GS LRI PCSD A +LS C+IQ
Sbjct  248   QLAEKSKHSLQLQKELAITKKGDKNAPQLYDIDGPESLGSYLRIYPCSDSAPELSGCTIQ  307

Query  1069  WYRLSSECSRREPILGADKSVYAPEPIDVGRVLEADIVSNGLKASVTTIGQIDQAAGLGN  1248
             WYR +SE  ++E I GA KS+YAPEP DVGR+L+A+I++     ++TT G ID AAGLGN
Sbjct  308   WYRSTSEDDKKELISGATKSIYAPEPFDVGRILQAEILAVDQIITLTTSGPIDPAAGLGN  367

Query  1249  YVETLLRKSNTEFSVVIAQMNGRNYSSRSIHSFHVGKMRMKLNKGWITKARDSYSGSMQL  1428
             YVE L+R+  TEF+VVI QMNG +++S+SIH  H+GKMR+KL +G  T A++ YS SMQ+
Sbjct  368   YVEALVRRHETEFNVVIIQMNGTDHASQSIHVLHIGKMRIKLCRGNATMAKEYYSHSMQI  427

Query  1429  CGFRGGGNSAAKSLFWQPRKGQSFVLVFDSERERNGALVVARKHALECNVSI  1584
             CG RGGGN+AA++++WQP+ G SFVL F+SERERN A+++AR+ A +CN+ +
Sbjct  428   CGVRGGGNAAAQAVYWQPKVGISFVLAFESERERNAAIMLARRFAFDCNIML  479



>ref|XP_010922033.1| PREDICTED: uncharacterized protein LOC105045454 [Elaeis guineensis]
 ref|XP_010922034.1| PREDICTED: uncharacterized protein LOC105045454 [Elaeis guineensis]
 ref|XP_010922035.1| PREDICTED: uncharacterized protein LOC105045454 [Elaeis guineensis]
Length=493

 Score =   550 bits (1416),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 294/484 (61%), Positives = 381/484 (79%), Gaps = 6/484 (1%)
 Frame = +1

Query  130   MTKVSPEFVGGEVQMYTFKSVSADVSFASNQFPKYKLGPDFQILEEALLEN-KGPSLKev  306
             MT+V+ +F G  +Q      VS+DV+F S +FP Y++G +  I+E    EN + PSLKE+
Sbjct  1     MTRVTRDF-GDSMQKEAIHLVSSDVNFVSGRFPDYQIGANNIIIEPE--ENPQMPSLKEL  57

Query  307   veeettRLTEQHKRLSVRDLASKFDKNLSSAAKLANEAKLRDAPSLEGHVLLKKLRDALE  486
             V +ET +L EQ KRLSVRDLA KF+K LS+AAKL++E+K R+  SL+ HVLLKKLRD L+
Sbjct  58    VAKETAQLLEQQKRLSVRDLADKFEKGLSAAAKLSDESKWREVASLDRHVLLKKLRDILD  117

Query  487   TLKGRLAGRNKEDVEIAIAMVEALAVRLTQKEGDLIQEKFEVNKLVSILKQASEDAKKLV  666
              L+GR+AGRNK+D E AI+MVEALAV+LTQ+EG+L+ EK EV KL + LKQA EDAKK++
Sbjct  118   QLRGRVAGRNKDDAEEAISMVEALAVQLTQREGELLHEKAEVKKLATFLKQAIEDAKKVI  177

Query  667   NQERSFACAEIESARAVVQRIGEALEEQEINSQVSGKQeveelmeeiqeARRIRVLHQPS  846
              +ERS A AEIESARA VQR+ EAL+EQE  S+ + KQ++EEL +E+QEARRI++LHQPS
Sbjct  178   EEERSIARAEIESARAAVQRVEEALQEQERMSRSAEKQDLEELKKEVQEARRIKMLHQPS  237

Query  847   KVMDMEHELRALRIQLNEKSVVSFKLQNELAMSKRTEQNKSQLYRIIGSESVGSILRIQP  1026
             +VMDMEHEL+ALR+Q+ EKS+   +L  ELAM K+ E+N+S LY + GSES+GS LRI P
Sbjct  238   RVMDMEHELQALRVQIAEKSMHCIQLNKELAMMKKLEENQSNLYDLEGSESLGSCLRIVP  297

Query  1027  CSDEAVDLSKCSIQWYRLSSECSRREPILGADKSVYAPEPIDVGRVLEADIVSNGLKASV  1206
               D A D++ CSI+WYR  +E S++E I GA K+VYAPEP DVGR L+A+IV N  + +V
Sbjct  298   RIDPAPDIANCSIRWYR--TEGSKKELISGASKTVYAPEPFDVGRFLQAEIVLNDERFTV  355

Query  1207  TTIGQIDQAAGLGNYVETLLRKSNTEFSVVIAQMNGRNYSSRSIHSFHVGKMRMKLNKGW  1386
             TT   ID AAGLG+YVE L+R+  TEF+VV+ QMNGRNYSS+SIH FHVGKMR+KL KG 
Sbjct  356   TTASPIDPAAGLGSYVEALVRRPETEFNVVVTQMNGRNYSSQSIHVFHVGKMRIKLCKGR  415

Query  1387  ITKARDSYSGSMQLCGFRGGGNSAAKSLFWQPRKGQSFVLVFDSERERNGALVVARKHAL  1566
              TKA++SYS SMQLCG RGGGN+AA+S+FWQ +KG  F+L F+SERERN A+++AR+ A 
Sbjct  416   STKAKESYSASMQLCGVRGGGNAAAQSIFWQAKKGLFFILAFESERERNAAIMLARRFAF  475

Query  1567  ECNV  1578
             +CNV
Sbjct  476   DCNV  479



>gb|KEH33524.1| Cyclin 4 [Medicago truncatula]
Length=498

 Score =   548 bits (1411),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 293/495 (59%), Positives = 383/495 (77%), Gaps = 8/495 (2%)
 Frame = +1

Query  130   MTKVSPEFVGGEVQMYTFKSVSADVSFASNQFPKYKLGPDFQILEEALLENKGPSLKevv  309
             MT+V+  F  G+  M     VSADV FAS +FP Y++G + +I+++     K  S+KEVV
Sbjct  1     MTRVTHSF--GDTMMMHKDVVSADVIFASLRFPTYQIGSNNKIMDDP----KVLSMKEVV  54

Query  310   eeettRLTEQHKRLSVRDLASKFDKNLSSAAKLANEAKLRDAPSLEGHVLLKKLRDALET  489
               ET +L EQ KRLSVRDLASKF+K L++AAKL+ EAKLR+A SLE HVLLKKLRD LE+
Sbjct  55    ARETAQLLEQQKRLSVRDLASKFEKGLAAAAKLSEEAKLREAASLEKHVLLKKLRDGLES  114

Query  490   LKGRLAGRNKEDVEIAIAMVEALAVRLTQKEGDLIQEKFEVNKLVSILKQASEDAKKLVN  669
             LKGR+ GRNK+DV  AI++VEALAV+LT +EG+L+QEK EV KL + LKQASEDAKKLV 
Sbjct  115   LKGRVTGRNKDDVHEAISLVEALAVQLTHREGELVQEKAEVKKLTNFLKQASEDAKKLVY  174

Query  670   QERSFACAEIESARAVVQRIGEALEEQEINSQVSGKQeveelmeeiqeARRIRVLHQPSK  849
             +ER+FA  EI++ARA VQR+ EAL+E E  S+ SG Q++E+LM+E+QEARRI++LHQPSK
Sbjct  175   EERAFARFEIDNARAAVQRVEEALQEHERMSRTSGNQDLEQLMKEVQEARRIKMLHQPSK  234

Query  850   VMDMEHELRALRIQLNEKSVVSFKLQNELAMSKRTEQNKSQLYRIIGSESVGSILRIQPC  1029
             VMDMEHEL+ALR QL EKS    +LQ ELA  K+ E+N   LY + G+E++GS L+IQPC
Sbjct  235   VMDMEHELQALRTQLAEKSRHYLRLQKELAREKKGEENVPHLYELEGTETLGSYLQIQPC  294

Query  1030  SDEAVDLSKCSIQWYRLSSECSRREPILGADKSVYAPEPIDVGRVLEADIVSNGLKASVT  1209
             S+ A +LS+CSIQWYR+S E +++E I GA KSVYAPEP DVGR+L+  I+S GL+ +++
Sbjct  295   SNNAPELSECSIQWYRVSPESAKKELISGATKSVYAPEPFDVGRILQVGIISEGLQITLS  354

Query  1210  TIGQIDQAAGLGNYVETLLRKSNTEFSVVIAQMNGRNYSSRSIHSFHVGKMRMKLNKGWI  1389
             T G I+ AAGLGNYVE L+RK +TEF+VV+ Q N  ++S+ SIH  +VGKMRMKL KG  
Sbjct  355   TTGPIEPAAGLGNYVEALVRKHDTEFNVVVTQTNDSHHSTESIHILNVGKMRMKLCKGKT  414

Query  1390  TKARDSYSGSMQLCGFRGGGNSAAKSLFWQPRKGQSFVLVFDSERERNGALVVARKHALE  1569
             T A++ YS SMQLCG RGGGN+AA++LFWQP++G SFVL F+SERERN A+++AR  ++ 
Sbjct  415   TIAKEFYSSSMQLCGVRGGGNAAAQALFWQPKQGLSFVLAFESERERNAAIMLAR--SIH  472

Query  1570  CNVSITSNLYLIICI  1614
              +V+     YL I +
Sbjct  473   VSVAKFPIPYLQIVL  487



>ref|XP_004250883.1| PREDICTED: uncharacterized protein LOC101257435 [Solanum lycopersicum]
 ref|XP_010313223.1| PREDICTED: uncharacterized protein LOC101257435 [Solanum lycopersicum]
Length=493

 Score =   548 bits (1411),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 294/486 (60%), Positives = 381/486 (78%), Gaps = 3/486 (1%)
 Frame = +1

Query  130   MTKVSPEFVGGEVQMYTFKSVSADVSFASNQFPKYKLGPDFQILEEALLENKGPSLKevv  309
             MT+V+ +F G  +Q      VSADV F S++FP YK+GP+ QI+E    ++K  ++KEVV
Sbjct  1     MTRVTLDF-GDTMQRDAVPPVSADVIFPSSRFPNYKIGPNNQIME-VKQDSKALTMKEVV  58

Query  310   eeettRLTEQHKRLSVRDLASKFDKNLSSAAKLANEAKLRDAPSLEGHVLLKKLRDALET  489
               ET  L EQ KRLSVRDLASKF+K L++AAKL++EA+++DA SLE HVLLKKLRDALE 
Sbjct  59    ARETAHLLEQQKRLSVRDLASKFEKGLAAAAKLSDEARMKDAASLEKHVLLKKLRDALEA  118

Query  490   LKGRLAGRNKEDVEIAIAMVEALAVRLTQKEGDLIQEKFEVNKLVSILKQASEDAKKLVN  669
             L+GR+AG+NK+DVE AIAMVEALAV+L Q+EG+LIQEK EV KL + LKQASEDAKKLV 
Sbjct  119   LRGRVAGKNKDDVEEAIAMVEALAVQLNQREGELIQEKTEVKKLATFLKQASEDAKKLVE  178

Query  670   QERSFACAEIESARAVVQRIGEALEEQEINSQVSGKQeveelmeeiqeARRIRVLHQPSK  849
             +ER++A AEIE+ARA VQR+ EAL+E E  S  SGKQ+++ELM+E+ EARRI++LHQPSK
Sbjct  179   EERAYARAEIENARAAVQRVEEALQEYEKMSGASGKQDMDELMKEVHEARRIKMLHQPSK  238

Query  850   VMDMEHELRALRIQLNEKSVVSFKLQNELAMSKRTEQNKSQLYRIIGSESVGSILRIQPC  1029
             VMDMEHEL+ALR+QL EK   S +LQ ELA  K  E+  SQLY + G+E++GS L IQPC
Sbjct  239   VMDMEHELQALRVQLAEKCKYSIQLQKELA-RKMGEETVSQLYELDGTEALGSCLHIQPC  297

Query  1030  SDEAVDLSKCSIQWYRLSSECSRREPILGADKSVYAPEPIDVGRVLEADIVSNGLKASVT  1209
             S  A +LS+C+IQWYRL+ E  ++EPI GA KSVYAPEP DVGR+L+A+I       SVT
Sbjct  298   SLAATELSECTIQWYRLACEGGKQEPISGATKSVYAPEPFDVGRILQAEITYGDQTTSVT  357

Query  1210  TIGQIDQAAGLGNYVETLLRKSNTEFSVVIAQMNGRNYSSRSIHSFHVGKMRMKLNKGWI  1389
             T G ID AAGLGNYVE L+R+ + EF+VV+ QMNG +++S +IH  H+G+MRMKL KG  
Sbjct  358   TAGPIDPAAGLGNYVEALVRRHDIEFNVVVVQMNGTDHTSETIHVLHIGRMRMKLCKGKT  417

Query  1390  TKARDSYSGSMQLCGFRGGGNSAAKSLFWQPRKGQSFVLVFDSERERNGALVVARKHALE  1569
             + A++ YS SMQLCG RGGGN+AA++ FWQ + G SFVL F++ERERN A+++AR+ A +
Sbjct  418   SIAKEYYSTSMQLCGVRGGGNAAAQAAFWQVKTGLSFVLAFETERERNAAIMLARRFAYD  477

Query  1570  CNVSIT  1587
             CN+ ++
Sbjct  478   CNIMLS  483



>ref|XP_010096133.1| Molybdopterin synthase catalytic subunit [Morus notabilis]
 gb|EXB63375.1| Molybdopterin synthase catalytic subunit [Morus notabilis]
Length=716

 Score =   556 bits (1432),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 308/493 (62%), Positives = 389/493 (79%), Gaps = 3/493 (1%)
 Frame = +1

Query  130   MTKVSPEFVGGEVQMYTFKSVSADVSFASNQFPKYKLGPDFQILEEALLENKGPSLKevv  309
             MT+VS +F G  +Q     +VSADV FAS++FP YKLG + QI+E    + +  S+KEVV
Sbjct  1     MTRVSRDF-GDTMQREAVPAVSADVIFASSRFPNYKLGANNQIVE-GKDDPRVLSMKEVV  58

Query  310   eeettRLTEQHKRLSVRDLASKFDKNLSSAAKLANEAKLRDAPSLEGHVLLKKLRDALET  489
               ET +L EQ KRLSVRDLASKF+K L++AAKL+ EA+LR+A SLE HVLLKKLRDALE+
Sbjct  59    ARETAQLLEQQKRLSVRDLASKFEKGLAAAAKLSEEARLREAASLEKHVLLKKLRDALES  118

Query  490   LKGRLAGRNKEDVEIAIAMVEALAVRLTQKEGDLIQEKFEVNKLVSILKQASEDAKKLVN  669
             L+GR+AGRNK+DVE AIAMVEALA++LTQ+EG+L+QEK EV KL + LKQASEDA+KLV+
Sbjct  119   LRGRVAGRNKDDVEEAIAMVEALAIQLTQREGELMQEKAEVKKLANFLKQASEDARKLVD  178

Query  670   QERSFACAEIESARAVVQRIGEALEEQEINSQVSGKQeveelmeeiqeARRIRVLHQPSK  849
             +ER+FA AEIE+ARA VQR+ EAL+EQE  S+ SGKQ++EELM+E+QEARRI++LHQPSK
Sbjct  179   EERAFARAEIEAARAAVQRVEEALQEQERMSRASGKQDLEELMKEVQEARRIKMLHQPSK  238

Query  850   VMDMEHELRALRIQLNEKSVVSFKLQNELAMSKRTEQNKSQLYRIIGSESVGSILRIQPC  1029
             VMDMEHEL+ALR QL EKS    +LQ ELA++K+  +N +QL+ + G E++GS L+IQPC
Sbjct  239   VMDMEHELQALRKQLAEKSKHYLRLQKELAINKKGMEN-NQLFELDGVEALGSYLQIQPC  297

Query  1030  SDEAVDLSKCSIQWYRLSSECSRREPILGADKSVYAPEPIDVGRVLEADIVSNGLKASVT  1209
              D A DLS+CSIQWYR+SSE  ++E I GA K VYAPEP DVGR+L+ DI + G   ++T
Sbjct  298   PDNAPDLSQCSIQWYRVSSEGGKKELISGATKLVYAPEPFDVGRILQVDITAEGQTKTLT  357

Query  1210  TIGQIDQAAGLGNYVETLLRKSNTEFSVVIAQMNGRNYSSRSIHSFHVGKMRMKLNKGWI  1389
             T G ID AAGLG+YVE L+RK + EF+VVI QMNG N  S SIH FH+GKMR+KL KG  
Sbjct  358   TTGAIDPAAGLGSYVEALVRKHDVEFNVVITQMNGVNQQSESIHVFHIGKMRIKLCKGKT  417

Query  1390  TKARDSYSGSMQLCGFRGGGNSAAKSLFWQPRKGQSFVLVFDSERERNGALVVARKHALE  1569
             T A++ YS SMQLCG RGGGN+AA++LFWQ +KG SFVL F+SERERN AL++AR+ A +
Sbjct  418   TVAKEYYSTSMQLCGVRGGGNAAAQALFWQAKKGLSFVLAFESERERNAALMLARRFAFD  477

Query  1570  CNVSITSNLYLII  1608
             CN       +  I
Sbjct  478   CNAKAIPKFHHFI  490



>ref|XP_006356373.1| PREDICTED: myosin-7B-like isoform X1 [Solanum tuberosum]
 ref|XP_006356374.1| PREDICTED: myosin-7B-like isoform X2 [Solanum tuberosum]
Length=493

 Score =   546 bits (1408),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 294/486 (60%), Positives = 380/486 (78%), Gaps = 3/486 (1%)
 Frame = +1

Query  130   MTKVSPEFVGGEVQMYTFKSVSADVSFASNQFPKYKLGPDFQILEEALLENKGPSLKevv  309
             MT+V+ +F G  +Q      VSADV F S++FP YK+GP+ QI+E    ++K  ++KEVV
Sbjct  1     MTRVTLDF-GDTMQRDAVPPVSADVIFPSSRFPNYKIGPNNQIME-VKQDSKALTMKEVV  58

Query  310   eeettRLTEQHKRLSVRDLASKFDKNLSSAAKLANEAKLRDAPSLEGHVLLKKLRDALET  489
               ET  L EQ KRLSVRDLASKF+K L++AAKL++EAK++DA SLE HVLLKKLRDALE 
Sbjct  59    ARETAHLLEQQKRLSVRDLASKFEKGLAAAAKLSDEAKMKDAASLEKHVLLKKLRDALEA  118

Query  490   LKGRLAGRNKEDVEIAIAMVEALAVRLTQKEGDLIQEKFEVNKLVSILKQASEDAKKLVN  669
             L+GR+AG+NK+DVE AIAMVEALAV+L Q+EG+LIQEK EV KL + LKQASEDAKKLV 
Sbjct  119   LRGRVAGKNKDDVEEAIAMVEALAVQLNQREGELIQEKTEVKKLATFLKQASEDAKKLVE  178

Query  670   QERSFACAEIESARAVVQRIGEALEEQEINSQVSGKQeveelmeeiqeARRIRVLHQPSK  849
             +ER++A AEIE+ARA VQR+ EAL+E E  S  SGKQ+++ELM+E+ EARRI++LHQPSK
Sbjct  179   EERAYARAEIENARAAVQRVEEALQEYEQMSGASGKQDMDELMKEVHEARRIKMLHQPSK  238

Query  850   VMDMEHELRALRIQLNEKSVVSFKLQNELAMSKRTEQNKSQLYRIIGSESVGSILRIQPC  1029
             VMDMEHEL+ALR+QL EK   S +LQ ELA  K  E+  SQLY + G+E++GS L IQPC
Sbjct  239   VMDMEHELQALRVQLAEKCKYSIQLQKELA-RKMGEETVSQLYELDGTEALGSFLHIQPC  297

Query  1030  SDEAVDLSKCSIQWYRLSSECSRREPILGADKSVYAPEPIDVGRVLEADIVSNGLKASVT  1209
             S  A +LS+C+IQWYRL+ E  ++EPI GA K VYAPEP DVGR+L+A+I   G   SVT
Sbjct  298   SLAASELSECTIQWYRLACEGGKQEPISGATKPVYAPEPFDVGRILQAEITYGGQTTSVT  357

Query  1210  TIGQIDQAAGLGNYVETLLRKSNTEFSVVIAQMNGRNYSSRSIHSFHVGKMRMKLNKGWI  1389
             T   ID AAGLGNYVE L+R+ + EF+VV+ QMNG +++S +IH  H+G+MRMKL KG  
Sbjct  358   TASPIDPAAGLGNYVEALVRRHDIEFNVVVVQMNGTDHTSETIHVLHIGRMRMKLCKGKS  417

Query  1390  TKARDSYSGSMQLCGFRGGGNSAAKSLFWQPRKGQSFVLVFDSERERNGALVVARKHALE  1569
             + A++ YS SMQLCG RGGGN+AA++ FWQ + G SFVL F++ERERN A+++AR+ A +
Sbjct  418   SVAKEYYSTSMQLCGVRGGGNAAAQAAFWQVKTGLSFVLAFETERERNAAIMLARRFAYD  477

Query  1570  CNVSIT  1587
             CN+ ++
Sbjct  478   CNIMLS  483



>ref|XP_008786860.1| PREDICTED: uncharacterized protein LOC103705047 [Phoenix dactylifera]
 ref|XP_008786861.1| PREDICTED: uncharacterized protein LOC103705047 [Phoenix dactylifera]
Length=493

 Score =   545 bits (1404),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 293/485 (60%), Positives = 380/485 (78%), Gaps = 8/485 (2%)
 Frame = +1

Query  130   MTKVSPEFVGGEVQMYTFKSVSADVSFASNQFPKYKLGPDFQILEEALLEN--KGPSLKe  303
             MT+V+ +F G  +Q      VS+DV+F S +FP Y++G +  I+E    EN  + PSLKE
Sbjct  1     MTRVTRDF-GDSMQKEAIHLVSSDVNFVSGRFPDYQIGANNIIIEP---ENNPRVPSLKE  56

Query  304   vveeettRLTEQHKRLSVRDLASKFDKNLSSAAKLANEAKLRDAPSLEGHVLLKKLRDAL  483
             +V +ETT+L EQ KRLSVRDLA KF+K LS+AAKL++E+K R+  SL+ HVLLKKLRD L
Sbjct  57    IVAKETTQLLEQQKRLSVRDLADKFEKGLSAAAKLSDESKWREVASLDRHVLLKKLRDVL  116

Query  484   ETLKGRLAGRNKEDVEIAIAMVEALAVRLTQKEGDLIQEKFEVNKLVSILKQASEDAKKL  663
             + L+GR+AGRNK+D E A++MVEALAV+LTQ+EG+L+ EK EV KL + LKQA EDAKK+
Sbjct  117   DQLRGRVAGRNKDDAEEAVSMVEALAVQLTQREGELLHEKAEVKKLATFLKQAIEDAKKV  176

Query  664   VNQERSFACAEIESARAVVQRIGEALEEQEINSQVSGKQeveelmeeiqeARRIRVLHQP  843
             + +ER+FA AEIESARA V+R+ EAL+EQE  S+ + KQE+EEL +E+QEARRI++LHQP
Sbjct  177   IEEERAFARAEIESARAAVRRVEEALQEQEQMSRSAEKQELEELKKEVQEARRIKMLHQP  236

Query  844   SKVMDMEHELRALRIQLNEKSVVSFKLQNELAMSKRTEQNKSQLYRIIGSESVGSILRIQ  1023
             SKVM MEHEL+ALRIQ+ EKS    +L+ ELA+ ++ E+NKS LY + GSES+GS LRI 
Sbjct  237   SKVMGMEHELQALRIQIAEKSAHCIQLKKELAILRKLEENKSNLYELEGSESLGSCLRIV  296

Query  1024  PCSDEAVDLSKCSIQWYRLSSECSRREPILGADKSVYAPEPIDVGRVLEADIVSNGLKAS  1203
             P +D A D+S CSIQWYR  +E S++E I GA K++YAPEP DVGR L+A+IV N  +  
Sbjct  297   PRTDPAPDISNCSIQWYR--TEGSKKELISGATKTLYAPEPFDVGRFLQAEIVLNDERFM  354

Query  1204  VTTIGQIDQAAGLGNYVETLLRKSNTEFSVVIAQMNGRNYSSRSIHSFHVGKMRMKLNKG  1383
             VTT   ID AAGLG+YVE L R+  TEF+VV+ QMNGR+Y S+SIH FHVGKMR+KL KG
Sbjct  355   VTTTSPIDPAAGLGSYVEALARRPETEFNVVVTQMNGRDYLSQSIHVFHVGKMRIKLRKG  414

Query  1384  WITKARDSYSGSMQLCGFRGGGNSAAKSLFWQPRKGQSFVLVFDSERERNGALVVARKHA  1563
               TKA++SYS SMQLCG RG GN+AAKS+FWQ +KG SF+L F+SERERN A+++AR+ A
Sbjct  415   RSTKAKESYSASMQLCGIRGCGNAAAKSIFWQAKKGLSFILAFESERERNAAIMLARRFA  474

Query  1564  LECNV  1578
              +CN+
Sbjct  475   FDCNI  479



>emb|CDP09656.1| unnamed protein product [Coffea canephora]
Length=491

 Score =   544 bits (1401),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 305/483 (63%), Positives = 382/483 (79%), Gaps = 5/483 (1%)
 Frame = +1

Query  130   MTKVSPEFVGGEVQMYTFKSVSADVSFASNQFPKYKLGPDFQILEEALLENKGPSLKevv  309
             MT+V  +F G  +Q      VSADV F S++FP YK+G + QI+E    + K  S+KEVV
Sbjct  1     MTRVGRDF-GDTMQKEAVPPVSADVVFTSSRFPNYKIGANNQIVE-VKEDPKVLSMKEVV  58

Query  310   eeettRLTEQHKRLSVRDLASKFDKNLSSAAKLANEAKLRDAPSLEGHVLLKKLRDALET  489
               ET +L EQ KRLSVRDLASKF+K L++AAKL++EAKLR+A SLE HVLLKKLRDALE 
Sbjct  59    ARETAQLLEQQKRLSVRDLASKFEKGLAAAAKLSDEAKLREAASLEKHVLLKKLRDALEA  118

Query  490   LKGRLAGRNKEDVEIAIAMVEALAVRLTQKEGDLIQEKFEVNKLVSILKQASEDAKKLVN  669
             L+GR+AG+NK+DVE AIAMVEALAV+LTQ+EG+LIQEK EV KL S LKQASEDAKKLV+
Sbjct  119   LRGRVAGKNKDDVEEAIAMVEALAVQLTQREGELIQEKAEVKKLASFLKQASEDAKKLVD  178

Query  670   QERSFACAEIESARAVVQRIGEALEEQEINSQVSGKQeveelmeeiqeARRIRVLHQPSK  849
             +ER+FA AEIE AR  VQR+ EAL+E E  S+ SG+Q+++ELM+E+QEARRI++LHQPSK
Sbjct  179   EERAFARAEIEKAREAVQRVEEALQEHERISRASGQQDIDELMKEVQEARRIKMLHQPSK  238

Query  850   VMDMEHELRALRIQLNEKSVVSFKLQNELAMSKRTEQNKSQLYRIIGSESVGSILRIQPC  1029
             VMDME EL ALR+QL EKS  S  LQ ELAMSKR+E N   +Y + G+E++GS LRI PC
Sbjct  239   VMDMEQELLALRLQLAEKSKHSLVLQKELAMSKRSEDN---MYELDGTEALGSYLRICPC  295

Query  1030  SDEAVDLSKCSIQWYRLSSECSRREPILGADKSVYAPEPIDVGRVLEADIVSNGLKASVT  1209
             S+ A++LS+CS QWYRLSSE  ++E I GA KSVYAPEP DVGR+L A+I+S+G   +V 
Sbjct  296   SERALELSECSFQWYRLSSEAGKKELISGATKSVYAPEPFDVGRILHAEIISDGQMTTVA  355

Query  1210  TIGQIDQAAGLGNYVETLLRKSNTEFSVVIAQMNGRNYSSRSIHSFHVGKMRMKLNKGWI  1389
             T G ID A GLGNYVE L+R+ + EF+VVI QMNG ++SS+SIH  HVGKMRMKL+KG  
Sbjct  356   TTGPIDPAPGLGNYVEALVRRHDIEFNVVIVQMNGLDHSSQSIHVLHVGKMRMKLHKGKT  415

Query  1390  TKARDSYSGSMQLCGFRGGGNSAAKSLFWQPRKGQSFVLVFDSERERNGALVVARKHALE  1569
             T  ++ YS SMQLCG RGGGN+AA++ FWQ + G SFVL F+SERERN A+++AR+ A +
Sbjct  416   TMTKEYYSTSMQLCGVRGGGNAAAQAAFWQAKVGLSFVLAFESERERNAAIMLARRFAFD  475

Query  1570  CNV  1578
             CN+
Sbjct  476   CNI  478



>ref|XP_008788541.1| PREDICTED: uncharacterized protein LOC103706263 [Phoenix dactylifera]
 ref|XP_008788542.1| PREDICTED: uncharacterized protein LOC103706263 [Phoenix dactylifera]
Length=493

 Score =   543 bits (1400),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 293/486 (60%), Positives = 381/486 (78%), Gaps = 6/486 (1%)
 Frame = +1

Query  130   MTKVSPEFVGGEVQMYTFKSVSADVSFASNQFPKYKLGPDFQILEEALLEN-KGPSLKev  306
             MT+++ +F G  +Q      VS DV+F   +FP Y++G +  I+E    EN + PSLKE+
Sbjct  1     MTRMTRDF-GDSMQKEAIHLVSTDVNFVLGRFPDYQIGANNIIIEPE--ENPQVPSLKEI  57

Query  307   veeettRLTEQHKRLSVRDLASKFDKNLSSAAKLANEAKLRDAPSLEGHVLLKKLRDALE  486
             V +ET +L EQ KRLSVRDLA KF+K LS+AAKL++E+K R+  SL+ HVLLKKLRDAL+
Sbjct  58    VAKETAQLLEQQKRLSVRDLADKFEKGLSAAAKLSDESKWREVASLDRHVLLKKLRDALD  117

Query  487   TLKGRLAGRNKEDVEIAIAMVEALAVRLTQKEGDLIQEKFEVNKLVSILKQASEDAKKLV  666
              L+GR+AGRNK+D E AI+MVEALAV+LTQ+EG+L+ EK EV KL + LKQA EDAKK++
Sbjct  118   QLRGRVAGRNKDDAEEAISMVEALAVQLTQREGELLHEKSEVKKLATFLKQAIEDAKKVI  177

Query  667   NQERSFACAEIESARAVVQRIGEALEEQEINSQVSGKQeveelmeeiqeARRIRVLHQPS  846
              +ER+ A AEIESARA VQR+ EAL+EQE  S+ + KQE+EEL +EIQEARRI++LHQPS
Sbjct  178   EEERAIARAEIESARAAVQRVEEALQEQERMSRSAEKQELEELKKEIQEARRIKMLHQPS  237

Query  847   KVMDMEHELRALRIQLNEKSVVSFKLQNELAMSKRTEQNKSQLYRIIGSESVGSILRIQP  1026
             +VMDMEHEL+ALRIQ+ +KS+   +L+ ELA+ K+ E+NKS LY + GSES+GS LRI P
Sbjct  238   RVMDMEHELQALRIQIADKSMHCIQLKKELAIMKKLEENKSNLYELEGSESLGSCLRIVP  297

Query  1027  CSDEAVDLSKCSIQWYRLSSECSRREPILGADKSVYAPEPIDVGRVLEADIVSNGLKASV  1206
               D A D+S CSI+WYR  +E S++E I GA K+VYAPEP DVGR L+A+IV N  + +V
Sbjct  298   RIDPAPDISNCSIRWYR--TEGSKKELISGATKTVYAPEPFDVGRFLQAEIVLNDERFTV  355

Query  1207  TTIGQIDQAAGLGNYVETLLRKSNTEFSVVIAQMNGRNYSSRSIHSFHVGKMRMKLNKGW  1386
             TT   ID AAGLG+YVE L R+  TEF+VV+ QMN R+YSS+SIH FHVGKMR+KL KG 
Sbjct  356   TTTSPIDPAAGLGSYVEALARRPETEFNVVVTQMNCRDYSSQSIHVFHVGKMRIKLCKGR  415

Query  1387  ITKARDSYSGSMQLCGFRGGGNSAAKSLFWQPRKGQSFVLVFDSERERNGALVVARKHAL  1566
              TKA++SYS SMQLCG RGGGN+AA+S+FWQ +KG SF++ F+SERERN A+++AR+ A 
Sbjct  416   STKAKESYSASMQLCGVRGGGNAAAQSIFWQAKKGLSFIIAFESERERNAAIMLARRFAF  475

Query  1567  ECNVSI  1584
             +CNV +
Sbjct  476   DCNVML  481



>ref|XP_010031696.1| PREDICTED: uncharacterized protein LOC104421446 [Eucalyptus grandis]
 gb|KCW51058.1| hypothetical protein EUGRSUZ_J00669 [Eucalyptus grandis]
Length=495

 Score =   543 bits (1399),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 295/483 (61%), Positives = 376/483 (78%), Gaps = 3/483 (1%)
 Frame = +1

Query  130   MTKVSPEFVGGEVQMYTFKSVSADVSFASNQFPKYKLGPDFQILEEALLENKGPSLKevv  309
             MT+VS +F    +    F +VSADV FAS++FP YK+G + QI++    + K  S+KEVV
Sbjct  1     MTRVSRDF-SKTMPKEAFAAVSADVIFASSRFPNYKIGFNNQIID-GKDDRKTLSMKEVV  58

Query  310   eeettRLTEQHKRLSVRDLASKFDKNLSSAAKLANEAKLRDAPSLEGHVLLKKLRDALET  489
               ET  L EQ KRLSVRDLA+KF+K L++AAKL+ EA+LR+A SLE HV+LKKLRDALE 
Sbjct  59    ARETAILLEQQKRLSVRDLANKFEKGLAAAAKLSEEARLREAVSLEKHVILKKLRDALEA  118

Query  490   LKGRLAGRNKEDVEIAIAMVEALAVRLTQKEGDLIQEKFEVNKLVSILKQASEDAKKLVN  669
             LKGR+AGRNK+DVE AIAMVEALAV+LTQ+EG+LIQEK EV +L + LKQASEDAKKLV 
Sbjct  119   LKGRVAGRNKDDVEEAIAMVEALAVKLTQREGELIQEKGEVKRLANFLKQASEDAKKLVE  178

Query  670   QERSFACAEIESARAVVQRIGEALEEQEINSQVSGKQeveelmeeiqeARRIRVLHQPSK  849
             +ER+FA AEIESARA VQR+ EAL+E E  S+ SGKQ++EELM+E+QEARRI++LHQPSK
Sbjct  179   EERAFARAEIESARAAVQRVEEALQEHETMSRASGKQDLEELMKEVQEARRIKMLHQPSK  238

Query  850   VMDMEHELRALRIQLNEKSVVSFKLQNELAMSKRTEQNKSQLYRIIGSESVGSILRIQPC  1029
             VMDME+EL ALR QL EKS  +  LQ ELA+ K  E+N   LY + G E++GSILRI P 
Sbjct  239   VMDMEYELSALRSQLAEKSKRALHLQKELAVCKSGEKN-PLLYELDGPEALGSILRILPS  297

Query  1030  SDEAVDLSKCSIQWYRLSSECSRREPILGADKSVYAPEPIDVGRVLEADIVSNGLKASVT  1209
             SD A ++S+ S+QWYRLSS+  ++  I GA K VYAPEP DVGR+L+ADI S G   +++
Sbjct  298   SDNAPEISEFSVQWYRLSSDGGKKVLISGATKQVYAPEPFDVGRILQADIFSEGQHITLS  357

Query  1210  TIGQIDQAAGLGNYVETLLRKSNTEFSVVIAQMNGRNYSSRSIHSFHVGKMRMKLNKGWI  1389
             T G I+ A GLG+YVE L+RK +T F+V+I+QM+G ++ S SIH  HVGKMRMKL KG  
Sbjct  358   TTGPIEPAPGLGSYVEALVRKHDTAFNVIISQMSGIDHISESIHVLHVGKMRMKLTKGKT  417

Query  1390  TKARDSYSGSMQLCGFRGGGNSAAKSLFWQPRKGQSFVLVFDSERERNGALVVARKHALE  1569
             T A++ YS SMQLCG RGGGN+A ++LFWQ + G SF+L F+SERERN A+++AR+ A +
Sbjct  418   TVAKEYYSSSMQLCGVRGGGNAAPQALFWQIKNGTSFILAFESERERNAAIMLARRFAYD  477

Query  1570  CNV  1578
             CN+
Sbjct  478   CNI  480



>ref|XP_009610562.1| PREDICTED: uncharacterized protein LOC104104241 [Nicotiana tomentosiformis]
 ref|XP_009610563.1| PREDICTED: uncharacterized protein LOC104104241 [Nicotiana tomentosiformis]
Length=493

 Score =   538 bits (1387),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 294/485 (61%), Positives = 381/485 (79%), Gaps = 3/485 (1%)
 Frame = +1

Query  130   MTKVSPEFVGGEVQMYTFKSVSADVSFASNQFPKYKLGPDFQILEEALLENKGPSLKevv  309
             MT+V+ +F G  +Q      VSADV F S++FP YK+G + QI+E    ++   ++KEVV
Sbjct  1     MTRVTRDF-GDTMQRDAVPPVSADVIFPSSRFPNYKIGANNQIVE-VKEDSTALTMKEVV  58

Query  310   eeettRLTEQHKRLSVRDLASKFDKNLSSAAKLANEAKLRDAPSLEGHVLLKKLRDALET  489
               ET +L EQ KRLSVRDLASKF+K L++AAKL++EA+L+DA SLE HVLLKKLRDALE 
Sbjct  59    ARETAQLLEQQKRLSVRDLASKFEKGLAAAAKLSDEARLKDAASLEKHVLLKKLRDALED  118

Query  490   LKGRLAGRNKEDVEIAIAMVEALAVRLTQKEGDLIQEKFEVNKLVSILKQASEDAKKLVN  669
             L+GR+AG+NK+DVE AIAMVEALAV+L+Q+EG+LIQEK EV KL + LKQASEDAKKLV 
Sbjct  119   LRGRVAGKNKDDVEEAIAMVEALAVQLSQREGELIQEKTEVKKLATFLKQASEDAKKLVE  178

Query  670   QERSFACAEIESARAVVQRIGEALEEQEINSQVSGKQeveelmeeiqeARRIRVLHQPSK  849
             +ER++A AEIE+ARA VQR+ EAL+E E  S  SGKQ++EELM+E+QEARRI++LHQPSK
Sbjct  179   EERAYARAEIENARAAVQRVEEALQEYERMSGASGKQDMEELMKEVQEARRIKMLHQPSK  238

Query  850   VMDMEHELRALRIQLNEKSVVSFKLQNELAMSKRTEQNKSQLYRIIGSESVGSILRIQPC  1029
             VMDMEHEL+ALR+QL EK+  S +LQ ELA  K  E+  SQLY + G+E++GS L+IQPC
Sbjct  239   VMDMEHELQALRVQLAEKAKYSVQLQKELA-RKMGEETVSQLYELDGTEALGSFLQIQPC  297

Query  1030  SDEAVDLSKCSIQWYRLSSECSRREPILGADKSVYAPEPIDVGRVLEADIVSNGLKASVT  1209
             S  + +LS+CSIQW+RL+ E  ++EPI GA K VYAPEP DVGRVL+A+I       SVT
Sbjct  298   SLASPELSECSIQWFRLACEGGKKEPISGATKLVYAPEPFDVGRVLQAEITYGDQITSVT  357

Query  1210  TIGQIDQAAGLGNYVETLLRKSNTEFSVVIAQMNGRNYSSRSIHSFHVGKMRMKLNKGWI  1389
             T   ID AAGLGNYVE L+R+ + EF+VV+ QMNG +++S SIH  H+G+MRMKL KG  
Sbjct  358   TASAIDPAAGLGNYVEALVRRHDIEFNVVVVQMNGTDHTSESIHVLHIGRMRMKLRKGKT  417

Query  1390  TKARDSYSGSMQLCGFRGGGNSAAKSLFWQPRKGQSFVLVFDSERERNGALVVARKHALE  1569
             + A++ YS SMQLCG RGGGN+AA++ FWQ + G SFVL F++ERERN A+++AR+ A +
Sbjct  418   SVAKEYYSASMQLCGVRGGGNAAAQAAFWQVKTGLSFVLAFETERERNAAIMLARRFAYD  477

Query  1570  CNVSI  1584
             CN+ +
Sbjct  478   CNIML  482



>gb|KGN66395.1| hypothetical protein Csa_1G600850 [Cucumis sativus]
Length=460

 Score =   532 bits (1370),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 279/464 (60%), Positives = 354/464 (76%), Gaps = 24/464 (5%)
 Frame = +1

Query  187   SVSADVSFASNQFPKYKLGPDFQILEEALLENKGPSLKevveeettRLTEQHKRLSVRDL  366
             +VSADV FAS++FP YK+GP+ QI+E A  + K  S+KEVV  ET +L EQ KRLSVRDL
Sbjct  8     AVSADVIFASSRFPNYKIGPNNQIVE-AKDDPKVLSMKEVVARETAQLLEQQKRLSVRDL  66

Query  367   ASKFDKNLSSAAKLANEAKLRDAPSLEGHVLLKKLRDALETLKGRLAGRNKEDVEIAIAM  546
             ASKF+K L++AAKL+ EA+LR+A SLE HVLLKKLRDALE L+GR+AGRNK+DVE AIAM
Sbjct  67    ASKFEKGLAAAAKLSEEARLREAASLEKHVLLKKLRDALEALRGRVAGRNKDDVEEAIAM  126

Query  547   VEALAVRLTQKEGDLIQEKFEVNKLVSILKQASEDAKKLVNQERSFACAEIESARAVVQR  726
             VEALAV+LTQ+EG+LIQEK EV KL + LKQASEDAKKLV++ER+FA AEIE+AR  VQR
Sbjct  127   VEALAVQLTQREGELIQEKAEVKKLANFLKQASEDAKKLVDEERAFARAEIENAREAVQR  186

Query  727   IGEALEEQEINSQVSGKQeveelmeeiqeARRIRVLHQPSKVMDMEHELRALRIQLNEKS  906
             + EAL+E E  S+ +GKQ                       VMDMEHEL+ALR+QL EKS
Sbjct  187   VEEALQEHERMSRAAGKQ-----------------------VMDMEHELQALRLQLAEKS  223

Query  907   VVSFKLQNELAMSKRTEQNKSQLYRIIGSESVGSILRIQPCSDEAVDLSKCSIQWYRLSS  1086
               S  LQ ELA+SK+   + S LY I G+ES+GS LRIQP  D + DLSKCSIQWYR++S
Sbjct  224   KYSILLQKELAISKKAMGDNSNLYEIDGTESLGSYLRIQPSCDTSPDLSKCSIQWYRIAS  283

Query  1087  ECSRREPILGADKSVYAPEPIDVGRVLEADIVSNGLKASVTTIGQIDQAAGLGNYVETLL  1266
             E  ++E I GA K+VYAPEP DVG++L+AD++ +  + ++TT G ID AAGLG+YVE L+
Sbjct  284   EGGKKELISGATKTVYAPEPFDVGKILQADVILDDHRITLTTTGPIDPAAGLGSYVEALV  343

Query  1267  RKSNTEFSVVIAQMNGRNYSSRSIHSFHVGKMRMKLNKGWITKARDSYSGSMQLCGFRGG  1446
             RK + EF+VV+ Q+NG N  S SIHS HVGKMR+KL KG  T A++ YS SMQLCG RGG
Sbjct  344   RKHDVEFNVVLTQVNGVNNPSESIHSLHVGKMRIKLCKGKNTIAKEYYSSSMQLCGVRGG  403

Query  1447  GNSAAKSLFWQPRKGQSFVLVFDSERERNGALVVARKHALECNV  1578
             GN+A ++LFWQ +K  S++L F+SER+RN A+++AR+ A +CN+
Sbjct  404   GNAAPQALFWQAKKDLSYILAFESERDRNAAIMLARRFAFDCNI  447



>ref|XP_010673798.1| PREDICTED: uncharacterized protein LOC104890123 [Beta vulgaris 
subsp. vulgaris]
 ref|XP_010673799.1| PREDICTED: uncharacterized protein LOC104890123 [Beta vulgaris 
subsp. vulgaris]
Length=493

 Score =   531 bits (1368),  Expect = 1e-180, Method: Compositional matrix adjust.
 Identities = 280/485 (58%), Positives = 371/485 (76%), Gaps = 3/485 (1%)
 Frame = +1

Query  130   MTKVSPEFVGGEVQMYTFKSVSADVSFASNQFPKYKLGPDFQILEEALLENKGPSLKevv  309
             MT+++ EF    +Q     +VSADV+F S++FP Y++G D Q+LE    E K  S+KE+V
Sbjct  1     MTRLTREF--ATMQKENVPAVSADVTFLSSRFPNYRIGADNQVLE-VKDERKMFSMKEIV  57

Query  310   eeettRLTEQHKRLSVRDLASKFDKNLSSAAKLANEAKLRDAPSLEGHVLLKKLRDALET  489
               ET  L EQ KRLSVRDLA KF+K L++AAKL+ E KL++A SLE HVLL+KLRDALE+
Sbjct  58    ARETAMLLEQQKRLSVRDLAYKFEKGLAAAAKLSEEDKLKEAASLEKHVLLRKLRDALES  117

Query  490   LKGRLAGRNKEDVEIAIAMVEALAVRLTQKEGDLIQEKFEVNKLVSILKQASEDAKKLVN  669
             L+GR+ G+NK DV+ AI+MVEALAV+L ++EG+L+ EK EV +L   LKQASE AK+LV 
Sbjct  118   LRGRVTGKNKGDVDEAISMVEALAVQLAKREGELLHEKEEVKRLAQFLKQASEQAKRLVE  177

Query  670   QERSFACAEIESARAVVQRIGEALEEQEINSQVSGKQeveelmeeiqeARRIRVLHQPSK  849
             +ERS A AEIE+ARA VQR+ EA++E E  S+ SGKQ+ +ELM+E+QEARRI++LHQPSK
Sbjct  178   EERSIARAEIENARAAVQRVEEAIQEHEQMSRASGKQDYDELMKEVQEARRIKMLHQPSK  237

Query  850   VMDMEHELRALRIQLNEKSVVSFKLQNELAMSKRTEQNKSQLYRIIGSESVGSILRIQPC  1029
             VMDME+ELRALR QL EKS  S +LQ EL M K+ E+    LY + G E +G+ LR Q  
Sbjct  238   VMDMEYELRALRTQLVEKSKHSIQLQKELIMKKKIEEEMLHLYELDGQELLGAFLRAQKR  297

Query  1030  SDEAVDLSKCSIQWYRLSSECSRREPILGADKSVYAPEPIDVGRVLEADIVSNGLKASVT  1209
             SD+A +LS+C IQWYR++S+  +REPI GA+K VYAPEP DVGR+L+A+I  +G K +V+
Sbjct  298   SDKAAELSECLIQWYRVTSDSDKREPISGANKQVYAPEPFDVGRLLQAEITFDGGKVTVS  357

Query  1210  TIGQIDQAAGLGNYVETLLRKSNTEFSVVIAQMNGRNYSSRSIHSFHVGKMRMKLNKGWI  1389
             T G ID A GLG+YVE L+R+ +TEF+VVI Q+NG +  S+SIH+ HVGKMRMKL KG  
Sbjct  358   TTGPIDPAPGLGSYVEALVRRHDTEFNVVITQINGADQPSQSIHALHVGKMRMKLCKGKT  417

Query  1390  TKARDSYSGSMQLCGFRGGGNSAAKSLFWQPRKGQSFVLVFDSERERNGALVVARKHALE  1569
             T A++ YS +MQLCG RGGGN+A ++LFWQ R   SFV+ F+SER+RN A+++AR+ A +
Sbjct  418   TVAKEYYSSAMQLCGVRGGGNAAVQALFWQVRPDLSFVIAFESERDRNAAIMLARRFAFD  477

Query  1570  CNVSI  1584
             CN+ +
Sbjct  478   CNIML  482



>gb|EYU35958.1| hypothetical protein MIMGU_mgv1a005292mg [Erythranthe guttata]
Length=490

 Score =   529 bits (1363),  Expect = 7e-180, Method: Compositional matrix adjust.
 Identities = 281/487 (58%), Positives = 371/487 (76%), Gaps = 6/487 (1%)
 Frame = +1

Query  130   MTKVSPEFVGGEVQMYTFKSVSADVSFASNQFPKYKLGPDFQILE-EALLENKGPSLKev  306
             MT+V   F    +Q      VSADV FAS +FP+YK+G +  I+E EA  ++   S+K++
Sbjct  1     MTRVGRGF-SYTLQNDAVSPVSADVVFASARFPRYKIGANNHIVEIEA--DSIMSSMKQM  57

Query  307   veeettRLTEQHKRLSVRDLASKFDKNLSSAAKLANEAKLRDAPSLEGHVLLKKLRDALE  486
             V  ETT L EQH+RLSVR+LASKF+K L++A+      +LR+A SLE HVLLKK+RD+LE
Sbjct  58    VARETTLLMEQHQRLSVRNLASKFEKGLAAASSYPT--RLREAASLEKHVLLKKIRDSLE  115

Query  487   TLKGRLAGRNKEDVEIAIAMVEALAVRLTQKEGDLIQEKFEVNKLVSILKQASEDAKKLV  666
              L+GR+  RNK+DV+ AI +VEALAV+LTQ+EG+LIQEK EV KL + LKQASEDAKKLV
Sbjct  116   ALRGRVGVRNKDDVKEAITIVEALAVQLTQREGELIQEKAEVKKLANFLKQASEDAKKLV  175

Query  667   NQERSFACAEIESARAVVQRIGEALEEQEINSQVSGKQeveelmeeiqeARRIRVLHQPS  846
             ++ERSFA AEIE+AR  VQR+ E+L E E  S+ SGKQ+++EL +E+QEARRI++LHQPS
Sbjct  176   DEERSFARAEIENAREAVQRVEESLHEHERISKASGKQDLDELRKEVQEARRIKMLHQPS  235

Query  847   KVMDMEHELRALRIQLNEKSVVSFKLQNELAMSKRTEQNKSQLYRIIGSESVGSILRIQP  1026
             KVMDMEHEL ALRIQL EKS  S KLQ ELA++K  +QN ++LY I G+E++GS LRI P
Sbjct  236   KVMDMEHELYALRIQLAEKSKHSLKLQKELAITKNVDQNTTRLYEIDGTEALGSYLRIFP  295

Query  1027  CSDEAVDLSKCSIQWYRLSSECSRREPILGADKSVYAPEPIDVGRVLEADIVSNGLKASV  1206
             CSD A DLS+C+IQWYR  SE   +E I GA KS YAPEP DVGR+L+A+I+++    +V
Sbjct  296   CSDIAPDLSECAIQWYRAISESDEKELISGATKSAYAPEPCDVGRILKAEIMTDDWTITV  355

Query  1207  TTIGQIDQAAGLGNYVETLLRKSNTEFSVVIAQMNGRNYSSRSIHSFHVGKMRMKLNKGW  1386
              T   ID A GLGNYVE L+R+ +TEF+V++ QMNG ++ S SIH  H+GKMRMKL KG 
Sbjct  356   ATSAPIDPAPGLGNYVEALVRRHDTEFTVILIQMNGVDHPSPSIHILHIGKMRMKLRKGQ  415

Query  1387  ITKARDSYSGSMQLCGFRGGGNSAAKSLFWQPRKGQSFVLVFDSERERNGALVVARKHAL  1566
              T  ++ YS SMQ+CG RGGGN+A ++++WQ + GQSF+  F+SERERN A+++AR+ A 
Sbjct  416   TTLTKEYYSNSMQICGIRGGGNAAPQAVYWQAKIGQSFIFAFESERERNAAIMLARRFAF  475

Query  1567  ECNVSIT  1587
             +CN+ ++
Sbjct  476   DCNIMLS  482



>ref|XP_010417822.1| PREDICTED: uncharacterized protein LOC104703495 [Camelina sativa]
Length=443

 Score =   527 bits (1357),  Expect = 1e-179, Method: Compositional matrix adjust.
 Identities = 267/421 (63%), Positives = 347/421 (82%), Gaps = 0/421 (0%)
 Frame = +1

Query  325   RLTEQHKRLSVRDLASKFDKNLSSAAKLANEAKLRDAPSLEGHVLLKKLRDALETLKGRL  504
             +L +Q KRLSVRDLA+KF+K L++AAKL+ EAKL++A SLE HVLLKKLRDALE+L+GR+
Sbjct  11    QLMDQQKRLSVRDLANKFEKGLAAAAKLSEEAKLKEATSLEKHVLLKKLRDALESLRGRV  70

Query  505   AGRNKEDVEIAIAMVEALAVRLTQKEGDLIQEKFEVNKLVSILKQASEDAKKLVNQERSF  684
             AGRNK+DVE AI+MVEALAV+LTQ+EG+L  EK EV KL S LKQASEDAKKLV +ER+F
Sbjct  71    AGRNKDDVEEAISMVEALAVQLTQREGELFIEKAEVKKLASFLKQASEDAKKLVYEERAF  130

Query  685   ACAEIESARAVVQRIGEALEEQEINSQVSGKQeveelmeeiqeARRIRVLHQPSKVMDME  864
             A AEIESARA VQR+ EAL E E  S+ SGKQ++E+LM+E+QEARRI++LHQPS+VMDME
Sbjct  131   ARAEIESARAAVQRVEEALREHEQMSRASGKQDMEDLMKEVQEARRIKMLHQPSRVMDME  190

Query  865   HELRALRIQLNEKSVVSFKLQNELAMSKRTEQNKSQLYRIIGSESVGSILRIQPCSDEAV  1044
             +ELRALR QL EKS    +LQ +LAM +++E+N S +Y I G+E++GS LR++ CS++A 
Sbjct  191   YELRALRNQLAEKSKHFLQLQKKLAMCRKSEENISLVYEIDGTEALGSCLRVRTCSNDAP  250

Query  1045  DLSKCSIQWYRLSSECSRREPILGADKSVYAPEPIDVGRVLEADIVSNGLKASVTTIGQI  1224
             DLSKC IQWYR SS+ S++E I GA KSVYAPEP DVGRVL ADI  +G   S++T+G+I
Sbjct  251   DLSKCMIQWYRSSSDGSKKELISGATKSVYAPEPFDVGRVLHADITYDGRLLSLSTVGKI  310

Query  1225  DQAAGLGNYVETLLRKSNTEFSVVIAQMNGRNYSSRSIHSFHVGKMRMKLNKGWITKARD  1404
             D AAGLG+YVE L+RK + +F+VV+ QM+G +++S SIH FHVGKMR+KL KG    A++
Sbjct  311   DPAAGLGSYVEALVRKHDVDFNVVVTQMSGEDHTSESIHLFHVGKMRIKLCKGKTVIAKE  370

Query  1405  SYSGSMQLCGFRGGGNSAAKSLFWQPRKGQSFVLVFDSERERNGALVVARKHALECNVSI  1584
              YS +MQLCG RGGGN+A ++L+WQ +KG SFV+ F+SERERN A+++AR+ A +CNV++
Sbjct  371   YYSSAMQLCGVRGGGNAAPQALYWQAKKGVSFVIAFESERERNAAIMLARRFACDCNVTL  430

Query  1585  T  1587
              
Sbjct  431   A  431



>ref|XP_007015356.1| Plectin-related isoform 3, partial [Theobroma cacao]
 gb|EOY32975.1| Plectin-related isoform 3, partial [Theobroma cacao]
Length=437

 Score =   526 bits (1355),  Expect = 2e-179, Method: Compositional matrix adjust.
 Identities = 288/439 (66%), Positives = 349/439 (79%), Gaps = 2/439 (0%)
 Frame = +1

Query  130   MTKVSPEFVGGEVQMYTFKSVSADVSFASNQFPKYKLGPDFQILEEALLENKGPSLKevv  309
             MT+VS EF G  +Q     +VSADV FAS++FP YK+G + QIL+ A  + K  S+KEVV
Sbjct  1     MTRVSREF-GDTMQKEAVPAVSADVIFASSRFPNYKIGANNQILD-AKEDPKVLSMKEVV  58

Query  310   eeettRLTEQHKRLSVRDLASKFDKNLSSAAKLANEAKLRDAPSLEGHVLLKKLRDALET  489
               ET  L EQ KRLSVRDLASKF+K L++AAKL+ EA+LR+A SLE HVLLKKLRDALE+
Sbjct  59    ARETALLLEQQKRLSVRDLASKFEKGLAAAAKLSEEARLREAASLEKHVLLKKLRDALES  118

Query  490   LKGRLAGRNKEDVEIAIAMVEALAVRLTQKEGDLIQEKFEVNKLVSILKQASEDAKKLVN  669
             LKGR+AGRNK+DV  AIAMVEALAV+LTQ+EG+LIQEK EV KL + LKQASEDAKKLV+
Sbjct  119   LKGRVAGRNKDDVAEAIAMVEALAVQLTQREGELIQEKAEVKKLANFLKQASEDAKKLVD  178

Query  670   QERSFACAEIESARAVVQRIGEALEEQEINSQVSGKQeveelmeeiqeARRIRVLHQPSK  849
             +ER+FA  EIESARA VQR+ EAL+E E  S+ SGKQ++EELM+E+QEARRI++LHQPSK
Sbjct  179   EERAFARVEIESARAAVQRVEEALQEHEQMSRASGKQDLEELMKEVQEARRIKMLHQPSK  238

Query  850   VMDMEHELRALRIQLNEKSVVSFKLQNELAMSKRTEQNKSQLYRIIGSESVGSILRIQPC  1029
             VMDMEHELRALRIQL EKS  S  LQ ELA SKR E+N S LY + G+E++GS  RI+PC
Sbjct  239   VMDMEHELRALRIQLAEKSKHSILLQKELARSKRVEENLSHLYELDGAETLGSYFRIKPC  298

Query  1030  SDEAVDLSKCSIQWYRLSSECSRREPILGADKSVYAPEPIDVGRVLEADIVSNGLKASVT  1209
             SD A +LS+CSIQWYR+SSE  ++E I GA KSVYAPEP DVGR+L+A+I+ +G K  + 
Sbjct  299   SDFAPELSRCSIQWYRISSEGGKKELISGASKSVYAPEPFDVGRILQAEIIYDGQKIILK  358

Query  1210  TIGQIDQAAGLGNYVETLLRKSNTEFSVVIAQMNGRNYSSRSIHSFHVGKMRMKLNKGWI  1389
             T G ID AAGLGNYVE L+RK + EF+VV+ QMNG ++ S SIH  HVGKMRMKL KG +
Sbjct  359   TTGAIDPAAGLGNYVEALVRKHDVEFNVVVTQMNGADHPSESIHVLHVGKMRMKLCKGKM  418

Query  1390  TKARDSYSGSMQLCGFRGG  1446
               A++ YS  MQLCG RGG
Sbjct  419   AIAKEYYSTVMQLCGVRGG  437



>ref|XP_010931532.1| PREDICTED: uncharacterized protein LOC105052430 isoform X2 [Elaeis 
guineensis]
Length=495

 Score =   526 bits (1355),  Expect = 1e-178, Method: Compositional matrix adjust.
 Identities = 282/484 (58%), Positives = 369/484 (76%), Gaps = 6/484 (1%)
 Frame = +1

Query  130   MTKVSPEFVGGEVQMYTFKSVSADVSFASNQFPKYKLGPDFQILEEALLEN-KGPSLKev  306
             MT+V+ +F G  +Q      VS+DV+F S +FP Y++G +  I+E    +N + PSLKE+
Sbjct  1     MTRVTRDF-GDSMQKEAIHLVSSDVNFVSGRFPDYQIGANNIIIEPE--DNPRVPSLKEI  57

Query  307   veeettRLTEQHKRLSVRDLASKFDKNLSSAAKLANEAKLRDAPSLEGHVLLKKLRDALE  486
             V +ET +L EQ KRLSVRDLA KF+K LS+A KL++E+K R+  SL+ HVLLKKLRD L+
Sbjct  58    VAKETAQLLEQQKRLSVRDLADKFEKGLSAAVKLSDESKWREVASLDRHVLLKKLRDVLD  117

Query  487   TLKGRLAGRNKEDVEIAIAMVEALAVRLTQKEGDLIQEKFEVNKLVSILKQASEDAKKLV  666
              L+GR+AGRNK+D + AI+MVEALAV+LTQ+EG+L  EK EV KL + LKQA EDAKK++
Sbjct  118   QLRGRVAGRNKDDADEAISMVEALAVQLTQREGELFHEKAEVKKLATFLKQAIEDAKKVI  177

Query  667   NQERSFACAEIESARAVVQRIGEALEEQEINSQVSGKQeveelmeeiqeARRIRVLHQPS  846
              +ER+FA AEIE AR  VQR+ EAL+EQE  S+   KQE+EEL +EI+EARRI++LHQPS
Sbjct  178   EEERAFAHAEIERARTAVQRVEEALQEQEQMSRSVEKQELEELKKEIREARRIKMLHQPS  237

Query  847   KVMDMEHELRALRIQLNEKSVVSFKLQNELAMSKRTEQNKSQLYRIIGSESVGSILRIQP  1026
             +VMDMEHEL+ LR+Q+ EKSV   +L+ ELA+ K+ E+NKS LY + GSES+GS LRI  
Sbjct  238   RVMDMEHELQGLRMQIAEKSVHCIQLKKELAVMKKLEENKSNLYELEGSESLGSCLRIVA  297

Query  1027  CSDEAVDLSKCSIQWYRLSSECSRREPILGADKSVYAPEPIDVGRVLEADIVSNGLKASV  1206
              +  A D+S C IQWYR  +E S++E I GA K++YAPEP DVGR L+ +IV N  +   
Sbjct  298   RTGPAPDISNCFIQWYR--TEGSKKELISGATKTLYAPEPFDVGRFLQVEIVLNDERFMA  355

Query  1207  TTIGQIDQAAGLGNYVETLLRKSNTEFSVVIAQMNGRNYSSRSIHSFHVGKMRMKLNKGW  1386
             TT   I+ AAGLG+YVE L R+  TEF+VV+ QMNG +  SRSIH FHVGKMR+KL KGW
Sbjct  356   TTTSLIEPAAGLGSYVEALARRPETEFNVVVTQMNGHDSLSRSIHVFHVGKMRIKLRKGW  415

Query  1387  ITKARDSYSGSMQLCGFRGGGNSAAKSLFWQPRKGQSFVLVFDSERERNGALVVARKHAL  1566
              TKA++SY  SMQLCG RGGGN+AA+S+FWQ +KG SF+L F+SERERN A+++AR+ A 
Sbjct  416   STKAKESYCASMQLCGVRGGGNAAAQSIFWQAKKGLSFILAFESERERNAAIMLARRFAF  475

Query  1567  ECNV  1578
             +CN+
Sbjct  476   DCNI  479



>ref|XP_010045094.1| PREDICTED: uncharacterized protein LOC104433899 [Eucalyptus grandis]
 gb|KCW87244.1| hypothetical protein EUGRSUZ_B03757 [Eucalyptus grandis]
Length=493

 Score =   526 bits (1355),  Expect = 1e-178, Method: Compositional matrix adjust.
 Identities = 285/485 (59%), Positives = 376/485 (78%), Gaps = 4/485 (1%)
 Frame = +1

Query  130   MTKVSPEFVGGEVQMYTFKSVSADVSFASNQFPKYKLGPDFQILEEALLENKGPSLKevv  309
             MT+++ EF G  +Q     +VSADV FAS +FPKYK+G + QI++ A  +    SLKEVV
Sbjct  1     MTRITREF-GTAIQ-RPVPAVSADVIFASTRFPKYKIGANNQIID-ARDDANILSLKEVV  57

Query  310   eeettRLTEQHKRLSVRDLASKFDKNLSSAAKLANEAKLRDAPSLEGHVLLKKLRDALET  489
               ET +L EQ KRLSVRDLASKF+K L++AAK+++EA+LR+A SLE HVLLKKLRD LE+
Sbjct  58    ARETAQLLEQQKRLSVRDLASKFEKGLAAAAKISDEARLREAASLEKHVLLKKLRDGLES  117

Query  490   LKGRLAGRNKEDVEIAIAMVEALAVRLTQKEGDLIQEKFEVNKLVSILKQASEDAKKLVN  669
             L+GR+ GR+K+DVE AIAMVE+LA +LTQ+EG+LIQEK EV KL + LKQASEDAKKLV+
Sbjct  118   LRGRVTGRSKDDVEEAIAMVESLAAQLTQREGELIQEKAEVKKLANFLKQASEDAKKLVD  177

Query  670   QERSFACAEIESARAVVQRIGEALEEQEINSQVSGKQeveelmeeiqeARRIRVLHQPSK  849
             +ER+FA AEIESA+A V+R+ EAL+E E  S+ SGKQ++E LM+E+QEARRI +LHQ SK
Sbjct  178   EERAFARAEIESAKAAVRRVEEALQEHERTSRASGKQDLEGLMKEVQEARRIIMLHQRSK  237

Query  850   VMDMEHELRALRIQLNEKSVVSFKLQNELAMSKRTEQNKSQLYRIIGSESVGSILRIQPC  1029
             VMDME+EL ALR QL EKS  S +LQ EL++ ++ E +   LY + G+E++GS L+I PC
Sbjct  238   VMDMEYELHALRNQLAEKSKRSLELQKELSVMRKGEMS-LLLYELEGAEALGSYLQIVPC  296

Query  1030  SDEAVDLSKCSIQWYRLSSECSRREPILGADKSVYAPEPIDVGRVLEADIVSNGLKASVT  1209
             SD A  LS+C+IQW+R+S E  R+E I GA K +YAPEP DVGR+L+ D+V +    ++T
Sbjct  297   SDSAPGLSECTIQWHRMSCEGGRKELISGATKPIYAPEPFDVGRLLQVDVVFDDQCIALT  356

Query  1210  TIGQIDQAAGLGNYVETLLRKSNTEFSVVIAQMNGRNYSSRSIHSFHVGKMRMKLNKGWI  1389
             T G ID AAGLG+YVE L+RK +T+F VV+AQ NG  +   SIH  H+G+MRMKL+K   
Sbjct  357   TTGPIDPAAGLGSYVEALVRKHDTQFKVVVAQTNGVEHPLESIHVLHIGRMRMKLSKEKT  416

Query  1390  TKARDSYSGSMQLCGFRGGGNSAAKSLFWQPRKGQSFVLVFDSERERNGALVVARKHALE  1569
             T A++ YS SMQLCG RGGGN+AA++LFWQ ++G SFVL F+SERERN  +++AR+ A +
Sbjct  417   TVAKEYYSSSMQLCGVRGGGNAAAQALFWQAKQGVSFVLAFESERERNATIMLARRFAYD  476

Query  1570  CNVSI  1584
             CN+ +
Sbjct  477   CNIML  481



>ref|XP_010931531.1| PREDICTED: uncharacterized protein LOC105052430 isoform X1 [Elaeis 
guineensis]
Length=501

 Score =   520 bits (1338),  Expect = 7e-176, Method: Compositional matrix adjust.
 Identities = 282/490 (58%), Positives = 369/490 (75%), Gaps = 12/490 (2%)
 Frame = +1

Query  130   MTKVSPEFVGGEVQMYTFKSVSADVSFASNQFPKYKLGPDFQILEEALLEN-KGPSLKev  306
             MT+V+ +F G  +Q      VS+DV+F S +FP Y++G +  I+E    +N + PSLKE+
Sbjct  1     MTRVTRDF-GDSMQKEAIHLVSSDVNFVSGRFPDYQIGANNIIIEPE--DNPRVPSLKEI  57

Query  307   veeettRLTEQHKRLSVRDLASKFDKNLSSAAKLANEAKLRDAPSLEGHVLLKKLRDALE  486
             V +ET +L EQ KRLSVRDLA KF+K LS+A KL++E+K R+  SL+ HVLLKKLRD L+
Sbjct  58    VAKETAQLLEQQKRLSVRDLADKFEKGLSAAVKLSDESKWREVASLDRHVLLKKLRDVLD  117

Query  487   TLKGRLAGRNKEDVEIAIAMVEALAVRLTQKEGDLIQEKFEVNKLVSILKQASEDAKKLV  666
              L+GR+AGRNK+D + AI+MVEALAV+LTQ+EG+L  EK EV KL + LKQA EDAKK++
Sbjct  118   QLRGRVAGRNKDDADEAISMVEALAVQLTQREGELFHEKAEVKKLATFLKQAIEDAKKVI  177

Query  667   NQERSFACAEIESARAVVQRIGEALEEQEINSQVSGKQeveelmeeiqeARRIRVLHQPS  846
              +ER+FA AEIE AR  VQR+ EAL+EQE  S+   KQE+EEL +EI+EARRI++LHQPS
Sbjct  178   EEERAFAHAEIERARTAVQRVEEALQEQEQMSRSVEKQELEELKKEIREARRIKMLHQPS  237

Query  847   KVMDMEHELRALRIQLNEKSVVSFKLQNELAMSKRTEQNKSQLYRIIGSESVGSILRIQP  1026
             +VMDMEHEL+ LR+Q+ EKSV   +L+ ELA+ K+ E+NKS LY + GSES+GS LRI  
Sbjct  238   RVMDMEHELQGLRMQIAEKSVHCIQLKKELAVMKKLEENKSNLYELEGSESLGSCLRIVA  297

Query  1027  CSDEAVDLSKCSIQWYRLSSECSRREPILGADKSVYAPEPIDVGRVLEADIVSNGLKASV  1206
              +  A D+S C IQWYR  +E S++E I GA K++YAPEP DVGR L+ +IV N  +   
Sbjct  298   RTGPAPDISNCFIQWYR--TEGSKKELISGATKTLYAPEPFDVGRFLQVEIVLNDERFMA  355

Query  1207  TTIGQIDQAAGLGNYVETLLRKSNTEFSVVIAQMNGRNYSSRSIHSFHVGKMRMKLNKGW  1386
             TT   I+ AAGLG+YVE L R+  TEF+VV+ QMNG +  SRSIH FHVGKMR+KL KGW
Sbjct  356   TTTSLIEPAAGLGSYVEALARRPETEFNVVVTQMNGHDSLSRSIHVFHVGKMRIKLRKGW  415

Query  1387  ITKARDSYSGSMQ------LCGFRGGGNSAAKSLFWQPRKGQSFVLVFDSERERNGALVV  1548
              TKA++SY  SMQ      LCG RGGGN+AA+S+FWQ +KG SF+L F+SERERN A+++
Sbjct  416   STKAKESYCASMQVATCPELCGVRGGGNAAAQSIFWQAKKGLSFILAFESERERNAAIML  475

Query  1549  ARKHALECNV  1578
             AR+ A +CN+
Sbjct  476   ARRFAFDCNI  485



>gb|AAB86442.1| hypothetical protein [Arabidopsis thaliana]
Length=945

 Score =   535 bits (1377),  Expect = 7e-176, Method: Compositional matrix adjust.
 Identities = 291/517 (56%), Positives = 369/517 (71%), Gaps = 55/517 (11%)
 Frame = +1

Query  130   MTKVSPEFVGGEV-QMYTFKSVSADVSFASNQFPKYKLGPDFQILEEALLENKGPSLKev  306
             MTKV P+     V      + +SADVSFASN FP YKLGPD QI++E   ++K PS+K+V
Sbjct  1     MTKVCPKTEEKRVVSEAVVEPISADVSFASNHFPTYKLGPDDQIVDEPDEDDKVPSVKDV  60

Query  307   veeettRLTEQHKRLSVRDLASKFDKNLSSAAKLANE--------------AKLRDAPSL  444
             V +ET  L++QHK+LSVRDLA KFDKNL++A+KL +E              AKL D  SL
Sbjct  61    VGKETGDLSDQHKKLSVRDLACKFDKNLAAASKLVDEVPLYFSSSYDYVSVAKLNDVTSL  120

Query  445   EGHVLLKKLRDALETLKGRLAGRNKEDVEIAIAMVEALAVRLTQKEGDLIQEKFEVNKLV  624
             EGHV+LKKLRDALET++GR+ GRN+E VE AI+MVEALAV+LTQ EG+LI +KFEV KL 
Sbjct  121   EGHVMLKKLRDALETMRGRMDGRNREAVEKAISMVEALAVKLTQNEGELIHDKFEVKKLA  180

Query  625   SILKQASEDAKKLVNQERSFACAEIESARAVVQRIGEALEEQEINSQVSGKQeveelmee  804
             S LK+AS+DAKKLVNQE+SFACAEIESARA+V ++G A EEQE+ S+ S  Q        
Sbjct  181   SFLKKASDDAKKLVNQEKSFACAEIESARALVMKLGGAFEEQELCSKASRDQ--------  232

Query  805   iqeARRIRVLHQPSKVMDMEHELRALRIQLNEKSVVSFKLQNELAMSKRTEQNKSQLYRI  984
                            V+ M+HELR L+ Q+ EKS  S KLQ E+A+ K+ E +KS  Y +
Sbjct  233   -------------GPVIGMQHELRDLKSQIQEKSAYSVKLQREIAIIKKAEGSKSCPYVL  279

Query  985   IGSESVGSILRIQPCSDEAVDLSKCSIQWYRLSSECSRREPILGADKSVYAPEPIDVGRV  1164
              G++S+GS LRI+  SD  +D+SKCSI WYR +SE SRRE I GA++SVYAPEP DVGRV
Sbjct  280   DGAQSLGSCLRIRASSDSGIDISKCSIHWYRAASESSRREAISGANRSVYAPEPFDVGRV  339

Query  1165  LEADIVSNGLKASVTTIGQIDQAAGLGNYVETLLRKSNTEFSVVIAQMNGRNYSSRSIHS  1344
             ++ADIVSNG K +VTT G I+ AAGL + VE+LLRKSN+EF+VVI+QMNG++++SRS H 
Sbjct  340   IQADIVSNGQKFTVTTDGPINTAAGLQSRVESLLRKSNSEFTVVISQMNGQDHASRS-HV  398

Query  1345  FHVGKMRMKLNKGWITKARDSYSGSM------------------QLCGFRGGGNSAAKSL  1470
             F VGK R+KL++GWITKAR+ YS SM                  QLCG RG  N  AK+L
Sbjct  399   FTVGKARIKLSRGWITKAREIYSTSMQLYLKFSFSSSLNGLVTFQLCGVRGNANVPAKAL  458

Query  1471  FWQPRKGQSFVLVFDSERERNGALVVARKHALECNVS  1581
             FWQ RKG +F+L F+SE+ERN A+V+AR +A +CNVS
Sbjct  459   FWQLRKGLTFLLTFESEQERNAAIVLARTYAYDCNVS  495



>ref|XP_004144148.1| PREDICTED: uncharacterized protein LOC101215534 [Cucumis sativus]
Length=475

 Score =   516 bits (1330),  Expect = 4e-175, Method: Compositional matrix adjust.
 Identities = 283/483 (59%), Positives = 369/483 (76%), Gaps = 21/483 (4%)
 Frame = +1

Query  130   MTKVSPEFVGGEVQMYTFKSVSADVSFASNQFPKYKLGPDFQILEEALLENKGPSLKevv  309
             MT++S  +    +Q     +VSADV FAS++FP YK+GP+ QI+E A  + K  S+KEVV
Sbjct  1     MTRISRTY-SDTMQREGVSAVSADVIFASSRFPNYKIGPNNQIVE-AKDDPKVLSMKEVV  58

Query  310   eeettRLTEQHKRLSVRDLASKFDKNLSSAAKLANEAKLRDAPSLEGHVLLKKLRDALET  489
               ET +L EQ KRLSVRDLASKF+K L++AAKL+ EA+LR+A SLE HVLLKKLRDALE 
Sbjct  59    ARETAQLLEQQKRLSVRDLASKFEKGLAAAAKLSEEARLREAASLEKHVLLKKLRDALEA  118

Query  490   LKGRLAGRNKEDVEIAIAMVEALAVRLTQKEGDLIQEKFEVNKLVSILKQASEDAKKLVN  669
             L+GR+AGRNK+DVE AIAMVEALAV+LTQ+EG+LIQEK EV KL + LKQASEDAKKLV+
Sbjct  119   LRGRVAGRNKDDVEEAIAMVEALAVQLTQREGELIQEKAEVKKLANFLKQASEDAKKLVD  178

Query  670   QERSFACAEIESARAVVQRIGEALEEQEINSQVSGKQeveelmeeiqeARRIRVLHQPSK  849
             +ER+FA AEIE+AR  VQR+ EAL+E E  S+ +GKQ++EELM+E+QEARRI++LHQPSK
Sbjct  179   EERAFARAEIENAREAVQRVEEALQEHERMSRAAGKQDLEELMKEVQEARRIKMLHQPSK  238

Query  850   VMDMEHELRALRIQLNEKSVVSFKLQNELAMSKRTEQNKSQLYRIIGSESVGSILRIQPC  1029
             V  ++    A+ I               LA+SK+   + S LY I G+ES+GS LRIQP 
Sbjct  239   VRILD----AVII---------------LAISKKAMGDNSNLYEIDGTESLGSYLRIQPS  279

Query  1030  SDEAVDLSKCSIQWYRLSSECSRREPILGADKSVYAPEPIDVGRVLEADIVSNGLKASVT  1209
              D + DLSKCSIQWYR++SE  ++E I GA K+VYAPEP DVG++L+AD++ +  + ++T
Sbjct  280   CDTSPDLSKCSIQWYRIASEGGKKELISGATKTVYAPEPFDVGKILQADVILDDHRITLT  339

Query  1210  TIGQIDQAAGLGNYVETLLRKSNTEFSVVIAQMNGRNYSSRSIHSFHVGKMRMKLNKGWI  1389
             T G ID AAGLG+YVE L+RK + EF+VV+ Q+NG N  S SIHS HVGKMR+KL KG  
Sbjct  340   TTGPIDPAAGLGSYVEALVRKHDVEFNVVLTQVNGVNNPSESIHSLHVGKMRIKLCKGKN  399

Query  1390  TKARDSYSGSMQLCGFRGGGNSAAKSLFWQPRKGQSFVLVFDSERERNGALVVARKHALE  1569
             T A++ YS SMQLCG RGGGN+A ++LFWQ +K  S++L F+SER+RN A+++AR+ A +
Sbjct  400   TIAKEYYSSSMQLCGVRGGGNAAPQALFWQAKKDLSYILAFESERDRNAAIMLARRFAFD  459

Query  1570  CNV  1578
             CN+
Sbjct  460   CNI  462



>emb|CAN82324.1| hypothetical protein VITISV_039755 [Vitis vinifera]
Length=369

 Score =   512 bits (1319),  Expect = 5e-175, Method: Compositional matrix adjust.
 Identities = 273/366 (75%), Positives = 317/366 (87%), Gaps = 1/366 (0%)
 Frame = +1

Query  130   MTKVSPEFVGGEVQMYTFKSVSADVSFASNQFPKYKLGPDFQILEEALLENKGPSLKevv  309
             MTKVSPE VG ++Q     SVSADVSFASN FPKYK+GP+ QILEE  ++ K PSLKEVV
Sbjct  1     MTKVSPE-VGDKMQEEIVLSVSADVSFASNHFPKYKIGPNNQILEEPKVDPKAPSLKEVV  59

Query  310   eeettRLTEQHKRLSVRDLASKFDKNLSSAAKLANEAKLRDAPSLEGHVLLKKLRDALET  489
              +ET+ L EQ KRLSVRDLASKFDKNLS+AAKL +EA+LR+  SLEGHVLLKKLRDALE+
Sbjct  60    AQETSLLVEQQKRLSVRDLASKFDKNLSAAAKLNDEARLREVASLEGHVLLKKLRDALES  119

Query  490   LKGRLAGRNKEDVEIAIAMVEALAVRLTQKEGDLIQEKFEVNKLVSILKQASEDAKKLVN  669
             ++GRLAGRNKEDVE AI+MVEALAV+LTQ+EG+LIQEKFEV KL + LKQASEDAKKLV+
Sbjct  120   IRGRLAGRNKEDVEKAISMVEALAVKLTQREGELIQEKFEVKKLANFLKQASEDAKKLVS  179

Query  670   QERSFACAEIESARAVVQRIGEALEEQEINSQVSGKQeveelmeeiqeARRIRVLHQPSK  849
             QERSFACAEIESARAVVQR GEALEEQE NSQ S KQ+VE LM+E+QEAR+IR+ HQPSK
Sbjct  180   QERSFACAEIESARAVVQRFGEALEEQEKNSQASEKQDVEGLMDEVQEARKIRIRHQPSK  239

Query  850   VMDMEHELRALRIQLNEKSVVSFKLQNELAMSKRTEQNKSQLYRIIGSESVGSILRIQPC  1029
             VMDMEHELRALRIQ+ EKS+ S KLQ ELA+SKR E+N S+LY + GSE++GS LRIQPC
Sbjct  240   VMDMEHELRALRIQIREKSIFSVKLQKELAISKRAEENPSRLYELNGSETLGSYLRIQPC  299

Query  1030  SDEAVDLSKCSIQWYRLSSECSRREPILGADKSVYAPEPIDVGRVLEADIVSNGLKASVT  1209
             SD+A +L KCSIQWYR+SSE S+ EPI GA+KS+YAPEP DVGR+L+ADIVSNG KA+V 
Sbjct  300   SDKAPELLKCSIQWYRVSSESSKNEPISGANKSIYAPEPFDVGRILQADIVSNGQKATVM  359

Query  1210  TIGQID  1227
             T G I+
Sbjct  360   TTGPIE  365



>ref|XP_007015357.1| Plectin-related isoform 4 [Theobroma cacao]
 gb|EOY32976.1| Plectin-related isoform 4 [Theobroma cacao]
Length=447

 Score =   513 bits (1322),  Expect = 3e-174, Method: Compositional matrix adjust.
 Identities = 283/435 (65%), Positives = 345/435 (79%), Gaps = 2/435 (0%)
 Frame = +1

Query  130   MTKVSPEFVGGEVQMYTFKSVSADVSFASNQFPKYKLGPDFQILEEALLENKGPSLKevv  309
             MT+VS EF G  +Q     +VSADV FAS++FP YK+G + QIL+ A  + K  S+KEVV
Sbjct  1     MTRVSREF-GDTMQKEAVPAVSADVIFASSRFPNYKIGANNQILD-AKEDPKVLSMKEVV  58

Query  310   eeettRLTEQHKRLSVRDLASKFDKNLSSAAKLANEAKLRDAPSLEGHVLLKKLRDALET  489
               ET  L EQ KRLSVRDLASKF+K L++AAKL+ EA+LR+A SLE HVLLKKLRDALE+
Sbjct  59    ARETALLLEQQKRLSVRDLASKFEKGLAAAAKLSEEARLREAASLEKHVLLKKLRDALES  118

Query  490   LKGRLAGRNKEDVEIAIAMVEALAVRLTQKEGDLIQEKFEVNKLVSILKQASEDAKKLVN  669
             LKGR+AGRNK+DV  AIAMVEALAV+LTQ+EG+LIQEK EV KL + LKQASEDAKKLV+
Sbjct  119   LKGRVAGRNKDDVAEAIAMVEALAVQLTQREGELIQEKAEVKKLANFLKQASEDAKKLVD  178

Query  670   QERSFACAEIESARAVVQRIGEALEEQEINSQVSGKQeveelmeeiqeARRIRVLHQPSK  849
             +ER+FA  EIESARA VQR+ EAL+E E  S+ SGKQ++EELM+E+QEARRI++LHQPSK
Sbjct  179   EERAFARVEIESARAAVQRVEEALQEHEQMSRASGKQDLEELMKEVQEARRIKMLHQPSK  238

Query  850   VMDMEHELRALRIQLNEKSVVSFKLQNELAMSKRTEQNKSQLYRIIGSESVGSILRIQPC  1029
             VMDMEHELRALRIQL EKS  S  LQ ELA SKR E+N S LY + G+E++GS  RI+PC
Sbjct  239   VMDMEHELRALRIQLAEKSKHSILLQKELARSKRVEENLSHLYELDGAETLGSYFRIKPC  298

Query  1030  SDEAVDLSKCSIQWYRLSSECSRREPILGADKSVYAPEPIDVGRVLEADIVSNGLKASVT  1209
             SD A +LS+CSIQWYR+SSE  ++E I GA KSVYAPEP DVGR+L+A+I+ +G K  + 
Sbjct  299   SDFAPELSRCSIQWYRISSEGGKKELISGASKSVYAPEPFDVGRILQAEIIYDGQKIILK  358

Query  1210  TIGQIDQAAGLGNYVETLLRKSNTEFSVVIAQMNGRNYSSRSIHSFHVGKMRMKLNKGWI  1389
             T G ID AAGLGNYVE L+RK + EF+VV+ QMNG ++ S SIH  HVGKMRMKL KG +
Sbjct  359   TTGAIDPAAGLGNYVEALVRKHDVEFNVVVTQMNGADHPSESIHVLHVGKMRMKLCKGKM  418

Query  1390  TKARDSYSGSMQLCG  1434
               A++ YS  MQ+ G
Sbjct  419   AIAKEYYSTVMQVLG  433



>ref|XP_010271917.1| PREDICTED: uncharacterized protein LOC104607860 isoform X2 [Nelumbo 
nucifera]
Length=451

 Score =   502 bits (1293),  Expect = 8e-170, Method: Compositional matrix adjust.
 Identities = 275/488 (56%), Positives = 350/488 (72%), Gaps = 51/488 (10%)
 Frame = +1

Query  130   MTKVSPEFVGGEVQMYTFKSVSADVSFASNQFPKYKLGPDFQILEEALLENKGP---SLK  300
             MT+VS +F G  +Q     SVSADVSF SN+FP Y++G + +I+E      +GP   S+K
Sbjct  1     MTRVSRDF-GNTMQRDAVPSVSADVSFVSNRFPHYRIGANNKIMEP----KEGPEVPSMK  55

Query  301   evveeettRLTEQHKRLSVRDLASKFDKNLSSAAKLANEAKLRDAPSLEGHVLLKKLRDA  480
             ++V  ET +L EQ KRLSVRDLASKF+K L++AAKL+ E                     
Sbjct  56    DIVARETAKLIEQKKRLSVRDLASKFEKGLAAAAKLSEE---------------------  94

Query  481   LETLKGRLAGRNKEDVEIAIAMVEALAVRLTQKEGDLIQEKFEVNKLVSILKQASEDAKK  660
                                   VEALAV+LT+ EGDLI EK EV KL +ILKQASEDA+K
Sbjct  95    ----------------------VEALAVQLTKSEGDLIHEKSEVKKLANILKQASEDARK  132

Query  661   LVNQERSFACAEIESARAVVQRIGEALEEQEINSQVSGKQeveelmeeiqeARRIRVLHQ  840
             LV++ERSFA AEIE+ARA VQR+ EAL+EQE  +Q SGKQE+E+L +E+QEARRI++LHQ
Sbjct  133   LVDEERSFARAEIENARAAVQRVEEALKEQERIAQTSGKQEMEDLRKEVQEARRIKMLHQ  192

Query  841   PSKVMDMEHELRALRIQLNEKSVVSFKLQNELAMSKRTEQNKSQLYRIIGSESVGSILRI  1020
             PSKVMDMEHELRALR QL EKS+ S +LQ ELAM K+ ++NKS+LY I GSE++GS LRI
Sbjct  193   PSKVMDMEHELRALRTQLAEKSMHSLQLQKELAMIKKLQENKSRLYVIDGSETLGSYLRI  252

Query  1021  QPCSDEAVDLSKCSIQWYRLSSECSRREPILGADKSVYAPEPIDVGRVLEADIVSNGLKA  1200
               C D+A D+ KCSIQWYR+  +  ++E I GA K  YAPEP DVGR+L+ADIVS+    
Sbjct  253   TSCVDKAPDILKCSIQWYRVLPDGGKKELISGATKPFYAPEPFDVGRILQADIVSDDQTV  312

Query  1201  SVTTIGQIDQAAGLGNYVETLLRKSNTEFSVVIAQMNGRNYSSRSIHSFHVGKMRMKLNK  1380
             SVTT G ID AAGLG+YVE L+RK  TEF+VVI QMNG+++ S  +H+FHVGKMR+KL K
Sbjct  313   SVTTAGPIDPAAGLGSYVEALVRKPETEFNVVITQMNGQDHPSNVVHTFHVGKMRIKLCK  372

Query  1381  GWITKARDSYSGSMQLCGFRGGGNSAAKSLFWQPRKGQSFVLVFDSERERNGALVVARKH  1560
             G  TKA+++YS SMQLCG RG GN+A ++LFW  +KGQS VL F+SERERN A+++AR+ 
Sbjct  373   GRFTKAKENYSNSMQLCGVRGAGNAAPQALFWHVKKGQSLVLAFESERERNAAIMLARRF  432

Query  1561  ALECNVSI  1584
             A +CN+ +
Sbjct  433   AFDCNIML  440



>ref|XP_007028250.1| Uncharacterized protein isoform 7 [Theobroma cacao]
 gb|EOY08752.1| Uncharacterized protein isoform 7 [Theobroma cacao]
Length=369

 Score =   496 bits (1277),  Expect = 1e-168, Method: Compositional matrix adjust.
 Identities = 253/360 (70%), Positives = 310/360 (86%), Gaps = 1/360 (0%)
 Frame = +1

Query  502   LAGRNKEDVEIAIAMVEALAVRLTQKEGDLIQEKFEVNKLVSILKQASEDAKKLVNQERS  681
             +AGRNKEDVE AI+MVEALAV+LTQKEG+LIQEKFEV KL + LKQASEDAKKLVNQE+S
Sbjct  1     MAGRNKEDVEKAISMVEALAVKLTQKEGELIQEKFEVKKLANFLKQASEDAKKLVNQEKS  60

Query  682   FACAEIESARAVVQRIGEALEEQEINSQVSGK-QeveelmeeiqeARRIRVLHQPSKVMD  858
             FACAEIESARAVVQR GEALEEQE NS++S K QEVEEL+EE+Q ARRI+++HQPSKVM 
Sbjct  61    FACAEIESARAVVQRFGEALEEQEKNSEISQKTQEVEELIEEVQVARRIKLMHQPSKVMG  120

Query  859   MEHELRALRIQLNEKSVVSFKLQNELAMSKRTEQNKSQLYRIIGSESVGSILRIQPCSDE  1038
             MEHELRALR Q+ EKS+ S KLQ ELA++K+ E+NKS++Y + GSE++GS LR+QPCSD 
Sbjct  121   MEHELRALRTQIREKSIFSVKLQKELALNKKAEENKSRVYILHGSETLGSCLRLQPCSDN  180

Query  1039  AVDLSKCSIQWYRLSSECSRREPILGADKSVYAPEPIDVGRVLEADIVSNGLKASVTTIG  1218
             A  LSK SIQWYR+SS+ +++E I GA+K +YAPEP+DVGR+L  DI+SNG K +VTT  
Sbjct  181   APVLSKSSIQWYRMSSDGNQQEIISGANKIMYAPEPLDVGRILLVDILSNGQKVTVTTSV  240

Query  1219  QIDQAAGLGNYVETLLRKSNTEFSVVIAQMNGRNYSSRSIHSFHVGKMRMKLNKGWITKA  1398
              I  AAGLG YVETLLRKS++EF+VVI+Q+NG+++ S S H+F+VGKMR+KL +GWITK+
Sbjct  241   PIGSAAGLGGYVETLLRKSSSEFNVVISQINGQDHPSHSTHAFNVGKMRIKLCRGWITKS  300

Query  1399  RDSYSGSMQLCGFRGGGNSAAKSLFWQPRKGQSFVLVFDSERERNGALVVARKHALECNV  1578
             R+ YS SM LCG RG GN+AAKSLFWQPRKG S+VL  +SERERN A++VARKHAL+C+V
Sbjct  301   REIYSTSMLLCGVRGDGNAAAKSLFWQPRKGLSYVLTCESERERNAAIMVARKHALDCSV  360



>ref|XP_007028251.1| Uncharacterized protein isoform 8 [Theobroma cacao]
 gb|EOY08753.1| Uncharacterized protein isoform 8 [Theobroma cacao]
Length=394

 Score =   490 bits (1261),  Expect = 8e-166, Method: Compositional matrix adjust.
 Identities = 278/394 (71%), Positives = 335/394 (85%), Gaps = 2/394 (1%)
 Frame = +1

Query  130   MTKVSPEFVGGEVQMYTFKSVSADVSFASNQFPKYKLGPDFQILEEALLENKGPSLKevv  309
             MTK+SPE     ++  +  +VSADVSFAS+ FPKYKLGP+ QILEE   +N GPSLKEVV
Sbjct  1     MTKISPEIEESMLK-ESILAVSADVSFASDHFPKYKLGPENQILEEPKGDNNGPSLKEVV  59

Query  310   eeettRLTEQHKRLSVRDLASKFDKNLSSAAKLANEAKLRDAPSLEGHVLLKKLRDALET  489
             E ETT+L+EQHKRLSVRDLASKFDKNL++AAKLA+EAKLR+  SLEGHVLLKKLRDALE+
Sbjct  60    ERETTQLSEQHKRLSVRDLASKFDKNLAAAAKLADEAKLREVASLEGHVLLKKLRDALES  119

Query  490   LKGRLAGRNKEDVEIAIAMVEALAVRLTQKEGDLIQEKFEVNKLVSILKQASEDAKKLVN  669
             L+GR+AGRNKEDVE AI+MVEALAV+LTQKEG+LIQEKFEV KL + LKQASEDAKKLVN
Sbjct  120   LRGRMAGRNKEDVEKAISMVEALAVKLTQKEGELIQEKFEVKKLANFLKQASEDAKKLVN  179

Query  670   QERSFACAEIESARAVVQRIGEALEEQEINSQVSGK-QeveelmeeiqeARRIRVLHQPS  846
             QE+SFACAEIESARAVVQR GEALEEQE NS++S K QEVEEL+EE+Q ARRI+++HQPS
Sbjct  180   QEKSFACAEIESARAVVQRFGEALEEQEKNSEISQKTQEVEELIEEVQVARRIKLMHQPS  239

Query  847   KVMDMEHELRALRIQLNEKSVVSFKLQNELAMSKRTEQNKSQLYRIIGSESVGSILRIQP  1026
             KVM MEHELRALR Q+ EKS+ S KLQ ELA++K+ E+NKS++Y + GSE++GS LR+QP
Sbjct  240   KVMGMEHELRALRTQIREKSIFSVKLQKELALNKKAEENKSRVYILHGSETLGSCLRLQP  299

Query  1027  CSDEAVDLSKCSIQWYRLSSECSRREPILGADKSVYAPEPIDVGRVLEADIVSNGLKASV  1206
             CSD A  LSK SIQWYR+SS+ +++E I GA+K +YAPEP+DVGR+L  DI+SNG K +V
Sbjct  300   CSDNAPVLSKSSIQWYRMSSDGNQQEIISGANKIMYAPEPLDVGRILLVDILSNGQKVTV  359

Query  1207  TTIGQIDQAAGLGNYVETLLRKSNTEFSVVIAQM  1308
             TT   I  AAGLG YVETLLRKS++EF+  +  +
Sbjct  360   TTSVPIGSAAGLGGYVETLLRKSSSEFNWCLTTL  393



>ref|XP_006595782.1| PREDICTED: rootletin-like isoform X4 [Glycine max]
Length=451

 Score =   492 bits (1266),  Expect = 9e-166, Method: Compositional matrix adjust.
 Identities = 266/485 (55%), Positives = 347/485 (72%), Gaps = 45/485 (9%)
 Frame = +1

Query  130   MTKVSPEFVGGEVQMYTFKSVSADVSFASNQFPKYKLGPDFQILEEALLENKGPSLKevv  309
             MT+++ +F G  +Q     +VS+DV FAS++FP Y++G + QI+E    + K  S+KEVV
Sbjct  1     MTRLTRDF-GDTMQRDAVPAVSSDVVFASSRFPNYRIGANNQIIETKD-DPKVLSMKEVV  58

Query  310   eeettRLTEQHKRLSVRDLASKFDKNLSSAAKLANEAKLRDAPSLEGHVLLKKLRDALET  489
               ET +L EQH RLSVRDLASKF+K L++AAKL+ E                        
Sbjct  59    ARETAQLLEQHNRLSVRDLASKFEKGLAAAAKLSEE------------------------  94

Query  490   LKGRLAGRNKEDVEIAIAMVEALAVRLTQKEGDLIQEKFEVNKLVSILKQASEDAKKLVN  669
                                VEALAV+LTQ+EG+LIQEK EV KL + LKQASEDAKKLV+
Sbjct  95    -------------------VEALAVQLTQREGELIQEKAEVKKLANFLKQASEDAKKLVD  135

Query  670   QERSFACAEIESARAVVQRIGEALEEQEINSQVSGKQeveelmeeiqeARRIRVLHQPSK  849
             +ER+FA AEIE ARA VQR+ EAL+E E  SQ SGKQ++E+LM E+QEARRI++LHQPSK
Sbjct  136   EERAFARAEIEDARAAVQRVEEALQEHERMSQASGKQDLEQLMREVQEARRIKMLHQPSK  195

Query  850   VMDMEHELRALRIQLNEKSVVSFKLQNELAMSKRTEQNKSQLYRIIGSESVGSILRIQPC  1029
             VMDMEHELRALR QL EK+    +LQ EL  +K+  +N   LY + G+E++GS L+IQPC
Sbjct  196   VMDMEHELRALRSQLAEKTRQYLRLQKELTRTKKGGENVPHLYELEGNETLGSYLQIQPC  255

Query  1030  SDEAVDLSKCSIQWYRLSSECSRREPILGADKSVYAPEPIDVGRVLEADIVSNGLKASVT  1209
             SD A ++SKCSIQWYR+SS+ +++E I GA KSVYAPEP DVGR+L+ DI+S     +++
Sbjct  256   SDNAPEVSKCSIQWYRVSSDGAKKELISGATKSVYAPEPFDVGRILQVDIISESEHVTLS  315

Query  1210  TIGQIDQAAGLGNYVETLLRKSNTEFSVVIAQMNGRNYSSRSIHSFHVGKMRMKLNKGWI  1389
             T G ID AAGLG YVE L+RK +TEF+VV+ QMNG ++ + SIH  HVGKMR+KL KG  
Sbjct  316   TAGPIDPAAGLGTYVEALVRKHDTEFNVVVTQMNGSHHPTESIHVLHVGKMRIKLCKGKT  375

Query  1390  TKARDSYSGSMQLCGFRGGGNSAAKSLFWQPRKGQSFVLVFDSERERNGALVVARKHALE  1569
             T A++ YS SMQLCG RGGGN+AA++LFWQP++G SFVL F+SERERN A+++AR+ A +
Sbjct  376   TIAKEYYSSSMQLCGVRGGGNAAAQALFWQPKQGHSFVLAFESERERNAAIMLARRFAFD  435

Query  1570  CNVSI  1584
             CN+ +
Sbjct  436   CNIML  440



>dbj|BAD68172.1| plectin-related protein-like [Oryza sativa Japonica Group]
Length=482

 Score =   492 bits (1267),  Expect = 2e-165, Method: Compositional matrix adjust.
 Identities = 256/474 (54%), Positives = 351/474 (74%), Gaps = 2/474 (0%)
 Frame = +1

Query  166   VQMYTFKSVSADVSFASNQFPKYKLGPDFQILEEALLENKGPSLKevveeettRLTEQHK  345
             +Q      VS+DV+F    FP YK+GP+ QI++   +    P LKE+V +ET +L EQ +
Sbjct  1     MQKEALAMVSSDVNFPKGHFPDYKIGPNNQIIDPEEIHEAVP-LKEIVAKETAQLLEQRR  59

Query  346   RLSVRDLASKFDKNLSSAAKLANEAKLRDAPSLEGHVLLKKLRDALETLKGRLAGRNKED  525
             RLSVRDL  KF+K LS A+KL+ EAK R+A SL+  VLLKKLRD L+TLKGR+AGRN++D
Sbjct  60    RLSVRDLKEKFEKGLSGASKLSEEAKRREAASLDRQVLLKKLRDVLDTLKGRVAGRNRDD  119

Query  526   VEIAIAMVEALAVRLTQKEGDLIQEKFEVNKLVSILKQASEDAKKLVNQERSFACAEIES  705
              + AI++VEALAV+LTQ+EG+LI EK EV KL S LKQA+EDA+K+  +ER+ A AEIE 
Sbjct  120   ADEAISLVEALAVQLTQREGELIYEKAEVKKLASFLKQATEDARKVAEEERALALAEIEK  179

Query  706   ARAVVQRIGEALEEQEINSQVSGKQeveelmeeiqeARRIRVLHQPSKVMDMEHELRALR  885
             AR  +  + + L+E +  S    K+E+E L +E++EARRI++LHQPSKVMDME EL+ALR
Sbjct  180   ARTAIAIVEKGLQEHDAASSSREKEEIEGLRKEVREARRIKMLHQPSKVMDMEFELKALR  239

Query  886   IQLNEKSVVSFKLQNELAMSKRTEQNKSQLYRIIGSESVGSILRIQPCSDEAVDLSKCSI  1065
               + EK+ +  +L  ELAM KR E++ S LY + GS+ +GS   I P  D+A D+S C  
Sbjct  240   TLIAEKNQLCNQLMKELAMIKRLEEDSSDLYDLEGSDILGSQFCIIPRFDDAPDISSCPT  299

Query  1066  QWYRLSSECSRREPILGADKSVYAPEPIDVGRVLEADIVSNGLKASVTTIGQIDQAAGLG  1245
             QWYR+ S    R  ILGA K  YAPEP DVGR+L+A+IV N  K ++ T+G I+ AAGL 
Sbjct  300   QWYRVIS-GGNRNLILGATKPTYAPEPFDVGRLLQAEIVLNAEKVTIQTMGPINPAAGLE  358

Query  1246  NYVETLLRKSNTEFSVVIAQMNGRNYSSRSIHSFHVGKMRMKLNKGWITKARDSYSGSMQ  1425
             +YVE+L+++++ EF+VV+ QMNG +YSS S+H+FH+GKMR+KL KGW TKAR+SYS +M+
Sbjct  359   HYVESLMKRADVEFNVVVTQMNGNDYSSNSVHAFHIGKMRIKLRKGWSTKARESYSTTMK  418

Query  1426  LCGFRGGGNSAAKSLFWQPRKGQSFVLVFDSERERNGALVVARKHALECNVSIT  1587
             LCG RGGGN+AA ++FWQ RKG S+ L F+++R+RN A+++ARK A  CN+++T
Sbjct  419   LCGSRGGGNAAATAVFWQARKGLSYTLAFETDRDRNAAIMLARKFASNCNITLT  472



>ref|NP_001044563.1| Os01g0805700 [Oryza sativa Japonica Group]
 dbj|BAF06477.1| Os01g0805700 [Oryza sativa Japonica Group]
 dbj|BAG95302.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG91415.1| unnamed protein product [Oryza sativa Japonica Group]
Length=493

 Score =   492 bits (1267),  Expect = 2e-165, Method: Compositional matrix adjust.
 Identities = 260/486 (53%), Positives = 357/486 (73%), Gaps = 3/486 (1%)
 Frame = +1

Query  130   MTKVSPEFVGGEVQMYTFKSVSADVSFASNQFPKYKLGPDFQILEEALLENKGPSLKevv  309
             MT+V  +  G  +Q      VS+DV+F    FP YK+GP+ QI++   +    P LKE+V
Sbjct  1     MTRVIHD-SGEGMQKEALAMVSSDVNFPKGHFPDYKIGPNNQIIDPEEIHEAVP-LKEIV  58

Query  310   eeettRLTEQHKRLSVRDLASKFDKNLSSAAKLANEAKLRDAPSLEGHVLLKKLRDALET  489
              +ET +L EQ +RLSVRDL  KF+K LS A+KL+ EAK R+A SL+  VLLKKLRD L+T
Sbjct  59    AKETAQLLEQRRRLSVRDLKEKFEKGLSGASKLSEEAKRREAASLDRQVLLKKLRDVLDT  118

Query  490   LKGRLAGRNKEDVEIAIAMVEALAVRLTQKEGDLIQEKFEVNKLVSILKQASEDAKKLVN  669
             LKGR+AGRN++D + AI++VEALAV+LTQ+EG+LI EK EV KL S LKQA+EDA+K+  
Sbjct  119   LKGRVAGRNRDDADEAISLVEALAVQLTQREGELIYEKAEVKKLASFLKQATEDARKVAE  178

Query  670   QERSFACAEIESARAVVQRIGEALEEQEINSQVSGKQeveelmeeiqeARRIRVLHQPSK  849
             +ER+ A AEIE AR  +  + + L+E +  S    K+E+E L +E++EARRI++LHQPSK
Sbjct  179   EERALALAEIEKARTAIAIVEKGLQEHDAASSSREKEEIEGLRKEVREARRIKMLHQPSK  238

Query  850   VMDMEHELRALRIQLNEKSVVSFKLQNELAMSKRTEQNKSQLYRIIGSESVGSILRIQPC  1029
             VMDME EL+ALR  + EK+ +  +L  ELAM KR E++ S LY + GS+ +GS   I P 
Sbjct  239   VMDMEFELKALRTLIAEKNQLCNQLMKELAMIKRLEEDSSDLYDLEGSDILGSQFCIIPR  298

Query  1030  SDEAVDLSKCSIQWYRLSSECSRREPILGADKSVYAPEPIDVGRVLEADIVSNGLKASVT  1209
              D+A D+S C  QWYR+ S    R  ILGA K  YAPEP DVGR+L+A+IV N  K ++ 
Sbjct  299   FDDAPDISSCPTQWYRVIS-GGNRNLILGATKPTYAPEPFDVGRLLQAEIVLNAEKVTIQ  357

Query  1210  TIGQIDQAAGLGNYVETLLRKSNTEFSVVIAQMNGRNYSSRSIHSFHVGKMRMKLNKGWI  1389
             T+G I+ AAGL +YVE+L+++++ EF+VV+ QMNG +YSS S+H+FH+GKMR+KL KGW 
Sbjct  358   TMGPINPAAGLEHYVESLMKRADVEFNVVVTQMNGNDYSSNSVHAFHIGKMRIKLRKGWS  417

Query  1390  TKARDSYSGSMQLCGFRGGGNSAAKSLFWQPRKGQSFVLVFDSERERNGALVVARKHALE  1569
             TKAR+SYS +M+LCG RGGGN+AA ++FWQ RKG S+ L F+++R+RN A+++ARK A  
Sbjct  418   TKARESYSTTMKLCGSRGGGNAAATAVFWQARKGLSYTLAFETDRDRNAAIMLARKFASN  477

Query  1570  CNVSIT  1587
             CN+++T
Sbjct  478   CNITLT  483



>ref|NP_001136837.1| uncharacterized protein LOC100216987 [Zea mays]
 gb|ACF82737.1| unknown [Zea mays]
 gb|AFW84821.1| cyclin4 [Zea mays]
Length=490

 Score =   491 bits (1264),  Expect = 6e-165, Method: Compositional matrix adjust.
 Identities = 259/485 (53%), Positives = 360/485 (74%), Gaps = 3/485 (1%)
 Frame = +1

Query  130   MTKVSPEFVGGEVQMYTFKSVSADVSFASNQFPKYKLGPDFQILEEALLENKGPSLKevv  309
             MT+V  +  G ++Q      VS+DV+F    FP Y++GP+ QI++        P LKE+V
Sbjct  1     MTRVIHD-SGDDMQKEALDLVSSDVNFPKGHFPDYRIGPNNQIIDPEETHEAVP-LKEIV  58

Query  310   eeettRLTEQHKRLSVRDLASKFDKNLSSAAKLANEAKLRDAPSLEGHVLLKKLRDALET  489
              +ET +L EQHKRLSVRDL  KF+K LS A+KL+ EAK R+A SL+  VLLKKLRD L+T
Sbjct  59    AKETAQLLEQHKRLSVRDLKEKFEKGLSGASKLSEEAKRREAASLDRQVLLKKLRDVLDT  118

Query  490   LKGRLAGRNKEDVEIAIAMVEALAVRLTQKEGDLIQEKFEVNKLVSILKQASEDAKKLVN  669
             LKGR+AGRN++D E AI++VEALAV+LTQ+EG+LI EK EV KL + LKQA+EDA+K+  
Sbjct  119   LKGRVAGRNRDDAEEAISLVEALAVQLTQREGELIYEKAEVKKLANFLKQATEDARKVAE  178

Query  670   QERSFACAEIESARAVVQRIGEALEEQEINSQVSGKQeveelmeeiqeARRIRVLHQPSK  849
             +ER+ A AEIE ARA ++++ +A    +  S    K E+EEL +E++EARRI++LHQPSK
Sbjct  179   EERALALAEIEKARAAIEKVEKAWRVHDFASSSREKAEIEELRKEVREARRIKMLHQPSK  238

Query  850   VMDMEHELRALRIQLNEKSVVSFKLQNELAMSKRTEQNKSQLYRIIGSESVGSILRIQPC  1029
             VMDME EL+ALR  ++EK+ +  +L+ ELAM KR E + S L+ + GS ++GS L I P 
Sbjct  239   VMDMEFELQALRTLISEKTQLCNQLKKELAMIKRLEDDSSGLFELEGSNTLGSQLCIIPR  298

Query  1030  SDEAVDLSKCSIQWYRLSSECSRREPILGADKSVYAPEPIDVGRVLEADIVSNGLKASVT  1209
              D A +++ C IQWYR+ S  + RE I GA K +YAPEP DVGR+L+A+IV N  K  V 
Sbjct  299   VDGASNITNCPIQWYRVISGGT-RELISGATKFMYAPEPFDVGRLLQAEIVLNADKIIVQ  357

Query  1210  TIGQIDQAAGLGNYVETLLRKSNTEFSVVIAQMNGRNYSSRSIHSFHVGKMRMKLNKGWI  1389
             T G +D AAGL  YV++L+++++ EF+VV+ QMNG++YSS S+H FH+GK+R+KL KGW 
Sbjct  358   TDGPVDNAAGLERYVDSLMKRTDIEFNVVVTQMNGKDYSSNSVHVFHIGKLRIKLRKGWS  417

Query  1390  TKARDSYSGSMQLCGFRGGGNSAAKSLFWQPRKGQSFVLVFDSERERNGALVVARKHALE  1569
             TKAR+SYS +M+LCG RGGGN+AA+++FW PRKG S+ L F+++R+RN A+++ARK A  
Sbjct  418   TKARESYSTTMKLCGSRGGGNAAARAVFWHPRKGSSYTLAFETDRDRNAAIMIARKFASN  477

Query  1570  CNVSI  1584
             CN+++
Sbjct  478   CNIAL  482



>ref|XP_002458653.1| hypothetical protein SORBIDRAFT_03g037470 [Sorghum bicolor]
 gb|EES03773.1| hypothetical protein SORBIDRAFT_03g037470 [Sorghum bicolor]
Length=490

 Score =   484 bits (1246),  Expect = 3e-162, Method: Compositional matrix adjust.
 Identities = 256/485 (53%), Positives = 359/485 (74%), Gaps = 3/485 (1%)
 Frame = +1

Query  130   MTKVSPEFVGGEVQMYTFKSVSADVSFASNQFPKYKLGPDFQILEEALLENKGPSLKevv  309
             MT+V  +  G ++       VS+DV+F   +FP Y++GP+ QI++        P LKE+V
Sbjct  1     MTRVIHD-SGDDMHKEALDLVSSDVNFPKGRFPDYRIGPNNQIIDPEETHEAVP-LKEIV  58

Query  310   eeettRLTEQHKRLSVRDLASKFDKNLSSAAKLANEAKLRDAPSLEGHVLLKKLRDALET  489
              +ET +L EQHKRLSVRDL  KF+K LS A+KL+ EAK R+A SL+  VLLKKLRD L+T
Sbjct  59    AKETAQLLEQHKRLSVRDLKEKFEKGLSGASKLSEEAKRREAASLDRQVLLKKLRDVLDT  118

Query  490   LKGRLAGRNKEDVEIAIAMVEALAVRLTQKEGDLIQEKFEVNKLVSILKQASEDAKKLVN  669
             LKGR+AGRN++D E AI++VEALAV+LTQ+EG+LI EK EV KL + LKQA+EDA+K+  
Sbjct  119   LKGRVAGRNRDDAEEAISLVEALAVQLTQREGELIYEKAEVKKLANFLKQATEDARKVAE  178

Query  670   QERSFACAEIESARAVVQRIGEALEEQEINSQVSGKQeveelmeeiqeARRIRVLHQPSK  849
             +ER+ A AEIE ARA ++++ +AL   +  S    K+E+EEL +E++EARRI++LHQPSK
Sbjct  179   EERALALAEIEKARAAIEKVEKALHVHDSASSSREKEEIEELRKEVREARRIKMLHQPSK  238

Query  850   VMDMEHELRALRIQLNEKSVVSFKLQNELAMSKRTEQNKSQLYRIIGSESVGSILRIQPC  1029
             VMDME EL+ALR  ++EK+ +  +L+ ELAM KR E++ S L+ + GS ++GS   I P 
Sbjct  239   VMDMEFELQALRTLISEKTQLCNQLKKELAMIKRLEEDSSDLFELEGSNTLGSQFCIVPR  298

Query  1030  SDEAVDLSKCSIQWYRLSSECSRREPILGADKSVYAPEPIDVGRVLEADIVSNGLKASVT  1209
              D A +++ C IQWYR+ S  + RE I GA K  YAPEP DVGR+L+A+I+ N  +  V 
Sbjct  299   VDGAPNIANCPIQWYRVISGGT-RELISGATKFTYAPEPFDVGRLLQAEILLNADRIVVQ  357

Query  1210  TIGQIDQAAGLGNYVETLLRKSNTEFSVVIAQMNGRNYSSRSIHSFHVGKMRMKLNKGWI  1389
             T G ID AAGL  Y ++L+++++ EF+VV+ QMNG++YSS S+H FH+GK+R+KL KGW 
Sbjct  358   TDGPIDNAAGLQRYADSLMKRTDIEFNVVVTQMNGKDYSSNSVHVFHIGKLRIKLRKGWS  417

Query  1390  TKARDSYSGSMQLCGFRGGGNSAAKSLFWQPRKGQSFVLVFDSERERNGALVVARKHALE  1569
             TKAR+SYS  M+LCG RGGGN+AA+++FWQ RKG S+ L F+++R+RN A+++ARK A  
Sbjct  418   TKARESYSTMMKLCGSRGGGNAAARAVFWQARKGLSYTLAFETDRDRNAAIMIARKFASN  477

Query  1570  CNVSI  1584
             CN+++
Sbjct  478   CNIAL  482



>ref|XP_010938831.1| PREDICTED: putative protein tag-278 isoform X1 [Elaeis guineensis]
Length=490

 Score =   483 bits (1243),  Expect = 1e-161, Method: Compositional matrix adjust.
 Identities = 265/477 (56%), Positives = 353/477 (74%), Gaps = 10/477 (2%)
 Frame = +1

Query  166   VQMYTFKSVSADVSFASNQFPKYKLGPDFQILEEALLENKGP---SLKevveeettRLTE  336
             +Q    + V+ +V+FAS +FP YK   D   +E     NKGP   SLKEVV +ET  L E
Sbjct  9     MQNEALRFVTYNVNFASRRFPNYKKRADSITVEP----NKGPEAPSLKEVVAKETIELLE  64

Query  337   QHKRLSVRDLASKFDKNLSSAAKLANEAKLRDAPSLEGHVLLKKLRDALETLKGRLAGRN  516
             + +RLSVRDLA KF+K L++A KL+NEAK R+    + HVLLKKL   LE+LKG + G++
Sbjct  65    RRQRLSVRDLAKKFEKGLNTATKLSNEAKWREVT--DRHVLLKKLMVVLESLKGHMVGQS  122

Query  517   KEDVEIAIAMVEALAVRLTQKEGDLIQEKFEVNKLVSILKQASEDAKKLVNQERSFACAE  696
             K++VE AI+MVE LAV+L Q+EG+L+QEK EV KL   LK+ASEDAKK+V +ER+ A  E
Sbjct  123   KDEVEEAISMVENLAVQLAQREGELLQEKSEVKKLAIFLKKASEDAKKVVEEERACARVE  182

Query  697   IESARAVVQRIGEALEEQEINSQVSGKQev-eelmeeiqeARRIRVLHQPSKVMDMEHEL  873
             IESARA +QR+ +A  E E+ ++ + KQ+  +ELM E+QEARRI++LHQPS+VM +EHEL
Sbjct  183   IESARAAMQRVIQAFHEHEMKTRSTEKQKDIQELMREVQEARRIKMLHQPSRVMHLEHEL  242

Query  874   RALRIQLNEKSVVSFKLQNELAMSKRTEQNKSQLYRIIGSESVGSILRIQPCSDEAVDLS  1053
             +ALRIQ  EKS+ S +L+ EL  +K+ E+NK+QLY + G ES+GS L I P  D A D+S
Sbjct  243   QALRIQYAEKSLSSVQLRKELERNKKLEENKNQLYELEGLESLGSSLHIIPREDTAPDIS  302

Query  1054  KCSIQWYRLSSECSRREPILGADKSVYAPEPIDVGRVLEADIVSNGLKASVTTIGQIDQA  1233
              CSIQWYR+  E +++E I GA KSVYAPEP DVGR L+A+IV      ++ T G ID A
Sbjct  303   TCSIQWYRIQPEGNKKELIPGATKSVYAPEPFDVGRFLQAEIVLGAESITIATTGPIDPA  362

Query  1234  AGLGNYVETLLRKSNTEFSVVIAQMNGRNYSSRSIHSFHVGKMRMKLNKGWITKARDSYS  1413
             AGLG+YVE LLRK  TEF+VV+ Q+NG N++S SIH FHVG++ +KL+KG +  AR+ YS
Sbjct  363   AGLGSYVEALLRKHETEFNVVLIQVNGENHASNSIHVFHVGRLSIKLSKGKMILAREFYS  422

Query  1414  GSMQLCGFRGGGNSAAKSLFWQPRKGQSFVLVFDSERERNGALVVARKHALECNVSI  1584
              SMQLCG RGGGN+AA++LFWQ +KG SF L F SERERN A+++AR+ A +CN+++
Sbjct  423   SSMQLCGVRGGGNAAAQALFWQVKKGLSFTLAFQSERERNAAMMLARRFAFDCNITL  479



>ref|XP_008810356.1| PREDICTED: uncharacterized protein LOC103721795 isoform X2 [Phoenix 
dactylifera]
Length=489

 Score =   478 bits (1230),  Expect = 9e-160, Method: Compositional matrix adjust.
 Identities = 265/468 (57%), Positives = 353/468 (75%), Gaps = 9/468 (2%)
 Frame = +1

Query  190   VSADVSFASNQFPKYKLGPDFQILEEALLENKGP---SLKevveeettRLTEQHKRLSVR  360
             V+ +V+FAS +F  YK+  D  I+E     NKGP   SLKE+V +ETT L E+ +RLSVR
Sbjct  17    VTYNVNFASRKFSNYKIRADSIIVEP----NKGPEAPSLKEIVAKETTELLERQQRLSVR  72

Query  361   DLASKFDKNLSSAAKLANEAKLRDAPSLEGHVLLKKLRDALETLKGRLAGRNKEDVEIAI  540
             DLA KF+K L++A KL+NEAK R+    + HVLLKKL+  LE+LKGR+ G+NK++ E AI
Sbjct  73    DLAKKFEKGLNTATKLSNEAKWREVT--DRHVLLKKLKVVLESLKGRMVGQNKDEFEEAI  130

Query  541   AMVEALAVRLTQKEGDLIQEKFEVNKLVSILKQASEDAKKLVNQERSFACAEIESARAVV  720
             +MVE LAV+L Q+EG+L+QEK EV KL   LK+ASEDAKK+V +ER+ A  +IESARA  
Sbjct  131   SMVETLAVQLAQREGELLQEKSEVKKLAIFLKKASEDAKKVVEEERACARVKIESARAAA  190

Query  721   QRIGEALEEQEINSQVSGKQeveelmeeiqeARRIRVLHQPSKVMDMEHELRALRIQLNE  900
             QR+ +A  E E+ ++ + KQ+ E+LM E+QEARRI++LHQPS+VM MEHEL+ALRIQ  E
Sbjct  191   QRVVQAFHEHEMKTRSTEKQDFEQLMREVQEARRIKMLHQPSRVMHMEHELQALRIQYAE  250

Query  901   KSVVSFKLQNELAMSKRTEQNKSQLYRIIGSESVGSILRIQPCSDEAVDLSKCSIQWYRL  1080
             KS+ S +L+ ELA +KR E+N +QLY + G ES+GS L I P  D A D+S C+IQWYR+
Sbjct  251   KSMSSVQLRKELARNKRLEENMNQLYELEGLESLGSSLHIIPREDTAPDISTCAIQWYRI  310

Query  1081  SSECSRREPILGADKSVYAPEPIDVGRVLEADIVSNGLKASVTTIGQIDQAAGLGNYVET  1260
              SE +++E I GA KSVY+PEP DVGR+L+A+IV      ++ T G ID AAGLG+YVE 
Sbjct  311   QSEGNKKELIPGATKSVYSPEPFDVGRLLQAEIVLGAESITIATTGPIDPAAGLGSYVEA  370

Query  1261  LLRKSNTEFSVVIAQMNGRNYSSRSIHSFHVGKMRMKLNKGWITKARDSYSGSMQLCGFR  1440
             LLRK  TEF+VV+ +MNG N++S SIH FHVG++ +KL+KG    AR+ YS SMQLCG R
Sbjct  371   LLRKHETEFNVVLIRMNGENHASNSIHVFHVGRLSIKLSKGKTILAREFYSSSMQLCGVR  430

Query  1441  GGGNSAAKSLFWQPRKGQSFVLVFDSERERNGALVVARKHALECNVSI  1584
             GGGN+AA++LFWQ +KG SF L F SERERN A+++AR+ A +CN+++
Sbjct  431   GGGNAAAQTLFWQVKKGLSFTLAFQSERERNAAMMLARRFAFDCNITL  478



>gb|EEE55547.1| hypothetical protein OsJ_03800 [Oryza sativa Japonica Group]
Length=985

 Score =   492 bits (1266),  Expect = 6e-159, Method: Compositional matrix adjust.
 Identities = 257/477 (54%), Positives = 352/477 (74%), Gaps = 2/477 (0%)
 Frame = +1

Query  157   GGEVQMYTFKSVSADVSFASNQFPKYKLGPDFQILEEALLENKGPSLKevveeettRLTE  336
             G  +Q      VS+DV+F    FP YK+GP+ QI++   +    P LKE+V +ET +L E
Sbjct  9     GEGMQKEALAMVSSDVNFPKGHFPDYKIGPNNQIIDPEEIHEAVP-LKEIVAKETAQLLE  67

Query  337   QHKRLSVRDLASKFDKNLSSAAKLANEAKLRDAPSLEGHVLLKKLRDALETLKGRLAGRN  516
             Q +RLSVRDL  KF+K LS A+KL+ EAK R+A SL+  VLLKKLRD L+TLKGR+AGRN
Sbjct  68    QRRRLSVRDLKEKFEKGLSGASKLSEEAKRREAASLDRQVLLKKLRDVLDTLKGRVAGRN  127

Query  517   KEDVEIAIAMVEALAVRLTQKEGDLIQEKFEVNKLVSILKQASEDAKKLVNQERSFACAE  696
             ++D + AI++VEALAV+LTQ+EG+LI EK EV KL S LKQA+EDA+K+  +ER+ A AE
Sbjct  128   RDDADEAISLVEALAVQLTQREGELIYEKAEVKKLASFLKQATEDARKVAEEERALALAE  187

Query  697   IESARAVVQRIGEALEEQEINSQVSGKQeveelmeeiqeARRIRVLHQPSKVMDMEHELR  876
             IE AR  +  + + L+E +  S    K+E+E L +E++EARRI++LHQPSKVMDME EL+
Sbjct  188   IEKARTAIAIVEKGLQEHDAASSSREKEEIEGLRKEVREARRIKMLHQPSKVMDMEFELK  247

Query  877   ALRIQLNEKSVVSFKLQNELAMSKRTEQNKSQLYRIIGSESVGSILRIQPCSDEAVDLSK  1056
             ALR  + EK+ +  +L  ELAM KR E++ S LY + GS+ +GS   I P  D+A D+S 
Sbjct  248   ALRTLIAEKNQLCNQLMKELAMIKRLEEDSSDLYDLEGSDILGSQFCIIPRFDDAPDISS  307

Query  1057  CSIQWYRLSSECSRREPILGADKSVYAPEPIDVGRVLEADIVSNGLKASVTTIGQIDQAA  1236
             C  QWYR+ S    R  ILGA K  YAPEP DVGR+L+A+IV N  K ++ T+G I+ AA
Sbjct  308   CPTQWYRVIS-GGNRNLILGATKPTYAPEPFDVGRLLQAEIVLNAEKVTIQTMGPINPAA  366

Query  1237  GLGNYVETLLRKSNTEFSVVIAQMNGRNYSSRSIHSFHVGKMRMKLNKGWITKARDSYSG  1416
             GL +YVE+L+++++ EF+VV+ QMNG +YSS S+H+FH+GKMR+KL KGW TKAR+SYS 
Sbjct  367   GLEHYVESLMKRADVEFNVVVTQMNGNDYSSNSVHAFHIGKMRIKLRKGWSTKARESYST  426

Query  1417  SMQLCGFRGGGNSAAKSLFWQPRKGQSFVLVFDSERERNGALVVARKHALECNVSIT  1587
             +M+LCG RGGGN+AA ++FWQ RKG S+ L F+++R+RN A+++ARK A  CN+++T
Sbjct  427   TMKLCGSRGGGNAAATAVFWQARKGLSYTLAFETDRDRNAAIMLARKFASNCNITLT  483



>ref|XP_003564423.1| PREDICTED: uncharacterized protein LOC100842834 [Brachypodium 
distachyon]
Length=498

 Score =   475 bits (1223),  Expect = 1e-158, Method: Compositional matrix adjust.
 Identities = 255/487 (52%), Positives = 359/487 (74%), Gaps = 3/487 (1%)
 Frame = +1

Query  127   KMTKVSPEFVGGEVQMYTFKSVSADVSFASNQFPKYKLGPDFQILEEALLENKGPSLKev  306
             +MT+V  +  G  +Q      VS+DV+F    FP Y++GP+ QI++        P LKE+
Sbjct  5     QMTRVIHD-SGEGMQKEALYMVSSDVNFPKGHFPDYRIGPNNQIIDPEETHEVVP-LKEI  62

Query  307   veeettRLTEQHKRLSVRDLASKFDKNLSSAAKLANEAKLRDAPSLEGHVLLKKLRDALE  486
             V +ET +L EQ +RLSVRDL  KF+K LS A KL+ EAK R+A SL+  VLLKKLRD L+
Sbjct  63    VAKETAQLLEQRRRLSVRDLKEKFEKGLSGATKLSEEAKRREAASLDRQVLLKKLRDVLD  122

Query  487   TLKGRLAGRNKEDVEIAIAMVEALAVRLTQKEGDLIQEKFEVNKLVSILKQASEDAKKLV  666
             +LKGR+AGRN++D + AI++VEALAV+LTQ+EG+LI EK EV KL S LKQA+EDA+K+ 
Sbjct  123   SLKGRVAGRNRDDADEAISLVEALAVQLTQREGELIYEKAEVKKLASFLKQATEDARKVA  182

Query  667   NQERSFACAEIESARAVVQRIGEALEEQEINSQVSGKQeveelmeeiqeARRIRVLHQPS  846
              +ER+ A AEIE +RA + ++ +AL+E +  S    K+E+EEL +EI+EARRI++LHQPS
Sbjct  183   EEERALALAEIEKSRAAIAKVEKALQEHDSASSSREKEEIEELRKEIREARRIKMLHQPS  242

Query  847   KVMDMEHELRALRIQLNEKSVVSFKLQNELAMSKRTEQNKSQLYRIIGSESVGSILRIQP  1026
             KVMDME EL+ LR  ++EK+ +  +L+ ELAM KR EQ+ S+L+ + GS+++GS  RI P
Sbjct  243   KVMDMEFELQGLRTLISEKTQLCNQLKKELAMIKRLEQDSSKLFELEGSDTLGSQFRIIP  302

Query  1027  CSDEAVDLSKCSIQWYRLSSECSRREPILGADKSVYAPEPIDVGRVLEADIVSNGLKASV  1206
               D A D++ C  QWYR+ S  S RE I GA +  YAPEP D+G++L+A+I+    K +V
Sbjct  303   RVDGAPDITSCLAQWYRVISGGS-RELISGATRLTYAPEPSDIGQLLQAEIILKADKVTV  361

Query  1207  TTIGQIDQAAGLGNYVETLLRKSNTEFSVVIAQMNGRNYSSRSIHSFHVGKMRMKLNKGW  1386
              T G ++ AAGL  YVE+L+R+++ EF+VV+ QMNG +YSS S+H FH+GK+R+KL KG 
Sbjct  362   QTDGPVNPAAGLERYVESLMRRTDIEFNVVVTQMNGNDYSSNSVHVFHIGKLRIKLRKGR  421

Query  1387  ITKARDSYSGSMQLCGFRGGGNSAAKSLFWQPRKGQSFVLVFDSERERNGALVVARKHAL  1566
              TKAR+SYS +M+LCG RGGGN+AA+++FWQ RK  S+ L F+++R+RN A+++ARK A 
Sbjct  422   STKARESYSTTMKLCGSRGGGNAAARAVFWQARKSLSYTLAFETDRDRNAAIMLARKFAS  481

Query  1567  ECNVSIT  1587
              CNV++T
Sbjct  482   NCNVALT  488



>ref|XP_006644870.1| PREDICTED: uncharacterized protein LOC102717018 [Oryza brachyantha]
Length=985

 Score =   490 bits (1262),  Expect = 3e-158, Method: Compositional matrix adjust.
 Identities = 258/487 (53%), Positives = 358/487 (74%), Gaps = 6/487 (1%)
 Frame = +1

Query  127   KMTKVSPEFVGGEVQMYTFKSVSADVSFASNQFPKYKLGPDFQILEEALLENKGPSLKev  306
             +MT+V  +  G  +Q      VS+DV+F    FP YK+GP+ QI++    +   P LKE+
Sbjct  10    QMTRVIHD-SGESIQKEALAMVSSDVNFPKGHFPDYKIGPNNQIIDPEETQEAVP-LKEI  67

Query  307   veeettRLTEQHKRLSVRDLASKFDKNLSSAAKLANEAKLRDAPSLEGHVLLKKLRDALE  486
             V +ET +L EQ +RLSVRDL  KF+K LS A+KL+ EAK R+A SL+  VLLKKLRD L+
Sbjct  68    VAKETAQLLEQRRRLSVRDLKEKFEKGLSGASKLSEEAKRREAASLDRQVLLKKLRDVLD  127

Query  487   TLKGRLAGRNKEDVEIAIAMVEALAVRLTQKEGDLIQEKFEVNKLVSILKQASEDAKKLV  666
             TLKGR+AGRN++D + AI++VEALAV+LTQ+EG+LI EK EV KL S LKQA+EDA+K+ 
Sbjct  128   TLKGRVAGRNRDDADEAISLVEALAVQLTQREGELIYEKAEVKKLASFLKQATEDARKVA  187

Query  667   NQERSFACAEIESARAVVQRIGEALEEQEINSQVSGKQeveelmeeiqeARRIRVLHQPS  846
              +ER+ A AEIE ARA + ++ + L+E +  S    K+E+E L +E++EARRI++LHQPS
Sbjct  188   EEERALALAEIEKARAAIAKVEKGLQEHDAASSSREKEEIEGLKKEVREARRIKMLHQPS  247

Query  847   KVMDMEHELRALRIQLNEKSVVSFKLQNELAMSKRTEQNKSQLYRIIGSESVGSILRIQP  1026
             KVMDME EL+ALR  + EK+ +  +L  ELAM KR E++ S L+ + GS+++GS   I P
Sbjct  248   KVMDMEFELKALRTLIAEKNQLYNQLMKELAMIKRLEEDGSDLFELEGSDTLGSQFCIIP  307

Query  1027  CSDEAVDLSKCSIQWYRLSSECSRREPILGADKSVYAPEPIDVGRVLEADIVSNGLKASV  1206
               D   D++ C IQWYR+ S    R  ILGA K  YAPEP DVGR+L+ DI+ N  K ++
Sbjct  308   RFD---DITSCPIQWYRVIS-GGNRNLILGATKPTYAPEPFDVGRLLQTDILLNSEKVTI  363

Query  1207  TTIGQIDQAAGLGNYVETLLRKSNTEFSVVIAQMNGRNYSSRSIHSFHVGKMRMKLNKGW  1386
              T+G I+ AAGL  YV++L+++++ EF+VV+ QMNG +YSS S+H+FH+GKMR+KL KGW
Sbjct  364   QTMGPINPAAGLERYVDSLMKRTDVEFNVVVTQMNGNDYSSNSVHAFHIGKMRIKLRKGW  423

Query  1387  ITKARDSYSGSMQLCGFRGGGNSAAKSLFWQPRKGQSFVLVFDSERERNGALVVARKHAL  1566
              TKAR+SYS +M+LCG RGGGN+AA ++FWQ RKG S+ L F+++R+RN A+++ARK A 
Sbjct  424   STKARESYSTTMKLCGSRGGGNAAATAVFWQARKGLSYTLAFETDRDRNAAIMLARKFAA  483

Query  1567  ECNVSIT  1587
              CN+S+T
Sbjct  484   NCNISLT  490



>gb|AFW84819.1| cyclin4 [Zea mays]
Length=987

 Score =   490 bits (1262),  Expect = 3e-158, Method: Compositional matrix adjust.
 Identities = 256/476 (54%), Positives = 355/476 (75%), Gaps = 2/476 (0%)
 Frame = +1

Query  157   GGEVQMYTFKSVSADVSFASNQFPKYKLGPDFQILEEALLENKGPSLKevveeettRLTE  336
             G ++Q      VS+DV+F    FP Y++GP+ QI++        P LKE+V +ET +L E
Sbjct  9     GDDMQKEALDLVSSDVNFPKGHFPDYRIGPNNQIIDPEETHEAVP-LKEIVAKETAQLLE  67

Query  337   QHKRLSVRDLASKFDKNLSSAAKLANEAKLRDAPSLEGHVLLKKLRDALETLKGRLAGRN  516
             QHKRLSVRDL  KF+K LS A+KL+ EAK R+A SL+  VLLKKLRD L+TLKGR+AGRN
Sbjct  68    QHKRLSVRDLKEKFEKGLSGASKLSEEAKRREAASLDRQVLLKKLRDVLDTLKGRVAGRN  127

Query  517   KEDVEIAIAMVEALAVRLTQKEGDLIQEKFEVNKLVSILKQASEDAKKLVNQERSFACAE  696
             ++D E AI++VEALAV+LTQ+EG+LI EK EV KL + LKQA+EDA+K+  +ER+ A AE
Sbjct  128   RDDAEEAISLVEALAVQLTQREGELIYEKAEVKKLANFLKQATEDARKVAEEERALALAE  187

Query  697   IESARAVVQRIGEALEEQEINSQVSGKQeveelmeeiqeARRIRVLHQPSKVMDMEHELR  876
             IE ARA ++++ +A    +  S    K E+EEL +E++EARRI++LHQPSKVMDME EL+
Sbjct  188   IEKARAAIEKVEKAWRVHDFASSSREKAEIEELRKEVREARRIKMLHQPSKVMDMEFELQ  247

Query  877   ALRIQLNEKSVVSFKLQNELAMSKRTEQNKSQLYRIIGSESVGSILRIQPCSDEAVDLSK  1056
             ALR  ++EK+ +  +L+ ELAM KR E + S L+ + GS ++GS L I P  D A +++ 
Sbjct  248   ALRTLISEKTQLCNQLKKELAMIKRLEDDSSGLFELEGSNTLGSQLCIIPRVDGASNITN  307

Query  1057  CSIQWYRLSSECSRREPILGADKSVYAPEPIDVGRVLEADIVSNGLKASVTTIGQIDQAA  1236
             C IQWYR+ S  + RE I GA K +YAPEP DVGR+L+A+IV N  K  V T G +D AA
Sbjct  308   CPIQWYRVISGGT-RELISGATKFMYAPEPFDVGRLLQAEIVLNADKIIVQTDGPVDNAA  366

Query  1237  GLGNYVETLLRKSNTEFSVVIAQMNGRNYSSRSIHSFHVGKMRMKLNKGWITKARDSYSG  1416
             GL  YV++L+++++ EF+VV+ QMNG++YSS S+H FH+GK+R+KL KGW TKAR+SYS 
Sbjct  367   GLERYVDSLMKRTDIEFNVVVTQMNGKDYSSNSVHVFHIGKLRIKLRKGWSTKARESYST  426

Query  1417  SMQLCGFRGGGNSAAKSLFWQPRKGQSFVLVFDSERERNGALVVARKHALECNVSI  1584
             +M+LCG RGGGN+AA+++FW PRKG S+ L F+++R+RN A+++ARK A  CN+++
Sbjct  427   TMKLCGSRGGGNAAARAVFWHPRKGSSYTLAFETDRDRNAAIMIARKFASNCNIAL  482



>ref|XP_008810354.1| PREDICTED: uncharacterized protein LOC103721795 isoform X1 [Phoenix 
dactylifera]
Length=490

 Score =   474 bits (1219),  Expect = 4e-158, Method: Compositional matrix adjust.
 Identities = 265/469 (57%), Positives = 353/469 (75%), Gaps = 10/469 (2%)
 Frame = +1

Query  190   VSADVSFASNQFPKYKLGPDFQILEEALLENKGP---SLKevveeettRLTEQHKRLSVR  360
             V+ +V+FAS +F  YK+  D  I+E     NKGP   SLKE+V +ETT L E+ +RLSVR
Sbjct  17    VTYNVNFASRKFSNYKIRADSIIVEP----NKGPEAPSLKEIVAKETTELLERQQRLSVR  72

Query  361   DLASKFDKNLSSAAKLANEAKLRDAPSLEGHVLLKKLRDALETLKGRLAGRNKEDVEIAI  540
             DLA KF+K L++A KL+NEAK R+    + HVLLKKL+  LE+LKGR+ G+NK++ E AI
Sbjct  73    DLAKKFEKGLNTATKLSNEAKWREVT--DRHVLLKKLKVVLESLKGRMVGQNKDEFEEAI  130

Query  541   AMVEALAVRLTQKEGDLIQEKFEVNKLVSILKQASEDAKKLVNQERSFACAEIESARAVV  720
             +MVE LAV+L Q+EG+L+QEK EV KL   LK+ASEDAKK+V +ER+ A  +IESARA  
Sbjct  131   SMVETLAVQLAQREGELLQEKSEVKKLAIFLKKASEDAKKVVEEERACARVKIESARAAA  190

Query  721   QRIGEALEEQEINSQVSGKQev-eelmeeiqeARRIRVLHQPSKVMDMEHELRALRIQLN  897
             QR+ +A  E E+ ++ + KQ+  E+LM E+QEARRI++LHQPS+VM MEHEL+ALRIQ  
Sbjct  191   QRVVQAFHEHEMKTRSTEKQKDFEQLMREVQEARRIKMLHQPSRVMHMEHELQALRIQYA  250

Query  898   EKSVVSFKLQNELAMSKRTEQNKSQLYRIIGSESVGSILRIQPCSDEAVDLSKCSIQWYR  1077
             EKS+ S +L+ ELA +KR E+N +QLY + G ES+GS L I P  D A D+S C+IQWYR
Sbjct  251   EKSMSSVQLRKELARNKRLEENMNQLYELEGLESLGSSLHIIPREDTAPDISTCAIQWYR  310

Query  1078  LSSECSRREPILGADKSVYAPEPIDVGRVLEADIVSNGLKASVTTIGQIDQAAGLGNYVE  1257
             + SE +++E I GA KSVY+PEP DVGR+L+A+IV      ++ T G ID AAGLG+YVE
Sbjct  311   IQSEGNKKELIPGATKSVYSPEPFDVGRLLQAEIVLGAESITIATTGPIDPAAGLGSYVE  370

Query  1258  TLLRKSNTEFSVVIAQMNGRNYSSRSIHSFHVGKMRMKLNKGWITKARDSYSGSMQLCGF  1437
              LLRK  TEF+VV+ +MNG N++S SIH FHVG++ +KL+KG    AR+ YS SMQLCG 
Sbjct  371   ALLRKHETEFNVVLIRMNGENHASNSIHVFHVGRLSIKLSKGKTILAREFYSSSMQLCGV  430

Query  1438  RGGGNSAAKSLFWQPRKGQSFVLVFDSERERNGALVVARKHALECNVSI  1584
             RGGGN+AA++LFWQ +KG SF L F SERERN A+++AR+ A +CN+++
Sbjct  431   RGGGNAAAQTLFWQVKKGLSFTLAFQSERERNAAMMLARRFAFDCNITL  479



>gb|AFW84820.1| cyclin4 [Zea mays]
Length=1003

 Score =   490 bits (1261),  Expect = 6e-158, Method: Compositional matrix adjust.
 Identities = 256/476 (54%), Positives = 355/476 (75%), Gaps = 2/476 (0%)
 Frame = +1

Query  157   GGEVQMYTFKSVSADVSFASNQFPKYKLGPDFQILEEALLENKGPSLKevveeettRLTE  336
             G ++Q      VS+DV+F    FP Y++GP+ QI++        P LKE+V +ET +L E
Sbjct  9     GDDMQKEALDLVSSDVNFPKGHFPDYRIGPNNQIIDPEETHEAVP-LKEIVAKETAQLLE  67

Query  337   QHKRLSVRDLASKFDKNLSSAAKLANEAKLRDAPSLEGHVLLKKLRDALETLKGRLAGRN  516
             QHKRLSVRDL  KF+K LS A+KL+ EAK R+A SL+  VLLKKLRD L+TLKGR+AGRN
Sbjct  68    QHKRLSVRDLKEKFEKGLSGASKLSEEAKRREAASLDRQVLLKKLRDVLDTLKGRVAGRN  127

Query  517   KEDVEIAIAMVEALAVRLTQKEGDLIQEKFEVNKLVSILKQASEDAKKLVNQERSFACAE  696
             ++D E AI++VEALAV+LTQ+EG+LI EK EV KL + LKQA+EDA+K+  +ER+ A AE
Sbjct  128   RDDAEEAISLVEALAVQLTQREGELIYEKAEVKKLANFLKQATEDARKVAEEERALALAE  187

Query  697   IESARAVVQRIGEALEEQEINSQVSGKQeveelmeeiqeARRIRVLHQPSKVMDMEHELR  876
             IE ARA ++++ +A    +  S    K E+EEL +E++EARRI++LHQPSKVMDME EL+
Sbjct  188   IEKARAAIEKVEKAWRVHDFASSSREKAEIEELRKEVREARRIKMLHQPSKVMDMEFELQ  247

Query  877   ALRIQLNEKSVVSFKLQNELAMSKRTEQNKSQLYRIIGSESVGSILRIQPCSDEAVDLSK  1056
             ALR  ++EK+ +  +L+ ELAM KR E + S L+ + GS ++GS L I P  D A +++ 
Sbjct  248   ALRTLISEKTQLCNQLKKELAMIKRLEDDSSGLFELEGSNTLGSQLCIIPRVDGASNITN  307

Query  1057  CSIQWYRLSSECSRREPILGADKSVYAPEPIDVGRVLEADIVSNGLKASVTTIGQIDQAA  1236
             C IQWYR+ S  + RE I GA K +YAPEP DVGR+L+A+IV N  K  V T G +D AA
Sbjct  308   CPIQWYRVISGGT-RELISGATKFMYAPEPFDVGRLLQAEIVLNADKIIVQTDGPVDNAA  366

Query  1237  GLGNYVETLLRKSNTEFSVVIAQMNGRNYSSRSIHSFHVGKMRMKLNKGWITKARDSYSG  1416
             GL  YV++L+++++ EF+VV+ QMNG++YSS S+H FH+GK+R+KL KGW TKAR+SYS 
Sbjct  367   GLERYVDSLMKRTDIEFNVVVTQMNGKDYSSNSVHVFHIGKLRIKLRKGWSTKARESYST  426

Query  1417  SMQLCGFRGGGNSAAKSLFWQPRKGQSFVLVFDSERERNGALVVARKHALECNVSI  1584
             +M+LCG RGGGN+AA+++FW PRKG S+ L F+++R+RN A+++ARK A  CN+++
Sbjct  427   TMKLCGSRGGGNAAARAVFWHPRKGSSYTLAFETDRDRNAAIMIARKFASNCNIAL  482



>gb|EEC71664.1| hypothetical protein OsI_04127 [Oryza sativa Indica Group]
Length=1001

 Score =   487 bits (1254),  Expect = 8e-157, Method: Compositional matrix adjust.
 Identities = 258/487 (53%), Positives = 357/487 (73%), Gaps = 3/487 (1%)
 Frame = +1

Query  127   KMTKVSPEFVGGEVQMYTFKSVSADVSFASNQFPKYKLGPDFQILEEALLENKGPSLKev  306
             +MT+V  +  G  +Q      VS+DV+F    FP Y++GP+ QI++   +    P LKE+
Sbjct  36    QMTRVIHD-SGEGMQKEALAMVSSDVNFPKGHFPDYEIGPNNQIIDPEEIHEAVP-LKEI  93

Query  307   veeettRLTEQHKRLSVRDLASKFDKNLSSAAKLANEAKLRDAPSLEGHVLLKKLRDALE  486
             V +ET +L EQ + LSVRDL  KF+K LS A+KL+ EAK R+A SL+  VLLKKLRD L+
Sbjct  94    VAKETAQLLEQRRGLSVRDLKEKFEKGLSGASKLSEEAKRREAASLDRQVLLKKLRDVLD  153

Query  487   TLKGRLAGRNKEDVEIAIAMVEALAVRLTQKEGDLIQEKFEVNKLVSILKQASEDAKKLV  666
             TLKGR+AGRN++D + AI++VEALAV+LTQ+EG+LI EK EV KL S LKQA+EDA+K+ 
Sbjct  154   TLKGRVAGRNRDDADEAISLVEALAVQLTQREGELIYEKAEVKKLASFLKQATEDARKVA  213

Query  667   NQERSFACAEIESARAVVQRIGEALEEQEINSQVSGKQeveelmeeiqeARRIRVLHQPS  846
              +ER+ A AEIE AR  +  + + L+E +  S    K+E+E L +E++EARRI++LHQPS
Sbjct  214   EEERALALAEIEKARTAIAIVEKGLQEHDAASSSREKEEIEGLRKEVREARRIKMLHQPS  273

Query  847   KVMDMEHELRALRIQLNEKSVVSFKLQNELAMSKRTEQNKSQLYRIIGSESVGSILRIQP  1026
             KVMDME EL+ALR  + EK+ +  +L  ELAM KR E++ S LY + GS+ +GS   I P
Sbjct  274   KVMDMEFELKALRTLIAEKNQLCNQLMKELAMIKRLEEDSSDLYDLEGSDILGSQFCIIP  333

Query  1027  CSDEAVDLSKCSIQWYRLSSECSRREPILGADKSVYAPEPIDVGRVLEADIVSNGLKASV  1206
               D+A D+S C  QWYR+ S    R  ILGA K  YAPEP DVGR+L+A+IV N  K ++
Sbjct  334   RFDDAPDISSCPTQWYRVIS-GGNRNLILGATKPTYAPEPFDVGRLLQAEIVLNAEKVTI  392

Query  1207  TTIGQIDQAAGLGNYVETLLRKSNTEFSVVIAQMNGRNYSSRSIHSFHVGKMRMKLNKGW  1386
              T+G I+ AAGL +YVE+L+++++ EF+VV+ QMNG +YSS S+H+FH+GKMR+KL KGW
Sbjct  393   QTMGPINPAAGLEHYVESLMKRADVEFNVVVTQMNGNDYSSNSVHAFHIGKMRIKLRKGW  452

Query  1387  ITKARDSYSGSMQLCGFRGGGNSAAKSLFWQPRKGQSFVLVFDSERERNGALVVARKHAL  1566
              TKAR+SYS +M+LCG RGGGN+AA ++FWQ RKG S+ L F+++R+RN A+++ARK A 
Sbjct  453   STKARESYSTTMKLCGSRGGGNAAATAVFWQARKGLSYTLAFETDRDRNAAIMLARKFAS  512

Query  1567  ECNVSIT  1587
              CN+++T
Sbjct  513   NCNITLT  519



>gb|EMT27137.1| hypothetical protein F775_30934 [Aegilops tauschii]
Length=531

 Score =   471 bits (1213),  Expect = 1e-156, Method: Compositional matrix adjust.
 Identities = 254/483 (53%), Positives = 357/483 (74%), Gaps = 2/483 (0%)
 Frame = +1

Query  127   KMTKVSPEFVGGEVQMYTFKSVSADVSFASNQFPKYKLGPDFQILEEALLENKGPSLKev  306
             +MT+V  +   G  +      VS+DV+F    FP Y++GP+ QI++        P LKE+
Sbjct  5     QMTRVIHDSGEGMQKGVALDIVSSDVNFPKGHFPDYRIGPNNQIIDPEETHEVVP-LKEI  63

Query  307   veeettRLTEQHKRLSVRDLASKFDKNLSSAAKLANEAKLRDAPSLEGHVLLKKLRDALE  486
             V +ETT+L EQ KRLSVRDL  KF+K LS A+KL+ EAK R+A SL+  VLLKKLRD L+
Sbjct  64    VAKETTQLLEQRKRLSVRDLREKFEKGLSGASKLSEEAKRREAASLDRQVLLKKLRDVLD  123

Query  487   TLKGRLAGRNKEDVEIAIAMVEALAVRLTQKEGDLIQEKFEVNKLVSILKQASEDAKKLV  666
             TLKGR+AGRN++D + AI++VEALAV+LTQ+EG+LI EK EV KL S LKQA+EDA+K+ 
Sbjct  124   TLKGRVAGRNRDDADEAISLVEALAVQLTQREGELIYEKAEVKKLASFLKQATEDARKVA  183

Query  667   NQERSFACAEIESARAVVQRIGEALEEQEINSQVSGKQeveelmeeiqeARRIRVLHQPS  846
              +ER+ A AEIE +RA ++++ +AL+EQ+  S    K+E+EEL +EI+EARRI++LHQPS
Sbjct  184   EEERALALAEIEKSRAAIEKVEKALQEQDSASSSREKEEIEELRKEIREARRIKMLHQPS  243

Query  847   KVMDMEHELRALRIQLNEKSVVSFKLQNELAMSKRTEQNKSQLYRIIGSESVGSILRIQP  1026
             KVMDM+ EL+ LR  ++EK+ +  +L+ ELAM KR EQ+ S+L+ + GS+++GS   I P
Sbjct  244   KVMDMQFELQGLRTLISEKTQLCNQLKKELAMIKRLEQDSSKLFELEGSDTLGSQFCIVP  303

Query  1027  CSDEAVDLSKCSIQWYRLSSECSRREPILGADKSVYAPEPIDVGRVLEADIVSNGLKASV  1206
               D A D+S C  QWYR+ S    RE I GA +  YAPEP DVG++L+A+I+    K +V
Sbjct  304   RVDGAPDISSCPAQWYRVIS-GGNRELISGATRLTYAPEPFDVGQLLQAEIILKADKVTV  362

Query  1207  TTIGQIDQAAGLGNYVETLLRKSNTEFSVVIAQMNGRNYSSRSIHSFHVGKMRMKLNKGW  1386
              T G I+ A+GL  YVE+L+++++ EF+VV+ QMNG +Y+S+S+H FH+GK+R+KL KG 
Sbjct  363   QTDGPINHASGLERYVESLMKRADIEFNVVVTQMNGNDYASKSVHVFHIGKLRVKLRKGR  422

Query  1387  ITKARDSYSGSMQLCGFRGGGNSAAKSLFWQPRKGQSFVLVFDSERERNGALVVARKHAL  1566
              TKAR+SYS +M+LCG RGGGN+AA ++FWQ RKG S+ L F+++R+RN A+++ARK A 
Sbjct  423   STKARESYSTTMKLCGSRGGGNAAACAVFWQTRKGLSYTLAFETDRDRNAAIMLARKFAS  482

Query  1567  ECN  1575
              CN
Sbjct  483   SCN  485



>emb|CDJ26534.1| unnamed protein product [Triticum aestivum]
Length=493

 Score =   469 bits (1206),  Expect = 4e-156, Method: Compositional matrix adjust.
 Identities = 256/485 (53%), Positives = 359/485 (74%), Gaps = 3/485 (1%)
 Frame = +1

Query  130   MTKVSPEFVGGEVQMYTFKSVSADVSFASNQFPKYKLGPDFQILEEALLENKGPSLKevv  309
             MT+V  +  G  +Q      VS+DV+F    FP Y++GP+ QI++        P LKE+V
Sbjct  1     MTRVIHD-SGEGMQKDALDMVSSDVNFPKGHFPDYRIGPNNQIIDPEETHEVVP-LKEIV  58

Query  310   eeettRLTEQHKRLSVRDLASKFDKNLSSAAKLANEAKLRDAPSLEGHVLLKKLRDALET  489
             E+ETT+L EQ KRLSVRDL  KF+K L+ A+KL+ EAK R+A SL+  VLLKKLRD L+T
Sbjct  59    EKETTQLLEQRKRLSVRDLREKFEKGLTGASKLSEEAKRREAASLDRQVLLKKLRDVLDT  118

Query  490   LKGRLAGRNKEDVEIAIAMVEALAVRLTQKEGDLIQEKFEVNKLVSILKQASEDAKKLVN  669
             LKGR+AGRN++D + AI++VEALAV+LTQ+EG+LI EK EV KL S LKQA+EDA+K+  
Sbjct  119   LKGRVAGRNRDDADEAISLVEALAVQLTQREGELIYEKAEVKKLASFLKQATEDARKVAE  178

Query  670   QERSFACAEIESARAVVQRIGEALEEQEINSQVSGKQeveelmeeiqeARRIRVLHQPSK  849
             +ER+ A AEIE +RA ++++ +AL E +  S    K+E+EEL +EI+EARRI++LHQPSK
Sbjct  179   EERALALAEIEKSRAAIEKVEKALREHDSASSSKEKEEIEELRKEIREARRIKMLHQPSK  238

Query  850   VMDMEHELRALRIQLNEKSVVSFKLQNELAMSKRTEQNKSQLYRIIGSESVGSILRIQPC  1029
             VMDM+ EL+ LR  ++EK+ +  +L+ ELAM KR EQ+ S+L+ + GS+++GS  RI P 
Sbjct  239   VMDMQFELQGLRTLISEKTQLCNQLKKELAMIKRLEQDSSKLFELEGSDTLGSQFRIVPR  298

Query  1030  SDEAVDLSKCSIQWYRLSSECSRREPILGADKSVYAPEPIDVGRVLEADIVSNGLKASVT  1209
              D A D+S C  QWYR+ S    RE I GA +  YAPEP DVG++L+A+I+    K +V 
Sbjct  299   VDGAPDISSCPAQWYRVIS-GGNRELISGATRLTYAPEPFDVGQLLQAEIILKADKVTVQ  357

Query  1210  TIGQIDQAAGLGNYVETLLRKSNTEFSVVIAQMNGRNYSSRSIHSFHVGKMRMKLNKGWI  1389
             T G I+ A+GL  YVE+L+++++ EF+VV+ QMNG +Y+S+S+H FH+GK+R+KL KG  
Sbjct  358   TDGPINHASGLERYVESLMKRADIEFNVVVTQMNGNDYASKSVHVFHIGKLRVKLRKGRS  417

Query  1390  TKARDSYSGSMQLCGFRGGGNSAAKSLFWQPRKGQSFVLVFDSERERNGALVVARKHALE  1569
             TKAR+SYS +M+LCG RGGGN+AA ++FWQ RKG S+ L F+++R+RN A+++ARK A  
Sbjct  418   TKARESYSTTMKLCGSRGGGNAAACAVFWQTRKGLSYTLAFETDRDRNAAIMLARKFASS  477

Query  1570  CNVSI  1584
             CNV +
Sbjct  478   CNVVL  482



>ref|XP_002299966.2| hypothetical protein POPTR_0001s27920g [Populus trichocarpa]
 gb|EEE84771.2| hypothetical protein POPTR_0001s27920g [Populus trichocarpa]
Length=414

 Score =   464 bits (1194),  Expect = 2e-155, Method: Compositional matrix adjust.
 Identities = 258/410 (63%), Positives = 326/410 (80%), Gaps = 2/410 (0%)
 Frame = +1

Query  130   MTKVSPEFVGGEVQMYTFKSVSADVSFASNQFPKYKLGPDFQILEEALLENKGPSLKevv  309
             MT+V+ +F G  +Q     +VSADV+FAS++FP YK+G   QIL+ A  + K  S+KEVV
Sbjct  1     MTRVTRDF-GDTMQKDAVLAVSADVAFASSRFPNYKIGATNQILD-AKDDPKVLSMKEVV  58

Query  310   eeettRLTEQHKRLSVRDLASKFDKNLSSAAKLANEAKLRDAPSLEGHVLLKKLRDALET  489
               ET  L EQ KRLSVRDLASKF+K L++AAKL+ EA+LR+A SLE HVLLKKLRDALE+
Sbjct  59    ARETALLLEQQKRLSVRDLASKFEKGLAAAAKLSEEARLREAASLEKHVLLKKLRDALES  118

Query  490   LKGRLAGRNKEDVEIAIAMVEALAVRLTQKEGDLIQEKFEVNKLVSILKQASEDAKKLVN  669
             LKGR+AGRNK+DVE AIAMVEALAV+LTQ+EG+LIQEK EV KL + LKQASEDAKKLV+
Sbjct  119   LKGRVAGRNKDDVEEAIAMVEALAVQLTQREGELIQEKAEVKKLANFLKQASEDAKKLVD  178

Query  670   QERSFACAEIESARAVVQRIGEALEEQEINSQVSGKQeveelmeeiqeARRIRVLHQPSK  849
             +ER++A AEIESARA VQR+ EAL+E E  S+  GKQ++EELM+E+QEARRI++LHQPSK
Sbjct  179   EERAYARAEIESARATVQRVEEALQEHERMSRALGKQDLEELMKEVQEARRIKMLHQPSK  238

Query  850   VMDMEHELRALRIQLNEKSVVSFKLQNELAMSKRTEQNKSQLYRIIGSESVGSILRIQPC  1029
             VMDMEHELRALR+QL EKS  S +LQ ELA S+R  Q+   L+ + GSE++GS LRI PC
Sbjct  239   VMDMEHELRALRMQLAEKSKCSLQLQKELARSRRGGQSMFHLFELDGSEALGSCLRINPC  298

Query  1030  SDEAVDLSKCSIQWYRLSSECSRREPILGADKSVYAPEPIDVGRVLEADIVSNGLKASVT  1209
             S+ A +LS+CSIQW+RLSSE  ++  I GA K VYAPEP DVGRVL+A+I+S+G + ++T
Sbjct  299   SENAPELSECSIQWFRLSSEDVKKALISGATKPVYAPEPFDVGRVLQAEIISDGQQFTLT  358

Query  1210  TIGQIDQAAGLGNYVETLLRKSNTEFSVVIAQMNGRNYSSRSIHSFHVGK  1359
             T   ID AAGLG+YVE L+RK + EF+VV+ QMNG +++S SIH     +
Sbjct  359   TTCAIDPAAGLGSYVEALVRKHDVEFNVVVTQMNGLDHTSESIHVLQASQ  408



>tpg|DAA57205.1| TPA: hypothetical protein ZEAMMB73_282504 [Zea mays]
Length=489

 Score =   466 bits (1200),  Expect = 2e-155, Method: Compositional matrix adjust.
 Identities = 254/485 (52%), Positives = 357/485 (74%), Gaps = 4/485 (1%)
 Frame = +1

Query  130   MTKVSPEFVGGEVQMYTFKSVSADVSFASNQFPKYKLGPDFQILEEALLENKGPSLKevv  309
             MT+V  +  G  +Q      VS+DV+F    FP Y++GP+ QI++        P LKEVV
Sbjct  1     MTRVIHD-SGDGMQKEALDLVSSDVNFPKGCFPDYRIGPNNQIIDPEETHEAVP-LKEVV  58

Query  310   eeettRLTEQHKRLSVRDLASKFDKNLSSAAKLANEAKLRDAPSLEGHVLLKKLRDALET  489
              +ET +L EQH+RLSVRDL  KF+K LSSA+KL+ EAK R+A SL+  VLLKKLRD L+T
Sbjct  59    AKETAQLLEQHRRLSVRDLKEKFEKGLSSASKLSEEAKRREAASLDRQVLLKKLRDVLDT  118

Query  490   LKGRLAGRNKEDVEIAIAMVEALAVRLTQKEGDLIQEKFEVNKLVSILKQASEDAKKLVN  669
             LKGR+AGRNK+D E AI++VEALAV+LTQ+EG+LI EK EV KL + LKQA+ DA+K+  
Sbjct  119   LKGRVAGRNKDDAEEAISLVEALAVQLTQREGELIYEKAEVKKLANFLKQATVDARKVAE  178

Query  670   QERSFACAEIESARAVVQRIGEALEEQEINSQVSGKQeveelmeeiqeARRIRVLHQPSK  849
             +ER+ A AEIE ARA ++++ +A    + +++ S ++E+EEL +E++EARRI++LHQP K
Sbjct  179   EERALALAEIEKARAAIEKVEKAFHVHD-STKSSREEEIEELRKEVREARRIKMLHQPIK  237

Query  850   VMDMEHELRALRIQLNEKSVVSFKLQNELAMSKRTEQNKSQLYRIIGSESVGSILRIQPC  1029
             VMDME EL+ALR  +++K+ +  +L  ELA  KR E + S L+ + GS ++GS   I P 
Sbjct  238   VMDMEFELQALRTLISQKTQLCNQLNKELATIKRLEVDSSDLFELEGSNTLGSQFCIIPR  297

Query  1030  SDEAVDLSKCSIQWYRLSSECSRREPILGADKSVYAPEPIDVGRVLEADIVSNGLKASVT  1209
              D A +++ C IQWYR+ S  SR   I GA K  YAPEP DVGR+L+A+I+ N  K  V 
Sbjct  298   VDGAPNIANCPIQWYRVISGGSR-GLISGATKFTYAPEPFDVGRLLQAEIILNADKIIVQ  356

Query  1210  TIGQIDQAAGLGNYVETLLRKSNTEFSVVIAQMNGRNYSSRSIHSFHVGKMRMKLNKGWI  1389
             T G ID AAGL +YV++L+++++ EF+VV+ QMNG++YSS S+H FH+GK+R+KL KGW 
Sbjct  357   TDGPIDNAAGLEHYVDSLMKRTDIEFNVVVTQMNGKDYSSNSVHVFHIGKLRIKLQKGWS  416

Query  1390  TKARDSYSGSMQLCGFRGGGNSAAKSLFWQPRKGQSFVLVFDSERERNGALVVARKHALE  1569
             TKAR+ YS +M+LCG RGGGN+AA+++FWQ RKG S+ L F+++R+RN A+++ARK A  
Sbjct  417   TKARELYSTTMKLCGSRGGGNAAARAVFWQARKGLSYTLAFETDRDRNAAIMIARKFASN  476

Query  1570  CNVSI  1584
             CN+++
Sbjct  477   CNIAL  481



>ref|XP_010931533.1| PREDICTED: meiosis-specific nuclear structural protein 1-like 
isoform X3 [Elaeis guineensis]
Length=440

 Score =   451 bits (1161),  Expect = 4e-150, Method: Compositional matrix adjust.
 Identities = 252/439 (57%), Positives = 328/439 (75%), Gaps = 6/439 (1%)
 Frame = +1

Query  130   MTKVSPEFVGGEVQMYTFKSVSADVSFASNQFPKYKLGPDFQILEEALLEN-KGPSLKev  306
             MT+V+ +F G  +Q      VS+DV+F S +FP Y++G +  I+E    +N + PSLKE+
Sbjct  1     MTRVTRDF-GDSMQKEAIHLVSSDVNFVSGRFPDYQIGANNIIIEPE--DNPRVPSLKEI  57

Query  307   veeettRLTEQHKRLSVRDLASKFDKNLSSAAKLANEAKLRDAPSLEGHVLLKKLRDALE  486
             V +ET +L EQ KRLSVRDLA KF+K LS+A KL++E+K R+  SL+ HVLLKKLRD L+
Sbjct  58    VAKETAQLLEQQKRLSVRDLADKFEKGLSAAVKLSDESKWREVASLDRHVLLKKLRDVLD  117

Query  487   TLKGRLAGRNKEDVEIAIAMVEALAVRLTQKEGDLIQEKFEVNKLVSILKQASEDAKKLV  666
              L+GR+AGRNK+D + AI+MVEALAV+LTQ+EG+L  EK EV KL + LKQA EDAKK++
Sbjct  118   QLRGRVAGRNKDDADEAISMVEALAVQLTQREGELFHEKAEVKKLATFLKQAIEDAKKVI  177

Query  667   NQERSFACAEIESARAVVQRIGEALEEQEINSQVSGKQeveelmeeiqeARRIRVLHQPS  846
              +ER+FA AEIE AR  VQR+ EAL+EQE  S+   KQE+EEL +EI+EARRI++LHQPS
Sbjct  178   EEERAFAHAEIERARTAVQRVEEALQEQEQMSRSVEKQELEELKKEIREARRIKMLHQPS  237

Query  847   KVMDMEHELRALRIQLNEKSVVSFKLQNELAMSKRTEQNKSQLYRIIGSESVGSILRIQP  1026
             +VMDMEHEL+ LR+Q+ EKSV   +L+ ELA+ K+ E+NKS LY + GSES+GS LRI  
Sbjct  238   RVMDMEHELQGLRMQIAEKSVHCIQLKKELAVMKKLEENKSNLYELEGSESLGSCLRIVA  297

Query  1027  CSDEAVDLSKCSIQWYRLSSECSRREPILGADKSVYAPEPIDVGRVLEADIVSNGLKASV  1206
              +  A D+S C IQWYR  +E S++E I GA K++YAPEP DVGR L+ +IV N  +   
Sbjct  298   RTGPAPDISNCFIQWYR--TEGSKKELISGATKTLYAPEPFDVGRFLQVEIVLNDERFMA  355

Query  1207  TTIGQIDQAAGLGNYVETLLRKSNTEFSVVIAQMNGRNYSSRSIHSFHVGKMRMKLNKGW  1386
             TT   I+ AAGLG+YVE L R+  TEF+VV+ QMNG +  SRSIH FHVGKMR+KL KGW
Sbjct  356   TTTSLIEPAAGLGSYVEALARRPETEFNVVVTQMNGHDSLSRSIHVFHVGKMRIKLRKGW  415

Query  1387  ITKARDSYSGSMQLCGFRG  1443
              TKA++SY  SMQ+   RG
Sbjct  416   STKAKESYCASMQISPCRG  434



>gb|KDO66437.1| hypothetical protein CISIN_1g011054mg [Citrus sinensis]
Length=405

 Score =   449 bits (1154),  Expect = 1e-149, Method: Compositional matrix adjust.
 Identities = 249/388 (64%), Positives = 309/388 (80%), Gaps = 2/388 (1%)
 Frame = +1

Query  130   MTKVSPEFVGGEVQMYTFKSVSADVSFASNQFPKYKLGPDFQILEEALLENKGPSLKevv  309
             MT+VS +F G  +Q     +VSADV FAS++FP YK+G + Q+++    + K  S+KEVV
Sbjct  1     MTRVSRDF-GNTMQKDAVPAVSADVVFASSRFPNYKIGANNQVVD-GKDDPKVLSMKEVV  58

Query  310   eeettRLTEQHKRLSVRDLASKFDKNLSSAAKLANEAKLRDAPSLEGHVLLKKLRDALET  489
               ET +L EQ KRLSVRDLA+KF+K L++AAKL+ EAKLR+A SLE HVLLKKLRDALE+
Sbjct  59    ARETAQLLEQQKRLSVRDLANKFEKGLAAAAKLSEEAKLREAASLEKHVLLKKLRDALES  118

Query  490   LKGRLAGRNKEDVEIAIAMVEALAVRLTQKEGDLIQEKFEVNKLVSILKQASEDAKKLVN  669
             L+GR+AGRNK+DVE AIAMVEALAV+LTQ+EG+LIQEK EV KL   LK+ASEDAKKLV+
Sbjct  119   LRGRVAGRNKDDVEEAIAMVEALAVQLTQREGELIQEKAEVKKLADFLKKASEDAKKLVD  178

Query  670   QERSFACAEIESARAVVQRIGEALEEQEINSQVSGKQeveelmeeiqeARRIRVLHQPSK  849
             +ER+FA AEIESARA VQR+ E+L+E E  S+ SGKQ+ EELM+E+QEARRI++LHQPSK
Sbjct  179   EERAFARAEIESARAAVQRVEESLQEHEQMSRASGKQDFEELMKEVQEARRIKMLHQPSK  238

Query  850   VMDMEHELRALRIQLNEKSVVSFKLQNELAMSKRTEQNKSQLYRIIGSESVGSILRIQPC  1029
             VMDMEHELRALRIQL EKS  S  L+ ELAMSKR E+  S  Y + GSE++GS LRI+PC
Sbjct  239   VMDMEHELRALRIQLAEKSKCSLLLRKELAMSKRIEEKLSDSYELDGSEALGSYLRIKPC  298

Query  1030  SDEAVDLSKCSIQWYRLSSECSRREPILGADKSVYAPEPIDVGRVLEADIVSNGLKASVT  1209
             S+   +LSKCSIQWYR+ SE  +RE I GA KSVYAPEP DVGR+L+A+I  NG + ++T
Sbjct  299   SNNGPELSKCSIQWYRVPSEGGKRELISGATKSVYAPEPFDVGRILQAEITYNGQQITLT  358

Query  1210  TIGQIDQAAGLGNYVETLLRKSNTEFSV  1293
             T G +D A GLG+YVE L+RK + EF V
Sbjct  359   TTGAVDPAPGLGSYVEALVRKHDVEFHV  386



>ref|XP_006293140.1| hypothetical protein CARUB_v10019446mg [Capsella rubella]
 gb|EOA26038.1| hypothetical protein CARUB_v10019446mg [Capsella rubella]
Length=451

 Score =   449 bits (1155),  Expect = 4e-149, Method: Compositional matrix adjust.
 Identities = 257/496 (52%), Positives = 331/496 (67%), Gaps = 64/496 (13%)
 Frame = +1

Query  130   MTKVSPEFVGGEVQMYTFKSVSADVSFASNQFPKYKLGPDFQILEEALLENKGPSLKevv  309
             MTKV PE       +   +++S      S+ FP YKL PD QI+EE   ++K PS+KE V
Sbjct  1     MTKVCPE-------IEDRRTLSKSAVPLSDHFPTYKLEPDNQIVEEPKEDDKCPSVKETV  53

Query  310   eeettRLTEQHKRLSVRDLASKFDKNLSSAAKLANEAKLRDAPSLEGHVLLKKLRDALET  489
             E+E+  L++QHKRLSVR+LASKF+KNL+SA  LA+EAKLR+  SLEGHV+LKKL DALE 
Sbjct  54    EKESELLSDQHKRLSVRNLASKFEKNLASAVSLADEAKLREVASLEGHVMLKKLMDALEC  113

Query  490   LKGRLAGRNKEDVEIAIAMVEALAVRLTQKEGDLIQEKFEVNKLVSILKQASEDAKKLVN  669
              +GR  G+NKED       VEALAV+LTQ EG LIQEKFEV KL + LK+ SEDAKKLVN
Sbjct  114   RRGRTDGKNKED-------VEALAVKLTQNEGKLIQEKFEVKKLGNFLKETSEDAKKLVN  166

Query  670   QERSFACAEIESARAVVQRIGEALEEQEINSQVSGKQeveelmeeiqeARRIRVLHQPSK  849
             QE SFACAEIE+A AVV ++GEA EEQE  S+ S  Q                       
Sbjct  167   QENSFACAEIETATAVVLKLGEAFEEQERISEASRAQ---------------------GP  205

Query  850   VMDMEHELRALRIQLNEKSVVSFKLQNELAMSKRTEQNKSQLYRIIGSESVGSILRIQ-P  1026
             V+ M+ EL  LR ++ EK +    L  E     R E++KS  + + G++S+GS L+++  
Sbjct  206   VIGMQQELHGLRNRIQEKYMNYVNLYKE-----RAEESKSCPFVLEGTQSLGSCLKVRVN  260

Query  1027  CSDEAVDLSKCSIQWYRLSSECSRREPI-----------LGADKSVYAPEPIDVGRVLEA  1173
               D + DLS CSIQWYR + E SRRE I            GA +S+YAPEP DVGR+L+A
Sbjct  261   APDNSPDLSNCSIQWYRAACETSRREAISDICSYLFASSFGAIQSIYAPEPFDVGRILQA  320

Query  1174  DIVSNGLKASVTTIGQIDQAAGLGNYVETLLRKSNTEFSVVIAQMNGRNYSSRSIHSFHV  1353
             DI+SNG K +VTT           +  ETL+RKSN+EF VVI+QMNG++Y+SRS H F +
Sbjct  321   DILSNGRKFTVTT-----------DDPETLMRKSNSEFIVVISQMNGQDYASRS-HIFTI  368

Query  1354  GKMRMKLNKGWITKARDSYSGSMQLCGFRGGGNSAAKSLFWQPRKGQSFVLVFDSERERN  1533
             GK R+KL++GWI+KAR+ YS SMQLCG R    +  K+LFWQPRK  SF+L F+SE+ERN
Sbjct  369   GKTRIKLSRGWISKAREIYSTSMQLCGVRSNIKTPTKALFWQPRKSLSFILTFESEQERN  428

Query  1534  GALVVARKHALECNVS  1581
              A+V+ARK+A +CNV+
Sbjct  429   AAIVLARKYAFDCNVA  444



>ref|XP_006446351.1| hypothetical protein CICLE_v10015010mg [Citrus clementina]
 gb|ESR59591.1| hypothetical protein CICLE_v10015010mg [Citrus clementina]
Length=404

 Score =   447 bits (1149),  Expect = 9e-149, Method: Compositional matrix adjust.
 Identities = 248/388 (64%), Positives = 309/388 (80%), Gaps = 2/388 (1%)
 Frame = +1

Query  130   MTKVSPEFVGGEVQMYTFKSVSADVSFASNQFPKYKLGPDFQILEEALLENKGPSLKevv  309
             MT++S +F G  +Q     +VSADV FAS++FP YK+G + Q+++    + K  S+KEVV
Sbjct  1     MTRLSRDF-GNTMQKDAVPAVSADVVFASSRFPNYKIGANNQVVD-GKDDPKVLSMKEVV  58

Query  310   eeettRLTEQHKRLSVRDLASKFDKNLSSAAKLANEAKLRDAPSLEGHVLLKKLRDALET  489
               ET +L EQ KRLSVRDLA+KF+K L++AAKL+ EAKLR+A SLE HVLLKKLRDALE+
Sbjct  59    ARETAQLLEQQKRLSVRDLANKFEKGLAAAAKLSEEAKLREAASLEKHVLLKKLRDALES  118

Query  490   LKGRLAGRNKEDVEIAIAMVEALAVRLTQKEGDLIQEKFEVNKLVSILKQASEDAKKLVN  669
             L+GR+AGRNK+DVE AIAMVEALAV+LTQ+EG+LIQEK EV KL   LK+ASEDAKKLV+
Sbjct  119   LRGRVAGRNKDDVEEAIAMVEALAVQLTQREGELIQEKAEVKKLADFLKKASEDAKKLVD  178

Query  670   QERSFACAEIESARAVVQRIGEALEEQEINSQVSGKQeveelmeeiqeARRIRVLHQPSK  849
             +ER+FA AEIESARA VQR+ E+L+E E  S+ SGKQ+ EELM+E+QEARRI++LHQPSK
Sbjct  179   EERAFARAEIESARAAVQRVEESLQEHERMSRASGKQDFEELMKEVQEARRIKMLHQPSK  238

Query  850   VMDMEHELRALRIQLNEKSVVSFKLQNELAMSKRTEQNKSQLYRIIGSESVGSILRIQPC  1029
             VMDMEHELRALRIQL EKS  S  L+ ELAMSKR E+  S  Y + GSE++GS LRI+PC
Sbjct  239   VMDMEHELRALRIQLAEKSKCSLLLRKELAMSKRIEEKLSDSYELDGSEALGSYLRIKPC  298

Query  1030  SDEAVDLSKCSIQWYRLSSECSRREPILGADKSVYAPEPIDVGRVLEADIVSNGLKASVT  1209
             S+   +LSKCSIQWYR+ SE  +RE I GA KSVYAPEP DVGR+L+A+I  NG + ++T
Sbjct  299   SNNGPELSKCSIQWYRVPSEGGKRELISGATKSVYAPEPFDVGRILQAEITYNGQQITLT  358

Query  1210  TIGQIDQAAGLGNYVETLLRKSNTEFSV  1293
             T G +D A GLG+YVE L+RK + EF V
Sbjct  359   TTGAVDPAPGLGSYVEALVRKHDVEFHV  386



>ref|XP_010938833.1| PREDICTED: uncharacterized protein LOC105057826 isoform X2 [Elaeis 
guineensis]
Length=462

 Score =   436 bits (1122),  Expect = 6e-144, Method: Compositional matrix adjust.
 Identities = 248/477 (52%), Positives = 331/477 (69%), Gaps = 38/477 (8%)
 Frame = +1

Query  166   VQMYTFKSVSADVSFASNQFPKYKLGPDFQILEEALLENKGP---SLKevveeettRLTE  336
             +Q    + V+ +V+FAS +FP YK   D   +E     NKGP   SLKEVV +ET  L E
Sbjct  9     MQNEALRFVTYNVNFASRRFPNYKKRADSITVEP----NKGPEAPSLKEVVAKETIELLE  64

Query  337   QHKRLSVRDLASKFDKNLSSAAKLANEAKLRDAPSLEGHVLLKKLRDALETLKGRLAGRN  516
             + +RLSVRDLA KF+K L++A KL+NEAK R+    + HVLLKKL   LE+LKG + G++
Sbjct  65    RRQRLSVRDLAKKFEKGLNTATKLSNEAKWREVT--DRHVLLKKLMVVLESLKGHMVGQS  122

Query  517   KEDVEIAIAMVEALAVRLTQKEGDLIQEKFEVNKLVSILKQASEDAKKLVNQERSFACAE  696
             K++VE AI+MVE LAV+L Q+EG+L+QEK EV KL   LK+ASEDAKK+V +ER+ A  E
Sbjct  123   KDEVEEAISMVENLAVQLAQREGELLQEKSEVKKLAIFLKKASEDAKKVVEEERACARVE  182

Query  697   IESARAVVQRIGEALEEQEINSQVSGKQev-eelmeeiqeARRIRVLHQPSKVMDMEHEL  873
             IESARA +QR+ +A  E E+ ++ + KQ+  +ELM E+QEARRI++LHQPS+        
Sbjct  183   IESARAAMQRVIQAFHEHEMKTRSTEKQKDIQELMREVQEARRIKMLHQPSR--------  234

Query  874   RALRIQLNEKSVVSFKLQNELAMSKRTEQNKSQLYRIIGSESVGSILRIQPCSDEAVDLS  1053
                                 L  +K+ E+NK+QLY + G ES+GS L I P  D A D+S
Sbjct  235   --------------------LERNKKLEENKNQLYELEGLESLGSSLHIIPREDTAPDIS  274

Query  1054  KCSIQWYRLSSECSRREPILGADKSVYAPEPIDVGRVLEADIVSNGLKASVTTIGQIDQA  1233
              CSIQWYR+  E +++E I GA KSVYAPEP DVGR L+A+IV      ++ T G ID A
Sbjct  275   TCSIQWYRIQPEGNKKELIPGATKSVYAPEPFDVGRFLQAEIVLGAESITIATTGPIDPA  334

Query  1234  AGLGNYVETLLRKSNTEFSVVIAQMNGRNYSSRSIHSFHVGKMRMKLNKGWITKARDSYS  1413
             AGLG+YVE LLRK  TEF+VV+ Q+NG N++S SIH FHVG++ +KL+KG +  AR+ YS
Sbjct  335   AGLGSYVEALLRKHETEFNVVLIQVNGENHASNSIHVFHVGRLSIKLSKGKMILAREFYS  394

Query  1414  GSMQLCGFRGGGNSAAKSLFWQPRKGQSFVLVFDSERERNGALVVARKHALECNVSI  1584
              SMQLCG RGGGN+AA++LFWQ +KG SF L F SERERN A+++AR+ A +CN+++
Sbjct  395   SSMQLCGVRGGGNAAAQALFWQVKKGLSFTLAFQSERERNAAMMLARRFAFDCNITL  451



>ref|XP_008362650.1| PREDICTED: LOW QUALITY PROTEIN: uncharacterized protein LOC103426331 
[Malus domestica]
Length=634

 Score =   436 bits (1120),  Expect = 3e-141, Method: Compositional matrix adjust.
 Identities = 222/349 (64%), Positives = 282/349 (81%), Gaps = 0/349 (0%)
 Frame = +1

Query  538   IAMVEALAVRLTQKEGDLIQEKFEVNKLVSILKQASEDAKKLVNQERSFACAEIESARAV  717
              + VEALAV+LTQ+EG+LIQEK EV KL + LK+ASEDAKKLV++ER+FA AEIE+ARA 
Sbjct  275   FSQVEALAVQLTQREGELIQEKAEVKKLANFLKKASEDAKKLVDEERAFARAEIENARAA  334

Query  718   VQRIGEALEEQEINSQVSGKQeveelmeeiqeARRIRVLHQPSKVMDMEHELRALRIQLN  897
             VQR+ +AL+EQE  S+ SGKQ++EELM+E+QEARRI++LHQPSKVMDMEHELRALR QL 
Sbjct  335   VQRVEKALQEQEQMSRASGKQDLEELMKEVQEARRIKMLHQPSKVMDMEHELRALRAQLT  394

Query  898   EKSVVSFKLQNELAMSKRTEQNKSQLYRIIGSESVGSILRIQPCSDEAVDLSKCSIQWYR  1077
             EKS  S +LQ ELAMSKR  +  S+L+ + G E +GS LRIQPCS +A +L KC IQWYR
Sbjct  395   EKSKNSVRLQKELAMSKRGLEKISELFELDGPEVLGSYLRIQPCSGDAPELCKCLIQWYR  454

Query  1078  LSSECSRREPILGADKSVYAPEPIDVGRVLEADIVSNGLKASVTTIGQIDQAAGLGNYVE  1257
             +SS+  ++E I GA KSVYAPEP DVGRVL+ DI+  G + ++TT G ID AAGLG+YVE
Sbjct  455   VSSQGGKKESISGAIKSVYAPEPXDVGRVLQVDIIYEGQRLTLTTAGPIDPAAGLGSYVE  514

Query  1258  TLLRKSNTEFSVVIAQMNGRNYSSRSIHSFHVGKMRMKLNKGWITKARDSYSGSMQLCGF  1437
              L+RK + EF+VVI QMNG N+ S SIH FHVGKMR+KL KG  T A++ +S SMQLCG 
Sbjct  515   ALVRKHDIEFNVVITQMNGVNHPSESIHVFHVGKMRIKLCKGKTTIAKEYFSPSMQLCGV  574

Query  1438  RGGGNSAAKSLFWQPRKGQSFVLVFDSERERNGALVVARKHALECNVSI  1584
             RGGGN+AA++LFWQ ++G S+VL F+SERERN A+++AR+ A +CN+ +
Sbjct  575   RGGGNAAAQALFWQAKQGLSYVLAFESERERNAAIMLARRFAFDCNIML  623



>ref|XP_008810357.1| PREDICTED: uncharacterized protein LOC103721795 isoform X3 [Phoenix 
dactylifera]
Length=462

 Score =   425 bits (1092),  Expect = 2e-139, Method: Compositional matrix adjust.
 Identities = 247/469 (53%), Positives = 331/469 (71%), Gaps = 38/469 (8%)
 Frame = +1

Query  190   VSADVSFASNQFPKYKLGPDFQILEEALLENKGP---SLKevveeettRLTEQHKRLSVR  360
             V+ +V+FAS +F  YK+  D  I+E     NKGP   SLKE+V +ETT L E+ +RLSVR
Sbjct  17    VTYNVNFASRKFSNYKIRADSIIVEP----NKGPEAPSLKEIVAKETTELLERQQRLSVR  72

Query  361   DLASKFDKNLSSAAKLANEAKLRDAPSLEGHVLLKKLRDALETLKGRLAGRNKEDVEIAI  540
             DLA KF+K L++A KL+NEAK R+    + HVLLKKL+  LE+LKGR+ G+NK++ E AI
Sbjct  73    DLAKKFEKGLNTATKLSNEAKWREVT--DRHVLLKKLKVVLESLKGRMVGQNKDEFEEAI  130

Query  541   AMVEALAVRLTQKEGDLIQEKFEVNKLVSILKQASEDAKKLVNQERSFACAEIESARAVV  720
             +MVE LAV+L Q+EG+L+QEK EV KL   LK+ASEDAKK+V +ER+ A  +IESARA  
Sbjct  131   SMVETLAVQLAQREGELLQEKSEVKKLAIFLKKASEDAKKVVEEERACARVKIESARAAA  190

Query  721   QRIGEALEEQEINSQVSGKQev-eelmeeiqeARRIRVLHQPSKVMDMEHELRALRIQLN  897
             QR+ +A  E E+ ++ + KQ+  E+LM E+QEARRI++LHQPS+                
Sbjct  191   QRVVQAFHEHEMKTRSTEKQKDFEQLMREVQEARRIKMLHQPSR----------------  234

Query  898   EKSVVSFKLQNELAMSKRTEQNKSQLYRIIGSESVGSILRIQPCSDEAVDLSKCSIQWYR  1077
                         LA +KR E+N +QLY + G ES+GS L I P  D A D+S C+IQWYR
Sbjct  235   ------------LARNKRLEENMNQLYELEGLESLGSSLHIIPREDTAPDISTCAIQWYR  282

Query  1078  LSSECSRREPILGADKSVYAPEPIDVGRVLEADIVSNGLKASVTTIGQIDQAAGLGNYVE  1257
             + SE +++E I GA KSVY+PEP DVGR+L+A+IV      ++ T G ID AAGLG+YVE
Sbjct  283   IQSEGNKKELIPGATKSVYSPEPFDVGRLLQAEIVLGAESITIATTGPIDPAAGLGSYVE  342

Query  1258  TLLRKSNTEFSVVIAQMNGRNYSSRSIHSFHVGKMRMKLNKGWITKARDSYSGSMQLCGF  1437
              LLRK  TEF+VV+ +MNG N++S SIH FHVG++ +KL+KG    AR+ YS SMQLCG 
Sbjct  343   ALLRKHETEFNVVLIRMNGENHASNSIHVFHVGRLSIKLSKGKTILAREFYSSSMQLCGV  402

Query  1438  RGGGNSAAKSLFWQPRKGQSFVLVFDSERERNGALVVARKHALECNVSI  1584
             RGGGN+AA++LFWQ +KG SF L F SERERN A+++AR+ A +CN+++
Sbjct  403   RGGGNAAAQTLFWQVKKGLSFTLAFQSERERNAAMMLARRFAFDCNITL  451



>ref|XP_010938834.1| PREDICTED: putative protein tag-278 isoform X3 [Elaeis guineensis]
Length=440

 Score =   407 bits (1045),  Expect = 9e-133, Method: Compositional matrix adjust.
 Identities = 233/426 (55%), Positives = 310/426 (73%), Gaps = 10/426 (2%)
 Frame = +1

Query  166   VQMYTFKSVSADVSFASNQFPKYKLGPDFQILEEALLENKGP---SLKevveeettRLTE  336
             +Q    + V+ +V+FAS +FP YK   D   +E     NKGP   SLKEVV +ET  L E
Sbjct  9     MQNEALRFVTYNVNFASRRFPNYKKRADSITVEP----NKGPEAPSLKEVVAKETIELLE  64

Query  337   QHKRLSVRDLASKFDKNLSSAAKLANEAKLRDAPSLEGHVLLKKLRDALETLKGRLAGRN  516
             + +RLSVRDLA KF+K L++A KL+NEAK R+    + HVLLKKL   LE+LKG + G++
Sbjct  65    RRQRLSVRDLAKKFEKGLNTATKLSNEAKWREV--TDRHVLLKKLMVVLESLKGHMVGQS  122

Query  517   KEDVEIAIAMVEALAVRLTQKEGDLIQEKFEVNKLVSILKQASEDAKKLVNQERSFACAE  696
             K++VE AI+MVE LAV+L Q+EG+L+QEK EV KL   LK+ASEDAKK+V +ER+ A  E
Sbjct  123   KDEVEEAISMVENLAVQLAQREGELLQEKSEVKKLAIFLKKASEDAKKVVEEERACARVE  182

Query  697   IESARAVVQRIGEALEEQEINSQVSGKQev-eelmeeiqeARRIRVLHQPSKVMDMEHEL  873
             IESARA +QR+ +A  E E+ ++ + KQ+  +ELM E+QEARRI++LHQPS+VM +EHEL
Sbjct  183   IESARAAMQRVIQAFHEHEMKTRSTEKQKDIQELMREVQEARRIKMLHQPSRVMHLEHEL  242

Query  874   RALRIQLNEKSVVSFKLQNELAMSKRTEQNKSQLYRIIGSESVGSILRIQPCSDEAVDLS  1053
             +ALRIQ  EKS+ S +L+ EL  +K+ E+NK+QLY + G ES+GS L I P  D A D+S
Sbjct  243   QALRIQYAEKSLSSVQLRKELERNKKLEENKNQLYELEGLESLGSSLHIIPREDTAPDIS  302

Query  1054  KCSIQWYRLSSECSRREPILGADKSVYAPEPIDVGRVLEADIVSNGLKASVTTIGQIDQA  1233
              CSIQWYR+  E +++E I GA KSVYAPEP DVGR L+A+IV      ++ T G ID A
Sbjct  303   TCSIQWYRIQPEGNKKELIPGATKSVYAPEPFDVGRFLQAEIVLGAESITIATTGPIDPA  362

Query  1234  AGLGNYVETLLRKSNTEFSVVIAQMNGRNYSSRSIHSFHVGKMRMKLNKGWITKARDSYS  1413
             AGLG+YVE LLRK  TEF+VV+ Q+NG N++S SIH FHVG++ +KL+KG +  AR+ YS
Sbjct  363   AGLGSYVEALLRKHETEFNVVLIQVNGENHASNSIHVFHVGRLSIKLSKGKMILAREFYS  422

Query  1414  GSMQLC  1431
              SMQ+ 
Sbjct  423   SSMQIT  428



>ref|NP_001060438.1| Os07g0642800 [Oryza sativa Japonica Group]
 dbj|BAC79975.1| unknown protein [Oryza sativa Japonica Group]
 dbj|BAD30256.1| unknown protein [Oryza sativa Japonica Group]
 dbj|BAF22352.1| Os07g0642800 [Oryza sativa Japonica Group]
 gb|EAZ40839.1| hypothetical protein OsJ_25318 [Oryza sativa Japonica Group]
 dbj|BAG93592.1| unnamed protein product [Oryza sativa Japonica Group]
Length=494

 Score =   399 bits (1025),  Expect = 5e-129, Method: Compositional matrix adjust.
 Identities = 217/458 (47%), Positives = 323/458 (71%), Gaps = 1/458 (0%)
 Frame = +1

Query  205   SFASNQFPKYKLGPDFQILEEALLENKGPSLKevveeettRLTEQHKRLSVRDLASKFDK  384
             +F  N+FP YK   +  I+ +   + + PSLKE V +ET  L  + +RLSVR+LA KF+K
Sbjct  27    NFIRNKFPTYKKSLN-GIVIKLTDDQEMPSLKEAVAKETADLLHRSQRLSVRELAMKFEK  85

Query  385   NLSSAAKLANEAKLRDAPSLEGHVLLKKLRDALETLKGRLAGRNKEDVEIAIAMVEALAV  564
              L++A  L+NE K R A  LE  +LLK L+  LE+L+ R+AG++K+++E +++MV+ L V
Sbjct  86    GLNTATLLSNEVKWRQAALLERDILLKNLKSVLESLRSRVAGKHKDEIEESLSMVDVLTV  145

Query  565   RLTQKEGDLIQEKFEVNKLVSILKQASEDAKKLVNQERSFACAEIESARAVVQRIGEALE  744
             +L+++E +L+Q+K EV K+ + LK ASEDA+++V +ERS A  EI++ARA VQ++ + ++
Sbjct  146   QLSKREDELLQQKAEVAKIATSLKLASEDARRIVEEERSNARIEIDNARAAVQKVEQLVK  205

Query  745   EQEINSQVSGKQeveelmeeiqeARRIRVLHQPSKVMDMEHELRALRIQLNEKSVVSFKL  924
             EQEI+ Q++GKQ+ +EL E+ QEARR+++LH PSK MD+E+E+  LR QL EKS     L
Sbjct  206   EQEIDPQINGKQDEDELKEKAQEARRVKMLHCPSKAMDIENEIEVLREQLAEKSSNCVHL  265

Query  925   QNELAMSKRTEQNKSQLYRIIGSESVGSILRIQPCSDEAVDLSKCSIQWYRLSSECSRRE  1104
               EL + +  E+N    Y + G ES+GS+LRI   SD  VDLS+ +IQW+R+  E +++E
Sbjct  266   LKELHLHQSYEENDVSSYELEGLESLGSMLRIVSQSDGYVDLSRSTIQWFRVQPEGNKKE  325

Query  1105  PILGADKSVYAPEPIDVGRVLEADIVSNGLKASVTTIGQIDQAAGLGNYVETLLRKSNTE  1284
              I GA K  YAPEP DVGR L+A+I   G  + V T G +D AAGL +YVETLLR   TE
Sbjct  326   IISGAIKQAYAPEPHDVGRYLQAEINHCGEISVVKTAGPVDPAAGLVDYVETLLRNPETE  385

Query  1285  FSVVIAQMNGRNYSSRSIHSFHVGKMRMKLNKGWITKARDSYSGSMQLCGFRGGGNSAAK  1464
             ++VV+ Q+NG    + SIH   +GK+RM+L KG    A++ YS +MQLCG RGGG++A +
Sbjct  386   YNVVVLQVNGIKQPTDSIHVLSIGKLRMRLAKGKTVIAKEFYSSTMQLCGMRGGGDAAPQ  445

Query  1465  SLFWQPRKGQSFVLVFDSERERNGALVVARKHALECNV  1578
             +++WQPR+  S VL F++ RERN A+++AR+ A++CN+
Sbjct  446   AMYWQPRRDLSLVLGFETARERNSAIMLARRFAIDCNI  483



>ref|XP_008810358.1| PREDICTED: uncharacterized protein LOC103721795 isoform X4 [Phoenix 
dactylifera]
Length=426

 Score =   396 bits (1017),  Expect = 1e-128, Method: Compositional matrix adjust.
 Identities = 233/416 (56%), Positives = 309/416 (74%), Gaps = 10/416 (2%)
 Frame = +1

Query  190   VSADVSFASNQFPKYKLGPDFQILEEALLENKGP---SLKevveeettRLTEQHKRLSVR  360
             V+ +V+FAS +F  YK+  D  I+E     NKGP   SLKE+V +ETT L E+ +RLSVR
Sbjct  17    VTYNVNFASRKFSNYKIRADSIIVEP----NKGPEAPSLKEIVAKETTELLERQQRLSVR  72

Query  361   DLASKFDKNLSSAAKLANEAKLRDAPSLEGHVLLKKLRDALETLKGRLAGRNKEDVEIAI  540
             DLA KF+K L++A KL+NEAK R+    + HVLLKKL+  LE+LKGR+ G+NK++ E AI
Sbjct  73    DLAKKFEKGLNTATKLSNEAKWREVT--DRHVLLKKLKVVLESLKGRMVGQNKDEFEEAI  130

Query  541   AMVEALAVRLTQKEGDLIQEKFEVNKLVSILKQASEDAKKLVNQERSFACAEIESARAVV  720
             +MVE LAV+L Q+EG+L+QEK EV KL   LK+ASEDAKK+V +ER+ A  +IESARA  
Sbjct  131   SMVETLAVQLAQREGELLQEKSEVKKLAIFLKKASEDAKKVVEEERACARVKIESARAAA  190

Query  721   QRIGEALEEQEINSQVSGKQev-eelmeeiqeARRIRVLHQPSKVMDMEHELRALRIQLN  897
             QR+ +A  E E+ ++ + KQ+  E+LM E+QEARRI++LHQPS+VM MEHEL+ALRIQ  
Sbjct  191   QRVVQAFHEHEMKTRSTEKQKDFEQLMREVQEARRIKMLHQPSRVMHMEHELQALRIQYA  250

Query  898   EKSVVSFKLQNELAMSKRTEQNKSQLYRIIGSESVGSILRIQPCSDEAVDLSKCSIQWYR  1077
             EKS+ S +L+ ELA +KR E+N +QLY + G ES+GS L I P  D A D+S C+IQWYR
Sbjct  251   EKSMSSVQLRKELARNKRLEENMNQLYELEGLESLGSSLHIIPREDTAPDISTCAIQWYR  310

Query  1078  LSSECSRREPILGADKSVYAPEPIDVGRVLEADIVSNGLKASVTTIGQIDQAAGLGNYVE  1257
             + SE +++E I GA KSVY+PEP DVGR+L+A+IV      ++ T G ID AAGLG+YVE
Sbjct  311   IQSEGNKKELIPGATKSVYSPEPFDVGRLLQAEIVLGAESITIATTGPIDPAAGLGSYVE  370

Query  1258  TLLRKSNTEFSVVIAQMNGRNYSSRSIHSFHVGKMRMKLNKGWITKARDSYSGSMQ  1425
              LLRK  TEF+VV+ +MNG N++S SIH FHVG++ +KL+KG    AR+ YS SMQ
Sbjct  371   ALLRKHETEFNVVLIRMNGENHASNSIHVFHVGRLSIKLSKGKTILAREFYSSSMQ  426



>ref|NP_001136832.1| hypothetical protein [Zea mays]
 ref|XP_008650988.1| PREDICTED: hypothetical protein isoform X1 [Zea mays]
 ref|XP_008650989.1| PREDICTED: hypothetical protein isoform X1 [Zea mays]
 gb|ACF82730.1| unknown [Zea mays]
 gb|ACN26176.1| unknown [Zea mays]
 tpg|DAA63879.1| TPA: hypothetical protein ZEAMMB73_650755 [Zea mays]
 tpg|DAA63880.1| TPA: hypothetical protein ZEAMMB73_650755 [Zea mays]
Length=494

 Score =   397 bits (1021),  Expect = 2e-128, Method: Compositional matrix adjust.
 Identities = 220/454 (48%), Positives = 321/454 (71%), Gaps = 1/454 (0%)
 Frame = +1

Query  217   NQFPKYKLGPDFQILEEALLENKGPSLKevveeettRLTEQHKRLSVRDLASKFDKNLSS  396
             N+FP YK G +  +++ A    + PSLKE V +E T L ++ +R SVR+L  KF+K  ++
Sbjct  31    NKFPTYKNGSNGIVIKLAD-GPEMPSLKEAVAKEATDLLDRCQRPSVRELTMKFEKGFNT  89

Query  397   AAKLANEAKLRDAPSLEGHVLLKKLRDALETLKGRLAGRNKEDVEIAIAMVEALAVRLTQ  576
             A  L+NEAK R A  LE  +LLK L+  LE+L+GR+ G+NK+++  +++MV+ LA+ L++
Sbjct  90    ATLLSNEAKWRHAALLERDILLKDLKSVLESLRGRVGGKNKDEIVESLSMVDILAIELSK  149

Query  577   KEGDLIQEKFEVNKLVSILKQASEDAKKLVNQERSFACAEIESARAVVQRIGEALEEQEI  756
             +E +L+++K EV K+   LK AS DAK+++++ER+ A  EIESA+A VQ+I  AL+EQE+
Sbjct  150   REDELLRQKTEVTKIADTLKLASTDAKRIIDEERANARLEIESAKASVQKIQSALKEQEL  209

Query  757   NSQVSGKQeveelmeeiqeARRIRVLHQPSKVMDMEHELRALRIQLNEKSVVSFKLQNEL  936
              SQ +GKQ+V+EL EE+QEARR+++LH PSK MD+E+E++ LR QL EKS  S +L  EL
Sbjct  210   FSQRTGKQDVDELKEEVQEARRVKMLHCPSKAMDIENEIQVLRDQLAEKSSDSLRLLKEL  269

Query  937   AMSKRTEQNKSQLYRIIGSESVGSILRIQPCSDEAVDLSKCSIQWYRLSSECSRREPILG  1116
              + +   +N   LY + G E++GS LRI      +VD S  SIQW+R+  E S++E I G
Sbjct  270   ELHRSYGENDMPLYELKGLETLGSTLRIVVHECASVDFSNSSIQWFRIQPEGSKKEIISG  329

Query  1117  ADKSVYAPEPIDVGRVLEADIVSNGLKASVTTIGQIDQAAGLGNYVETLLRKSNTEFSVV  1296
             A K VYAPEP DVGR ++A++ S G  +   T G ID AAGL  YVETL+R   T+++VV
Sbjct  330   ATKPVYAPEPHDVGRYIQAEVKSGGQISVAKTAGSIDPAAGLVEYVETLVRNPETDYNVV  389

Query  1297  IAQMNGRNYSSRSIHSFHVGKMRMKLNKGWITKARDSYSGSMQLCGFRGGGNSAAKSLFW  1476
             I Q+NG   ++ S+H   +G++RM+L K     A++ YS SMQLCG RGGG++A +S+FW
Sbjct  390   IIQVNGVAQAADSVHVLCIGRLRMRLAKEKTVVAKEFYSSSMQLCGVRGGGDAAPQSIFW  449

Query  1477  QPRKGQSFVLVFDSERERNGALVVARKHALECNV  1578
             QPRKG SFVL F++ RERN AL++AR+ A++CN+
Sbjct  450   QPRKGLSFVLAFETTRERNSALMLARRFAIDCNI  483



>gb|EAZ04885.1| hypothetical protein OsI_27067 [Oryza sativa Indica Group]
Length=494

 Score =   397 bits (1020),  Expect = 3e-128, Method: Compositional matrix adjust.
 Identities = 217/458 (47%), Positives = 324/458 (71%), Gaps = 1/458 (0%)
 Frame = +1

Query  205   SFASNQFPKYKLGPDFQILEEALLENKGPSLKevveeettRLTEQHKRLSVRDLASKFDK  384
             +F  N+FP YK   +  I+ +   + + PSLKE V +ET  L ++ +RLSVR+LA KF+K
Sbjct  27    NFIRNKFPTYKKSLN-GIVIKLTDDQEMPSLKEAVAKETADLLDRSQRLSVRELAMKFEK  85

Query  385   NLSSAAKLANEAKLRDAPSLEGHVLLKKLRDALETLKGRLAGRNKEDVEIAIAMVEALAV  564
              L++A  L+NE K R    LE  +LLK L++ LE+L+ R+AG++K+++E +++MV+ L V
Sbjct  86    GLNTATLLSNEVKWRQVALLERDILLKNLKNVLESLRSRVAGKHKDEIEESLSMVDILTV  145

Query  565   RLTQKEGDLIQEKFEVNKLVSILKQASEDAKKLVNQERSFACAEIESARAVVQRIGEALE  744
             +L+++E +L+Q+K EV K+ + LK ASEDA+++V +ERS A  EI++ARA VQ++ + ++
Sbjct  146   QLSKREDELLQQKAEVAKIATSLKLASEDARRIVEEERSNARIEIDNARAAVQKVEQLVK  205

Query  745   EQEINSQVSGKQeveelmeeiqeARRIRVLHQPSKVMDMEHELRALRIQLNEKSVVSFKL  924
             +QEI+ Q++GKQ+ +EL E+ QEARR+++LH PSK MD+E+E+  LR QL EKS     L
Sbjct  206   DQEIDPQINGKQDEDELKEKAQEARRVKMLHCPSKAMDIENEIEVLREQLAEKSSNCVHL  265

Query  925   QNELAMSKRTEQNKSQLYRIIGSESVGSILRIQPCSDEAVDLSKCSIQWYRLSSECSRRE  1104
               EL + +  E+N    Y + G ES+GS+LRI   SD  VDLS+ +IQW+R+  E +++E
Sbjct  266   LKELHLHQSYEKNDVSSYELEGLESLGSMLRIVSQSDGFVDLSRSTIQWFRVQPEGNKKE  325

Query  1105  PILGADKSVYAPEPIDVGRVLEADIVSNGLKASVTTIGQIDQAAGLGNYVETLLRKSNTE  1284
              I GA K  YAPEP DVGR L+A+I   G  + V T G +D AAGL +YVETLLR   TE
Sbjct  326   IISGAIKQAYAPEPHDVGRYLQAEINHCGEISVVKTAGPVDPAAGLVDYVETLLRNPETE  385

Query  1285  FSVVIAQMNGRNYSSRSIHSFHVGKMRMKLNKGWITKARDSYSGSMQLCGFRGGGNSAAK  1464
             ++VV+ Q+NG    + SIH   VGK+RM+L KG    A++ YS +MQLCG RGGG++A +
Sbjct  386   YNVVVLQVNGIKQLTDSIHVLSVGKLRMRLAKGKTVIAKEFYSSTMQLCGMRGGGDAAPQ  445

Query  1465  SLFWQPRKGQSFVLVFDSERERNGALVVARKHALECNV  1578
             S++WQPR+  S VL F++ RERN A+++AR+ A++CN+
Sbjct  446   SMYWQPRRDLSLVLGFETARERNSAIMLARRFAIDCNI  483



>gb|ABF96114.1| proline-rich family protein, putative, expressed [Oryza sativa 
Japonica Group]
 gb|ABF96115.1| proline-rich family protein, putative, expressed [Oryza sativa 
Japonica Group]
 gb|EEC75315.1| hypothetical protein OsI_11686 [Oryza sativa Indica Group]
 gb|EEE59099.1| hypothetical protein OsJ_10953 [Oryza sativa Japonica Group]
Length=503

 Score =   396 bits (1018),  Expect = 1e-127, Method: Compositional matrix adjust.
 Identities = 224/482 (46%), Positives = 324/482 (67%), Gaps = 2/482 (0%)
 Frame = +1

Query  136   KVSPEFVGGEVQMYTFKSVSA-DVSFASNQFPKYKLGPDFQILEEALLENKGPSLKevve  312
             KV     GG+ Q  T +       +    +FP YK G +  +++ A    + PSLKE V 
Sbjct  12    KVQTRDYGGKAQTETLRPGPLRPANIIRAKFPTYKNGLNGIVVKLAD-GPEMPSLKETVT  70

Query  313   eettRLTEQHKRLSVRDLASKFDKNLSSAAKLANEAKLRDAPSLEGHVLLKKLRDALETL  492
             +ET  + +  +RLSVR+LA KF+K L++A  L+NE K R    LE  +LLK L+  LE+L
Sbjct  71    KETADMLDHRQRLSVRELAMKFEKGLNTATLLSNEVKWRQVALLERDILLKNLKTVLESL  130

Query  493   KGRLAGRNKEDVEIAIAMVEALAVRLTQKEGDLIQEKFEVNKLVSILKQASEDAKKLVNQ  672
             +GR+ G+ K ++E +I+MV+ LAV+L+++E +L+Q+K EV +L   LK ASEDAKK+V++
Sbjct  131   RGRVTGKTKAELEDSISMVDILAVQLSKREAELLQQKAEVTELAKSLKLASEDAKKIVDE  190

Query  673   ERSFACAEIESARAVVQRIGEALEEQEINSQVSGKQeveelmeeiqeARRIRVLHQPSKV  852
             ER+ A  EIESAR+ VQR+ +AL+E E  S+ +GKQ++EEL +E++EARRI++LH PSK 
Sbjct  191   ERASAHTEIESARSSVQRVQQALQEHEKMSRTTGKQDMEELKKEVREARRIKMLHYPSKA  250

Query  853   MDMEHELRALRIQLNEKSVVSFKLQNELAMSKRTEQNKSQLYRIIGSESVGSILRIQPCS  1032
             MD+E+E++ LR    E+S     L  EL + KR E N   L+ + G + +GSILRI   S
Sbjct  251   MDLENEIKILRKTFVERSTDCVNLLKELELHKRPEGNDIPLFDLEGLQCLGSILRIVSQS  310

Query  1033  DEAVDLSKCSIQWYRLSSECSRREPILGADKSVYAPEPIDVGRVLEADIVSNGLKASVTT  1212
                +D S  SIQW+R+  + S +E I GA +SVYAPEP DVGR LEA+I   G  A   T
Sbjct  311   STTMDFSNISIQWFRVHPKESNKEIISGATRSVYAPEPHDVGRYLEAEINYGGEIAIAKT  370

Query  1213  IGQIDQAAGLGNYVETLLRKSNTEFSVVIAQMNGRNYSSRSIHSFHVGKMRMKLNKGWIT  1392
              G ID  AGL +YVETL+RK  TEF+VV+ Q+NG +    S+H  ++GK+RM+L+KG   
Sbjct  371   AGPIDPDAGLVDYVETLVRKRETEFNVVVLQLNGIDQPKESVHVLNIGKLRMRLSKGKTV  430

Query  1393  KARDSYSGSMQLCGFRGGGNSAAKSLFWQPRKGQSFVLVFDSERERNGALVVARKHALEC  1572
              A++ YS SMQLCG RGGG +A++++FW+PR   S VL F++ RERN A+++ R+ A++C
Sbjct  431   VAKEFYSSSMQLCGVRGGGEAASQAMFWRPRNDLSMVLAFETTRERNTAIMLTRRFAIDC  490

Query  1573  NV  1578
             N+
Sbjct  491   NI  492



>ref|XP_002465226.1| hypothetical protein SORBIDRAFT_01g034550 [Sorghum bicolor]
 gb|EER92224.1| hypothetical protein SORBIDRAFT_01g034550 [Sorghum bicolor]
Length=494

 Score =   392 bits (1007),  Expect = 3e-126, Method: Compositional matrix adjust.
 Identities = 219/459 (48%), Positives = 321/459 (70%), Gaps = 2/459 (0%)
 Frame = +1

Query  205   SFASNQFPKYKLGPDFQILEEALLENKGPSLKevveeettRLTEQHKRLSVRDLASKFDK  384
             +F  N+FP YK G +  +++ A    + P LKE+V +ET  L ++ +RLSVR+LA KF+K
Sbjct  26    NFIRNKFPTYKNGSNGIVIKLAD-GPEMPPLKEIVAKETADLLDRRQRLSVRELAMKFEK  84

Query  385   NLSSAAKLANEAKLRDAPSLEGHVLLKKLRDALETLKGRLAGRNKEDVEIAIAMVEALAV  564
              L++A  L+NE K R    LE  +LLK L+  LE+L+G++ G+ K+++E +I+MVE LAV
Sbjct  85    GLNTATLLSNEVKWRQVALLERDILLKNLKSVLESLRGQVTGKTKDEIEESISMVEILAV  144

Query  565   RLTQKEGDLIQEKFEVNKLVSILKQASEDAKKLVNQERSFACAEIESARAVVQRIGEALE  744
             +L+++E +L+Q+K EV KL   LKQASEDAK++V +ER+ A  EIE+A++ VQR+ +A++
Sbjct  145   QLSKREAELLQQKEEVTKLAKSLKQASEDAKRIVEEERANAHTEIETAKSAVQRVQQAVQ  204

Query  745   EQEINSQVSGKQeveelmeeiqeARRIRVLHQPSKVMDMEHELRALRIQLNEKSVVSFKL  924
             E E  SQ +GKQ++EEL +E++EARRI++LHQPSK MD+E+E+R LR    EKS     L
Sbjct  205   EHEKMSQNTGKQDMEELKKEVREARRIKMLHQPSKAMDLENEIRILRNTFAEKSKDCVNL  264

Query  925   QNELAMSKRTEQNKS-QLYRIIGSESVGSILRIQPCSDEAVDLSKCSIQWYRLSSECSRR  1101
               EL M KR ++N +   + + G + +GS+LRI   S   +DLS  SIQW+R+  + S +
Sbjct  265   LKELEMHKRLKENGTIPSFDLEGLQCLGSMLRIVGLSGTHMDLSNISIQWFRIHPKESNK  324

Query  1102  EPILGADKSVYAPEPIDVGRVLEADIVSNGLKASVTTIGQIDQAAGLGNYVETLLRKSNT  1281
             E I GA + VYA EP DVGR L+A+I   G  A   T G +D  AGL +YVETL+RK  T
Sbjct  325   EIISGATRPVYALEPHDVGRYLQAEIDVGGEIAVAKTAGPVDPDAGLVDYVETLVRKPET  384

Query  1282  EFSVVIAQMNGRNYSSRSIHSFHVGKMRMKLNKGWITKARDSYSGSMQLCGFRGGGNSAA  1461
             EF+VV+ Q+NG +    S+H  +VG++RM+L KG    A++ YS SMQLCG RGGG +A+
Sbjct  385   EFNVVVLQLNGVDQPKESVHVLNVGRLRMRLTKGKSVVAKEFYSSSMQLCGVRGGGEAAS  444

Query  1462  KSLFWQPRKGQSFVLVFDSERERNGALVVARKHALECNV  1578
             +++FW+PR   S VL F+S RERN A+++AR+ A++CN+
Sbjct  445   QAMFWRPRNDLSLVLAFESTRERNTAIMLARRFAIDCNI  483



>ref|XP_006650110.1| PREDICTED: uncharacterized protein LOC102719937 [Oryza brachyantha]
Length=492

 Score =   391 bits (1004),  Expect = 8e-126, Method: Compositional matrix adjust.
 Identities = 214/453 (47%), Positives = 315/453 (70%), Gaps = 1/453 (0%)
 Frame = +1

Query  220   QFPKYKLGPDFQILEEALLENKGPSLKevveeettRLTEQHKRLSVRDLASKFDKNLSSA  399
             +FP YK G +  +++ A    + PS+KE V +ET  + ++ +RLSVR+LA KF+K L++A
Sbjct  30    KFPTYKNGLNGIVVKLAD-GPEMPSVKETVTKETADILDRRQRLSVRELAMKFEKGLNTA  88

Query  400   AKLANEAKLRDAPSLEGHVLLKKLRDALETLKGRLAGRNKEDVEIAIAMVEALAVRLTQK  579
               L+NE K R    LE  +LLK L+  LE+L+GR+ G+ K ++E +I+MV+ LAV+L+++
Sbjct  89    TLLSNEVKWRQVALLERDILLKNLKTVLESLRGRVTGKTKAELEDSISMVDILAVQLSKR  148

Query  580   EGDLIQEKFEVNKLVSILKQASEDAKKLVNQERSFACAEIESARAVVQRIGEALEEQEIN  759
             E +L+Q+K EV KL   LK ASEDAK++V +ER+ A  EIESAR+ VQR+ +AL+E E  
Sbjct  149   EAELLQQKEEVTKLAKSLKLASEDAKRIVEEERASAHTEIESARSAVQRVQQALQEHEKI  208

Query  760   SQVSGKQeveelmeeiqeARRIRVLHQPSKVMDMEHELRALRIQLNEKSVVSFKLQNELA  939
             S+ +GKQ++ EL +E++EARRI++LH PSK MD+E+E++ LR    E+S+    L  EL 
Sbjct  209   SKTTGKQDMVELKKEVREARRIKMLHHPSKAMDLENEIKILRKTFAERSMDCVNLLKELE  268

Query  940   MSKRTEQNKSQLYRIIGSESVGSILRIQPCSDEAVDLSKCSIQWYRLSSECSRREPILGA  1119
             + KR + N   ++ + G + +GSILRI   S  A+D S  SIQW+R+  + S +E I GA
Sbjct  269   LHKRPQGNDIPVFDLEGLQCLGSILRIVAQSGAAMDFSNISIQWFRVHPKESNKEIISGA  328

Query  1120  DKSVYAPEPIDVGRVLEADIVSNGLKASVTTIGQIDQAAGLGNYVETLLRKSNTEFSVVI  1299
              +SVYAPEP DVGR LEA+I   G  A   T G ID  AGL  YVETL++K  TEF+VV+
Sbjct  329   TRSVYAPEPHDVGRYLEAEISFGGEIAIAKTAGPIDPDAGLVEYVETLVKKRETEFNVVV  388

Query  1300  AQMNGRNYSSRSIHSFHVGKMRMKLNKGWITKARDSYSGSMQLCGFRGGGNSAAKSLFWQ  1479
              Q+NG +    S+H  ++GK+RM+L+KG    A++ YS SMQLCG RGGG +A++++FW+
Sbjct  389   LQLNGIDQPKESVHVLNIGKLRMRLSKGKTVVAKEFYSSSMQLCGVRGGGEAASQAMFWR  448

Query  1480  PRKGQSFVLVFDSERERNGALVVARKHALECNV  1578
             PR   S VL F++ RERN A+++ R+ A++CN+
Sbjct  449   PRNDLSMVLAFETTRERNTAIMLTRRFAIDCNI  481



>ref|XP_004984289.1| PREDICTED: uncharacterized protein LOC101759597 [Setaria italica]
Length=493

 Score =   389 bits (999),  Expect = 4e-125, Method: Compositional matrix adjust.
 Identities = 216/457 (47%), Positives = 315/457 (69%), Gaps = 7/457 (2%)
 Frame = +1

Query  217   NQFPKYKLGPDFQILEEALLENKGP---SLKevveeettRLTEQHKRLSVRDLASKFDKN  387
             ++FP YK G +  +++ A     GP    LKE+V +ET  L ++ +RLSVR+LA KF+K 
Sbjct  30    SKFPTYKNGSNGIVIKLA----DGPEIPPLKEIVAKETADLLDRRQRLSVRELAMKFEKG  85

Query  388   LSSAAKLANEAKLRDAPSLEGHVLLKKLRDALETLKGRLAGRNKEDVEIAIAMVEALAVR  567
             L++A  L+NE K R    LE  +LLK L+  LE+L+GR+ G+ K+++E +I+MVE LAV+
Sbjct  86    LNTATLLSNEVKWRQVALLERDILLKNLKSVLESLRGRVTGKTKDEIEESISMVEILAVQ  145

Query  568   LTQKEGDLIQEKFEVNKLVSILKQASEDAKKLVNQERSFACAEIESARAVVQRIGEALEE  747
             L+++E +L+Q+K EV KL   LKQASEDAK++V +ER+ A  EIESA+  VQR+ +A++E
Sbjct  146   LSKREAELLQQKEEVTKLAKSLKQASEDAKRIVEEERANAHTEIESAKDAVQRVQQAVQE  205

Query  748   QEINSQVSGKQeveelmeeiqeARRIRVLHQPSKVMDMEHELRALRIQLNEKSVVSFKLQ  927
              E   Q +GKQ+++EL +E++EARRI++LHQPSK MD+E+E+R LR    EKS     L 
Sbjct  206   HEKMCQSTGKQDMDELKKEVREARRIKMLHQPSKAMDLENEIRILRKTFAEKSTDCVNLL  265

Query  928   NELAMSKRTEQNKSQLYRIIGSESVGSILRIQPCSDEAVDLSKCSIQWYRLSSECSRREP  1107
              EL + KR ++N +  + + G + +GS+L I   S   +DLS  SIQW+R+  + S +E 
Sbjct  266   KELELHKRLKENSTPSFDLEGLQCLGSVLCIVALSGTHMDLSNISIQWFRIHPKESNKEI  325

Query  1108  ILGADKSVYAPEPIDVGRVLEADIVSNGLKASVTTIGQIDQAAGLGNYVETLLRKSNTEF  1287
             I GA + VYA EP DVGR L+A+I   G  A   T G +D  AGL +YVETL+RK  TEF
Sbjct  326   ISGATRPVYALEPHDVGRYLQAEIDVGGEIAVAKTAGPVDPDAGLVDYVETLVRKPETEF  385

Query  1288  SVVIAQMNGRNYSSRSIHSFHVGKMRMKLNKGWITKARDSYSGSMQLCGFRGGGNSAAKS  1467
             +VV+ Q+NG      S+H  +VG++RM+L KG    A++ YS SMQLCG RGGG +A+++
Sbjct  386   NVVVLQLNGIEQPKESVHVLNVGRLRMRLTKGKSVVAKEFYSSSMQLCGVRGGGEAASQA  445

Query  1468  LFWQPRKGQSFVLVFDSERERNGALVVARKHALECNV  1578
             +FWQPR   S VL F++ RERN A+++AR+ A++CN+
Sbjct  446   IFWQPRNDLSLVLAFETARERNTAIMLARRFAIDCNI  482



>ref|XP_002461113.1| hypothetical protein SORBIDRAFT_02g040980 [Sorghum bicolor]
 gb|EER97634.1| hypothetical protein SORBIDRAFT_02g040980 [Sorghum bicolor]
Length=498

 Score =   388 bits (996),  Expect = 1e-124, Method: Compositional matrix adjust.
 Identities = 223/459 (49%), Positives = 325/459 (71%), Gaps = 5/459 (1%)
 Frame = +1

Query  217   NQFPKYKLGPDFQILEEALLENKGPSLKevveeettRLTEQHKRLSVRDLASKFDKNLSS  396
             N+FP YK G +  I+ + +   + PSLKE V +ETT L ++ +RLSVR+L  KF+K  ++
Sbjct  31    NKFPTYKNGSN-GIVIKLVDAPEMPSLKEAVAKETTDLLDRCQRLSVRELTMKFEKGFNT  89

Query  397   AAKLANEAKLRDAPSLEGHVLLKKLRDALETLKGRLAGRNKEDVEIAIAMVEALAVRLTQ  576
             A  L+NEAK R A  LE  +LLK L+  LE+L+GR+ G+NK+++E +++MV+ LAV L++
Sbjct  90    ATLLSNEAKWRHAALLERDILLKNLKSVLESLRGRVGGKNKDEIEESLSMVDILAVELSK  149

Query  577   KEGDLIQEKFEVNKLVSILKQASEDAKKLVNQERSFACAEIESARAVVQRIGEALEEQEI  756
             +E +L+Q+K E+ K+ + LK AS+DAK++V++ER+ A  EIESA+A V +I  AL+EQE 
Sbjct  150   REDELLQQKTEITKIAATLKLASKDAKRIVDEERANARLEIESAKAAVHKIQLALKEQEN  209

Query  757   NSQVSGKQeveelmeeiqeARRIRVLHQPSKVMDMEHELRALRIQLNEKSVVSFKLQNEL  936
               Q +GKQ+V+EL EE+QEARR+++LH PSK MD+E+E++ LR QL+EKS  S  L  EL
Sbjct  210   FYQRTGKQDVDELKEEVQEARRVKMLHCPSKAMDIENEIQVLRDQLSEKSSTSLHLLKEL  269

Query  937   AMSKRTEQNKSQLYRIIGSESVGSILRI--QPCSDEAVDLSKCSIQWYRLSSECSRREPI  1110
              + +  E+N   L  + G E++GS+LRI  Q C+   VD S CSIQW+R+  E S +E I
Sbjct  270   ELHRSYEENAMPLCELKGLETLGSMLRIVVQDCAH--VDFSNCSIQWFRIQPEGSNQEII  327

Query  1111  LGADKSVYAPEPIDVGRVLEADIVSNGLKASVTTIGQIDQAAGLGNYVETLLRKSNTEFS  1290
              GA K VYAPEP DVGR ++A+I   G  +   T G ID A GL +YVE L+R   T+++
Sbjct  328   SGATKPVYAPEPHDVGRYIQAEIKFGGQISIAKTAGPIDPAPGLVDYVEALVRNPETDYN  387

Query  1291  VVIAQMNGRNYSSRSIHSFHVGKMRMKLNKGWITKARDSYSGSMQLCGFRGGGNSAAKSL  1470
             VVI Q+NG   ++ S+H   +G++RM+L K     A++ YS SMQLCG RGGG++A +++
Sbjct  388   VVILQVNGIAQAADSLHVLCIGRLRMRLAKEKAVVAKEFYSSSMQLCGVRGGGDAAPQAI  447

Query  1471  FWQPRKGQSFVLVFDSERERNGALVVARKHALECNVSIT  1587
             FWQPRK  SFVL F++ RERN AL++AR+ A++CN+ +T
Sbjct  448   FWQPRKDLSFVLAFETTRERNSALMLARRFAIDCNIILT  486



>ref|XP_008658208.1| PREDICTED: uncharacterized protein LOC100217304 isoform X1 [Zea 
mays]
 ref|XP_008658209.1| PREDICTED: uncharacterized protein LOC100217304 isoform X1 [Zea 
mays]
Length=504

 Score =   385 bits (988),  Expect = 3e-123, Method: Compositional matrix adjust.
 Identities = 217/471 (46%), Positives = 317/471 (67%), Gaps = 10/471 (2%)
 Frame = +1

Query  217   NQFPKYKLGPDFQILEEALLENKGP---SLKevveeettRLTEQHKRLSVRDLASKFDKN  387
             N+FP YK G +  +++ A     GP    LKE+V +ET  L ++ +RLSVR+LA KF+K 
Sbjct  30    NKFPTYKNGSNGIVIKLA----DGPEIPPLKEIVAKETADLLDRRQRLSVRELAMKFEKG  85

Query  388   LSSAAKLANEAKLRDAPSLEGHVLLKKLRDALETLKGRLAGRNKEDVEIAIAMVEALAVR  567
             LS+A  L+NE K R    +E  +LLK L+  LE+L+G++ G+ K+++E +I+MVE L V+
Sbjct  86    LSTATLLSNEVKWRQVALMERDILLKNLKSVLESLRGQVTGKTKDEIEESISMVEILTVQ  145

Query  568   LTQKEGDLIQEKFEVNKLVSILKQASEDAKKLVNQERSFACAEIESARAVVQRIGEALEE  747
             L+++E +L+Q+K EV KL   LKQASEDAK++V +ER+ A  EIE+A+  VQR+ +A++E
Sbjct  146   LSKREAELVQQKEEVTKLAKSLKQASEDAKRIVEEERANAHTEIETAKGAVQRVQQAVQE  205

Query  748   QEINSQVSGKQeveel--meeiqeARRIRVLHQPSKVMDMEHELRALRIQLNEKSVVSFK  921
              E  SQ +GKQ+ +     +E++EARRI++LHQPSK MD+E+E+R LR    EKS     
Sbjct  206   HEKMSQNTGKQKQDMEELKKEVREARRIKMLHQPSKAMDLENEIRILRNTFAEKSKDCVS  265

Query  922   LQNELAMSKRTEQNKS-QLYRIIGSESVGSILRIQPCSDEAVDLSKCSIQWYRLSSECSR  1098
             L  EL   KR ++N +   + + G + +GS+LRI   S   +DLS  SIQW+R+  + S 
Sbjct  266   LLKELETHKRLKENGTIPSFDLEGLQCLGSMLRIVGLSGTHMDLSNISIQWFRIHPKESN  325

Query  1099  REPILGADKSVYAPEPIDVGRVLEADIVSNGLKASVTTIGQIDQAAGLGNYVETLLRKSN  1278
             +E I GA + VYA EP DVGR L+A+I   G  A   T G +D  AGL +YVETL+RK  
Sbjct  326   KEIISGATRPVYALEPHDVGRYLQAEIDVGGEIAVAKTAGPVDPDAGLVDYVETLVRKPE  385

Query  1279  TEFSVVIAQMNGRNYSSRSIHSFHVGKMRMKLNKGWITKARDSYSGSMQLCGFRGGGNSA  1458
             TEF+VV+ Q NG +    S+H  +VG++RM+L KG    A++ YS SMQLCG RGGG +A
Sbjct  386   TEFNVVVLQSNGVDQPKESVHVLNVGRLRMRLTKGKSVVAKEFYSSSMQLCGVRGGGEAA  445

Query  1459  AKSLFWQPRKGQSFVLVFDSERERNGALVVARKHALECNVSITSNLYLIIC  1611
             ++++FW+PR   S VL F+S RERN A+++AR+ A++CNV   +  Y+I+ 
Sbjct  446   SQAMFWRPRNDLSLVLAFESTRERNAAIMLARRFAVDCNVCAFTKRYIILA  496



>ref|XP_003557842.1| PREDICTED: uncharacterized protein LOC100840551 [Brachypodium 
distachyon]
Length=494

 Score =   384 bits (987),  Expect = 3e-123, Method: Compositional matrix adjust.
 Identities = 212/454 (47%), Positives = 313/454 (69%), Gaps = 1/454 (0%)
 Frame = +1

Query  217   NQFPKYKLGPDFQILEEALLENKGPSLKevveeettRLTEQHKRLSVRDLASKFDKNLSS  396
             N+FP YK G +  +++ A      P LKEVV +ET  L ++ +RLSVR+LA KF+K L++
Sbjct  31    NKFPTYKNGSNGIVIKLADGSEISP-LKEVVAKETADLLDRRQRLSVRELAMKFEKGLNT  89

Query  397   AAKLANEAKLRDAPSLEGHVLLKKLRDALETLKGRLAGRNKEDVEIAIAMVEALAVRLTQ  576
             A  L+ E K R    LE  +LLK L+  LE+L+G++ G+ K+++E +I+MVE L V+L++
Sbjct  90    ATLLSKEVKWRQVALLERDILLKNLKSVLESLRGQVTGKTKDEIEESISMVEILGVQLSK  149

Query  577   KEGDLIQEKFEVNKLVSILKQASEDAKKLVNQERSFACAEIESARAVVQRIGEALEEQEI  756
             +E +L+Q+K EV KL + LK ASEDAK++V +ER  A  E+ESAR+ VQR+ +AL+E E 
Sbjct  150   REAELLQQKEEVTKLATSLKLASEDAKRIVEEERVNAHTEVESARSAVQRVQQALQEHEK  209

Query  757   NSQVSGKQeveelmeeiqeARRIRVLHQPSKVMDMEHELRALRIQLNEKSVVSFKLQNEL  936
              SQ +GKQ+++EL +E++ ARRI++LH PSK MD+E+E++ LR    EKS   F L  EL
Sbjct  210   ISQRTGKQDMDELKKEVRVARRIKMLHCPSKAMDLENEIKTLRKTFTEKSADCFNLLKEL  269

Query  937   AMSKRTEQNKSQLYRIIGSESVGSILRIQPCSDEAVDLSKCSIQWYRLSSECSRREPILG  1116
              + KR + N + ++ + G + +GSILRI   +   +D S  SIQW+R+  + S +E I G
Sbjct  270   ELHKRLKGNSNPVFDLEGLQCLGSILRIVSQNGAPMDFSDISIQWFRIHPKESNKEIISG  329

Query  1117  ADKSVYAPEPIDVGRVLEADIVSNGLKASVTTIGQIDQAAGLGNYVETLLRKSNTEFSVV  1296
             A + VYAPEP DVGR ++A+I   G  A   T G +D  AGL +YVETL+RK  TEF+VV
Sbjct  330   ATRPVYAPEPHDVGRYVQAEINFGGEIAIAKTAGLLDPDAGLLDYVETLVRKPETEFNVV  389

Query  1297  IAQMNGRNYSSRSIHSFHVGKMRMKLNKGWITKARDSYSGSMQLCGFRGGGNSAAKSLFW  1476
             + Q+NG +    S+H  +VG++RM+L KG    A++ YS SMQLCG RGGG +A++++FW
Sbjct  390   VLQLNGIDQPKESVHVLNVGRLRMRLCKGKTVVAKEFYSSSMQLCGVRGGGEAASQAMFW  449

Query  1477  QPRKGQSFVLVFDSERERNGALVVARKHALECNV  1578
             QPR   S  L F++ RERN A+++AR+ A++CN+
Sbjct  450   QPRSDLSLGLAFETARERNTAIMLARRFAIDCNI  483



>ref|XP_004958494.1| PREDICTED: uncharacterized protein LOC101770092 isoform X1 [Setaria 
italica]
 ref|XP_004958495.1| PREDICTED: uncharacterized protein LOC101770092 isoform X2 [Setaria 
italica]
Length=494

 Score =   384 bits (985),  Expect = 6e-123, Method: Compositional matrix adjust.
 Identities = 212/454 (47%), Positives = 319/454 (70%), Gaps = 1/454 (0%)
 Frame = +1

Query  217   NQFPKYKLGPDFQILEEALLENKGPSLKevveeettRLTEQHKRLSVRDLASKFDKNLSS  396
             N+FP +K G +  I++ A    + PSLK+ V +ETT L ++H+RLSVR+L  KF+K  ++
Sbjct  31    NKFPTFKNGSNGIIIKLAD-SPEMPSLKDAVAKETTDLLDKHQRLSVRELTMKFEKGFNT  89

Query  397   AAKLANEAKLRDAPSLEGHVLLKKLRDALETLKGRLAGRNKEDVEIAIAMVEALAVRLTQ  576
             A  L+NE K R A  LE  +LLK L++ LE+L+ R+AG+N++++E +++MV+ LAV+L++
Sbjct  90    ATLLSNEVKWRHAALLERDILLKNLKNVLESLRSRVAGKNRDEIEESLSMVDILAVQLSK  149

Query  577   KEGDLIQEKFEVNKLVSILKQASEDAKKLVNQERSFACAEIESARAVVQRIGEALEEQEI  756
             +E +L+++K EV K+ + LK ASEDAK++V++ER+ A  E+ESA+   QR+  A+EE+E 
Sbjct  150   REDELLRQKTEVTKIAASLKLASEDAKRIVDEERANARVEMESAKGSAQRVQLAIEEEEN  209

Query  757   NSQVSGKQeveelmeeiqeARRIRVLHQPSKVMDMEHELRALRIQLNEKSVVSFKLQNEL  936
              SQ + KQ+V EL EE+QEARR+++LH PSK MD+E+E++ LR QL EKS     L  EL
Sbjct  210   VSQRTRKQDVNELKEEVQEARRVKMLHCPSKAMDIENEIQVLRDQLAEKSSDYVHLLKEL  269

Query  937   AMSKRTEQNKSQLYRIIGSESVGSILRIQPCSDEAVDLSKCSIQWYRLSSECSRREPILG  1116
              + +   +N    Y + G E++GS+L I    + +VD S  SIQW+R+  E S++E I G
Sbjct  270   ELHQLFGENDMPSYELQGLETLGSMLHIVARDNASVDFSNGSIQWFRIQPEGSKKEIISG  329

Query  1117  ADKSVYAPEPIDVGRVLEADIVSNGLKASVTTIGQIDQAAGLGNYVETLLRKSNTEFSVV  1296
             A K VYAPEP DVGR ++A+I   G  +   T G +D AAGL +YVE L+R   TE++VV
Sbjct  330   ATKPVYAPEPHDVGRYIQAEITFGGQISIAKTAGPVDPAAGLADYVEALIRNPETEYNVV  389

Query  1297  IAQMNGRNYSSRSIHSFHVGKMRMKLNKGWITKARDSYSGSMQLCGFRGGGNSAAKSLFW  1476
             + Q+NG    + S+H   +G++RM+L KG    A++ YS S+QLCG RGGG++A +++FW
Sbjct  390   VLQVNGVAQPADSLHVLCIGRLRMRLAKGASVVAKEFYSSSLQLCGVRGGGDAAPQAIFW  449

Query  1477  QPRKGQSFVLVFDSERERNGALVVARKHALECNV  1578
             QPRK  SFVL F++ RERN AL++AR+ A++CN+
Sbjct  450   QPRKELSFVLGFETTRERNSALMLARRFAMDCNI  483



>gb|AFW88301.1| hypothetical protein ZEAMMB73_412695 [Zea mays]
Length=505

 Score =   382 bits (982),  Expect = 2e-122, Method: Compositional matrix adjust.
 Identities = 218/472 (46%), Positives = 318/472 (67%), Gaps = 11/472 (2%)
 Frame = +1

Query  217   NQFPKYKLGPDFQILEEALLENKGP---SLKevveeettRLTEQHKRLSVRDLASKFDKN  387
             N+FP YK G +  +++ A     GP    LKE+V +ET  L ++ +RLSVR+LA KF+K 
Sbjct  30    NKFPTYKNGSNGIVIKLA----DGPEIPPLKEIVAKETADLLDRRQRLSVRELAMKFEKG  85

Query  388   LSSAAKLANEAKLRDAPSLEGHVLLKKLRDALETLKGRLAGRNKEDVEIAIAMVEALAVR  567
             LS+A  L+NE K R    +E  +LLK L+  LE+L+G++ G+ K+++E +I+MVE L V+
Sbjct  86    LSTATLLSNEVKWRQVALMERDILLKNLKSVLESLRGQVTGKTKDEIEESISMVEILTVQ  145

Query  568   LTQKEGDLIQEKFEVNKLVSILKQASEDAKKLVNQERSFACAEIESARAVVQRIGEALEE  747
             L+++E +L+Q+K EV KL   LKQASEDAK++V +ER+ A  EIE+A+  VQR+ +A++E
Sbjct  146   LSKREAELVQQKEEVTKLAKSLKQASEDAKRIVEEERANAHTEIETAKGAVQRVQQAVQE  205

Query  748   QEINSQVSGKQeveel--meeiqeARRIRVLHQPSKVMDMEHELRALRIQLNEKSVVSFK  921
              E  SQ +GKQ+ +     +E++EARRI++LHQPSK MD+E+E+R LR    EKS     
Sbjct  206   HEKMSQNTGKQKQDMEELKKEVREARRIKMLHQPSKAMDLENEIRILRNTFAEKSKDCVS  265

Query  922   LQNELAMSKRTEQNKS-QLYRIIGSESVGSILRIQPCSDEAVDLSKCSIQWYRLSSECSR  1098
             L  EL   KR ++N +   + + G + +GS+LRI   S   +DLS  SIQW+R+  + S 
Sbjct  266   LLKELETHKRLKENGTIPSFDLEGLQCLGSMLRIVGLSGTHMDLSNISIQWFRIHPKESN  325

Query  1099  REPILGADKSVYAPEPIDVGRVLEADIVSNGLKASVTTIGQIDQA-AGLGNYVETLLRKS  1275
             +E I GA + VYA EP DVGR L+A+I   G  A   T G +D A AGL +YVETL+RK 
Sbjct  326   KEIISGATRPVYALEPHDVGRYLQAEIDVGGEIAVAKTAGPVDPADAGLVDYVETLVRKP  385

Query  1276  NTEFSVVIAQMNGRNYSSRSIHSFHVGKMRMKLNKGWITKARDSYSGSMQLCGFRGGGNS  1455
              TEF+VV+ Q NG +    S+H  +VG++RM+L KG    A++ YS SMQLCG RGGG +
Sbjct  386   ETEFNVVVLQSNGVDQPKESVHVLNVGRLRMRLTKGKSVVAKEFYSSSMQLCGVRGGGEA  445

Query  1456  AAKSLFWQPRKGQSFVLVFDSERERNGALVVARKHALECNVSITSNLYLIIC  1611
             A++++FW+PR   S VL F+S RERN A+++AR+ A++CNV   +  Y+I+ 
Sbjct  446   ASQAMFWRPRNDLSLVLAFESTRERNAAIMLARRFAVDCNVCAFTKRYIILA  497



>ref|XP_006658035.1| PREDICTED: sarcolemmal membrane-associated protein-like [Oryza 
brachyantha]
Length=494

 Score =   381 bits (979),  Expect = 4e-122, Method: Compositional matrix adjust.
 Identities = 213/463 (46%), Positives = 320/463 (69%), Gaps = 7/463 (2%)
 Frame = +1

Query  205   SFASNQFPKYKL---GPDFQILEEALLENKGPSLKevveeettRLTEQHKRLSVRDLASK  375
             +F  N+FP YK    G   ++ ++ ++    PSLKE+V +ET  L ++ +RLSVR+LA K
Sbjct  27    NFIRNKFPTYKKSLNGIVVKLADDPVI----PSLKEIVAKETEDLLDRRQRLSVRELAMK  82

Query  376   FDKNLSSAAKLANEAKLRDAPSLEGHVLLKKLRDALETLKGRLAGRNKEDVEIAIAMVEA  555
             F+K L++A  L+NE K R    LE  +LLK L++ LE+L+ R+AG++K+++E + +MV+ 
Sbjct  83    FEKGLNTATLLSNEVKWRQVALLERDILLKNLKNVLESLRSRVAGKHKDEIEESFSMVDV  142

Query  556   LAVRLTQKEGDLIQEKFEVNKLVSILKQASEDAKKLVNQERSFACAEIESARAVVQRIGE  735
             LAV+L+++E +L+Q+K EV K+ + LK ASEDA+++V +ERS A  EI++ARA VQ++ +
Sbjct  143   LAVQLSKREDELLQQKTEVAKIATSLKLASEDARRIVEEERSNARIEIDNARAAVQKVEQ  202

Query  736   ALEEQEINSQVSGKQeveelmeeiqeARRIRVLHQPSKVMDMEHELRALRIQLNEKSVVS  915
              ++EQEI+ Q++ KQ+ +EL E+ QEARR+++LH PSK MD+E+E+  LR QL EKS   
Sbjct  203   LVKEQEIDPQINEKQDEDELKEKAQEARRVKMLHCPSKAMDIENEIEVLREQLAEKSSNC  262

Query  916   FKLQNELAMSKRTEQNKSQLYRIIGSESVGSILRIQPCSDEAVDLSKCSIQWYRLSSECS  1095
               L  EL + +R ++N    Y + G ES+GS+L +   SD  VDLSK  IQW+R+  E +
Sbjct  263   VHLLKELHLHQRYKENDMSSYELEGLESLGSMLHLVAQSDGFVDLSKSRIQWFRVQPEGN  322

Query  1096  RREPILGADKSVYAPEPIDVGRVLEADIVSNGLKASVTTIGQIDQAAGLGNYVETLLRKS  1275
             ++E I GA K  YAP+P DVG  L+A+I   G    V T G ID AAGL + VETLLR  
Sbjct  323   KKEIISGAIKQAYAPDPHDVGWYLQAEINHCGQILVVKTAGPIDPAAGLVDCVETLLRNP  382

Query  1276  NTEFSVVIAQMNGRNYSSRSIHSFHVGKMRMKLNKGWITKARDSYSGSMQLCGFRGGGNS  1455
              TE++VV+ Q+NG    + SIH   +GK+RM L KG    A++ YS SMQLCG RG G++
Sbjct  383   ETEYNVVVLQVNGIKQPTDSIHVLTIGKLRMWLAKGKTVIAKEFYSSSMQLCGMRGSGDA  442

Query  1456  AAKSLFWQPRKGQSFVLVFDSERERNGALVVARKHALECNVSI  1584
             A ++++WQPR+  S VL F++ RERN A+++AR+ A++CN+ +
Sbjct  443   APQAMYWQPRRDLSLVLGFETARERNCAIILARRFAIDCNIVL  485



>gb|AFW88303.1| hypothetical protein ZEAMMB73_412695 [Zea mays]
Length=525

 Score =   382 bits (980),  Expect = 9e-122, Method: Compositional matrix adjust.
 Identities = 216/468 (46%), Positives = 315/468 (67%), Gaps = 10/468 (2%)
 Frame = +1

Query  217   NQFPKYKLGPDFQILEEALLENKGP---SLKevveeettRLTEQHKRLSVRDLASKFDKN  387
             N+FP YK G +  +++ A     GP    LKE+V +ET  L ++ +RLSVR+LA KF+K 
Sbjct  30    NKFPTYKNGSNGIVIKLA----DGPEIPPLKEIVAKETADLLDRRQRLSVRELAMKFEKG  85

Query  388   LSSAAKLANEAKLRDAPSLEGHVLLKKLRDALETLKGRLAGRNKEDVEIAIAMVEALAVR  567
             LS+A  L+NE K R    +E  +LLK L+  LE+L+G++ G+ K+++E +I+MVE L V+
Sbjct  86    LSTATLLSNEVKWRQVALMERDILLKNLKSVLESLRGQVTGKTKDEIEESISMVEILTVQ  145

Query  568   LTQKEGDLIQEKFEVNKLVSILKQASEDAKKLVNQERSFACAEIESARAVVQRIGEALEE  747
             L+++E +L+Q+K EV KL   LKQASEDAK++V +ER+ A  EIE+A+  VQR+ +A++E
Sbjct  146   LSKREAELVQQKEEVTKLAKSLKQASEDAKRIVEEERANAHTEIETAKGAVQRVQQAVQE  205

Query  748   QEINSQVSGKQeveel--meeiqeARRIRVLHQPSKVMDMEHELRALRIQLNEKSVVSFK  921
              E  SQ +GKQ+ +     +E++EARRI++LHQPSK MD+E+E+R LR    EKS     
Sbjct  206   HEKMSQNTGKQKQDMEELKKEVREARRIKMLHQPSKAMDLENEIRILRNTFAEKSKDCVS  265

Query  922   LQNELAMSKRTEQNKS-QLYRIIGSESVGSILRIQPCSDEAVDLSKCSIQWYRLSSECSR  1098
             L  EL   KR ++N +   + + G + +GS+LRI   S   +DLS  SIQW+R+  + S 
Sbjct  266   LLKELETHKRLKENGTIPSFDLEGLQCLGSMLRIVGLSGTHMDLSNISIQWFRIHPKESN  325

Query  1099  REPILGADKSVYAPEPIDVGRVLEADIVSNGLKASVTTIGQIDQAAGLGNYVETLLRKSN  1278
             +E I GA + VYA EP DVGR L+A+I   G  A   T G +D  AGL +YVETL+RK  
Sbjct  326   KEIISGATRPVYALEPHDVGRYLQAEIDVGGEIAVAKTAGPVDPDAGLVDYVETLVRKPE  385

Query  1279  TEFSVVIAQMNGRNYSSRSIHSFHVGKMRMKLNKGWITKARDSYSGSMQLCGFRGGGNSA  1458
             TEF+VV+ Q NG +    S+H  +VG++RM+L KG    A++ YS SMQLCG RGGG +A
Sbjct  386   TEFNVVVLQSNGVDQPKESVHVLNVGRLRMRLTKGKSVVAKEFYSSSMQLCGVRGGGEAA  445

Query  1459  AKSLFWQPRKGQSFVLVFDSERERNGALVVARKHALECNVSITSNLYL  1602
             ++++FW+PR   S VL F+S RERN A+++AR+ A++CNV   +  Y+
Sbjct  446   SQAMFWRPRNDLSLVLAFESTRERNAAIMLARRFAVDCNVCAFTKRYV  493



>ref|XP_008658210.1| PREDICTED: uncharacterized protein LOC100217304 isoform X2 [Zea 
mays]
 gb|AFW88302.1| hypothetical protein ZEAMMB73_412695 [Zea mays]
Length=496

 Score =   380 bits (976),  Expect = 1e-121, Method: Compositional matrix adjust.
 Identities = 214/460 (47%), Positives = 312/460 (68%), Gaps = 10/460 (2%)
 Frame = +1

Query  217   NQFPKYKLGPDFQILEEALLENKGP---SLKevveeettRLTEQHKRLSVRDLASKFDKN  387
             N+FP YK G +  +++ A     GP    LKE+V +ET  L ++ +RLSVR+LA KF+K 
Sbjct  30    NKFPTYKNGSNGIVIKLA----DGPEIPPLKEIVAKETADLLDRRQRLSVRELAMKFEKG  85

Query  388   LSSAAKLANEAKLRDAPSLEGHVLLKKLRDALETLKGRLAGRNKEDVEIAIAMVEALAVR  567
             LS+A  L+NE K R    +E  +LLK L+  LE+L+G++ G+ K+++E +I+MVE L V+
Sbjct  86    LSTATLLSNEVKWRQVALMERDILLKNLKSVLESLRGQVTGKTKDEIEESISMVEILTVQ  145

Query  568   LTQKEGDLIQEKFEVNKLVSILKQASEDAKKLVNQERSFACAEIESARAVVQRIGEALEE  747
             L+++E +L+Q+K EV KL   LKQASEDAK++V +ER+ A  EIE+A+  VQR+ +A++E
Sbjct  146   LSKREAELVQQKEEVTKLAKSLKQASEDAKRIVEEERANAHTEIETAKGAVQRVQQAVQE  205

Query  748   QEINSQVSGKQeveel--meeiqeARRIRVLHQPSKVMDMEHELRALRIQLNEKSVVSFK  921
              E  SQ +GKQ+ +     +E++EARRI++LHQPSK MD+E+E+R LR    EKS     
Sbjct  206   HEKMSQNTGKQKQDMEELKKEVREARRIKMLHQPSKAMDLENEIRILRNTFAEKSKDCVS  265

Query  922   LQNELAMSKRTEQNKS-QLYRIIGSESVGSILRIQPCSDEAVDLSKCSIQWYRLSSECSR  1098
             L  EL   KR ++N +   + + G + +GS+LRI   S   +DLS  SIQW+R+  + S 
Sbjct  266   LLKELETHKRLKENGTIPSFDLEGLQCLGSMLRIVGLSGTHMDLSNISIQWFRIHPKESN  325

Query  1099  REPILGADKSVYAPEPIDVGRVLEADIVSNGLKASVTTIGQIDQAAGLGNYVETLLRKSN  1278
             +E I GA + VYA EP DVGR L+A+I   G  A   T G +D  AGL +YVETL+RK  
Sbjct  326   KEIISGATRPVYALEPHDVGRYLQAEIDVGGEIAVAKTAGPVDPDAGLVDYVETLVRKPE  385

Query  1279  TEFSVVIAQMNGRNYSSRSIHSFHVGKMRMKLNKGWITKARDSYSGSMQLCGFRGGGNSA  1458
             TEF+VV+ Q NG +    S+H  +VG++RM+L KG    A++ YS SMQLCG RGGG +A
Sbjct  386   TEFNVVVLQSNGVDQPKESVHVLNVGRLRMRLTKGKSVVAKEFYSSSMQLCGVRGGGEAA  445

Query  1459  AKSLFWQPRKGQSFVLVFDSERERNGALVVARKHALECNV  1578
             ++++FW+PR   S VL F+S RERN A+++AR+ A++CN+
Sbjct  446   SQAMFWRPRNDLSLVLAFESTRERNAAIMLARRFAVDCNI  485



>ref|XP_003562576.1| PREDICTED: uncharacterized protein LOC100843028 [Brachypodium 
distachyon]
 ref|XP_010234815.1| PREDICTED: uncharacterized protein LOC100843028 [Brachypodium 
distachyon]
Length=491

 Score =   378 bits (971),  Expect = 6e-121, Method: Compositional matrix adjust.
 Identities = 213/462 (46%), Positives = 321/462 (69%), Gaps = 4/462 (1%)
 Frame = +1

Query  202   VSFASNQFPKYKLGPDFQILEEALLENKGPSLKevveeettRLTEQHKRLSVRDLASKFD  381
             V+   N+FP YK G +  I++ A  + + PSLKE V +ET  L ++ +RLSVR+LA KF+
Sbjct  26    VNVIRNKFPTYKNGANGIIIKLAD-DPETPSLKETVAKETADLLDRRQRLSVRELAMKFE  84

Query  382   KNLSSAAKLANEAKLRDAPSLEGHVLLKKLRDALETLKGRLAGRNKEDVEIAIAMVEALA  561
             K L++A  L+NE K R    LE ++LLK L   LE+L+ R+AG+ K+++E +++MV+ LA
Sbjct  85    KGLNTATLLSNEVKWRQVALLERNILLKNLMSVLESLRDRVAGKYKDEIEESVSMVDILA  144

Query  562   VRLTQKEGDLIQEKFEVNKLVSILKQASEDAKKLVNQERSFACAEIESARAVVQRIGEAL  741
             V+L+++E +L+Q+K EV ++ S LK ASEDA+++V+ ER+ A  EIE+ARA VQR+ + L
Sbjct  145   VQLSKREDELLQQKTEVTRIASSLKLASEDARRIVDDERANARTEIENARAAVQRVQQVL  204

Query  742   EEQEINSQVSGKQeveelmeeiqeARRIRVLHQPSKVMDMEHELRALRIQLNEKSVVSFK  921
             +E+E +S   GKQ+++EL E+ QEARR+++LH PSK MD+++E+  LR Q +E S  S  
Sbjct  205   KEKEKHSHTIGKQDMDELREKGQEARRVKMLHCPSKAMDIKNEIHVLRGQFSEISASSAH  264

Query  922   LQNELAMSKRTEQNKSQLYRIIGSESVGSILRIQPCSDEAVDLSKCSIQWYRLSSECSRR  1101
             L  EL + +  E++    Y + G ES+GS+LR+    D  V L   S+QW+R+  + S++
Sbjct  265   LLKELKLHQIKEKDVPS-YELEGLESLGSMLRVVVRCD--VPLPNSSVQWFRIQHKGSKK  321

Query  1102  EPILGADKSVYAPEPIDVGRVLEADIVSNGLKASVTTIGQIDQAAGLGNYVETLLRKSNT  1281
             E I GA K VYAPEP DVGR L+A+I   G  +   T G +D AAGL +YVETL+R   T
Sbjct  322   ELISGATKLVYAPEPHDVGRYLQAEINLGGEVSVAKTTGPVDPAAGLVDYVETLVRNPET  381

Query  1282  EFSVVIAQMNGRNYSSRSIHSFHVGKMRMKLNKGWITKARDSYSGSMQLCGFRGGGNSAA  1461
             E++V++ Q+NG N S+ SIH   +GK+RM+L KG    A++ YS SMQLCG RGGG++A 
Sbjct  382   EYNVIVLQVNGVNQSTDSIHVLCIGKLRMRLAKGMTVVAKEFYSPSMQLCGVRGGGDAAP  441

Query  1462  KSLFWQPRKGQSFVLVFDSERERNGALVVARKHALECNVSIT  1587
             +++FWQP +  S VL F++ RERN A+++AR+ A++CN+ + 
Sbjct  442   QAMFWQPCEDLSLVLGFETARERNSAIMLARRFAIDCNIVLV  483



>ref|XP_008810442.1| PREDICTED: uncharacterized protein LOC103721857 [Phoenix dactylifera]
Length=473

 Score =   375 bits (964),  Expect = 5e-120, Method: Compositional matrix adjust.
 Identities = 226/465 (49%), Positives = 299/465 (64%), Gaps = 54/465 (12%)
 Frame = +1

Query  190   VSADVSFASNQFPKYKLGPDFQILEEALLENKGPSLKevveeettRLTEQHKRLSVRDLA  369
             V+ +V+FAS++F  YK+  +  IL E     + PSLKE+V +ET  L E+ +RLSVRDLA
Sbjct  52    VTYNVNFASSKFSNYKIRAN-NILVEPNKAPEAPSLKEIVAKETAELLERRQRLSVRDLA  110

Query  370   SKFDKNLSSAAKLANEAKLRDAPSLEGHVLLKKLRDALETLKGRLAGRNKEDVEIAIAMV  549
              KF+K L++A KL+NEAK R+  +  G VLLKKL   LE+LKGR+ G+NK++VE AI+MV
Sbjct  111   KKFEKGLNTATKLSNEAKWREVTN--GGVLLKKLMVVLESLKGRMVGQNKDEVEEAISMV  168

Query  550   EALAVRLTQKEGDLIQEKFEVNKLVSILKQASEDAKKLVNQERSFACAEIESARAVVQRI  729
             E L  +L + EG+L+QEK EV KL  +LK+ASEDAKKLV +ER+ A A+IESARA VQR+
Sbjct  169   EILVDQLAESEGELLQEKSEVKKLAILLKKASEDAKKLVEEERACAHAKIESARAAVQRV  228

Query  730   GEALEEQEINSQVSGKQeveelmeeiqeARRIRVLHQPSKVMDMEHELRALRIQLNEKSV  909
              +A  E E  S+   KQ                                           
Sbjct  229   LQAFHEHEKLSRSKEKQ-------------------------------------------  245

Query  910   VSFKLQNELAMSKRTEQNKSQLYRIIGSESVGSILRIQPCSDEAVDLSKCSIQWYRLSSE  1089
                     L  S+  ++NK+QLY + G ES+GS L I P  D A D+S CSIQWYR+  E
Sbjct  246   --------LERSRTLKENKNQLYELEGLESLGSSLHIIPREDTAPDISTCSIQWYRIQPE  297

Query  1090  CSRREPILGADKSVYAPEPIDVGRVLEADIVSNGLKASVTTIGQIDQAAGLGNYVETLLR  1269
              +++E I GA KSVYAPEP DVGR + A+IV      +V T G ID AAGLG+YVE LLR
Sbjct  298   GNKKELIPGATKSVYAPEPFDVGRFVLAEIVMGAESITVATTGPIDPAAGLGSYVEALLR  357

Query  1270  KSNTEFSVVIAQMNGRNYSSRSIHSFHVGKMRMKLNKGWITKARDSYSGSMQLCGFRGGG  1449
             K  TEF VV+ +MNG N+ S SIH FHVG++ +KL++     AR+ YS SMQLCG RGGG
Sbjct  358   KHETEFKVVVVRMNGENHVSNSIHVFHVGRLSIKLSREKTILAREFYSTSMQLCGARGGG  417

Query  1450  NSAAKSLFWQPRKGQSFVLVFDSERERNGALVVARKHALECNVSI  1584
             N+AA+++FWQ +KG SF L F SERERN A+++AR+ A +CN+++
Sbjct  418   NAAAQAIFWQAKKGLSFTLAFQSERERNAAMMLARRFAFDCNITL  462



>dbj|BAK07098.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=492

 Score =   365 bits (936),  Expect = 9e-116, Method: Compositional matrix adjust.
 Identities = 208/456 (46%), Positives = 315/456 (69%), Gaps = 3/456 (1%)
 Frame = +1

Query  217   NQFPKYKLGPDFQILEEALLENKGPSLKevveeettRLTEQHKRLSVRDLASKFDKNLSS  396
             N+FP YK G +  +++ A  E + PSLKE V +ET  L  + +RLSVR+LA KF+K LS+
Sbjct  31    NKFPTYKNGLNGIVIKFAD-EPETPSLKESVAKETEDLLGRRQRLSVRELAMKFEKGLST  89

Query  397   AAKLANEAKLRDAPSLEGHVLLKKLRDALETLKGRLAGRNKEDVEIAIAMVEALAVRLTQ  576
             A  L+NE K +    LE  +LLK L+  LE+L+G++AG+ K+++E +++MV+ LAV+L++
Sbjct  90    ATLLSNEVKCKQVALLERDILLKNLKSVLESLRGQVAGKYKDEIEESVSMVDILAVQLSK  149

Query  577   KEGDLIQEKFEVNKLVSILKQASEDAKKLVNQERSFACAEIESARAVVQRIGEALEEQEI  756
             +E +L+Q+K EV ++ + LK ASEDA+++V++ER+ A  EIE+ARA VQR+ + L+E+E 
Sbjct  150   RENELLQQKTEVTRIATSLKLASEDARRIVDEERTNARTEIENARAAVQRVQKVLKEKEN  209

Query  757   NSQVSGKQeveelmeeiqeARRIRVLHQPSKVMDMEHELRALRIQLNEKSVVSFKLQNEL  936
             +SQ   KQ+V+EL E++QEARR+++LH PS+ MD++ E+  LR Q  E S  S  L  EL
Sbjct  210   SSQRIVKQDVDELKEKVQEARRVKMLHCPSEAMDIKSEIHVLRDQYAEISSSSTHLLKEL  269

Query  937   AMSKRTEQNKSQLYRIIGSESVGSILRIQPCSDEAVDLSKCSIQWYRLSSECSRREPILG  1116
              + +  ++N      + G ES+GS+L +    D  V LS  S+QW+R+     ++E I G
Sbjct  270   KLHQSFKENGVLSCGLEGLESLGSMLHV--VVDNDVALSNNSVQWFRIQPGGHKKEIISG  327

Query  1117  ADKSVYAPEPIDVGRVLEADIVSNGLKASVTTIGQIDQAAGLGNYVETLLRKSNTEFSVV  1296
             A K VYAPEP DVGR L+A++   G  +   T G +D A GL +YVETL+R   T+++VV
Sbjct  328   ATKLVYAPEPHDVGRYLQAEVNLGGEISVAKTAGPLDPAPGLVDYVETLVRNPETDYNVV  387

Query  1297  IAQMNGRNYSSRSIHSFHVGKMRMKLNKGWITKARDSYSGSMQLCGFRGGGNSAAKSLFW  1476
             + ++NG N  + SIH   VGK+RM+L KG    AR+ YS SMQLCG RGGG++A +++FW
Sbjct  388   VLKVNGINQPTDSIHVLCVGKLRMRLAKGTTVVAREFYSSSMQLCGVRGGGDAAPQAMFW  447

Query  1477  QPRKGQSFVLVFDSERERNGALVVARKHALECNVSI  1584
             QPR+G S VL F++ RERN  +++AR+ A++CN+ +
Sbjct  448   QPREGLSLVLGFETPRERNSGIMLARRFAIDCNIVL  483



>ref|XP_002979271.1| hypothetical protein SELMODRAFT_110449 [Selaginella moellendorffii]
 gb|EFJ19679.1| hypothetical protein SELMODRAFT_110449 [Selaginella moellendorffii]
Length=471

 Score =   362 bits (929),  Expect = 5e-115, Method: Compositional matrix adjust.
 Identities = 206/469 (44%), Positives = 309/469 (66%), Gaps = 15/469 (3%)
 Frame = +1

Query  190   VSADVSFASNQFPKYKLGPDFQILEEALLENKGPSLKevveeettRLTEQHKRLSVRDLA  369
             V AD+    + F    LG D    EE   +   PS +E++ +E   L  Q KRLSVRDLA
Sbjct  5     VEADIKLVPSVF--LALGSD----EE---DQPSPSKREILAKEAADLVAQQKRLSVRDLA  55

Query  370   SKFDKNLSSAAKLANEAKLRDAPSLEGHVLLKKLRDALETLKGRLAGRNKEDVEIAIAMV  549
             SKF++   +A   A +     A  LE   L+ KLR  L+ L GR+AGRN++DVE ++ +V
Sbjct  56    SKFERGQEAAHAAAAKLAEDSALMLERQELITKLRHVLDALGGRVAGRNRDDVEESVTLV  115

Query  550   EALAVRLTQKEGDLIQEKFEVNKLVSILKQASEDAKKLVNQERSFACAEIESARAVVQRI  729
             EAL ++L Q+E ++ QEK E+ K+ ++ KQAS +AK++V + RS A AEIE A+A V R+
Sbjct  116   EALGIQLVQREIEMSQEKIELRKMATLFKQASGEAKRMVEEARSVAQAEIEKAKASVLRV  175

Query  730   GEAL--EEQEINSQVSGKQeveelmeeiqeARRIRVLHQPSKVMDMEHELRALRIQLNEK  903
              EAL  E+Q  +   S + E+E +  E+QEARRI++LH+PSKVMDM+++L+A++ Q + K
Sbjct  176   -EALITEQQRRSYSDSERAELEAMRREVQEARRIKMLHEPSKVMDMDYKLQAIQQQFDVK  234

Query  904   SVVSFKLQNELAMSKRTEQNKSQLYRIIGSESVGSILRIQPCSDEAVDLSKCSIQWYRLS  1083
             S    +L+ EL ++K      +++YR+ G+E +GS+L + P  ++A DLS C  QW+R+S
Sbjct  235   SAEVLQLRKELDIAKHG--ANARVYRVDGTECLGSLLSLSPVDEQAPDLSFCKFQWHRIS  292

Query  1084  SECSRREPILGADKSVYAPEPIDVGRVLEADI-VSNGLKASVTTIGQIDQAAGLGNYVET  1260
             ++  ++E I GA KS YAP+P D GR+L  DI +  G K  ++T G +D A GLGNYVE 
Sbjct  293   ADGGKKELISGAVKSQYAPDPFDAGRILRVDITLPGGAKEFLSTTGPVDPAPGLGNYVEA  352

Query  1261  LLRKSNTEFSVVIAQMNGRNYSSRSIHSFHVGKMRMKLNKGWITKARDSYSGSMQLCGFR  1440
             L +K  TEF+VVI Q NG     +++H+  +G++RMKL KG  TK ++ Y+  MQLCG R
Sbjct  353   LAKKGGTEFNVVIVQQNGEYVEKQALHALEIGRLRMKLRKGLTTKIKEKYAAGMQLCGAR  412

Query  1441  GGGNSAAKSLFWQPRKGQSFVLVFDSERERNGALVVARKHALECNVSIT  1587
             GGG +A  ++FW  ++G +++L F+SERERN A+++AR+ A +CNV + 
Sbjct  413   GGGQAAPLAMFWLVKRGLTYMLGFESERERNAAIMLARRFAFDCNVMLA  461



>ref|XP_002988577.1| hypothetical protein SELMODRAFT_128387 [Selaginella moellendorffii]
 gb|EFJ10373.1| hypothetical protein SELMODRAFT_128387 [Selaginella moellendorffii]
Length=470

 Score =   361 bits (926),  Expect = 2e-114, Method: Compositional matrix adjust.
 Identities = 205/468 (44%), Positives = 310/468 (66%), Gaps = 14/468 (3%)
 Frame = +1

Query  190   VSADVSFASNQFPKYKLGPDFQILEEALLENKGPSLKevveeettRLTEQHKRLSVRDLA  369
             V AD+    + F    LG D    EE   +   PS +E++ +E   L  Q KRLSVRDLA
Sbjct  5     VEADIKLVRSVF--LALGSD----EE---DQPSPSRREILAKEAADLVAQQKRLSVRDLA  55

Query  370   SKFDKNLSSAAKLANEAKLRDAPSLEGHVLLKKLRDALETLKGRLAGRNKEDVEIAIAMV  549
             SKF++   +A   A +     A  LE   L+ KLR+ L+ L GR+AGRN++DVE ++ +V
Sbjct  56    SKFERGQEAAHAAAAKLAEDSALMLERQELITKLRNVLDALGGRVAGRNRDDVEESVTLV  115

Query  550   EALAVRLTQKEGDLIQEKFEVNKLVSILKQASEDAKKLVNQERSFACAEIESARAVVQRI  729
             EAL ++L Q+E ++ QEK E+ K+ ++ KQAS +AKK+V + RS A AEIE A+A V R+
Sbjct  116   EALGIQLVQREIEMSQEKIELRKMATLFKQASGEAKKMVEEARSVAQAEIEKAKASVLRV  175

Query  730   GEALEEQEINSQVSGK-QeveelmeeiqeARRIRVLHQPSKVMDMEHELRALRIQLNEKS  906
              EA+ +   NS  +   QE+E +  E+QEARRI++LH+PSKVMDM+++L+A++ Q + KS
Sbjct  176   -EAIYQLSRNSSRNFHCQELEAMRREVQEARRIKMLHEPSKVMDMDYKLQAIQQQFDVKS  234

Query  907   VVSFKLQNELAMSKRTEQNKSQLYRIIGSESVGSILRIQPCSDEAVDLSKCSIQWYRLSS  1086
                 +L+ EL ++K      +++YR+ G+E +GS+L + P  ++A DLS C  QW+R+S+
Sbjct  235   AEVLQLRKELDVAKHG--ANARVYRVDGTECLGSLLSLSPVDEQAPDLSSCKFQWHRISA  292

Query  1087  ECSRREPILGADKSVYAPEPIDVGRVLEADI-VSNGLKASVTTIGQIDQAAGLGNYVETL  1263
             +  ++E I GA KS YAP+P D GR+L  DI + +G K  ++T G +D A GLGNYVE L
Sbjct  293   DGGKKELISGAVKSQYAPDPFDAGRILRVDITLPDGAKEFLSTTGPVDPAPGLGNYVEAL  352

Query  1264  LRKSNTEFSVVIAQMNGRNYSSRSIHSFHVGKMRMKLNKGWITKARDSYSGSMQLCGFRG  1443
              +K  +EF+VVI Q NG     +++H+  +G++RMKL KG  TK ++ Y+  MQLCG RG
Sbjct  353   AKKGGSEFNVVIVQQNGEYVEKQALHALEIGRLRMKLRKGLTTKIKEKYAAGMQLCGARG  412

Query  1444  GGNSAAKSLFWQPRKGQSFVLVFDSERERNGALVVARKHALECNVSIT  1587
             GG +A  ++FW  ++G +++L F+SERERN A+++AR+ A +CNV + 
Sbjct  413   GGQAAPLAMFWLVKRGLTYMLGFESERERNAAIMLARRFAFDCNVMLA  460



>gb|EPS58021.1| hypothetical protein M569_16796, partial [Genlisea aurea]
Length=255

 Score =   344 bits (883),  Expect = 4e-111, Method: Compositional matrix adjust.
 Identities = 160/244 (66%), Positives = 202/244 (83%), Gaps = 0/244 (0%)
 Frame = +1

Query  847   KVMDMEHELRALRIQLNEKSVVSFKLQNELAMSKRTEQNKSQLYRIIGSESVGSILRIQP  1026
             +V D+E+ELR LR Q+ EKS +S  LQN+L   K  + N S +Y + GS ++ S+LRIQP
Sbjct  1     QVADIENELRELRQQVIEKSAISADLQNQLETRKNFDGNISSVYELTGSAAIDSMLRIQP  60

Query  1027  CSDEAVDLSKCSIQWYRLSSECSRREPILGADKSVYAPEPIDVGRVLEADIVSNGLKASV  1206
              ++ A++L KCSIQW+RLSS+CSRREPILGA+KSVYAPEPIDVGRVL+ADI SNGLK ++
Sbjct  61    RTEAALELGKCSIQWFRLSSQCSRREPILGANKSVYAPEPIDVGRVLQADICSNGLKVTL  120

Query  1207  TTIGQIDQAAGLGNYVETLLRKSNTEFSVVIAQMNGRNYSSRSIHSFHVGKMRMKLNKGW  1386
             TT   I Q   L NY+ETL+RK N++F+VVI+QMNGRNY+S S H FH+GK R+KL++GW
Sbjct  121   TTPKPIMQVMYLENYLETLVRKQNSDFNVVISQMNGRNYTSNSTHVFHIGKTRIKLSRGW  180

Query  1387  ITKARDSYSGSMQLCGFRGGGNSAAKSLFWQPRKGQSFVLVFDSERERNGALVVARKHAL  1566
             ITKAR+SYS  MQLCGFRGGGN A+KSLFWQ RKGQ+FVLVF+SE+ERNGAL++AR++A 
Sbjct  181   ITKARESYSKPMQLCGFRGGGNCASKSLFWQARKGQNFVLVFESEQERNGALILARRYAS  240

Query  1567  ECNV  1578
             ECNV
Sbjct  241   ECNV  244



>gb|EMT27221.1| hypothetical protein F775_16353 [Aegilops tauschii]
Length=520

 Score =   349 bits (896),  Expect = 2e-109, Method: Compositional matrix adjust.
 Identities = 199/454 (44%), Positives = 298/454 (66%), Gaps = 28/454 (6%)
 Frame = +1

Query  217   NQFPKYKLGPDFQILEEALLENKGPSLKevveeettRLTEQHKRLSVRDLASKFDKNLSS  396
             N+FP YK G +  +++ A    + P LKEVV +ET  L ++ +R SVR+LA KF+K L++
Sbjct  84    NKFPTYKNGSNGIVIKLAD-GPEVPPLKEVVAKETEELLDRRQRFSVRELAMKFEKGLNT  142

Query  397   AAKLANEAKLRDAPSLEGHVLLKKLRDALETLKGRLAGRNKEDVEIAIAMVEALAVRLTQ  576
             A  L+ E K R    LE  +LLK L+  LE+L+G++ G+ K+++E +I+MVE LAV+L++
Sbjct  143   ATLLSKEVKWRQVALLERDILLKNLKSVLESLRGQVTGKTKDEIEESISMVEILAVQLSK  202

Query  577   KEGDLIQEKFEVNKLVSILKQASEDAKKLVNQERSFACAEIESARAVVQRIGEALEEQEI  756
             +E +LIQ+K EV +L   LK ASEDAK++V +ER  A  E+ESAR+ VQR+ EAL+E E 
Sbjct  203   REAELIQQKTEVTELAKSLKLASEDAKRIVEEERVNANTEVESARSAVQRVQEALQEHEK  262

Query  757   NSQVSGKQeveelmeeiqeARRIRVLHQPSKVMDMEHELRALRIQLNEKSVVSFKLQNEL  936
              S+ +GKQ++EEL +E++ ARRI++LH PSK MD+E+E++ LR    EKSV    L  EL
Sbjct  263   MSKRTGKQDMEELKKEVRVARRIKMLHCPSKAMDLENEIKTLRKTFTEKSVDCVNLLKEL  322

Query  937   AMSKRTEQNKSQLYRIIGSESVGSILRIQPCSDEAVDLSKCSIQWYRLSSECSRREPILG  1116
              + KR + N   ++ + G + +GS+L I  C +                          G
Sbjct  323   ELHKRLKGNDIPVFDLEGLQCLGSMLHIV-CQN--------------------------G  355

Query  1117  ADKSVYAPEPIDVGRVLEADIVSNGLKASVTTIGQIDQAAGLGNYVETLLRKSNTEFSVV  1296
             A +  YAPEP DVGR ++A+I   G  A   T G +D  AGL +YVETL+RK  TEF+VV
Sbjct  356   ATRPAYAPEPNDVGRYMQAEINFGGETAIAKTAGLVDPDAGLVDYVETLVRKPETEFNVV  415

Query  1297  IAQMNGRNYSSRSIHSFHVGKMRMKLNKGWITKARDSYSGSMQLCGFRGGGNSAAKSLFW  1476
             + Q+NG +    ++H  +VG++RM+L+KG    A++ YS SMQLCG RGGG +A++++FW
Sbjct  416   VLQLNGIDQPKEAVHVLNVGRLRMRLSKGKTVVAKEFYSSSMQLCGVRGGGEAASQAMFW  475

Query  1477  QPRKGQSFVLVFDSERERNGALVVARKHALECNV  1578
             +PR   SF + F++ RERN A+++AR+ A++CN+
Sbjct  476   RPRSDLSFAVAFETARERNAAIMLARRFAIDCNI  509



>ref|XP_008656013.1| PREDICTED: fas-binding factor 1 homolog, partial [Zea mays]
Length=449

 Score =   346 bits (888),  Expect = 5e-109, Method: Compositional matrix adjust.
 Identities = 201/420 (48%), Positives = 292/420 (70%), Gaps = 2/420 (0%)
 Frame = +1

Query  217   NQFPKYKLGPDFQILEEALLENKGPSLKevveeettRLTEQHKRLSVRDLASKFDKNLSS  396
             N+FP YK G +  +++ A    + P LKE+V +ET  L ++ +RLSVR+LA KF+K L++
Sbjct  30    NKFPTYKNGSNGIVIKLAD-GPEMPPLKEIVAKETADLLDRRQRLSVRELAMKFEKGLNT  88

Query  397   AAKLANEAKLRDAPSLEGHVLLKKLRDALETLKGRLAGRNKEDVEIAIAMVEALAVRLTQ  576
             A  L+NE K R    LE  +LLK L+  LE+L+GR+ G+ K+++E +I+MVE LAV+L++
Sbjct  89    ATLLSNEVKWRQVALLERDILLKNLKCVLESLRGRVTGKTKDEIEESISMVEILAVQLSK  148

Query  577   KEGDLIQEKFEVNKLVSILKQASEDAKKLVNQERSFACAEIESARAVVQRIGEALEEQEI  756
             +E +L+Q+K EV KL   LKQASEDAK++V +ER+ A  EIE+A++ VQR+ +A++E E 
Sbjct  149   REAELLQQKEEVTKLAKSLKQASEDAKRIVEEERANAHTEIETAKSSVQRVQQAVQEHEK  208

Query  757   NSQVSGKQeveelmeeiqeARRIRVLHQPSKVMDMEHELRALRIQLNEKSVVSFKLQNEL  936
              SQ +GKQ++EEL +E++EARRI++LHQPSK MD+E+E+R LR    EKS     L  EL
Sbjct  209   MSQNTGKQDMEELKKEVREARRIKMLHQPSKAMDLENEIRILRNTFAEKSKDCVNLLKEL  268

Query  937   AMSKRTEQNKS-QLYRIIGSESVGSILRIQPCSDEAVDLSKCSIQWYRLSSECSRREPIL  1113
              M KR ++N +   + + G + +GS+LRI   S   +DLS  SIQW+R+  + S +E I 
Sbjct  269   EMHKRLKENGTIPSFDLEGLQCLGSMLRIVGLSGTHMDLSNISIQWFRIHPKESNKEIIS  328

Query  1114  GADKSVYAPEPIDVGRVLEADIVSNGLKASVTTIGQIDQAAGLGNYVETLLRKSNTEFSV  1293
             GA + VYA EP DVGR L+A+I   G  A   T G +D  AGL +YVETL+RK  TEF+V
Sbjct  329   GATRPVYALEPHDVGRYLQAEIDVGGEIAVAKTAGPVDPDAGLVDYVETLVRKPETEFNV  388

Query  1294  VIAQMNGRNYSSRSIHSFHVGKMRMKLNKGWITKARDSYSGSMQLCGFRGGGNSAAKSLF  1473
             V+ Q+NG +    S+H  +VG++RM+L KG    A++ YS SMQLCG RGGG +A++++F
Sbjct  389   VVLQLNGIDLPKESVHVLNVGRLRMRLTKGNSVVAKEFYSSSMQLCGVRGGGEAASQAMF  448



>gb|KDO53648.1| hypothetical protein CISIN_1g0127251mg, partial [Citrus sinensis]
Length=288

 Score =   335 bits (859),  Expect = 4e-107, Method: Compositional matrix adjust.
 Identities = 177/251 (71%), Positives = 212/251 (84%), Gaps = 0/251 (0%)
 Frame = +1

Query  640   ASEDAKKLVNQERSFACAEIESARAVVQRIGEALEEQEINSQVSGKQeveelmeeiqeAR  819
             ASEDAKKLVNQE+SFACAEIESARAVVQR GEALEE+E NS  S  Q+VE L++EIQEAR
Sbjct  1     ASEDAKKLVNQEKSFACAEIESARAVVQRFGEALEEEEKNSPKSKTQDVERLVDEIQEAR  60

Query  820   RIRVLHQPSKVMDMEHELRALRIQLNEKSVVSFKLQNELAMSKRTEQNKSQLYRIIGSES  999
             RI+ LHQPSKVMDMEHEL ALR Q+ EKSV+S K+Q ELAM+KR E+NKS LY   GSE+
Sbjct  61    RIKRLHQPSKVMDMEHELHALRTQIREKSVLSLKIQKELAMNKRAEENKSCLYVFDGSEA  120

Query  1000  VGSILRIQPCSDEAVDLSKCSIQWYRLSSECSRREPILGADKSVYAPEPIDVGRVLEADI  1179
             +GS LRI+P SD A  LSKCSIQWYR+S + S++E I GA K  YAPEP+DVGRVL+ADI
Sbjct  121   LGSHLRIRPRSDTAPSLSKCSIQWYRVSLDGSQKEIISGASKLAYAPEPLDVGRVLQADI  180

Query  1180  VSNGLKASVTTIGQIDQAAGLGNYVETLLRKSNTEFSVVIAQMNGRNYSSRSIHSFHVGK  1359
             +SNG K +VT+ G I+ AAGLG+YVETLLRKS++EF+VVI+QMNG++YSS S H F+VGK
Sbjct  181   LSNGQKITVTSAGPIESAAGLGSYVETLLRKSSSEFNVVISQMNGQDYSSHSNHCFNVGK  240

Query  1360  MRMKLNKGWIT  1392
             +R+KL +GWIT
Sbjct  241   LRIKLCRGWIT  251



>gb|EPS62653.1| hypothetical protein M569_12137, partial [Genlisea aurea]
Length=243

 Score =   302 bits (774),  Expect = 4e-95, Method: Compositional matrix adjust.
 Identities = 170/251 (68%), Positives = 210/251 (84%), Gaps = 8/251 (3%)
 Frame = +1

Query  130  MTKVSPEFVGGEVQMYTFKSVSADVSFASNQFPKYKLGPDFQILEEALLENKGPSLKevv  309
            MT+V PE + G        +VS DVSF S+ FPKYKLGPD ++LE+   + KGPSLKEV+
Sbjct  1    MTRVVPEIMVG--------TVSVDVSFKSDHFPKYKLGPDNEVLEDIDEDLKGPSLKEVI  52

Query  310  eeettRLTEQHKRLSVRDLASKFDKNLSSAAKLANEAKLRDAPSLEGHVLLKKLRDALET  489
            +++  +LTEQHKRLSVRDLASKFDKNL+SAAKL+ EAKL++  S +G++LLKKLRDALE 
Sbjct  53   DQQVNQLTEQHKRLSVRDLASKFDKNLASAAKLSEEAKLKEVASFDGYLLLKKLRDALEC  112

Query  490  LKGRLAGRNKEDVEIAIAMVEALAVRLTQKEGDLIQEKFEVNKLVSILKQASEDAKKLVN  669
            LKG+++G NK+DV+ AI+MVEALAV+LTQKEG+LIQEKFEV KLV+ LKQASEDAKKLVN
Sbjct  113  LKGKMSGHNKDDVDKAISMVEALAVKLTQKEGELIQEKFEVKKLVNFLKQASEDAKKLVN  172

Query  670  QERSFACAEIESARAVVQRIGEALEEQEINSQVSGKQeveelmeeiqeARRIRVLHQPSK  849
            QE+SFACAEIESARAVV RIG+ALEEQE +     KQE+EEL++E+QEAR+IR+ HQP K
Sbjct  173  QEKSFACAEIESARAVVLRIGQALEEQERSQCPDEKQELEELIQEVQEARKIRLKHQPWK  232

Query  850  VMDMEHELRAL  882
            V D+E+ELR L
Sbjct  233  VADIENELREL  243



>gb|EMT17545.1| hypothetical protein F775_29736 [Aegilops tauschii]
Length=523

 Score =   308 bits (789),  Expect = 1e-93, Method: Compositional matrix adjust.
 Identities = 186/408 (46%), Positives = 280/408 (69%), Gaps = 3/408 (1%)
 Frame = +1

Query  202   VSFASNQFPKYKLGPDFQILEEALLENKGPSLKevveeettRLTEQHKRLSVRDLASKFD  381
             V+   N+FP YK G +  +++ A  E + PSLKE V EET  L ++ +RLSVR+LA KF+
Sbjct  26    VNVIRNKFPTYKNGSNGIVIKFAD-EPETPSLKESVAEETADLLDRRQRLSVRELAMKFE  84

Query  382   KNLSSAAKLANEAKLRDAPSLEGHVLLKKLRDALETLKGRLAGRNKEDVEIAIAMVEALA  561
             K LS+A  L+NE K +    LE  +LLK L+  LE+L+G++AG+ K+++E +++MV+ LA
Sbjct  85    KGLSTATLLSNEVKCKQVALLERDILLKNLKSVLESLRGQVAGKYKDEIEESVSMVDILA  144

Query  562   VRLTQKEGDLIQEKFEVNKLVSILKQASEDAKKLVNQERSFACAEIESARAVVQRIGEAL  741
             V+L+++E +L+Q+K EV ++ + LK ASEDA+++V++ER+ A AEIE+ARA +QR+ + L
Sbjct  145   VQLSKRENELLQQKTEVTRIATSLKLASEDARRIVDEERTNARAEIENARAALQRVQKVL  204

Query  742   EEQEINSQVSGKQeveelmeeiqeARRIRVLHQPSKVMDMEHELRALRIQLNEKSVVSFK  921
             +E+E +SQ  GKQ+V+EL E++QEARR+++LH PSK MD++ E+  LR Q  E S  S  
Sbjct  205   KEKENSSQRIGKQDVDELREKVQEARRVKMLHCPSKAMDIKSEIYVLRDQYAEISSSSAH  264

Query  922   LQNELAMSKRTEQNKSQLYRIIGSESVGSILRIQPCSDEAVDLSKCSIQWYRLSSECSRR  1101
             L  EL + +  ++N      + G ES+GS+LR+   +D  V LS  S+QW+R+  +  ++
Sbjct  265   LLKELELHQSFKENGVPSCELEGLESLGSMLRVVVRND--VALSNSSVQWFRIQPKGHKK  322

Query  1102  EPILGADKSVYAPEPIDVGRVLEADIVSNGLKASVTTIGQIDQAAGLGNYVETLLRKSNT  1281
             E I GA K VYAPEP DVGR L+A++   G  +   T G +D A GL +YVETL+R   T
Sbjct  323   EIISGATKLVYAPEPHDVGRYLQAEVNLGGETSVAKTAGPLDPAPGLVDYVETLVRNPET  382

Query  1282  EFSVVIAQMNGRNYSSRSIHSFHVGKMRMKLNKGWITKARDSYSGSMQ  1425
             +++VV+ QMNG +  + SIH   +GK+RM+L KG    AR+ YS SMQ
Sbjct  383   DYNVVVLQMNGIDQPTDSIHVLCIGKLRMRLAKGTTVIAREFYSSSMQ  430



>ref|XP_008674925.1| PREDICTED: interactor of constitutive active ROPs 5-like [Zea 
mays]
Length=414

 Score =   300 bits (769),  Expect = 6e-92, Method: Compositional matrix adjust.
 Identities = 187/365 (51%), Positives = 251/365 (69%), Gaps = 9/365 (2%)
 Frame = +1

Query  157   GGEVQMYTFKSVSADVSFASNQFPKYKLGPDFQILEEALLENKGPSLKevveeettRLTE  336
             G  +Q      VS+DV+F    FP Y++GP+ QI++        P LKEVV +ET +L E
Sbjct  9     GDGMQKEALDLVSSDVNFPKGCFPDYRIGPNNQIIDPEETHEAVP-LKEVVAKETAQLLE  67

Query  337   QHKRLSVRDLASKFDKNLSSAAKLANEAKLRDAPSLEGHVLLKKLRDALETLKGRLAGRN  516
             QH+RLSVRDL  KF+K LSSA+KL+ EAK R+A SL+  VLLKKLRD L+TLKGR+AGRN
Sbjct  68    QHRRLSVRDLKEKFEKGLSSASKLSEEAKRREAASLDRQVLLKKLRDVLDTLKGRVAGRN  127

Query  517   KEDVEIAIAMVEALAVRLTQKEGDLIQEKFEVNKLVSILKQASEDAKKLVNQERSFACAE  696
             K+D E AI++VEALAV+LTQ+EG+LI EK EV KL + LKQA+ DA+K+  +ER+ A AE
Sbjct  128   KDDAEEAISLVEALAVQLTQREGELIYEKAEVKKLANFLKQATVDARKVAEEERALALAE  187

Query  697   IESARAVVQRIGEALEEQEINSQVSGKQev-----eelmeeiqeARRIRVLHQPSKVMDM  861
             IE ARA ++++ +A      +S  S ++EV     EEL +E++EARRI++LHQP KVMDM
Sbjct  188   IEKARAAIEKVEKAFHVH--DSTKSSREEVLISEIEELRKEVREARRIKMLHQPIKVMDM  245

Query  862   EHELRALRIQLNEKSVVSFKLQNELAMSKRTEQNKSQLYRIIGSESVGSILRIQPCSDEA  1041
             E EL+ALR  +++K+ +  +L  ELA  KR E + S L+ + GS ++GS   I P  D A
Sbjct  246   EFELQALRTLISQKTQLCNQLNKELATIKRLEVDSSDLFELEGSNTLGSQFCIIPRVDGA  305

Query  1042  VDLSKCSIQWYRLSSECSRREPILGADKSVYAPEPIDVGRVLEADIVSNGLKASVTTIGQ  1221
              +++ C IQWYR+ S  S R  I GA K  YAPEP DVGR+L+A+I+ N  K  V T G 
Sbjct  306   PNIANCPIQWYRVISGGS-RGLISGATKFTYAPEPFDVGRLLQAEIILNADKIIVQTDGP  364

Query  1222  IDQAA  1236
             ID  +
Sbjct  365   IDNGS  369



>ref|XP_001754501.1| predicted protein [Physcomitrella patens]
 gb|EDQ80471.1| predicted protein [Physcomitrella patens]
Length=466

 Score =   295 bits (756),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 185/431 (43%), Positives = 276/431 (64%), Gaps = 7/431 (2%)
 Frame = +1

Query  328   LTEQHKRLSVRDLASKFDKNLSSAAKLANEA-KLRDAPSLEGHVLLKKLRDALETLKGRL  504
             L +  KRLS+ D+  +F+   S+A   A +  +  D   ++   L KKLR  L  L GR+
Sbjct  36    LEKLQKRLSIGDVTMEFESGESAAKAAAAKLAESEDIMVMDRSALTKKLRVLLSELAGRV  95

Query  505   AGRNKEDVEIAIAMVEALAVRLTQKEGDLIQEKFEVNKLVSILKQASEDAKKLVNQERSF  684
             AGRNKEDV  A+A+VEA+ ++  QKE +L QEK EV K+ ++  QAS+D+K+++ + R+ 
Sbjct  96    AGRNKEDVTEALAIVEAMELQWIQKENELAQEKAEVRKMAALFNQASDDSKRIMKEARAK  155

Query  685   ACAEIESARAVVQRIGEALEEQEINSQVSGKQeveelmeeiqeARRIRVLHQPSKVMDME  864
             A AE+E+A+A V R+  ALEEQ     ++ K+E+E + +EI +ARRIR+LH+PSK MDME
Sbjct  156   AQAEVEAAQAAVLRVEAALEEQTQFLSIAEKEELEAMRKEINDARRIRMLHEPSKTMDME  215

Query  865   HELRALRIQLNEKSVVSFKLQNELAMSKRTEQNKSQLYRIIGSESVGSILRIQPCSDEAV  1044
              E+  LR  L++K+    +L+ EL  +KR  Q     Y I G E +G  L I   ++ +V
Sbjct  216   FEIEGLRQGLSQKAGEVVQLRKELLAAKRAGQTGH--YEIQGEERLGGALVITQTNETSV  273

Query  1045  DLSKCSIQWYRLSSECSRREPILGADKSVYAPEPIDVGRVLEADI-VSNGLKASVTTIGQ  1221
             D+SKC IQW+R++ + S+    +GA +  YAPEP+DVG +L AD+ + +G K SV T G 
Sbjct  274   DVSKCVIQWHRIAVDGSKVCLFVGATRPQYAPEPLDVGWLLRADLTMPDGKKESVFTTGS  333

Query  1222  IDQAAGLGNYVETLLRKSNTEFSVVIAQMNGRNYSSRSIHSFHVGKMRMKLNKGWITKAR  1401
             +D A GLGNYVE L +K +TEF+V + Q NG       +   H+ ++R+KL KG    A+
Sbjct  334   LDAAPGLGNYVEALFKKGSTEFNVRLVQQNGEVLEKPLLLMMHIDRIRIKLQKGRKKIAK  393

Query  1402  DSYSGSMQLCGFRGGGNSAAKSLFWQPRKGQSFVLVFDSERERNGALVVARKHALECNVS  1581
             + Y+  +QLCG RGGG +A+++L+W   K  S +LV +SERERN A+++AR+ A + NV 
Sbjct  394   EEYTSMVQLCGARGGGQAASRALYWVANKSVSLMLVLESERERNAAILLARRFARDQNV-  452

Query  1582  ITSNLYLIICI  1614
               S+L L I  
Sbjct  453   --SDLQLFIIF  461



>ref|XP_001778664.1| predicted protein [Physcomitrella patens]
 gb|EDQ56559.1| predicted protein [Physcomitrella patens]
Length=494

 Score =   291 bits (745),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 191/474 (40%), Positives = 300/474 (63%), Gaps = 24/474 (5%)
 Frame = +1

Query  181   FKSVSADVSFASNQFPKYKLGPDFQILEEALLENKGPSLKevveeettRLTEQHKRLSVR  360
              K ++ADV+     F  +              + + PS K VV  ET  L +  +RLSVR
Sbjct  1     MKGITADVTLNGTGFHDHDD------------DTESPS-KFVVAAETVELEKLQRRLSVR  47

Query  361   DLASKFDKNLSSAAKLA----NEA-KLRDAPSLEGHVLLKKLRDALETLKGRLAGRNKED  525
             DLA +F+K  ++A  LA    +EA K+++   L+   L KKLR  L  L GR+AGRNK+D
Sbjct  48    DLAIQFEKGQTAAKALAAKLADEAHKVQEVMVLDRPALTKKLRVLLSELAGRVAGRNKDD  107

Query  526   VEIAIAMVEALAVRLTQKEGDLIQEKFEVNKLVSILKQASEDAKKLVNQERSFACAEIES  705
             V  A+A++EA+ ++  QKE +L QEK +V K  S+ +QAS++A+K+V + R+ A A++E+
Sbjct  108   VTEALAIIEAMELQWLQKENELAQEKADVKKAASLFQQASDEARKMVEEARANAKAQVEA  167

Query  706   ARAVVQRIGEALEEQEINSQVSGKQeveelmeeiqeARRIRVLHQPSKVMDMEHELRALR  885
             A+A V R+  ALEEQ  +  V+ K+E+E + ++I EARRI++LH+PSK MDME E+  LR
Sbjct  168   AQAAVFRVEAALEEQTQSLSVAEKKELEMMRKDIHEARRIKMLHEPSKTMDMEFEIEGLR  227

Query  886   IQLNEKSVVSFKLQNELAMSKRTEQNKSQL--YRIIGSESVGSILRIQPCSDEAVDLSKC  1059
               L +K+    +L+ E+ +    E +  Q+  Y + G E +G +L I   +++ VD+SKC
Sbjct  228   QGLLQKAEELVRLRKEVRIK---ESSNCQIGNYELQGEERLGGVLAITRINEKVVDVSKC  284

Query  1060  SIQWYRLSSECSRREPILGADKSVYAPEPIDVGRVLEADI-VSNGLKASVTTIGQIDQAA  1236
             +IQW+R++++ S+  PI GA +  YAPEP+DVG +L A++ + +G K S+ T G +D A 
Sbjct  285   TIQWHRIAADGSKGGPITGATRPQYAPEPLDVGWLLRANLSMPDGKKESIFTTGPLDAAP  344

Query  1237  GLGNYVETLLRKSNTEFSVVIAQMNGRNYSSRSIHSFHVGKMRMKLNKGWITKARDSYSG  1416
             GLGNYVE L  + ++EF+  + Q NG       +    + + R+KL KG  + A++ Y+ 
Sbjct  345   GLGNYVEALFNRGSSEFNTRLVQQNGEVLEKPLLLVMLIDRTRIKLYKGRKSVAKEEYTS  404

Query  1417  SMQLCGFRGGGNSAAKSLFWQPRKGQSFVLVFDSERERNGALVVARKHALECNV  1578
             ++QLCG RGGG +A+++L+W   K  S +LV +SERERN A+++AR+ A + NV
Sbjct  405   TIQLCGARGGGQAASRALYWVANKSHSLMLVLESERERNAAILLARRFARDQNV  458



>ref|XP_004159362.1| PREDICTED: uncharacterized LOC101215534 [Cucumis sativus]
Length=246

 Score =   281 bits (718),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 131/233 (56%), Positives = 176/233 (76%), Gaps = 0/233 (0%)
 Frame = +1

Query  880   LRIQLNEKSVVSFKLQNELAMSKRTEQNKSQLYRIIGSESVGSILRIQPCSDEAVDLSKC  1059
             +R+ L  KS  S  LQ ELA+SK+   + S LY I G+ES+GS LRIQP  D + DLSKC
Sbjct  1     MRLYLIHKSKYSILLQKELAISKKAMGDNSNLYEIDGTESLGSYLRIQPSCDTSPDLSKC  60

Query  1060  SIQWYRLSSECSRREPILGADKSVYAPEPIDVGRVLEADIVSNGLKASVTTIGQIDQAAG  1239
             SIQWYR++SE  ++E I GA K+VYAPEP DVG++L+AD++ +  + ++TT G ID AAG
Sbjct  61    SIQWYRIASEGGKKELISGATKTVYAPEPFDVGKILQADVILDDHRITLTTTGPIDPAAG  120

Query  1240  LGNYVETLLRKSNTEFSVVIAQMNGRNYSSRSIHSFHVGKMRMKLNKGWITKARDSYSGS  1419
             LG+YVE L+RK + EF+VV+ Q+NG N  S SIHS HVGKMR+KL KG  T A++ YS S
Sbjct  121   LGSYVEALVRKHDVEFNVVLTQVNGVNNPSESIHSLHVGKMRIKLCKGKNTIAKEYYSSS  180

Query  1420  MQLCGFRGGGNSAAKSLFWQPRKGQSFVLVFDSERERNGALVVARKHALECNV  1578
             MQLCG RGGGN+A ++LFWQ +K  S++L F+SER+RN A+++AR+ A +CN+
Sbjct  181   MQLCGVRGGGNAAPQALFWQAKKDLSYILAFESERDRNAAIMLARRFAFDCNI  233



>ref|XP_001761779.1| predicted protein [Physcomitrella patens]
 gb|EDQ73535.1| predicted protein [Physcomitrella patens]
Length=519

 Score =   290 bits (741),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 194/484 (40%), Positives = 296/484 (61%), Gaps = 23/484 (5%)
 Frame = +1

Query  181   FKSVSADVSFASNQFPKYKLGPDFQILEEALLENKGPSLKevveeettRLTEQHKRLSVR  360
              K ++ADV+ +   F             +   + + PS K VV +E   L +  +RLSVR
Sbjct  1     MKGIAADVTLSRTGF------------HDQDDDTESPS-KVVVAQEAVELEKLQRRLSVR  47

Query  361   DLASKFDKN-----LSSAAKLANEAKLRDAPSLEGHVLLKKLRDALETLKGRLAGRNKED  525
             DLA++F+        ++A       K+++   L+   L KKLR  L  L GR+AGRNK+D
Sbjct  48    DLATQFENGQAAATAAAAKLADEAHKVQEVMVLDRTALTKKLRVLLSELAGRVAGRNKDD  107

Query  526   VEIAIAMVEALAVRLTQKEGDLIQEKFEVNKLVSILKQASEDAKKLVNQERSFACAEIES  705
             V  A+A++EA+ ++  QKE +L QEK ++ K  ++ KQAS+DA+++V + R+ A AE+E+
Sbjct  108   VTEALAIIEAMDLQWIQKENELAQEKADLKKTAALFKQASDDARRMVEEARANAQAEVEA  167

Query  706   ARAVVQRIGEALEEQEINSQVSGKQeveelmeeiqeARRIRVLHQPSKVMDMEHELRALR  885
             A+A V R+  ALEEQ  +  ++ K+E+E + +EI EARRI++LH+PSK MDME E+  LR
Sbjct  168   AQAAVLRVEAALEEQTQSLSIAEKEELEMMRKEINEARRIKMLHEPSKTMDMECEIEGLR  227

Query  886   IQLNEKSVVSFKLQNELAMSKRTEQNKSQLYRIIGSESVGSILRIQPCSDEAVDLSKCSI  1065
               L++KSV   +L+ EL  +KR  Q     Y + G E +G  L I   ++ AVD+SKC I
Sbjct  228   QGLSQKSVEIVQLRKELLAAKRAGQTGH--YELQGEERLGGALAITQINEGAVDVSKCII  285

Query  1066  QWYRLSSECSRREPILGADKSVYAPEPIDVGRVLEADI-VSNGLKASVTTIGQIDQAAGL  1242
             QW+R     S    ++GA +  YAPEP+DVG +L AD+ + +  K S+ T G +D A GL
Sbjct  286   QWHRCHL-MSNTFMLVGATRPQYAPEPLDVGWLLRADLTMPDEKKESIFTTGPLDAAPGL  344

Query  1243  GNYVETLLRKSNTEFSVVIAQMNGRNYSSRSIHSFHVGKMRMKLNKGWITKARDSYSGSM  1422
             GNYVE L +K ++EF++ + Q NG            + + R+KL KG  T A++ Y+  +
Sbjct  345   GNYVEALFKKGSSEFNIRLVQQNGEVLEKPLHRVMLIDRTRIKLYKGRKTIAKEEYTSII  404

Query  1423  QLCGFRGGGNSAAKSLFWQPRKGQSFVLVFDSERERNGALVVARKHALECNVSITSNLYL  1602
             QLCG RGGG +A+++L+W   KG S +LV DSERERN A+++AR+ A + NV +   L +
Sbjct  405   QLCGARGGGQAASRALYWVANKGLSLMLVLDSERERNAAILLARRFARDQNVRVLP-LEI  463

Query  1603  IICI  1614
             + C+
Sbjct  464   VPCL  467



>pdb|4DIX|A Chain A, Crystal Structure Of The Ig-ph Domain Of Actin-binding 
Protein Scab1
 pdb|4DIX|B Chain B, Crystal Structure Of The Ig-ph Domain Of Actin-binding 
Protein Scab1
Length=230

 Score =   279 bits (714),  Expect = 3e-86, Method: Compositional matrix adjust.
 Identities = 125/214 (58%), Positives = 174/214 (81%), Gaps = 0/214 (0%)
 Frame = +1

Query  943   SKRTEQNKSQLYRIIGSESVGSILRIQPCSDEAVDLSKCSIQWYRLSSECSRREPILGAD  1122
             S ++E+N S +Y I G+E++GS LR++PCS++A DLSKC+IQWYR SS+ S++E I GA 
Sbjct  4     SSKSEENISLVYEIDGTEALGSCLRVRPCSNDAPDLSKCTIQWYRSSSDGSKKELISGAT  63

Query  1123  KSVYAPEPIDVGRVLEADIVSNGLKASVTTIGQIDQAAGLGNYVETLLRKSNTEFSVVIA  1302
             KSVYAPEP DVGRVL ADI+ +G   S++T+G+ID AAGLG+YVE L+RK + +F+VV+ 
Sbjct  64    KSVYAPEPFDVGRVLHADIIYDGHSLSLSTVGKIDPAAGLGSYVEALVRKHDVDFNVVVT  123

Query  1303  QMNGRNYSSRSIHSFHVGKMRMKLNKGWITKARDSYSGSMQLCGFRGGGNSAAKSLFWQP  1482
             QM+G +++S SIH FHVGKMR+KL KG    A++ YS +MQLCG RGGGN+AA++L+WQ 
Sbjct  124   QMSGEDHTSESIHLFHVGKMRIKLCKGKTVIAKEYYSSAMQLCGVRGGGNAAAQALYWQA  183

Query  1483  RKGQSFVLVFDSERERNGALVVARKHALECNVSI  1584
             +KG SFV+ F+SERERN A+++AR+ A +CNV++
Sbjct  184   KKGVSFVIAFESERERNAAIMLARRFACDCNVTL  217



>ref|XP_001767383.1| predicted protein [Physcomitrella patens]
 gb|EDQ67874.1| predicted protein [Physcomitrella patens]
Length=434

 Score =   276 bits (707),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 190/417 (46%), Positives = 268/417 (64%), Gaps = 8/417 (2%)
 Frame = +1

Query  343   KRLSVRDLASKFDKNLSSAA----KLANEAKLRDAPSLEGHVLLKKLRDALETLKGRLAG  510
             KR+SVRDLASKF+   ++A     +LA E K ++   L+   LLKKLR  L  L GR+AG
Sbjct  14    KRMSVRDLASKFESGQAAAQAAAARLAEEQKAKEVALLDKPALLKKLRGLLGDLLGRVAG  73

Query  511   RNKEDVEIAIAMVEALAVRLTQKEGDLIQEKFEVNKLVSILKQASEDAKKLVNQERSFAC  690
             RNK+DV  A+  V+A+  + TQ+E + +QE+ E  KL ++ ++ASEDAK ++ +ER  A 
Sbjct  74    RNKDDVTEALITVDAVEAQWTQRETEAMQERGESRKLAALFQKASEDAKSIIEKERQEAQ  133

Query  691   AEIESARAVVQRIGEALEEQEINSQVSGKQeveelmeeiqeARRIRVLHQPSKVMDMEHE  870
             AEIE+ARA   R  +ALEEQ      + ++E+ EL +EI+EARRI +LH PSKVMDME+E
Sbjct  134   AEIEAARATALRCQQALEEQTHALSHAEQEELVELRQEIKEARRITMLHAPSKVMDMEYE  193

Query  871   LRALRIQLNEKSVVSFKLQNELAMSKRTEQNKSQLYRIIGSESVGSILRIQPCSDEAVDL  1050
             +  LR QL EK++    L+ ++       +  S  + + G E +GS L I P    + +L
Sbjct  194   IAGLRQQLTEKALEVVALRKKVDALVSNSEGPSH-FELQGEERLGSSLVIVPADSLSPEL  252

Query  1051  SKCSIQWYRLSSECSRREPILGADKSVYAPEPIDVGRVLEADI-VSNGLKASVTTIGQID  1227
              KC  QW+R+     + E I+GA +  YAPEP+DVG+ L+ DI + +G + S+ T G ID
Sbjct  253   GKCKFQWHRMHG--IKAETIIGATRPQYAPEPLDVGKKLKVDIDLPDGSRESLATSGPID  310

Query  1228  QAAGLGNYVETLLRKSNTEFSVVIAQMNGRNYSSRSIHSFHVGKMRMKLNKGWITKARDS  1407
              AAGLG  VE L+RK   EF+V I Q NG +    +     + K RMKL KG   +A++ 
Sbjct  311   GAAGLGQCVEALVRKGGAEFNVRIFQENGEHVVKATFQVLVIDKSRMKLFKGRHNRAKEE  370

Query  1408  YSGSMQLCGFRGGGNSAAKSLFWQPRKGQSFVLVFDSERERNGALVVARKHALECNV  1578
             YS SMQLCG RGGG++AA+SL+W   K  +F+LV DSERERN A+++AR+ A +CNV
Sbjct  371   YSSSMQLCGARGGGDAAARSLYWVANKSLTFMLVLDSERERNAAIMLARRFAYDCNV  427



>ref|XP_001777717.1| predicted protein [Physcomitrella patens]
 gb|EDQ57497.1| predicted protein [Physcomitrella patens]
Length=469

 Score =   276 bits (707),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 190/419 (45%), Positives = 273/419 (65%), Gaps = 12/419 (3%)
 Frame = +1

Query  343   KRLSVRDLASKFDKN----LSSAAKLANEAKLRDAPSLEGHVLLKKLRDALETLKGRLAG  510
             KR+SVRDLASKF+       ++AA+LA E K ++   L+   LLKKLR  L  L GR+AG
Sbjct  47    KRMSVRDLASKFESRQAAAHAAAARLAEEQKAKEVALLDKPALLKKLRGLLGDLLGRVAG  106

Query  511   RNKEDVEIAIAMVEALAVRLTQKEGDLIQEKFEVNKLVSILKQASEDAKKLVNQERSFAC  690
             R+K+DV  A+  V+A+  + TQ+E + +QE+ E  KL ++ ++ASEDAK ++ +ER  A 
Sbjct  107   RSKDDVTEALITVDAVEAQWTQQETEAVQEREESRKLAALFQKASEDAKSIIEKERQEAQ  166

Query  691   AEIESARAVVQRIGEALEEQEINSQVSGKQeveelmeeiqeARRIRVLHQPSKVMDMEHE  870
             AEIE+AR    R  + LEEQ      S ++E+ EL +EI+EARRI +LH PSKVMDME+E
Sbjct  167   AEIEAARVTALRCQQTLEEQAHTLSQSEQEELAELRQEIKEARRITMLHAPSKVMDMEYE  226

Query  871   LRALRIQLNEKS--VVSFKLQNELAMSKRTEQNKSQLYRIIGSESVGSILRIQPCSDEAV  1044
             +  LR QL EK+  VV+ + + ++ +S          + + G E +GS L   P    + 
Sbjct  227   IAGLRQQLTEKTLEVVAIRRKMDVLVSN---PEVPAHFELQGEERLGSSLVTVPADSHSP  283

Query  1045  DLSKCSIQWYRLSSECSRREPILGADKSVYAPEPIDVGRVLEADI-VSNGLKASVTTIGQ  1221
             +L KC  QW+R+    ++ E I+GA +  YAPEP+DVG+VL+ DI + +G + S+ T+G 
Sbjct  284   ELGKCIFQWHRMHG--AKAEAIVGATRPQYAPEPLDVGKVLKVDIDLPDGSRESLATLGP  341

Query  1222  IDQAAGLGNYVETLLRKSNTEFSVVIAQMNGRNYSSRSIHSFHVGKMRMKLNKGWITKAR  1401
             ID AAGL  YVE L+RK   EF+V I Q NG +    +     + K+RMKL KG   +A+
Sbjct  342   IDGAAGLSQYVEALIRKGGAEFNVRIFQENGEHVVKATFQMLAIDKLRMKLYKGRHNRAK  401

Query  1402  DSYSGSMQLCGFRGGGNSAAKSLFWQPRKGQSFVLVFDSERERNGALVVARKHALECNV  1578
             + YS SMQLCG RGGG++AA+SL+W   K  +F+LV DSERERN A+++AR++A +CNV
Sbjct  402   EEYSSSMQLCGARGGGDAAARSLYWVVNKSLTFMLVLDSERERNAAIMLARRYAYDCNV  460



>tpg|DAA45492.1| TPA: hypothetical protein ZEAMMB73_782278 [Zea mays]
Length=393

 Score =   273 bits (699),  Expect = 6e-82, Method: Compositional matrix adjust.
 Identities = 176/412 (43%), Positives = 253/412 (61%), Gaps = 52/412 (13%)
 Frame = +1

Query  217   NQFPKYKLGPDFQILEEALLENKGPSLKevveeettRLTEQHKRLSVRDLASKFDKNLSS  396
             N+FP YK G +  +++ A    + P LKE+V +ET  L ++ +RLSVR+LA KF+K L++
Sbjct  30    NKFPTYKNGSNGIVIKLAD-GPEMPPLKEIVAKETADLLDRRQRLSVRELAMKFEKGLNT  88

Query  397   AAKLANEAKLRDAPSLEGHVLLKKLRDALETLKGRLAGRNKEDVEIAIAMVEALAVRLTQ  576
             A  L+NE K R    LE  +LLK L+  LE+L+GR+ G+ K+++E +I+MVE LAV+L++
Sbjct  89    ATLLSNEVKWRQVALLERDILLKNLKCVLESLRGRVTGKTKDEIEESISMVEILAVQLSK  148

Query  577   KEGDLIQEKFEVNKLVSILKQASEDAKKLVNQERSFACAEIESARAVVQRIGEALEEQEI  756
             +E +L+Q+K EV KL   LKQASEDAK++V +ER+ A  EIE+A++ VQR+ +A++E E 
Sbjct  149   REAELLQQKEEVTKLAKSLKQASEDAKRIVEEERANAHTEIETAKSSVQRVQQAVQEHEK  208

Query  757   NSQVSGKQeveelmeeiqeARRIRVLHQPSKVMDMEHELRALRIQLNEKSVVSFKLQNEL  936
              SQ +GKQ++EEL +E++EARRI++LHQPSK MD+E+E+R LR    EKS     L  EL
Sbjct  209   MSQNTGKQDMEELKKEVREARRIKMLHQPSKAMDLENEIRILRNTFAEKSKDCVNLLKEL  268

Query  937   AMSKRTEQNKSQLYRIIGSESVGSILRIQPCSDEAVDLSKCSIQWYRLSSECSRREPILG  1116
              M KR ++N                                                  G
Sbjct  269   EMHKRLKEN--------------------------------------------------G  278

Query  1117  ADKSVYAPEPIDVGRVLEADIVSNGLKASVTTIGQIDQAAGLGNYVETLLRKSNTEFSVV  1296
             A + VYA EP DVGR L+A+I   G  A   T G +D  AGL +YVETL+RK  TEF+VV
Sbjct  279   ATRPVYALEPHDVGRYLQAEIDVGGEIAVAKTAGPVDPDAGLVDYVETLVRKPETEFNVV  338

Query  1297  IAQMNGRNYSSRSIHSFHVGKMRMKLNKGWITKARDSYSGSMQLCGFRGGGN  1452
             + Q+NG +    S+H  +VG++RM+L KG    A++ YS SMQ+    G G+
Sbjct  339   VLQLNGIDLPKESVHVLNVGRLRMRLTKGNSVVAKEFYSSSMQII-LAGPGD  389



>ref|XP_004172976.1| PREDICTED: uncharacterized LOC101215534, partial [Cucumis sativus]
Length=247

 Score =   266 bits (679),  Expect = 6e-81, Method: Compositional matrix adjust.
 Identities = 158/241 (66%), Positives = 198/241 (82%), Gaps = 2/241 (1%)
 Frame = +1

Query  130  MTKVSPEFVGGEVQMYTFKSVSADVSFASNQFPKYKLGPDFQILEEALLENKGPSLKevv  309
            MT++S  +    +Q     +VSADV FAS++FP YK+GP+ QI+E A  + K  S+KEVV
Sbjct  1    MTRISRTY-SDTMQREGVSAVSADVIFASSRFPNYKIGPNNQIVE-AKDDPKVLSMKEVV  58

Query  310  eeettRLTEQHKRLSVRDLASKFDKNLSSAAKLANEAKLRDAPSLEGHVLLKKLRDALET  489
              ET +L EQ KRLSVRDLASKF+K L++AAKL+ EA+LR+A SLE HVLLKKLRDALE 
Sbjct  59   ARETAQLLEQQKRLSVRDLASKFEKGLAAAAKLSEEARLREAASLEKHVLLKKLRDALEA  118

Query  490  LKGRLAGRNKEDVEIAIAMVEALAVRLTQKEGDLIQEKFEVNKLVSILKQASEDAKKLVN  669
            L+GR+AGRNK+DVE AIAMVEALAV+LTQ+EG+LIQEK EV KL + LKQASEDAKKLV+
Sbjct  119  LRGRVAGRNKDDVEEAIAMVEALAVQLTQREGELIQEKAEVKKLANFLKQASEDAKKLVD  178

Query  670  QERSFACAEIESARAVVQRIGEALEEQEINSQVSGKQeveelmeeiqeARRIRVLHQPSK  849
            +ER+FA AEIE+AR  VQR+ EAL+E E  S+ +GKQ++EELM+E+QEARRI++LHQPSK
Sbjct  179  EERAFARAEIENAREAVQRVEEALQEHERMSRAAGKQDLEELMKEVQEARRIKMLHQPSK  238

Query  850  V  852
            V
Sbjct  239  V  239



>gb|EPS58051.1| hypothetical protein M569_16765, partial [Genlisea aurea]
Length=234

 Score =   263 bits (672),  Expect = 4e-80, Method: Compositional matrix adjust.
 Identities = 149/234 (64%), Positives = 187/234 (80%), Gaps = 1/234 (0%)
 Frame = +1

Query  415   EAKLRDAPSLEGHVLLKKLRDALETLKGRLAGRNKEDVEIAIAMVEALAVRLTQKEGDLI  594
             +AKLR+A SLE HVLL KLR+ALE LKGR+AGRNK+DVE AI MVEALAV+LT++EG+L 
Sbjct  2     QAKLREAASLEKHVLLMKLREALEALKGRVAGRNKDDVEEAILMVEALAVQLTRREGELT  61

Query  595   QEKFEVNKLVSILKQASEDAKKLVNQERSFACAEIESARAVVQRIGEALEEQEINSQVSG  774
             QEK EV KL + LKQASEDAKK+V++ER+FA AEIE AR  VQR+ +A+ E E  S+ SG
Sbjct  62    QEKAEVKKLANFLKQASEDAKKIVDEERAFARAEIEKAREAVQRVEDAIHEYEKMSKASG  121

Query  775   KQeveelmeeiqeARRIRVLHQPSKVMDMEHELRALRIQLNEKSVVSFKLQNELAMSKRT  954
             KQ+++ELM+E+QEARRI++LHQPS+VMDMEHEL+ALR QL EKS  S +LQ ELA+ KR 
Sbjct  122   KQDLDELMKEVQEARRIKMLHQPSRVMDMEHELQALRTQLAEKSKHSAQLQKELAICKRA  181

Query  955   EQNKSQLYRIIGSESVGSILRIQPCSDEAVDLSKCSIQWYRLSSECSRREPILG  1116
             E++   LY I G+ES+GS LRI P  D A DLS C+IQWYR +   +++E I G
Sbjct  182   EKDVHLLYEIDGTESLGSCLRIYPLKD-APDLSDCAIQWYRSTPGRAKKEIISG  234



>emb|CAN69648.1| hypothetical protein VITISV_043238 [Vitis vinifera]
Length=251

 Score =   254 bits (648),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 127/236 (54%), Positives = 161/236 (68%), Gaps = 26/236 (11%)
 Frame = +1

Query  967   SQLYRIIGSESVGSILRIQPCSDEAVDLSKCSIQWYRLSSECSRREPILGADKSVYAPEP  1146
             S +Y + G E++GS L+IQ  SD+A DLS CSIQWYR+SSE  +RE I GA KSVYAPEP
Sbjct  2     SDMYELDGPEALGSFLQIQAXSDKAPDLSHCSIQWYRVSSEGGKRELISGAIKSVYAPEP  61

Query  1147  IDVGRVLEADIVSNGLKASVTTIGQIDQAAGLGNYVETLLRKSNTEFS------------  1290
              DVGRVL+ADIV +G + ++ T G ID AAGLG+YVE L+RK +TEF+            
Sbjct  62    FDVGRVLQADIVLDGYQITLATAGPIDPAAGLGSYVEALVRKHDTEFNNTWTFMXWLIIA  121

Query  1291  --------------VVIAQMNGRNYSSRSIHSFHVGKMRMKLNKGWITKARDSYSGSMQL  1428
                           VVI QMNG ++ S SIH  HVGKMR+KL KG  T A++ YS SMQL
Sbjct  122   VLEPRKVDDIQVNRVVITQMNGADHPSESIHVLHVGKMRIKLCKGKATIAKEYYSTSMQL  181

Query  1429  CGFRGGGNSAAKSLFWQPRKGQSFVLVFDSERERNGALVVARKHALECNVSITSNL  1596
             CG RGGGN+A ++L+WQ +KG SFVL F+SER+RN A+++AR+ A +CNV     L
Sbjct  182   CGVRGGGNAATQALYWQAKKGLSFVLAFESERDRNAAIMLARRFAFDCNVPYNLKL  237



>ref|NP_001137123.1| uncharacterized protein LOC100217304 [Zea mays]
 gb|ACF83312.1| unknown [Zea mays]
Length=288

 Score =   241 bits (614),  Expect = 9e-71, Method: Compositional matrix adjust.
 Identities = 123/256 (48%), Positives = 171/256 (67%), Gaps = 1/256 (0%)
 Frame = +1

Query  814   ARRIRVLHQPSKVMDMEHELRALRIQLNEKSVVSFKLQNELAMSKRTEQNKS-QLYRIIG  990
             ARRI++LHQPSK MD+E+E+R LR    EKS     L  EL   KR ++N +   + + G
Sbjct  22    ARRIKMLHQPSKAMDLENEIRILRNTFAEKSKDCVSLLKELETHKRLKENGTIPSFDLEG  81

Query  991   SESVGSILRIQPCSDEAVDLSKCSIQWYRLSSECSRREPILGADKSVYAPEPIDVGRVLE  1170
              + +GS+LRI   S   +DLS  SIQW+R+  + S +E I GA + VYA EP DVGR L+
Sbjct  82    LQCLGSMLRIVGLSGTHMDLSNISIQWFRIHPKESNKEIISGATRPVYALEPHDVGRYLQ  141

Query  1171  ADIVSNGLKASVTTIGQIDQAAGLGNYVETLLRKSNTEFSVVIAQMNGRNYSSRSIHSFH  1350
             A+I   G  A   T G +D  AGL +YVETL+RK  TEF+VV+ Q NG +    S+H  +
Sbjct  142   AEIDVGGEIAVAKTAGPVDPDAGLVDYVETLVRKPETEFNVVVLQSNGVDQPKESVHVLN  201

Query  1351  VGKMRMKLNKGWITKARDSYSGSMQLCGFRGGGNSAAKSLFWQPRKGQSFVLVFDSERER  1530
             VG++RM+L KG    A++ YS SMQLCG RGGG +A++++FW+PR   S VL F+S RER
Sbjct  202   VGRLRMRLTKGKSVVAKEFYSSSMQLCGVRGGGEAASQAMFWRPRNDLSLVLAFESTRER  261

Query  1531  NGALVVARKHALECNV  1578
             N A+++AR+ A++CN+
Sbjct  262   NAAIMLARRFAVDCNI  277



>gb|KDO53647.1| hypothetical protein CISIN_1g0127252mg, partial [Citrus sinensis]
Length=169

 Score =   231 bits (589),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 126/170 (74%), Positives = 148/170 (87%), Gaps = 1/170 (1%)
 Frame = +1

Query  130  MTKVSPEFVGGEVQMYTFKSVSADVSFASNQFPKYKLGPDFQILEEALLENKGPSLKevv  309
            MTK+SPE +  +VQ  +  SVSADVSF+SN FPKYKLGPD QI+EE+  ++KG SLKEVV
Sbjct  1    MTKISPE-IEEDVQAESLLSVSADVSFSSNCFPKYKLGPDNQIVEESKEDSKGLSLKEVV  59

Query  310  eeettRLTEQHKRLSVRDLASKFDKNLSSAAKLANEAKLRDAPSLEGHVLLKKLRDALET  489
            E+ET +L+EQHKRLSVRDLASKFDKNL++AAKLA+EAKLRD  SLEGHVLLKKLRDALE 
Sbjct  60   EKETVQLSEQHKRLSVRDLASKFDKNLTAAAKLADEAKLRDVASLEGHVLLKKLRDALEA  119

Query  490  LKGRLAGRNKEDVEIAIAMVEALAVRLTQKEGDLIQEKFEVNKLVSILKQ  639
            L+GR+AGR KEDVE AI++VEALAV+LTQ EG+LIQEKFEV KL + LKQ
Sbjct  120  LRGRMAGRTKEDVEKAISLVEALAVKLTQNEGELIQEKFEVKKLANFLKQ  169



>ref|NP_001050172.1| Os03g0364500 [Oryza sativa Japonica Group]
 dbj|BAF12086.1| Os03g0364500, partial [Oryza sativa Japonica Group]
Length=244

 Score =   221 bits (563),  Expect = 6e-64, Method: Compositional matrix adjust.
 Identities = 111/233 (48%), Positives = 153/233 (66%), Gaps = 0/233 (0%)
 Frame = +1

Query  880   LRIQLNEKSVVSFKLQNELAMSKRTEQNKSQLYRIIGSESVGSILRIQPCSDEAVDLSKC  1059
             LR    E+S     L  EL + KR E N   L+ + G + +GSILRI   S   +D S  
Sbjct  1     LRKTFVERSTDCVNLLKELELHKRPEGNDIPLFDLEGLQCLGSILRIVSQSSTTMDFSNI  60

Query  1060  SIQWYRLSSECSRREPILGADKSVYAPEPIDVGRVLEADIVSNGLKASVTTIGQIDQAAG  1239
             SIQW+R+  + S +E I GA +SVYAPEP DVGR LEA+I   G  A   T G ID  AG
Sbjct  61    SIQWFRVHPKESNKEIISGATRSVYAPEPHDVGRYLEAEINYGGEIAIAKTAGPIDPDAG  120

Query  1240  LGNYVETLLRKSNTEFSVVIAQMNGRNYSSRSIHSFHVGKMRMKLNKGWITKARDSYSGS  1419
             L +YVETL+RK  TEF+VV+ Q+NG +    S+H  ++GK+RM+L+KG    A++ YS S
Sbjct  121   LVDYVETLVRKRETEFNVVVLQLNGIDQPKESVHVLNIGKLRMRLSKGKTVVAKEFYSSS  180

Query  1420  MQLCGFRGGGNSAAKSLFWQPRKGQSFVLVFDSERERNGALVVARKHALECNV  1578
             MQLCG RGGG +A++++FW+PR   S VL F++ RERN A+++ R+ A++CN+
Sbjct  181   MQLCGVRGGGEAASQAMFWRPRNDLSMVLAFETTRERNTAIMLTRRFAIDCNI  233



>gb|ACJ83336.1| unknown [Medicago truncatula]
Length=195

 Score =   214 bits (545),  Expect = 7e-62, Method: Compositional matrix adjust.
 Identities = 122/200 (61%), Positives = 155/200 (78%), Gaps = 6/200 (3%)
 Frame = +1

Query  130  MTKVSPEFVGGEVQMYTFKSVSADVSFASNQFPKYKLGPDFQILEEALLENKGPSLKevv  309
            MT+V+  F  G+  M     VSADV FAS +FP Y++G + +I+++     K  S+KEVV
Sbjct  1    MTRVTHSF--GDTMMMHKDVVSADVIFASLRFPTYQIGSNNKIMDDP----KVLSMKEVV  54

Query  310  eeettRLTEQHKRLSVRDLASKFDKNLSSAAKLANEAKLRDAPSLEGHVLLKKLRDALET  489
              ET +L EQ KRLSVRDLASKF+K L++AAKL+ EAKLR+A SLE HVLLKKLRD LE+
Sbjct  55   ARETAQLLEQQKRLSVRDLASKFEKGLAAAAKLSEEAKLREAASLEKHVLLKKLRDGLES  114

Query  490  LKGRLAGRNKEDVEIAIAMVEALAVRLTQKEGDLIQEKFEVNKLVSILKQASEDAKKLVN  669
            LKGR+ GRNK+DV  AI++VEALAV+LT +EG+L+QEK EV KL + LKQASEDAKKLV 
Sbjct  115  LKGRVTGRNKDDVHEAISLVEALAVQLTHREGELVQEKAEVKKLTNFLKQASEDAKKLVY  174

Query  670  QERSFACAEIESARAVVQRI  729
            +ER+FA  EI++ARA VQR+
Sbjct  175  EERAFARFEIDNARAAVQRV  194



>tpg|DAA63878.1| TPA: hypothetical protein ZEAMMB73_650755 [Zea mays]
Length=298

 Score =   196 bits (498),  Expect = 7e-54, Method: Compositional matrix adjust.
 Identities = 126/271 (46%), Positives = 190/271 (70%), Gaps = 7/271 (3%)
 Frame = +1

Query  217   NQFPKYKLGPDFQILEEALLENKGP---SLKevveeettRLTEQHKRLSVRDLASKFDKN  387
             N+FP YK G +  +++ A     GP   SLKE V +E T L ++ +R SVR+L  KF+K 
Sbjct  31    NKFPTYKNGSNGIVIKLA----DGPEMPSLKEAVAKEATDLLDRCQRPSVRELTMKFEKG  86

Query  388   LSSAAKLANEAKLRDAPSLEGHVLLKKLRDALETLKGRLAGRNKEDVEIAIAMVEALAVR  567
              ++A  L+NEAK R A  LE  +LLK L+  LE+L+GR+ G+NK+++  +++MV+ LA+ 
Sbjct  87    FNTATLLSNEAKWRHAALLERDILLKDLKSVLESLRGRVGGKNKDEIVESLSMVDILAIE  146

Query  568   LTQKEGDLIQEKFEVNKLVSILKQASEDAKKLVNQERSFACAEIESARAVVQRIGEALEE  747
             L+++E +L+++K EV K+   LK AS DAK+++++ER+ A  EIESA+A VQ+I  AL+E
Sbjct  147   LSKREDELLRQKTEVTKIADTLKLASTDAKRIIDEERANARLEIESAKASVQKIQSALKE  206

Query  748   QEINSQVSGKQeveelmeeiqeARRIRVLHQPSKVMDMEHELRALRIQLNEKSVVSFKLQ  927
             QE+ SQ +GKQ+V+EL EE+QEARR+++LH PSK MD+E+E++ LR QL EKS  S +L 
Sbjct  207   QELFSQRTGKQDVDELKEEVQEARRVKMLHCPSKAMDIENEIQVLRDQLAEKSSDSLRLL  266

Query  928   NELAMSKRTEQNKSQLYRIIGSESVGSILRI  1020
              EL + +   +N   LY + G E++GS L I
Sbjct  267   KELELHRSYGENDMPLYELKGLETLGSTLHI  297



>gb|KHN05999.1| hypothetical protein glysoja_048539 [Glycine soja]
Length=221

 Score =   187 bits (476),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 132/266 (50%), Positives = 169/266 (64%), Gaps = 46/266 (17%)
 Frame = +1

Query  130  MTKVSPEFVGGEVQMYTFKSVSADVSF-ASNQFPKYKLGPDFQILEEALLENKGPSLKev  306
            MT+++ +F G  +Q     +VS+DV   A+N+  + K  P            K  S+KEV
Sbjct  1    MTRLTRDF-GDTMQRDVVPAVSSDVVIGANNKIIETKDDP------------KVLSMKEV  47

Query  307  veeettRLTEQHKRLSVRDLASKFDKNLSSAAKLANEAKLRDAPSLEGHVLLKKLRDALE  486
            V  ET +L EQH  LSVRDLASKF+K L++  K + EA+LR+A SLE HVLLKKLRDALE
Sbjct  48   VARETAQLLEQHNHLSVRDLASKFEKGLAAPTKFSEEARLREAASLEKHVLLKKLRDALE  107

Query  487  TLKGRLAGRNKEDVEIAIAMVEALAVRLTQKEGDLIQEKFEVNKLVSILKQASEDAKKLV  666
            +LK RLAGRNK+D E  IAM                               ASEDA K+V
Sbjct  108  SLKRRLAGRNKDDAEDTIAM-------------------------------ASEDA-KIV  135

Query  667  NQERSFACAEIESARAVVQRIGEALEEQEINSQVSGKQeveelmeeiqeARRIRVLHQPS  846
            ++ER+FA AE + ARA VQR+  AL+E E  SQ SGKQ++E+LM E+QEARRI++LHQP 
Sbjct  136  DEERAFAHAESKDARAAVQRVEVALQEHERMSQASGKQDLEQLMREVQEARRIKMLHQPR  195

Query  847  KVMDMEHELRALRIQLNEKSVVSFKL  924
            KVMDMEHELRALR+QL +K+    +L
Sbjct  196  KVMDMEHELRALRVQLAKKTRQYLRL  221



>gb|EMS52536.1| hypothetical protein TRIUR3_27268 [Triticum urartu]
Length=485

 Score =   183 bits (465),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 118/269 (44%), Positives = 181/269 (67%), Gaps = 1/269 (0%)
 Frame = +1

Query  217   NQFPKYKLGPDFQILEEALLENKGPSLKevveeettRLTEQHKRLSVRDLASKFDKNLSS  396
             N+FP YK G +  +++ A    + P LKEVV +ET  L ++ +R SVR+LA KF+K L++
Sbjct  116   NKFPTYKNGSNGIVIKLAD-GPEVPPLKEVVAKETEELLDRRQRFSVRELAMKFEKGLNT  174

Query  397   AAKLANEAKLRDAPSLEGHVLLKKLRDALETLKGRLAGRNKEDVEIAIAMVEALAVRLTQ  576
             A  L+ E K R    LE  +LLK L+  LE+L+G++ G+ K+++E +I+MVE LAV+L++
Sbjct  175   ATLLSKEVKWRQVALLERDILLKNLKSVLESLRGQVTGKTKDEIEESISMVEILAVQLSK  234

Query  577   KEGDLIQEKFEVNKLVSILKQASEDAKKLVNQERSFACAEIESARAVVQRIGEALEEQEI  756
             +E +LIQ+K EV +L   LK ASEDAK++V +ER  A  E+ESAR+ VQR+ EAL+E E 
Sbjct  235   REAELIQQKTEVTELAKSLKLASEDAKRIVEEERVNANTEVESARSAVQRVQEALQEHEK  294

Query  757   NSQVSGKQeveelmeeiqeARRIRVLHQPSKVMDMEHELRALRIQLNEKSVVSFKLQNEL  936
              S+ +GKQ++EEL +E++ ARRI++LH PSK MD+E+E++ LR    EKSV    L  E+
Sbjct  295   MSKKTGKQDMEELKKEVRVARRIKMLHCPSKAMDLENEIKTLRKTFTEKSVDCVNLLKEV  354

Query  937   AMSKRTEQNKSQLYRIIGSESVGSILRIQ  1023
                +   Q++  L      +S+  ++ +Q
Sbjct  355   PQDQHMLQSQMMLDVTCKLKSILGVVVLQ  383


 Score =   112 bits (280),  Expect = 5e-23, Method: Compositional matrix adjust.
 Identities = 44/98 (45%), Positives = 72/98 (73%), Gaps = 0/98 (0%)
 Frame = +1

Query  1285  FSVVIAQMNGRNYSSRSIHSFHVGKMRMKLNKGWITKARDSYSGSMQLCGFRGGGNSAAK  1464
               VV+ Q+NG +    ++H  +VG++RM+L+KG    A++ YS SMQLCG RGGG +A++
Sbjct  377   LGVVVLQLNGIDQPKEAVHVLNVGRLRMRLSKGKTVVAKEFYSSSMQLCGVRGGGEAASQ  436

Query  1465  SLFWQPRKGQSFVLVFDSERERNGALVVARKHALECNV  1578
             ++FW+PR   SF + F++ RERN A+++AR+ A++CN+
Sbjct  437   AMFWRPRSDLSFAVAFETARERNTAIMLARRFAIDCNI  474



>gb|KHG04375.1| ribosomal rna large subunit methyltransferase i [Gossypium arboreum]
Length=160

 Score =   173 bits (439),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 80/137 (58%), Positives = 104/137 (76%), Gaps = 0/137 (0%)
 Frame = +1

Query  1174  DIVSNGLKASVTTIGQIDQAAGLGNYVETLLRKSNTEFSVVIAQMNGRNYSSRSIHSFHV  1353
             +I+ +G    +TT G ID AAGLGNYVE L+RK + EF+VV+ QMNG +  S SIH  HV
Sbjct  13    EIIYDGQLIMLTTTGAIDPAAGLGNYVEALVRKHDVEFNVVVTQMNGVDQPSESIHVLHV  72

Query  1354  GKMRMKLNKGWITKARDSYSGSMQLCGFRGGGNSAAKSLFWQPRKGQSFVLVFDSERERN  1533
             GKMRMKL KG  T A++ YSGSMQLCG RGGGN+AA++LFWQ +K  S VL F+SER+RN
Sbjct  73    GKMRMKLRKGKATIAKEYYSGSMQLCGVRGGGNAAAQALFWQAKKEFSVVLAFESERDRN  132

Query  1534  GALVVARKHALECNVSI  1584
              A+++AR+ A +CN+ +
Sbjct  133   AAIMLARRFAFDCNIML  149



>ref|XP_003620242.1| hypothetical protein MTR_6g079040 [Medicago truncatula]
 gb|AES76460.1| myosin heavy chain-like protein, putative [Medicago truncatula]
Length=179

 Score =   171 bits (434),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 89/115 (77%), Positives = 102/115 (89%), Gaps = 1/115 (1%)
 Frame = +1

Query  418  AKLRDAPSLEGHVLLKKLRDALETLKGRLAGRNKEDVEIAIAMVEALAVRLTQK-EGDLI  594
            AKLR+ PSLEGHVLLKK RDALE LKGR  GRNKEDV  +I+MVEALAV+LTQK EG+LI
Sbjct  46   AKLREVPSLEGHVLLKKQRDALEYLKGRFTGRNKEDVANSISMVEALAVKLTQKNEGELI  105

Query  595  QEKFEVNKLVSILKQASEDAKKLVNQERSFACAEIESARAVVQRIGEALEEQEIN  759
            QEKF+V KL++ LKQASEDAKKLVNQE+SFACAEIE+ARAVV R GEALEE+++ 
Sbjct  106  QEKFKVKKLLNFLKQASEDAKKLVNQEQSFACAEIENARAVVLRFGEALEEEKVT  160



>gb|ACJ07060.1| expressed protein [Triticum urartu]
Length=142

 Score =   169 bits (428),  Expect = 7e-46, Method: Compositional matrix adjust.
 Identities = 74/139 (53%), Positives = 111/139 (80%), Gaps = 0/139 (0%)
 Frame = +1

Query  1162  VLEADIVSNGLKASVTTIGQIDQAAGLGNYVETLLRKSNTEFSVVIAQMNGRNYSSRSIH  1341
             +L+A+I+    K +V T G I+ A+GL +YVE+L+++++ EF+VV+ QMNG +Y+S+S+H
Sbjct  1     LLQAEIILKADKVTVQTDGPINHASGLEHYVESLMKRADIEFNVVVTQMNGNDYASKSVH  60

Query  1342  SFHVGKMRMKLNKGWITKARDSYSGSMQLCGFRGGGNSAAKSLFWQPRKGQSFVLVFDSE  1521
              FH+GK+R+KL KG  TKAR+SYS +M+LCG RGGGN+AA ++FWQ RKG S+ L F+++
Sbjct  61    VFHIGKLRVKLRKGRSTKARESYSTTMKLCGSRGGGNAAACAVFWQTRKGLSYTLAFETD  120

Query  1522  RERNGALVVARKHALECNV  1578
             R+RN A+++ARK A  CNV
Sbjct  121   RDRNAAIMLARKFASSCNV  139



>gb|ACJ07059.1| expressed protein [Aegilops speltoides]
Length=142

 Score =   168 bits (426),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 74/139 (53%), Positives = 110/139 (79%), Gaps = 0/139 (0%)
 Frame = +1

Query  1162  VLEADIVSNGLKASVTTIGQIDQAAGLGNYVETLLRKSNTEFSVVIAQMNGRNYSSRSIH  1341
             +L+A+I+    K +V T G I+ A+GL  YVE+L+++++ EF+VV+ QMNG +Y+S+S+H
Sbjct  1     LLQAEIILKADKVTVQTDGPINHASGLERYVESLMKRADIEFNVVVTQMNGNDYASKSVH  60

Query  1342  SFHVGKMRMKLNKGWITKARDSYSGSMQLCGFRGGGNSAAKSLFWQPRKGQSFVLVFDSE  1521
              FH+GK+R+KL KG  TKAR+SYS +M+LCG RGGGN+AA ++FWQ RKG S+ L F+++
Sbjct  61    VFHIGKLRVKLRKGRSTKARESYSTTMKLCGSRGGGNAAACAVFWQTRKGLSYTLAFETD  120

Query  1522  RERNGALVVARKHALECNV  1578
             R+RN A+++ARK A  CNV
Sbjct  121   RDRNAAIMLARKFASSCNV  139



>gb|ACJ07057.1| expressed protein [Secale cereale]
Length=141

 Score =   167 bits (422),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 74/138 (54%), Positives = 108/138 (78%), Gaps = 0/138 (0%)
 Frame = +1

Query  1165  LEADIVSNGLKASVTTIGQIDQAAGLGNYVETLLRKSNTEFSVVIAQMNGRNYSSRSIHS  1344
             L A+I+    K +V T G I+ A+GL  YVE+L+++++ EF+VV+ QMNG +Y+S+S+H 
Sbjct  1     LXAEIILKADKVTVQTDGPINHASGLERYVESLMKRADIEFNVVVTQMNGNDYASKSVHV  60

Query  1345  FHVGKMRMKLNKGWITKARDSYSGSMQLCGFRGGGNSAAKSLFWQPRKGQSFVLVFDSER  1524
             FH+GK+R+KL KG  TKAR+SYS +M+LCG RGGGN+AA ++FWQ RKG S+ L F+++R
Sbjct  61    FHIGKLRVKLRKGRSTKARESYSTTMKLCGSRGGGNAAACAVFWQTRKGLSYTLAFETDR  120

Query  1525  ERNGALVVARKHALECNV  1578
             +RN A+++ARK A  CNV
Sbjct  121   DRNAAIMLARKFASSCNV  138



>gb|ACJ07058.1| expressed protein [Triticum monococcum]
Length=141

 Score =   167 bits (422),  Expect = 5e-45, Method: Compositional matrix adjust.
 Identities = 74/140 (53%), Positives = 109/140 (78%), Gaps = 0/140 (0%)
 Frame = +1

Query  1165  LEADIVSNGLKASVTTIGQIDQAAGLGNYVETLLRKSNTEFSVVIAQMNGRNYSSRSIHS  1344
             L+A+I+    K  V T G I+ A+GL  YVE+L+++++ EF+VV+ QMNG +Y+S+S+H 
Sbjct  1     LQAEIILKADKVMVQTDGPINHASGLERYVESLMKRADIEFNVVVTQMNGNDYASKSVHV  60

Query  1345  FHVGKMRMKLNKGWITKARDSYSGSMQLCGFRGGGNSAAKSLFWQPRKGQSFVLVFDSER  1524
             FH+GK+R+KL KG  TKAR+SYS +M+LCG RGGGN+AA ++FWQ RKG S+ L F+++R
Sbjct  61    FHIGKLRVKLRKGRSTKARESYSTTMKLCGSRGGGNAAACAVFWQTRKGLSYTLAFETDR  120

Query  1525  ERNGALVVARKHALECNVSI  1584
             +RN A+++ARK A  CNV +
Sbjct  121   DRNAAIMLARKFASSCNVVL  140



>gb|AFK36560.1| unknown [Lotus japonicus]
Length=150

 Score =   158 bits (399),  Expect = 9e-42, Method: Compositional matrix adjust.
 Identities = 76/120 (63%), Positives = 93/120 (78%), Gaps = 0/120 (0%)
 Frame = +1

Query  853   MDMEHELRALRIQLNEKSVVSFKLQNELAMSKRTEQNKSQLYRIIGSESVGSILRIQPCS  1032
             M ME+ELRALR Q+ EKS+ S KLQ EL MSKR E+NKS  Y + GSE++GS L++QP S
Sbjct  1     MAMEYELRALRDQIREKSIFSIKLQKELTMSKRDEENKSHPYMLHGSEALGSYLKVQPRS  60

Query  1033  DEAVDLSKCSIQWYRLSSECSRREPILGADKSVYAPEPIDVGRVLEADIVSNGLKASVTT  1212
              E   +SKCS QWYRLSSE S RE + GADKS+YAP+P DVGR+L+ DIVSNG K ++TT
Sbjct  61    GEVPQVSKCSFQWYRLSSEGSWREVVSGADKSIYAPDPFDVGRILQVDIVSNGKKLTLTT  120



>gb|EPS57928.1| hypothetical protein M569_16888, partial [Genlisea aurea]
Length=123

 Score =   153 bits (386),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 68/119 (57%), Positives = 89/119 (75%), Gaps = 0/119 (0%)
 Frame = +1

Query  1231  AAGLGNYVETLLRKSNTEFSVVIAQMNGRNYSSRSIHSFHVGKMRMKLNKGWITKARDSY  1410
             A GL NYVE L R+   EF+VV+ QMNG + S  SIH  H+GKM MKL K    KA++ Y
Sbjct  1     APGLANYVEALKRRHEIEFTVVVIQMNGEDESLESIHVLHIGKMGMKLRKAKTVKAKEYY  60

Query  1411  SGSMQLCGFRGGGNSAAKSLFWQPRKGQSFVLVFDSERERNGALVVARKHALECNVSIT  1587
             S +MQLCG RGGGN+AA+S +WQP+ G SF+L F+SERERN A+V+AR+ AL+CN+ ++
Sbjct  61    SNAMQLCGIRGGGNAAAQSAYWQPKPGLSFILAFESERERNTAIVLARRFALDCNIVLS  119



>ref|XP_008362638.1| PREDICTED: uncharacterized protein LOC103426324 [Malus domestica]
Length=155

 Score =   140 bits (354),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 83/139 (60%), Positives = 106/139 (76%), Gaps = 2/139 (1%)
 Frame = +1

Query  130  MTKVSPEFVGGEVQMYTFKSVSADVSFASNQFPKYKLGPDFQILEEALLENKGPSLKevv  309
            MT+V  +F G  +Q     +VSADV FAS++FP Y++G + QI+E    + K  S+KEVV
Sbjct  1    MTRVGRDF-GDTMQKDAVPAVSADVVFASSRFPNYRIGANNQIVE-GKDDRKVLSMKEVV  58

Query  310  eeettRLTEQHKRLSVRDLASKFDKNLSSAAKLANEAKLRDAPSLEGHVLLKKLRDALET  489
              ET +L EQ  RLSVRDLASKF+K L++AAKL+ EA+LR+A SLE HVLLKKLRDALE+
Sbjct  59   ARETAQLLEQQNRLSVRDLASKFEKGLAAAAKLSEEARLREAASLEKHVLLKKLRDALES  118

Query  490  LKGRLAGRNKEDVEIAIAM  546
            LKGR+AGRNK+DV  AI+M
Sbjct  119  LKGRVAGRNKDDVVDAISM  137



>emb|CDY46462.1| BnaA08g06460D [Brassica napus]
Length=163

 Score =   140 bits (353),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 84/147 (57%), Positives = 111/147 (76%), Gaps = 2/147 (1%)
 Frame = +1

Query  130  MTKVSPEFVGGEVQMYTFKSVSADVSFASNQFPKYKLGPDFQILEEALLENKGPSLKevv  309
            MT+V+ +F    +      +VSADV FAS++FP Y++G + QI + A  + K  S+KEVV
Sbjct  1    MTRVTRDF-RDSLHKEVVPAVSADVRFASSRFPNYRIGANDQIFD-AKDDPKVLSMKEVV  58

Query  310  eeettRLTEQHKRLSVRDLASKFDKNLSSAAKLANEAKLRDAPSLEGHVLLKKLRDALET  489
              ET +L +Q KR+SVRDLA+KF+K L++AAKL+ EAKL++A SLE HVLLKKLRDALE+
Sbjct  59   ARETAQLMDQQKRMSVRDLANKFEKGLAAAAKLSEEAKLKEATSLEKHVLLKKLRDALES  118

Query  490  LKGRLAGRNKEDVEIAIAMVEALAVRL  570
            L+GR+AGRNK+DVE AIAMV  L V L
Sbjct  119  LRGRVAGRNKDDVEEAIAMVSLLLVNL  145



>gb|KDP36625.1| hypothetical protein JCGZ_08441 [Jatropha curcas]
Length=104

 Score =   121 bits (304),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 55/94 (59%), Positives = 71/94 (76%), Gaps = 0/94 (0%)
 Frame = +1

Query  1306  MNGRNYSSRSIHSFHVGKMRMKLNKGWITKARDSYSGSMQLCGFRGGGNSAAKSLFWQPR  1485
             MNG +Y S SIH  HVGKMRMKL KG  T  ++ YS  MQLCG RGGGN+AA++L+WQ  
Sbjct  1     MNGVDYKSDSIHVLHVGKMRMKLRKGKSTITKEYYSTLMQLCGVRGGGNAAAQALYWQAS  60

Query  1486  KGQSFVLVFDSERERNGALVVARKHALECNVSIT  1587
             KG SFVL F+SER+RN A+++AR+ A +CN+ + 
Sbjct  61    KGLSFVLAFESERDRNAAVMLARRFAFDCNIMLA  94



>gb|KDP36964.1| hypothetical protein JCGZ_08556 [Jatropha curcas]
Length=104

 Score =   114 bits (286),  Expect = 1e-26, Method: Composition-based stats.
 Identities = 53/93 (57%), Positives = 69/93 (74%), Gaps = 0/93 (0%)
 Frame = +1

Query  1306  MNGRNYSSRSIHSFHVGKMRMKLNKGWITKARDSYSGSMQLCGFRGGGNSAAKSLFWQPR  1485
             MNG +Y S  I   HVGKMRMKL KG  T  ++ YS  MQLCG RGGGN+AA++L+WQ  
Sbjct  1     MNGVDYKSDLIRVLHVGKMRMKLRKGKSTITKEYYSTLMQLCGVRGGGNAAAQALYWQAC  60

Query  1486  KGQSFVLVFDSERERNGALVVARKHALECNVSI  1584
             KG SFVL F+SER+RN A++ AR+ A +CN+++
Sbjct  61    KGLSFVLAFESERDRNAAIMPARRFAFDCNITL  93



>ref|XP_002980338.1| hypothetical protein SELMODRAFT_420081 [Selaginella moellendorffii]
 gb|EFJ18598.1| hypothetical protein SELMODRAFT_420081 [Selaginella moellendorffii]
Length=348

 Score =   115 bits (287),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 63/174 (36%), Positives = 96/174 (55%), Gaps = 26/174 (15%)
 Frame = +1

Query  1057  CSIQWYRLSSECSRREPILGADKSVYAPEPIDVGRVLEADI-VSNGLKASVTTIGQIDQA  1233
             C++ + + ++   R   + GA KS YAP+P D GR+L  DI + +G K  + T G  D A
Sbjct  4     CAVGYCKTNARVYR---VDGAVKSQYAPDPFDAGRILRVDITLPDGAKEFLFTTGPDDPA  60

Query  1234  AGLGNYVETLLRKSNTEFSVVIAQMNGRNYSSRSIHSFHVGKMRMKLNKGWITKARDSYS  1413
              GL        +K  TEF+ + ++M                  RMKL KG  TK ++ Y+
Sbjct  61    LGLA-------KKGGTEFNSLYSRM---------------ASTRMKLRKGLTTKIKEKYA  98

Query  1414  GSMQLCGFRGGGNSAAKSLFWQPRKGQSFVLVFDSERERNGALVVARKHALECN  1575
                QLCG RGGG  A  ++FW  ++G +++L F+SERERN A+++AR+ A +C 
Sbjct  99    AGKQLCGARGGGQIAPFAMFWLVKRGLTYMLGFESERERNAAIMLARRFAFDCT  152



>gb|AFW81568.1| hypothetical protein ZEAMMB73_269241 [Zea mays]
Length=193

 Score =   103 bits (256),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 69/157 (44%), Positives = 102/157 (65%), Gaps = 0/157 (0%)
 Frame = +1

Query  640   ASEDAKKLVNQERSFACAEIESARAVVQRIGEALEEQEINSQVSGKQeveelmeeiqeAR  819
             AS DAK+++++ER+ A  EI  A+A VQ+I  AL+EQE  S  +GKQ+V+EL EE+QEA 
Sbjct  37    ASTDAKRIIDEERANARLEIGRAKASVQKIQSALKEQEKFSHRTGKQDVDELKEEVQEAP  96

Query  820   RIRVLHQPSKVMDMEHELRALRIQLNEKSVVSFKLQNELAMSKRTEQNKSQLYRIIGSES  999
             R+++LH PSK MD+E+E++ L  QL + S  S +L   L + +   +N   LY + G E+
Sbjct  97    RVKMLHCPSKAMDIENEIQVLCDQLAKTSSYSLRLLKVLELHRSYGENDMPLYELKGLET  156

Query  1000  VGSILRIQPCSDEAVDLSKCSIQWYRLSSECSRREPI  1110
             +GS L I      +VD    SIQW+R+  E S++E I
Sbjct  157   LGSTLHIVVHDCASVDFWNSSIQWFRIQPEGSKKEII  193



>emb|CDY35368.1| BnaA04g14790D [Brassica napus]
Length=106

 Score = 95.5 bits (236),  Expect = 9e-20, Method: Composition-based stats.
 Identities = 39/72 (54%), Positives = 56/72 (78%), Gaps = 0/72 (0%)
 Frame = +1

Query  1363  RMKLNKGWITKARDSYSGSMQLCGFRGGGNSAAKSLFWQPRKGQSFVLVFDSERERNGAL  1542
             R+KL++GWITKAR+ YS S QLCG RG   + A++LFWQPRK  +F+L F+SE+E N  +
Sbjct  19    RIKLSRGWITKAREIYSTSRQLCGVRGNIKAPAEALFWQPRKSLTFILTFESEQEHNTVI  78

Query  1543  VVARKHALECNV  1578
              ++RK+A +CN+
Sbjct  79    TLSRKYAFDCNI  90



>gb|AFW81567.1| hypothetical protein ZEAMMB73_269241 [Zea mays]
Length=271

 Score = 92.8 bits (229),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 84/258 (33%), Positives = 140/258 (54%), Gaps = 24/258 (9%)
 Frame = +1

Query  640   ASEDAKKLVNQERSFACAEIESARAVVQRIGEALEEQEINSQVSGKQeveelmeeiqeAR  819
             AS DAK+++++ER+ A  EI  A+A VQ+I  AL+EQE  S  +GKQ+V+EL EE+QEA 
Sbjct  37    ASTDAKRIIDEERANARLEIGRAKASVQKIQSALKEQEKFSHRTGKQDVDELKEEVQEAP  96

Query  820   RIRVLHQPSKVMDMEHELRALRIQLNEKSVVSFKLQNELAMSKRTEQNKSQLYRIIGSES  999
             R+++LH PSK MD+E+E++ L  QL + S  S +L   L +   T Q+    Y +   E+
Sbjct  97    RVKMLHCPSKAMDIENEIQVLCDQLAKTSSYSLRL---LKVISGTVQSSGFAYSL--KEA  151

Query  1000  VGSILRIQPCSDEAVDLSKCSIQWYRLSSECSRREPILGADKSVYAPEPIDVGRVLEADI  1179
                +  ++  S      ++  +Q + + +   + +  L A    +  + + V  +L    
Sbjct  152   RKKLFEVEQFSSYKAPQNQHMLQNHMMWAGTPKLKSNLVAK---HQSQKLLVQYILFFSF  208

Query  1180  VSNGLKASVTTIGQIDQAAGLGNYVETLLRKSNTEFSVVIAQMNGRNYSSRSIHSFHVGK  1359
             V                AAGL +YVE L+R+  T + VVI Q+NG   ++ S+H   +G+
Sbjct  209   V----------------AAGLVHYVEALVRRRETGYDVVILQVNGVAQAADSVHILCIGR  252

Query  1360  MRMKLNKGWITKARDSYS  1413
             ++M+L K      ++ YS
Sbjct  253   LQMRLAKEKTIIVKEFYS  270



>ref|XP_010908517.1| PREDICTED: uncharacterized protein LOC105034896 [Elaeis guineensis]
 ref|XP_010908518.1| PREDICTED: uncharacterized protein LOC105034896 [Elaeis guineensis]
Length=101

 Score = 88.6 bits (218),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 50/93 (54%), Positives = 69/93 (74%), Gaps = 0/93 (0%)
 Frame = +1

Query  502  LAGRNKEDVEIAIAMVEALAVRLTQKEGDLIQEKFEVNKLVSILKQASEDAKKLVNQERS  681
            + G+NK++VE A++MVE LA +L Q+EG+L+ EK EV KL  +LK+ASEDAKK+V +ER+
Sbjct  1    MVGQNKDEVEEAMSMVETLADQLVQREGELLHEKSEVKKLAILLKKASEDAKKVVEEERA  60

Query  682  FACAEIESARAVVQRIGEALEEQEINSQVSGKQ  780
             A A+IESA A VQR+ +A  E E  S+   KQ
Sbjct  61   CARAKIESATAAVQRVLQAFHEHEKLSRSQEKQ  93



>dbj|BAK04085.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=131

 Score = 87.4 bits (215),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 46/106 (43%), Positives = 68/106 (64%), Gaps = 1/106 (1%)
 Frame = +1

Query  982   IIGSESVGSILRIQPCSDEAVDLSKCSIQWYRLSSECSRREPILGADKSVYAPEPIDVGR  1161
             ++ S + GS  RI    D A D+S C  QWYR+ S    RE I GA K  YAPEP DVG+
Sbjct  14    VLVSRTFGSQFRIVHRVDGATDISSCPAQWYRVISG-GNRELISGATKLTYAPEPFDVGQ  72

Query  1162  VLEADIVSNGLKASVTTIGQIDQAAGLGNYVETLLRKSNTEFSVVI  1299
             +L+A+I+    K +V T   I+ A+GL +YVE+L+++++ EF+V +
Sbjct  73    LLQAEIILEADKVTVQTDCPINPASGLEHYVESLMKRADIEFNVCM  118



>pdb|4DJG|A Chain A, Crystal Structure Of The Coiled-coil 1 Domain Of Actin-binding 
Protein Scab1
 pdb|4DJG|B Chain B, Crystal Structure Of The Coiled-coil 1 Domain Of Actin-binding 
Protein Scab1
Length=52

 Score = 84.7 bits (208),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 42/52 (81%), Positives = 49/52 (94%), Gaps = 0/52 (0%)
 Frame = +1

Query  433  APSLEGHVLLKKLRDALETLKGRLAGRNKEDVEIAIAMVEALAVRLTQKEGD  588
            A SLE HVLLKKLRDALE+L+GR+AGRNK+DVE AIAMVEALAV+LTQ+EG+
Sbjct  1    ATSLEKHVLLKKLRDALESLRGRVAGRNKDDVEEAIAMVEALAVQLTQREGE  52



>dbj|BAK08073.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=162

 Score = 87.0 bits (214),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 46/109 (42%), Positives = 69/109 (63%), Gaps = 1/109 (1%)
 Frame = +1

Query  982   IIGSESVGSILRIQPCSDEAVDLSKCSIQWYRLSSECSRREPILGADKSVYAPEPIDVGR  1161
             ++ S + GS  RI    D A D+S C  QWYR+ S    RE I GA K  YAPEP DVG+
Sbjct  14    VLVSRTFGSQFRIVHRVDGATDISSCPAQWYRVISG-GNRELISGATKLTYAPEPFDVGQ  72

Query  1162  VLEADIVSNGLKASVTTIGQIDQAAGLGNYVETLLRKSNTEFSVVIAQM  1308
             +L+A+I+    K +V T   I+ A+GL +YVE+L+++++ EF+V +  +
Sbjct  73    LLQAEIILEADKVTVQTDCPINPASGLEHYVESLMKRADIEFNVDLGML  121



>gb|AFK33883.1| unknown [Medicago truncatula]
Length=66

 Score = 82.8 bits (203),  Expect = 1e-15, Method: Composition-based stats.
 Identities = 34/53 (64%), Positives = 45/53 (85%), Gaps = 0/53 (0%)
 Frame = +1

Query  1420  MQLCGFRGGGNSAAKSLFWQPRKGQSFVLVFDSERERNGALVVARKHALECNV  1578
             MQLCG RGGGN AA++LFWQP++G SFVL F+SERE N A+++AR+ A +CN+
Sbjct  1     MQLCGVRGGGNVAAQALFWQPKQGLSFVLAFESEREGNAAIMLARRFAFDCNI  53



>ref|XP_003623842.1| hypothetical protein MTR_7g076240 [Medicago truncatula]
Length=79

 Score = 72.0 bits (175),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 41/77 (53%), Positives = 60/77 (78%), Gaps = 1/77 (1%)
 Frame = +1

Query  187  SVSADVSFASNQFPKYKLGPDFQILEEALLENKGPSLKevveeettRLTEQHKRLSVRDL  366
            S+++ +S +++ FPKYKL  D Q+ ++   +N GP LK+V+E+E   L+EQ+K +SVRDL
Sbjct  2    SLTSIISPSNSSFPKYKLEVDHQVFQQPAEDNHGP-LKDVIEQEAFNLSEQNKCISVRDL  60

Query  367  ASKFDKNLSSAAKLANE  417
            ASKFDKNLS+ AKL+NE
Sbjct  61   ASKFDKNLSTTAKLSNE  77



>gb|AFW75782.1| putative O-Glycosyl hydrolase superfamily protein [Zea mays]
Length=324

 Score = 74.7 bits (182),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 64/185 (35%), Positives = 103/185 (56%), Gaps = 28/185 (15%)
 Frame = +1

Query  640   ASEDAKKLVNQERSFACAEI--ESARAVVQRIGEALEEQE---------INSQVS-----  771
             AS DAK+++++ERS A  EI  E  + + ++  + L+ ++         I+SQ+S     
Sbjct  140   ASTDAKRIIDEERSNARLEIGIEVLKLLYKKFNQHLKSRKNFLTELGSSISSQLSIDMSY  199

Query  772   ------------GKQeveelmeeiqeARRIRVLHQPSKVMDMEHELRALRIQLNEKSVVS  915
                          + +V+EL EE+QEA R+++LH PSK MD+E+E++ L  QL +KS  S
Sbjct  200   YGNLKLLVSIDKMQMDVDELKEEVQEAPRVKMLHCPSKAMDIENEIQVLCDQLAKKSSDS  259

Query  916   FKLQNELAMSKRTEQNKSQLYRIIGSESVGSILRIQPCSDEAVDLSKCSIQWYRLSSECS  1095
              +L  EL + +   +N   LY + G E++GS L I      +VD    SIQW+R+  E S
Sbjct  260   LRLLKELELHRSYGENDMPLYELKGLETLGSTLHIVVHDCASVDFWNSSIQWFRIQPEGS  319

Query  1096  RREPI  1110
             ++E I
Sbjct  320   KKEII  324



>gb|ABN08253.1| hypothetical protein MtrDRAFT_AC155886g31v2 [Medicago truncatula]
 gb|ABN08832.1| hypothetical protein MtrDRAFT_AC160924g7v1 [Medicago truncatula]
Length=86

 Score = 68.9 bits (167),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 39/65 (60%), Positives = 51/65 (78%), Gaps = 1/65 (2%)
 Frame = +1

Query  223  FPKYKLGPDFQILEEALLENKGPSLKevveeettRLTEQHKRLSVRDLASKFDKNLSSAA  402
            FPKYKL  D Q+ ++   +N GP LK+V+E+E   L+EQ+K +SVRDLASKFDKNLS+ A
Sbjct  21   FPKYKLEVDHQVFQQPAEDNHGP-LKDVIEQEAFNLSEQNKCISVRDLASKFDKNLSTTA  79

Query  403  KLANE  417
            KL+NE
Sbjct  80   KLSNE  84



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 4968245977748